2IU3A

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-based design, synthesis, evaluation, and crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
total genus 203
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2006-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2iu3A04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2iu3A01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu3A02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu3A03
4EHIA 1M9NA 1S89A 1B93A 1C3OA 1T36A 5H3LA 1KEEA 2IU3A 1EGHA 1PKXA 1S8AA 1A9XA 2X8WA 1VMDA 1CE8A 1JDBB 1BXRA 1IK4A 2IU0A 1PL0A 3ZZMA 2B1IA 1THZA 4A1OA 1M6VA 1G8MA 1P4RA 2YVQA 1ZCZA 1C30A 2B1GA 2XW6A 1OZ0A 1WO8A 1CS0A
chains in the Genus database with same CATH superfamily
4HDMA 4M9QA 5FWDA 3HO1A 2PEYA 3WK6A 1HDXA 3E6AA 1RHRA 5IZCC 2WR8A 2IU3A 1JUDA 4WECA 1HFKA 4BBAA 3QPCA 1DRUA 2IUEA 3KSDO 2V7QG 3RYIB 1RWMA 4Q7JB 3VGJA 4C9BA 5KYUB 3U7JA 5ALEA 1TM3E 1I51A 2M6LA 6CHYA 1CE8A 2RHHA 1NMXA 3G6WA 3PSAA 2ZKOA 1JEJA 1NF2A 4D9MA 4A03A 2B8WA 4WSOA 3TK1A 5DGTA 1NVPD 1FTGA 3PC3A 5AKYA 3C6ZA 3V8RA 3ZZMA 5BVGB 1G4YB 5AW0A 3OLCX 4RGQA 3CRNA 2F4VO 2NMVA 2AA3A 4LJ4A 4GPEA 4TSFA 5JD6A 3AVTA 1NTOA 1XL0A 5BN4B 3TQRA 4D8YA 2XVAA 4NECA 1JKJA 4MKIA 5CEFA 4F3TA 2P11A 3VU3A 2W2VA 1FKAO 4UU0A 4FEAA 5JRJA 4AF8A 4BLRA 4UEQA 4DNPA 4PW0A 3QLVC 4HXEB 2FMUA 5EPOA 1NTKH 3B2EA 1Z8FA 1OJLA 4MTGA 1DQRA 1HA3A 1Z25A 2AFIE 4HWKA 4TUYB 1OIXA 2J3HA 3KCYA 3MUNA 4KR7A 1KHTA 2BGMA 4D5EA 4MVJE 5FPPA 4EFEA 1JE1A 3G02A 4UD6A 1M1NA 5AI8A 3R7LA 3SBDA 3ZHYA 4ALLA 1B04A 2GK4A 1QFYA 4E5PA 5I7AA 2LV8A 4II3A 9GPBA 1FW6A 4JT8A 3ZTTA 4E33A 1U8FO 1DX9A 5B58T 3HU5A 1RAHA 3ORSA 1NQXA 1FFEA 4BYGA 1IWBB 1G60A 3O1HB 4IZOA 3ZJYA 2PL3A 1SR8A 3QLTA 2CXOA 3HL4A 5COBA 3I5MA 4POAA 3N2LA 1UC4B 4MJXA 3OUTA 1YQ9A 2YIDA 4D42A 2XHZA 4XVQA 3T3IA 4CQLA 1WG8A 4B74A 2YQ5A 4QNRA 3NDJA 4RGBA 1UBKS 4WZ6A 4US0R 2VH2A 1N2BA 4WCDA 2VSFA 1Y9DA 1O95A 4P4UA 1JTFA 5JYDA 4LY0A 3GP8A 2G83A 2OCLA 1OTHA 1UDBA 3MLAA 3CD6V 1PL6A 4HGNA 2Q73A 1MJHA 2XAQA 1NJGA 2EWWA 4HNAA 2ZT5A 3HI4A 4K3VA 3WA7A 4XWTA 4BW9A 1MA0A 4TMFA 2A86A 2EEZA 1P81A 3DLIA 3KEQA 4TTRA 1MC5A 2IXEA 4LXGA 2YDXA 1XF1A 1PFUA 1UBHS 1CUUA 1T4MA 2GK6A 1YWGO 4AWBA 5I01A 3EF3A 1G4AE 1P1KA 1ZK4A 2C8LA 5TPZD 5CMUA 3CC2V 1TMOA 4F2WA 1PNMA 4OGQB 5EYPB 4R7CA 3OCZA 2MWMA 4M1MA 4DCOA 1G59A 1QHXA 2CHFA 2C83A 1IAVA 3IVXA 1JJIA 1AJEA 3KYBA 3W8RA 2W11A 1DDOA 4MKXA 4EOGA 1FNNA 1F5SA 1RHMA 4B0PA 4KR2A 2KKWA 1BW9B 3F7MA 1N25A 1EDEA 3ISTA 5ETJA 1OKKD 1M2GA 4C6HA 1IM5A 2ORWA 3M89A 1B16A 2DH6A 4E2LA 5DNAA 5BYKA 3OZWA 4RE5A 4I7ZB 4BX8A 1J99A 4M1ZA 4Z3KA 2FHSA 3AC0A 4H4DA 1G0NA 5AI9A 5ALDA 3DZIA 5IFKA 4QOSA 4OHMA 1TO6A 2PKCA 3OJLA 3NUZA 4HMPA 4QUHA 5JSYA 1VQOV 3V2IA 5I45A 1KYQA 1XFDA 4LXQA 1QH8B 1S89A 4MVJM 4KPUB 1KTIA 1K6XA 4B7AA 2GYUA 4I2VA 4F5DA 4F71A 4UCTA 3ER6A 4QD3A 1WWRA 5I8PA 2QTLA 1DB3A 4UNPA 1O03A 2DLDA 3DO6A 4INAA 1WVIA 3MHPA 16PKA 4JENA 3K03A 3AI2A 3CH5A 1JHAA 4TRNA 1COWA 3ZX5A 5CFLA 4XI9A 1EVQA 5CVTA 3R44A 4IEEA 3KOMA 1AVMA 4R2MA 2FKAA 1T5IA 2Q50A 1HLGA 2GJ4A 3F3YA 5K0SA 1TMGE 1XLTC 4NNJA 1KOLA 2D2CB 4HNVA 4HDKB 1ZD2P 2WWWA 4OX9O 2P1ZA 1Y42X 3N8NA 3PV0A 5THKA 5BR1A 1FZTA 4C0AC 4DOMA 5JMOA 3DJYA 4YV7A 4CKWB 1OGJA 3P8ZA 4EHKA 2JFOA 4C6SA 1BH6A 4M37A 5AI5A 3IDZA 4PTLA 3BX1A 3EBLA 2WU4A 4YAGA 3AL0C 4MHSA 5TPWA 1IXBA 5HTOA 1FYDA 4IDDA 3UEOA 2HO5A 1NXSA 1D0SA 5HNKA 2R7AA 4AJHA 4CJXA 4KLAA 3WIVA 5T41A 1OFIA 1WSAA 2P2DA 1UBCA 2ODBA 3HP4A 4Q3EA 1OREA 3FZYA 3CNHA 5LMUB 3R09A 1HLDA 2B83A 1SKYE 4MIEA 3IJ5A 1Y3DE 5L7YA 5UKDA 1OYWA 1U04A 3JTEA 3T5TA 2OFWA 4LEIA 5KNDH 2H31A 1VI6A 1H6CA 1RXVA 1HNXB 4BBZA 1XCPA 2OR3A 5LP6A 3E70C 1W47A 3KJFA 3CUTA 1CEQA 3E53A 4FVTA 5CIQA 3PN1A 5K3AA 2PYLA 3BK1A 3BRCA 1AHIA 4GXNA 2APJA 1BDIA 4MQFA 3L1HA 4PICA 5EJ2A 3NYQA 1N1MA 1FMJA 3WSTA 1YIAA 2RJ3A 2WAAA 3B6EA 4MMYB 1ZIPA 2JL1A 2VT7A 3T1CA 4NDAA 3ZD7A 1N6IA 2PO7A 4IJVA 4YUZA 2ZUSA 2R25B 4S1TA 4AJ9A 1G0OA 1AJPA 1JEQA 1QE5A 1URPA 3CT4A 4GMDA 1FCJA 4LJKA 5E1MA 1CDDA 4DC1A 2QQGA 4JASA 1FLDA 2VTEA 3EPPA 3QMMA 4A0HA 1WN6A 3X2QC 2QWNB 2QTBA 2VJDA 3W8NA 4A6DA 5ALGA 2CK3A 1Q6HA 4M60A 5EVJA 2VKQA 2A8YA 2NO7A 1TJNA 3W2TA 1SD5A 5DCLA 3DMOA 3NTRA 2VA9A 3U17A 2FMXA 3KZKA 1X77A 1M56B 2B4YA 1NMEA 2V6GA 4PGHA 5DM1A 5F12A 4DFDA 2BI7A 4QULA 3AVWA 2CJPA 3IFXA 3KZOA 3ZI0A 3LU1A 2WZQA 2XR1A 3E15A 3DHVA 1PR3A 4BIMA 3VO1A 3C3EA 4DKXA 2O23A 4LXIA 5TVKA 1A9XB 4NXMO 1AM4D 4C0SA 1DIAA 1W34A 2H1HA 2AXNA 1K5QA 5AHRA 3NR7A 1DC8A 1T9ZA 2HADA 2PRSA 3A27A 3EYWA 5ALKA 5K09A 5KC8A 1WSBA 1X7YA 2VDPB 3H2BA 3V2GA 3Q0TA 2IJHA 3C1UA 3KLMX 5DNDA 2QJFA 4PSVA 3QE2A 4KX3A 4WDQA 3I5AA 2VZLA 3II6X 5CJ2A 5BY2A 3FMPB 1JB1A 5LGTA 2GO1A 4FYYA 4HNQA 4OHOA 1II8A 2BM0A 1IXKA 2VJKA 3CRZA 4KXQA 1L3BA 3QW4B 4QXRA 1Y9JA 3KKPA 2TMKA 3COSA 3SGLA 3I6QA 1AI5A 3GXBA 4MMXB 2JKYA 1IWPB 1E1RA 4WZZA 5FNZA 3ETCA 1TGVA 3STLC 4OLFA 3FGNA 4JLKA 2YICA 5F2EA 3WZ2A 1YE3A 4BO6A 2HA7A 4C78A 4C2AA 4EGQA 4N49A 3KRTA 2ZT9B 2V59A 4QOJA 4C2TA 1YE5A 2UUAB 1J5PA 3DC6A 1Z83A 3IKMB 4N5DA 4UVIA 4YAEA 3I72A 3TZEA 1NBEA 