2IU3A

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
590
structure length
590
Chain Sequence
b'RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
publication title Structure-based design, synthesis, evaluation, and crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
total genus 203
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2006-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2iu3A04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2iu3A01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu3A02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu3A03
1M9NA 1C3OA 1S8AA 1A9XA 3ZZMA 2IU0A 1BXRA 2XW6A 1B93A 5H3LA 2B1GA 4A1OA 2YVQA 1T36A 1P4RA 2X8WA 1WO8A 1S89A 1KEEA 1JDBB 4EHIA 1M6VA 1CE8A 1EGHA 1PKXA 2B1IA 1CS0A 2IU3A 1G8MA 1PL0A 1IK4A 1VMDA 1ZCZA 1C30A 1THZA 1OZ0A
chains in the Genus database with same CATH superfamily
2O1XA 5AQEA 1Z5OA 4DG8A 2WA1A 4EEXA 3FLAA 5C81A 2ZUBA 1O58A 2YJ4A 1WQ3A 4WXEA 1O4VA 5B1AC 2JI8A 4C0AC 1RJEA 3RBVA 4XQ0A 3I2GA 5F2OA 1JMKC 2P4QA 3TG2A 1MOPA 4KQ9A 3LWDA 5D6NA 3R66A 5JO9A 1NF3A 3V2HA 1FFEA 2QE7G 4KXUA 1ZM9A 5ALGA 4WQMA 3S2UA 1A9RA 1IQRA 5DB4A 1O08A 5FD8A 4UU7A 2X2PA 1XMSA 2QVCA 5EG5A 4A9AA 3DM9B 4JWKA 3AO0B 2AXPA 1NP6A 4YIOA 2PMCA 3VR4H 4AJKA 1L5QA 1C7QA 1AUOA 1XU9A 3OFJA 1T0JB 2ZXWC 2BYTA 5EP1A 4LWSB 4TT3A 4IQGA 4OXRA 5K3EA 2PGLA 1PGQA 2ACVA 1EVJA 4XX0B 3TIGA 1TM1E 3LUDA 1WEHA 1TO1E 5AVZA 2G17A 3N8NA 4NEQA 4KKVA 4U02A 1RXWA 1KBHA 2QRZA 3JYNA 5FNVB 2HQOA 2Q6KA 1BCSB 2YVLA 2ZTLA 5K4HA 4FFKA 2MYTA 3W3AA 4OX9O 3AR9A 2XODA 4B71A 2ZITA 3WB1A 5BWLA 3S40A 3W5UA 4P5PA 3B9BA 3P4YA 1W36C 2MU1A 5JDIC 4BAZA 3H5LA 4JLBA 3HDQA 3JR3A 2G9UA 4YAUA 4MVJH 4KMRA 4ZN6A 3CNHA 4BEVA 3IQXA 1MTOA 1Z0JA 4OK5A 2C2KA 3PE3A 2DQ3A 3QEMA 2Y66A 1BW9A 4EHDA 3IQHX 3VNUA 2W6CX 5B1SA 2H2DA 3B3JA 4JP3A 4KSCA 3IUSA 1Q7YW 1BDHA 1YHZA 4C4OA 3REGA 1H4SA 1KAEA 3F78A 3F8TA 3B40A 1E9EA 3I34X 3WNVA 6ABPA 2W4QA 4UVIA 5ITVA 1BQ0A 4L76A 4DO2A 1L7NA 1WP9A 1O97C 5AKYA 3V8BA 1T4GA 4OHFA 2QXUA 3DXRB 3KPJA 1AJEA 2W2TA 2E3CA 5CITA 3QZUA 4MI1A 2C4HA 2EJUA 4CU2A 1Y1QA 3K35A 3GEGA 5KU7A 1F38A 1CR6A 1V9CA 1QQ5A 3PHBE 2JIOA 2WWHA 3GARA 4YYEA 2HL6A 4DDVA 2EZPA 2KW5A 1VP3A 4L87A 2HK9A 2VF5X 1AP5A 2O0HA 5CM2Z 3TLXA 4HH3C 2G8NA 2EF0A 2GCIA 1PFUA 1A88A 4EHAA 3CIFA 2HWWA 2O3RA 1PP9H 1I6KA 4IYHA 4L3WA 5BSTA 1UKEA 3IQIX 1UPXA 3ILVA 4HVLA 4Y0AA 1N2CB 1SZTA 5KREA 1D4ZA 4JEIA 2AB0A 5JIBA 3CZQA 3V5NA 1K8ZB 2KKWA 4LCBA 4ZAFA 4EY4A 3M5WA 3B13B 4CM7A 3MD9A 4LCJA 3LXUX 5CA1B 2A1IA 1CS0B 2FPLA 1CR2A 1DQSA 1QAQA 4H35A 1YRQA 2QLNA 4F0JA 3EOBI 3PCTA 2GN0A 4DPMA 2GTAA 3PK0A 4MSMA 2QLMA 4EA8A 1MOQA 2QM0A 4KN6A 5ALYA 2QN7A 2D4AA 1LUVA 2D5IA 2B4YA 2VJKA 2GYUA 3ASOB 2XGGA 2GSDA 1IN7A 2CV0A 3P2KA 1KDTA 3KJFA 4KPFC 5EA2A 2BH2A 5IP5A 1Y8QA 4MPJA 3R0QA 3AFHA 1UC9A 3N0TA 1G7RA 1GGFA 1XL6A 1V8OA 1C9KA 4YDRA 3N6VA 1EDDA 2ZJ1A 3NYRA 4GH5A 3CLSD 3AOEA 4ZA2A 5CYOA 1U1GA 5KIAA 1T3HA 1NYQA 1WR8A 3W78A 1NUUA 3VR6A 3AF4A 2O2DA 1FYJA 3AKYA 2XGSA 1GFSA 5CX1B 1BE3H 5H02A 1Y81A 3AF0A 4NB5A 1TUGA 1Z9BA 3ZWWA 3U3OA 4YFYA 4YA6A 4KXYA 4UKDA 1I14A 2JLSA 2UUPA 3TVYA 4CLOB 1XYVA 5BSFA 3EXG1 4L0DA 2ACWA 4WI1A 2GDZA 5CCBA 4FUTA 2X5OA 2DRIA 3U16A 4RKQA 2AFVA 1C9YA 2UXBO 3A11A 4EB0A 3HKCB 4PYQA 2CZQA 3IEUA 4FFPA 3G8DA 2AQKA 3ZXIA 2I2DA 4MHOA 1ICEA 2Z9BA 5C5IA 4I55F 5AXAA 2V7TA 1P4HA 2NO1A 3UICA 1RAFA 3KDPA 1L7XA 2WU4A 2P8SA 1IQUA 5IBPA 3H8WA 1YNOA 4G0XA 2AG5A 3AF6A 1M7GA 4I66A 4BJ1A 2ZM6B 1NVBA 4MRMB 1E1CA 4N5NA 2ZAMA 5TRTA 3BFJA 4PLCA 2WWFA 4BZZA 1CHNA 1C7ZA 5D86A 2VZ0A 1PEKE 1P3DA 4KL8S 2PWBA 1KB9F 3ZZNA 3QMWA 1W87A 3NALA 1MX9A 1Z56C 3GLGE 4QPJA 2WVAA 2AV6A 1RC8A 3PNKA 1U1EA 2HH9A 4P9OA 1AQYA 4NMMA 1QH8A 1LSUA 1DMRA 5LOVA 2Q1UA 1S72V 1GITA 1VBNA 4QPDA 1ROPA 2HXSA 3ROFA 2J3QA 2PMFA 2CXSA 3FOZA 1SS3A 3LL7A 4OFWA 3UJAA 1PR0A 1Y8ZA 1C3XA 1XLUA 4TTSA 3PKJA 3SEQA 4R1TA 4BLOA 3DA8A 5KVSA 1JE0A 2CL6X 3E05A 4OHXA 1Z2EA 1AXEA 1U2SA 1NQOA 2QRJA 5FWXA 1FY2A 3I62A 4GZ5A 4BNXA 3K6SA 3ITNA 1RWNA 3K94A 4F8YA 1Q86W 4IRXA 4H7HA 3CR7A 2FR8C 3OOJA 1FU8A 5JRDS 4R2IA 4IDHA 3O0TA 4DFDA 4G9BA 4YPOA 3G2IA 2R47A 1JEAA 4LYEA 4L78A 4A6XA 5AMXA 1Y4DE 1OXTA 5JRJA 3EFEA 1HE8B 2ZZMA 3SZLA 5KOJA 5ITZB 3A0BZ 3GLFE 4UBIA 3DMPA 1U5BA 3GEPA 3VOBA 1INLA 4LPKA 2OLKA 1KJNA 2UXNA 5CAEA 1BXRA 3GLIE 2PD4A 5A5EA 3GFQA 2BTOA 3IRUA 1BFDA 3HGMA 1W2GA 1K9MW 4RKFA 2CV1A 3PYLA 3M2PA 3BVPA 2VDRB 2AGAA 3GDFA 2EGGA 1N2BA 2JFQA 5CBPB 2RC6A 2OK7A 1HYQA 5LJLA 3KQTA 4GYCB 4L3VA 5AVSA 1P1RA 2WKQA 4LYGA 2DLNA 4C4SA 4CG2A 5B1DA 1CRPA 2WA2A 9MHTA 4QGHA 1FP2A 1G5FA 2P5SA 1NL3A 3HQ4O 4CKXA 5LSAA 5EY5B 3IQGX 4MR9A 3EOAI 2QMYA 4D0SA 4Q4LA 5FPTA 3CXCU 4HLUA 4O8XA 3WGNA 5K3AA 4UAUA 3S1SA 4OGFA 4MSUA 4FMCF 5IUNC 2DPGA 1E9RA 1UZMA 5K7SA 5B1BB 3MT8A 4DSNA 4ZVLA 2DFVA 3AF1A 3L2OB 3CLRD 5KCZA 1NW8A 3RJ9A 4H4CA 3L92A 1FXHA 2JAOA 2EULA 3UOGA 5JSYA 5EKUA 3A32A 3CX6A 4DJDC 2VYND 4E88A 5E3HA 2FR5A 3A0RA 4E5SA 2ZB7A 1J1UA 1XZ8A 1OTHA 4OGLA 1I0LA 2RGDA 5AVKA 3KZOA 1J23A 1K86A 1WVIA 4GR4A 4QRDA 2XYVA 5F5NA 2C8VA 3CCBA 3CZCA 1JLKA 1KO8A 2FV8A 3DE6X 1LQTA 