2DN9A

Solution structure of j-domain from the dnaj homolog, human tid1 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
79
structure length
79
Chain Sequence
GSSGSSGDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of J-domain from the DnaJ homolog, human Tid1 protein
rcsb
source organism Homo sapiens
molecule tags Apoptosis, chaperone
molecule keywords DnaJ homolog subfamily A member 3
total genus 19
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2dn9A01
2PF4E 3UO3A 1FPOA 2QWPB 2GUZB 1GH6A 3BVOA 2QSAA 1BQ0A 3UCSC 2CTWA 4RWUA 1IURA 2GUZA 1WJZA 2YUAA 4IT5A 3AG7A 3UO2A 1BQZA 2N05A 2EJ7A 2L6LA 2M6YA 1XBLA 3APOA 1FAFA 1HDJA 2CTQA 2DMXA 2DN9A 4J80A 2QWRB 2QWQB 2YS8A 2CTRA 2OCHA 2QWOB 1NZ6A 2QWNB 2LGWA 3APQA 2KQXA 4J7ZA 2CUGA 2Y4TA 1N4CA 2LO1A 2N04A 2CTPA 2Y4UA
chains in the Genus database with same CATH superfamily
5KHJA 2X0LA 1GAXA 3WG7B 1Q90D 3ZHQA 1ZSPA 2QTSA 4RO2A 1FJGB 1I5XA 1FFXA 1Q8IA 5KA5A 2LFSA 4EFBA 2YDEA 4DR3B 3U11A 1GTOA 1IBMO 4JI6O 5E1AC 3CCJV 5LA6B 3ZHTA 1K34A 2F4VO 3UCSC 2HKOA 3OGIB 1G8MA 1XMQB 3RYHB 1Q6HA 1NJIW 1Z5VA 2ZE8A 1RM1B 3OMIB 1R6KA 2OT5A 2X6CA 3C90A 4LF7B 1I5YA 4JGSA 4I50B 2WLLB 3VOUA 3F7YC 4PJ0Z 4FFKA 4HZ3A 4UUJC 4DR6B 2Z5UA 1R3LC 1K92A 1FFXB 3DXRA 3M8AA 4ZOLB 2CAZC 4BIOA 4RUEA 4DR5B 3OMNB 2PUSA 1H38A 4N23A 3E8BA 5CBHA 2QTOA 3ZIAG 4EB6A 4WFEA 2WLIB 4UCOA 1H2SB 1H8EG 2Y4UA 2DE0X 2QWPB 3KKYA 3BVOA 4U7OA 1KD1W 2AXTZ 3LSUA 4Q20A 3SPHA 3T2MA 5DEDA 1YCIA 1QLEC 3P30A 4MVOA 1QCEA 1MOFA 4UVBA 5CN0A 2ZDIC 4JI1O 2CUGA 2V7QG 2YI9A 4R7CA 1F51A 4DR4O 2WLHA 1PM9A 2CTPA 2EIMC 1PP9H 1ZL8A 3JASA 4I0XA 2A9HA 4RWUA 4DR5O 2ZM6B 2IH3C 3FB6C 5KUKA 4HNAB 4UCTA 1LR1A 2IM9A 2UXXA 3B2EE 3E8FA 3SJBC 4B3RB 3ZRVA 1IBKO 1ZX3A 2XOKG 1XI1A 4UXNA 5JH7B 5CA1A 3ABLB 3BHPA 1H2NA 4DV0O 3A0RA 3EHBB 3N27A 1U96A 2RN9A 3AG2B 1M5IA 1EZVH 3EVKA 2FKXA 1W0JG 1N36B 5GTHZ 2YEVB 5KMGB 1HDJA 2JJ2G 3QNEA 5EIBD 3TGUH 4DV1B 4LF8O 1O9GA 5LYJB 2BOCC 1V54B 4DO2A 3OR7C 3J81N 3JASB 2QKSA 4H44B 3UO3A 3CXHF 4DR3O 3SYAA 1XL4A 4DUYB 1YHQV 3CRMA 1ORQC 1LUWA 4LFAB 3AG3B 1Y74A 2DWDC 4R50A 2QKAA 1MSWD 4DW0A 3FB5C 3VQVA 4D7TA 1N33B 5FNVA 2EIKC 1I7FA 2VQEO 3CCMV 4YJ3A 3A0BZ 4CH6A 3AG1C 3JD0A 1OJHA 5IJ9A 1H2MA 5LL6Y 3CHXA 2DYSC 2F66C 2GSMB 2JS3A 1WA8B 4PELA 4FLTA 2ITDC 3K0GA 1N0NA 1YITV 4YY3B 4DV7B 3T1YO 3ASNC 2QA4V 4ZIBA 4LF6B 5IJ0B 5AG2A 4MW8A 1K4CC 1JJ2U 4DUYO 3K5NA 3G6BA 4H37A 4I7ZB 3AG7A 5B1BC 3RYIB 2H94A 2V4DA 4B3TB 3WG7C 1CEZA 2QWQB 3W7UA 3CCSV 4PV1B 3ZMSA 3JARA 2WA3A 2JRIA 3OGCC 1P7GA 3ZHSA 3ABMB 2JEUA 4CS3A 3ABTA 4LH7A 2EBOA 1IURA 1SS3A 2BE3A 3KCYA 3BRCA 1B06A 5BMVB 1YIJV 1JOYA 2AZ2A 3QF7A 1XQ8A 1ENVA 1E1RG 1HWYA 3JATB 4LF9O 4TT3G 4K3AA 1MMMA 2LFRA 2A3QA 1RPRA 4YHHB 4NXMB 4FM0A 4FLZA 3FAVB 4O4LA 3EXAA 3RVYA 5GONB 2NN4A 4B7KA 1IBKB 3J7AU 2Q0OC 1QU7A 4DV0B 2IU0A 5A2QN 5FNVB 3G71V 3SJCC 3CD6V 5FL7G 4FM1A 5JWPA 2EILC 2R9IA 4DUZB 4I0XB 2HVKC 3ABKC 1BQ0A 4JASA 4PDRA 1GN3A 4J42A 1GM7A 1S5HC 3B40A 2A7WA 5LP6A 3E89A 4NVPA 1QR8A 2DN9A 2HP8A 3K03A 4WFAV 1IBMB 1W2BU 5JQGB 4J10A 4FLXA 3ASNB 1AI4A 4PD4F 3ZMUA 3BABA 3K06A 1Y4MA 1XMQO 4UVAA 3P3PA 4JI7B 3G80A 3L74H 4LBEC 3RGBA 5IYBO 4ZKIA 1SRYA 1DGSA 1W59A 2WLJA 2CTQA 2X6BA 3RBZA 3W7WA 4QE7A 4MTFA 2BSKA 5LMUO 1AI6A 2F23A 1O9HA 3ZHVA 4GX1A 2IJJA 4C7UA 5EBLC 1QR9A 3CCVV 3U10A 4DV3B 1MA1A 5L3BA 4HNAA 5LXTA 4B3SB 3LNNA 2GTSA 4JF3A 2R70A 1XNRO 3CCEV 3CJHB 3K58A 3CXCU 4E4EA 1UJWB 3B09A 3JCZA 4DR1O 3OD4A 2QM8A 3ETGA 2F43G 4YJ2A 4DV4B 3NXSA 1V54C 4X66B 4LF5B 3IC7A 1S0VA 1P7BA 2YIBA 3T1CA 1Q6UA 3D3IA 4U7NA 1SZTA 1NZ6A 1G6UA 2MK3A 2VS0A 1HNZO 4JI0B 3CC4V 5LOVB 4MVZA 3HKEB 3LDCA 1WB7A 1VQMV 5B5EZ 2ODMA 1P84F 4LH6A 1P49A 3K57A 2LP7A 2V1DA 2OIEA 4O2BA 2DMXA 2XAJA 2K1EA 1NH2D 2Z0AA 2ZDIA 5KHIA 1NTKH 1DLBA 1ZAUA 1OCOC 3H9VA 2JEXA 4IT5A 3RFRA 1B6QA 5LBQA 3OUSA 4B08A 5J2UA 3OW2U 1WP7A 1WN7A 1EN5A 2ITCC 4H13B 1DK1A 3CX5F 4I55B 4FZ1A 3OMAB 2QJ1A 2HG5C 1K73W 4N21A 2LW7A 4LFBO 