4BJHB 2V4MA 2GLXA 4NFLA 4QPJA 3WKCA 1HR0O 4HH3C 3BH7A 2H1VA 1Q7TA 1XZGA 4KI0A 4HRVA 2JFXA 5HFLA 2XYVA 4PFKA 5CXUA 4AS1A 1KRXA 1LWNA 1IEXA 2G08A 1KYZA 2ZROA 3B1WA 1ZP6A 2X5KO 3AM5A 2PQ0A 4LF4B 2DY0A 4MDYA 4D5GA 1T26A 2GD1O 2CB0A 3FTCA 2HREA 4L4XA 3VSDA 1Q6IA 3Q8LA 1HFEL 2VJQA 4IIUA 4Y2RA 2QXTA 2I3BA 4ISBA 3EXHA 1JSZA 3C15C 3E27A 3VBCA 4JYYA 2FQWA 4O2AB 4UARA 2ZNVA 3BSFA 3CWCA 3C8DA 3IBFA 1UFQA 1G18A 2PK3A 4RKQA 1V4BA 4EW3A 4QQNA 1ODTC 1SZPA 3OEEG 1KZYC 1Z34A 2Y2VA 1GNQA 1O0SA 4HDSB 5DHSA 1VBFA 5ENZA 3SHOA 4A6PA 4Z5XA 3V2UA 4B6SA 4ZALA 5I7EA 3CRCA 4LF8O 1UPCA 3R5XA 3SDBA 1J97A 3A6KA 4BFZA 4HB2A 2Y69B 1NBWB 1FLNA 1UFRA 4PZEA 1JTKA 3FDJA 3L7OA 2Q3LA 3HYCA 5EIEA 4MGHA 2R72A 4JI1O 4C4PA 3NHSA 1FX1A 4YAWA 1T6XA 5JJNB 1X9GA 1K7CA 4N01A 3OIYA 4LGVA 1NLYA 5GZ6A 2OV2A 4TL9A 4BN4A 4U1RA 2IP1A 4PLTA 1PQWA 3ZBQA 4YWHA 1DC5A 3OQHA 4IZIA 2P4QA 4JLUA 3U4CA 1YI1A 3U80A 1DC6A 1TT7A 2P27A 1AUVA 3ENZA 2UXDB 1OI7A 2OKCA 2Q3HA 1BG6A 2RGBA 4G86A 2V03A 4OU5A 1Y6FA 1T9HA 2QT1A 1C9DB 2IELA 1FS0G 2MSNA 2VHYA 1H6DA 2GO7A 3L8HA 3LQQA 3HXQA 3K05A 3CS3A 1QP8A 4ZD5A 4WOJA 1OWOA 3O8QB 1C30B 2K4MA 1N32O 3FLMA 4RPGA 4AY2A 1A9RA 1GZUA 2ORYA 3GPDG 3M1LA 1E66A 3DHYA 3FCYA 3W3AH 1U7HA 1VRWA 1HF3A 5IDJA 3MJHA 4LNHA 2H4HA 2ODEA 4YRCA 2JI7A 1K97A 5EQTA 3UWKA 2BLNA 3UHJA 1N8TA 4NVRA 4ZJUA 1RPZA 2QLCA 3PR3A 3DAOA 1EP1B 4Y1GA 1P8JA 4RHFA 4ES6A 3FOCA 3E89A 4RKFA 2A14A 2ZUCA 5CMLA 2PGGA 1N9ZA 3G5AA 3MJEA 4J0IA 5ALHA 3ZCUA 5FUMA 4J1SA 1PWXA 4YR9A 1KDZA 2CAZC 3SR2C 2ACVA 5HMLA 2VJPA 5AD1A 3PB3A 4MI6A 5CA1F 5IK2D 2K5UA 2XNDA 4R81A 1EXVA 1XTRA 2F1HA 4FYMA 2VPWA 2B9EA 2IGTA 2JD2A 1W87A 4FEYA 3PHGA 1LWOA 4B35A 4DMKA 2QRUA 4M9RA 3FOWA 2ZXFA 2VVTA 3K9WA 3SNHA 1LLDA 2H1SA 3A6EA 3IBYA 2V6MA 4H7EA 3KFXA 3SFZA 3ZCRA 3W9SA 1E7MA 5CGZA 2EG5A 2JRLA 4BO4A 1YF3A 3PQ2A 2Z0AA 2YIMA 2YUIA 1EVZA 1DDGA 5A5GA 2I4LA 1XMIA 1OI3A 2C4HA 3PNSA 1TKBA 5C7LO 1PVOA 3PEUA 3MDSA 4PC2A 1AMUA 2XUGA 2ZIEA 4R1QA 3PC4A 3UO3A 1JOYA 1XDZA 3JQ7A 4MKZA 3WS7A 5EKXA 4HVLA 3K9AA 4XGQA 5DK6A 2R6ZA 5K9ZA 2OD2A 2I6UA 3TDKA 4OTZA 1TC2A 1T2NA 2WFLB 2ZIUB 1JPJA 2G84A 1UP6A 1Z9BA 1VGQA 4U3JB 2D5LA 3E8BA 2CDBA 1QAMA 2NTVA 3NC1C 1QIGA 4TLAA 4MI9A 3RBXA 4WLOA 1FYWA 5AW9A 4C4TA 3E81A 3OOHA 4I0XA 3BORA 5IG2A 1UBEA 3V8QA 3CT6A 2TRSB 3U44B 3IJEB 1Q3KA 3K58A 2I1LA 3K71B 4BPBA 3MSXA 2ZNJA 3GLRA 3AZOA 1XMQO 3OD1A 3GLIA 4EW6A 2VDRB 3DXFA 1EMDA 2IDKA 3IX7A 4J43A 4EAAA 4F5EA 1T5OA 1A5AB 1EZVH 4NBKA 1YT5A 3L8EA 1M4UA 1OHHA 1J06A 4KQGA 1JMKC 1Z6TA 3GWOA 5ED0A 4JBNA 3EH2A 1EZ1A 5JBNA 2DT8A 2FRXA 4YP7A 1PGOA 1Y33E 2GBFA 4XX0B 3E7WA 4RQFA 3E9YA 1M33A 5IDXA 1ZWKA 1Z2CA 1BX0A 1GAEO 2CNBA 3KJIA 1BZYA 3WY9A 4DCNA 3KEFA 1KMHA 3A4MA 3WHIA 4E5YA 3ICQB 4OUDA 4U8HA 4CGZA 2ZM5A 1J21A 1C50A 4QBIA 4C08A 5KHIA 3DMTC 3N5CA 1Z35A 1XMOB 1QTNA 3MVEA 4HWPA 4MB2A 4M8NE 3SBEA 3HJFA 4F92B 5JBQA 4DM7A 2ZQMA 3P9IA 1IJFA 4H08A 4W8HA 3BQ9A 3IELA 2H4YA 2Z3ZA 3JQ7B 4M9UA 5CH8A 4MAFA 2BOVA 5JJEB 1O57A 2Y1XA 1FMFA 5EEGA 2Q5QA 3DTTA 1DTSA 4EUSA 1F3LA 1Z68A 4G5HA 1AR1B 3GRZA 3CLVA 3H6HA 5KYYA 1I2AA 3R5KA 4WFEA 4EYSA 1MO3A 1E3EA 1XZPA 4QE3A 5AK0A 1OHHD 3WQQA 4NHEA 4XAQA 3SC3A 2VZEA 2FNAA 2VYQA 3P3NA 2EL7A 2XAFA 4ZZ0A 3R20A 1D6SA 1OFUX 2VQFB 2O1WA 1GV1A 4GVLA 4I1RA 2D59A 4OI2A 5F78A 3S3TA 4EL0A 2IW5A 2FEKA 2XWJI 4FOSA 2SKEA 4CF5A 2AZ2A 2R4TA 2BH2A 4J6FA 2DWOA 3UYKA 2IZZA 3UGQA 2AHRA 2IVZA 2YW9A 4OXNA 2HRCA 3B5EA 2NZUG 5ALFA 4B9AA 2RSLA 5B64A 1B6GA 4CKYA 1RZRD 1PI3A 2JA2A 1KEZA 1UF9A 4I4TF 2ZJ6A 4BWFB 4F9GA 1L5LA 4GKVA 4JGIA 2RH9B 5LOVA 1FOEB 4JITA 4MUFA 5DLEA 3SJZA 3VX3A 3B8EA 3W2GA 3ZE8A 2PS9A 4JI8O 4KC0A 3RROA 1F8UA 5HJ5A 3FCUB 3H1IH 4P9DA 2PVSA 4QGAA 1SQQH 1FUKA 1QCEA 3C3SA 1AGRA 1MAVA 2CFCA 2IF0A 3O8QA 3WHKA 5GM1A 4HLQB 4EZBA 5A5EA 5BXYA 1DUIA 5JCZA 3WL3A 1PFVA 2VWQA 1POWA 2F4NA 1RJDA 1SRRA 3QI7A 1EUDA 1F1JA 1WW3A 2WSMA 5BV7A 2QWOB 4J9YB 5MN5A 4EJ2A 5BYJA 4DIBA 2QN6A 4CFYA 1C0LA 1TI7A 2POCA 4ZO9A 3CE6A 4JBLA 5A5DA 3TSAA 1JF8A 3KSZO 3MQFA 5A3QA 1NOJA 1S96A 1ZESA 2X9LA 5IK2A 3KG2A 1GJRA 3QO5A 2P9HA 3IXLA 4PLPA 1GZ4A 3EC2A 3WG9A 4ZFRA 1SUAA 2FU5C 4ONEA 1W1IA 2ZK7A 3CJTA 1EWYA 2BFDA 2JAUA 4LJYA 4CEIB 4K87A 1OE0A 3D43A 1DTOA 4KN9S 3ETEA 5J9FA 2B5OA 4PQEA 2JIBA 3OPMA 1D7AA 1VQNV 1N9GA 1PJ8A 2B34A 3NOQA 3PXEA 4HYYA 4LRYA 4XW2A 1L7EA 3HGQA 4E2YA 5AW6A 5DNEA 3GLFB 4XDJA 1VCOA 3PYXA 4LE0A 1G21A 2QP9X 3LTNC 3DO5A 1MFZA 3BDVA 3LW7A 2OA0A 4MVRA 3FUWA 3LL4A 4Z7NB 3TCUA 5DHUA 1WZIA 2FN9A 2Q3JA 1AI4A 4LJ8A 1OH8A 2OZEA 2R84A 1HNWB 2H0AA 4AZTA 5JDCC 4DDHA 5J4VA 2VQEB 4XM2A 1N1GA 1HX7A 4RK7A 2GFQA 3L4JA 3U7FB 3ZGZA 3EXHB 4L3VA 2QZJA 4M1EA 4TMKA 5IDQA 3WGKA 3PHBE 1IMOA 4ND4A 1KP9A 4UDYX 1WA8A 4FHDA 1FIUA 2FAXA 3O2NA 2CE4A 1W6RA 2RHJA 3IR5A 1JU9A 1YR8A 3V4FA 2QWPB 5C8VA 2WLNA 3KKKA 4CM8B 4OP2A 1DAFA 5KMGB 2IP2A 5F1YA 3IOCA 4OHBA 5ILQA 3TOCA 5HZGA 3OR6C 2NZXA 5B3AA 2GPSA 2PLNA 2Q62A 3AK4A 3WGOA 3OCWA 3C90A 4LGYA 1QUEA 5IJXA 3U56A 4WINA 3V4LA 5KB3A 3CKLA 3Q7RA 2AKYA 4NYKA 1CG6A 1KAEA 1U2SA 4I5IA 4MLCA 1QH1B 1X0VA 3A0RA 3JXEA 4DARA 3I6MA 1OA0A 1GNPA 2GCIA 3APOA 3L73H 3O92A 1WPBA 3EGCA 