5AR1A 5L3ZA 1VBKA 4KLAA 2NXCA 5I01A 4B43A 4LJRA 4Z4HA 1QCZA 4J4TA 3B9QA 1ND5A 1QM5A 1QU3A 1VQ5V 2C00A 4KXNA 1ULSA 5DX0A 4ZQIA 3M2TA 2F1RA 2NU9A 4NRDA 5AKIA 3ZJVA 1K7CA 2FPXA 2VP0A 5TNXA 4N0EA 3HC7A 4GOOD 3M70A 3DEJA 4AZWA 3SDZA 3FUVA 2C54A 3OCWA 3OFSA 5FO1A 5FTWA 3GZNA 2FR1A 4CBCA 1M2JA 5HFNA 3CZAA 4DCVA 5GVRA 1LTHR 3TI9A 4MV8A 5DM4A 2O1WA 1J1IA 1PO7A 1HMYA 2I7DA 1AKNA 1RADA 1FFXA 4OL9A 4LZLA 4W9NC 3JVDA 9LDTA 3TQQA 3QEMB 1BW9B 2SKDA 2AYXA 4UEQA 1SKAA 3DGEC 2CVPA 4XDZA 3FMVA 4ZARA 2WF6A 5JROA 2V6FA 3M4XA 1MDFA 2A0XA 2GZRA 3Q7PA 4HNVA 1PFYA 2HMAA 3B2EA 3MWGA 2B2CA 3MTIA 4FZ3A 2GWHA 2QR2A 5IXYA 1PN3A 4JLSA 5HKAA 3IE1A 1CF9A 2WLKA 3K9AA 2WT9A 3RIYA 3AVPA 1JVNA 1QCDA 4LV8B 3TDMA 2XUIA 1XAGA 2ATVA 2JBAA 4GLFA 4N1AA 5JAMA 3O5AA 1HNXO 2R11A 3AFMA 2HBQA 3THOA 1SCNE 3FUWA 3IKJA 1XVIA 1KJJA 1RAGA 2BZ0A 2WNHA 2H31A 2KM1A 2VA9A 1TVKA 2FRVA 4X3CA 1TZ2A 3D5TA 1VDZA 5J2UB 2EWVA 3P0JA 2JZNA 1FMLA 2X5NA 3C5WP 2PS3A 4KBGA 3H6HA 3NWOA 3PNVA 3SEFA 2F93B 4C0LA 5JHGB 1A8PA 4D46A 2PV7A 4YRMA 4FSHA 4RM2A 1QRRA 4W6QA 3N8KA 1KY5A 1E89A 3QLUC 1KOGA 3V4PB 1E7SA 2IFTA 5AXDA 5IFKA 2PX8A 3VKGA 2KBEA 1V8PA 3GROA 4JH0A 5C37A 2X4LA 4URZR 4DK0A 1OAKA 4ZZ1A 3KT8A 1SXJD 4WLEA 2QQGA 4WNCA 3H2YA 4H60A 2NU6A 2CBGA 5B12A 3KQSA 2ZAGA 2WR8A 4URFA 4UOZA 4HAZA 4Z4EA 3CKLA 4EKIA 4UTOA 5JS1A 1URPA 3QWIA 1BCCH 2WZCA 3TQTA 4UBNA 1R0BA 3AHGA 4DUZB 1HM5A 2Q3HA 3OO1A 1BX3A 1XZGA 1D8AA 3Q7EA 1J33A 4NCJA 3LYAA 3T61A 2ZCJA 2G63A 1O7JA 2OCHA 1P6XA 1EM6A 2AFIA 3NLLA 1AXGA 1USWA 5J4HA 3C7KA 4B9EA 1QHEA 4MTGA 3USCS 4ITUA 1Y8QB 3DDWA 5TV2A 4M49A 3RWMB 3G9XA 1CQJA 2ZJYA 1Y7LA 1YASA 3R75A 1Q7CA 2ZRJA 4RVHA 4RLQA 2ROQA 4NZZA 2BSQA 2Q1YA 4DZRA 1X9HA 1ID1A 3H5RA 3JQDA 3T4DA 4MKRA 2PX5A 1AY0A 1FBNA 4LJ8A 4JAAA 1U0GA 3LT1A 1WMSA 2W11A 5CXXA 5JMTA 4C0QC 1DT5A 4WUTA 4ARBA 3ZQ6A 4L4RA 4C6HA 2GCOA 4R2XA 2RNBA 2X3YA 4HB4A 3EXG2 2ANCA 1NZFA 3IESA 3C0KA 2Q4PA 3EX8A 2XNJA 3KYBA 3PXAA 4OBEA 1K98A 2OQIA 5JCOC 1RQPA 2R4TA 1EB9A 1N6OA 2AJDA 3HUEA 4MQMA 3QFHA 1UPBA 2WLNA 4JCCA 4IJVA 2BM9A 3A6KA 4BFWA 4QDKA 2PXHA 1XVTA 3GLUA 1AKEA 2XCLA 1TD9A 2BFOA 4RJ2A 2I2AA 1DDGA 4ZT4A 3OOEA 2VJQA 3E03A 1T2AA 5TF0A 5JZ9A 4N76A 4DCPA 3RRJA 4JI4B 4Q37A 1OHHA 3M6VA 3K0BA 2XQFA 1WP7A 4YHHB 3GFFA 3X1WA 5WRFA 3LA8A 2P6NA 4P4GA 4U0JA 1NI5A 4URYR 5ECWA 1H6BA 3PHCA 2EW2A 4O02B 2ASVA 4C43A 4PGHA 3GRPA 2C2HA 8OHMA 4J0EA 1FVHA 4L5IA 5LZ2A 1QP8A 3BC1A 3BCRA 3T5AA 5J40A 4S0ZA 1Y6FA 4W9MC 1C0LA 1QRTA 1C81A 4NV3A 4KXWA 3M9XA 1XQ9A 3W7SA 1M75A 4HJXA 3TVDA 1A7AA 4KO3S 4UMEA 2W37A 1QH8B 3TSCA 5IY5B 4Y7DA 5LOVB 1HLPA 2DWOA 2O7RA 4XJSA 3ZJUA 1J2JA 3PCRB 3FSRA 4G4JA 3NYQA 3OEHD 4L8YA 3VX8A 1ZSNA 3ED5A 3HN7A 2VYNA 1NVXQ 2ZIOA 1A8IA 1ODTC 3BULA 2PL1A 3L7OA 1W48A 1DCKA 3D6TB 5M5BA 1R64A 4QRIA 2ON6A 2AKEA 3D64A 4LJ6A 1ZOOA 5AO9A 3EK2A 1IEWA 1FJGB 1N4DA 2VYVA 1PNMA 1QTIA 1ESDA 3K6SB 2AX3A 3H17A 4M46A 4EI2A 3QE0A 1LK7A 4IDCA 5A71A 3W6NA 1VLVA 2ODBA 1R6VA 5AW1A 2EIJB 3GT3A 4DEXA 1YBFA 2B30A 1F2UA 3VOUA 5U4XA 4IOLA 4MA5A 1H2LA 5REQA 4RIEA 1UKYA 5KOJB 4BE7B 2V0CA 2VT7A 3X2QC 1U5BB 4H59A 4O4IA 3DD1A 2BFFA 2C1XA 2WRZA 5CAEB 2HHJA 2IK8A 3IOCA 1WKQA 1ISMA 1JLSA 3CSDA 2CJXA 5L3VA 1PT8A 1DJOA 1NMZA 2O3TA 5HKKD 4KHPO 4UCFA 2EL9A 3VC3A 2HLPA 2BI7A 2O52A 1IOVA 2RDMA 2G40A 5AVVA 2FFRA 4ZTBA 2XCTB 3TZLA 4UUMA 3SN6A 5DM1A 2RK3A 1QVGU 3O8CA 1DAKA 3LG2A 1Q0ZA 4RVDA 4WXYB 4IP0A 4OXXA 3DE1X 4P54A 4C0JA 3EQ8A 1TQ2A 4BYGA 2D5LA 3ZGYA 1EE9A 4E12A 2EGHA 1S2LA 1NTOA 4Q1AA 2EJTA 3KTFA 3SJBC 3IPCA 1AN0A 2PO7A 5T41A 1L5WA 2I2CA 4TTQA 2Z43A 2WKRA 1PZHA 4HWPA 2ZRPA 3UKJA 2HK6A 2RKOA 4O8XB 3P8ZA 3FR7A 1YZTA 1AQLA 1JZTA 1QX3A 4LJAA 3PFKA 2CNNA 4R7GA 2OG1A 3M7MX 5FR1A 3QYAA 4FLZA 1CUWA 3WO1A 1EDEA 2B8JA 3AJ9A 2DCMA 3IVRA 3QI2A 3ETLA 2AQHA 1D4AA 4MVMA 1PE0A 2F4NA 2CUTA 3L1IA 1N7JA 2XNDG 3ACCA 3CA8A 3VPGA 3C3PA 4UHHA 1KXZA 5I5GA 4JOCA 5EZYB 4F71A 2K6GA 2VBIA 1UBGA 3CF4G 1XTPA 3C6MA 3OQBA 2O8EA 5DCWA 2W0XA 2VF7A 1QWSA 4G0UA 3BIXA 4A2WA 3AUTA 1APBA 2QZJA 4OLBA 4RPIA 3BE6A 2GJ4A 1RPNA 3ADBA 4AO7A 4UHJA 3WLRA 1LJ8A 4QGBA 1NBMD 1ISHA 3PJDA 5IVIA 4FOLA 3ASZA 4IUDS 3SR3A 2NU9B 2AC2A 2OV1A 3G1WA 2PX6A 3RJZA 2IW5A 3NAZA 3DEKA 3S3XA 1ZL8B 1NQUA 3TUJC 1BTOA 3Q5GA 4BU1A 3OU7A 1VOTA 5M59B 2OAGA 1ODIA 4F11A 2PGIA 2B3JA 4RIGA 1R00A 3GZNB 4XIFA 4PNPA 3HDYA 1RPAA 1B15A 1XVAA 1MDBA 5EZSA 4IHJA 3H9UA 3OX2A 2PNJA 3AK3A 4CLHA 4ENPA 2YIBD 4PA6A 1YS2X 3JQ9A 2AI3A 3S44A 2IJJA 1T1SA 3KKLA 1N33B 1A9QA 1XR3A 3UYLA 1FFXB 1F0PA 1Q3HA 1YJNV 3TKLA 3HR4A 5C5EA 3DSQA 5DNUA 4UHFA 1WCYA 1NATA 1G7TA 3K15A 1A9YA 5HOEA 1M2KA 2QV0A 2ZCEA 2VJPA 2NQ2C 4DV1O 2EL7A 2R70A 4RIFA 1WX1A 4N54A 2LTAA 1PWEA 2QSJA 5DX8A 2EKDA 3WGQA 2IOQA 1JDBB 4FHFA 1WNFA 3AUAA 4ZO4A 4CL2A 4I5DA 3V2GA 4G01B 3WGHA 3CUVA 1H3NA 2PGJA 2VF8A 3FZEA 2NMVA 1WW2A 1CYDA 4EPTA 1E2MA 3HJAA 4XB6B 5IHPA 1RYEA 3MCVA 2AK3A 3AG2C 3GJ3A 3GQBA 2JBAB 4HDCA 5LM3A 3ISVA 3E2PA 5AK3A 3ABLB 2YV4A 4Y1RA 2J48A 4ZVOA 4QDJA 3ESZA 2OQ2A 2RH5A 4LXQA 4MR7A 4U2FA 1QIKA 2DFTA 1TVKB 1QZTA 3QUCA 5FJJA 4GXQA 2JBHA 2UXDO 3AXSA 4AS3A 3QO5A 1RPRA 3K9NA 1IZ9A 4C3VA 2VP5A 1KP9A 5L3FA 1VL2A 4OP3A 