2IU3A

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
publication title Structure-based design, synthesis, evaluation, and crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
total genus 203
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2006-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2iu3A04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2iu3A01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu3A02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu3A03
1CE8A 3ZZMA 1WO8A 1EGHA 1B93A 1PL0A 1BXRA 2X8WA 4A1OA 2B1GA 1P4RA 1C3OA 2YVQA 1S8AA 1CS0A 1T36A 2B1IA 5H3LA 1M9NA 1C30A 4EHIA 1KEEA 1IK4A 2XW6A 1A9XA 1ZCZA 1PKXA 2IU3A 2IU0A 1THZA 1OZ0A 1VMDA 1JDBB 1M6VA 1S89A 1G8MA
chains in the Genus database with same CATH superfamily
1YKFA 2NACA 2DWOA 2BLNA 4XVRA 1R0BA 2GCGA 3FVQA 3PRJA 3CMCO 3IJ4A 1XTIA 2NQ8A 5F1PA 1LUAA 3PHHA 1QYWA 2W2XA 4GFDA 4HJXA 5FTJA 3PNPA 3C3MA 5L6LB 3EFFK 2TECE 3QVGB 4NEHB 2OBLA 3H8JA 1UWLA 4X6UA 3NXKA 4JBYA 2DX7A 4F85A 1R3JC 2JNWA 3GIWA 4H6WA 1YQTA 5JO0A 3TZKA 5C5CA 1VCNA 4JWTA 4A8PA 2O8EB 3MB8A 1NMZA 3HRHA 2NIPA 4W4TA 1YE8A 2L19A 2HB6A 1GGVA 3UGKA 1HDJA 3VQXA 9GPBA 2P0AA 3PC4A 4AROA 2WJZB 2FR8C 1L5NA 1KFBB 3EY4A 3TSOA 4CR6A 4JS0A 1VL0A 3KHSA 1D9XA 1U3DA 2JL1A 1UBCA 3RV4A 2ITCC 4N8SA 3GCDA 4BC1A 1IK6A 1O5TA 2PJZA 3ET4A 3GEDA 1FMTA 2FG6C 3HVKA 2B25A 2X5NA 2A0LA 3GJSA 4LEIA 5KNBA 1K5DA 1JJAA 1JDNA 4TKUB 5I8PA 1RJEA 1X2EA 3MIZA 3Q7TA 4M54A 3ILVA 4KRYA 1B06A 3G88A 3PPIA 4LC5A 2CHEA 2OENG 3SQMA 2PYJA 2LKDA 3ESQA 3I8XA 1PUIA 3OZXA 1GPDG 1ZXLA 1L4HA 2QTMA 1MHPA 2F67A 1HE2A 1FNNA 1VF6C 5FUYA 1H2MA 4I50A 1KVQA 2PQ6A 1ZCAA 3QJ5A 2NO9A 3U60B 1FAFA 4K1XA 2C7GA 3OF3A 1PJTA 4KH1A 3KXLA 2WAMA 1TM2A 3TETA 1L9KA 4QJ4A 1GDDA 1RXVA 2JI7A 3VJMA 5KOJB 1LTQA 1MORA 3L70H 2EIMC 3TM5A 5JR3A 1WCYA 5GTHZ 5AW8A 1HUQA 3LOPA 1EWVA 2J07A 1WUTA 3R74A 1DBSA 3FF4A 1XCOA 3RSOA 3FSGA 1ZFNA 4IMJB 4XQCA 1FYXA 5A6SA 1ZX1A 1U9YA 4AZSA 5TQVA 2WV7A 3KQVA 1H2RS 1F8YA 2OAEA 3D59A 3D8NA 4BDTA 5AUNB 5FPTA 2OK8A 2QVLA 3AM5A 3KIPA 4CIWA 1QCDA 3TJMA 2R96A 3AL0C 1BOOA 3L9XA 3NHMA 3E9MA 5I9TA 3NFRA 1X1DA 4U9UA 1VPLA 2J33A 2E87A 5CBPA 5JEEA 4RJIA 2DWCA 4AZ3B 1VQ7V 1OASA 4OQEA 2WJ4A 1JIXA 3KUKA 2R8EA 4B82A 1MFZA 2PGNA 4MUMA 3N8DA 1XNGA 5C9ZA 4MLDA 3PQFA 5IKXA 2CLMB 1WB5A 2X14A 2EOAA 4IIFA 4O8CA 3DO6A 3TYXA 3CU5A 1IFXA 4QFBA 1LK0A 2V3WA 4H4EA 1M73E 1N0UA 1P7PA 1YZGA 3WMRA 2OYCA 4C76A 2W2MA 1RYHA 4EI8A 1RRCA 2NZJA 4JJEA 1NM5C 4ZEOA 3VTAA 3DONA 4L5YA 3KD2A 4Q1CA 1P2TA 1ZMTA 1U8YA 5CH3A 2YJ4A 4BP9A 1FRNA 4QTUB 3GT7A 2GSDA 2DHRA 3K8QA 5CNMA 4UFNA 5DLYA 3M6MD 3IEUA 3IQDB 2BJWA 2EFGA 4M89A 3GGGA 2AZMA 5GJBA 4ER3A 1ZM4A 3OZWA 3IO5A 3JYOA 1EWKA 2ZUCA 3H1EA 5DHQA 5F64A 1D1TA 1E5DA 2RHWA 4MYTA 1N6LA 3JWPA 1QRDA 4ZEVA 1GGFA 3AUAA 4OX9O 1JT9A 3P27A 5A5FA 4MMZB 4LFCO 5L3BA 3CGGA 5JSUA 2WJIA 1K5QA 2JAXA 3DT8A 4OX9B 5AVXA 2QEXV 1T5SA 1DFIA 1U2PA 2GWHA 2AQ8A 2RFLA 2QLBA 1TTQB 1NR7A 1PZXA 1WMFA 1PJSA 3IV7A 2EX3A 3SDSA 3W8EA 2OCGA 1IXYA 1UK9A 4UMVA 1RP3B 2AG5A 3HABA 1QYIA 3F5DA 4LDNA 3I5XA 3C8DA 2ZB8A 4S3MA 1U1EA 4OD0A 5KSWB 5KYVA 2A86A 2EFHB 1QONA 4DJAA 5IUNC 4BFVA 3HY6A 3FFWA 4DCNA 1WKVA 4EHFA 1I4LD 2CVZA 2XQIA 1UBNA 2HXVA 2A0KA 1B8PA 3EARA 5L3QA 4DCGA 4BLQA 3DYVA 1AGYA 2R7MA 5GZ1A 3VPAA 1U7HA 3CRQA 3R5SA 3CCUV 2QA5A 3L4EA 3B12A 3E8FA 1E1KA 3VBBA 1EXWA 5DNYB 4C4RA 4AJ2A 3MLBA 4D9NA 2IDZA 1XAJA 4LOKA 5CCDA 3CCSV 3OUTA 2FN7A 3BXPA 4YJGA 4LYAA 5H83A 1EINA 3KSMA 1F6BA 2NO7A 3OJEA 1R5NA 4G9EA 2ILVA 5KTRA 3B4SA 3D36A 2Q8VA 1ROPA 4IXTA 3P20A 4HZIA 4Y0VA 3L8EA 1ZM2A 3X2QB 2ECQA 4ND8B 5LZ7A 1AS2A 4N7BA 4U3JA 3ZW9A 1Y8CA 5T4HA 2Z5VA 3VH2A 5LA6A 1E3EA 1C3EA 2AXPA 2AB0A 2ZT8A 4FMTA 1LSUA 1O5IA 4EI2A 1Q7GA 3HHPA 4I1YA 3P2MA 5GONB 2QGZA 2ET6A 3V4PB 2XRMA 4IF6A 2ZRBA 4ARCA 5C37A 2P9JA 5I9LA 1MLDA 2EC5A 3CW8X 3ESZA 5FR1A 3T3IA 2BGKA 1RFLA 2I4LA 3UM9A 1NJ6A 4EHIA 4M0LA 2XUJA 2QAGB 3UWPA 1WXFA 4BQQA 1ZL8B 4OX9Y 3QFTA 2QY9A 1ZJYA 4HTAA 4O2BB 3AR5A 4M87A 4UM8B 2XUFA 2APJA 4L4XA 3VX4A 3IT1A 4BQIA 1XNHA 2C0PA 2BFDA 1BN7A 3GO4A 2H00A 1KMHB 4DPMA 5KNLA 4KWTA 4H7KA 4X85A 1XROA 4D9CA 1RMTA 2WLLB 1PQUA 2BFBA 2NYTA 2AEFA 4IXWA 3PJEA 4Q9JA 4DMCA 5G0VA 2PR7A 3R41A 4P3KA 3QFRA 4KPGA 4BJ1A 4KO1S 4PO1A 4R7ZA 4JU8A 4EQZA 1XE3A 2FOXA 2A5DA 4D7TA 3JYHA 1R5BA 1U2GA 3CBGA 3L1HA 3BHPA 3O7WA 4FJ2A 3KVVA 5BWNA 2NN3C 3UMVA 3ABRB 2VEOA 1J99A 4YAEA 5JBQA 5KAPA 1VJRA 1XT6A 2WB4A 3C3WA 4KVFA 4XQGA 1MSDA 4RY9A 3A10A 1TEVA 3CJTA 3CN9A 5JH7B 2JVDA 5FB3A 1Z6QA 4P3XA 5KQRA 3WKCA 5J2UA 1IYZA 4FHZA 2AX3A 5KQPA 3LW8A 3ZR4B 4R3UC 3BL6A 1MOZA 3LMKA 1AZSC 4RQFA 5A0TA 2GHIA 5FPYA 1CDZA 2CD7A 1WUIS 1PN3A 1QXSA 4P4NA 3A9SA 4ZZ0A 3CNLA 4IDBA 1SRYA 1OF1A 3X44A 4RJLA 2TSYB 2Q73A 2DOKA 4RKFA 5T67A 1GYRA 3EIWA 3H5OA 1QKIA 1B0AA 4HRAA 1QU3A 4C7XA 1Z8NA 4ALKA 1UJ4A 3QVGA 4BQEA 1CNFA 2DQSA 1KQOA 3U7QB 1IOWA 4WASA 1VQ6V 1P81A 1GL6A 4D5GA 1D2NA 2IZ6A 4JI7O 1K6EA 4TSFA 4DLBA 3U4HA 1AB3A 1A69A 2H2FA 3BJRA 3UTDA 2VA8A 1JZQA 2JDIG 2CHGA 2PUHA 4BECA 1P7BA 4Z99A 2Z5LA 4HNSA 4EY7A 5FHRA 3AB7A 4TKVB 3H3FA 5YASA 