1VHTA 5IRCD 3LX8A 4HEA1 3N86A 4IZHA 5ALTA 4QYXA 5ALOA 3RBZA 4OA8A 2CXSA 5EHGA 5KVAA 1RBZA 3EVKA 4RTPA 2NPFA 1TYEB 3JVIA 4PIVA 3NBZC 1OCOB 3OPNA 3AW9A 1FYVA 2IYYA 4AJNA 1VQ9V 2CVQA 2HNAA 2HLDA 3AH8A 3KJNA 4L4YA 3S70A 5A9SB 2B4TO 1CR4A 1WAMA 4GZMA 5JCXA 3Q2IA 3DCIA 1BSVA 1VF7A 1U65A 1X7YB 2DKOA 3NHJA 4U0KA 5FTWA 1BQ0A 2VS1A 3L0OA 1RYZA 5TS2A 3GP3A 3KPVA 3L7LA 3G59A 4L8YA 4YAFA 5DT9A 3BJZA 5FI0B 2JLUA 4A8JC 4TKLA 5AJXA 3VR2D 1A9XA 3U39A 5EMNA 4Y6OA 2X3UA 4CM8A 5KOHB 3B8FA 1UM9B 2XWPA 1WAZA 1HE8B 3DGFC 4RACA 3ZJVA 5CA3A 4F56A 1I7LA 4K28A 3F71A 1IRIA 2WZDA 4MI1A 4YRQA 4B9EA 4BQEA 4PG5A 1HYQA 3EZLA 3TLJA 4CN8A 4TZKA 4MYUA 1CC1S 4TTIA 2E55A 5EJAA 4MS7A 4QUDA 4QZVA 3G9ZA 3L9XA 1ZJ4A 2X22A 5EZYA 2OO5C 3IP9A 4H7KA 3SZUA 4KXRA 4P58A 1G21B 2EP8A 2OXTA 1R4MB 3DV0B 3R75A 3HEMA 1M5UA 2XA2A 2XGJA 5DEDA 4RQTA 4FDLA 3RR2A 1SC6A 5LC1A 2CTPA 4B3MB 2I8AA 3AV0B 1ST2A 2GTIA 2VRWA 3N2NA 4IS2A 4LDQA 1P4GA 2ZJ3A 5KBYA 2ZCJA 2N47A 2XQGA 1X3LA 2GAFA 3CXUA 3UATA 1HFWA 1WHSA 4N41A 3DH1A 1K68A 2CKMA 1OJHA 1I08A 3CG0A 1R1BA 5BUSA 3TM5A 3PPVA 2AVNA 3LNMB 3RIGA 4NJEA 3BWBA 4HDNA 1E63A 3FDZB 3DQPA 1JJAA 4CLXA 4MGEA 4UM9D 1NSTA 3GFRA 2DCMA 4OI0A 4E5MA 3ZLVA 3GDWA 3BKWA 1JDBB 2C9ZA 5LBTA 4JJIA 4PE5B 1GQYA 3ENWA 1L7OA 1AHPA 1MSDA 4K26A 3IAAA 4AS3A 3BXHA 4B8YA 4WESB 2V7GA 3K8OE 4YGYA 3QE4A 2OTCA 3AVQA 3ETNA 5IP5A 1ZCZA 2XKBA 1MIHA 4QQRA 4R2HA 3Q7TA 1ZOPA 1W85B 2I1QA 5HJ2A 4G9BA 2Z9BA 2XITA 3K5MA 4LY6A 3ITNA 5DLPA 3AZPA 1G9SA 1EVIA 1IXRC 5BRNA 2AXTZ 3GUCA 4KV7A 3F6RA 2I7XA 4K8RB 2PZJA 3EVDA 3ZGYA 2I4NA 2H1FA 3ND7A 4QTYA 5KUMA 1XZHA 1UOEA 1R8SA 1LCIA 2JI9A 1J39A 1ODSA 5HF5A 4NBVA 1SPXA 1GKFA 4WCFB 2O8BA 5B3SB 3JYQA 4E1AA 2QTOA 2R8XA 5B1NA 3MGKA 3H1AA 5C1IA 1U7WA 2JJ2D 3C3YA 3U16A 4RK5A 1N2HA 4ZMBA 1G20B 1U8CB 2PYZA 3I28A 3AKEA 3PYMA 3IDOA 3S2FA 1WKBA 2ECPA 2XQVA 3ASUA 4HF7A 2B9VA 2FN3A 5KYYB 1Z0FA 1L5YA 2YJNA 3JATA 4L75A 3CCJV 2WHPA 2X86A 2PRKA 2ZUDA 3SQLA 4BEWA 3MJSA 3EQ9A 3GMDA 3RASA 3LHKA 4WHMA 3RQIA 5I3CA 1CTTA 4OVKA 3X1XA 4V1CB 3I1FA 5CIYA 3WNZA 2KWIA 1KSHA 2Y92A 3S7TA 4I55A 2Y69C 3SAJA 3ORRA 2DTDA 1Q91A 2QSAA 2YW2A 4M0FA 2V7VA 3AIKA 2PZ8A 1ISRA 2C5FA 3HP1A 3COJA 3TLKA 2IEYA 4DR2B 1X80B 2Q7HA 4YTEA 5ALQA 1FL9A 1WPRA 2Z2KA 4QJ3A 1CVIA 2BHNA 1UMKA 2A3NA 2VJCA 5E1BA 1M74A 1YUMA 3UNXA 4RTOA 3QEMA 2P6RA 1JW9B 2RI6A 3K30A 3H2ZA 4XSVA 1VQ7V 5FEUA 5FL7D 2LCQA 2GAJA 1I8TA 4W5TA 2OZPA 1GDTA 3W5AA 1ONBA 5DHQA 1PRYA 2CBZA 1YJNV 1IUKA 3V6LA 1TCUA 2Q41A 3EEQA 1K0FA 2VP0A 10MHA 1HE1C 4GLXA 1K5HA 4OUKX 2DCUA 3WMRA 3RNLA 2QU7A 1OLSA 3F90A 4XDKA 2G40A 1WD7A 4FCVA 1CX9B 2XXAA 1FFXB 2B1RA 2P8JA 1QFXA 2BEJA 4TYPA 4NYMR 4K9DA 4MUBA 3IP3A 4OGLA 1B14A 4EEZA 1C5KA 3GJRA 5A7FA 4J29A 2HZ7A 5A3VA 3W8EA 5DYYA 1BIFA 3STXA 3WKAA 4AIIA 5J4YA 1W9MA 2ZI9A 1QC5B 4MLZA 1Y7LA 3DFZA 2JH8A 3FFWA 2JI6A 2HPVA 2ONYA 3A4VA 4A92A 1B3BA 4MS3A 4P3XA 4CE6A 4CM9A 4F3KA 1JZTA 1C8LA 1Y1SA 4TLCA 3Q7PA 3IH5A 3H65A 4URYR 2ZWPA 3E22A 2PLFA 3LUKA 3O8LA 1WMBA 2I2XB 4B6EA 1Y1RA 3PTZA 5ISMA 3BHMA 4P34A 4L9SA 5TQ0B 4YPOA 3V1KA 3MEQA 3STHA 1AB6A 5DEOA 2SKDA 3EFEA 1PJ4A 1ZUD1 4KGDA 2FG5A 2QX8A 3MF4A 4FGLA 5FO1A 4C4XA 1O1YA 2NU6B 3O65A 2AUNA 5AXBA 2UXXA 3QO8A 2YMMA 2YZ2A 3KJZA 1ZI6A 3QVTA 5GV7A 2WLJA 4CMAA 3K3WA 3D0RA 4LV5B 4ZZIA 1KYOF 3Q3IA 2W6ID 1L8XA 4S05A 2E5FA 4EGFA 5B7PA 4RWZA 3ZHVA 4DV6O 5AKLA 1RLUA 4CFZA 4E7OA 1T8YA 1TOAA 2IODA 3B3QA 4BECA 2C1EA 4WD3A 1H9CA 1TIYA 3IGAC 2WLHA 1ML4A 4UEWA 1FJGB 4LNAA 1N4DA 3VV3A 5MGNA 5KNLA 4MDEA 4EFBA 4AI8A 2Y1EA 3BD6A 3CUYA 5FBLB 4ZT2A 3K1YA 4PINA 2RCVA 2WWFA 3FJOA 3DWGA 3HO8A 1XEXB 1ONSA 1CUYA 5K3DA 1YBAA 3JQPA 4MQUA 3EEFA 3RIYA 3BK2A 1Y6XA 2Z08A 1IOWA 4PPGA 1Q84A 5IUJC 2FK8A 2ZWMA 4GLJA 1F3OA 5HFNA 1BROA 2C2AA 3BPSA 3O21A 2W48A 1NLZA 4ZI3A 1J0EA 5E6UA 3MGGA 1VEWA 5EGSA 3FPHA 5BQXA 3DXZA 1T6NA 4TM8A 3WRXC 4V2IA 5F2NA 1Q20A 2OHXA 2XA9A 1N0IA 4B0OA 1Q5PA 4N3CA 2WLLA 1XRLA 3KQPA 2CLMB 3MWYW 3N76A 4HOYA 4OQLA 4B34A 2EIJB 3V8PA 4BP9A 5G4KB 4F7DA 4J0FA 4I2NA 3VZBA 5JCPA 2CSUA 1SETA 5CXQA 1J24A 1H42A 3C3PA 5KOYA 4UOEA 1CE8B 5HWSA 3RKSA 5CNJA 2F95B 1O5TA 2VOJA 4QFDA 5JD5A 1F2DA 3CRRA 2H0RA 2ZJ2A 4R1OA 3DTUB 3C3AA 2C2OA 2JEXA 1PTJA 4YRDA 1Q0RA 1UWCA 3X44A 4PS1A 3VAAA 1L7NA 2FKXA 4DR6B 2DQSA 2G9NA 2OMEA 5K8LA 1MOFA 1HOTA 1NGSA 2ORED 1NOKA 3MQ4A 4GM4A 4R51A 4MUEA 4WW0A 1W5EA 4C21A 3LDCA 1TZJA 3U0ZA 1FU7A 2B3TA 4A0GA 4D98A 5CFMA 7ADHA 4GOXA 3HG7A 1QCZA 2F8MA 3LDDA 3L71H 4LFCO 1VKHA 3H1PA 3K8QA 5KPJA 1SEPA 2YIBD 1O96B 1WETA 3BJMA 1Z3IX 4QUIA 4CNBA 3RC9A 5CAEA 2FR6A 2DHQA 4YK7A 5LLSA 2VQFO 1E0AA 2MMGA 1XEXA 3T4UA 2M7WA 1S4QA 1EI9A 2RBEA 4GECA 4AY5A 5HRUA 1NVPB 3DDCA 3MRSA 3EEBA 5KA5A 1IOVA 4NU0A 4EKDA 3C7AA 2IPOA 1YONA 3GEHA 4NJMA 5GZ1A 4AILC 2I2AA 2AZXA 5E7JA 3ZW7A 3EVNA 4OLBA 2O1SA 7REQB 3DYIA 4L85A 4F96A 1EP2B 2PV0A 3Q40A 3W9YA 1D2GA 2DJVA 1LQ2A 3FXAA 3VPXA 5FBHA 1TE2A 2C3MA 2UXDO 4GMGA 2OWOA 2D00A 4ZOEA 1C7JA 1P45A 2DT5A 5C3UA 5CEEA 4N82A 5FUYA 4JYPA 1QQ5A 3BH0A 1HL3A 4MW7A 4P7GA 1PS8A 3NGLA 4PLGA 2RAPA 5JAHA 3PDIB 5J5AA 4CM5A 2F9FA 2A3RA 2BP7A 3CCVV 3AJDA 1BHQ1 3PDCA 4L15A 4EMSA 