1HDJA

Human hsp40 (hdj-1), nmr
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
77
structure length
77
Chain Sequence
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear magnetic resonance solution structure of the human Hsp40 (HDJ-1) J-domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Molecular chaperone
molecule keywords HUMAN HSP40
total genus 29
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1996-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1hdjA00
2M6YA 2QWPB 1WJZA 2QWRB 3APQA 2QWOB 1NZ6A 2KQXA 1FAFA 2DMXA 3UCSC 2QSAA 2LGWA 3APOA 1XBLA 3UO3A 2CTRA 1N4CA 4J80A 4J7ZA 2GUZA 4RWUA 2Y4TA 2CTWA 3UO2A 2CTQA 2Y4UA 2DN9A 2YUAA 2EJ7A 2N04A 3BVOA 2QWNB 2OCHA 1HDJA 1BQ0A 2LO1A 2GUZB 1BQZA 4IT5A 2CUGA 2QWQB 2L6LA 1FPOA 2PF4E 2YS8A 2CTPA 2N05A 1IURA 3AG7A 1GH6A
chains in the Genus database with same CATH superfamily
2WLMA 3H1HH 3QG5A 2R9RB 4PELA 1PD3A 4CBCA 4LFBB 4DXWA 3CE2A 1AI7A 2EIKC 4TUYA 1N0NA 4D6TH 3JARA 1XMOB 1M90W 4YJ3B 2P22C 1FJGO 1M1KW 3JALB 5KUKA 1YDXA 5CB4B 3APQA 4AILC 2ZE5A 2VQFO 2LJ2A 1SF9A 2ILMA 4FPPA 4FJCC 4NTXA 3DXRB 2Q0OC 2IJKA 3JAMN 1Y6XA 2IJJA 3CMAV 4CC5A 4E4EA 1BE3H 3UQ8A 1NI8A 2GV9A 3QO8A 4X64B 3L71H 2W6IG 1YEWA 1YJNV 5TISZ 2LP7A 2DWEC 4YJ2A 4JPRA 1UJWB 3T1HB 2WLIB 3JCZA 5C8YA 5CA1A 4H13B 4DR3B 3ZN1A 1E1QG 5L3BA 2A79B 3BRCA 1JFFA 5GONA 1N32B 3TJTA 3OFNG 4JAUA 1QCEA 4TQFA 3TXQA 5AG2A 4XBFA 1HWYA 2QM8A 3MD0A 5JH7B 4B3TO 4GKKB 2HJDA 2VQEB 3P32A 4IYHA 4LBEC 1R6TA 1HR0B 2ZM6O 1XBLA 2VS0A 1RM1B 2UXXA 5IDJA 1RFYA 4RWUA 3SPGA 4LFAB 1R3IC 1O9HA 4WCEV 2BTOA 2IJIA 3SGIA 4R6ZA 1SERA 4FZ1A 2BOBC 2UU9O 3SJBC 3TK1A 2VQFB 1QQCA 4WFBV 4PA9A 3FFQA 1K97A 3QF7A 2QWPB 1WAZA 5LL6Y 