1XL0A 5KSOA 2P2DA 1KI2A 2CDBA 3TRKA 4TSFG 5DWQA 3IE2A 2YUTA 1EJ0A 3EC1A 4EFBA 1EBFA 2J7PA 4DIDA 1LRJA 5DTQA 5K1XA 4C20A 5HF9A 2PL5A 4D9IA 3GCXA 3MWEA 4BW9A 4XW2A 4E5NA 5KLVH 4KMSA 1QYDA 3M6LA 5DWDA 1Y9EA 4G8DA 2NU6B 1ZD8A 3PIDA 3KXKA 1VPVA 3TZKA 2A8NA 1HEUA 3ESYA 1E6WA 1J7KA 3TG8A 4DQXA 2YHSA 3AI3A 3WV5A 2WQZA 1QP7A 1UKCA 5HHTA 1VHLA 5ICFA 2AFIB 1QU2A 2IYAA 4WGGA 1CJMA 3HL0A 1QDUA 4N5HX 2P9HA 1XVUA 4UJ5A 2QNIA 2ZJ2A 1YKFA 3N3BC 3AJAA 2EBWA 1CQJB 1WMFA 2DQSA 2CJYA 3GHHA 2OLJA 4DCUA 3GJTA 1IXRC 3WB2A 1Q74A 2ZRGA 3PNSA 5D3QA 4TTJA 1RP1A 3O1HB 2WSBA 1PFKA 1E2NA 2QLTA 3H3JA 1Z0UA 4IIYA 4MOWA 1FSSA 3LW7A 5CTAA 3FBGA 3AFOA 3QEBZ 2RONA 2GCOB 3W1WA 2Q8VA 2A9JA 3QPCA 2W5UA 3MF4A 3UWPA 4ZI5A 1FYVA 3ZE9A 2VUSA 5HMMA 4KITC 4Y9SA 4R50A 1M6HA 3DS8A 2Q7EA 3KUCA 1C7FA 3A7DA 3RVSA 4RD2A 3DAYA 3ZU2A 4AS2A 3DHEA 3I64A 4MP3A 4X1KA 1T2NA 4EHLA 4O3MA 2IUTA 2X8JB 4KWTA 3T35A 2NZ2A 3FLEA 3N2IA 4A0FA 1CUDA 3HTXA 4NYIQ 4XA8A 2WF7A 1L0NH 2FW0A 4QU0A 1PL8A 4ZMRA 1S3JA 3QTBA 2CWDA 3K6KA 2H1VA 4LGCA 2ZWPA 1K2VN 5BNWA 3GLQA 3OESA 1H8EA 1WXWA 5EXSA 5HM6A 3DVQX 4ESEA 5HTOA 2GXAA 4JI3B 1VYVA 5F9MA 1KI3A 5KAIZ 1AUVA 4QNRA 3HCWA 4QATA 4J07A 2QG4A 4ALIA 4PZ0A 3C6YA 3MERA 3OFND 2G82A 3CRVA 3WLLA 4AIIA 1YS9A 1AC5A 4U7TB 3CC2V 2FKXA 4K6MA 3AZPA 4TWJA 2G6VA 2VNIA 2QKCA 1OVGA 1M9NA 1U9IA 4DLZA 2WJYA 1I4LD 5EVCA 4ES6A 3TETA 3HI6A 1K3EA 1XD9A 3DZDA 5EJ4A 5ALSA 1BEEA 2ZIAA 3MFYA 3PXGA 2JS3A 3A2MA 3JARA 1DG3A 1ZMTA 4EG3A 2MIIA 4H7KA 5L6LB 1Q5PA 1XKQA 3JYHA 2TRSB 3AG4C 1MQ9A 1PR1A 2PGDA 3GJ6A 4ZJYA 3L4SO 2JEXA 3V1TC 3TH5A 4ZYYA 1P91A 4A7PA 1P4AA 3KQOA 2WM2A 1TIYA 1KQPA 4XH9B 2II6A 3WGVA 4KPYA 2BGIA 2XB8A 1JILA 1D2MA 1Z83A 5LWHA 1CRWG 3JQFC 3IV6A 4H0LB 2WLHA 5SY6A 2VRNA 5AW6A 2D1QA 2FEPA 1TZJA 1M2GA 4IL6Z 1VMKA 4NU6A 3OOHA 7MDHA 4QLOA 2XVZA 3O3OB 1PT7A 3VDNB 1OFIA 1PR2A 4PXSA 2DQ4A 3IUNA 4NBSA 4CIYA 3INNA 3AHDA 4PA3A 2GAJA 1DGSA 2AUMA 3NNDA 3DXRA 2JCBA 4RZIA 1Z7YA 3TOXA 2A1TS 5JMPA 3RS9A 5FPPA 4ETWA 1NBMA 3O9VA 1QZXA 2Z0AA 2AX4A 5REQB 4OGKA 4EHHA 3VBCA 3GA7A 1PKEA 5BPHA 1AF7A 5CXUA 1JAHA 5AWFC 4DTIA 1Y3IA 4O4IB 1XA0A 2FRXA 5SZHB 1M8GA 1JWAB 3HUUA 3WAGA 4IMRA 1N6HA 5ALVA 2E18A 5SICE 3MA0A 5DHUA 4LAFA 2YIBA 2VAWA 2XWSA 4XSHA 4N12A 2D3WA 1ZCBA 5CM9C 3KQNA 2V65A 5EBMC 1UAAA 3CT6A 2AG6A 1EXVA 1QQCA 2C9CA 3PNQA 4C01A 3ZE0B 4M21A 2HREA 1F8XA 3NDBB 1Y6XA 5CA1A 3BMQA 3OD1A 3OT4A 1SXGA 3E15A 5I7SA 5LIPA 2WSSG 3P2OA 2OFFA 3PPYA 1Z2AA 1O1YA 5HGXA 1XJCA 5BR8B 1XLTC 2A79B 3P9IA 2W2LA 2YWDA 4ZVVA 1Q43A 3AF5A 1DBSA 2R1VA 2IXDA 3ANSA 2I6QA 3RFRA 2YRWA 2ZBFA 1W2WB 2P4EA 1Q44A 4HGYA 3BXFA 2VJOA 5FIUA 1CVIA 2VDOB 3IA7A 4DUPA 2JGLA 5F3RA 3AUXA 2OZVA 4GLJA 4G1MB 3SFVA 3AG1C 5KOYA 1W0JG 5IC5A 5FUWA 5E4YA 1TEHA 5IMSA 1HOTA 2JVIA 4Z4QA 3Q3VA 4KAFA 1KVRA 1WN6A 4GRAA 4J7XA 1JCHA 3DAFA 3FZNA 1DBRA 4W4LA 1EK5A 2O8EB 4YP0A 4UB8Z 3ZU5A 2PKEA 2QTRA 3JQ6A 4TUYF 1MX3A 2Y3IA 3WJ1A 3KEFA 4MV0A 3ESQA 3CLTD 4QTYA 1L1RA 2JASA 1G5HA 2J32A 1N6NA 4HN2A 1F48A 4L4XA 4KEAA 4IH4A 1RT9A 4LFCB 3OA0A 3X0DA 2DWEC 1OA0A 2XEXA 5F5XA 5K3OA 5K0CA 2W70A 3QUSA 3L71H 1NOIA 3SX0A 4LWQA 3ZGXA 1H23A 3FNRA 1X70A 2V6GA 1JIUA 3RVDA 4Q7LA 2R48A 3MTQA 4R05A 2W6ZA 4NECA 2X0EA 3ZHTA 4IHJB 1GXSB 3AVQA 2EQAA 3TKYA 5H6QA 3VPHA 3UCXA 1CEZA 1L5ZA 4KQKA 1RI4A 5JLAA 2BMVA 5K99A 1BZKA 3D7SA 3QGMA 5LB4A 4WFJA 4LDAA 4H31A 2QHXA 4B4OA 4Q18A 5G1NA 2CLDX 3MJDA 1OXKB 2MJLA 2P3OA 1ZD2P 3CNEA 4PAGA 4EYGA 4V0MA 2X8BA 3IRVA 3TQRA 1K7FB 2MT9A 1GA6A 4ENSA 4PTZA 3NBUA 3GVHA 4KE8A 5H3CA 3W8DA 4B74A 2B8NA 3GQBB 3WSTA 2DY0A 5AVRA 3KQLA 1EZ4A 5CT6A 3L8YA 3OUFA 4Y1RB 1N36O 3LO8A 4BFXA 4MR7B 4JXEA 5CP8A 1UK6A 1XG5A 3FPGA 4O33A 3HACA 4G86A 3HCPA 2I03A 4I5IA 4KR3A 3E5NA 4RS4A 2M6SA 3HUFA 2YS6A 1NZ6A 3ICVA 2QD3A 1HOXA 1Q6YA 2IY9A 4LY6A 1E1MA 4YJ2F 2ZWOA 4RNDB 2GM5A 4OLHA 3DMNA 4MVZA 2MSNA 4UVAA 1MQSA 3VH2A 3DONA 4IJUA 4JI5O 3PDHA 2PEZA 2FUCA 3MWEB 2IL1A 3KEGA 3UPUA 4UNNA 5TGTA 1NXPA 4OQFA 5JR3A 2BGWA 1IN5A 4B32A 2CCGA 4NR1A 5DP1A 5JWRA 4U7FA 2IPOA 4K46A 5ITZA 4LC5A 5DM60 2WSIA 5LVAA 4JU9A 1IAVA 4GDMA 4NPCA 2C4NA 1LUAA 5F64A 1JR3E 2XV1A 2A0WA 1K8QA 1U94A 4NOLA 4TLAA 5CFRA 4X6YA 4NYJR 5CXSA 3ZQKA 3GRUA 1KO5A 1SVOA 3F46A 2A88A 1EESA 1RLMA 1IG3A 2WVGA 1KK0A 2FX5A 1ZAYA 2R9IA 2GO7A 4MRVA 1ETHA 4K6OA 3F71A 3VNSA 4GQBA 4GPIB 5IWCA 5JC1A 5GY7A 1FFTB 1GZ7A 2AR0A 5AUQA 1XAHA 3CB4A 4N6NA 3D2BA 1ZIPA 5DTJA 2V7GA 4YP1A 1ICIA 4Q1DA 1D7OA 2KPOA 3SMVA 4LF8O 2PZFA 2WAMA 1NNI1 1UIMA 2G88A 4GX0A 2FG7C 4KJXA 2QMUA 2IQ5A 1JB1A 4G97A 4Y18A 1I3MA 1YNSA 1QXSA 5C1IA 1J70A 4F3YA 3PUHA 2OYRA 3PITA 5AM1A 1L5SA 2O6LA 1HNNA 2NX2A 2OECA 5EC2C 1OCZC 4NCHA 1U2GC 1SVLA 3VR3D 4D6XA 3G79A 4JMPA 2KSQA 1EVIA 3KWFA 1H6CA 5FL3A 3AP3A 2FAXA 4X1KB 4RPHA 3KM0A 4BWAA 4TMTA 4HLDA 2WUGA 3CO0S 4BRWA 4TMFA 5FOSA 2HMVA 4UNPA 1Y9ZA 4JI1O 4RZ2A 3RV3A 3GNLA 4URVR 2X9VA 2XECA 2VWPA 2X0NA 4PAMA 3UMMA 1N5LA 1K68A 2BM0A 4EJFA 4MGIR 3T1CA 5B53A 2OHJA 2N74A 3COPA 1WZIA 1UWZA 3KQQA 4GYKA 1F3OA 1RYBA 1SBIA 1QFZA 4H17A 3EVZA 2QWNB 2WJIA 2O5VA 4ARCA 4X8HA 4ENUA 4ABMA 4R1UA 4BNUA 4BX2A 2E4VA 3QU4A 2CYAA 1D1TA 3RROA 3CC7V 4TM8A 2FZLA 3QBJA 