1RM1B

Structure of a yeast tfiia/tbp/tata-box dna complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
117
structure length
101
Chain Sequence
b'PGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEVISVDKLRIVACNSKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*TP*CP*GP*AP*TP*CP*GP*AP*TP*AP*TP*AP*AP*AP*AP*CP*G)-
molecule tags Transcription/dna
source organism Saccharomyces cerevisiae
publication title High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
rcsb
total genus 23
structure length 101
sequence length 117
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
B PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1rm1B01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1rm1B02
5IYCO 1NH2D 1NVPC 1RM1B 1YTFD 5IYDO 1RM1C 1NVPD 5IYBO 1YTFC 1NH2C
chains in the Genus database with same CATH superfamily
4YJ3B 1BSMA 3CRRA 1N32B 2P5OA 1N33O 5EBMC 4NXNO 4IL6Z 1NVPC 5KHHA 4O4IB 4H44B 2CH7B 4NR1A 3ASNB 2Q69A 5E79Z 2O57A 3QG5A 3SGIA 4K0KB 3K5OA 4MVOA 4DUYB 3F7VC 2G38A 5LHHA 5B1BB 4UUJC 5FNVB 2YXYA 3G4SV 2EIJB 2Q73A 1WLEA 4J7ZA 2X6BA 4J7KA 4CS3A 4X89A 1ZUQA 4JI4O 4ZI7B 3UT5A 3LSUA 1TVKA 5C93A 3ZS8C 4DR4O 1QQCA 2NNUA 1K73W 3ZHRA 3GWOA 4QE7A 5KAIZ 2WLKA 4ABMA 1HP8A 1R1BA 2RJZA 2CDYA 1VIBA 4JAUA 3RYFB 3ZMZA 1R73A 4FJCC 4CBCA 3LNNA 4D6TH 1DF4A 3ETDA 3ML0A 4HNAA 3X2QC 5C8YB 3JATB 1Y74B 3LNMB 3L71H 4O4JA 2N05A 1S77D 3D3QA 4JI1O 3UO2A 5KUKA 3AK2A 4OGQB 3JAWA 4TUYB 1XHZA 4ZOLB 1W0JG 3ZMTA 1VQ5V 2YIBA 1JPXA 2BE3A 1GN2A 3OEHG 1L1FA 4B3MO 2B1GA 3W7XA 1OCRC 4OXSA 3S3WA 1BQ0A 2HJFC 2Q67A 3PJSK 1NJIW 1EN4A 1N34B 1K3EA 1M90W 4PV1B 2UUAO 2CGOA 3MDSA 3OTFA 1XILA 4LFCO 4NXMO 3CXCU 4JTDB 3SPCA 5CA0B 2W6IG 1VF6C 1IBLB 4LF6O 4BAYA 3X2QB 2A0LA 4R8CA 1NR7A 4RQEA 4QPJA 2DYRC 3F5WC 3JCUZ 4DW1A 1COWG 1P7BA 1OZ0A 3CCQV 4JI5B 2JEXA 4MTOA 2HJDA 5KMGB 1BS3A 3SJCC 3ZMSA 4P9OA 2DN9A 4BW9A 2UXXA 4KL1A 4GT1A 3LSSA 5JJNB 2KQXA 4LFBO 5L3GA 3K06A 3I5DA 4QPKA 2B5UA 3EXAA 1KQSU 1V9PA 1GN3A 4DR7O 3BEHA 2L6LA 2BTQA 3SPJA 1PPJH 4DR2O 4FK5C 3M99B 2YXLA 1ZSPA 5JJEB 4X65B 4B3SO 1I94O 1MA1A 3ABLB 4FMTA 1FS0G 4J42A 3WFVA 4DYLA 5J9PC 1R6NA 1XMOO 3OMIB 2HP8A 1JMKC 1XI1A 4LH6A 4X88A 2DJVA 1L0NH 3N2KB 4TUYA 2QWPB 1R3KC 1FFXA 1HR0B 1F7YA 1XMOB 1KUQA 3KKYA 3SR2C 1K92A 5B1AC 3CHXA 1WNSA 4MS2A 1J95A 1OV9A 3KCXA 1I94B 1X59A 3IC7A 2XAJA 5LGNA 2Q7EA 1K5SA 1WAZA 3D36C 2N04A 5LMNO 4CZZA 5KHKA 4DR2B 2NR5A 3SDLA 2LW7A 2JJ2G 1K8AW 1M9NA 1KP2A 1H2KA 4DR7B 1J5EB 1T5EA 1VQOV 5LL6Y 1RPRA 4MTXA 3ZN1A 5GTIZ 2PZSA 1IBMO 1G1XB 1SERA 2ZKOA 1V55C 4TV8B 4JI3B 2C2AA 4UV8A 4LFBB 2R9AA 2RCVA 1ENVA 2ZT9B 4JZ2A 4O2AB 1S3JA 3QF7A 1G6UA 1AI6A 3CRQA 3CPWU 2E5LB 1YTFC 2RN9A 2ZDIC 5GONB 2R9IA 3JALA 4XBFA 4G27B 1MABG 4DV3O 5LMUB 1FXVA 2IM9A 2A79B 5EYPB 3CC4V 3AK1A 1Z2GA 4YIPA 5EIBD 3OGCC 3CXHF 3JCZA 2R72A 4GLXA 2JJ1G 4ZHQA 3ICXA 4FM1A 3SPHA 3ZRXA 1JX9A 1MZEA 2UUAB 4IHJA 2PYLA 3FKSG 3GB7C 3WU2Z 1D5AA 1NH2B 1H8EG 2WPDG 2V7QG 1NQTA 1EM1A 2JGDA 4RAIA 3HR0A 4UVBA 1ZTEA 2YEVB 3KCYA 4WFBV 4TT3G 4BR6A 4X1YB 4I0XB 1HNXB 3IGAC 2UU9B 4J9YB 3CS5A 3CCRV 2WLMA 2E74B 3ZRWA 1QHTA 4ZKIA 5KUMA 3M8AA 1QCEA 1FJGO 1THZA 3AG3B 1IBKB 4Z1MG 2WLNA 2ZD9A 2ZE7A 4JYYA 2GTAA 2WA3A 4X65O 5A9GA 3RWRD 2UXNA 1FD9A 2EINB 3ETQA 3N27A 1NVPD 1QVFU 1TUEB 5B1NA 3RVYA 2YUAA 5H6RA 5KX5A 3A0BZ 1Q43A 3QNEA 5H2FZ 4I55A 4J10A 1KB9F 4OPHA 5KHIA 1VQKV 2K9PA 2MW2B 3LDCA 1XNRB 3T4DA 1NVPB 3CJHB 3JARA 4ZI7A 1AI7A 4DV0B 3G6EV 4BIOA 1BMFG 5EZYA 3K9SA 4NKGB 1SQXH 2IH1C 2PI4A 5CN0A 1MMMA 4L87A 4DR3B 3B40A 1GO3F 5CBFA 1GN6A 1FKAO 5JCOA 2AHYA 3T1YB 1VQ8V 4MVUA 2HR3A 3CSXA 2EJ7A 4UCVA 1H2GA 1XNQO 1N33B 4JYAO 4JYAB 3OAAG 1SF9A 3I55V 4LF9O 1K4CC 2XAFA 5KLVH 1Q7YW 1N0NA 1NT2B 4B7EA 4IIJB 1LUWA 3OEEG 4JYCA 1HNZB 2Q68A 4RUFA 3ASOB 1N34O 2EIMC 4JASA 1KU9A 1BCCH 2LFRA 1CEZA 5B66Z 4DV0O 2P4KA 3E22A 2ATKC 3C3TA 2QDOA 2FL4A 3QO7A 4CH4A 2P7TC 5KHJA 4QIWF 3ZIAG 3OD4A 1VF6A 4DK1A 1XL4A 3ASOC 3I56V 4FLZA 4GKJO 2ADPA 1SC5B 4MVRA 2WLIB 2M7WA 2YXHA 2VQFB 4JI8B 2DOSA 4AHCA 3OFNG 3K59A 5KMGA 1V54B 4LF5O 2DYRB 4X62O 4X62B 3JD1A 1Q6IA 3CMEV 1Q6HA 3RVZA 1YTFB 1YVWA 1NKDA 5JJJB 1NZ6A 1FJGB 4PA9A 2GUZB 2VQFO 4JI8O 3RFRA 5IWAB 3TCUA 3ETEA 2B9ZA 3AG1C 4ICGA 4ZBMA 5IYZA 3J80N 4JI4B 3E22B 1AP6A 1OHHG 1QLEB 2CTWA 2YI8A 5FPOA 3KG2A 3E86A 5LGUA 1ROPA 3SYOA 2PF4E 1FXKB 1E1QG 3AG2C 1H2LA 1XHXA 4BIUA 1L0LH 1URFA 3JSLA 1Y76A 2AHZA 5LYJB 2HKOA 2DWEC 2F43G 5L3EA 4LH7A 2PI5A 4X66B 1VQ7V 4R6ZA 3ZHQA 4FFBA 4TOIA 5FL7G 3ZJZA 2P06A 4Z1VA 3K04A 3UQ8A 1VARA 4WCEV 1YI2V 4NXNB 2ZINA 2ZQMA 3H1HH 4MW8A 3G67A 1Z5WA 3W7UA 2P67A 3T1YO 2UXCB 2AXTZ 3HB3B 1XDCA 4DV2B 4YIOA 2CE4A 1AR5A 3F5TA 4UCUA 3H1KH 4JV5B 5LBQA 4O4HB 4ZHQB 4UB6Z 4UCSA 1SS3A 3APOA 4DV6B 2DWDC 5L3FA 5CA3A 1H8HG 3OUFA 2FB5A 1RM1C 1XBLA 1IBMB 1EFRG 1SQQH 1HWYA 3PN1A 5H6QA 4JI0B 4J41A 1Q81W 4LBEC 1JCHA 4WFEA 5J2UA 1LNQA 1M57B 3W7WA 2LGWA 5LA6A 2Y4UA 1GN4A 3N2GB 4OPAA 3OM3B 3CX5F 3E83A 1YITV 5HFMA 5HFLA 4C7UA 3ZRWB 1SQVH 1P7GA 2Y0IA 3HKEB 2A7WA 4DV1B 2VRZA 1VQ9V 3AG4B 3DC6A 4Q20A 4ASUG 4K8XA 1YDXA 3FYIB 4JYBA 2GHYA 2EJRA 3A0HZ 3H1JH 2PGGA 1PKXA 4AI8A 1SA0B 4HZ3A 3RYCB 2Q4PA 2H94A 1PNLA 3K08A 5CBHA 4X1KB 1VMGA 2ZCEA 3OR7C 2KKWA 2Q7HA 2UXDO 3B4SA 1CPYA 4NTWA 5KA6A 4LF4B 2L35A 5EK0A 2ZM6O 1QLEC 1K9MW 1H2SB 5IJ9B 1ZLZA 