1E79G 1O9GA 2QA4V 2ZT9B 2ZD9A 4J7ZA 4IIJA 1QR9A 5EZYA 3T4DA 2B5UA 1WB8A 1Y67A 2OYQA 4K8ZA 1MA1A 1AB3A 3ZHQA 1YTFB 3LSSA 3ABKC 4JAVA 3VQWA 4QNHB 1PPJH 4XDJA 3OW2U 5KHIA 3N2KB 2QGNA 1S0VA 5KLVH 4DR5O 1XHXA 4WFHA 1KQSU 1QLEB 3GVMA 5LYJB 2ZQMA 4O2BA 2ADPA 1I94O 2Y0IA 1WNSA 4I0XB 5LHIA 5B66Z 3TCUA 5JJJB 3CC2V 4IT5A 3ZHSA 1JFFB 5B5EZ 1S72V 4IHJB 4DV4O 1E1RG 1K3EA 4DV6B 2BSKA 4UCVA 2P7TC 1AI6A 3RYHB 3ZHTA 3KCXA 4X1KA 5KAIZ 4CS4A 4JI5B 1JCHA 4EFEA 4F6RB 3TETA 1DF5A 2CTWA 4BW9A 3STLC 3I55V 2RQ6A 2ZE8A 4B3SO 1XMQO 4DV7B 2ZKOA 5JQGB 3KCYA 3HKCB 4MTOA 2DYSB 2WSSG 3M7MX 4I50B 1YJWV 1IVSA 2EX3A 5DEDA 1SESA 2Y4UA 1FXKC 2CAZC 2LQTA 1I94B 2EINB 5FPOA 2YIBA 5IJ0B 5EC2C 4TV8A 4I5SA 1AROP 4P9PA 1IXMA 3K03A 3ZRSA 4MW3A 3CXHF 1WP8A 5CB4A 2WLNA 2QTSA 4JI3O 3ABLC 3APOA 3F5TA 3T1CA 3CCMV 2BOCC 1R3KC 3AK3A 3K5NA 3CC7V 2WLJA 1XREA 3CB2A 2ARHA 1TUBA 2CUGA 1KP3A 4HNAA 3ZRWB 4Z1MG 2JJ1G 5J2TA 4OPHA 1SETA 2F93B 1Y66A 4JI4B 1AR4A 2Z5UA 4JI6O 3UM7A 4BIZA 4XDKA 1SZTA 3T2MA 5KMGB 4LFAO 1FFTB 2X6CA 1FXHA 2ZDIA 4WF9V 5J9PC 1K5QA 5DN6G 5JJNB 1F7YA 1L0LH 3G80A 2AHYA 1WPBA 3OAAG 1FAFA 4JI7B 3J7AU 3CRAA 1NH2B 2KSDA 4ZHQA 1OCRB 3HKBA 3SR2C 4X66O 3WFVA 4GLXA 4DV1B 1AP5A 3L75H 1XUQA 3PN1A 1VQKV 4DV2B 4MVQA 1N32O 2LO1A 2Q0AA 2WLHA 4TT3G 4HYOA 4JTDB 5LMNO 4YHHO 1XEQA 3LDEA 4FFBA 4GKJO 1G4YB 3AK1A 1JQ0A 5EYPB 1BL8A 5L3GA 3L74H 3RVYA 4GUNA 1SRYA 1U97A 3BEHA 3WB0A 1EN6A 5B3SB 3ABLB 1K92A 1K5SA 4ZBMA 5A9GA 1BCCH 2YIBD 4TV9A 3HKEA 2CH7B 1RM1C 4DUZB 5GTIZ 4YHHB 1H2LA 5LMNB 2PI4A 4J11A 5B1AB 1JJOA 1XNQB 1TGOA 4DV1O 2ITCC 3CRMA 5E1AC 1TUBB 4TWKA 4X66B 2E76B 1DGSA 4GYCB 4UCRA 4H44B 4YY3B 3SPCA 1PNMA 3A0BZ 4PI2A 2OIEA 1VF7A 3QO5A 3A2FA 3CSXA 1SQVH 1L0NH 