2IU3A

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
publication title Structure-based design, synthesis, evaluation, and crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase.
pubmed doi rcsb
source organism Gallus gallus
total genus 203
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2006-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2iu3A04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2iu3A01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu3A02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu3A03
1S89A 4A1OA 1CS0A 1C30A 1G8MA 1PL0A 1ZCZA 4EHIA 1B93A 5H3LA 1EGHA 1JDBB 1T36A 2XW6A 2B1GA 1BXRA 1M9NA 1A9XA 1IK4A 1THZA 1KEEA 1C3OA 1M6VA 1P4RA 2IU0A 2B1IA 1PKXA 1CE8A 2IU3A 1S8AA 1VMDA 2YVQA 3ZZMA 2X8WA 1WO8A 1OZ0A
chains in the Genus database with same CATH superfamily
4JKIA 1QLEC 3DC7A 4N0QA 5J23A 1MAAA 1AKTA 4M38A 3ZS8A 4UB6Z 4R40A 4G0YA 4E4RA 4ZVTA 1NT4A 4MWGA 2WMNB 4J10A 1C3EA 3R5XA 4BC1A 4XGIA 1GU0A 3JZDA 4HQKA 1AN0A 2HVJC 5DHRA 4EA7A 4TXMA 3LPCA 1IHDA 1WD7A 4QG3A 2XOKG 4HPJB 5MHTA 3FI9A 1GD1O 3D8CA 3KP1A 4G4IA 2VF4X 2PMDA 4U7DA 2C00A 3SEAA 2FEKA 3LD9A 4YX9A 4BW9A 2WU0A 4JS0A 3L18A 3LLVA 2WWIA 4H7EA 3TQHA 4QDJA 3D3WB 4D9JA 1F2DA 3FNIA 4FK5C 3K0AB 4N0DA 3VO8A 3ZHRA 5IKPA 4FHCA 2AXPA 5BSMA 5IXSA 4J2OA 1C81A 2XAGA 3MCVA 2H92A 2O23A 3W3AH 1RXIA 3P9IA 3CX8A 4AJEA 5EXEA 1XDBA 3DOJA 4BMOB 3P5BA 2DKOA 3H5LA 1C8LA 2XUZA 5GVSA 1G2PA 2GO7A 1Y3BE 4KR9A 1JQ5A 3CCSV 5KCZA 4DB4A 3TO5A 2NTJA 2GZ1A 1U9JA 2BI8A 5ALVA 4EHHA 5ICMA 1NVEA 3DONA 4L4YA 3F6CA 1R6XA 1YRQA 1DO0A 2RAVA 3KKKA 1W5SA 3ABKB 2VRBA 2AI2A 1Z0DA 4HQ0A 1E1QG 3HNOA 3L8GA 1YZBA 5DCWA 2JGKA 3U3RA 1VQ6V 4JDUA 4KCGA 1JQAA 3FHOA 2W2MA 3GMIA 4ZEOA 5G0SA 4ICGA 2PZ8A 1W0KD 5WRFA 2PGXA 1XZKA 5JNLA 1LPBB 3AR9A 1Y9JA 3K16A 1NLMA 2IS6A 4F92B 4JJKA 3LDAA 5E9QA 3DA8A 2IU0A 2FPMA 4W4TA 3AF3A 4X8MA 2HPVA 4A8JB 3VM6A 4TN1A 4MYTA 2ZSDA 1TF7A 1WG8A 1Y6XA 1E9DA 3WB9A 2VKQA 1P1JA 2ZRQA 1JE1A 3WK7A 4TSRA 3NEJA 4RHTA 3JQQA 2QPOA 4RTMA 4FMPA 5BQOA 1YUBA 4YRJA 2GCOB 2ZVQX 1W48A 1ZDMA 3HCBA 4BX8A 5AI9A 2VDLB 1UQUA 3WV5A 4G65A 4DIEA 2W6QA 1T5OA 4LGVA 4YBRA 2G83A 3QXHA 2BEWB 4DUGD 1XKLA 4PBTA 3NDPA 3PUYA 3KB8A 2R7AA 4HNSA 3WWEA 5CFPA 4MYRA 1J56A 2M32A 3WR5A 1OXBB 1HXHA 4MYDA 3UG7A 5GTIZ 3IL2A 1L7XA 2QE6A 2ZBVA 2VP9A 4LI3X 4DJ5X 2O4CA 4C1BA 3PFCA 1DC7A 2Q9UA 1BFDA 2PV7A 1G9XA 1JQKA 1XHFA 3HN2A 4G5GA 5K0GA 4D0GA 3OR7C 1GKUB 2DQSA 1FTYA 2IZ7A 1OXSC 1UMDB 1RYNA 1ONPA 1LVHA 1BS3A 4U7JA 1NQUA 2W2VA 4CC6A 3DL0A 2P2LA 1NATA 4W7IA 2AWOA 3EX7C 3WLNA 1TUBA 1JEYA 3VPSA 2LFRA 2VPYA 1QVFU 3U3OA 4YMVA 2QTCA 4TS4A 5A05A 1TQ6A 3NTRA 2NR5A 3H2HA 1P0FA 4LXYA 3CZ5A 3HV2A 1GQOA 2ZI5A 3Q7TA 1R9MA 4TV8F 3THXA 4ZYLA 3HFRA 2CKMA 2REQB 4AS2A 3T1TA 2JRLA 3NO4A 4Q9JA 4U9HS 3KWJA 2Q7DA 4P5DA 2XXBA 3GCWA 2YBDA 1LU9A 2FWNA 4C0HA 2FKAA 4FK8A 3TINA 1EQUA 2R8PA 4I3FA 2ZGVA 3H04A 2OCHA 4WLEA 4AJHA 4BO7A 2ZKOA 4EHNA 1S8OA 1G66A 4NI5A 4V03A 3NCHA 1E1DA 4FC7A 3OUZA 4X7PA 1BCSA 2JK0A 2VDOB 5CYPA 3INYA 1C0EA 3L49A 4WJLA 4MH0R 2O05A 4PHGA 1GZ4A 3VDNB 3ADPA 4A03A 3E58A 1C7ZA 1J07A 1E4OA 5EBLC 2JIMA 2ZETA 4WXHA 2OT5A 4B2LA 3A1UA 1N34O 2Y1FA 3ECSA 2BFWA 3TSOA 5DLEA 2B4RO 2NU8B 5TS3A 3UOWA 4NE2A 1VYHA 1GPNA 1CT9A 4E5PA 2PBFA 4QPJA 5E4JA 4JC4A 2YI9A 1HDIA 3ED1A 2QRQA 3BMQB 3G88A 4RTKA 2D62A 4J3NA 3QBJA 4TL8A 2RGNA 4J7CA 5A62A 3VSBA 4MT8A 3RYHA 2BM1A 5LWHA 4S0ZA 1N9KA 1HDYA 2ZJ4A 4EHIA 3ZHCA 3PNSA 1K5HA 1W2GA 2PQ6A 2VHCA 1ZK2A 2XBUA 5JQWA 4YB8A 2FMUA 1P75A 5BNWA 1K68A 4RLQA 4LCOA 1RLUA 3UCEA 1THTA 4X1KB 3JPWA 2OEPA 3I8XA 4JZKA 4M9SA 2HSWA 1FRQA 5FFFA 1N9GB 2FZEA 2ZQZA 4K0KB 4RJJA 1U4NA 3A6PC 1U63A 2Q9BA 3H1BA 2QN3A 2INGX 4DJFC 4MS4A 1EJ0A 4OXIA 1FFXB 5BR8B 1E3DA 4Z4GA 2BMFA 3L75H 2ILVA 3BK2A 1K6XA 2F64A 5G1PA 4NB5A 3TK1A 3I39X 2LKCA 3BPSA 5HILA 4E5NA 3X1WA 2P0AA 2QTGA 4E2YA 3IMFA 2JLBA 3SSOA 3N2EA 1CUDA 2BRUC 1HNNA 3ZN1A 5AVRA 5KHIA 1QVGU 3DEZA 3KAPA 1DWUA 2QGZA 3IR7A 1V54B 1ECPA 3CPHA 1YT5A 3SYCA 4DPKA 3LDDA 4I8XA 3A2MA 3R7BA 1UBFA 3HA5A 3PUIA 3UPUA 4U00A 4OX9B 1JA8A 3K59A 2C0CA 3P45A 4AU1A 3WRXC 5HFNA 2BT4A 3PE3A 1D6SA 3VR2A 3QVKA 1SN7A 4NY1A 4NTYA 5JXWA 3E8GA 3ZR4B 5HRUA 2XDQA 3DQZA 1RXCA 4L07A 4CM6A 1YA4A 1IONA 4B4KA 1LK5A 3K70B 4UUQA 1NXWA 3DC6A 1O97C 1WHTA 5F35A 4PXYA 3IGFA 4HWKA 2X8BA 3TLXA 5KKNB 4JP3A 3H5WA 4WNYA 1I6MA 1ZCFA 1IHPA 5HUJA 4AJPA 1D0IA 4V0OA 4NHEA 5KYXA 5H83A 3NWBA 3RT9A 3TZCA 5GTHZ 1U3DA 4TV9F 2QM4A 2F8LA 1FRNA 1T10A 3MBOA 3C3WA 3RVQA 4US0R 2YHBA 2ANBA 1WCIB 1MX9A 5M5BA 1QFXA 2Q27A 4RTLA 4XDYA 1E3EA 1GVNB 2I5PO 3KXKA 2V7WA 1JYEA 2X7HA 4XVHA 1QHHB 2IUTA 4LOHA 2ZI3A 4GLBA 1NRXA 1C5KA 4RVUA 1CHDA 3UQZA 1VMDA 2YDXA 4HL6A 5DYIA 4AP9A 1U5BB 2EP8A 3PJSK 3ONEA 1NKSA 1DKQA 4LCEA 2PHZA 2NLJC 3KZMA 3VHLB 5AUNB 1D4OA 4NU8X 2D74A 4DSOA 5AI0A 1QZXA 2Q5OA 2VYFA 3JR7A 5AH0A 4UM8B 3WNCA 1F3LA 1LUWA 4DXHA 2X13A 1L9XA 2JI9A 1GT91 3I01A 2PKQO 2PX5A 2NN4A 2C2WA 1I13A 3B51X 4F45A 1R0WA 4RD4A 2MR6A 1SQPH 5K8IA 1JFLA 3SIRA 3TTXA 1VKZA 1U0RA 4MMYB 1R4NA 1GGFA 2E9SA 2ZYGA 5AK4A 1E7SA 5LIPA 1Y3FE 3G1WA 3SDZA 5CK5A 