1NBMG 3GWKC 3AG1B 1US6A 3H1LH 2V1DA 2BCCH 1M5IA 2XNDG 3JAKA 3OW2U 2HVKC 4L8JA 1IXBA 1V55B 2QWOB 2QWRB 2LJ2A 4IT5A 1MZFA 4PA4A 2HHHB 1VP7A 4P9PA 1N8RW 4PD4F 3UKMA 1DK1A 5BMVB 2IU0A 1R3JC 2ZE6A 5TISZ 2F23A 3CMAV 3SJAC 4O4LB 5L3CA 4GX1A 4XDKA 1QLNA 2BTOA 2E5LO 2ARHA 3UO3A 5IJ9A 5BR8O 5BR8B 5L3BA 2H8PC 4K3AA 3VQVA 2M6YA 1DF5A 4I4TB 4X20B 4PDMA 2BOCC 3E8BA 4RUEA 2JIZG 2FKXA 1V54C 1RSOB 2ZIOA 2QEXV 2W0XA 2F66C 4FLTA 3WB0A 3OGIB 3BA9A 1OCRB 3BFRA 3ABMC 4U7NA 5CB4A 3RGBA 4JPRA 3ZX6A 4X66O 3T1HO 3MAQA 5LMNB 1S72V 3P3PA 2ITDC 4ZOLA 4QE9A 3LDEA 5J2TA 1M57C 5CB4B 3O65A 1M56B 3AG4C 4G2KA 4I50B 4PA7A 4CH6A 2YICA 3JYCA 4JF3A 1FXKC 1NH2C 4TV8A 2BOBC 1HR0O 3B2EE 1LUVA 1P4RA 3HKCA 4J80A 5A2QN 4O2AA 5KX5B 1IXMA 2AZ0A 2QR4A 5JH7B 1YHQV 2Y4TA 2ZIMA 3K3WA 5IYZB 4X9QA 2Q0OC 1U96A 3ZHUA 1VF5B 4JI2B 4X1KA 4UVCA 4FM0A 2Y0PA 2EZOA 1OJHA 1RP3B 2YC0A 1MNGA 5F2VO 2E75B 3SYCA 4I50A 2W6JG 1PNMA 1WN7A 2YSUB 3RYIA 1AR1B 4TSFG 3ZHSA 4GKJB 3EVKA 2LW1A 5EYPA 3CC7V 4KP4A 5B3SC 1PM9A 3ZCCA 1VQMV 2F95B 3VOUA 3N2KA 1HNWB 2X6AA 4W4KA 1M1KW 4U3JB 3VQXA 4PDLA 2DMXA 2ZR2A 1DLBA 1KP3A 3EHBB 4DV6O 4DV4B 4I7ZB 1XOUA 4JV5O 4DUYO 4JAAA 4K0KO 2XUMA 2ADQB 4D7SA 3RYFA 1D5NA 2UXCO 1OCZB 3JAMN 1L8DA 2QA4V 4FIPC 2RDCA 1BQZA 4LF9B 4O4HA 4JI5O 1FPOA 1R6KA 3JASA 4B3RO 4EFBA 1GAXA 1AVMA 5IJ0A 5H9CA 4LF6B 4Z2WA 1I7FA 3L75H 1OCCC 1S5LZ 4LFCB 2QTSA 1P49A 4DR3O 2NLJC 2ZE5A 1XREA 5LP6A 3E8FA 1BHBA 2LGQA 2IJIA 2A3QA 3E2EA 1YEWA 4UXNA 2ZR3A 3B8MA 1B3QA 3QVNA 1Q82W 4CH3A 2EIJC 1HNWO 5IYBO 3L72H 5BY1A 1QNMA 3CE2A 3EFFK 3VQWA 2DE0X 2UUCO 1FFXB 2Z5UA 1K97A 5IJ0B 4GKKO 3N2GA 3RYHA 5EZYB 4J7JA 4YY3B 1EN6A 2HG5C 1F23A 5CA0A 4UCOA 3VBBA 4JI1B 1B04A 1GM7A 4QGPA 3MHSC 5DECA 4UV9A 2ILMA 3H9VA 3E8GA 1M56C 1VQLV 3K0GA 3T2MA 4DR1B 1VQ6V 3BVOA 3HKDB 4JI2O 4LF5B 4DR1O 4MTFA 4UCTA 1N36B 1WA8B 2KG7B 1TUBB 1NI8A 1YZBA 2H3OA 3AG7A 2XAHA 4FLUA 5B1OA 3CYOA 2A9HA 5EBLC 2VWKA 2IJJA 5IYDO 4GX5A 4DR4B 3RYHB 4FFBB 4MW3A 2CTRA 5EC1C 4YHHO 5K1PA 4WF9V 2UU9O 1GKFA 4WFFA 3U11A 2PYJA 4WBNA 1RPOA 3L70H 3UCSC 3G80A 4O2BA 4BIZA 4YJ2A 4CC6A 3HKDA 1YCIA 4I0XA 4N21A 3K58A 3LUTB 1M4UA 1XEQA 2GTSA 1K33A 3JAKB 1XMQO 4DXWA 4FLVA 2WLHA 4WFGA 4JI7O 4F4LA 2DW4A 2VS0A 2YIAA 3UT5B 2P4VA 4BWAA 1B06A 2OT5A 4DW0A 2CTQA 4DK0A 3K03A 1I08A 1TGOA 1EN5A 5IDJA 5LMUO 3T1HB 1FFTB 1N4CA 4X64B 5IE9A 3AG3C 2OCHA 2E76B 5BXZA 4OX9O 2YS8A 3BY6A 1AJQA 2MK3A 3P32A 3CB2A 4CS2A 3U0ZA 1MOFA 3SJBC 1YTFD 4GX2A 4DV4O 3JD3A 2EULA 1PD3A 1VQ4V 2QKCA 3DTUB 3ETGA 5LP6B 3D3IA 1JQ0A 4TQDA 5D5PA 3CCLV 1JFFB 2UUBO 1S0VA 1CP9A 4E2LA 1R6TA 4MSWC 4ZIBA 3C90A 1J5EO 2VQEB 2EZPA 1I5YA 3JD4A 4AQYO 3TXSA 1WPXA 2Q7GA 5EC2C 1FXKA 5CMUA 4B08A 4JAVA 3DC5A 3SYAA 1SETA 1R3IC 1YJ9V 3F7YC 2XAGA 1G4YB 3BHPA 1KYOF 5KHGA 3TK1A 3RT3C 3KZIZ 3IAYA 4LF4O 5JVDB 4MTGA 2WLLA 2NN4A 4PA3A 2QSAA 4HAMA 4JZGA 4O2BB 3OTOB 1K7DA 4LFAO 1SZTA 2QKSA 2EIKB 2X6CA 5IYCO 1NTKH 2Q0AA 3ABUA 3ZEDA 2ODMA 1PP9H 3GVMA 2D3OW 3W7SA 5AG2A 1SRYA 4EEQA 3BA8A 3FFQA 1RM1B 1Q8IA 1E1RG 3JATA 4I9QA 2OIEA 1A32A 4CH5A 3TXQA 2QJ1A 4FM2A 4B3SB 2QE7G 1O9HA 5JWPA 2QWNB 3CJHA 1IDSA 4P2ZA 3K0DA 4H0LB 2FYUH 1KKDA 2JGDB 5CBGA 1R3LC 1XQ8A 3Q4HA 4F6RB 1VF7A 2OIGA 1I5XA 3AEIA 1F4MA 2VQEO 4R50A 4B3TB 4KXRA 1AP5A 2X0LA 4JTAB 2Z3YA 4DR6O 3CRCA 2XTAA 3WG7C 4RWUA 1VEWA 5GW7A 4RQFA 1JJOA 4DV3B 2VWJA 4KHPB 3STZC 2P22C 2BTQB 3K57A 5JH7A 3D8CA 1VQPV 5EIBC 5LHIA 1I0HA 1OCOB 4FLWA 1AB3A 3BCCH 4LF7O 2F1MA 4MVZA 5LA6B 1IURA 4X64O 3ABKC 1IX9A 1ZX3A 2FTKA 4EB6A 3T4ZA 2PTMA 3ZMUA 3S3XA 1EZJA 2P6JA 1N0JA 1H2NA 2Q8VA 2Y69C 5L3DA 5K1XA 1IBLO 1GMGA 1EZVH 1AJNA 1GH6A 4LR3A 4I5SA 1G8MA 2AW9A 3E8HA 4NYKA 1P84F 4HBNA 4UCRA 3BABA 3ZRVA 2XT9A 3QTCA 3IC9A 5KA5A 4RO2A 3SPIA 2DYSC 1SQPH 2DYSB 3CWBH 2CTPA 2RQ6A 2V4DA 2XAQA 2K1EA 2IJKA 1Q6UA 4DR5B 3UM7A 4FZ1A 1KECA 1WPBA 4PELA 3CCUV 4U3FH 4E4EA 1WP8A 1TVKB 4TQFA 2ETNA 4NVPA 2JDIG 3OUSA 5IWAO 1CXZB 4PA6A 1KMIZ 3QO8A 4P30A 2WLJA 4LFAB 4DV5O 1NTZH 2Y69B 2QM8A 1ZL8B 5B1AB 1UJWB 3L74H 2ZDIA 4K35A 3K79A 5GONA 1GRJA 4LCUC 1TA8A 4O4JB 1F51A 2ZNIA 5LHGA 1GK9A 4G28B 4FPPA 4DUZB 4GKKB 4AILC 1SA0A 3SYQA 3RYCA 1UPGA 1WJZA 4FZ0A 1K4DC 5H5NA 4JI0O 1H2MA 1S5JA 1JA8A 1ORQC 1U97A 3E35A 5LOVA 3WG7B 1F4NA 4KUMA 4B7KA 2IJHA 3LDDA 1VQNV 2HFEC 3FB7C 1MSWD 4TV9B 3C3SA 1WB8A 3ZN0A 1HW7A 2Q9LA 3A8TA 1UFIA 3JD2A 5LXTB 3CEIA 1SESA 2ITCC 4DV2O 1S5HC 3VQYA 2BSKB 3QO5A 3K5LA 1SQBH 2XOKG 3K9AA 1WP7A 4MT8A 2GDSA 2IW5A 3DXRB 1KBHA 3DSQA 2LQTA 4LNUA 4B3RB 2OCCB 4DRXA 5C8YA 1N32O 1XNQB 2EBOA 5D5QA 4NTYA 1XUQA 2GSMB 2IH3C 2YIBD 1K34A 4F6EA 1PNKA 2Y48A 4PDRA 2F93B 3FB6C 5FPRA 3BRCA 3J81N 2QKAA 1XMQB 4LF8B 3G71V 3OR6C 1W59A 4QJFB 3ASNC 4I55B 2CGNA 5DN6G 3FYEB 5GTHZ 3CC2V 4LWSA 4NTXA 1XNRO 3HKBA 4DRXB 4DO2A 1HDJA 2WA4A 3CRAA 4DUZO 5BZBA 3J7AU 1S76D 3DXRA 4GYCB 3CCSV 1GTOA 4GX0A 2LO1A 5CA1A 1JOYA 3TJTA 2LFSA 3APQA 4UFZA 3NR7A 5J2TB 1Y66A 3JASB 1FXHA 3HKBB 4YJ3A 1YF2A 1JVMA 4EFEA 2FMLA 1E79G 2CAZC 3ZMVA 1MSDA 5LGTA 4PDVA 2JK5C 2WSSG 3D36A 4BW5A 3TETA 1H38A 1HNXO 3IFXA 3SJQC 1BGYH 4LP8A 4DR5O 4LWSB 1AI4A 1QR8A 4IYIA 4JTCB 5FLXN 4PI2A 2UXBO 4IIJA 1W2BU 3DGEA 2RMKB 5KAFZ 2ZE8A 2P90A 3ABLC 2F4VB 3JD0A 3T1CA 1JFFA 2JS3A 2QGNA 4WBNB 4FFKA 2YIDA 1GM8A 4H37A 2D2CB 1YIJV 1HNZO 1M93A 4NB5A 3JAWB 3FAVA 5JQGA 3RYIB 4X1IB 5LXTA 4LC1A 3ZHTA 1Y4MA 