1HDJA

Human hsp40 (hdj-1), nmr
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
77
structure length
77
Chain Sequence
b'MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN HSP40
publication title Nuclear magnetic resonance solution structure of the human Hsp40 (HDJ-1) J-domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Molecular chaperone
total genus 29
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1996-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1hdjA00
2YS8A 1BQZA 1N4CA 2LGWA 1NZ6A 2LO1A 3UO2A 3UO3A 1GH6A 2N04A 2DMXA 2QWPB 3APOA 2OCHA 2CTPA 2CUGA 2GUZB 1BQ0A 2PF4E 2CTQA 2EJ7A 2GUZA 2M6YA 3UCSC 2YUAA 4RWUA 3APQA 1WJZA 2N05A 1XBLA 1FPOA 2Y4TA 1FAFA 1IURA 2L6LA 2DN9A 2QSAA 2KQXA 2QWNB 4J80A 2QWRB 3BVOA 2Y4UA 4J7ZA 2CTWA 2QWQB 3AG7A 2QWOB 2CTRA 1HDJA 4IT5A
chains in the Genus database with same CATH superfamily
2V7QG 3RYFB 4JI5O 2EINB 1YI2V 3E8HA 4LF9B 2QR4A 4J10A 1FXKA 4N21A 1ZWIC 1RPRA 4WFEA 1MABG 3EVKA 2XAQA 3FB5C 1OCZC 3SPGA 3OUSA 3T1CA 3ZHUA 1SA0B 4B08A 3K5MA 2Z3YA 1BE3H 3UKMA 3BABA 2MW2B 2YDEA 1W0JG 4P9PA 4LFAB 1QR8A 3QF7A 4NXNO 1FYJA 1Q7YW 2AHZA 2EIMC 4LF9O 3UT5B 3ZRSA 2N05A 3VOUA 2GTSA 4IIJB 1WPXA 4R6ZA 3K0GA 3ETEA 5LMNO 1WNSA 4LF7B 3M7MX 4F4LA 4UVBA 2OCCC 4CC5A 2ZNJA 1R6NA 5CBGA 4JAVA 5C93A 1TVKB 4DV4B 5GTIZ 1VQ5V 4R8CA 3JYCA 2B9ZA 3NXSA 5K1PA 3CC7V 3LDDA 4W4KA 3SJBC 2HJFC 1HNWO 3BVOA 5LXTA 4TSFG 5B1AC 4LF7O 3O9OA 3K3WA 2IM9A 3K08A 3LSUA 2ZIMA 4GKJB 3I56V 4G27B 2XAGA 1E1QG 2F23A 2CUGA 4TUYB 2PGGA 5LGTA 3K5LA 3SR2C 2HEPA 4UV8A 4DR1O 1I94O 2IU3A 4PA6A 4OX9B 2QM4A 4PA7A 3WG7B 4CS2A 5CMUA 3E8BA 3K5OA 3T1YB 2WLIA 5EK0A 2X7RB 4FVMA 1VP7A 4GKJO 1IXBA 3H9VA 4LNUA 1SQGA 5IJ9B 2A3QA 3BHPA 1CPYA 4OPHA 4MVRA 4OX9O 1FXHA 1YJWV 2BOCC 2CTRA 4PDLA 2ODMA 1FKAO 4XDKA 1PNMA 1XI1A 1R3IC 1YIJV 3LUTB 1T5EA 4CS4A 4TT3G 1R3LC 4YJ3B 3HKCB 1WPBA 3EFFK 2Q7EA 4DK1A 2AZ2A 2P7TC 1DGSA 2DOSA 5JQGA 4TQDA 1WLEA 3AK3A 5JH7B 1KP3A 2GV9A 4KUMA 5B66Z 1EFRG 4CH6A 3BAAA 1J95A 3E8FA 5KUMA 3X2QB 4DR6B 2JIZG 1R3JC 2WLNA 4X1IA 4U3JB 2JDIG 5IJ0A 3MAQA 4EB6B 2E75B 4X65B 3ZJZA 2MK3A 3IGAC 5B1AB 4DV1B 1XMQB 4K8ZA 4LCUC 4YIPA 4B3RB 4U3FH 1GTOA 2OT5A 3S3XA 3AG3C 3UCSC 3MDSA 1YHQV 5CA0A 2RN9A 3CE2A 4LWSB 4FLUA 4CH3A 4UFZA 2ZT9B 5D5QA 4EFBA 4YJ2A 3CP1A 1Y6XA 4LFBB 4X65O 3OFNG 4X66B 1DTOA 3E83A 3RGBA 2W6IG 1AJNA 1KMIZ 4X1KB 3RYHA 4JPRA 4MVMA 1H2KA 3SYCA 4ZHQB 4B3RO 2GUZB 3O65A 5EC2C 2XHBA 3G71V 5KAIZ 3ZX6A 3CCRV 4NKGB 5LP6C 4H33A 2LFSA 4JYYA 5F2VO 2ZM6B 2CK3G 1B3QA 3DC6A 1Q86W 4X66O 4GZRB 2E74B 2EIJB 3ZHRA 2EJ7A 2H3OA 2X6BA 4O4JB 4RQFA 1JJOA 2L6LA 3T2MA 3BPZA 2QTSA 2YXLA 2CAZC 4AI8A 2UUAB 4X1YB 3ZMZA 3B8MA 1PL4A 2BSKA 1YDXA 2Q5ZA 3EXAA 5CA1B 4JAUA 5KMGB 2HFEC 5L3BA 1ZAUA 2EILC 3T1HO 5IT9N 4DUYB 1OCOB 2UUAO 3BFRA 1PV0A 3C90A 4O4HA 4ZOLB 4UVCA 3FAVB 5ITZB 4P2ZA 5LHIA 3AG3B 3JAWA 3ZHVA 3B40A 2XOKG 1YJ9V 3FD9A 2KKWA 3PN1A 4B3SB 3MHHC 4W4LA 3BA8A 3KCYA 1Q3EA 1M4UA 1FD9A 4Z1MG 4L8JA 1BGYH 2BOBC 1LUWA 1QQCA 2ILMA 2L35A 1MSDA 3CSXA 4FLZA 3GWOA 2ZDIA 3APQA 5C8YA 2QSAA 1SQXH 3CMEV 3WB0A 1AI7A 3RWRD 2IU0A 1VEWA 2QWQB 5LP6B 3FYEB 1RP3B 3Q4HB 5EBWC 4FJCC 3JAKA 2DMXA 2QWPB 4MW8A 1Q81W 3BCCH 4JASA 1VQ9V 2IJKA 3L75H 2P06A 4O2AA 1XNRB 5CBHA 1F7YA 4MTFA 1H38A 1P4RA 2JVDA 4X20A 1SESA 2IH1C 3F5WC 5K1XA 1Y67A 1YSCA 4I55B 3W7SA 2A79B 4GLXA 3HKEA 1GAXA 1HNZO 4JI8O 3S3WA 3RW0A 4UCRA 5JVDB 4DV3O 3OM3B 4WFGA 2Q6AA 1N33O 2UXDB 3AG1B 1XNRO 4JI1B 1VQPV 1NH2B 4DXWA 2OWOA 3ABKC 4U7NA 4DV2B 2Y69B 3LNNA 2AW9A 3FB7C 1E1RG 1K97A 1QLEC 2EILB 1N8RW 1H8EG 2O57A 1XL6A 3APOA 2QJ1A 1AR5A 1R3KC 3G6EV 3OEHG 3SYAA 4GX5A 3P3NA 4IL6Z 1AI5A 3PJSK 3VQVA 2PTMA 4O2BA 3ZHQA 1K3EA 1QHTA 1KD1W 5HFMA 5DEDA 1SKVA 4JI1O 4CH5A 4YIOA 4X8AA 3EHBB 2R9RB 2V1DA 4NR1A 1G4YB 1L8DA 2DE0X 1PP9H 1AB3A 2W6JG 4B3MB 4I4TB 3ZRWA 5LYJB 2Y0IA 3IJ4A 3CCSV 4JI3O 1S5JA 1GN4A 2XASA 1XUQA 5IY5C 1CP9A 1XNQB 3H1HH 5GW7A 1NTMH 5EIBD 3B8NA 1MSWD 2KQXA 4JTDB 4AQYB 