2QSAA 1SA0A 3G67A 3CRRA 3FX7A 1EZJA 4TQFA 3DC6A 3GVMA 4TV8A 3F5TA 1EFRG 2DWEC 1QLNA 2HJFC 2ZE7A 3VQYA 5DN6G 3N2GA 3UKMA 1I94O 4JZ2A 2JGDB 4UCUA 1PL4A 4GUNA 1RP3B 4DV7O 5B1AB 4LWSA 5J2UB 4L87A 3L70H 4FPPA 4FJCC 3DC5A 4LC1A 4EFEA 4MVSA 5GONA 2GHYA 4JI6B 5B1OA 4JTDB 1YF2A 1Q43A 1AROP 2ZR2A 2F4VB 2W0XA 1AR4A 1JR9A 1Z2GA 4O2BB 1OHHG 1QQCA 3SPCA 4TV8B 2P22C 2O57A 3JAWB 5IWAO 4DK0A 2E5LB 3E83A 2Y0PA 4LF7O 1N36O 4LCUC 3W7TA 1YDXA 1B04A 4QPKA 4DV1O 2YIAA 4JI8B 4MVRA 2E3CA 4O2AA 1IXMA 1OCCB 2UUAO 2PF4E 3JD2A 4WFBV 5K1XA 1VQKV 1GH6A 4LWSB 5H6QA 4OX9O 5KX5B 3LDDA 3D3QA 4K35A 4KP4A 1RPOA 3CCQV 4KL1A 4AILC 3RYFB 2PI5A 4FLUA 2QM7A 4JYBA 2LGWA 4RQEA 1W0KG 4X8AA 2ZE5A 5CB4A 3K5LA 1OCZC 4JAAA 3H1IH 1NS1A 2BTOA 2OYQA 4X1IA 5FPOA 5B66Z 1WJZA 1PL0A 3ABKB 5IYDO 3D36C 4ZI7B 1IDSA 2IJKA 4X62O 4Z1MG 4YJ3B 2EIJB 4P30A 2DYRB 5KAFZ 1EN4A 2R72A 3OTFA 3CS5A 4UFZA 3T1YB 5LXTB 4UCRA 4W4KA 2QGNA 2Y69C 1ZWIC 4X1KA 3ZX6A 1OZ0A 2LQTA 4EEQA 1Y76B 1NU1H 3UO2A 1KP3A 3CCLV 3QO5A 1M90W 5D5QA 2XUMA 4LFCB 2UXCB 1JFFB 4OGQB 2XAQA 3RT3C 3FYIB 3S3WA 1L0NH 1BGYH 2QWNB 3K3WA 1XMOB 2B5UA 1R1BA 2ZINA 3CC7V 1XNQB 1ZLZA 4G28B 5C93A 4DRXB 3SYQA 1FPOA 1SQQH 4QNHB 2W6JG 1EM1A 2ZT9B 2IU3A 5EC1C 2UUCO 1HNWO 5ITZB 2YXLA 3WB1A 2VQFB 4LR3A 4JPRA 5CMUA 4PA6A 2EIJC 4ASUG 4BIZA 4CS2A 1FXHA 4TUYB 3O9OA 4MVUA 4F6RB 1QLEB 1OCRB 2BCCH 1AI7A 1KU9A 3P3NA 3ZRWB 3CRCA 1X59A 2WWWA 3QVNA 2XTAA 1SC5B 2XAFA 4O4HB 2ZQMA 1KUQA 3GB7C 1YI2V 2HLDG 2KQXA 4O4LB 3L72H 1S72V 3DTUB 2RQ6A 1QBZA 2E5LO 4YIOA 1L1FA 5EBWC 2UU9B 4Q6GA 2ZNIA 1PKXA 2UUCB 2YXHA 4MSWC 5CA1B 4JYYA 3ABMC 3SJQC 2Q7HA 4KXRA 4JI8O 3BAAA 1SQFA 3H01A 1TUBA 1WP8A 5IE9A 1AP5A 3C3TA 3APQA 5IT9N 4X9QA 2AGAA 3J80N 4BW5A 4GKKB 3ZN1A 5EZYB 4GLXA 1BE3H 2CH7A 1HW7A 4JI7O 3BCCH 4IL6Z 5J2TA 4GX0A 4CC5A 3H1HH 1HR0O 4ICGA 4O4JB 1KQSU 4E2LA 1M1KW 3I5DA 2JGDA 1A32A 1B3QA 4O2AB 3K9AA 4DV6O 2YIDA 1MZEA 5KX5A 3CMEV 1DF5A 4JI4O 3JCUZ 4LNUA 2P7TC 2Q69A 4B7EA 1X4TA 1WPXA 3N2KB 1H2KA 1TUBB 2CK3G 1XILA 2Y0IA 5ITZA 4NYKA 5IJ9B 4DV5O 3TXQA 4GKKO 4G2KA 1VF6A 1PV0A 4DR2O 3I55V 4UB6Z 2ZKOA 2QEXV 5IYZB 5J2TB 4FLYA 1GN4A 4B3MO 2P6JA 5H9CA 1HR0B 1AILA 1HP8A 4X1YA 5B1AC 3KG2A 1Q3EA 5HFLA 3ZMVA 1M56B 5L3CA 3SJAC 4AQYO 4Z1VA 4CH5A 3RWRD 5H5NA 1PNLA 5JJJB 1NVPB 1MABG 1S76D 2WLMA 5JJEB 2ZXWC 2K9PA 1YZBA 3HKCA 4FLWA 1VQ7V 3OR6C 3JAWA 4I50A 2YXYA 3TCUA 3C3SA 4PI0A 1NTZH 1K8AW 5JJNB 3DGEA 1IBLB 4UCVA 4TV9B 4DW1A 2LGQA 4J80A 3ZBHA 4GX2A 3JAKA 3E22B 5IYZA 1IXBA 2PYJA 4TWKA 1AJNA 5L3EA 5BY1A 3QTCA 3AG2C 3AG4B 3SDLA 2HHHO 2WLLA 2CTWA 1YVWA 1S77D 2D3OW 3EFFK 3H1KH 2A79B 4X89A 4DR7B 2P67A 4MS2A 1HNXO 5LMUB 2P4KA 4HYOA 2KB1A 1YXBA 3ML0A 3PN1A 2ZM6O 4X64B 2N04A 5B3SB 2A0LA 3JARB 1CXZB 1VQ4V 3N2KA 4IYHA 4O4HA 4NXMO 1SQGA 2EULA 2E76B 2OWOA 5EBMC 5KA6A 3T1HB 2XAGA 4YXWG 1V9PA 2JS5A 1CP9A 1EBOA 3UM7A 3ZRSA 4J7KA 2FYUH 1LNQA 3LSQA 1SZXA 2Q67A 1I94B 3HB3B 1M9NA 1IX9A 4X62B 1M4UA 2P06A 4UCSA 3IGAC 3B77A 2N74A 2VWJA 4X64O 3L9DA 4NKGB 4D7SA 4LFAO 4MVQA 3OFNG 5JCOC 2E74B 3SR2C 5IJ0A 4X65B 2ZIOA 1AR5A 3CCUV 3VQXA 3APOA 3THOA 1BHAA 3DXRB 1NH2B 3E8GA 3RYIA 3AG1B 2PY5A 3CJHA 4Z2WA 3OE7G 3SYCA 2EIKB 4LNUB 4QIWF 5JQGA 1AJQA 1VQLV 1WB8A 1TVKB 4OPHA 5EYPA 2UUAB 3OTOO 4YY3O 2H3OA 1VQNV 1RSOB 4LF6O 2EJ7A 4P9PA 4HBNA 2R9AA 1K7DA 4P9OA 5LHGA 3MAQA 2JIZG 1THZA 2YSUB 5EZYA 4I4TA 2QM4A 5KHHA 5LGNA 3WB2A 4J9ZB 2EIMB 2FTKA 4MTXA 5IY5C 1NVPD 4J41A 2IBZH 2ZCEA 5EIBC 2P4VA 1COWG 4DR1B 4JV5B 2VWKA 1ZL8B 5KUMA 1OCZB 1QVGU 4LF5O 2WLIA 1FD9A 1JVMA 2OCHA 1NTMH 1R73A 3ABLC 5JVDB 3CMAV 3K0DA 2NR5A 4EB6B 3G4SV 1GKFA 3UQ8A 4LF9B 2IW5A 4JI3O 3BA8A 3D8CA 4ZHQB 1SKVA 4GCZA 3JD3A 1XREA 5FLXN 2DYRC 3RYCB 1YEWA 3A2FA 1V55C 5BZBA 3OUFA 3T1HO 2P5OA 4BIUA 1XUQA 1GO3F 4K0KB 4IHJA 4JV5O 2VQEB 2D2CB 4LF4B 3HKEA 1VQ9V 4PA9A 1F23A 1KBHA 3F5WC 1BQZA 3ZMTA 2RDCA 3NR7A 2EX3A 1VQPV 1QHTA 3BA9A 1KMIZ 3KZIZ 3MD0A 4MTOA 2WA4A 2ILMA 3B4SA 1UPGA 3GWKC 1BCCH 4K8XA 4KHPO 5DM6V 4WBNA 2BSKB 3IFXA 