1SUWA 1CJBA 5BN3B 2SHKA 2KG7B 1G8MA 2JH3A 1YOBA 5ALSA 2HXYA 2Q6TA 3IURA 1FMLA 3ASYA 2F17A 3OOSA 4WY5A 4UE3S 1MB4A 3I73A 3U17A 3EWSA 1QGUB 1BQ4A 1R16A 4MCAA 5IAKA 2ZS8A 3F9IA 5K3DA 2E76B 3PI7A 1TW2A 4V0RA 3RRZA 3A14A 2AYZA 2RB5A 4G37A 3EY4A 3S2FA 3GJQA 1M2FA 1T2EA 3A32A 3E27A 1GKFA 1EGVB 2QW0X 1U3WA 1PBNA 4DQKA 1PAUA 2R1VB 3R24A 4KO2S 1KE2A 4ES6A 1XKQA 2DX7A 4M1QA 1LLFA 4V0SA 3I5YA 1Z08A 5KTKA 1TC2A 3TMYA 3TNFA 2QY9A 1A9RA 3IP6A 1K4KA 2AFIB 2ZWIA 4URHA 2V98A 1NT2B 3BJIC 2FUG1 4Q3DA 2JAHA 4QIWF 1K7DA 4KTVE 2QRKA 2ZUCA 1XR3A 2YL2A 1MO2A 3IO3A 3F3KA 4PLHA 4C43A 5DULA 4KC0A 4PRYA 3ZH9B 4CKCB 4M4SA 3ZEAA 1RZ3A 5T8KA 4EA6A 3ISVA 5FWAA 5ESRA 5CNJA 5C8YB 2CF5A 3PXXA 1D1QA 1S2NA 3HY3A 2IGBA 5B1HA 1ND6A 2NP6A 3WGKA 1UFOA 4GFDA 1PM9A 2KQXA 4F84A 4URUR 1IY1A 2QF7A 3AL2A 1YQ9A 3G2JA 3ZW8A 4MRAA 4CWAA 1OQAA 3LXUX 3ZE0B 4GIBA 2Q50A 2BOBC 1PTJC 2C8KA 3IQDB 4RAIA 2OENG 4GEKA 5DGXA 4NDAA 5KWJA 3JZFA 4WY8A 4R6WA 5IZ4A 5ESWA 1ZI8A 1N4AA 4N3BA 1AKVA 3ZHZA 2YOGA 4IMRA 2VXOA 3VPXA 3QFCA 1TVMA 2VYVA 3AF5A 1P6QA 1XBTA 4RTSA 5HIAA 2Z6AA 1KZ6A 5EGSA 3V4ZA 1IB6A 1BW9B 2BE7A 3E89A 1KXJA 3TXSA 2AG8A 4JZYA 2CEKA 4UMEA 2XVYA 1Y42X 3QWFA 5CURA 1MAWA 2W8BB 2QROA 4UOZA 1NU1H 2OHXA 2WAYA 1MTZA 1OD6A 1B0PA 3A4TA 5JC1A 4K9KA 4WNIA 1FTGA 4ZAVA 1AX9A 1AZLA 3KX2A 4U7TB 4LK2A 2PG3A 1TVKA 1Z2AA 2GD2A 1T36A 1INLA 3G8YA 1V3TA 2BI7A 3RS7A 2WT8A 1N32O 3S3WA 3J81k 4WBNB 3AEXA 4POOA 3T1VA 1RKVA 5BN5A 4LC0A 2W90A 1XNGA 3FY4A 3LNCA 2YJ4A 2H8GA 2V59A 4HG2A 1H0HA 1L5SA 4DNFA 4CM3A 2BGIA 4LH7A 4K1RA 4EI9A 2DYKA 4NJEA 2F3RA 4OQYA 4DF3A 5KAMA 2VA9A 4X9XA 4WZBB 1KQGA 821PA 1R4ZA 3OZTA 2ZI9A 3LP5A 5A0VA 3HXTA 1T0PA 5LP6B 1DQPA 1GV1A 1VCMA 3D8RA 5M3BA 2QJ1A 4L0MA 2QVLA 7YASA 3KKQA 4IAOA 4PHFA 2QKAA 3A6ZA 3GRPA 3PHHA 3ZE6A 1RYHA 4E22A 4OCLA 3EQ9A 5I8PA 2PW9A 1C2YA 5B4UA 4BLPA 4DV2B 2EP7A 4MGEA 4BKUA 1QO7A 2J31A 4LC9A 3OAAG 2L82A 1M2JA 2H8PC 4CTOA 4WOPA 2XSZD 4ZI5A 3RK1A 1KY4A 3W5CA 1N2CB 3OEEA 1NSTA 4OH7A 4QKQA 1PP9H 1E9BA 1XNRB 1ORQC 2FGKA 1EUZA 4R8LA 1IN8A 2P91A 4L16A 2OWDA 5D6OA 4HN2A 2QN9A 4GX1A 2UZ3A 4L8JA 1R0CA 1K7XB 3C1AA 2NSHA 5AK0A 4YJKA 1BWSA 3DFZA 4CM4B 4KQJA 2OV4A 3MBIA 5HOEA 4CKBB 5JTUA 4AXXA 2H0AA 2GHYA 2E85A 4F9EA 4K26A 3RWOA 2DFNA 3PX3A 1WY5A 3PKZA 3E8FA 5BWLA 4WXMA 5TQ2A 3QX8A 1SC4A 1Y4AE 4XUGB 3ESCA 2DW4A 1F4LA 4Y9RA 4DNXA 2EBOA 3FAKA 2QUAA 1YD7A 3CXHF 1AB6A 1KS9A 2VLBA 5LD2C 4UVDA 5FYDA 4ASUD 1TL7C 4UATA 2IDMA 3DB2A 1L1QA 2DWDC 2FH5B 4FFLA 3OLQA 2K7FA 1OH7A 2DF8A 3QHPA 2X40A 2XASA 4HT3B 1XROA 3ASNB 5I8WA 4LRXA 2C2GA 4DZZA 3N2YA 4Q00A 4UUAA 1TEZA 1DTSA 1DQYA 4TTSA 4BGEA 3N70A 3S81A 3QY0A 2NO5A 1RLMA 3PTZA 4JI3B 2WABA 1V8FA 4B7EA 3A1NA 2W6JA 2WA1A 4GPAA 2HREA 3C15C 4WOJA 5F5XA 3OFVA 4ZREA 4H4CA 3UY4A 4KSCA 1T5SA 3MLEA 1J24A 2ONKA 3RSQA 3Q88A 4LHXA 3AFMA 4OMFG 3P30A 1HKHA 4EIWA 1NBOA 1BDIA 3STUA 3G2NA 4ZOAA 1CEYA 1WRBA 1LZLA 4B3MO 5F3DA 1Q1QA 4QDKA 1GA6A 1ETHA 3FSEA 2HXVA 3LRXA 1BSVA 1TUGA 1LA2A 2XB2A 5HWSA 3UG6A 2QMEA 1T5TA 3A1WA 1RWOA 2XWQA 3TEMA 3U4QB 1XQWA 3S3XA 3Q3HA 3Q3VA 4DNOA 3TL6A 1LNQA 4JYAO 1QDEA 5HCNA 5GJBA 5JO0A 1H8EG 3KOOA 2CLIB 4XDGA 2P77A 4LNUA 4GMDA 1QGZA 1YIAA 3A6JA 5CFOA 3UAYA 1T1RA 1K89A 4IWYA 3UMSA 1DUIA 4C01A 5BO5A 1HNZB 3RJTA 2TYSB 4Y2JA 4DW0A 5JISA 4MKRA 1OT5A 5IDQA 5JZVA 2G7ZA 4CF4A 5JHHB 4RZ3A 2VRNA 1Z7GA 5BSHA 4DIFA 1E0AA 1G5RA 2YHUA 3FCYA 2QHXA 4G1FA 4D9FA 4ZYWA 4BQSA 1SOVA 2AG6A 1BWQA 5IKOA 3FBGA 2NNLD 1L5NA 4YRZA 4ITRC 1ONNA 4M55A 2D3WA 5I9LA 3BHIA 3PEYA 1EFRD 4DS3A 1OBFO 3FUWA 4EJ6A 3VXKA 3A1SA 1C9KA 2RK4A 5U9CA 4RTJA 5EEHA 2GXUA 3R76A 1IN1A 1LDNA 4FN4A 3OFND 4IHJA 3KYDA 5KO2A 4UCTA 1KJZA 4PINA 1Q17A 1FDRA 3USZA 3HCAA 4WLFA 3UJHA 1GUDA 4CLOA 2BISA 3ORQA 2G25A 2QX6A 3Q4GA 2HWYA 2DPYA 3WXBA 1VMGA 3DOHA 3UJNA 5JD3A 2NZ2A 1YB6A 4DLTA 2B30A 2AQHA 2P06A 2J5QA 1LS1A 3A1VA 4KR6A 3G9XA 3CG0A 2PU5A 1HEUA 3SC4A 1I5RA 1M2EA 4MW7A 4BVLA 3HRKA 5FLEX 3K71B 5EYPB 2OXTA 4WFHA 2JGDB 3RC3A 1J5PA 16PKA 1T5HX 2EZ4A 3UUGA 2N04A 2RN9A 4RETA 3JD3A 5I45A 2F7SA 1J25A 2M6SA 2ET6A 3MD9A 3AB7A 4UDNA 3IRVA 2JHAA 2E4WA 3H86A 3IJFX 3AG7A 2V03A 1P0MA 3BE8A 2GUZB 4JASB 3QUQA 4LTMA 1A4UA 3NWJA 1NBMG 4EJSC 4HDQB 1YZKA 4FT4A 1NMZA 1QQ7A 5EZQA 2HDNB 3RABA 4WPGA 2PT5A 4N9WA 3L73H 4NOKA 1GKIA 3E81A 4R51A 3B5JA 1VQPV 3H1KH 5JVDF 1CTUA 5KDOA 1X1DA 1QKJA 1KEPA 2B36A 4D79A 2PD3A 4MV9A 4YV0A 3CO0S 1F1BA 2BMDA 3VC7A 3F0TA 6LDHA 4R2MA 1R6VA 3JSXA 4RS4A 4OP3A 2P9HA 3NHJA 1JJBA 3B8MA 3M70A 5DSXA 4TVBA 1YI2V 3ZLTA 3VZQA 2PWYA 3OKCA 3SOZA 1ZI9A 2RG7A 1OIVA 1E8MA 5LA6F 1YCIA 4QTZA 2L0XA 5EXDA 2VUSA 2RHJA 4MO9A 4ZIRA 3N2KB 2DYSC 3QNMA 5EIBD 2HM7A 2B0CA 2HK7A 4W5HA 2X6TA 5T3UA 3B8HA 3MJ4A 4C6TA 4U6NA 4KFTA 1EESA 1L5HB 3LF1A 2ECOA 1J1ZA 1KFEB 3A3OA 3AETA 5E6SB 1KJJA 4LHZA 3O8NA 1IPEA 1H2SB 4IF6A 1NR7A 1XX6A 5FOWA 3CS3A 4JAVC 4OBWA 2W6ZA 3SPCA 5J5AA 4JA2A 4AWXA 4EQ6B 1SESA 3QBDA 3AHEA 1CUJA 4HNTA 3WYDA 1VQ7V 3WK4A 3OPNA 3SLRA 4K2HA 5AVVA 3OF5A 4FFNA 2GK6A 3OEHD 3VQXA 1WKBA 1TE2A 3FPJA 4IILA 3OQBA 3WADA 1JVNA 2AGAA 4DV3B 3WJAA 1N1GA 3KYCA 2OLEA 4DJAA 2XB9A 3KL4A 4U7PB 1CETA 2JFZA 4G85A 3HKDA 2YUAA 