2BSKA 3P3NA 1IVSA 2ZNJA 2YEVA 3CP1A 1RFYA 3FAVB 5IY5C 1YSCA 4DV7B 2PY5A 3NXSA 1QBZA 3K5NA 4LF7B 4O4IA 4IHJB 2WWWA 2R9RB 3CCEV 1SKVA 4MVQA 5JCOC 4WFAV 2X7RB 3OE7G 1Q86W 3HPLC 2W0FC 4K8ZA 2EILB 3U10A 4XDLA 2DQ0A 5IT9N 5ITZB 1AR4A 3A2FA 3FB5C 4X8AA 4JI3O 4KHPO 2E3CA 1O9GA 2WAMA 2B1IA 3HKCB 3Q4HB 4I9WA 4F6RA 3M7MX 3R65A 3ABKB 2EIMB 2QM7A 2RNBA 4B3TO 5FNVA 3WB2A 5LP6C 2JVDA 2KB1A 2EX3A 5JQGB 1QU7A 1W0KG 1IZ3A 4IYHA 2OTLV 1OCOC 4X1IA 5CA1B 3JALB 1OCCB 4CS4A 4FLYA 1SZXA 4JI6B 3CCJV 1Y76B 5LYJA 4WFHA 4HYOA 2A06H 3A0RA 1BL8A 4W4LA 4GCZA 1SQFA 3WB1A 4QNHB 1D2DA 1IBKO 1KKCA 4X1YA 3ABTA 3SYPA 4DV5B 3OMAB 5B5EZ 1OCZC 4HNAB 1SQGA 3AK3A 2IU3A 1RSOA 2XHBA 1Y74A 4Q6GA 4X20A 4J9ZB 2WLLB 3O9OA 3STLC 2PUSA 3RW0A 3K5MA 2EIKC 3OT7A 2KSDA 1AROP 2CK3G 3SPGA 4FVMA 3CCVV 2HLDG 4UVAA 3FX7A 3B77A 3ZHVA 2GUZA 4PI0A 1NU1H 4H13B 4DV1O 1KD1W 1FYJA 2IBZH 5DM6V 2LP7A 1AILA 3RBZA 4XDJA 2OTJV 4EB6B 3BPZA 3H1IH 3AG2B 1JJ2U 1WA8A 2KG7A 2ZXWC 4TV9A 5E1AC 2QM4A 2JEUA 2EINC 2GBOA 2N74A 5ITZA 3JARB 1NTMH 1DTOA 2QTOA 2OWOA 4OX9B 1AI5A 1ZWIC 2XASA 2YI9A 1NS1A 5JVDA 3E89A 1Y6XA 2GV9A 3R66A 1AJPA 2Q5ZA 3MHHC 3JSNA 1XL6A 3B8NA 4JGSA 2CUGA 4DR6B 2HEPA 1BE3H 2HHHO 1Q90D 3OMNB 5B1BC 4U3JA 3H01A 1FAFA 4H33A 4JI7B 4NXMB 2AGAA 4YXWG 2EILC 4CC5A 2HVJC 2DQ3A 4TWKA 3W7TA 2ZXWB 1K5QA 4PJ0Z 3CRMA 2F4VO 2ZM6B 2CH7A 2Q6AA 4D7TA 4MVMA 2UXBB 3HKEA 3MD0A 4B3MB 4J11A 2YDEA 2UXDB 4A5UB 1EBOA 2AZ2A 1LR1A 1PV0A 4YHHB 4IGGA 1Z5VA 3IJ4A 1BHAA 1JR9A 2QWQB 3G6BA 5J2UB 3RN4A 5DEDA 4KFMA 2OYQA 1Q3EA 2JGUA 3OTOO 3L73H 3ABMB 3FD9A 1N36O 4O4LA 3TGUH 3LSQA 3ZRSA 1NH2D 5EBWC 3P30A 4I4TA 4LNUB 4JI6O 1GM9A 1NR1A 4YJ2B 2R70A 1Y67A 3L9DA 1ZL8A 4GUNA 1BT8A 5B3SB 4YY3O 4FLXA 4EKWA 4AQYB 1PL4A 1YJWV 1X4TA 4R7CA 2UUCB 2OCCC 1QVGU 1YJNV 4GZRB 5IY5B 3CD6V 2UUBB 1PL0A 4U7OA 1MG1A 2JRIA 3B09A 3CCMV 5BMVA 1QR9A 3FB8C 4N23A 2WLIA 1KC8W 1DGSA 1TUBA 3BAAA 1YXBA 4PHZA 2JS5A 4LF8O 4MVSA 3THOA 5LOVB 1B6QA 4UB8Z 1BZKA 1ZAUA 3ZBHA 4DV7O 1Q5OA 2Z0AA 1TAEA 1WB7A
chains in the Genus database with same CATH topology
1H2GA 2OCCB 1R6KA 3OAAG 5EBMC 2EBOA 3I55V 1K4CC 2GSMB 2XAFA 1Q7YW 1NVPC 2IH3C 5H9CA 1K34A 1OCCC 3ASNB 1PNKA 2Q69A 3OEEG 4JYCA 2Y48A 4PDRA 2QA4V 3FB6C 2NLJC 4MVOA 2Q68A 3E8FA 4RUFA 3ASOB 3F7VC 3G71V 2EIMC 3OR6C 5LHHA 2IJIA 1BHBA 3E2EA 4JASA 4UXNA 5B1BB 2ZR3A 4QJFB 3ASNC 2LFRA 1CEZA 3B8MA 4UUJC 5DN6G 3FYEB 1Q82W 3G4SV 2EIJC 2ATKC 2EIJB 3CC2V 3QO7A 5IYBO 1WLEA 4DO2A 3EFFK 2X6BA 2P7TC 4QIWF 3ZIAG 2Z5UA 1K97A 4X89A 5C93A 1XL4A 3ASOC 2HG5C 3I56V 1F23A 5BZBA 4MVRA 2NNUA 1K73W 3GWOA 1S76D 2WLIB 3VBBA 4QE7A 2M7WA 1GM7A 3CCSV 3MHSC 1GTOA 2WLKA 3OFNG 4UV9A 3E8GA 4GX0A 1M56C 1VQLV 4JAUA 3K0GA 3ZMZA 1JOYA 1R73A 1V54B 3T2MA 2DYRB 4FJCC 4CBCA 1VQ6V 2LFSA 3JD1A 1DF4A 4MTFA 3CMEV 3ETDA 3ML0A 3RVZA 1Y66A 3X2QC 1YTFB 1NKDA 2XAHA 1FXHA 5B1OA 4PA9A 3LNMB 3CYOA 2A9HA 1JVMA 1S77D 5EBLC 5KUKA 1E79G 3ZMVA 2IJJA 5LGTA 5IYDO 4GX5A 4PDVA 3TCUA 4MW3A 3ETEA 5EC1C 4ZBMA 2JK5C 2WSSG 3AG1C 3D36A 4BW5A 3TETA 1H38A 4WF9V 1W0JG 3ZMTA 1OHHG 1QLEB 1GKFA 1VQ5V 3IFXA 1JPXA 4WFFA 3SJQC 4LP8A 3KG2A 3E86A 1RPOA 3OEHG 5LGUA 1ROPA 3SYOA 1AI4A 1L1FA 1FXKB 1QR8A 1E1QG 2B1GA 4JTCB 3W7XA 1OCRC 4BIZA 3AG2C 1W2BU 4OXSA 3DGEA 3ABLC 2P90A 2HJFC 2Q67A 4BIUA 3JD0A 4N21A 3LUTB 3PJSK 3T1CA 1NJIW 2AHZA 2HKOA 1K33A 1K3EA 1M90W 2DWEC 1GM8A 4H37A 2F43G 5L3EA 1YIJV 4DXWA 2PI5A 2WLHA 1VQ7V 4WFGA 4R6ZA 3CXCU 4JTDB 3SPCA 4F4LA 2DW4A 2W6IG 5FL7G 3ZJZA 4BAYA 3X2QB 3K04A 2A0LA 2OT5A 4LC1A 4WCEV 1YI2V 1Y4MA 4R8CA 1NR7A 4RQEA 2ZQMA 4QPJA 2DYRC 3F5WC 1COWG 3K03A 4MW8A 1P7BA 1OZ0A 3CCQV 5IDJA 2YEVA 2JEXA 4MTOA 1FFTB 3CP1A 5IY5C 2P67A 1YSCA 3W7UA 3NXSA 3AG3C 1QBZA 3ZMSA 3HB3B 3BY6A 2WWWA 1AJQA 2MK3A 2R9RB 3P32A 3CCEV 4P9OA 4MVQA 1MOFA 4WFAV 2UXXA 2X7RB 3OE7G 1Q86W 3HPLC 2W0FC 4GT1A 5LBQA 2EILB 3LSSA 4XDLA 1YTFD 4GX2A 2DQ0A 3JD3A 1PD3A 5L3GA 2DWDC 5L3FA 5CA3A 1VQ4V 1H8HG 3FB5C 3OUFA 3DTUB 4X8AA 3ETGA 1RM1C 3D3IA 1JQ0A 3CCLV 3K06A 2WAMA 1EFRG 4QPKA 2B5UA 1HWYA 2B1IA 1KQSU 1S0VA 1CP9A 5H6QA 4I9WA 4E2LA 4MSWC 3R65A 1Q81W 3ABKB 4LBEC 2EIMB 1JCHA 2QM7A 4WFEA 1LNQA 1M57B 3W7WA 2EZPA 1I5YA 3BEHA 3JD4A 2KB1A 1WPXA 5EC2C 1FXKA 5CMUA 3SPJA 1W0KG 4JAVA 2OTLV 1OCOC 4FK5C 3SYAA 3M99B 1SETA 1R3IC 3OM3B 1OCCB 3E83A 1YITV 1YJ9V 5HFMA 3F7YC 2XAGA 5HFLA 3ZRWB 3CCJV 1G4YB 4WFHA 4HYOA 1VQ9V 3A0RA 3AG4B 3TK1A 1BL8A 3ABLB 4GCZA 4MTGA 2WLLA 4PA3A 4Q20A 4ASUG 4QNHB 3FYIB 4FMTA 4HAMA 1FS0G 4JYBA 2GHYA 2EJRA 3ABTA 3SYPA 1K7DA 3OMAB 3WFVA 5J9PC 1R6NA 1OCZC 1SZTA 2QKSA 2IU3A 3OMIB 2EIKB 2X6CA 1PKXA 4HZ3A 5IYCO 2H94A 4X88A 1PNLA 4J9ZB 3K08A 5CBHA 2WLLB 3ABUA 1R3KC 3STLC 3RW0A 2D3OW 3W7SA 2EIKC 3OR7C 1SRYA 1K92A 1AROP 5B1AC 1RM1B 2CK3G 3SPGA 1E1RG 1CPYA 3CCVV 2HLDG 4UVAA 4MS2A 5KA6A 1J95A 3B77A 5EK0A 2QE7G 3IC7A 1QLEC 4P2ZA 1K9MW 1KD1W 2XAJA 3K0DA 5DM6V 5LGNA 1K5SA 2LP7A 1NBMG 1KKDA 4CZZA 3AG1B 5CBGA 1R3LC 3RBZA 2V1DA 2XNDG 3OW2U 2HVKC 4XDJA 2JJ2G 2OTJV 1I5XA 3AEIA 1M9NA 1K8AW 1F4MA 1KP2A 1V55B 4PA4A 4R50A 4P9PA 1N8RW 2X0LA 4JTAB 2Z3YA 3UKMA 1VQOV 2IU0A 1R3JC 3AG2B 1RPRA 4MTXA 3ZN1A 3WG7C 5GW7A 1JJ2U 4RQFA 1SERA 1V55C 2ZXWC 3STZC 3CMAV 5L3CA 2C2AA 4UV8A 4GX1A 1VQPV 4XDKA 5E1AC 1ENVA 1QLNA 1S3JA 5LHIA 2JEUA 1OCOB 2EINC 1AI6A 3CPWU 5L3BA 2H8PC 1DTOA 2QTOA 1YTFC 1AI5A 1DF5A 1ZWIC 2XASA 4PDMA 2ZDIC 