1RM1B

Structure of a yeast tfiia/tbp/tata-box dna complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
101
Chain Sequence
PGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEVISVDKLRIVACNSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*CP*GP*AP*TP*CP*GP*AP*TP*AP*TP*AP*AP*AP*AP*CP*G)-
publication title High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 23
structure length 101
sequence length 117
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
B PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1rm1B01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1rm1B02
1RM1B 1NH2C 1NVPC 5IYBO 5IYCO 1YTFC 1RM1C 1YTFD 5IYDO 1NH2D 1NVPD
chains in the Genus database with same CATH superfamily
4JAAA 1Y4MA 1B04A 3G6EV 3FAVA 3A0RA 3JATB 2YSUB 3HR0A 5CB4B 2ITDC 2IU0A 2C2AA 2IM9A 4CS2A 2XUMA 1HNXO 4K0KB 3ZHVA 4R50A 2ZNIA 4JTDB 1K4DC 3DTUB 1ROPA 1FFXA 5LHGA 3FB8C 1F51A 4N21A 2F43G 3ABMC 5JCOC 2X0LA 4DV1B 2ZM6B 2B1IA 2FMLA 4J80A 4X62B 3FB6C 3CP1A 1EM1A 1XMQO 4X1KA 5E1AC 3E86A 3BA8A 4F6EA 3IC9A 1P4RA 2VS0A 4FLZA 4B3TO 4O4JA 3ZBHA 1M90W 3PJSK 1MA1A 3CCMV 1W59A 2ETNA 5IJ9A 2IJHA 2Y48A 1K5SA 3F5TA 2OT5A 1VQ5V 2GSMB 1AJPA 4LF9B 3HKDA 2DOSA 3CX5F 5FL7G 4I4TB 5CBGA 2CTQA 1FXHA 1QLEC 4H13B 3T1HB 5B1BB 1PNMA 1DF4A 3FB7C 4P2ZA 1W2BU 1WPBA 1ZX3A 2XAQA 1QLNA 2RCVA 2DYSC 4AQYB 1N33B 2ARHA 4EB6B 4KHPO 1GO3F 4GYCB 4O2BA 2WA4A 5LP6B 1QR8A 1PM9A 1FKAO 3D3QA 3UO3A 2O57A 3L74H 3RVYA 1GAXA 1AR1B 2JIZG 5ITZA 4X1IB 3K03A 5LL6Y 4QPKA 5FPOA 2WLHA 1WLEA 2Y69B 1ZWIC 1GK9A 4JI7B 5KMGB 1N32B 3LDCA 3JAKA 5J9PC 3P30A 5KHJA 4I55B 1K97A 1E1RG 1FXKA 4OXSA 4DW0A 3SJQC 4B3MB 4MVOA 1GH6A 1R6KA 3C90A 1GN4A 2DW4A 1KP3A 2KQXA 1B06A 1CXZB 3SYAA 5LGUA 5IJ0B 3CCUV 4DR1B 1RP3B 2XTAA 4E4EA 1KU9A 4B3SO 1N0NA 1FAFA 1M1KW 2P5OA 3AK1A 2JRIA 2HVJC 1XNRB 1PV0A 2A3QA 1MSDA 3CCLV 4LFCO 5KX5A 2IU3A 3MD0A 4C7UA 2F4VB 2UUCO 2ZCEA 3A0HZ 4RWUA 5H9CA 3I55V 4JI5B 5BY1A 4YY3B 3H1KH 3OMAB 4LF4O 2JJ1G 3RYCA 1JFFA 2QA4V 3AG7A 3B40A 5CA3A 2E75B 3BHPA 2UU9B 2R9RB 2XHBA 2HP8A 3W7XA 3OTFA 1JA8A 3ABMB 4CBCA 2WLMA 3CC4V 3E89A 3UM7A 5IYBO 5H6RA 3ZHRA 3T1YB 2EULA 4PA4A 4DV2O 4PELA 1EN4A 4CH5A 3R66A 1HWYA 2AZ2A 4DUZB 1H2LA 2HJFC 3M99B 4QE9A 4FK5C 4RQFA 2YXYA 5HFLA 3B09A 1NU1H 1CPYA 1A32A 1YEWA 3FX7A 4X88A 4GLXA 4D6TH 2BTQA 4HZ3A 2A79B 1QLEB 3ASOC 4UV9A 4PDRA 2VWJA 4R7CA 3LSQA 1KUQA 1NTMH 2LO1A 3CRAA 3E8HA 5KLVH 4QPJA 3BAAA 2DYSB 4DR4B 3TK1A 3OTOO 4JI0O 2OYQA 4FPPA 1I0HA 3VQYA 5LHHA 1SESA 4UXNA 4XDKA 1I7FA 2RMKB 1QVFU 2Z3YA 4PI2A 5EC1C 4OPAA 4EFEA 3EXAA 2VQFB 4CS3A 3T4ZA 2HLDG 1NBMG 4JI1B 1JMKC 1H2MA 3KCYA 5BZBA 1Q86W 4GZRB 3SPGA 2KG7A 4MVSA 2NNUA 2EZPA 1BHBA 4TWKA 1IBLB 1DF5A 4UFZA 2HHHO 1SQQH 3QNEA 1ZL8B 3A2FA 1SQVH 1SF9A 2ILMA 3H1JH 1XMQB 4B7EA 1D2DA 4NB5A 4X65O 3AEIA 5BMVB 1PL4A 4FFKA 5B1AC 2JK5C 4UCSA 3CC7V 4J41A 1EFRG 3QG5A 1EN6A 1AB3A 3OMIB 4LR3A 1U97A 4PA9A 1WN7A 4PDVA 4Z1VA 4GX1A 5JQGA 1YCIA 1H38A 2ZNJA 2EILC 4WFBV 3A0BZ 2B1GA 4JYAB 4B7KA 5EC2C 5BXZA 5JH7A 2LGQA 3SR2C 4MS2A 2K9PA 3CMAV 3D8CA 4GX5A 4K0KO 1NH2C 1J5EB 5LMNB 1Q81W 1MZFA 4JI8B 3WB2A 4YXWG 4DV1O 2QR4A 2ZM6O 5KAFZ 4X62O 3JARB 2QKSA 4LF8B 3E22A 2GBOA 1COWG 3DXRA 4UV8A 1KECA 1SC5B 3OEHG 3B4SA 2WLJA 2ZQMA 4DYLA 3Q4HB 4JASA 1EBOA 2P7TC 2W0XA 4P9OA 1JQ0A 3WFVA 4JV5B 4DRXA 1ZUQA 2NR5A 5EBWC 2PYLA 4U7NA 4LF9O 4X89A 5FNVB 4YIPA 1WB7A 1NVPD 4IL6Z 2WLNA 4JI3B 3UT5B 1ORQC 4P9PA 2JGDB 1OCCC 5C8YB 3T1CA 1PNKA 4IIJA 4TOIA 4Q6GA 2BSKB 3N2GA 4TV9A 2V4DA 3KG2A 3CB2A 3LNNA 1VF5B 4AQYO 3ASOB 4NVPA 4UCTA 5D5PA 2MW2B 1N33O 3N2KB 3BFRA 4B3SB 1OJHA 4N23A 3E8FA 1M5IA 1SA0B 2ZDIA 2XNDG 1OCZC 3S3WA 3DGEA 4YJ2A 4JI6B 3ABUA 3JCUZ 3P3NA 4K3AA 1H8HG 3E8GA 2YEVB 1ZTEA 1VQ9V 1P49A 1FPOA 1VQMV 2EINC 2Q7EA 3PN1A 1S5LZ 2EJ7A 3G67A 3BVOA 4I0XA 4JI7O 3OT7A 1HNWB 2AZ0A 3CPWU 1N32O 5EYPA 3DSQA 2X6AA 3CE2A 3J80N 3CXHF 5IYZB 3MAQA 1MG1A 4FLYA 2P4KA 4TUYA 2QWPB 1XNQB 4FLUA 4NXMO 2JS3A 4B3MO 3SJBC 3AG3C 3BEHA 4TSFG 2GUZA 5GW7A 3AK3A 1S5JA 2JJ2G 5B1AB 2OCCC 3HKCA 3ETEA 5IT9N 2ADQB 3H1IH 4LF7B 4DR1O 1SKVA 2A9HA 4BIUA 2YIDA 4IHJA 5CA1B 3JD3A 1JJ2U 1XNRO 3JSLA 2EILB 4HBNA 2R9AA 4MTXA 3K5MA 1OCOC 5LA6B 4RAIA 1BCCH 1AP5A 2WLLA 3CCRV 4LFBB 5DM6V 1NJIW 2F4VO 2K1EA 1NH2B 1DLBA 2X6BA 2DN9A 4JI5O 4YY3O 3KZIZ 5IWAB 1DGSA 4BAYA 2UU9O 3HKBA 1D5NA 3E8BA 2DQ0A 2DJVA 3JD1A 2QM4A 3T1YO 5GONA 3K0GA 1XEQA 2WLIB 1TUBA 1Q43A 1SERA 2DYRC 3RYIB 1SS3A 4DUZO 1PD3A 4O4IB 5C93A 2BOBC 2QWNB 1AI7A 3X2QC 4MTFA 5CMUA 2HHHB 3ML0A 2QWQB 5IYDO 1KP2A 2Q8VA 1GTOA 3K59A 1YJNV 2W6IG 1K5QA 2WSSG 3F7VC 3K57A 1OCCB 1H2SB 2N74A 4XDJA 2YIAA 2YICA 3FFQA 5EK0A 1FS0G 4UVAA 3GWOA 3J7AU 1GMGA 3F5WC 2FTKA 2KB1A 2LFSA 1K92A 4IYIA 3P3PA 3OEEG 5J2UA 4DR4O 3L9DA 1VQNV 2XAGA 4J7JA 3JALA 1Q5OA 4FFBA 1AP6A 1VARA 2F93B 1NKDA 3J81N 3EVKA 2Q7HA 1OCZB 3K5LA 4FLTA 2VQFO 3TGUH 1LR1A 4J7KA 3OE7G 4JI1O 5L3BA 2PY5A 2EINB 2Y4UA 4JI2B 1IBLO 1UPGA 1R3IC 2HFEC 1VQLV 3CCVV 3SYOA 1S3JA 2ZE5A 5L3CA 1AROP 3ABKC 4ZI7B 4TV8A 2IBZH 2GTSA 1QCEA 3JAWB 5DECA 2A06H 3K5OA 2RDCA 3STZC 1Y74B 1EN5A 3P32A 4LC1A 2AHYA 3AG3B 3B8MA 3CMEV 4DR6B 3RYFA 5JWPA 2B9ZA 2OCCB 2Q5ZA 3AK2A 3QO5A 3G6BA 1IBKB 4FLWA 3VOUA 4J9YB 1PNLA 3AG1C 1AI6A 4H0LB 4JYAO 2CDYA 2ZE6A 4YIOA 3ZN0A 4X20A 5L3EA 2QM7A 5L3GA 1S76D 2EIJC 2IJIA 