1RM1B

Structure of a yeast tfiia/tbp/tata-box dna complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
101
Chain Sequence
PGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEVISVDKLRIVACNSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*TP*CP*GP*AP*TP*CP*GP*AP*TP*AP*TP*AP*AP*AP*AP*CP*G)-
total genus 23
structure length 101
sequence length 117
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
B PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1rm1B01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1rm1B02
1RM1B 1NVPD 1NVPC 5IYCO 1YTFD 5IYDO 1NH2C 1NH2D 1YTFC 1RM1C 5IYBO
chains in the Genus database with same CATH superfamily
1ZTEA 1NBMG 2CGOA 1SQGA 3F5TA 2PUSA 2WPDG 3EVKA 3LSUA 4OPAA 2JEUA 5B1OA 1PL0A 1R73A 1H2GA 3KKYA 3LNNA 1P4RA 5J2TA 1GK9A 1XI1A 1YEWA 1SC5B 4D7TA 4NTWA 1GH6A 4FLXA 5KMGA 3JD1A 5C93A 1AI5A 1AR5A 2LO1A 2OTJV 4A5UB 1AJQA 1R3LC 3SPIA 4TUYA 5FNVA 2UXCB 2HHHB 2ADQB 3AG3C 4LP8A 2V7QG 4X64B 4YY3O 3OW2U 2Q68A 3RWRD 2MW2B 2YUAA 1R6TA 4G27B 4DO2A 3JAKB 4KUMA 5H2FZ 1XL6A 1MOFA 3CXHF 4OGQB 2YXLA 2VQEO 1VQ5V 4UVAA 4FFBA 3RYHA 1Q81W 3WG7B 3T2MA 4LF4B 3F5WC 4GKJO 2WLMA 4FIPC 3AEIA 4X66O 1WPBA 2E5LO 3JALB 1RSOA 4PELA 4JZGA 1M56C 2Q73A 4Z2WA 4X62B 3N2GB 4FLVA 5CMUA 3CRRA 3JSLA 4R6ZA 1SZTA 3THOA 1H2SB 4KFMA 4ZI7B 4FM0A 2GUZA 2YDEA 1VF6C 3FAVA 4G2KA 4I55A 2BCCH 1AVMA 2IM9A 1K4DC 2DN9A 5BZBA 3A2FA 1FJGO 3SJAC 5LMNO 3U11A 1SQPH 4DR2O 1ZX3A 1NQTA 1N34B 5BR8O 1XMQB 2P06A 3JALA 4GX5A 1BHAA 2YSUB 5GTHZ 2ATKC 4XBFA 4UCSA 2V4DA 3OR7C 2NN4A 4NB5A 1NS1A 3IFXA 4LC1A 1GKFA 1BCCH 1JJOA 3CE2A 1N33B 1YCIA 2EINB 1K34A 3VBBA 3B09A 3ZRSA 3C3TA 4LF7O 1GM7A 1R3IC 4P9PA 2N74A 3H1HH 3NR7A 1WNSA 1FYJA 1IZ3A 2VQFB 2Y0PA 1NTKH 4TT3G 3ZMUA 4JI3B 2EILB 4EFBA 1F4MA 2LGWA 5IE9A 3CCVV 4WFFA 1KU9A 1XOUA 5JJJB 2H94A 3SYAA 1K5QA 5KUKA 4KP4A 4YHHB 2DJVA 1VMGA 2F43G 4HNAA 4O4LA 1XILA 2XT9A 2OCCB 4WBNA 5DEDA 3M99B 1WB7A 5LXTB 4CH4A 2EIJB 1WLEA 1WPXA 4ZKIA 4QJFB 4RQFA 4LR3A 3TK1A 4JTAB 4J10A 5JWPA 3OGCC 1NT2B 3JATA 3O9OA 3UM7A 1EN4A 1L0LH 2OCCC 3N27A 3ZBHA 1OHHG 4NR1A 1KP3A 3HKEB 5J2TB 3HKDA 3HR0A 1PP9H 2EJ7A 4ZHQA 4QGPA 2FMLA 4IYHA 4PA3A 2W0XA 2OIEA 4R50A 1YVWA 5FPOA 4CC5A 4JGSA 1JJ2U 4DR3O 5DM6V 1Z2GA 2GTSA 2D2CB 4AILC 1M57B 2PYLA 5CA0B 1HR0O 5BMVB 1CP9A 4MVSA 2XTAA 2K9PA 2ODMA 3OMAB 2ZDIA 1EFRG 5CN0A 1L1FA 2F66C 4Z1VA 1H8HG 4MVRA 4DYLA 2PYJA 3QO5A 1DK1A 5KHKA 5EC1C 5J2UB 1XDCA 2W6IG 3I56V 1BZKA 2F1MA 2R9IA 3AG4C 1GM8A 3E2EA 3K0GA 5LP6A 1DTOA 2QM8A 3PN1A 4LFAO 4GLXA 3OMIB 4ICGA 3ABKB 3H1JH 3T1YB 3CCMV 3SR2C 1Q90D 2HVKC 2CH7A 4ZOLA 4FLTA 1LNQA 3HKCA 4IYIA 3OFNG 2LP7A 5H6RA 1IVSA 3MD0A 4X1KA 5JQGB 2Q4PA 3HKBB 4JYBA 2R72A 2DYRB 4DW0A 3IC9A 2WLIA 3Q4HA 3APQA 3IJ4A 1GN2A 2V1DA 5LHHA 3K57A 5FPRA 1VQKV 2DE0X 3L73H 1VP7A 4L8JA 1SQVH 5B1AC 4OXSA 2UXXA 5J9PC 1QLNA 1VQ9V 1COWG 3JAWA 2WLJA 4KHPO 4DR4O 5KX5B 3G71V 5IYZB 2P4KA 2EIKB 4JASA 1QLEC 3STLC 2FKXA 3D36C 4Q6GA 4X1YB 5ITZA 1US6A 5KAIZ 2VWJA 4LF5O 4WFEA 1FS0G 4DR1O 2X0LA 4IIJB 1X4TA 2EJRA 1IBMO 2ZKOA 4CH6A 4NTXA 4AI8A 1EZVH 3CRAA 1NR7A 3OD4A 1YIJV 2Y4UA 4J7JA 2JDIG 1VIBA 3B2EE 3CEIA 3OGIB 4O4HB 3T1YO 2Q5ZA 1AR4A 2Q7EA 4YIOA 3ASNC 4FJCC 4PD4F 1Q8IA 2Q6AA 1H2NA 1SQBH 1KD1W 1I5XA 4PA7A 4RWUA 2F4VB 4FLUA 5L3CA 1T5EA 1Q7YW 4JYYA 5K1PA 1S77D 2CGNA 3JAWB 5JJEB 3L9DA 4PI2A 1OZ0A 2YIBA 5H6QA 3D3QA 3WB2A 1YTFD 4IHJA 2KKWA 3A0RA 3AG1B 3W7WA 2EIJC 4JTCB 2QWNB 4GZRB 3GVMA 4TV8B 1AP6A 3R65A 2IH1C 3OT7A 4JYAO 2P6JA 5LYJB 4U7OA 1NVPB 1Y76A 5L3FA 4LFBB 3QNEA 1XMOB 1OCZB 2OIGA 1N8RW 4ZIBA 4FFBB 4X1IA 3BFRA 4TWKA 1N36O 3FFQA 4OX9O 2DWDC 1SETA 1HNWB 3JASA 1JFFA 2A9HA 1F7YA 2WLIB 3CRMA 2F93B 2F4VO 4NXMO 4DR5O 4JI7O 4L87A 2X7RB 1P7GA 3ML0A 2ILMA 3W7UA 2AZ0A 1MSDA 2ZCEA 4FM2A 3J7AU 1IBLB 1WP7A 2QGNA 3BVOA 4UV9A 1WAZA 3K58A 1NH2C 4I5SA 4PA6A 1AB3A 3AG2B 3A8TA 4ZBMA 1N33O 3ABMB 3CD6V 5KLVH 2PGGA 2QTOA 5E79Z 1SKVA 4H33A 1K92A 2EILC 3H1KH 4TUYB 2RN9A 5FNVB 1HWYA 1FKAO 1VQOV 3ZMTA 4TOIA 2OT5A 1NZ6A 3SJBC 2QWPB 3IC7A 2QWQB 1FXKA 4PJ0Z 1YF2A 1IBKO 5LXTA 4DR5B 3SYPA 4LBEC 1GO3F 2Q0AA 3TJTA 3LDCA 4YIPA 3JD3A 2RCVA 1XNRO 1JCHA 3OEHG 4XDLA 4DR6B 3N2KB 2LW7A 4DV0B 1SERA 3R66A 4O2AB 4IGGA 1WA8B 5B3SC 1FXKC 3OMNB 4X88A 2NLJC 3AK2A 4D6TH 3B77A 4TQFA 5IYDO 2AZ2A 4LFCB 1V9PA 3CCUV 2UXNA 1YJNV 4ASUG 4PA9A 1SQQH 3T1HO 4HNAB 2FB5A 3DGEA 1FJGB 4JI8B 1XUQA 4LWSB 3CWBH 3K9SA 3OTOB 1ENVA 4B3SO 4NYKA 3LUTB 4HBNA 1AROP 1QVGU 1KC8W 3FYEB 3WFVA 4UCRA 5CBGA 4DV7O 1W2BU 1PL4A 4MW3A 1NVPC 3SYCA 3ABUA 2XUMA 2HP8A 3K3WA 2HVJC 2EX3A 4OPHA 1YTFC 3E86A 1ZUQA 3FB7C 4WFHA 3CCSV 5KUMA 3WG7C 1Z5WA 2HKOA 1PKXA 3AG3B 3ETGA 4AQYB 1ORQC 3W7TA 5KHGA 1NH2B 2Q0OC 1VQ7V 4UCTA 2YI9A 4CBCA 4F6RB 1Q6IA 3CCRV 4K8ZA 3EXAA 3BRCA 5KA6A 1NVPD 4LF6O 4LNUB 1PM9A 2WLLA 1Y76B 4FPPA 2A0LA 2QKCA 3RYFB 4XDJA 4DUZB 1WB8A 2EIMB 1B04A 2JJ2G 2NR5A 4LFCO 2B5UA 4JV5O 4P2ZA 5KX5A 2XAQA 2QR4A 1XHZA 4U3FH 4B7KA 3CPWU 4J41A 5LBQA 1G8MA 1NJIW 3SYQA 1W59A 1K73W 2KSDA 3E35A 3JARA 1GN4A 1M4UA 4G28B 2R9RB 4LF6B 1GTOA 4PDLA 1VQNV 3TXSA 4DV6O 4B3RB 1R1BA 2B9ZA 4XDKA 2N04A 3H1LH 1A32A 4O4HA 5B66Z 2ZM6B 5TISZ 1FFXB 3MAQA 3P30A 2QKSA 1FFTB 1KQSU 1YHQV 4JTDB 2EIMC 4JAAA 3FD9A 3QG5A 2WA4A 2UXDO 3DXRB 3ABLC 1BS3A 3K59A 5LHGA 4O4IB 1YTFB 1LR1A 3CYOA 1QLEB 