2IU3A

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-based design, synthesis, evaluation, and crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
total genus 203
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2006-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2iu3A04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2iu3A01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu3A02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu3A03
1BXRA 4A1OA 1CS0A 1CE8A 5H3LA 1OZ0A 1A9XA 2B1GA 2B1IA 1JDBB 1M6VA 1VMDA 1T36A 1G8MA 2YVQA 2XW6A 1IK4A 1B93A 1P4RA 1M9NA 1EGHA 1C30A 1C3OA 1PKXA 2IU3A 3ZZMA 1ZCZA 1THZA 4EHIA 1S8AA 1KEEA 1WO8A 2IU0A 1PL0A 2X8WA 1S89A
chains in the Genus database with same CATH superfamily
3HCBA 1Z83A 3ZZNA 3GUHA 3M34A 4E4TA 3VVBA 3Q7RA 2MYPA 3I64A 3LCVB 2BEKA 4MP6A 2VPPA 4PLYA 1MHPA 2BL4A 3Q9SA 2MW2B 1UBNA 3ZBUA 2VTEA 1AJEA 4AZ0A 1ZAUA 4U63A 5FI1B 4YWHA 4YPFA 3G5LA 1Q6ZA 2P9QA 1F8FA 2OCLA 3BJEA 3C3BA 1KE2A 3STZC 1MO5A 3UJ7A 1WABA 2A5LA 3FDFA 4NPAA 2GARA 4Z2WA 3WWOA 1XTPA 3KDSE 5AKXA 3NWOA 3NFRA 4PZLA 2IHJA 1VIMA 1ZH6A 5JZ9A 3GLUA 4ER0A 1YDMA 4I6GA 5CCBA 1QV6A 2A79B 2WHXA 1UC9A 4PC1A 4X41A 2H1VA 3FFXA 3AF5A 3HFRA 1Z28A 3GLGA 3P30A 4JC8A 1OHHA 2GBOA 1LJUA 3I1YA 3V7NA 3MQ4A 1FC0A 1A0OA 4TLBA 4XFJA 1IZ7A 1H23A 1EE2A 3F2IA 4PBSA 1LA2A 2PIDA 3UAXA 4C20A 1MQ9A 2VSXA 4L57A 4ZBMA 1N9GA 4H3KB 3UFBA 1HLGA 4C04A 2VDQB 2ODMA 1IJFA 1E3LA 3EWIA 2XMRA 1I2AA 1KHTA 2P79A 3ND9A 3HB1A 5FUXA 2W2LD 3ABLC 3P4YA 3SDZA 3SYCA 2EP5A 3R40A 2AD1A 4LYYA 5C52B 3VX3A 5JCJA 2IQ5A 5KX5B 3E89A 1BWSA 3L05A 4K6FA 4RF3A 4LRTB 1V5IA 4PR3A 1Y8ZA 4I14A 4UBKA 5KDDA 2ZIVB 2LO1A 5M29A 4DDHA 1SS3A 1GLVA 3M83A 4PYRA 2F93B 2BKUA 3P7MA 3SAJA 4FD2A 4LK2A 4DWJA 1P0FA 2PWBA 4LKOA 1T2VA 2ZZMA 4KUGA 1JH9A 4J07A 4CYMA 1DWUA 3GK3A 3H2ZA 3L01A 4R1OA 4DL9A 4PRYA 4GICA 1ZM3A 1X59A 3U31A 5ALRA 2G84A 4X92A 3OQNA 1GGVA 4HTAA 3TG8A 4Z4EA 2QPLA 1C8VB 1AR5A 1PFYA 2ZSIA 3LKDA 5AM5A 2EKBA 1PEDA 3LUKA 3CSUA 5B53A 3RVOA 1O6GA 4X1OA 1VLHA 1WD7A 1UPXA 4MMXB 1J9GA 3RW0A 1W0CA 4IVNA 2C5GA 3DFUA 1PGNA 2QMZA 4LJKA 4E13A 3UMJA 3W7TA 4D98A 1YMQA 1CFZA 1PV1A 3KVYA 3BIFA 3OZRA 5EWLA 1YSCA 3AI7A 4DSZA 4ZOLA 2X2FA 3LOPA 2CE7A 2GEFA 3DWIA 2XNDG 1V16A 2WTBA 4J16A 1XHXA 2XNJA 1NI4B 4CU2A 3LK6A 4EGJA 4JI5B 1ENZA 1NF8A 3HU5A 4W5JA 1U4NA 2JIBA 3J80A 4ID3A 3HC7A 1F0YA 4KUMA 4FZ0A 1BOFA 1IXKA 3N8KA 4LMPA 4M9QA 4HNTA 2A1TR 1ZAKA 2CHQA 1E7QA 1L5FA 3NHSA 4J3JA 4RLSA 4UUMA 1Y6FA 1WCWA 4RH1A 3U3DA 1PYDA 4HATA 5FOUA 2I80A 3WZMA 2CUTA 1OZHA 3KT0A 1HYEA 3AVQA 1W2BU 4FI3C 3UMYA 4I0XB 3ABZA 3V1UA 3OAAD 2ODPA 4HGRA 1LX7A 1VARA 2K1EA 2H4ZA 3Q3EA 4YMIA 3V6LA 5A02A 2VF2A 1FXUA 1YQEA 1NZ6A 4H6XA 2Q4OA 4MDYA 5JMPA 2IHZA 3ZLUA 2FDCA 4BEWA 2PZGA 3P4XA 3KTDA 1W9MA 3MTGA 2DP4E 4BLVA 1Z3CA 2NO6A 3L7IA 2Z3VA 2WU4A 3S2SA 4PG7A 3RIEA 3OUTA 4C3UA 4BNHA 3GB7C 5EGNA 4CVNA 4G36A 3RK4A 3INNA 3KKYA 1QPZA 3HV0A 1VI2A 1Q0UA 5LZ9A 4MPDA 4AP9A 2VDWB 4MWDA 2F3UA 3THXA 1ZK3A 1KZ1A 4EYOA 3SYMA 5HHTA 1V16B 3LO8A 5E7IA 3FSEA 2RIPA 1XDWA 3B13B 2IE0A 1GZDA 3ZIAG 1FRQA 3KKKA 1TC2A 4ZMSA 5LQRA 1CY7A 1QH9A 2WSSD 3PCXA 4HB4A 4NEHB 3H4TA 3VHQA 2I87A 1H8ED 1QZUA 1NF2A 2BGNA 5GJWC 3WLHA 4RSRA 3G0OA 4MQBA 3ZK9A 2XMGA 3R4CA 1X7ZB 2WE8A 3P71T 3RR2A 4B82A 1LEHA 1OXUA 2II6A 3TSAA 1S3JA 4MJ3A 1E6MA 4Q7EA 4TTAA 3SZRA 3UUFA 1ZNXA 4V0RA 4CFSA 4GECA 2PCLA 2ZEJA 3PZRA 4W1RA 3A6HA 1IY2A 4WFBV 4COKA 4H77A 1JHUA 1QVVA 1I01A 4MX8A 4JKYA 4NCNA 3CE2A 1M8KA 1VJRA 2X4IA 1XKXA 1SIOA 4FX2A 4LHZA 4CG2A 1X1SA 1E7RA 3FPKA 2YMLA 2VDOB 2ILVA 3CSDA 4I1OA 1JIIA 4D0NA 3WGIA 1UJBA 1PSWA 2RE8A 3LSYA 5PNTA 1W36D 3TRFA 5JYBA 4N3BA 1BQ0A 2O2CA 4U7OA 1ULAA 3QK7A 1G7CA 2HJRA 4HLCA 1SVOA 2FSGA 4YUZA 1G2QA 3LTNC 1W48A 3IAHA 5CHEA 5DW0A 3UWDA 2C9ZA 4BGDC 5KPDA 4DJ5X 1QHGA 4OHRA 1G1MA 2RK4A 2WIKA 2XIJA 1Q12A 2RAPA 2ZIEA 3H9CA 1WSAA 3GFQA 2Q1YA 4LOHA 4LNHA 1IK4A 2GAJA 3AFMA 3V2GA 3E2EA 1MX9A 1MTZA 2QYTA 2VJDA 4DIMA 3BE4A 5A9SB 5I7UA 4QYMA 3WIBA 2JLXA 3WLLA 2ZR9A 2J6IA 3UKDA 3OD1A 2D2CB 1U8UA 2PYIA 2G1UA 3L7OA 4MV6A 3HPRA 1SUFA 1FF9A 4KN6A 1PN3A 3NC1C 2B6NA 4RXTA 4U2EA 4O4HA 2D30A 1JJIA 5C35A 2EEZA 5KHAA 4I3HA 2H06A 1WHTA 2VO1A 1Y5MA 1K8ZB 1SR8A 2WAAA 3CX8A 4IIGA 2IUUA 4AN0A 3IX7A 4ND8A 4XUCA 3PJRA 3AEQB 3A2FA 5IKEA 4UB8Z 1EA7A 4UEJA 4G5RA 1N3BA 3DLPX 1POXA 2J08A 1Y6RA 2BHTA 5ICEA 1MB9A 2WWRA 1M0SA 2BBWA 2VK8A 3CH5A 3HCFA 3L06A 3QF4B 2JFXA 5EC1C 1PNTA 3TZKA 4LXQA 4YAUA 1Z45A 2O5EA 1K9MW 4JLDA 1NW3A 1KSGA 4E7OA 5BN3B 1HGXA 3F2VA 2RGRA 3MWEA 1YZLA 3WRVA 5EJ8A 4WI1A 5KNDD 3EXEB 3CPEA 2XMSA 4P3OA 4PRZA 4WLEA 2QUKA 4AZ3A 4BGVA 4LDAA 3CEIA 2EX0A 4JJKA 2AXNA 2ZAMA 4WFFA 5FYDA 2DQ0A 3FWZA 4PYNA 4TTTS 3O4HA 5K8LA 2DEUA 1FP4B 2WJGA 3DE3X 2X1HA 5EZQA 2FWNA 3NTXA 1YI8A 2BAGA 4DQKA 3PC6A 1L5KA 4ZGBA 1N32B 1JMVA 2LCFA 3S81A 4BFCA 4UNSA 3ABMC 1KKDA 3W6NA 1KHHA 4L15A 3PGXA 2KBFA 3QBVA 3ZKAA 3QNEA 1B73A 1V54B 3CMCO 4I4IA 1AQUA 2VDWA 5F2KA 4Q1CA 3SJZA 2LKDA 2AOTB 2JD2A 5AM3A 1IN7A 2WOOA 1VSTA 5E4TA 4QLBA 4CKCB 2GN0A 1VE7A 3FNGA 3WLQA 4DKJA 1E2IA 1FAFA 4NAUA 3PA6A 4NCKA 