5EWJB 2YFHA 4N7MA 1YEWA 1T2UA 2JK0A 2Z6UA 3ONVA 1LJ8A 4Q9DA 5CCXA 3N87A 4TKMA 4KW7A 3LVFO 3PHJA 4UCUA 2ZDGA 1H9BA 4BNLA 4D6PA 1B42A 2H3EA 1L8OA 3KEOA 4YV1A 3MWFA 3IB3A 3BCCH 1NTRA 2M6YA 4W82A 1YJ8A 2GPNA 4IDHA 4WMLA 1YJAA 1KMIY 1R6KA 2HCRA 2PWPA 4P3NA 2Z2IA 1EYZA 3OBBA 3WOVA 2PXAA 3WMGA 1ZABA 4LZPA 2BR4A 2J9FA 1R50A 1CJTC 1H85A 3K35A 3OHSX 1RPJA 2A0KA 2V8OA 3TAUA 4M38A 1XR3A 1YTFD 4KU4A 5FLXA 5EIHA 3D8RA 2GJKA 1KP3A 3H9GA 3GT0A 2VNIA 4J3JA 4DYHA 1O89A 2X7JA 4FSDA 2DFLA 2A35A 4MYDA 1EUCA 1PR0A 2CGOA 4RO0A 2HDNB 4YPFA 1TIPA 4KWTA 4OO3A 2IQ5A 5FI1B 1L5FA 1Z0SA 4XFKA 2EJ7A 1Z5WA 2DFNA 1P9RA 2BJHA 2W00A 3COPA 2JLSA 1S8OA 2I3DA 1P39A 3HFGA 5PNTA 2ZWIA 3OI7A 2VDWB 4DLAA 1XJ0A 2QTSA 3AWIA 2PUWA 4G0UA 3W5CA 4R1TA 3BVOA 1IN7A 1BFDA 1HQDA 2DBZA 3SQDA 4DLYA 3UJCA 2RD2A 2CNNA 2FSSA 2IW1A 3KEGA 4OYHA 5IARA 3KOUA 3GZNA 4NQZA 2CSXA 3HUUA 4EITA 4TV9B 4BV9A 1U31A 1OJ7A 3I1JA 2P8RA 1H65A 3UWPA 4FZ3A 4PZZA 2Q5EA 5BSFA 3AMVA 1GMGA 4WNAA 1XJ5A 3ZWMA 4YBZA 1U8UA 1GN9A 4Q7MB 5KTNA 2QTVA 2KPOA 3L8CA 1BS2A 2M32A 4BX3A 4LYHA 1R3JC 3VBEA 4B46A 3U09A 2R6AA 4A27A 4GRAA 3OE1A 1TTPB 1Y3CE 4MV5A 5A71A 4CL3A 3EUFA 2Q5IA 4AURA 4MV1A 5BORA 2FQQA 3HMKA 2XTAA 5ADVA 1QH9A 4YMWA 3TOXA 3HR7A 1X94A 1RB7A 2AUMA 1QQTA 1S8FA 3IT3A 1I5YA 3EEYA 3K9QO 2CLOB 4OCZA 4CU5A 1IXYA 2Y6VA 1GA4A 3WTCA 3UMRA 5TGTA 3DZHA 4YRKA 3BDAA 4X8AA 2EX4A 3MOGA 4QEKA 2PUFA 3ERCA 4CM9D 4WF9V 1VQLV 5EL0A 3FRHA 2HG5C 2BISA 2PFKA 5SZJA 5K8TA 3WJ2A 5CCBA 5JCOA 3OVMA 4M4SA 4D81A 2IPNA 1JBKA 2ZWAA 3QPAA 3ROEA 4XVUA 1RJGA 1DINA 3ZBTA 3DG9A 4OWPB 4EX7A 5BMVB 1ZJ6A 3CF0A 1A98A 5H59A 4RADA 5JMPA 4H7JA 2FFRA 1ZQ9A 2QPAA 5F52A 2JIOA 2IWRA 3THXA 4BE7B 1DC7A 1W4AA 1WA5A 1UINA 2XNDG 1A82A 3ESQA 1Q3HA 3LWBA 4QHTA 1OH6A 4C6TA 3K1JA 4HDKA 4OFWA 2DQ3A 3HU2A 2B98A 4A9AA 1OZ0A 2ZJ1A 1RCFA 5JJCA 3HKBB 1FSPA 2XVMA 1JR3A 1JH8A 1Z47A 1XC7A 1SJ9A 5AKZA 1QGED 2PH7A 1BKYA 3GH1A 4BRZA 4ETWA 3CF4G 3ANNA 2ZW9A 3GLFE 2MYPA 2XRZA 4R9SA 3JQ8B 3BULA 3RU7A 1FC0A 1T2DA 5BSRA 4C5CA 3RLIA 4ZYLA 4Y18A 2FFQA 3HDYA 4YMTA 2H7VA 5KYKA 2HLPA 4S2EA 3KVRA 1NH2D 1NDQA 3S1LA 4YT4A 3WLRA 1R5NA 1CRQA 2X19A 2AFHE 4ZI7F 2Q9AA 5IAOA 2QAJA 4ZKIA 4B83A 3UGKA 2RGYA 1FNMA 3IXMA 5EMMA 1UMCB 5FBKA 4QT0A 4BJ5A 1ODFA 2PSDA 4HCJA 4G0NA 2UZ3A 4YHHO 2GCGA 2V58A 5DK4A 4O4JF 4CN9A 2IBTA 3PE4A 1LNZA 2PRYA 3KM0A 2JF0A 5LXTB 1P2TA 3H0CA 3ET5A 4XB2A 1K75A 5K7SA 3GYGA 2P3SA 3AR2A 3CN7A 3KCXA 2AI2A 2B82A 2PYDA 4LJLA 2CH7A 2O8DA 4QG3A 4CI9A 4L07A 3KQUA 3OD4A 3THXB 2OV3A 3FI9A 2BYTA 3IRUA 2MK3A 3H1EA 1JSCA 4OHKA 4EG4A 1U3DA 2X9QA 2X8JA 3AKYA 1KK1A 1G291 5CB6A 2GAAA 1M1UA 2Q2NA 4YRRA 2I0FA 4R5HA 1TCAA 4YP5A 1VLQA 3NNDA 4JY7A 3DXRB 2OYSA 3C41J 4YC7A 1M83A 4MVJF 5CVCA 5IANA 3K2BA 1MZPA 2R3SA 4UBJA 4YDSA 2RBKA 3IUQA 5THXA 2OCHA 4KOAA 4IMIB 3CISA 3B1FA 4NL4H 4QLBA 3BWXA 1Z73A 4H59A 3WJ1A 3BVPA 4WBNF 5EXTA 3TLXA 4PHHA 4FYVA 1XP8A 3SR3A 3W78A 1DKOA 2HA5A 2JJYA 3K09A 3HWRA 1PR1A 4X61A 3R7WA 4Q6GA 5LHGA 4HRYA 1E2NA 4FFRA 4BNWA 3AG4B 2WPDG 3D64A 2I7TA 4LZJA 3TTTA 4DLVA 1WKVA 4A15A 4W9NC 1GU0A 1S8AA 4E5SA 3AY6A 1V3UA 3DKIA 1AURA 2B3ZA 3OT5A 3ABKC 1YQXA 3Q9LA 1KSJA 4IICA 4RJKA 3WR5A 1IOZA 3GELA 1SG6A 2VC2B 2E3CA 2ZE8A 1WXGA 5IJWA 4JOSA 4Z2WA 2Q28A 1QNLA 3MFQA 4CH6A 1HZZC 3FKJA 1VYUA 3IMEA 5DSZA 1H22A 1JILA 4DMRA 5BVHA 1Y37A 4UXJA 3E0QA 4BDSA 1K6JA 3I2JA 2HH9A 5FRDA 5IMSA 1JDNA 3H1LH 4QKQA 4B71A 4LDRA 1G6KA 1KMQA 1KZ6A 1QG0A 2BKUA 2JCGA 3GVHA 4H7DA 4B44A 2KB1A 4QA9A 2A6PA 3IOBA 4JVOA 3FB6C 1I7QB 3FNQA 1Q0UA 3AK3A 3GFBA 4IH4A 3LXUX 4P3OA 2NXWA 4B47A 1SMKA 1EUCB 1U63A 1ZD1A 5D5PA 1PBNA 1BWRA 1P3Y1 3ESZA 3UUGA 3OLQA 5IN4A 2DTEA 1NI3A 1L0NH 3GLFA 5AJUA 4DW1A 4DWVA 1THTA 2A9KA 3QE9Y 5IT4A 4N48A 4ZCLA 3FYEB 3JQAA 3PS9A 1XL4A 3ECSA 2HIGA 2QZSA 5GMOA 3A58B 4WNCA 5FUWA 4MLDA 3TINA 1H2SB 3E18A 2FDCA 4L78A 2IV7A 1C1DB 1U7XA 3VQWA 3EWAA 3T9BA 2CK3G 1ULTA 1MEOA 1VPVA 1EFPB 4ZEWA 2AK3A 1U94A 2V8BA 4WZAA 2P2SA 3GIWA 3PEEA 1NDUA 3PC2A 3EH1A 4WXEA 2YNMC 3FYUA 3ECCA 4NBTA 1ZVQA 2HNKA 3UA3A 1IUPA 5LHIA 2G9ZA 2QMOA 1YJ9V 1E2GA 3O7WA 5LYYA 1PF7E 2PTMA 4DMFA 2X5JO 1KD1W 1Z4NA 1ENOA 3TEFA 3ORYA 4JROA 3AESB 3NPAA 2NN4A 2X6BA 1E0JA 5FTMA 3QF7A 2NO6A 2Q9UA 3CC4V 1GPWB 3I39X 4DJTA 2D0DA 5JZSA 3H16A 3JV7A 3FJYA 1JEAA 1T0PA 4Q6WA 4PRYA 1TK3A 1V8BA 3DFMA 5U4QA 1R0WA 4RY0A 5IF9A 1YA4A 5JWHA 1BWPA 1XZAA 2O4UX 3VM6A 4CDNA 3TGPA 5EI5A 1T13A 2JFBA 1GCAA 1GNLA 1OH5A 5H6RA 3L05A 4HY3A 2RGNA 3VVLA 1Z2AA 4P3YA 5IS2A 5EIWA 1OB2A 1ZXXA 3RVBA 4DC0A 1YA8A 4LJAA 2RGNC 1IM2A 4G5QA 1N2SA 5DMXA 4KL8S 3V1YA 4ZVPA 5HCIA 4EYGA 4O2AF 3HLKA 3TNYA 4F6CA 4INJA 2XCIA 1Y7IA 3B2EE 5K6RA 3UM7A 5DCAJ 3MMZA 1U5BB 2IRWA 1O95C 5HKLA 4GWKA 4AFNA 3PUKA 2HW8A 5GTHZ 3E84A 3I12A 5HRCA 1L8LA 3OEHG 2QZ4A 3P9NA 3RK1A 3DULA 3O2SB 4H7HA 4LV6A 4X3PA 1X6VA 4CIXA 3QPBA 4FK8A 3IUMA 2PKXA 2Q1TA 4WOCA 4Z0HO 1RWPA 1SD2A 1F7UA 4YIHA 1F7YA 1QPGA 2DBQA 3RSGA 3RU3A 1X13A 2CMKA 2WZBA 3IPXA 4UAGA 4RIHA 3FRIA 4F72A 3LF2A 1U4OA 1XZKA 3RSOA 2O4CA 2QV7A 2KB0A 1HT1E 1SU8A 2ASEA 5EFZA 4TMZA 5C1OA 1UX0A 3K1TA 2IUYA 4O59O 2W42A 2VHXA 4TQUS 4MRAA 4BGIA 1X1CA 2QWQB 