4YJ3B 1Q6UA 2QTOA 4HNAB 1OCOB 5LYJB 1J5EO 5LMNO 5K1PA 4UCVA 1BGYH 3OR7C 1US6A 4DV5B 4JI8O 3C3SA 4JPRA 2MK3A 1YJWV 4LF6B 1Q6IA 3RFRA 2HJDA 1P84F 1BMFG 3QVNA 5JVDB 3RYHB 3IAYA 4LF8O 1Y76B 4U3JA 1R6TA 2IJKA 1R3LC 4DR5B 3HPLC 3HKEB 2E76B 2A7WA 1MNGA 4AILC 4NKGB 5H5NA 4J42A 3M8AA 1BSMA 1FXKC 4WF9V 4K8ZA 2DYRB 3CEIA 4WBNB 1L8DA 3X2QB 4JV5O 2P90A 2F95B 4JI4B 2HEPA 5KUMA 4JI3O 5LMUB 5B1OA 2YDEA 4NXMB 4X64B 4HYOA 1FD9A 2YUAA 2PUSA 2YIBA 4DV0B 2FB5A 4U7OA 5TISZ 4KFMA 4LNUB 5IY5C 2YIBD 1M93A 3FAVB 3ZRWA 2WWWA 2PTMA 1HR0B 4DUYO 2ITCC 3JYCA 2OWOA 5KA6A 3UCSC 4JZGA 4W4KA 5EZYA 3T2MA 3K08A 1TVKA 2N05A 3ZIAG 1XDCA 1XHXA 1FFXB 4JI6O 2LGWA 5B5EZ 1S77D 1P7BA 3TCUA 4U3FH 1IVSA 5CA0A 2ATKC 1WJZA 4LWSA 1F23A 1HNWO 1JJOA 1JOYA 3FB5C 4O4JB 4DXWA 1WPXA 1XNQO 3CRRA 3ABKB 1JVMA 1K34A 2UXNA 5IJ9B 1NT2B 2YI8A 1NQTA 2AW9A 5CBHA 2L35A 2UXCB 3MHHC 3OMNB 3I56V 1N34B 3HKDB 3SJCC 1R73A 2Q6AA 5J2TA 4LF7O 3SPJA 2QWOB 1WB8A 4P30A 1J95A 2F1MA 1NTZH 3QO7A 2BCCH 3ZCCA 4F4LA 2OTLV 1Y6XA 3RW0A 3CCSV 4KP4A 2CTPA 5D5QA 3OAAG 3ZJZA 5KHGA 3I5DA 1R3JC 3AG1B 4JF3A 2KSDA 1UJWB 2ODMA 4FLVA 4DR7B 4O2BB 5DN6G 4LFBO 3QF7A 2EIJB 2HG5C 4UCRA 2UXXA 4K35A 2P22C 4PV1B 1KC8W 3L71H 4FM0A 3K04A 3CJHA 2HVKC 2IH3C 1YZBA 2W6JG 1QVGU 5IWAO 5ITZB 4RO2A 3OFNG 3CC2V 3FYIB 1N36B 1H2KA 1GM8A 3BRCA 3CSXA 2Q0OC 2FL4A 1N8RW 1VQKV 2Q73A 1SQXH 2UUBB 1WA8A 4NR1A 4FZ0A 4UCOA 1X59A 3E83A 3DC5A 4D7SA 2EJRA 1VQ7V 3LDDA 3JAKB 4I5SA 1BS3A 4DW1A 3OUFA 1M57C 4O4HA 1FXKB 3E35A 4GKJB 4R6ZA 4ZHQA 1RSOA 1NR7A 2Y4TA 3C3TA 4LH6A 4I7ZB 1IZ3A 3TXQA 2GHYA 2RNBA 1BQ0A 4F6RB 3MHSC 2JDIG 5LXTA 3N27A 5IY5B 4I50A 1EZJA 5LOVA 2LFRA 4G2KA 1ENVA 1KYOF 3F7YC 1L0NH 2IH1C 4E2LA 2H3OA 5FLXN 5AG2A 5KX5B 2H94A 1XI1A 1QNMA 4MVZA 2E74B 1PP9H 1SZTA 1KQSU 4ZKIA 1JFFB 1X4TA 5KHIA 1S0VA 4LF5O 4JI2O 3CYOA 3W7WA 2Q67A 1CP9A 4X8AA 4DV4B 3G71V 2WA3A 2EBOA 4GCZA 3JASA 3NR7A 3ASNC 3VQVA 4O2AA 1NVPC 2LJ2A 2BOCC 4DK0A 3RVZA 2FYUH 5LHIA 5EIBD 3ZHQA 4FLXA 3UQ8A 4O4LA 5EBLC 4DR6O 5JJJB 4JTCB 2BTQB 3GWKC 1Q82W 4UB8Z 1IBKO 2LW7A 2VQEO 1XHZA 4CH4A 2Q0AA 4ZOLB 3FKSG 1RPOA 1FJGB 2QGNA 1AR4A 4YHHB 4H37A 2ZDIC 1S72V 1T5EA 4X66B 1SETA 4FIPC 4J7ZA 2P67A 2Q68A 3CCQV 4DV5O 4RUEA 1F7YA 4PDLA 4DUYB 2ZIMA 2P4VA 3ZMSA 4LF6O 3D36A 3H01A 3OUSA 1QBZA 4DO2A 2OCHA 3ABTA 3VQXA 4IYHA 3ABLC 4DR5O 2E5LB 4X1YA 1MOFA 4GX2A 2UXDB 3ZEDA 1IBMB 1YF2A 2OIGA 1CEZA 3JD0A 4PA6A 4KXRA 1K3EA 2DQ3A 3CCEV 3RN4A 3G4SV 1W0KG 2P6JA 1M57B 1DTOA 4JI4O 3JATA 2V1DA 5LMUO 2Y0PA 4X64O 5CB4A 3OM3B 3ZRVA 2F66C 2CH7B 3ZS8C 1S5HC 4DV0O 3HB3B 5E79Z 2XT9A 4FZ1A 5JQGB 1W0JG 1BT8A 2R9IA 1Z2GA 1IX9A 3A8TA 4B3RO 4PA7A 4TT3G 2DMXA 3GVMA 4CH6A 1HR0O 3L70H 5JH7B 3IGAC 2QJ1A 1HDJA 2QEXV 1R6NA 2CAZC 2CTRA 3BY6A 1VF6A 4Z2WA 4NXNB 4LFAB 1AVMA 1VQ8V 4CS4A 1H2GA 3E22B 2Q7GA 4EFBA 1K8AW 3DXRB 4OGQB 2BE3A 2VRZA 1VQOV 5BR8B 2AHZA 3DC6A 1UFIA 1SQFA 2ZE8A 4I4TA 1PL0A 2Q9LA 3ASNB 2QSAA 1YTFC 1I5XA 1NVPB 4DK1A 3KKYA 3SPHA 2UXCO 4DRXB 2XAHA 1N34O 4GKKB 5KHHA 1K7DA 4JAVA 2LQTA 4IT5A 4EB6A 2ZT9B 4CZZA 3K3WA 5LP6A 1BE3H 2JEUA 3N2GB 4TV9B 1XUQA 1H2NA 3RWRD 2CTWA 1OCRC 3NXSA 4X1IA 1L0LH 4DR7O 3THOA 3FD9A 1OV9A 1AJNA 4JTAB 2Q69A 3GB7C 4YJ2B 4UB6Z 5KMGA 2E3CA 3SYPA 1E79G 3O65A 2PGGA 4DR2B 1G4YB 1N36O 5JJEB 3RGBA 2XASA 4I55A 1XMOB 2PZSA 3JSNA 2X6CA 4I0XB 3ABLB 4WCEV 1WNSA 1SRYA 2UUBO 1VP7A 4FMTA 5EYPB 1M56C 4A5UB 3CRQA 2R70A 4LF5B 1JPXA 4TUYB 5IJ0A 1KB9F 3BPZA 2PI5A 5L3DA 4UVBA 1HNZB 4FVMA 4MSWC 1P7GA 4GKJO 2M7WA 2GUZB 4DV7B 1YVWA 4D7TA 1KMIZ 3HKCB 4W4LA 3L75H 4L87A 3BABA 1HP8A 2EX3A 1G8MA 1FYJA 1GM9A 4IHJB 4RQEA 3K0DA 4MW8A 1VQ6V 4ZIBA 2ZKOA 2WLKA 2EZOA 2VWKA 4Z1MG 1QQCA 1Y67A 1URFA 3ZHSA 2VQEB 4CC5A 4NTWA 2IJJA 1R3KC 2WLLB 5JCOA 1M4UA 1KKCA 1K73W 2QKAA 4JYYA 4JYCA 3CXCU 3AG4C 5CBFA 1BQZA 3R65A 1XBLA 4QE7A 3HKBB 4EEQA 1XILA 1ZAUA 2Q4PA 2XAJA 3H1LH 5GONB 4DV4O 3E2EA 1TUBB 5L3FA 4BWAA 1TUEB 1OZ0A 3S3XA 1U96A 3ETQA 4Q20A 3CRCA 1YTFB 1O9HA 2PF4E 3K58A 2OTJV 1VIBA 1WAZA 5IYCO 5GTIZ 2ZINA 3QO8A 1NR1A 2YXHA 3JAMN 4MW3A 4TQFA 1O9GA 3OW2U 1VF7A 5A9GA 1BZKA 2FKXA 3ZMUA 4DR3B 1G1XB 2YI9A 1FJGO 4YHHO 5J2UB 2CE4A 4AI8A 2JS5A 1YSCA 4X66O 1OCRB 2EIMC 4B3RB 2UUAB 3JALB 4FFBB 2M6YA 4DV6B 1GM7A 1YHQV 3W7TA 3JCZA 3UKMA 1ZL8A 1R1BA 2CGNA 1MMMA 3WU2Z 1YXBA 5A2QN 5BMVA 4K8XA 3ZRSA 3LUTB 4KUMA 1MSWD 2E5LO 2AXTZ 1QR9A 2UXBO 1IXBA 4ASUG 2UXDO 1N4CA 3APQA 1IBMO 3W7SA 1HW7A 1YITV 3JD2A 2RJZA 3U10A 4F6RA 3SYQA 4TV8B 3OR6C 2N04A 4GUNA 4X1KB 4I9QA 1M56B 4H44B 4CC6A 3TXSA 1IXMA 5B3SC 3TJTA 4OX9B 4FM2A 1G6UA 1Z5VA 2RN9A 3TETA 1AI5A 2P06A 3ETGA 3RYFB 2L6LA 5LBQA 4UVCA 4DV3B 3ZMTA 2QDOA 3EFFK 4BIOA 5B1NA 1NS1A 4X20B 1TAEA 2A0LA 4J10A 3JARA 3SGIA 4HAMA 4NTYA 4NXNO 1KBHA 4LFAO 1LNQA 3ZMZA 4CH3A 3OGCC 1KD1W 3Q4HA 1QU7A 1I5YA 4ICGA 3U0ZA 3ZHUA 3AG4B 3AG2C 5LGNA 4U3JB 4OPHA 3K9AA 4G28B 3LNMB 3WB1A 3STLC 1I94B 5BR8O 3VBBA 1B6QA 1L1FA 1BL8A 5FNVA 2BTOA 2GDSA 4WFHA 3SJAC 4ZOLA 1JCHA 1NTKH 3UT5A 5FPRA 2JGDA 1ZLZA 5C8YA 3SYCA 3CHXA 3ZHTA 2BSKA 4WFGA 2CK3G 4MTGA 4GKKO 2W0FC 1PKXA 2X7RB 2PYJA 1AJQA 4BW9A 3LSUA 1SZXA 4J11A 3N2KA 3APOA 4B08A 3K5NA 1HNXB 2ZR2A 1OHHG 1TGOA 2IW5A 1SA0A 3BA9A 1GKFA 4J9ZB 3ZRWB 1RM1C 1SQPH 1Y66A 4BR6A 4JZ2A 1KKDA 2YEVA 4H33A 2R72A 2WAMA 1YJ9V 5EZYB 4PI0A 3L72H 1TVKB 2ZIOA 1RFYA 2EIMB 1XL6A 5KHKA 1VEWA 1E1QG 