1X0VA 3WMXA 1MGOA 3UAVA 4URHA 4XVRA 1UKYA 2G5GX 1G4YB 1GK9A 4X8AA 1ZJ6A 1BDBA 2HRZA 2XUAA 3G5TA 5ECYA 5L9AA 3U7FB 1XO1A 3SFTA 1JDNA 2HDWA 2H85A 3QVMA 1QLEC 3GBVA 4QHYA 3KM0A 1B0PA 4F2GA 3IR5A 1THGA 1RYYA 2P6UA 4IEIA 1G6KA 2ZB4A 4PZ9A 5KJFA 1K3UB 4NENA 1AV6A 4QGBA 4FGWA 3ROEA 1ZHFA 3N0XA 3A9TA 4U0JA 4X6YA 4EL0A 1DQNA 1SUIA 3QEJA 3UAGA 2Q4TA 5CDFA 2HPVA 3AR9A 2V5AA 2QLNA 3MILA 1OSNA 1HNXB 1ORVA 3NDJA 4M7RA 1EZJA 1RYDA 3IUYA 3ZMVA 3JZFA 2JGRA 4G41A 2C2GA 5ABPA 4OYYA 1DC5A 3ZY3A 1QK5A 5CDFE 4DDWA 2Z6UA 1USVA 2Y1FA 3ICVA 1C7EA 4NJMB 4TQDA 1LI4A 2Y1OA 1H5UA 3PT5A 3NHLA 1VL0A 2A3NA 2N47A 2V6FA 4I4TF 3GN2A 3FWYA 3K32A 3Q6MA 1KS9A 3USZA 1E3IA 5B4VA 1AMOA 4O4HF 4QBKA 1CY1A 1N5OX 2ONCA 3JU3A 13PKA 1QYXA 5DO9A 3LW7A 3ZVLA 1Y5NA 4L4YA 2BELA 2G82A 3DXXA 2HJSA 1EHCA 4G0ZA 4UVEA 4E5NA 1PV4A 5C53B 4CCAA 4RQEA 1RPTA 3ZDFA 3OEHG 2CNNA 2L0XA 3JQ6A 1JEOA 3L8GA 5FP0A 1YS7A 4LJ6A 1U9JA 4D96A 2YV4A 4Z0HO 3TIIA 4FLUA 4NABA 2P30A 1FZQA 1SPBS 2OG1A 5GTIZ 2FPGB 5CYPA 5BN3A 3D3QA 1SOVA 5EBLC 2VZEA 5KQMA 3IJPA 4QDXA 1DQSA 1K75A 5K20A 2EQAA 1MC1A 3MGGA 3QF4A 4LE1A 5THQA 3EIXA 3CMMA 1SIWA 2Z2JA 3IJFX 1UADA 3CRW1 3CURA 3PUYA 2B37A 3OUFA 2GKOA 2B4KA 2LIPA 2Z2XA 3L49A 4HAIA 3FKSD 2GS9A 721PA 1WHTB 1ZSYA 2IY9A 2EW2A 1TUEA 3BIJA 1IIRA 1JG4A 3OTFA 1C1XB 3AIIA 3CN7A 2FFBA 3CWCA 3JWIA 4IDHA 4L5IA 2HW8A 4KLZA 3TTWA 2FW1A 1C4WA 1IY0A 1UEXC 3G2NA 3KEFA 4RH3A 3LUTB 4KL1A 4K1XA 3EMKA 5L53A 2C5FA 3Q41A 4DQUA 4RIGA 4C0LA 4D41A 1BA2A 4EVSA 1NFRA 1PHRA 1ZRMA 2ZG6A 3GY0A 4KMRA 3DLBA 3WGKA 1X15A 1WPQA 2X6RA 1I0IA 1GNLA 1I3NA 3NNNA 4PSKA 3JYLA 3RVDA 3CJHB 4FE4A 3QYAA 2Q27A 5AW8A 5C7IO 5G1NA 4V0LA 3OM8A 1UOEA 4BKUA 3D9QX 3OIWA 3AB7A 3F73A 2C9CA 1L7MA 2FWAA 2XIQA 4NKGB 1OFIA 2A86A 4YONB 2FPIB 1UPCA 2W6ID 5IP5A 4KR7A 5LA6B 3AILA 1KMIY 4D8UA 1VA5A 2GXQA 4WTOA 4Q39A 5LIRA 1QHSA 2ZRHA 3H04A 3GEBA 1I1NA 3K8YA 1NXXA 4LE2A 3VQXA 4RE6A 4NJEB 1V4BA 2RH4A 2H92A 4OGGA 5EYPA 5BR1A 3DVSX 3MJHA 3KQTA 5E6SA 3SXUB 4BQRA 5EIXA 4YRCA 1W0JA 4AS1A 4OSPA 3GPIA 2HR3A 2FMUA 2NTYC 4KN8A 2CY0A 4O2BF 4GGOA 2Q7XA 1P4HA 4X97A 1XTBA 4MTXA 5DK4A 5HCNA 2OBMA 3BGWA 4LJAA 5EIWA 4IIFA 4AZ0B 1WXEA 2ZI5A 4MRPA 1NBAA 2RN9A 3KR1A 2PVSA 3GCWA 3P0JA 4D8XA 2QJWA 1J8QA 4WIGA 1WD5A 3M6AA 4GI1A 1DBQA 1ZVQA 5CBKA 3GLHE 1FX0B 1M1ZA 2Q29A 5JJ5A 5KWSA 4QUGA 3AL0C 3ND8A 4NATA 2OB1A 5EUBA 1G20A 5EIFA 5IYZF 4N3AA 5JLJA 2PH5A 1PP9H 1W0KD 3DOIA 4XX0B 5KVAA 2JH8A 3D0OA 4XI9A 3ZGOA 4MUYA 2Q07A 1J0DA 2BFOA 2G8LA 4H18A 3ZD9A 5A7HA 1HE2A 4PIPA 2XTNA 3V3TA 3CG4A 4GLFA 4WKPA 4FGZA 2IZOA 4MR9A 2K9PA 4MPRA 3W2EA 2IH1C 1P9LA 1KZGB 4D4JA 2X9LA 4D26A 2HEPA 1KDRA 1G21A 3QOFA 4LPKA 3VR4A 3WGYA 4C07A 4YRZA 4XIJA 3LAWA 1BAPA 1DX4A 2ZPTX 4LJLA 4MUFA 1YU6A 4B6JA 1KYOF 2FPUA 1MVOA 2H0QA 4MUKA 3NKVA 4NK5A 1OFVA 1N36B 1VHWA 2YWXA 2XGMA 3DDWA 3HJUA 2IELA 3FCAA 1HRKA 3Q9LA 3GBSA 3F5WC 1KP3A 4DR4B 1NHGA 2VWGA 3KJIA 3LGAA 3ORFA 3KX2A 3PC8A 4ITVA 1OA1A 1ZSVA 1KBQA 2PD6A 2OD9A 2RKOA 3CRVA 3NHBA 1QYCA 4DLUA 1MZPA 3A1VA 3FA2A 4C0JA 1ZOPA 4CM6A 2PX0A 5G1PA 1X1TA 3C0KA 2HZ7A 4F45A 3V8EA 4YXWG 1OX4A 1ZKDA 3IUSA 4MUXA 5BVGA 5KYXA 5ADWA 3A1DA 5IS2A 1NNLA 2J8ZA 3K6KA 4KVGA 1BGXT 2IEAA 3DBOB 3QX9A 4TT3A 2Z0AA 2QPAA 1RXYA 1GUDA 2VNKA 4DLZA 5BQXA 1ZIDA 1GKUB 1T9DA 1UKAA 2VAPA 1GQYA 1GD1O 3HSSA 3PIDA 4HDQB 3ROXA 5T64A 4B75A 4RY9A 1GDTA 1M83A 4YP7A 4F6EA 4Y2QA 1LPNA 3DEFA 3QMWA 2OCKA 4HQRA 5GONB 3ZWMA 2MSNA 1R0YA 4IBOA 4MP3A 1ML3A 4F72A 2VF7A 1JAXA 1LTQA 4Q20A 2JGIA 1WG8A 3DNFA 2VH1A 3JQCA 4MI6A 3RVMA 1H1TA 3EN0A 5CBPA 5HVNA 2UUBO 1MNQA 2HA3A 2JARA 4A26A 3H8VA 5GOTA 2ZT7A 1KXJA 2FSHA 5ERYA 3EF1A 5DIFA 1H1LA 1E7YA 3NOOA 3BE6A 1NC1A 5M04A 4GR9A 3RM3A 3KB2A 1RJEA 3S2GA 3VO9A 3BD7A 1XILA 5TF4A 1CP3A 4Q93A 1O5IA 3T2MA 1ZGZA 4N9WA 4W8GA 5I6DA 4RCVA 3ZHUA 1CU1A 3UMVA 3FNFA 1UK7A 4D9NA 5MN6A 1EB9A 4MJLA 2XITA 2B1RA 1F4LA 2GPSA 2HCBA 1FQJA 4KQ2A 4PRLA 4UAJA 2AF3C 4WEOA 1T5TA 4DGSA 1O4WA 5A9RA 1YE3A 2I03A 4WNAB 1C0KA 2J1LA 3LQFA 1W2GA 3P2OA 2D06A 2BTOA 4HUJA 4JT2A 3SQDA 3ZUPA 4BFLA 1CYEA 5ARDA 5B5EZ 5AW5A 3WRXC 3LF2A 1Z4KA 5KAFZ 2SBTA 2Y2UA 2ZJ1A 4IHJA 4G4GA 1JQBA 1NRWA 1ISRA 1DFHA 3H8SA 3SIXA 4ZEOA 4QVKA 3FPHA 2ZYWX 4MUBA 4EUEA 5H3HA 3I4LA 4OQPA 1QHXA 1RQ7A 4PM4A 4JI4B 1NP6A 3P0HA 5A03A 5CEFA 2HVWA 1FOEB 1FXKA 4XDJA 5ESXA 5LPNA 5KDOA 1HDJA 1O87A 3L18A 2V58A 4O08A 1DWPA 1W2WB 2NO0A 1JGTA 2NXWA 4K81B 3TKAA 1F60A 3WHPA 3H5VA 1E0DA 1GILA 2XBUA 4CNBA 3PRHA 2ZD9A 1WB9A 4WA8A 3I6IA 3PJGA 1CF2O 3CXHF 2GETA 2I65A 2JRLA 3IQZA 5EHGA 2Z9CA 1RM5A 4F84A 2CJXA 1WZCA 2X6TA 3VR5H 4GAEA 1V6CA 2DN9A 1JJOA 1SAYA 5LYJA 1Y48E 4M2LA 1UBFA 3HA7A 1HQDA 5EWJA 3JQGB 4ZAVA 2ZIMA 2OV8A 5DI3B 4Q3OA 1YJWV 1I2DA 4PTZA 5CFLA 4PPQA 3BB4A 4K2AA 4D43A 3GFVA 3MTDA 4CLRA 2C9DA 2G9UA 2BI4A 2ON6A 4PO1A 4GYJA 3GJRA 4XD7D 4EJSB 3ME5A 1SGWA 1NU1H 3EW9A 1Z2DA 3BQMB 2OHIA 4RTMA 2DT5A 3IULA 5EESA 4B17A 5KOHB 4V03A 2O8BB 2NVBA 1MRNA 3AM5A 2IH3C 3L43A 4KZKA 1E2EA 2WLSA 4NOKA 4RGYA 3S29A 2G5TA 1MFZA 1T5HX 1VE9A 3QP9A 3RGGA 5LN1A 1ZN2A 2ZYUX 1EN4A 2IHKA 3NYIA 3TF5A 4GQBA 5K3AA 3AEYA 1DFIA 3Q4GA 4HY3A 3RUEA 1HDOA 1TO6A 