2DN9A

Solution structure of j-domain from the dnaj homolog, human tid1 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
GSSGSSGDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis, chaperone
molecule keywords DnaJ homolog subfamily A member 3
publication title Solution structure of J-domain from the DnaJ homolog, human Tid1 protein
rcsb
source organism Homo sapiens
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2dn9A01
2CTRA 2YS8A 1N4CA 1BQZA 2QWRB 2YUAA 1XBLA 1GH6A 3UCSC 3APOA 3UO3A 1HDJA 2QSAA 2CTPA 3AG7A 2LO1A 2M6YA 2EJ7A 2CTQA 1BQ0A 2LGWA 4IT5A 3APQA 1IURA 2DMXA 2OCHA 4RWUA 2Y4UA 2L6LA 2QWNB 2CTWA 2GUZB 2N04A 2QWOB 2GUZA 2DN9A 2PF4E 4J7ZA 2QWPB 2QWQB 1FAFA 1NZ6A 4J80A 3UO2A 2Y4TA 2KQXA 1WJZA 1FPOA 3BVOA 2N05A 2CUGA
chains in the Genus database with same CATH superfamily
5BY1A 4FZ1A 3FD9A 4X8AA 1TVKA 1GN6A 4FM1A 3P32A 3K0DA 1L8DA 2PTMA 5H9CA 5EC2C 1TUBB 1AROP 2XASA 1K7DA 3ASNB 4DV5O 4DR4B 1RP3B 4TV9B 3RYIB 3WU2Z 3K79A 3CCMV 1XEQA 2Y0PA 1IURA 1Q86W 2L6LA 3AG3B 3RW0A 2VRZA 1KMIZ 1SZTA 3K04A 3QG5A 4BIZA 3G6EV 2QDOA 1M56B 4UCOA 1O9HA 2ITDC 2F43G 4DV1O 1N8RW 3LDCA 4TV9A 3RYIA 4NYKA 2EIKC 1VF6A 5TISZ 2XAJA 3BFRA 4WFAV 3HKEB 3SJQC 4TUYA 4B3SO 1BHBA 1GKFA 1QU7A 2G38A 1XL6A 1OCZB 2WLIB 5KUKA 1AP6A 4X62B 1NTMH 2KB1A 1M93A 1GK9A 4JI1B 4JTDB 2LQTA 3JD4A 3J80N 4DR3O 2WPDG 2H8PC 2ILMA 4GKJO 4UXNA 5B1BC 3MHSC 3TCUA 4P9PA 3A0BZ 1V9PA 3FAVA 3A2FA 4EKWA 4ZI7B 3CXHF 5E1AC 2GV9A 3OR7C 4PA7A 4ZBMA 3SPGA 2XUMA 4GLXA 4K3AA 4NXMB 4LF4O 1SZXA 3KKYA 2Y69C 1K4DC 5KHIA 4QNHB 3LDEA 1YZBA 4MS2A 3JATB 1PD3A 2GBOA 3SYCA 1H2NA 2X6BA 4IGGA 3E83A 5C93A 2ZIOA 2ZNIA 3RVZA 4B7KA 4DR1O 1QR9A 4ZI7A 3CCUV 3JARA 2XAQA 1LUWA 1VMGA 5L3EA 1N33B 4MTOA 2UXCB 3C3SA 1FJGO 4DV5B 1KKDA 2JVDA 2QKSA 1F7YA 2OCCB 4KHPB 1JMKC 1I94O 2VWJA 1ROPA 1Q6IA 3ZIAG 1KC8W 1N36B 1L0NH 2BOBC 5KAIZ 5AG2A 1N34B 1D2DA 1MMMA 4CC6A 3OR6C 4HBNA 4NTXA 3P3PA 1YJWV 4B3RO 2E5LB 2RCVA 2JK5C 2W0FC 5IYBO 4XBFA 1XNQO 4UCRA 4LFAO 2GUZB 1N32O 3GWKC 4UB8Z 1H8EG 3VBBA 2ZM6O 5LGTA 4F6RB 1H2SB 1XNRO 5BZBA 3FYIB 5FNVB 4FLXA 3K5NA 2D3OW 1NQTA 2UXNA 1AI5A 3ABKC 3VQYA 2ZR2A 1W0JG 4AHCA 1M4UA 2QKAA 3SGIA 1BSMA 2NN4A 4FZ0A 5GONB 4J7JA 2KSDA 5D5PA 2GUZA 1AILA 4DR5O 4LF9O 3CRQA 3A0RA 2KG7A 3ZHRA 4WFGA 1SF9A 2AHZA 1HNXO 3HR0A 2F1MA 5B3SB 5FNVA 1BQZA 4X66O 1KYOF 1URFA 4Z1MG 2CTPA 1VF5B 3DSQA 1OCOB 2IH3C 4JAAA 3K59A 1Q6UA 3IGAC 4DW1A 1MSDA 4L8JA 2X7RB 5GONA 3KCXA 4FFBA 1BHAA 3BHPA 1PNMA 1S5LZ 2UXDO 3AG4C 1VQ7V 5LMNB 2JGDA 1WB7A 3OD4A 2QM8A 4DR2O 4KP4A 1K97A 1XUQA 4JYAB 2CGNA 1R6NA 3QNEA 4QE7A 4FLVA 1F4NA 1SQPH 1AJNA 5KHGA 1PKXA 4JI0O 4F4LA 2DN9A 3CCVV 2IJKA 1COWG 1R3KC 4FLWA 4WFBV 5KMGB 4W4LA 2P7TC 3L70H 5B1AC 4NXNO 2CUGA 2DYRC 4LCUC 1SQXH 1KUQA 3AG2B 2ZINA 3ZRXA 3ASOC 1KECA 2OIEA 5BMVB 4B3MO 4X1KB 2N74A 4TT3G 1MA1A 2W6IG 4IIJB 3CX5F 3ZMVA 1Y6XA 2Q0AA 4DV2O 5KMGA 3OMAB 1IBMO 5K1PA 2YS8A 4DV4O 1L1FA 3JCZA 1AI7A 1EZJA 2D2CB 5BMVA 4X1KA 2OTJV 1L0LH 3L71H 2CTWA 4DV6O 1P7GA 3B40A 1JJ2U 1W59A 4MT8A 4JI5O 3ZMTA 1JPXA 3FB6C 3JYCA 3BVOA 3B4SA 3K9SA 1KD1W 1H38A 4DUZO 2WAMA 4XDJA 3GWOA 4ABMA 2Z5UA 2A7WA 3SR2C 1VQMV 4DUYB 4BWAA 1WB8A 4Q20A 3G71V 4JI4O 2DW4A 1PNLA 4H0LB 2B1GA 2QTSA 2XOKG 2YI9A 3B2EE 2XNDG 1BQ0A 4JASA 3ZN1A 4FIPC 2ZT9B 2ADPA 3E86A 3BPZA 4B3TO 1AJPA 1KB9F 1Y76B 2A9HA 2OT5A 2QE7G 1QR8A 1WJZA 3ABTA 1FKAO 1K4CC 1R3IC 1XREA 1F51A 2P06A 2YIBD 1QQCA 4O4IB 1DF4A 4B3MB 2LO1A 1J5EO 2FTKA 2BCCH 3RFRA 1FXHA 1X4TA 4JI6B 4AQYO 2QWQB 1DGSA 3ZMSA 1Y76A 2UU9O 4NKGB 5EC1C 1QLEB 1BS3A 3ETQA 4I4TB 3EFFK 1B04A 2LGQA 4O4IA 1OCCC 3SPHA 5L3GA 3PJSK 5IE9A 4X64O 3S3XA 5GTHZ 2E74B 4UV9A 4YIPA 1GRJA 1SQBH 1XQ8A 4JI5B 3J7AU 3OUFA 1I5XA 1YSCA 1Q82W 4J41A 4TQDA 4FM2A 2QJ1A 3A0HZ 3GB7C 4I4TA 1NS1A 2EJ7A 2B1IA 3CXCU 3CC4V 4DV3O 2EZPA 3C90A 3OAAG 2WA4A 3M99B 2JEUA 1HWYA 2CDYA 3ZN0A 2P67A 4UVBA 3WFVA 5L3CA 3B77A 5HFMA 4XDKA 3OEEG 3WB2A 1GH6A 1HNWO 4GX5A 3L73H 4I9QA 2IW5A 