3SYOA 3K0DA 3CCJV 2ITCC 4LF4O 2Q67A 3CB2A 3W7SA 4CZZA 4NXMB 1FXVA 4IIJA 4X1YA 5ITZB 2IJKA 3K5MA 5BMVA 2BSKA 2JEXA 2UUAO 2CTQA 5EZYA 1VQ8V 5C8YA 2HFEC 4X8AA 2IBZH 1S5JA 1NU1H 5J2UA 4X64O 1GAXA 3LDEA 4JI0B 3RVZA 1XMOO 3A0BZ 4DR7O 3SPHA 3DTUB 2EBOA 1HNXO 4JAVA 5FLXN 4BW9A 1X59A 1FXKB 3ABLB 4B3MB 2GTAA 3AG4B 4FVMA 5IDJA 1NH2D 3B40A 3ZHQA 4YJ3B 3JYCA 3VOUA 4O2BA 3P3PA 1VF5B 2F95B 2EZPA 5CB4A 1Z5VA 4W4LA 4E2LA 1H2KA 4U7NA 1K3EA 4X89A 1QBZA 3L75H 1N0NA 1CPYA 4FLYA 4ZOLB 1NI8A 3TXQA 4LFAB 2XAHA 4DV4O 3CS5A 5L3BA 4DUYB 3ZJZA 2IU3A 5B3SB 2Y0IA 1YDXA 3SDLA 4JAUA 1I5YA 3UO3A 2HG5C 3EHBB 4YJ2A 3KCYA 1M90W 4X20A 3E8FA 3BA8A 4BIOA 3A0HZ 2YEVA 4U3JA 3ABMC 4WBNB 1Q6HA 3ASOC 1N34O 1Q86W 4LF5B 3ZHRA 1DGSA 1V55C 5IWAO 1D5AA 4B3RO 4O4JA 1YJ9V 2EULA 3DXRA 1MZEA 2X6BA 4DR4B 4YJ2B 1BHBA 4TV9A 2OCHA 2R9AA 1QHTA 1ZL8A 4J7KA 1FPOA 1L8DA 2ZR3A 3U10A 3BA9A 3EFFK 4JI2O 3ZMSA 3HPLC 5JQGA 3E8HA 5EYPB 3ZRWA 2LJ2A 1IXBA 2Y69B 2KQXA 4X20B 1I7FA 4RO2A 2M6YA 1ROPA 2JGDB 3JD2A 4GX0A 4RAIA 1NTZH 4O4JB 2ZR2A 3L71H 4MTGA 1MA1A 2DW4A 2LFRA 2YIBD 3QO8A 4RUFA 1P84F 4JI6B 2WSSG 3G6EV 1GMGA 1SS3A 1SA0B 3IGAC 3UQ8A 1QCEA 3VQXA 4UVBA 1H8EG 4CS4A 2UXBB 2DQ0A 4CH3A 1V55B 2JK5C 3FB6C 4MT8A 2CDYA 4UFZA 3RFRA 4B08A 5LL6Y 4BIZA 2PY5A 4J9YB 1YZBA 4DUYO 4DV0O 2YICA 5KMGB 4H0LB 2WWWA 4H44B 1BQZA 2A06H 3F7YC 4PDRA 4UCUA 2UXCO 4W4KA 5EBWC 2D3OW 1SRYA 4KXRA 3VQYA 1BT8A 3CC7V 2GHYA 1RM1B 2EZOA 3RYCB 1B6QA 5IJ0A 4LNUA 2JS5A 1OJHA 1B3QA 1S0VA 2DYSB 5C8YB 3QTCA 2L6LA 1KUQA 3RYFA 3X2QB 3ZMVA 1AJNA 4JI1O 3BCCH 1TUBB 2B1GA 4LH7A 2Q7HA 3KZIZ 3E8BA 4UB6Z 2WAMA 4I0XA 3WB0A 5EBLC 3HKCB 3DSQA 2CAZC 4PA4A 1XREA 3MHHC 1JA8A 4U3JB 1AJPA 2QWOB 4KHPB 4BR6A 1QR9A 5AG2A 3L74H 2B1IA 1XNQB 1JX9A 1ZSPA 5LGUA 3ZCCA 2XAFA 2ZE8A 2HEPA 2QSAA 1THZA 2YIDA 3OUFA 2ZINA 3JSNA 2R70A 3E8GA 2ZNJA 1S5HC 3CP1A 3FAVB 4CC6A 1W0KG 4DV1B 4B3MO 3D36A 3STZC 3RYIB 1RPRA 2WLLB 3U0ZA 2HJFC 4N23A 1AI7A 1ZWIC 4EFEA 3TETA 1OCRB 3SJQC 1SQFA 2WA3A 4DR1B 5H9CA 3ZHUA 2P4VA 3OAAG 4QE7A 4FM1A 4JI8O 3SPGA 5LA6B 1S3JA 1O9HA 1PNKA 5B1AB 3GWKC 4DV6B 2OWOA 1M1KW 2QJ1A 3J80N 2VWKA 4C7UA 2RDCA 1QNMA 4WFAV 5KA5A 2QDOA 3HKEA 3UT5A 2O57A 4MVZA 3UCSC 5A2QN 1EN6A 3AK1A 1JPXA 3CJHB 3QF7A 2UXDB 3X2QC 1Y67A 2UU9O 2MK3A 3I5DA 2PF4E 1M57C 2ZXWB 1K9MW 1YSCA 1XMQO 5CBFA 3DC6A 4DR6O 2ITDC 2X6CA 1HNXB 2ZM6O 1Q43A 5EYPA 1RM1C 1VF7A 2CTPA 1GN6A 1L0NH 4MVUA 4FFKA 1MG1A 1IXMA 3P32A 2IH3C 1LUVA 4D7SA 1QQCA 2P67A 3CX5F 4F4LA 2RJZA 1K97A 2ZE6A 2UUBB 4NVPA 4PI0A 3RYIA 4AQYO 4B7EA 2BE3A 3RBZA 3QVNA 3C3SA 4BW5A 5JCOA 2XOKG 4MVOA 3TCUA 3FB5C 1WN7A 5LP6B 2Q7GA 2XAGA 2XHBA 3ZHTA 2BSKB 2LW1A 2E75B 1OCRC 4JPRA 3JAKA 2EIKC 4GKJB 4GX2A 5KHIA 3CHXA 2JJ1G 2YIAA 2Z3YA 3RGBA 2AHYA 3CMAV 4MVMA 2QKAA 5L3DA 3F7VC 5IJ9A 3OUSA 5F2VO 4DV4B 1PPJH 1S76D 3BAAA 3OE7G 3K03A 4JZ2A 3K5NA 4Q20A 5BY1A 2OTLV 5B1BC 4O2AA 1LUWA 4GUNA 1TUBA 4EEQA 4PDMA 2BTQA 2QEXV 5IYBO 1UFIA 3JCUZ 2VRZA 1N32O 2FYUH 3S3XA 4P30A 3ICXA 3PJSK 2YI8A 1FFXA 4JF3A 5CA1B 2L35A 5IJ9B 4J80A 3K79A 1OCOC 3AK3A 3M7MX 1O9GA 1OCCB 1TA8A 3MHSC 4QPKA 4DUZO 1JVMA 4O4LB 1PNMA 1Q5OA 1D5NA 2BTQB 3UT5B 2IU0A 4E4EA 1BSMA 2C2AA 1KKDA 1Y66A 3OEEG 1HNZO 4NTYA 4K8XA 2OYQA 5GONA 1V54B 2ZDIC 1Q6UA 2CK3G 1XQ8A 4BAYA 5HFMA 2P5OA 2GSMB 4UUJC 3J81N 4R8CA 3LDDA 2Q8VA 2LQTA 1URFA 1R3KC 3AG7A 4X65B 2UUCB 2ZE7A 4LF8O 5BXZA 3ABTA 1NTMH 2E5LB 3ZN1A 4WFBV 1U96A 3ZIAG 4GT1A 4BWAA 3CC2V 2Y48A 5CA0A 3SPCA 4I9QA 1IX9A 3CRQA 3HB3B 2WLNA 3I55V 1OCOB 1CEZA 5IY5B 3G6BA 4DRXB 2LFSA 5LHIA 1VF6A 5LOVB 2A79B 2ZNIA 3TGUH 3H9VA 4B3SB 3AG2C 4DV2O 3G80A 4GKKB 4K0KO 1IBKB 5EC2C 4I0XB 3BPZA 2Y69C 3L72H 3K5OA 4QPJA 1E79G 4DRXA 4X9QA 3ZN0A 1H2LA 2QTSA 1YITV 4JI6O 3JD4A 4JI1B 3FKSG 3JCZA 4UVCA 5JVDB 4JI5O 4CH5A 3WB1A 3ABKC 3O65A 1I94B 3CSXA 4DK0A 3QO7A 1GN3A 1P49A 5JJNB 2ZD9A 3ZRVA 3RYHB 4HYOA 1OCZC 1W0JG 1MNGA 2CTWA 4K3AA 4J9ZB 1HP8A 2PI5A 2W6JG 3D8CA 2RQ6A 3W7XA 4GX1A 3ZMZA 3Q4HB 3BABA 1VARA 1RSOB 4UCVA 3B8NA 5IJ0B 5CB4B 1K8AW 1XL4A 3K9AA 4F6RA 4O2BB 4EKWA 1YI2V 2DQ3A 2QA4V 2ADPA 1QVFU 3UO2A 1BL8A 1SA0A 5LP6C 2YXYA 3JASB 2P22C 3OR6C 2ZXWC 3E22A 3SGIA 4EB6A 1IBLO 3OM3B 2IJIA 1G6UA 4DV1O 1F4NA 4LF9B 5JH7B 3OTOO 1UJWB 2ZT9B 1I08A 5H5NA 2AHZA 2CUGA 2DOSA 2QWRB 4MSWC 4P9OA 1AP5A 2RNBA 4QNHB 1K33A 2ETNA 4J42A 2AXTZ 1G1XB 3OTFA 3CMEV 4JI4B 2E76B 1EM1A 5D5QA 4WCEV 1DF5A 2PZSA 4FLZA 3ETQA 1KYOF 4I4TA 3RW0A 1HNWO 3NXSA 1BE3H 4H13B 2HJDA 2WLHA 4FMTA 4NXNO 3IAYA 2BOBC 3E83A 1JOYA 4TSFG 5JH7A 5KAFZ 1GRJA 3ZX6A 1Q82W 1ZL8B 1CXZB 2FL4A 1NKDA 4FZ0A 4I50A 2Q69A 4IHJB 2DMXA 4DR7B 1VQPV 1GM9A 4QIWF 3KG2A 3JAMN 4MTFA 1TGOA 5IYCO 3T4DA 3GWOA 3FX7A 1KB9F 1SZXA 3E89A 2UUCO 3VQVA 1WP8A 3RVYA 1TAEA 2BTOA 4CS2A 2XASA 4YJ3A 2ZE5A 1DLBA 1KP2A 1PV0A 2KG7B 2G38A 2E3CA 3ZHVA 2EINC 3K06A 4MTXA 4YY3B 5LGNA 2DYRC 1S72V 1Y6XA 2W0FC 4JI5B 1Y74B 2VS0A 4ZHQB 3JD0A 2DWEC 4TQDA 5EBMC 4I4TB 1EBOA 1HNZB 4JYAB 2K1EA 1E1RG 1ZLZA 4ABMA 4FZ1A 1RPOA 4JI7B 2JS3A 4GYCB 3C90A 3LNMB 1KKCA 1G4YB 2P7TC 1BMFG 1MZFA 4RUEA 4K0KB 2P90A 2N05A 2UUBO 1J5EB 3T4ZA 2DYSC 5KHHA 1FXHA 1I0HA 5IYZA 3N2GA 4N21A 4PV1B 4WFGA 3P3NA 3ZRXA 3M8AA 4DK1A 5EIBC 1VQ6V 4DV2B 4ZI7A 2E74B 4UB8Z 1FD9A 4UCOA 1OCCC 5B1NA 4J11A 3ZS8C 4DV3O 1Q3EA 1FAFA 4LCUC 1AR1B 1YJWV 1M56B 5LA6A 4DV5B 3G4SV 5IWAB 2ZIMA 