2V7WA 3VFDA 4HZ3A 3N59A 4G24A 5BORA 1RKXA 3ZD6A 4GI7A 2JDID 5CPBA 2QSZA 3JARB 1NTMH 2XY4A 3UAZA 4AKSA 3DKVA 1PJZA 4P0PB 3BWMA 3V34A 4IRUB 1KHTA 7YASA 1VQ2A 1ATZA 2OYSA 5B3SB 3OH8A 3U0ZA 1Z2CA 1BKSB 3LXXA 1QUFA 4NFSA 3VAYA 3GQVA 3MWJA 2AMJA 3JTEA 4G5HA 3U7JA 1CWUA 4X66B 1WD7A 3CPEA 3IPYA 3CYOA 4QKQA 5KQPA 4NDNE 2FZGA 1PUIA 5AKGA 4EA9A 2WTNA 3THSA 2R84A 4UCOA 5BWNA 5FPYA 4IV8A 3O21A 4JASA 2Z58A 2H6EA 1ZAKA 5K0SA 2XAUA 5F3DA 1FMCA 3UO8B 4O8ZA 1P2GA 3FG9A 3EZ7A 3PSHA 1T25A 3ZVRA 3ASNB 2JJ2G 1QH9A 3QBDA 3T4EA 4NXNO 1EK6A 5J2UA 3T1YB 2XRFA 4RTOA 3AL2A 4PO1A 3N3AC 2Q7DA 1R5NA 2GZDA 2YQZA 4I5GA 3AIMA 4M98A 1US6A 1XMIA 2VEDA 4CETA 2KX7A 2R751 4JBXA 1Q20A 3OMLA 4MW3A 2ZR7A 3NKLA 1NURA 2IBMA 1U4NA 3TWOA 2FFHA 1E6CA 1ZI6A 4IQ4A 1G55A 1FW8A 1MXFA 2B0CA 4QIHA 1TCAA 1UJ6A 4NKGB 4EUNA 4R0VA 2B2NA 5CCXA 3L72H 5HUJA 2JJ1A 2YY5A 2ZUSA 3J7TA 3SGIA 3QKIA 3LCCA 4JR0A 3BMQB 4XAQA 3SQNA 2Y48A 1RACA 4LGMA 3PUYA 4OP2A 3M1AA 4M3NA 3R3HA 2AOUA 4Y2YA 2QJTA 4N3AA 4U2CA 4HDKB 1M1ZA 2WIBA 4TQUS 1N5DA 2R6HA 3OPVA 2BKEA 1QFMA 2YMQA 1CRZA 3E4CA 2R1VB 4QDZA 5T6MA 1M8FA 2CNWD 1DINA 3B78A 5FPOA 3PNMA 2HR1A 2HEGA 1NY5A 2BVNA 4IMPA 2IDKA 1YKGA 4E11A 2PLRA 2FZCA 2OSBA 3RS8A 3FNIA 4CV0A 1Z6YA 4KB5A 5TVKA 3AG3C 3T1VA 5IZ4A 4FP9A 4Z49A 4DUGD 1G4AE 4YV0A 3VHLB 2C7OA 4AJJA 1KA9H 5C2OA 4QWWA 2JHGA 4M1YA 1E4VA 2C77A 1CEYA 3GB7C 4KWHA 1DEXA 2TYSB 5LFAA 1M1YE 4IBOA 1J2UA 3U7FB 3QBEA 5J59A 2XDQA 3K32A 2DR0A 3DOOA 2BDEA 1P2DA 5DYNA 1A8QA 3RS2A 5MDHA 2CNBA 3LL4A 3L43A 4FQ5A 3GYBA 5LD2C 3ZUGA 5C0OE 4LFBB 3ZJYA 1H4VB 3IQDB 2E49A 1H0RA 4U8HA 1PX0A 3RVNA 4F84A 5IT5A 1EWQA 2ZJ6A 4AQ7A 2DECA 2E5LO 4ZC1A 2QZSA 3H5OA 3AWIA 5CBKA 1QGED 3NFYA 4WOKA 4YDQA 1USVA 1KJZA 5L3QA 1KKDA 3NKFA 1Y4AE 3H0KA 3U2QA 1PLLA 4MUAA 2HWYA 2ILMA 4LZJA 3TR6A 3O4FA 2VWJA 3UANA 4G1VA 2SNIE 1GGJA 3B3FA 2QWOB 2Q4RA 1JQKA 4NFYA 1K33A 5JJKA 3F3SA 2AHZA 2ZTHA 1FU7A 2GBPA 4WBSA 4QICA 1YZKA 5BWBA 4J75A 1ORHA 3EY9A 2Z98A 1ALNA 5TX7A 3JX9A 4OCLB 3TR5A 3I5UA 5K45A 1USUA 2ZU6A 4Y6RA 2GHTA 3VPFA 3U40A 2UUCB 2ZIGA 1OAAA 1FFGA 1DWUA 4QYMA 4OLJA 4B7AA 4OFZA 2P9YA 3FTFA 2V97A 4GWGA 1U3UA 4J6EA 1YRHA 4FFVA 3KQPA 1BS1A 7ABPA 4DJAA 4C22A 4ENQA 5KHAA 4D82A 3H97A 2IBSA 1QVVA 4E0QA 5K8UA 5JAZA 2KJQA 5HCUA 1EM1A 3JQRA 2ZB8A 1CYEA 2PBFA 5TARA 3AINA 821PA 2WTXA 1RHJA 3CIOA 3W7UA 3TZHA 4PO9A 3R7BA 4FHEA 4DDMA 1ZGBA 2O2IA 1G8YA 2GBFA 2XCSB 1RRPA 4BB0A 3LLCA 3KQMA 3I56V 2Y92A 3OECA 1NG9A 2YTZA 1PYGA 5K4GA 2D1YA 3JWPA 1DXHA 1U4SA 5HIJA 1HMPA 3L0BA 1L5LA 3KWJA 4EZIA 1CY6A 3F7MA 5JALA 4D43A 3U4HA 4MTXA 3O95A 3ENNA 2BR4A 3DLAA 3OZWA 4TLCA 4M37A 4N82A 4BEBA 1T24A 2ZBPA 4WZAE 1HE4A 4LJLA 1SG6A 4G4GA 1CUAA 1ONBA 3NOXA 2WU3A 1OJHA 1RWBA 3VUFA 3ZE7A 2EV9A 1VLZA 2XYRA 4NS1A 3WLFA 4OMFG 2BONA 4TLBA 5B7PA 2WNIA 3ZY3A 2WE8A 3VAAA 5JSQA 3AUYA 1GFZA 3CLUD 5I7EA 5HE8A 1ZD5A 4J11A 4DJTA 4Q05A 4ECEA 1ONPA 5L9AA 2D8AA 3MJFA 4PHCA 3CGWA 1F9AA 5FH9A 5LPNA 3R0ZA 2VK2A 2ZIMA 5COBA 5JE8A 1QMGA 1Q7BA 1ZVVA 2XSZD 4FS8A 4D7AA 2XX3A 1R5OA 3BTOA 1ZISA 5IAEA 1G63A 1GGNA 1VARA 4ODIA 1XPOA 1FRZA 3PD7A 1XZFA 4C7UA 1QZUA 4BQIA 3CVYA 1OJLA 5EUBA 5FKJA 3U9SA 4FKZA 3HKEB 4L7VA 2GKSA 4LWOA 2R00C 4ZAGA 3WK7A 3EA0A 2C4KA 5C35A 3BJEA 1Z6XA 4BZXA 2Y1XA 2GN6A 1K63A 1K6IA 4ZVTA 2JI9A 2D1FA 4I9NA 1W5TA 1J6UA 3O4RA 4IX9A 1XF9A 1ZJZA 4DR1O 3GP8A 1XYYA 4D9EA 1LKZA 1BMTA 3W5AA 5EZYA 2VTDA 2WKPA 5EHGA 1YS7A 3QWBA 1W5EA 1VGRA 4YRSA 4O4JA 2Q7GA 3JZAA 2IHYA 2PF4E 4N0MA 4WJZA 3WV4A 3IEXA 5GAOA 2V54A 1QFXA 2ZLBA 1CJBA 5FLYA 4C7BA 5F1OA 3UTDA 1JHRA 1Z2NX 3DOHA 3TRDA 2XVXA 3L6EA 1P73A 4GICA 5F1YA 1EYZA 1U2TA 4ACBA 4G67A 2J4FA 1EXWA 2CNLA 1Z4PX 1GUZA 4N49A 5TSDA 1S0VA 1XXLA 1ZL8A 4X9XA 1U2RA 3O74A 1BGYH 4BO6A 4DLLA 3ZWDA 2FZEA 1A9PA 1LX6A 2CNWA 1YVUA 2PYLA 4PX5A 3H2JA 3IDSA 1K3FA 2FTKE 1H2KA 2Y1KA 5GOZA 4YPVA 3JRNA 3T9DA 2P4VA 3E8BA 2QIOA 5L3EA 4LDNA 3BB1A 2NTJA 1VPLA 3M4YA 4GZMA 3HLYA 3R3JA 2GK6A 5L3RA 1XPRA 1XHLA 4U2EA 2R2AA 2AHYA 4F5EA 1NU6A 1T4CA 4RWUA 3OWHA 3WGJA 1VJ0A 4E13A 3FN4A 1C8VB 3H8JA 3QA9A 5KEIA 1CFZA 1M56C 2VDLB 4ZBMA 1L5VA 2OCAA 1RPOA 3TUIC 2BJVA 2QE6A 2ZSAA 4JASB 3I09A 1LJUA 3WDSA 5T4FA 4P5EA 2BI4A 1U97A 2XBUA 3WWZA 5LN1A 5IASA 3RH0A 4YUZA 1D1PA 2CUZA 3EFHA 3IE0A 1RM1B 4MVJF 5C9ZA 1R6AA 4CKCB 1X1AA 3FCCA 3QU9A 3WK9A 4OYHA 3ZHXA 2HHHO 1KKUA 3EYAA 1X1CA 2X2FA 3SJAA 4B6EA 2PLFA 4WNYA 3TL3A 1XTKA 2VO1A 2ORVA 3IALA 2D2CB 2GEVA 2Y1DA 4UPEA 2QXTA 3F0TA 3QIAA 3DQQA 2W98A 5AW4A 4DV6B 1T8YA 5FR2A 2CZCA 3AL3A 3PS9A 3I83A 3B9RA 4PQEA 4L0CA 4OFBA 2X6AA 4POOA 3OLQA 1KI6B 2PA3A 4BFYA 1KKMA 1MNAA 2HPHA 2LKCA 1QIFA 4LOHA 4G1EB 5BVGB 1A9TA 5L53A 5JJNB 4P92A 3PQ8A 4DG5A 2YJ6A 3AOGA 3KETA 5IWAB 2HLDG 4TXJA 1QSGA 4MGYR 2AOUB 4KXFB 2E1PA 3NHUA 4K8OA 2ID7A 1E9DA 2OPHA 4IDEA 1R0ZA 4BCCA 2P77A 4U7OA 1B7GO 4BIUA 2F62A 4IY1A 3EVNA 4B73A 4TLMB 1R6KA 2YIMA 5FBLB 2Q3BA 4NMWA 1NYRA 3REQB 1UJBA 4W1RA 3NG1A 5LZ5A 3UJ8A 2C1ZA 1N0WA 3EXHC 4B4KA 3K92A 4EG7A 2AOWA 3HBJA 2Z95A 4PC7A 1UPTA 1B3QA 1R12A 2NG1A 3IVGA 4BXOA 4WXPA 3I2YX 2HPAA 2OIGA 2P40A 4G41A 5LLTA 4MIYA 2FR6A 3TJZA 1OH8A 3VR0A 2XEDA 4XIYA 4LWZA 4XDHA 1E3WA 