1RM1B

Structure of a yeast tfiia/tbp/tata-box dna complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
101
Chain Sequence
PGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEVISVDKLRIVACNSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*TP*CP*GP*AP*TP*CP*GP*AP*TP*AP*TP*AP*AP*AP*AP*CP*G)-
publication title High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
rcsb
source organism Saccharomyces cerevisiae
total genus 23
structure length 101
sequence length 117
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
B PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1rm1B01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1rm1B02
5IYDO 1NVPC 1RM1C 1YTFC 1NH2C 1NVPD 1YTFD 5IYBO 1NH2D 1RM1B 5IYCO
chains in the Genus database with same CATH superfamily
1TAEA 3OAAG 4C7UA 4DO2A 4J42A 1QLEB 1K73W 3EVKA 3CYOA 3BHPA 1F51A 4JAVA 1KB9F 4AILC 2YEVB 4UCSA 5C8YB 4DV7B 1ZL8B 2AZ0A 3EHBB 4TQDA 2XAHA 3L71H 4MT8A 3OUFA 3LNMB 2ZE7A 1VQ5V 2JEXA 1DLBA 2XAFA 2OCHA 2YIBA 1URFA 1XMOO 1Z2GA 2EBOA 3AG3C 4U3FH 3T4ZA 2L6LA 3CXHF 2AGAA 4DV3B 2W6IG 4HZ3A 4BIUA 2JS3A 3O65A 2AHZA 3CCVV 4LFAO 1E1RG 4DR2O 1B6QA 1MNGA 1TUBB 1ZWIC 2HLDG 5B1AB 4DV0O 1N0JA 3UO2A 1QVFU 4NTYA 2LFRA 1PNLA 5KUKA 4UVAA 2RCVA 3K08A 4JTDB 2ZQMA 2WWWA 4LF7O 2QM4A 5EC2C 1P49A 2BCCH 5B1NA 3OT7A 2EIKB 3R66A 1IXBA 4IIJB 5LMNB 1JJOA 1V54B 3QO5A 1L0LH 1WA8B 2R9IA 4AQYB 3D3IA 3BCCH 3CRAA 1GM8A 4B3SB 3ZN0A 2CAZC 1EZJA 4JYAB 2HHHB 1GH6A 4DV4O 4ABMA 3U0ZA 1P7BA 2GSMB 2GTAA 3N27A 4DR3B 1K9MW 3CEIA 3K9AA 2WLNA 1GTOA 2IJIA 3KZIZ 1OJHA 5IJ0B 3TETA 2XTAA 1ZTEA 1SQQH 1PL4A 1MSWD 1AROP 2DWDC 1GN6A 3ABMB 5GONA 5J2UA 4IL6Z 4E4EA 2EZPA 3FYEB 3A0BZ 3JATB 1MABG 2LP7A 1SERA 2YXHA 4X64O 1XNRB 3G6BA 4LNUA 1SQVH 3IC9A 3D36C 1KYOF 3J81N 3G6EV 1FJGB 2EINB 1VMGA 2BTOA 1NTZH 3CJHB 1JR9A 2PY5A 1CEZA 4HYOA 2XAGA 1K4DC 4LF4O 4X1IA 2XUMA 1WLEA 4CH4A 2YXYA 3ZMZA 2Q4PA 4DYLA 3LSUA 4FLVA 2RDCA 1EN6A 2P22C 2GDSA 2C2AA 4K8XA 4AI8A 1BE3H 1COWG 1W2BU 4O2BB 4H37A 3IC7A 4RUEA 5JH7B 3N2GA 1I7FA 3APQA 4BW5A 3RYFA 2XHBA 4X1YB 4ZIBA 4DUYB 4X9QA 4H13B 1SQBH 1NR7A 5L3CA 2UUAB 4TV8A 2VRZA 5L3BA 3ETEA 2YI8A 1ORQC 1BQZA 3JD2A 3E8BA 5LMNO 1YZBA 3SJAC 1K97A 2UUBO 3ABKC 3C90A 5LHIA 4O4HB 3ASOC 3E8FA 2JGDA 4O4LB 1G4YB 4B3SO 3RYCA 3K58A 1FFTB 3H1IH 4A5UB 2QA4V 3CWBH 3QO7A 1FXVA 1KP3A 3L72H 3T4DA 3W7WA 2WLIB 2DJVA 4QGPA 4PV1B 1GMGA 5E79Z 1HP8A 4NTXA 4J9ZB 2E75B 1XUQA 2WA4A 3JCUZ 4WBNA 2JIZG 1RM1C 1VQ9V 4TV9A 1D5NA 1NKDA 1QBZA 2LQTA 3JCZA 2PGGA 5IE9A 2F66C 1VQPV 5LGTA 3RGBA 2HR3A 1XILA 4X66O 1SQGA 4OGQB 2R9AA 1R3KC 2FYUH 2ITCC 2DQ3A 5B1BB 2E5LO 1Y76A 4JI5O 3JD4A 2BTQA 3FYIB 3HB3B 2Q7EA 3A0RA 1NH2C 2DW4A 4MVZA 3GWKC 1QLEC 3H1KH 4PA6A 3ZX6A 3JAWB 3JASA 5B1OA 4ZI7A 1MZFA 3VQYA 3VBBA 4U7OA 4GX5A 2P5OA 3JSLA 4YY3B 1SZTA 2ZR2A 2XASA 5CB4B 4JZGA 2BE3A 3OR6C 4JASA 1IXMA 4XDJA 4PI0A 3BPZA 2PYJA 1WP7A 4X65B 3X2QB 2HVKC 5B3SB 1KC8W 4I4TA 1YVWA 1P84F 4UB6Z 3FB6C 5A9GA 3OMAB 2DE0X 2FL4A 2IJJA 5IT9N 4FFBB 5B1AC 1NU1H 5HFLA 5D5PA 1S5JA 2N05A 5KHIA 4GYCB 4B3RB 4H0LB 4NYKA 1T5EA 2FTKA 1YDXA 1E79G 2ZM6B 1XBLA 4LP8A 2UUCB 1R6KA 3OE7G 3E8HA 1Y6XA 1WN7A 4CC6A 1V54C 3WG7C 3KCYA 4MS2A 4NXNB 1JMKC 2X7RB 4DK1A 1YIJV 1M5IA 1XNQO 1JQ0A 3B40A 2CK3G 5JJEB 5LA6B 1PV0A 4I55A 1S76D 4CH6A 5KA5A 4UXNA 1DF4A 1TGOA 1XHXA 2CTRA 4K35A 4LR3A 1V55B 2E74B 3NXSA 5KUMA 3DGEA 2BSKB 3NR7A 2JVDA 2X6BA 4ZBMA 4X89A 5CA0B 1BS3A 3UQ8A 1H38A 1B04A 2QWOB 2ZDIC 3ABMC 2YEVA 1HWYA 5FL7G 5C8YA 4G2KA 1ZL8A 1YEWA 3GWOA 2BOBC 1HNXO 2MW2B 4FMTA 1I08A 3CP1A 3G80A 2JJ2G 2Q69A 1D5AA 2ATKC 2LW7A 2ADPA 2KKWA 3P3PA 1G8MA 4JI1O 4DR5B 3ZMUA 3AG4C 5LHHA 1SKVA 1BT8A 2EINC 1WNSA 1Y67A 2NR5A 1PNMA 3RT3C 3C3SA 3QTCA 4RQFA 4YIPA 3FKSG 3G71V 3CPWU 1FXHA 1TUBA 3BA8A 3DC5A 4YY3O 3FX7A 2MK3A 3A2FA 4CS3A 5IY5C 2YXLA 2YDEA 1FFXA 1AI7A 1X59A 3AG2B 4Q20A 3RFRA 4X65O 3ASNB 4X62B 3CHXA 2QWNB 2EJ7A 3MDSA 2R9RB 1XQ8A 4DR7B 2RN9A 4D6TH 2A79B 1WA8A 3ZHRA 1MOFA 3ZHTA 4GLXA 2VQEB 1HNZB 4X1KA 3LDCA 4B3MB 4JI6O 3GB7C 3ZEDA 1BGYH 2OIGA 1Z5VA 4B3RO 3ETDA 4LFCB 3OFNG 5CA1A 4UUJC 1YF2A 2UUCO 1RP3B 1DF5A 5IDJA 4DV5O 4YJ2A 4NXNO 2Q5ZA 2Z3YA 1IBKB 5IJ0A 1S3JA 3RYIA 1HNWO 3CCEV 1QCEA 2K1EA 2D2CB 2ZDIA 2LGWA 2DMXA 3B8NA 5K1PA 4FM0A 4YHHB 3JATA 1XOUA 1EZVH 2E3CA 4DR4O 4CH5A 4LF6B 2PUSA 4PHZA 5BR8O 2B1IA 3K06A 3B8MA 4GKJO 2EIJB 2WA3A 1U97A 1VQ7V 1FAFA 4TUYB 2ZXWB 5LOVB 3ABUA 4I50B 1WP8A 2KG7B 4JI7B 1JX9A 2JK5C 5FNVB 5EBMC 1Y74A 4J80A 2UXBB 4NVPA 4UV8A 1YI2V 4UB8Z 2UXDB 1BHAA 1H8EG 3B77A 3K03A 2A9HA 5B1BC 1H2GA 4QPJA 4FLYA 3SYPA 3M8AA 2OIEA 5KLVH 2QTSA 3U11A 2D3OW 4FLWA 3ABLC 3OEHG 2XAJA 4ZOLB 2Q67A 4MVRA 2CGNA 2IU3A 1AJNA 1Q90D 2NN4A 4PJ0Z 4O2BA 4ICGA 3JAMN 1AJPA 5JH7A 3RW0A 4HNAB 4I0XB 2DYRB 2ZE6A 4K8ZA 4I5SA 5EZYB 1I94B 3CC2V 4JI4O 5FPRA 1I0HA 2EIMC 4FFKA 4OXSA 3SPHA 3MHHC 2CUGA 5KHKA 4LF5O 5CBGA 1O9GA 1NTKH 3X2QC 1OCRC 5B3SC 4WFEA 3E22B 1NQTA 2ZE5A 1F4MA 1ZLZA 4K0KO 2XNDG 2VQEO 4OPAA 1THZA 3ZN1A 4X8AA 1HNZO 4O4HA 4B3MO 2DN9A 1FYJA 1DTOA 4O4LA 3RVZA 3PN1A 3KKYA 3I55V 2QKSA 4XDLA 4J11A 2WLIA 4UCRA 3RBZA 5KA6A 4Q6GA 4WFGA 2Z5UA 1EFRG 3H1JH 2UXNA 3J7AU 1F4NA 1H2NA 2RQ6A 3CE2A 3I56V 1IBKO 1H2KA 2HJFC 5H6QA 1S77D 4X20A 4X88A 3K5NA 1ZUQA 4JGSA 2DWEC 1PM9A 1M57B 2M7WA 4YHHO 4KXRA 5IWAO 4OX9O 1R3LC 