1JA8A 4DV5B 1YSCA 2DJVA 4PI2A 1XEQA 5EYPB 3T4DA 4R6ZA 2QR4A 1AJPA 2KG7B 3FB8C 1GN6A 3JSLA 1VQ8V 3AG4C 2ETNA 4B3MB 1Q7YW 4CH3A 1VIBA 3JALB 4QGPA 4I55A 4AQYB 4CBCA 3JD1A 2DQ3A 3ZJZA 2VRZA 4EKWA 4JZGA 2KSDA 2YICA 3K5OA 4NXNO 3Q4HB 5JVDA 1TUEB 2Q0AA 3ZMZA 1J5EB 1Z5WA 2JJ1G 1PPJH 4MW3A 3K79A 3MHHC 1VQ5V 1EN6A 3E2EA 1ZUQA 1OCRC 5BMVA 4XDLA 5K1PA 1TA8A 4GYCB 1GK9A 1XNQO 1R3JC 3M7MX 1WA8A 3OEHG 3FAVA 4CS4A 1PNMA 2JK5C 5L3DA 5IWAB 4X88A 3HPLC 4PA3A 1HNWB 2ZNJA 4DR7O 4JI5B 2B9ZA 1FXKA 4BW9A 4UV8A 2YUAA 3UT5A 4NXNB 4JI0O 1HNZB 1FKAO 4DV2O 2N05A 1N0JA 2CGNA 1ROPA 5E79Z 2UXNA 4U3FH 1K5QA 2Q9LA 2Q7EA 4ZI7A 3CCRV 3WB0A 4NTXA 2WPDG 2FB5A 3P32A 4YJ2B 1GM8A 1G1XB 1Y74B 1FFTB 4B3TO 4TV9A 1CPYA 1JCHA 2Y69B 1MZFA 4K0KO 4U3JA 1XHXA 5LHHA 3S3XA 2CTRA 2OTJV 4MVMA 4K8ZA 3IAYA 1TVKA 2WSSG 4OPAA 3X2QB 5LMNB 2BTQA 3SPGA 2L35A 1Q82W 5L3FA 5C8YB 4TOIA 1GM9A 3N2GB 2Q5ZA 3RYHA 2UUBO 1M57C 2RJZA 4DRXA 3ABUA 5IY5B 1ZTEA 2H8PC 4B3SO 4PA4A 4H0LB 3ZCCA 4JYAB 1KKDA 4LP8A 4YIPA 5B1NA 1GN2A 3F7VC 4DK1A 2YIBD 3ETEA 3HKCB 2B1GA 2EILB 4JI2O 1WAZA 1AVMA 3ZN0A 3H1LH 1BS3A 3BY6A 2HVJC 2WAMA 3JAKB 3E35A 2OTLV 3RN4A 4I4TB 1NT2B 4XDJA 4UB8Z 1Y76A 3JYCA 1D5NA 3K04A 1VQ6V 1VARA 1HNXB 4WBNB 2Y4TA 1P4RA 5LA6A 4CZZA 3JAMN 2UXBB 4PA7A 4ZHQA 3UT5B 4ZBMA 2ZXWB 3OAAG 3RYCA 2F95B 3X2QC 1J5EO 1R3KC 4JYAO 4FFBB 1D2DA 1XDCA 2YC0A 5KHGA 3ZHRA 4WFGA 1I0HA 4IHJB 1M93A 3I56V 1VF7A 1FXVA 3R66A 2PZSA 3A0HZ 1NI8A 5BR8B 2EZPA 1SESA 3HR0A 3RVZA 1K3EA 3TXSA 4DR4B 1XOUA 2F1MA 3GWOA 3CWBH 3TJTA 1I08A 4OX9B 4RAIA 2P90A 3AK2A 4DV2B 2AZ0A 2YI8A 3K59A 1H8HG 2RNBA 4IGGA 2B1IA 2ZD9A 4OXSA 3E8HA 1JPXA 2BTQB 3MDSA 4YHHO 1Q81W 3ZS8C 1FYJA 2Q6AA 3WFVA 4BAYA 5CA0B 5BXZA 3LUTB 4BR6A 4LF4O 1JFFA 2HHHB 1QNMA 4UVCA 1NBMG 3L75H 4KUMA 1GRJA 1SQBH 4JYCA 5JCOA 1Q5OA 4H33A 3Q4HA 4NB5A 5LMNO 1K4DC 4NR1A 3G6EV 1VP7A 3OTOB 3RW0A 1RFYA 4AI8A 2AW9A 1R6TA 2YS8A 1TAEA 3AK1A 1URFA 3K08A 2F93B 3BEHA 2IJIA 1JX9A 5IDJA 4TUYA 2ZIMA 1Q6IA 2Q8VA 4I5SA 1TGOA 3M99B 3H1JH 4J11A 3FB7C 1E1QG 3CPWU 1XBLA 4GT1A 3LSSA 2E75B 4BWAA 5KLVH 2PTMA 2VQFO 1SA0B 3W7SA 2JVDA 2G38A 1DTOA 3ASOB 3CP1A 4JAVA 4PDLA 2ADQB 3ICXA 4XBFA 2DOSA 2IJHA 2QDOA 4DV3O 5LHIA 4NTYA 3FYEB 4JTCB 5LOVA 4G27B 3K5MA 1GMGA 1OCCC 2C2AA 4B3RO 3JSNA 4LFBB 3A8TA 1BT8A 4FIPC 3SGIA 3DSQA 5CA0A 3FFQA 1RM1C 4J7JA 2GTAA 1V55B 1BSMA 1MNGA 3JATA 5F2VO 1SQXH 3QO7A 3JD4A 2ZR3A 4GZRB 1YTFD 2Z3YA 4QE9A 3W7XA 5TISZ 2DQ0A 2WLNA 2W0FC 1M57B 2RCVA 5A9GA 4FMTA 1XHZA 1K97A 4ZOLA 1SERA 1S5LZ 4FFBA 4QPJA 1IZ3A 2XASA 3ASOC 3HKDB 1KC8W 2Q4PA 1D5AA 2XNDG 1G4YB 1WPBA 1N8RW 1VMGA 3ZRXA 5J9PC 2NNUA 4LFCO 1F4NA 2UXCO 1WLEA 2JGUA 3AEIA 4IYIA 1N33O 2LW1A 2RMKB 1N32B 4J9YB 3KCXA 2EJRA 3CRQA 2X6AA 2AHYA 1LUVA 1NQTA 2ZE6A 2L6LA 1WNSA 4DUZO 1US6A 2Q68A 3ETDA 3JALA 2XT9A 4O4JA 3CRAA 5EK0A 4PDVA 4J7ZA 2AHZA 3QG5A 4X1IB 4RUFA 1FXKB 1SETA 2MW2B 3TK1A 5D5PA 3LNMB 4RQFA 4FVMA 2KKWA 5H2FZ 4F6EA 1Y67A 2HJDA 1MSDA 2EINC 3FD9A 3B8NA 3CEIA 3SPIA 4D6TH 1FS0G 3BPZA 1RSOA 5JH7A 3BFRA 1NR1A 3IJ4A 2BOBC 2QKCA 1S3JA 3E86A 4X20A 1YJ9V 4R8CA 4X1KB 4WF9V 4FZ0A 2GDSA 2XAHA 5LYJA 1F7YA 4WCEV 3ZRWA 2ADPA 1VF6C 2X7RB 2YEVA 2GBOA 1K5SA 5KMGA 2W6IG 2UU9O 4F6RA 3R65A 3L73H 5LP6B 4IIJA 1SQVH 4JI5O 1AP6A 4GX5A 1SF9A 1NR7A 1MG1A 3CYOA 4DR6O 3CB2A 1JQ0A 4KHPB 2Y48A 2GV9A 1IBLO 1DF4A 3AG3C 2PYLA 1N34O 2UXDB 3FKSG 4AHCA 2EINB 4I9WA 1FXKC 4MTGA 2CE4A 4DV4O 2CDYA 2Q7GA 4X1YB 4X66O 1AI5A 4U3JB 1BL8A 4ABMA 1QVFU 3LDEA 1N4CA 2IH1C 1KECA 4DV6B 3CSXA 1KKCA 4HAMA 4XDKA 3CC2V 1BMFG 1Q86W 5LGTA 1BHBA 1VQOV 2ATKC 2CGOA 3ZHUA 3CE2A 4KFMA 5B1BB 4JI3B 1KP2A 5CB4B 5C8YA 4GKJO 4W4LA 1Y66A 4L8JA 2M7WA 4PHZA 5IYCO 1T5EA 1YTFB 1AB3A 2GUZA 4QJFB 3VBBA 2WLKA 2OCCB 1F4MA 4NTWA 3U0ZA 3SYPA 1N32O 2QWRB 3IC9A 1PNKA 2QE7G 4LF8B 3ZEDA 1NKDA 3VQWA 4FK5C 1S5JA 5EC2C 2PI4A 5CBFA 4O4IA 2XHBA 1J95A 5DECA 4IIJB 3HKBB 5H6RA 4A5UB 1VF5B 1OCOB 1YJWV 5GTIZ 4DXWA 3OM3B 4GKJB 1VEWA 1KYOF 1PD3A 2GUZB 2HEPA 1XMOO 1K9MW 2NLJC 