4EECA 5DTMA 3QE9Y 5C1PA 5A9GA 2XDQB 3AUSA 2FK8A 4LF7B 1S02A 4KU4A 3B3GA 1LA2A 2E55A 5IVDA 1I4TD 4BMVA 3KOOA 2OM6A 2H1RA 1J07A 4CDMA 2X8JA 3AQ4A 2DWDC 5B7GA 4RJLA 4DA0A 4K81B 3HBNA 3K9LA 3V7FA 1JSZA 1E79G 2WTUA 3H2IA 3WFIA 3BG5A 3T5CA 4R1PA 4JYAB 1F23A 5DP2A 3LW8A 1KS2A 1Y1PA 3T3IA 1E1LA 3H05A 1XI1A 3W7VA 1YSBA 2IC5A 1I33A 1N0VC 2CE4A 2K4MA 2GRJA 1BG6A 1NULA 4JJ6A 3RUFA 5L3QB 3HCOA 1HH4A 2WLIB 4R9RA 4KTTE 4WL0A 3EB9A 1GZ6A 2I67A 4B3MO 2ES4A 1LVGA 3IA2A 3SYRA 4YTEA 5FTNA 1X7YB 3PUXA 3S28A 1OYWA 5LZ9A 3PFHA 4OJYA 1K9VF 5EP4A 3E9QA 2YYSA 4X0EA 3CISA 2YMPA 2GM3A 2CLFB 2HNAA 5CG1A 4II3A 1MRZA 3SYKA 2GVNA 1GD1O 1T4BA 4F2PA 5KWEA 4HWRA 3OTIA 1PQWA 1QE3A 4NL4H 3LY7A 2F1MA 4MQFA 1OH5A 4EFNA 4LOAA 4D4IA 4M0KA 4ZVQA 5BUCA 1MX1A 2OBYA 5IUJC 2B4RO 3GEBA 4NU0A 1RLJA 4HSGA 4HTFA 2WTAA 4GMKA 2OCYC 2IU6A 3TW0A 1WNSA 1T5IA 2QL9A 1NN3A 2POCA 3F7VC 4E3ZA 5C3UA 4G0QA 1PNKA 1DAOA 1NBAA 1YUMA 2GRUA 5ARBA 1PI3A 3MJHA 4LP8A 2B4QA 4YALA 3ZWCA 4D3DA 2BP7A 4DZTA 1NJ5A 4RPJA 9LDBA 4J7JA 4LOJA 3DSRA 1EUQA 4G8CA 3GLHA 2P9TA 2H7XA 4A8HA 1BWPA 1GV0A 4L0QA 2M9MA 3G2OA 3UKOA 4NWIA 3K8OE 4RO2A 5EXPA 1GPDG 4ZHSA 3K9HA 1NW6A 1X1QA 3RYIA 2MOKA 1QPBA 3A4LA 1QR8A 1WD5A 4I1IA 3DFFA 1N5JA 4MGZR 3WJ7A 4K88A 4EPWA 4OXIA 2BBOA 2I6XA 1U28C 5JH7B 3D8TA 1IPHA 3AK2A 4G5QA 2HU2A 2A4KA 3R3VA 4CKWA 1COZA 4G26A 5DO9A 3UQZA 2WV9A 3AL0C 1NXVA 1F5NA 4HDMA 4EPVA 2LGJA 3FGZA 2JAQA 5KB3A 3TQIA 2OV2A 1XDZA 4EYSA 3MSCA 3KUKA 1GY8A 1G2QA 2P2NA 4CQJA 4F91B 1U80A 4QFCA 2AGVA 3KVRA 4LZNA 3NEYA 3D6NB 4TTVA 1NUQA 1QGUA 4OG2A 5E9JA 3ZBTA 2VCHA 4DDTA 3QE3A 1ZCAA 1UJWB 2QZ4A 3SKXA 3LDFA 4CTKA 4H7EA 1G16A 3K9WA 4XCQA 2CTWA 4N4AA 4L9RA 2QTHA 4J4BA 4UU0A 2IXGA 4IXNA 5EYPB 4R6XA 2P6OA 1VJDA 5EMJA 4P3YA 3TRIA 2HF8A 4F3CA 2WYVA 1HDRA 2VJMA 1U6JA 1SNYA 1ZVMA 3SIRA 1XTZA 2AN3A 2Z30A 1MGPA 5CU7A 3NWJA 2GNPA 4FGJA 4JJIA 1I4EB 3HDJA 4POAA 3WZ2A 4R2KA 4UEWA 3K59A 3KOMA 4KLZA 4XWYA 1ABBA 3K0HA 1VQ6V 3R3WA 1T5HX 4LXYA 1SQ0A 4O4JB 1Z7WA 5K9ZA 5B6JA 1OBFO 2ZR0A 3AHIA 3WRVA 3O8BA 2B8TA 2VHUA 1VSTA 3NHFA 5LKRA 3QMPA 3QTLA 3W5VA 3DHYA 3VHXA 2FMXA 3PEFA 1S5PA 3W9BA 3H1EA 5FOXA 1XDDA 1GTSA 2IH2A 1SXJA 2IBTA 1DE0A 2EX0A 4UCVA 3SQXA 2VUUA 5EHQA 1XLVA 1XTUA 2P6PA 1KPHA 1TW2A 3SQLA 1FXSA 3OLZA 4K9OA 4I7ZB 4DXDA 5JO0A 2H5EA 4KNYA 1U2DA 3BA1A 1PJAA 4OD0A 3F67A 1KDZA 4D92A 1PR9A 3GY0A 1DTEA 5FYDA 4XGKA 1GXSA 3HVKA 1COWG 3SNKA 3CLHA 1KFEB 4BGDC 4XEUA 2X5JO 3ISTA 2ZDGA 1QKKA 5ALDA 2X58A 3U49A 1VIBA 4DAEA 2WV7A 1I1QB 2ZRMA 3AX6A 1LC0A 2FA9A 4B09A 1MJ5A 3TL6A 3WMEA 3K0CC 1XE3A 3GBPA 4LHXA 3L1VA 3BD7A 3HLTA 5I3CA 3SE0A 1K5HA 1E1DA 1T0IA 3KR9A 2JHFA 1T4CB 2XCUA 4ZEOA 1UPUA 2JFVA 2WG1A 2QA4V 3P2EA 5CLGA 1L5GB 1CY4A 1SQGA 1JBEA 4LRTB 1I3LA 1KEWA 3UVEA 4YCMA 1NVPD 1KFCB 1T2DA 1HP8A 4DA6A 5E79Z 1Z2PX 3F9CA 2ZUTA 2GQ0A 1JPNA 1GQYA 1CPYA 4IFTA 1C1YA 4GR9A 5I6DA 4QUKA 4BVKA 3B7WA 3QLJA 3N1UA 1X6VA 1OLSB 2IEZA 2FEXA 1DPFA 421PA 2EIKB 2RKBA 2XHBA 1EXNA 1XNRO 4MS4A 3V3KA 4NG4A 1IEXA 3ELBA 3WFZA 1MAHA 1B06A 2E87A 4B6SA 3H4IA 5B1OA 1KK1A 3K96A 1G5TA 5DISB 2IHUA 3TGPA 3OZDA 3M34A 4B3TB 2ZYVX 1P0IA 4MV3A 3A06A 2EZ4A 4X54A 3MTBA 4DCNA 4MKXA 3BY6A 5CFOA 4AI6A 1Z4JA 3H04A 1YZBA 2HPVA 5KYUA 1RRMA 5AOAA 4K9SA 2QTVB 3CVJA 2CXNA 3LPMA 1NW9B 3BQNB 1WZUA 3I53A 3IAYA 1SUWA 2I7XA 2IUUA 4B5KA 4NZ9A 3MJEA 3BMNA 4EVIA 4I50B 2ZWIA 1PYOA 3R7WB 4LQCA 2KCQA 2XF8A 1JFRA 1FXKA 1WBJB 2AQIA 2ZYIA 1L7QA 4DA4A 3ICPA 2CXHA 3DMDA 1XEAA 3OHMA 2BMEA 4H44B 1SESA 3NW9A 2VSQA 4BKUA 1EN5A 5CR9A 2PH5A 2R7NA 1T9ZA 4LZAA 1T9DA 3D3NA 2QSAA 1VBFA 3CPWU 4MS3A 5A7HA 4CL8A 1I2MA 1U9JA 2J5XA 4EKWA 5I8PA 3OEHA 1JXOA 1LDGA 3FB8C 3OJCA 4K1LA 2IYOA 4CMKA 1OBVA 3F47A 1Z5NA 2JJMA 2YC0A 3Q2OA 4LI0A 2OM2A 3JALA 2CFOA 3E9CA 4IF6A 2ETVA 2JLQA 4IINA 4J0FA 4MUIA 1NTZH 1Q6IA 4RDCA 3JASA 4MA4A 1T8PA 1WUHS 1R6NA 4KZKA 1B23P 2Z6VA 2XLBA 2FXIA 4BXOB 3RGGA 2IYFA 3IPXA 2LGQA 1ACLA 4F04A 4LF6B 3U3XA 2IQIA 4MKFA 2O48X 2H1WA 3GU3A 2C20A 3T3OA 2WWXA 2LCQA 5SY9A 2IPNA 1TLLA 2HNKA 2V74B 3K30A 3TBHA 2F1JA 1S1CA 4B79A 1WXXA 4U2DA 3AJRA 1R4MA 4P36A 1E3WB 2B69A 5JASA 1E9VA 5LB2A 4JIMA 1YQDA 2QKYA 2WIAA 2IP2A 1D2NA 4H1TA 1KFJB 5IULC 2XJ4A 5I48A 2QT9A 3QXGA 1SHLA 1L3BA 3IPRA 4XYEA 5EVJA 5CIYA 3RUAA 1MMFB 3FA2A 3WAJA 3EMVA 4WZZA 4CM4B 4GBED 2NUTA 4F3TA 4RLHA 4DR5O 2ID8A 3DTNA 2PK3A 2GBGA 2P30A 4HXYA 4OV6B 2Q9UA 2DZDA 5HKKA 2ZINA 3Q3EA 4WEQA 4UTRA 4L5CA 1G20A 3W05A 4KE9A 4ESOA 2Q28A 1I0IA 2OV8A 5DXFA 3ORRA 3RGBA 4XUEA 4LXIA 1D2AA 3D43A 2H4WA 2OAP1 3WGLA 3DE7X 3GIDA 4D6PA 2V6JA 3NBKA 2I6SA 3BRWD 3E7DA 1BHAA 4F1KA 2OQVA 3N28A 4IKOA 3WNZA 1LV7A 1PWHA 4D3FA 1IY2A 2VWKA 4KV9A 4MDHA 5TC4A 4DKXA 1Y5RA 1BVUA 3O92A 3I8OA 1FTSA 5I9BA 3OZFA 3O84A 3S1AA 2BFPA 2QGFA 2Q49A 3UMFA 3VR4D 1H3EA 1KH2A 3AG5A 3ZZTA 3HADA 4MQFB 4QBGB 3DV9A 4MWOA 1GQOA 3SMQA 1CUZA 1RC0A 1D2CA 1LI5A 4R2JA 2ESRA 5I4KA 1K73W 1GU0A 5DNDA 1AK9A 2ERCA 1LSJA 4RXUA 3DE3X 2V7QD 4FC6A 1Z0AA 2ZG6A 4DM4A 1KDVA 4HTFB 1DIAA 3TIFA 5EFOA 1KEZA 4QAQA 1OBHA 3MELA 3SDLA 5C8YB 5ED4A 4D6YA 2FWNA 4NMHA 5J1TB 4L8GA 1DUVG 3I55V 3BPZA 3ZIAG 1UR5A 1X0XA 1GN9A 3QXJA 3ZLJA 4YX9A 3D6UA 1RFYA 