2DHDA 3QI2A 5AXCA 3RW9A 4AO6A 2YDYA 2XCIA 1CF4A 1ZO8A 1WN6A 4JVMA 3ESDA 3UAOA 1EJ6A 4H6VA 2NYTA 3PJSK 3T1YB 3D8BA 3TNJA 2UVQA 2CSXA 3RAJA 1I2ZA 1ZQ1A 1DEXA 1QZTA 1G5IA 4BKOA 1HTBA 1QCCA 4B4KA 3DHVA 5IT9N 3FROA 1NUTA 4EG4A 4JI7O 5JVDA 4G85A 5B1BB 1A9RA 3IESA 5FL3A 4X7RA 2JJ2D 3I37X 3P9NA 5EQJB 2PS0A 2Z04A 4RVUA 3KDAA 1PBNA 2FK8A 4Y2RA 4LHYA 3DKRA 3OCJA 2V03A 3X1XA 4F8YA 5MFZA 1AKRA 4HVLA 3OT5A 1G7SA 2AG0A 3H2GA 1PJZA 2B7BA 3I9V1 3A1SA 4DIDA 3QM1A 3QG5A 4XSGA 4B74A 1DJPA 5FEUA 4TYNA 4B80A 1VIBA 5TQJA 2C5LA 1GHTA 2OCBA 3FCXA 2H2AA 4PWZA 2QVCA 3F8TA 4ZJPA 5CA1F 3EH2A 3T9EA 1KOGA 1OCRB 4L51A 1OYVA 1U1IA 2VUSA 4NMMA 4B34A 2FEAA 2O1XA 1U63A 4X66O 4IIVA 4XB6B 4H33A 3OCUA 4KQIA 1RYHA 4RVNA 4R1MA 5GZ1A 3O8CA 2EBOA 5B58T 2XQIA 2LXNA 4JY7A 1T9KA 3Q10A 2IYUA 2XEDA 1CZOA 1WA8A 2XQKA 2A1TS 5LGNA 3BFJA 3M6MD 3NRJA 4LSMA 1O96B 2BRUC 1QYRA 2V1XA 3LECA 4KQKA 1FVOA 4ZU3A 4C05A 5AQEA 2ZGVA 4QZVA 1FU7A 2V7GA 3EDYA 3C3MA 1SEVA 5LP6C 4K9NA 5IARA 1M66A 3IYLW 1MOFA 1GA6A 2JDIA 1Q7BA 1UJ6A 2ZTVA 4KH1A 5F98A 4WLUA 1W5AA 1R4MA 1GM7A 3J81A 1A5TA 1J1ZA 3D3IA 1RU3A 2WZQA 4BMYA 2LGQA 4JTDB 4HADA 4IS2A 1ZINA 3BA6A 1G8FA 3DC7A 2VSNA 5KEIA 3N75A 3WLKX 6YASA 5IG2A 3GT4A 5K8JB 1N1DA 3JSLA 1Y34E 1BE8A 1E1CA 2RHTA 3BWDD 1FXWA 2B35A 2L42A 2Q62A 3LV8A 4KXUA 3SX2A 4DQLA 3FOFC 3RB8A 4P9DA 3O2NA 3SSOA 3TQFA 3G6WA 1M33A 2HF8A 1BO6A 4NY1A 4KFMA 2VRZA 1SU4A 1NVBA 1VQ8V 1YZNA 4YJFA 2CDAA 3INYA 3Q7TA 2D5LA 4R5HA 2HMTA 3ZKWB 4EFBA 5HG0A 5ISMA 3UCXA 4IG9A 2IUSA 5TEWA 5FL7G 3P4UA 3MJ4A 4MKZA 4QYTA 1NNEA 5FOVA 1R15A 2GZ1A 3B9PA 2DERA 3I01M 1K8XB 3EA4A 1Y76B 5FH9A 2XHBA 1F2TA 3T0GA 2ZNRA 1QVZA 1L4MA 1T1JA 3QKTA 5H70A 1DT5A 1FTYA 3L7DA 3V97A 4DA9A 2NOAA 2LWIA 3OPNA 3VU0A 3AYZB 3T61A 1O9GA 4X1IB 3ACCA 2W70A 4BO9A 3O8RA 2AOUB 3NM4A 2QUIA 2VPZA 2Z8YM 2X9GA 4X45A 1S3SA 1DZIA 4JUFA 1SXJE 2WF5A 5AKGA 5C7OO 3IALA 1A82A 5CVCA 2JFZA 4NR0A 1TEHA 2AOXA 4H2DA 5HIAA 2I2AA 4EB3A 1QTIA 3D36A 1DQYA 1Y98A 3RSLA 4AF6A 2RMKB 1EZ1A 4QNHB 3ZDAA 1P1JA 1QQ5A 4LHXA 4P58A 3AW8A 2UUAB 2AXEA 4L85A 2XOKG 4NYMQ 2R11A 3GB9A 1J5PA 3LG2A 3EBPA 2QJRA 4JLUA 1BA3A 3HCDA 1XBLA 1A9TA 1RTTA 3P5BA 1KFJB 1SQ6A 4YP6A 2DAPA 4GE3A 2I7TA 3L8YA 1P2TA 4Y7CA 4BNVA 1PDOA 1XZBA 3DXFA 4PZEA 2EV9A 2W6JA 2ASEA 5FJJA 4CPDA 1QYDA 1VF5B 1P4AA 1VYHA 5TMPA 4TM8A 4DUYB 4QU0A 5FO0A 3ZWBA 4CM7A 2N04A 2I4RA 1HQYE 3PPVA 4EJ0A 1ABEA 4N5IX 5CA1B 2FWBA 3D4NA 4DAOA 1ESNA 3EB9A 1C9DB 1XCBA 2GKSA 4UCXA 4DKXA 1MJGM 2FK7A 1KTIA 3CS3A 3O8DA 3B1XA 4X6UA 2Q3BA 4M88A 3BE8A 3LHFA 3DV9A 4A5UB 3N7UA 1V2GA 2VZ9A 2ZRQA 3R09A 1FYJA 4RXUA 3RAPR 4BVAA 4FOLA 1BZYA 5BYAA 4E07A 1WF6A 1XB2A 2CNOA 3KAKA 5HE9A 3T7AA 5EXEA 3BSSA 4XZ3A 5B4TA 5HPYB 1G9SA 1GQSA 1XNGA 2P77A 2GT1A 5A4AA 5H59A 4PN7A 4F4CA 2JBAB 1E60A 1TU4A 3KSRA 5JCPA 2YJ3A 4AUEA 2I99A 2IXEA 1I0LA 4LFCB 2YDEA 4PO8A 3ZGNA 4CM5A 4MRNA 4C4ZA 2YC4C 4EDFA 2YYSA 1SD5A 3A6GA 5SICE 4R0VA 1HFKA 4AUKA 3LX5A 4HGOA 4OHBA 3JCUZ 4H08A 3C3CA 3AONB 3BMNB 1ZN8A 4EEXA 4UUNA 3K9QO 1D1PA 4YUAA 1X92A 4W5QA 1TZKA 4AT1A 3TECE 3DBVO 4C0HA 4K9DA 3WADA 5TMDA 4LVOA 2XLBA 1AQJA 6REQA 1V55C 2YYAA 3VZPA 1CSEE 3CBQA 1T13A 3IDQA 3DP9A 4UVDA 3RRXA 1I4WA 1WUTA 3K0AA 3WO0A 4YMTA 3A0BZ 3HJRA 1N0IA 3I2HA 3SIPA 1PJ4A 1ZVMA 4D9IA 4KWCA 4OD0A 1I2MA 4LQLA 1ZR2A 1DF4A 2MIIA 3LHSA 1WLSA 1P91A 2F59A 3K5OA 1RXSA 2J3QA 2JLCA 1I30A 3GRVA 4DV2O 1O2DA 3SEQA 1PQYA 2I7DA 1DT3A 4DV7O 4ZQCB 2VC2B 1E9FA 1H4VB 5A06A 5CBPB 4ETMA 2JEUA 2XY4A 1VJTA 4Y9SA 3DAGA 2ZW9A 1URFA 4IMIB 3PUIA 2VUIB 3HXKA 1MBZA 3DO8A 4JODA 4NOMA 3E0QA 4W5TA 1Z9BA 3LIIA 3UJBA 2ZQMA 3V55A 1Y3BE 4WAUA 4Q05A 3WV5A 4E5SA 1ISHA 4HUQA 2QI9F 3LOQA 4MPPA 2G40A 2EQBA 2GSWA 2JFQA 1Y37A 2K2WA 2FZ4A 1T8YA 1LH0A 3G8BA 3IPAA 4K86A 5L8VA 1BDMA 1EGVB 1O0CA 2G0TA 4MV0A 2ZITA 1GQRA 3P9XA 4UVCA 1X1CA 1KY5A 1RSOA 4ABTA 3V9AA 1CEEA 2YINC 3UHAA 2H3EA 2HSGA 4ZI7B 2OHJA 2ZBDA 4ME6A 4A73A 1OCZB 1XD8A 3W7BA 3OZCA 5AO9A 4DZTA 2QR5A 1NJ5A 4KACA 3MWLA 1P73A 2WKQA 4AIIA 2VAWA 2ODEA 1AC5A 3DLCA 3IHLA 3L0IB 2OYCA 2AFIB 4HXGA 5B3KA 2V7VA 4YY3O 3RHZA 2EJCA 2FB9A 4W63A 4XM1A 1KP9A 1VBMA 1Q1QA 1Q7EA 4IFTA 3TRKA 4RETA 3VKFA 2P41A 3I05A 1GYPA 4JL6A 1N0VC 2XE6A 1RWXA 4LY0A 2DWDC 4PCUA 4YJ2F 1W25A 5ALYA 1CNMA 1EXWA 1QDEA 1TZBA 2HKIA 2SNIE 4Y1GA 1OIXA 3VTKA 1YTUA 1U2SA 3I0MA 4IH1A 2XNKA 2GI4A 1P4JA 2RC6A 4HWKA 4DEYA 2Q73A 1KJ9A 2HQBA 3LYHA 3PTLA 5JSZA 3G80A 2BOBC 3CX4A 1KVQA 5LDGA 2JIMA 2E82A 4OXSA 5JR3A 3AJEA 5JZSA 1ETUA 1OBVA 4TS3A 4TSKA 4FHFA 5E1DA 1PEYA 3F71A 3F7MA 3IDAA 3LLCA 5H3LA 2CV1A 5LHGA 3DDZX 3MXTA 1ZMOA 2KHZA 2WICA 3A58B 3FTNA 3PFGA 4KVAA 4K46A 5CCDA 3TLZA 1RPRA 1V6AA 4BMSA 3O1JC 1EXVA 5TNXA 1R00A 1TE2A 1Z16A 1GP2A 2O2DA 2HDOA 3OLYA 2DH5A 2NMVA 4IX1A 3T99A 2JGJA 2MHCA 3WMRA 5JW6A 3CIOA 3HLKA 2JCGA 3Q8MA 1WSBA 4QJIA 2WVGA 3HCRA 2RD2A 4I5DA 2B99A 3WRYC 2UUBB 1N0NA 3PD1A 3SMQA 2W43A 3IKLA 1YIDA 3NBXX 1PJSA 4XA8A 4DMMA 4NR1A 4ZK6A 4AY6A 3SHTA 1JWBB 4OSOA 2VZLA 1VQ6V 2XCLA 5BW6B 1Q50A 3S3TA 1ZCZA 4L08A 5K6RA 1FJHA 2VQ3A 2XYPA 1L8LA 1Q43A 1QHNA 5JNLA 1GNQA 2JZOA 3SSAA 4FLZA 3LQRA 3ZCCA 3VKWA 2E3CA 1V9LA 1T3GA 2OUIA 