3ETGA 2HR3A 4OX9B 2YDEA 2JGUA 4WF9V 4PELA 1SETA 3CMAV 1MZEA 1R3JC 1FXKB 4LH6A 4YY3O 3K5OA 2ZD9A 2AHYA 4E2LA 4IYHA 3RYHB 1FXVA 1J5EB 5ITZB 2AXTZ 1PNKA 1B06A 4LF6B 2H3OA 3ZHVA 1VEWA 4D6TH 4IT5A 1BL8A 2HJFC 1WP7A 1SESA 2P90A 4X1YB 1KBHA 3JAWB 2N05A 5DM6V 1FXKA 4MTFA 3G4SV 1ENVA 2L35A 4UCVA 3RYHA 4DR6O 5ITZA 2LFRA 3CRAA 3ZRSA 5L3FA 4B08A 2XTAA 4TV8B 2GTAA 4CH5A 4X1YA 4FMTA 5EBLC 1H8HG 4YHHO 1X59A 1JVMA 2DQ0A 2JIZG 4CC5A 1WA8B 5B1OA 2ZXWC 5J2TB 1BZKA 5IYZB 4JAUA 2HJDA 1CPYA 4MVUA 2F4VO 1GO3F 3NR7A 3ABUA 4TV8A 1AR4A 3I56V 3AK3A 4X89A 5KA6A 4MSWC 3SPIA 4GUNA 4D7SA 2OIGA 1WA8A 1HNWB 1P49A 2AZ2A 3RYFB 1FS0G 5J2TA 2PZSA 4ZIBA 1JA8A 3SYPA 1SA0B 3ASNC 1XMOB 2LW7A 1AB3A 1CP9A 3AG3C 1VF6C 3O65A 1PL4A 3OMNB 1HR0B 3CPWU 3K9AA 5IY5B 2OTLV 4JI7B 1M56C 3F5WC 1JQ0A 2PY5A 3APOA 1VIBA 3RYFA 4XDLA 1Q6HA 2H94A 3ZJZA 4JI3B 1SA0A 3L72H 4DR7O 2EIMB 5KHJA 1TGOA 2DQ3A 2UUAB 3VQWA 3R66A 5IDJA 4X65O 2UXBO 1AI6A 3W7SA 3FB7C 5KUMA 1M57B 1OCZC 4IYIA 1TUBA 3FB5C 4FLTA 2IU3A 4C7UA 4E4EA 2X6CA 3OW2U 2WSSG 3U10A 3QO7A 1IBKO 3E8BA 2XAHA 4JAVA 1ZL8B 2YIDA 2BSKB 4YHHB 2UUCB 4FPPA 2YXYA 4KL1A 3H1KH 4JI2B 1Z2GA 2P22C 4BW5A 3F7VC 5EZYB 4R6ZA 2F4VB 4I55B 3DC5A 4LF8O 1HNZO 5BR8O 4LF7O 5DN6G 4OXSA 5JJNB 4DV0B 4RUFA 2IU0A 4EFBA 2BSKA 1YI2V 1Q7YW 4JI8O 1XHZA 3HKEA 4PDLA 4GCZA 2ZE5A 4PDMA 1H2KA 2WLIA 3ZX6A 4LFCO 3M7MX 2CAZC 2HHHO 5EZYA 4D7TA 2ATKC 1H2GA 4I55A 2ETNA 5CA3A 2OCCC 1W2BU 3CD6V 5IYDO 1NH2D 3FYEB 3T2MA 1NZ6A 4CH4A 4PD4F 2Y4TA 1GTOA 4JGSA 1XBLA 1M9NA 3OUSA 4JYCA 2A3QA 1YITV 1XILA 4IHJB 2HVKC 2K1EA 3IAYA 5IYCO 4DR7B 1YVWA 3T1HO 1BCCH 2LJ2A 4BW9A 5DEDA 4AILC 2OYQA 5EIBD 1KQSU 1HW7A 2Q7GA 3JATA 5LBQA 4LC1A 1P7BA 1ZSPA 1GN4A 2JDIG 1G8MA 3WG7B 2B9ZA 4FLYA 1K34A 4ZHQB 1S5JA 3DXRB 1Y74B 2V1DA 2YXLA 2HVJC 4ASUG 1BE3H 4DV1B 2ITCC 4QGPA 2M6YA 3BY6A 2DE0X 2IJIA 3EHBB 3VQXA 4IHJA 1NKDA 1K73W 3T1YO 4O4LB 1OCRB 1UPGA 4J7ZA 4B3SB 3LNNA 4R7CA 5H2FZ 2QTOA 4JTAB 1KKCA 1JJOA 4ZHQA 1Y74A 5B3SC 3KG2A 5H6QA 5LXTB 4MTXA 3H1IH 3HKDB 2LFSA 4DR3B 1OCOC 4GKJB 2GSMB 4A5UB 4O4LA 3K08A 4KXRA 3JALB 1JR9A 1WNSA 2HFEC 1VQKV 1US6A 5LHIA 5J2UB 2Q5ZA 1GM9A 4F6RA 3E2EA 3OMIB 1SQQH 2E3CA 3ZRWB 3HB3B 4LFBO 2RDCA 4FLZA 1HDJA 5LXTA 1SERA 3RT3C 4LF4B 4CZZA 3HKDA 2Q8VA 3TETA 4LWSB 4BIOA 3JALA 3CCEV 3ZEDA 3MAQA 3P3NA 4DR1B 5J2UA 5FPRA 4ICGA 4FVMA 2RN9A 2Y0IA 1NT2B 2WLMA 1FJGB 2NNUA 1XMQO 3AG7A 1D5AA 3AG2C 4GYCB 1I94B 1K8AW 1NU1H 2X6AA 4LWSA 1YXBA 3D3IA 1Z5WA 1VQNV 5JCOA 1VP7A 3UO2A 4OPAA 4MVOA 3CCQV 2QR4A 3SJAC 1IX9A 2IJJA 2EULA 4B3RB 2Q9LA 3K5LA 3CHXA 1SS3A 2W6JG 1JCHA 3OM3B 4DW0A 4MVRA 1XNQB 3APQA 5KHHA 3CMEV 5C8YB 4LFAB 5KHKA 5JJJB 2WLLB 1N32B 4RO2A 3GVMA 2ZM6B 3RGBA 1XNRB 2EJRA 2EIJB 4J11A 4PA4A 2WLKA 2RMKB 1BMFG 2YICA 3SYOA 1N0JA 4JV5O 1NH2B 3OT7A 3JAKB 2QWNB 3PN1A 3X2QB 5C8YA 2ZDIA 3ML0A 5GW7A 2QEXV 4IIJA 2P5OA 5E79Z 4DR5B 4LF9B 2F93B 1IBLO 3RWRD 1VQ4V 1HNXB 3HKCB 1WPBA 1G6UA 3KCYA 2ZQMA 1OZ0A 3OE7G 4X66B 1G4YB 3ETDA 1V54B 2ADQB 3JAKA 2R9AA 1NR7A 1P84F 4J10A 2UXDB 1BGYH 2P6JA 4J9ZB 1FAFA 4PI0A 3HKCA 4H44B 4DR2B 1H2MA 2CK3G 5EYPB 1OHHG 4U7NA 1S5HC 3D8CA 3JASB 4U7OA 5LP6B 2Q68A 2VQFO 3KZIZ 3LUTB 1IZ3A 3HKBB 5IJ0B 4QIWF 1ZAUA 2K9PA 4JI0B 3B8MA 4FJCC 3L75H 2FKXA 1PV0A 1QNMA 3FB8C 4EB6B 4I5SA 2M7WA 1MZFA 2HKOA 4NXNB 1S77D 2HEPA 1YHQV 1U97A 1AR1B 5EYPA 4DXWA 1QLEC 2VQEO 3C3TA 3JD3A 4MVSA 4L87A 3STZC 1HP8A 4JYBA 3K03A 5LP6A 5HFLA 2XAFA 1GMGA 3NXSA 2ZCEA 4DV7O 5IJ0A 3CC2V 1KP2A 2QWOB 2ZIMA 4WFHA 4DV2B 5CA0B 5GTIZ 1XDCA 1T5EA 5J9PC 1QCEA 1IBMB 4EB6A 4QPJA 5KA5A 3SYQA 4HAMA 4DV4B 3SJCC 2BTOA 4G27B 4J42A 2DYSB 4HYOA 3W7UA 3F7YC 4CS2A 2EILB 2PI4A 4RWUA 2JJ2G 4J9YB 4PDVA 4MVZA 4DV6B 4F6EA 1VARA 3ETEA 3K0GA 4HNAB 1IXMA 3FFQA 5CA0A 1XI1A 1EM1A 5L3BA 1MNGA 4K8XA 1K33A 3FX7A 1J95A 1E79G 5IJ9B 4DUZB 3CRRA 1GN3A 4GX2A 3AG1B 4PI2A 4WBNB 2Q67A 2YI8A 1NR1A 1UFIA 2Q7HA 3LSUA 2UUBO 1NVPD 4JI4B 4HNAA 1SRYA 4O2AB 1FPOA 1YIJV 1GAXA 1PM9A 1NTZH 1V55B 4ZOLB 2P4VA 3CCSV 