4WFFA 1YJNV 1H2LA 1IVSA 1L8DA 5BR8O 1AR1B 2M6YA 4WFHA 2Q73A 5KHKA 3D36A 4FM2A 4MT8A 5HFMA 3AK3A 2OCCC 4CH4A 4JI4B 3ETQA 2JDIG 3PJSK 2UUBB 3QO8A 2OIGA 1L0LH 5KAIZ 5L3GA 1SQPH 2PGGA 1JJOA 2DYSB 1XL6A 1UFIA 5CA3A 1N34B 2UXDO 1M56C 4CC6A 4I9QA 4TSFG 4JI2B 1JMKC 3STZC 4DR2B 1R3IC 5B3SC 5LGUA 3WU2Z 1U97A 4F4LA 1Y6XA 3OEEG 2FMLA 3OT7A 2HFEC 3HKDA 3RYFA 1R6NA 3L71H 4JI1B 5GW7A 2A06H 4DYLA 1FJGO 4FLVA 4UV9A 3T4ZA 3K9SA 2FL4A 2QWOB 2R9RB 4JAUA 2UXBO 2CH7B 2LO1A 3MHSC 1H2GA 5CBGA 4O4IB 3E22A 3O65A 3B8MA 1XNRB 4PDMA 4X65O 1OV9A 4P2ZA 2LJ2A 3TETA 3SYOA 1FAFA 4X20B 2DW4A 1K33A 5LP6C 3HKBA 4JTAB 3STLC 3SPJA 1BZKA 2EZOA 1KB9F 2KG7A 1E79G 2ARHA 5FPRA 2HR3A 4TQDA
chains in the Genus database with same CATH topology
2PF4E 3UO3A 1FPOA 2QWPB 2GUZB 1GH6A 3BVOA 2QSAA 1BQ0A 3UCSC 2CTWA 4RWUA 1IURA 2GUZA 1WJZA 2YUAA 4IT5A 3AG7A 3UO2A 1BQZA 2N05A 2EJ7A 2L6LA 2M6YA 1XBLA 3APOA 1FAFA 1HDJA 2CTQA 2DMXA 2DN9A 4J80A 2QWRB 2QWQB 2YS8A 2CTRA 2OCHA 2QWOB 1NZ6A 2QWNB 2LGWA 3APQA 2KQXA 4J7ZA 2CUGA 2Y4TA 1N4CA 2LO1A 2N04A 2CTPA 2Y4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PF4 E;  3UO3 A;  1FPO A;  2QWP B;  2GUZ B;  1GH6 A;  3BVO A;  2QSA A;  1BQ0 A;  3UCS C;  2CTW A;  4RWU A;  1IUR A;  2GUZ A;  1WJZ A;  2YUA A;  4IT5 A;  3AG7 A;  3UO2 A;  1BQZ A;  2N05 A;  2EJ7 A;  2L6L A;  2M6Y A;  1XBL A;  3APO A;  1FAF A;  1HDJ A;  2CTQ A;  2DMX A;  2DN9 A;  4J80 A;  2QWR B;  2QWQ B;  2YS8 A;  2CTR A;  2OCH A;  2QWO B;  1NZ6 A;  2QWN B;  2LGW A;  3APQ A;  2KQX A;  4J7Z A;  2CUG A;  2Y4T A;  1N4C A;  2LO1 A;  2N04 A;  2CTP A;  2Y4U A; 
#chains in the Genus database with same CATH topology
 5KHJ A;  2X0L A;  1GAX A;  3WG7 B;  1Q90 D;  3ZHQ A;  1ZSP A;  2QTS A;  4RO2 A;  1FJG B;  1I5X A;  1FFX A;  1Q8I A;  5KA5 A;  2LFS A;  4EFB A;  2YDE A;  4DR3 B;  3U11 A;  1GTO A;  1IBM O;  4JI6 O;  5E1A C;  3CCJ V;  5LA6 B;  3ZHT A;  1K34 A;  2F4V O;  3UCS C;  2HKO A;  3OGI B;  1G8M A;  1XMQ B;  3RYH B;  1Q6H A;  1NJI W;  1Z5V A;  2ZE8 A;  1RM1 B;  3OMI B;  1R6K A;  2OT5 A;  2X6C A;  3C90 A;  4LF7 B;  1I5Y A;  4JGS A;  4I50 B;  2WLL B;  3VOU A;  3F7Y C;  4PJ0 Z;  4FFK A;  4HZ3 A;  4UUJ C;  4DR6 B;  2Z5U A;  1R3L C;  1K92 A;  1FFX B;  3DXR A;  3M8A A;  4ZOL B;  2CAZ C;  4BIO A;  4RUE A;  4DR5 B;  3OMN B;  2PUS A;  1H38 A;  4N23 A;  3E8B A;  5CBH A;  2QTO A;  3ZIA G;  4EB6 A;  4WFE A;  2WLI B;  4UCO A;  1H2S B;  1H8E G;  2Y4U A;  2DE0 X;  2QWP B;  3KKY A;  3BVO A;  4U7O A;  1KD1 W;  2AXT Z;  3LSU A;  4Q20 A;  3SPH A;  3T2M A;  5DED A;  1YCI A;  1QLE C;  3P30 A;  4MVO A;  1QCE A;  1MOF A;  4UVB A;  5CN0 A;  2ZDI C;  4JI1 O;  2CUG A;  2V7Q G;  2YI9 A;  4R7C A;  1F51 A;  4DR4 O;  2WLH A;  1PM9 A;  2CTP A;  2EIM C;  1PP9 H;  1ZL8 A;  3JAS A;  4I0X A;  2A9H A;  4RWU A;  4DR5 O;  2ZM6 B;  2IH3 C;  3FB6 C;  5KUK A;  4HNA B;  4UCT A;  1LR1 A;  2IM9 A;  2UXX A;  3B2E E;  3E8F A;  3SJB C;  4B3R B;  3ZRV A;  1IBK O;  1ZX3 A;  2XOK G;  1XI1 A;  4UXN A;  5JH7 B;  5CA1 A;  3ABL B;  3BHP A;  1H2N A;  4DV0 O;  3A0R A;  3EHB B;  3N27 A;  1U96 A;  2RN9 A;  3AG2 B;  1M5I A;  1EZV H;  3EVK A;  2FKX A;  1W0J G;  1N36 B;  5GTH Z;  2YEV B;  5KMG B;  1HDJ A;  2JJ2 G;  3QNE A;  5EIB D;  3TGU H;  4DV1 B;  4LF8 O;  1O9G A;  5LYJ B;  2BOC C;  1V54 B;  4DO2 A;  3OR7 C;  3J81 N;  3JAS B;  2QKS A;  4H44 B;  3UO3 A;  3CXH F;  4DR3 O;  3SYA A;  1XL4 A;  4DUY B;  1YHQ V;  3CRM A;  1ORQ C;  1LUW A;  4LFA B;  3AG3 B;  1Y74 A;  2DWD C;  4R50 A;  2QKA A;  1MSW D;  4DW0 A;  3FB5 C;  3VQV A;  4D7T A;  1N33 B;  5FNV A;  2EIK C;  1I7F A;  2VQE O;  3CCM V;  4YJ3 A;  3A0B Z;  4CH6 A;  3AG1 C;  3JD0 A;  1OJH A;  5IJ9 A;  1H2M A;  5LL6 Y;  3CHX A;  2DYS C;  2F66 C;  2GSM B;  2JS3 A;  1WA8 B;  4PEL A;  4FLT A;  2ITD C;  3K0G A;  1N0N A;  1YIT V;  4YY3 B;  4DV7 B;  3T1Y O;  3ASN C;  2QA4 V;  4ZIB A;  4LF6 B;  5IJ0 B;  5AG2 A;  4MW8 A;  1K4C C;  1JJ2 U;  4DUY O;  3K5N A;  