5JVDF 4ED9A 2RCYA 4DR6O 3C1TA 2PVSA 3GVCA 2ZWOA 3KXIA 4I0XB 5FBKA 4MWSA 2VHTA 4ZTBA 4KYTA 5CB8A 1DI0A 5EUMA 2QLLA 3RF7A 4AILC 1YDGA 1M9NA 4L5BA 4YCNA 2PM8A 4XOIA 2VQ3A 2WAOA 3SD7A 4Z8XA 2CFTA 5KTNA 3HRIA 2ZYIA 4TKUA 2GFQA 1RNLA 1FQJA 2OV1A 3DOEA 5DHSA 1XJWA 5JARA 4F6EA 3CD6V 3T1CA 1YKGA 3I52A 1AO0A 2GM9A 3DE7X 5CNKA 5IDYA 4CR7A 4W8OA 2IXBA 3ZDAA 3HADA 1G7SA 2QKYA 4ECEA 5D8DA 4CU2A 3IMGA 1YHYA 4QYWA 2ORYA 2PV0A 2G71A 3K70D 1LH0A 1IBLB 3BM5A 5BV8A 2A7QA 3X1ZA 3EIUA 3Q15C 2IVFA 3GCWA 1Z5ZA 3EMVA 5B64A 1UKVY 1AD2A 1QU7A 5IKMA 2WTAA 5LQAA 3H5AA 1NKVA 5LGTA 1EQUA 4Q05A 3WLIA 5KOJA 5E95A 1KETA 2IYZA 5DSTA 5J5VA 4OIFA 2JCVA 4CEHB 3TIGA 2ZKLA 1V5WA 1KVSA 1TOAA 4FHDA 3NJ8A 5E7MA 4MSDA 4PPNA 5A9RA 1F38A 4XGRA 1G64A 2X8LA 2PBLA 3L6OO 4JJAA 2AYXA 3FIJA 1WXEA 1IE3A 2YXPX 2PUSA 2EQ5A 1SKVA 2V96A 1M56B 1NXQA 3S3WA 4GQBA 3WQRA 4B6QA 3V4OA 2AG1A 3ZS8C 1TO2E 3C6XA 4UHJA 1SKBA 1JG2A 1YK0A 5MN5A 3ESXA 3TDMA 2CHVA 2WY2D 4P7KA 3OPYI 2A3RA 3VNSA 2SBTA 1XG5A 4AZ3A 3QLUA 1S9HA 5JYEA 2QSZA 4HAZA 1DTOA 1ZD8A 2ZE8A 1ZH6A 1EFTA 3RTCA 5EG5A 2NPIA 4OXIA 4F7WA 5COBA 3GNSA 2ZYUX 3LPCA 4LXUA 5DH9A 2BEWB 2PTHA 1GPMA 3EUEA 4QIHA 4IZIA 4PAGA 1ZOLA 4YUVA 3O2SB 5K0ZA 3GFRA 1F8XA 3B1WA 3G6WA 3A4VA 1K8QA 4IQ8A 3NKVA 1K1EA 1CJSA 2QX6A 1TTTA 2NNUA 3P30A 2RIRA 3TVTA 2RHJA 4FC6A 2YMQA 4IQ0A 2HLDD 3ZU5A 4YALA 4TVSA 3KTAA 4RXUA 4U0JA 4H0LB 1QJ4A 2HSDA 2O3RA 1QGOA 2PGIA 1SUEA 4Q6BA 1C80A 3EBPA 3T3HA 3RIEA 2PMDA 1V1MB 2IHYA 1PYGA 2ZRPA 3HWWA 3C4VA 1TKAA 4GOND 2Y0CA 3FW1A 4LHYA 5LMNO 2LKCA 3GLKA 4LJ7A 2QVGA 2XF2A 3D31A 1PPJH 1ZUHA 4UATA 2X7JA 5GADl 2I54A 3OFNA 1QQAA 3P26A 2H2HA 2PW9A 4ZJUA 1T3ZA 2X5JO 3QSGA 4JP5A 3EXFB 3RRJA 3LCRA 4MYUA 3AHHA 1J2EA 3SKVA 3ZV4A 2QRHA 5KQLA 3QJYA 3CR8A 4KR0A 2IHNA 2O5CA 3RSHA 2IYNA 2P1ZA 3HG7A 3NRBA 2AFVA 1UXIA 5FA8A 2D0IA 5KAIZ 4QUIA 1XQYA 3W5AA 2PPLA 1LZKA 2F4VO 4MUAA 4QDTA 1SKQA 3U44B 1QTIA 4IL5A 5T3UA 2FWJA 5AW7A 5GINE 1LGYA 4X1OA 5DEIA 4FM1A 2D30A 1N78A 8GPBA 5HIIA 1X94A 3GW8A 2O20A 2REBA 3FH0A 5IJ0B 4CT4B 5JS6A 4LSZA 2EZ9A 2UXCO 1K5GA 3M0EA 4KRXA 3KJIA 4G63A 3WIBA 2WYUA 3WA6A 4NF2A 3MXTA 2I1QA 4CF5A 3A6ZA 1CETA 2AUTA 3EHBB 4AWXA 3OCJA 2N05A 4WCEV 4JP8A 2WMDA 5A05A 2ECPA 1NR5A 3ZDZB 4JQOA 1XZ8A 4M1EA 1QF6A 1KQNA 4GI1A 3D6AA 3W9UA 4IDGA 3PRYA 2MWMA 5GWXA 4ND8A 3CEMA 4NMMA 1B3BA 2Z6UA 4B44A 2VZ8A 1O97D 2B4QA 3ZMSA 1AB6A 5KNBH 2OCCB 2H4WA 1DLIA 1KZ7B 5IF3A 2A79B 3JQQA 4DS3A 5B4VA 1XRSB 1Y5NA 1LBHA 3ZY2A 2WPDA 1Y89A 1YSBA 1T8RA 3IOBA 4RA9B 2HSEA 5LDHA 5GONA 4OQNA 3UMRA 3IUYA 4JV5O 4TTRA 3ADBA 2XXBA 4PQTA 1I5XA 3BK2A 2VQ6A 2XX3A 3T4DA 4JV5B 2WTUA 3QEJA 1Z37A 2HEPA 3ASNB 5KJCA 3DLPX 5F2VO 3ZVNA 1U9IA 2QZSA 2B34A 3AY6A 2QAGA 1CQXA 4CV0A 1ZL8A 2QGFA 2V4MA 2AN5A 4G37A 4WVLA 4MPTA 3UZUA 3VOSA 4M36A 4DC1A 1VBNA 3T4PA 2PKXA 4R1MA 4A0QA 3IE1A 4BO6A 4O2BA 1TE2A 4IAOA 2PKEA 2Z3HA 2GJ9A 3ZNOA 2B1IA 3D6TB 2NZ2A 4R2WA 4MQMA 1WN7A 2G9UA 2J6IA 1JHAA 1KMHA 4NR1A 5DBHX 5AVTA 2IIVA 4FFDA 1K92A 3ZXSA 2GT1A 1HE1C 4BXOA 3WGMA 1CUGA 2VYNA 3ANXA 1ECBA 3DFIA 1LLUA 3QKSA 4N5IX 4DLWA 1NPYA 4QX6A 3ABZA 4KSCA 2AI3A 3F9IA 2GSWA 3ULKA 3WJ7A 4PTZA 4E2WA 4MGHA 3COVA 3GFFA 1XQ1A 1DUIA 2Q28A 2XA9A 2Z1NA 1PJZA 1T6XA 2LCQA 4UE3S 4LWQA 4CODB 1V95A 3JQDA 3HEMA 1ZTEA 2PZFA 3EGWA 4UDNA 4B8YA 4HGYA 2OMKA 5IJWA 4ICIA 4UUPA 2JLXA 4HQKA 1TEHA 1S7GA 5ITSA 2AR9A 1Q2UA 4MVCA 5FPQA 4D9MA 1NW7A 5CA0B 5I5GA 2XCSB 2C98A 1N2JA 4XTRA 1I94B 3BMNA 4ESHA 5CX1B 1OH7A 4PPYA 4YTEA 3TXYA 5JH7A 2FVXA 3F1LA 1IN1A 2ZIOA 4I3GA 1SHZA 4BASA 4MV5A 5B1DA 5DBGA 4CMAA 2EGUA 1KZ1A 3OJ0A 3WKAA 3CCRV 3A1SA 5CIQA 4OFZA 3KT3A 4F11A 4JF3A 4PHFA 4C2BA 1P7CA 1BEUB 3PLRA 3IMKA 2IS4A 2YZ2A 1YA8A 1HDXA 4QPNA 4LYYA 2VT6A 2GILA 3T1OA 1IURA 1SB8A 1UC9A 1U5AA 2A84A 1HQYE 2XMRA 4ZYUA 1HFKA 4BJ6A 2OHJA 3H84A 4X6YA 5C34B 2XCTB 2FR6A 3DO5A 3O4FA 1KJ9A 1UH5A 4DLUA 5AVWA 3W4KA 2RHMA 5LD2B 2Z2JA 3U7QA 1NTKH 1DRVA 5M34A 3EX8A 2P2GA 5A4KA 2IUFA 3FGNA 2OO5A 4TMYA 1BJTA 3SZGA 3I9FA 3SS7X 1L7XA 1ALNA 4MWZA 3TTTA 1M1ZA 4N5NA 3GNLA 4TKVA 4D6TH 4PZZA 4PI0A 2RK3A 4CLOA 2JAHA 4DCCA 2JVJA 1XTUA 2W2PA 1VE1A 2H2AA 1MC8A 4I0XA 3HWRA 1XL6A 2QRNA 4MI6A 2VZ9A 4DLZA 4PBSA 4QBHA 1R0CA 4ME6A 1JIVA 3BXGA 4NSNA 3EHDA 2FZ5A 3KELA 3DVQX 1E6EA 4KYUA 1IXBA 1TAEA 4C7OA 3C3TA 4ZQFA 3GAMA 3FZEA 1E6KA 2JI4A 3B60A 3WGGA 4KH0A 4G5XA 4QWMA 2Q5ZA 4IS2A 3GQBB 1GCAA 5JYCA 5HOQA 2WF5A 4UREA 1TQ6A 3OP4A 4A36A 1CPYA 3EFBA 4IOLA 5DGDA 1LBTA 3D1VA 5AHKA 2RGAA 4LX0A 3JSNA 1JTKA 1NV8A 1N9KA 5I3CA 1BDMA 3E8XA 4RD2A 3DMFA 4NS4A 3AG4C 2MR5A 3PX2A 3OQOA 2EFYA 1PI3A 4C6RA 2IDJA 4JLMA 1UUFA 3O74A 4MR9B 2RAFA 4K87A 3M8KA 4ROTA 3IPCA 3U7RA 2CHQA 1L5VA 2HU2A 3GEBA 1F9AA 2YC2C 2AZ0A 3I58A 5TJHA 3DTYA 4AX8A 4ID9A 4W82A 1G4HA 2IJKA 3RTDA 4LK2A 5H0IA 3PT9A 1R8XA 1O6BA 3Q6NA 1ML3A 1XZGA 3Q11A 4P4SB 3DLAA 3R6WA 5TLSA 2VLBA 4TGLA 4OMFG 1AXGA 2DCUA 3TOSA 4MSQA 1OXXK 4DBZA 3J80N 3LSYA 2VTVA 1GRCA 3RBZA 4YV2A 2G76A 3PV0A 4FCWA 4MVYA 2OHGA 3NRJA 3M89A 1DPFA 2GEFA 2GN1A 2X0RA 3EZFA 1ETHA 4QD3A 2IEYA 2C5EA 4MUFA 3VQYA 5BSKA 1Z2NX 2EP8A 1GAJA 1RLMA 3WAJA 5KMGB 3WRXA 1F3LA 1R27A 4BBPA 5KUKA 1Z4PX 