2BOCC 2R9IA 3E8BA 4MVZA 4XBFA 2JIZG 3ABKC 3E89A 4G27B 1V54C 1AJPA 1MABG 2FTKA 4RUEA 2QEXV 3T4ZA 3MHHC 3ZMUA 1FXVA 1XL6A 3B8NA 1EZJA 2A79B 4JGSA 2P6JA 3CC4V 1OCRB 3OGCC 2Y69C 3ABMC 4U7NA 5L3DA 3OMNB 3JCZA 1GMGA 5B1BC 1AJNA 3H01A 2JJ1G 4I5SA 4JPRA 4H33A 4YXWG 3SPHA 3ZRXA 2EILC 1JX9A 1G8MA 2HVJC 2DQ3A 3E8HA 4TWKA 1S72V 2ITDC 4QE9A 3LDEA 3W7TA 2ZXWB 1K5QA 1M57C 3FKSG 3GB7C 1NH2B 3ZRVA 1H8EG 2Q6AA 2WPDG 4MVMA 2V7QG 1NQTA 5KA5A 4RAIA 1M56B 4UVBA 4RO2A 3MD0A 3SPIA 3AG4C 2DYSC 4G2KA 2DYSB 2YEVB 4WFBV 4PA7A 4TT3G 2XAQA 1EBOA 2K1EA 2IJKA 3JYCA 4JF3A 1FXKC 3UM7A 1NH2C 1KECA 3IGAC 4PELA 3CCUV 2BOBC 4J9YB 3CCRV 1P4RA 2WLMA 1BHAA 2JDIG 3OUSA 1IXMA 4PA6A 3ZRWA 1YHQV 3QO8A 4P30A 4ZKIA 2WLJA 5KUMA 1QCEA 4KFMA 3K3WA 1THZA 3AG3B 2Y69B 3ABMB 4Z1MG 2WLNA 2QM8A 2ZD9A 5B1AB 4UVCA 1UJWB 2ZDIA 2EZOA 3LSQA 3K79A 3ZRSA 1NH2D 5EBWC 3P30A 4LCUC 3SYCA 1GM9A 2W6JG 1PNMA 2YSUB 1NR1A 2UXNA 2EINB 1F51A 1NVPD 1AR1B 5LHGA 1GK9A 4G28B 4TSFG 1QVFU 1TUEB 5B1NA 3RVYA 3CC7V 4FPPA 4KP4A 5H6RA 5B3SB 5B3SC 3ZCCA 4EKWA 1YJWV 3QNEA 1VQMV 1VQKV 3SYQA 4R7CA 3VOUA 1K4DC 2OCCC 1QVGU 1ORQC 1YJNV 3E35A 3LDCA 5IY5B 3CD6V 1PL0A 3T4DA 4U7OA 1MG1A 3CCMV 1NVPB 2X6AA 1QR9A 3WG7B 1F4NA 3FB8C 1M1KW 4N23A 2WLIA 1AI7A 4KUMA 4PDLA 1KC8W 3G6EV 2IJHA 3EHBB 1DLBA 1KP3A 2ZR2A 3LDDA 1VQNV 1BMFG 2HFEC 3FB7C 1MSWD 3ZN0A 2IH1C 2PI4A 3JD2A 5CN0A 4MVSA 4L87A 1SESA 2ITCC 1S5HC 1B6QA 1GO3F 3QO5A 5CBFA 2XOKG 3K9AA 2AHYA 4MT8A 1OCZB 1VQ8V 2IW5A 2HR3A 4MVUA 4FIPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC O;  1NH2 D;  1NVP C;  1RM1 B;  1YTF D;  5IYD O;  1RM1 C;  1NVP D;  5IYB O;  1YTF C;  1NH2 C; 
#chains in the Genus database with same CATH topology
 4YJ3 B;  1BSM A;  3CRR A;  1N32 B;  2P5O A;  1N33 O;  5EBM C;  4NXN O;  4IL6 Z;  1NVP C;  5KHH A;  4O4I B;  4H44 B;  2CH7 B;  4NR1 A;  3ASN B;  2Q69 A;  5E79 Z;  2O57 A;  3QG5 A;  3SGI A;  4K0K B;  3K5O A;  4MVO A;  4DUY B;  3F7V C;  2G38 A;  5LHH A;  5B1B B;  4UUJ C;  5FNV B;  2YXY A;  3G4S V;  2EIJ B;  2Q73 A;  1WLE A;  4J7Z A;  2X6B A;  4J7K A;  4CS3 A;  4X89 A;  1ZUQ A;  4JI4 O;  4ZI7 B;  3UT5 A;  3LSU A;  1TVK A;  5C93 A;  3ZS8 C;  4DR4 O;  1QQC A;  2NNU A;  1K73 W;  3ZHR A;  3GWO A;  4QE7 A;  5KAI Z;  2WLK A;  4ABM A;  1HP8 A;  1R1B A;  2RJZ A;  2CDY A;  1VIB A;  4JAU A;  3RYF B;  3ZMZ A;  1R73 A;  4FJC C;  4CBC A;  3LNN A;  4D6T H;  1DF4 A;  3ETD A;  3ML0 A;  4HNA A;  3X2Q C;  5C8Y B;  3JAT B;  1Y74 B;  3LNM B;  3L71 H;  4O4J A;  2N05 A;  1S77 D;  3D3Q A;  4JI1 O;  3UO2 A;  5KUK A;  3AK2 A;  4OGQ B;  3JAW A;  4TUY B;  1XHZ A;  4ZOL B;  1W0J G;  3ZMT A;  1VQ5 V;  2YIB A;  1JPX A;  2BE3 A;  1GN2 A;  3OEH G;  1L1F A;  4B3M O;  2B1G A;  3W7X A;  1OCR C;  4OXS A;  3S3W A;  1BQ0 A;  2HJF C;  2Q67 A;  3PJS K;  1NJI W;  1EN4 A;  1N34 B;  1K3E A;  1M90 W;  4PV1 B;  2UUA O;  2CGO A;  3MDS A;  3OTF A;  1XIL A;  4LFC O;  4NXM O;  3CXC U;  4JTD B;  3SPC A;  5CA0 B;  2W6I G;  1VF6 C;  1IBL B;  4LF6 O;  4BAY A;  3X2Q B;  2A0L A;  4R8C A;  1NR7 A;  4RQE A;  4QPJ A;  2DYR C;  3F5W C;  3JCU Z;  4DW1 A;  1COW G;  1P7B A;  1OZ0 A;  3CCQ V;  4JI5 B;  2JEX A;  4MTO A;  2HJD A;  5KMG B;  1BS3 A;  3SJC C;  3ZMS A;  4P9O A;  2DN9 A;  4BW9 A;  2UXX A;  4KL1 A;  4GT1 A;  3LSS A;  5JJN B;  2KQX A;  4LFB O;  5L3G A;  3K06 A;  3I5D A;  4QPK A;  2B5U A;  3EXA A;  1KQS U;  1V9P A;  1GN3 A;  4DR7 O;  3BEH A;  2L6L A;  2BTQ A;  3SPJ A;  1PPJ H;  4DR2 O;  4FK5 C;  3M99 B;  2YXL A;  1ZSP A;  5JJE B;  4X65 B;  4B3S O;  1I94 O;  1MA1 A;  3ABL B;  4FMT A;  1FS0 G;  4J42 A;  3WFV A;  4DYL A;  5J9P C;  1R6N A;  1XMO O;  3OMI B;  2HP8 A;  1JMK C;  1XI1 A;  4LH6 A;  4X88 A;  2DJV A;  1L0N H;  3N2K B;  4TUY A;  2QWP B;  1R3K C;  1FFX A;  1HR0 B;  1F7Y A;  1XMO B;  1KUQ A;  3KKY A;  3SR2 C;  1K92 A;  5B1A C;  3CHX A;  1WNS A;  4MS2 A;  1J95 A;  1OV9 A;  3KCX A;  1I94 B;  1X59 A;  3IC7 A;  2XAJ A;  5LGN A;  2Q7E A;  1K5S A;  1WAZ A;  3D36 C;  2N04 A;  5LMN O;  4CZZ A;  5KHK A;  4DR2 B;  2NR5 A;  3SDL A;  2LW7 A;  2JJ2 G;  1K8A W;  1M9N A;  1KP2 A;  1H2K A;  4DR7 B;  1J5E B;  1T5E A;  1VQO V;  5LL6 Y;  1RPR A;  4MTX A;  3ZN1 A;  5GTI Z;  2PZS A;  1IBM O;  1G1X B;  1SER A;  2ZKO A;  1V55 C;  4TV8 B;  4JI3 B;  2C2A A;  4UV8 A;  4LFB B;  2R9A A;  2RCV A;  1ENV A;  2ZT9 B;  4JZ2 A;  4O2A B;  1S3J A;  3QF7 A;  1G6U A;  1AI6 A;  3CRQ A;  3CPW U;  2E5L B;  1YTF C;  2RN9 A;  2ZDI C;  5GON B;  2R9I A;  3JAL A;  4XBF A;  4G27 B;  1MAB G;  4DV3 O;  5LMU B;  1FXV A;  2IM9 A;  2A79 B;  5EYP B;  3CC4 V;  3AK1 A;  1Z2G A;  4YIP A;  5EIB D;  3OGC C;  3CXH F;  3JCZ A;  2R72 A;  4GLX A;  2JJ1 G;  4ZHQ A;  3ICX A;  4FM1 A;  3SPH A;  3ZRX A;  1JX9 A;  1MZE A;  2UUA B;  4IHJ A;  2PYL A;  3FKS G;  3GB7 C;  3WU2 Z;  1D5A A;  1NH2 B;  1H8E G;  2WPD G;  2V7Q G;  1NQT A;  1EM1 A;  2JGD A;  4RAI A;  3HR0 A;  4UVB A;  1ZTE A;  2YEV B;  3KCY A;  4WFB V;  4TT3 G;  4BR6 A;  4X1Y B;  4I0X B;  1HNX B;  3IGA C;  2UU9 B;  4J9Y B;  3CS5 A;  3CCR V;  2WLM A;  2E74 B;  3ZRW A;  1QHT A;  4ZKI A;  5KUM A;  3M8A A;  1QCE A;  1FJG O;  1THZ A;  3AG3 B;  1IBK B;  4Z1M G;  2WLN A;  2ZD9 A;  2ZE7 A;  4JYY A;  2GTA A;  2WA3 A;  4X65 O;  5A9G A;  3RWR D;  2UXN A;  1FD9 A;  2EIN B;  3ETQ A;  3N27 A;  1NVP