1Q6IA 4MVUA 4O4IB 2ILMA 3J80N 1SA0B 1GK9A 2CTPA 1V55C 4LF6O 3T1CA 4LFBB 4NKGB 4GT1A 2A0LA 4IYHA 1L8DA 1FKAO 3LDEA 1QU7A 1N32O 3E2EA 2UU9B 4BWAA 2P4VA 3JAWA 4N23A 1OCCB 1H2MA 1MA1A 3ZRWB 2F95B 4JTAB 2UXDO 1PL0A 2ZT9B 4P30A 1IURA 1YTFB 2W0XA 1Q7YW 5CB4A 4YJ3B 4IHJB 1SS3A 1VP7A 5IYBO 4CC5A 4B3TB 2XOKG 3F7VC 5IYDO 4DV1B 4JPRA 4LBEC 4R6ZA 2YIDA 4FIPC 2V4DA 1AB3A 4JI0O 1PP9H 4O4JB 3F5TA 3K57A 3OR7C 3RYHB 3TXSA 2FB5A 4MVSA 1I94O 3P30A 1CPYA 5E1AC 2CTQA 4FFBA 1WB8A 4KHPB 3C3TA 2ZD9A 4Z2WA 2M6YA 3AG2C 4N21A 3T1YB 4MTOA 4WFAV 4UCTA 3JAKA 4LC1A 1GN3A 2Y48A 2RMKB 4DV7O 4FLXA 4XBFA 3CCQV 2B9ZA 4MVOA 1FXKC 2R72A 4MTGA 4DRXB 2UXXA 4BW9A 5IYCO 5BMVB 1M4UA 3APOA 3QG5A 5KMGB 3AG1C 1IZ3A 4J9YB 5LA6A 4DV3O 4GX1A 4RWUA 1WPBA 2FMLA 4JZ2A 1VQ8V 1UJWB 2YSUB 4LWSB 1Q6HA 2ETNA 3FB8C 3W7TA 5FLXN 1FS0G 3K59A 4FLZA 2BSKA 4DW0A 5CA0A 1QHTA 2IH3C 3ZRVA 2LW1A 1SQPH 2WLLB 4U3JB 1K33A 2R70A 4QE7A 2QR4A 3QNEA 3K0GA 3E86A 1KKCA 1AI6A 4AQYO 4PDRA 1RPOA 5KX5B 3M7MX 2OCCB 4R8CA 1PPJH 2H3OA 3TCUA 2OWOA 5EIBD 3B09A 3K5LA 3N2KA 2ZXWC 3FAVB 2UU9O 2BOCC 3HKCB 2YIAA 3P32A 4JYAO 2HHHO 1R3IC 1JPXA 1NBMG 4IYIA 4DR3O 1SZXA 3SPGA 2Q8VA 1Y66A 1IDSA 3HKDB 3CMAV 1AVMA 3OTOB 1N34B 2N74A 4B7EA 3ZMTA 3LDDA 2ZNJA 1R6TA 1AP6A 4GKKB 4DV2B 3H1HH 3TK1A 1YJWV 2WLMA 4JI3B 4LF8B 1FXKA 4NB5A 1IBMB 1YITV 4WFHA 2JRIA 2HJDA 1XNRO 1IBLB 2DYRC 4J41A 2EZOA 3T2MA 2EILC 3H1LH 3LSQA 4WF9V 1NR1A 3T1YO 1AP5A 1YJNV 4F6RB 1B06A 2JEUA 2O57A 1FJGO 1KECA 2CDYA 1K34A 2YI9A 4RO2A 3STZC 2P67A 3L9DA 1N36B 1SQFA 5JCOA 2VS0A 3CCSV 2F1MA 3CRQA 3RN4A 1YCIA 5GW7A 5LYJB 2UXCB 1Y4MA 1JOYA 5K1XA 2RNBA 5H6RA 4W4KA 5DM6V 1QLNA 5IJ9B 3CRCA 1NI8A 5KHJA 4B7KA 1YXBA 5EYPB 3OEEG 4BR6A 5BXZA 2WLKA 2ZNIA 1Q6UA 4DR6B 1TUEB 2NLJC 2JGUA 1N33B 1AR4A 3JALB 1RPRA 1TVKB 3VQVA 2XAQA 2ADQB 4DUYO 4MTFA 4TUYA 2UUAO 5LOVA 1P7GA 4I50A 1AR1B 2H94A 3HPLC 1K8AW 5FNVA 5EBWC 2ITDC 1M57C 1OHHG 1I5YA 5L3GA 1AJQA 3WB1A 3AK1A 4F6EA 2EIKC 4NXMB 5JJJB 1CP9A 3AG3B 1M9NA 4KFMA 1E1QG 1XI1A 5LBQA 3SDLA 4DR1B 2Q0OC 1VF6C 5D5QA 1RSOB 3RVYA 1VQNV 3SPJA 1K92A 4HNAA 4I0XA 4X1IB 5J2TA 3CB2A 3OTOO 5LGNA 5EZYA 3ETGA 2QKAA 4JV5B 3H01A 4WFFA 1SC5B 3JD3A 4DV6B 2JDIG 4JYBA 4Z1VA 4DV2O 1XREA 4CS4A 4CZZA 1OCZB 4JI3O 1OZ0A 1HDJA 4LF8O 1EM1A 3E22A 4HBNA 3MAQA 2L35A 3EXAA 1ZSPA 4YIOA 1N8RW 1NVPB 1JFFB 3ZBHA 1EBOA 1ZAUA 5FPOA 2KQXA 3STLC 1VQMV 2EX3A 1VQKV 3A0HZ 2ZKOA 4LCUC 4JI8B 1QR8A 5H2FZ 1W59A 1L0NH 3AEIA 3ZS8C 5C93A 4J7KA 1N36O 2WAMA 2P7TC 4J10A 1BQ0A 5LXTB 2UXCO 3THOA 2P90A 4CH3A 5H9CA 3E83A 4GCZA 3SPIA 1BSMA 1YSCA 1W0KG 2Q73A 5B5EZ 1CXZB 3UKMA 2HKOA 4PELA 3BRCA 1VQ6V 5LP6B 2AW9A 4O4IA 5GTHZ 4IIJA 1SA0A 3ZHVA 4WBNB 4TV9B 1W0JG 2F23A 2V1DA 1J5EB 1NZ6A 2RJZA 1QNMA 3OM3B 2HVJC 3K04A 2GTSA 1OCOB 1H2SB 1SETA 2P06A 3WFVA 4UCVA 2AHYA 3ZHUA 1VF6A 2JS5A 1VIBA 2ZM6O 3ZRWA 4EFBA 1X4TA 3JYCA 4BAYA 3FB5C 1NJIW 3HKEB 4MVMA 4YJ3A 4IHJA 5EBLC 4DW1A 4G27B 4ZHQB 4IT5A 4DXWA 3JARB 1XMOB 2OCCC 1VF7A 4B08A 2LO1A 3ZCCA 1RFYA 3ZRXA 4O4JA 4LFAB 1L1FA 3RYHA 4FM2A 4DR2B 2G38A 3DTUB 1QQCA 1ENVA 3ZIAG 1WJZA 2X6AA 1ROPA 4MVQA 1M1KW 2GV9A 4FLUA 4DV6O 1SESA 1FPOA 3T1HB 5JQGB 3W7XA 4LF7B 5CMUA 3K3WA 1OV9A 5L3FA 2CGOA 3AK3A 3L75H 4JAAA 2W0FC 3CX5F 3CJHA 4R7CA 4DRXA 2Q7GA 3CD6V 3S3WA 4EB6B 1HR0B 4QJFB 5BMVA 3HR0A 5KMGA 1M56B 3O9OA 3DXRB 2IJHA 2A3QA 5EIBC 1MMMA 2YICA 4DR5O 2QM8A 4CS2A 1SQXH 2KB1A 1S5HC 3HKBB 2ODMA 4LWSA 4TT3G 1NTMH 1LUVA 1HW7A 2QTOA 4MTXA 4X1YA 3WB0A 3E8GA 1GKFA 3OTFA 2Q9LA 4BIOA 2Y0IA 3CCUV 4J7JA 1VQ4V 2WLJA 4X62O 3OGCC 2QKCA 4TWKA 2WLLA 3IGAC 4U3JA 3AG7A 3A8TA 4DR7O 4FZ0A 3L70H 3TJTA 4X64B 1V9PA 1NH2B 4W4LA 5KX5A 3ZJZA 2GUZB 3MHSC 2B1GA 3GVMA 4RAIA 5KHGA 2QWPB 1Q8IA 3FAVA 3CCMV 4PDVA 3HKCA 1AI4A 4LFCO 2HG5C 4JF3A 4D7SA 1KU9A 1EN4A 3SJCC 5B66Z 3SR2C 2F4VB 1PD3A 3HKDA 1BL8A 4LF4B 1YTFD 5DEDA 1VF5B 4QNHB 4UFZA 4DUZB 4H33A 1M93A 3CS5A 3ZHSA 3Q4HB 3CC7V 5L3DA 1H2LA 1J95A 3OGIB 3SPCA 4WFBV 2ARHA 1KUQA 1FFXB 3L73H 5AG2A 3T1HO 1US6A 1MZEA 2YC0A 3BABA 2LJ2A 2B5UA 4F6RA 4O2AB 4JI7O 1GN4A 5KAIZ 1F23A 1TA8A 1XL4A 2W6JG 2UXBO 1UFIA 1OCZC 3WG7B 5IYZB 3UT5B 2JJ1G 4NR1A 1XHZA 1BCCH 1VEWA 4F4LA 2UUBB 5LYJA 1HR0O 4X1KB 3VQWA 1YHQV 3SJBC 5ITZB 1NVPC 2WPDG 5IJ9A 4PA3A 1NT2B 2EJRA 5BZBA 5EYPA 2GBOA 2P6JA 5A2QN 1F7YA 5CA1B 3K5MA 4JAUA 1P4RA 4PD4F 1WB7A 1KKDA 4YJ2B 1B3QA 1IX9A 1ZX3A 3OMIB 5JVDB 4GUNA 4PA4A 3P3NA 3EFFK 3JALA 1TVKA 1PNKA 3FB7C 5J9PC 3RYIB 3OUSA 4X66B 1GRJA 4DK0A 4UCUA 3CRRA 1KP2A 1XL6A 3ASNC 5TISZ 2PI4A 5LGUA 5LP6C 3FFQA 2E5LB 4JI5B 2DYSB 1VARA 4BIZA 1GN2A 4FVMA 1I5XA 2QE7G 1LNQA 1OCOC 3QO8A 1FD9A 3CSXA 4MW8A 3DC6A 4JYCA 3AG4B 3OW2U 3KCXA 2WLHA 3OMNB 1Y74B 2CH7B 4PA7A 4JI2B 1RSOA 4PDLA 2GHYA 2Y69B 2F4VO 4EEQA 1UPGA 5IY5B 4UV9A 5JCOC 2IW5A 3SYAA 2YIBD 4J7ZA 2Q7HA 5CA3A 4DUZO 3B4SA 1S72V 2LGQA 1XDCA 3AK2A 3DSQA 4PA9A 3ZHQA 1JFFA 4LFBO 2AXTZ 3QVNA 2KSDA 4LF9B 4GX2A 1H8HG 5F2VO 3ZMVA 1Q5OA 2EIJC 4RUFA 4EFEA 2WSSG 1U96A 1SRYA 3CRMA 2K9PA 1JVMA 2HEPA 3TXQA 2QM7A 3UCSC 5LXTA 3WU2Z 5CBHA 3UO3A 3K5OA 3BFRA 3SYQA 1AILA 2V7QG 2ZE8A 4TQFA 4B3TO 1XNQB 2Q68A 4DV1O 1M56C 3BA9A 2EULA 3VOUA 4FK5C 5LP6A 1BHBA 2P4KA 1K3EA 2PZSA 4UVBA 3I5DA 4QIWF 3VQXA 2PI5A 1AR5A 3CCLV 3D36A 4LH7A 3SYCA 4KHPO 3FD9A 4X20B 2Y0PA 3K9SA 1QVGU 3D3QA 2OT5A 4LH6A 1IVSA 3IJ4A 4HAMA 3SGIA 4R50A 2F93B 