4XBFA 4B3TB 4QJFB 5IYZA 4DR2O 2CGOA 4L8JA 3W7UA 1VQ4V 5CA0B 1XMOO 1Q8IA 4LWSB 2V7QG 4JGSA 2CH7A 3RYCB 5DEDA 1XL4A 5HFMA 4FM1A 1Q3EA 1NZ6A 1Q6HA 5EIBC 1GN2A 5JJNB 4QGPA 3D3IA 3WB0A 3BCCH 2OIEA 1HNZO 1VMGA 4LBEC 5CA1A 1WP8A 2GTAA 2HKOA 4EKWA 2D2CB 4DV7O 2EIKC 1MZEA 2ZXWC 5B3SB 1N0JA 5J2TB 5LA6A 2QM8A 4NYKA 3MDSA 4KHPB 2LP7A 4LP8A 1V54C 1GN6A 3ZX6A 4MVUA 1V55C 1GN3A 2RQ6A 3SPIA 1H8EG 1F4MA 2GV9A 1NI8A 2LW1A 5LGTA 1NH2D 2CUGA 4WFEA 2DWDC 4QNHB 4BIZA 1K9MW 3M7MX 1F4NA 1XREA 1LUVA 2NLJC 3H1HH 3U11A 3D36C 3CJHB 3SDLA 3H9VA 3WG7C 2WLIA 3IJ4A 1MABG 3B77A 5F2VO 4UUJC 1M9NA 3RYIA 2KKWA 3IFXA 4G27B 4KL1A 2YXLA 3ICXA 4O4IA 5CN0A 2AGAA 1IDSA 4LCUC 2DWEC 3AG2B 3T1HO 1B3QA 1WA8B 4GX0A 1SQGA 2KG7B 3OD4A 2UXBB 4PD4F 3RBZA 2JVDA 2WPDG 4O4HB 1DK1A 1Q7YW 2HR3A 3K06A 3ZN1A 3LSSA 1YIJV 4ZHQB 1RSOB 4AHCA 4PJ0Z 3QTCA 3K9SA 2YS8A 1K33A 3ZRXA 1VQPV 4BW5A 4LFCB 5IE9A 1V9PA 3EHBB 2UUCB 5LXTB 3O9OA 4DR3O 4I50B 3T4DA 2QTSA 5LOVB 4LF4B 3VQWA 2NN4A 1THZA 2JGUA 1RM1B 2QWRB 3SPCA 3B8NA 1VF6C 1K4CC 2UUAO 1IURA 4QIWF 3CS5A 2DE0X 5H6QA 4DV6O 2YC0A 2ZD9A 1LUWA 3CRMA 4DV2B 4NTXA 5B66Z 1XOUA 1FXVA 2ZR3A 4ZI7A 4UCUA 2XAFA 4ABMA 1SQBH 4RUFA 1AI4A 1D5AA 3JAWA 2Z5UA 1RPRA 5EBMC 1Y74A 4WFAV 2ADPA 3B2EE 2XOKG 1I08A 3JASB 5B1BC 4O2AB 1Z5WA 1PPJH 1YDXA 4OX9O 4MVRA 4JAUA 2G38A 1GRJA 5GTHZ 2Z0AA 3CWBH 4O4LB 2D3OW 1JX9A 2ZE7A 3RT3C 3CCJV 5LP6C 5K1XA 2EIKB 1AR5A 5IDJA 2QKCA 4YJ3A 1BHAA 2ZXWB 4PDMA 4HNAA 1XQ8A 4JYBA 4DV3O 5KAIZ 3OTOB 4MVMA 4JI0B 5LYJA 3JD4A 1V54B 5KUKA 2Y0IA 1ZSPA 1EZVH 1V55B 4I9WA 4GT1A 3CD6V 1YI2V 4IGGA 4IIJB 3UO2A 3IC7A 1AILA 1QHTA 3K79A 2Y69C 1Q90D 3G80A 3LDEA 5JVDA 3RYHA 5H2FZ 1Y76A 2JEXA 4MVQA 4LH7A 1WP7A 3KCXA 2F23A 3HKEA 5KA5A 3ETDA 4R8CA 3L73H 4MTOA 3WG7B 2PI4A 1TA8A 4WFFA 4XDLA 4X65B 2H8PC 4WBNA 4FJCC 4X1YB 1YTFD 1I94O 1JR9A 4ZBMA 3ZMVA 4X9QA 4MT8A 2QE7G 3OGIB 1FFTB 4TQDA 4PHZA 2B5UA 3FYEB 4PA3A 4LNUA
chains in the Genus database with same CATH topology
1Y4MA 3UKMA 3G6EV 3A0RA 2GHYA 2YSUB 3CPWU 3MHSC 3ZRSA 2JDIG 3LUTB 4KUMA 1MSWD 2ITDC 2X6AA 2IU0A 2C2AA 1QR9A 1MG1A 4ASUG 5IY5B 1EZJA 4R50A 4JTDB 3W7SA 2LFRA 1YITV 4G2KA 1ENVA 3JD2A 1K4DC 3F7YC 3DTUB 1ROPA 3SYQA 2IH1C 4E2LA 3OR6C 5LHGA 3FB8C 3AG3C 2H94A 3BEHA 4TSFG 1M56B 1F51A 4N21A 2F43G 5GW7A 3ABMC 2X0LA 4MVZA 2JJ2G 5B1AB 2OCCC 2B1IA 3ETEA 3FB6C 3CP1A 1IXMA 5B3SC 1SZTA 5E1AC 1KQSU 4ZKIA 2A9HA 4BIUA 3E86A 1S0VA 1P4RA 3TETA 1AI5A 3ETGA 3JD3A 1JJ2U 1M90W 3PJSK 5LBQA 3CYOA 2EILB 3W7WA 2Q67A 4UVCA 3CCMV 1CP9A 4MTXA 3ZMTA 4X8AA 3G71V 1OCOC 3EFFK 4RAIA 2EBOA 5B1NA 4GCZA 2IJHA 2Y48A 2WLLA 3ASNC 3CCRV 5DM6V 1K5SA 1NVPC 1NJIW 2A0LA 2K1EA 2OT5A 1VQ5V 2BOCC 2GSMB 1NH2B 1AJPA 1DLBA 2X6BA 3RVZA 5LHIA 5FL7G 5CBGA 4HAMA 1FXHA 1QLEC 4BAYA 1LNQA 3ZMZA 3OGCC 5B1BB 1PNMA 5EBLC 1DF4A 3E8BA 2DQ0A 3FB7C 4P2ZA 1W2BU 1KD1W 4JTCB 1Q82W 2XAQA 3JD1A 1QLNA 1I5YA 2DYSC 3K0GA 3AG4B 3AG2C 5LGNA 2WLIB 1SERA 1GO3F 3K9AA 4G28B 2DYRC 3LNMB 3STLC 1PD3A 5C93A 2BOBC 3FKSG 3VBBA 1AI7A 1RPOA 4MTFA 5CMUA 3X2QC 1QR8A 1B6QA 1L1FA 1BL8A 4H37A 3RVYA 4WFHA 2ZDIC 3ML0A 1JCHA 1S72V 1SETA 4FIPC 3SYCA 1AR1B 2P67A 2JIZG 1KP2A 5IYDO 2Q68A 1GTOA 1YJNV 3K03A 3CCQV 4QPKA 4RUEA 2W6IG 4PDLA 3ZMSA 4WFGA 1K5QA 2CK3G 1WLEA 2WLHA 4MTGA 2WSSG 2Y69B 3D36A 2W0FC 1PKXA 2X7RB 3H01A 3F7VC 1ZWIC 3OUSA 1GK9A 1QBZA 4DO2A 1AJQA 1OCCB 3ABTA 4XDJA 3ABLC 3LDCA 5EK0A 1FS0G 4UVAA 1MOFA 3GWOA 4GX2A 1GMGA 3F5WC 2FTKA 2ZR2A 2KB1A 1OHHG 2LFSA 1K92A 3P30A 5J9PC 2IW5A 3OEEG 1GKFA 1K97A 1E1RG 1CEZA 3JD0A 1FXKA 4OXSA 4J9ZB 4PA6A 2XAGA 3SJQC 1VQNV 3ZRWB 1RM1C 1Y66A 4MVOA 1K3EA 1R6KA 2DQ3A 1KKDA 2YEVA 4H33A 3CCEV 2DW4A 1KP3A 2WAMA 1NKDA 1YJ9V 3G4SV 3SYAA 1OCZB 1W0KG 2P6JA 5LGUA 3CCUV 1M57B 1DTOA 3OE7G 2EIMB 2V1DA 1XL6A 3OM3B 1M1KW 1E1QG 5L3BA 3ZRVA 4XBFA 1S5HC 3HB3B 2EINB 4QJFB 2HVJC 1VQ4V 1R3IC 3W7UA 1W0JG 2HFEC 1VQLV 2R9IA 3CCVV 3SYOA 1S3JA 5L3CA 1AROP 3ABKC 4PA7A 2V7QG 4JGSA 4TT3G 3CCLV 1XL4A 2IU3A 5HFMA 3MD0A 3IGAC 5H9CA 1QCEA 3I55V 2QEXV 3OMAB 1R6NA 3STZC 2JJ1G 3D3IA 3BY6A 2QA4V 5CA3A 3P32A 2AHYA 3B8MA 3AG3B 4LBEC 2R9RB 4LC1A 4EKWA 2HKOA 3W7XA 3CMEV 4CBCA 3ABMB 2WLMA 1VQ8V 3E89A 3UM7A 3CC4V 2EIKC 5IYBO 2OCCB 5H6RA 3QO5A 1H2GA 2ZXWC 4PA4A 5B3SB 3VOUA 4J9YB 4PELA 2QM8A 1PNLA 3AG1C 1AI6A 1K8AW 2LP7A 4LP8A 3ZN0A 1V54C 1HWYA 5L3EA 2QM7A 5L3GA 1VQOV 4MVUA 1V55C 2HJFC 2AHZA 3M99B 4QE9A 1S76D 2EIJC 2IJIA 4FK5C 4RQFA 3SPIA 2QTOA 1H8EG 5HFLA 1F4MA 1OCOB 1PL0A 5LGTA 1NH2D 1CPYA 4WFEA 2DWDC 3ASNB 1YTFC 4QNHB 1I5XA 3OR7C 1NVPB 4BIZA 1K9MW 1F4NA 3SPHA 4X88A 2XAHA 2MK3A 4JPRA 4HZ3A 1YJWV 2NLJC 1BMFG 1K7DA 4JAVA 3WG7C 2A79B 1QLEB 2WLIA 3ASOC 2IJKA 4UV9A 1R3LC 1MABG 3B77A 4PDRA 4UUJC 4CZZA 1M9NA 3K3WA 3HPLC 3IFXA 3LSQA 4G27B 4R7CA 5CN0A 3E8HA 2JEUA 4QPJA 2DYSB 4LCUC 2DWEC 3TK1A 3AG2B 4FPPA 1FXKC 4WF9V 1OCRC 2DYRB 3NXSA 5LHHA 4GX0A 1SESA 4UXNA 4XDKA 3X2QB 1QVFU 1AJNA 2Z3YA 5EC1C 3RBZA 4JTAB 2P90A 2Q69A 2WPDG 3T4ZA 5KUMA 2HLDG 3GB7C 1NBMG 5B1OA 1Q7YW 2HR3A 3K06A 5BZBA 1Q86W 3SYPA 4HYOA 3ZN1A 1E79G 3LSSA 3SPGA 4MVSA 2NNUA 2EZPA 4U7OA 1YIJV 1BHBA 4KFMA 4TWKA 1G4YB 1DF5A 5IY5C 2XASA 3QNEA 1K33A 3ZRXA 1VQPV 2X6CA 3ZRWA 2WWWA 4BW5A 3ABLB 4WCEV 3EHBB 1SRYA 3AEIA 4FMTA 2ITCC 3JYCA 1M56C 5KA6A 3T2MA 3T4DA 1JPXA 3K08A 5B1AC 2JK5C 1THZA 3ZIAG 3CC7V 1EFRG 1RM1B 2PI5A 5L3DA 