D;  1QVF U;  1TUE B;  5B1N A;  3RVY A;  2YUA A;  5H6R A;  5KX5 A;  3A0B Z;  1Q43 A;  3QNE A;  5H2F Z;  4I55 A;  4J10 A;  1KB9 F;  4OPH A;  5KHI A;  1VQK V;  2K9P A;  2MW2 B;  3LDC A;  1XNR B;  3T4D A;  1NVP B;  3CJH B;  3JAR A;  4ZI7 A;  1AI7 A;  4DV0 B;  3G6E V;  4BIO A;  1BMF G;  5EZY A;  3K9S A;  4NKG B;  1SQX H;  2IH1 C;  2PI4 A;  5CN0 A;  1MMM A;  4L87 A;  4DR3 B;  3B40 A;  1GO3 F;  5CBF A;  1GN6 A;  1FKA O;  5JCO A;  2AHY A;  3T1Y B;  1VQ8 V;  4MVU A;  2HR3 A;  3CSX A;  2EJ7 A;  4UCV A;  1H2G A;  1XNQ O;  1N33 B;  4JYA O;  4JYA B;  3OAA G;  1SF9 A;  3I55 V;  4LF9 O;  1K4C C;  2XAF A;  5KLV H;  1Q7Y W;  1N0N A;  1NT2 B;  4B7E A;  4IIJ B;  1LUW A;  3OEE G;  4JYC A;  1HNZ B;  2Q68 A;  4RUF A;  3ASO B;  1N34 O;  2EIM C;  4JAS A;  1KU9 A;  1BCC H;  2LFR A;  1CEZ A;  5B66 Z;  4DV0 O;  2P4K A;  3E22 A;  2ATK C;  3C3T A;  2QDO A;  2FL4 A;  3QO7 A;  4CH4 A;  2P7T C;  5KHJ A;  4QIW F;  3ZIA G;  3OD4 A;  1VF6 A;  4DK1 A;  1XL4 A;  3ASO C;  3I56 V;  4FLZ A;  4GKJ O;  2ADP A;  1SC5 B;  4MVR A;  2WLI B;  2M7W A;  2YXH A;  2VQF B;  4JI8 B;  2DOS A;  4AHC A;  3OFN G;  3K59 A;  5KMG A;  1V54 B;  4LF5 O;  2DYR B;  4X62 O;  4X62 B;  3JD1 A;  1Q6I A;  3CME V;  1Q6H A;  3RVZ A;  1YTF B;  1YVW A;  1NKD A;  5JJJ B;  1NZ6 A;  1FJG B;  4PA9 A;  2GUZ B;  2VQF O;  4JI8 O;  3RFR A;  5IWA B;  3TCU A;  3ETE A;  2B9Z A;  3AG1 C;  4ICG A;  4ZBM A;  5IYZ A;  3J80 N;  4JI4 B;  3E22 B;  1AP6 A;  1OHH G;  1QLE B;  2CTW A;  2YI8 A;  5FPO A;  3KG2 A;  3E86 A;  5LGU A;  1ROP A;  3SYO A;  2PF4 E;  1FXK B;  1E1Q G;  3AG2 C;  1H2L A;  1XHX A;  4BIU A;  1L0L H;  1URF A;  3JSL A;  1Y76 A;  2AHZ A;  5LYJ B;  2HKO A;  2DWE C;  2F43 G;  5L3E A;  4LH7 A;  2PI5 A;  4X66 B;  1VQ7 V;  4R6Z A;  3ZHQ A;  4FFB A;  4TOI A;  5FL7 G;  3ZJZ A;  2P06 A;  4Z1V A;  3K04 A;  3UQ8 A;  1VAR A;  4WCE V;  1YI2 V;  4NXN B;  2ZIN A;  2ZQM A;  3H1H H;  4MW8 A;  3G67 A;  1Z5W A;  3W7U A;  2P67 A;  3T1Y O;  2UXC B;  2AXT Z;  3HB3 B;  1XDC A;  4DV2 B;  4YIO A;  2CE4 A;  1AR5 A;  3F5T A;  4UCU A;  3H1K H;  4JV5 B;  5LBQ A;  4O4H B;  4ZHQ B;  4UB6 Z;  4UCS A;  1SS3 A;  3APO A;  4DV6 B;  2DWD C;  5L3F A;  5CA3 A;  1H8H G;  3OUF A;  2FB5 A;  1RM1 C;  1XBL A;  1IBM B;  1EFR G;  1SQQ H;  1HWY A;  3PN1 A;  5H6Q A;  4JI0 B;  4J41 A;  1Q81 W;  4LBE C;  1JCH A;  4WFE A;  5J2U A;  1LNQ A;  1M57 B;  3W7W A;  2LGW A;  5LA6 A;  2Y4U A;  1GN4 A;  3N2G B;  4OPA A;  3OM3 B;  3CX5 F;  3E83 A;  1YIT V;  5HFM A;  5HFL A;  4C7U A;  3ZRW B;  1SQV H;  1P7G A;  2Y0I A;  3HKE B;  2A7W A;  4DV1 B;  2VRZ A;  1VQ9 V;  3AG4 B;  3DC6 A;  4Q20 A;  4ASU G;  4K8X A;  1YDX A;  3FYI B;  4JYB A;  2GHY A;  2EJR A;  3A0H Z;  3H1J H;  2PGG A;  1PKX A;  4AI8 A;  1SA0 B;  4HZ3 A;  3RYC B;  2Q4P A;  2H94 A;  1PNL A;  3K08 A;  5CBH A;  4X1K B;  1VMG A;  2ZCE A;  3OR7 C;  2KKW A;  2Q7H A;  2UXD O;  3B4S A;  1CPY A;  4NTW A;  5KA6 A;  4LF4 B;  2L35 A;  5EK0 A;  2ZM6 O;  1QLE C;  1K9M W;  1H2S B;  5IJ9 B;  1ZLZ A;  1NBM G;  3GWK C;  3AG1 B;  1US6 A;  3H1L H;  2V1D A;  2BCC H;  1M5I A;  2XND G;  3JAK A;  3OW2 U;  2HVK C;  4L8J A;  1IXB A;  1V55 B;  2QWO B;  2QWR B;  2LJ2 A;  4IT5 A;  1MZF A;  4PA4 A;  2HHH B;  1VP7 A;  4P9P A;  1N8R W;  4PD4 F;  3UKM A;  1DK1 A;  5BMV B;  2IU0 A;  1R3J C;  2ZE6 A;  5TIS Z;  2F23 A;  3CMA V;  3SJA C;  4O4L B;  5L3C A;  4GX1 A;  4XDK A;  1QLN A;  2BTO A;  2E5L O;  2ARH A;  3UO3 A;  5IJ9 A;  5BR8 O;  5BR8 B;  5L3B A;  2H8P C;  4K3A A;  3VQV A;  2M6Y A;  1DF5 A;  4I4T B;  4X20 B;  4PDM A;  2BOC C;  3E8B A;  4RUE A;  2JIZ G;  2FKX A;  1V54 C;  1RSO B;  2ZIO A;  2QEX V;  2W0X A;  2F66 C;  4FLT A;  3WB0 A;  3OGI B;  3BA9 A;  1OCR B;  3BFR A;  3ABM C;  4U7N A;  5CB4 A;  3RGB A;  4JPR A;  3ZX6 A;  4X66 O;  3T1H O;  3MAQ A;  5LMN B;  1S72 V;  3P3P A;  2ITD C;  4ZOL A;  4QE9 A;  3LDE A;  5J2T A;  1M57 C;  5CB4 B;  3O65 A;  1M56 B;  3AG4 C;  4G2K A;  4I50 B;  4PA7 A;  4CH6 A;  2YIC A;  3JYC A;  4JF3 A;  1FXK C;  1NH2 C;  4TV8 A;  2BOB C;  1HR0 O;  3B2E E;  1LUV A;  1P4R A;  3HKC A;  4J80 A;  5A2Q N;  4O2A A;  5KX5 B;  1IXM A;  2AZ0 A;  2QR4 A;  5JH7 B;  1YHQ V;  2Y4T A;  2ZIM A;  3K3W A;  5IYZ B;  4X9Q A;  2Q0O C;  1U96 A;  3ZHU A;  1VF5 B;  4JI2 B;  4X1K A;  4UVC A;  4FM0 A;  2Y0P A;  2EZO A;  1OJH A;  1RP3 B;  2YC0 A;  1MNG A;  5F2V O;  2E75 B;  3SYC A;  4I50 A;  2W6J G;  1PNM A;  1WN7 A;  2YSU B;  3RYI A;  1AR1 B;  4TSF G;  3ZHS A;  4GKJ B;  3EVK A;  2LW1 A;  5EYP A;  3CC7 V;  4KP4 A;  5B3S C;  1PM9 A;  3ZCC A;  1VQM V;  2F95 B;  3VOU A;  3N2K A;  1HNW B;  2X6A A;  4W4K A;  1M1K W;  4U3J B;  3VQX A;  4PDL A;  2DMX A;  2ZR2 A;  1DLB A;  1KP3 A;  3EHB B;  4DV6 O;  4DV4 B;  4I7Z B;  1XOU A;  4JV5 O;  4DUY O;  4JAA A;  4K0K O;  2XUM A;  2ADQ B;  4D7S A;  3RYF A;  1D5N A;  2UXC O;  1OCZ B;  3JAM N;  1L8D A;  2QA4 V;  4FIP C;  2RDC A;  1BQZ A;  4LF9 B;  4O4H A;  4JI5 O;  1FPO A;  1R6K A;  3JAS A;  4B3R O;  4EFB A;  1GAX A;  1AVM A;  5IJ0 A;  5H9C A;  4LF6 B;  4Z2W A;  1I7F A;  3L75 H;  1OCC C;  1S5L Z;  4LFC B;  2QTS A;  1P49 A;  4DR3 O;  2NLJ C;  2ZE5 A;  1XRE A;  5LP6 A;  3E8F A;  1BHB A;  2LGQ A;  2IJI A;  2A3Q A;  3E2E A;  1YEW A;  4UXN A;  2ZR3 A;  3B8M A;  1B3Q A;  3QVN A;  1Q82 W;  4CH3 