1R6NA 5CN0A 2OTJV 2IBZH 2NNUA 2ZIMA 5BY1A 5LHGA 2PTMA 3S3XA 1HNXB 3HKEA 5LMUB 3ABLB 4ZHQA 4FJCC 3JARA 2IU0A 4AHCA 4JI1B 1VQOV 4P9OA 1XMQB 2XT9A 4I9WA 2ZCEA 1SF9A 1EN5A 1JJ2U 4JI2O 3L74H 3U10A 2YS8A 4FZ1A 1R1BA 4FM1A 4UVCA 2EIMB 3SYOA 2PF4E 5JQGA 2CE4A 4PDMA 1OCRB 5GONB 5J2UB 3UM7A 4MSWC 2KG7A 2YUAA 1M90W 1BMFG 2VQFB 5H5NA 2CTWA 1K5SA 3JSNA 4P9PA 3BEHA 5DN6G 2Y4UA 5DECA 1G1XB 3BY6A 2OTLV 1GO3F 5KHHA 4KP4A 3CCRV 1NVPD 4EB6A 1PKXA 4EKWA 4LF9O 4FPPA 4JI6B 1A32A 2HP8A 4LNUB 1DK1A 2QDOA 3DXRA 4ZOLA 3JD1A 3K79A 3JAKB 1QR9A 3SJQC 1KQSU 1LUWA 3R65A 4XDKA 3HKBA 1OCCC 4DV5B 4CBCA 3E35A 4L87A 1N34O 2VWJA 4P2ZA 5CBFA 1K7DA 2QWRB 2F43G 1YTFC 1WAZA 1JA8A 1JCHA 1KMIZ 2QWQB 1HNWB 3MD0A 4GKKO 3IFXA 1IBMO 3N2GB 3W7UA 3RYFB 3ETQA 4DR4B 1IBLO 3CC4V 2FKXA 5BR8B 4GKJB 2GUZA 3G4SV 4TV8B 1D2DA 2ZINA 2DQ0A 4KL1A 3CMEV 1R73A 3B2EE 2DOSA 2LFSA 2HFEC 1GM9A 4E2LA 4U7NA 2DYSC 2A06H 2JGDB 5LMUO 3G67A 3RYCB 5JWPA 2N04A 3M99B 3N2KB 4RQEA 3CCJV 1XMQO 1MSDA 4MW3A 1Q81W 1N4CA 1S0VA 2A7WA 4JTCB 3F7YC 3Q4HA 1S5LZ 4TOIA 4DR6O 4GX0A 3CXCU 1N33O 2OYQA 2QJ1A 2Y69C 4QPKA 5LL6Y 3LNNA 1BZKA 3KG2A 4JI4B 1WPXA 2H8PC 5EC1C 4LF5B 2X0LA 4WCEV 4L8JA 4O2AA 1R3JC 5KAFZ 2VQFO 2ZR3A 1VQLV 1FXKB 5IYZA 1Q3EA 3QF7A 3UT5A 3ZMSA 1Q82W 1Y76B 3TGUH 4K0KB 4NXMO 2BTQB 3H9VA 3BAAA 4UCOA 5ITZA 3AG1B 3WB2A 3OD4A 3K0DA 2VWKA 3IAYA 3JASB 1Z5WA 4DR1O 4ZI7B 3W7SA 3ABTA 2Q0AA 2QGNA 1MG1A 2E76B 5GTIZ 2QEXV 5JVDA 4TSFG 3PJSK 4G28B 4DV0B 2AZ2A 1KD1W 4JV5O 1O9HA 5HFMA 5IWAB 4OX9B 1Q86W 4NTWA 1DGSA 1K4CC 4I4TB 3ICXA 3ABKB 4ASUG 3ASOB 4IGGA 3LSSA 1NH2D 1AI5A 2IJKA 3E89A 1YJ9V 4I7ZB 4D7TA 2Y4TA 1N32B 2IM9A 1Q43A 4Z1MG 4JI8O 4PI2A 4QE9A 2CH7A 1GM7A 2Z0AA 3BVOA 4DV4B 5L3EA 2Q6AA 1RM1B 5JJNB 3F5WC 4K3AA 4ZKIA 3ML0A 4GZRB 4I9QA 4FLTA 3RWRD 2PYLA 1KBHA 2X6CA 2IH1C 5EK0A 3JD0A 4H44B 1K5QA 2ZIOA 4KUMA 4JYYA 1N0NA 1LR1A 1NS1A 3ZRSA 4I55B 1GAXA 3D8CA 4JI0B 3LUTB 1G6UA 4YXWG 4OPHA 5J2TB 1J5EO 2EILB 2QSAA 1XEQA
chains in the Genus database with same CATH topology
1I5XA 3OAAG 4DO2A 5H6RA 5IY5C 2QE7G 1AI7A 5DM6V 1QLNA 1LNQA 1OCOC 3AG2B 3QO8A 4Q20A 4MW8A 1QLEB 1K73W 4JYCA 3AG4B 3OW2U 2WLHA 3CYOA 3OMNB 3ASNB 3OEEG 1F51A 2WLKA 4PA7A 4JAVA 2R9RB 2YEVB 1TUEB 4PDLA 2GHYA 2NLJC 2Y69B 3EHBB 2XAHA 2A79B 1MOFA 4MT8A 3OUFA 3LNMB 5IY5B 1VQ5V 1RPRA 4UV9A 2IW5A 2JEXA 3SYAA 1DLBA 2XAQA 2XAFA 3LDCA 4MTFA 3GB7C 5CA3A 1S72V 2EBOA 3AG3C 3T4ZA 1AR1B 2H94A 3HPLC 1K8AW 3ETDA 2W6IG 3OFNG 4HZ3A 5EBWC 4BIUA 4UUJC 2ITDC 1M57C 2AHZA 1OHHG 1DF5A 1I5YA 3CCVV 5L3GA 1AJQA 5IDJA 1E1RG 4PA9A 2EIKC 1B6QA 1ZWIC 2HLDG 5B1AB 1CP9A 2Z3YA 3AG3B 4GX2A 1H8HG 1M9NA 1QVFU 4KFMA 2LFRA 3ZMVA 1PNLA 1E1QG 1S3JA 4UVAA 5KUKA 3K08A 2EIJC 4RUFA 4JTDB 2ZQMA 2WWWA 5LBQA 1QCEA 2K1EA 3CCEV 5EC2C 2ZDIA 2WSSG 3B8NA 5B1NA 1SRYA 2EIKB 1V54B 1JVMA 3QO5A 3RVYA 1VQNV 3SPJA 1K92A 2QM7A 5CBHA 2R9IA 5LGNA 3D3IA 2B1IA 3K06A 3B8MA 3ETGA 3SYQA 2EIJB 1GM8A 1VQ7V 3H01A 2ZXWB 2V7QG 4WFFA 3ABUA 3ZN0A 3JD3A 2Q68A 2JDIG 1M56C 1EZJA 4JYBA 1JX9A 2JK5C 4CZZA 5EBMC 1OCZB 3VOUA 1OZ0A 1P7BA 4FK5C 2GSMB 1BHBA 4UV8A 1K9MW 1YI2V 1K3EA 3K9AA 2WLNA 1GTOA 1H8EG 2IJIA 2A9HA 3B77A 1H2GA 3K03A 5B1BC 4UVBA 4QIWF 4QPJA 1N8RW 1NVPB 2PI5A 3SYPA 3CCLV 3D36A 1EBOA 1VQMV 3STLC 3SYCA 1VQKV 2D3OW 3TETA 3ABLC 3OEHG 2XAJA 4MVRA 2Q67A 1QVGU 1AROP 4LCUC 1MSWD 2OT5A 2DWDC 1QR8A 2IU3A 3ABMB 4HAMA 1AJNA 4R50A 3AEIA 2EZPA 3FYEB 5C93A 1R6NA 5CN0A 2WAMA 1AJPA 1MABG 2P7TC 2LP7A 2OTJV 2NNUA 1SERA 3RW0A 2DYRB 5LHGA 2P90A 5H9CA 4I5SA 3E83A 3CC2V 4GCZA 3ABLB 3SPIA 4FJCC 2EIMC 1YSCA 1W0KG 4OXSA 3SPHA 2IU0A 3MHHC 3UKMA 5CBGA 1VQOV 2HKOA 4PELA 4P9OA 3G6EV 1VQ6V 4I9WA 2EINB 3X2QC 1OCRC 1JJ2U 5B3SC 4WFEA 1NQTA 1CEZA 4HYOA 1F4MA 1W0JG 2V1DA 2XAGA 2XNDG 2EILB 1K4DC 1THZA 3ZN1A 4X8AA 1WLEA 2HVJC 3K04A 3OM3B 4UVCA 1DTOA 3RVZA 3ZMZA 2EIMB 1OCOB 3I55V 2QKSA 3SYOA 4XDLA 1SETA 3WFVA 2AHYA 2WLIA 4PDMA 1OCRB 3RBZA 2C2AA 5KA6A 3UM7A 4MSWC 4WFGA 1M90W 1BMFG 1COWG 1W2BU 4H37A 2Z5UA 1EFRG 1K5SA 3IC7A 4P9PA 3BEHA 3ZRWA 2UXNA 5DN6G 4RUEA 3BY6A 2OTLV 3JYCA 4BAYA 4BW5A 1GO3F 3CCRV 1F4NA 4KP4A 1NVPD 3FB5C 1NJIW 1PKXA 4EKWA 4FPPA 3I56V 4MVMA 5EBLC 4G27B 1NR7A 2HJFC 4DXWA 5L3CA 2OCCC 5H6QA 1S77D 4X88A 3ZCCA 5L3BA 3JD1A 4JGSA 2DWEC 3ETEA 1M57B 1ORQC 3K79A 2M7WA 3ZRXA 1QR9A 3SJQC 1KQSU 1R3LC 3JD2A 3E8BA 3R65A 4MVUA 4XDKA 1L1FA 1OCCC 1GK9A 3DTUB 1K97A 3ZIAG 1ENVA 1V55C 4CBCA 3E35A 3ABKC 4L87A 5LHIA 3T1CA 3ASOC 3E8FA 2X6AA 4P2ZA 5CBFA 1K7DA 1ROPA 1G4YB 2F43G 4GT1A 4MVQA 1YTFC 2A0LA 1M1KW 1FFTB 1JCHA 3LDEA 1SESA 2QA4V 3QO7A 1FXVA 1KP3A 3T4DA 3W7XA 3MD0A 2WLIB 3W7WA 5CMUA 3E2EA 3K3WA 1GMGA 4N23A 5L3FA 1OCCB 4J9ZB 2W0FC 3IFXA 3ZRWB 4JTAB 4R7CA 1PL0A 3W7UA 2JIZG 1RM1C 1VQ9V 4P30A 3CD6V 1NKDA 1QBZA 1YTFB 3JCZA 1Q7YW 3CC4V 4QJFB 1VQPV 5LGTA 5IYBO 3G4SV 2HR3A 1M56B 2XOKG 3F7VC 5IYDO 4JPRA 4LBEC 1R3KC 2IJHA 4FIPC 4R6ZA 2DQ0A 2QM8A 3CMEV 1R73A 2ITCC 2DQ3A 2KB1A 5B1BB 1S5HC 2HFEC 2LFSA 3OR7C 1GM9A 4E2LA 4U7NA 3JD4A 4TT3G 3FYIB 2DYSC 2QTOA 4MTXA 4MVSA 3P30A 3E8GA 1CPYA 5E1AC 3HB3B 1GKFA 3A0RA 1NH2C 2ZD9A 3M99B 4RQEA 2DW4A 4MVZA 3AG2C 3CCJV 4N21A 3CCUV 1VQ4V 1QLEC 4PA6A 2WLJA 4MTOA 5B1OA 3OGCC 4MW3A 4TWKA 4WFAV 2WLLA 3IGAC 1Q81W 1S0VA 4JTCB 3F7YC 3VBBA 4LC1A 2Y48A 4GX0A 4XBFA 3CCQV 3CXCU 4MVOA 1FXKC 4U7OA 4MTGA 2Y69C 4QPKA 4GX5A 2UXXA 1NH2B 