1I8TA 3O1HB 5ETJA 1IVNA 4GH5A 4B6GA 2VK2A 3FPFA 2JGRA 3CZQA 4M38A 4TSFG 5AM2A 1GRRA 2BEWA 2AJ8A 4N3BA 1EFAA 2BOBC 4X54A 3STZC 2FGKA 3OH8A 3GWGA 4YJ2F 3DTTA 4XW2A 5KVCA 3E7FA 3ORHA 2OB1A 1P61B 1VHTA 4WPGA 5D87A 4PS1A 1JAHA 1B41A 3CNOA 3LIIA 5EA2A 3M3PA 1E3MA 3ONDA 1V55B 2NVWA 2HJ9A 4R98A 3T1TA 4YDRA 5DM6V 3A4NA 3IBSA 2Q7DA 3O9MA 4A1FA 2WLTA 3PJFA 2PEZA 2PI4A 4J1TC 1TYEB 4IDHA 5JEDA 2KWIA 1N2EA 3G2KA 4Z86A 2FWNA 2AFHE 3RM3A 1NSTA 4HFMA 2ZB2A 1V1MA 4A8TA 3N6RA 4KFCA 2GPJA 1MMMA 4DA0A 3VO1A 3NX4A 4UVEA 5D1NA 3I8OA 2WSSA 4ND2A 1JALA 4B8ZA 1A3CA 1SUCA 3WX0A 5HKAA 4B74A 2P8JA 4L5CA 1RAIA 3FCOA 2JK5C 1H2AS 2B4YA 5AW2A 2KS6A 2KJQA 4I3FA 3UAZA 2IHUA 4LSGA 3OQVA 5LOVB 4HUTA 5JCOC 2EJCA 4WXEA 3EXFA 4LQDA 2C31A 3H4VA 1Y74B 2A5FA 3U17A 4UCWA 4FD2A 5HGXA 2P2NA 5JV5A 3BK7A 1P33A 2AFHB 2Y8EA 3JSAA 3UNXA 2IHBA 5IM5A 5EWMB 2HNAA 2B82A 3DH1A 3LQRA 4I9WA 5EIEA 4QOIA 2P4KA 3N28A 3FZQA 2EIHA 5LZ2A 2EKQA 4MMYB 1N4AA 4I9NA 1PFGA 1ULHA 3SZ3A 3U44A 1XRMA 2E85A 1OKKD 1I3MA 4URXR 1CJCA 3T7EA 3JPYA 3LX6A 4WN3A 4MKHA 1QZ3A 4JZ2A 1RHMA 3DTVB 4XCQA 2X0NA 2Q69A 3TIIA 2VYQA 3R3VA 5IJ0A 1IQ0A 2N1MA 3EJWA 2OLKA 3M1YA 3A27A 3FUCA 2HT6A 4AJ1A 4REMA 3BA1A 1RLUA 1SIWA 4LZPA 4B7KA 2VZEA 2GRAA 1E2NA 3PTLA 5A3JA 4N8EA 4MCIA 1DKNA 1MH1A 1QHEA 4W9NA 1VLLA 3JZIA 4YLGA 3KQWA 1FFYA 2UZ3A 3EOZA 2WHXA 3EZ7A 3SSNA 1GP2A 2JK0A 5FHQA 2FV8A 3E1SA 4EUKA 2FPMA 3SBDA 4RM3A 2DCMA 3RTGA 3SR4A 4RVHA 4EJ0A 1NDHA 4XFKA 2N42A 2EFDB 3TQRA 1WUKS 3ASVA 4KLCA 3QK7A 2WAYA 1YEWA 3N27A 1GLNA 4GZ5A 4PYJA 2B4AA 4G8CA 2O2YA 2AF3C 1M34B 1J1UA 3S28A 2EYQA 3ETLA 3TZEA 5CCXA 2NO6A 1P3DA 2H5JA 1JR4A 1G9SA 4RA9A 3GFPA 4JL8A 2OGSA 3KR0A 1FKAO 2XQJA 2P3LA 1P8AA 4L3WA 1PV2A 2GB4A 4KR9A 1XVIA 1RKXA 4W7IA 2PGAA 2QDXA 2ZZNA 1SQXH 1GXSB 2Q0AA 4UAVA 2B8TA 2PBFA 3A9CA 4RTNA 3SQXA 3IEKA 1LRKA 3HXPA 2RN9A 3AOGA 3P52A 4D43A 3TUJC 4V0OA 3GA5A 2JH3A 1FUKA 4WBSA 1Y8QA 1JT2A 5EVCA 4MQBA 1SK9A 3OFNG 3UMGA 4GIBA 1RSOA 2VL7A 3EAFA 1VRWA 3M49A 4MAFA 3IKJA 4HKTA 2BBSA 2X9GA 2JAOA 3NBUA 1RM5A 3L8YA 3UTCA 4YPFA 3AF5A 4OHYA 4QQ8A 2VDWB 1W4RA 4PYIA 4PZDA 1FLAA 3NWEA 3OBIA 3DCJA 1RCTE 5FO1A 1X6VA 1CR2A 4M22A 2LGQA 3DBLA 1UXHA 5LP1A 2YWHA 4GVXA 4N76A 4PV7A 3UVEA 1Q1GA 5CFOA 3IULA 4W5RA 2RGNC 2WM9B 4ZI7B 2RG7A 1A77A 2AHOA 3G71V 4OCMB 2FA9A 1ORIA 5SY9A 3E83A 3R8CA 1IBSA 1WL8A 3M81A 2WNIA 4ARUA 4E31A 3QHQA 2OKCA 5EXDA 4A82A 1XZNA 4BQOA 2P79A 4AQYB 3WKBA 4HL6A 4HQ6A 1J9ZA 4JI1B 4MHTA 2XPCA 4TTVA 3G7SA 2GYWA 4UFPA 2X7RB 5FWDA 5I6DA 2B9EA 1QPGA 5DWQA 2QT9A 3TKYA 1I4WA 2JFXA 1CS0B 5CA0A 2Q68A 3M9LA 2J7PD 1SBYA 2OC9A 5CX1A 5FWAA 6ADHA 1SVSA 3WRYC 2XUIA 3R40A 3V1MA 3G3EA 1LC0A 5JS2A 3RANA 4QGSA 3ND8A 1PGNA 1ZD1A 2PMKA 2YNMD 1WPRA 2BMWA 2PH7A 3D6JA 8ABPA 4XDYA 3STHA 4FLZA 4P82A 1SGWA 3QX3A 1M8FA 3IDZA 3MGBA 4OYHA 3QI7A 1BEZA 1G66A 3U40A 3V33A 3QPVA 1Q74A 2HVWA 4HX5A 1XDSA 5C8XA 3ABMB 4RD1A 2WD7A 2Q5FA 3T7TA 4F72A 1Z4LA 5AW6A 5FWXB 1CUZA 4TTIA 1F5SA 4CIXA 2PZBA 4YRIA 4YWJA 1RZVA 2A5YB 3WNDA 5EY5B 5ADHA 2WPDG 1GQYA 2HCRA 4PA6A 2X8AA 4QFMA 3HCCA 3QNMA 4UXJA 1NZJA 2FPOA 5C5DA 1JU9A 2WUFA 2VHVA 2R8YA 4AKIA 1B6SA 3IA7A 1IIBA 3BERA 1IY8A 1GZVA 3TW0A 3OOJA 3C7TA 3WYFA 4P38A 1N75A 1UMKA 2GLTA 4Z53A 1YVPA 1DC7A 5I8ZA 4EL0A 1U7PA 3D8SA 5ECYA 1VFNA 4K8OA 1QK4A 4DGQA 4PLPA 5DNVA 2JIMA 4RO2A 1OXKB 1XEXB 4EJFA 1K86A 2BKUA 4AS2A 2JCYA 2V98A 4XDHA 5KTTA 3MJDA 4DXHA 4I08A 1PV1A 2P75A 4WKOA 3CT4A 1I2ZA 3ZY5A 3GQBA 4JBLA 5JAPA 1KSGA 2ZBRA 4AMBA 4II3A 4BJHB 5I7EA 2A59A 4BFUA 3PHCA 3IKVA 3ZWKA 1I01A 3LLMA 2JGJA 3NASA 4XCXA 4WE3A 3DE4X 5J58A 1Q44A 1BWQA 1ZK1A 4PYMA 2H52A 3TVYA 2WF7A 2VP2A 3EEBA 1OYVA 2O48X 5TNXA 4X7MA 3I9V1 1G98A 2B7LA 2ZGVA 2QRLA 4BKRA 1R8JA 4RKQA 5IYBO 1UKYA 4MR9A 4FVMA 3K32A 2FUNB 1SVNA 1YMVA 1O03A 4CKXA 3JYQA 4NATA 3DCIA 5TF0A 2CMDA 3VSCA 2V65A 1E7YA 4LYFA 2CJXA 1UADA 1W52X 2DPLA 4J76A 4OQ4A 3BWBA 5ICSA 3L8ZA 4Y6QA 4XDZA 5D3QA 2Q4EA 4XASA 2BRUC 4L8GA 3U09A 4BNNA 3TKAA 4BLPA 3DHNA 3MS4A 3VOBA 2ETNA 3PGKA 4RJ2A 1AF7A 4N0EA 4BRUA 4H59A 3VPDA 3OOEA 3HFRA 1DG3A 3SX0A 3TTVA 4XX0B 4AU1A 4M0EA 2PG3A 4PV1B 3NDJA 5F35A 4I2NA 1KWKA 5H5JA 1OV6A 2RK6A 5IBQA 3S8EA 4PM4A 3W8FA 4LYHA 1ECGA 3JQ7B 1DG1G 5GY7A 5KMGA 3NTXA 2UUCO 3NTOA 3FSJX 1UWVA 3Q6MA 1MB2A 1Q0RA 1VLVA 2Q7HA 4ZQBA 3TUIC 2FZGA 3LK7A 1N8SA 2UUCB 4K40A 2GM5A 5EESA 5LR6A 3G2OA 1JSXA 5H80A 4ZHQB 4DMHA 4OPAA 2Q2OA 2RHHA 4DCPA 3A6HA 1R9NA 4OKIA 4N8DA 5B4UA 5DN9A 2QRVB 3DL2A 3QLVA 4LHEA 3VV3A 2AS0A 1HRDA 2WWVD 2CXQA 2XT0A 3U7GA 5CFPA 4A73A 4A5OA 4Y2XA 4EI9A 5DGHA 4QTZA 3AVVA 3FX7A 1Z47A 2EF1A 1FJXA 2XIJA 3NW9A 4DMFA 1YASA 4EO9A 4W8GA 3X1WA 4KI7A 5B30A 4QDJA 5H16A 1VJGA 4UHCA 3EVBA 4QGGA 4CLHA 4MA0A 4NS1A 1TRKA 1KJNA 1E79D 2NV2B 1ZOPA 3QTLA 4EBFA 3PQ8A 5BN4B 3HXTA 4C4YA 1GL9B 3RRNA 3AP1A 3CNNA 2OP1A 4BP1A 4CLEA 5LOVA 3ZDBA 1OIWA 1Y74A 1THGA 5KPDA 4X89A 2G7MC 1GM7A 4X0EA 3WKEA 4D9GA 1QO9A 4R54A 1GZ6A 2GR9A 2VJKA 1NH2B 4A0SA 2AFHA 3U56A 4G0PA 1GH6A 3W04A 2ZUUA 2FG5A 5KSPA 3PI6A 5TVKA 4GE3A 1RWPA 2WFAA 5EHXA 4GF5A 1GNSA 1PUJA 3OQNA 4HLDA 4HQRA 2HQRA 3TJTA 1IN8A 4YRPA 1D2DA 2ZCJA 1ZUQA 2B78A 4MS4B 4KXFB 