1YITV 3P30A 1K5QA 1SETA 1FFXB 5JWPA 2ZXWB 5KHGA 2EINC 4GYCB 1AR1B 1WP8A 3ETGA 2ITDC 4LF5O 3GB7C 4PDRA 2R9IA 1K4CC 2PY5A 5EC1C 2RMKB 1ZSPA 4HBNA 1K34A 2FTKA 3AG7A 1VF6C 2AZ0A 3G67A 1NH2D 1N4CA 4N23A 1H2GA 1TUEB 2WLMA 5CB4A 1YJNV 1BHBA 4JZ2A 2WWWA 2F95B 2OYQA 2YIBD 1HW7A 4JTAB 4WF9V 1V9PA 5IWAO 2WPDG 3JASB 2DYRB 1Q6HA 1EN6A 5EZYA 2JGUA 3K79A 3ABKB 1TUBA 4YY3B 1Y76A 4X64B 4ZI7A 5DECA 1RFYA 4LBEC 5BMVB 1GH6A 1WN7A 2B5UA 3BY6A 4Q6GA 4CH4A 5LOVA 4NXMB 3QTCA 2UXNA 1TA8A 4C7UA 1I0HA 3QO7A 3CS5A 4QNHB 1Y74B 4OXSA 2F93B 3BA9A 3ETQA 4PI0A 4WBNB 1QCEA 4MTXA 4IT5A 2E5LB 5IYBO 3TJTA 3HKDA 4JAAA 1M56B 2CH7A 2G38A 4WFFA 3N2KA 2LW7A 3CC2V 3MHSC 4K0KO 4FFBA 2HKOA 5GONB 2ETNA 1S5LZ 1K5SA 1GK9A 1ORQC 3CCQV 4B7EA 3RBZA 3SYQA 3GWKC 4GKKB 2IW5A 1AJPA 3QO8A 2E5LO 4IGGA 2YEVB 5IYDO 4QPKA 4NXNB 3UQ8A 3K57A 4O4LB 4MVSA 4GUNA 3OGCC 3CXHF 2W0XA 5LMNB 1Q43A 3F7VC 1RM1B 2M7WA 1NBMG 2ZCEA 4FK5C 2UXBB 2N74A 3THOA 4GKKO 5KUKA 3H1LH 1AI4A 1KUQA 1RSOB 1QU7A 1JMKC 1JQ0A 4IHJA 4NTXA 3B77A 3G4SV 5BXZA 1SQBH 2JS5A 1K33A 1D5NA 1WA8B 4JF3A 1HNWB 2IH3C 4MT8A 3WU2Z 3OT7A 1M5IA 1XL4A 3U10A 2QGNA 3JAMN 2UXBO 2H8PC 3CJHA 3OMNB 1AJQA 1GN6A 4L87A 5LHGA 2E3CA 1ZTEA 3X2QC 1I5XA 2OCHA 1BT8A 1IDSA 4A5UB 4NTYA 2K1EA 4PHZA 4DR1B 1NTKH 2XAJA 3D8CA 3FFQA 4GX2A 1I94B 2B1GA 3K9AA 5B1BB 4WFAV 1S77D 3RYCA 3ZIAG 3ZCCA 5KX5B 3G6BA 4GX1A 1W0KG 2HLDG 4TV9A 4ABMA 2Y0PA 1NZ6A 3OTOB 1J5EB 1VF7A 1JFFA 3CCMV 3OR7C 1GM8A 2JGDB 1N0JA 1DF4A 1YCIA 3JALB 5A2QN 1I08A 5JJJB 1GM9A 4J80A 5KA5A 2F43G 3N2GB 1L0NH 3K5NA 2HVJC 4QE7A 4FIPC 1BCCH 3JATA 2EZOA 1W2BU 3OTOO 1NR1A 1J5EO 2XNDG 3UM7A 3C3SA 3T4DA 3ZMVA 1FJGO 4E2LA 1R73A 2H94A 2UUBB 5IYZA 1BZKA 2QWNB 1YTFB 2DW4A 1SQPH 4WFBV 2HR3A 5IE9A 1KB9F 2EIJC 3RYIB 2QE7G 3CRCA 1F51A 1S0VA 1XMOB 1NS1A 1JCHA 1JJ2U 2WA3A 4TV8A 2UUBO 4JI6O 4ICGA 5H6RA 2DYSB 2Q7HA 5J2TA 3CC4V 4X9QA 1PD3A 3ZN0A 1V55B 1WAZA 4I7ZB 3K03A 3AEIA 4BW9A 3AG2C 3P3PA 3QNEA 1Q6IA 5JCOC 3ZS8C 4F6RA 1XMOO 2UXCB 2FYUH 2ZE7A 1R6KA 3QVNA 4MVZA 1Z5WA 1OCOC 3R66A 4EKWA 2WLLA 2PUSA 5EYPA 2EIKC 2HHHO 4J9YB 4UUJC 1QLNA 1HNXO 2P4VA 4DRXB 5KHJA 1DF5A 3T4ZA 2RCVA 1ENVA 4X89A 3L73H 4Z2WA 3ASOB 4LF6O 1SERA 3CCVV 1XHXA 5FNVA 1GRJA 4UCOA 5LA6B 2UXCO 4OPAA 2Y4UA 1Q82W 3F7YC 2DQ0A 4FM2A 1ZL8A 2XAFA 4B3TB 5L3CA 5B3SB 2JJ1G 4PA3A 4FFKA 3CWBH 1YTFD 2VRZA 1AP5A 4NTWA 3DTUB 2BTQA 5L3EA 3ZRXA 3E22B 1H2NA 2ZR3A 1NKDA 4EFEA 3B2EE 3ZBHA 4F6EA 1EM1A 4HAMA 2ZD9A 5CBFA 2ZIOA 4I0XB 3CRRA 1KU9A 3W7WA 4B3TO 2AHYA 2AGAA 2KG7B 3D36C 1U97A 3G80A 3LSQA 5EIBC 1OV9A 3ABTA 3DXRA 5J2UA 1KP2A 2UXXA 1AP6A 2WLHA 3HKBB 4LFCO 2RNBA 2VQEB 4KHPO 4DV6B 5B5EZ 4KP4A 1TGOA 2QA4V 2LP7A 3T1HB 2RQ6A 4HNAA 3B4SA 1R1BA 3GVMA 4O4IB 3RYFA 2CGNA 1F4NA 3VBBA 2RJZA 3AG1C 3H1IH 4DUZB 3AG2B 1L1FA 2NNUA 5KLVH 2VWJA 2VQEO 3CCEV 1BSMA 4DV6O 4GT1A 3ZN1A 2FMLA 3ICXA 1NU1H 2BCCH 4I50B 4LH7A 3STLC 4FPPA 2Y69C 1SA0A 4GX0A 2R9AA 3TGUH 1KKCA 4MS2A 3JARB 4ASUG 2P22C 2EIKB 2YXHA 1JPXA 1PNLA 4MVUA 1IBMB 1S72V 3OGIB 3K0DA 1OCRB 3UT5A 4DUZO 1MMMA 3WFVA 4DV5B 4IIJA 1P84F 5B1OA 2K9PA 3JD3A 3CCLV 1AROP 3M8AA 3ML0A 4PA4A 2OTJV 3K9SA 1UFIA 1FXKB 2W0FC 2Z5UA 4G28B 4B7KA 3RN4A 4XBFA 3FKSG 1TVKA 1IBMO 4D7TA 3OW2U 3A0RA 4MTOA 4NYKA 4DV5O 2ADPA 5E1AC 1SQVH 1WB7A 4JI0B 2ZXWC 4KXRA 3JCUZ 1HNZB 4JI8B 4HYOA 4PDMA 2ZINA 4DV3B 1BS3A 2BTOA 1VQMV 2PF4E 4Q20A 4TUYA 1N33B 2P4KA 4UB6Z 2LFRA 3LSSA 1WP7A 4U7OA 3H1JH 1FS0G 3SPCA 5AG2A 4BIOA 2QTOA 5KA6A 4JI0O 2Q0AA 2Q69A 4UB8Z 3A0BZ 3ASNB 1IBKO 4PI2A 4PA9A 3AG4C 4PV1B 3BRCA 1MOFA 5IJ9A 3E89A 3IFXA 2DYRC 3CRMA 5LXTB 4DV0B 3JD1A 3OE7G 1NJIW 1SZXA 4X62B 3CHXA 3UO2A 1QVFU 4JI3B 2Q7GA 2AXTZ 4CC6A 2UU9O 1Q6UA 4I9WA 4JZGA 1DLBA 3FB8C 3TXSA 2IJIA 2VQFB 4J42A 1VQ8V 1KYOF 4DR4B 5A9GA 4YJ3A 3HKCA 2FKXA 1K92A 4LC1A 3FB6C 2XUMA 3J7AU 1NTZH 4DV0O 3WB1A 1OHHG 3VQYA 3OMIB 3JATB 2KB1A 2WLIB 4PD4F 1M56C 5JH7A 1M90W 5KHKA 3OEEG 4X62O 4LF5B 2NN4A 3E2EA 3W7TA 4LNUB 4LF4B 2D2CB 1COWG 2OTLV 2VQFO 4DR4O 4U3JA 1QBZA 