2UUAO 3AG7A 3WG7B 1JPXA 3SYOA 2LFRA 4U3JA 2JGDB 3RYIB 1MABG 3ZMVA 2HP8A 1FJGB 2CE4A 4DV4B 5IT9N 5IJ0A 2JVDA 4K8XA 3AG2C 1JR9A 4X20B 5B1AC 4LFBO 4UCSA 3JD2A 2JEUA 3BPZA 4PDMA 4RQFA 3DC5A 2Z3YA 4Z1VA 4WBNA 2ZIMA 1Q6IA 5FPRA 1YVWA 1HW7A 3D3QA 3P3NA 5BY1A 3K58A 2D3OW 4LWSB 3K5LA 3X2QB 2B9ZA 3ZRVA 2W0FC 1M57B 3DXRA 3FB7C 1P49A 2WPDG 4X65O 4UB8Z 4DK0A 2IJHA 3JASA 3HPLC 4PA7A 2QJ1A 1KU9A 2ZE6A 5H5NA 1YSCA 1I0HA 4TQDA 1CXZB 3FX7A 1QLNA 1AJNA 2A7WA 2VQEO 2NR5A 1U96A 1JX9A 2WLLA 2AXTZ 4DR1B 3MHSC 3SYCA 2QR4A 4DR7B 2P4VA 3RW0A 4MSWC 3BVOA 3UKMA 1HDJA 4P2ZA 3C3TA 2XAHA 4DR6B 5LGNA 5FL7G 4IYIA 4DR3O 3IAYA 4KHPB 4L8JA 2H3OA 1RSOB 2GHYA 1WN7A 1YHQV 3LDCA 1TAEA 5J2UB 5IWAO 1VQ5V 1XHZA 2HHHB 2IU0A 2Y69C 2YICA 1QVGU 2CTPA 4DR5B 4FM0A 5GTHZ 5KX5A 1VEWA 3FB5C 4U3JB 3SPHA 4EEQA 1FXKB 2QWOB 5J2TB 3R66A 5JQGA 1H2NA 2F1MA 5H9CA 2RDCA 3E22A 3W7XA 1W0KG 2ZDIC 1GN6A 1KECA 2X7RB 1HNWO 1QNMA 2JS5A 4O2AB 2HKOA 4JYAO 4I55B 3WB1A 3H9VA 3OE7G 4FLYA 1N8RW 3B77A 4LH7A 1ZL8B 4JV5O 2KG7A 1SA0B 1QU7A 1Q6UA 5IYDO 1P7GA 2F4VO 5IY5B 3IFXA 1NVPD 4YJ2B 2ITDC 3G6BA 3CS5A 4LF7O 1B3QA 4X62B 3S3WA 1J5EO 4RO2A 4J41A 1YTFD 4F6EA 1Q5OA 4B3MO 4EB6B 1BT8A 2YUAA 1LNQA 4WFGA 1K73W 4J7KA 1QLEC 2LW1A 1G6UA 1M9NA 1SQFA 2PZSA 3AG1C 2Q73A 5BR8B 1H2KA 2XTAA 1VIBA 2ZNJA 1OCCB 1VQ4V 3FYIB 4I9QA 3MHHC 4LF5B 2M7WA 1OHHG 5KAFZ 5EIBC 4PV1B 5A2QN 2GUZB 5LBQA 1PM9A 4RQEA 2WA3A 4JYCA 2WWWA 4OPAA 4K3AA 4BAYA 1DF4A 1AVMA 2DYRC 1L1FA 5KHHA 1KUQA 2DQ0A 1GN4A 4IGGA 3JASB 1GRJA 3N2KA 1HNZB 4R7CA 5KHJA 2EIMB 3I5DA 5L3FA 3ETDA 5EBLC 1IBMB 2CTRA 3SJQC 1R1BA 1FKAO 4LF8B 1HNXB 4ZOLA 2UXBB 4I9WA 4JI5O 1IBLB 4EB6A 1XL4A 3BY6A 1X59A 1K4DC 1KMIZ 4LCUC 4G27B 1N0JA 2UXCB 2OCCB 1HP8A 