3KG2A 1SZTA 5IYCO 2ZR2A 2XASA 3ZJZA 3MHSC 3OR6C 4JASA 1IXMA 2B1GA 1WPXA 2H8PC 3AG1C 4XDJA 4RAIA 5EC1C 2X0LA 4J9YB 4WCEV 3CCMV 4PDVA 3X2QB 1R3JC 1AI4A 4GX1A 2HVKC 2HG5C 5B3SB 2ZR3A 4JF3A 1VQLV 1FXKB 1KC8W 1VQ8V 1UJWB 2YSUB 3ZMSA 1Q82W 3FB8C 3FB6C 3W7TA 1PD3A 1FS0G 3OMAB 1BL8A 1YTFD 4QNHB 2IJJA 3AG1B 5B1AC 5HFLA 3K0DA 2IH3C 4H33A 3ZRVA 2WLLB 3W7SA 2FTKA 3ABTA 1K33A 3CC7V 1E79G 5L3DA 1MG1A 4LP8A 1J95A 3SPCA 4WFBV 4QE7A 1R6KA 3OE7G 3E8HA 3QNEA 2QEXV 3K0GA 3E86A 1V54C 3WG7C 4MS2A 2X7RB 4TSFG 3PJSK 4G28B 1AI6A 4PDRA 1RPOA 2OCCB 4R8CA 1KD1W 3TCUA 1YIJV 1JQ0A 2ZXWC 2CK3G 2B5UA 1S76D 2BOCC 5HFMA 3P32A 5KA5A 1R3IC 4UXNA 1F23A 1XL4A 2W6JG 1DF4A 1JPXA 1NBMG 1Q86W 1OCZC 3WG7B 1K4CC 2JJ1G 3SPGA 1V55B 3NXSA 1Y66A 5KUMA 3ABKB 4ASUG 3ASOB 4F4LA 3CMAV 3DGEA 3LSSA 1NH2D 1AI5A 1YHQV 2X6BA 2IJKA 3E89A 3ZMTA 1NVPC 2WPDG 4ZBMA 4X89A 1YJ9V 4PA3A 3LDDA 1H38A 2EJRA 5BZBA 4Z1MG 2P6JA 4QE9A 1GM7A 4JAUA 2ZDIC 1P4RA 3ABMC 3TK1A 1YJWV 2WLMA 1FXKA 2YEVA 5L3EA 1HWYA 5FL7G 1KKDA 2Q6AA 1RM1B 4G2KA 3F5WC 1YITV 3OMIB 4WFHA 4ZKIA 4PA4A 3ML0A 3EFFK 3GWOA 2BOBC 1PNKA 2DYRC 4FMTA 3CP1A 2EZOA 3FB7C 2X6CA 2IH1C 5EK0A 2JJ2G 5J9PC 3JD0A 2Q69A 3T2MA 1K5QA 2EILC 4KUMA 2ATKC 3LSQA 4WF9V 3OUSA 3ZRSA 1NR1A 1G8MA 1YJNV 1BHAA 3ZMUA 2JEUA 3AG4C 5LHHA 1KECA 3LUTB 1K34A 1KP2A 4RO2A 1XL6A 3ASNC 3STZC 2PI4A 2EINC 2P67A 1PNMA 5LGUA 4YXWG 4RQFA 3FKSG 2DYSB 3G71V 3CCSV 4BIZA 3CPWU 1FXHA 5GW7A 1Y4MA 1JOYA 2MK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYD O;  1NVP C;  1RM1 C;  1YTF C;  1NH2 C;  1NVP D;  1YTF D;  5IYB O;  1NH2 D;  1RM1 B;  5IYC O; 
#chains in the Genus database with same CATH topology
 1TAE A;  3OAA G;  4C7U A;  4DO2 A;  4J42 A;  1QLE B;  1K73 W;  3EVK A;  3CYO A;  3BHP A;  1F51 A;  4JAV A;  1KB9 F;  4AIL C;  2YEV B;  4UCS A;  5C8Y B;  4DV7 B;  1ZL8 B;  2AZ0 A;  3EHB B;  4TQD A;  2XAH A;  3L71 H;  4MT8 A;  3OUF A;  3LNM B;  2ZE7 A;  1VQ5 V;  2JEX A;  1DLB A;  2XAF A;  2OCH A;  2YIB A;  1URF A;  1XMO O;  1Z2G A;  2EBO A;  3AG3 C;  4U3F H;  3T4Z A;  2L6L A;  3CXH F;  2AGA A;  4DV3 B;  2W6I G;  4HZ3 A;  4BIU A;  2JS3 A;  3O65 A;  2AHZ A;  3CCV V;  4LFA O;  1E1R G;  4DR2 O;  1B6Q A;  1MNG A;  1TUB B;  1ZWI C;  2HLD G;  5B1A B;  4DV0 O;  1N0J A;  3UO2 A;  1QVF U;  4NTY A;  2LFR A;  1PNL A;  5KUK A;  4UVA A;  2RCV A;  3K08 A;  4JTD B;  2ZQM A;  2WWW A;  4LF7 O;  2QM4 A;  5EC2 C;  1P49 A;  2BCC H;  5B1N A;  3OT7 A;  2EIK B;  3R66 A;  1IXB A;  4IIJ B;  5LMN B;  1JJO A;  1V54 B;  3QO5 A;  1L0L H;  1WA8 B;  2R9I A;  4AQY B;  3D3I A;  3BCC H;  3CRA A;  1GM8 A;  4B3S B;  3ZN0 A;  2CAZ C;  1EZJ A;  4JYA B;  2HHH B;  1GH6 A;  4DV4 O;  4ABM A;  3U0Z A;  1P7B A;  2GSM B;  2GTA A;  3N27 A;  4DR3 B;  1K9M W;  3CEI A;  3K9A A;  2WLN A;  1GTO A;  2IJI A;  3KZI Z;  1OJH A;  5IJ0 B;  3TET A;  2XTA A;  1ZTE A;  1SQQ H;  1PL4 A;  1MSW D;  1ARO P;  2DWD C;  1GN6 A;  3ABM B;  5GON A;  5J2U A;  4IL6 Z;  4E4E A;  2EZP A;  3FYE B;  3A0B Z;  3JAT B;  1MAB G;  2LP7 A;  1SER A;  2YXH A;  4X64 O;  1XNR B;  3G6B A;  4LNU A;  1SQV H;  3IC9 A;  3D36 C;  1KYO F;  3J81 N;  3G6E V;  1FJG B;  2EIN B;  1VMG A;  2BTO A;  1NTZ H;  3CJH B;  1JR9 A;  2PY5 A;  1CEZ A;  4HYO A;  2XAG A;  1K4D C;  4LF4 O;  4X1I A;  2XUM A;  1WLE A;  4CH4 A;  2YXY A;  3ZMZ A;  2Q4P A;  4DYL A;  3LSU A;  4FLV A;  2RDC A;  1EN6 A;  2P22 C;  2GDS A;  2C2A A;  4K8X A;  4AI8 A;  1BE3 H;  1COW G;  1W2B U;  4O2B B;  4H37 A;  3IC7 A;  4RUE A;  5JH7 B;  3N2G A;  1I7F A;  3APQ A;  4BW5 A;  3RYF A;  2XHB A;  4X1Y B;  4ZIB A;  4DUY B;  4X9Q A;  4H13 B;  1SQB H;  1NR7 A;  5L3C A;  2UUA B;  4TV8 A;  2VRZ A;  5L3B A;  3ETE A;  2YI8 A;  1ORQ C;  1BQZ A;  3JD2 A;  3E8B A;  5LMN O;  1YZB A;  3SJA C;  1K97 A;  2UUB O;  3ABK C;  3C90 A;  5LHI A;  4O4H B;  3ASO C;  3E8F A;  2JGD A;  4O4L B;  1G4Y B;  4B3S O;  3RYC A;  3K58 A;  1FFT B;  3H1I H;  4A5U B;  2QA4 V;  3CWB H;  3QO7 A;  1FXV A;  1KP3 A;  3L72 H;  3T4D A;  3W7W A;  2WLI B;  2DJV A;  4QGP A;  4PV1 B;  1GMG A;  5E79 Z;  1HP8 A;  4NTX A;  4J9Z B;  2E75 B;  1XUQ A;  2WA4 A;  3JCU Z;  4WBN A;  2JIZ G;  1RM1 C;  1VQ9 V;  4TV9 A;  1D5N A;  1NKD A;  1QBZ A;  2LQT A;  3JCZ A;  2PGG A;  5IE9 A;  2F66 C;  1VQP V;  5LGT A;  3RGB A;  2HR3 A;  1XIL A;  4X66 O;  1SQG A;  4OGQ B;  2R9A A;  1R3K C;  2FYU H;  2ITC C;  2DQ3 A;  5B1B B;  2E5L O;  1Y76 A;  4JI5 O;  3JD4 A;  2BTQ A;  3FYI B;  3HB3 B;  2Q7E A;  3A0R A;  1NH2 C;  2DW4 A;  4MVZ A;  3GWK C;  1QLE C;  3H1K H;  4PA6 A;  3ZX6 A;  3JAW B;  3JAS A;  5B1O A;  4ZI7 A;  1MZF A;  3VQY A;  3VBB A;  4U7O A;  4GX5 A;  2P5O A;  3JSL A;  4YY3 B;  1SZT A;  2ZR2 A;  2XAS A;  5CB4 B;  4JZG A;  2BE3 A;  3OR6 C;  4JAS A;  1IXM A;  4XDJ A;  4PI0 A;  3BPZ A;  2PYJ A;  1WP7 A;  4X65 B;  3X2Q B;  2HVK C;  5B3S B;  1KC8 W;  4I4T A;  1YVW A;  1P84 F;  4UB6 Z;  3FB6 C;  5A9G A;  3OMA B;  2DE0 X;  2FL4 A;  2IJJ A;  5IT9 N;  4FFB B;  5B1A C;  1NU1 H;  5HFL A;  5D5P A;  1S5J A;  2N05 A;  5KHI A;  4GYC B;  4B3R B;  4H0L B;  4NYK A;  1T5E A;  2FTK A;  1YDX A;  1E79 G;  2ZM6 B;  1XBL A;  4LP8 A;  2UUC B;  1R6K A;  3OE7 G;  3E8H A;  1Y6X A;  1WN7 A;  4CC6 A;  1V54 C;  3WG7 C;  3KCY A;  4MS2 A;  4NXN B;  1JMK C;  2X7R B;  4DK1 A;  1YIJ V;  1M5I A;  