4J7ZA 4EB6A 1EBOA 1LNQA 1CXZB 2YS8A 2A7WA 3CMAV 1Q8IA 2OIEA 1M1KW 3SPIA 4LF4O 3M99B 1RM1C 3J81N 4LWSA 5IWAB 1UJWB 1Y66A 5JQGB 1GM7A 3CX5F 1NVPB 2JS3A 2Q9LA 5E79Z 5BR8B 3ABLC 1IVSA 3K04A 5LMUB 2DQ3A 4AHCA 2PI5A 2YICA 4TOIA 4X1KA 2LJ2A 3D3IA 4DW1A 2M6YA 4ZHQA 2GUZA 2A0LA 1KBHA 3CPWU 4X1IB 1LUVA 5IJ0B 3AG4B 4EEQA 2KSDA 3JSLA 2IJJA 4DYLA 2YIAA 2DWDC 1YZBA 4QGPA 5BR8O 4XDJA 2ZE8A 3ZHTA 2CDYA 4JI2B 3SJQC 5LMUO 1US6A 4K0KB 3CRAA 5CA0B 5FNVB 4JYCA 4UCUA 5B1BC 4FZ0A 4O4JA 3CYOA 3SYOA 3C3TA 1XOUA 2ZE5A 2P67A 2ZE6A 2GHYA 4UVAA 2Q68A 2Q4PA 4IYHA 4NB5A 4YJ2B 4FLYA 1AVMA 2Z0AA 4MTGA 1MG1A 4X1YA 1YXBA 3RYHB 2EJRA 4JI2O 2PYJA 1GN2A 4E4EA 4FLTA 4RAIA 1GKFA 3SPJA 1Y4MA 1IX9A 4UCTA 1IBLB 3CD6V 5KMGA 4R7CA 3DGEA 3VQXA 3N27A 2YI9A 3DXRB 2DWEC 3JSNA 1NVPD 2D3OW 1VQLV 1VQKV 4ZOLA 3FAVA 2ZQMA 2C2AA 2VS0A 5GTHZ 1QNMA 1XBLA 2Y4TA 4LF8B 4H37A 4D7SA 3WB2A 4HZ3A 2EULA 4KFMA 4P9OA 1IBLO 3W7XA 4DV7O 3H01A 3KCXA 1BL8A 3ZMSA 1SZTA 3HR0A 1GO3F 1H2LA 1SQQH 2BSKB 3HB3B 4LH6A 3ABLB 3KG2A 4YHHB 4MW3A 1NT2B 5LHHA 3ABUA 4I9QA 1YF2A 3F5TA 4LF8O 5DM6V 2DYSC 2F4VB 2CTWA 3CRQA 1V55C 1S3JA 5LP6A 1EN4A 3Q4HA 4MVQA 4H13B 3E86A 1G8MA 5L3DA 4FLXA 2GDSA 4O4HB 4YHHO 4ZIBA 3D36A 3AK2A 5LGUA 1WB8A 3JAWB 4WCEV 2ARHA 1OJHA 2F4VO 3BEHA 3STZC 4UXNA 1V54B 4JV5B 1N34B 4I55A 3L72H 2R72A 3K59A 3RFRA 2F66C 4LFAO 3ASOC 2HVKC 5JVDA 1FJGB 2CTQA 1SRYA 3RVYA 4FLWA 5KAFZ 5C8YB 4BR6A 3I55V 2FL4A 4RQEA 1VARA 1O9HA 4LP8A 4X88A 5CN0A 4TWKA 2EX3A 3SJCC 1ZLZA 5B3SC 3A2FA 3QO5A 3OAAG 4PELA 2IJHA 4J7KA 4JV5O 1M57C 2R70A 3JAKB 1N34O 2LGWA 2HP8A 2CE4A 2Y48A 2YIBA 1KQSU 3IC9A 4G2KA 4O2AB 1Q90D 4QE9A 4DV4O 5FLXN 4Z1VA 1FPOA 4DR2B 1IURA 4JI6B 4RUFA 4X20B 3OR6C 2JEUA 4FZ1A 2YI8A 3HKEB 3TK1A 1P49A 1BQZA 4I4TA 2YC0A 5LYJA 4J7JA 4JYBA 2JEXA 1G6UA 1AR4A 3L74H 1FXVA 4RWUA 5FL7G 4BAYA 1U96A 3KZIZ 1OCZB 4DR2O 4JTCB 3LDEA 4DK0A 4J41A 4UV9A 4UCVA 2HHHB 1N32B 2NR5A 2GTAA 1HNXB 1FFXA 2HJDA 1XREA 3ABMC 3T1YO 1XDCA 4FM1A 4LF6B 1P7GA 2EIMB 4O2BB 1B04A 1OCCC 3A0HZ 4ZBMA 1K7DA 3JD0A 1VIBA 3E35A 2QWRB 2JK5C 2PI4A 3JD4A 3U0ZA 1N32O 3ZRWB 2UUCB 4XDLA 1S5HC 2OCCB 4BWAA 1RPOA 2YXYA 1XEQA 4D6TH 1YVWA 1OCRC 5H2FZ 2E76B 3A8TA 4PJ0Z 1H2MA 2XAHA 3OUFA 1A32A 3JASA 1ZX3A 4OGQB 5TISZ 2ADQB 2WA4A 1FXKC 2UUCO 3DC5A 1M57B 3TETA 1Q5OA 2QM8A 4LFCB 5BMVA 4KHPB 4DR6O 1PL0A 5JJEB 3QG5A 5H9CA 1Y74A 3U11A 1K9MW 1Z2GA 3L70H 1L0LH 5HFLA 4WBNA 1SC5B 3MD0A 3SPHA 4DV1O 1XMQO 3ZMTA 2LO1A 4FMTA 5CB4B 3SDLA 3OD4A 4CBCA 1VQNV 5GONA 5KHIA 3TCUA 3ZRVA 1XQ8A 5EZYB 2QDOA 1TUBB 1VMGA 4K35A 3J80N 1BHAA 5CA3A 1Y76B 4LFBO 4JGSA 4ZI7B 3TXQA 3ASNC 1F4MA 2QKCA 2YEVA 2P6JA 1KECA 1P7BA 1VF5B 3ABMB 4O4LA 5LOVB 5LGNA 1EZVH 2X6CA 1JVMA 4NVPA 1MA1A 3P32A 1VQ6V 1OCCB 1GMGA 3FYIB 1XHZA 2ZNIA 4BW5A 3HPLC 4I5SA 1THZA 4GCZA 3SYPA 3HKDB 4H44B 2ZM6O 2GSMB 1VF6A 2CH7B 2LGQA 4MSWC 4RO2A 4DR5B 1RSOA 3FX7A 3N2KB 1XILA 3CCJV 2LW1A 4FFBB 5BZBA 4MVOA 1WA8A 4QIWF 1D2DA 5KHHA 1AILA 1B6QA 1E79G 1JR9A 1EN5A 1KKDA 1HP8A 2WAMA 4BIUA 2Q8VA 2F1MA 4K8XA 4AILC 4DR5O 3H1KH 5H5NA 1NQTA 3NR7A 2QKSA 3SJAC 1HDJA 4DUYO 5KX5A 3IAYA 1LR1A 1M93A 1IBKB 3JD2A 2IBZH 1JX9A 4IHJB 1PKXA 1BQ0A 1WJZA 2XT9A 2JGDA 2ITCC 2FB5A 3JALA 3D3QA 3IC7A 4DR7B 5IDJA 1SS3A 3N2GA 3CJHB 2P90A 1PNKA 4B3SO 1VQOV 2QM7A 1MZFA 1G1XB 2N04A 3I5DA 4BIZA 2UU9B 4JYAB 1NR7A 2ZR2A 2YUAA 2Q73A 4CZZA 3CB2A 3RYCB 2WLKA 5D5PA 4LR3A 1F23A 4DR7O 2VWKA 4TV9B 1UPGA 4WFHA 2PZSA 2YSUB 1JFFB 2OIGA 3RYIA 1KC8W 5EBLC 4JYAO 3K06A 3CCUV 3R65A 3ZEDA 3L71H 1R6TA 4JI4B 5B1NA 3E8GA 2BE3A 3JCZA 4QPJA 1ROPA 2Q0OC 5J9PC 3ZMUA 1K4DC 1NI8A 5LL6Y 4QJFB 1K73W 1URFA 5L3FA 2X0LA 3VQWA 1B06A 4PDVA 2UXDO 4J11A 5IYZB 2QKAA 1HR0B 2A9HA 2P5OA 3LNMB 1QVGU 1PPJH 1VQ7V 1PM9A 5L3GA 2NLJC 1Z5VA 2JJ2G 1IZ3A 5IYCO 1H2SB 4DV2O 3LDCA 2Q67A 1H8HG 4JI4O 2B1IA 3L9DA 3B09A 4DRXA 2QEXV 3ETDA 4J9ZB 2LQTA 3CEIA 4KL1A 1M9NA 4TV8B 1FAFA 1YEWA 1HR0O 2DN9A 1S76D 4CS3A 5LA6A 1OZ0A 5EBMC 5J2TB 1BMFG 2XTAA 4B3MO 3K58A 1SF9A 3RT3C 4P30A 