4UEKA 1NNEA 2W6JD 1EPUA 5IKOA 1R5XA 2QZJA 1MRSA 1H9BA 1T43A 3L0PA 4WXHA 3HS3A 1RQRA 3B1XA 5EJ8A 1FY2A 4UHHA 2VOJA 2FMIA 1RJDA 3DKVA 3J80A 3DTVA 1R3KC 4JLKA 4PZPA 1X14A 5I9NA 4RVCA 3U5ZB 4O8XB 4C21A 3GN1A 1QYXA 4BV9A 1VKJA 1LRJA 1L0LH 3KQQA 3QV1A 9ABPA 1VB5A 4TWIA 4FE4A 4CZ2A 1YHNA 4X8HA 5EUBA 1RI1A 2J0QA 1QYVA 3U16A 3FNRA 4JLUA 4PLCA 4RACA 2HXGA 5C4MA 4Q24A 1HYBA 3V8VA 1XD9A 1N7IA 2FJPA 9LDTA 4L87A 1T0BA 5AHWA 1CUSA 3RIGA 4KN6A 2LBPA 2JGDA 3INYA 2JRLA 5ISMA 3IIIA 1HC7A 4F2PA 2BJVA 3ZD9A 4XH9B 3WADA 1CC1S 4D9HA 2JS3A 3JSLA 1MOFA 1M34A 3ROEA 5CLJA 3ICOA 4FLXA 2Z5FA 1ISIA 1IEXA 1EXNA 1YJNV 3NEAA 1MFPA 4DV1O 3PU6A 3G5LA 2R00A 1P2FA 2PRIA 3VU9B 2EJTA 2VEDA 3GZTB 2FW7A 1B2LA 4Q3DA 2IF2A 4AY6A 4DV1B 3IJRA 5M59B 1YE3A 5KQSA 1DELA 4M0DA 3MK31 5KDLA 1GXSA 3STWA 1WS6A 2WSSG 2HADA 2I7DA 4KGVA 5KHLB 5AIBA 4OM8A 4E2ZA 3TLAA 2VDQB 1RWXA 3GLUA 1IWPB 3QKWA 1XMSA 1KKLA 1WF6A 3ETHA 1EG7A 4NCKA 1A71A 1E2BA 3OD5A 4D96A 4WOKA 1NFFA 3U62A 1TZCA 1CYEA 3NU1A 1KZGB 3R77A 2EX1A 5ALXA 4HB3A 5GMOA 5A7GA 4NOLA 2ZI9A 4OLBA 2VDWA 5IARA 3C1OA 3P4YA 2Z9DA 3JRWA 1TF5A 3LI2A 1T24A 1AI5A 4CDNA 2C94A 5I7SA 4CMEC 5MF6A 3VVBA 5KHKA 4ZI7A 4K3AA 4OCMA 5JFGA 3NLLA 3E3LA 3QKTA 2ECKA 2WHEA 1BX3A 3WMXA 2VVTA 2H2DA 4X8OA 1QGZA 4UBOA 2PZKA 3AH8A 3K30A 1J20A 4FGZA 2HF2A 4DQUA 2ID9A 4J07A 4OTZA 3R4CA 1W2HA 5IVDA 4LW8A 1HTBA 3F7YC 5K0TA 2QQEA 2P06A 1MB3A 2FR5A 1PWHA 4KE7A 3LBAA 3F7OA 2ODMA 3GLTA 1CS0A 4BNYA 4LNAA 1C4KA 2DY0A 3NONA 3CJRA 3MJFA 3AFMA 4NU0A 4N0QA 2ZBDA 2WTNA 1JUDA 4QGPA 4HQOA 2WTXA 3HZZA 4YIOA 3KYJB 4AXXA 4OGGA 2V4UA 3IFXA 3O5AA 1R4NB 4LZOA 3JQ9C 4PYQA 2XGJA 3NIGB 2QM3A 5AM0A 2BOVA 1O9GA 1AF2A 1YF3A 2JGEA 3URKA 3HKEB 2TRSB 4JLSA 2R7KA 3ERCA 4L28A 2FFBA 3UQZA 5J4YA 5FWXA 2VDPB 4WMLA 2PYIA 2UXDB 5K45A 5DCWA 3KWFA 1IUOA 1E9DA 2IYEA 3S1SA 2VPXA 4AMVA 1QK3A 2IU3A 2ZDQA 3R0JA 3WTCA 4EMUA 5JW6A 4B6FA 3ZRWB 4AJLA 3H2YA 1GZSA 2C3OA 2BKLA 5CXXA 3OQMA 5LKRA 4Q1VA 2OCHA 3SIWA 4HEA6 3GAFA 4FWTA 3P2YA 5SYNA 1GTL1 3W1EA 2YN2A 2NQ2C 3ZD7A 1YS9A 4XGKA 3AEUB 5JSQA 3GA7A 4G84A 5TGTA 2ZNIA 2X2EA 2WQ6A 5DVZA 2QMZA 1ORRA 3R5KA 2XQGA 2VF5X 1UPBA 4Y1GA 3IDSA 3RRZA 4OGKA 1SG9A 1XEXA 4BMZA 1AILA 4TSRA 3O8OB 3Q3CA 1NLYA 3I5AA 2VDVE 1SCNE 4HYEA 2X40A 1WOMA 3V4SA 4N6NA 4DDMA 3RK1A 2Y66A 4YUYA 3BE8A 3LPDA 1VBKA 4W8HA 1LQ2A 2Q27A 2AJCA 2BMEA 4MMXB 4TLDA 3EPHA 2MSKA 4L9AA 1VMAA 5I45A 2IUSA 3EGDB 3D4IA 3FNFA 2IUUA 1NG9A 3FKSD 4DCTA 3R5FA 4KNWA 5I7UA 2CXTA 4IKEA 1RHKA 2QAJA 5K1PA 1JWBB 3FROA 3RU9A 1QZUA 4FLTA 4BKPA 3MT8A 2Y0PA 3CX4A 2EG5A 4JYZA 5HKKA 4F3CA 2Q2VA 1I5YA 4YFVA 4EP1A 2A5GA 4G86A 2O7VA 2YHUA 1EN6A 3SFVA 2GM4A 1AKUA 4XWGA 4GL2A 1A2BA 4DNQA 3ISTA 2I1LA 2J59A 1XAGA 2Q4DA 1PS8A 3AK2A 4C06A 2QXUA 4BO8A 5HUQA 1KZ6A 1H4QA 4Y2YA 2PRJA 1YR1A 1W48A 3LUKA 2P2SA 2J30A 3AYXB 4REQA 3L3BA 1JRLA 1OB2A 5AESA 1E64A 5KNDA 4XX0A 4MITA 2O2GA 2X9VA 1F17A 3E15A 2EJVA 1UX1A 1B6GA 5JY6A 3ZCXA 1OZ0A 2V03A 1R5OA 3UMCA 3JQ7A 4QUDA 3VC2A 2JAWA 2CVOA 4Z0NA 3TRHA 4O5AA 1GM8A 3IHKA 4KIFA 3AU8A 4EH1A 5G4KB 2XZOA 1XMXA 5T4EA 5IBRA 1N2CB 1WCXA 3SLRA 1QFMA 4N4AA 3T52A 1GFIA 1RYDA 1WLYA 4HQLA 3VYUB 4UVCA 4RFLA 5TMBA 1T5HX 4WKPA 1AS3A 4HV4A 3WL5A 2ZBVA 3EFHA 4ZHQA 3N0RA 4DANA 1CEEA 2R5WA 3W2EA 1J25A 1ZN2A 1T9GS 2HSZA 2XZDA 3KNZA 1R37A 1WSDA 1YJ8A 1TIBA 4Y67A 2G1JA 1MB9A 2QRVA 2AYZA 4ZN6A 2O8EA 3SHFA 3V1YA 1Y1KE 1TCAA 2N47A 2VJQA 4YAUA 1ZCJA 1E8DA 1Z0FA 2GOYA 1L7DA 1R15A 3LRXA 1UODA 3OY7A 2CGNA 2BOCC 2NLJC 1J97A 2D06A 4DUZB 1EA7A 2C4MA 3GEHA 1YS1X 1S8OA 4EYEA 5H81A 3WYBA 1G20B 2PL5A 5DYWA 1TIYA 1K7XB 1EBBA 3QTBA 1JF8A 3N2YA 1DINA 4FLEA 4G1CA 2YV4A 1A9XB 3L6RA 4IGEA 5I7FA 2KQUA 1K27A 4W4LA 2R6R1 1SELA 3TRKA 1L5WA 1HDCA 3PQ2A 2ZRFA 1EBOA 4IH9A 4YRDA 3OMXA 2GZRA 1L5QA 3I30X 4HNUA 1YO6A 1IBLO 2R11A 1PX2A 4MDHA 3THRA 3BL8A 1R0XA 4U0KA 3MWYW 2G7ZA 3K03A 3U7FB 4YRGA 3WG7C 3L6CA 4ZYXA 4BCBA 1XGKA 1KPHA 1USVA 3Q4HB 4UXIA 1MMFB 5BSTA 1AGRA 1CZUA 2ETVA 2C9MA 3EXG2 4MS4A 1LW6E 3O2NA 1BXZA 1GAEO 2C42A 3FTQA 3OA2A 4B85A 2ZJFA 3OT5A 4GCZA 3WIVA 2FSHA 1KORA 2CEKA 1EWQA 3FYDA 4G65A 1MNQA 5T41A 3N6VA 4O8XA 1DB3A 1N2HA 1RVDA 4YMWA 3I4CA 5LSAA 1M57B 2H1IA 4K9DA 2GN2A 1XLTC 4PA3A 4GMXA 5BORA 2ZUBA 4WY5A 3UGTA 1LR1A 1SRRA 1KEEB 1J07A 4U7FA 2AC7A 1RYFA 2IPMA 2PRKA 1CY4A 2IOYA 4MVXA 2OXIA 3A3NA 4FZJA 2EV9A 5CM9C 3WSTA 4GX0A 1ODTC 1UCFA 5IBCA 3DJYA 4D5EA 4I9GA 4PFQA 4XIYA 4IG4A 5FX2A 5JXGA 4WXYB 3AOEA 3UT0A 4OAQA 3WOHA 1VHQA 1BE0A 3VZBA 1RXIA 4O1MA 4QVKA 3HCNA 5L6MB 1SIUA 4URHA 4JOSA 2EJWA 1TUGA 3RSCA 2P90A 2YY7A 3D9QX 1H2KA 4ALMA 2C00A 4V0LA 1TTPB 4IIVA 3W6NA 2E18A 5G0UA 4Z9FA 3VU9A 2D1SA 1EDEA 1PVDA 5DLEA 3WWCA 3WZMA 4WY8A 1ETUA 4LN1A 3SPCA 1U94A 2GQ0A 1YVEI 1NUUA 1L0BA 3MJ4A 3UJ6A 5KYXB 1MX5A 3G02A 1UDXA 3DZHA 3R0ZA 3OEEA 3R65A 1IHOA 1EB9A 3NMUF 3DXYA 3TCUA 2H08A 3WB2A 4EJ2A 4FK8A 2CHUA 5A4JA 1JX6A 2ZIWB 2VLIA 4JGIA 2VJCA 4FNOA 3OWHA 1KSHA 1NY6A 3SZOA 4XUCA 2GAAA 1IY1A 2YVLA 4RY8A 5ECDA 4LZWA 3BCHA 3Q72A 2QT0A 1K4DC 1IZ7A 1D2GA 1Z9BA 2QTWB 3BAAA 1F0YA 5TR9A 2HWXA 5IP5A 3FPAA 1CIPA 1GARA 4V1CB 2GTIA 2GN4A 4HAMA 4Q6GA 2BELA 3LHDA 4GEGA 