1FXKC 3BEHA 4KFMA 5IJ9A 2E76B 3JCUZ 3MDSA 1JFFB 3D36C 4DRXB 2B5UA 2XT9A 1TAEA 4FLUA 1JOYA 1VF7A 4WBNA 4BR6A 4B3TB 3QF7A 2GTSA 3D3QA 5JQGB 3ZRVA 3OTOO 2AW9A 4O2AA 3CEIA 3K06A 1VQ8V 1VQOV 1AVMA 4ZOLA 4P2ZA 1MABG 1H2LA 3ABLB 3T1CA 3TXSA 5IWAO 1ZLZA 3DC6A 1YEWA 4DRXA 2ZE7A 2P4KA 2ZE8A 1F4MA 2GDSA 1VQLV 5LMUO 4AQYB 4JTCB 4X1IB 4QJFB 1GM7A 2UU9B 3U11A 5JQGA 1U96A 1PP9H 3UT5B 1Y4MA 2OWOA 1ZWIC 2FYUH 1UJWB 2YEVB 3D36A 4KUMA 3BABA 4FK5C 1Q90D 4O2BB 4X64B 4DR4O 2IH1C 2WLHA 1P4RA 1RFYA 5F2VO 2EINB 3H1JH 3CJHB 4X1IA 1M5IA 1W0KG 1Q81W 4NTWA 4UFZA 3UT5A 3JAWA 4GZRB 3FKSG 3W7WA 4JZGA 3EVKA 1E1RG 2YEVA 2CTQA 4O2BA 4EFEA 2BTQB 2C2AA 3CP1A 5KX5B 4DV3B 5K1XA 3CJHA 1MSWD 3IJ4A 4X62O 3CCJV 2Z0AA 5IY5C 2LP7A 5D5QA 5IYZA 3T4DA 4I0XB 5JH7B 3SPJA 2DMXA 1B3QA 2BTQA 1SC5B 5CBHA 5KX5A 1S76D 3RN4A 3EXAA 2EIMC 4G28B 4UVCA 5LGUA 2AGAA 1Y67A 2FB5A 4YY3B 4WCEV 2Y48A 2JRIA 1RM1B 3WB0A 2YIBA 4BAYA 3OEHG 2MW2B 1M57C 3K3WA 5IWAB 4NB5A 2BOCC 1S72V 1PPJH 1A32A 4I0XA 4NXMO 1F23A 5JH7A 3N2GB 1RPOA 1NBMG 2X0LA 5LMUB 4GKKO 3ABMB 1EN4A 3M8AA 3SYAA 1S0VA 5JWPA 1VQ5V 3WB1A 5FL7G 4LH7A 1Y66A 3AEIA 3O9OA 3CE2A 2QM7A 1N33O 1B6QA 4DR6B 4EEQA 2UXCO 1Z5VA 2A79B 1K5QA 2VWKA 4KHPO 1YCIA 4RAIA 3N2GA 4IL6Z 1NVPB 4LR3A 4K0KO 4TUYB 1N36O 2QM4A 2PGGA 1N34O 1M1KW 2DWDC 5LGNA 2ODMA 3UO3A 1Q8IA 3LDDA 4PA6A 2E5LO 4P30A 4N23A 4Q6GA 1G1XB 3THOA 4HZ3A 4YJ3B 1CEZA 2DWEC 3FAVB 2N04A 2CE4A 1ZL8A 1DF5A 3F5TA 3L74H 1SQGA 2DJVA 5L3DA 4H13B 3LSQA 1VQ6V 4UUJC 2AZ0A 2QWRB 3ZHTA 5EBWC 2RQ6A 5B1NA 2ZR3A 3E8FA 2RJZA 2V4DA 2YXHA 2EIKB 3CRCA 3K57A 4RQFA 4YJ3A 3IFXA 3N27A 1ZX3A 1EN5A 3JAMN 1YF2A 3JARB 1IDSA 3OTFA 1CXZB 5FLXN 2IBZH 3WG7C 1SQVH 4CH3A 4UCSA 2WWWA 5LA6B 5B1BB 3LSSA 4GKKB 2UXBB 1M90W 4X65B 1ZTEA 1OCRC 5FPOA 4J80A 3JD0A 3SDLA 3ZHUA 2KQXA 3UKMA 4X20B 1AI4A 5LMNO 1Q5OA 3ZMZA 1IXBA 5JVDB 5LL6Y 3H1LH 4NTYA 2Y69B 3B09A 2CH7B 3L9DA 4JYAO 5KLVH 1IBKB 5LA6A 3IC7A 2OCHA 2JS3A 2Y4UA 5LHHA 4K0KB 4YXWG 3RVYA 1VQPV 1THZA 3ZS8C 4CS3A 2R9IA 1R1BA 2IM9A 4DK0A 1DTOA 4BIUA 1K92A 1K5SA 1XL4A 1OJHA 4X20A 4UCUA 3AK2A 5JJEB 3W7XA 3QO8A 3JD1A 5JVDA 1R6KA 2YUAA 3DXRA 4Z2WA 3I55V 4LF8B 1WAZA 4X88A 1HNZB 5BR8B 1I5YA 3TJTA 1OV9A 2CH7A 4LF7B 3J81N 5LHGA 4UB6Z 3E35A 3BRCA 1QLNA 1R3LC 1YJ9V 5H5NA 5LOVB 1QVGU 3UQ8A 2KG7B 4JI8B 3CWBH 4CH6A 5CN0A 5JCOC 5CBGA 2NLJC 2ZE6A 4LFCB 3Q4HB 2HLDG 2PYJA 2HG5C 1E1QG 2HHHB 4MVMA 2HP8A 4DO2A 3SJBC 3DTUB 1JX9A 4MW3A 2QGNA 4FFBB 2O57A 3LNMB 5LOVA 3OGIB 1WLEA 3JD2A 2JGDB 3JSNA 4TWKA 3VOUA 4GT1A 3OGCC 3ABKB 3Q4HA 1AP5A 2V7QG 3ZRWA 1Q3EA 4JPRA 1EN6A 3CC7V 4RQEA 3T1HB 3A8TA 4DK1A 3RBZA 4DUYO 2ZDIC 2A06H 2Q4PA 1YDXA 3CRMA 2GHYA 3JSLA 2EIJC 4NVPA 1NJIW 1SQFA 4WFFA 5EBMC 1BT8A 5CA1B 3RYCB 4O4JB 2FMLA 1RSOB 3T1YB 3N2KB 1K9MW 3AG4B 3X2QC 3TK1A 4PJ0Z 4YIOA 1N0NA 1QHTA 4OPHA 3K58A 3HPLC 2R72A 2EX3A 4YJ2B 5A9GA 1MOFA 2MK3A 3BCCH 2YSUB 1XHXA 3I5DA 4QPKA 5CA1A 1TUEB 2R70A 4O4JA 3RYCA 1RSOA 1V54C 2Q0OC 3VQVA 3N2KA 5EIBC 4JI6O 2PF4E 1XOUA 2WLLA 2JS5A 1EBOA 4OGQB 5B1AB 2DYRB 1SKVA 1DK1A 4YJ2A 2YIAA 3ASOB 4LFBB 5KAFZ 3UM7A 1LUVA 5B66Z 1YJNV 2EBOA 3BA9A 1FFXB 1PL0A 3DGEA 5LP6C 1IVSA 2QWPB 1FYJA 4B7EA 2JEXA 2CGOA 1I7FA 3E22B 1FD9A 2VS0A 2DOSA 4W4KA 1XMQB 1NTKH 1S3JA 1KP3A 3AK1A 2A0LA 1FFXA 2YC0A 2F95B 4H37A 5LYJB 4FFKA 2NR5A 2PI5A 4U3FH 4LNUB 3OFNG 3B8NA 4LF5O 5A2QN 2R9RB 3CYOA 3E22A 1YTFD 2ZNJA 4LBEC 3JASA 4PA9A 4DYLA 4OX9O 2DYSC 1AR5A 2ARHA 1KU9A 2EILC 3HKBA 3CSXA 5LYJA 5BXZA 4I9WA 4LNUA 4PA3A 2WA3A 3E8GA 2JJ1G 4NR1A 3CCLV 2PUSA 4R50A 4RUEA 4UV8A 4FM0A 2Q7EA 1GM8A 1EFRG 4I7ZB 2E75B 1LR1A 2LGWA 4LF6O 4JV5B 4PV1B 2LW1A 3MD0A 4R8CA 3W7TA 3AG1C 3TXQA 3G80A 1IBLB 1EZVH 2BE3A 5CMUA 4CS4A 4LP8A 3E89A 1D5NA 4ZKIA 1Q43A 1N4CA 5H6RA 3QTCA 2WLJA 3ZHSA 3IC9A 4K35A 4MVQA 4Z1VA 3P30A 1V55C 4I50B 1LNQA 3ZMUA 5B5EZ 3S3WA 3CS5A 1DLBA 2Q6AA 1O9GA 3TGUH 2Z3YA 2F66C 1OCCB 3MHHC 2FL4A 4I50A 2XAGA 2VQFB 2W0XA 3ABLC 4G2KA 4GX1A 4TSFG 3H9VA 3K5MA 1NI8A 3QVNA 4LF5B 4JZ2A 