3VISA 1TYZA 4I5FA 1XZCA 2YINC 3RTEA 1I7SB 5JR3A 1B0UA 1CUVA 3M7MX 1EE2A 1OCCB 1E62A 2HA6A 1FP2A 4DG5A 4LYFA 1P8AA 3HDHA 4OG2A 4U9UA 1G9TA 5L4NA 3RSQA 1H2GA 4X63A 1J23A 3OCCA 1M6VB 1V5IA 3QXHA 3HY3A 2O5EA 2AJBA 4YXWD 1G6UA 3OZRA 2IC5A 4GBED 1WL8A 1ZU4A 3QEJA 1GPJA 4BAZA 1YDFA 2VJOA 1JU4A 2QKAA 1WOYA 2WC1A 3F9RA 3WC4A 3GNTA 7ABPA 4QEZA 1VBMA 1CUJA 2EKPA 2ZI5A 4IZ6A 4PGGA 3DFIA 4RJJA 5K3CA 5G2OA 5ER9A 3Q6MA 1Q11A 2YI8A 3CNBA 3CZ9A 3MUOA 3DL0A 5A2QN 1ENZA 2YI9A 1SKBA 4IIDA 4A8JA 3TRKA 4IOLA 2J85A 1XQWA 2NO9A 1GZ7A 4EMTA 2R4QA 4JNCA 4G3XA 3S8MA 4OIFA 4WACA 4Z0PA 4QYMA 5BVHB 1HZZA 3FR7A 3LC1O 9MHTA 1QHSA 3ZJZA 2CLFB 1OUMA 2GSWA 4D8VA 5E4JA 2X2EA 4H35A 1Q6YA 2F43G 1X9HA 1U1IA 4D7TA 3AM4A 4U39A 1T2AA 1SXPA 1XLWA 3FUCA 1E6CA 2FMHA 5C4MA 1YB1A 4D92A 2XUDA 3B7WA 3RFFA 2CCJA 1ETUA 1IHPA 1DXHA 1YDGA 2VNSA 2Q4OA 1QNFA 4HDOB 2YIBA 1YZ3A 3RSSA 2OCYC 4LN1A 4MA5A 2VJAA 3U7HB 3G67A 2A88A 3RCBA 4GYWA 2FKNA 1CQIB 3PXAA 4F38A 1Y6GA 5SZKB 1BHJA 1R37A 1RMYA 2BJWA 3LUAA 3QFFA 4NPAA 2HEGA 3VR6H 5LOVF 1Q1NA 1BNCA 2XF2A 1QNMA 1LZKA 4RV9A 3PCRB 4GXTA 3H4MA 2E48A 3OUSA 2GN9A 2XNDD 2V3VA 3EASA 1SCJA 3I01A 4LZLA 2PGAA 1RHKA 4G0PA 4UFZA 1WP7A 4UUPA 2Z3YA 1O4WA 1QO9A 3A7DA 1NUHA 4QJFB 1M5TA 3DEIA 3G7SA 4MRRA 5DF1A 5EERA 4BGEA 2H8PC 1ZIOA 2W2LA 4C1NA 1BD3A 1S2MA 5CFRA 2CNWA 3ASNC 3QYPA 4OK6A 3LX4A 4IDQA 1Y34E 2UYCA 2I6FA 4WBXC 5COAA 3WYCA 3ABTA 2F62A 3GWKC 5JWOA 3CLUC 4LS3A 3ZH2A 4Z7OB 4GUDA 1C9NA 5TPWB 1HO3A 5TLSA 4NCBA 4Z4EA 2Z2ZA 3VQVA 1KETA 3PX2A 4KZPA 4QNMA 2IW3A 4XIYA 5I9TA 1W48A 1E2DA 1IK4A 1FK8A 2WILA 3MWDB 3R4CA 4KQ2A 4AX8A 4GZ5A 5JWRA 3CVVA 2GARA 2UUOA 2V7QD 3DZGA 1KSGA 1BVHA 1GRRA 1TX4B 2QD4A 1HE5A 4HYEA 1C9KA 2X0RA 2HLNA 2VQEO 1R4NA 4Y6LA 4NENB 3I58A 3SICE 2HZBA 2CLLB 5FX2A 1ZU5A 1EHIA 4MV0A 1ZFNA 3DKVA 3ILSA 1JIVA 4O3MA 4P86A 3UT5A 3HSYA 2IHYA 1F51E 3GU3A 5IN5A 1JNXX 2VI5A 4G81A 1NW7A 4KSYA 3TETA 1X7ZA 2EZ4A 2JFZA 4K0KO 1CXZA 1FDVA 2GR9A 2VEOA 1AKYA 1YDMA 3E86A 1RHJA 2A1UA 2RJOA 2QM8A 1QHYA 1WU8A 2XI4A 2XZPA 5TT0A 4RDCA 4N76A 1V2GA 3D36C 3R6TA 1K4DC 3PWKA 2AX3A 1UJNA 2LKCA 3GG9A 2ZFUA 1KK3A 4ARZA 1NURA 3B8HA 4ON9A 4Q3DA 1UJ6A 1ZHOA 4NENA 2R66A 2OGUA 4G5GA 2LIVA 2WJYA 3GWZA 2Q67A 3OE4A 3ZIUA 4MVUA 4KDFA 5HGJA 1PJ3A 3NDIA 4ZIBA 4KVZA 5B1IA 4Z1MA 4I46A 1ZJZA 2H4JA 4IDAA 4KFRA 2QR4A 3GAFA 3IAHA 4RA6B 4BB5A 2VQ6A 3SIWA 3Q8MA 3X1WA 4FKBA 5JAPA 4BO8A 3EISA 3KVOA 4RK6A 1JLRA 4C0KA 3EIWA 4RFVA 5D01A 3AOGA 1P84F 3CPWU 1Z26A 3RWMB 3UJ6A 1DBPA 2JC3A 3OLWA 5FFFA 3N0XA 2QJ1A 2AEMA 5DT2A 1AKTA 4GR4A 4HQLA 1GCGA 1LPAB 1D2CA 2B2CA 3OP4A 3E4DA 4XCVA 2HOQA 1C1HA 4YN3A 3UKOA 5F98A 4BEJA 2ZUUA 2LGJA 1UBFA 1N0HA 4Z2AA 5C8YF 3WLQA 4KRGA 3DBRA 1H05A 1KVQA 4DZZA 3DEJA 2IKSA 1Y89A 3G2KA 1ZRNA 3O94A 2XT9A 1D3AA 4G6ZA 1YR1A 4M9CA 5IVPA 1HT0A 1UZAA 2HCBA 2Z5VA 3NW9A 4RLHA 4ZV9A 1RKUA 3AOEC 2JHFA 1GQQA 3THOA 2CDRA 1S2OA 4O8ZA 3VZRA 4D8WA 5DP1A 4PN7A 2JANA 5ITSA 1R12A 3ON5A 5PGMA 3X1DA 4E94A 2HY7A 2VXBA 4FS3A 1M6NA 4PYLA 4ARUA 3RJZA 2R00A 4MEAA 5A7HA 4J0KA 1UBSB 2BFEA 4OLHA 3VC2A 4LNUB 1OFGA 3L5KA 4EB8A 1E9SA 1GGEA 3TF5A 3LLVA 3PQ4A 5M29A 5LQUA 4TTVA 4KVAA 5AQEA 2CUNA 2PZBA 2ZSKA 3MJTA 3NFRA 4W5WA 4UM7A 1SOMA 3DOEA 1LX6A 1M67A 2DWCA 5FNVA 1H69A 4MQ6A 1JQAA 1P6UA 1KHHA 3IVRA 5T4FA 2NO0A 2ZYAA 3DFFA 1I3CA 3PENA 3GHHA 4R1NA 4WXMA 4ALJA 2QVGA 1V5FA 1B2LA 2UDPA 3O1JC 1ENYA 2A9JA 3WOHA 4DA4A 3GBVA 3BL5A 4PQGA 1TEHA 3AFGA 2HF9A 2R8OA 4F8YA 1EG2A 2D3TA 2WJWA 4E31A 3BJIC 5AI4A 4P9EA 1C9MA 1P0PA 4MZDA 5ENVA 2ZCUA 5SYMA 4QQ8A 3KQMA 5TF4A 4E22A 4P5DA 3QU2A 2HXYA 3TJRA 1TQDA 4ENTA 1EX6A 5BQFA 3ZDBA 2WSYB 1BQ4A 1OLXB 5EUCA 4MROA 1GCIA 3CCSV 1SKAA 2R96A 1P5JA 3IC9A 3AXTA 4XCXA 4LF8B 1Y8AA 3HN7A 1Q19A 1O77A 4FZ1A 1UEJA 5JSZA 4QG7A 3CLSC 1HY3A 3ILHA 3K0AA 5FQNA 1MV5A 3BJRA 2Z2JA 3T9AA 4CQMB 1L4MA 3P3PA 4TS9A 4OYYA 4P32A 2N04A 3SC2B 3UQYS 1I3LA 4XOIA 3KHSA 2PDAA 4B4UA 1ZUNA 5LMNO 1B8UA 3LFTA 3RJ5A 2G4LA 1UX1A 3P2IA 2JDID 5CD9A 4Q4JA 1ONPA 2VT6A 3SLGA 4YV0A 5C80A 2FUEA 4I7EA 3KB6A 2GBGA 2GZHA 4R16A 4V0RA 1NG1A 2GUGA 4DNQA 3A2MA 4HRQA 2BCGY 3EGEA 3NYRA 4BKRA 1E3LA 5FPTA 2EQAA 1E9BA 3QVUA 3HCAA 3DZFA 2VJLA 3AF1A 1O7JA 3CBGA 1IMJA 1JPUA 3C3TA 5AVZA 2R1TA 1C3OB 3FYIB 1JHXA 3HZOA 1Y6JA 1G1AA 3LXMA 1BCRA 4CV3A 4URXR 3HJUA 2O7SA 1KF0A 3ZVLA 3OESA 1GKIA 4RTKA 1Y3HA 2EG9A 5F9HA 3HSSA 2PW9A 5E6RA 3FFTA 4I08A 3NCHA 1FFSA 1PQYA 1SZDA 3FLBA 3QVOA 1IBMO 5J2TA 1VMEA 2KSQA 4H17A 1SUPA 4MW2A 4HATA 4N3NA 5CCEA 2EZPA 1DFGA 3DNPA 4N21A 3DZKA 3K4PA 3OJCA 3UXMA 5JYCA 5G41A 1S2GA 1ZLZA 3GEIA 3GUHA 5DFAA 3RU2A 4AN4A 2AGAA 5TEVA 2XYHA 4KWIA 1JJ2U 3VNRA 3BB3A 4MW0A 1OBHA 3SR4A 5KVCA 4BFSA 2EQ5A 4DV4O 2YV3A 5YASA 2Q7GA 3HCDA 2XTNA 2NR5A 1ICIA 4IUYA 3ZUGA 1PWZA 1E4VA 4PVCA 5F33A 5TF0A 4IYHA 4WK6A 1GPKA 2PS1A 1NVGA 2A94A 4RW0A 3UWMA 4MB6A 4EUKA 4V1CI 1E2EA 2D2VA 1CJUC 2XYRA 2ZXUA 3QG5A 1IQUA 4AKSA 2D1RA 3CXRA 1B15A 2RB5A 4JR1A 5KNCH 3BSWA 1DX4A 1F0NA 4MVMA 1XN4A 1XZNA 3LUPA 3NIBA 2QVZX 4KVGA 3KYDA 2GZDA 1OCZC 3FAVB 3TMAA 2YYSA 5JC8A 2Z6AA 2JD1A 4UB6Z 3OJ0A 4JFRA 2PL1A 1WMEA 1D4ZA 3T4PA 3QBJA 5C52B 3TNJA 1OFVA 5E2AA 