4IIHA 2WSIA 4C88A 3GCDA 3OBIA 4L22A 1EVIA 1E1RA 4UJ5A 4GKJB 1NVEA 1Z2AA 5A9GA 2QGFA 2JJ1G 3PQCA 2OO5C 1NW6A 1PKEA 5JH7B 3VAZA 1GR1A 3OCQA 2WJ4A 2GTPA 4BFXA 3KWJA 2ACEA 4XCVA 2CE4A 4ZXFA 4CEHB 3FXAA 5BW8A 5F2NA 4K8OA 1XZDA 4S05A 5EJAA 1ORIA 5G3ZA 3HYTA 4P84A 2AJBA 2Z56A 3RRJA 4Z51A 4HNUA 3G2QA 3D5TA 3NRCA 4IZHA 4M0DA 4RWZA 1SUWA 3OE7G 5DNEA 2UVPB 1EK6A 2B34A 2X3UA 3OQIB 1JEQB 1NXWA 4JMPA 1G8PA 2E4ZA 4R05A 3ZJZA 2BPOA 2J0UB 4INPA 2V74B 4N9QA 4X64O 2B30A 1AOXA 3EDOA 5LP6B 2OC4A 4TV9A 3FHJA 2QN8A 2V4UA 2NNLD 1DC3A 5LIPA 3I01A 3MHHC 1A5BB 2W6MA 3HJAA 1VYUA 1H4TA 4JGBA 4RHUA 1GARA 2HCJB 3PNVA 4WGFA 5DYWA 4BAZA 4CCYA 5JMWA 4Q6GA 3PDIA 1E1RG 3CZAA 4KFUA 4PG6A 3G2PA 5BWOA 1QRSA 1SC9A 1UT8A 5KNDA 3BZWA 1E89A 2FPGA 2WW8A 3E8HA 2JCYA 3B36A 3KVOA 4CQMA 4EYEA 2CLEB 5BN5B 5CLFA 5AW6A 1T2CA 1NTOA 5COBA 2AGAA 3UQ8A 3R2JA 4W5WA 2CT8A 4HN9A 3UMRA 1XTZA 3V5NA 4OY3A 2WNSA 4E11A 1Z25A 4GD3Q 2C1EA 1QB8A 2OXEA 5IJ0B 1DKRA 3TLYA 5K3FB 4JSRA 1CS0A 3WB9A 1WB5A 3RODA 3G1TA 2FG7C 1YD7A 1SC4A 3DNPA 1X14A 3DB2A 3OE7A 3P9ZA 5TPZA 3VPFA 1FNNA 3R5HA 4KPGA 4TLAA 1O94C 1OAAA 1BXRB 4R8KA 4C4SA 4KU4A 3T3DA 5C0OE 3SGIA 3QHQA 5AI5A 4CKZA 3OIFA 1ENVA 4ETIA 2CLLB 1XYGA 2WC1A 2IUYA 3JQAD 3ZC3A 4U7DA 2R8OA 2ARKA 2F55A 4PQFA 3S2YA 2VCYA 3OQJA 1A9QA 4KKVA 3A3YA 1J0XO 3GWKC 4HAVA 3DEJA 4EHKA 4RACA 2AFHA 4CG0A 4AKGA 2EFDB 2FZKA 1RHMA 3TXAA 2PQ6A 3FHTA 3CHYA 2Y67A 2VYFA 4L8YA 3V8RA 4D4MA 2WJAA 3NM5A 4G56A 5DYNA 1WVIA 2WTMA 5LMNB 5HEKA 2WHYA 1X70A 1IG0A 3FFAA 4UHDA 3ZCXA 3MQFA 3LDGA 1TK9A 2HU5A 5COQA 2ZR0A 3R7NA 5DNVA 3DCNA 4OF4A 5JQGB 1F8UA 3O2QB 4JP5A 4RD6A 2FXVA 3P3NA 3PKZA 5IWAO 4OKIA 1R6DA 3I9MA 4CHTA 5KTMA 1CUBA 2D1FA 2QWOB 1W5BA 3CTPA 1Q7TA 3LY7A 4TRJA 4H3HB 3KSBC 4MP8A 5D3QA 1I4LD 3I5DA 2G72A 2OUKA 2WKRA 2YS7A 3I9JA 5LLDA 2I2DA 1NVVR 1VI5A 2CLFB 4NXMO 4CEJB 2RBGA 4XYEA 3HGTA 1MRZA 1SUPA 3IV7A 1QNFA 5C8YB 1JJFA 3KLBA 2HU8A 1CQXA 4M7OA 4M46A 3B7WA 3E53A 1G20B 1VPEA 2O5RA 1L5GB 5IT5A 1Z5NA 3P9RA 1NI4A 2PBLA 4CKWA 4EPRA 2HMWA 1ZCBA 1FX0A 3BDVA 3PKJA 4ARSA 3ZG6A 1I24A 4ZEXA 3VH3A 4M8SA 1QGYA 1SULA 2P8JA 1Y6ZA 4IVRA 5JIBA 3SHQA 1IBKO 1T34A 3I3SR 1YACA 2GD0A 2X0KA 1V48A 1MA0A 3PE4A 5AQ1A 1HT0A 2QY6A 2YL2A 3QH4A 1H2MA 5KI6A 4CMHA 1H0HA 2PEZA 2XB9A 1U7WA 3JQBA 3EC2A 1NM5A 1Q82W 1NJ1A 4J2HA 4TSFD 5DCYA 2A94A 4M4SA 1XZCA 3RC8A 4O8XA 4ESHA 2PQMA 2PX6A 3MELA 5KYKA 1WPXA 3SLRA 4M8LA 4Q15A 3SSMA 3TO5A 1THZA 4B3RB 1UMKA 2VSFA 1JA0A 3DOJA 4IUYA 3JASB 4JITA 1TOAA 4NBNA 5DU2A 5U4XA 2DBZA 1ZUQA 2PX8A 2P78A 3DVLA 2AN1A 2QM7A 3QPCA 4M60A 3U7JA 5BOSB 5EK0A 3RWBA 3SR2C 3GT3A 3IB6A 4RFVA 4J49A 1MIHA 3V7UA 5JNUA 1MT3A 1NUUA 1OXXK 1E62A 2IDMA 2IYEA 3SYLA 1U2TA 4QUKA 1EN5A 3L1JA 2PUGA 1B3BA 3OD5A 1FQWA 2CK3G 2ZJZA 2NO5A 2COEA 1H05A 3JYCA 1NUAA 1S2IA 1YNSA 2R9VA 1PL7A 3B6EA 5G4LA 3AMVA 2BFBA 2VDKB 3FB6C 3ZDZB 3ZTWA 4CTKA 2ZBGA 3GMSA 4L4RA 2YC2C 4MHTA 2ZM5A 1M0EA 2H5LA 2EG9A 2B4RO 1R73A 2WTXA 1E63A 4FYJA 3GIWA 4YROA 3FDXA 4XYBA 2LNDA 4MO2A 4MWBA 4W82A 4Y0NA 1TC1A 5A62A 1VQ9V 2J0QA 4O2AA 1XAHA 3QVKA 3O2JA 4B9AA 3IKTA 3BTVA 1QHHA 4L5AA 1QK3A 3DHYA 2QRKA 1J90A 2I71A 1DAHA 3EXHC 1JHQA 4PDRA 3DOUA 2NPIA 4F5YA 1QB7A 4JGGA 3KOOA 1AHHA 1NE2A 2BFMA 2UUPA 3UKMA 4NS4A 4P32A 3K1YA 4XWGA 4DAEA 3EXG2 5L3CA 1PJBA 2R6R1 3H5TA 4UASA 3KXLA 5AKYA 2XBMA 2GR9A 4DR6O 2GPBA 2LQTA 1VYTA 2Q4EA 1W0JD 2QTFA 3G7SA 4HWGA 1EDBA 3OZUA 3TRHA 1VJ1A 3V80A 1KAGA 3CO0S 1RS0A 2YWHA 5FI5A 3GRUA 3Q3HA 1P6QA 4LV8B 3R7WB 4RA9A 5JVDF 3CU5A 1Z2GA 2CHVA 1TEXA 3ED5A 3IVXA 3IXLA 1YI0A 3MF4A 3VGPA 1M1XB 1EU1A 3ICOA 5FLXN 3V4FA 4ZFRA 1FXWF 1P33A 4YVFA 3DC5A 3GVHA 4N0MA 2RDMA 4DCVA 1TJNA 5TPWB 2IX9A 4MSMA 2V54A 5CDTA 2GJ4A 1JDSA 1GA1A 1LTKA 1NMXA 3W7AA 2NLOA 2OKGA 2R62A 1LCIA 1KZ9A 2PJZA 3OX4A 1TEZA 3UJDA 3UA3A 2G80A 3R0JA 2DQSA 3E15A 2O0HA 4A3SA 2B1QA 2W8BB 1NVDA 1AKVA 4HXEB 3W9BA 4MDEA 4N48A 1U3FA 3A3KA 2C1XA 2CN1A 2FGKA 2P6PA 4BFVA 3R65A 1TJ3A 3DE6X 3H6GA 4JJ8A 4BV2A 5IANA 4CEJA 1JT9A 2GK4A 1MZVA 3FBWA 3SHVA 2NUPA 4WBXC 2GBCA 2GHRA 2E85A 1U0TA 5D5QA 1RM0A 3BHIA 2DFVA 5MN5A 3KQLA 4UXNA 4NU0A 1SXJA 4ZCIA 3OETA 3ZRWA 3M6LA 3NTQA 4XEUA 2Q67A 2EKLA 1YHNA 4RL6A 1SHUX 2H4JA 3TIFA 3WL6A 1YR2A 2Q0HA 2CC2A 3BJRA 2JIOA 3Q3CA 2P1DA 3UPUA 3NANA 3QKSA 3X1MA 2DR2A 1CRZA 2PK3A 2OBFA 1O3YA 3A37A 1Z0SA 1E1NA 3QU4A 5B55A 2O8NA 1Q5OA 5AM4A 1PVVA 5G2OA 1O9BA 2UXCO 5BV2P 2PMDA 4HH0A 2MDTA 1JLKA 1M1YA 3DPSA 3RIMA 5JD4A 3R9WA 4GYKA 4XYGA 3OLXA 5GJBA 3FFTA 5B36A 3QELA 2LV8A 1H2RS 2PWPA 2YVAA 1ANKA 3JAMN 1FBTA 1TGYA 3BRWD 3N28A 4PBRA 4V0OA 4B4WA 3FAVA 4GIBA 4P5DA 1FTQA 4OAPA 2IU0A 1R0RE 4J7CA 5ALXA 4YAEA 1UXJA 2WM2A 3ZWDA 3QIAA 4KL8S 1LPOA 2GVZC 2OCDA 4LZPA 4N6NA 3MBIA 4I36A 1R1DA 2GF9A 4DLLA 4FMCB 5L40A 4KITB 4E09A 1BVHA 3ZN1A 1E2MA 4NS1A 3JQFA 2QF7A 2C9MA 4FW8A 5EPEA 1UWZA 1XUQA 4LQCA 3WLEA 2BUCA 1S8FA 3A6LA 3I9FA 1U0BB 2WEKA 3BVOA 2AI3A 2DOKA 2G09A 3ZWCA 1KQOA 5TARA 3NAQA 3FI0A 3WFJA 4CQMB 3PV0A 1OFHA 4GBED 4FM9A 1JG2A 1U2ZA 3QVJA 3F9RA 3GVPA 3FF4A 5KNCH 3WMEA 2HA6A 2JB9A 2IV7A 2C2WA 1IUPA 1RMQA 2G4VA 4ZV4A 1I6KA 1TM2A 1Y3DE 2GZSA 4G0NA 1NE7A 3P0EA 1YGYA 