4GRDA 2X4GA 3U61B 2EIJB 3A0RA 3MZ0A 4IMIB 3UAZA 4LK3A 2VH5R 4KK4A 5FPRA 1X1AA 2PT9A 4L3VA 3T5BA 1FTQA 4DWVA 1ZIPA 2GCGA 3VR5D 3M5PA 1TYAE 4PYKA 2WJWA 1XTIA 4RVFA 2D06A 1DZ3A 5C5IA 4POAA 5ALZA 1OYVA 3KBBA 5ADHA 5KMGA 1MABA 4JI8O 3OTFA 3ZGXA 1A5BB 1NW5A 4BEBA 1Z2EA 2PGIA 1VPTA 3ECCA 3Q8KA 1J97A 1NKTA 4DCOA 3LU1A 1IB0A 2GRUA 5FPYA 3HDGA 4FIZA 3PHBE 4JLKA 4MSQA 3U19A 1KK0A 1VI2A 5EPUA 5TPWA 4NV3A 2ZTHA 2DT5A 3S2ZA 1Q91A 3VHXB 4QDTA 3S29A 4FYKA 2O0LA 4IMJB 1WOMA 1QLNA 2ZNIA 1MF7A 4JA0A 3P2EA 4WZAE 2OCKA 1EUCA 5DBIA 4C03A 4JTDB 1F5NA 4MQBA 1N2JA 3QVUA 4K46A 4P36A 7REQB 1XJQA 4MVCA 2J32A 1Z0FA 1Y8QB 2AVDA 2YWDA 4FKBA 2EILB 3LBNA 1CF2O 3T4DA 3HB0A 4G0UA 1IAQA 1SG9A 1LPOA 2BMJA 4BGIA 1IBKO 2J0UA 1R1DA 1USVA 3T5AA 1WBDA 3QLUA 4JKOA 2JS5A 1X38A 3H1GA 4O6VA 2Q4DA 1GNVA 4OUDA 5FADA 3E3NA 3M6FA 4G5RA 3L74H 3I58A 1GO3F 3GZJA 3AESB 3L6RA 1NYQA 3FKSD 5LN1A 3V4LA 3SX4A 4XFKA 2Y69C 4L87A 4EGAA 2D3OW 2EZPA 3FKQA 4FYMA 4G81A 1EHIA 3EPKA 4B7CA 1VA4A 4QDZA 2EKPA 1K3EA 2KSDA 4ZVMA 2BR4A 4BNUA 2D7CA 4XA8A 6YASA 2P9YA 1HMYA 3M6IA 3ONNA 1ZGGA 4EUFA 3WOHA 3WLMA 1XPUA 3MSCA 1YB5A 1XA3A 1FS5A 2WUEA 2J9FB 3DHNA 3F5TA 3MMXA 1M56B 1HNWB 2EP5A 5IWAB 2WF7A 4DK0A 1W44A 4REQA 1IG0A 2O96A 2OHOA 3A1TA 3BFKA 4DLZA 4XD7D 3TNYA 2OQVA 2J85A 3C7TA 1NBEA 1XDGA 4MRVA 1RRGA 4EHKA 3OU6A 3N9IA 4Y30A 4MVOA 4FYXA 4IZIA 3CSUA 2ESRA 4E4EA 4W4KA 4QFCA 3L8ZA 3IULA 1VIDA 1LBEA 4Z0PA 1HFKA 3Q2IA 3REQA 1AVTA 2DYRC 3C70A 2B4TO 1I6WA 3AY6A 4YALA 2AW3A 3SI7A 5AM0A 3VU1A 3NEAA 1UOEA 5IF3A 4BGDC 2CNOA 2YJ3A 4JODA 3FDFA 4KHZA 5HKKD 2QTLA 2NACA 1ESCA 3VTFA 4LE2A 2PJZA 3NTQA 1GK9A 1L1FA 1ISJA 3MWFA 4OXKA 4WXPA 4B3CA 4L2IB 4DSZA 2GYYA 2HF2A 2ZQMA 3QLJA 5GZ3A 1E8NA 2PEZA 4WFAV 4DWWA 1EQ2A 3QX9A 4JYYA 1XF9A 2II6A 1CRQA 4QDXA 4GMKA 2I2AA 2BOCC 3SVTA 4L5YA 1I08A 5IARA 2GJ8A 4I9WA 5AXCA 4WF9V 1R0XA 5KUTA 1O54A 4R01A 3R4CA 5KJCA 3NVAA 6Q21A 1YR6A 4I50B 3NHFA 1ODTC 2ZIEA 3Q9LA 4G5YA 1KA9H 5IDYA 3DH0A 1UJ6A 1R3DA 1PWEA 1TF2A 1BCRA 1Z3IX 5LQCA 1CS0A 1M2OA 4BFZA 1JDBC 3UXEA 4ZOLF 2GZ3A 3I5MA 3CV3A 3TD2A 4XYEA 4U2DA 1C8KA 3F6RA 3F90A 5T4BA 4PYJA 4NVPA 4MNTA 4QTTB 1XCMA 4LRUA 4N0EA 2HKOA 4UHKA 3O4FA 3SVLA 2JFUA 4GKJB 5THQA 2Y2UA 4RK6A 1R4MA 3BCHA 4UVHA 2E5WA 4MS1B 3JQFA 4E5VA 2OORA 2Q62A 4V39A 1H0SA 3FJ1A 3G85A 3AKZA 1QR9A 3EQ6A 4GICA 3NHSA 2EW8A 2Z2KA 1JTVA 1I94O 3V4SA 2Z2JA 1ADGA 5B7QA 3IE2A 3I0ZA 4DUZO 3FB1A 5LDGA 1CDOA 1N2ZA 2PGLA 3DJFA 3JALB 2OMEA 1G20B 2ZIWB 1O1YA 1P8JA 1XJCA 3SYPA 1YIJV 2G40A 4UHBA 1PGOA 4JI6O 4MJ3A 1ZH8A 2WM3A 2FK7A 4IICA 4W5WA 2VI5A 2XNDG 4KTTE 3NBMA 3RZVA 2NWQA 4TXLA 4EMTA 3X1KA 3QFSA 3DW1X 3M83A 1LDEA 3EDCA 1SXJB 4TYQA 5KVSA 4MR7A 4F2HA 3A4IA 3I0NA 3K92A 2REOA 5CDYA 4XGRA 4OH1A 2YXYA 4OQMA 4QOHA 3UBTA 1O96A 1JJIA 4TTIA 1TJ5A 2VEDA 3CCCA 2H2AA 1R5XA 3TOSA 1CB0A 4I9FA 4JUAA 4L4UA 2R9VA 1DHRA 1GUAA 1J0AA 3A26A 3V7FA 4X65B 2FPWA 2HC9A 2LE0A 1ESZA 3F8SA 2WD7B 4PZYA 5LMUB 4RQTA 3ZCTA 2GF0A 1RRFA 3PFNA 3K4HA 5TARA 4LOLA 4WNCA 3W34A 4DC9A 2WFLB 3NQ41 3RRFA 3S2EA 5HJ7A 1R88A 4A2WA 4GYCB 5EUBA 1QFSA 4CIWA 5A3JA 1U4SA 1I14A 3NHKA 1Q3EA 1ZSPA 1ENVA 2PUJA 4FLXA 1YITV 4BNWA 4TL7A 4HDKB 5HKOA 4ALIA 2C92A 1W1UA 2P2SA 2XWJI 1I5EA 5DK6A 2K2WA 5DEIA 2R25B 2HBYA 1RYDA 4MVJD 1UAGA 2FR0A 3CF6R 1KOGA 4PPFA 1XI1A 5BNZA 2E75B 4ND5A 4LDZA 4U7GA 1T29A 5J9PC 1N0IA 1SERA 3RS9A 1MO6A 4QM6A 3D3IA 4QBFA 3IHKA 1YZLA 2PT6A 2HYDA 2YWRA 3HLTA 3IBTA 4JJ6A 4YIPA 2CHUA 4B85A 2V3CC 1IH8A 3FCAA 4NR1A 1E5XA 5AW0A 1NRIA 2CMHA 4B6OA 3VAZA 1VQNV 2YZGA 4I4CA 3DLBA 4P35A 1XD8A 1LV8A 4NX2A 1XQ9A 3ESRA 3K30A 3PPXA 5B1OA 1XRPA 1XE3A 1HMPA 1DIHA 4YXWA 2WKRA 4NZYA 4K3AA 1AHIA 5CA3A 3ICPA 5AKKA 1P44A 1FPOA 3P2MA 1EHYA 3Q4HB 2X58A 5ESXA 3ASUA 1JQ0A 1J9ZA 2UU9B 4XM0A 4OGFA 1DEKA 1E3WA 1JFVA 1W5AA 2JCXA 2X9GA 3GQBB 1WUIS 4X00A 4CM1A 2QSUA 1OCRC 2IYXA 3IH5A 2JZNA 3SJCA 1RJWA 1W0CA 1VA5A 2G8LA 3D6UA 3B2QA 1KYTA 5FI5A 1YTFB 3DLAA 3FMPB 2JEXA 3CF4A 4H3SA 4HDMA 4UARA 1OREA 1CY6A 2TECE 4UBIA 2EU8A 1TMGE 1VC2A 4OQEA 2W0XA 3DPSA 3T94A 2QVXX 5EKTA 3OI7A 1E1RG 2X41A 1E63A 5D2CA 3A3PA 1JLRA 5EKDA 1ZCZA 3KDSE 4NU0A 1KIMA 2D5AA 5EZYB 3KWFA 1Q2UA 1ZY2A 1W4ZA 2GKGA 2EVWX 3MYYA 1M0SA 4B47A 4O1MA 3TEFA 4D9NA 5F21A 4FYWA 3AEIA 3PQDA 1UXKA 5FX2A 4CQMA 2K1EA 2TSYB 4K28A 3HRHA 3FAVA 4YN3A 1FFGA 5HQTA 1EZJA 1KNQA 4RANA 3E5RA 4URWR 3DV0B 2CDBA 2PMBA 2Y0IA 5HGJA 4YCAA 4FYVA 5IPFA 1CXZA 4TWAA 2NAPA 1KU6A 4ZMSA 3AHHA 1P7PA 3FZYA 1DJLA 1MSWD 4QTXA 1BYUA 1QHYA 1S8NA 3PQ4A 2VT7A 1AA6A 1WUHS 3L4BC 3TW6A 2IXTA 4EG4A 2D2VA 3R3UA 1F48A 2QD4A 3ZBUA 3H18A 5CB0A 3AUAA 2EDCA 4L0CA 1YC5A 4MCHA 3KQMA 1R0KA 1ZWIC 4LXUA 3TI9A 4FZVA 3LWBA 1L8XA 5GMOA 5BUQA 2GPAA 5I01A 2Y1XA 2PMEA 2B2NA 1SBZA 3KB1A 5DEDA 2RJNA 5G02A 2XZTA 2CY0A 4HATA 4BMDA 4BVGA 1SXHA 1U65A 5EE5B 2ORVA 4YUAA 3LHKA 1AK9A 1CRWG 3ELWA 4B3GA 4CIDA 3OMXA 3AHFA 1GAJA 4DJDC 3C1UA 3DAHA 3BCUA 2RC5A 4OU4A 4KX5A 3VGJA 3Q6NA 3B53X 3KKZA 1L0LH 4ZICA 1G4UR 3ER8A 3TZQA 2WOJA 5IC6A 3ET5A 3PCTA 3NETA 4ZKEA 2CJYA 1T43A 1ZSVA 4WGGA 1F2TB 1KQNA 1M57C 2Y1CA 2VO1A 1KI2A 3GDOA 1UWVA 4S04A 3BZBA 1XIVA 5CXQA 5CW2A 4KAJA 1VSBA 