4UVBA 3SPCA 3OMIB 3B8NA 4MSWC 1K4CC 4PA9A 4QIWF 2M7WA 4PDVA 1S77D 1P7BA 3TCUA 5H6QA 4GX1A 2ZD9A 1H38A 2ATKC 2EILC 4L87A 2ZR3A 1FXVA 4WFBV 2B1GA 1G8MA 2XAFA 1GM9A 1F23A 4RUFA 4RQEA 1AI4A 1JOYA 3FB5C 3K0DA 5EC2C 4MW8A 1VQ6V 4MS2A 3CMAV 4DXWA 2WLKA 4GX5A 1NH2C 2EZOA 1WPXA 2Z5UA 1RPRA 5EBMC 4Z1MG 4WFAV 3ABKB 1JVMA 1K34A 2UXNA 2XOKG 1Q81W 2IJJA 1NQTA 1R3KC 2WLLB 5CBHA 5B1BC 4YXWG 3MHHC 3OMNB 3I56V 1K73W 1R73A 2Q6AA 4JYCA 2QKSA 3SPJA 3CXCU 4P30A 1COWG 3AG4C 4MVRA 1J95A 3R65A 5CBFA 4JAUA 3QO7A 4UV8A 1KECA 4QE7A 1JX9A 3ZCCA 3OEHG 4F4LA 3CCJV 2WLJA 2D3OW 2OTLV 2ZQMA 2EIKB 5IDJA 3RW0A 3CCSV 4KP4A 1BHAA 4JASA 1EBOA 2ZXWB 3OAAG 4PDMA 2XAJA 4JYBA 3ZJZA 4MVMA 2P7TC 1R3JC 3AG1B 4JF3A 1UJWB 3JD4A 3E2EA 1V54B 5L3FA 4P9OA 5KUKA 1JQ0A 3WFVA 5DN6G 1V55B 4I9WA 2EIJB 4GT1A 3CD6V 2HG5C 1YI2V 2UXXA 1TUEB 5EBWC 3IC7A 4U7NA 1KC8W 1OZ0A 4X89A 3K79A 2Y69C 3LDEA 3K04A 1NVPD 2WLNA 2HVKC 2IH3C 2W6JG 2JEXA 4Q20A 1ORQC 4P9PA 1QVGU 4MVQA 1OCCC 1YTFB 3T1CA 1PNKA 2OTJV 4RO2A 3OFNG 3CC2V 5IYCO 5KA5A 3ETDA 3FYIB 1GM8A 3QO8A 1NR1A 3KG2A 4R8CA 4MTOA 3WG7B 4MW3A 3ASOB 2PI4A 4WFFA 1N8RW 4XDLA 3OW2U 1VQKV 2H8PC 4FJCC 1YTFD 3ZMUA 3E83A 4N23A 2EJRA 1VQ7V 3LDDA 4ZBMA 3ZMVA 4I5SA 3E8FA 4MT8A 2ZDIA 2XNDG 1OCZC 3OUFA 1M57C 1FXKB 1YSCA 3DGEA 1OCRB 3ABUA 2EIMC 2QE7G 1FFTB 3E35A 1H8HG 3E8GA 4R6ZA 2B5UA 3FYEB 2YEVB 1GM7A 1VQ9V 4PA3A 1YHQV 1VQMV 1NR7A 2EINC 3W7TA 3JCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM1 B;  1NH2 C;  1NVP C;  5IYB O;  5IYC O;  1YTF C;  1RM1 C;  1YTF D;  5IYD O;  1NH2 D;  1NVP D; 
#chains in the Genus database with same CATH topology
 4JAA A;  1Y4M A;  1B04 A;  3G6E V;  3FAV A;  3A0R A;  3JAT B;  2YSU B;  3HR0 A;  5CB4 B;  2ITD C;  2IU0 A;  2C2A A;  2IM9 A;  4CS2 A;  2XUM A;  1HNX O;  4K0K B;  3ZHV A;  4R50 A;  2ZNI A;  4JTD B;  1K4D C;  3DTU B;  1ROP A;  1FFX A;  5LHG A;  3FB8 C;  1F51 A;  4N21 A;  2F43 G;  3ABM C;  5JCO C;  2X0L A;  4DV1 B;  2ZM6 B;  2B1I A;  2FML A;  4J80 A;  4X62 B;  3FB6 C;  3CP1 A;  1EM1 A;  1XMQ O;  4X1K A;  5E1A C;  3E86 A;  3BA8 A;  4F6E A;  3IC9 A;  1P4R A;  2VS0 A;  4FLZ A;  4B3T O;  4O4J A;  3ZBH A;  1M90 W;  3PJS K;  1MA1 A;  3CCM V;  1W59 A;  2ETN A;  5IJ9 A;  2IJH A;  2Y48 A;  1K5S A;  3F5T A;  2OT5 A;  1VQ5 V;  2GSM B;  1AJP A;  4LF9 B;  3HKD A;  2DOS A;  3CX5 F;  5FL7 G;  4I4T B;  5CBG A;  2CTQ A;  1FXH A;  1QLE C;  4H13 B;  3T1H B;  5B1B B;  1PNM A;  1DF4 A;  3FB7 C;  4P2Z A;  1W2B U;  1WPB A;  1ZX3 A;  2XAQ A;  1QLN A;  2RCV A;  2DYS C;  4AQY B;  1N33 B;  2ARH A;  4EB6 B;  4KHP O;  1GO3 F;  4GYC B;  4O2B A;  2WA4 A;  5LP6 B;  1QR8 A;  1PM9 A;  1FKA O;  3D3Q A;  3UO3 A;  2O57 A;  3L74 H;  3RVY A;  1GAX A;  1AR1 B;  2JIZ G;  5ITZ A;  4X1I B;  3K03 A;  5LL6 Y;  4QPK A;  5FPO A;  2WLH A;  1WLE A;  2Y69 B;  1ZWI C;  1GK9 A;  4JI7 B;  5KMG B;  1N32 B;  3LDC A;  3JAK A;  5J9P C;  3P30 A;  5KHJ A;  4I55 B;  1K97 A;  1E1R G;  1FXK A;  4OXS A;  4DW0 A;  3SJQ C;  4B3M B;  4MVO A;  1GH6 A;  1R6K A;  3C90 A;  1GN4 A;  2DW4 A;  1KP3 A;  2KQX A;  1B06 A;  1CXZ B;  3SYA A;  5LGU A;  5IJ0 B;  3CCU V;  4DR1 B;  1RP3 B;  2XTA A;  4E4E A;  1KU9 A;  4B3S O;  1N0N A;  1FAF A;  1M1K W;  2P5O A;  3AK1 A;  2JRI A;  2HVJ C;  1XNR B;  1PV0 A;  2A3Q A;  1MSD A;  3CCL V;  4LFC O;  5KX5 A;  2IU3 A;  3MD0 A;  4C7U A;  2F4V B;  2UUC O;  2ZCE A;  3A0H Z;  4RWU A;  5H9C A;  3I55 V;  4JI5 B;  5BY1 A;  4YY3 B;  3H1K H;  3OMA B;  4LF4 O;  2JJ1 G;  3RYC A;  1JFF A;  2QA4 V;  3AG7 A;  3B40 A;  5CA3 A;  2E75 B;  3BHP A;  2UU9 B;  2R9R B;  2XHB A;  2HP8 A;  3W7X A;  3OTF A;  1JA8 A;  3ABM B;  4CBC A;  2WLM A;  3CC4 V;  3E89 A;  3UM7 A;  5IYB O;  5H6R A;  3ZHR A;  3T1Y B;  2EUL A;  4PA4 A;  4DV2 O;  4PEL A;  1EN4 A;  4CH5 A;  3R66 A;  1HWY A;  2AZ2 A;  4DUZ B;  1H2L A;  2HJF C;  3M99 B;  4QE9 A;  4FK5 C;  4RQF A;  2YXY A;  5HFL A;  3B09 A;  1NU1 H;  1CPY A;  1A32 A;  1YEW A;  3FX7 A;  4X88 A;  4GLX A;  4D6T H;  2BTQ A;  4HZ3 A;  2A79 B;  1QLE B;  3ASO C;  4UV9 A;  4PDR A;  2VWJ A;  4R7C A;  3LSQ A;  1KUQ A;  1NTM H;  2LO1 A;  3CRA A;  3E8H A;  5KLV H;  4QPJ A;  3BAA A;  2DYS B;  4DR4 B;  3TK1 A;  3OTO O;  4JI0 O;  2OYQ A;  4FPP A;  1I0H A;  3VQY A;  5LHH A;  1SES A;  4UXN A;  4XDK A;  1I7F A;  2RMK B;  1QVF U;  2Z3Y A;  4PI2 A;  5EC1 C;  4OPA A;  4EFE A;  3EXA A;  2VQF B;  4CS3 A;  3T4Z A;  2HLD G;  1NBM G;  4JI1 B;  1JMK C;  1H2M A;  3KCY A;  5BZB A;  1Q86 W;  4GZR B;  3SPG A;  2KG7 A;  4MVS A;  2NNU A;  2EZP A;  1BHB A;  4TWK A;  1IBL B;  1DF5 A;  4UFZ A;  2HHH O;  1SQQ H;  3QNE A;  1ZL8 B;  3A2F A;  1SQV H;  1SF9 A;  2ILM A;  3H1J H;  1XMQ B;  4B7E A;  1D2D A;  4NB5 A;  4X65 O;  3AEI A;  5BMV B;  1PL4 A;  4FFK A;  5B1A C;  2JK5 C;  4UCS A;  3CC7 V;  4J41 A;  1EFR G;  3QG5 A;  1EN6 A;  1AB3 A;  3OMI B;  4LR3 A;  1U97 A;  4PA9 A;  1WN7 A;  4PDV A;  4Z1V A;  4GX1 A;  5JQG A;  1YCI A;  1H38 A;  2ZNJ A;  2EIL C;  4WFB V;  3A0B Z;  2B1G A;  4JYA B;  4B7K A;  5EC2 C;  5BXZ A;  5JH7 A;  2LGQ A;  3SR2 C;  4MS2 A;  2K9P A;  3CMA V;  3D8C A;  4GX5 A;  4K0K O;  1NH2 C;  1J5E B;  5LMN B;  1Q81 W;  1MZF A;  4JI8 B;  3WB2 A;  4YXW G;  4DV1 O;  2QR4 A;  2ZM6 O;  5KAF Z;  4X62 O;  3JAR B;  2QKS A;  4LF8 B;  3E22 A;  2GBO A;  1COW G;  3DXR A;  4UV8 A;  1KEC A;  1SC5 B;  3OEH G;  3B4S A;  2WLJ A;  2ZQM A;  4DYL A;  3Q4H B;  4JAS A;  1EBO A;  2P7T C;  2W0X A;  4P9O A;  1JQ0 A;  3WFV A;  4JV5 B;  4DRX A;  1ZUQ A;  2NR5 A;  5EBW C;  2PYL A;  4U7N A;  4LF9 O;  4X89 A;  5FNV B;  4YIP A;  1WB7 A;  1NVP D;  4IL6 Z;  2WLN A;  4JI3 B;  3UT5 B;  1ORQ C;  4P9P A;  2JGD B;  1OCC C;  5C8Y B;  3T1C A;  1PNK A;  4IIJ A;  4TOI A;  4Q6G A;  2BSK B;  3N2G A;  4TV9 A;  2V4D A;  3KG2 A;  3CB2 A;  3LNN A;  1VF5 B;  4AQY O;  3ASO B;  4NVP A;  4UCT A;  5D5P A;  2MW2 B;  1N33 O;  3N2K B;  3BFR A;  4B3S B;  1OJH A;  4N23 A;  3E8F A;  1M5I A;  1SA0 B;  2ZDI A;  2XND G;  1OCZ C;  3S3W A;  3DGE A;  4YJ2 A;  4JI6 B;  3ABU A;  3JCU Z;  3P3N A;  4K3A A;  1H8H G;  3E8G A;  2YEV B;  1ZTE A;  1VQ9 V;  1P49 A;  1FPO A;  1VQM V;  2EIN C;  2Q7E A;  3PN1 A;  1S5L Z;  2EJ7 A;  3G67 A;  3BVO A;  4I0X A;  4JI7 O;  3OT7 A;  1HNW B;  2AZ0 A;  3CPW U;  1N32 O;  5EYP A;  3DSQ A;  2X6A A;  3CE2 A;  3J80 N;  3CXH F;  5IYZ B;  3MAQ A;  1MG1 A;  4FLY A;  2P4K A;  4TUY A;  2QWP B;  1XNQ B;  4FLU A;  4NXM O;  2JS3 A;  4B3M O;  3SJB C;  3AG3 C;  3BEH A;  4TSF G;  2GUZ A;  5GW7 A;  3AK3 A;  1S5J A;  2JJ2 G;  5B1A B;  2OCC C;  3HKC A;  3ETE A;  5IT9 N;  2ADQ B;  3H1I H;  4LF7 B;  4DR1 O;  1SKV A;  2A9H A;  4BIU A;  2YID A;  4IHJ A;  5CA1 B;  3JD3 A;  1JJ2 U;  1XNR O;  3JSL A;  2EIL B;  4HBN A;  2R9A A;  4MTX A;  3K5M A;  1OCO C;  5LA6 B;  4RAI A;  1BCC H;  1AP5 A;  2WLL A;  3CCR V;  4LFB B;  5DM6 V;  1NJI W;  2F4V O;  2K1E A;  1NH2 B;  1DLB A;  2X6B A;  2DN9 A;  4JI5 O;  4YY3 O;  3KZI Z;  5IWA B;  1DGS A;  4BAY A;  2UU9 O;  3HKB A;  1D5N A;  3E8B A;  2DQ0 A;  2DJV A;  3JD1 A;  2QM4 A;  3T1Y O;  5GON A;  3K0G A;  1XEQ A;  2WLI B;  1TUB A;  1Q43 A;  1SER A;  2DYR C;  3RYI B;  1SS3 A;  4DUZ O;  1PD3 A;  4O4I B;  5C93 A;  2BOB C;  2QWN B;  1AI7 A;  3X2Q C;  4MTF A;  5CMU A;  2HHH B;  3ML0 A;  2QWQ B;  5IYD O;  1KP2 A;  2Q8V A;  1GTO A;  3K59 A;  1YJN V;  2W6I G;  1K5Q A;  2WSS G;  3F7V C;  3K57 A;  1OCC B;  1H2S B;  2N74 A;  4XDJ A;  2YIA A;  2YIC A;  3FFQ A;  5EK0 A;  1FS0 G;  4UVA A;  3GWO A;  3J7A U;  1GMG A;  3F5W C;  2FTK A;  2KB1 A;  2LFS A;  1K92 A;  4IYI A;  3P3P A;  3OEE G;  5J2U A;  4DR4 O;  3L9D A;  1VQN V;  2XAG A;  4J7J A;  3JAL A;  1Q5O A;  4FFB A;  1AP6 A;  1VAR A;  2F93 B;  1NKD A;  3J81 N;  3EVK A;  2Q7H A;  1OCZ B;  3K5L A;  4FLT A;  2VQF O;  3TGU H;  1LR1 A;  4J7K A;  3OE7 G;  4JI1 O;  5L3B A;  2PY5 A;  2EIN B;  2Y4U A;  4JI2 B;  1IBL O;  1UPG A;  1R3I C;  2HFE C;  1VQL V;  3CCV V;  3SYO A;  1S3J A;  2ZE5 A;  5L3C A;  1ARO P;  3ABK C;  4ZI7 B;  4TV8 A;  2IBZ H;  2GTS A;  1QCE A;  3JAW B;  5DEC A;  2A06 H;  3K5O A;  2RDC A;  3STZ C;  1Y74 B;  1EN5 A;  3P32 A;  4LC1 A;  2AHY A;  3AG3 B;  3B8M A;  3CME V;  4DR6 B;  3RYF A;  5JWP A;  2B9Z A;  2OCC B;  2Q5Z A;  3AK2 A;  3QO5 A;  3G6B A;  1IBK B;  4FLW A;  3VOU A;  4J9Y B;  1PNL A;  3AG1 C;  1AI6 A;  4H0L B;  4JYA O;  2CDY A;  2ZE6 A;  4YIO A;  3ZN0 A;  4X20 A;  5L3E A;  2QM7 A;  5L3G A;  1S76 D;  2EIJ C;  2IJI A;  4YJ3 B;  1Q6U A;  2QTO A;  4HNA B;  1OCO B;  5LYJ B;  1J5E O;  5LMN O;  5K1P A;  4UCV A;  1BGY H;  3OR7 C;  1US6 A;  4DV5 B;  4JI8 O;  3C3S A;  4JPR A;  2MK3 A;  1YJW V;  4LF6 B;  1Q6I A;  3RFR A;  2HJD A;  1P84 F;  1BMF G;  3QVN A;  5JVD B;  3RYH B;  3IAY A;  4LF8 O;  1Y76 B;  4U3J A;  1R6T A;  2IJK A;  1R3L C;  4DR5 B;  3HPL C;  3HKE B;  2E76 B;  2A7W A;  1MNG A;  4AIL C;  4NKG B;  5H5N A;  4J42 A;  3M8A A;  1BSM A;  1FXK C;  4WF9 V;  4K8Z A;  2DYR B;  3CEI A;  4WBN B;  1L8D A;  3X2Q B;  4JV5 O;  2P90 A;  2F95 B;  4JI4 B;  2HEP A;  5KUM A;  4JI3 O;  5LMU B;  5B1O A;  2YDE A;  4NXM B;  4X64 B;  4HYO A;  1FD9 A;  2YUA A;  2PUS A;  2YIB A;  4DV0 B;  2FB5 A;  4U7O A;  5TIS Z;  4KFM A;  4LNU B;  5IY5 C;  2YIB D;  1M93 A;  3FAV B;  3ZRW A;  2WWW A;  2PTM A;  1HR0 B;  4DUY O;  2ITC C;  3JYC A;  2OWO A;  5KA6 A;  3UCS C;  4JZG A;  4W4K A;  5EZY A;  3T2M A;  3K08 A;  1TVK A;  2N05 A;  3ZIA G;  1XDC A;  1XHX A;  1FFX B;  4JI6 O;  2LGW A;  5B5E Z;  1S77 D;  1P7B A;  3TCU A;  4U3F H;  1IVS A;  5CA0 A;  2ATK C;  1WJZ A;  4LWS A;  1F23 A;  1HNW O;  1JJO A;  1JOY A;  3FB5 C;  4O4J B;  4DXW A;  1WPX A;  1XNQ O;  3CRR A;  3ABK B;  1JVM A;  1K34 A;  2UXN A;  5IJ9 B;  1NT2 B;  2YI8 A;  1NQT A;  2AW9 A;  5CBH A;  2L35 A;  2UXC B;  3MHH C;  3OMN B;  3I56 V;  1N34 B;  3HKD B;  3SJC C;  1R73 A;  2Q6A A;  5J2T A;  4LF7 O;  3SPJ A;  2QWO B;  1WB8 A;  4P30 A;  1J95 A;  2F1M A;  1NTZ H;  3QO7 A;  2BCC H;  3ZCC A;  4F4L A;  2OTL V;  1Y6X A;  3RW0 A;  3CCS V;  4KP4 A;  2CTP A;  5D5Q A;  3OAA G;  3ZJZ A;  5KHG A;  3I5D A;  1R3J C;  3AG1 B;  4JF3 A;  2KSD A;  1UJW B;  2ODM A;  4FLV A;  4DR7 B;  4O2B B;  5DN6 G;  4LFB O;  3QF7 A;  2EIJ B;  2HG5 C;  4UCR A;  2UXX A;  4K35 A;  2P22 C;  4PV1 B;  1KC8 W;  3L71 H;  4FM0 A;  3K04 A;  3CJH A;  2HVK C;  2IH3 C;  1YZB A;  2W6J G;  1QVG U;  5IWA O;  5ITZ B;  4RO2 A;  3OFN G;  3CC2 V;  3FYI B;  1N36 B;  1H2K A;  1GM8 A;  3BRC A;  3CSX A;  2Q0O C;  2FL4 A;  1N8R W;  1VQK V;  2Q73 A;  1SQX H;  2UUB B;  1WA8 A;  4NR1 A;  4FZ0 A;  4UCO A;  1X59 A;  3E83 A;  3DC5 A;  4D7S A;  2EJR A;  1VQ7 