4C0WA 4RQAA 4ENUA 3RUDA 1Z08A 1D6JA 4JMPA 4EW2A 2AW5A 3FHOA 3A28A 2VT2A 4Q7LA 5JLAA 4KRGA 3WNVA 2VBCA 4B6JA 5I5EA 4RE5A 3W2TA 5L3RA 5KB3A 2WLJA 2Z6QA 5F4ZA 5D00A 3AX6A 1DKLA 1WA8B 4HVLA 1DEHA 3H04A 2I6SA 4RNCA 2NYVA 3P19A 1B7GO 3UG7A 1JYSA 1H4TA 1MZEA 3B8NA 2VP4A 5BT8A 1Y5IA 1P29A 1OX4B 3QVWA 4WTOA 4YP0A 4DADA 3D6UA 2K7ZA 3C85A 4TXJA 2O3KA 3BDIA 3ZEIA 5IZ4A 5AH0A 3L7IA 1YI1A 4D0NA 2NV0A 4WFEA 3BFRA 3DP7A 1OFTA 1EUYA 3C7KA 4LOIA 3KCYA 4GP7A 4HDKB 1RWOA 4YMUA 5C1OA 2WLIB 5C8ZA 4WDRA 2PANA 1SQFA 2PWPA 1C1XB 4Q37A 1P4JA 1E3SA 1R4NA 3G82C 5CCBA 2CNWD 4EGFA 3W78A 4BWGA 3ZNNA 1XA3A 3M70A 4YMSA 1WE2A 4KN5A 2IYFA 1CUHA 3HKEA 3KP1A 4K9NA 2CFIA 2UVQA 4LMPA 4Y18A 2EWWA 1FSGA 1G8KA 4N7RA 5TQ2B 4O0LA 2QJRA 1JVSA 4J9YB 4L7VA 2DBYA 1BVHA 4M37A 2EZOA 3LTNC 2XAUA 3G0OA 3PKZA 3D3QA 1MD9A 1UMDB 2DECA 4UXHA 1ZSPA 4C20A 2POCA 4Y2VA 5KJEA 4DCVA 1IM2A 3NIBA 4KQKA 3ABLB 3ZRWA 1UWCA 5DASA 1AE1A 5E0KB 5IDWA 2AHYA 2B2CA 4V0NA 3SSOA 4ZYVA 3AKZA 2EEZA 1YJ5A 4Q0MA 2GJSA 1DKQA 5CIYA 2AGAA 1K88A 3RVRA 4Z1OA 4OI0A 2VDMB 3RJ5A 4L8YA 3F7TA 1XZCA 1COWD 4LDAA 3DKIA 4ZT6A 4A2CA 3OIGA 5JVDB 3EB9A 1YDWA 1XKTA 2B94A 1J8DA 4RAIA 1ORVA 4M1ZA 1EVQA 3VNRA 3LD9A 4NCIA 5AM5A 1Q0TA 1QO0A 3O8OA 2QMEA 4FSXA 4NCAA 4ETMA 3SYOA 4MS1B 5DB4A 3OO1A 3N58A 3UAOA 2PRZA 4Z1MD 5HILA 2DKNA 4ENVA 1XJQA 1XMJA 5B1BB 4HI0E 1B15A 1WZCA 1QOPB 2VDRB 3G89A 4MW4A 1I13A 1VIYA 2Y0EA 1XILA 1QNLA 5ALHA 5JAQA 3VZSA 1PIWA 1C9NA 2XDYA 5F7JA 1FTYA 2GASA 1WEHA 3UOAB 4LECA 1YDMA 3EGDA 4L4ZA 1P4RA 1OFGA 3K70C 2WLLA 1EGAA 2OCYC 5L53A 1CWUA 3VI3B 2QTNA 1RWQA 2QUZA 1F8GA 4FMPA 1KGDA 1VHJA 4FZ0A 2CVFA 1X1AA 1KSFX 1COZA 1Z25A 4U4AA 2HWYA 2QB5A 3BIJA 3ASZA 5J2TF 4BAZA 3BHIA 3FRHA 5HPYB 1HDGO 3F0TA 3GG9A 2VXCA 1X1QA 1SZPA 4NI5A 1K3TA 3WGLA 2WKPA 5A1JA 3BKXA 4KPFC 3LPMA 4BIUA 1VL2A 3LDEA 3V7FA 3DNPA 3H2KA 3D6FA 4W6ZA 4Y2RA 2ZXWB 2O7RA 1B0ZA 3UQ8A 3OVMA 2XSZA 1I94O 4Q4HB 3KHTA 3ASUA 3ET5A 1DRWA 2M1XA 3H3JA 4QKQA 3G85A 1JJIA 2I67A 4LYDA 3T2MA 3SS9X 2XVYA 1U65A 3MG9A 4FZRA 4EOGA 3TFOA 2BL4A 3UAVA 2K4MA 4QICA 4MICA 3RZVA 3LGAA 2EKPA 1PEKE 1OCRB 4FKZA 5LQKA 4CU5A 4XYBA 1XZLA 1ZNZA 4UQLA 4BE4A 5BR1A 5EC2C 1XNJA 2C7VA 3SIPA 4TVOA 4V3BA 3E9EA 4GMKA 3AUFA 4G41A 2FQYA 2PH1A 2I3DA 3NGMA 1U7DA 2HA0A 1TFUA 3QBDA 2DR2A 5FR2A 5G4KA 1QLEC 3HJBA 1N2CA 3S2GA 2AMYA 1E2IA 1KYQA 4BCDA 1NXOA 2ZWIA 3LZ6A 2WSLA 3B6MA 3EZLA 4CMCA 5D5HA 4YWHA 2ETXA 4PWZA 1L5KA 4CL0A 1GIAA 2PXCA 3QO5A 2BEVB 2UZ0A 5IABA 3AY7A 4JUCA 1JBQA 2ZYVX 3Q7RA 4CQJA 1CDOA 1Q95A 3PFCA 2YHIB 2Q3LA 3KALA 3BSSA 3Q7QA 5HSGA 1XR3A 1ULBA 4FZVA 4NNPA 3I42A 3M6UA 1V7CA 4GUAA 3DMYA 3MUEA 1LVUA 1PYDA 4YUWA 4FGLA 5G3ZA 1JHUA 4HO1X 1XRJA 1CP9A 1TZBA 4TMFA 2VF8A 1G20A 5D6OA 5LPNA 4CTMA 5LBQA 4AJ9A 1Q83A 2CXOA 5FPSA 1L5ZA 2J4FA 3FGPA 4E5YA 1XELA 1A9XA 4NCXA 4YP5A 1VMDA 3A36A 3FYIB 4LOHA 4F9TA 3A58B 1VEWA 1U2EA 1NRJB 1EAMA 3G49A 1E2JA 3MRTA 2RARA 5LL6Y 1EUDB 1M2HA 2P41A 2ILTA 4MLZA 1IZ0A 3ELUA 1KJZA 3OX3A 3R5HA 4GD3Q 5D5PA 3BQ9A 5GVRA 3CUSA 1ATIA 4KLZA 1UK7A 3WLEA 4XSHA 4ZOCA 3LDAA 3BGVA 2YZKA 1L5SA 1ODFA 2WWHA 1V8BA 2BKEA 3Q4HA 4HZGA 1HT2E 2F1IA 3EBLA 4WNCA 5H82A 4ASUD 3JQRA 4IKOA 1DAEA 1JLSA 2VRNA 3RUAA 3KHUA 1JHQA 4HLUA 2XVMA 1EVZA 3AR9A 2B8WA 4OBWA 1RWKA 4CEHA 1QBZA 1YRBA 1G9XA 1MN6A 2EFJA 4LFAO 2R87A 5CXUA 1M8GA 4HRVA 5HRUA 1Y80A 1R6NA 4BQPA 4IS3A 4LFAB 2WOJA 3HGMA 4P54A 4GYCB 5BV1A 3O8DA 3WB1A 2XW6A 1Y7IA 2INGX 4RC9A 3SMQA 2UYYA 2EGGA 2FRDC 4FEEA 3SSAA 1KEEA 5FH9A 2GN6A 5AIAA 3F8WA 3NC1C 1TUEB 2ZKOA 3S99A 1HDYA 5T64A 4F1KA 5JC1A 1WB6A 2JKVA 2HCTA 3A31A 1V25A 3MJTA 1O97C 2CNBA 1HI9A 4G67A 1FW6A 4DAOA 2ZUSA 3KSBC 2Q2WA 4IHQA 3BWYA 4QUJA 1U4NA 3DDWA 3RVDA 3O8LA 3NEJA 3N8GA 1JS1X 3WFIA 4ZCIA 2SNIE 4H1WA 3FCSB 4B7EA 5CLGA 5K4AA 3ZBQA 1UP4A 2J46A 4ZT7A 4FW9A 4IFEA 3ZE8A 1DJLA 1X2BA 3P9CA 4QJIA 5KYXA 5B58T 2ORED 1LCIA 2R4QA 3VH1A 1SD5A 2WVAA 3AL2A 3O4HA 4BFLA 1M83A 1FDVA 1XC7A 4MVJI 3CMAV 4J29A 4UU0A 3NH9A 3TMAA 4AUEA 1AM4D 2H8KA 2PA3A 5JMPA 2EERA 1RQPA 1C7ZA 4X71A 4Q48A 4HY3A 3TOVA 3CVXA 3CT6A 3OIUA 2BWJA 2IWRA 3HC7A 5CMUA 4CS2A 4TV9F 4V1CA 2ZT9B 4P7BA 4HB2A 2FEPA 1CBUA 3U80A 3CSDA 3I9NA 2RQ6A 1J5XA 3GZNB 3TXSA 3MFQA 5JDIC 3E03A 2WJ3A 2YHSA 3P9NA 1BAPA 5KNDH 1U0BB 5DMXA 4EL5A 3FYUC 3U0VA 1ND5A 2E4WA 1T9CA 4UCTA 1Z75A 2IYUA 3P1JA 1WA8A 5IVHA 1CCWA 4IJ5A 2FWIA 1XDUA 1OX4A 2MCFA 3FTDA 3QUQA 2WIBA 3F67A 4CRWB 5MN4A 3PXUA 2WSYB 2ZTLA 1NUSA 1JJVA 4KDFA 2ZR8A 3DR5A 3R6TA 3AWIA 3U7EB 4EHJA 5I9IA 3TS1A 5LYYA 3FUUA 3R0IA 4UZFA 1N2GA 2C5AA 3GDFA 5CT5A 5LL6P 4PLFA 4HDKA 5DK6A 2V7VA 4NNOA 2DGDA 1T2EA 1GPKA 4V2IA 2WLIA 1M34E 1J8FA 3ZMTA 1C1XA 3OTHA 4BO4A 1ZGCA 3VGPA 3RGGA 2VUTA 3DAHA 5ADWA 4HP8A 1EYZA 4EZBA 2ZBPA 3MMNA 5AUQA 1C3JA 4GGOA 3EQ7A 1MXFA 1GYQA 5ICFA 3DAOA 2NW6A 2VQDA 1WXQA 5TQ2A 5CB6A 2J9YB 1CZOA 5A04A 1NE7A 3K2QA 1HTTA 2PXXA 2X0JA 1JXOA 4C05A 5JS8A 2YASA 3HUEA 2B1JA 1ZD2P 3PVCA 3Q1KA 3J7AU 2VP0A 2ZSJA 4B4DA 1LV8A 4ILKA 2PTMA 4UUJC 2B61A 2SKEA 4S1VA 3ZGYA 1A2QA 3MUOA 2OHOA 5K8IA 1K9VF 3QEOA 3VOUA 4DW1A 1C4OA 4GI5A 3FDZB 3G5UA 1GAQA 1P6UA 3AEXA 1PT5A 3TW4A 1DIGA 3FWKA 3OEEG 4DM3A 2DBZA 