4JI1B 1B26A 1WW8A 4E5UA 3M1IA 3VOBA 1A3CA 5J5CA 1OBOA 1I4DD 1PNTA 4Z86A 1T1SA 2FFQA 3HO8A 1XOIA 2Z3ZA 4L15A 3BH6A 2A7QA 1KOJA 3EPPA 4OIFA 2GXQA 1N8TA 4UV9A 5L3RA 5JCJA 1MEJA 1PKEA 1JJVA 3A25A 3O0TA 4CCYA 4CEHA 5E38A 3EXIB 2C96A 2OFOA 2ZCVA 1UKEA 1MQ9A 4LF4B 1MA0A 4IX9A 5GOTA 3TLJA 4CMEA 4ILGC 3IGAC 2VWJA 4R0NA 4PAMA 3DV2A 5D00A 4S1TA 3QVJA 4LXIA 1X13A 2DPMA 4KP4A 3KTFA 4DCGA 2N46A 3C3XA 2TS1A 3KPJA 3L07A 4CG1A 2YV3A 3DL7A 2OQRA 2CNKA 1RQ2A 5JH7B 1MV8A 1ZA1A 2G1AA 5H9WA 4XJSA 4U9UA 5I9NA 4IXMA 3PX2A 2VJCA 3C0KA 2ZJFA 1PFYA 4G27B 1F8UA 1YVUA 5DGIA 4DQ0A 3EMKA 5AKGA 3H9GA 1CULC 5FOSA 1IBMO 3RUHA 1FNBA 1SOAA 3H0KA 4US2R 3B82A 3BDVA 4D81A 4C0QC 2XVMA 2BKAA 3MNFA 3LUJA 2QSJA 1VF6A 5DCAJ 5DK4A 2ZZMA 4Y98A 1N33O 4G3MA 4B35A 4XSHA 3R0ZA 3IFXA 4LJYA 1WB4A 1TYCA 1AHNA 1YS2X 4S1NA 3LYHA 4RDHA 5EJGA 3UMMA 4FI3C 5DFAA 5IJXA 1X7GA 4M7PA 5DE3A 4RMIA 2ZTVA 4JLVA 2ZDHA 3IUPA 3FE2A 1FW8A 3DLIA 1BU5A 1ODJA 1IZ9A 1SVWA 3RKSA 5BPFA 2IYNA 3KV1A 1ORTA 2BJVA 3K0DA 3OTGA 1SD5A 1H8HG 1IEWA 3AI1A 5HGXA 2YXBA 3I5XA 2OLJA 4FYIA 3WWPA 3H19A 3JSNA 2R11A 3DEHA 2W0FC 1EWKA 4MKFA 2E21A 3BXHA 5BYJA 2I3GA 1EXWA 4LHWA 3L6UA 1FFHA 4IYIA 4FNAA 3A9VA 3HKCA 1NVKA 2FB5A 2AJBA 2QPTA 4JOSA 3U40A 4EKDA 3GJ5A 3B36A 2QTRA 2BFFB 4UEQA 3MT7A 1Y1QA 4BNKA 4Z4EA 2VATA 3H9QA 2K87A 4GLJA 4XDLA 4O4HA 4LXHA 3IP7A 1Z6PA 1H93A 3BM5A 3JAMN 3CC8A 3RTBA 1FQOA 3ZDZB 4D4MA 1M7BA 2GZAA 2HHLA 3C8ZA 1AKMA 5GTDA 3IUBA 4OI0A 4G6ZA 3HYCA 3PHLA 5A9RA 3NNSA 1TU0A 4MHSA 3U56A 3RT7A 2JB9A 3FMVA 1U99A 1XHLA 1Z0KA 2AFHB 4XWKA 4ARVA 1NTZH 1L8AA 1RZVA 1ORWA 2V4ZA 4CS3A 1S4QA 4HAOA 2WJPA 2VBGA 5A9SA 4KXFB 3AJ9A 5DM2A 1VMIA 2C29D 2FE4A 1RXWA 5A6VA 1U0JA 3DBRB 5AI8A 3SF8B 1XN1A 3L0YA 2QIOA 2A6PA 4L7QA 2C8LA 1UP6A 4QU9A 4Y6LA 1GA1A 5A02A 3HXMA 1VGVA 4HLQB 3GGOA 3AF4A 2QNIA 1T9AA 4KVZA 1YB1A 2A1TR 1AK1A 1OLSA 5F9FA 1P1FA 4ZO4A 1WW2A 3REGA 3NANA 1L5OA 5DGTA 3IB6A 5BVGB 3TZ6A 2B92A 2C99A 1J70A 4A7PA 2C7GA 3WJ2A 2I1QA 5B3AA 1H66A 1G17A 4IUYA 3MN1A 2J3MA 4TYWA 1UDRA 3ESAA 4JJIA 1GZ6A 1AGXA 4GNRA 2ZJ5A 4EL0A 5E4TA 4TWJA 4H59A 1T8YA 1XU4A 4M9ZA 2F93B 1XDUA 3BRSA 3B6KA 4MMZB 4R1NA 4FDMA 2J3DA 4X62O 3RAEC 1R6TA 5H68A 5IYZB 2Y76A 3G6KA 1ADFA 1EX7A 5IWCA 2X9QA 3SAJA 5IT9N 2VJBA 2QDXA 3I5AA 4GZ3A 1QIMA 3CD6V 4GKKO 2QM0A 2RBEA 1TM7E 2KKWA 2YIVX 2Y92A 2OCAA 3OPYI 3EEQA 3TLZA 3ND9A 5AICA 1JFRA 1FFWA 2P65A 2IYYA 4D3ZA 1PDVA 1JFFB 4R1MA 2O6HA 4Q02A 3WLLA 2XQFA 1Z4KA 4C7BA 5JS8A 5CDTA 2AJTA 1EM6A 4UVBA 1KZ9A 4DCSA 4LJ7A 3LY7A 2BBTA 3JQAA 3ZGYA 3VKGA 3GN1A 1E2LA 3HUUA 1WLEA 4EMSA 1ZK1A 2VJYA 1DRWA 2R47A 1XLTA 5KIAA 3GNLA 5DN9A 5ERYA 5BV8A 4OGQB 3SR4A 2ZDQA 4MIYA 1A82A 1AGNA 4FJ0A 2DWCA 1WL8A 1TDJA 1YR8A 4J1TA 3U60B 4O2BB 3BD7A 4EBFA 2VWHA 2GZMA 3TW4A 3ZVRA 1TIKA 4TMKA 3T3OA 2PPVA 3CCFA 3MFYA 2XRFA 1PT5A 3OX2A 4NK4A 5KQGA 4NEQA 3MGKA 4RU1A 4ND2A 1R5JA 1QRSA 3WZMA 4I81A 3TH5A 1C8VB 2JIDA 3EF3A 1MJGA 2ZR0A 3NVDA 1H23A 2XAJA 3RS8A 4BLUA 4QFMA 3X2EA 3DBLA 2PX0A 2BH2A 1ATIA 2WAMA 3IAM6 4KQHA 3AP3A 1BN7A 3L7YA 5FL7D 3OQ6A 1W1IA 1K63A 3DVLA 5EJ4A 2IYTA 4I08A 4DR1B 2FN4A 3ZWAA 3ETDA 4P82A 3X3HA 5H80A 4CKWA 3RJZA 3EULA 1F06A 3C87A 2C2OA 2V3WA 5KSYA 4ARZA 4MV7A 5IVKA 3OQMA 1O95A 2H29A 4MAAA 3GYBA 1XZNA 1PEAA 1Z07A 1SVIA 3NIDB 4G8DA 3MCTA 1UMKA 3VTZA 4ZCPA 3HUTA 3T38A 3CRMA 3KQNA 3VRHA 2G17A 3UMVA 5DP2A 2XMZA 2EJVA 5IBCA 1GYQA 4R1LA 4LMAA 3WIBA 2P2DA 2EZTA 1GP2A 1ODLA 2PLWA 2R6DA 3T1YO 1NW6A 1LTKA 4BBJA 1XO1A 2ZR3A 3GLIB 1YZNA 3VBCA 3AVTA 3HXPA 5CDGA 5HJ2A 3R7WA 4BKQA 3B9PA 1J9EA 1JKJB 4BQEA 5B3SC 4WKGA 2CWDA 3TTUA 2I6XA 1O2DA 2O0MA 3LT1A 2AFVA 2VRCA 2C5HA 3DDUA 3PHCA 3R7SA 4PZEA 5CLLA 1NM5A 2CUTA 4N4AA 4FR0A 1IJBA 1IUNA 2PS3A 4EGSA 2J3HA 3AZOA 4QQ8A 4LTNA 3TR5A 4M9CA 4DW1A 4EVSA 3B1YA 4KRXA 1MVLA 1T15A 1UODA 4P3KA 4DEXA 3CRZA 5LMNB 2JLWA 5KHHA 2LNDA 5AVYA 5CA1A 1M8JA 2PMFA 1W4RA 2ARKA 5FEUA 4YTEA 2RHHA 2C0PA 2YV1A 3UMJA 1KFCB 2WWWA 3T7AA 4DT1B 1Y7IA 3KUXA 1CPYA 4RZXA 1TO2E 1ULUA 4K6OA 4F11A 3K15A 3QVTA 4D80A 2H1HA 4BE7B 4DR5O 3STXA 2YFKA 2IW1A 4LVNA 4KL1A 1U28C 3RSLA 3AW9A 2O57A 3MC1A 4OK6A 1Z6AA 4TTVA 3ZG6A 1AUOA 2ZW9A 3DBOB 2XUOA 3N75A 3QPDA 5KVCA 5F64A 1XQXA 4DE5A 2G8NA 1O57A 1F1JA 3DT6A 1Y8CA 1L7QA 4C0WA 2A3RA 2NN3C 4BJ5A 3R3ZA 3TW8A 2CSUA 2YJ6A 3RU3A 1VE3A 2NPIA 4D56A 4S24A 4B8WA 2XMPA 3RCBA 3K0CA 2ZULA 4MW2A 1II9A 4GVPA 3MTGA 3W2GA 4LVOA 3ZZMA 5KTMA 3O21A 1H9BA 5JQGB 1N6PA 3RFXA 4OP2A 2ZRPA 4I9NA 3LPNA 4NHOA 3U44A 3WGVA 5CU7A 3K5IA 3L8HA 4W1QA 1R00A 1KKUA 1VHJA 4INZA 1NMYA 1P4HA 2UYYA 4RPIA 5KNDH 4MLZA 1H6BA 5EUQB 1H3EA 3FTNA 3LUBA 1WKVA 1UL1X 3GVIA 4MW9A 3PXCX 1YI1A 1QM5A 1LVUA 4IXWA 4JX8A 3RTEA 3AR7A 1I24A 2ZNRA 3C6KA 5H0IA 3A2LA 2JLYA 2PT7A 1F8FA 4B6EA 1S9HA 2YYYA 1A95A 5KYNA 2IPOA 1FBTA 1CQPA 3URMA 4EX6A 3V8MA 1W0KA 2G08A 4D3DA 1EFCA 3THWA 2PZJA 4B6JA 2A58A 4CI0B 2JFYA 2C83A 2VEOA 5K2MA 1YK0A 2MJLA 4AIIA 3L7NA 3NW9A 2Q5EA 4I6JA 1MAVA 4OEHA 5HFLA 3ROXA 3IQGX 4RY2A 4D4KA 2HIMA 3NIWA 3BWVA 2PMWB 1JU3A 4MWDA 3ZOZA 2IEDA 2ATVA 2EAUA 3IJRA 4DR3O 4AX8A 1YZVA 2AMVA 4AUKA 3BF8A 2V74B 1F20A 5EMMA 1WCV1 3MCUA 1UZLA 1L4BA 1M2VB 1X4TA 4NS4A 