1SA0A 2ONKA 2DYRB 4K35A 3QXCA 1VPDA 5KYXB 3KR1A 1HP8A 2P4SA 1ATZA 1IJEA 1GQSA 2WHQA 3C3BA 3F5SA 3LCVB 4MUIA 1V9SA 2FQYA 1BMFG 3J81N 1EFPA 1X92A 3N8DA 4RAQA 3OFVA 4YFVA 5IZ4A 2E4UA 2VHEA 4BTVA 2RPZA 4EELA 1S3FA 1PYDA 5H9WA 2CHQA 3H9UA 1CUEA 3BIFA 3FE2A 2QN1A 5TSDA 1KWGA 5B2FA 4ZREA 2WAYA 4ARCA 3LQ1A 3T9FA 2B1GA 3PPXA 3V8EA 3U3XA 1B1AA 2AOTA 5IDYA 5JS1A 1N75A 5JARA 1I4OA 3E2EA 1U0FA 4IDOA 5FOTA 1QU7A 2WJ4A 4ZQBA 4ZDWA 1QF9A 5DGIA 1FRZA 2J4FA 3ANSA 4NEHB 1HT3A 3AEKA 4FILA 2Z2YA 1GO3F 1KECA 2Y6UA 2DWUA 2LD4A 3QXGA 3VI3B 4UHHA 1Q6ZA 2OM6A 2OY0A 4KYVA 4DMMA 3SFTA 4RK1A 4ZAXA 2NTJA 3TCNA 4ZQEA 2HPHA 2Q0HA 1RE1A 2BZ1A 4RZHA 1JNYA 1XN1A 1YBMA 1Q7EA 4YCJA 4BCCA 3DGEA 1Y4SA 2JI8A 2VH1A 3SE7A 4D9EA 5JQGF 2SKCA 1ZG3A 4EPTA 3IEMA 3N39C 1ZWIC 2QQ5A 1GLGA 3RB8A 3RHTA 1C2YA 4BO9A 4O8XA 1ZRSA 3EMKA 3WDKA 3TKYA 2Z5GA 3HYTA 1TW2A 5FP0A 5B3JA 1ZGAA 1YNSA 2NN3C 5B12A 2R00C 2FB5A 1JSXA 3IOEA 5BWLA 4I4TB 4JKIA 1BA2A 1Z33A 5D6OA 4AG3A 2HQOA 4MJLA 1JDVA 2C5LA 2V97A 1N8RW 2ISQA 4UASA 1EWVA 4I4CA 5K8VA 4FC7A 3JYOA 4CKBB 2XE6A 2O7VA 3R6DA 4PN3A 1C0EA 3PNKA 3HP7A 2A1TS 3HFRA 3NH9A 4YP1A 1H2MA 2Z8ZA 3KKYA 3N8KA 4RXTA 2IHNA 1ULHA 3SFVA 3G6KA 1YVEI 2W6JD 3AHGA 4JELA 3Q6NA 2XIJA 4NK5A 1T8RA 5KWSA 5F5XA 2QG9A 1T1EA 1U4SA 3MELA 4IGIA 4Z53A 1IVYA 3NU1A 4B73A 3HM2A 1NQAO 4Q34A 4A8JB 4DW0A 1LK0A 4JB8A 3IUYA 3CXCU 5K6TA 1SG9A 3QKRA 1M0EA 3DGEC 3P27A 2CFTA 3DLCA 3DMFA 3LDHA 5FI5A 2F3RA 1JRLA 1XU9A 2QX7A 3RS4A 3QA3E 5KOIA 1DJMA 1T6YA 2O07A 3QPVA 1R4AA 4D2IA 4X20B 2WAOA 3K9NA 4D43A 2OFPA 3EB9A 1U4NA 3DOIA 5BNZA 5AUNB 1F2VA 2J3QA 3NTXA 5KAIZ 3VMFA 4FW8A 2ADQB 3BXGA 1AX9A 1UBRS 2FEPA 2B25A 2ZRHA 4RU1A 4CL2A 3EVZA 4EJSA 2LPMA 4NE2A 1NVVQ 1P1RA 1P7WA 3B85A 1THZA 2YHAA 3GGPA 3FPSA 3WBFA 2P4HX 3C3XA 3GNSA 4PC3A 4QXPA 3TLYA 1T5EA 4TXLA 1TUBB 1SG0A 2HT6A 4YONB 4EVSA 2K2QB 4B75A 3QNWA 1DGQA 3FOZA 1TKCA 1RAAA 2FSFA 3KAPA 5DEIA 2ODNA 1S02A 5LM3A 1RRPA 2Z9DA 4HWTA 1IQRA 2PT6A 1IIBA 3OE7D 2FR1A 2MYTA 3AHEA 2IOHA 4U2KA 3UZUA 4BKMA 4BUZA 5DTRA 1AZTA 1FA9A 4I9WA 5DSTA 4MMZB 3AFMA 3ESXA 4G1VA 3TH5A 5KYXA 4BO3A 3BCHA 4C4ZA 1KPIA 2QVXX 1QHGA 4I55B 1I94B 3KR9A 5I4IA 2OCDA 4LECA 5F5LA 4ZMSA 1BYUA 5CLHA 5FYDA 1BE6A 1C8BA 3I0MA 4G23A 3CKYA 2W2NA 5F3RA 2OZLB 2FPXA 1R10A 1YF2A 4BP3A 4E13A 1KO7A 3ABZA 5EBMC 1JDUA 2SECE 4ZT6A 3ZRWA 4RCVA 1UXIA 2UYGA 2ZUVA 3EUAA 2ZR0A 3NGXA 1AN0A 1A5ZA 5BN1A 3QGMA 5E7QA 3AIOA 3OT4A 1TVMA 3G13A 2Q45A 5FJIA 1XGKA 5JVDB 1Q1GA 3EFOB 3PEFA 3TR0A 3X2SA 5HIKA 1ZI8A 4UTVA 4DR2O 3APQA 1E0SA 1O95D 4P7KA 1SVMA 2J5KA 4JDPA 4LMRA 4PNEA 4TKVA 5HKOA 3AEQB 3IE2A 3ZE7A 5K2OA 3FAZA 2V5UA 1GQOA 1PJZA 2PJDA 4DXDA 1RFLA 2EW8A 2J3MA 1FYJA 1NE7A 4P4LA 1VSBA 4YRFA 4V24A 1OV4A 3ZDAA 2AYXA 3EQ8A 3HCWA 1Z5ZA 1NOIA 4UBKA 3F1KA 1L5GB 1GPUA 2CL6X 2DFDA 3UAWA 5GTDA 1AN9A 5HW0A 3M8KA 1MO2A 5CFZA 1ZL8B 3T5PA 4JLBA 4P9OA 5CA1B 3K5NA 1DJNA 4TT3A 5I5EA 2K6GA 2E4VA 2A84A 5FOXA 3V8MA 1F4NA 5L8VA 1UKZA 3QU5A 4BP8A 1XPJA 4IJKA 4WBNA 3FBTA 4Q15A 1N6HA 4FZJA 4U7HA 4G37A 2QA4V 5HF8A 5K2MA 4WA7A 1NVWQ 1F14A 2GSDA 2M9MA 3DEAA 2IKQA 3SEQA 2X1MA 4WZAB 2ZVQX 2IEAA 4G9EA 4PAGA 5HFAA 1T1RA 1UDXA 2YJ3A 4JI3B 1S0VA 1L7QA 4RY9A 4C4RA 4YRTA 3HB3B 1ZO8A 2EX1A 4DRYA 5HVNA 3R9WA 1IB0A 2FFHA 3ZXSA 1GUZA 4G0QA 5EHZA 3KAQA 2G1JA 3R3WA 3ABIA 3CCRV 3GD7A 4KXYA 4OBXA 4CBCA 2E6UX 2P87A 3JQGA 4D4KA 1MAAA 4FNAA 4YIOA 2QYHA 2R62A 1Y0BA 3W90A 4EA9A 4OU4A 1M1YE 3ZWQA 4B8WA 3O2JA 4GRDA 5IH7A 3JWIA 5HFMA 3E7DA 4MCJA 1KI6B 1RI2A 3FCEA 4I50B 2MSCB 1XTKA 4HHEA 1FJHA 5KI6A 2RIRA 3KAKA 5B6IA 3RYCB 4BJ1A 3OPQA 2RONA 3U3JA 3SPHA 1J07A 1MJGM 1E20A 1OROA 4D9GA 3GJ4A 3OC0A 4AXXA 3QU4A 4JL6A 4KYUA 2RARA 1FBNA 2EZOA 1A9OA 4PWZA 4PCAA 5F9MA 4HVCA 3FHTA 3EMVA 3BSSA 3IP8A 3WE7A 3FCXA 3MZ0A 4JYAB 3NNSA 2RHMA 2DWQA 2QN8A 3N6XA 2F2TA 4Q24A 1D07A 2I6QA 1ESEA 4CM3A 4YYEA 3I04A 2FMTA 3ZMSA 5MDHA 3ZZ1A 1ZH0A 3HVJA 3MT0A 1WNTA 2C4UA 2GERA 2JGAA 5JNSA 2Q2WA 5KQMA 2RHGB 1UC5B 1XL6A 3JPWA 2FPWA 1QFJA 1GR0A 1LW7A 1VSTA 2QUKA 1E4EA 2PLAA 3GJQA 3HCPA 2CVPA 2ZRPA 3WB1A 2PCJA 2AFHA 3OBIA 3E03A 3ZEAA 3JU3A 4IFIA 2F3PA 5F21A 2C20A 1YB6A 1ECJA 3PDHA 5LKRA 1QZXA 2H9YA 1ODKA 2GBIA 4E2ZA 4F97A 3RYFB 4KUGA 2XODA 1E2BA 3LVBA 3INNA 4UHBA 4HEQA 4HG2A 1TM2A 3WKDA 1N33B 1VDMA 1WNSA 2OBNA 1DDIA 4P31A 1MW9X 4XYMA 2ILTA 3U1TA 5TV2A 1JQ5A 4O1MA 2H2FA 2B3DA 2FN4A 4JDUA 3I61A 4I1SA 5EKUA 3IEIA 2XT0A 3QPWA 4U3FH 1DU4A 4I6GA 4EHNA 2IX3A 1GEEA 1Y1LA 1S5JA 1LFDB 1XVAA 4CDMA 3UB3A 3ACBA 3WB9A 1MRSA 5FLXN 1MRNA 3ACCA 3OJFA 3WMFA 1SZJG 3M70A 4C06A 1WVMA 3KT3A 5K8JB 4A1FA 3ZWDA 2Y93A 5JH7F 4MSQA 4GOOD 4IXNA 1V3QE 5FFMA 1VKNA 3NATA 3J81k 2PSEA 1OX4B 2KM1A 3ZDEA 1GA6A 4I19A 1JQLB 1KI6A 4WKPA 4ND1A 2DPGA 3UYLA 3PIIA 2GXUA 2OXRA 4ZCRA 5H8WA 2DUNA 3JALA 4PGFA 1AGXA 1EJ2A 3U4MA 2JBAA 3ZK8A 4S1OA 3MINA 3G0DA 1GLVA 4PG7A 1PW5A 4OBWA 4PDMA 1RLIA 3C85A 3J7AU 2VYCA 2HM7A 1IEQA 1TZ2A 2QM7A 2EP5A 2IIVA 4PYRA 3ZWXA 5KREA 1G9XA 4P93A 1L2TA 4CHTA 3BTSA 3RC7A 2YMLA 5LKAA 3E0XA 1E7SA 3K4HA 2IEDA 2CLKB 2ODPA 4YJ3A 3NCTA 4H31A 2XCTB 4HGRA 3GFQA 3KQYA 3K8YA 4DSZA 5CUQA 5THQA 1A9YA 2EJWA 1IUOA 1JI3A 