2JRIA 5DN6G 5FPOA 4R50A 4F6RB 3SGIA 1XNQO 1K8AW 1EZJA 3E22A 1I5YA 1JOYA 1X59A 3OTFA 1D5AA 1O9GA 2WSSG 4FM0A 4AQYO 2WLLB 4YXWG 5EYPB 4DR3B 4I0XA 4FLVA 1TAEA 2KG7A 1X4TA 1CEZA 2PYLA 3RVZA 2CTPA 3CXCU 2X6AA 2EBOA 3HKBA 4K3AA 4ZKIA 2A06H 3OMAB 1I7FA 1V54C 1ZL8B 4H0LB 1ZUQA 3W7UA 3ZHSA 5BY1A 1FFTB 3KKYA 1N0NA 4DR3O 2ATKC 4O4IA 1QLEB 2V4DA 3UO3A 4DW0A 2BTQB 2ZDIC 1GN3A 1DK1A 4UCSA 5CA1A 4JI7B 2WLJA 2RDCA 1VQ4V 5JCOA 1W59A 4I50A 5FPRA 4DV7B 1N36B 2ZKOA 2CGOA 3AK1A 1QR9A 1SQFA 1HWYA 5JJNB 4TQFA 5LBQA 1MZEA 4JI5B 4YY3O 3JARA 5J2UB 4X64O 2GBOA 2HG5C 2YIDA 3DSQA 1AI6A 5ITZA 4IYIA 4NXMO 2DJVA 4JI7O 5IY5B 4DO2A 4RUEA 2EZPA 3WG7C 4HNAB 1IXMA 1N36O 1JA8A 2QWOB 1MNGA 5H6QA
chains in the Genus database with same CATH topology
2YS8A 1BQZA 1N4CA 2LGWA 1NZ6A 2LO1A 3UO2A 3UO3A 1GH6A 2N04A 2DMXA 2QWPB 3APOA 2OCHA 2CTPA 2CUGA 2GUZB 1BQ0A 2PF4E 2CTQA 2EJ7A 2GUZA 2M6YA 3UCSC 2YUAA 4RWUA 3APQA 1WJZA 2N05A 1XBLA 1FPOA 2Y4TA 1FAFA 1IURA 2L6LA 2DN9A 2QSAA 2KQXA 2QWNB 4J80A 2QWRB 3BVOA 2Y4UA 4J7ZA 2CTWA 2QWQB 3AG7A 2QWOB 2CTRA 1HDJA 4IT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YS8 A;  1BQZ A;  1N4C A;  2LGW A;  1NZ6 A;  2LO1 A;  3UO2 A;  3UO3 A;  1GH6 A;  2N04 A;  2DMX A;  2QWP B;  3APO A;  2OCH A;  2CTP A;  2CUG A;  2GUZ B;  1BQ0 A;  2PF4 E;  2CTQ A;  2EJ7 A;  2GUZ A;  2M6Y A;  3UCS C;  2YUA A;  4RWU A;  3APQ A;  1WJZ A;  2N05 A;  1XBL A;  1FPO A;  2Y4T A;  1FAF A;  1IUR A;  2L6L A;  2DN9 A;  2QSA A;  2KQX A;  2QWN B;  4J80 A;  2QWR B;  3BVO A;  2Y4U A;  4J7Z A;  2CTW A;  2QWQ B;  3AG7 A;  2QWO B;  2CTR A;  1HDJ A;  4IT5 A; 
#chains in the Genus database with same CATH topology
 2V7Q G;  3RYF B;  4JI5 O;  2EIN B;  1YI2 V;  3E8H A;  4LF9 B;  2QR4 A;  4J10 A;  1FXK A;  4N21 A;  1ZWI C;  1RPR A;  4WFE A;  1MAB G;  3EVK A;  2XAQ A;  3FB5 C;  1OCZ C;  3SPG A;  3OUS A;  3T1C A;  3ZHU A;  1SA0 B;  4B08 A;  3K5M A;  2Z3Y A;  1BE3 H;  3UKM A;  3BAB A;  2MW2 B;  2YDE A;  1W0J G;  4P9P A;  4LFA B;  1QR8 A;  3QF7 A;  4NXN O;  1FYJ A;  1Q7Y W;  2AHZ A;  2EIM C;  4LF9 O;  3UT5 B;  3ZRS A;  2N05 A;  3VOU A;  2GTS A;  4IIJ B;  1WPX A;  4R6Z A;  3K0G A;  3ETE A;  5LMN O;  1WNS A;  4LF7 B;  3M7M X;  4F4L A;  4UVB A;  2OCC C;  4CC5 A;  2ZNJ A;  1R6N A;  5CBG A;  4JAV A;  5C93 A;  1TVK B;  4DV4 B;  5GTI Z;  1VQ5 V;  4R8C A;  3JYC A;  2B9Z A;  3NXS A;  5K1P A;  3CC7 V;  3LDD A;  4W4K A;  3SJB C;  2HJF C;  1HNW O;  3BVO A;  5LXT A;  4TSF G;  5B1A C;  4LF7 O;  3O9O A;  3K3W A;  2IM9 A;  3K08 A;  3LSU A;  2ZIM A;  4GKJ B;  3I56 V;  4G27 B;  2XAG A;  1E1Q G;  2F23 A;  2CUG A;  4TUY B;  2PGG A;  5LGT A;  3K5L A;  3SR2 C;  2HEP A;  4UV8 A;  4DR1 O;  1I94 O;  2IU3 A;  4PA6 A;  4OX9 B;  2QM4 A;  4PA7 A;  3WG7 B;  4CS2 A;  5CMU A;  3E8B A;  3K5O A;  3T1Y B;  2WLI A;  5EK0 A;  2X7R B;  4FVM A;  1VP7 A;  4GKJ O;  1IXB A;  3H9V A;  4LNU A;  1SQG A;  5IJ9 B;  2A3Q A;  3BHP A;  1CPY A;  4OPH A;  4MVR A;  4OX9 O;  1FXH A;  1YJW V;  2BOC C;  2CTR A;  4PDL A;  2ODM A;  1FKA O;  4XDK A;  1PNM A;  1XI1 A;  1R3I C;  1YIJ V;  3LUT B;  1T5E A;  4CS4 A;  4TT3 G;  1R3L C;  4YJ3 B;  3HKC B;  1WPB A;  3EFF K;  2Q7E A;  4DK1 A;  2AZ2 A;  2P7T C;  1DGS A;  2DOS A;  5JQG A;  4TQD A;  1WLE A;  3AK3 A;  5JH7 B;  1KP3 A;  2GV9 A;  4KUM A;  5B66 Z;  1EFR G;  4CH6 A;  3BAA A;  1J95 A;  3E8F A;  5KUM A;  3X2Q B;  4DR6 B;  2JIZ G;  1R3J C;  2WLN A;  4X1I A;  4U3J B;  2JDI G;  5IJ0 A;  3MAQ A;  4EB6 B;  2E75 B;  4X65 B;  3ZJZ A;  2MK3 A;  3IGA C;  5B1A B;  4DV1 B;  1XMQ B;  4K8Z A;  4LCU C;  4YIP A;  4B3R B;  4U3F H;  1GTO A;  2OT5 A;  3S3X A;  3AG3 C;  3UCS C;  3MDS A;  1YHQ V;  5CA0 A;  2RN9 A;  3CE2 A;  4LWS B;  4FLU A;  4CH3 A;  4UFZ A;  2ZT9 B;  5D5Q A;  4EFB A;  4YJ2 A;  3CP1 A;  1Y6X A;  4LFB B;  4X65 O;  3OFN G;  4X66 B;  1DTO A;  3E83 A;  3RGB A;  2W6I G;  1AJN A;  1KMI Z;  4X1K B;  3RYH A;  4JPR A;  4MVM A;  1H2K A;  3SYC A;  4ZHQ B;  