3G6B A;  4H37 A;  4I7Z B;  3AG7 A;  5B1B C;  3RYI B;  2H94 A;  2V4D A;  4B3T B;  3WG7 C;  1CEZ A;  2QWQ B;  3W7U A;  3CCS V;  4PV1 B;  3ZMS A;  3JAR A;  2WA3 A;  2JRI A;  3OGC C;  1P7G A;  3ZHS A;  3ABM B;  2JEU A;  4CS3 A;  3ABT A;  4LH7 A;  2EBO A;  1IUR A;  1SS3 A;  2BE3 A;  3KCY A;  3BRC A;  1B06 A;  5BMV B;  1YIJ V;  1JOY A;  2AZ2 A;  3QF7 A;  1XQ8 A;  1ENV A;  1E1R G;  1HWY A;  3JAT B;  4LF9 O;  4TT3 G;  4K3A A;  1MMM A;  2LFR A;  2A3Q A;  1RPR A;  4YHH B;  4NXM B;  4FM0 A;  4FLZ A;  3FAV B;  4O4L A;  3EXA A;  3RVY A;  5GON B;  2NN4 A;  4B7K A;  1IBK B;  3J7A U;  2Q0O C;  1QU7 A;  4DV0 B;  2IU0 A;  5A2Q N;  5FNV B;  3G71 V;  3SJC C;  3CD6 V;  5FL7 G;  4FM1 A;  5JWP A;  2EIL C;  2R9I A;  4DUZ B;  4I0X B;  2HVK C;  3ABK C;  1BQ0 A;  4JAS A;  4PDR A;  1GN3 A;  4J42 A;  1GM7 A;  1S5H C;  3B40 A;  2A7W A;  5LP6 A;  3E89 A;  4NVP A;  1QR8 A;  2DN9 A;  2HP8 A;  3K03 A;  4WFA V;  1IBM B;  1W2B U;  5JQG B;  4J10 A;  4FLX A;  3ASN B;  1AI4 A;  4PD4 F;  3ZMU A;  3BAB A;  3K06 A;  1Y4M A;  1XMQ O;  4UVA A;  3P3P A;  4JI7 B;  3G80 A;  3L74 H;  4LBE C;  3RGB A;  5IYB O;  4ZKI A;  1SRY A;  1DGS A;  1W59 A;  2WLJ A;  2CTQ A;  2X6B A;  3RBZ A;  3W7W A;  4QE7 A;  4MTF A;  2BSK A;  5LMU O;  1AI6 A;  2F23 A;  1O9H A;  3ZHV A;  4GX1 A;  2IJJ A;  4C7U A;  5EBL C;  1QR9 A;  3CCV V;  3U10 A;  4DV3 B;  1MA1 A;  5L3B A;  4HNA A;  5LXT A;  4B3S B;  3LNN A;  2GTS A;  4JF3 A;  2R70 A;  1XNR O;  3CCE V;  3CJH B;  3K58 A;  3CXC U;  4E4E A;  1UJW B;  3B09 A;  3JCZ A;  4DR1 O;  3OD4 A;  2QM8 A;  3ETG A;  2F43 G;  4YJ2 A;  4DV4 B;  3NXS A;  1V54 C;  4X66 B;  4LF5 B;  3IC7 A;  1S0V A;  1P7B A;  2YIB A;  3T1C A;  1Q6U A;  3D3I A;  4U7N A;  1SZT A;  1NZ6 A;  1G6U A;  2MK3 A;  2VS0 A;  1HNZ O;  4JI0 B;  3CC4 V;  5LOV B;  4MVZ A;  3HKE B;  3LDC A;  1WB7 A;  1VQM V;  5B5E Z;  2ODM A;  1P84 F;  4LH6 A;  1P49 A;  3K57 A;  2LP7 A;  2V1D A;  2OIE A;  4O2B A;  2DMX A;  2XAJ A;  2K1E A;  1NH2 D;  2Z0A A;  2ZDI A;  5KHI A;  1NTK H;  1DLB A;  1ZAU A;  1OCO C;  3H9V A;  2JEX A;  4IT5 A;  3RFR A;  1B6Q A;  5LBQ A;  3OUS A;  4B08 A;  5J2U A;  3OW2 U;  1WP7 A;  1WN7 A;  1EN5 A;  2ITC C;  4H13 B;  1DK1 A;  3CX5 F;  4I55 B;  4FZ1 A;  3OMA B;  2QJ1 A;  2HG5 C;  1K73 W;  4N21 A;  2LW7 A;  4LFB O;  2QSA A;  1SA0 A;  3G67 A;  3CRR A;  3FX7 A;  1EZJ A;  4TQF A;  3DC6 A;  3GVM A;  4TV8 A;  3F5T A;  1EFR G;  2DWE C;  1QLN A;  2HJF C;  2ZE7 A;  3VQY A;  5DN6 G;  3N2G A;  3UKM A;  1I94 O;  4JZ2 A;  2JGD B;  4UCU A;  1PL4 A;  4GUN A;  1RP3 B;  4DV7 O;  5B1A B;  4LWS A;  5J2U B;  4L87 A;  3L70 H;  4FPP A;  4FJC C;  3DC5 A;  4LC1 A;  4EFE A;  4MVS A;  5GON A;  2GHY A;  4JI6 B;  5B1O A;  4JTD B;  1YF2 A;  1Q43 A;  1ARO P;  2ZR2 A;  2F4V B;  2W0X A;  1AR4 A;  1JR9 A;  1Z2G A;  4O2B B;  1OHH G;  1QQC A;  3SPC A;  4TV8 B;  2P22 C;  2O57 A;  3JAW B;  5IWA O;  4DK0 A;  2E5L B;  3E83 A;  2Y0P A;  4LF7 O;  1N36 O;  4LCU C;  3W7T A;  1YDX A;  1B04 A;  4QPK A;  4DV1 O;  2YIA A;  4JI8 B;  4MVR A;  2E3C A;  4O2A A;  1IXM A;  1OCC B;  2UUA O;  2PF4 E;  3JD2 A;  4WFB V;  5K1X A;  1VQK V;  1GH6 A;  4LWS B;  5H6Q A;  4OX9 O;  5KX5 B;  3LDD A;  3D3Q A;  4K35 A;  4KP4 A;  1RPO A;  3CCQ V;  4KL1 A;  4AIL C;  3RYF B;  2PI5 A;  4FLU A;  2QM7 A;  4JYB A;  2LGW A;  4RQE A;  1W0K G;  4X8A A;  2ZE5 A;  5CB4 A;  3K5L A;  1OCZ C;  4JAA A;  3H1I H;  1NS1 A;  2BTO A;  2OYQ A;  4X1I A;  5FPO A;  5B66 Z;  1WJZ A;  1PL0 A;  3ABK B;  5IYD O;  3D36 C;  4ZI7 B;  1IDS A;  2IJK A;  4X62 O;  4Z1M G;  4YJ3 B;  2EIJ B;  4P30 A;  2DYR B;  5KAF Z;  1EN4 A;  2R72 A;  3OTF A;  3CS5 A;  4UFZ A;  3T1Y B;  5LXT B;  4UCR A;  4W4K A;  2QGN A;  2Y69 C;  1ZWI C;  4X1K A;  3ZX6 A;  1OZ0 A;  2LQT A;  4EEQ A;  1Y76 B;  1NU1 H;  3UO2 A;  1KP3 A;  3CCL V;  3QO5 A;  1M90 W;  5D5Q A;  2XUM A;  4LFC B;  2UXC B;  1JFF B;  4OGQ B;  2XAQ A;  3RT3 C;  3FYI B;  3S3W A;  1L0N H;  1BGY H;  