3UCSC 2VQEB 4H33A 3H01A 4X9QA 3G6BA 1JFFA 3ICXA 4DV7B 1ZUQA 1XMOO 3ZCCA 1AJQA 4MTGA 5IT9N 3ZHQA 5EK0A 2EINC 1ORQC 1VQ9V 2ZKOA 1WPXA 1HR0O 3SPCA 2IJHA 1WP8A 4JYYA 1I08A 4JI7O 1R73A 4AI8A 4PHZA 2QSAA 2KKWA 1MG1A 1TA8A 4J7KA 5DECA 2UXXA 2RNBA 4UCTA 5CB4B 4JI3O 4GX0A 2QKCA 3E8HA 2UUAO 3T4ZA 1R6TA 4JF3A 1QVFU 1RPRA 2WLNA 2CTRA 5CBFA 4WFEA 1WN7A 3G67A 4MW8A 3H1HH 4CBCA 3R65A 2Q69A 4TQFA 2XHBA 4O4HB 2F23A 5CB4A 4U3JB 4QE9A 1GN2A 2UUBB 1FFTB 3QO5A 3BA8A 1YTFB 2UUCO 1K3EA 4JI2O 4UVAA 3CB2A 1RM1C 3BAAA 4K8ZA 4TOIA 1TVKB 4JI1O 3CCRV 3STLC 4O4HA 4N21A 4P9OA 1I0HA 3U0ZA 4U3JA 3ZBHA 4DV0O 2Q73A 4PDRA 2QA4V 1QBZA 2PYLA 2EZOA 3ABMC 3OTOB 2ZXWB
chains in the Genus database with same CATH topology
2CTRA 2YS8A 1N4CA 1BQZA 2QWRB 2YUAA 1XBLA 1GH6A 3UCSC 3APOA 3UO3A 1HDJA 2QSAA 2CTPA 3AG7A 2LO1A 2M6YA 2EJ7A 2CTQA 1BQ0A 2LGWA 4IT5A 3APQA 1IURA 2DMXA 2OCHA 4RWUA 2Y4UA 2L6LA 2QWNB 2CTWA 2GUZB 2N04A 2QWOB 2GUZA 2DN9A 2PF4E 4J7ZA 2QWPB 2QWQB 1FAFA 1NZ6A 4J80A 3UO2A 2Y4TA 2KQXA 1WJZA 1FPOA 3BVOA 2N05A 2CUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTR A;  2YS8 A;  1N4C A;  1BQZ A;  2QWR B;  2YUA A;  1XBL A;  1GH6 A;  3UCS C;  3APO A;  3UO3 A;  1HDJ A;  2QSA A;  2CTP A;  3AG7 A;  2LO1 A;  2M6Y A;  2EJ7 A;  2CTQ A;  1BQ0 A;  2LGW A;  4IT5 A;  3APQ A;  1IUR A;  2DMX A;  2OCH A;  4RWU A;  2Y4U A;  2L6L A;  2QWN B;  2CTW A;  2GUZ B;  2N04 A;  2QWO B;  2GUZ A;  2DN9 A;  2PF4 E;  4J7Z A;  2QWP B;  2QWQ B;  1FAF A;  1NZ6 A;  4J80 A;  3UO2 A;  2Y4T A;  2KQX A;  1WJZ A;  1FPO A;  3BVO A;  2N05 A;  2CUG A; 
#chains in the Genus database with same CATH topology
 5BY1 A;  4FZ1 A;  3FD9 A;  4X8A A;  1TVK A;  1GN6 A;  4FM1 A;  3P32 A;  3K0D A;  1L8D A;  2PTM A;  5H9C A;  5EC2 C;  1TUB B;  1ARO P;  2XAS A;  1K7D A;  3ASN B;  4DV5 O;  4DR4 B;  1RP3 B;  4TV9 B;  3RYI B;  3WU2 Z;  3K79 A;  3CCM V;  1XEQ A;  2Y0P A;  1IUR A;  1Q86 W;  2L6L A;  3AG3 B;  3RW0 A;  2VRZ A;  1KMI Z;  1SZT A;  3K04 A;  3QG5 A;  4BIZ A;  3G6E V;  2QDO A;  1M56 B;  4UCO A;  1O9H A;  2ITD C;  2F43 G;  4DV1 O;  1N8R W;  3LDC A;  4TV9 A;  3RYI A;  4NYK A;  2EIK C;  1VF6 A;  5TIS Z;  2XAJ A;  3BFR A;  4WFA V;  3HKE B;  3SJQ C;  4TUY A;  4B3S O;  1BHB A;  1GKF A;  1QU7 A;  2G38 A;  1XL6 A;  1OCZ B;  2WLI B;  5KUK A;  1AP6 A;  4X62 B;  1NTM H;  2KB1 A;  1M93 A;  1GK9 A;  4JI1 B;  4JTD B;  2LQT A;  3JD4 A;  3J80 N;  4DR3 O;  2WPD G;  2H8P C;  2ILM A;  4GKJ O;  4UXN A;  5B1B C;  3MHS C;  3TCU A;  4P9P A;  3A0B Z;  1V9P A;  3FAV A;  3A2F A;  4EKW A;  4ZI7 B;  3CXH F;  5E1A C;  2GV9 A;  3OR7 C;  4PA7 A;  4ZBM A;  3SPG A;  2XUM A;  4GLX A;  4K3A A;  4NXM B;  4LF4 O;  1SZX A;  3KKY A;  2Y69 C;  1K4D C;  5KHI A;  4QNH B;  3LDE A;  1YZB A;  4MS2 A;  3JAT B;  1PD3 A;  2GBO A;  3SYC A;  1H2N A;  2X6B A;  4IGG A;  3E83 A;  5C93 A;  2ZIO A;  2ZNI A;  3RVZ A;  4B7K A;  4DR1 O;  1QR9 A;  4ZI7 A;  3CCU V;  3JAR A;  2XAQ A;  1LUW A;  1VMG A;  5L3E A;  1N33 B;  4MTO A;  2UXC B;  3C3S A;  1FJG O;  4DV5 B;  1KKD A;  2JVD A;  2QKS A;  1F7Y A;  2OCC B;  4KHP B;  1JMK C;  1I94 O;  2VWJ A;  1ROP A;  1Q6I A;  3ZIA G;  1KC8 W;  1N36 B;  1L0N H;  2BOB C;  5KAI Z;  5AG2 A;  1N34 B;  1D2D A;  1MMM A;  4CC6 A;  3OR6 C;  4HBN A;  4NTX A;  3P3P A;  1YJW V;  4B3R O;  2E5L B;  2RCV A;  2JK5 C;  2W0F C;  5IYB O;  4XBF A;  1XNQ O;  4UCR A;  4LFA O;  2GUZ B;  1N32 O;  3GWK C;  4UB8 Z;  1H8E G;  3VBB A;  2ZM6 O;  5LGT A;  4F6R B;  1H2S B;  1XNR O;  5BZB A;  3FYI B;  5FNV B;  4FLX A;  3K5N A;  2D3O W;  1NQT A;  2UXN A;  1AI5 A;  3ABK C;  3VQY A;  2ZR2 A;  1W0J G;  4AHC A;  1M4U A;  2QKA A;  3SGI A;  1BSM A;  2NN4 A;  4FZ0 A;  5GON B;  4J7J A;  2KSD A;  5D5P A;  2GUZ A;  1AIL A;  4DR5 O;  4LF9 O;  3CRQ A;  3A0R A;  2KG7 A;  3ZHR A;  4WFG A;  1SF9 A;  2AHZ A;  1HNX O;  3HR0 A;  2F1M A;  5B3S B;  5FNV A;  1BQZ A;  4X66 O;  1KYO F;  1URF A;  4Z1M G;  2CTP A;  1VF5 B;  3DSQ A;  