A;  2EIJ C;  1HNW O;  5IYB O;  3L72 H;  5BY1 A;  1QNM A;  3CE2 A;  3EFF K;  3VQW A;  2DE0 X;  2UUC O;  1FFX B;  2Z5U A;  1K97 A;  5IJ0 B;  4GKK O;  3N2G A;  3RYH A;  5EZY B;  4J7J A;  4YY3 B;  1EN6 A;  2HG5 C;  1F23 A;  5CA0 A;  4UCO A;  3VBB A;  4JI1 B;  1B04 A;  1GM7 A;  4QGP A;  3MHS C;  5DEC A;  4UV9 A;  2ILM A;  3H9V A;  3E8G A;  1M56 C;  1VQL V;  3K0G A;  3T2M A;  4DR1 B;  1VQ6 V;  3BVO A;  3HKD B;  4JI2 O;  4LF5 B;  4DR1 O;  4MTF A;  4UCT A;  1N36 B;  1WA8 B;  2KG7 B;  1TUB B;  1NI8 A;  1YZB A;  2H3O A;  3AG7 A;  2XAH A;  4FLU A;  5B1O A;  3CYO A;  2A9H A;  5EBL C;  2VWK A;  2IJJ A;  5IYD O;  4GX5 A;  4DR4 B;  3RYH B;  4FFB B;  4MW3 A;  2CTR A;  5EC1 C;  4YHH O;  5K1P A;  4WF9 V;  2UU9 O;  1GKF A;  4WFF A;  3U11 A;  2PYJ A;  4WBN A;  1RPO A;  3L70 H;  3UCS C;  3G80 A;  4O2B A;  4BIZ A;  4YJ2 A;  4CC6 A;  3HKD A;  1YCI A;  4I0X A;  4N21 A;  3K58 A;  3LUT B;  1M4U A;  1XEQ A;  2GTS A;  1K33 A;  3JAK B;  1XMQ O;  4DXW A;  4FLV A;  2WLH A;  4WFG A;  4JI7 O;  4F4L A;  2DW4 A;  2VS0 A;  2YIA A;  3UT5 B;  2P4V A;  4BWA A;  1B06 A;  2OT5 A;  4DW0 A;  2CTQ A;  4DK0 A;  3K03 A;  1I08 A;  1TGO A;  1EN5 A;  5IDJ A;  5LMU O;  3T1H B;  1FFT B;  1N4C A;  4X64 B;  5IE9 A;  3AG3 C;  2OCH A;  2E76 B;  5BXZ A;  4OX9 O;  2YS8 A;  3BY6 A;  1AJQ A;  2MK3 A;  3P32 A;  3CB2 A;  4CS2 A;  3U0Z A;  1MOF A;  3SJB C;  1YTF D;  4GX2 A;  4DV4 O;  3JD3 A;  2EUL A;  1PD3 A;  1VQ4 V;  2QKC A;  3DTU B;  3ETG A;  5LP6 B;  3D3I A;  1JQ0 A;  4TQD A;  5D5P A;  3CCL V;  1JFF B;  2UUB O;  1S0V A;  1CP9 A;  4E2L A;  1R6T A;  4MSW C;  4ZIB A;  3C90 A;  1J5E O;  2VQE B;  2EZP A;  1I5Y A;  3JD4 A;  4AQY O;  3TXS A;  1WPX A;  2Q7G A;  5EC2 C;  1FXK A;  5CMU A;  4B08 A;  4JAV A;  3DC5 A;  3SYA A;  1SET A;  1R3I C;  1YJ9 V;  3F7Y C;  2XAG A;  1G4Y B;  3BHP A;  1KYO F;  5KHG A;  3TK1 A;  3RT3 C;  3KZI Z;  3IAY A;  4LF4 O;  5JVD B;  4MTG A;  2WLL A;  2NN4 A;  4PA3 A;  2QSA A;  4HAM A;  4JZG A;  4O2B B;  3OTO B;  1K7D A;  4LFA O;  1SZT A;  2QKS A;  2EIK B;  2X6C A;  5IYC O;  1NTK H;  2Q0A A;  3ABU A;  3ZED A;  2ODM A;  1PP9 H;  3GVM A;  2D3O W;  3W7S A;  5AG2 A;  1SRY A;  4EEQ A;  3BA8 A;  3FFQ A;  1RM1 B;  1Q8I A;  1E1R G;  3JAT A;  4I9Q A;  2OIE A;  1A32 A;  4CH5 A;  3TXQ A;  2QJ1 A;  4FM2 A;  4B3S B;  2QE7 G;  1O9H A;  5JWP A;  2QWN B;  3CJH A;  1IDS A;  4P2Z A;  3K0D A;  4H0L B;  2FYU H;  1KKD A;  2JGD B;  5CBG A;  1R3L C;  1XQ8 A;  3Q4H A;  4F6R B;  1VF7 A;  2OIG A;  1I5X A;  3AEI A;  1F4M A;  2VQE O;  4R50 A;  4B3T B;  4KXR A;  1AP5 A;  2X0L A;  4JTA B;  2Z3Y A;  4DR6 O;  3CRC A;  2XTA A;  3WG7 C;  4RWU A;  1VEW A;  5GW7 A;  4RQF A;  1JJO A;  4DV3 B;  2VWJ A;  4KHP B;  3STZ C;  2P22 C;  2BTQ B;  3K57 A;  5JH7 A;  3D8C A;  1VQP V;  5EIB C;  5LHI A;  1I0H A;  1OCO B;  4FLW A;  1AB3 A;  3BCC H;  4LF7 O;  2F1M A;  4MVZ A;  5LA6 B;  1IUR A;  4X64 O;  3ABK C;  1IX9 A;  1ZX3 A;  2FTK A;  4EB6 A;  3T4Z A;  2PTM A;  3ZMU A;  3S3X A;  1EZJ A;  2P6J A;  1N0J A;  1H2N A;  2Q8V A;  2Y69 C;  5L3D A;  5K1X A;  1IBL O;  1GMG A;  1EZV H;  1AJN A;  1GH6 A;  4LR3 A;  4I5S A;  1G8M A;  2AW9 A;  3E8H A;  4NYK A;  1P84 F;  4HBN A;  4UCR A;  3BAB A;  3ZRV A;  2XT9 A;  3QTC A;  3IC9 A;  5KA5 A;  4RO2 A;  3SPI A;  2DYS C;  1SQP H;  2DYS B;  3CWB H;  2CTP A;  2RQ6 A;  2V4D A;  2XAQ A;  2K1E A;  2IJK A;  1Q6U A;  4DR5 B;  3UM7 A;  4FZ1 A;  1KEC A;  1WPB A;  4PEL A;  3CCU V;  4U3F H;  4E4E A;  1WP8 A;  1TVK B;  4TQF A;  2ETN A;  4NVP A;  2JDI G;  3OUS A;  5IWA O;  1CXZ B;  4PA6 A;  1KMI Z;  3QO8 A;  4P30 A;  2WLJ A;  4LFA B;  4DV5 O;  1NTZ H;  2Y69 B;  2QM8 A;  1ZL8 B;  5B1A B;  1UJW B;  3L74 H;  2ZDI A;  4K35 A;  3K79 A;  5GON A;  1GRJ A;  4LCU C;  1TA8 A;  4O4J B;  1F51 A;  2ZNI A;  5LHG A;  1GK9 A;  4G28 B;  4FPP A;  4DUZ B;  4GKK B;  4AIL C;  1SA0 A;  3SYQ A;  3RYC A;  1UPG A;  1WJZ A;  4FZ0 A;  1K4D C;  5H5N A;  4JI0 O;  1H2M A;  1S5J A;  1JA8 A;  1ORQ C;  1U97 A;  3E35 A;  5LOV A;  3WG7 B;  1F4N A;  4KUM A;  4B7K A;  2IJH A;  3LDD A;  1VQN V;  2HFE C;  3FB7 C;  1MSW D;  4TV9 B;  3C3S A;  1WB8 A;  3ZN0 A;  1HW7 A;  2Q9L A;  3A8T A;  1UFI A;  3JD2 A;  5LXT B;  3CEI A;  1SES A;  2ITC C;  4DV2 O;  1S5H C;  3VQY A;  2BSK B;  3QO5 A;  3K5L A;  1SQB H;  2XOK G;  3K9A A;  1WP7 A;  4MT8 A;  2GDS A;  2IW5 A;  3DXR B;  1KBH A;  3DSQ A;  2LQT A;  4LNU A;  4B3R B;  2OCC B;  4DRX A;  5C8Y A;  1N32 O;  1XNQ B;  2EBO A;  5D5Q A;  4NTY A;  1XUQ A;  2GSM B;  2IH3 C;  2YIB D;  1K34 A;  4F6E A;  1PNK A;  2Y48 A;  4PDR A;  2F93 B;  3FB6 C;  5FPR A;  3BRC A;  3J81 N;  2QKA A;  1XMQ B;  4LF8 B;  3G71 V;  3OR6 C;  1W59 A;  4QJF B;  3ASN C;  4I55 B;  2CGN A;  5DN6 G;  3FYE B;  5GTH Z;  3CC2 V;  4LWS A;  4NTX A;  1XNR O;  3HKB A;  4DRX B;  4DO2 A;  1HDJ A;  2WA4 A;  3CRA A;  4DUZ O;  5BZB A;  3J7A U;  1S76 D;  3DXR A;  4GYC B;  3CCS V;  1GTO A;  4GX0 A;  2LO1 A;  5CA1 A;  1JOY A;  3TJT A;  2LFS A;  3APQ A;  4UFZ A;  3NR7 A;  5J2T B;  1Y66 A;  3JAS B;  1FXH A;  3HKB B;  4YJ3 A;  1YF2 A;  1JVM A;  4EFE A;  2FML A;  1E79 G;  2CAZ C;  3ZMV A;  1MSD A;  5LGT A;  4PDV A;  2JK5 C;  2WSS G;  3D36 A;  4BW5 A;  3TET A;  1H38 A;  1HNX O;  3IFX A;  3SJQ C;  1BGY H;  4LP8 A;  4DR5 O;  4LWS B;  1AI4 