4QM7A 4GP7A 1I2DA 3UT6A 5TQJA 1G8FA 3A4YA 3LT0A 5EWLB 2XUPA 1T6BY 1GYRA 3VYUB 1X86B 5F9HA 1ABEA 1ULTA 2QVYX 5L3GA 4F6EA 2PLAA 4J6EA 4PQFA 4DUGA 5CX4A 1XZBA 4CW7A 1RU3A 3I64A 1Y5LA 1RVV1 5L3DA 5FNVA 3BEHA 4R69A 2I7CA 5SZKB 5ED4A 5AJTA 2R72A 5CVEA 1JR3D 2N1MA 1IHOA 4MIEA 5HQJA 4ZT2A 3EGXB 4FFRA 2Z0MA 1ZEMA 3LNNA 2OC9A 4BKMA 4H0FA 3R0XA 1KE1A 3RPEA 2PRSA 4B8ZA 3SHQA 2R751 4J0GA 4Q3CA 3RUCA 3BMXA 2ZR9A 1CB7A 2JGRA 4Q3OA 4H3HB 1VOTA 2GVZC 1H4TA 3A70A 5TVKA 1UM8A 3OE7G 2UXDO 3CNBA 4LOJA 3R9XB 3T9EA 3VBEA 2FQQA 4ANFA 4UE6A 4AZVA 4F3RA 3PKIA 2CDYA 5BSVA 2IK8A 4CL8A 1MJFA 4JLNA 2FN7A 5BXYA 5HCIA 4TSFG 1IWBB 1LDGA 1UKCA 4TLLB 4YRRA 1Z45A 3IDAA 2I65A 1KI7A 1AF2A 3E1UA 1V43A 3PGKA 5ARDA 3TAHA 2O8EA 3MQ4A 2QZJA 4HSGA 1F0PA 5JSQA 4KWCA 4UU0A 3CW8X 4LDQA 2A9FA 4X3OA 1M83A 3ZRWB 1Y76A 1OGIA 2B83A 5KNLA 1SCBA 2YICA 1ZKMA 4X41A 3IEMA 1DBVO 4FQ5A 3UATA 4F96A 3B3QA 4A9AA 1KYOF 1LSSA 3DE6X 4UU1A 2GM3A 3WYBA 4AYWA 4TKLA 4ZTUB 1FUUA 3UAXA 4G67A 1NVAA 1U2DC 2NZ8A 5EP2A 3QWAA 3PLNA 2VR1A 3K0EA 5K20A 1TB4A 1VHDA 4BNDA 4CMBA 3NS7A 2Q4PA 1MA3A 5J4LA 1THGA 2QSYA 2YXHA 1SWVA 4DIMA 2F2TA 2QTTA 4R1UA 3QE9Y 2ZTSA 4YDSA 4PLVA 4CV0A 1V4NA 2V45A 3SJBC 3SLGA 2OBMA 4LBVA 1XVAA 5CLQA 3IE0A 1EBUA 1YB2A 4C5CA 3O8QA 1LFDB 1RS0A 2MYUA 1GADO 4TTPA 3G89A 4XVQA 1QOPB 4TS3A 3DVSX 3O83A 1PNQA 1U7UA 5JS1A 1XCOA 4UVIA 4MI6A 2ZUSA 2A06H 1NLYA 2B34A 3KCNA 4EGFA 4BZXA 1B8PA 3BMOA 1RAFA 2G07A 4C3VA 3GEGA 4YRSA 3GPIA 2Z5VA 4KVGA 1T3HA 4GQIA 3EQ8A 4FXOA 3MPZA 4NZMA 3BIOA 2AL7A 3JWJA 3MJSA 4LXXA 4I5EA 5EC1C 1YIDA 4F06A 2HEPA 3H0CA 4GOJA 4OB6A 4C7UA 1H0KA 5B1NA 1BTOA 5AM4A 1SBNE 1N5DA 4R2IA 4Y7CA 2XD4A 4Q4CA 3G8QA 1IK4A 4RXTA 4WZAA 1L2TA 2O2ZA 5CBGA 2DWUA 5H82A 3J7TA 1TAHA 3KJIA 2DSNA 1L5MA 1NQAO 1MC8A 1N3IA 4GGMX 4BVBA 1DXOA 3A6KA 3ZV6A 1E64A 1LSOA 4RGVA 2LO1A 2X0FA 4IIDA 2QE7G 1Y6FA 2VJNA 5FWYB 3PR2B 5AYVA 2WLKA 4I4TB 3BMNB 1KQPA 4D8YA 2C31A 5I9TA 1V3UA 3FDIA 2X6BA 1X7XA 3ZW9A 1QWOA 4LP8A 3SF0A 2I4RA 3DXYA 4JHXA 2QPLA 1UBTS 3AEQB 4OXQA 4YP5A 3GEBA 2IELA 3UMYA 4KR2A 2YFHA 3UV6A 1A8HA 1II8A 2R68A 1FDVA 1C1XA 2CVFA 3DO8A 1BJKA 1FRFS 2AQKA 4TZ0A 3SBDA 3EEIA 5LBUA 4OLJA 4FYJA 4ZRNA 2XH8A 2O2SA 5IM4A 4HK4A 4DHEA 5FA8A 1IDN1 1BNCA 3AUFA 4WXEA 1OZ0A 4ENUA 2VSNA 2CXUA 4PSAA 5FPOA 3QE3A 2QTAA 3CBGA 4RESA 3TIIA 4DAEA 2JBWA 1P60A 1ZGCA 3ELDA 2D5CA 3KHTA 5FBWB 1ECGA 4F4UA 3JQPA 1ZLXA 4TYNA 4NZNA 1N5JA 1JPVA 4M1OA 1Y81A 1MOQA 1A7UA 4C07A 1BKYA 1JPXA 2OAGA 4QGSA 3U7HB 3HPQA 3IIIA 2CE4A 1NMSA 1CVIA 2MOKA 4R5HA 5GV8A 4MR8B 1PV4A 3SR3A 4DSUA 1XCBA 2ZR2A 1YJWV 5LWQA 4Q1FA 5DCYA 3EXG1 4YAWA 3ER9A 5FBRB 3WYFA 2OZLA 4JBHA 1KP2A 1MO4A 4H7JA 4XGNA 8AT1A 5GY7A 3O9ZA 1OUMA 5K05A 4KGXA 1G2OA 3TLGB 2W00A 2DLCX 2GZDA 1U8ZA 2ID7A 3ASOB 1UDAA 5KOJB 9ATCA 3ZGVA 3P0FA 4D97A 2YIBA 4I5GA 2P87A 1E4VA 3KPYA 3OQIA 3Q3EA 5LKAA 2HWKA 2V6BA 1KJQA 3ABZA 2DQKA 1UIRA 3IOBA 2MSWA 3LVQE 1TJPB 4RK1A 4EKNB 2PL9A 4NXMB 3PBKA 1IVNA 3F2VA 2VL7A 2C9DA 1N0WA 3VUFA 2JFFA 4P22A 2Q3MA 1KO7A 1NE7A 1F60A 3RHZA 3P71T 1YASA 3TG8A 1NAHA 3P4XA 3W2FA 2V7UA 2ZYUX 1BZKA 2J7PA 2WLIA 2PBZA 2HSGA 2QXTA 5C32A 3DVQX 1DKMA 2Z5GA 5BW5A 1NKDA 1VJGA 2D2EA 4S0XA 1X39A 2JD2A 2GHIA 4AKSA 4OFBA 3CUSA 5FUQA 4B4WA 3H97A 2BM0A 5C8VA 4RSHA 1NF8A 1YOVA 2C5EA 1PT6A 1FTWA 1VMAA 5DI3A 1M10A 4MTGA 4CR6A 4XWWA 1Q6HA 1X7HA 2B25A 7MHTA 2ZE6A 1EFHA 3DDCA 4F5YA 1A72A 4AQYB 3FYTA 3E9DA 2DJVA 5BT8A 2RI6A 4FWBA 3AFGA 2ECPA 4JQOA 4P9EA 4Z4FA 3AEKA 2HQBA 2DWEC 3NIFB 2CLHB 2PGDA 3HBMA 4ZZ2A 3N58A 3IVRA 5DRTA 1J8VA 3RM3A 4BL5A 2I67A 1WB6A 1F51E 1XA0A 3B8EA 2IBTA 3O3OB 4KSBA 1B15A 2HAEA 2MMCA 3K6SA 4GI2A 4KITC 2RKOA 5KNBH 1HWYA 3K6JA 4U3JB 4KKXB 3QA3E 4YFVA 3S2SA 4FEYA 3BBPA 3IAM1 2FWBA 3INTA 2R8RA 4QQRA 3B3JA 3BC1A 1FNDA 2FB9A 4HDOB 5HRCA 3AWIA 2C1XA 3WYNA 5K0TA 1P6XA 1N6LA 1BS9A 3TYXA 4D6PA 1Q1NA 5HMMA 5CA0B 3AUKA 1P33A 4IGGA 4EYSA 1N36B 1CKEA 3LC7O 2IHZA 1ZU4A 1WEHA 2Z9DA 3O8OB 3TSZA 1T4MA 2FWPA 3GZNB 5LQDA 1OB2A 3QO8A 3D7RA 1JB1A 3D8HA 2GJKA 1E2QA 1AGRA 4AZ3B 5IT9A 1VSUA 2PLNA 4PC3A 4ZV4A 4HEQA 2UUAO 3SK0A 1U8FO 1VHWA 2Y66A 5BSGA 4DMFA 2Y77A 1DBPA 2H6EA 1G55A 2A9VA 2F1MA 4UHFA 5LL6Y 3W5UA 2RGAA 1VRVA 4CG3A 4TRRA 4W8GA 2EARA 1XRQA 4EB6A 1LLDA 3AM4A 1V95A 3KUUA 2ISCA 4F6CA 2RHBA 3GOQA 4Q3NA 4L4ZA 4BFVA 4PPQA 4DA6A 3RI3A 4YYEA 4BASA 4V2UA 1NHGA 3CMCO 4QXRA 2ZJ6A 4CMGA 1NVPD 4FQ7A 4KXYA 2NPOA 5GJWC 4H6VA 2R3SA 2EZ8A 2GN6A 2JG3A 1FNNA 5JAIA 4YFYA 2Q67A 3WLOA 4R7ZA 3BWCA 3TPFA 4A10A 3GFTA 1JU4A 4MSMA 1DCTA 3ZEIA 2NU7B 4YH1A 2Y8EA 3KEQA 3JYOA 3FPFA 1DKUA 1EEXB 1F23A 2ZAIA 1U0HC 1WVIA 2PPLA 3OD4A 3GWGA 2CYAA 1AKQA 3FOBA 3ZCQA 4DR4O 1K97A 4X66O 2IE8A 2W43A 3INGA 2QNBA 3FOEC 3L8YA 4BVHA 3H01A 3IEPA 3MWEB 9ABPA 1FXHA 2QQ5A 3SYLA 1GFWA 2PZSA 1TXGA 2XZDA 2CK3G 3SIPA 3P9RA 4Q4DA 3HGMA 3CZ4A 1OLUB 5THKA 5C8YF 2HA2A 3L05A 4AX4A 4RLHA 5IAGA 1CUGA 4MLCA 3L7KA 2VDPB 3F5MA 3CKKA 2A5JA 1WB8A 2ITDC 5H3CA 2X9LA 3PRJA 4QSHA 3U3MA 4ZV7A 1E7QA 5EVCA 1E1QD 4LF8B 4DRXB 3GLHB 3TTTA 1B73A 4ASUA 4K9RA 5D86A 1HT1E 4B73A 3LE8A 3QLVA 5HX7A 2WJ6A 4D0NA 5IMBA 1VIYA 5HSGA 5CNMA 1T8PA 4MA4A 1CUEA 4F1JA 4AJ1A 2V58A 