1XQ6A 2WFMA 4F7OA 1IHPA 1BVRA 1K8YB 2BP7B 3N9IA 3AY6A 1VKZA 5D1HA 1YXBA 4OF4A 4IGEA 2BSXA 1YCFA 5EHZA 3GJ8A 1W35A 3GLHB 2IOYA 2JFOA 1MOZA 3LF1A 1UBHS 1B00A 2QTTA 1Z75A 1UOOA 2PBZA 4MVJD 3IX7A 2AMVA 2A0LA 1JQAA 4JODA 2NSLA 1XZLA 1TVMA 2CB0A 3RYIB 3OETA 5ALZA 2P3QA 3NJRA 5EOVA 4FLVA 5G41A 3WLJA 5E3IA 4Z9BA 5AK6A 3NBZC 2N46A 4RABA 3T12A 3ZGVA 1DBPA 4LJ4A 5FPQA 3TXYA 1QLHA 3ZHBA 3W2HA 2XMDA 3FIJA 2YFKA 1FNDA 1ZJ4A 4CKWB 2A5GA 2UZ1A 4Z4FA 1XCJA 1JA0A 3AY7A 4ALMA 1X87A 4KBFA 2G09A 5DTIA 1YZLA 4QSHA 1BMDA 4HDMB 3RKUA 4X8MA 4NTWA 2CVFA 4I19A 1T6YA 5FORA 4JI0O 4JJFA 1D5AA 1HYBA 3DO8A 4RQTA 5FI0B 1USIA 5EHIA 2J09A 1I4WA 2DKFA 3O8OA 3B8MA 1QGUB 2UZ3A 2ZJ8A 4UUPA 4EJSC 2XBMA 2BFDB 5ECGC 3OJWA 4PZPA 4HDKA 1JVMA 1XWWA 2IYQA 4CV2A 3IOEA 3VKHA 3UWOA 2I80A 4TWIA 5HKBA 4FTWA 1YIOA 2WJHA 3SR2C 1H5UA 2VJMB 4N65A 3E8MA 4UUAA 4PC3A 1YB5A 5C8DA 1Z5UA 2DQYA 3I1JA 2O23A 4QHYA 3FYUC 3G67A 1XD2A 2NT3A 3QFCA 2IHKA 3D59A 3MWYW 5C7YA 4P86A 2F00A 2PJZA 3K16A 3DLTA 1SEVA 4F6EA 2FSSA 1BWRA 1OXSC 2B5UA 4QPZA 4DV2B 4BLSA 1PNTA 1YB6A 1YU6A 1W47A 1BD3A 4BQEA 4WX2B 3WISA 1EBUA 5AVJA 3JY6A 1K5GA 5KTPA 2J5KA 3FCYA 3VZQA 9ATCA 2Q4DA 3VHXB 4WCFC 1JW9B 2JLUA 1PS8A 4BO9A 2A1UA 5MF6A 4CYMA 1TEXA 1SXJB 4YMSA 4RZ3A 1F0KA 3I2JA 5FULA 3PJEA 3L02A 2OTJV 4BMCA 1PKXA 3A05A 3OLYA 3AR8A 3U3MA 4A0GA 3FWKA 2BW0A 4OQLA 1XT6A 3L8ZA 2QLCA 3HBLA 1T3ZA 3SHWA 4A8JA 3MLAA 3FI0A 5GVSA 1QOPB 3D3EA 4MPTA 3KR0A 4X65B 3UXMA 1V6CA 1EFPB 5CDFA 4FM9A 2OD7A 5CEJA 1CEEA 5JYDA 3LOQA 3S4YA 1CUBA 4CMAA 5L7TA 2J87A 2J7KA 4O2AF 4Q4JA 3R3UA 1TKCA 1RXIA 3DDSA 3F6PA 3OY2A 5IDQA 3K9SA 5IZCC 4K9RA 3PEYA 2Q46A 2W0SA 4HYTA 1QQTA 3DCIA 4YDSA 2FL4A 1RTKA 3DNMA 2I7VA 5BYKA 2YZMA 2P87A 2RAVA 2ZIEA 3IT2A 4RQAA 3ER8A 1AR4A 1NVKA 4LHZA 2OBMA 4OCLA 3COZA 3I30X 4L02A 2H08A 2G3YA 2HMWA 4YN3A 4Q4CA 5CB4F 3SOPA 1MC5A 2SECE 1PNRA 1E6UA 4W5JA 4PBTA 5KJ6A 5JDCA 1XOIA 2Y1FA 3ZH9B 3CCJV 2QAJA 2ZCUA 2ZYDA 4M9XA 3CINA 3R40A 4FLEA 2R6ZA 4ROSA 4EH1A 5C51B 2C7GA 2PU5A 3UH1A 3VBEA 1PNQA 1GN3A 1C0IA 2HRDA 3STYA 4MS4B 1BEUB 1FPQA 3BA6A 3NTXA 2VT2A 3QVMA 1X86B 2EIHA 2GJKA 1XNQB 5JZMA 5DNYB 1LSSA 2FFQA 1NMXA 5ALEA 4J16C 4C7MA 5A6SA 1FUKA 3OIFA 2HJGA 3UF0A 1TLFA 2AYYA 3ABIA 1JIIA 4MVJI 2C2OA 2JFBA 3FJYA 3CLVA 2XZOA 2OR3A 4OXNA 1UX1A 5KYUB 4FILA 1DUIA 2RHTA 1T2CA 2NUBA 4LXUA 3OFNA 1ZINA 1GYPA 3BRWA 2IBZH 3WOVA 4Z2WA 2OGSA 2VNHA 1MW9X 3TOVA 3P2IA 1HURA 3BMNB 1LFDB 3KFVA 3K0FA 1FXKB 2IPAB 3L7MA 1AB3A 3UPTA 4YMWA 2ODTX 3NHWA 1WQ4A 2GPSA 3P3NA 2JHAA 2BGGA 2Y27A 4UUQA 3K1TA 4KQ6A 2O5EA 3SEZA 4DC1A 4MI6A 3QE2A 4CZ2A 2XAQA 4MS3B 4ZEMA 4ZI2A 4J0JA 1CBUA 2R68A 1TYZA 3EASA 4EIWA 4Y6QA 2C2XA 1AI7A 1WAMA 4LYDA 3NANA 4BBJA 3H1PA 4X3PA 3JALB 2VG8A 1IG0A 5JXWA 3F6YA 3DFUA 4Q82A 3TLGA 3JASB 5A5GA 2AZ2A 2ZSKA 2NSJA 4B2IA 1RQGA 3TBKA 3ZC3A 2QRUA 1E2JA 1K92A 4H6PA 2R85A 2NACA 3QIVA 4HGRA 3HKEA 3H8SA 1A2OA 2HK7A 3SSNA 2P68A 1E5TA 3JD3A 4MQ4A 4GOMD 3ZDRA 4GM0A 1R4MB 3LHFA 5AJWA 4XM0A 3BA8A 1H2GA 1BAPA 2IS4A 3K70C 1R18A 1GL9B 1QAMA 2G6BA 1KKCA 2YWFA 3ZEIA 1M0WA 2DJ5A 3TQHA 5DXJA 3IOYA 1NUPA 3TNDA 5THKA 2H92A 3VJKA 4PDVA 1P77A 3R77A 5E8JA 3ZYZA 1CUHA 1M5TA 1QHFA 2NW6A 2NUTB 2WIGA 2B6NA 3UBMA 5EJMA 2R6AA 1B14A 1OROA 4HV4A 1J0DA 1E3QA 1XDBA 4L75A 4UUBA 5ALNA 3KLOA 2VQFO 1G20B 2HMSA 3ELDA 4F4IA 4XDGA 4CIBA 4YXWG 2AT1A 4B7CA 4BRSA 3WNDA 1J09A 3WLSA 4EY7A 1DO0A 4F86A 3GW8A 4Q1CA 4BYMA 5GGXA 5FF9A 1T9KA 2VPWA 3GWGA 4KXXA 2G71A 4M0FA 4CMHA 4MRPA 1UOEA 1DAPA 1IL0A 3HR7A 2J8ZA 2FU5C 1LB1B 1SRQA 4BATA 1C50A 4BQSA 1IMOA 2YVKA 3OJ0A 1R6UA 5LQRA 3SPCA 5K2OA 3M6XA 1B76A 2VSFA 4OI2A 4RDIA 2PH7A 1M1KW 1EB8A 4ILEA 3S1AB 3HB3B 4DANA 3PDJA 4CKZA 4HNUA 1J99A 4G2TA 3PQ3A 1NNUA 3L0PA 4JJ4A 2HXGA 4HRXA 2Q6OA 3SS9X 3P4XA 3IO5A 4B44A 3WIEA 1HDYA 4MEBA 4AY6A 4UE6A 2Z09A 3ZEAA 3V9PA 3ZIDA 3NHSA 3PFNA 2F1OA 3TMYA 1ACMA 2XNSA 2CXPA 4S1OA 1ZD4A 5L7YA 1SB9A 5ALKA 3MTDA 1V7ZA 5DRTA 1VL0A 3QO7A 1W59A 4R7CA 2HXVA 1N0JA 1FFYA 4OH7A 1HT0A 2OL4A 1E5DA 2AH5A 4X6XA 1F2DA 1G8GA 2ZT7A 3MN1A 3I01M 3W0LB 3CCFA 1KZ1A 4TXNA 3KL4A 3FFBA 2C61A 3L1KA 4MR8A 1LCIA 2YZNA 2FB9A 3DOCA 5LHGA 4OMDA 1GL6A 2PBLA 1Y3BE 5F9HA 1VQMV 3FMGA 2TMYA 2OXIA 4BO4A 4PZZA 2KHZA 5LA6F 1WPBA 2EBHX 3U48A 4CKCA 4H9GA 2RC5A 4A1FA 2WI8A 3T7JA 3TIXB 3L6UA 3PHIA 4Y9DA 4I55B 4JI2O 4WKNA 3PNOA 2PYJA 3EFOA 5DIFA 2RGAA 4UM7A 1OLOA 2ZETA 1OX6A 4PXYA 2UZ1B 2BMFA 1W6UA 3MBIA 1YZYA 4B81A 4MW8A 1HV8A 4C4XA 4KK4A 2Y68A 3TNYA 1KI6A 1RRFA 4RV5A 3ZDFA 4HNAA 1HG1A 3KHSA 3O8OB 3A0UA 2ZVDA 3DM5A 5BVGA 4WOPA 4EX7A 1ZZEA 4BE9A 3H99A 5C3MA 5KDLA 2Y1EA 2OO5A 3EUAA 3NUQA 1KEUA 1B8OA 1EEHA 3M3PA 4GQIA 4QXAA 3N8IA 4FBGA 1TGYA 1JX9A 1R4AA 1GPKA 1NVPB 1UXJA 1SETA 3G2PA 4MUXA 1EPUA 4ZEXA 1KQNA 3AY3A 3G5AA 3E9RA 1VE9A 2C59A 3REQA 1YUNA 4J0KA 4JV5B 2YWHA 1XD2B 2ZWMA 3EA5A 2Q62A 3WMXA 4RQEA 1I32A 3LVRE 4GBGA 3WYGA 4G0VA 3SP1A 1HA3A 3ROTA 3IAXA 4A10A 3R3SA 2P9JA 2XPCA 1KAOA 1CJCA 2X41A 3GRCA 1C1DA 4FHGA 1HC7A 2FHSA 1K4CC 5TEVA 5CCDA 3LVFO 4UULA 4GYYA 2WWWA 3FMOB 4A91A 4EVRA 1PFQA 2R8PA 3N2LA 4EG8A 1MN6A 4A2PA 4ZU1X 1ODJA 2A1UB 4M0LA 2J08A 3O91A 3KELA 1M5RA 2J3IA 2DN9A 4J2OA 