2F43G 2LGQA 4X8AA 2HR3A 3CJHB 1MMMA 1V9PA 3FYEB 1KD1W 2E75B 1GAXA 4K35A 4FLUA 1K33A 1NTKH 2QWQB 3ABTA 3K57A 1MSDA 1K34A 2RN9A 4JZ2A 3ABUA 3WB2A 4MVRA 3GWOA 1COWG 2EIJC 2P6JA 4NXMB 3G6EV 2QSAA 2Y0PA 1W2BU 5IYZA 4LR3A 2XAQA 3K08A 3P30A 3T1YB 3OTOB 1XNRO 4LC1A 3QNEA 4JI2B 2YC0A 2XNDG 4F6RA 1A32A 1SA0A 2Q5ZA 4DRXB 4JI8B 2PYJA 1GH6A 2N74A 2FL4A 2QE7G 4LF9O 4NXNO 1AI4A 3CCEV 1AJQA 2UU9B 5LOVA 1R6NA 4TV9B 1SZXA 1ZAUA 1QBZA 2YIDA 4B7KA 2KB1A 2E74B 3HKDA 4MW8A 1YZBA 2X0LA 4JZGA 2XAGA 2HG5C 4B3TB 5IY5C 1K8AW 5D5QA 5KA6A 2P90A 5KX5B 4DUYO 3C3SA 1SS3A 3H01A 4YXWG 3ZCCA 1AP6A 4FMTA 1KB9F 1GN2A 4LF4B 1N4CA 1EZVH 4JI0B 2FYUH 3ZJZA 2P06A 2PTMA 3SPIA 4K0KB 3F7YC 4CH3A 1X4TA 4QJFB 1Q3EA 2OCHA 4X9QA 3Q4HA 4XDLA 5H2FZ 3SJCC 3J81N 3K3WA 2GTSA 4JI1B 1Q43A 1DTOA 4NXNB 1VMGA 3IC9A 2Q69A 2ZNIA 1GTOA 2LFSA 2ZCEA 3E89A 4CS3A 4ZOLB 1NKDA 1XDCA 3QVNA 5LMUB 4JI2O 5KMGA 3OR7C 4NB5A 2PF4E 2B1IA 4J10A 3SYAA 1VQ6V 5IYBO 2Z0AA 4KL1A 2YIAA 3W7SA 1WJZA 4WFFA 1KC8W 2E5LO 3U10A 2XAJA 4JF3A 3K0DA 2DYSC 3JAKB 4FM1A 3BA8A 3ZX6A 3ZMZA 1FFXA 5K1PA 2YI9A 4L87A 3ABMB 1NT2B 4GZRB 5EBMC 4MTXA 4P9OA 4PD4F 3CEIA 3ZHVA 1YIJV 1THZA 5KUMA 5KA5A 2QTOA 1KKCA 3UCSC 1YXBA 4JTAB 2IH1C 2CTQA 3LSUA 3CD6V 1D2DA 1TVKA 4IL6Z 1EM1A 2GDSA 1VQ8V 2UXBO 1HNXO 1OJHA 3THOA 1IBMO 2JGDA 3RYIA 4UXNA 3ZMTA 1I08A 2QDOA 2K9PA 4TV8B 4JAAA 3EXAA 3ZIAG 1ZTEA 2XASA 1Q82W 1TVKB 3ABKB 4I7ZB 4N23A 1AJPA 2UXDB 1JA8A 2EIKB 3JYCA 4A5UB 4NTWA 2QWRB 4JASA 4CH5A 4O4LB 3H1JH 4F4LA 5EIBD 5CBFA 4GX1A 4RAIA 1JJ2U 4QPJA 2UXDO 1NTZH 1CPYA 2FTKA 2QKCA 3JD3A 4I0XA 1Y76A 3B4SA 3E22B 2F23A 1AILA 1Z2GA 4QPKA 4X1KB 1Y74A 3ASNC 3CPWU 3JATB 2ZXWB 3D36C 3STZC 1IBKO 2CH7A 1UFIA 4DK1A 4Q6GA 2BE3A 5B3SC 2IM9A 