4B3R O;  2GUZ B;  3O65 A;  5EC2 C;  2XHB A;  3G71 V;  5KAI Z;  3ZX6 A;  3CCR V;  4NKG B;  5LP6 C;  4H33 A;  2LFS A;  4JYY A;  5F2V O;  2ZM6 B;  2CK3 G;  1B3Q A;  3DC6 A;  1Q86 W;  4X66 O;  4GZR B;  2E74 B;  2EIJ B;  3ZHR A;  2EJ7 A;  2H3O A;  2X6B A;  4O4J B;  4RQF A;  1JJO A;  2L6L A;  3T2M A;  3BPZ A;  2QTS A;  2YXL A;  2CAZ C;  4AI8 A;  2UUA B;  4X1Y B;  3ZMZ A;  3B8M A;  1PL4 A;  2BSK A;  1YDX A;  2Q5Z A;  3EXA A;  5CA1 B;  4JAU A;  5KMG B;  2HFE C;  5L3B A;  1ZAU A;  2EIL C;  3T1H O;  5IT9 N;  4DUY B;  1OCO B;  2UUA O;  3BFR A;  1PV0 A;  3C90 A;  4O4H A;  4ZOL B;  4UVC A;  3FAV B;  5ITZ B;  4P2Z A;  5LHI A;  3AG3 B;  3JAW A;  3ZHV A;  3B40 A;  2XOK G;  1YJ9 V;  3FD9 A;  2KKW A;  3PN1 A;  4B3S B;  3MHH C;  4W4L A;  3BA8 A;  3KCY A;  1Q3E A;  1M4U A;  1FD9 A;  4Z1M G;  4L8J A;  1BGY H;  2BOB C;  1LUW A;  1QQC A;  2ILM A;  2L35 A;  1MSD A;  3CSX A;  4FLZ A;  3GWO A;  2ZDI A;  3APQ A;  5C8Y A;  2QSA A;  1SQX H;  3CME V;  3WB0 A;  1AI7 A;  3RWR D;  2IU0 A;  1VEW A;  2QWQ B;  5LP6 B;  3FYE B;  1RP3 B;  3Q4H B;  5EBW C;  4FJC C;  3JAK A;  2DMX A;  2QWP B;  4MW8 A;  1Q81 W;  3BCC H;  4JAS A;  1VQ9 V;  2IJK A;  3L75 H;  2P06 A;  4O2A A;  1XNR B;  5CBH A;  1F7Y A;  4MTF A;  1H38 A;  1P4R A;  2JVD A;  4X20 A;  1SES A;  2IH1 C;  3F5W C;  5K1X A;  1Y67 A;  1YSC A;  4I55 B;  3W7S A;  2A79 B;  4GLX A;  3HKE A;  1GAX A;  1HNZ O;  4JI8 O;  3S3W A;  3RW0 A;  4UCR A;  5JVD B;  4DV3 O;  3OM3 B;  4WFG A;  2Q6A A;  1N33 O;  2UXD B;  3AG1 B;  1XNR O;  4JI1 B;  1VQP V;  1NH2 B;  4DXW A;  2OWO A;  3ABK C;  4U7N A;  4DV2 B;  2Y69 B;  3LNN A;  2AW9 A;  3FB7 C;  1E1R G;  1K97 A;  1QLE C;  2EIL B;  1N8R W;  1H8E G;  2O57 A;  1XL6 A;  3APO A;  2QJ1 A;  1AR5 A;  1R3K C;  3G6E V;  3OEH G;  3SYA A;  4GX5 A;  3P3N A;  4IL6 Z;  1AI5 A;  3PJS K;  3VQV A;  2PTM A;  4O2B A;  3ZHQ A;  1K3E A;  1QHT A;  1KD1 W;  5HFM A;  5DED A;  1SKV A;  4JI1 O;  4CH5 A;  4YIO A;  4X8A A;  3EHB B;  2R9R B;  2V1D A;  4NR1 A;  1G4Y B;  1L8D A;  2DE0 X;  1PP9 H;  1AB3 A;  2W6J G;  4B3M B;  4I4T B;  3ZRW A;  5LYJ B;  2Y0I A;  3IJ4 A;  3CCS V;  4JI3 O;  1S5J A;  1GN4 A;  2XAS A;  1XUQ A;  5IY5 C;  1CP9 A;  1XNQ B;  3H1H H;  5GW7 A;  1NTM H;  5EIB D;  3B8N A;  1MSW D;  2KQX A;  4JTD B;  4AQY B;  1YIT V;  3P30 A;  1K5Q A;  1SET A;  1FFX B;  5JWP A;  2ZXW B;  5KHG A;  2EIN C;  4GYC B;  1AR1 B;  1WP8 A;  3ETG A;  2ITD C;  4LF5 O;  3GB7 C;  4PDR A;  2R9I A;  1K4C C;  2PY5 A;  5EC1 C;  2RMK B;  1ZSP A;  4HBN A;  1K34 A;  2FTK A;  3AG7 A;  1VF6 C;  2AZ0 A;  3G67 A;  1NH2 D;  1N4C A;  4N23 A;  1H2G A;  1TUE B;  2WLM A;  5CB4 A;  1YJN V;  1BHB A;  4JZ2 A;  2WWW A;  2F95 B;  2OYQ A;  2YIB D;  1HW7 A;  4JTA B;  4WF9 V;  1V9P A;  5IWA O;  2WPD G;  3JAS B;  2DYR B;  1Q6H A;  1EN6 A;  5EZY A;  2JGU A;  3K79 A;  3ABK B;  1TUB A;  4YY3 B;  1Y76 A;  4X64 B;  4ZI7 A;  5DEC A;  1RFY A;  4LBE C;  5BMV B;  1GH6 A;  1WN7 A;  2B5U A;  3BY6 A;  4Q6G A;  4CH4 A;  5LOV A;  4NXM B;  3QTC A;  2UXN A;  1TA8 A;  4C7U A;  1I0H A;  3QO7 A;  3CS5 A;  4QNH B;  1Y74 B;  4OXS A;  2F93 B;  3BA9 A;  3ETQ A;  4PI0 A;  4WBN B;  1QCE A;  4MTX A;  4IT5 A;  2E5L B;  5IYB O;  3TJT A;  3HKD A;  4JAA A;  1M56 B;  2CH7 A;  2G38 A;  4WFF A;  3N2K A;  2LW7 A;  3CC2 V;  3MHS C;  4K0K O;  4FFB A;  2HKO A;  5GON B;  2ETN A;  1S5L Z;  1K5S A;  1GK9 A;  1ORQ C;  3CCQ V;  4B7E A;  3RBZ A;  3SYQ A;  3GWK C;  4GKK B;  2IW5 A;  1AJP A;  3QO8 A;  2E5L O;  4IGG A;  2YEV B;  5IYD O;  4QPK A;  4NXN B;  3UQ8 A;  3K57 A;  4O4L B;  4MVS A;  4GUN A;  3OGC C;  3CXH F;  2W0X A;  5LMN B;  1Q43 A;  3F7V C;  1RM1 B;  2M7W A;  1NBM G;  2ZCE A;  4FK5 C;  2UXB B;  2N74 A;  3THO A;  4GKK O;  5KUK A;  3H1L H;  1AI4 A;  1KUQ A;  1RSO B;  1QU7 A;  1JMK C;  1JQ0 A;  4IHJ A;  4NTX A;  3B77 A;  3G4S V;  5BXZ A;  1SQB H;  2JS5 A;  1K33 A;  1D5N A;  1WA8 B;  4JF3 A;  1HNW B;  2IH3 C;  4MT8 A;  3WU2 Z;  3OT7 