5WRFA 4BLVA 1JU3A 4BGIA 2FPRA 2HA5A 2QTLA 1K7YA 2HT1A 1AGNA 4Q34A 3AJRA 3L1KA 5IM4F 1KP2A 1HXHA 5JJ5A 2QL9A 1R3IC 4US1R 4DYLA 5JVDA 3PNYA 1HOTA 4ZIBA 1IJKA 1FFDA 2CLKB 3BH0A 1R9GA 4RTLA 2HM7A 3SBGA 3AZPA 2WHQA 3K0BA 4L6AA 4QPJC 4OA8A 1ZA2A 1RQ7A 4RKEA 3P2EA 2LGWA 3GH3A 3QF7A 4BB5A 1W30A 3A0UA 4YBRA 1I7SB 4Q20A 4MS1A 2PUAA 5AVOA 4QIWF 5EKUA 2Q07A 2V7EA 4J7CA 4A23A 1US8B 2LDBA 1M8JA 1GGJA 2ICAA 4HEQA 3DCYA 1U3WA 3Q8KA 1FXKB 3BEDA 2Q1SA 4HDOB 4DPKA 4P9EA 2LQTA 4WWHA 3FTNA 5EQFA 1W93A 1BXKA 1N8TA 3BA9A 3U6BA 2GH1A 1I3LA 3EIQA 3HB0A 1F06A 1PFQA 4G3XA 4X9XA 2VWQA 5H6QA 2GFHA 2BBOA 4P34A 1Y9JA 4GDMA 1IM8A 4FOTA 3ZD8A 4AQYO 4PICA 1QHSA 2BFEB 4JI1O 1F2DA 4ZWNA 4ON9A 2WLNA 4CM9D 4K86A 3BJIC 2QI9F 4E33A 2RCVA 1VQOV 2J9FB 5LC1A 3MOSA 4JHXA 1JLLB 1L4YA 3H11B 5I7RA 3UMFA 4FFRA 4Q4HA 1PBNA 1DPGA 2VDOB 3M5DA 1N5RA 1ZUNB 2BI7A 2HMVA 3CR3C 2BMFA 3RFFA 2COUA 3QYPA 3PWTA 1ZXXA 4QDXA 3WL3A 3WP1B 2WBLC 1LFDB 1WZNA 4WXPA 2W2LA 1AROP 5ELLA 2QTGA 4YCMA 3HYRA 3AJAA 1ILEA 2VF2A 5A06A 1FQKA 2I03A 3HXLA 4FLUA 3O21A 2F3RA 2LE0A 1W6UA 3PDJA 2E55A 2QM4A 4IY1A 3AG3B 4JPRA 4G28B 1ZOSA 1RXUA 2FOIA 4P7GA 4EHAA 3J7AC 3IAAA 2WUGA 1SVKA 1S5PA 5BYAA 3VR5D 5H02A 1XDWA 3V00A 2LIPA 2GCEA 1JBEA 3LVBA 2XUOA 1V3TA 1P5RA 1CIJA 4H4DA 2HAEA 3QX7A 4RHUA 1J8MF 3ST7A 2BEVA 3NYIA 2IIPA 4YJ2B 3CEIA 4QHTA 2Q9CA 5FI5A 1YACA 1GSAA 2I2WA 3WDLA 3U3MA 3QVVA 2H2WA 5C4GB 2D5AA 2RPZA 2YHIA 2Y69B 4F92B 2F1MA 4BEVA 2Q7EA 1T0IA 1XD2B 1BD3A 3RJMA 1PK9A 3FBGA 2WIFA 1ZIYA 3HXKA 2PUJA 1HX7A 1BS1A 3SVLA 2IPAB 4CNBA 2DOSA 2C5HA 2A35A 4KO4S 3ZGNA 2X2OA 3F5WC 3ZMZA 2QLCA 4FYMA 4ESVA 1H4SA 2C7RA 3TRDA 4UNIA 3X1YA 3OOYA 1XA0A 2IQIA 4OY3A 4HX9A 2YJ3A 3EQ9A 5BSWA 2QTOA 3LA8A 1JPVA 4PAQA 3CH6A 3PGXA 3ZWYA 1KERA 1A8UA 3OCXA 4MV8A 3TF5A 4KAJA 1NE2A 1ST3A 1EKXA 2QLTA 1IN4A 3GPBA 4WZAE 4TV9B 5TMDA 3MW8A 1Z74A 2ZIZA 4LXXA 4Q9NA 1TYDE 3TUZC 3EMBA 5B6PA 1EUDA 2OBNA 3K9NA 3ZRSA 2D2VA 5DHRA 3O8RA 3IC9A 2XNDA 1T4GA 1KMIZ 4FFPA 1X77A 2P1DA 3DWEX 2VT7A 5L95A 4IUDS 1PWZA 4GI3A 3EC7A 3AR6A 4ITRC 3C24A 3CRZA 1I2BA 5LHHA 3QXXA 3IGFA 1WF3A 3FMIA 3BY6A 4EA8A 4EEKA 2A9HA 5CLHA 2J7KA 4BIMA 4WZAB 1QR6A 2ANCA 1IDN1 4IDQA 5C52B 3SDLA 1E6WA 3IT0A 4F4HA 2HMYB 3PEYA 2XGOA 2AF4C 3CZCA 2LUOA 4P4SA 4WJKB 3DEKA 3DOOA 1BRMA 5LM3A 4DT1B 3UCSC 1THTA 5I7VA 1RPTA 1SXGA 2FZEA 3AEZA 4QM6A 1XQ6A 3T7RA 1NVPB 4RY0A 2JIOA 4BFYA 1RYMA 3BORA 4MUXA 1ISHA 2DTEA 3UAXA 3V2IA 4JENA 1ADGA 1M2JA 5A4IS 4NU6A 1TUEA 3RLFA 1PP9H 2BM0A 4GICA 2Q5IA 3QP9A 2CFSA 4OVKA 2G04A 4DRYA 5E9AA 1KZ9A 1NNSA 5HF5A 4GWLA 4P3PA 4QYIB 3SPGA 3VSAA 3TDKA 5BVGB 1DBRA 1UAGA 2V97A 3C87A 4ZDWA 2GV9A 2W5UA 3QTTA 3A3KA 1NN5A 2HPAA 3LO5A 2IUYA 1RYZA 2CKDA 2ZNRA 1GOTA 4N3NA 2CGOA 1M1YE 1OZGA 3GWKC 2ATXA 5SY4A 2BE7A 1LA2A 3B9RA 4WH0A 1N5MA 2ZJ8A 3VTFA 4CNQA 3TE6A 1ZJ4A 3IEVA 3IUBA 4LR3A 4W7SA 4KJXA 5DP2A 3V9AA 3AETB 1Y5LA 1W8IA 4I4TF 2HGZA 3K20A 1I7QB 3IC7A 2BFNA 4EARA 1N57A 3ZE7A 3MRSA 1BQZA 3ELYA 4NHOA 2W0SA 3AM4A 2PIAA 3AUXA 2M32A 2JJ1D 2PX3A 4QBTA 1DS6A 4MS3B 3ICVA 2WZQA 4LSWA 3H9GA 4D97A 2OORC 2WLKA 3KPYA 4C5CA 1XRLA 2ZRCA 3EA0A 3GJXC 4TM7A 3H0EA 3NC0C 1Q3KA 1KEPA 3SJAC 1C7IA 4CG2A 1M1YB 5D5QA 3OM8A 2I3ZA 3IVAA 1NWCA 4U2BA 5ALNA 2I99A 3KR9A 3PX3A 3FOEC 3TN7A 5IC6A 2WG2A 5JRZA 1X1RA 3P9IA 3I9V6 1DBWA 4L0MA 4V2UA 2BMDA 3K9BA 3FB8C 2FR1A 3H83A 3GZNA 3ICXA 5E79Z 1W5SA 3I5DA 5EWMA 3K5LA 5JMWA 4A0GA 3NCHA 4UM9D 2M2IA 2OG2A 2V54A 1JKJB 1MZVA 3NHYA 1DJMA 2H1RA 2CDAA 2ON6A 3NHSA 2QG9A 5T4BA 4HLNA 4AN4A 4YQZA 3E84A 1CIVA 2NSDA 2ZI4A 4FM9A 3H6KA 1VRCA 4Z7JA 2BTQB 1Q50A 1G4AE 4IGGA 4F5EA 2Q41A 1QR9A 2A0XA 1ESEA 3DFFA 1T91A 2DUWA 1M8KA 1NQUA 4BMPB 3WGYA 5AOAA 3U5TA 3UV7A 4WSOA 3D7RA 4KUMA 1E2QA 5KTKA 5D7NA 4P2ZA 3GUZA 5HDQA 3ITDA 4DV7O 3K4QA 2YNMC 3AR7A 1G8SA 1T9KA 3ZI4A 2GTSA 2XD4A 2C99A 1ORTA 2W00A 3U4QB 4CS4A 2JEXA 3T7CA 3D7SA 1XEFA 3I9OA 2BE9A 4DV7B 3R8FA 4W5OA 3ZOKA 1U80A 3LHFA 4V39A 3R8XA 3FYEB 4ZO8A 1A72A 1G21E 2JEOA 2ZW9A 4ZCMA 4QEKA 1UBMS 3QOWA 1F8FA 4MIKA 2Z0AA 3PGLA 3R5JA 4XX1A 2AXEA 4YR9A 3K08A 1W25A 5BW8A 4LZZA 1YITV 2Y1FA 4HDCA 1KNXA 1PS9A 3L4KA 2AK3A 2OM2A 3MQFA 3O3MB 3TD9A 1FD9A 4IFBA 4INOA 3K5WA 2AZXA 2ZJYA 1E4YA 4AMZA 4XE5A 4OMUA 3E18A 3GI1A 3FDZA 4FYHA 1MT0A 2X2PA 1XCPA 2IDMA 4XB2A 1GM9A 1G21B 2QTCA 3DMTC 2AK2A 5GP1A 4K1RA 2XXJA 4PDVA 2GBOA 5JCJD 3CO5A 3VM6A 1VC2A 1KVUA 4G23A 4FFNA 3QUSA 2WQ7A 1T34A 3SPXA 4A5SA 2D2XA 3O1JC 3PNVA 5EXSA 3WL6A 2AJLI 1S3SA 5IPFA 5HFNA 3TNDA 2WWYA 1XOUA 1ZIOA 1TCCA 3H9EO 4ZK6A 4MWTA 3K2IA 1YU6A 4Q4LA 2ODQA 5FPOA 4I19A 5DRYA 5TMEA 4LY0A 2BGTA 1US8A 5E3JA 2Q5LA 1W0CA 4IJQA 2GZ3A 3QX9A 1OROA 2A0UA 1E5VA 3PFKA 3RF6A 5DHAA 3ZBUA 1FXKA 1XU9A 5CG2A 2H7XA 2EFCB 1C7EA 1PRYA 5ER6A 3SMVA 2I9KA 1GKFA 1OCCC 1UPXA 5BSUA 2RI0A 1ULUA 2LFSA 2F48A 3B1KA 1T8WA 1N6OA 3C3DA 1ORHA 4JDPA 1XCJA 3HB5X 1LDEA 2JGAA 3OIFA 3MAJA 1QR8A 2BFEA 1P1JA 2WP8J 3AZQA 2KYRA 3IOCA 3HZHA 2QP4A 2PGJA 4IVNA 3KHKA 3QU2A 3RHTA 3USES 3GJ5A 3NH6A 2JZCA 3V55A 2O2SA 2J9FA 1JLLA 1V26A 1AUPA 3H11A 4DQXA 1YH3A 5FYQA 1ZUNA 2XAJA 2B7CA 3TDNA 4CF6A 1H69A 1IUKA 4I5IA 4KXMA 4ABTA 2CLSA 4FYJA 3K53A 