3CJHA 1S5LZ 1VQMV 4I55B 2UXBO 1MSWD 4LFBO 4R7CA 5IT9N 4LF8B 4X62O 1K5SA 4B3TB 4LH6A 4RQEA 3RT3C 5LOVA 2IJHA 1HR0B 2AW9A 3CCEV 1MMMA 2IJJA 4JV5B 4JYCA 2F23A 1R6KA 1VQ4V 1JFFB 2CH7B 4YHHO 3K04A 2GDSA 4UXNA 2XNDG 1YXBA 1QU7A 1DF4A 2IW5A 4FK5C 1NR1A 4UV8A 2UUAB 4CS3A 4JI2B 1M9NA 1Y74A 5CA1A 2YEVB 2H8PC 3RYCA 1XEQA 2CTRA 1H38A 3ZHSA 1M5IA 1HW7A 2H3OA 5D5PA 5EK0A 1QR8A 4IL6Z 2BOCC 3K5LA 2A7WA 2JVDA 2Y4TA 5DECA 3CC4V 1N4CA 3K08A 5CBHA 5LGTA 4MVQA 3WU2Z 4X1IB 3ASOB 5E1AC 3GB7C 1PNLA 1VEWA 5GONB 1K7DA 1RFYA 4NXNB 1TUEB 4PDVA 1F51A 4JI0O 2A3QA 1BQ0A 3LSQA 1IBMB 5L3GA 4DV7B 2M7WA 4IT5A 4NKGB 2QM7A 1N32B 3BY6A 1HDJA 1SQXH 5LMUO 4O4IA 1E1QG 3ETEA 3T1CA 4X1KB 5JCOC 1XNQO 1EZJA 4JI4O 3H01A 3VQWA 1H2MA 4BIUA 1SF9A 4KL1A 1N0JA 3HKDB 2GUZB 3B8MA 4K35A 1BGYH 2NNUA 3JATB 3H1IH 5A9GA 3JARB 3UKMA 5IY5C 1PD3A 2Z5UA 5GW7A 4MTOA 1AI4A 1J95A 4GCZA 2GBOA 3RN4A 1AI6A 2ARHA 1JQ0A 1U97A 1VQLV 4DXWA 3ASNB 2JIZG 4B3TO 1JR9A 3SJCC 5BR8B 3L70H 3HKBA 4X65O 2XAJA 2QM4A 1SESA 4LWSA 4AHCA 4J7ZA 1V54C 1TVKA 3B4SA 4MS2A 4HZ3A 2JGDA 2VQFO 3KCXA 3APOA 2JGUA 5B1BB 5L3EA 1MABG 3SPJA 5LYJA 2HR3A 2JRIA 5JVDA 4I50B 4DW1A 1WA8A 2YXHA 3CCLV 1WJZA 2KG7A 4TV9B 1I94O 1P7BA 1TVKB 3N2KA 3ETDA 3D3IA 1KMIZ 2UU9B 2QE7G 2WLKA 5K1XA 1EN5A 5DN6G 3ZRWB 4Z1MG 1R3JC 5B5EZ 3CRCA 5GTIZ 3FYIB 5LMNB 4H37A 2VQEB 4I7ZB 1XBLA 4DV3B 4GKKO 2PTMA 2YC0A 4DR2B 1J5EO 1F23A 3AG1C 3CXCU 4TV8A 2LGQA 4MW8A 4FLWA 1B06A 4HAMA 2HHHO 2YS8A 4YXWG 1XHXA 3E22B 4EB6B 1UPGA 2GV9A 3MDSA 5HFLA 4LF9O 2Z0AA 5EZYB 5KHJA 1IURA 2AGAA 2CE4A 4LF7B 2PI4A 4X66B 1KECA 1ZAUA 2ZQMA 3BEHA 1D2DA 2Q9LA 2X6AA 2KB1A 3FB8C 4I9WA 1K4CC 2FTKA 4DR3B 1XNRB 2RMKB 2ZIOA 4DV5O 4PHZA 4QE9A 1IDSA 1OV9A 3BHPA 1AILA 1JMKC 1KBHA 3T1HB 1RP3B 3CCQV 3S3WA 3G67A 3ZEDA 1Y4MA 1N36B 4OX9B 2HLDG 4WF9V 5CA3A 5FL7G 3LSSA 1M93A 3DC5A 5LMUB 4F6EA 4JI3O 1R6NA 5EIBD
chains in the Genus database with same CATH topology
1H8EG 1NBMG 2DWDC 1SETA 2WPDG 2DQ0A 3OR6C 2ZXWC 2JEUA 1V55B 2A9HA 2JK5C 5B1OA 3FB6C 4MT8A 1PL0A 1R73A 3OM3B 2IJIA 1H2GA 2WLIB 1F4NA 4BIZA 1P4RA 4J9YB 1UJWB 4L87A 2X7RB 1GK9A 2AHZA 3ML0A 3W7UA 2WWWA 4MSWC 3F7YC 4PDRA 4P9OA 3JD1A 4QNHB 1K33A 4UV9A 5EBWC 1NH2C 5C93A 2D3OW 1AI5A 4I5SA 4PA6A 1SRYA 3AG2B 3CC7V 4ZBMA 2GHYA 3CMEV 2OTJV 3ABMB 3CD6V 1AJQA 2QTOA 1R3LC 3SPIA 1RM1B 2EZOA 4H33A 4WCEV 1DF5A 1K92A 2EILC 3AG3C 4LP8A 2V7QG 1HWYA 1B6QA 3OW2U 1VQOV 2Q68A 3ZMTA 1S0VA 2OT5A 3RW0A 3NXSA 4G27B 4DO2A 3IC7A 4KUMA 2DYSB 1XL6A 1MOFA 1FXKA 2WLHA 3X2QB 3ZMVA 1AJNA 4FMTA 1VQ5V 4UVAA 2BOBC 3E83A 1JOYA 2B1GA 4LBEC 3SYPA 1GO3F 4TSFG 1Q81W 3E8BA 3LDCA 1Q82W 3WG7B 2WAMA 3T2MA 3JD3A 1NKDA 5EBLC 3F5WC 2WLMA 4PA4A 2Q69A 1JCHA 3MHHC 3OEHG 3AEIA 1AJPA 4FIPC 4XDLA 1VQPV 1GM9A 1QR9A 4QIWF 1SERA 4PELA 2B1IA 1JX9A 3KG2A 1M56C 4MTFA 5IYCO 3T4DA 5LGUA 3GWOA 3ZCCA 5CMUA 2XAFA 3E89A 4R6ZA 1SZTA 5B3SC 1FXKC 3OMNB 1THZA 4KFMA 4X88A 2NLJC 3RVYA 3OUFA 2XASA 3E8GA 4G2KA 1DLBA 1KP2A 1S5HC 3B77A 3CP1A 2EINC 3K06A 4MTXA 5IYDO 1W0KG 3CCUV 1K4DC 2UXNA 5BZBA 5LGNA 3D36A 2DYRC 1S72V 1YJNV 2W0FC 3STZC 4ASUG 4PA9A 3JD0A 2DWEC 1RPRA 2WLLB 5EBMC 2HJFC 1EBOA 2K1EA 4N23A 1AI7A 1E1RG 3DGEA 1ZWIC 1NQTA 3TETA 4GX5A 1OCRB 1BHAA 3SJQC 1RPOA 2YSUB 5H9CA 2ATKC 4XBFA 3OAAG 1ENVA 4QE7A 3LNMB 3OR7C 1G4YB 2P7TC 1BMFG 3IFXA 3LUTB 1S3JA 3SPGA 4LC1A 4RUEA 1AROP 1PNKA 5B1AB 1QVGU 1GKFA 1KC8W 2P90A 3FYEB 3WFVA 5CBGA 1W2BU 4MW3A 1NVPC 3SYCA 2EINB 3VBBA 1K34A 3ABUA 3ZRSA 3T4ZA 2DYSC 1M1KW 1GM7A 1R3IC 4P9PA 1FXHA 4N21A 4WFGA 3K3WA 3ZRXA 2HVJC 4WFAV 5KA5A 1YTFC 1VQ6V 3E86A 3CCSV 3FB7C 4WFHA 5KUMA 4MVZA 3WG7C 4TT3G 1OCCC 2HKOA 1PKXA 5B1NA 3ZMUA 4LCUC 1AR1B 1YJWV 2EILB 1JPXA 1F4MA 1M56B 3AG3B 1ORQC 3ETGA 3W7TA 3G4SV 3X2QC 1NH2B 1VQ7V 1VQMV 1MSWD 4CBCA 3CCVV 2MK3A 4R7CA 4WFFA 2H94A 1M57C 3SYAA 1K5SA 2ZXWB 1K5QA 5KUKA 1K9MW 3CCRV 4RQEA 1YSCA 4KP4A 5CBFA 2IJHA 2F43G 2ITDC 5KA6A 1NVPD 2X6CA 3CCEV 2IJJA 2OCCB 2WLLA 4JYCA 1RM1C 1R6KA 4FPPA 1VQ4V 3M99B 3K04A 2A0LA 4UXNA 4XDJA 2EIMB 2XNDG 4MVUA 2JJ2G 1MG1A 2EIJB 1IXMA 1DF4A 3P32A 1WLEA 2IH3C 2B5UA 2P67A 1WPXA 2IW5A 4P2ZA 4F4LA 4FK5C 1K97A 1NR1A 4UV8A 2XAQA 4QJFB 4ZKIA 4RQFA 3TK1A 4JTAB 1M9NA 3OGCC 3CPWU 5LBQA 1G8MA 1NJIW 3SYQA 2YEVB 3UM7A 2H8PC 2OCCC 3RBZA 1OHHG 1K73W 1H38A 1KP3A 4BW5A 5EK0A 1QR8A 3E35A 2BOCC 2XOKG 4MVOA 3TCUA 3FB5C 2XAGA 4G28B 2R9RB 4PA3A 3CC4V 1GTOA 3K08A 4PDLA 5CBHA 4MVQA 5LGTA 4R50A 1VQNV 1OCRC 4JPRA 2EIKC 3ASOB 4GX2A 2JJ1G 4JGSA 2Z3YA 2AHYA 3CMAV 5E1AC 4MVMA 3GB7C 1PNLA 4XDKA 5L3DA 5DM6V 3F7VC 1JJ2U 1K7DA 3OUSA 1TUEB 4PDVA 1F51A 1M57B 1S76D 3LSQA 3OE7G 5L3GA 1CP9A 3P30A 3K03A 4MVSA 2QKSA 4Q20A 1FFTB 2M7WA 1YHQV 1KQSU 2OTLV 4JTDB 5B1BC 2EIMC 2QM7A 3OMAB 2ZDIA 1EFRG 5CN0A 1L1FA 3BY6A 4PDMA 1E1QG 3ABLC 3ETEA 3T1CA 5LHGA 2QEXV 1YTFB 1EZJA 1H8HG 5IYBO 4MVRA 3QO5A 3H01A 3CYOA 5EC1C 4P30A 4BIUA 1QLEB 3PJSK 2W6IG 3SYOA 3I56V 3K0DA 3CCJV 2ITCC 2Q67A 2R9IA 3AG4C 3B8MA 4JF3A 3W7SA 1GM8A 2NNUA 4CZZA 3E2EA 3K0GA 3UKMA 5IY5C 1DTOA 2QM8A 1PD3A 2Z5UA 1FXVA 3K79A 1OCOC 5GW7A 1OCCB 3MHSC 4MTOA 4QPKA 1JVMA 1AI4A 3OMIB 3ABKB 1PNMA 1J95A 3CCMV 4GCZA 2IJKA 2JEXA 2IU0A 2HVKC 2C2AA 1KKDA 1Y66A 3OEEG 1AI6A 1VQ8V 1LNQA 2HFEC 4X8AA 1JQ0A 1VQLV 4DXWA 3ASNB 1V54B 3OFNG 2LP7A 2JIZG 3LDEA 3RVZA 5H6RA 2ZDIC 3MD0A 2XAJA 2CK3G 3SPHA 1SESA 