1XNQ O;  1JQ0 A;  3B40 A;  2CK3 G;  5JJE B;  5LA6 B;  1PV0 A;  4I55 A;  1S76 D;  4CH6 A;  5KA5 A;  4UXN A;  1DF4 A;  1TGO A;  1XHX A;  2CTR A;  4K35 A;  4LR3 A;  1V55 B;  2E74 B;  3NXS A;  5KUM A;  3DGE A;  2BSK B;  3NR7 A;  2JVD A;  2X6B A;  4ZBM A;  4X89 A;  5CA0 B;  1BS3 A;  3UQ8 A;  1H38 A;  1B04 A;  2QWO B;  2ZDI C;  3ABM C;  2YEV A;  1HWY A;  5FL7 G;  5C8Y A;  4G2K A;  1ZL8 A;  1YEW A;  3GWO A;  2BOB C;  1HNX O;  2MW2 B;  4FMT A;  1I08 A;  3CP1 A;  3G80 A;  2JJ2 G;  2Q69 A;  1D5A A;  2ATK C;  2LW7 A;  2ADP A;  2KKW A;  3P3P A;  1G8M A;  4JI1 O;  4DR5 B;  3ZMU A;  3AG4 C;  5LHH A;  1SKV A;  1BT8 A;  2EIN C;  1WNS A;  1Y67 A;  2NR5 A;  1PNM A;  3RT3 C;  3C3S A;  3QTC A;  4RQF A;  4YIP A;  3FKS G;  3G71 V;  3CPW U;  1FXH A;  1TUB A;  3BA8 A;  3DC5 A;  4YY3 O;  3FX7 A;  2MK3 A;  3A2F A;  4CS3 A;  5IY5 C;  2YXL A;  2YDE A;  1FFX A;  1AI7 A;  1X59 A;  3AG2 B;  4Q20 A;  3RFR A;  4X65 O;  3ASN B;  4X62 B;  3CHX A;  2QWN B;  2EJ7 A;  3MDS A;  2R9R B;  1XQ8 A;  4DR7 B;  2RN9 A;  4D6T H;  2A79 B;  1WA8 A;  3ZHR A;  1MOF A;  3ZHT A;  4GLX A;  2VQE B;  1HNZ B;  4X1K A;  3LDC A;  4B3M B;  4JI6 O;  3GB7 C;  3ZED A;  1BGY H;  2OIG A;  1Z5V A;  4B3R O;  3ETD A;  4LFC B;  3OFN G;  5CA1 A;  4UUJ C;  1YF2 A;  2UUC O;  1RP3 B;  1DF5 A;  5IDJ A;  4DV5 O;  4YJ2 A;  4NXN O;  2Q5Z A;  2Z3Y A;  1IBK B;  5IJ0 A;  1S3J A;  3RYI A;  1HNW O;  3CCE V;  1QCE A;  2K1E A;  2D2C B;  2ZDI A;  2LGW A;  2DMX A;  3B8N A;  5K1P A;  4FM0 A;  4YHH B;  3JAT A;  1XOU A;  1EZV H;  2E3C A;  4DR4 O;  4CH5 A;  4LF6 B;  2PUS A;  4PHZ A;  5BR8 O;  2B1I A;  3K06 A;  3B8M A;  4GKJ O;  2EIJ B;  2WA3 A;  1U97 A;  1VQ7 V;  1FAF A;  4TUY B;  2ZXW B;  5LOV B;  3ABU A;  4I50 B;  1WP8 A;  2KG7 B;  4JI7 B;  1JX9 A;  2JK5 C;  5FNV B;  5EBM C;  1Y74 A;  4J80 A;  2UXB B;  4NVP A;  4UV8 A;  1YI2 V;  4UB8 Z;  2UXD B;  1BHA A;  1H8E G;  3B77 A;  3K03 A;  2A9H A;  5B1B C;  1H2G A;  4QPJ A;  4FLY A;  3SYP A;  3M8A A;  2OIE A;  5KLV H;  2QTS A;  3U11 A;  2D3O W;  4FLW A;  3ABL C;  3OEH G;  2XAJ A;  4ZOL B;  2Q67 A;  4MVR A;  2CGN A;  2IU3 A;  1AJN A;  1Q90 D;  2NN4 A;  4PJ0 Z;  4O2B A;  4ICG A;  3JAM N;  1AJP A;  5JH7 A;  3RW0 A;  4HNA B;  4I0X B;  2DYR B;  2ZE6 A;  4K8Z A;  4I5S A;  5EZY B;  1I94 B;  3CC2 V;  4JI4 O;  5FPR A;  1I0H A;  2EIM C;  4FFK A;  4OXS A;  3SPH A;  3MHH C;  2CUG A;  5KHK A;  4LF5 O;  5CBG A;  1O9G A;  1NTK H;  3X2Q C;  1OCR C;  5B3S C;  4WFE A;  3E22 B;  1NQT A;  2ZE5 A;  1F4M A;  1ZLZ A;  4K0K O;  2XND G;  2VQE O;  4OPA A;  1THZ A;  3ZN1 A;  4X8A A;  1HNZ O;  4O4H A;  4B3M O;  2DN9 A;  1FYJ A;  1DTO A;  4O4L A;  3RVZ A;  3PN1 A;  3KKY A;  3I55 V;  2QKS A;  4XDL A;  4J11 A;  2WLI A;  4UCR A;  3RBZ A;  5KA6 A;  4Q6G A;  4WFG A;  2Z5U A;  1EFR G;  3H1J H;  2UXN A;  3J7A U;  1F4N A;  1H2N A;  2RQ6 A;  3CE2 A;  3I56 V;  1IBK O;  1H2K A;  2HJF C;  5H6Q A;  1S77 D;  4X20 A;  4X88 A;  3K5N A;  1ZUQ A;  4JGS A;  2DWE C;  1PM9 A;  1M57 B;  2M7W A;  4YHH O;  4KXR A;  5IWA O;  4OX9 O;  1R3L C;  1Q6I A;  4MVU A;  4O4I B;  2ILM A;  3J80 N;  1SA0 B;  1GK9 A;  2CTP A;  1V55 C;  4LF6 O;  3T1C A;  4LFB B;  4NKG B;  4GT1 A;  2A0L A;  4IYH A;  1L8D A;  1FKA O;  3LDE A;  1QU7 A;  1N32 O;  3E2E A;  2UU9 B;  4BWA A;  2P4V A;  3JAW A;  4N23 A;  1OCC B;  1H2M A;  1MA1 A;  3ZRW B;  2F95 B;  4JTA B;  2UXD O;  1PL0 A;  2ZT9 B;  4P30 A;  1IUR A;  1YTF B;  2W0X A;  1Q7Y W;  5CB4 A;  4YJ3 B;  4IHJ B;  1SS3 A;  1VP7 A;  5IYB O;  4CC5 A;  4B3T B;  2XOK G;  3F7V C;  5IYD O;  4DV1 B;  4JPR A;  4LBE C;  4R6Z A;  2YID A;  4FIP C;  2V4D A;  1AB3 A;  4JI0 O;  1PP9 H;  4O4J B;  3F5T A;  3K57 A;  3OR7 C;  3RYH B;  3TXS A;  2FB5 A;  4MVS A;  1I94 O;  3P30 A;  1CPY A;  5E1A C;  2CTQ A;  4FFB A;  1WB8 A;  4KHP B;  3C3T A;  2ZD9 A;  4Z2W A;  2M6Y A;  3AG2 C;  4N21 A;  3T1Y B;  4MTO A;  4WFA V;  4UCT A;  3JAK A;  4LC1 A;  1GN3 A;  2Y48 A;  2RMK B;  4DV7 O;  4FLX A;  4XBF A;  3CCQ V;  2B9Z A;  4MVO A;  1FXK C;  2R72 A;  4MTG A;  4DRX B;  2UXX A;  4BW9 A;  5IYC O;  5BMV B;  1M4U A;  3APO A;  3QG5 A;  5KMG B;  3AG1 C;  1IZ3 A;  4J9Y B;  5LA6 A;  4DV3 O;  4GX1 A;  4RWU A;  1WPB A;  2FML A;  4JZ2 A;  1VQ8 V;  1UJW B;  2YSU B;  4LWS B;  1Q6H A;  2ETN A;  3FB8 C;  3W7T A;  5FLX N;  1FS0 G;  3K59 A;  4FLZ A;  2BSK A;  4DW0 A;  5CA0 A;  1QHT A;  2IH3 C;  3ZRV A;  2LW1 A;  1SQP H;  2WLL B;  4U3J B;  1K33 A;  2R70 A;  4QE7 A;  2QR4 A;  3QNE A;  3K0G A;  3E86 A;  1KKC A;  1AI6 A;  4AQY O;  4PDR A;  1RPO A;  5KX5 B;  3M7M X;  2OCC B;  4R8C A;  1PPJ H;  2H3O A;  3TCU A;  2OWO A;  5EIB D;  3B09 A;  3K5L A;  3N2K A;  2ZXW C;  3FAV B;  2UU9 O;  2BOC C;  3HKC B;  2YIA A;  3P32 A;  4JYA O;  2HHH O;  1R3I C;  1JPX A;  1NBM G;  4IYI A;  4DR3 O;  1SZX A;  3SPG A;  2Q8V A;  1Y66 A;  1IDS A;  3HKD B;  3CMA V;  1AVM A;  3OTO B;  1N34 B;  2N74 A;  4B7E A;  3ZMT A;  3LDD A;  2ZNJ A;  1R6T A;  1AP6 A;  4GKK B;  4DV2 B;  3H1H H;  3TK1 A;  1YJW V;  2WLM A;  4JI3 B;  4LF8 B;  1FXK A;  4NB5 A;  1IBM B;  1YIT V;  4WFH A;  2JRI A;  2HJD A;  1XNR O;  1IBL B;  2DYR C;  4J41 A;  2EZO A;  3T2M A;  2EIL C;  3H1L H;  3LSQ A;  4WF9 V;  1NR1 A;  3T1Y O;  1AP5 A;  1YJN V;  4F6R B;  1B06 A;  2JEU A;  2O57 A;  1FJG O;  