3AJAA 4NV1A 1JYSA 1HZZA 1R6KA 1ONNA 3COPA 1P2BA 2GK7A 3GZNB 3HVKA 3JRNA 4MEBA 4HYYA 1QUFA 3OAAA 4KLAA 4TXJA 2H17A 3VQWA 4U9UA 4Z3DA 5BSUA 3SYNA 1XZFA 2PV0A 4YRIA 2ZCEA 2F9FA 3IPRA 3ASOC 1ONOA 3N3AC 3O82A 3ZHYA 4H7HA 4BASA 2N74A 1GNSA 3ENKA 4JI1O 5JCOA 1GPDG 2AIRA 3OZTA 1N6OA 4MKGA 2O4UX 1XK6A 2BSAA 2L2QA 1TQDA 3E9MA 4OBEA 4PGAA 4WFIA 1AB3A 2FH5B 3HG7A 1JEEA 3RFVA 2PBFA 4KE7A 2R84A 3AZPA 1ZJ4A 4YIPA 2ATKC 4KAFA 2O3KA 1O97D 4WLNA 5CTAA 4FMDF 2O7RA 3HXOA 3L1IA 4BNDB 3HXMA 4CI9A 1TIKA 3L93A 1YULA 2PRZA 1ZW1A 5DLDA 4YAIA 4M53A 3MJVA 2X6AA 3MYRA 4GSYA 1VBKA 3F47A 4KE9A 4DV7B 1I14A 2C3MA 3VYTB 4G5HA 3S27A 1F4MA 4TRMA 2C4HA 2QA5A 5FKJA 3ZJ5A 4C0AC 4JYPA 1E69A 1T9GR 3CGWA 1BN7A 3R6GA 4YGYA 5SYNA 1W49A 4BAGA 4YV2A 3TFWA 2YVUA 2JGNA 1SXPA 1QF6A 1F17A 4NONA 4QPZA 4HVAA 4J0KA 3G0IA 5TY0A 1ZUIA 3T41A 2FN9A 4D9JA 1E6KA 1VRVA 2QN6A 4D4HA 1XD9A 3R9KA 3RTDA 1JDJA 3NQ41 5EFZA 3APQA 4JI5O 4DMLA 1L5HA 3FHLA 3UCFA 5C1DA 4OQMA 2OPBA 1MG5A 2I91A 4C14A 3KJNA 4CMAA 4KRXA 3NR7A 3K94A 1R9NA 3MAGA 2B4QA 1IJKA 3ECSA 4FQ8A 4ZEWA 2H94A 2X23A 3NCTA 3OF5A 2HA5A 1G7TA 1Q74A 2YWFA 3H5AA 3TB6A 1BE6A 2PKYX 4H31A 2Y27A 5IE9A 5D2CA 4RS3A 2VS0A 1K34A 3E8BA 3QWAA 2YIMA 4B3JA 1EXNA 1WX1A 2VEDA 4Z7JA 2ZIXB 1VMKA 3WGTA 3L1VA 5GGXA 4MYHA 2WTEA 5IY5C 2O0KA 1ZS9A 3Q87B 1ZPDA 3MTAA 2NO7A 1C1HA 4M37A 4RVHA 3NIDB 3P2JA 1MZEA 1VCOA 4C78A 4PI2A 1UDBA 3PC3A 4Z1MG 3ZV3A 1USGA 2GD6A 3IS3A 4PFKA 3EZXA 3TW8A 2VDUE 5JQGA 2W71A 3L82B 3PNLA 3QUSA 4PX9A 4URYR 3VU8A 3H6HA 3O92A 1AHPA 5HX7A 4NQLA 1YS9A 3DZKA 2VJKA 3H05A 1C0IA 2A0WA 2D5IA 3A70A 3KYCB 3NNDA 3CS5A 2Q1XA 4RK5A 3LQKA 4PSVA 1JR9A 4PC6A 3TW6A 4AWBA 3EK2A 4UCWA 3V4LA 4RSMA 2QE7G 3ZXIA 3LDCA 3K0DA 4IJVA 2FPLA 4FP9A 4TWKA 2ADMA 4A5OA 1RC1A 3TM5A 1RXWA 5B6IA 3KSUA 3TOCA 2QZPA 2VOEA 1KKMA 3BDAA 3MIIA 4O2RA 2Z5FA 4KW7A 2VHXA 2Y0BA 4BNLA 6PFKA 3B8FA 2JVDA 2QTCA 2FF7A 1QO9A 3PGJA 4F3CA 1P7ZA 2VWKA 1P1BA 1T1GA 2SHKA 1Q7CA 3AR2A 1TKCA 1X8KA 1TMGE 1XQ8A 2PUWA 4QDOA 3I3OA 5THKA 4IH9A 1TTTA 3ZLJA 1UT5A 4TXHA 2DB3A 3EY4A 3K09C 3UOGA 1XNQB 1KQ3A 4EJMA 5ALVA 4HO1X 1X4TA 1YA4A 1NSYA 4DUZB 3CIFA 3F67A 1CDEA 3OJXA 4RC9A 2ZR8A 4X8OA 2XQGA 2O8DB 4W6QA 1MV8A 2WF8A 1DBPA 3RG2A 1EJ0A 3TVDA 5KZMB 1M3SA 2LTAA 1DBWA 5LZ4A 2PUFA 1CP2A 1Z26A 2AJLI 4PHHA 4EFKA 3BT7A 5FI0B 4KEAA 1DQRA 4JP2A 1NBOA 1UPGA 3SE7A 5EKUA 1ECJA 4Z1OA 1ND6A 3U6KA 1EAYA 2B82A 3KT6A 3O1HB 5AIAA 2GBGA 2XTJA 2H6EA 4NSNA 5JRJA 4PIVA 1NUSA 3C4QA 2P4VA 1GPYA 4BMZA 1P5HA 4FEGA 3E1UA 4IR7A 5C7LO 2ZVQX 3F9IA 1LX6A 1MG1A 1USWA 3KVVA 2EKDA 4IOLA 4NH4A 4QBHA 5KX5A 2H2FA 3CKMA 5FWDA 1A8UA 1TMOA 2CH7A 3JATA 1VTKA 2R8RA 2ZSHA 3QW2A 1JG7A 5LM3A 2TRSB 1JN0A 1XPJA 1F7UA 5AK4A 4BLUA 1UDXA 3EGOA 3ZN0A 4EWLA 3FPJA 3SHOA 2W22A 3TCKA 3GDWA 2AMLA 1CDDA 1JBKA 5DBEX 4ZI2A 2XUOA 4EARA 3H4IA 5TGTA 3W9YA 4Z0TA 5KHOC 3OOWA 2I22A 2CBGA 2BGUA 1BXGB 3C8MA 1CRQA 3MWGA 4HFJA 1IPFA 3PB3A 4M6WA 4PQYA 2JLBA 2F00A 1I33A 1N6PA 5K0FA 1VECA 1PFKA 3JVEA 1E3EA 5A5VA 3FB7C 4ZT7A 4NARA 2IIVA 2HF2A 1KI7A 3A7EA 3EH1A 3AEKB 3GZNA 5B1NA 1P5ZB 3H11B 4WERA 4YX9A 6ABPA 5LBIA 1S5LZ 1D04A 3D3WB 3BEHA 1RCUA 1P72A 2EZUA 2VDLB 4L3OA 4TL9A 4F8EA 4BIIA 2EHJA 4I1UA 2DT8A 1SCIA 3KWLA 5AVZA 2DLNA 4MVOA 1TNDA 1PL8A 1E0SA 4MCAA 2WIGA 1CZHA 2HKOA 1UM8A 2JVIA 2WM8A 4U2BA 1SCKA 3S1LA 3CCLV 1XC7A 4YR7A 4IDDA 2JH9A 3RHSA 2DXIA 4D7SA 3WLFA 2NU8A 1IEXA 4JBIA 2G1PA 1MO3A 1Z6XA 1RLUA 2Q6TA 2VN8A 1US8A 4NZOA 4KYIB 5D3MA 1D8TA 3HY3A 5HBRA 4Q1AA 3ZDEA 4C0XA 4O3MA 4UBIA 2KW5A 2WABA 3NUGA 1RBMA 2CFOA 4QJ4A 1GPAA 1IN8A 2E7ZA 2YICA 4O02B 1W96A 3EA5A 1M5RA 4NYIR 2BFDA 1PQWA 3PCTA 1QG2A 1RKQA 1ONSA 2GPYA 2ZBEA 4QDJA 4AMZA 3O1LA 5FNZA 3C2QA 1W1UA 4BMOB 5I8WA 1UL1X 3OEED 3AM1A 2VTBB 1RCTE 2D4AA 1ULHA 1M76A 1REQA 1S0UA 1MOPA 4YMSA 4DDMA 3WSTA 4YH1A 1SN7A 3IIKA 4F85A 4DV4O 2OV2A 1DAFA 5D7NA 3FPLA 4D7TA 2QWQB 4IH4A 4U6QA 4XOUA 1PRYA 4YGXB 5FQOA 3UMBA 2ZYGA 4PA4A 1DAKA 4AS3A 4CTMA 3TM4A 3K72B 3RWOA 2X8JB 3LCRA 1NNI1 1SQPH 1X39A 4O59O 4A36A 2PUEA 2F3SA 2Q9CA 4LGMA 4UW9A 1P2UA 2XKJE 3OLZA 5BQPA 1E2JA 3U4MA 2PLNA 2QKCA 3PXGA 4EEQA 4P38A 4HWRA 3IPLA 4J3FA 4WVLA 5IPFA 3BF7A 3EFOA 1LQ2A 1UMBA 3CKKA 5M3BA 3FX7A 1OXVA 4JI8O 1LF5A 4E94A 4BKMA 3FPAA 3TQOA 3H1PA 5F3DA 1G42A 3OFNG 1VJ5A 1SUCA 3VR1A 2VKQA 2OXRA 3TW4A 2H57A 3GP8A 3ZEDA 5J3JA 4B3MO 3PXDA 1T9ZA 2Z4RA 5HK9A 2C8LA 1FYXA 1N6IA 1YONA 5AVJA 3T5PA 2C2ZA 3IBYA 2QM4A 4ENVA 2ZCJA 1PR5A 1YIOA 1W34A 3H1JH 4J9ZB 4MVSA 4B45A 5FOQA 4UCVA 2PO5A 1TXGA 2UYGA 1RRGA 1YUNA 2Q3CA 4LBZA 4W9NC 4XDHA 4MKFA 3GPLA 3LYLA 1A2KC 3A9VA 4Q9HA 4AECA 1PSZA 2Q28A 3GLVA 5GINE 1TCVA 3N2LA 5LHHA 2CMGA 3KT3A 1F5SA 3BSFA 1ZL8B 1YR3A 4GVLA 4LZWA 5FPYA 1N5DA 4QOJA 5JD3A 4B7ZA 5C2OA 1QH8B 4RA6A 1L7XA 4Q3EA 3ABMB 3FYSA 4BCDA 2ZYTX 5JANA 5CB4A 4MVJD 4WPGA 1S02A 1BZKA 1ZEJA 2A0KA 2VRBA 5C1BA 2EFHB 4L78A 4JELA 5IT0A 3EGDA 1JB1A 2J5XA 3IODA 1DBVO 2OT3B 1KNQA 5TGZA 3ROPA 5BV0A 4A92A 2XZTA 1J0CA 1BE1A 3NVDA 2Y3IA 5EUQB 1P9NA 3MGKA 4R50A 3AOEC 4WUTA 1STOA 3LD9A 4ECEA 3KCXA 3FUWA 5KLVH 3CEJA 4LOLA 1RNLA 3WHKA 4D9KA 1RWBA 4HB0A 4BDSA 1W29A 5L6LB 2V5UA 3LXRA 4NCAA 