1NZJA 4H13B 1I5EA 3VV2A 1J2YA 5LZ4A 2O5CA 2Z56A 3W4JA 4B2PA 4BNLA 4RL4A 3LUHA 3QEAZ 1SRYA 4FWIB 4TT8A 4A8JB 5LMUO 1OC4A 1QCCA 4FMDF 1ZZGA 2J9ZB 1Z34A 3OIGA 2IH1C 1TF2A 1DKLA 1OX4A 2NU7B 4KQIA 2I29A 4TWRA 4BFLA 2HUNA 2IEIA 2CXRA 1ZIOA 1R3JC 1EHYA 2YQ4A 4Q4JB 1S77D 2WLIA 1IN8A 4O8CA 2IYYA 5CDYA 1F17A 1SCDA 2FDXA 1XTIA 3KOWA 5CHYA 5EXDA 1J0AA 4MARA 1X7YA 1J39A 1XRQA 5LNK6 4AWBA 3W1EA 5LUBA 1B42A 4EQZA 2JGIA 1N4AA 4CMCA 4QGPA 2LFSA 3DZFA 1R4NB 3JD4A 4C08A 4B85A 1N1GA 1NMYA 1X8LA 3W2GA 3ZWBA 4FMCB 3ZWQA 1YQUA 5DHRA 3CW8X 1ODCA 1U1CA 2Z2KA 4B45A 4QOHA 2W6JG 3MJVA 2O95A 1TW3A 2X2EA 4HMPA 2Q4OA 3FWYA 3PZRA 3OSZA 4X8OA 1QYIA 4UXIA 3VR3A 2QMEA 4FJ0A 3TZBA 1WP8A 1XL1A 4FJCC 1IUNA 3QOFA 2ZZNA 3C6ZA 4E1BA 4DWWA 4LZOA 2R8XA 2Q2OA 1GT6A 3W2TA 4Y3UA 2MSDB 4V0RA 4PNZA 4D74A 2VYQA 5KHOC 1VHDA 2IYUA 4H1HA 3CP1A 1RRGA 1W25A 2XE8A 1QTQA 2EBFX 1NQAO 2DKOA 1XNGA 3K4QA 5A6SB 4OU4A 4I08A 3PUWA 3L70H 4UDYX 2DFPA 1JXMA 3LBIA 5HR5A 1M0SA 3GWKC 4UQPA 3EEOA 3OUZA 3D8UA 1RSZA 4M36A 2N1MA 2ZS9A 2IZZA 1EFRD 2RGNC 3H1FA 1KQOA 1HZZA 1Y9JA 3EXIA 2AW3A 4O08A 1KAHA 3M99B 1XRPA 1E1KA 2WF5A 5ELXA 5IM4F 1PGNA 2XZLA 2C94A 1YGYA 3K0FB 2FQ1A 1SVIA 4L8JA 4FYXA 4D0RA 1ZQ1A 4OVKA 1RNLA 3CO5A 2W9XA 5IK2D 5JH7A 1UQRA 2EINB 2HKIA 3MUOA 4JK3A 3FTDA 4FFMA 2SKEA 2JDIA 3AUJB 1FD9A 3V2IA 1U98A 1ZUHA 4LZPA 2P91A 2VUTA 1ZI8A 4GGMX 2ZT5A 2XAJA 4RK7A 5BZBA 4FPPA 4BKMA 121PA 5U1PA 4KVGA 2VNSA 3ANTA 1SCIA 4IIVA 3V4VB 1LF0A 2WF9A 1OASA 5DK6A 3E61A 3O9OA 4MRNA 1TO6A 2FQYA 2V4MA 5GPBA 7ADHA 2HIAA 5HMLA 1BQ3A 1F51E 5DGDA 3TLGB 3W7TA 4YCJA 5D01A 2HVWA 3UW3A 3LBFA 4FXOA 1O94C 1OWNA 3R6DA 4RF5A 1Q14A 1BH6A 2V5AA 1G4HA 4HDSA 4ZKEA 4CG0A 4FDLA 1PWXA 1TDJA 2P11A 4DLXA 4EW3A 4H7PA 1GPMA 5EYPA 4TLDA 3E9ZA 3ABZA 1Q5OA 4JAVA 1Y8AA 1YQWA 2IITA 3GEMA 4LH6A 4WK2B 4EARA 3UJ6A 3K8QA 4U4AA 1UBNA 1QV7A 4N8DA 4EYOA 1V3VA 4ZANA 4ZHQA 3CU5A 2OENG 1YOVB 4YH1A 6REQA 4CHGA 1E4OA 3DVLA 3F90A 4ZYUA 2WLJA 2H5JA 2PKCA 1MFPA 3E0QA 2GWRA 4HRYA 2NQTA 3KQUA 4LPSA 4E2FA 4JFAA 5FHRA 2FG5A 4BV2A 2F3SA 4D4LA 4HRAA 1CB7A 3KQYA 1G5QA 2VSXA 2IXAA 4OBXA 1FJ2A 3FLBA 1YVRA 4GR5A 1ZW1A 2CFSA 2ZWVA 2I2WA 1Y0BA 1DAFA 3VOTA 1GRQA 2WPDG 4W99A 1XC7A 4HC4A 4M1KA 4XDKA 4MYSA 3WKEA 1VQ4V 2IW3A 5ALTA 4CLRA 1CF4A 2GF2A 4PICA 3P5BA 1KAQA 2JIZG 4KODA 3O3MB 3U4DA 2V0GA 4MP6A 1TJ5A 1SN7A 1GO2A 1V6AA 2HGZA 1MJHA 2QJRA 3VTZA 4ZCMA 2UUAB 2P1DA 3OZRA 4J7ZA 4Y2XA 1B26A 1GH6A 3FCOA 2PXXA 2W6IG 1HE3A 2XT9A 4G9GA 4QD3A 1S4MA 5D7BA 5KKAA 4PS0A 3CMAV 2VSNA 4Q21A 5BQ3A 1RYHA 2GBLA 4P0TA 2G4LA 1JEJA 2VLBA 2ODAA 3KOZA 2DAPA 1THGA 3EQ2A 3EQ9A 2WHYA 3U7HB 4D2IA 2XOKG 4V0QA 2XKKA 1HT1E 3QJGA 3EUEA 4GE3A 3HU2A 4DUGA 1MRNA 3CPHA 1DAGA 4JUBA 5HFLA 2NAFA 3ZVLA 1BGVA 3WA7A 1YE8A 4U9HS 3OEEG 5IBQA 2R44A 4R3NA 3U1VA 5CFQA 2Z3YA 3WXBA 2ONZA 4Y30A 3ZPXA 1P17A 4RZXA 4CLEA 2ZXEA 4CCWA 3F4BA 3SYLA 4MVQA 1I1OA 2WU0A 4MR8B 2AHRA 4JOSA 5KMGB 1RRCA 1FDOA 4LY9A 2B3ZA 3OQHA 2JAHA 1JDZA 5BUSA 3J81A 3Q0IA 3N7TA 4V38A 3CRW1 1QV6A 3D4NA 4PR0A 3T5MA 1OLSA 2NADA 4CDNA 4DG9A 1SJ9A 2L6LA 4B9AA 5ICGA 2OBBA 1ZL0A 5TE9A 3IULA 3T34A 2O8DB 3ZQJA 4ZO7A 2YY6A 4Q9JA 2GESA 3WWEA 1AXRA 3F5WC 1GEGA 2IYLD 3KVVA 4RMJA 1OV9A 2P9ZA 4PINA 1TX4B 3EFOB 7GPBA 3IGFA 1NR7A 1T36A 4BOYA 2P41A 3ICXA 3RSSA 3EQ7A 5J4KA 1O95D 4C07A 4AJ4A 1KI1A 3D0RA 4PZCA 2QTVA 3CW2A 1OT3A 1Y33E 4BV3A 2JVDA 1N2CE 4ASUD 3F1KA 2R0QC 4HNAB 3LAWA 2Q3JA 4UARA 2DHQA 4I50A 4LZZA 1BE1A 1FB5A 3R7WA 4C87A 1DF5A 1NQ5A 2G0TA 2R4QA 5F4BA 5JJCA 1BU5A 1K0FA 1BXZA 1E9BA 1FF9A 1VRCA 4QEDA 1YB2A 3A4MA 3RFTA 3LDAA 2PT6A 2QOEA 4IIXA 3L0CA 4K26A 1YMUA 4Z9XA 4FLTA 1OW3B 1RYMA 4JA2A 2VNAA 4B3SO 1H2ZA 4AW9A 4B4WA 5CJPA 3HJFA 2F7SA 4D3SA 1FTGA 2Q5FA 1NN0A 5EIFA 2OWEA 3IMEA 3ECAA 3TK1A 4M8LA 4TKUB 4HB0A 3DTVD 4JUAA 1T5LA 1R8SA 4PSCA 1YA6A 1PR4A 4BP1A 3UCSC 1C1DB 2AC4A 1G17A 5JADA 2OCXA 3QTTA 3DYVA 3IXMA 1WXIA 4QULA 3TINA 2COUA 2JIBA 1DRKA 1ZM4A 3AFGA 3UMVA 2BE3A 1Z8HA 3SXPA 4Z99A 1SPXA 1RI5A 4KVZA 3DJYA 1L1FA 2VJNA 3EIXA 3KHTA 3ZWOA 2CEAA 1RAHA 2XMGA 5DHFA 3WWOA 4RGQA 2KE5A 1SPBS 3LUCA 3NHMA 4Q3AA 3K5LA 1EU1A 4QFBA 1D7AA 1V2HE 3R7AA 5DBIA 2D2IA 2PRYA 4CM4A 2ZI7A 2RHGB 4HT3B 3SAJA 2BE7A 2V5UA 3NP7A 4B7UA 2OB2A 1C2TA 1OX4B 5KI6A 1VCHA 1T0HB 2VR1A 1EQUA 1JVBA 3RJMA 2A7QA 5T4BA 1X7DA 3P9PA 1G4UR 3TX6A 1P4RA 4TRRA 1MA1A 3LWZA 2XSZA 4NFHA 4S1PA 4DR7B 2C9OA 1TKRA 2I1VB 2HI0A 2VH5R 4OP1A 3OUTA 3K0KA 4JXJA 3C5CA 3EEIA 1JJ7A 3FDJA 3ELYA 3CUEF 2FX3A 1DRUA 3SYNA 1KMHA 2EP5A 2W6MA 1F2TB 2XQKA 4OEHA 1KOJA 5G3ZA 4NH0A 1ZUNA 4N23A 1SQ6A 1P33A 3BEDA 1QH0A 1ECJA 3NC1C 3INYA 4HHEA 3AZQA 4XYGA 5CGQB 3BA9A 4MW4A 5JWPA 4CXMA 3VU0A 1OCRC 2AN4A 4HZUA 4ID3A 5CMLA 1WETA 3FB1A 2X22A 1NV9A 3U56A 2FG6C 4Q3DA 4J1TA 1NDUA 4CQMD 3FHLA 1X0VA 4CW7A 1V5WA 1ML3A 3KJEA 3TLKA 3RF6A 1GCAA 1EK0A 4NI5A 3ZE8A 5DT2A 4X97A 5C8YA 3GRRA 4QOIA 3VRHA 4FNAA 1ZMBA 1JZSA 4TUYA 2HCJB 4Q7JB 2BGLA 3Q4HA 1GYQA 2BM8A 3C6KA 3EAFA 1AZTA 1EWTA 4L85A 3RG8A 1ITZA 4Y0VA 2Y1GA 4XD2A 3SC4A 4KAXA 4RWZA 1J25A 1K1EA 3SEAA 4JYPA 3EXIB 2J3EA 4GEKA 1AQIA 2FVXA 3OIVA 2HJWA 4FYKA 3FIUA 4KQEA 1YGPA 1V5FA 3WHKA 2PJDA 1EHCA 4EHFA 