1KEC A;  2CDY A;  1K34 A;  2YI9 A;  4RO2 A;  3STZ C;  2P67 A;  3L9D A;  1N36 B;  1SQF A;  5JCO A;  2VS0 A;  3CCS V;  2F1M A;  3CRQ A;  3RN4 A;  1YCI A;  5GW7 A;  5LYJ B;  2UXC B;  1Y4M A;  1JOY A;  5K1X A;  2RNB A;  5H6R A;  4W4K A;  5DM6 V;  1QLN A;  5IJ9 B;  3CRC A;  1NI8 A;  5KHJ A;  4B7K A;  1YXB A;  5EYP B;  3OEE G;  4BR6 A;  5BXZ A;  2WLK A;  2ZNI A;  1Q6U A;  4DR6 B;  1TUE B;  2NLJ C;  2JGU A;  1N33 B;  1AR4 A;  3JAL B;  1RPR A;  1TVK B;  3VQV A;  2XAQ A;  2ADQ B;  4DUY O;  4MTF A;  4TUY A;  2UUA O;  5LOV A;  1P7G A;  4I50 A;  1AR1 B;  2H94 A;  3HPL C;  1K8A W;  5FNV A;  5EBW C;  2ITD C;  1M57 C;  1OHH G;  1I5Y A;  5L3G A;  1AJQ A;  3WB1 A;  3AK1 A;  4F6E A;  2EIK C;  4NXM B;  5JJJ B;  1CP9 A;  3AG3 B;  1M9N A;  4KFM A;  1E1Q G;  1XI1 A;  5LBQ A;  3SDL A;  4DR1 B;  2Q0O C;  1VF6 C;  5D5Q A;  1RSO B;  3RVY A;  1VQN V;  3SPJ A;  1K92 A;  4HNA A;  4I0X A;  4X1I B;  5J2T A;  3CB2 A;  3OTO O;  5LGN A;  5EZY A;  3ETG A;  2QKA A;  4JV5 B;  3H01 A;  4WFF A;  1SC5 B;  3JD3 A;  4DV6 B;  2JDI G;  4JYB A;  4Z1V A;  4DV2 O;  1XRE A;  4CS4 A;  4CZZ A;  1OCZ B;  4JI3 O;  1OZ0 A;  1HDJ A;  4LF8 O;  1EM1 A;  3E22 A;  4HBN A;  3MAQ A;  2L35 A;  3EXA A;  1ZSP A;  4YIO A;  1N8R W;  1NVP B;  1JFF B;  3ZBH A;  1EBO A;  1ZAU A;  5FPO A;  2KQX A;  3STL C;  1VQM V;  2EX3 A;  1VQK V;  3A0H Z;  2ZKO A;  4LCU C;  4JI8 B;  1QR8 A;  5H2F Z;  1W59 A;  1L0N H;  3AEI A;  3ZS8 C;  5C93 A;  4J7K A;  1N36 O;  2WAM A;  2P7T C;  4J10 A;  1BQ0 A;  5LXT B;  2UXC O;  3THO A;  2P90 A;  4CH3 A;  5H9C A;  3E83 A;  4GCZ A;  3SPI A;  1BSM A;  1YSC A;  1W0K G;  2Q73 A;  5B5E Z;  1CXZ B;  3UKM A;  2HKO A;  4PEL A;  3BRC A;  1VQ6 V;  5LP6 B;  2AW9 A;  4O4I A;  5GTH Z;  4IIJ A;  1SA0 A;  3ZHV A;  4WBN B;  4TV9 B;  1W0J G;  2F23 A;  2V1D A;  1J5E B;  1NZ6 A;  2RJZ A;  1QNM A;  3OM3 B;  2HVJ C;  3K04 A;  2GTS A;  1OCO B;  1H2S B;  1SET A;  2P06 A;  3WFV A;  4UCV A;  2AHY A;  3ZHU A;  1VF6 A;  2JS5 A;  1VIB A;  2ZM6 O;  3ZRW A;  4EFB A;  1X4T A;  3JYC A;  4BAY A;  3FB5 C;  1NJI W;  3HKE B;  4MVM A;  4YJ3 A;  4IHJ A;  5EBL C;  4DW1 A;  4G27 B;  4ZHQ B;  4IT5 A;  4DXW A;  3JAR B;  1XMO B;  2OCC C;  1VF7 A;  4B08 A;  2LO1 A;  3ZCC A;  1RFY A;  3ZRX A;  4O4J A;  4LFA B;  1L1F A;  3RYH A;  4FM2 A;  4DR2 B;  2G38 A;  3DTU B;  1QQC A;  1ENV A;  3ZIA G;  1WJZ A;  2X6A A;  1ROP A;  4MVQ A;  1M1K W;  2GV9 A;  4FLU A;  4DV6 O;  1SES A;  1FPO A;  3T1H B;  5JQG B;  3W7X A;  4LF7 B;  5CMU A;  3K3W A;  1OV9 A;  5L3F A;  2CGO A;  3AK3 A;  3L75 H;  4JAA A;  2W0F C;  3CX5 F;  3CJH A;  4R7C A;  4DRX A;  2Q7G A;  3CD6 V;  3S3W A;  4EB6 B;  1HR0 B;  4QJF B;  5BMV A;  3HR0 A;  5KMG A;  1M56 B;  3O9O A;  3DXR B;  2IJH A;  2A3Q A;  5EIB C;  1MMM A;  2YIC A;  4DR5 O;  2QM8 A;  4CS2 A;  1SQX H;  2KB1 A;  1S5H C;  3HKB B;  2ODM A;  4LWS A;  4TT3 G;  1NTM H;  1LUV A;  1HW7 A;  2QTO A;  4MTX A;  4X1Y A;  3WB0 A;  3E8G A;  1GKF A;  3OTF A;  2Q9L A;  4BIO A;  2Y0I A;  3CCU V;  4J7J A;  1VQ4 V;  2WLJ A;  4X62 O;  3OGC C;  2QKC A;  4TWK A;  2WLL A;  3IGA C;  4U3J A;  3AG7 A;  3A8T A;  4DR7 O;  4FZ0 A;  3L70 H;  3TJT A;  4X64 B;  1V9P A;  1NH2 B;  4W4L A;  5KX5 A;  3ZJZ A;  2GUZ B;  3MHS C;  2B1G A;  3GVM A;  4RAI A;  5KHG A;  2QWP B;  1Q8I A;  3FAV A;  3CCM V;  4PDV A;  3HKC A;  1AI4 A;  4LFC O;  2HG5 C;  4JF3 A;  4D7S A;  1KU9 A;  1EN4 A;  3SJC C;  5B66 Z;  3SR2 C;  2F4V B;  1PD3 A;  3HKD A;  1BL8 A;  4LF4 B;  1YTF D;  5DED A;  1VF5 B;  4QNH B;  4UFZ A;  4DUZ B;  4H33 A;  1M93 A;  3CS5 A;  3ZHS A;  3Q4H B;  3CC7 V;  5L3D A;  1H2L A;  1J95 A;  3OGI B;  3SPC A;  4WFB V;  2ARH A;  1KUQ A;  1FFX B;  3L73 H;  5AG2 A;  3T1H O;  1US6 A;  1MZE A;  2YC0 A;  3BAB A;  2LJ2 A;  2B5U A;  4F6R A;  4O2A B;  4JI7 O;  1GN4 A;  5KAI Z;  1F23 A;  1TA8 A;  1XL4 A;  2W6J G;  2UXB O;  1UFI A;  1OCZ C;  3WG7 B;  5IYZ B;  3UT5 B;  2JJ1 G;  4NR1 A;  1XHZ A;  1BCC H;  1VEW A;  4F4L A;  2UUB B;  5LYJ A;  1HR0 O;  4X1K B;  3VQW A;  1YHQ V;  3SJB C;  5ITZ B;  1NVP C;  2WPD G;  5IJ9 A;  4PA3 A;  1NT2 B;  2EJR A;  5BZB A;  5EYP A;  2GBO A;  2P6J A;  5A2Q N;  1F7Y A;  5CA1 B;  3K5M A;  4JAU A;  1P4R A;  4PD4 F;  1WB7 A;  1KKD A;  4YJ2 B;  1B3Q A;  1IX9 A;  1ZX3 A;  3OMI B;  5JVD B;  4GUN A;  4PA4 A;  3P3N A;  3EFF K;  3JAL A;  1TVK A;  1PNK A;  3FB7 C;  5J9P C;  3RYI B;  3OUS A;  4X66 B;  1GRJ A;  4DK0 A;  4UCU A;  3CRR A;  1KP2 A;  1XL6 A;  3ASN C;  5TIS Z;  2PI4 A;  5LGU A;  5LP6 C;  3FFQ A;  2E5L B;  4JI5 B;  2DYS B;  1VAR A;  4BIZ A;  1GN2 A;  4FVM A;  1I5X A;  2QE7 G;  1LNQ A;  1OCO C;  3QO8 A;  1FD9 A;  3CSX A;  4MW8 A;  3DC6 A;  4JYC A;  3AG4 B;  3OW2 U;  3KCX A;  2WLH A;  3OMN B;  1Y74 B;  2CH7 B;  4PA7 A;  4JI2 B;  1RSO A;  4PDL A;  2GHY A;  2Y69 B;  2F4V O;  4EEQ A;  1UPG A;  5IY5 B;  4UV9 A;  5JCO C;  2IW5 A;  3SYA A;  2YIB D;  4J7Z A;  2Q7H A;  5CA3 A;  4DUZ O;  3B4S A;  1S72 V;  2LGQ A;  1XDC A;  3AK2 A;  3DSQ A;  4PA9 A;  3ZHQ A;  1JFF A;  4LFB O;  2AXT Z;  3QVN A;  2KSD A;  4LF9 B;  4GX2 A;  1H8H G;  5F2V O;  3ZMV A;  1Q5O A;  2EIJ C;  4RUF A;  4EFE A;  2WSS G;  1U96 A;  1SRY A;  3CRM A;  2K9P A;  1JVM A;  2HEP A;  3TXQ A;  2QM7 A;  3UCS C;  5LXT A;  3WU2 Z;  5CBH A;  3UO3 A;  3K5O A;  