1HYHA 2QWNB 3AVPA 4PN7A 2W48A 2A57A 4XFJA 2AT1A 1U5CA 3H5WA 2X76A 4AG6A 4HNTA 2GO1A 2CSXA 3MGAA 1E5LA 1GILA 1BC5A 3ZHUA 2PS0A 3HTXA 1TI7A 2JGLA 1VQPV 1Z2OX 2Q4TA 2D3OW 2VWPA 2BI8A 2XLCA 2LR0A 4OQPA 1PFVA 4HVTA 1PAUA 3U3OA 3K0DA 2OTCA 1YZLA 3CZMA 4KE9A 2UXDO 4QATA 4KR2A 1OX7A 2HMAA 2MMCA 3PHJA 3H17A 4M7PA 1RC0A 1CNEA 3F7MA 1JW9B 3KOZA 5M04A 4FFBB 1Y6ZA 2WLMA 2XCRB 3B70A 2J3KA 4E6EA 4U2KA 1SQBH 5FQNA 3ZIAA 2GCIA 4B08A 5LQMA 5IT5A 4QUAA 2Z4RA 3GUVA 4BYMA 2RHGB 4YJ2A 2XGSA 3GEMA 5CFZA 1XLWA 3NKLA 3M8AA 4QL3A 2QTHA 5G0WA 4Z4HA 1YGPA 2MYPA 1JG6A 3ANTA 4RJJA 4DNFA 3PUKA 1XD2A 2J48A 2Z3JA 2D5NA 3BWDD 1ZUWA 3TVDA 3ZC3A 4ENRA 4H6PA 2AMFA 1DADA 3C8UA 3ABOB 4ZYWA 1MEOA 2JI9A 1TJNA 3BE5A 1XPOA 3FHTA 3OMLA 4GSLA 2YXHA 4CFSA 1J8QA 1ILWA 1EWYA 3TIVA 4KL1A 2CLLB 2HDNB 2IOFA 2WA2A 4GPAA 2OL4A 1N6PA 3FFAA 1FFBA 2FCRA 1YZHA 2O7SA 4Q1DA 2VYCA 3UKMA 1PR9A 4AG5A 3O94A 1YIAA 2X9NA 2DWDC 4BVKA 1BFDA 5KA5A 2LTAA 1GRQA 1T2UA 4WINA 4YIPA 4NAUA 2O2IA 2BFMA 3B53X 2C20A 3MTJA 1EP2B 1V16B 3KAJA 1MQAA 3PFIA 4G1UC 4ZI5A 3TZCA 5JPCA 1P0IA 3P2JA 3WL8A 1NSFA 4C0XA 1UZMA 3K1ZA 2D5CA 4FDUA 3SEAA 2W6IG 1XHZA 5JJBA 5TX7A 3JAWB 2WEKA 5E1OA 3U1TA 4P3NA 1T8PA 4JT8A 4DIKA 2XGGA 4RKRA 5DI3B 3AI3A 3W5DA 1DTSA 3PENA 1KK3A 2WM8A 3HCFA 1SXJB 2X5XA 1MZPA 4B3HA 5ABPA 1I32A 4JI4O 3QPDA 4WZAA 2BFWA 1T29A 3H1FA 4GRAA 4X66O 3H8VA 5HIKA 4FMBB 2J0VA 3B8FA 4JI4B 4UHDA 5C1IA 2XYPA 3VGJA 3IYLW 3WGQA 4X66B 1H3EA 1N2CE 1USGA 3PQEA 1USWA 4Z7OB 1M72A 3KZVA 1NURA 2JI8A 4DT1A 2AG0A 2XJ4A 3V1LA 4EBBA 1XLUA 3VC1A 3OE7A 4BMOB 3S7ZA 1P5JA 1SC1A 3CUKA 2F4NA 4PNHA 2FPGB 2PVPA 4W4KA 4NOMA 2F3PA 3AKYA 1H42A 1WU7A 4JQZA 3G0CA 4GBGA 3GP5A 5BYKA 4P08A 3VXKA 1PJLA 3EW7A 5EE3A 4FPPA 2GCOB 1QQ7A 1T36B 3LFTA 3RSGA 4QYIA 2CW5A 4YRTA 3K1AB 5ECWA 2P9QA 5BVGA 1O77A 4JBXA 2QTBA 1W36B 4KX3A 5I01A 3QFSA 3A11A 1DX9A 2I5PO 4OXQA 2PZEA 3C6MA 1G20E 4XVCA 2WWFA 3HCEA 4P9DA 2CE2X 1RBQA 1Z2AA 5KWEA 1KI9A 4MW7A 1YCFA 5IS2A 4DDTA 2WD9A 4CS3A 3CX3A 4CLRB 4QSHA 5CPBA 2I9PA 3AETA 3UB3A 4IMIB 4DUZO 3I5MA 3CNBA 4R41A 3ADPA 5FV4A 5BUQA 2A4MA 1KMMA 1GG9A 4FQ5A 5CYOA 3FB6C 1KECA 1JQAA 3Q7SA 5I9SA 3WJ1A 3KSAC 4MS3A 3CZPA 4ZVKA 2M1ZA 5ALLA 2PNJA 5H8WA 3H2HA 1KO4A 4NDNE 4JCCA 1DIOB 3ML1A 5IYCO 4QEZA 5FI0B 1ZWLA 3AFNA 5BN4A 1M1YA 1QHNA 4ID3A 4ZA2A 4P5PA 4OXKA 3FBTA 2ZQMA 2HHHB 2UZ1B 1Y3BE 4JVLA 5LNK1 3A2KA 4LWPA 2XNDG 3TI9A 4FHEA 5EHZA 1KJQA 5EJ7A 3JRXA 1WPBA 4UCQA 1WABA 3G8AA 1ISRA 3GGJA 4J1NA 3AJDA 2MSEB 1W46A 4EHDA 1LWNA 4E6PA 5DCYA 3PJGA 5A6VA 1OI7A 2H1SA 4EPRA 1JKJA 1KAQA 4ATNA 1HT1E 3RVBA 4QDOA 1SURA 4PHZA 1JKIA 4D2IA 5K03A 2FPKA 4FSDA 4QEDA 3O75A 2BTQA 3IUMA 1SESA 3PX7A 3VO8A 4DMKA 4ZIRB 4DMGA 16PKA 1YZUA 4QE7A 2PL9A 1N2SA 3WWPA 4TN1A 3R3ZA 4JEHA 1QB8A 4TRNA 1U1CA 3ORFA 2R9VA 1YTFB 1JTFA 1ZMRA 1TC2A 3EXHC 4B71A 1IPFA 3WIDA 4FZ5A 1IIRA 1UBOS 4RVNA 1JEOA 3FOBA 1RRPA 3P9PA 3U4QA 4EGCB 1CT9A 3ZZUA 2WAAA 2YC4C 4RADA 3VAAA 2XZTA 1K6MA 5ALQA 1T1JA 5TE9A 3VJLA 5IK2D 4Z3OA 4DW0A 2EIMB 1X9GA 4TWJA 1W1WA 1ZCFA 2H6EA 1FXHA 3J7TA 4RH3A 3MBIA 1RAAA 3V46A 1E1RD 1VQMV 1SC9A 4NRDA 5F9FA 1NNLA 4NIMA 4Q01A 2G3YA 3D4NA 4L7QA 5BSHA 5CK4A 4DSUA 1L6RA 3GVMA 1I2MA 3V5NA 2GK3A 3H1KH 1YULA 2QW8A 4HS9A 5K8UA 1FYEA 4E08A 3WLHA 3IALA 3W6ZA 4EKNB 4IQ4A 5IRCD 5BRJA 2GZAA 3UA4A 1HT3A 4OKSA 2GKSA 2OYRA 4BX0A 4HPJB 3PNKA 4CHTA 1G21A 2BFOA 3PDCA 5E6UB 4LRSB 1ZAYA 2A9JA 5MGNA 4YIHA 5DI9A 4ZYTA 2WWGA 1R1BA 4LDQA 4ZKEA 3B5IA 4G4SO 2RD2A 5JYBA 2VTKA 2JIPA 2A78A 1G19A 3KYIB 2H5EA 1JLHA 1BS2A 3RCBA 4C0KA 3V7YA 3NHZA 5KWJA 1TLFA 3BSWA 3FKQA 2GN8A 3TSYA 3O91A 1DKMA 2P9ZA 2O8CB 1Y3HA 1MOQA 3Q87B 1D6MA 1O95D 2XD9A 4F7DA 1Q5PA 2VOEA 2HJVA 2XWJI 3P9XA 1PR5A 5KYGA 1BSVA 4IYRA 5E7JA 4BGDC 4FDTA 4ER6A 4IQFA 1I30A 1A8QA 1ISFA 1NKSA 4X1KB 1RXSA 4QDUA 1KHHA 3EG5A 2CTRA 4IRUB 2I22A 5K6AC 3KCQA 4B3BA 1CX9B 2Z30A 3MPUA 1PNRA 2ROQA 4DZTA 5LBIA 3K8YA 3A37A 2I7CA 2D8AA 4BEBA 3L79A 3PWKA 4MRVA 4LH7A 3CZ9A 1L3BA 3SQWA 2HXSA 4Y6LA 3PC2A 2ZATA 4IVQA 2XNKA 1WRBA 3NP7A 4KQCA 2XMPA 1XTJA 3S40A 1O94A 4UVGA 3I6ZA 3OKCA 4L85A 1OC2A 1Z83A 3QUTA 3QE4A 5EZ6B 1ONPA 3NIDB 4BV3A 3TINA 3FNBA 1GCGA 3IP9A 3T1QA 2OV3A 5M3BA 4CDRA 5K8CA 2DSTA 2HRCA 3ANMA 4MEAA 4RGBA 2R9RB 2AVDA 2O0KA 2YIBA 2VG8A 4F4JA 3G2PA 4YBZA 1APBA 3HYLA 2FEXA 2YYAA 1OTXA 1MC5A 3TL3A 4MP6A 5JJKA 2YX1A 1QP4A 4NZNA 2RAVA 3RS4A 1JHYA 3EVFA 3MTQA 5HTOA 3NOQA 1SIBE 3A1FA 1LF5A 1OD6A 3L6DA 4FFVA 5IZCC 3N3AC 1GDTA 1U0NA 4ANFA 3JVDA 1G8HA 1H8EA 5GV7A 1QDEA 3IAUA 3KOUA 2CXUA 1TT5B 4EG2A 3BXEA 2IS2A 3D7MA 2FLWA 2XUAA 3E5RA 3M6LA 5JAHA 1PYOA 2SICE 1XWIA 3BE6A 3OQ6A 5L4SA 5BOVA 3T4UA 3PRHA 2A0WA 4JLPA 3F3MA 3WISA 2ZRDA 1KR2A 1IHXA 3Q2KA 1MOPA 2XLBA 4FFBA 4JIGA 5I3ZA 1T9DA 3EVKA 4BX3A 1D3AA 4PIPA 4Y2JA 4NJOA 2WFLB 3K0AB 4MZDA 2PH5A 3GZ4A 2H3EA 1Z6PA 1YB2A 1VE6A 4RGVA 2UYOA 4M8KA 4DWVA 3HCRA 4LJ6A 3AXSA 3LGXA 3CGWA 2QQGA 1YQQA 1JDUA 1E9VA 2X42A 3C7AA 5IDVA 1U98A 4OJQA 1FFXB 4Q1FA 5JYDA 3WMGA 3UGQA 5IKEA 3AJ8A 3CHYA 2GN9A 3RAFC 2E82A 1TDJA 4CF7A 2IV3A 1EB8A 3AEUA 1NBWB 5JAZA 4KLNA 4CLDA 4FFWA 3KKKA 1SZTA 1QAQA 3T7DA 2R2AA 3ON5A 5GGXA 4BVBA 