1XKTA 5LP6C 2A4MA 3IIIA 4LOIA 4B5LA 3WIOA 2AJ8A 4ZIRA 1D5AA 2IUFA 3MWKA 4D57A 3PF9A 1XKXA 4U7PB 5IBPA 3IQIX 3D7KA 3UMBA 4Q01A 1WXXA 1SPBS 2G5PA 4BE4A 5E6UB 1D2NA 1I2ZA 1Y81A 2JPDA 1VHDA 3N05A 3T7KA 4KQHA 5IXSA 1MD9A 5G0VA 2QMQA 2FLWA 3COVA 2G9RA 3I83A 4U7DA 3FFBA 5E0KB 1ZONA 2A5FA 2SBTA 1TAGA 2G04A 3BMOA 4QIWF 1PS0A 3A4YA 2COEA 3AEUA 4G1BA 4JBXA 5I7RA 3L6BA 2HA4A 3FZNA 3WDMA 4MAMA 4BV2A 1VKJA 1W52X 1M8PA 4DJDC 2V3CC 3TLCA 2PT9A 2O2CA 4EKEA 1WPQA 2WA4A 5FLEX 3TUJC 3MFYA 1C4WA 5A4MS 3OQ1A 4DEVA 3BTOA 4TRMA 3MPZA 3JYPA 1GXSA 3JASB 5KU7A 1VQ6V 1Y76B 3KB2A 4MPTA 2G1PA 1H1TA 1RC8A 1E1CA 1WNFA 5EA2A 1YRQA 1F48A 1U28A 5BYAA 1FXWF 3SPGA 1PV2A 2ZRNA 3PCXA 4B3CA 3ETGA 3UICA 4D45A 1R9MA 1B6RA 2ZB4A 3F4LA 3HWSA 2DECA 3NIGB 4FYHA 1H4VB 2EFYA 3TXYA 3ZI7A 4B45A 3UPUA 1JQDA 4TWAA 1FUYB 1ZM9A 2O6LA 3OUFA 4KAJA 2HDOA 2GEDA 1U28C 2DHDA 3EHEA 4NCNA 2G72A 2GHYA 3RWRD 1LW6E 3N2EA 4FQ7A 4I36A 3L77A 4JLWA 4K9OA 4G65A 1DEKA 1NNLA 2MYNA 2Q3CA 2PUHA 3GZTB 1RWNA 4ML3A 4N5HX 4J4TA 1J9EA 3L1JA 1B2RA 4RD6A 4YO7A 3SSMA 3TPFA 3V1NA 4D82A 2B35A 4MRPA 4I1UA 1XRRA 3DW3X 2BCCH 2B5WA 2R751 1GSAA 3I8OA 1GVNB 3EZGA 1YDHA 3IHLA 4TV9A 3LSYA 2R6R1 3Q98A 3ZTWA 1APBA 1XNRB 1TM7E 3GRCA 3ILYA 1IVSA 2AS0A 1Q2XA 2Q49A 1SZTA 4OQEA 4Q9JA 4DQVA 4PV1B 1UMDB 5I7HA 1SC4A 3MMPA 2QYSA 3H7AA 3FWNA 4GS5A 2C95A 1KYVA 3A25A 3Q8WA 1W93A 4V39A 4BOYA 5K3OA 1SQVH 4JI2B 3UO2A 3DYBA 3HXMA 2ACWA 1RZUA 3LUJA 4IO1A 3LX6A 4OBEA 1M9NA 1XJCA 5EE5B 1SCAA 5B2ZA 3LT5A 3U40A 1G42A 3ZWPA 1RE0A 2IH2A 1Y1PA 4HAUA 1KY5A 4AJPA 1RJ9B 5IFLA 2G7ZA 1QSGA 3EG9A 2X4GA 3GPBA 3MNFA 1QK5A 3OMAB 1A9QA 1FP4B 2JIDA 1VYHA 4LSZA 2IZOA 2J0UA 1VI2A 3PF8A 4X8LA 3UWDA 1X9IA 1ZC4A 4FOPA 4Z4HA 1LI7A 1QGZA 1MAWA 3F8WA 1NZJA 3D6MA 1PFQA 2PBLA 4LXUA 3DAPA 3V46A 5DXFA 2NPIA 2HVWA 1WXHA 3C3KA 5KSPA 1R5XA 3GDGA 3OU7A 1F1BA 2W5UA 1R3UA 2ICAA 2NX2A 3DOHA 3FROA 1IY1A 1IONA 1K6EA 3I9MA 2RDCA 1BHAA 1KAMA 5KHGA 1KNXA 4CCYA 3A6PC 4YECA 2PUBA 2QTGA 3T4XA 4FLWA 1JQEA 3B60A 5KVSA 2C59A 4OJMX 2A9OA 4MP3A 3ETQA 2HFEC 3LP6A 4PEVA 1VSVA 2QPTA 4M76B 3FB5C 1QR9A 2QZ9A 3EA0A 4TSFD 5FPKA 2YN0A 4LHZA 3ZHCA 1SUCA 3NQ41 4R98A 3R2JA 1JVNA 4ZOBA 1U7PA 1C0IA 1NXXA 3PVSA 4IIFA 3OSZA 4RV4A 4DO2A 2B7CA 3A1SA 1T1IA 3AR3A 2OHOA 5JXGA 4JI7O 1P1JA 3LOQA 3OZVA 3AU8A 3B70A 4E2XA 4YRBA 1IOLA 2I2DA 2ZSBA 3AHHA 3DB1A 4KCGA 3I6YA 3CG4A 1U97A 1EB9A 1RW4A 4MVJA 4MYTA 4U7TB 4BKUA 5AVTA 5CW1A 4UUMA 4ZVKA 2EFCB 4RVOA 1G20A 5AVJA 3INTA 3WWDA 4RIGA 3M4JA 2HWUA 4MQ5A 5LB4A 1YTFB 1YO6A 3Q2KA 4G26A 2IHZA 3U4QA 2D62A 4B7XA 1PR2A 1MB0A 2PMWB 2ZR7A 2P06A 2NYVA 1ROPA 1J8QA 2WYUA 4HSEA 3NYIA 2O8VA 1VG9B 3E5HA 1QO0A 4J10A 1P3DA 3RUAA 3VZCA 2BEWB 4E1VA 2GQ0A 3FNHA 1EVLA 2HSWA 4MNTA 2FY8A 4MWBA 3PL5A 4RPIA 4CUKA 4LXXA 3G82C 2Z5UA 2FSPA 1Q0QA 1Y3FE 1Q0SA 3DT9A 2QL6A 1UT8A 4KXLA 4L5YA 3IALA 3LGAA 1OT5A 1QBGA 3NB0A 1O96A 2R5FA 3ZVRA 3S55A 5CA0F 3F4KA 4MW1A 4F6RA 1SC3A 1UIMA 1R0BA 3IR6A 4NNPA 4BNDB 4B87A 1RP1A 1RQGA 1A8SA 3STZC 5E2IA 3RUHA 2WQZA 4H13B 3JQ9C 4ZBMA 5CBFA 2PUJA 3KE9A 2PAAA 1JR9A 4ZVNA 4ZDKA 2X9VA 3BWVA 3IFSA 3CNEA 3OQNA 4JI5B 2WTXA 5K3SA 4X1IA 3SS8A 3MGAA 2C5EA 3RS3A 4PELA 2EZ9A 5K4GA 4P83A 4B6JA 3MOIA 3DMPA 4TUYF 4J2OA 4JI1B 4Y9SA 3RC8A 1CF4A 4S0ZA 3HBJA 1YS1X 3ZGOA 3BD7A 2RGEA 4L0QA 4UE2A 2LXNA 4LDAA 3U3RA 4RZXA 4KBFA 2JFVA 2WY2D 1RVV1 3OJOA 1CJSA 3D1JA 4M0UA 3NWJA 2GXAA 3BWEA 5LP6F 3IEKA 4BVAA 5CNMA 3FSEA 4GLBA 1W2BU 1OAOA 4ZYVA 4FI3F 3WJAA 2HQ1A 3ZX6A 3OGCC 5BN3A 5JS6A 5L3QA 5JCJD 1RZRA 1JHPA 3JQAB 3L0CA 3FCCA 3BMQB 3A2KA 1U6IA 4PZAA 1UJWB 1U8YA 3AJ9A 3T1HO 1KJ9A 3B3GA 3D0QA 4HQOA 5CHEA 4YQFA 5A0VA 2YJGA 1BMFD 3K73O 2ADOA 2GBLA 1KJNA 4ZTUB 1SIOA 2HRQA 4NZZA 1T36A 4F6RB 1VQKV 5EZSA 4BNDA 3FD8A 1KYTA 1U1FA 4OCNA 3DMRA 4FLYA 3I37X 3VJMA 3CMAV 2Z1MA 1XT6A 4PZ0A 2BMFA 2HMWA 3GN1A 2XHEA 3M6LA 1SQ6A 3SXUB 4DE5A 1LKZA 2D74A 3RFUA 1IN1A 2GVNA 1AP5A 1FFCA 1W88A 2C98A 4TTAA 4YRMA 3KYCA 3ELBA 3RFVA 3EGWA 5IEJA 2Y0DA 3T1YB 3DOCA 2QLLA 2NZYA 2XGSA 2ZRJA 3OICA 3WO0A 4DCPA 4I9QA 4IEIA 1QIMA 1SCUA 2A78A 3GAZA 2Q2QA 4M8KA 4UTXA 1CV2A 2UYQA 1NMZA 2ZSUA 4RPJA 1GTG1 1RP7A 4UVAA 2XTJA 3MB5A 2FFBA 1E2KA 5CX4A 2E7ZA 2PAFA 3Q15C 3TW4A 4CV2A 2NVWA 4O08A 4PIPA 3P30A 3ET4A 1H8HG 2NU6A 3DTVA 1YVDA 2I29A 2IYAA 3TB4A 2HGZA 2RIPA 3A6DA 1RD4A 4GICA 1EIZA 4K2AA 1TCBA 1TYAE 4RD4A 4QPPA 5DVZA 1K0UA 2EVWX 1DHRA 1YHNA 3BFJA 1P2GA 4IDEA 1PNOA 5DYTA 1V9LA 3VDNB 3MTBA 2GUZB 4D3DA 2WQ7A 2R79A 3H1HH 3ZWOA 2AJCA 3H87A 4K86A 4QO7A 2GXSA 3AWDA 3TZKA 2NUAB 3DXXA 3FBWA 1PGQA 4WK4B 1Y6QA 4MS3B 1OT3A 2OV8A 1C7EA 1RQ2A 1R66A 3ILVA 3LCUA 5DZSA 3SC2A 2F67A 1MJGA 2F1JA 4HB0A 1Z6YA 2FF7A 4DBLE 4TSRA 1ATIA 2XEXA 3E8GA 1NE2A 2NOAA 2H17A 3ZCVA 2Q99A 3OU6A 1K6IA 4ZT3A 3H5NA 1BFUA 4OH1A 1CNEA 4WEQA 5CFNA 1H8EA 1L5SA 1T0BA 4PU0A 2QBYB 1X4TA 3U60B 3CE2A 1DTWA 1N6OA 4F7WA 3V7YA 5GGXA 1KRWA 1X2EA 2CW5A 1Y1QA 3KKNA 1FRQA 4CT4B 4WLUA 1QVWA 3GVXA 1N0WA 3WLNA 1JJFA 4E7PA 1USKA 1KI7A 3KVVA 2QN2A 4KX5A 1EUYA 3NS7A 2JVIA 3I45A 4CG0A 1CERA 1COWG 2QTNA 2CJXA 2CFSA 2J0EA 3HZHA 4BNVA 2EW1A 5D00A 1QLEC 4GP7A 2P6OA 1D1TA 4Q02A 1RRVA 2Q07A 