V;  3LDD A;  3JAK B;  4I5S A;  1BS3 A;  4DW1 A;  3OUF A;  1M57 C;  4O4H A;  1FXK B;  3E35 A;  4GKJ B;  4R6Z A;  4ZHQ A;  1RSO A;  1NR7 A;  2Y4T A;  3C3T A;  4LH6 A;  4I7Z B;  1IZ3 A;  3TXQ A;  2GHY A;  2RNB A;  1BQ0 A;  4F6R B;  3MHS C;  2JDI G;  5LXT A;  3N27 A;  5IY5 B;  4I50 A;  1EZJ A;  5LOV A;  2LFR A;  4G2K A;  1ENV A;  1KYO F;  3F7Y C;  1L0N H;  2IH1 C;  4E2L A;  2H3O A;  5FLX N;  5AG2 A;  5KX5 B;  2H94 A;  1XI1 A;  1QNM A;  4MVZ A;  2E74 B;  1PP9 H;  1SZT A;  1KQS U;  4ZKI A;  1JFF B;  1X4T A;  5KHI A;  1S0V A;  4LF5 O;  4JI2 O;  3CYO A;  3W7W A;  2Q67 A;  1CP9 A;  4X8A A;  4DV4 B;  3G71 V;  2WA3 A;  2EBO A;  4GCZ A;  3JAS A;  3NR7 A;  3ASN C;  3VQV A;  4O2A A;  1NVP C;  2LJ2 A;  2BOC C;  4DK0 A;  3RVZ A;  2FYU H;  5LHI A;  5EIB D;  3ZHQ A;  4FLX A;  3UQ8 A;  4O4L A;  5EBL C;  4DR6 O;  5JJJ B;  4JTC B;  2BTQ B;  3GWK C;  1Q82 W;  4UB8 Z;  1IBK O;  2LW7 A;  2VQE O;  1XHZ A;  4CH4 A;  2Q0A A;  4ZOL B;  3FKS G;  1RPO A;  1FJG B;  2QGN A;  1AR4 A;  4YHH B;  4H37 A;  2ZDI C;  1S72 V;  1T5E A;  4X66 B;  1SET A;  4FIP C;  4J7Z A;  2P67 A;  2Q68 A;  3CCQ V;  4DV5 O;  4RUE A;  1F7Y A;  4PDL A;  4DUY B;  2ZIM A;  2P4V A;  3ZMS A;  4LF6 O;  3D36 A;  3H01 A;  3OUS A;  1QBZ A;  4DO2 A;  2OCH A;  3ABT A;  3VQX A;  4IYH A;  3ABL C;  4DR5 O;  2E5L B;  4X1Y A;  1MOF A;  4GX2 A;  2UXD B;  3ZED A;  1IBM B;  1YF2 A;  2OIG A;  1CEZ A;  3JD0 A;  4PA6 A;  4KXR A;  1K3E A;  2DQ3 A;  3CCE V;  3RN4 A;  3G4S V;  1W0K G;  2P6J A;  1M57 B;  1DTO A;  4JI4 O;  3JAT A;  2V1D A;  5LMU O;  2Y0P A;  4X64 O;  5CB4 A;  3OM3 B;  3ZRV A;  2F66 C;  2CH7 B;  3ZS8 C;  1S5H C;  4DV0 O;  3HB3 B;  5E79 Z;  2XT9 A;  4FZ1 A;  5JQG B;  1W0J G;  1BT8 A;  2R9I A;  1Z2G A;  1IX9 A;  3A8T A;  4B3R O;  4PA7 A;  4TT3 G;  2DMX A;  3GVM A;  4CH6 A;  1HR0 O;  3L70 H;  5JH7 B;  3IGA C;  2QJ1 A;  1HDJ A;  2QEX V;  1R6N A;  2CAZ C;  2CTR A;  3BY6 A;  1VF6 A;  4Z2W A;  4NXN B;  4LFA B;  1AVM A;  1VQ8 V;  4CS4 A;  1H2G A;  3E22 B;  2Q7G A;  4EFB A;  1K8A W;  3DXR B;  4OGQ B;  2BE3 A;  2VRZ A;  1VQO V;  5BR8 B;  2AHZ A;  3DC6 A;  1UFI A;  1SQF A;  2ZE8 A;  4I4T A;  1PL0 A;  2Q9L A;  3ASN B;  2QSA A;  1YTF C;  1I5X A;  1NVP B;  4DK1 A;  3KKY A;  3SPH A;  2UXC O;  4DRX B;  2XAH A;  1N34 O;  4GKK B;  5KHH A;  1K7D A;  4JAV A;  2LQT A;  4IT5 A;  4EB6 A;  2ZT9 B;  4CZZ A;  3K3W A;  5LP6 A;  1BE3 H;  2JEU A;  3N2G B;  4TV9 B;  1XUQ A;  1H2N A;  3RWR D;  2CTW A;  1OCR C;  3NXS A;  4X1I A;  1L0L H;  4DR7 O;  3THO A;  3FD9 A;  1OV9 A;  1AJN A;  4JTA B;  2Q69 A;  3GB7 C;  4YJ2 B;  4UB6 Z;  5KMG A;  2E3C A;  3SYP A;  1E79 G;  3O65 A;  2PGG A;  4DR2 B;  1G4Y B;  1N36 O;  5JJE B;  3RGB A;  2XAS A;  4I55 A;  1XMO B;  2PZS A;  3JSN A;  2X6C A;  4I0X B;  3ABL B;  4WCE V;  1WNS A;  1SRY A;  2UUB O;  1VP7 A;  4FMT A;  5EYP B;  1M56 C;  4A5U B;  3CRQ A;  2R70 A;  4LF5 B;  1JPX A;  4TUY B;  5IJ0 A;  1KB9 F;  3BPZ A;  2PI5 A;  5L3D A;  4UVB A;  1HNZ B;  4FVM A;  4MSW C;  1P7G A;  4GKJ O;  2M7W A;  2GUZ B;  4DV7 B;  1YVW A;  4D7T A;  1KMI Z;  3HKC B;  4W4L A;  3L75 H;  4L87 A;  3BAB A;  1HP8 A;  2EX3 A;  1G8M A;  1FYJ A;  1GM9 A;  4IHJ B;  4RQE A;  3K0D A;  4MW8 A;  1VQ6 V;  4ZIB A;  2ZKO A;  2WLK A;  2EZO A;  2VWK A;  4Z1M G;  1QQC A;  1Y67 A;  1URF A;  3ZHS A;  2VQE B;  4CC5 A;  4NTW A;  2IJJ A;  1R3K C;  2WLL B;  5JCO A;  1M4U A;  1KKC A;  1K73 W;  2QKA A;  4JYY A;  4JYC A;  3CXC U;  3AG4 C;  5CBF A;  1BQZ A;  3R65 A;  1XBL A;  4QE7 A;  3HKB B;  4EEQ A;  1XIL A;  1ZAU A;  2Q4P A;  2XAJ A;  3H1L H;  5GON B;  4DV4 O;  3E2E A;  1TUB B;  5L3F A;  4BWA A;  1TUE B;  1OZ0 A;  3S3X A;  1U96 A;  3ETQ A;  4Q20 A;  3CRC A;  1YTF B;  1O9H A;  2PF4 E;  3K58 A;  2OTJ V;  1VIB A;  1WAZ A;  5IYC O;  5GTI Z;  2ZIN A;  3QO8 A;  1NR1 A;  2YXH A;  3JAM N;  4MW3 A;  4TQF A;  1O9G A;  3OW2 U;  1VF7 A;  5A9G A;  1BZK A;  2FKX A;  3ZMU A;  4DR3 B;  1G1X B;  2YI9 A;  1FJG O;  4YHH O;  5J2U B;  2CE4 A;  4AI8 A;  2JS5 A;  1YSC A;  4X66 O;  1OCR B;  2EIM C;  4B3R B;  2UUA B;  3JAL B;  4FFB B;  2M6Y A;  4DV6 B;  1GM7 A;  1YHQ V;  3W7T A;  3JCZ A;  3UKM A;  1ZL8 A;  1R1B A;  2CGN A;  1MMM A;  3WU2 Z;  1YXB A;  5A2Q N;  5BMV A;  4K8X A;  3ZRS A;  3LUT B;  4KUM A;  1MSW D;  2E5L O;  2AXT Z;  1QR9 A;  2UXB O;  1IXB A;  4ASU G;  2UXD O;  1N4C A;  3APQ A;  1IBM O;  3W7S A;  1HW7 A;  1YIT V;  3JD2 A;  2RJZ A;  3U10 A;  4F6R A;  3SYQ A;  4TV8 B;  3OR6 C;  2N04 A;  4GUN A;  4X1K B;  4I9Q A;  1M56 B;  4H44 B;  4CC6 A;  3TXS A;  1IXM A;  5B3S C;  3TJT A;  4OX9 B;  4FM2 A;  1G6U A;  1Z5V A;  2RN9 A;  3TET A;  1AI5 A;  2P06 A;  3ETG A;  3RYF B;  2L6L A;  5LBQ A;  4UVC A;  4DV3 B;  3ZMT A;  2QDO A;  3EFF K;  4BIO A;  5B1N A;  1NS1 A;  4X20 B;  1TAE A;  2A0L A;  4J10 A;  3JAR A;  3SGI A;  4HAM A;  4NTY A;  4NXN O;  1KBH A;  4LFA O;  1LNQ A;  3ZMZ A;  4CH3 A;  3OGC C;  1KD1 W;  3Q4H A;  1QU7 A;  1I5Y A;  4ICG A;  3U0Z A;  3ZHU A;  3AG4 B;  3AG2 C;  5LGN A;  4U3J B;  4OPH A;  3K9A A;  4G28 B;  3LNM B;  3WB1 A;  3STL C;  1I94 B;  5BR8 O;  3VBB A;  1B6Q A;  1L1F A;  1BL8 A;  5FNV A;  2BTO A;  2GDS A;  4WFH A;  3SJA C;  4ZOL A;  1JCH A;  1NTK H;  3UT5 A;  5FPR A;  2JGD A;  1ZLZ A;  5C8Y A;  3SYC A;  3CHX A;  