2QWN B;  3K3W A;  1XMO B;  2B5U A;  1R1B A;  2ZIN A;  3CC7 V;  1XNQ B;  1ZLZ A;  4G28 B;  5C93 A;  4DRX B;  3SYQ A;  1FPO A;  1SQQ H;  4QNH B;  2W6J G;  1EM1 A;  2ZT9 B;  2IU3 A;  5EC1 C;  2UUC O;  1HNW O;  5ITZ B;  2YXL A;  3WB1 A;  2VQF B;  4LR3 A;  4JPR A;  5CMU A;  4PA6 A;  2EIJ C;  4ASU G;  4BIZ A;  4CS2 A;  1FXH A;  4TUY B;  3O9O A;  4MVU A;  4F6R B;  1QLE B;  1OCR B;  2BCC H;  1AI7 A;  1KU9 A;  3P3N A;  3ZRW B;  3CRC A;  1X59 A;  2WWW A;  3QVN A;  2XTA A;  1SC5 B;  2XAF A;  4O4H B;  2ZQM A;  1KUQ A;  3GB7 C;  1YI2 V;  2HLD G;  2KQX A;  4O4L B;  3L72 H;  1S72 V;  3DTU B;  2RQ6 A;  1QBZ A;  2E5L O;  4YIO A;  1L1F A;  5EBW C;  2UU9 B;  4Q6G A;  2ZNI A;  1PKX A;  2UUC B;  2YXH A;  4MSW C;  5CA1 B;  4JYY A;  3ABM C;  3SJQ C;  2Q7H A;  4KXR A;  4JI8 O;  3BAA A;  1SQF A;  3H01 A;  1TUB A;  1WP8 A;  5IE9 A;  1AP5 A;  3C3T A;  3APQ A;  5IT9 N;  4X9Q A;  2AGA A;  3J80 N;  4BW5 A;  4GKK B;  3ZN1 A;  5EZY B;  4GLX A;  1BE3 H;  2CH7 A;  1HW7 A;  4JI7 O;  3BCC H;  4IL6 Z;  5J2T A;  4GX0 A;  4CC5 A;  3H1H H;  1HR0 O;  4ICG A;  4O4J B;  1KQS U;  4E2L A;  1M1K W;  3I5D A;  2JGD A;  1A32 A;  1B3Q A;  4O2A B;  3K9A A;  4DV6 O;  2YID A;  1MZE A;  5KX5 A;  3CME V;  1DF5 A;  4JI4 O;  3JCU Z;  4LNU A;  2P7T C;  2Q69 A;  4B7E A;  1X4T A;  1WPX A;  3N2K B;  1H2K A;  1TUB B;  2CK3 G;  1XIL A;  2Y0I A;  5ITZ A;  4NYK A;  5IJ9 B;  4DV5 O;  3TXQ A;  4GKK O;  4G2K A;  1VF6 A;  1PV0 A;  4DR2 O;  3I55 V;  4UB6 Z;  2ZKO A;  2QEX V;  5IYZ B;  5J2T B;  4FLY A;  1GN4 A;  4B3M O;  2P6J A;  5H9C A;  1HR0 B;  1AIL A;  1HP8 A;  4X1Y A;  5B1A C;  3KG2 A;  1Q3E A;  5HFL A;  3ZMV A;  1M56 B;  5L3C A;  3SJA C;  4AQY O;  4Z1V A;  4CH5 A;  3RWR D;  5H5N A;  1PNL A;  5JJJ B;  1NVP B;  1MAB G;  1S76 D;  2WLM A;  5JJE B;  2ZXW C;  2K9P A;  1YZB A;  3HKC A;  4FLW A;  1VQ7 V;  3OR6 C;  3JAW A;  4I50 A;  2YXY A;  3TCU A;  3C3S A;  4PI0 A;  1NTZ H;  1K8A W;  5JJN B;  3DGE A;  1IBL B;  4UCV A;  4TV9 B;  4DW1 A;  2LGQ A;  4J80 A;  3ZBH A;  4GX2 A;  3JAK A;  3E22 B;  5IYZ A;  1IXB A;  2PYJ A;  4TWK A;  1AJN A;  5L3E A;  5BY1 A;  3QTC A;  3AG2 C;  3AG4 B;  3SDL A;  2HHH O;  2WLL A;  2CTW A;  1YVW A;  1S77 D;  2D3O W;  3EFF K;  3H1K H;  2A79 B;  4X89 A;  4DR7 B;  2P67 A;  4MS2 A;  1HNX O;  5LMU B;  2P4K A;  4HYO A;  2KB1 A;  1YXB A;  3ML0 A;  3PN1 A;  2ZM6 O;  4X64 B;  2N04 A;  5B3S B;  2A0L A;  3JAR B;  1CXZ B;  1VQ4 V;  3N2K A;  4IYH A;  4O4H A;  4NXM O;  1SQG A;  2EUL A;  2E76 B;  2OWO A;  5EBM C;  5KA6 A;  3T1H B;  2XAG A;  4YXW G;  1V9P A;  2JS5 A;  1CP9 A;  1EBO A;  3UM7 A;  3ZRS A;  4J7K A;  2FYU H;  1LNQ A;  3LSQ A;  1SZX A;  2Q67 A;  1I94 B;  3HB3 B;  1M9N A;  1IX9 A;  4X62 B;  1M4U A;  2P06 A;  4UCS A;  3IGA C;  3B77 A;  2N74 A;  2VWJ A;  4X64 O;  3L9D A;  4NKG B;  4D7S A;  4LFA O;  4MVQ A;  3OFN G;  5JCO C;  2E74 B;  3SR2 C;  5IJ0 A;  4X65 B;  2ZIO A;  1AR5 A;  3CCU V;  3VQX A;  3APO A;  3THO A;  1BHA A;  3DXR B;  1NH2 B;  3E8G A;  3RYI A;  3AG1 B;  2PY5 A;  3CJH A;  4Z2W A;  3OE7 G;  3SYC A;  2EIK B;  4LNU B;  4QIW F;  5JQG A;  1AJQ A;  1VQL V;  1WB8 A;  1TVK B;  4OPH A;  5EYP A;  2UUA B;  3OTO O;  4YY3 O;  2H3O A;  1VQN V;  1RSO B;  4LF6 O;  2EJ7 A;  4P9P A;  4HBN A;  2R9A A;  1K7D A;  4P9O A;  5LHG A;  3MAQ A;  2JIZ G;  1THZ A;  2YSU B;  5EZY A;  4I4T A;  2QM4 A;  5KHH A;  5LGN A;  3WB2 A;  4J9Z B;  2EIM B;  2FTK A;  4MTX A;  5IY5 C;  1NVP D;  4J41 A;  2IBZ H;  2ZCE A;  5EIB C;  2P4V A;  1COW G;  4DR1 B;  4JV5 B;  2VWK A;  1ZL8 B;  5KUM A;  1OCZ B;  1QVG U;  4LF5 O;  2WLI A;  1FD9 A;  1JVM A;  2OCH A;  1NTM H;  1R73 A;  3ABL C;  5JVD B;  3CMA V;  3K0D A;  2NR5 A;  4EB6 B;  3G4S V;  1GKF A;  3UQ8 A;  4LF9 B;  2IW5 A;  4JI3 O;  3BA8 A;  3D8C A;  4ZHQ B;  1SKV A;  4GCZ A;  3JD3 A;  1XRE A;  5FLX N;  2DYR C;  3RYC B;  1YEW A;  3A2F A;  1V55 C;  5BZB A;  3OUF A;  3T1H O;  2P5O A;  4BIU A;  1XUQ A;  1GO3 F;  