1FEZA 3GV0A 4ZDIA 1NXOA 2P5OA 4DV0B 2YINC 3OI7A 3TTYA 1O5OA 3K9BA 3GK3A 4ZCLA 2EXXA 1E2BA 4MTOA 1KQSU 2LXNA 4ZJPA 4JT9A 5KQMA 3PD1A 3BDIA 2OCCB 2EKZA 3PICA 1WZEA 1ETUA 4FZJA 2IVZA 1ZGJA 1GN2A 2IJGX 4WKBA 2ORIA 4OB7A 4U7PB 2AMLA 1GG5A 4NE9A 1R0XA 3RD5A 3ROQA 4RZSA 3E5RA 1TJNA 1W85A 1E1RD 4GM1A 5FBQB 3ROXA 4IM7A 3MWKA 4Y2RA 4ZFTA 1ZN2A 2GN8A 1OI0A 4PO8A 2GI4A 1NXWA 3RVMA 1YA8A 5AXCA 5A4AA 4LY3A 4UEOA 2EF1A 1RAIA 1LNSA 3W34A 3QM1A 3PU6A 2QUJA 2PCLA 4NE7A 4YAIA 4K9MA 2BFDA 4RD4A 5DN6D 1FC0A 1L7MA 4HDSB 4MYTA 5EEHA 3Q1LA 4WY8A 2DQKA 2XWJI 3E1UA 4UBLA 5CN0A 1NVDA 3IKVA 1L4LA 4QX6A 1SK9A 3HCNA 4N40A 4MUYA 2BV3A 3C3SA 4C1BA 4LOLA 3FOAA 3RARA 1Y4ZA 4NBLA 2OUIA 1ZWLA 4WOBA 2VK8A 4RVUA 4MA0A 4ZHQB 2YHBA 1MR3F 3DDOA 4CTOA 1FRFS 2OVFA 4QUAA 4OB8A 6REQB 4L16A 3VTFA 1A8SA 2FF7A 1XMQO 5EK0A 4YJ2A 3OE7D 5CT5A 3RRZA 1WSBA 4HH4A 1P0CA 3N87A 2P67A 2PX4A 1IBMO 1N1MA 4AD8A 2ZT6A 4W7HA 3H01A 4AP9A 4W5OA 2CKDA 2BCCH 3HI4A 1PFGA 1V26A 2PUHA 5FEMA 3SLGA 3L7CA 1KU9A 4PGAA 1MB4A 4II2A 2I2BA 5BSEA 2LRHA 1UL1X 4WW0A 3RC1A 5HJ5A 4ASUA 3DP9A 2R6FA 3BFRA 3MOSA 4RELA 4BDSA 1Z18A 4IAOA 4YUYA 2HWXA 4CLRB 3BRSA 2NYTA 4GX2A 4PXAA 3B1KA 3T5TA 3W7WA 4PYNA 2O7VA 4GUDA 4MI9A 4RY2A 5TT1A 3FMFA 3CEMA 1DQNA 5C46F 2V7BA 1BVYF 4QTZA 3SYQA 4IJMA 4S24A 4KXLA 1XRLA 2BZSA 4JQSA 1EFPA 4ZPXA 3L4KA 2H00A 1D2HA 3S2YA 3CF0A 2VP6A 3QQPA 1L6RA 1N2GA 4E6PA 3HXTA 4I5FA 2A30A 4ALKA 5KNCH 2Q5CA 2YYYA 2GAFA 1QIDA 3CPSA 2C5HA 5HF5A 2XIQA 5CX4A 3M6FA 3GP3A 2A0KA 4I4NA 5AKKA 1SUFA 3GL9A 2UZ4A 5B5SA 2XLCA 3FPFA 3HUDA 2RGYA 2FUEA 3KT0A 5B3KA 3RKSA 4TV8F 3AGPA 4PRKA 5K8CA 4BNGA 5HUHA 1NJIW 2C7BA 2F8LA 3ZJ4A 4N3CA 2ZRHA 1YJAA 3DKPA 2O0LA 1K7XB 1T10A 4WJLA 3UYKA 3QBVA 1HF3A 2VAPA 2VOJA 3T1HO 5AVOA 1KSHA 1S8FA 2XW6A 2R7KA 1IVNA 5BSHA 1PV1A 4H7JA 5BYBA 4A5OA 1XZJA 5CK4A 5LQCA 2C5AA 2E6UX 3AR3A 4GKJB 2J67A 4OGQB 3PUVA 4RV4A 2HLHA 1DTSA 1E77A 1Z17A 4REQB 1R3IC 2ZTUA 5CH3A 3I9V1 3G2LA 2QN1A 4U2KA 5KVVA 4ZEVA 5CVUA 4PFJA 4RSHA 1W9HA 1IBLB 2Q2VA 1E0AA 2EILB 4QASA 4E51A 1T36B 3AKCA 5GM2A 2ZR3A 4C14A 3UK7A 2VHWA 3Q5DA 1IXSB 1H0KA 1SD5A 4RPCA 3EH1A 2I2FA 1V7QA 1KJQA 1N92A 3U0VA 2VUHB 2JFXA 5CG2A 4TSKA 1DGQA 3CE6A 1E1QG 2QVLA 1GGVA 5DBEX 3NGMA 3FTQA 4US2R 2RBEA 5K8LA 5JC8A 5LQUA 3RAPR 4KAJA 5BRNA 4AZTA 5AXBA 1U3WA 2QSUA 2PLNA 3JW8A 1HDOA 2QMZA 4K03A 3RHSA 2GMWA 1DKOA 4IG4A 3IR5A 4DSUA 1FU4A 3VKUA 3HCEA 1KVUA 2WC1A 4JP5A 4I1RA 3N0RA 4RVGA 2BHSA 3DT6A 2FUKA 3V7NA 3D6FA 3WL7A 2FQXA 1FDWA 5TIIA 3AKEA 1WE2A 4P31A 4Z3KA 3SHQA 4M1ZA 2GD0A 4RY8A 5TQJA 1W9MA 2RHDA 4M9CA 1AG9A 2JLXA 1B6SA 5AVTA 2O1EA 5EHXA 2ZBQA 3WVNA 5GIPE 3QLVC 1SVKA 3NWBA 4XWKA 1JFVA 1UZLA 1JEDA 3LNNA 4AZVA 1NWCA 3D2AA 1Z6TA 3FH0A 3NORA 2QWRB 4AILC 3MJ4A 1C80A 4KDFA 4D41A 3JYOA 1DO2A 3MYYA 5T8KA 2WF8A 1JZQA 2QRHA 1X77A 2QUIA 4RO0A 4V2IA 3OQNA 4PVDA 1IB0A 1AQ6A 5HG0A 2P0YA 2PR2A 2VJYA 4IGKA 4YFVA 3FB4A 5LMNO 3O73A 4MKGA 1KZ9A 5EZQA 3SZGA 4UUJC 2BT4A 4JI8O 4TXHA 4H1UA 3KTAA 3UFXA 4ZOEA 3E18A 1SUEA 3BHIA 1TO2E 3RHTA 3D36C 3FR8A 1GK9A 1L5MA 2PPLA 1E1RA 5B2EA 5GW7A 3FHOA 5D8DA 4B6GA 2NN3C 4HQFA 4COKA 4RQFA 3BEOA 4JL6A 4ZD5A 2G67A 2X9LA 5A6VA 3R76A 2EARA 3IQZA 1HNZO 3PJSK 1E5LA 4AKIA 2R4UA 2CL7X 5DN6A 5EC1C 1TMKA 3AG6A 4B7XA 2BCJQ 1KMHB 4QXRA 2PZKA 1ZEMA 3FWZA 4LBYA 2EJWA 4OJMX 4KBYA 3PLRA 5B3JA 1GGMA 1YIDA 1ZUNB 5BMVF 4HUJA 4V1CI 2RGGA 3WI7A 4L5BA 4YWJA 3C3EA 2F9FA 2YXNA 4P4NA 5HJEA 3FE2A 2H8PC 4ND3A 2AG0A 3U60B 1ND6A 4KSBA 1Q19A 3OCVA 3PT9A 1E0JA 3BX1A 3BIFA 3OZBA 2B5WA 3ACDA 1SOUA 4HZUB 4YP5A 4HX9A 3ZY5A 2VYCA 3V8QA 2OTCA 3TLEA 4PAOA 1W5FA 1PR6A 2FUG1 3OE7A 2OOKA 3PPIA 5AOCA 4YMVA 2HU5A 4W5QA 3S27A 2XUAA 4FT2A 4YRPA 4ZVPA 2Y2VA 1V54C 1PL0A 4RD3A 2CE2X 4A5SA 1U3GA 2GERA 2H8KA 4TUYB 4YP9A 4E5DA 3Q4HB 4YP6A 1N7GA 2D4HA 4D45A 2FRDA 2W48A 1D4OA 1E7MA 4YI3A 4BMSA 4DLYA 3A2LA 4GLXA 2H4JA 4HDAA 1AHHA 1MFZA 4NENA 1TKBA 1NLUA 2NO5A 3W5CA 1FJHA 1MO2A 1DKQA 7REQA 1VYUA 3FYCA 4OGGA 5CXQA 1WDWB 4PDRA 2OKCA 5B64A 4PV1B 2RI6A 4EUHA 1LVUA 1U8XX 3DXXA 4Q19A 2JCSA 2P5YA 4I55A 1OGIA 4Q39A 4P34A 3BK7A 3DR3A 3V00A 4TV9F 4UM8B 5DBGA 2OGWA 4ZO6A 1ZBDA 1FZTA 1ZNXA 1KEVA 4IIFA 3TLBA 2BRUC 1M1XB 4PEVA 3VVBA 2QN6A 1JHYA 3PJGA 1VJ5A 5HFJA 2N3ZA 3F97A 3CE2A 1JTEA 4IOKA 1W85B 2VTVA 2XYHA 4BV8A 5YASA 4FN4A 1SULA 2FPOA 4FFDA 1KZ4A 4HEA1 4MUEA 4WACA 3G7UA 3COYA 1OAOA 2BSKA 1ZMOA 1MLDA 3E22A 1NBIA 5E2BA 3ABSB 5TY0A 5J58A 2IJKA 1P49A 4J0HA 5B58T 1BQEA 1RKQA 5KKCA 3SIXA 2CDNA 3I4FA 3WX0A 3AMVA 5DCLA 1RXUA 1VXRA 3T9CA 4Q16A 1TM2A 1W0CA 3BSSA 2Z3JA 3EGVA 3EZFA 2R8YA 4YRBA 2GUGA 3K72B 3M4ZA 4FJ1A 2OFWA 4DMLA 4YJ2B 1GTL1 1VQ8V 4G5YA 3REFA 5LYJF 5GWXA 5ES3A 4LF9B 3CW9A 3KT6A 2FPKA 2FLVA 3LV8A 4F97A 2R72A 2BUBA 4J29A 1NF9A 5ICMA 2Q5JA 3CX7A 2FZVA 4J9UE 1A32A 2VNKA 1VA5A 3KV3O 1GPH1 3UGTA 2YXLA 1IWBB 4DM7A 4YJHA 2DG2A 3FTEA 5B4VA 2WMOB 4IJQA 3NEJA 1J0CA 2HDNB 5HJ2A 1WXEA 4F2HA 3PE4A 1GTRA 4MV7A 4U7JA 2XB6A 3FCAA 2XR1A 4RF2A 1UEIA 4P38A 1LLCA 1X7HA 3PENA 3LMKA 3FNBA 4PSVA 2J33A 3ROEA 4ARIA 2XWBF 2EX1A 1WVGA 2HM7A 2X6QA 4KJZA 2J3MA 3VX4A 2PL3A 2I76A 2HQRA 3PRJA 4H6WA 2WDZA 3IURA 2NU7A 3PXDA 1T0PA 5C1DA