1OCO B;  2IH3 C;  4JAA A;  3K59 A;  1Q6U A;  3IGA C;  4DW1 A;  1MSD A;  4L8J A;  2X7R B;  5GON A;  3KCX A;  4FFB A;  1BHA A;  3BHP A;  1PNM A;  1S5L Z;  2UXD O;  3AG4 C;  1VQ7 V;  5LMN B;  2JGD A;  1WB7 A;  3OD4 A;  2QM8 A;  4DR2 O;  4KP4 A;  1K97 A;  1XUQ A;  4JYA B;  2CGN A;  1R6N A;  3QNE A;  4QE7 A;  4FLV A;  1F4N A;  1SQP H;  1AJN A;  5KHG A;  1PKX A;  4JI0 O;  4F4L A;  2DN9 A;  3CCV V;  2IJK A;  1COW G;  1R3K C;  4FLW A;  4WFB V;  5KMG B;  4W4L A;  2P7T C;  3L70 H;  5B1A C;  4NXN O;  2CUG A;  2DYR C;  4LCU C;  1SQX H;  1KUQ A;  3AG2 B;  2ZIN A;  3ZRX A;  3ASO C;  1KEC A;  2OIE A;  5BMV B;  4B3M O;  4X1K B;  2N74 A;  4TT3 G;  1MA1 A;  2W6I G;  4IIJ B;  3CX5 F;  3ZMV A;  1Y6X A;  2Q0A A;  4DV2 O;  5KMG A;  3OMA B;  1IBM O;  5K1P A;  2YS8 A;  4DV4 O;  1L1F A;  3JCZ A;  1AI7 A;  1EZJ A;  2D2C B;  5BMV A;  4X1K A;  2OTJ V;  1L0L H;  3L71 H;  2CTW A;  4DV6 O;  1P7G A;  3B40 A;  1JJ2 U;  1W59 A;  4MT8 A;  4JI5 O;  3ZMT A;  1JPX A;  3FB6 C;  3JYC A;  3BVO A;  3B4S A;  3K9S A;  1KD1 W;  1H38 A;  4DUZ O;  2WAM A;  4XDJ A;  3GWO A;  4ABM A;  2Z5U A;  2A7W A;  3SR2 C;  1VQM V;  4DUY B;  4BWA A;  1WB8 A;  4Q20 A;  3G71 V;  4JI4 O;  2DW4 A;  1PNL A;  4H0L B;  2B1G A;  2QTS A;  2XOK G;  2YI9 A;  3B2E E;  2XND G;  1BQ0 A;  4JAS A;  3ZN1 A;  4FIP C;  2ZT9 B;  2ADP A;  3E86 A;  3BPZ A;  4B3T O;  1AJP A;  1KB9 F;  1Y76 B;  2A9H A;  2OT5 A;  2QE7 G;  1QR8 A;  1WJZ A;  3ABT A;  1FKA O;  1K4C C;  1R3I C;  1XRE A;  1F51 A;  2P06 A;  2YIB D;  1QQC A;  4O4I B;  1DF4 A;  4B3M B;  2LO1 A;  1J5E O;  2FTK A;  2BCC H;  3RFR A;  1FXH A;  1X4T A;  4JI6 B;  4AQY O;  2QWQ B;  1DGS A;  3ZMS A;  1Y76 A;  2UU9 O;  4NKG B;  5EC1 C;  1QLE B;  1BS3 A;  3ETQ A;  4I4T B;  3EFF K;  1B04 A;  2LGQ A;  4O4I A;  1OCC C;  3SPH A;  5L3G A;  3PJS K;  5IE9 A;  4X64 O;  3S3X A;  5GTH Z;  2E74 B;  4UV9 A;  4YIP A;  1GRJ A;  1SQB H;  1XQ8 A;  4JI5 B;  3J7A U;  3OUF A;  1I5X A;  1YSC A;  1Q82 W;  4J41 A;  4TQD A;  4FM2 A;  2QJ1 A;  3A0H Z;  3GB7 C;  4I4T A;  1NS1 A;  2EJ7 A;  2B1I A;  3CXC U;  3CC4 V;  4DV3 O;  2EZP A;  3C90 A;  3OAA G;  2WA4 A;  3M99 B;  2JEU A;  1HWY A;  2CDY A;  3ZN0 A;  2P67 A;  4UVB A;  3WFV A;  5L3C A;  3B77 A;  5HFM A;  4XDK A;  3OEE G;  3WB2 A;  1GH6 A;  1HNW O;  4GX5 A;  3L73 H;  4I9Q A;  2IW5 A;  3ETG A;  2HR3 A;  4OX9 B;  2YDE A;  2JGU A;  4WF9 V;  4PEL A;  1SET A;  3CMA V;  1MZE A;  1R3J C;  1FXK B;  4LH6 A;  4YY3 O;  3K5O A;  2ZD9 A;  2AHY A;  4E2L A;  4IYH A;  3RYH B;  1FXV A;  1J5E B;  5ITZ B;  2AXT Z;  1PNK A;  1B06 A;  4LF6 B;  2H3O A;  3ZHV A;  1VEW A;  4D6T H;  4IT5 A;  1BL8 A;  2HJF C;  1WP7 A;  1SES A;  2P90 A;  4X1Y B;  1KBH A;  3JAW B;  2N05 A;  5DM6 V;  1FXK A;  4MTF A;  3G4S V;  1ENV A;  2L35 A;  4UCV A;  3RYH A;  4DR6 O;  5ITZ A;  2LFR A;  3CRA A;  3ZRS A;  5L3F A;  4B08 A;  2XTA A;  4TV8 B;  2GTA A;  4CH5 A;  4X1Y A;  4FMT A;  5EBL C;  1H8H G;  4YHH O;  1X59 A;  1JVM A;  2DQ0 A;  2JIZ G;  4CC5 A;  1WA8 B;  5B1O A;  2ZXW C;  5J2T B;  1BZK A;  5IYZ B;  4JAU A;  2HJD A;  1CPY A;  4MVU A;  2F4V O;  1GO3 F;  3NR7 A;  3ABU A;  4TV8 A;  1AR4 A;  3I56 V;  3AK3 A;  4X89 A;  5KA6 A;  4MSW C;  3SPI A;  4GUN A;  4D7S A;  2OIG A;  1WA8 A;  1HNW B;  1P49 A;  2AZ2 A;  3RYF B;  1FS0 G;  5J2T A;  2PZS A;  4ZIB A;  1JA8 A;  3SYP A;  1SA0 B;  3ASN C;  1XMO B;  2LW7 A;  1AB3 A;  1CP9 A;  3AG3 C;  1VF6 C;  3O65 A;  1PL4 A;  3OMN B;  1HR0 B;  3CPW U;  3K9A A;  5IY5 B;  2OTL V;  4JI7 B;  1M56 C;  3F5W C;  1JQ0 A;  2PY5 A;  3APO A;  1VIB A;  3RYF A;  4XDL A;  1Q6H A;  2H94 A;  3ZJZ A;  4JI3 B;  1SA0 A;  3L72 H;  4DR7 O;  2EIM B;  5KHJ A;  1TGO A;  2DQ3 A;  2UUA B;  3VQW A;  3R66 A;  5IDJ A;  4X65 O;  2UXB O;  1AI6 A;  3W7S A;  3FB7 C;  5KUM A;  1M57 B;  1OCZ C;  4IYI A;  1TUB A;  3FB5 C;  4FLT A;  2IU3 A;  4C7U A;  4E4E A;  2X6C A;  3OW2 U;  2WSS G;  3U10 A;  3QO7 A;  1IBK O;  3E8B A;  2XAH