3IMEA 5FR1A 4HYOA 2ZE8A 2BSKA 1EE9A 4DIKA 3IJPA 1K66A 1G4HA 4FZ5A 2H54A 2NYRA 2GYVA 3K9CA 1JXOA 1FU7A 4DA8A 5EHNA 1E3LA 3L8EA 1FYDA 3MGBA 2OSVA 1VJ0A 3I61A 3CCEV 1VE1A 1I6KA 3TIXB 4YJ2A 4MUAA 3KVNA 5BP7A 4ZAYA 3OUTA 2RG1A 2MYPA 3DHVA 2CL0X 2NSDA 3LNTA 3EAQA 2HHAA 4WBNF 3WGMA 4PDMA 3L0DA 3UB4A 2ONCA 2PGOA 5EKSA 3JRXA 2UZ4A 1VYVA 1GTRA 1KL7A 4QXMA 4BO8A 4IS2A 2WMYA 1UJNA 4ND8A 2JJ1D 3FUTA 3P7MA 4JKYA 2WLMA 3A1DA 3D5TA 1X74A 1CK4A 3SIWA 4L8VA 3GDHA 3QXJA 3U0BA 3C3AA 4RVCA 2JASA 3F1LA 2XWSA 1D3AA 2ZAOA 1Y66A 3AG1B 3ZZTA 4IIXA 5LP6F 4TTRA 3QF4A 3PL5A 4NCKA 3BSWA 4ALJA 3N05A 1RXSA 1C4XA 3G0IA 3GGCA 4NQZA 3KKOA 4IW3B 4Z2YA 2XWPA 2IEGA 3L1JA 2V7QA 5KHGA 1DIBA 3DAYA 1JNYA 3C39A 2RGYA 5I4KA 2L2QA 3UBMA 2AQ8A 2A0WA 4DV4B 5KNCH 4V1CA 1PGJA 5B66Z 1QCYA 3MTEA 4M0FA 4NAHA 3MM4A 1WZ2A 2F1IA 4HX2A 1J33A 1WXXA 5EMNA 2FWMX 3SQWA 3GY0A 4WTOA 1QRAA 3BYZA 1UEJA 4ZTZB 1QHGA 4OI2A 3EXFA 4PFJA 5E1MA 2WOOA 1DO8A 5G1OA 2FP3A 3I6YA 2O0HA 4E32A 4RD2A 3WTBA 4NAVA 2ZWMA 5DH9A 4NQLA 1R5BA 1E3IA 1EUDB 3HWSA 4TQAA 3ZQKA 3D8BA 2JJMA 1NJ5A 2OO5C 2Z56A 5JNTA 3T2MA 3ABTA 3N39C 2O2CA 1MR3F 3UHPA 2IH1C 3P3PA 1FNMA 1TNDA 1FMJA 2WWXA 4F3KA 1XZDA 1HE5A 5H1YA 2B4AA 2YDYA 1M33A 3FYUC 5L53A 4QBHA 2DM6A 3GFOA 3WG7B 2IOFK 5BV1A 4XWTA 2ZYIA 3RVMA 4JSRA 1X1CA 3QH4A 4HWPA 1KNXA 1OZAA 3PGVA 4MA0A 5JDCA 1S7GA 4JT2A 1MT3A 3DD1A 3JZIA 1WW3A 1WQ4A 1PL8A 1BHO1 1O97D 4U63A 4R8MA 3RUDA 3SX2A 1YBAA 3U9TA 4JVSB 2IWRA 3I56V 4Q48A 3N8HA 4AKIA 1U8AA 2UXCB 5IS2A 1ZUNB 3EXHB 5L9AA 2E87A 4EG2A 3SS7X 1GITA 3JD4A 1FFEA 2ZWPA 1HDOA 3MHTA 2LBPA 1PHPA 1M72A 3FTPA 3C6YA 3Q9SA 2I1WA 1JGTA 3N0XA 3KR9A 2IL1A 1A9XA 4I4IA 4JJAA 4Z3KA 2FPGA 3GHHA 3X2QB 1AXRA 4ZCSA 2GLUA 4WCFB 5IY5C 3D2CA 4TMWA 3I9FA 3HDTA 1N6RA 4RHYA 2P78A 1J4AA 4GUDA 2XW6A 5KREA 3ZDFA 5CEFA 4CR8A 4KYIB 1W4BA 3OOEA 2AKAB 1A8IA 1X7WA 3BWEA 3NG1A 4FB4A 3MXTA 5LKRA 2G1KA 2F00A 4ZTBA 1L0NH 1RZRA 1AILA 4INOA 4A27A 3M5CA 4JGBA 2DJIA 4R7TA 2FX5A 3K3PA 4L9SA 6PFKA 4RABA 3N53A 1JRLA 3T5DA 4DR2B 1FLAA 3FETA 1CFJA 3Q2KA 3OIYA 3D36C 5A7GA 3UENA 1K4MA 4LRYA 1ZH4A 1SQBH 2FQ1A 1Y80A 1YFKA 5K4HA 1G41A 3FRIA 5KOYA 2FDRA 5D3KA 2NO7A 4COOA 3AEYA 1TIPA 2D4HA 4HVLA 5AKHA 4JI5O 1R8YA 4IH9A 1I5OA 2WB2A 2HU2A 3Q3GE 4KIWA 1DIAA 4TPKA 5CLFA 3H6KA 3QVXA 4G5XA 1YKGA 2K4MA 1DELA 4HX9A 4G4JA 2OD9A 2XTMA 2JKVA 3O8LA 2AR0A 2R2GA 3A2NA 2YZ7A 3EPJA 2C2HA 2BI4A 1Z12A 1CZKA 4E03A 1IWOA 3ETQA 1QK4A 1N7HA 3FF1A 3P0JA 1ZOSA 1MCZA 3KQPA 1ZHFA 3OT1B 3WYCA 2OD7A 1ST2A 2XYGA 1EM8B 5LYYA 1VP3A 2OZKA 1RE1A 1SIWA 1HRDA 4LY0A 2KM1A 1ZH0A 2DFKB 1K4DC 2J33A 2NTYC 1WNSA 3EGVA 5DX1A 2NUTA 2UZ1A 1KYYA 1ZTEA 2V7XA 1U2GA 4EFEA 2FDCA 4S1VA 3HB4X 3L4JA 5CBPB 1I2ZA 1DAIA 1A0OA 1PFUA 4X6XA 3LY5A 2HIHA 4X1OA 2Y1LA 4Z7JA 1N2HA 1YDHA 3B52X 2EINB 4YCNA 4ZYXA 2PJRA 4BLTA 3K09A 4EPRA 5JBIA 3ZHUA 3DW3X 5ES3A 4WEQA 5EWJB 3FRJA 3TJTA 3TNLA 2I4MA 4LSWA 3ELUA 3KPVA 4GYJA 3GG2A 1PW5A 1ZC4A 5L3BA 1ZUD1 4NBSA 4WDQA 1FFTB 4HUQB 1WP4A 2CLFB 1BS1A 2GYWA 3WAGA 3UAOA 3ZCRA 4OGKA 1GQQA 3HYSA 2EZOA 4XCXA 4XCQA 1HF3A 4Z7NB 3D81A 1C7RA 3UW3A 3VX4A 4PSUA 2QVZX 2X3UA 3HGTA 3G80A 3CUYA 4P93A 5CVCA 1MOFA 4MV8A 5JALA 5HFJA 5TT1A 2VZEA 1GM9A 2C7QA 1CUCA 2GBPA 3L41A 4KEAA 3QIVA 4C2AA 3KLBA 1XL4A 4DR6B 3PXUA 3VNVA 4OFXA 4UNNA 5FP0A 2PYLA 1X7ZA 3LFTA 1QZ3A 5DHAA 2JVDA 1Q81W 4KQGA 4WECA 3RVPA 3GJ3A 2HWXA 4PU0A 2Q2WA 2FZ4A 1ZD3A 1OHHG 4KX3A 4NG4A 3A6GA 4P9OA 4AMZA 4G3XA 3VO2A 2OESA 4WN9B 3BAFA 2CV1A 5CG1A 3DMHA 3CINA 2AOXA 3FNRA 2RMKA 1AJEA 1I8TA 3BTUA 4IOLA 3AERB 3DAPA 1R74A 3K9HA 1ZIYA 1CRLA 5CBKA 5D87A 2FHSA 2XQIA 3FFWA 2MTBA 1Q50A 4M3NA 1JF8A 4AP5A 3CA8A 4YV1A 2MT9A 1Y5MA 1JKFA 3TQSA 5L40A 3RIEA 1ORIA 4GM0A 1PWZA 2AI1A 4MPJA 5TF4A 3EBOA 4QE3A 2P1ZA 2O2GA 3RFCA 5JXHA 1JW9B 4CJXA 4EFDA 3IAEA 1NZDA 4TQGA 1BVHA 1B74A 2WE7A 2YVAA 5SY4A 1RMQA 3D6TB 3K8ZA 2GCIA 3FDXA 4EFLA 5IDXA 5IJ0B 1GKKA 4UAVA 3GLVA 5C46F 1Y4SA 4P5EA 4X1IA 3G9TA 1UBCA 3HKEA 3E9MA 2KKSA 1WMDA 5K51A 1KMMA 1I4OA 3M7IA 4AJIA 1BKDR 3L0ZA 3BHJA 1KI6A 3SYNA 5JCOC 1TPYA 5HKKA 2QRZA 2EW1A 3C3TA 3BL5A 3ESQA 4R2JA 2XUGA 1HNXB 2FJPA 4HF7A 1WHSB 4PNEA 4HDNB 4MKZA 1SG0A 1OH8A 4G0MA 4Q37A 4OYLA 1YQEA 1Q92A 3K58A 2CBGA 4MW1A 5JYDA 2PD4A 1IBLB 3HJGA 4P08A 4XEUA 3RVZA 5ED0A 2VOEA 4GBED 2HBQA 3SXUB 4GX5A 1R1BA 2IW3A 2D5BA 1X94A 2OYCA 1VPDA 3ZY5A 3UW1A 2FYUH 1X9IA 2C4NA 1A9TA 4X20A 2B8JA 4V02A 3U4GA 3DMYA 4DHWA 3PFKA 4J1QA 1IN5A 4WCEV 1D09A 3KM0A 3QEOA 3B85A 1NH2D 3C5WP 4P54A 2OCCC 2Z98A 2EFCB 2GSDA 3W78A 3WL7A 2ODPA 5BNTA 1R3IC 1I0LA 4JH0A 3EN0A 4S35A 1BU8A 2WM2A 3DOUA 1MG1A 3MJRA 1MVNA 2C4HA 3GH3A 3T9AA 1WPQA 1L5WA 2OP1A 1C9MA 2V65A 4XIIA 3ZY4A 3E3LA 2DHCA 3BGIA 1W76A 4TX1A 5J2UA 2R6AA 1ZVJA 1DT5A 2JDIG 1WBBA 2ZB3A 4WDRA 1XTKA 4M21A 1SBTA 1DJQA 3EFOB 4PTLA 4PCUA 1V5GA 4C3UA 3S7ZA 1T1IA 3L9XA 3CH4B 3TR0A 3AM5A 2CLOB 5F1YA 1BKSB 2FYTA 2DJ5A 4ZYTA 3ZWYA 4F4CA 3HABA 5KPDA 1VFNA 1U1GA 4QUGA 1P8AA 1QWSA 3B89A 2HCFA 3ZZUA 1TUEB 2IYLD 2YBEA 4CLRA 4X9QA 3GQVA 3H7AA 2WJZB 4PR3A 3F97A 3ANXA 1XNQB 1M34B 2Q3JA 2FZWA 4O2AB 1KH2A 3DKKA 4KQFA 2H3EA 4MS7A 2QI9F 2ZAMA 1WXWA 1O9GA 4HLCA 4YJFA 