4BAYA 3DTUB 5HFMA 2EBOA 4JAVA 4JYBA 1V54C 1FXKB 2GSMB 4UUJC 4R8CA 3ABLB 2DYRB 3LDDA 4MS2A 4HZ3A 3AG4B 5IDJA 1NH2D 2WLIA 1R3KC 2V1DA 5LHHA 5B1BB 5L3EA 1VQKV 1MABG 3JYCA 3SPJA 3VOUA 2HR3A 5B1AC 2EZPA 4OXSA 2UXXA 5J9PC 3ABTA 3CCLV 1QLNA 4E2LA 1VQ9V 1COWG 3ZN1A 4WFBV 2WLJA 4U7NA 3ZIAG 4GT1A 3G71V 1K3EA 4X89A 1QBZA 1CPYA 2EIKB 3CC2V 1P7BA 2Y48A 4JASA 1QLEC 3STLC 3SPCA 3ETDA 2XAHA 5L3BA 3HB3B 2WLNA 3D3IA 3I55V 1OCOB 3ZJZA 4WFEA 1FS0G 2IU3A 1CEZA 2X0LA 2QE7G 5IY5B 2WLKA 5B3SB 5DN6G 2LFSA 3ZRWB 2EJRA 5LHIA 4Z1MG 1R3JC 2A79B 4JAUA 1I5YA 3AG2C 2HG5C 3FYIB 4H37A 1NR7A 5EC2C 1YIJV 3EHBB 1M90W 3E8FA 2JDIG 1F23A 2Y69C 3AG1C 3CXCU 2YEVA 4QPJA 1E79G 3ABMC 3ASOC 4MW8A 3ASNC 4FJCC 1Q86W 4HAMA 3ZN0A 2Q6AA 4YXWG 1KD1W 1YITV 1I5XA 4PA7A 3JD4A 3FKSG 3JCZA 4UVCA 5HFLA 1V55C 1YJ9V 5L3CA 3ABKC 2X6BA 1BHBA 2PI4A 1Q7YW 1S77D 3QO7A 1KECA 2ZD9A 2ZQMA 3BEHA 3ZRVA 2ZR3A 4HYOA 1OCZC 1OZ0A 1W0JG 3EFFK 5H6QA 2X6AA 3ZMSA 2KB1A 3FB8C 4J9ZB 3HPLC 1YTFD 2PI5A 2W6JG 4UVBA 3E8HA 3W7XA 4I9WA 3A0RA 3ZRWA 1K4CC 4GX1A 2Y69B 3AG1B 2FTKA 3W7WA 2EIJC 4JTCB 3ZMZA 4RO2A 1ROPA 3JD2A 4QE9A 4GX0A 4RAIA 3B8NA 1K8AW 2ZR2A 1XL4A 4MTGA 3R65A 2DW4A 2IH1C 2LFRA 3QO8A 4RUFA 3CCQV 2P6JA 3K9AA 4EKWA 1YI2V 4U7OA 1NVPB 1Y4MA 5L3FA 2HLDG 2WSSG 4WF9V 3G6EV 3QNEA 1GMGA 2DQ3A 5CA3A 1OCZB 2QA4V 5FL7G 3LSSA 1QVFU 3IGAC 1BL8A 1QCEA 1N8RW 1R6NA 4TWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM1 B;  1NVP D;  1NVP C;  5IYC O;  1YTF D;  5IYD O;  1NH2 C;  1NH2 D;  1YTF C;  1RM1 C;  5IYB O; 
#chains in the Genus database with same CATH topology
 1ZTE A;  1NBM G;  2CGO A;  1SQG A;  3F5T A;  2PUS A;  2WPD G;  3EVK A;  3LSU A;  4OPA A;  2JEU A;  5B1O A;  1PL0 A;  1R73 A;  1H2G A;  3KKY A;  3LNN A;  1P4R A;  5J2T A;  1GK9 A;  1XI1 A;  1YEW A;  1SC5 B;  4D7T A;  4NTW A;  1GH6 A;  4FLX A;  5KMG A;  3JD1 A;  5C93 A;  1AI5 A;  1AR5 A;  2LO1 A;  2OTJ V;  4A5U B;  1AJQ A;  1R3L C;  3SPI A;  4TUY A;  5FNV A;  2UXC B;  2HHH B;  2ADQ B;  3AG3 C;  4LP8 A;  2V7Q G;  4X64 B;  4YY3 O;  3OW2 U;  2Q68 A;  3RWR D;  2MW2 B;  2YUA A;  1R6T A;  4G27 B;  4DO2 A;  3JAK B;  4KUM A;  5H2F Z;  1XL6 A;  1MOF A;  3CXH F;  4OGQ B;  2YXL A;  2VQE O;  1VQ5 V;  4UVA A;  4FFB A;  3RYH A;  1Q81 W;  3WG7 B;  3T2M A;  4LF4 B;  3F5W C;  4GKJ O;  2WLM A;  4FIP C;  3AEI A;  4X66 O;  1WPB A;  2E5L O;  3JAL B;  1RSO A;  4PEL A;  4JZG A;  1M56 C;  2Q73 A;  4Z2W A;  4X62 B;  3N2G B;  4FLV A;  5CMU A;  3CRR A;  3JSL A;  4R6Z A;  1SZT A;  3THO A;  1H2S B;  4KFM A;  4ZI7 B;  4FM0 A;  2GUZ A;  2YDE A;  1VF6 C;  3FAV A;  4G2K A;  4I55 A;  2BCC H;  1AVM A;  2IM9 A;  1K4D C;  2DN9 A;  5BZB A;  3A2F A;  1FJG O;  3SJA C;  5LMN O;  3U11 A;  1SQP H;  4DR2 O;  1ZX3 A;  1NQT A;  1N34 B;  5BR8 O;  1XMQ B;  2P06 A;  3JAL A;  4GX5 A;  1BHA A;  2YSU B;  5GTH Z;  2ATK C;  4XBF A;  4UCS A;  2V4D A;  3OR7 C;  2NN4 A;  4NB5 A;  1NS1 A;  3IFX A;  4LC1 A;  1GKF A;  1BCC H;  1JJO A;  3CE2 A;  1N33 B;  1YCI A;  2EIN B;  1K34 A;  3VBB A;  3B09 A;  3ZRS A;  3C3T A;  4LF7 O;  1GM7 A;  1R3I C;  4P9P A;  2N74 A;  3H1H H;  3NR7 A;  1WNS A;  1FYJ A;  1IZ3 A;  2VQF B;  2Y0P A;  1NTK H;  4TT3 G;  3ZMU A;  4JI3 B;  2EIL B;  4EFB A;  1F4M A;  2LGW A;  5IE9 A;  3CCV V;  4WFF A;  1KU9 A;  1XOU A;  5JJJ B;  2H94 A;  3SYA A;  1K5Q A;  5KUK A;  4KP4 A;  4YHH B;  2DJV A;  1VMG A;  2F43 G;  4HNA A;  4O4L A;  1XIL A;  2XT9 A;  2OCC B;  4WBN A;  5DED A;  3M99 B;  1WB7 A;  5LXT B;  4CH4 A;  2EIJ B;  1WLE A;  1WPX A;  4ZKI A;  4QJF B;  4RQF A;  4LR3 A;  3TK1 A;  4JTA B;  4J10 A;  5JWP A;  3OGC C;  1NT2 B;  3JAT A;  3O9O A;  3UM7 A;  1EN4 A;  1L0L H;  2OCC C;  3N27 A;  3ZBH A;  1OHH G;  4NR1 A;  1KP3 A;  3HKE B;  5J2T B;  3HKD A;  3HR0 A;  1PP9 H;  2EJ7 A;  4ZHQ A;  4QGP A;  2FML A;  4IYH A;  4PA3 A;  2W0X A;  2OIE A;  4R50 A;  1YVW A;  5FPO A;  4CC5 A;  4JGS A;  1JJ2 U;  4DR3 O;  5DM6 V;  1Z2G A;  2GTS A;  2D2C B;  4AIL C;  1M57 B;  2PYL A;  5CA0 B;  1HR0 O;  5BMV B;  1CP9 A;  4MVS A;  2XTA A;  2K9P A;  2ODM A;  3OMA B;  2ZDI A;  1EFR G;  5CN0 A;  1L1F A;  2F66 C;  4Z1V A;  1H8H G;  4MVR A;  4DYL A;  2PYJ A;  3QO5 A;  1DK1 A;  5KHK A;  5EC1 C;  5J2U B;  1XDC A;  2W6I G;  3I56 V;  1BZK A;  2F1M A;  2R9I A;  3AG4 C;  1GM8 A;  3E2E A;  3K0G A;  5LP6 A;  1DTO A;  2QM8 A;  3PN1 A;  4LFA O;  4GLX A;  3OMI B;  4ICG A;  3ABK B;  3H1J H;  3T1Y B;  3CCM V;  3SR2 C;  1Q90 D;  2HVK C;  2CH7 A;  4ZOL A;  4FLT A;  1LNQ A;  3HKC A;  4IYI A;  3OFN G;  2LP7 A;  5H6R A;  1IVS A;  3MD0 A;  4X1K A;  5JQG B;  2Q4P A;  3HKB B;  4JYB A;  2R72 A;  2DYR B;  4DW0 A;  3IC9 A;  2WLI A;  3Q4H A;  3APQ A;  3IJ4 A;  1GN2 A;  2V1D A;  5LHH A;  3K57 A;  5FPR A;  1VQK V;  2DE0 X;  3L73 H;  1VP7 A;  4L8J A;  1SQV H;  5B1A C;  4OXS A;  2UXX A;  5J9P C;  1QLN A;  1VQ9 V;  1COW G;  3JAW A;  2WLJ A;  4KHP O;  4DR4 O;  5KX5 B;  3G71 V;  5IYZ B;  2P4K A;  2EIK B;  4JAS A;  1QLE C;  3STL C;  2FKX A;  3D36 C;  4Q6G A;  4X1Y B;  5ITZ A;  1US6 A;  5KAI Z;  2VWJ A;  4LF5 O;  4WFE A;  1FS0 G;  4DR1 O;  2X0L A;  4IIJ B;  1X4T A;  2EJR A;  1IBM O;  2ZKO A;  4CH6 A;  4NTX A;  4AI8 A;  1EZV H;  3CRA A;  1NR7 A;  3OD4 A;  1YIJ V;  2Y4U A;  4J7J A;  2JDI G;  1VIB A;  3B2E E;  3CEI A;  3OGI