A;  1M5I A;  1XL4 A;  3U10 A;  2QGN A;  3JAM N;  2UXB O;  2H8P C;  3CJH A;  3OMN B;  1AJQ A;  1GN6 A;  4L87 A;  5LHG A;  2E3C A;  1ZTE A;  3X2Q C;  1I5X A;  2OCH A;  1BT8 A;  1IDS A;  4A5U B;  4NTY A;  2K1E A;  4PHZ A;  4DR1 B;  1NTK H;  2XAJ A;  3D8C A;  3FFQ A;  4GX2 A;  1I94 B;  2B1G A;  3K9A A;  5B1B B;  4WFA V;  1S77 D;  3RYC A;  3ZIA G;  3ZCC A;  5KX5 B;  3G6B A;  4GX1 A;  1W0K G;  2HLD G;  4TV9 A;  4ABM A;  2Y0P A;  1NZ6 A;  3OTO B;  1J5E B;  1VF7 A;  1JFF A;  3CCM V;  3OR7 C;  1GM8 A;  2JGD B;  1N0J A;  1DF4 A;  1YCI A;  3JAL B;  5A2Q N;  1I08 A;  5JJJ B;  1GM9 A;  4J80 A;  5KA5 A;  2F43 G;  3N2G B;  1L0N H;  3K5N A;  2HVJ C;  4QE7 A;  4FIP C;  1BCC H;  3JAT A;  2EZO A;  1W2B U;  3OTO O;  1NR1 A;  1J5E O;  2XND G;  3UM7 A;  3C3S A;  3T4D A;  3ZMV A;  1FJG O;  4E2L A;  1R73 A;  2H94 A;  2UUB B;  5IYZ A;  1BZK A;  2QWN B;  1YTF B;  2DW4 A;  1SQP H;  4WFB V;  2HR3 A;  5IE9 A;  1KB9 F;  2EIJ C;  3RYI B;  2QE7 G;  3CRC A;  1F51 A;  1S0V A;  1XMO B;  1NS1 A;  1JCH A;  1JJ2 U;  2WA3 A;  4TV8 A;  2UUB O;  4JI6 O;  4ICG A;  5H6R A;  2DYS B;  2Q7H A;  5J2T A;  3CC4 V;  4X9Q A;  1PD3 A;  3ZN0 A;  1V55 B;  1WAZ A;  4I7Z B;  3K03 A;  3AEI A;  4BW9 A;  3AG2 C;  3P3P A;  3QNE A;  1Q6I A;  5JCO C;  3ZS8 C;  4F6R A;  1XMO O;  2UXC B;  2FYU H;  2ZE7 A;  1R6K A;  3QVN A;  4MVZ A;  1Z5W A;  1OCO C;  3R66 A;  4EKW A;  2WLL A;  2PUS A;  5EYP A;  2EIK C;  2HHH O;  4J9Y B;  4UUJ C;  1QLN A;  1HNX O;  2P4V A;  4DRX B;  5KHJ A;  1DF5 A;  3T4Z A;  2RCV A;  1ENV A;  4X89 A;  3L73 H;  4Z2W A;  3ASO B;  4LF6 O;  1SER A;  3CCV V;  1XHX A;  5FNV A;  1GRJ A;  4UCO A;  5LA6 B;  2UXC O;  4OPA A;  2Y4U A;  1Q82 W;  3F7Y C;  2DQ0 A;  4FM2 A;  1ZL8 A;  2XAF A;  4B3T B;  5L3C A;  5B3S B;  2JJ1 G;  4PA3 A;  4FFK A;  3CWB H;  1YTF D;  2VRZ A;  1AP5 A;  4NTW A;  3DTU B;  2BTQ A;  5L3E A;  3ZRX A;  3E22 B;  1H2N A;  2ZR3 A;  1NKD A;  4EFE A;  3B2E E;  3ZBH A;  4F6E A;  1EM1 A;  4HAM A;  2ZD9 A;  5CBF A;  2ZIO A;  4I0X B;  3CRR A;  1KU9 A;  3W7W A;  4B3T O;  2AHY A;  2AGA A;  2KG7 B;  3D36 C;  1U97 A;  3G80 A;  3LSQ A;  5EIB C;  1OV9 A;  3ABT A;  3DXR A;  5J2U A;  1KP2 A;  2UXX A;  1AP6 A;  2WLH A;  3HKB B;  4LFC O;  2RNB A;  2VQE B;  4KHP O;  4DV6 B;  5B5E Z;  4KP4 A;  1TGO A;  2QA4 V;  2LP7 A;  3T1H B;  2RQ6 A;  4HNA A;  3B4S A;  1R1B A;  3GVM A;  4O4I B;  3RYF A;  2CGN A;  1F4N A;  3VBB A;  2RJZ A;  3AG1 C;  3H1I H;  4DUZ B;  3AG2 B;  1L1F A;  2NNU A;  5KLV H;  2VWJ A;  2VQE O;  3CCE V;  1BSM A;  4DV6 O;  4GT1 A;  3ZN1 A;  2FML A;  3ICX A;  1NU1 H;  2BCC H;  4I50 B;  4LH7 A;  3STL C;  4FPP A;  2Y69 C;  1SA0 A;  4GX0 A;  2R9A A;  3TGU H;  1KKC A;  4MS2 A;  3JAR B;  4ASU G;  2P22 C;  2EIK B;  2YXH A;  1JPX A;  1PNL A;  4MVU A;  1IBM B;  1S72 V;  3OGI B;  3K0D A;  1OCR B;  3UT5 A;  4DUZ O;  1MMM A;  3WFV A;  4DV5 B;  4IIJ A;  1P84 F;  5B1O A;  2K9P A;  3JD3 A;  3CCL V;  1ARO P;  3M8A A;  3ML0 A;  4PA4 A;  2OTJ V;  3K9S A;  1UFI A;  1FXK B;  2W0F C;  2Z5U A;  4G28 B;  4B7K A;  3RN4 A;  4XBF A;  3FKS G;  1TVK A;  1IBM O;  4D7T A;  3OW2 U;  3A0R A;  4MTO A;  4NYK A;  4DV5 O;  2ADP A;  5E1A C;  1SQV H;  1WB7 A;  4JI0 B;  2ZXW C;  4KXR A;  3JCU Z;  1HNZ B;  4JI8 B;  4HYO A;  4PDM A;  2ZIN A;  4DV3 B;  1BS3 A;  2BTO A;  1VQM V;  2PF4 E;  4Q20 A;  4TUY A;  1N33 B;  2P4K A;  4UB6 Z;  2LFR A;  3LSS A;  1WP7 A;  4U7O A;  3H1J H;  1FS0 G;  3SPC A;  5AG2 A;  4BIO A;  2QTO A;  5KA6 A;  4JI0 O;  2Q0A A;  2Q69 A;  4UB8 Z;  3A0B Z;  3ASN B;  1IBK O;  4PI2 A;  4PA9 A;  3AG4 C;  4PV1 B;  3BRC A;  1MOF A;  5IJ9 A;  3E89 A;  3IFX A;  2DYR C;  3CRM A;  5LXT B;  4DV0 B;  3JD1 A;  3OE7 G;  1NJI W;  1SZX A;  4X62 B;  3CHX A;  3UO2 A;  1QVF U;  4JI3 B;  2Q7G A;  2AXT Z;  4CC6 A;  2UU9 O;  1Q6U A;  4I9W A;  4JZG A;  1DLB A;  3FB8 C;  3TXS A;  2IJI A;  2VQF B;  4J42 A;  1VQ8 V;  1KYO F;  4DR4 B;  5A9G A;  4YJ3 A;  3HKC A;  2FKX A;  