4TV8F 3TRFA 3W4JA 4NV1A 4C4AA 4TOIA 3LOUA 5IC5A 4LH7A 4ZZ3A 1K88A 4PAMA 4WXPA 4BU0A 1U8XX 5KX5A 1MJNA 1H4TA 4XQCA 3VA7A 3W7VA 4F6LA 1A8HA 2Y67A 5AJVB 3WL8A 1M2VA 4OFXA 1HNZO 1JIKA 2P6PA 5IKPA 4KAAA 5KINB 3KALA 2QSZA 1GU7A 4TYWA 2ZGVA 1H1LB 1KQGA 1Y4MA 4GGOA 1YXBA 1M1ZA 3AR6A 4FYXA 4YLGA 5LNK1 3HKBA 5EN4A 4HGZA 4N5NA 1HWYA 3DSRA 2PQ6A 2YEVA 1GL6A 3HLYA 5T7BA 3OQPA 1NX6A 1SHJA 4HBNA 5JATA 2NU7A 3SF8B 2HKOA 2BJVA 5HS4A 3RSHA 2Q9CA 4EPYA 3DM9B 3AB3A 4Q9AA 2Q7XA 3DD1A 3NLLA 4QFBA 3F73A 1NA5A 1PZXA 1MA3A 4OKIA 1FXKA 2WLKA 4AC9A 2BVNA 2TECE 3WLIA 1Z4IA 4TRJA 3R5HA 3UMJA 5B3JC 4OLAA 1O08A 4QDXA 1R4ZA 1YS4A 4LZAA 1ACJA 2GNAA 3K6RA 4QSHA 3F47A 2XUIA 4GZ3A 4ESHA 3F96A 3BCSA 3GT7A 4C0HA 3ZW8A 4MB0A 2AHOA 4R8KA 4QGBA 1CUWA 4WV3A 4V0QA 1JLSA 1FTWA 1W29A 3PT5A 1G2QA 1KK2A 3TXQA 5CBHA 3ZHUA 1I0IA 1RJFA 1OX5A 4LBZA 2D1TA 1J6UA 2LP7A 2ZYHA 3AEYA 3JTMA 1QGUB 1WP4A 2ZIXB 3GFGA 3OQJA 5CM9C 5GWXA 3UOGA 1COWD 4W4KA 2WUWE 1DK1A 1DAKA 1DC3A 2W0SA 5B57C 1UJ4A 4BP1A 1VJDA 4F5ZA 1W0KA 3OKFA 3U3MA 5BNWA 1ZJWA 1TJ3A 1S4MA 3T34A 4L27A 4DQXA 3LSQA 3CUSA 4HZUB 1VCHA 2YVKA 4PDRA 4PA3A 3OX2A 1KDRA 2C3OA 4BFYA 4WIFA 2R47A 4GOND 1PG0A 1FDUA 4EYOA 2OQIA 1JPNA 1KFBB 3QUAA 1BQ3A 3VNAA 4BRSA 2QRNA 1JHOA 4HEHA 1FU4A 3E9QA 1IN4A 3GDHA 1ORQC 4KR9A 1PEDA 1N2IA 4DB2A 2RK4A 3PI6A 5C18A 1P0QA 2QTVB 5BN5B 1L8DA 1V5GA 2Q6TA 1JDZA 1GAQA 3LL7A 4JEIA 4K9LA 2AOXA 1GT6A 5BNIA 4HH0A 5G1PA 5IBQA 1UDRA 5LUAA 5JAQA 3TGWA 5CB4A 2C2YA 5AUQA 4OH7A 5FBVB 2A30A 1Q0HA 2XMRA 3K16A 3KT8A 4CM4B 4ZZ1A 1ODLA 1HNZB 2Q4DA 1R0SA 3W5BA 2G09A 1EWTA 2QAGC 2XB8A 1D4AA 1FQJA 3ZU5A 1CFZA 3MINB 3NM4A 5DM2A 1Z0KA 1VJ1A 3GJ3A 3PA6A 2ST1A 5I4CA 1Q90D 1NR7A 5LR6A 2W4IA 1FY2A 2CNDA 2WTUA 1MVNA 3BRSA 1QQ6A 1QRUA 1WXQA 4H1UA 3N27A 2OILA 4DANA 4GYCB 4QDZA 1U1CA 3TG2A 5DGHA 1ECFA 2CE2X 4YJ3F 1QVAA 4ZAVA 1P19A 5HIAA 5C51B 3CVWA 3OKPA 5KA6A 3D3WA 3HM9A 5IUNC 3BREA 2HT1A 5EP3A 1JFFB 4RIEA 3G9TA 4JVMA 1J49A 4X6YA 3ZIAA 1JHUA 3PX3A 1FPOA 3JSNA 1T91A 2RHCA 2NZWA 1QUFA 3LKVA 2E2WA 3IIMA 1HTTA 1YL6A 1XNQB 2QIPA 1SWVA 4PRZA 4RD1A 3F5WC 4U3JA 1N0JA 5EIBD 4B3TB 1RKXA 3N3AC 1KNQA 3OQIB 5D7NA 2XSZA 1XWFA 2XDYA 3G6BA 2QD1A 4Y9TA 1YZVA 1A71A 3EGXB 4P80A 3A8TA 1AXEA 5CLJA 4OK3A 3KJHA 1SXJC 2IJKA 1NW9B 3A4IA 4GC9A 3H9EO 1EAYA 3EZFA 4BU1A 4DBZA 2P35A 3F97A 2WKRA 1VQ8V 1EEHA 3GLSA 1OH7A 4P30A 4E15A 1J1IA 4LWQA 5IDVA 3QVSA 3CONA 5JJBA 2EIMB 4G5XA 4JQOA 2H9IA 4B6QA 3HA5A 3ZRSA 1TCCA 3GJ8A 3NDRA 4EY3A 3ZVNA 3PD0A 3PDIA 4OPMA 3X1JA 4D46A 1ZCAA 1X19A 4CKZA 2IVFA 4G8BA 3KFLA 4CBVA 4YAUA 5T3UA 1C7ZA 1YCDA 1NF8A 2JAPA 2RAVA 3LXRA 5T64A 1Q0TA 3M83A 2Q5OA 4GMFA 2BFFA 1XCJA 1XVVA 1JEYA 1PT8A 3B77A 1N2CB 3LVRE 3VDMA 3T7RA 2PJZA 1TAUA 2OTJV 2OVFA 1GYRA 4DR7O 1ZITA 2P62A 2E4XA 3CO5A 4IO0A 4Q3BA 4UKDA 2JLBA 5ALZA 1I7PA 1GSHA 4IGGA 1S8NA 4GKJB 1YOBA 4OXYA 5BRAA 1NI8A 2PPLA 2X0IA 1H3FA 3D8TA 1FFDA 3ESYA 3H9QA 3R5SA 4DKJA 1SK9A 1LBTA 3C3CA 3IUEA 4HNRA 2QOEA 3OTFA 1QIDA 1KL7A 4B48A 2IYVA 1SXJE 2QRVA 2CY0A 2VYFA 3NALA 2FZEA 1VMDA 1PPJH 3FHLA 4DV3B 1ZOSA 2R9RB 2PVPA 4M83A 2E4YA 4ER0A 3QRWA 4TXMA 4WNIA 5TX7A 4ETIA 4FWTA 1GTRA 3A05A 2ODMA 3K2IA 2IHKA 1M0WA 1GWNA 2FK7A 1US6A 2I33A 2JKZA 2QB5A 3A04A 4UVHA 5D3MA 3I4CA 3GLIE 2CV0A 3TYXA 2DF8A 5L3QB 3ENNA 5DHFA 5JO9A 2P7HA 4MSUA 5CA0A 4JT4A 1XCLA 4UMDA 5JS8A 2I3AA 3PPIA 1ZNQO 3E3AA 3QF4B 1RM4A 1FMCA 3E3NA 1IH8A 2Q8NA 3P1JA 5AT1A 1LVHA 4EF5A 2Z83A 5ADUS 3E9RA 2O8FA 2ERCA 4I4IA 2YR0A 4UVBA 2XAJA 4G89A 2GCEA 3T3PB 4AMVA 1EGMB 1JG2A 1X2BA 2CN1A 3B6MA 4BZXA 2C88A 3R74A 4CF4A 4X62B 1NQ5A 4E70A 1D1SA 4FJ0A 4RPHA 1SUBA 1QDUA 2BE9A 4QGPA 2XVXA 3L0BA 4U02A 5K03A 3DS8A 4X1IB 2BGLA 4JXEA 2J5RA 3LWNA 4U9HS 5E3JA 3AG2B 4GEKA 3TPZA 1KZ7B 4JA0A 1BXKA 8AT1A 2GTAA 1J25A 1T9GR 2CXTA 2N9UA 2WMNB 3B13B 3PC6A 3QXSA 1DWQA 4OQXA 4IILA 1REQA 2EP7A 2RHOA 1H8HA 2ZVJA 3QVWA 4XD7A 2C4NA 1WZCA 2R8RA 2XEDA 4R84A 3RFTA 4O2AA 2BRUC 3ITEA 3KV3O 3N6RA 4A8PA 1R5OA 5BOSA 1AD2A 3GQBA 4J75A 4YUYA 5TC4A 3DYVA 1CY4A 4LI3X 2IYNA 3HBMA 4WNYA 3ZV7A 1P60A 1ALNA 4XVRA 4RD3A 1WB8A 2PH1A 1TVKB 4MS4B 3AUKA 3A9CA 4CL0A 1F8FA 2OGTA 4F3NA 1VCNA 3EFOA 4RCYA 2IXGA 5AKJA 4EK9A 2AEJA 1PJTA 2IITA 1EVKA 4XIFA 1ZY2A 4EVQA 3T7AA 3IAM6 3CB2A 2X1HA 1SBQA 3LM8A 4OREX 5IF3A 5JLJA 2RKOA 4QYIA 2J3IA 1EVJA 2FPIB 3VYSB 2V0CA 4WKCA 1Z5UA 4UCWA 2YC4C 2OCPA 3K32A 4RIFA 4DRXB 2E85A 4PONA 3F2IA 4BVFA 3VOUA 2X15A 4QASA 1FNCA 1UANA 5HDBB 2VDMB 1U11A 4CGYA 1J8DA 5TQ0A 5HQ3B 1VB5A 3S3XA 1KO1A 2XASA 3BL8A 3HXKA 4XFDA 4IT5A 4ZO4A 2I76A 3B2QA 4X8HA 4KE7A 2WU1A 4FLMA 3W1VA 3ESCA 1K4MA 4DM3A 4O4LA 2IU0A 3UC5A 3W2HA 1SUIA 3HS3A 2F1RA 4LE1A 2ZR8A 1PFYA 3H0EA 1F9EA 4DVGA 3WXBA 3WLFA 4GQIA 4IOKA 1ZH2A 3RAFC 3ZLBA 2XE7A 3DT8A 4KEAA 4P8RA 4PZUA 1L1EA 2B78A 3N7TA 1YV9A 1PK8A 4CQMA 2XD4A 3A4TA 3VR5A 2D3OW 4JI8B 2HQBA 2P4UA 4FDTA 1B26A 1WQ4A 5CB0A 2PKQP 2QVLA 3VYWA 5JJLA 3VR1A 3F74A 3EYAA 2A9RA 1B6TA 2CT8A 5C0OE 1QRAA 5CNKA 3PLRA 2VH5R 4L9WA 2B5UA 1DJQA 4WKNA 1LY1A 1Y3IA 2OORC 2YH2A 2NV2B 2GKOA 1V5EA 3IULA 1PZMA 2GWHA 2OQVA 4J16A 1XQYA 3RJTA 4ZOCA 1T9BA 4C89A 5SZHB 3M2TA 2QX4A 3DEZA 1FXWA