A;  4JAV A;  1ZL8 B;  2YID A;  2BSK B;  4YHH B;  2UUC B;  4FPP A;  2YXY A;  4KL1 A;  3H1K H;  4JI2 B;  1Z2G A;  2P22 C;  4BW5 A;  3F7V C;  5EZY B;  4R6Z A;  2F4V B;  4I55 B;  3DC5 A;  4LF8 O;  1HNZ O;  5BR8 O;  4LF7 O;  5DN6 G;  4OXS A;  5JJN B;  4DV0 B;  4RUF A;  2IU0 A;  4EFB A;  2BSK A;  1YI2 V;  1Q7Y W;  4JI8 O;  1XHZ A;  3HKE A;  4PDL A;  4GCZ A;  2ZE5 A;  4PDM A;  1H2K A;  2WLI A;  3ZX6 A;  4LFC O;  3M7M X;  2CAZ C;  2HHH O;  5EZY A;  4D7T A;  2ATK C;  1H2G A;  4I55 A;  2ETN A;  5CA3 A;  2OCC C;  1W2B U;  3CD6 V;  5IYD O;  1NH2 D;  3FYE B;  3T2M A;  1NZ6 A;  4CH4 A;  4PD4 F;  2Y4T A;  1GTO A;  4JGS A;  1XBL A;  1M9N A;  3OUS A;  4JYC A;  2A3Q A;  1YIT V;  1XIL A;  4IHJ B;  2HVK C;  2K1E A;  3IAY A;  5IYC O;  4DR7 B;  1YVW A;  3T1H O;  1BCC H;  2LJ2 A;  4BW9 A;  5DED A;  4AIL C;  2OYQ A;  5EIB D;  1KQS U;  1HW7 A;  2Q7G A;  3JAT A;  5LBQ A;  4LC1 A;  1P7B A;  1ZSP A;  1GN4 A;  2JDI G;  1G8M A;  3WG7 B;  2B9Z A;  4FLY A;  1K34 A;  4ZHQ B;  1S5J A;  3DXR B;  1Y74 B;  2V1D A;  2YXL A;  2HVJ C;  4ASU G;  1BE3 H;  4DV1 B;  2ITC C;  4QGP A;  2M6Y A;  3BY6 A;  2DE0 X;  2IJI A;  3EHB B;  3VQX A;  4IHJ A;  1NKD A;  1K73 W;  3T1Y O;  4O4L B;  1OCR B;  1UPG A;  4J7Z A;  4B3S B;  3LNN A;  4R7C A;  5H2F Z;  2QTO A;  4JTA B;  1KKC A;  1JJO A;  4ZHQ A;  1Y74 A;  5B3S C;  3KG2 A;  5H6Q A;  5LXT B;  4MTX A;  3H1I H;  3HKD B;  2LFS A;  4DR3 B;  1OCO C;  4GKJ B;  2GSM B;  4A5U B;  4O4L A;  3K08 A;  4KXR A;  3JAL B;  1JR9 A;  1WNS A;  2HFE C;  1VQK V;  1US6 A;  5LHI A;  5J2U B;  2Q5Z A;  1GM9 A;  4F6R A;  3E2E A;  3OMI B;  1SQQ H;  2E3C A;  3ZRW B;  3HB3 B;  4LFB O;  2RDC A;  4FLZ A;  1HDJ A;  5LXT A;  1SER A;  3RT3 C;  4LF4 B;  4CZZ A;  3HKD A;  2Q8V A;  3TET A;  4LWS B;  4BIO A;  3JAL A;  3CCE V;  3ZED A;  3MAQ A;  3P3N A;  4DR1 B;  5J2U A;  5FPR A;  4ICG A;  4FVM A;  2RN9 A;  2Y0I A;  1NT2 B;  2WLM A;  1FJG B;  2NNU A;  1XMQ O;  3AG7 A;  1D5A A;  3AG2 C;  4GYC B;  1I94 B;  1K8A W;  1NU1 H;  2X6A A;  4LWS A;  1YXB A;  3D3I A;  1Z5W A;  1VQN V;  5JCO A;  1VP7 A;  3UO2 A;  4OPA A;  4MVO A;  3CCQ V;  2QR4 A;  3SJA C;  1IX9 A;  2IJJ A;  2EUL A;  4B3R B;  2Q9L A;  3K5L A;  3CHX A;  1SS3 A;  2W6J G;  1JCH A;  3OM3 B;  4DW0 A;  4MVR A;  1XNQ B;  3APQ A;  5KHH A;  3CME V;  5C8Y B;  4LFA B;  5KHK A;  5JJJ B;  2WLL B;  1N32 B;  4RO2 A;  3GVM A;  2ZM6 B;  3RGB A;  1XNR B;  2EJR A;  2EIJ B;  4J11 A;  4PA4 A;  2WLK A;  2RMK B;  1BMF G;  2YIC A;  3SYO A;  1N0J A;  4JV5 O;  1NH2 B;  3OT7 A;  3JAK B;  2QWN B;  3PN1 A;  3X2Q B;  5C8Y A;  2ZDI A;  3ML0 A;  5GW7 A;  2QEX V;  4IIJ A;  2P5O A;  5E79 Z;  4DR5 B;  4LF9 B;  2F93 B;  1IBL O;  3RWR D;  1VQ4 V;  1HNX B;  3HKC B;  1WPB A;  1G6U A;  3KCY A;  2ZQM A;  1OZ0 A;  3OE7 G;  4X66 B;  1G4Y B;  3ETD A;  1V54 B;  2ADQ B;  3JAK A;  2R9A A;  1NR7 A;  1P84 F;  4J10 A;  2UXD B;  1BGY H;  2P6J A;  4J9Z B;  1FAF A;  4PI0 A;  3HKC A;  4H44 B;  4DR2 B;  1H2M A;  2CK3 G;  5EYP B;  1OHH G;  4U7N A;  1S5H C;  3D8C A;  3JAS B;  4U7O A;  5LP6 B;  2Q68 A;  2VQF O;  3KZI Z;  3LUT B;  1IZ3 A;  3HKB B;  5IJ0 B;  4QIW F;  1ZAU A;  2K9P A;  4JI0 B;  3B8M A;  4FJC C;  3L75 H;  2FKX A;  1PV0 A;  1QNM A;  3FB8 C;  4EB6 B;  4I5S A;  2M7W A;  1MZF A;  2HKO A;  4NXN B;  1S77 D;  2HEP A;  1YHQ V;  1U97 A;  1AR1 B;  5EYP A;  4DXW A;  1QLE C;  2VQE O;  3C3T A;  3JD3 A;  4MVS A;  4L87 A;  3STZ C;  1HP8 A;  4JYB A;  3K03 A;  5LP6 A;  5HFL A;  2XAF A;  1GMG A;  3NXS A;  2ZCE A;  4DV7 O;  5IJ0 A;  3CC2 V;  1KP2 A;  2QWO B;  2ZIM A;  4WFH A;  4DV2 B;  5CA0 B;  5GTI Z;  1XDC A;  1T5E A;  5J9P C;  1QCE A;  1IBM B;  4EB6 A;  4QPJ A;  5KA5 A;  3SYQ A;  4HAM A;  4DV4 B;  3SJC C;  2BTO A;  4G27 B;  4J42 A;  2DYS B;  4HYO A;  3W7U A;  3F7Y C;  4CS2 A;  2EIL B;  2PI4 A;  4RWU A;  2JJ2 G;  4J9Y B;  4PDV A;  4MVZ A;  4DV6 B;  4F6E A;  1VAR A;  3ETE A;  3K0G A;  4HNA B;  1IXM A;  3FFQ A;  5CA0 