3ZHT A;  2BSK A;  4WFG A;  2CK3 G;  4MTG A;  4GKK O;  2W0F C;  1PKX A;  2X7R B;  2PYJ A;  1AJQ A;  4BW9 A;  3LSU A;  1SZX A;  4J11 A;  3N2K A;  3APO A;  4B08 A;  3K5N A;  1HNX B;  2ZR2 A;  1OHH G;  1TGO A;  2IW5 A;  1SA0 A;  3BA9 A;  1GKF A;  4J9Z B;  3ZRW B;  1RM1 C;  1SQP H;  1Y66 A;  4BR6 A;  4JZ2 A;  1KKD A;  2YEV A;  4H33 A;  2R72 A;  2WAM A;  1YJ9 V;  5EZY B;  4PI0 A;  3L72 H;  1TVK B;  2ZIO A;  1RFY A;  2EIM B;  1XL6 A;  5KHK A;  1VEW A;  1E1Q G;  4XBF A;  4B3T B;  4QJF B;  5IYZ A;  4DR2 O;  2CGO A;  4L8J A;  3W7U A;  1VQ4 V;  5CA0 B;  1XMO O;  1Q8I A;  4LWS B;  2V7Q G;  4JGS A;  2CH7 A;  3RYC B;  5DED A;  1XL4 A;  5HFM A;  4FM1 A;  1Q3E A;  1NZ6 A;  1Q6H A;  5EIB C;  1GN2 A;  5JJN B;  4QGP A;  3D3I A;  3WB0 A;  3BCC H;  2OIE A;  1HNZ O;  1VMG A;  4LBE C;  5CA1 A;  1WP8 A;  2GTA A;  2HKO A;  4EKW A;  2D2C B;  4DV7 O;  2EIK C;  1MZE A;  2ZXW C;  5B3S B;  1N0J A;  5J2T B;  5LA6 A;  2QM8 A;  4NYK A;  3MDS A;  4KHP B;  2LP7 A;  4LP8 A;  1V54 C;  1GN6 A;  3ZX6 A;  4MVU A;  1V55 C;  1GN3 A;  2RQ6 A;  3SPI A;  1H8E G;  1F4M A;  2GV9 A;  1NI8 A;  2LW1 A;  5LGT A;  1NH2 D;  2CUG A;  4WFE A;  2DWD C;  4QNH B;  4BIZ A;  1K9M W;  3M7M X;  1F4N A;  1XRE A;  1LUV A;  2NLJ C;  3H1H H;  3U11 A;  3D36 C;  3CJH B;  3SDL A;  3H9V A;  3WG7 C;  2WLI A;  3IJ4 A;  1MAB G;  3B77 A;  5F2V O;  4UUJ C;  1M9N A;  3RYI A;  2KKW A;  3IFX A;  4G27 B;  4KL1 A;  2YXL A;  3ICX A;  4O4I A;  5CN0 A;  2AGA A;  1IDS A;  4LCU C;  2DWE C;  3AG2 B;  3T1H O;  1B3Q A;  1WA8 B;  4GX0 A;  1SQG A;  2KG7 B;  3OD4 A;  2UXB B;  4PD4 F;  3RBZ A;  2JVD A;  2WPD G;  4O4H B;  1DK1 A;  1Q7Y W;  2HR3 A;  3K06 A;  3ZN1 A;  3LSS A;  1YIJ V;  4ZHQ B;  1RSO B;  4AHC A;  4PJ0 Z;  3QTC A;  3K9S A;  2YS8 A;  1K33 A;  3ZRX A;  1VQP V;  4BW5 A;  4LFC B;  5IE9 A;  1V9P A;  3EHB B;  2UUC B;  5LXT B;  3O9O A;  4DR3 O;  4I50 B;  3T4D A;  2QTS A;  5LOV B;  4LF4 B;  3VQW A;  2NN4 A;  1THZ A;  2JGU A;  1RM1 B;  2QWR B;  3SPC A;  3B8N A;  1VF6 C;  1K4C C;  2UUA O;  1IUR A;  4QIW F;  3CS5 A;  2DE0 X;  5H6Q A;  4DV6 O;  2YC0 A;  2ZD9 A;  1LUW A;  3CRM A;  4DV2 B;  4NTX A;  5B66 Z;  1XOU A;  1FXV A;  2ZR3 A;  4ZI7 A;  4UCU A;  2XAF A;  4ABM A;  1SQB H;  4RUF A;  1AI4 A;  1D5A A;  3JAW A;  2Z5U A;  1RPR A;  5EBM C;  1Y74 A;  4WFA V;  2ADP A;  3B2E E;  2XOK G;  1I08 A;  3JAS B;  5B1B C;  4O2A B;  1Z5W A;  1PPJ H;  1YDX A;  4OX9 O;  4MVR A;  4JAU A;  2G38 A;  1GRJ A;  5GTH Z;  2Z0A A;  3CWB H;  4O4L B;  2D3O W;  1JX9 A;  2ZE7 A;  3RT3 C;  3CCJ V;  5LP6 C;  5K1X A;  2EIK B;  1AR5 A;  5IDJ A;  2QKC A;  4YJ3 A;  1BHA A;  2ZXW B;  4PDM A;  4HNA A;  1XQ8 A;  4JYB A;  4DV3 O;  5KAI Z;  3OTO B;  4MVM A;  4JI0 B;  5LYJ A;  3JD4 A;  1V54 B;  5KUK A;  2Y0I A;  1ZSP A;  1EZV H;  1V55 B;  4I9W A;  4GT1 A;  3CD6 V;  1YI2 V;  4IGG A;  4IIJ B;  3UO2 A;  3IC7 A;  1AIL A;  1QHT A;  3K79 A;  2Y69 C;  1Q90 D;  3G80 A;  3LDE A;  5JVD A;  3RYH A;  5H2F Z;  1Y76 A;  2JEX A;  4MVQ A;  4LH7 A;  1WP7 A;  3KCX A;  2F23 A;  3HKE A;  5KA5 A;  3ETD A;  4R8C A;  3L73 H;  4MTO A;  3WG7 B;  2PI4 A;  1TA8 A;  4WFF A;  4XDL A;  4X65 B;  2H8P C;  4WBN A;  4FJC C;  4X1Y B;  1YTF D;  1I94 O;  1JR9 A;  4ZBM A;  3ZMV A;  4X9Q A;  4MT8 A;  2QE7 G;  3OGI B;  1FFT B;  4TQD A;  4PHZ A;  2B5U A;  3FYE B;  4PA3 A;  4LNU A; 
#chains in the Genus database with same CATH homology
 1Y4M A;  3UKM A;  3G6E V;  3A0R A;  2GHY A;  2YSU B;  3CPW U;  3MHS C;  3ZRS A;  2JDI G;  3LUT B;  4KUM A;  1MSW D;  2ITD C;  2X6A A;  2IU0 A;  2C2A A;  1QR9 A;  1MG1 A;  4ASU G;  5IY5 B;  1EZJ A;  4R50 A;  4JTD B;  3W7S A;  2LFR A;  1YIT V;  4G2K A;  1ENV A;  3JD2 A;  1K4D C;  3F7Y C;  3DTU B;  1ROP A;  3SYQ A;  2IH1 C;  4E2L A;  3OR6 C;  5LHG A;  3FB8 C;  3AG3 C;  2H94 A;  3BEH A;  4TSF G;  1M56 B;  1F51 A;  4N21 A;  2F43 G;  5GW7 A;  3ABM C;  2X0L A;  4MVZ A;  2JJ2 G;  5B1A B;  2OCC C;  2B1I A;  3ETE A;  3FB6 C;  3CP1 A;  1IXM A;  5B3S C;  1SZT A;  5E1A C;  1KQS U;  4ZKI A;  2A9H A;  4BIU A;  3E86 A;  1S0V A;  1P4R A;  3TET A;  1AI5 A;  3ETG A;  3JD3 A;  1JJ2 U;  1M90 W;  3PJS K;  5LBQ A;  3CYO A;  2EIL B;  3W7W A;  2Q67 A;  4UVC A;  3CCM V;  1CP9 A;  4MTX A;  3ZMT A;  4X8A A;  3G71 V;  1OCO C;  3EFF K;  4RAI A;  2EBO A;  5B1N A;  4GCZ A;  2IJH A;  2Y48 A;  2WLL A;  3ASN C;  3CCR V;  5DM6 V;  1K5S A;  1NVP C;  1NJI W;  2A0L A;  2K1E A;  2OT5 A;  1VQ5 V;  2BOC C;  2GSM B;  1NH2 B;  1AJP A;  1DLB A;  2X6B A;  3RVZ A;  5LHI A;  5FL7 G;  5CBG A;  4HAM A;  1FXH A;  1QLE C;  4BAY A;  1LNQ A;  3ZMZ A;  3OGC C;  5B1B B;  1PNM A;  5EBL C;  1DF4 A;  3E8B A;  2DQ0 A;  3FB7 C;  4P2Z A;  1W2B U;  1KD1 W;  4JTC B;  1Q82 W;  2XAQ A;  3JD1 A;  1QLN A;  1I5Y A;  2DYS C;  3K0G A;  3AG4 B;  3AG2 C;  5LGN A;  2WLI B;  1SER A;  1GO3 F;  3K9A A;  4G28 B;  2DYR C;  3LNM B;  3STL C;  1PD3 A;  5C93 A;  2BOB C;  3FKS G;  3VBB A;  1AI7 A;  1RPO A;  4MTF A;  5CMU A;  3X2Q C;  1QR8 A;  1B6Q A;  1L1F A;  1BL8 A;  4H37 A;  3RVY A;  4WFH A;  2ZDI C;  3ML0 A;  1JCH A;  1S72 V;  1SET A;  4FIP C;  3SYC A;  1AR1 B;  2P67 A;  2JIZ G;  1KP2 A;  5IYD O;  2Q68 A;  1GTO A;  1YJN V;  3K03 A;  3CCQ V;  4QPK A;  4RUE A;  2W6I G;  4PDL A;  3ZMS A;  4WFG A;  1K5Q A;  