4K0K B;  4IHJ A;  4JV5 O;  2VQE B;  2D2C B;  4LF4 B;  3HKE A;  1VQ9 V;  4PA9 A;  1F23 A;  1KBH A;  3F5W C;  1BQZ A;  3ZMT A;  2RDC A;  3NR7 A;  2EX3 A;  1VQP V;  1QHT A;  3BA9 A;  1KMI Z;  3KZI Z;  3MD0 A;  4MTO A;  2WA4 A;  2ILM A;  3B4S A;  1UPG A;  3GWK C;  1BCC H;  4K8X A;  4KHP O;  5DM6 V;  4WBN A;  2BSK B;  3IFX A;  1JA8 A;  4DV5 B;  1YSC A;  2DJV A;  4PI2 A;  1XEQ A;  5EYP B;  3T4D A;  4R6Z A;  2QR4 A;  1AJP A;  2KG7 B;  3FB8 C;  1GN6 A;  3JSL A;  1VQ8 V;  3AG4 C;  2ETN A;  4B3M B;  1Q7Y W;  4CH3 A;  1VIB A;  3JAL B;  4QGP A;  4I55 A;  4AQY B;  4CBC A;  3JD1 A;  2DQ3 A;  3ZJZ A;  2VRZ A;  4EKW A;  4JZG A;  2KSD A;  2YIC A;  3K5O A;  4NXN O;  3Q4H B;  5JVD A;  1TUE B;  2Q0A A;  3ZMZ A;  1J5E B;  1Z5W A;  2JJ1 G;  1PPJ H;  4MW3 A;  3K79 A;  3MHH C;  1VQ5 V;  1EN6 A;  3E2E A;  1ZUQ A;  1OCR C;  5BMV A;  4XDL A;  5K1P A;  1TA8 A;  4GYC B;  1GK9 A;  1XNQ O;  1R3J C;  3M7M X;  1WA8 A;  3OEH G;  3FAV A;  4CS4 A;  1PNM A;  2JK5 C;  5L3D A;  5IWA B;  4X88 A;  3HPL C;  4PA3 A;  1HNW B;  2ZNJ A;  4DR7 O;  4JI5 B;  2B9Z A;  1FXK A;  4BW9 A;  4UV8 A;  2YUA A;  3UT5 A;  4NXN B;  4JI0 O;  1HNZ B;  1FKA O;  4DV2 O;  2N05 A;  1N0J A;  2CGN A;  1ROP A;  5E79 Z;  2UXN A;  4U3F H;  1K5Q A;  2Q9L A;  2Q7E A;  4ZI7 A;  3CCR V;  3WB0 A;  4NTX A;  2WPD G;  2FB5 A;  3P32 A;  4YJ2 B;  1GM8 A;  1G1X B;  1Y74 B;  1FFT B;  4B3T O;  4TV9 A;  1CPY A;  1JCH A;  2Y69 B;  1MZF A;  4K0K O;  4U3J A;  1XHX A;  5LHH A;  3S3X A;  2CTR A;  2OTJ V;  4MVM A;  4K8Z A;  3IAY A;  1TVK A;  2WSS G;  4OPA A;  3X2Q B;  5LMN B;  2BTQ A;  3SPG A;  2L35 A;  1Q82 W;  5L3F A;  5C8Y B;  4TOI A;  1GM9 A;  3N2G B;  2Q5Z A;  3RYH A;  2UUB O;  1M57 C;  2RJZ A;  4DRX A;  3ABU A;  5IY5 B;  1ZTE A;  2H8P C;  4B3S O;  4PA4 A;  4H0L B;  3ZCC A;  4JYA B;  1KKD A;  4LP8 A;  4YIP A;  5B1N A;  1GN2 A;  3F7V C;  4DK1 A;  2YIB D;  3ETE A;  3HKC B;  2B1G A;  2EIL B;  4JI2 O;  1WAZ A;  1AVM A;  3ZN0 A;  3H1L H;  1BS3 A;  3BY6 A;  2HVJ C;  2WAM A;  3JAK B;  3E35 A;  2OTL V;  3RN4 A;  4I4T B;  1NT2 B;  4XDJ A;  4UB8 Z;  1Y76 A;  3JYC A;  1D5N A;  3K04 A;  1VQ6 V;  1VAR A;  1HNX B;  4WBN B;  2Y4T A;  1P4R A;  5LA6 A;  4CZZ A;  3JAM N;  2UXB B;  4PA7 A;  4ZHQ A;  3UT5 B;  4ZBM A;  2ZXW B;  3OAA G;  3RYC A;  2F95 B;  3X2Q C;  1J5E O;  1R3K C;  4JYA O;  4FFB B;  1D2D A;  1XDC A;  2YC0 A;  5KHG A;  3ZHR A;  4WFG A;  1I0H A;  4IHJ B;  1M93 A;  3I56 V;  1VF7 A;  1FXV A;  3R66 A;  2PZS A;  3A0H Z;  1NI8 A;  5BR8 B;  2EZP A;  1SES A;  3HR0 A;  3RVZ A;  1K3E A;  3TXS A;  4DR4 B;  1XOU A;  2F1M A;  3GWO A;  3CWB H;  3TJT A;  1I08 A;  4OX9 B;  4RAI A;  2P90 A;  3AK2 A;  4DV2 B;  2AZ0 A;  2YI8 A;  3K59 A;  1H8H G;  2RNB A;  4IGG A;  2B1I A;  2ZD9 A;  4OXS A;  3E8H A;  1JPX A;  2BTQ B;  3MDS A;  4YHH O;  1Q81 W;  3ZS8 C;  1FYJ A;  2Q6A A;  3WFV A;  4BAY A;  5CA0 B;  5BXZ A;  3LUT B;  4BR6 A;  4LF4 O;  1JFF A;  2HHH B;  1QNM A;  4UVC A;  1NBM G;  3L75 H;  4KUM A;  1GRJ A;  1SQB H;  4JYC A;  5JCO A;  1Q5O A;  4H33 A;  3Q4H A;  4NB5 A;  5LMN O;  1K4D C;  4NR1 A;  3G6E V;  1VP7 A;  3OTO B;  3RW0 A;  1RFY A;  4AI8 A;  2AW9 A;  1R6T A;  2YS8 A;  1TAE A;  3AK1 A;  1URF A;  3K08 A;  2F93 B;  3BEH A;  2IJI A;  1JX9 A;  5IDJ A;  4TUY A;  2ZIM A;  1Q6I A;  2Q8V A;  4I5S A;  1TGO A;  3M99 B;  3H1J H;  4J11 A;  3FB7 C;  1E1Q G;  3CPW U;  1XBL A;  4GT1 A;  3LSS A;  2E75 B;  4BWA A;  5KLV H;  2PTM A;  2VQF O;  1SA0 B;  3W7S A;  2JVD A;  2G38 A;  1DTO A;  3ASO B;  3CP1 A;  4JAV A;  4PDL A;  2ADQ B;  3ICX A;  4XBF A;  2DOS A;  2IJH A;  2QDO A;  4DV3 O;  5LHI A;  4NTY A;  3FYE B;  4JTC B;  5LOV A;  4G27 B;  3K5M A;  1GMG A;  1OCC C;  2C2A A;  4B3R O;  3JSN A;  4LFB B;  3A8T A;  1BT8 A;  4FIP C;  3SGI A;  3DSQ A;  5CA0 A;  3FFQ A;  1RM1 C;  4J7J A;  2GTA A;  1V55 B;  1BSM A;  1MNG A;  3JAT A;  5F2V O;  1SQX H;  3QO7 A;  3JD4 A;  2ZR3 A;  4GZR B;  1YTF D;  2Z3Y A;  4QE9 