B;  4O4H B;  3T1Y O;  2Q5Z A;  1AR4 A;  2Q7E A;  4YIO A;  3ASN C;  4FJC C;  4PD4 F;  1Q8I A;  2Q6A A;  1H2N A;  1SQB H;  1KD1 W;  1I5X A;  4PA7 A;  4RWU A;  2F4V B;  4FLU A;  5L3C A;  1T5E A;  1Q7Y W;  4JYY A;  5K1P A;  1S77 D;  2CGN A;  3JAW B;  5JJE B;  3L9D A;  4PI2 A;  1OZ0 A;  2YIB A;  5H6Q A;  3D3Q A;  3WB2 A;  1YTF D;  4IHJ A;  2KKW A;  3A0R A;  3AG1 B;  3W7W A;  2EIJ C;  4JTC B;  2QWN B;  4GZR B;  3GVM A;  4TV8 B;  1AP6 A;  3R65 A;  2IH1 C;  3OT7 A;  4JYA O;  2P6J A;  5LYJ B;  4U7O A;  1NVP B;  1Y76 A;  5L3F A;  4LFB B;  3QNE A;  1XMO B;  1OCZ B;  2OIG A;  1N8R W;  4ZIB A;  4FFB B;  4X1I A;  3BFR A;  4TWK A;  1N36 O;  3FFQ A;  4OX9 O;  2DWD C;  1SET A;  1HNW B;  3JAS A;  1JFF A;  2A9H A;  1F7Y A;  2WLI B;  3CRM A;  2F93 B;  2F4V O;  4NXM O;  4DR5 O;  4JI7 O;  4L87 A;  2X7R B;  1P7G A;  3ML0 A;  2ILM A;  3W7U A;  2AZ0 A;  1MSD A;  2ZCE A;  4FM2 A;  3J7A U;  1IBL B;  1WP7 A;  2QGN A;  3BVO A;  4UV9 A;  1WAZ A;  3K58 A;  1NH2 C;  4I5S A;  4PA6 A;  1AB3 A;  3AG2 B;  3A8T A;  4ZBM A;  1N33 O;  3ABM B;  3CD6 V;  5KLV H;  2PGG A;  2QTO A;  5E79 Z;  1SKV A;  4H33 A;  1K92 A;  2EIL C;  3H1K H;  4TUY B;  2RN9 A;  5FNV B;  1HWY A;  1FKA O;  1VQO V;  3ZMT A;  4TOI A;  2OT5 A;  1NZ6 A;  3SJB C;  2QWP B;  3IC7 A;  2QWQ B;  1FXK A;  4PJ0 Z;  1YF2 A;  1IBK O;  5LXT A;  4DR5 B;  3SYP A;  4LBE C;  1GO3 F;  2Q0A A;  3TJT A;  3LDC A;  4YIP A;  3JD3 A;  2RCV A;  1XNR O;  1JCH A;  3OEH G;  4XDL A;  4DR6 B;  3N2K B;  2LW7 A;  4DV0 B;  1SER A;  3R66 A;  4O2A B;  4IGG A;  1WA8 B;  5B3S C;  1FXK C;  3OMN B;  4X88 A;  2NLJ C;  3AK2 A;  4D6T H;  3B77 A;  4TQF A;  5IYD O;  2AZ2 A;  4LFC B;  1V9P A;  3CCU V;  2UXN A;  1YJN V;  4ASU G;  4PA9 A;  1SQQ H;  3T1H O;  4HNA B;  2FB5 A;  3DGE A;  1FJG B;  4JI8 B;  1XUQ A;  4LWS B;  3CWB H;  3K9S A;  3OTO B;  1ENV A;  4B3S O;  4NYK A;  3LUT B;  4HBN A;  1ARO P;  1QVG U;  1KC8 W;  3FYE B;  3WFV A;  4UCR A;  5CBG A;  4DV7 O;  1W2B U;  1PL4 A;  4MW3 A;  1NVP C;  3SYC A;  3ABU A;  2XUM A;  2HP8 A;  3K3W A;  2HVJ C;  2EX3 A;  4OPH A;  1YTF C;  3E86 A;  1ZUQ A;  3FB7 C;  4WFH A;  3CCS V;  5KUM A;  3WG7 C;  1Z5W A;  2HKO A;  1PKX A;  3AG3 B;  3ETG A;  4AQY B;  1ORQ C;  3W7T A;  5KHG A;  1NH2 B;  2Q0O C;  1VQ7 V;  4UCT A;  2YI9 A;  4CBC A;  4F6R B;  1Q6I A;  3CCR V;  4K8Z A;  3EXA A;  3BRC A;  5KA6 A;  1NVP D;  4LF6 O;  4LNU B;  1PM9 A;  2WLL A;  1Y76 B;  4FPP A;  2A0L A;  2QKC A;  3RYF B;  4XDJ A;  4DUZ B;  1WB8 A;  2EIM B;  1B04 A;  2JJ2 G;  2NR5 A;  4LFC O;  2B5U A;  4JV5 O;  4P2Z A;  5KX5 A;  2XAQ A;  2QR4 A;  1XHZ A;  4U3F H;  4B7K A;  3CPW U;  4J41 A;  5LBQ A;  1G8M A;  1NJI W;  3SYQ A;  1W59 A;  1K73 W;  2KSD A;  3E35 A;  3JAR A;  1GN4 A;  1M4U A;  4G28 B;  2R9R B;  4LF6 B;  1GTO A;  4PDL A;  1VQN V;  3TXS A;  4DV6 O;  4B3R B;  1R1B A;  2B9Z A;  4XDK A;  2N04 A;  3H1L H;  1A32 A;  4O4H A;  5B66 Z;  2ZM6 B;  5TIS Z;  1FFX B;  3MAQ A;  3P30 A;  2QKS A;  1FFT B;  1KQS U;  1YHQ V;  4JTD B;  2EIM C;  4JAA A;  3FD9 A;  3QG5 A;  2WA4 A;  2UXD O;  3DXR B;  3ABL C;  1BS3 A;  3K59 A;  5LHG A;  4O4I B;  1YTF B;  1LR1 A;  3CYO A;  1QLE B;  3SYO A;  3K0D A;  3CCJ V;  2ITC C;  4LF4 O;  2Q67 A;  3CB2 A;  3W7S A;  4CZZ A;  4NXM B;  1FXV A;  4IIJ A;  4X1Y A;  5ITZ B;  2IJK A;  3K5M A;  5BMV A;  2BSK A;  2JEX A;  2UUA O;  2CTQ A;  5EZY A;  1VQ8 V;  5C8Y A;  2HFE C;  4X8A A;  2IBZ H;  1S5J A;  1NU1 H;  5J2U A;  4X64 O;  1GAX A;  3LDE A;  4JI0 B;  3RVZ A;  1XMO O;  3A0B Z;  4DR7 O;  3SPH A;  3DTU B;  2EBO A;  1HNX O;  4JAV A;  5FLX N;  4BW9 A;  1X59 A;  1FXK B;  3ABL B;  4B3M B;  2GTA A;  3AG4 B;  4FVM A;  5IDJ A;  1NH2 D;  3B40 A;  3ZHQ A;  4YJ3 B;  3JYC A;  3VOU A;  4O2B A;  3P3P A;  1VF5 B;  2F95 B;  2EZP A;  5CB4 A;  1Z5V A;  4W4L A;  4E2L A;  1H2K A;  4U7N A;  1K3E A;  4X89 A;  1QBZ A;  3L75 H;  1N0N A;  1CPY A;  4FLY A;  4ZOL B;  1NI8 A;  3TXQ A;  4LFA B;  2XAH A;  4DV4 O;  3CS5 A;  5L3B A;  4DUY B;  3ZJZ A;  2IU3 A;  5B3S B;  2Y0I A;  1YDX A;  3SDL A;  4JAU A;  1I5Y A;  3UO3 A;  2HG5 C;  3EHB B;  4YJ2 A;  3KCY A;  1M90 W;  4X20 A;  3E8F A;  3BA8 A;  4BIO A;  3A0H Z;  2YEV A;  4U3J A;  3ABM C;  4WBN B;  1Q6H A;  3ASO C;  1N34 O;  1Q86 W;  4LF5 B;  3ZHR A;  1DGS A;  1V55 C;  5IWA O;  1D5A A;  4B3R O;  4O4J A;  1YJ9 V;  2EUL A;  3DXR A;  1MZE A;  2X6B A;  4DR4 B;  4YJ2 B;  1BHB A;  4TV9 A;  2OCH A;  2R9A A;  1QHT A;  1ZL8 A;  4J7K A;  1FPO A;  1L8D A;  2ZR3 A;  3U10 A;  3BA9 A;  3EFF K;  4JI2 O;  3ZMS A;  3HPL C;  5JQG A;  3E8H A;  5EYP B;  3ZRW A;  2LJ2 A;  1IXB A;  2Y69 B;  2KQX A;  4X20 B;  1I7F A;  4RO2 A;  2M6Y A;  1ROP A;  2JGD B;  3JD2 A;  4GX0 A;  4RAI A;  1NTZ H;  4O4J B;  2ZR2 A;  3L71 H;  4MTG A;  1MA1 A;  2DW4 A;  2LFR A;  2YIB D;  3QO8 A;  4RUF A;  1P84 F;  4JI6 B;  2WSS G;  3G6E V;  1GMG A;  1SS3 A;  1SA0 B;  3IGA C;  3UQ8 A;  1QCE A;  3VQX A;  4UVB A;  1H8E G;  4CS4 A;  2UXB B;  2DQ0 A;  4CH3 A;  1V55 B;  2JK5 C;  3FB6 C;  4MT8 A;  2CDY A;  4UFZ A;  3RFR A;  4B08 A;  5LL6 Y;  4BIZ A;  2PY5 A;  4J9Y B;  1YZB A;  4DUY O;  4DV0 O;  2YIC A;  5KMG B;  4H0L B;  2WWW A;  4H44 B;  1BQZ A;  2A06 H;  3F7Y C;  4PDR A;  4UCU A;  2UXC O;  4W4K A;  5EBW C;  2D3O W;  1SRY A;  