3BFR A;  3SYQ A;  1AIL A;  2V7Q G;  2ZE8 A;  4TQF A;  4B3T O;  1XNQ B;  2Q68 A;  4DV1 O;  1M56 C;  3BA9 A;  2EUL A;  3VOU A;  4FK5 C;  5LP6 A;  1BHB A;  2P4K A;  1K3E A;  2PZS A;  4UVB A;  3I5D A;  4QIW F;  3VQX A;  2PI5 A;  1AR5 A;  3CCL V;  3D36 A;  4LH7 A;  3SYC A;  4KHP O;  3FD9 A;  4X20 B;  2Y0P A;  3K9S A;  1QVG U;  3D3Q A;  2OT5 A;  4LH6 A;  1IVS A;  3IJ4 A;  4HAM A;  3SGI A;  4R50 A;  2F93 B;  1R6N A;  5CN0 A;  2OTJ V;  2IBZ H;  2NNU A;  2ZIM A;  5BY1 A;  5LHG A;  2PTM A;  3S3X A;  1HNX B;  3HKE A;  5LMU B;  3ABL B;  4ZHQ A;  4FJC C;  3JAR A;  2IU0 A;  4AHC A;  4JI1 B;  1VQO V;  4P9O A;  1XMQ B;  2XT9 A;  4I9W A;  2ZCE A;  1SF9 A;  1EN5 A;  1JJ2 U;  4JI2 O;  3L74 H;  3U10 A;  2YS8 A;  4FZ1 A;  1R1B A;  4FM1 A;  4UVC A;  2EIM B;  3SYO A;  2PF4 E;  5JQG A;  2CE4 A;  4PDM A;  1OCR B;  5GON B;  5J2U B;  3UM7 A;  4MSW C;  2KG7 A;  2YUA A;  1M90 W;  1BMF G;  2VQF B;  5H5N A;  2CTW A;  1K5S A;  3JSN A;  4P9P A;  3BEH A;  5DN6 G;  2Y4U A;  5DEC A;  1G1X B;  3BY6 A;  2OTL V;  1GO3 F;  5KHH A;  4KP4 A;  3CCR V;  1NVP D;  4EB6 A;  1PKX A;  4EKW A;  4LF9 O;  4FPP A;  4JI6 B;  1A32 A;  2HP8 A;  4LNU B;  1DK1 A;  2QDO A;  3DXR A;  4ZOL A;  3JD1 A;  3K79 A;  3JAK B;  1QR9 A;  3SJQ C;  1KQS U;  1LUW A;  3R65 A;  4XDK A;  3HKB A;  1OCC C;  4DV5 B;  4CBC A;  3E35 A;  4L87 A;  1N34 O;  2VWJ A;  4P2Z A;  5CBF A;  1K7D A;  2QWR B;  2F43 G;  1YTF C;  1WAZ A;  1JA8 A;  1JCH A;  1KMI Z;  2QWQ B;  1HNW B;  3MD0 A;  4GKK O;  3IFX A;  1IBM O;  3N2G B;  3W7U A;  3RYF B;  3ETQ A;  4DR4 B;  1IBL O;  3CC4 V;  2FKX A;  5BR8 B;  4GKJ B;  2GUZ A;  3G4S V;  4TV8 B;  1D2D A;  2ZIN A;  2DQ0 A;  4KL1 A;  3CME V;  1R73 A;  3B2E E;  2DOS A;  2LFS A;  2HFE C;  1GM9 A;  4E2L A;  4U7N A;  2DYS C;  2A06 H;  2JGD B;  5LMU O;  3G67 A;  3RYC B;  5JWP A;  2N04 A;  3M99 B;  3N2K B;  4RQE A;  3CCJ V;  1XMQ O;  1MSD A;  4MW3 A;  1Q81 W;  1N4C A;  1S0V A;  2A7W A;  4JTC B;  3F7Y C;  3Q4H A;  1S5L Z;  4TOI A;  4DR6 O;  4GX0 A;  3CXC U;  1N33 O;  2OYQ A;  2QJ1 A;  2Y69 C;  4QPK A;  5LL6 Y;  3LNN A;  1BZK A;  3KG2 A;  4JI4 B;  1WPX A;  2H8P C;  5EC1 C;  4LF5 B;  2X0L A;  4WCE V;  4L8J A;  4O2A A;  1R3J C;  5KAF Z;  2VQF O;  2ZR3 A;  1VQL V;  1FXK B;  5IYZ A;  1Q3E A;  3QF7 A;  3UT5 A;  3ZMS A;  1Q82 W;  1Y76 B;  3TGU H;  4K0K B;  4NXM O;  2BTQ B;  3H9V A;  3BAA A;  4UCO A;  5ITZ A;  3AG1 B;  3WB2 A;  3OD4 A;  3K0D A;  2VWK A;  3IAY A;  3JAS B;  1Z5W A;  4DR1 O;  4ZI7 B;  3W7S A;  3ABT A;  2Q0A A;  2QGN A;  1MG1 A;  2E76 B;  5GTI Z;  2QEX V;  5JVD A;  4TSF G;  3PJS K;  4G28 B;  4DV0 B;  2AZ2 A;  1KD1 W;  4JV5 O;  1O9H A;  5HFM A;  5IWA B;  4OX9 B;  1Q86 W;  4NTW A;  1DGS A;  1K4C C;  4I4T B;  3ICX A;  3ABK B;  4ASU G;  3ASO B;  4IGG A;  3LSS A;  1NH2 D;  1AI5 A;  2IJK A;  3E89 A;  1YJ9 V;  4I7Z B;  4D7T A;  2Y4T A;  1N32 B;  2IM9 A;  1Q43 A;  4Z1M G;  4JI8 O;  4PI2 A;  4QE9 A;  2CH7 A;  1GM7 A;  2Z0A A;  3BVO A;  4DV4 B;  5L3E A;  2Q6A A;  1RM1 B;  5JJN B;  3F5W C;  4K3A A;  4ZKI A;  3ML0 A;  4GZR B;  4I9Q A;  4FLT A;  3RWR D;  2PYL A;  1KBH A;  2X6C A;  2IH1 C;  5EK0 A;  3JD0 A;  4H44 B;  1K5Q A;  2ZIO A;  4KUM A;  4JYY A;  1N0N A;  1LR1 A;  1NS1 A;  3ZRS A;  4I55 B;  1GAX A;  3D8C A;  4JI0 B;  3LUT B;  1G6U A;  4YXW G;  4OPH A;  5J2T B;  1J5E O;  2EIL B;  2QSA A;  1XEQ A; 
#chains in the Genus database with same CATH homology
 1I5X A;  3OAA G;  4DO2 A;  5H6R A;  5IY5 C;  2QE7 G;  1AI7 A;  5DM6 V;  1QLN A;  1LNQ A;  1OCO C;  3AG2 B;  3QO8 A;  4Q20 A;  4MW8 A;  1QLE B;  1K73 W;  4JYC A;  3AG4 B;  3OW2 U;  2WLH A;  3CYO A;  3OMN B;  3ASN B;  3OEE G;  1F51 A;  2WLK A;  4PA7 A;  4JAV A;  2R9R B;  2YEV B;  1TUE B;  4PDL A;  2GHY A;  2NLJ C;  2Y69 B;  3EHB B;  2XAH A;  2A79 B;  1MOF A;  4MT8 A;  3OUF A;  3LNM B;  5IY5 B;  1VQ5 V;  1RPR A;  4UV9 A;  2IW5 A;  2JEX A;  3SYA A;  1DLB A;  2XAQ A;  2XAF A;  3LDC A;  4MTF A;  3GB7 C;  5CA3 A;  1S72 V;  2EBO A;  3AG3 C;  3T4Z A;  1AR1 B;  2H94 A;  3HPL C;  1K8A W;  3ETD A;  2W6I G;  3OFN G;  4HZ3 A;  5EBW C;  4BIU A;  4UUJ C;  2ITD C;  1M57 C;  2AHZ A;  1OHH G;  1DF5 A;  1I5Y A;  3CCV V;  5L3G A;  1AJQ A;  5IDJ A;  1E1R G;  4PA9 A;  2EIK C;  1B6Q A;  1ZWI C;  2HLD G;  5B1A B;  1CP9 A;  2Z3Y A;  3AG3 B;  4GX2 A;  1H8H G;  1M9N A;  1QVF U;  4KFM A;  2LFR A;  3ZMV A;  1PNL A;  1E1Q G;  1S3J A;  4UVA A;  5KUK A;  3K08 A;  2EIJ C;  4RUF A;  4JTD B;  2ZQM A;  2WWW A;  5LBQ A;  1QCE A;  2K1E A;  3CCE V;  5EC2 C;  2ZDI A;  2WSS G;  3B8N A;  5B1N A;  1SRY A;  2EIK B;  1V54 B;  1JVM A;  3QO5 A;  3RVY A;  1VQN V;  3SPJ A;  1K92 A;  2QM7 A;  5CBH A;  2R9I A;  5LGN A;  3D3I A;  2B1I A;  3K06 A;  3B8M A;  3ETG A;  3SYQ A;  2EIJ B;  1GM8 A;  1VQ7 V;  3H01 A;  2ZXW B;  2V7Q G;  4WFF A;  3ABU A;  3ZN0 A;  3JD3 A;  2Q68 A;  2JDI G;  1M56 C;  1EZJ A;  4JYB A;  1JX9 A;  2JK5 C;  4CZZ A;  5EBM C;  1OCZ B;  3VOU A;  1OZ0 A;  1P7B A;  4FK5 C;  2GSM B;  1BHB A;  4UV8 A;  1K9M W;  1YI2 V;  1K3E A;  3K9A A;  2WLN A;  1GTO A;  1H8E G;  2IJI A;  2A9H A;  3B77 A;  1H2G A;  3K03 A;  5B1B C;  4UVB A;  4QIW F;  4QPJ A;  1N8R W;  1NVP B;  2PI5 A;  3SYP A;  3CCL V;  3D36 A;  1EBO A;  1VQM V;  3STL C;  3SYC A;  1VQK V;  2D3O W;  3TET A;  3ABL