1K92 A;  4LC1 A;  3FB6 C;  2XUM A;  3J7A U;  1NTZ H;  4DV0 O;  3WB1 A;  1OHH G;  3VQY A;  3OMI B;  3JAT B;  2KB1 A;  2WLI B;  4PD4 F;  1M56 C;  5JH7 A;  1M90 W;  5KHK A;  3OEE G;  4X62 O;  4LF5 B;  2NN4 A;  3E2E A;  3W7T A;  4LNU B;  4LF4 B;  2D2C B;  1COW G;  2OTL V;  2VQF O;  4DR4 O;  4U3J A;  1QBZ A;  4J7Z A;  4EB6 A;  1EBO A;  1LNQ A;  1CXZ B;  2YS8 A;  2A7W A;  3CMA V;  1Q8I A;  2OIE A;  1M1K W;  3SPI A;  4LF4 O;  3M99 B;  1RM1 C;  3J81 N;  4LWS A;  5IWA B;  1UJW B;  1Y66 A;  5JQG B;  1GM7 A;  3CX5 F;  1NVP B;  2JS3 A;  2Q9L A;  5E79 Z;  5BR8 B;  3ABL C;  1IVS A;  3K04 A;  5LMU B;  2DQ3 A;  4AHC A;  2PI5 A;  2YIC A;  4TOI A;  4X1K A;  2LJ2 A;  3D3I A;  4DW1 A;  2M6Y A;  4ZHQ A;  2GUZ A;  2A0L A;  1KBH A;  3CPW U;  4X1I B;  1LUV A;  5IJ0 B;  3AG4 B;  4EEQ A;  2KSD A;  3JSL A;  2IJJ A;  4DYL A;  2YIA A;  2DWD C;  1YZB A;  4QGP A;  5BR8 O;  4XDJ A;  2ZE8 A;  3ZHT A;  2CDY A;  4JI2 B;  3SJQ C;  5LMU O;  1US6 A;  4K0K B;  3CRA A;  5CA0 B;  5FNV B;  4JYC A;  4UCU A;  5B1B C;  4FZ0 A;  4O4J A;  3CYO A;  3SYO A;  3C3T A;  1XOU A;  2ZE5 A;  2P67 A;  2ZE6 A;  2GHY A;  4UVA A;  2Q68 A;  2Q4P A;  4IYH A;  4NB5 A;  4YJ2 B;  4FLY A;  1AVM A;  2Z0A A;  4MTG A;  1MG1 A;  4X1Y A;  1YXB A;  3RYH B;  2EJR A;  4JI2 O;  2PYJ A;  1GN2 A;  4E4E A;  4FLT A;  4RAI A;  1GKF A;  3SPJ A;  1Y4M A;  1IX9 A;  4UCT A;  1IBL B;  3CD6 V;  5KMG A;  4R7C A;  3DGE A;  3VQX A;  3N27 A;  2YI9 A;  3DXR B;  2DWE C;  3JSN A;  1NVP D;  2D3O W;  1VQL V;  1VQK V;  4ZOL A;  3FAV A;  2ZQM A;  2C2A A;  2VS0 A;  5GTH Z;  1QNM A;  1XBL A;  2Y4T A;  4LF8 B;  4H37 A;  4D7S A;  3WB2 A;  4HZ3 A;  2EUL A;  4KFM A;  4P9O A;  1IBL O;  3W7X A;  4DV7 O;  3H01 A;  3KCX A;  1BL8 A;  3ZMS A;  1SZT A;  3HR0 A;  1GO3 F;  1H2L A;  1SQQ H;  2BSK B;  3HB3 B;  4LH6 A;  3ABL B;  3KG2 A;  4YHH B;  4MW3 A;  1NT2 B;  5LHH A;  3ABU A;  4I9Q A;  1YF2 A;  3F5T A;  4LF8 O;  5DM6 V;  2DYS C;  2F4V B;  2CTW A;  3CRQ A;  1V55 C;  1S3J A;  5LP6 A;  1EN4 A;  3Q4H A;  4MVQ A;  4H13 B;  3E86 A;  1G8M A;  5L3D A;  4FLX A;  2GDS A;  4O4H B;  4YHH O;  4ZIB A;  3D36 A;  3AK2 A;  5LGU A;  1WB8 A;  3JAW B;  4WCE V;  2ARH A;  1OJH A;  2F4V O;  3BEH A;  3STZ C;  4UXN A;  1V54 B;  4JV5 B;  1N34 B;  4I55 A;  3L72 H;  2R72 A;  3K59 A;  3RFR A;  2F66 C;  4LFA O;  3ASO C;  2HVK C;  5JVD A;  1FJG B;  2CTQ A;  1SRY A;  3RVY A;  4FLW A;  5KAF Z;  5C8Y B;  4BR6 A;  3I55 V;  2FL4 A;  4RQE A;  1VAR A;  1O9H A;  4LP8 A;  4X88 A;  5CN0 A;  4TWK A;  2EX3 A;  3SJC C;  1ZLZ A;  5B3S C;  3A2F A;  3QO5 A;  3OAA G;  4PEL A;  2IJH A;  4J7K A;  4JV5 O;  1M57 C;  2R70 A;  3JAK B;  1N34 O;  2LGW A;  2HP8 A;  2CE4 A;  2Y48 A;  2YIB A;  1KQS U;  3IC9 A;  4G2K A;  4O2A B;  1Q90 D;  4QE9 A;  4DV4 O;  5FLX N;  4Z1V A;  1FPO A;  4DR2 B;  1IUR A;  4JI6 B;  4RUF A;  4X20 B;  3OR6 C;  2JEU A;  4FZ1 A;  2YI8 A;  3HKE B;  3TK1 A;  1P49 A;  1BQZ A;  4I4T A;  2YC0 A;  5LYJ A;  4J7J A;  4JYB A;  2JEX A;  1G6U A;  1AR4 A;  3L74 H;  1FXV A;  4RWU A;  5FL7 G;  4BAY A;  1U96 A;  3KZI Z;  1OCZ B;  4DR2 O;  4JTC B;  3LDE A;  4DK0 A;  4J41 A;  4UV9 A;  4UCV A;  2HHH B;  1N32 B;  2NR5 A;  2GTA A;  1HNX B;  1FFX A;  2HJD A;  1XRE A;  3ABM C;  3T1Y O;  1XDC A;  4FM1 A;  4LF6 B;  1P7G A;  2EIM B;  4O2B B;  1B04 A;  1OCC C;  3A0H Z;  4ZBM A;  1K7D A;  3JD0 A;  1VIB A;  3E35 A;  2QWR B;  2JK5 C;  2PI4 A;  3JD4 A;  3U0Z A;  1N32 O;  3ZRW B;  2UUC B;  4XDL A;  1S5H C;  2OCC B;  4BWA A;  1RPO A;  2YXY A;  1XEQ A;  4D6T H;  1YVW A;  1OCR C;  5H2F Z;  2E76 B;  3A8T A;  4PJ0 Z;  1H2M A;  2XAH A;  3OUF A;  1A32 A;  3JAS A;  1ZX3 A;  4OGQ B;  5TIS Z;  2ADQ B;  2WA4 A;  1FXK C;  2UUC O;  3DC5 A;  1M57 B;  3TET A;  1Q5O A;  2QM8 A;  4LFC B;  5BMV A;  4KHP B;  4DR6 O;  1PL0 A;  5JJE B;  3QG5 A;  5H9C A;  1Y74 A;  3U11 A;  1K9M W;  1Z2G A;  3L70 H;  1L0L H;  5HFL A;  4WBN A;  1SC5 B;  3MD0 A;  3SPH A;  4DV1 O;  