4KXR A;  3VQY A;  1BT8 A;  3CC7 V;  2GHY A;  1RM1 B;  2EZO A;  3RYC B;  1B6Q A;  5IJ0 A;  4LNU A;  2JS5 A;  1OJH A;  1B3Q A;  1S0V A;  2DYS B;  5C8Y B;  3QTC A;  2L6L A;  1KUQ A;  3RYF A;  3X2Q B;  3ZMV A;  1AJN A;  4JI1 O;  3BCC H;  1TUB B;  2B1G A;  4LH7 A;  2Q7H A;  3KZI Z;  3E8B A;  4UB6 Z;  2WAM A;  4I0X A;  3WB0 A;  5EBL C;  3HKC B;  3DSQ A;  2CAZ C;  4PA4 A;  1XRE A;  3MHH C;  1JA8 A;  4U3J B;  1AJP A;  2QWO B;  4KHP B;  4BR6 A;  1QR9 A;  5AG2 A;  3L74 H;  2B1I A;  1XNQ B;  1JX9 A;  1ZSP A;  5LGU A;  3ZCC A;  2XAF A;  2ZE8 A;  2HEP A;  2QSA A;  1THZ A;  2YID A;  3OUF A;  2ZIN A;  3JSN A;  2R70 A;  3E8G A;  2ZNJ A;  1S5H C;  3CP1 A;  3FAV B;  4CC6 A;  1W0K G;  4DV1 B;  4B3M O;  3D36 A;  3STZ C;  3RYI B;  1RPR A;  2WLL B;  3U0Z A;  2HJF C;  4N23 A;  1AI7 A;  1ZWI C;  4EFE A;  3TET A;  1OCR B;  3SJQ C;  1SQF A;  2WA3 A;  4DR1 B;  5H9C A;  3ZHU A;  2P4V A;  3OAA G;  4QE7 A;  4FM1 A;  4JI8 O;  3SPG A;  5LA6 B;  1S3J A;  1O9H A;  1PNK A;  5B1A B;  3GWK C;  4DV6 B;  2OWO A;  1M1K W;  2QJ1 A;  3J80 N;  2VWK A;  4C7U A;  2RDC A;  1QNM A;  4WFA V;  5KA5 A;  2QDO A;  3HKE A;  3UT5 A;  2O57 A;  4MVZ A;  3UCS C;  5A2Q N;  1EN6 A;  3AK1 A;  1JPX A;  3CJH B;  3QF7 A;  2UXD B;  3X2Q C;  1Y67 A;  2UU9 O;  2MK3 A;  3I5D A;  2PF4 E;  1M57 C;  2ZXW B;  1K9M W;  1YSC A;  1XMQ O;  5CBF A;  3DC6 A;  4DR6 O;  2ITD C;  2X6C A;  1HNX B;  2ZM6 O;  1Q43 A;  5EYP A;  1RM1 C;  1VF7 A;  2CTP A;  1GN6 A;  1L0N H;  4MVU A;  4FFK A;  1MG1 A;  1IXM A;  3P32 A;  2IH3 C;  1LUV A;  4D7S A;  1QQC A;  2P67 A;  3CX5 F;  4F4L A;  2RJZ A;  1K97 A;  2ZE6 A;  2UUB B;  4NVP A;  4PI0 A;  3RYI A;  4AQY O;  4B7E A;  2BE3 A;  3RBZ A;  3QVN A;  3C3S A;  4BW5 A;  5JCO A;  2XOK G;  4MVO A;  3TCU A;  3FB5 C;  1WN7 A;  5LP6 B;  2Q7G A;  2XAG A;  2XHB A;  3ZHT A;  2BSK B;  2LW1 A;  2E75 B;  1OCR C;  4JPR A;  3JAK A;  2EIK C;  4GKJ B;  4GX2 A;  5KHI A;  3CHX A;  2JJ1 G;  2YIA A;  2Z3Y A;  3RGB A;  2AHY A;  3CMA V;  4MVM A;  2QKA A;  5L3D A;  3F7V C;  5IJ9 A;  3OUS A;  5F2V O;  4DV4 B;  1PPJ H;  1S76 D;  3BAA A;  3OE7 G;  3K03 A;  4JZ2 A;  3K5N A;  4Q20 A;  5BY1 A;  2OTL V;  5B1B C;  4O2A A;  1LUW A;  4GUN A;  1TUB A;  4EEQ A;  4PDM A;  2BTQ A;  2QEX V;  5IYB O;  1UFI A;  3JCU Z;  2VRZ A;  1N32 O;  2FYU H;  3S3X A;  4P30 A;  3ICX A;  3PJS K;  2YI8 A;  1FFX A;  4JF3 A;  5CA1 B;  2L35 A;  5IJ9 B;  4J80 A;  3K79 A;  1OCO C;  3AK3 A;  3M7M X;  1O9G A;  1OCC B;  1TA8 A;  3MHS C;  4QPK A;  4DUZ O;  1JVM A;  4O4L B;  1PNM A;  1Q5O A;  1D5N A;  2BTQ B;  3UT5 B;  2IU0 A;  4E4E A;  1BSM A;  2C2A A;  1KKD A;  1Y66 A;  3OEE G;  1HNZ O;  4NTY A;  4K8X A;  2OYQ A;  5GON A;  1V54 B;  2ZDI C;  1Q6U A;  2CK3 G;  1XQ8 A;  4BAY A;  5HFM A;  2P5O A;  2GSM B;  4UUJ C;  3J81 N;  4R8C A;  3LDD A;  2Q8V A;  2LQT A;  1URF A;  1R3K C;  3AG7 A;  4X65 B;  2UUC B;  2ZE7 A;  4LF8 O;  5BXZ A;  3ABT A;  1NTM H;  2E5L B;  3ZN1 A;  4WFB V;  1U96 A;  3ZIA G;  4GT1 A;  4BWA A;  3CC2 V;  2Y48 A;  5CA0 A;  3SPC A;  4I9Q A;  1IX9 A;  3CRQ A;  3HB3 B;  2WLN A;  3I55 V;  1OCO B;  1CEZ A;  5IY5 B;  3G6B A;  4DRX B;  2LFS A;  5LHI A;  1VF6 A;  5LOV B;  2A79 B;  2ZNI A;  3TGU H;  3H9V A;  4B3S B;  3AG2 C;  4DV2 O;  3G80 A;  4GKK B;  4K0K O;  1IBK B;  5EC2 C;  4I0X B;  3BPZ A;  2Y69 C;  3L72 H;  3K5O A;  4QPJ A;  1E79 G;  4DRX A;  4X9Q A;  3ZN0 A;  1H2L A;  2QTS A;  1YIT V;  4JI6 O;  3JD4 A;  4JI1 B;  3FKS G;  3JCZ A;  4UVC A;  5JVD B;  4JI5 O;  4CH5 A;  3WB1 A;  3ABK C;  3O65 A;  1I94 B;  3CSX A;  4DK0 A;  3QO7 A;  1GN3 A;  1P49 A;  5JJN B;  2ZD9 A;  3ZRV A;  3RYH B;  4HYO A;  1OCZ C;  1W0J G;  1MNG A;  2CTW A;  4K3A A;  4J9Z B;  1HP8 A;  2PI5 A;  2W6J G;  3D8C A;  2RQ6 A;  3W7X A;  4GX1 A;  3ZMZ A;  3Q4H B;  3BAB A;  1VAR A;  1RSO B;  4UCV A;  3B8N A;  5IJ0 B;  5CB4 B;  1K8A W;  1XL4 A;  3K9A A;  4F6R A;  4O2B B;  4EKW A;  1YI2 V;  2DQ3 A;  2QA4 V;  2ADP A;  1QVF U;  3UO2 A;  1BL8 A;  1SA0 A;  5LP6 C;  2YXY A;  3JAS B;  2P22 C;  3OR6 C;  2ZXW C;  3E22 A;  3SGI A;  4EB6 A;  1IBL O;  3OM3 B;  2IJI A;  1G6U A;  4DV1 O;  1F4N A;  4LF9 B;  5JH7 B;  3OTO O;  1UJW B;  2ZT9 B;  1I08 A;  5H5N A;  2AHZ A;  2CUG A;  2DOS A;  2QWR B;  4MSW C;  4P9O A;  1AP5 A;  2RNB A;  4QNH B;  1K33 A;  2ETN A;  4J42 A;  2AXT Z;  1G1X B;  3OTF A;  3CME V;  4JI4 B;  2E76 B;  1EM1 A;  5D5Q A;  4WCE V;  1DF5 A;  2PZS A;  4FLZ A;  3ETQ A;  1KYO F;  4I4T A;  3RW0 A;  1HNW O;  3NXS A;  1BE3 H;  4H13 B;  2HJD A;  2WLH A;  4FMT A;  4NXN O;  3IAY A;  2BOB C;  3E83 A;  1JOY A;  4TSF G;  5JH7 A;  5KAF Z;  1GRJ A;  3ZX6 A;  1Q82 W;  1ZL8 B;  1CXZ B;  2FL4 A;  1NKD A;  4FZ0 A;  4I50 A;  2Q69 A;  4IHJ B;  2DMX A;  4DR7 B;  1VQP V;  1GM9 A;  4QIW F;  3KG2 A;  3JAM N;  4MTF A;  1TGO A;  5IYC O;  3T4D A;  3GWO A;  3FX7 A;  1KB9 F;  1SZX A;  3E89 A;  2UUC O;  3VQV A;  1WP8 A;  3RVY A;  1TAE A;  2BTO A;  4CS2 A;  2XAS A;  4YJ3 A;  2ZE5 A;  1DLB A;  1KP2 A;  1PV0 A;  2KG7 B;  2G38 A;  2E3C A;  3ZHV A;  2EIN C;  3K06 A;  4MTX A;  4YY3 B;  5LGN A;  2DYR C;  1S72 V;  1Y6X A;  2W0F C;  4JI5 B;  1Y74 B;  2VS0 A;  4ZHQ B;  3JD0 A;  2DWE C;  4TQD A;  5EBM C;  4I4T B;  1EBO A;  1HNZ B;  4JYA B;  2K1E A;  1E1R G;  1ZLZ A;  4ABM