C;  3OEH G;  2XAJ A;  4MVR A;  2Q67 A;  1QVG U;  1ARO P;  4LCU C;  1MSW D;  2OT5 A;  2DWD C;  1QR8 A;  2IU3 A;  3ABM B;  4HAM A;  1AJN A;  4R50 A;  3AEI A;  2EZP A;  3FYE B;  5C93 A;  1R6N A;  5CN0 A;  2WAM A;  1AJP A;  1MAB G;  2P7T C;  2LP7 A;  2OTJ V;  2NNU A;  1SER A;  3RW0 A;  2DYR B;  5LHG A;  2P90 A;  5H9C A;  4I5S A;  3E83 A;  3CC2 V;  4GCZ A;  3ABL B;  3SPI A;  4FJC C;  2EIM C;  1YSC A;  1W0K G;  4OXS A;  3SPH A;  2IU0 A;  3MHH C;  3UKM A;  5CBG A;  1VQO V;  2HKO A;  4PEL A;  4P9O A;  3G6E V;  1VQ6 V;  4I9W A;  2EIN B;  3X2Q C;  1OCR C;  1JJ2 U;  5B3S C;  4WFE A;  1NQT A;  1CEZ A;  4HYO A;  1F4M A;  1W0J G;  2V1D A;  2XAG A;  2XND G;  2EIL B;  1K4D C;  1THZ A;  3ZN1 A;  4X8A A;  1WLE A;  2HVJ C;  3K04 A;  3OM3 B;  4UVC A;  1DTO A;  3RVZ A;  3ZMZ A;  2EIM B;  1OCO B;  3I55 V;  2QKS A;  3SYO A;  4XDL A;  1SET A;  3WFV A;  2AHY A;  2WLI A;  4PDM A;  1OCR B;  3RBZ A;  2C2A A;  5KA6 A;  3UM7 A;  4MSW C;  4WFG A;  1M90 W;  1BMF G;  1COW G;  1W2B U;  4H37 A;  2Z5U A;  1EFR G;  1K5S A;  3IC7 A;  4P9P A;  3BEH A;  3ZRW A;  2UXN A;  5DN6 G;  4RUE A;  3BY6 A;  2OTL V;  3JYC A;  4BAY A;  4BW5 A;  1GO3 F;  3CCR V;  1F4N A;  4KP4 A;  1NVP D;  3FB5 C;  1NJI W;  1PKX A;  4EKW A;  4FPP A;  3I56 V;  4MVM A;  5EBL C;  4G27 B;  1NR7 A;  2HJF C;  4DXW A;  5L3C A;  2OCC C;  5H6Q A;  1S77 D;  4X88 A;  3ZCC A;  5L3B A;  3JD1 A;  4JGS A;  2DWE C;  3ETE A;  1M57 B;  1ORQ C;  3K79 A;  2M7W A;  3ZRX A;  1QR9 A;  3SJQ C;  1KQS U;  1R3L C;  3JD2 A;  3E8B A;  3R65 A;  4MVU A;  4XDK A;  1L1F A;  1OCC C;  1GK9 A;  3DTU B;  1K97 A;  3ZIA G;  1ENV A;  1V55 C;  4CBC A;  3E35 A;  3ABK C;  4L87 A;  5LHI A;  3T1C A;  3ASO C;  3E8F A;  2X6A A;  4P2Z A;  5CBF A;  1K7D A;  1ROP A;  1G4Y B;  2F43 G;  4GT1 A;  4MVQ A;  1YTF C;  2A0L A;  1M1K W;  1FFT B;  1JCH A;  3LDE A;  1SES A;  2QA4 V;  3QO7 A;  1FXV A;  1KP3 A;  3T4D A;  3W7X A;  3MD0 A;  2WLI B;  3W7W A;  5CMU A;  3E2E A;  3K3W A;  1GMG A;  4N23 A;  5L3F A;  1OCC B;  4J9Z B;  2W0F C;  3IFX A;  3ZRW B;  4JTA B;  4R7C A;  1PL0 A;  3W7U A;  2JIZ G;  1RM1 C;  1VQ9 V;  4P30 A;  3CD6 V;  1NKD A;  1QBZ A;  1YTF B;  3JCZ A;  1Q7Y W;  3CC4 V;  4QJF B;  1VQP V;  5LGT A;  5IYB O;  3G4S V;  2HR3 A;  1M56 B;  2XOK G;  3F7V C;  5IYD O;  4JPR A;  4LBE C;  1R3K C;  2IJH A;  4FIP C;  4R6Z A;  2DQ0 A;  2QM8 A;  3CME V;  1R73 A;  2ITC C;  2DQ3 A;  2KB1 A;  5B1B B;  1S5H C;  2HFE C;  2LFS A;  3OR7 C;  1GM9 A;  4E2L A;  4U7N A;  3JD4 A;  4TT3 G;  3FYI B;  2DYS C;  2QTO A;  4MTX A;  4MVS A;  3P30 A;  3E8G A;  1CPY A;  5E1A C;  3HB3 B;  1GKF A;  3A0R A;  1NH2 C;  2ZD9 A;  3M99 B;  4RQE A;  2DW4 A;  4MVZ A;  3AG2 C;  3CCJ V;  4N21 A;  3CCU V;  1VQ4 V;  1QLE C;  4PA6 A;  2WLJ A;  4MTO A;  5B1O A;  3OGC C;  4MW3 A;  4TWK A;  4WFA V;  2WLL A;  3IGA C;  1Q81 W;  1S0V A;  4JTC B;  3F7Y C;  3VBB A;  4LC1 A;  2Y48 A;  4GX0 A;  4XBF A;  3CCQ V;  3CXC U;  4MVO A;  1FXK C;  4U7O A;  4MTG A;  2Y69 C;  4QPK A;  4GX5 A;  2UXX A;  1NH2 B;  3KG2 A;  1SZT A;  5IYC O;  2ZR2 A;  2XAS A;  3ZJZ A;  3MHS C;  3OR6 C;  4JAS A;  1IXM A;  2B1G A;  1WPX A;  2H8P C;  3AG1 C;  4XDJ A;  4RAI A;  5EC1 C;  2X0L A;  4J9Y B;  4WCE V;  3CCM V;  4PDV A;  3X2Q B;  1R3J C;  1AI4 A;  4GX1 A;  2HVK C;  2HG5 C;  5B3S B;  2ZR3 A;  4JF3 A;  1VQL V;  1FXK B;  1KC8 W;  1VQ8 V;  1UJW B;  2YSU B;  3ZMS A;  1Q82 W;  3FB8 C;  3FB6 C;  3W7T A;  1PD3 A;  1FS0 G;  3OMA B;  1BL8 A;  1YTF D;  4QNH B;  2IJJ A;  3AG1 B;  5B1A C;  5HFL A;  3K0D A;  2IH3 C;  4H33 A;  3ZRV A;  2WLL B;  3W7S A;  2FTK A;  3ABT A;  1K33 A;  3CC7 V;  1E79 G;  5L3D A;  1MG1 A;  4LP8 A;  1J95 A;  3SPC A;  4WFB V;  4QE7 A;  1R6K A;  3OE7 G;  3E8H A;  3QNE A;  2QEX V;  3K0G A;  3E86 A;  1V54 C;  3WG7 C;  4MS2 A;  2X7R B;  4TSF G;  3PJS K;  4G28 B;  1AI6 A;  4PDR A;  1RPO A;  2OCC B;  4R8C A;  1KD1 W;  3TCU A;  1YIJ V;  1JQ0 A;  2ZXW C;  2CK3 G;  2B5U A;  1S76 D;  2BOC C;  5HFM A;  3P32 A;  5KA5 A;  1R3I C;  4UXN A;  1F23 A;  1XL4 A;  2W6J G;  1DF4 A;  1JPX A;  1NBM G;  1Q86 W;  1OCZ C;  3WG7 B;  1K4C C;  2JJ1 G;  3SPG A;  1V55 B;  3NXS A;  1Y66 A;  5KUM A;  3ABK B;  4ASU G;  3ASO B;  4F4L A;  3CMA V;  3DGE A;  3LSS A;  1NH2 D;  1AI5 A;  1YHQ V;  2X6B A;  2IJK A;  3E89 A;  3ZMT A;  1NVP C;  2WPD G;  4ZBM A;  4X89 A;  1YJ9 V;  4PA3 A;  3LDD A;  1H38 A;  2EJR A;  5BZB A;  4Z1M G;  2P6J A;  4QE9 A;  1GM7 A;  4JAU A;  2ZDI C;  1P4R A;  3ABM C;  3TK1 A;  1YJW V;  2WLM A;  1FXK A;  2YEV A;  5L3E A;  1HWY A;  5FL7 G;  1KKD A;  2Q6A A;  1RM1 B;  4G2K A;  3F5W C;  1YIT V;  3OMI B;  4WFH A;  4ZKI A;  4PA4 A;  3ML0 A;  3EFF K;  3GWO A;  2BOB C;  1PNK A;  2DYR C;  4FMT A;  3CP1 A;  2EZO A;  3FB7 C;  2X6C A;  2IH1 C;  5EK0 A;  2JJ2 G;  5J9P C;  3JD0 A;  2Q69 A;  3T2M A;  1K5Q A;  2EIL C;  4KUM A;  2ATK C;  3LSQ A;  4WF9 V;  3OUS A;  3ZRS A;  1NR1 A;  1G8M A;  1YJN V;  1BHA A;  3ZMU A;  2JEU A;  3AG4 C;  5LHH A;  1KEC A;  3LUT B;  1K34 A;  1KP2 A;  4RO2 A;  1XL6 A;  3ASN C;  3STZ C;  2PI4 A;  2EIN C;  2P67 A;  1PNM A;  5LGU A;  4YXW G;  4RQF A;  3FKS G;  2DYS B;  3G71 V;  3CCS V;  4BIZ A;  3CPW U;  1FXH A;  5GW7 A;  1Y4M A;  1JOY A;  2MK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...