A;  1XI1 A;  1EM1 A;  5L3B A;  1MNG A;  4K8X A;  1K33 A;  3FX7 A;  1J95 A;  1E79 G;  5IJ9 B;  4DUZ B;  3CRR A;  1GN3 A;  4GX2 A;  3AG1 B;  4PI2 A;  4WBN B;  2Q67 A;  2YI8 A;  1NR1 A;  1UFI A;  2Q7H A;  3LSU A;  2UUB O;  1NVP D;  4JI4 B;  4HNA A;  1SRY A;  4O2A B;  1FPO A;  1YIJ V;  1GAX A;  1PM9 A;  1NTZ H;  1V55 B;  4ZOL B;  2P4V A;  3CCS V;  1FXK C;  3BEH A;  4KFM A;  5IJ9 A;  2E76 B;  3JCU Z;  3MDS A;  1JFF B;  3D36 C;  4DRX B;  2B5U A;  2XT9 A;  1TAE A;  4FLU A;  1JOY A;  1VF7 A;  4WBN A;  4BR6 A;  4B3T B;  3QF7 A;  2GTS A;  3D3Q A;  5JQG B;  3ZRV A;  3OTO O;  2AW9 A;  4O2A A;  3CEI A;  3K06 A;  1VQ8 V;  1VQO V;  1AVM A;  4ZOL A;  4P2Z A;  1MAB G;  1H2L A;  3ABL B;  3T1C A;  3TXS A;  5IWA O;  1ZLZ A;  3DC6 A;  1YEW A;  4DRX A;  2ZE7 A;  2P4K A;  2ZE8 A;  1F4M A;  2GDS A;  1VQL V;  5LMU O;  4AQY B;  4JTC B;  4X1I B;  4QJF B;  1GM7 A;  2UU9 B;  3U11 A;  5JQG A;  1U96 A;  1PP9 H;  3UT5 B;  1Y4M A;  2OWO A;  1ZWI C;  2FYU H;  1UJW B;  2YEV B;  3D36 A;  4KUM A;  3BAB A;  4FK5 C;  1Q90 D;  4O2B B;  4X64 B;  4DR4 O;  2IH1 C;  2WLH A;  1P4R A;  1RFY A;  5F2V O;  2EIN B;  3H1J H;  3CJH B;  4X1I A;  1M5I A;  1W0K G;  1Q81 W;  4NTW A;  4UFZ A;  3UT5 A;  3JAW A;  4GZR B;  3FKS G;  3W7W A;  4JZG A;  3EVK A;  1E1R G;  2YEV A;  2CTQ A;  4O2B A;  4EFE A;  2BTQ B;  2C2A A;  3CP1 A;  5KX5 B;  4DV3 B;  5K1X A;  3CJH A;  1MSW D;  3IJ4 A;  4X62 O;  3CCJ V;  2Z0A A;  5IY5 C;  2LP7 A;  5D5Q A;  5IYZ A;  3T4D A;  4I0X B;  5JH7 B;  3SPJ A;  2DMX A;  1B3Q A;  2BTQ A;  1SC5 B;  5CBH A;  5KX5 A;  1S76 D;  3RN4 A;  3EXA A;  2EIM C;  4G28 B;  4UVC A;  5LGU A;  2AGA A;  1Y67 A;  2FB5 A;  4YY3 B;  4WCE V;  2Y48 A;  2JRI A;  1RM1 B;  3WB0 A;  2YIB A;  4BAY A;  3OEH G;  2MW2 B;  1M57 C;  3K3W A;  5IWA B;  4NB5 A;  2BOC C;  1S72 V;  1PPJ H;  1A32 A;  4I0X A;  4NXM O;  1F23 A;  5JH7 A;  3N2G B;  1RPO A;  1NBM G;  2X0L A;  5LMU B;  4GKK O;  3ABM B;  1EN4 A;  3M8A A;  3SYA A;  1S0V A;  5JWP A;  1VQ5 V;  3WB1 A;  5FL7 G;  4LH7 A;  1Y66 A;  3AEI A;  3O9O A;  3CE2 A;  2QM7 A;  1N33 O;  1B6Q A;  4DR6 B;  4EEQ A;  2UXC O;  1Z5V A;  2A79 B;  1K5Q A;  2VWK A;  4KHP O;  1YCI A;  4RAI A;  3N2G A;  4IL6 Z;  1NVP B;  4LR3 A;  4K0K O;  4TUY B;  1N36 O;  2QM4 A;  2PGG A;  1N34 O;  1M1K W;  2DWD C;  5LGN A;  2ODM A;  3UO3 A;  1Q8I A;  3LDD A;  4PA6 A;  2E5L O;  4P30 A;  4N23 A;  4Q6G A;  1G1X B;  3THO A;  4HZ3 A;  4YJ3 B;  1CEZ A;  2DWE C;  3FAV B;  2N04 A;  2CE4 A;  1ZL8 A;  1DF5 A;  3F5T A;  3L74 H;  1SQG A;  2DJV A;  5L3D A;  4H13 B;  3LSQ A;  1VQ6 V;  4UUJ C;  2AZ0 A;  2QWR B;  3ZHT A;  5EBW C;  2RQ6 A;  5B1N A;  2ZR3 A;  3E8F A;  2RJZ A;  2V4D A;  2YXH A;  2EIK B;  3CRC A;  3K57 A;  4RQF A;  4YJ3 A;  3IFX A;  3N27 A;  1ZX3 A;  1EN5 A;  3JAM N;  1YF2 A;  3JAR B;  1IDS A;  3OTF A;  1CXZ B;  5FLX N;  2IBZ H;  3WG7 C;  1SQV H;  4CH3 A;  4UCS A;  2WWW A;  5LA6 B;  5B1B B;  3LSS A;  4GKK B;  2UXB B;  1M90 W;  4X65 B;  1ZTE A;  1OCR C;  5FPO A;  4J80 A;  3JD0 A;  3SDL A;  3ZHU A;  2KQX A;  3UKM A;  4X20 B;  1AI4 A;  5LMN O;  1Q5O A;  3ZMZ A;  1IXB A;  5JVD B;  5LL6 Y;  3H1L H;  4NTY A;  2Y69 B;  3B09 A;  2CH7 B;  3L9D A;  4JYA O;  5KLV H;  1IBK B;  5LA6 A;  3IC7 A;  2OCH A;  2JS3 A;  2Y4U A;  5LHH A;  4K0K B;  4YXW G;  3RVY A;  1VQP V;  1THZ A;  3ZS8 C;  4CS3 A;  2R9I A;  1R1B A;  2IM9 A;  4DK0 A;  1DTO A;  4BIU A;  1K92 A;  1K5S A;  1XL4 A;  1OJH A;  4X20 A;  4UCU A;  3AK2 A;  5JJE B;  3W7X A;  3QO8 A;  3JD1 A;  5JVD A;  1R6K A;  2YUA A;  3DXR A;  4Z2W A;  3I55 V;  4LF8 B;  1WAZ A;  4X88 A;  1HNZ B;  5BR8 B;  1I5Y A;  3TJT A;  1OV9 A;  2CH7 A;  4LF7 B;  3J81 N;  5LHG A;  4UB6 Z;  3E35 A;  3BRC A;  1QLN A;  1R3L C;  1YJ9 V;  5H5N A;  5LOV B;  1QVG U;  3UQ8 A;  2KG7 B;  4JI8 B;  3CWB H;  4CH6 A;  5CN0 A;  5JCO C;  5CBG A;  2NLJ C;  2ZE6 A;  4LFC B;  3Q4H B;  2HLD G;  2PYJ A;  2HG5 C;  1E1Q G;  2HHH B;  4MVM A;  