A;  3W7X A;  5TIS Z;  2DQ0 A;  2WLN A;  2W0F C;  1M57 B;  2RCV A;  5A9G A;  4FMT A;  1XHZ A;  1K97 A;  4ZOL A;  1SER A;  1S5L Z;  4FFB A;  4QPJ A;  1IZ3 A;  2XAS A;  3ASO C;  3HKD B;  1KC8 W;  2Q4P A;  1D5A A;  2XND G;  1G4Y B;  1WPB A;  1N8R W;  1VMG A;  3ZRX A;  5J9P C;  2NNU A;  4LFC O;  1F4N A;  2UXC O;  1WLE A;  2JGU A;  3AEI A;  4IYI A;  1N33 O;  2LW1 A;  2RMK B;  1N32 B;  4J9Y B;  3KCX A;  2EJR A;  3CRQ A;  2X6A A;  2AHY A;  1LUV A;  1NQT A;  2ZE6 A;  2L6L A;  1WNS A;  4DUZ O;  1US6 A;  2Q68 A;  3ETD A;  3JAL A;  2XT9 A;  4O4J A;  3CRA A;  5EK0 A;  4PDV A;  4J7Z A;  2AHZ A;  3QG5 A;  4X1I B;  4RUF A;  1FXK B;  1SET A;  2MW2 B;  3TK1 A;  5D5P A;  3LNM B;  4RQF A;  4FVM A;  2KKW A;  5H2F Z;  4F6E A;  1Y67 A;  2HJD A;  1MSD A;  2EIN C;  3FD9 A;  3B8N A;  3CEI A;  3SPI A;  4D6T H;  1FS0 G;  3BPZ A;  1RSO A;  5JH7 A;  3BFR A;  1NR1 A;  3IJ4 A;  2BOB C;  2QKC A;  1S3J A;  3E86 A;  4X20 A;  1YJ9 V;  4R8C A;  4X1K B;  4WF9 V;  4FZ0 A;  2GDS A;  2XAH A;  5LYJ A;  1F7Y A;  4WCE V;  3ZRW A;  2ADP A;  1VF6 C;  2X7R B;  2YEV A;  2GBO A;  1K5S A;  5KMG A;  2W6I G;  2UU9 O;  4F6R A;  3R65 A;  3L73 H;  5LP6 B;  4IIJ A;  1SQV H;  4JI5 O;  1AP6 A;  4GX5 A;  1SF9 A;  1NR7 A;  1MG1 A;  3CYO A;  4DR6 O;  3CB2 A;  1JQ0 A;  4KHP B;  2Y48 A;  2GV9 A;  1IBL O;  1DF4 A;  3AG3 C;  2PYL A;  1N34 O;  2UXD B;  3FKS G;  4AHC A;  2EIN B;  4I9W A;  1FXK C;  4MTG A;  2CE4 A;  4DV4 O;  2CDY A;  2Q7G A;  4X1Y B;  4X66 O;  1AI5 A;  4U3J B;  1BL8 A;  4ABM A;  1QVF U;  3LDE A;  1N4C A;  2IH1 C;  1KEC A;  4DV6 B;  3CSX A;  1KKC A;  4HAM A;  4XDK A;  3CC2 V;  1BMF G;  1Q86 W;  5LGT A;  1BHB A;  1VQO V;  2ATK C;  2CGO A;  3ZHU A;  3CE2 A;  4KFM A;  5B1B B;  4JI3 B;  1KP2 A;  5CB4 B;  5C8Y A;  4GKJ O;  4W4L A;  1Y66 A;  4L8J A;  2M7W A;  4PHZ A;  5IYC O;  1T5E A;  1YTF B;  1AB3 A;  2GUZ A;  4QJF B;  3VBB A;  2WLK A;  2OCC B;  1F4M A;  4NTW A;  3U0Z A;  3SYP A;  1N32 O;  2QWR B;  3IC9 A;  1PNK A;  2QE7 G;  4LF8 B;  3ZED A;  1NKD A;  3VQW A;  4FK5 C;  1S5J A;  5EC2 C;  2PI4 A;  5CBF A;  4O4I A;  2XHB A;  1J95 A;  5DEC A;  4IIJ B;  3HKB B;  5H6R A;  4A5U B;  1VF5 B;  1OCO B;  1YJW V;  5GTI Z;  4DXW A;  3OM3 B;  4GKJ B;  1VEW A;  1KYO F;  1PD3 A;  2GUZ B;  2HEP A;  1XMO O;  1K9M W;  2NLJ C;  4WFF A;  1YJN V;  1H2L A;  1IVS A;  1L8D A;  5BR8 O;  1AR1 B;  2M6Y A;  4WFH A;  2Q73 A;  5KHK A;  3D36 A;  4FM2 A;  4MT8 A;  5HFM A;  3AK3 A;  2OCC C;  4CH4 A;  4JI4 B;  3ETQ A;  2JDI G;  3PJS K;  2UUB B;  3QO8 A;  2OIG A;  1L0L H;  5KAI Z;  5L3G A;  1SQP H;  2PGG A;  1JJO A;  2DYS B;  1XL6 A;  1UFI A;  5CA3 A;  1N34 B;  2UXD O;  1M56 C;  4CC6 A;  4I9Q A;  4TSF G;  4JI2 B;  1JMK C;  3STZ C;  4DR2 B;  1R3I C;  5B3S C;  5LGU A;  3WU2 Z;  1U97 A;  4F4L A;  1Y6X A;  3OEE G;  2FML A;  3OT7 A;  2HFE C;  3HKD A;  3RYF A;  1R6N A;  3L71 H;  4JI1 B;  5GW7 A;  2A06 H;  4DYL A;  1FJG O;  4FLV A;  4UV9 A;  3T4Z A;  3K9S A;  2FL4 A;  2QWO B;  2R9R B;  4JAU A;  2UXB O;  2CH7 B;  2LO1 A;  3MHS C;  1H2G A;  5CBG A;  4O4I B;  3E22 A;  3O65 A;  3B8M A;  1XNR B;  4PDM A;  4X65 O;  1OV9 A;  4P2Z A;  2LJ2 A;  3TET A;  3SYO A;  1FAF A;  4X20 B;  2DW4 A;  1K33 A;  5LP6 C;  3HKB A;  4JTA B;  3STL C;  3SPJ A;  1BZK A;  2EZO A;  1KB9 F;  2KG7 A;  1E79 G;  2ARH A;  5FPR A;  2HR3 A;  4TQD A; 
#chains in the Genus database with same CATH homology
 2PF4 E;  3UO3 A;  1FPO A;  2QWP B;  2GUZ B;  1GH6 A;  3BVO A;  2QSA A;  1BQ0 A;  3UCS C;  2CTW A;  4RWU A;  1IUR A;  2GUZ A;  1WJZ A;  2YUA A;  4IT5 A;  3AG7 A;  3UO2 A;  1BQZ A;  2N05 A;  2EJ7 A;  2L6L A;  2M6Y A;  1XBL A;  3APO A;  1FAF A;  1HDJ A;  2CTQ A;  2DMX A;  2DN9 A;  4J80 A;  2QWR B;  2QWQ B;  2YS8 A;  2CTR A;  2OCH A;  2QWO B;  1NZ6 A;  2QWN B;  2LGW A;  3APQ A;  2KQX A;  4J7Z A;  2CUG A;  2Y4T A;  1N4C A;  2LO1 A;  2N04 A;  2CTP A;  2Y4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...