A;  1QR8 A;  4IYI A;  4JTC B;  5FLX N;  4PI2 A;  2UXB O;  4IIJ A;  1W2B U;  3DGE A;  2RMK B;  5KAF Z;  2ZE8 A;  2P90 A;  3ABL C;  2F4V B;  3JD0 A;  3T1C A;  1JFF A;  2JS3 A;  2QGN A;  4WBN B;  4FFK A;  2YID A;  1GM8 A;  4H37 A;  2D2C B;  1YIJ V;  1HNZ O;  1M93 A;  4NB5 A;  3JAW B;  3FAV A;  5JQG A;  3RYI B;  4X1I B;  5LXT A;  4LC1 A;  3ZHT A;  1Y4M A;  2BSK A;  3P3N A;  1IVS A;  2ZNJ A;  2YEV A;  3CP1 A;  1RFY A;  3FAV B;  5IY5 C;  1YSC A;  4DV7 B;  2PY5 A;  3NXS A;  1QBZ A;  3K5N A;  4LF7 B;  4O4I A;  4IHJ B;  2WWW A;  2R9R B;  3CCE V;  1SKV A;  4MVQ A;  5JCO C;  4WFA V;  2X7R B;  3OE7 G;  1Q86 W;  3HPL C;  2W0F C;  4K8Z A;  2EIL B;  3U10 A;  4XDL A;  2DQ0 A;  5IT9 N;  5ITZ B;  1AR4 A;  3A2F A;  3FB5 C;  4X8A A;  4JI3 O;  4KHP O;  2E3C A;  1O9G A;  2WAM A;  2B1I A;  3HKC B;  3Q4H B;  4I9W A;  4F6R A;  3M7M X;  3R65 A;  3ABK B;  2EIM B;  2QM7 A;  2RNB A;  4B3T O;  5FNV A;  3WB2 A;  5LP6 C;  2JVD A;  2KB1 A;  2EX3 A;  5JQG B;  1QU7 A;  1W0K G;  1IZ3 A;  4IYH A;  2OTL V;  1OCO C;  4X1I A;  5CA1 B;  3JAL B;  1OCC B;  4CS4 A;  4FLY A;  1SZX A;  4JI6 B;  3CCJ V;  1Y76 B;  5LYJ A;  4WFH A;  4HYO A;  2A06 H;  3A0R A;  1BL8 A;  4W4L A;  4GCZ A;  1SQF A;  3WB1 A;  4QNH B;  1D2D A;  1IBK O;  1KKC A;  4X1Y A;  3ABT A;  3SYP A;  4DV5 B;  3OMA B;  5B5E Z;  1OCZ C;  4HNA B;  1SQG A;  3AK3 A;  2IU3 A;  1RSO A;  2XHB A;  1Y74 A;  4Q6G A;  4X20 A;  4J9Z B;  2WLL B;  3O9O A;  3STL C;  2PUS A;  3RW0 A;  3K5M A;  2EIK C;  3OT7 A;  2KSD A;  1ARO P;  2CK3 G;  3SPG A;  4FVM A;  3CCV V;  2HLD G;  4UVA A;  3FX7 A;  3B77 A;  3ZHV A;  2GUZ A;  4PI0 A;  1NU1 H;  4H13 B;  4DV1 O;  1KD1 W;  1FYJ A;  2IBZ H;  5DM6 V;  2LP7 A;  1AIL A;  3RBZ A;  4XDJ A;  2OTJ V;  4EB6 B;  3BPZ A;  3H1I H;  3AG2 B;  1JJ2 U;  1WA8 A;  2KG7 A;  2ZXW C;  4TV9 A;  5E1A C;  2QM4 A;  2JEU A;  2EIN C;  2GBO A;  2N74 A;  5ITZ A;  3JAR B;  1NTM H;  1DTO A;  2QTO A;  2OWO A;  4OX9 B;  1AI5 A;  1ZWI C;  2XAS A;  2YI9 A;  1NS1 A;  5JVD A;  3E89 A;  1Y6X A;  2GV9 A;  3R66 A;  1AJP A;  2Q5Z A;  3MHH C;  3JSN A;  1XL6 A;  3B8N A;  4JGS A;  2CUG A;  4DR6 B;  2HEP A;  1BE3 H;  2HHH O;  1Q90 D;  3OMN B;  5B1B C;  4U3J A;  3H01 A;  1FAF A;  4H33 A;  4JI7 B;  4NXM B;  2AGA A;  4YXW G;  2EIL C;  4CC5 A;  2HVJ C;  2DQ3 A;  4TWK A;  3W7T A;  2ZXW B;  1K5Q A;  4PJ0 Z;  3CRM A;  2F4V O;  2ZM6 B;  2CH7 A;  2Q6A A;  4D7T A;  4MVM A;  2UXB B;  3HKE A;  3MD0 A;  4B3M B;  4J11 A;  2YDE A;  2UXD B;  4A5U B;  1EBO A;  2AZ2 A;  1LR1 A;  1PV0 A;  4YHH B;  4IGG A;  1Z5V A;  3IJ4 A;  1BHA A;  1JR9 A;  2QWQ B;  3G6B A;  5J2U B;  3RN4 A;  5DED A;  4KFM A;  2OYQ A;  1Q3E A;  2JGU A;  3OTO O;  3L73 H;  3ABM B;  3FD9 A;  1N36 O;  4O4L A;  3TGU H;  3LSQ A;  3ZRS A;  1NH2 D;  5EBW C;  3P30 A;  4I4T A;  4LNU B;  4JI6 O;  1GM9 A;  1NR1 A;  4YJ2 B;  2R70 A;  1Y67 A;  3L9D A;  1ZL8 A;  4GUN A;  1BT8 A;  5B3S B;  4YY3 O;  4FLX A;  4EKW A;  4AQY B;  1PL4 A;  1YJW V;  1X4T A;  4R7C A;  2UUC B;  2OCC C;  1QVG U;  1YJN V;  4GZR B;  5IY5 B;  3CD6 V;  2UUB B;  1PL0 A;  4U7O A;  1MG1 A;  2JRI A;  3B09 A;  3CCM V;  5BMV A;  1QR9 A;  3FB8 C;  4N23 A;  2WLI A;  1KC8 W;  1DGS A;  1TUB A;  3BAA A;  1YXB A;  4PHZ A;  2JS5 A;  4LF8 O;  4MVS A;  3THO A;  5LOV B;  1B6Q A;  4UB8 Z;  1BZK A;  1ZAU A;  3ZBH A;  4DV7 O;  1Q5O A;  2Z0A A;  1TAE A;  1WB7 A; 
#chains in the Genus database with same CATH homology
 1H2G A;  2OCC B;  1R6K A;  3OAA G;  5EBM C;  2EBO A;  3I55 V;  1K4C C;  2GSM B;  2XAF A;  1Q7Y W;  1NVP C;  2IH3 C;  5H9C A;  1K34 A;  1OCC C;  3ASN B;  1PNK A;  2Q69 A;  3OEE G;  4JYC A;  2Y48 A;  4PDR A;  2QA4 V;  3FB6 C;  2NLJ C;  4MVO A;  2Q68 A;  3E8F A;  4RUF A;  3ASO B;  3F7V C;  3G71 V;  2EIM C;  3OR6 C;  5LHH A;  2IJI A;  1BHB A;  3E2E A;  4JAS A;  4UXN A;  5B1B B;  2ZR3 A;  4QJF B;  3ASN C;  2LFR A;  1CEZ A;  3B8M A;  4UUJ C;  5DN6 G;  3FYE B;  1Q82 W;  3G4S V;  2EIJ C;  2ATK C;  2EIJ B;  3CC2 V;  3QO7 A;  5IYB O;  1WLE A;  4DO2 A;  3EFF K;  2X6B A;  2P7T C;  4QIW F;  3ZIA G;  2Z5U A;  1K97 A;  4X89 A;  5C93 A;  1XL4 A;  3ASO C;  2HG5 C;  3I56 V;  1F23 A;  5BZB A;  4MVR A;  2NNU A;  1K73 W;  3GWO A;  1S76 D;  2WLI B;  3VBB A;  4QE7 A;  2M7W A;  1GM7 A;  3CCS V;  3MHS C;  1GTO A;  2WLK A;  3OFN G;  4UV9 A;  3E8G A;  4GX0 A;  1M56 C;  1VQL V;  4JAU A;  3K0G A;  3ZMZ A;  1JOY A;  1R73 A;  1V54 B;  3T2M A;  2DYR B;  4FJC C;  4CBC A;  1VQ6 V;  2LFS A;  3JD1 A;  1DF4 A;  4MTF A;  3CME V;  3ETD A;  3ML0 A;  3RVZ A;  1Y66 A;  3X2Q C;  1YTF B;  1NKD A;  2XAH A;  1FXH A;  5B1O A;  4PA9 A;  3LNM B;  3CYO A;  2A9H A;  1JVM A;  1S77 D;  5EBL C;  5KUK A;  1E79 G;  3ZMV A;  2IJJ A;  5LGT A;  5IYD O;  4GX5 A;  4PDV A;  3TCU A;  4MW3 A;  3ETE A;  5EC1 C;  4ZBM A;  2JK5 C;  2WSS G;  3AG1 C;  3D36 A;  4BW5 A;  3TET A;  1H38 A;  4WF9 V;  1W0J G;  3ZMT A;  1OHH G;  1QLE B;  1GKF A;  1VQ5 V;  3IFX A;  1JPX A;  4WFF A;  3SJQ C;  4LP8 A;  3KG2 A;  3E86 A;  1RPO A;  3OEH G;  5LGU A;  1ROP A;  3SYO A;  1AI4 A;  1L1F A;  1FXK B;  1QR8 A;  1E1Q G;  2B1G A;  4JTC B;  3W7X A;  1OCR C;  4BIZ A;  3AG2 C;  1W2B U;  4OXS A;  3DGE A;  3ABL C;  2P90 A;  2HJF C;  2Q67 A;  4BIU A;  3JD0 A;  4N21 A;  3LUT B;  3PJS K;  3T1C A;  1NJI W;  2AHZ A;  2HKO A;  1K33 A;  1K3E A;  1M90 W;  2DWE C;  1GM8 A;  4H37 A;  2F43 G;  5L3E A;  1YIJ V;  4DXW A;  2PI5 A;  2WLH A;  1VQ7 V;  4WFG A;  4R6Z A;  3CXC U;  4JTD B;  3SPC A;  4F4L A;  2DW4 A;  2W6I G;  5FL7 G;  3ZJZ A;  4BAY A;  3X2Q B;  3K04 A;  2A0L A;  2OT5 A;  4LC1 A;  4WCE V;  1YI2 V;  1Y4M A;  4R8C A;  1NR7 A;  4RQE A;  2ZQM A;  4QPJ A;  2DYR C;  3F5W C;  1COW G;  3K03 A;  4MW8 A;  1P7B A;  1OZ0 A;  3CCQ V;  5IDJ A;  2YEV A;  2JEX A;  4MTO A;  1FFT B;  3CP1 A;  5IY5 C;  2P67 A;  1YSC A;  3W7U A;  3NXS A;  3AG3 C;  1QBZ A;  3ZMS A;  3HB3 B;  3BY6 A;  2WWW A;  1AJQ A;  2MK3 A;  2R9R B;  3P32 A;  3CCE V;  4P9O A;  4MVQ A;  1MOF A;  4WFA V;  2UXX A;  2X7R B;  3OE7 G;  1Q86 W;  3HPL C;  2W0F C;  4GT1 A;  5LBQ A;  2EIL B;  3LSS A;  4XDL A;  1YTF D;  4GX2 A;  2DQ0 A;  3JD3 A;  1PD3 A;  5L3G A;  2DWD C;  5L3F A;  5CA3 A;  1VQ4 V;  1H8H G;  3FB5 C;  3OUF A;  3DTU B;  4X8A A;  3ETG A;  1RM1 C;  3D3I A;  1JQ0 A;  3CCL V;  3K06 A;  2WAM A;  1EFR G;  4QPK A;  2B5U A;  1HWY A;  2B1I A;  1KQS U;  1S0V A;  1CP9 A;  5H6Q A;  4I9W A;  4E2L A;  4MSW C;  3R65 A;  1Q81 W;  3ABK B;  4LBE C;  2EIM B;  1JCH A;  2QM7 A;  4WFE A;  1LNQ A;  1M57 B;  3W7W A;  2EZP A;  1I5Y A;  3BEH A;  3JD4 A;  2KB1 A;  1WPX A;  5EC2 C;  1FXK A;  5CMU A;  3SPJ A;  1W0K G;  4JAV A;  2OTL V;  1OCO C;  4FK5 C;  3SYA A;  3M99 B;  1SET A;  1R3I C;  3OM3 B;  1OCC B;  3E83 A;  1YIT V;  1YJ9 V;  5HFM A;  3F7Y C;  2XAG A;  5HFL A;  3ZRW B;  3CCJ V;  1G4Y B;  4WFH A;  4HYO A;  1VQ9 V;  3A0R A;  3AG4 B;  3TK1 A;  1BL8 A;  3ABL B;  4GCZ A;  4MTG A;  2WLL A;  4PA3 A;  4Q20 A;  4ASU G;  4QNH B;  3FYI B;  4FMT A;  4HAM A;  1FS0 G;  4JYB A;  2GHY A;  2EJR A;  3ABT A;  3SYP A;  1K7D A;  3OMA B;  3WFV A;  5J9P C;  1R6N A;  1OCZ C;  1SZT A;  2QKS A;  2IU3 A;  3OMI B;  2EIK B;  2X6C A;  1PKX A;  4HZ3 A;  5IYC O;  2H94 A;  4X88 A;  1PNL A;  4J9Z B;  3K08 A;  5CBH A;  2WLL B;  3ABU A;  1R3K C;  3STL C;  3RW0 A;  2D3O W;  3W7S A;  2EIK C;  3OR7 C;  1SRY A;  1K92 A;  1ARO P;  5B1A C;  1RM1 B;  2CK3 G;  3SPG A;  1E1R G;  1CPY A;  3CCV V;  2HLD G;  4UVA A;  4MS2 A;  5KA6 A;  1J95 A;  3B77 A;  5EK0 A;  2QE7 G;  3IC7 A;  1QLE C;  4P2Z A;  1K9M W;  1KD1 W;  2XAJ A;  3K0D A;  5DM6 V;  5LGN A;  1K5S A;  2LP7 A;  1NBM G;  1KKD A;  4CZZ A;  3AG1 B;  5CBG A;  1R3L C;  3RBZ A;  2V1D A;  2XND G;  3OW2 U;  2HVK C;  4XDJ A;  2JJ2 G;  2OTJ V;  1I5X A;  3AEI A;  1M9N A;  1K8A W;  1F4M A;  1KP2 A;  1V55 B;  4PA4 A;  4R50 A;  4P9P A;  1N8R W;  2X0L A;  4JTA B;  2Z3Y A;  3UKM A;  1VQO V;  2IU0 A;  1R3J C;  3AG2 B;  1RPR A;  4MTX A;  3ZN1 A;  3WG7 C;  5GW7 A;  1JJ2 U;  4RQF A;  1SER A;  1V55 C;  2ZXW C;  3STZ C;  3CMA V;  5L3C A;  2C2A A;  4UV8 A;  4GX1 A;  1VQP V;  4XDK A;  5E1A C;  1ENV A;  1QLN A;  1S3J A;  5LHI A;  2JEU A;  1OCO B;  2EIN C;  1AI6 A;  3CPW U;  5L3B A;  2H8P C;  1DTO A;  2QTO A;  1YTF C;  1AI5 A;  1DF5 A;  1ZWI C;  2XAS A;  4PDM A;  2ZDI C;  2BOC C;  2R9I A;  3E8B A;  4MVZ A;  4XBF A;  2JIZ G;  3ABK C;  3E89 A;  4G27 B;  1V54 C;  1AJP A;  1MAB G;  2FTK A;  4RUE A;  2QEX V;  3T4Z A;  3MHH C;  3ZMU A;  1FXV A;  1XL6 A;  3B8N A;  1EZJ A;  2A79 B;  4JGS A;  2P6J A;  3CC4 V;  1OCR B;  3OGC C;  2Y69 C;  3ABM C;  4U7N A;  5L3D A;  3OMN B;  3JCZ A;  1GMG A;  5B1B C;  1AJN A;  3H01 A;  2JJ1 G;  4I5S A;  4JPR A;  4H33 A;  4YXW G;  3SPH A;  3ZRX A;  2EIL C;  1JX9 A;  1G8M A;  2HVJ C;  2DQ3 A;  3E8H A;  4TWK A;  1S72 V;  2ITD C;  4QE9 A;  3LDE A;  3W7T A;  2ZXW B;  1K5Q A;  1M57 C;  3FKS G;  3GB7 C;  1NH2 B;  3ZRV A;  1H8E G;  2Q6A A;  2WPD G;  4MVM A;  2V7Q G;  1NQT A;  5KA5 A;  4RAI A;  1M56 B;  4UVB A;  4RO2 A;  3MD0 A;  3SPI A;  3AG4 C;  2DYS C;  4G2K A;  2DYS B;  2YEV B;  4WFB V;  4PA7 A;  4TT3 G;  2XAQ A;  1EBO A;  2K1E A;  2IJK A;  3JYC A;  4JF3 A;  1FXK C;  3UM7 A;  1NH2 C;  1KEC A;  3IGA C;  4PEL A;  3CCU V;  2BOB C;  4J9Y B;  3CCR V;  1P4R A;  2WLM A;  1BHA A;  2JDI G;  3OUS A;  1IXM A;  4PA6 A;  3ZRW A;  1YHQ V;  3QO8 A;  4P30 A;  4ZKI A;  2WLJ A;  5KUM A;  1QCE A;  4KFM A;  3K3W A;  1THZ A;  3AG3 B;  2Y69 B;  3ABM B;  4Z1M G;  2WLN A;  2QM8 A;  2ZD9 A;  5B1A B;  4UVC A;  1UJW B;  2ZDI A;  2EZO A;  3LSQ A;  3K79 A;  3ZRS A;  1NH2 D;  5EBW C;  3P30 A;  4LCU C;  3SYC A;  1GM9 A;  2W6J G;  1PNM A;  2YSU B;  1NR1 A;  2UXN A;  2EIN B;  1F51 A;  1NVP D;  1AR1 B;  5LHG A;  1GK9 A;  4G28 B;  4TSF G;  1QVF U;  1TUE B;  5B1N A;  3RVY A;  3CC7 V;  4FPP A;  4KP4 A;  5H6R A;  5B3S B;  5B3S C;  3ZCC A;  4EKW A;  1YJW V;  3QNE A;  1VQM V;  1VQK V;  3SYQ A;  4R7C A;  3VOU A;  1K4D C;  2OCC C;  1QVG U;  1ORQ C;  1YJN V;  3E35 A;  3LDC A;  5IY5 B;  3CD6 V;  1PL0 A;  3T4D A;  4U7O A;  1MG1 A;  3CCM V;  1NVP B;  2X6A A;  1QR9 A;  3WG7 B;  1F4N A;  3FB8 C;  1M1K W;  4N23 A;  2WLI A;  1AI7 A;  4KUM A;  4PDL A;  1KC8 W;  3G6E V;  2IJH A;  3EHB B;  1DLB A;  1KP3 A;  2ZR2 A;  3LDD A;  1VQN V;  1BMF G;  2HFE C;  3FB7 C;  1MSW D;  3ZN0 A;  2IH1 C;  2PI4 A;  3JD2 A;  5CN0 A;  4MVS A;  4L87 A;  1SES A;  2ITC C;  1S5H C;  1B6Q A;  1GO3 F;  3QO5 A;  5CBF A;  2XOK G;  3K9A A;  2AHY A;  4MT8 A;  1OCZ B;  1VQ8 V;  2IW5 A;  2HR3 A;  4MVU A;  4FIP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...