2HP8 A;  4DO2 A;  3SJB C;  3DTU B;  1JX9 A;  4MW3 A;  2QGN A;  4FFB B;  2O57 A;  3LNM B;  5LOV A;  3OGI B;  1WLE A;  3JD2 A;  2JGD B;  3JSN A;  4TWK A;  3VOU A;  4GT1 A;  3OGC C;  3ABK B;  3Q4H A;  1AP5 A;  2V7Q G;  3ZRW A;  1Q3E A;  4JPR A;  1EN6 A;  3CC7 V;  4RQE A;  3T1H B;  3A8T A;  4DK1 A;  3RBZ A;  4DUY O;  2ZDI C;  2A06 H;  2Q4P A;  1YDX A;  3CRM A;  2GHY A;  3JSL A;  2EIJ C;  4NVP A;  1NJI W;  1SQF A;  4WFF A;  5EBM C;  1BT8 A;  5CA1 B;  3RYC B;  4O4J B;  2FML A;  1RSO B;  3T1Y B;  3N2K B;  1K9M W;  3AG4 B;  3X2Q C;  3TK1 A;  4PJ0 Z;  4YIO A;  1N0N A;  1QHT A;  4OPH A;  3K58 A;  3HPL C;  2R72 A;  2EX3 A;  4YJ2 B;  5A9G A;  1MOF A;  2MK3 A;  3BCC H;  2YSU B;  1XHX A;  3I5D A;  4QPK A;  5CA1 A;  1TUE B;  2R70 A;  4O4J A;  3RYC A;  1RSO A;  1V54 C;  2Q0O C;  3VQV A;  3N2K A;  5EIB C;  4JI6 O;  2PF4 E;  1XOU A;  2WLL A;  2JS5 A;  1EBO A;  4OGQ B;  5B1A B;  2DYR B;  1SKV A;  1DK1 A;  4YJ2 A;  2YIA A;  3ASO B;  4LFB B;  5KAF Z;  3UM7 A;  1LUV A;  5B66 Z;  1YJN V;  2EBO A;  3BA9 A;  1FFX B;  1PL0 A;  3DGE A;  5LP6 C;  1IVS A;  2QWP B;  1FYJ A;  4B7E A;  2JEX A;  2CGO A;  1I7F A;  3E22 B;  1FD9 A;  2VS0 A;  2DOS A;  4W4K A;  1XMQ B;  1NTK H;  1S3J A;  1KP3 A;  3AK1 A;  2A0L A;  1FFX A;  2YC0 A;  2F95 B;  4H37 A;  5LYJ B;  4FFK A;  2NR5 A;  2PI5 A;  4U3F H;  4LNU B;  3OFN G;  3B8N A;  4LF5 O;  5A2Q N;  2R9R B;  3CYO A;  3E22 A;  1YTF D;  2ZNJ A;  4LBE C;  3JAS A;  4PA9 A;  4DYL A;  4OX9 O;  2DYS C;  1AR5 A;  2ARH A;  1KU9 A;  2EIL C;  3HKB A;  3CSX A;  5LYJ A;  5BXZ A;  4I9W A;  4LNU A;  4PA3 A;  2WA3 A;  3E8G A;  2JJ1 G;  4NR1 A;  3CCL V;  2PUS A;  4R50 A;  4RUE A;  4UV8 A;  4FM0 A;  2Q7E A;  1GM8 A;  1EFR G;  4I7Z B;  2E75 B;  1LR1 A;  2LGW A;  4LF6 O;  4JV5 B;  4PV1 B;  2LW1 A;  3MD0 A;  4R8C A;  3W7T A;  3AG1 C;  3TXQ A;  3G80 A;  1IBL B;  1EZV H;  2BE3 A;  5CMU A;  4CS4 A;  4LP8 A;  3E89 A;  1D5N A;  4ZKI A;  1Q43 A;  1N4C A;  5H6R A;  3QTC A;  2WLJ A;  3ZHS A;  3IC9 A;  4K35 A;  4MVQ A;  4Z1V A;  3P30 A;  1V55 C;  4I50 B;  1LNQ A;  3ZMU A;  5B5E Z;  3S3W A;  3CS5 A;  1DLB A;  2Q6A A;  1O9G A;  3TGU H;  2Z3Y A;  2F66 C;  1OCC B;  3MHH C;  2FL4 A;  4I50 A;  2XAG A;  2VQF B;  2W0X A;  3ABL C;  4G2K A;  4GX1 A;  4TSF G;  3H9V A;  3K5M A;  1NI8 A;  3QVN A;  4LF5 B;  4JZ2 A;  3UCS C;  2VQE B;  4H33 A;  3H01 A;  4X9Q A;  3G6B A;  1JFF A;  3ICX A;  4DV7 B;  1ZUQ A;  1XMO O;  3ZCC A;  1AJQ A;  4MTG A;  5IT9 N;  3ZHQ A;  5EK0 A;  2EIN C;  1ORQ C;  1VQ9 V;  2ZKO A;  1WPX A;  1HR0 O;  3SPC A;  2IJH A;  1WP8 A;  4JYY A;  1I08 A;  4JI7 O;  1R73 A;  4AI8 A;  4PHZ A;  2QSA A;  2KKW A;  1MG1 A;  1TA8 A;  4J7K A;  5DEC A;  2UXX A;  2RNB A;  4UCT A;  5CB4 B;  4JI3 O;  4GX0 A;  2QKC A;  3E8H A;  2UUA O;  3T4Z A;  1R6T A;  4JF3 A;  1QVF U;  1RPR A;  2WLN A;  2CTR A;  5CBF A;  4WFE A;  1WN7 A;  3G67 A;  4MW8 A;  3H1H H;  4CBC A;  3R65 A;  2Q69 A;  4TQF A;  2XHB A;  4O4H B;  2F23 A;  5CB4 A;  4U3J B;  4QE9 A;  1GN2 A;  2UUB B;  1FFT B;  3QO5 A;  3BA8 A;  1YTF B;  2UUC O;  1K3E A;  4JI2 O;  4UVA A;  3CB2 A;  1RM1 C;  3BAA A;  4K8Z A;  4TOI A;  1TVK B;  4JI1 O;  3CCR V;  3STL C;  4O4H A;  4N21 A;  4P9O A;  1I0H A;  3U0Z A;  4U3J A;  3ZBH A;  4DV0 O;  2Q73 A;  4PDR A;  2QA4 V;  1QBZ A;  2PYL A;  2EZO A;  3ABM C;  3OTO B;  2ZXW B; 
#chains in the Genus database with same CATH homology
 2CTR A;  2YS8 A;  1N4C A;  1BQZ A;  2QWR B;  2YUA A;  1XBL A;  1GH6 A;  3UCS C;  3APO A;  3UO3 A;  1HDJ A;  2QSA A;  2CTP A;  3AG7 A;  2LO1 A;  2M6Y A;  2EJ7 A;  2CTQ A;  1BQ0 A;  2LGW A;  4IT5 A;  3APQ A;  1IUR A;  2DMX A;  2OCH A;  4RWU A;  2Y4U A;  2L6L A;  2QWN B;  2CTW A;  2GUZ B;  2N04 A;  2QWO B;  2GUZ A;  2DN9 A;  2PF4 E;  4J7Z A;  2QWP B;  2QWQ B;  1FAF A;  1NZ6 A;  4J80 A;  3UO2 A;  2Y4T A;  2KQX A;  1WJZ A;  1FPO A;  3BVO A;  2N05 A;  2CUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...