4X7BA 3TAXA 4XR9A 1L1FA 1KZ6A 5H68A 2EKQA 2GN4A 4F38A 2FX3A 5A3SA 2FWMX 3I23A 4IOMA 5FV4A 4IGAA 1HYGA 5DHPA 4CZZA 1WXQA 4E2YA 1Q7RA 1ZNYA 5JQWA 4D3SA 2XSZD 2VJBA 2WR8A 3JQPA 1NR1A 3ABKB 3NEYA 4L9WA 1OBFO 2DPXA 2WLLB 1CQWA 5CX1B 2NXNA 1CHNA 4MGKR 4YQYA 3CCBA 1WQ3A 4CIVA 3V7FA 1IRXA 1H3FA 1HR0O 3O4FA 2YYYA 3SJBC 3TLGA 3UV3A 2MSCB 3HCCA 4DCOA 4UXHA 3Q2IA 4IIXA 1RRFA 1J42A 1XCPA 4KXYA 2EBUA 4CMIB 3KJZA 1D2RA 5IYZB 1L8XA 4ZQEA 3ZGLA 1GL9B 1NASA 2DUMA 1YV9A 1N2BA 2JJMA 4YCCA 4KPFC 1T1RA 4TUYB 1ZD2P 2X5OA 2B8JA 4KSBA 1RFYA 3R75A 2WKWA 3C41J 2B98A 2R00C 1QVGU 2AZ0A 2UZ1A 2W2KB 2E4XA 4X8LA 3K0CC 3HB5X 5LBUA 3SHWA 4E3WA 5KOHA 3L73H 3CB4A 5A6SB 3NH9A 3L3BA 3R3SA 2VTKA 4C6HA 2CWDA 3GFOA 1L5SA 3K4QA 3O2SB 1HMPA 2IWRA 5KNCD 3SD7A 1E6UA 2CNLA 2FZLA 4YRDA 5EE0A 1P0PA 3FX2A 4J1TA 3TUJC 1Q7YW 3VNUA 5J2UF 2PMCA 1IIBA 5F9HA 3UATA 1QIEA 4MA5A 1QQ6A 1ZGGA 1FVXA 1MABA 4MV5A 4OGWA 3ROMA 1JEYA 1O1YA 1KOLA 4EGQA 2VSYA 3U10A 3BPSA 5FWXA 4JLWA 4RGQA 2AUNA 3D7SA 4V2UA 2HBZA 1J2RA 4JOQA 3HN7A 3SBEA 5KOIA 1SBIA 1X7WB 2CSUA 2EX4A 2JLAA 4ZHQF 2YMMA 5LP6F 2PX5A 3C16C 3SX4A 5IF3A 3B2QA 1QF9A 2GAFA 4RK7A 5FNVF 1BD3A 2KQUA 1W46A 4LF4B 3BHNA 1VHLA 2BEVB 2FV8A 4NU8X 5EQDA 2WTAA 1SJ9A 1OWPA 2ZRKA 1Z6AA 2RGEA 5SZKB 1XNRO 4A8JB 4U5XA 5ERGB 4ALKA 3GQBB 5EXXA 3PC2A 5DM70 2VLIA 4WINA 1W4LA 4YT2A 3M4NA 4KI0A 5HKAA 1AILA 4DADA 4G86A 1WDKA 5LQJA 1RZRA 2OHHA 1FIUA 4BZQA 1B1CA 1YB4A 4MGIR 4RSGA 3ORSA 3NOVA 3S2EA 1N8TA 1OUMA 1Q1AA 1XD2B 1XXHB 2IKQA 1S2DA 4TTSA 1W59A 4NHOA 4TV8F 3JD2A 1U6JA 1MX3A 3GYBA 4IY1A 5JO9A 3GBPA 4U2DA 2RSLA 3CUVA 4Q00A 3QU5A 3OBBA 3QEOA 3KXIA 4ESEA 4OPAA 1KGDA 5F73A 3WY9A 2FRXA 5E9QA 5JS1A 1BMTA 3TQHA 4G5OA 1XPRA 2BR5A 3I30X 2Q8PA 1FLDA 3KHKA 4M9UA 3U0BA 1SHJA 3PTZA 3W5CA 1P8AA 2PR2A 5H9VA 3SBXA 2EWWA 1H6DA 1L8OA 2JCVA 2PL3A 3DE2X 3SPXA 4DM4A 4O4LB 1YVWA 4M3NA 5EQFA 3FCEA 1F9EA 1IFXA 4KHZA 1VIYA 2DWQA 3SLGA 4Z4HA 2FZVA 3E5MA 3EHEA 3REFA 4H44B 5E1MA 3RU2A 1BX1A 2VHUA 3LHKA 3G2OA 2FR0A 2F9MA 2X5XA 1ZXBA 1BGVA 4HDSB 1SVSA 4LG1A 5FPHA 4DR5O 2IEBA 2GGSA 2AQ8A 4YQEA 4JJEA 2IP2A 2JBWA 1S7GA 5K51A 3SC2B 4Z9BA 4L6IA 3TFOA 2AG8A 2O59A 2GA8A 2XWSA 4ZCLA 4BJ3A 3JAMA 4BJ6A 1EM8B 1G3RA 1LFDB 3L6BA 1AKEA 1CFJA 2ZDIC 3DLTA 3N2IA 4H7PA 4ODIA 1P9OA 1EUQA 5BVGB 4HYOA 4OX9O 3WIUA 2HQOA 5U1PA 5K6AC 4JI2O 1TQ4A 4ZOLF 4CRWB 4MJ7A 4ZYLA 3QX3A 1N34B 2G7MC 2JCXA 4NOJA 1G3IA 1QPGA 3KL4A 2OL4A 4F2WA 3BH1A 4PQTA 3OSZA 5EQTA 2CVQA 4EKYA 3HBNA 4A16A 2E5LO 3EUAA 3ICEA 1DGQA 1I3CA 4NEGA 4TL6A 2FW6A 1AS0A 2VQFB 5T5QA 1E1QA 2YXHA 3OFVA 5CDYA 1PLKA 4WZAA 3VQTA 3PQFA 2HJVA 4PZZA 3WNDA 3AP1A 3AXTA 4RKYA 1DP4A 4ANFA 4GYCB 1SD2A 2QG4A 4UBLA 1QDUA 3LJKA 3QMMA 4EP1A 4ZK2A 4BVJA 5M7EA 2CAZC 1DGSA 1KRHA 3HRHA 1FZTA 2R65A 1ZD9A 1G41A 5AW1A 5FT9A 2J3EA 4Y3UA 3LU1A 4DLPA 1OMOA 1W19A 4P9NA 1N78A 2DGDA 5JECA 2ATCA 2BM9A 4A6DA 2QQ5A 1KVSA 4TTIA 5LGTA 2P0EA 1F7VA 5CR9A 4GRIA 2GH1A 2QZ9A 1Q3TA 3EHDA 1D9ZA 1NT2B 1ORTA 3K0FA 1N8KA 4HGYA 5C4IA 1LQTA 3OQHA 4PLHA 3RFRA 4JV5O 3R41A 1E79A 3OCXA 1TZJA 4YV1A 2VPXA 1Z6GA 4P7GA 3L1HA 5F21A 3I62A 3PNSA 5BW5A 2QAGC 3PXCX 5DISB 1I5RA 3EZ6A 2QRMA 4EQZA 3OWHA 4BO5A 1AI5A 2INGX 2GAAA 3OZ7A 3WZLA 5CXSA 1S4MA 2CXSA 2GBIA 2PRSA 5IAOA 3L7YA 1OH5A 2P5OA 3DXZA 1QTQA 1GUYA 3EFHA 1Y4DE 3BC1A 3QYJA 4HZIA 2V7XA 2CL5A 4Y1EA 1F0PA 3R5KA 4UNNA 3U09A 1J95A 4QBTA 3BIOA 3IP3A 3MNFA 4FWIB 4GLJA 1OU0A 4CM9A 6Q21A 3U1BA 4IMRA 3OTOO 3EPHA 1BE0A 3HR0A 2VP0A 1MB0A 4S24A 2BFCB 4PGHA 4A03A 5CD9A 4JYZA 2WVAA 3UNXA 3FGZA 3H1BA 5K0ZA 4AM8A 1D8AA 1ZH4A 2GKGA 4C4TA 1PVDA 1XVUA 2VJCA 4DC9A 4JYBA 4DV4B 1EVLA 4MZDA 4CMEC 3LA6A 4JEHA 2ZWOA 2IXFA 4G26A 1NI5A 3UGKA 2NP6A 3HCOA 3KFLA 1V5EA 4B6SA 3Q85A 5TQ2A 5LJIA 5BOVA 5ADHA 1Y5RA 4QTXA 5DSZA 2I3GA 5JROA 5CX1A 5DCAJ 2GAOA 4D3FA 2EZ4A 2EDCA 1UBOS 1LC3A 4YTEA 3ZXUB 1GNRA 2FETA 4KYUA 2ZRBA 3C39A 4ITRC 3P3PA 3HR7A 4DV6O 1GXSA 3FDJA 4XUDA 3O9OA 3BCSA 4LF8O 3NR2A 4HFMA 5AOVA 1EWTA 1UMCB 2JAQA 2CCKA 3CC2V 4DR2O 5IN4A 4NVPA 4DB2A 1M6VB 4K2HA 1YCGA 4E2LA 4OATA 1JVBA 2PBRA 3PVZA 4DBLE 4DNXA 4BLSA 4DRZA 2O4CA 2JIZG 4PR0A 3E1SA 3UO8B 3W0LB 2N1BA 3WJ2A 4ZDKA 3G2JA 4DCNA 2FUG6 2D1QA 2PXHA 2JJYA 1PWHA 2ZSBA 3G6BA 4QE9A 2ENUA 4P4NA 4S0ZA 2C2KA 4AD8A 5DWQA 2NZWA 3IBGA 4P0TA 3KYBA 4TVBA 3N27A 5IX8A 2EZ9A 3E1GA 2PLRA 4TRRA 2XADA 2CXUA 4KDFA 3L8EA 4LCUC 1K2VN 3RYIA 1R9GA 3E2PA 2W48A 4QQKA 4CIXA 4NOLA 4LWSB 2OP1A 5ESRA 5ADVA 3DBLB 3ZEFB 4DA0A 3TIGA 2FMKA 3EEFA 1VHJA 1QO7A 1DIAA 1N0HA 4EA8A 4YMLA 4RPKA 3AJDA 5I5EA 1MQAA 1UBTS 2N1MA 3LBIA 1H38A 3PNBA 4FQ7A 1XDSA 4GGMX 4HD8A 4RA6B 3MPOA 4AZVA 1XPOA 1Z4OA 1EFPB 3NG1A 1BMQA 3ZIAD 3DMNA 4TQFA 2QNRA 5JNRA 4JEIA 3GNSA 3RNOA 9LDTA 3FVTA 3FTCA 3STTA 3UHFA 3WBFA 1CRPA 3IAAA 1TAGA 1Z38A 3HJBA 4WW0A 3SKVA 4PSUA 1ONPA 1H2AS 1E2UA 1VQ2A 4XIYA 5BT8A 1LLQA 1SC1A 2GAIA 4ATNA 3ILSA 4ND3A 5AWFC 1XZ8A 5JS7A 1Z35A 1EESA 2QTHA 4UBOA 4L2IB 1YBMA 3AIOA 4UZFA 4BTEA 3NWBA 2GF2A 4URWR 3WGZA 2VT3A 3UG6A 4FZ3A 2NTJA 3LE8A 1EI9A 3E2MA 5ITWA 3R3ZA 4GC9A 1UBCA 4ZJZA 3OP4A 3DJYA 4RJ2A 3WA7A 1W5SA 2HYDA 1K98A 1RR6A 1XZKA 4PC2A 3HWWA 4X5OA 1C1DB 1Z2PX 