A;  4FZ1 A;  1RPO A;  4JI7 B;  2JS3 A;  4GYC B;  3C90 A;  3LNM B;  1KKC A;  1G4Y B;  2P7T C;  1BMF G;  1MZF A;  4RUE A;  4K0K B;  2P90 A;  2N05 A;  2UUB O;  1J5E B;  3T4Z A;  2DYS C;  5KHH A;  1FXH A;  1I0H A;  5IYZ A;  3N2G A;  4N21 A;  4PV1 B;  4WFG A;  3P3N A;  3ZRX A;  3M8A A;  4DK1 A;  5EIB C;  1VQ6 V;  4DV2 B;  4ZI7 A;  2E74 B;  4UB8 Z;  1FD9 A;  4UCO A;  1OCC C;  5B1N A;  4J11 A;  3ZS8 C;  4DV3 O;  1Q3E A;  1FAF A;  4LCU C;  1AR1 B;  1YJW V;  1M56 B;  5LA6 A;  4DV5 B;  3G4S V;  5IWA B;  2ZIM A;  3CJH A;  1S5L Z;  1VQM V;  4I55 B;  2UXB O;  1MSW D;  4LFB O;  4R7C A;  5IT9 N;  4LF8 B;  4X62 O;  1K5S A;  4B3T B;  4LH6 A;  4RQE A;  3RT3 C;  5LOV A;  2IJH A;  1HR0 B;  2AW9 A;  3CCE V;  1MMM A;  2IJJ A;  4JV5 B;  4JYC A;  2F23 A;  1R6K A;  1VQ4 V;  1JFF B;  2CH7 B;  4YHH O;  3K04 A;  2GDS A;  4UXN A;  2XND G;  1YXB A;  1QU7 A;  1DF4 A;  2IW5 A;  4FK5 C;  1NR1 A;  4UV8 A;  2UUA B;  4CS3 A;  4JI2 B;  1M9N A;  1Y74 A;  5CA1 A;  2YEV B;  2H8P C;  3RYC A;  1XEQ A;  2CTR A;  1H38 A;  3ZHS A;  1M5I A;  1HW7 A;  2H3O A;  5D5P A;  5EK0 A;  1QR8 A;  4IL6 Z;  2BOC C;  3K5L A;  2A7W A;  2JVD A;  2Y4T A;  5DEC A;  3CC4 V;  1N4C A;  3K08 A;  5CBH A;  5LGT A;  4MVQ A;  3WU2 Z;  4X1I B;  3ASO B;  5E1A C;  3GB7 C;  1PNL A;  1VEW A;  5GON B;  1K7D A;  1RFY A;  4NXN B;  1TUE B;  4PDV A;  1F51 A;  4JI0 O;  2A3Q A;  1BQ0 A;  3LSQ A;  1IBM B;  5L3G A;  4DV7 B;  2M7W A;  4IT5 A;  4NKG B;  2QM7 A;  1N32 B;  3BY6 A;  1HDJ A;  1SQX H;  5LMU O;  4O4I A;  1E1Q G;  3ETE A;  3T1C A;  4X1K B;  5JCO C;  1XNQ O;  1EZJ A;  4JI4 O;  3H01 A;  3VQW A;  1H2M A;  4BIU A;  1SF9 A;  4KL1 A;  1N0J A;  3HKD B;  2GUZ B;  3B8M A;  4K35 A;  1BGY H;  2NNU A;  3JAT B;  3H1I H;  5A9G A;  3JAR B;  3UKM A;  5IY5 C;  1PD3 A;  2Z5U A;  5GW7 A;  4MTO A;  1AI4 A;  1J95 A;  4GCZ A;  2GBO A;  3RN4 A;  1AI6 A;  2ARH A;  1JQ0 A;  1U97 A;  1VQL V;  4DXW A;  3ASN B;  2JIZ G;  4B3T O;  1JR9 A;  3SJC C;  5BR8 B;  3L70 H;  3HKB A;  4X65 O;  2XAJ A;  2QM4 A;  1SES A;  4LWS A;  4AHC A;  4J7Z A;  1V54 C;  1TVK A;  3B4S A;  4MS2 A;  4HZ3 A;  2JGD A;  2VQF O;  3KCX A;  3APO A;  2JGU A;  5B1B B;  5L3E A;  1MAB G;  3SPJ A;  5LYJ A;  2HR3 A;  2JRI A;  5JVD A;  4I50 B;  4DW1 A;  1WA8 A;  2YXH A;  3CCL V;  1WJZ A;  2KG7 A;  4TV9 B;  1I94 O;  1P7B A;  1TVK B;  3N2K A;  3ETD A;  3D3I A;  1KMI Z;  2UU9 B;  2QE7 G;  2WLK A;  5K1X A;  1EN5 A;  5DN6 G;  3ZRW B;  4Z1M G;  1R3J C;  5B5E Z;  3CRC A;  5GTI Z;  3FYI B;  5LMN B;  4H37 A;  2VQE B;  4I7Z B;  1XBL A;  4DV3 B;  4GKK O;  2PTM A;  2YC0 A;  4DR2 B;  1J5E O;  1F23 A;  3AG1 C;  3CXC U;  4TV8 A;  2LGQ A;  4MW8 A;  4FLW A;  1B06 A;  4HAM A;  2HHH O;  2YS8 A;  4YXW G;  1XHX A;  3E22 B;  4EB6 B;  1UPG A;  2GV9 A;  3MDS A;  5HFL A;  4LF9 O;  2Z0A A;  5EZY B;  5KHJ A;  1IUR A;  2AGA A;  2CE4 A;  4LF7 B;  2PI4 A;  4X66 B;  1KEC A;  1ZAU A;  2ZQM A;  3BEH A;  1D2D A;  2Q9L A;  2X6A A;  2KB1 A;  3FB8 C;  4I9W A;  1K4C C;  2FTK A;  4DR3 B;  1XNR B;  2RMK B;  2ZIO A;  4DV5 O;  4PHZ A;  4QE9 A;  1IDS A;  1OV9 A;  3BHP A;  1AIL A;  1JMK C;  1KBH A;  3T1H B;  1RP3 B;  3CCQ V;  3S3W A;  3G67 A;  3ZED A;  1Y4M A;  1N36 B;  4OX9 B;  2HLD G;  4WF9 V;  5CA3 A;  5FL7 G;  3LSS A;  1M93 A;  3DC5 A;  5LMU B;  4F6E A;  4JI3 O;  1R6N A;  5EIB D; 
#chains in the Genus database with same CATH homology
 1H8E G;  1NBM G;  2DWD C;  1SET A;  2WPD G;  2DQ0 A;  3OR6 C;  2ZXW C;  2JEU A;  1V55 B;  2A9H A;  2JK5 C;  5B1O A;  3FB6 C;  4MT8 A;  1PL0 A;  1R73 A;  3OM3 B;  2IJI A;  1H2G A;  2WLI B;  1F4N A;  4BIZ A;  1P4R A;  4J9Y B;  1UJW B;  4L87 A;  2X7R B;  1GK9 A;  2AHZ A;  3ML0 A;  3W7U A;  2WWW A;  4MSW C;  3F7Y C;  4PDR A;  4P9O A;  3JD1 A;  4QNH B;  1K33 A;  4UV9 A;  5EBW C;  1NH2 C;  5C93 A;  2D3O W;  1AI5 A;  4I5S A;  4PA6 A;  1SRY A;  3AG2 B;  3CC7 V;  4ZBM A;  2GHY A;  3CME V;  2OTJ V;  3ABM B;  3CD6 V;  1AJQ A;  2QTO A;  1R3L C;  3SPI A;  1RM1 B;  2EZO A;  4H33 A;  4WCE V;  1DF5 A;  1K92 A;  2EIL C;  3AG3 C;  4LP8 A;  2V7Q G;  1HWY A;  1B6Q A;  3OW2 U;  1VQO V;  2Q68 A;  3ZMT A;  1S0V A;  2OT5 A;  3RW0 A;  3NXS A;  4G27 B;  4DO2 A;  3IC7 A;  4KUM A;  2DYS B;  1XL6 A;  1MOF A;  1FXK A;  2WLH A;  3X2Q B;  3ZMV A;  1AJN A;  4FMT A;  1VQ5 V;  4UVA A;  2BOB C;  3E83 A;  1JOY A;  2B1G A;  4LBE C;  3SYP A;  1GO3 F;  4TSF G;  1Q81 W;  3E8B A;  3LDC A;  1Q82 W;  3WG7 B;  2WAM A;  3T2M A;  3JD3 A;  1NKD A;  5EBL C;  3F5W C;  2WLM A;  4PA4 A;  2Q69 A;  1JCH A;  3MHH C;  3OEH G;  3AEI A;  1AJP A;  4FIP C;  4XDL A;  1VQP V;  1GM9 A;  1QR9 A;  4QIW F;  1SER A;  4PEL A;  2B1I A;  1JX9 A;  3KG2 A;  1M56 C;  4MTF A;  5IYC O;  3T4D A;  5LGU A;  3GWO A;  3ZCC A;  5CMU A;  2XAF A;  3E89 A;  4R6Z A;  1SZT A;  5B3S C;  1FXK C;  3OMN B;  1THZ A;  4KFM A;  4X88 A;  2NLJ C;  3RVY A;  3OUF A;  2XAS A;  3E8G A;  4G2K A;  1DLB A;  1KP2 A;  1S5H C;  3B77 A;  3CP1 A;  2EIN C;  3K06 A;  4MTX A;  5IYD O;  1W0K G;  3CCU V;  1K4D C;  2UXN A;  5BZB A;  5LGN A;  3D36 A;  2DYR C;  1S72 V;  1YJN V;  2W0F C;  3STZ C;  4ASU G;  4PA9 A;  3JD0 A;  2DWE C;  1RPR A;  2WLL B;  5EBM C;  2HJF C;  1EBO A;  2K1E A;  4N23 A;  1AI7 A;  1E1R G;  3DGE A;  1ZWI C;  1NQT A;  3TET A;  