1XMQ O;  3ZMT A;  2LO1 A;  4FMT A;  5CB4 B;  3SDL A;  3OD4 A;  4CBC A;  1VQN V;  5GON A;  5KHI A;  3TCU A;  3ZRV A;  1XQ8 A;  5EZY B;  2QDO A;  1TUB B;  1VMG A;  4K35 A;  3J80 N;  1BHA A;  5CA3 A;  1Y76 B;  4LFB O;  4JGS A;  4ZI7 B;  3TXQ A;  3ASN C;  1F4M A;  2QKC A;  2YEV A;  2P6J A;  1KEC A;  1P7B A;  1VF5 B;  3ABM B;  4O4L A;  5LOV B;  5LGN A;  1EZV H;  2X6C A;  1JVM A;  4NVP A;  1MA1 A;  3P32 A;  1VQ6 V;  1OCC B;  1GMG A;  3FYI B;  1XHZ A;  2ZNI A;  4BW5 A;  3HPL C;  4I5S A;  1THZ A;  4GCZ A;  3SYP A;  3HKD B;  4H44 B;  2ZM6 O;  2GSM B;  1VF6 A;  2CH7 B;  2LGQ A;  4MSW C;  4RO2 A;  4DR5 B;  1RSO A;  3FX7 A;  3N2K B;  1XIL A;  3CCJ V;  2LW1 A;  4FFB B;  5BZB A;  4MVO A;  1WA8 A;  4QIW F;  1D2D A;  5KHH A;  1AIL A;  1B6Q A;  1E79 G;  1JR9 A;  1EN5 A;  1KKD A;  1HP8 A;  2WAM A;  4BIU A;  2Q8V A;  2F1M A;  4K8X A;  4AIL C;  4DR5 O;  3H1K H;  5H5N A;  1NQT A;  3NR7 A;  2QKS A;  3SJA C;  1HDJ A;  4DUY O;  5KX5 A;  3IAY A;  1LR1 A;  1M93 A;  1IBK B;  3JD2 A;  2IBZ H;  1JX9 A;  4IHJ B;  1PKX A;  1BQ0 A;  1WJZ A;  2XT9 A;  2JGD A;  2ITC C;  2FB5 A;  3JAL A;  3D3Q A;  3IC7 A;  4DR7 B;  5IDJ A;  1SS3 A;  3N2G A;  3CJH B;  2P90 A;  1PNK A;  4B3S O;  1VQO V;  2QM7 A;  1MZF A;  1G1X B;  2N04 A;  3I5D A;  4BIZ A;  2UU9 B;  4JYA B;  1NR7 A;  2ZR2 A;  2YUA A;  2Q73 A;  4CZZ A;  3CB2 A;  3RYC B;  2WLK A;  5D5P A;  4LR3 A;  1F23 A;  4DR7 O;  2VWK A;  4TV9 B;  1UPG A;  4WFH A;  2PZS A;  2YSU B;  1JFF B;  2OIG A;  3RYI A;  1KC8 W;  5EBL C;  4JYA O;  3K06 A;  3CCU V;  3R65 A;  3ZED A;  3L71 H;  1R6T A;  4JI4 B;  5B1N A;  3E8G A;  2BE3 A;  3JCZ A;  4QPJ A;  1ROP A;  2Q0O C;  5J9P C;  3ZMU A;  1K4D C;  1NI8 A;  5LL6 Y;  4QJF B;  1K73 W;  1URF A;  5L3F A;  2X0L A;  3VQW A;  1B06 A;  4PDV A;  2UXD O;  4J11 A;  5IYZ B;  2QKA A;  1HR0 B;  2A9H A;  2P5O A;  3LNM B;  1QVG U;  1PPJ H;  1VQ7 V;  1PM9 A;  5L3G A;  2NLJ C;  1Z5V A;  2JJ2 G;  1IZ3 A;  5IYC O;  1H2S B;  4DV2 O;  3LDC A;  2Q67 A;  1H8H G;  4JI4 O;  2B1I A;  3L9D A;  3B09 A;  4DRX A;  2QEX V;  3ETD A;  4J9Z B;  2LQT A;  3CEI A;  4KL1 A;  1M9N A;  4TV8 B;  1FAF A;  1YEW A;  1HR0 O;  2DN9 A;  1S76 D;  4CS3 A;  5LA6 A;  1OZ0 A;  5EBM C;  5J2T B;  1BMF G;  2XTA A;  4B3M O;  3K58 A;  1SF9 A;  3RT3 C;  4P30 A;  2JRI A;  5DN6 G;  5FPO A;  4R50 A;  4F6R B;  3SGI A;  1XNQ O;  1K8A W;  1EZJ A;  3E22 A;  1I5Y A;  1JOY A;  1X59 A;  3OTF A;  1D5A A;  1O9G A;  2WSS G;  4FM0 A;  4AQY O;  2WLL B;  4YXW G;  5EYP B;  4DR3 B;  4I0X A;  4FLV A;  1TAE A;  2KG7 A;  1X4T A;  1CEZ A;  2PYL A;  3RVZ A;  2CTP A;  3CXC U;  2X6A A;  2EBO A;  3HKB A;  4K3A A;  4ZKI A;  2A06 H;  3OMA B;  1I7F A;  1V54 C;  1ZL8 B;  4H0L B;  1ZUQ A;  3W7U A;  3ZHS A;  5BY1 A;  1FFT B;  3KKY A;  1N0N A;  4DR3 O;  2ATK C;  4O4I A;  1QLE B;  2V4D A;  3UO3 A;  4DW0 A;  2BTQ B;  2ZDI C;  1GN3 A;  1DK1 A;  4UCS A;  5CA1 A;  4JI7 B;  2WLJ A;  2RDC A;  1VQ4 V;  5JCO A;  1W59 A;  4I50 A;  5FPR A;  4DV7 B;  1N36 B;  2ZKO A;  2CGO A;  3AK1 A;  1QR9 A;  1SQF A;  1HWY A;  5JJN B;  4TQF A;  5LBQ A;  1MZE A;  4JI5 B;  4YY3 O;  3JAR A;  5J2U B;  4X64 O;  2GBO A;  2HG5 C;  2YID A;  3DSQ A;  1AI6 A;  5ITZ A;  4IYI A;  4NXM O;  2DJV A;  4JI7 O;  5IY5 B;  4DO2 A;  4RUE A;  2EZP A;  3WG7 C;  4HNA B;  1IXM A;  1N36 O;  1JA8 A;  2QWO B;  1MNG A;  5H6Q A; 
#chains in the Genus database with same CATH homology
 2YS8 A;  1BQZ A;  1N4C A;  2LGW A;  1NZ6 A;  2LO1 A;  3UO2 A;  3UO3 A;  1GH6 A;  2N04 A;  2DMX A;  2QWP B;  3APO A;  2OCH A;  2CTP A;  2CUG A;  2GUZ B;  1BQ0 A;  2PF4 E;  2CTQ A;  2EJ7 A;  2GUZ A;  2M6Y A;  3UCS C;  2YUA A;  4RWU A;  3APQ A;  1WJZ A;  2N05 A;  1XBL A;  1FPO A;  2Y4T A;  1FAF A;  1IUR A;  2L6L A;  2DN9 A;  2QSA A;  2KQX A;  2QWN B;  4J80 A;  2QWR B;  3BVO A;  2Y4U A;  4J7Z A;  2CTW A;  2QWQ B;  3AG7 A;  2QWO B;  2CTR A;  1HDJ A;  4IT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...