2PL9A 3PEEA 4EKDA 3AP2A 1TTPB 2M32A 3ELYA 1U2GC 2HWWA 1W94A 2O2IA 4RK0A 4EBBA 5E2BA 2CLCX 2AUTA 4MUMA 3ZX4A 3SYAA 2BFFB 4M89A 1TAUA 1ZAYA 4ACAA 1KS2A 1LDYA 5HRCA 1EDEA 2UUAO 4WOKA 4D4GA 5AUNB 3EPKA 4CLXA 1E3JA 2PT6A 3AFGA 1DF5A 4N7JA 1K08A 1RPJA 1O5OA 1RKXA 4BECA 1G0NA 2R8EA 5JWHA 2ZNIA 1C4OA 1G3MA 1R8YA 3EAGA 4Y6PA 5EUMA 3IBCA 1W4BA 3DLHA 4LFAO 1J20A 1MH9A 2C78A 4FDUA 1DQZA 3KNZA 3RG8A 1I5XA 3WK9A 4WSOA 4A2CA 3BWMA 4YCDA 1CJKC 2QI9C 3F6PA 2EGUA 1HFEL 5IDJA 3KCYA 5I7AA 1Z4PX 4FHDA 2FUEA 1Y6QA 1Y6JA 2BFEB 2OGTA 4NICA 5FOTA 4A6PA 1V5GA 3EXEA 4AZ3B 1U1EA 1K7CA 2XX3A 1VIDA 3A3PA 3TVTA 5LYJB 2BHNA 4C7UA 1U97A 2XJ9A 1HDRA 4KV9A 4YEDA 3E4DA 3SXUA 1NOJA 5HUQA 3GAFA 1A9ZA 1TO2E 1JIXA 4HC4A 1MZFA 4JWTA 3JRWA 2QNIA 1GYQA 2WIDA 4DJTA 2VJLA 3CLTC 1L8AA 2R79A 3L8FA 1E0JA 1KAOA 3OTIA 3PQ6A 3B40A 1NXVA 3GRYA 3NH6A 1A4UA 2E37A 2J3JA 5CCXA 3HNRA 1Q81W 2X6BA 4YHHB 3RS4A 1IY9A 5C8YF 4IOKA 2WFMA 1JKJB 1QU3A 2BZ0A 5H9WA 5DTIA 5DTQA 3LW8A 1Y80A 3I5MA 1VKOA 1YJ5A 5LXTA 4JU9A 4CKBA 4ECAA 4GRDA 1M57C 4MW5A 4ML3A 3LFUA 1EIZA 3SQMA 5KYYB 1ZXXA 1H66A 5AK6A 1M56C 4M0FA 1I7LA 5L51A 1ZU4A 3FUVA 4URFA 3T9FA 3IUQA 5EKDA 3CISA 4X3OA 3SMVA 1N3LA 4HLNA 5CIWA 4EHDA 1H8HD 1E2LA 3ZJUA 1E2PA 3BUSA 1ZUNB 3IH5A 1GAEO 1L7PA 2Q99A 1LBEA 2P4EA 3ZY4A 3R1IA 3C3SA 4F9EA 1QRAA 3MTBA 3GP5A 1EFCA 2Y68A 2A35A 4FDTA 5J2TF 4DFDA 1YXBA 3D3JA 4D9HA 4N5LA 3LUGA 3CR8A 1V37A 5A05A 4CL3A 5KDLA 3FNIA 2OSVA 5FPQA 2YN0A 2AWNA 4D57A 4DA6A 1LNZA 4FZJA 4Z4FA 3GMTA 4ARZA 4P93A 2NX8A 1S1CA 4FOOA 5IAAA 1FDVA 4YUYA 2YQ4A 4OLAA 4FE7A 3CRMA 2YBDA 3AF0A 4X84A 1P77A 1G5QA 2BCEA 4GMHA 5JCXA 3A4VA 3TKLA 4M38A 4C21A 3NATA 1DXHA 1RI2A 1Z8HA 3TZLA 2R25B 1ZONA 2IFTA 1S6YA 2ZB7A 4BNKA 4IGGA 2JD0A 4YXFA 4KR2A 1A4XA 4RPJA 4TZTA 2FQYA 4X66B 3FNBA 3PJDA 4DIUA 3NT2A 5DLYA 4MLCA 3HBAA 4LDPA 1F1BA 3E8XA 4MQFB 5A4DA 4Y6LA 1AUXA 1P29A 4HNAB 4MVWA 1JQ5A 1TUBB 4UAVA 3TI9A 3VJLA 3RT3C 4A0FA 3GJXC 2JIPA 3LRXA 7REQB 1RQGA 3BY6A 4DO2A 1HOTA 2D2EA 2DX7A 3NBMA 3NI2A 4JNKA 5AR1A 5F7ZA 1QR6A 3IAM1 3QKUA 4TZ6A 3EDQA 4H0CA 3LC7O 1S01A 1U5BA 2OGSA 1E9AA 4RORA 5ALZA 4QGGA 5LZ2A 1DV1A 5P8WA 3N0RA 1Z0UA 3NLLA 3TX6A 2RJZA 4MVJM 4BIZA 1E4EB 4BE7B 4B81A 3FAVB 5B2FA 2Y0PA 1MT0A 2BOCC 3CF4G 3ZMTA 2EIMB 3KBBA 4IUBS 3LP5A 1IMJA 4JQSA 4LF9B 2PZJA 1NRJB 3BB3A 2O57A 4IL5A 1U04A 4YR9A 1ZY2A 1QIJA 1GN3A 2XYGA 2AV6A 4NQZA 4GX0A 4HBNA 2CD7A 3WBJA 4KGXA 4BATA 5H3CA 4U7NA 1HTWA 5GM1A 3BYZA 3OM0A 3MBOA 3ZHBA 2DPMA 3QKSB 3K5HA 3MIZA 5IAKA 1SESA 2JEYA 2OCXA 4KLCA 5BN4B 2YMQA 4N47A 5JY6A 2XCTB 4KC0A 3HEMA 3Q7PA 4WMLA 4HDRA 2FWPA 2VKTA 4YMGA 3V2IA 5HIMA 5FTMA 4HX2A 2CLHB 3DVAA 2BKEA 2UXDB 1ZWKA 3LRTA 4OCMA 3RLIA 2J4CA 4DY6A 3OZGA 4MVJG 4YBRA 3WMGA 4AWXA 1TU3A 3B3AA 2GPWA 2RG7A 3DDHA 5HS6A 4B6OA 2X0LA 1N8RW 2MSDB 2GBPA 1EDOA 3A4IA 1ATIA 2EBFX 4HR7A 5DHRA 1RAEA 3QKRA 4CXMA 4ND7A 4DB4A 2O9JA 1XMVA 2E4VA 1MW8X 1CNFA 2XV1A 3C48A 2FI1A 3OP1A 3GJ0A 3U9TA 2F43A 1J07A 3IAS6 5LQKA 1V1MB 1UZUA 4IXTA 1G1XB 4P0QB 2ZJOA 1O95A 1WB7A 1P62B 3E5HA 1F38A 3GGSA 3ORRA 1Y7TA 4M1WA 2IYVA 4OU5A 3GC6A 3OQBA 4JYCA 1DWOA 1N2SA 4ZOEA 4AWAA 3BMQB 2DYRB 3GOHA 4CV3A 1XV5A 2COUA 3P2YA 1FP4A 1ISJA 1T0UA 3A9UA 2ZRAA 3SVTA 4Z4IA 1EVJA 1Z7WA 3MTIA 4MS3B 1MPTA 1OJLA 1D03A 1CY8A 1M1NB 1N6NA 2NXJA 2XECA 3LY9A 4K3UA 3TLCA 4DQDA 5CYFA 4RTQA 3KJGA 1TEVA 4ZICA 3BTOA 1VQPV 4AI8A 2RAFA 4LOIA 2VK2A 3LCUA 3NHUA 5EYPB 2QTGA 3HO1A 2QSYA 5J2TB 2PZBA 2FEMA 3QBJA 3GWOA 4NBUA 2YIJA 4P7BA 3JD0A 2WF7A 3HR4A 2XKAA 4BY9E 1NJIW 3GHYA 1W44A 3MINA 1MX1A 3O7MA 4L50A 5TSDA 5EPUA 4D80A 1DLIA 2EZOA 4YJGB 3V32A 4C30A 4XPIB 4E12A 1KO5A 5EHXA 7MHTA 2VZ0A 3MLEA 1TCCA 3TPZA 3VOTA 2BM8A 2A4KA 3AKZA 1NMZA 3PXAA 3LXUX 1OCRC 4RY2A 2I33A 2FGJA 2X14A 1U7OA 3TLGB 3B52X 1HL3A 1N1GA 3I9NA 2YY7A 3M8KA 4XGNA 2PSJA 1HT1E 3AK1A 3K20A 5DN6A 5UKDA 4X9QA 4KIFA 4WASA 3PYXA 4ABMA 2J4DA 4KO8A 2B3JA 5DM6V 4OEHA 1R6AA 2AHRA 4X64B 1TW3A 4NPCA 3V8MA 4PV7A 4QDKA 4L8GA 3V42A 4QO7A 5JT1A 3VU9A 2XRZA 4GUNA 2VP2A 3C3JA 2J30A 1FFSA 1H8HA 3NHJA 5TVGA 3SYRA 3WNCA 4LJYA 1XMPA 2D5AA 1MIOA 1VG0B 4R9RA 4YCSA 3JYNA 4TYPA 4QFTA 1V54C 3KUKA 1XAGA 1HNNA 4U7PB 1QYIA 2NACA 4S1TA 2X76A 4V1CA 2UYCA 4S04A 2XT6A 2HNKA 2OAEA 3D8NA 5H1YA 4XQCA 4ZI5A 3TGLA 3TEJA 2IF2A 4OQNA 5FUQA 1Z06A 2ZSAA 2X15A 5SYMA 1CUJA 5CG1A 3TOZA 3OJFA 2D5NA 2V7BA 3WFZA 1KYXA 2ZLBA 1U7ZA 5EGSA 3TN7A 4IIDA 2J6CA 3T9CA 4H27A 1KJYA 2FW8A 2X8AA 4M1QA 4P33A 4R81A 5KQRA 4CW7A 4G9EA 5KJ6A 2ZJ2A 3IO5A 3OCZA 4H1HA 2Q7OE 3HR8A 2ZZKA 5YASA 2HUNA 3IB3A 2QLBA 3V1LA 4CTJA 4W9MC 3ABTA 3IPCA 1YZBA 4D6PA 4Z1VA 3QLTA 4NYKA 3DLIA 3VU1A 3J81N 1TM4E 3OD4A 2Q2VA 3AHJA 3BGVA 3OX1A 3LSUA 2PWYA 3GRCA 3NAGA 4I1YA 1WEHA 3KVNA 3NYRA 2CLMB 1SUDA 4EHAA 3AVTA 2F9LA 3KTOA 4V24A 3MD0A 1ODJA 1R8SA 2X7HA 4R2LA 1ELOA 1OWOA 2ANCA 5IVDA 5BSMA 1HT2E 4H37A 3E70C 3AK3A 5CA0F 5IH7A 2ZSDA 2XAQA 1FUYB 4LNAA 2NZYA 4DW0A 1V1MA 3EVFA 3ONNA 3CQ9A 3P9CA 5EKTA 2A59A 3AESB 1GZ4A 4Q4JA 1JIQA 2OFFA 1QH1A 1PDVA 4LFBB 1KC3A 4PV1B 1TF5A 2XMQA 2LKCA 3S4YA 1CHDA 2WB2A 1XMIA 1V41E 4L8JA 5EAIA 4OGQB 3GARA 1II0A 3KQMA 3CZRA 1S3IA 5FYQA 1DEAA 