2CK3 G;  1WLE A;  2WLH A;  4MTG A;  2WSS G;  2Y69 B;  3D36 A;  2W0F C;  1PKX A;  2X7R B;  3H01 A;  3F7V C;  1ZWI C;  3OUS A;  1GK9 A;  1QBZ A;  4DO2 A;  1AJQ A;  1OCC B;  3ABT A;  4XDJ A;  3ABL C;  3LDC A;  5EK0 A;  1FS0 G;  4UVA A;  1MOF A;  3GWO A;  4GX2 A;  1GMG A;  3F5W C;  2FTK A;  2ZR2 A;  2KB1 A;  1OHH G;  2LFS A;  1K92 A;  3P30 A;  5J9P C;  2IW5 A;  3OEE G;  1GKF A;  1K97 A;  1E1R G;  1CEZ A;  3JD0 A;  1FXK A;  4OXS A;  4J9Z B;  4PA6 A;  2XAG A;  3SJQ C;  1VQN V;  3ZRW B;  1RM1 C;  1Y66 A;  4MVO A;  1K3E A;  1R6K A;  2DQ3 A;  1KKD A;  2YEV A;  4H33 A;  3CCE V;  2DW4 A;  1KP3 A;  2WAM A;  1NKD A;  1YJ9 V;  3G4S V;  3SYA A;  1OCZ B;  1W0K G;  2P6J A;  5LGU A;  3CCU V;  1M57 B;  1DTO A;  3OE7 G;  2EIM B;  2V1D A;  1XL6 A;  3OM3 B;  1M1K W;  1E1Q G;  5L3B A;  3ZRV A;  4XBF A;  1S5H C;  3HB3 B;  2EIN B;  4QJF B;  2HVJ C;  1VQ4 V;  1R3I C;  3W7U A;  1W0J G;  2HFE C;  1VQL V;  2R9I A;  3CCV V;  3SYO A;  1S3J A;  5L3C A;  1ARO P;  3ABK C;  4PA7 A;  2V7Q G;  4JGS A;  4TT3 G;  3CCL V;  1XL4 A;  2IU3 A;  5HFM A;  3MD0 A;  3IGA C;  5H9C A;  1QCE A;  3I55 V;  2QEX V;  3OMA B;  1R6N A;  3STZ C;  2JJ1 G;  3D3I A;  3BY6 A;  2QA4 V;  5CA3 A;  3P32 A;  2AHY A;  3B8M A;  3AG3 B;  4LBE C;  2R9R B;  4LC1 A;  4EKW A;  2HKO A;  3W7X A;  3CME V;  4CBC A;  3ABM B;  2WLM A;  1VQ8 V;  3E89 A;  3UM7 A;  3CC4 V;  2EIK C;  5IYB O;  2OCC B;  5H6R A;  3QO5 A;  1H2G A;  2ZXW C;  4PA4 A;  5B3S B;  3VOU A;  4J9Y B;  4PEL A;  2QM8 A;  1PNL A;  3AG1 C;  1AI6 A;  1K8A W;  2LP7 A;  4LP8 A;  3ZN0 A;  1V54 C;  1HWY A;  5L3E A;  2QM7 A;  5L3G A;  1VQO V;  4MVU A;  1V55 C;  2HJF C;  2AHZ A;  3M99 B;  4QE9 A;  1S76 D;  2EIJ C;  2IJI A;  4FK5 C;  4RQF A;  3SPI A;  2QTO A;  1H8E G;  5HFL A;  1F4M A;  1OCO B;  1PL0 A;  5LGT A;  1NH2 D;  1CPY A;  4WFE A;  2DWD C;  3ASN B;  1YTF C;  4QNH B;  1I5X A;  3OR7 C;  1NVP B;  4BIZ A;  1K9M W;  1F4N A;  3SPH A;  4X88 A;  2XAH A;  2MK3 A;  4JPR A;  4HZ3 A;  1YJW V;  2NLJ C;  1BMF G;  1K7D A;  4JAV A;  3WG7 C;  2A79 B;  1QLE B;  2WLI A;  3ASO C;  2IJK A;  4UV9 A;  1R3L C;  1MAB G;  3B77 A;  4PDR A;  4UUJ C;  4CZZ A;  1M9N A;  3K3W A;  3HPL C;  3IFX A;  3LSQ A;  4G27 B;  4R7C A;  5CN0 A;  3E8H A;  2JEU A;  4QPJ A;  2DYS B;  4LCU C;  2DWE C;  3TK1 A;  3AG2 B;  4FPP A;  1FXK C;  4WF9 V;  1OCR C;  2DYR B;  3NXS A;  5LHH A;  4GX0 A;  1SES A;  4UXN A;  4XDK A;  3X2Q B;  1QVF U;  1AJN A;  2Z3Y A;  5EC1 C;  3RBZ A;  4JTA B;  2P90 A;  2Q69 A;  2WPD G;  3T4Z A;  5KUM A;  2HLD G;  3GB7 C;  1NBM G;  5B1O A;  1Q7Y W;  2HR3 A;  3K06 A;  5BZB A;  1Q86 W;  3SYP A;  4HYO A;  3ZN1 A;  1E79 G;  3LSS A;  3SPG A;  4MVS A;  2NNU A;  2EZP A;  4U7O A;  1YIJ V;  1BHB A;  4KFM A;  4TWK A;  1G4Y B;  1DF5 A;  5IY5 C;  2XAS A;  3QNE A;  1K33 A;  3ZRX A;  1VQP V;  2X6C A;  3ZRW A;  2WWW A;  4BW5 A;  3ABL B;  4WCE V;  3EHB B;  1SRY A;  3AEI A;  4FMT A;  2ITC C;  3JYC A;  1M56 C;  5KA6 A;  3T2M A;  3T4D A;  1JPX A;  3K08 A;  5B1A C;  2JK5 C;  1THZ A;  3ZIA G;  3CC7 V;  1EFR G;  1RM1 B;  2PI5 A;  5L3D A;  4UVB A;  3SPC A;  3OMI B;  3B8N A;  4MSW C;  1K4C C;  4PA9 A;  4QIW F;  2M7W A;  4PDV A;  1S77 D;  1P7B A;  3TCU A;  5H6Q A;  4GX1 A;  2ZD9 A;  1H38 A;  2ATK C;  2EIL C;  4L87 A;  2ZR3 A;  1FXV A;  4WFB V;  2B1G A;  1G8M A;  2XAF A;  1GM9 A;  1F23 A;  4RUF A;  4RQE A;  1AI4 A;  1JOY A;  3FB5 C;  3K0D A;  5EC2 C;  4MW8 A;  1VQ6 V;  4MS2 A;  3CMA V;  4DXW A;  2WLK A;  4GX5 A;  1NH2 C;  2EZO A;  1WPX A;  2Z5U A;  1RPR A;  5EBM C;  4Z1M G;  4WFA V;  3ABK B;  1JVM A;  1K34 A;  2UXN A;  2XOK G;  1Q81 W;  2IJJ A;  1NQT A;  1R3K C;  2WLL B;  5CBH A;  5B1B C;  4YXW G;  3MHH C;  3OMN B;  3I56 V;  1K73 W;  1R73 A;  2Q6A A;  4JYC A;  2QKS A;  3SPJ A;  3CXC U;  4P30 A;  1COW G;  3AG4 C;  4MVR A;  1J95 A;  3R65 A;  5CBF A;  4JAU A;  3QO7 A;  4UV8 A;  1KEC A;  4QE7 A;  1JX9 A;  3ZCC A;  3OEH G;  4F4L A;  3CCJ V;  2WLJ A;  2D3O W;  2OTL V;  2ZQM A;  2EIK B;  5IDJ A;  3RW0 A;  3CCS V;  4KP4 A;  1BHA A;  4JAS A;  1EBO A;  2ZXW B;  3OAA G;  4PDM A;  2XAJ A;  4JYB A;  3ZJZ A;  4MVM A;  2P7T C;  1R3J C;  3AG1 B;  4JF3 A;  1UJW B;  3JD4 A;  3E2E A;  1V54 B;  5L3F A;  4P9O A;  5KUK A;  1JQ0 A;  3WFV A;  5DN6 G;  1V55 B;  4I9W A;  2EIJ B;  4GT1 A;  3CD6 V;  2HG5 C;  1YI2 V;  2UXX A;  1TUE B;  5EBW C;  3IC7 A;  4U7N A;  1KC8 W;  1OZ0 A;  4X89 A;  3K79 A;  2Y69 C;  3LDE A;  3K04 A;  1NVP D;  2WLN A;  2HVK C;  2IH3 C;  2W6J G;  2JEX A;  4Q20 A;  1ORQ C;  4P9P A;  1QVG U;  4MVQ A;  1OCC C;  1YTF B;  3T1C A;  1PNK A;  2OTJ V;  4RO2 A;  3OFN G;  3CC2 V;  5IYC O;  5KA5 A;  3ETD A;  3FYI B;  1GM8 A;  3QO8 A;  1NR1 A;  3KG2 A;  4R8C A;  4MTO A;  3WG7 B;  4MW3 A;  3ASO B;  2PI4 A;  4WFF A;  1N8R W;  4XDL A;  3OW2 U;  1VQK V;  2H8P C;  4FJC C;  1YTF D;  3ZMU A;  3E83 A;  4N23 A;  2EJR A;  1VQ7 V;  3LDD A;  4ZBM A;  3ZMV A;  4I5S A;  3E8F A;  4MT8 A;  2ZDI A;  2XND G;  1OCZ C;  3OUF A;  1M57 C;  1FXK B;  1YSC A;  3DGE A;  1OCR B;  3ABU A;  2EIM C;  2QE7 G;  1FFT B;  3E35 A;  1H8H G;  3E8G A;  4R6Z A;  2B5U A;  3FYE B;  2YEV B;  1GM7 A;  1VQ9 V;  4PA3 A;  1YHQ V;  1VQM V;  1NR7 A;  2EIN C;  3W7T A;  3JCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...