4D7TA 1ZNXA 4TUYB 1R12A 5AK5A 1VARA 5DHQA 2JBAB 3EOAI 1L4YA 4XVRA 4PRKA 4QUDA 5C0OE 4U2CA 2DQ4A 5B1SA 1GL9B 4PX5A 4YPFA 5HG0A 2BFNA 1Q0RA 2I2WA 3G5UA 2IH4A 4YJDA 4PS0A 3PYXA 2XRYA 2NO1A 1XJWA 4CPDA 1J9GA 5F78A 2OGUA 1JWLA 3R7FA 3EBPA 5M59B 1OCOC 3T7IA 2AJCA 3NLLA 3P9QA 1KSFX 3Q11A 4NU6A 4ZO7A 1M5UA 4IJ6A 1U11A 1EUQA 2ECKA 2QMYA 4LF6B 3KSUA 3TJMA 2QT1A 5FBQB 1HT3A 3MTIA 3RNLA 1IQUA 4TT8A 3F9RA 5JD6A 3U13A 1VJCA 5KLVH 3GEDA 1MD9A 4LIPD 1WSBA 3BABA 4FHGA 1NFQA 2SKDA 1UBHS 2EXXA 1NFRA 1AMOA 3CE6A 3KQUA 1VPEA 4AZWA 2C07A 1PD1A 4XSVA 4NYIQ 5FLYA 1FXWA 1XQYA 2YMQA 2WNIA 4UFPA 4ZI7B 5JPDA 1A9QA 3KCYA 5D8DA 1TEHA 4RXUA 3X2SA 4QOIA 5REQB 1H8ED 2GWRA 3P2JA 1DKRA 3KLPX 4XJVA 3BB3A 3CU5A 3U37A 4IQ4A 4O8XA 4YCJA 3CGWA 1ZM9A 2C04A 4X84A 3H13A 4WFGA 2PRJA 2QMHA 1PG2A 3H2KA 1ABBA 1SRQA 3AQIA 4W5RA 4NTWA 4NZZA 3LGAA 3EIQA 4G0WA 4KXVA 2JA1A 3EPRA 1XQ6A 4F72A 3PGJA 4NQRA 3KJHA 2R44A 1M1YE 3NHBA 5C3MA 1UMBA 4UB8Z 1KEKA 3D6VA 4BP3A 4RYDA 1PFGA 1KC1A 1Z3AA 1GXSB 3DTYA 4K9OA 5BY2A 2WFMA 1SS3A 4D0SA 1PR2A 2ODQA 2CGOA 5J40A 2PI4A 2FZ5A 2A7WA 4COKA 3FVQA 3NHZA 1V9LA 5LBTA 5JWHA 1KY5A 4F12A 5AVTA 4EHJA 4MQEB 4JXZA 1YJAA 1ZHHA 2QG4A 5AKIA 4JVOA 4TL9A 1OBVA 1VE9A 4PLTA 1QK5A 3TKAA 3LBAA 4YRAA 4Z0TA 3NT2A 3N7AA 2AN5A 1T2UA 1KH1A 3HU5A 1KMHB 3WMEA 1F2UB 5B64A 2ZIGA 3SM3A 4HGNA 4FXPA 2EYQA 4BTVA 1E2IA 5L45A 4Y67A 1KJYA 3U7RA 3K8QA 1ZISA 4MZDA 1K7SN 1D8AA 4KR0A 5CG2A 2WSLA 5CW1A 4B6FA 5DBFA 2X5XA 1X3SA 3BBLA 1USUA 3WK5A 4X90A 1E1CA 2H1OA 4H17A 3PQ7A 4DV5O 2WILA 2N1BA 2IIBA 3OZFA 1PCXA 3MS4A 4F4FA 5TGDA 4P3PA 4JXEA 4KBYA 5KWSA 4BMXA 4OWPA 2W6OA 3CH6A 1Y4UA 1AJPA 1I0IA 4O25A 3WOVA 3QUCA 3RFFA 3ZUPA 1UM9A 3ZCXA 1T5DX 2POQX 3RIXA 1TQ4A 4HTFA 5KUKA 3PS9A 1N6NA 3ZQJA 2Y0BA 1IZ0A 3D5EA 4PLGA 4GKVA 4NH0A 3OFJA 1NBMD 4HC4A 1BE8A 4NOLA 3CJTA 1OLOA 1YBVA 2XCRB 3VI3B 4KE7A 1VQ2A 4G2NA 1VG0B 5I7WA 1NVMB 1PJ4A 4XOIA 4KPUA 1TYBE 4UZFA 2YW9A 1CVLA 1R27A 3KKMA 2CE7A 2WIDA 1YCDA 1US8B 3N2IA 4LWQA 4RHEA 3ZGNA 4FWIB 4G1CA 3QOYA 4MSDA 3GT3A 5ALFA 5F2EA 4Z7QB 2WINI 4RIIA 4DJJA 1J95A 1EK5A 3R66A 4UXNA 3UCSC 5HYVA 2Q0QA 3AZPA 1B2LA 4LZOA 4EPTA 1A8SA 1A9PA 4Y1RA 3AY7A 4RVGA 3HYRA 1C30B 2PQ2A 4DARA 4MQ4A 1VYTA 5D1NA 1DK1A 3NATA 3U16A 3I2JA 5F76A 4AAYA 2ZDGA 1U0SY 4ND4A 2QYOA 5ADUS 4DA7A 2V7GA 2ACVA 1BC5A 2C7PA 3DZ8A 2QVBA 3TIFA 2H57A 1LRLA 2NYTA 1KFJB 3A1CA 1MQSA 2IYVA 4BVAA 1VLHA 1FDTA 3CSDA 4HWTA 3E7FA 3GNTA 1PNOA 4I8IA 1U8TA 2JD1A 1Q43A 5FOUA 4YMUA 5AKXA 4XM1A 3PSAA 4C6HA 2OXRA 2XYPA 2HBRA 2X0RA 3M99B 1Z56C 3W4JA 1HQYE 4GOOD 4JLWA 2C7OA 4RSGA 5FIUA 1XWIA 5AMXA 2WVAA 5EBMC 3B2NA 3DFIA 2P68A 4Q16A 3B7WA 4XAQA 3MRTA 3TS1A 3LPMA 4U1RA 4A6XA 2SCUB 3RRJA 4KZKA 3HXQA 2V7BA 2R1TB 2PZKA 5EZYF 2PM8A 2OP0A 2B5VA 3OY7A 5CTJA 4OQZA 1BX3A 2CVZA 3DZFA 4D6XA 1UXGA 3BE6A 3S1AB 1KC3A 3CLUC 3RSZA 4RQAA 3CEHA 3VU9A 5EMHA 2QDOA 3W3AD 3DUWA 2OHFA 5JJ5A 3K9FC 4YJGA 4AG3A 3IE1A 1YJQA 2RAPA 3H65A 4B81A 5CYGA 2I87A 2HA3A 1P0PA 1W87A 4YRFA 2GEVA 5FXMA 5T7BA 3JRWA 3GUYA 3RARA 2X0LA 4BMYA 1Z17A 4ID9A 3W1EA 1D04A 4F3CA 4MXDA 1T5LA 3ZWKA 1DKNA 2IQIA 3T4PA 1RRCA 1H05A 4OVKA 1ZJ6A 2JJ2G 1Z16A 3RC7A 2V7PA 4HD8A 1HFWA 4FOPA 4RE5A 2ODTX 1AN9A 3OWHA 1UKYA 2A86A 5HUHA 5C18A 4A8TA 2WJJA 2ENUA 2F6RA 3UB2A 1FXVA 3ZBPA 3U4HA 2CLKB 5IVHA 3B20A 1K08A 1QKKA 3STTA 4UCVA 1DAMA 4ZGBA 4FCTA 1ODKA 2WKSA 3P97A 3LHSA 4YUWA 4GX0A 3ABOB 4RSRA 5FBZA 4MVJE 2Z83A 4NL4H 2B9ZA 2IS1A 2IM9A 1CY7A 2FY8A 2ZR7A 3RG8A 2SECE 4H7IA 3R6WA 1OX4B 2J9YB 13PKA 1EINA 4WBXC 2JFPA 4Y7DA 1BX1A 3DNMA 3SN6A 4RCZA 4P3XA 3CNEA 2G67A 1TK9A 2Z2ZA 2EQ5A 4I9QA 5LJLA 3JQ7B 3IV7A 2IZ6A 1MX3A 3EK2A 3X1MA 3HCWA 5EKXA 3OKPA 2P2ZA 4ZMBA 4GLOA 3DBHA 3OJEA 2OG2A 3TSCA 4CMIB 2FU5C 1QR2A 2DVMA 3LVFO 4OQNA 3TLCA 4XB2A 5IUNC 1XZMA 1DFIA 4HBZA 3I52A 1L4NA 1N1MA 4X3PA 3SZRA 2XOXA 3LLMA 1C7EA 4C7MA 4M6WB 4OQDA 3OKAA 2VF7A 1XFDA 1DNPA 2MDTA 1YSBA 1DIOB 2UZAA 3E9YA 3LAWA 1DRJA 2AHOA 2QMOA 1MZFA 1MLDA 3EEFA 5A0TA 3GPCA 2H4HA 1XJ0A 2QG9A 4E2XA 4MTXA 3COZA 4M1WA 2XI4A 4KZPA 4FBMA 4C30A 2H08A 4JJZA 1PWHA 5LR6A 5A9TA 4DV7O 3H87A 3LYUA 3QTBA 5F2VO 5HOQA 3RBXA 1DTWA 4DEVA 3E23A 4MR9A 2G38A 3T7KA 4DM3A 4KWTA 5SICE 4NNJA 4Z4CA 1D6NA 1NYTA 4M49A 3RS5A 3UM9A 3WHIA 3URKA 1OVMA 2WW8A 3TM4A 4C7OB 3A6LA 2AG0A 5JSFA 2NU9B 1NIPA 1PFWA 2ZM5A 4KIFA 1AKEA 1MEOA 1F51A 4KN9S 4P83A 3G2KA 4OLAA 2QTVA 1V11B 5JH7F 2RHOA 5CAEB 4WK4B 3V6LA 4BCBA 3KD3A 5D51S 1AURA 1QP8A 1ZSYA 3FUUA 3KSRA 1XRMA 4Q6WA 3SPGA 1E79G 3IP8A 1FVFA 2C8JA 3OG9A 3S55A 1NDHA 4EOGA 2I9KA 2IE0A 4D8WA 1A9YA 3TOZA 4RMNA 2I7XA 1XMOO 3OU2A 4AM8A 3MTDA 3ZJVA 3PF8A 1FB5A 5AJUA 3C3PA 2YW2A 4PYQA 2JRCA 2DY0A 3MG9A 3N86A 2LDXA 3FNQA 3WNZA 2HOQA 3GK3A 3AGPA 1Z82A 4NCHA 2GETA 2BE3A 3MINA 1TT5B 4X64O 3VFDA 1OMOA 1OGYA 1YB7A 3KE9A 3IC9A 1WO8A 1KU9A 3AG4B 5EMJA 5AD1A 3WLEA 2H63A 1TRKA 1ZMBA 2HX1A 4FW8A 5KPJA 1D2EA 4JUFA 2PUVA 1SIBE 3OTOO 4FM9A 2ZAGA 4AS3A 3CJQA 3VPCA 2CUNA 3I6BA 1ZCAA 1MZEA 4QWWA 1SVLA 3MJTA 2CBXA 2ZK7A 5AESA 2FPPB 1Z33A 2R8EA 4EQZA 1LPMA 3K35A 1WMAA 5K1ZA 3CR7A 1P2GA 1CCWA 1NUQA 1Z7BA 4NENB 2FMFA 2RH4A 1ZNWA 3K1AA 4HB0A 2IJHA 5FI1B 4OJTA 