2Z2KA 2PMWB 4TL8A 4IGEA 4LNUB 3SBOA 1CEQA 3C8HA 4MTLA 5DLQC 1X42A 4MKXA 4P36A 4Y2TA 2CBXA 2R6CA 2N46A 4MKIA 1UMBB 1QZZA 3NWEA 5IBPA 2WJPA 3M2PA 4E2FA 2XAGA 1P6OA 3HLTA 3CF0A 4OPMA 2V1DA 2AC7A 2HK9A 4EMUA 2Q6OA 4CETA 2QP9X 4G23A 4O63O 1G6Q1 4PFSA 3ZS8A 3PQ4A 1DS6A 2UYOA 2VHTA 4J0CA 4PC7A 4PNHA 4DMHA 1B04A 5L4NA 4YB8A 1TI7A 2YQ5A 4HDCA 5CLIA 4IWYA 2W2TA 3JYPA 3KB1A 1GAQA 3X2EA 2A7WA 4ZZ0A 3E7DA 1FMLA 1ECLA 3DE7X 3I1JA 5LBTA 1YC2A 2O5CA 5K3DA 1MMMA 3AU8A 1QH1B 1SQSA 1J21A 5G1OA 3WAKA 1NTKH 3SQXA 5FCDA 5KHLB 1XVLA 2I7CA 1PR6A 1TK3A 1E3DA 4WFEA 1AS3A 3AB3A 3BXFA 4J16C 1O54A 5EWLB 4ZT6A 2C2OA 2VDVE 1WP7A 2A5YB 5IVKA 2I8CA 3O4IA 3B2EE 5IUJC 2GASA 5LHIA 2QD2A 1MR3F 2V7QG 3V4OA 4Q7JB 3PPWA 1JL3A 2ZIGA 4KWEA 1B43A 1DJLA 3EG5A 3D0KA 3A9CA 3ICPA 4ZVQA 3FD8A 3JAWB 3H0CA 2FPPB 2FJ0A 2HFEC 2DWEC 5AJHA 5KAIZ 2XR1A 3NVMB 2GUGA 3K0EA 4P08A 4V0SA 3L1KA 1ZIPA 3QE3A 1BROA 1XQVA 4EPWA 1W4RA 4H35A 3V7WA 1AA6A 4F2PA 3DWGA 1KPGA 3HDJA 3OU6A 3WLAA 4B6QA 1R5TA 3ZPXA 2JFYA 4DABA 1QE0A 1QTNA 3D2AA 3F3MA 1G8GA 1M2WA 3EULA 4ISCA 5KKNB 1Y9DA 1YTLA 1VZ2A 4M87A 3MGBA 3FWPA 5LA6A 2AFRA 3QGMA 3ZW8A 1R8QA 2PPVA 5FNVA 1T8RA 1QE5A 2OQ2A 1S76D 3QLJA 4XTCS 5IDQA 1SC5B 2I9KA 1CG6A 4TV9B 1DXQA 2RH8A 3PTAA 2Z3IA 4HRQA 4KE8A 4MCIA 2OLEA 1SVUA 4MHSA 4ZARA 4AJEA 4EY7A 2CTRA 1IWBB 2NZVG 1QKIA 2G67A 4LH6A 2Q0SA 2O6LA 2WIAA 3IMCA 4I55F 4NCHA 4UU0A 4YJHB 2Z4SA 4ILKA 3HBMA 3UA4A 3SFZA 4YCMA 5HK8A 5BRNA 4MDFA 4YLGA 4BIOA 1N6HA 4OO3A 1GZVA 4C7MA 3VDNB 3ANNA 4DLAA 3ZE8A 4CLHA 4DPLA 3UAZA 4UAGA 3PHIA 4HDOB 4DJFC 1M73E 4F1KA 4ZQHA 2FPOA 4BL5A 3VYRB 121PA 4EYKA 2NZ2A 1GRJA 3GGJA 1WCIA 1QHTA 5HMMA 1Y6GA 1WHSA 5CVJA 2FR8A 2Q2OA 4HTFA 4R8CA 3LQ2A 3PUXA 1B16A 4OI4A 4Q4DA 3VAYA 1PGPA 5C18A 5IKPA 5MHTA 2OO5A 3TTTA 3UMMA 1JXAA 4ZVSA 3TJMA 1Z0FA 1Z8NA 5B3AA 1M8JA 3MMSA 1TD1A 4QREA 2IOQA 3A9WA 3RBVA 5I3CA 1I13A 1AP6A 1N2GA 2Z30A 4GP6A 2GYVA 4GWLA 3VI4B 1Q6HA 5LZ7A 4B3TB 4CQLA 2X6CA 2RK6A 2VP3A 3SHFA 1K88A 2IYQA 3EGWA 3T1HB 3ABSB 2HIAA 1I9GA 3ZVNA 2O05A 4KREA 3RVZA 2PS9A 5FPPA 1UINA 3DR5A 3W1VA 1YJNV 3ZWPA 4UU8A 4RTJA 1JF8A 2GV9A 3THSA 4MS4A 1JVNA 4P22A 4B9EA 3CNOA 3OA2A 5EJIA 1QJ4A 3UK6A 4ASUA 3DZDA 1E20A 1IHOA 2XEXA 3G71V 1QR9A 2HGZA 2WLTA 3PSAA 4JK3A 2ZT8A 1Q0QA 1DELA 3AEXA 5B1IA 3V4ZA 2C2BA 1PG5A 1PJ2A 1WSWA 2C31A 4X1YA 5GGYA 5DBGA 4CKXA 2XDWA 5CXQA 2NZUG 3KJFA 3WU2Z 3CNHA 1K4CC 2YQZA 1R9MA 2JCSA 3JR3A 3LX8A 4P83A 1N32O 5CUQA 1FPMA 1XLUA 2WG2A 3DZHA 2BMEA 4UNIA 3DV0A 3IT3A 1M1UA 3WRWA 2QTBA 4EPTA 4GKKO 4W5OA 3A3NA 1GOTA 3V33A 1M0WA 5KSPA 2O1WA 4CE6A 4QUBA 1S8AA 1JSCA 4IQGA 5FLYA 3TOVA 4B3BA 2V3VA 3SJUA 3N58A 4FLXA 1MXFA 5M59B 4XDLA 2FQ1A 3PYMA 4REQB 5C5EA 1WDWB 1NLZA 3ND5A 4PPGA 2CZQA 1MB4A 1B06A 5LMNO 2A1UB 2QL6A 2QRNA 1Z37A 4IKPA 4JLNA 4EAQA 1QOPB 3UKOA 3QVGA 2A5FA 4WY2A 4AF8A 4BUCA 4BO1A 3QXGA 4CN9A 5DEOA 4QLOA 4YDRA 3WGMA 4OUDA 4BZPA 5BSEA 3TXQA 1NT4A 2GHIA 2L69A 3H1EA 5CGQB 4J43A 1DJQA 4BQFA 2HRBA 3F1LA 2JHCA 4ZAXA 1FFDA 1HM5A 2H4WA 2HHAA 3OU7A 2VWPA 4PAQA 2ZANA 4YDSA 4BLRA 4E6EA 4EB8A 1DO2A 4I7EA 4MQMA 5LR6A 1OH8A 2IBTA 2BUAA 4DR7O 3HYCA 3VPHA 3E9NA 3MYYA 1KECA 1KVRA 2JGUA 1E7MA 2BBOA 3ET4A 3KUCA 4N12A 4EEKA 4DBZA 2NZJA 2JLWA 2NTVA 4YWJA 4RZ3A 1E9RA 4JAVA 4P9PA 1X7XB 3FTPA 4YRTA 3KELA 1K4KA 1TQHA 2VAVA 1JHVA 3AEUA 3PXBA 5A5DA 2EJRA 2P68A 5A5EA 1C41A 2XDYA 5B37A 4J7UA 1DQPA 4MLZA 2PMEA 5BMOA 3THYA 3FLBA 2FSSA 3KG2A 3DTVD 2BF4A 3GLHA 4M1EA 5JJLA 3FSGD 1NVPD 1X38A 2B2NA 3JQDA 4AL4A 2QY9A 3H2KA 1X6VA 3H4MA 2G9QA 1CDZA 4JLSA 1EGQA 2GHTA 4JR1A 5IJWA 1FDRA 2NUTB 3KQHA 2NU7B 3C7AA 3HDTA 3HO6A 4CBVA 1RC8A 2JAOA 4C4RA 5FBVB 4Q82A 3CFYA 3RC1A 3CCJV 1XJWA 2JGMA 1PV0A 1DDIA 3T1YO 1BJTA 5JXIA 3VHRA 1DZ3A 4DLVA 2I6GA 4HTFB 5DZSA 4PNZA 3GIDA 1X0XA 5I7RA 5CDUA 5GJCA 3U16A 4M1SA 4ZC1A 3D43A 4AJKA 2FX5A 3CTMA 1GGKA 1A7JA 2YWBA 5CYOA 5JYEA 2VLBA 4EHFA 3NKFA 2OXFA 1FMFA 2CMFA 4GF5A 3E86A 5K3CA 4BZZA 2VA9A 4M76B 3GI1A 3NVAA 3OJ0A 2VUUA 4DCUA 3HZHA 3INTA 4FFVA 4TZ0A 2ZRCA 4KMMA 2UXXA 4TROA 4EVIA 4O25A 1WXWA 2R1ZA 5BXZA 4P5EA 5CH5A 5FL7A 2RH9B 1LBSA 3HS3A 3UM9A 3TLBA 3TXXA 4FB5A 5C8XA 5K99A 3HXQA 4Q1VA 5KNDH 4IIBA 2DW4A 1JJ2U 2IL1A 3WBKA 3ZK8A 1GGNA 3JQ7B 4YP9A 1ZMXA 1NYRA 4RWEA 3Q12A 3RH0A 2A0UA 2F48A 2XE8A 3NU1A 3T0IA 4JI8B 2A30A 2Z08A 2VHCA 3WLMA 3ZYZA 1CY6A 1YCFA 3ASVA 3H9GA 3NBFA 2D5BA 4LV5B 4MQ5A 1X77A 1ZISA 2ZUDA 2HLDG 2IUTA 4ARVA 3P2MA 1RWPA 2I54A 1VP7A 1W4CA 1NKVA 2QTTA 1UXHA 2CZGA 2E4UA 3WWYA 5KWVA 1TRHA 3SP1A 2QN7A 3E8GA 1RWVA 5F9MA 1EK0A 2MR6A 4RVFA 4EUSA 2BWJA 3K0KA 3KPWA 4QOEA 4XD7A 2O2ZA 3T4EA 4D3YA 2O5VA 2BEWA 1BMFD 5D3ZA 5GY7A 2F1MA 2A0XA 4H6WA 4EABA 1SKUA 3FETA 2GPNA 3IAEA 1QBZA 3LNCA 2HSEA 3NHFA 5EZYF 3G8YA 1OJ7A 1RXEA 3RKSA 3CCFA 4YCAA 4ZOQI 4R1TA 2BHRA 2O2HA 3H3XA 4MW3A 2V6BA 1ZHHA 3TSYA 1GM9A 1R74A 4AJNA 4ZEVA 2J45A 1VRWA 1AHNA 3LXMA 4ZOBA 2CW5A 3ZCQA 4XQEA 3UG7A 2NSYA 1VJDA 2VXCA 1E1KA 1KEEB 1BCSA 2X1LA 3FMFA 3G2MA 3A10A 1F9AA 1OOEA 4DTCA 3U7QA 4XDKA 4LXHA 2IS4A 3UHOA 4JAVC 3RBZA 4IDNA 1EH5A 3KJEA 2ZIOA 3I8XA 4MR8A 4NFHA 2Z6VA 4RKEA 3WP1B 2Y2VA 3E9QA 5I9SA 1BRTA 2G6VA 1LDNA