4GX5 A;  1OCR B;  1BHA A;  3SJQ C;  1RPO A;  2YSU B;  5H9C A;  2ATK C;  4XBF A;  3OAA G;  1ENV A;  4QE7 A;  3LNM B;  3OR7 C;  1G4Y B;  2P7T C;  1BMF G;  3IFX A;  3LUT B;  1S3J A;  3SPG A;  4LC1 A;  4RUE A;  1ARO P;  1PNK A;  5B1A B;  1QVG U;  1GKF A;  1KC8 W;  2P90 A;  3FYE B;  3WFV A;  5CBG A;  1W2B U;  4MW3 A;  1NVP C;  3SYC A;  2EIN B;  3VBB A;  1K34 A;  3ABU A;  3ZRS A;  3T4Z A;  2DYS C;  1M1K W;  1GM7 A;  1R3I C;  4P9P A;  1FXH A;  4N21 A;  4WFG A;  3K3W A;  3ZRX A;  2HVJ C;  4WFA V;  5KA5 A;  1YTF C;  1VQ6 V;  3E86 A;  3CCS V;  3FB7 C;  4WFH A;  5KUM A;  4MVZ A;  3WG7 C;  4TT3 G;  1OCC C;  2HKO A;  1PKX A;  5B1N A;  3ZMU A;  4LCU C;  1AR1 B;  1YJW V;  2EIL B;  1JPX A;  1F4M A;  1M56 B;  3AG3 B;  1ORQ C;  3ETG A;  3W7T A;  3G4S V;  3X2Q C;  1NH2 B;  1VQ7 V;  1VQM V;  1MSW D;  4CBC A;  3CCV V;  2MK3 A;  4R7C A;  4WFF A;  2H94 A;  1M57 C;  3SYA A;  1K5S A;  2ZXW B;  1K5Q A;  5KUK A;  1K9M W;  3CCR V;  4RQE A;  1YSC A;  4KP4 A;  5CBF A;  2IJH A;  2F43 G;  2ITD C;  5KA6 A;  1NVP D;  2X6C A;  3CCE V;  2IJJ A;  2OCC B;  2WLL A;  4JYC A;  1RM1 C;  1R6K A;  4FPP A;  1VQ4 V;  3M99 B;  3K04 A;  2A0L A;  4UXN A;  4XDJ A;  2EIM B;  2XND G;  4MVU A;  2JJ2 G;  1MG1 A;  2EIJ B;  1IXM A;  1DF4 A;  3P32 A;  1WLE A;  2IH3 C;  2B5U A;  2P67 A;  1WPX A;  2IW5 A;  4P2Z A;  4F4L A;  4FK5 C;  1K97 A;  1NR1 A;  4UV8 A;  2XAQ A;  4QJF B;  4ZKI A;  4RQF A;  3TK1 A;  4JTA B;  1M9N A;  3OGC C;  3CPW U;  5LBQ A;  1G8M A;  1NJI W;  3SYQ A;  2YEV B;  3UM7 A;  2H8P C;  2OCC C;  3RBZ A;  1OHH G;  1K73 W;  1H38 A;  1KP3 A;  4BW5 A;  5EK0 A;  1QR8 A;  3E35 A;  2BOC C;  2XOK G;  4MVO A;  3TCU A;  3FB5 C;  2XAG A;  4G28 B;  2R9R B;  4PA3 A;  3CC4 V;  1GTO A;  3K08 A;  4PDL A;  5CBH A;  4MVQ A;  5LGT A;  4R50 A;  1VQN V;  1OCR C;  4JPR A;  2EIK C;  3ASO B;  4GX2 A;  2JJ1 G;  4JGS A;  2Z3Y A;  2AHY A;  3CMA V;  5E1A C;  4MVM A;  3GB7 C;  1PNL A;  4XDK A;  5L3D A;  5DM6 V;  3F7V C;  1JJ2 U;  1K7D A;  3OUS A;  1TUE B;  4PDV A;  1F51 A;  1M57 B;  1S76 D;  3LSQ A;  3OE7 G;  5L3G A;  1CP9 A;  3P30 A;  3K03 A;  4MVS A;  2QKS A;  4Q20 A;  1FFT B;  2M7W A;  1YHQ V;  1KQS U;  2OTL V;  4JTD B;  5B1B C;  2EIM C;  2QM7 A;  3OMA B;  2ZDI A;  1EFR G;  5CN0 A;  1L1F A;  3BY6 A;  4PDM A;  1E1Q G;  3ABL C;  3ETE A;  3T1C A;  5LHG A;  2QEX V;  1YTF B;  1EZJ A;  1H8H G;  5IYB O;  4MVR A;  3QO5 A;  3H01 A;  3CYO A;  5EC1 C;  4P30 A;  4BIU A;  1QLE B;  3PJS K;  2W6I G;  3SYO A;  3I56 V;  3K0D A;  3CCJ V;  2ITC C;  2Q67 A;  2R9I A;  3AG4 C;  3B8M A;  4JF3 A;  3W7S A;  1GM8 A;  2NNU A;  4CZZ A;  3E2E A;  3K0G A;  3UKM A;  5IY5 C;  1DTO A;  2QM8 A;  1PD3 A;  2Z5U A;  1FXV A;  3K79 A;  1OCO C;  5GW7 A;  1OCC B;  3MHS C;  4MTO A;  4QPK A;  1JVM A;  1AI4 A;  3OMI B;  3ABK B;  1PNM A;  1J95 A;  3CCM V;  4GCZ A;  2IJK A;  2JEX A;  2IU0 A;  2HVK C;  2C2A A;  1KKD A;  1Y66 A;  3OEE G;  1AI6 A;  1VQ8 V;  1LNQ A;  2HFE C;  4X8A A;  1JQ0 A;  1VQL V;  4DXW A;  3ASN B;  1V54 B;  3OFN G;  2LP7 A;  2JIZ G;  3LDE A;  3RVZ A;  5H6R A;  2ZDI C;  3MD0 A;  2XAJ A;  2CK3 G;  3SPH A;  1SES A;  4BAY A;  3DTU B;  5HFM A;  2EBO A;  4JAV A;  4JYB A;  1V54 C;  1FXK B;  2GSM B;  4UUJ C;  4R8C A;  3ABL B;  2DYR B;  3LDD A;  4MS2 A;  4HZ3 A;  3AG4 B;  5IDJ A;  1NH2 D;  2WLI A;  1R3K C;  2V1D A;  5LHH A;  5B1B B;  5L3E A;  1VQK V;  1MAB G;  3JYC A;  3SPJ A;  3VOU A;  2HR3 A;  5B1A C;  2EZP A;  4OXS A;  2UXX A;  5J9P C;  3ABT A;  3CCL V;  1QLN A;  4E2L A;  1VQ9 V;  1COW G;  3ZN1 A;  4WFB V;  2WLJ A;  4U7N A;  3ZIA G;  4GT1 A;  3G71 V;  1K3E A;  4X89 A;  1QBZ A;  1CPY A;  2EIK B;  3CC2 V;  1P7B A;  2Y48 A;  4JAS A;  1QLE C;  3STL C;  3SPC A;  3ETD A;  2XAH A;  5L3B A;  3HB3 B;  2WLN A;  3D3I A;  3I55 V;  1OCO B;  3ZJZ A;  4WFE A;  1FS0 G;  2IU3 A;  1CEZ A;  2X0L A;  2QE7 G;  5IY5 B;  2WLK A;  5B3S B;  5DN6 G;  2LFS A;  3ZRW B;  2EJR A;  5LHI A;  4Z1M G;  1R3J C;  2A79 B;  4JAU A;  1I5Y A;  3AG2 C;  2HG5 C;  3FYI B;  4H37 A;  1NR7 A;  5EC2 C;  1YIJ V;  3EHB B;  1M90 W;  3E8F A;  2JDI G;  1F23 A;  2Y69 C;  3AG1 C;  3CXC U;  2YEV A;  4QPJ A;  1E79 G;  3ABM C;  3ASO C;  4MW8 A;  3ASN C;  4FJC C;  1Q86 W;  4HAM A;  3ZN0 A;  2Q6A A;  4YXW G;  1KD1 W;  1YIT V;  1I5X A;  4PA7 A;  3JD4 A;  3FKS G;  3JCZ A;  4UVC A;  5HFL A;  1V55 C;  1YJ9 V;  5L3C A;  3ABK C;  2X6B A;  1BHB A;  2PI4 A;  1Q7Y W;  1S77 D;  3QO7 A;  1KEC A;  2ZD9 A;  2ZQM A;  3BEH A;  3ZRV A;  2ZR3 A;  4HYO A;  1OCZ C;  1OZ0 A;  1W0J G;  3EFF K;  5H6Q A;  2X6A A;  3ZMS A;  2KB1 A;  3FB8 C;  4J9Z B;  3HPL C;  1YTF D;  2PI5 A;  2W6J G;  4UVB A;  3E8H A;  3W7X A;  4I9W A;  3A0R A;  3ZRW A;  1K4C C;  4GX1 A;  2Y69 B;  3AG1 B;  2FTK A;  3W7W A;  2EIJ C;  4JTC B;  3ZMZ A;  4RO2 A;  1ROP A;  3JD2 A;  4QE9 A;  4GX0 A;  4RAI A;  3B8N A;  1K8A W;  2ZR2 A;  1XL4 A;  4MTG A;  3R65 A;  2DW4 A;  2IH1 C;  2LFR A;  3QO8 A;  4RUF A;  3CCQ V;  2P6J A;  3K9A A;  4EKW A;  1YI2 V;  4U7O A;  1NVP B;  1Y4M A;  5L3F A;  2HLD G;  2WSS G;  4WF9 V;  3G6E V;  3QNE A;  1GMG A;  2DQ3 A;  5CA3 A;  1OCZ B;  2QA4 V;  5FL7 G;  3LSS A;  1QVF U;  3IGA C;  1BL8 A;  1QCE A;  1N8R W;  1R6N A;  4TWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...