1KI1A 4RZ3A 3PICA 3LSTA 3K92A 5EJ9A 1O9BA 4YRBA 3PA6A 1BVUA 1RI3A 4UAUA 5ARCA 3L7OA 1FS4A 3IKMB 2QP3A 2QWOB 1YCHA 5NLLA 3T5DA 1PGJA 4XXHA 5ALUA 1V16A 2V6FA 2R5FA 2P5YA 3ROFA 5AKKA 5MFZA 1H9AA 1HR0B 2TMDA 5TXGA 3KT0A 4ZOLF 3BFKA 4ZT3A 3EVDA 2NWQA 2YN0A 2TYSB 221PA 2EP5A 4UTVA 3B1ZA 4I9HA 4H6XA 1YIJV 3JAWA 4HATA 3TBFA 1MQ0A 4I1VA 10MHA 2AD1A 4WLVA 3MJCA 5JALA 3V48A 2HPHA 4PZLA 3CVUA 1FB5A 1I80A 5AJXA 4M1YA 4MUJA 4IV5A 5KS2A 4QREA 4RTMA 4R31A 1R0SA 4JX9A 5D84A 3PDIB 1TKBA 1SXJA 2JLRA 5EXPA 3ZN2A 5L3VA 2P3OA 4FHGA 4QSMA 4J03A 4AP6A 1MRNA 4G36A 2B4KA 5IN4A 3IP7A 1QP0A 3S3XA 2C1XA 4ZAFA 4CZZA 4UMDA 1GPNA 4BZPA 2PUFA 2PD4A 3RPEA 1A0OA 2Y4OA 1X59A 3WDKA 1G5TA 1G2IA 3R66A 4UTNA 2R85A 2O05A 3KYCB 4ZAGA 2FWRA 1V9CA 2GGSA 2IU0A 2HF8A 1WCIB 3GXOA 2BLLA 4E5PA 5DX1A 1E5QA 1ZQ1A 3BPZA 3GJQA 4PQFA 3DW1X 4YAJA 2ZTVA 1L4FA 3PG5A 3UWKA 1H6DA 3BGWA 1K98A 3UXEA 4K03A 4HR7A 2R48A 1JV2B 4CMJA 2E5LB 2NMVA 3UJCA 2Y1CA 3N75A 3PUWA 3ZIAG 2GCOA 1CY0A 3ILSA 1T36A 5CR9A 3TKLA 5H9CA 5AJWA 4UCFA 2VO1A 1DOAA 5MFPA 2JFOA 4KQEA 3B89A 5JCPA 1DJPA 5EJFA 3UANA 2F8SA 1JJFA 2B2NA 5F51A 3Q85A 3H9JA 1E1YA 3BA8A 1GD1O 1EIWA 1PR6A 4WD3A 3PXGA 2QYTA 2NXJA 1P18A 2F1HA 3MAGA 3RRBA 4J0KA 1DGSA 1JDVA 1NBMD 3C14C 3FFXA 1OXTA 1N9GB 1KOGA 4AG3A 3RGBA 4N6OA 4TMVA 1JP7A 3IPLA 4U2FA 1NOJA 1WAZA 2YUTA 5I7WA 2YQZA 4N0PA 4HN9A 3BMQB 1X7HA 4GR4A 1NQVA 1P1KA 1QHHB 1FJGB 2BM8A 2GMWA 2H9IA 4YDQA 1CJUC 4ZCRA 3Q3GE 13PKA 5H6RA 4TKLA 1N36B 5CX4A 4LF9B 1ONSA 2AEEA 3T5GA 2ONKA 3SJ7A 2OZPA 3ILHA 1B93A 3PEVA 3K9FC 2KCQA 2UZ1A 5B3KA 1KPGA 1N92A 4G4SP 3BXOA 3AHGA 3ORRA 1KO1A 2IPOA 1FK8A 4PW0A 5CHEA 3DC5A 1JOYA 5JT1A 3LKDA 3QPBA 4W1RA 5JZSA 3EISA 1HLGA 1JJOA 3LNMB 3P0RA 1YRHA 4I9UA 1DBIA 5DIFA 3RHFA 3H5IA 5I4KA 5IC4A 2XADA 1BIFA 4U5XA 2HNKA 1CD5A 4YT4A 4TM8A 4POOA 3ROTA 2DYKA 4I2VA 4Q3EA 1QLHA 4AN1A 5BNTA 2W4LA 3I9JA 3RRFA 5COAA 2IYQA 3IO3A 4S04A 1SBQA 4ZIRA 4UCOA 4KCGA 2IIQA 3SC4A 4L16A 5DEDA 3DD1A 4H31A 4M6WB 1DQNA 3GEGA 5F33A 1ZICA 1VG9B 1F12A 2O4CA 4Q3OA 3OE7G 4PO3X 4IQGA 4HMQA 1S2DA 3JWHA 4BB0A 1CNMA 1VF6A 1W4AA 4CH5A 1VL8A 3CX8A 4A0HA 3A3PA 5HQ3B 3MQ4A 3IUPA 1IMJA 3DDCA 2FZVA 4HXEB 3W8DA 3ZCUA 3I1YA 2X0FA 3VOTA 2FK8A 3FPCA 1POWA 3H9UA 2W7TA 4PLYA 2DFVA 2WLSA 1QFYA 2GESA 4G81A 2KB0A 5EUCA 1P44A 4R8RA 5JS7A 3OOSA 1CXZB 3I9LA 3LDHA 2RCNA 4INPA 2GO7A 1Z5WA 1TVKB 4LI0A 5EJAA 3KCXA 1XTVA 3ER6A 4GLJA 1U99A 1W2WB 1KDZA 2WAXA 4RZQA 4XDKA 3SPJA 2N04A 4TLLB 3GPDG 1XL1A 2X0EA 1Z07A 3K15A 3OTOB 1FE8A 2V7TA 1ULZA 4C08A 2ZT5A 3P2IA 4C43A 4H33A 4TL7A 4ICGA 4I7ZB 1YQ9A 3G23A 3HR0A 2DQYA 4KDRA 5E6UA 4A03A 3CIOA 2HDWA 3SJBC 4B17A 1EBFA 2R8OA 4E12A 3DDSA 3EVCA 1XF9A 1FYWA 5THKA 4MXDA 2QU8A 1XZQA 3K5MA 3ZHBA 3TNLA 1HLFA 2CH7B 3NVAA 2O8CA 3UHFA 1JU4A 2O9JA 4M9UA 4XM2A 3E1UA 4IZ6A 4JJFA 2WE8A 3N8NA 2DH5A 3MB5A 3ZDEA 3U9SA 4OJTA 3A7EA 5FUXA 1NM5A 4GBJA 2B4TO 5HCUA 3NUQA 2D6FA 2EQAA 3FE2A 4X1KA 1ZVVA 1UBRS 2ZE5A 2NPFA 1AF4A 3EGOA 4BFWA 5K2MA 3M2TA 1ABBA 3BAZA 3TLMA 4ZAYA 1VOTA 1QHXA 5KQMA 4CV2A 2B1GA 4EGQA 4JJGA 3KLMX 4CMGA 2ZAIA 5ADUS 2AE1A 1NBHA 5J2TB 2QW1A 1IHPA 4RS3A 1YR7A 4EMBA 5B66Z 3ZZ0A 3FPGA 1SERA 1A5AB 5DULA 2DQZA 4N47A 1G7RA 5BUZA 4UNQA 4BVFA 4CKYA 3KYBA 3R5TA 3ADCA 4ZGWA 2XMBA 1S0VA 1B8OA 4ZJYA 1QHFA 2CN1A 4JSYA 4IOMA 4HH1A 4GC9A 1DDGA 1W9MA 2JFGA 5BQ5A 1PP4A 2JEYA 4RNDB 5HRAA 1YF2A 3PFHA 5FORA 1NLFA 4MROA 1PNMA 3TAHA 3V4RA 1E2EA 3NP9A 1JTVA 4FLFA 4J7JA 3BBLA 3DMHA 2B3TA 3WNBA 1W0JA 1KFJB 2FFRA 4X6XA 1OH5A 4JFRA 4MRMB 4L95C 4XCVA 4NARA 1TT5A 2HUPA 1QRUA 1VFPA 2PJRA 3ICCA 1OLSB 2XMQA 2YH2A 7AT1A 3JPWA 1RQ2A 4ACBA 2QR3A 3IP1A 2HBRA 2D1FA 4CHGA 3CB4A 3OU6A 4PC1A 3EK2A 4OM7A 1CZKA 2QWPB 4HRWA 3KQTA 3BJMA 2ZDHA 3JQ8B 2PX8A 2G4CA 2UUBO 5AVRA 1VYVA 1QE5A 5EKSA 2JH9A 4FYVA 3FTFA 4TMTA 1E9BA 2JIZA 3SZMA 4F9EA 3HU3A 2GEVA 1UMDA 4MYRA 2WFLA 3K0AA 3I23A 4KNVA 4O63O 2UUBB 3WV4A 4D8VA 4K3VA 1VL1A 2X8BA 1UX0A 4JYAO 3ISVA 4HFNA 1C41A 2ORWA 4LBZA 5ALDA 4PEVA 4HNGA 3V4ZA 1FFXA 2WWTA 4CTKA 2VYFA 4JYAB 3FCUB 2JCBA 4AKTA 1ZVKA 4X93A 3U13A 4WIAA 4OJMX 1DF4A 5AM4A 5IMSA 4ZBMA 1LX6A 2NP7A 3W2FA 2QWQB 4CDGA 1UFQA 4Z54A 3BZUA 1JIUA 1Z6GA 2RH4A 1GZ3A 2I6QA 1FCJA 4DG8A 2IOFK 5JSHA 5CLFA 4E70A 2DVMA 5AHOA 1XKXA 1N8RW 3PKJA 4G0ZA 4HOYA 4AF8A 1GZ4A 1Z26A 3T1YO 5ULLA 4CPDA 4JLNA 1K0FA 3TZHA 3IILA 4QTXA 3TIFA 4NTZA 4RO0A 1FUUA 3RH0A 2CFCA 4DB4A 2FPIB 2PO7A 3QNEA 3T1YB 3D6HA 3ROZA 4IL6Z 3MT0A 2C2ZA 2O2DA 1R0KA 5B1SA 3WAGA 3M6IA 3OZIA 2I33A 1PLKA 5JQWA 1NVVR 1E96A 1A7AA 2MOKA 4GUNA 1FU7A 3B6JA 1YJQA 3E22B 4CETA 4C1BA 3AUKA 2W6IA 4KO3S 3D3KA 1NVKA 3UT5B 4DBLE 3IVMA 4EJSB 3HKBB 3B2QA 4DLTA 3JWGA 3PDIA 4QVIA 3VR3D 2Q62A 3FY4A 5SV2A 4A0FA 3DFKA 5KREA 5LU9A 5JJJB 4GDFA 1D2HA 4BVLA 2GBIA 3VR4A 5F2NA 3MPOA 1LNQA 4BGEA 4ZPXA 1JHXA 1W581 1MENA 3IMEA 1YJBA 3U3DA 4NR0A 2WMYA 5AI8A 2JLCA 2P62A 1E8MA 2Y9PB 1H8EG 4GVLA 1DV1A 3KYCA 1WCIA 4K9RA 5HXAA 5FADA 2XKAA 1E62A 5ALPA 1YUBA 4M0KA 3QBJA 4RKWA 4A2WA 5C8VA 4F0JA 5AVZA 2FKNA 4Q1EA 4IFIA 2PY6A 3PL5A 2E0IA 4FYIA 1ZVQA 4FUTA 1PWYE 2XUQA 2H1LA 2L6LA 3AB3A 4MUEA 3NUGA 3OCCA 2OZLB 4XYGA 2J5RA 3QQPA 4P3YA