1QS0B 4NCJA 4P92A 3A4VA 1TT7A 2PL3A 3S0JA 1WXGA 2IGTA 4B4OA 1EPUA 1IJKA 2OBBA 2P2YA 1W0JG 2JCVA 4XPIB 1DADA 2X0DA 3FZNA 2KPOA 4W7HA 3RVYA 3WIOA 3HN7A 2H1WA 1TU4A 4CVNA 3ZEFB 1CW2B 1SC5B 4BVEA 1QGYA 4RPKA 1ENZA 2B2CA 5DTEA 1LK7A 4QVIA 1JALA 5CM9C 1N5MA 3HH8A 1DAHA 4DCUA 3TOVA 4YI3A 4R8SA 4O4LA 1KQOA 3GGPA 4UUOA 2XNDD 3DS8A 4FDAA 3C14C 1W52X 1DHTA 3I92A 1FOEB 1T0IA 4BJ1A 1DVRA 3QVMA 2ZBQA 3FNGA 1OAOA 3CIOA 2UUBO 4CM8A 3IVAA 2HJGA 4EGCB 1IWPB 4FFSA 3BIFA 3V7WA 4QYSA 1RTKA 4CF6A 2WTEA 3ZXYA 1RP1A 3LHFA 1SIUA 1QVRA 1U5CA 3PV0A 4UM7A 1P29A 2OGTA 2OZVA 1U7OA 4ER3A 5JU6A 2JAQA 2PSFA 3VDQA 3RK4A 3OZWA 5JAPA 2Z8ZA 4E33A 1E9AA 2XLBA 4KNWA 4WKNA 3M6VA 3TL3A 4KPGA 4YCMA 1JIVA 1XC7A 4PLPA 4G2KA 3MT9A 3NV9A 2BEJA 4ONEA 4RTNA 5IYZF 2GA8A 1IY0A 4W63A 1OV4A 4AXBA 1WAMA 2A92A 1RWVA 3S5UA 4MKXA 4RTOA 3KIPA 1WDMA 1GRQA 5EQDA 1O94C 2ARHA 3TLEA 4R81A 4Q3KA 3A3YA 4N48A 2VDWA 1AQYA 3E61A 4ABMA 5DLPA 3JCZA 1MUUA 3BE5A 1HDJA 4BGUA 1ZH2A 4K8XA 3UWDA 3C6QA 5SV2A 3F47A 1FMFA 1Z5GA 5TQVA 4C6SA 2D5IA 3F71A 1TZCA 2QAGA 4BIOA 2PBRA 2Z2XA 3LUFA 4B0PA 4IGEA 1JLMA 1I30A 1BROA 1S2MA 3MOSA 4Q9HA 3OPXA 4MV0A 2E1RA 3OQVA 5ALTA 2DHQA 4O2BF 1E62A 4PHCA 3X1XA 4LSMA 3WGUA 2ZSBA 2B1RA 3VHQA 3RVSA 3T3GA 3BICA 2C5GA 1SK8A 2SICE 1VBFA 4LF9B 4JIMA 1ECCA 4YC7A 1G6UA 1Y89A 1FIUA 4R9SA 3OOYA 1LUVA 3VDMA 3AIKA 5EOVA 3HFGA 4BFTA 1VZ3A 3MCWA 1KKCA 2O8CA 3DO6A 4LJ4A 1RWQA 3RHFA 3PTAA 5DZSA 3JAMA 1CP3A 2XKBA 1LF5A 4XKJA 4B3IA 4YT8A 1AA9A 1PJAA 1YDXA 2ASEA 621PA 3M33A 3PD0A 3VH3A 3N1UA 4OCNA 1Q0PA 2AMJA 4B3XA 2ZBPA 3RVOA 3QIAA 3CXCU 3UMRA 4F21A 2I54A 2CLSA 1U6IA 3C8MA 5C1PA 3S2GA 1C4OA 5J58A 1E1RD 1AQLA 4X1YA 5HNKA 3P32A 1Q3TA 4FFOA 1Y1PA 2HSEA 5E8JA 1ZX3A 1CJVC 2QMUA 4L1KA 3GEPA 3DPUA 3B5EA 4HUJA 3QX3A 1TMOA 1PL7A 2WLSA 1JB9A 2F59A 4WBSA 2XHEA 4C4TA 4ZO9A 1GAQA 1UT8A 4NYMR 3NUGA 4ERXA 2YS8A 1AV7A 2WZQA 5CDUA 4RJLA 1NJFA 4G28B 3ENWA 3SYRA 1GUBA 1TADA 5TRTA 2FSGA 2KLBA 1DINA 2JGNA 3OPQA 1CEXA 1IU9A 5FUBA 3LVRE 4IHKA 3NB0A 3QKUA 1GKLA 3NBZC 1CTQA 3DSQA 5CVVA 3E9ZA 3HCDA 1PZXA 3AVUA 5FT9A 2D0IA 3WICA 3BZWA 4QT0A 3M3HA 3AFIA 2IOHA 3R3WA 4YR9A 3J7AC 1NYRA 3KT6A 4AW9A 1AI7A 2FRDA 3HEMA 4N5MA 3FROA 5LB4A 1E98A 1O5OA 4ARCA 2HPAA 1WZEA 1Y3IA 3DLTA 5IKXA 3RVBA 4X8OA 4QIHA 1WJZA 3X2FA 3DZKA 3UPTA 3IALA 1HG1A 2CTPA 2HLDG 5MN6A 4J2TA 3SNKA 3GOHA 4QNNA 3PD7A 2C9BA 2NU6A 1JSXA 1Y6RA 3Q5EA 1IURA 4XR9A 5LQJA 4J49A 2XMGA 2QR3A 4B6PA 1GJRA 3JYPA 2AMFA 4K1LA 1AKUA 4JLUA 3RBVA 3RRXA 3LDCA 4DCMA 2B8TA 4CL3A 2HP8A 4QGFA 3HV0A 4DV1O 4FGKA 3OU7A 2ORED 3AYZB 2I8LA 1IDSA 4JAAA 1QNLA 4Q5IA 1FLNA 3O75A 1TZ2A 4RM2A 2RHTA 2GR9A 2R9AA 3CB4A 4F2GA 3AOEC 3JQGA 1XXHB 3G9ZA 4DA4A 2XOKD 4TQUS 1A71A 4JJ8A 1HK7A 3DFMA 2AG1A 4RV9A 1KTVA 2MYNA 3ZPCA 4N5DA 2ISQA 3LM8A 2WQ7A 2V5VA 4BKPA 3ILHA 2ZRGA 3ZV3A 5JQGF 3QRWA 1NSFA 5KYKA 2FPIA 1EYZA 1OXMA 4AT1A 4W9MC 3RUFA 1RFYA 3IKTA 3SQMA 3ABKC 2HJRA 1PQUA 4FGSA 1SUFA 2Y9PB 1P2DA 1I7QB 3FR7A 5FUVA 3KL2A 1P2TA 4NYJQ 5CITA 1ZAKA 1WXQA 3T35A 3G49A 3QYAA 3PR1A 3QNEA 5I51A 3HUDA 4MSWC 2XSZA 1PK7A 1COZA 2C1ZA 2FWAA 4PV1B 4X60A 5G2OA 5DB4A 5DM4A 1MJHA 4I5IA 4IR7A 3O6VA 2BV3A 4ZHSA 1P17A 2VNHA 5AW4A 2VXCA 2HT1A 4JT8A 3CZAA 3SC6A 4CF3A 4A8JC 4Q19A 3DOEA 4BJHB 3TKYA 2O2HA 4DNQA 4JTAB 3IIKA 4RFSB 4R9RA 3U0VA 3TJZA 4Q9AA 2RGXA 1WZCA 5LZ7A 2OPHA 1CJCA 1Q5OA 4ZJZA 1YJXA 4BB5A 2WU8A 2JEUA 4D98A 2GARA 3L1VA 1J2UA 3JQ8B 4RW0A 3ZE2B 3I45A 4B6GA 5COQA 1PO7A 4KKVA 1RABA 1R3UA 2PCLA 3FMGA 5IRCD 3CLRC 3AI3A 1K3TA 2J7KA 1U9YA 3VDRA 3CZCA 2BTEA 3LUCA 3F7YC 3ETEA 2B61A 4QFTA 4KVAA 4KPFC 4QJBA 3SKVA 4ESOA 2XGMA 4O29A 4N5IX 5ILOA 4RJ2A 4AO6A 1TA8A 4AY2A 3ET4A 1KORA 2JFNA 1DB3A 1UKBA 4AG5A 2X7JA 3GAFA 4ESEA 4G1VA 1GM8A 5IH3A 4YJHB 1C3OA 5F3WB 5T3YA 1SCNE 1Q0LA 2V6FA 2VOJA 2CYBA 1ADBA 1QHNA 1RYMA 3FPEA 1Y3CE 4FPPA 3R65A 3OTIA 4K8OA 2AZ0A 1WQ1R 2GPBA 3MWYW 2G9NA 3AUXA 5G53C 4QYIB 3VX8A 4IGAA 4BRUA 4GKAA 4J0DA 5I9BA 3ANLA 4UFOA 1VL8A 3I01M 2YJZA 2QG6A 4WK2B 3GMTA 1FYWA 4KXLA 3PXGA 3JD2A 4HSEA 1FQJA 2BEVA 5EY5B 2C78A 5E4FA 1HL3A 4UJ3A 2DKNA 4JGGA 3V4OA 3L7IA 1BJRE 1P1CA 3RASA 3CRNA 5G4KA 3L7DA 1YJCA 3T7EA 3MMPA 1L7BA 5C8XA 2OKCA 1PGQA 2A9QA 1Z13A 2FN9A 5B1EA 4TVSA 1EK6A 4Z9XA 5CB4A 2F23A 3IA2A 5FWDA 5CDFE 3FZQA 4H44B 1G8YA 2O2DA 3T1HO 1D0VA 1XZHA 1GH6A 2Q29A 1WA8A 1JAYA 1M6VB 2H1SA 1EWTA 3O4IA 4MDYA 5K0SA 2C5AA 4Q4AA 2M6LA 1ONSA 4J4TA 3MUOA 3ZE7A 2WHXA 4OA5A 2P5OA 3ZV5A 3DXFA 4N3CA 1IE3A 4Z8XA 3RRNA 1EFRA 4BP1A 2E4XA 1G60A 1WP7A 1ODFA 1QPBA 2JFVA 2XT0A 2VHZA 5D84A 4MIKA 1NJ6A 2PUEA 2O7SA 1JHVA 4M8LA 5JYEA 5IFLA 5BWOA 3OFNA 4YAIA 4EY4A 3QUAA 4YRGA 3K53A 2WPNA 1XNJA 3W1WA 1YHZA 1ZVQA 5EIAA 1KB9F 4R5MA 1A76A 1E92A 4LJSA 1IMJA 3I1IA 3A0BZ 3B7GA 2BTQB 3U2QA 1Z8DA 3DR3A 1W6RA 1OTYA 1E3JA 4WFEA 1O5IA 4F60A 5A2QN 1KQSU 4X97A 3IB3A 5FHRA 1S3SA 1IXSB 2BZ0A 4ZD5A 1F17A 2Q41A 4MGIR 1E2BA 1N8NA 4FJ2A 4GD3Q 3UHJA 1L6RA 2E4YA 1NIJA 5D3QA 2C88A 2KB0A 3HFSA 2IYZA 4CZ2A 3BJEA 2G06A 3UO3A 4E88A 3DMTC 1I7LA 4QWMA 3V1KA 1J21A 1Y1LA 1ZQ9A 4EI7A 4HUTA 4L73A 3RBZA 2YINC 3FMOB 3QW2A 4D92A 2LWIA 1SCUA 5T5QA 2A1UA 4BUZA 1N7JA 2BGWA 5D01A 1SETA