5KHGA 4DV5O 3K79A 3OGIB 3OMIB 1SQBH 3JAWA 4B3RO 2ZIOA 1N36B 4MVOA 5LYJA 3UT5B 2PY5A 2RNBA 2ZE7A 1GKFA 2YXYA 2JIZG 2DW4A 1QVFU 4JV5B 2C2AA 4ZI7B 1NR7A 3N2GB 2Y69B 2VWJA 1FS0G 4QGPA 3H1IH 3RYCA 1YJ9V 3CRCA 3ML0A 3GB7C 3JAWB 3ZRXA 4B7EA 5LGUA 3A0HZ 5IE9A 1ZLZA 4PHZA 2IW5A 1WB7A 2EILB 3C90A 1LUVA 5F2VO 2XUMA 2QEXV 3RWRD 3WG7C 5LMUO 1MNGA 3ZMUA 1OZ0A 5E79Z 1NVPB 3CCUV 1EBOA 3H1LH 2KG7B 4AI8A 3IGAC 1ZL8A 1R6KA 3RYFA 1S5JA 2OTLV 2EBOA 2ETNA 2CK3G 2OT5A 3OEHG 3P3PA 4BIUA 3J80N 1M57C 3O65A 3OMAB 2AW9A 1EFRG 1RP3B 1J95A 1MSWD 3OD4A 4DR6O 1Z5VA 1Q81W 5BXZA 3K9SA 1K7DA 2R9AA 1R3JC 1VARA 3L73H 5LP6C 2IH3C 1ZX3A 4DUYB 2ZR2A 4I50A 2XAFA 5IYCO 5C8YB 2NLJC 3OR6C 1IDSA 1QR8A 1BHBA 3CCQV 1SQGA 1FXVA 4R50A 4UCOA 4UCUA 2ADQB 2X6BA 4H37A 4OX9B 4U3FH 5H6RA 2FKXA 2OCCC 4MTFA 3A0RA 4AHCA 4DW0A 4BWAA 1Q6HA 1BSMA 4LF5O 3ABMC 1PNKA 2MK3A 3CRRA 2YEVB 1NJIW 1R73A 3AEIA 4LF9B 3B09A 1PV0A 1VQOV 1GM9A 1VQMV 2UUCB 1WP7A 2EILC 5BR8O 1F4NA 4QE7A 2N04A 4BIOA 1B04A 4DV3B 4GX0A 3OTOO 3D8CA 4O2BB 2P67A 1D5AA 1BGYH 3JSLA 5FNVA 3CC4V 2BSKB 1WPXA 1WA8B 3CCVV 3I56V 4FLZA 3B2EE 3RT3C 3G71V 4H0LB 4X62O 3ASNB 2L35A 2W6JG 3RVZA 2OTJV 3B40A 2DN9A 4GCZA 1GM7A 3HR0A 4PA6A 4KFMA 4PJ0Z 1K9MW 3CCSV 3BABA 3T4ZA 4PI0A 2Y48A 2L6LA 1NBMG 1SQXH 2F4VB 1NS1A 5B1BB 3CXCU 3OUFA 2XOKG 4MVSA 3LDDA 4PDRA 3CCJV 1NZ6A 3CHXA 4UV9A 1MZEA 2CDYA 3W7WA 2RCVA 4DV3O 1P4RA 2JS3A 1IBLO 3TXSA 4D7SA 2AHZA 4J7JA 3RYCB 4PA4A 2OIGA 4FZ0A 4JTCB 1BS3A 2EZOA 3MDSA 1P84F 5IJ9A 5FLXN 2HJFC 2WLKA 4RUFA 2Q67A 2PUSA 3BAAA 2UUBB 1SQQH 5B1BC 1WLEA 3N27A 1VQ7V 2QM7A 2PGGA 1Y76B 1DK1A 5KHKA 4NR1A 4G2KA 4LFCO 4EFBA 5LA6A 1ZUQA 3D3IA 3ICXA 1ORQC 5GONB 4DV0B 4DR4B 1BHAA 3KG2A 1IURA 1ZWIC 3ZEDA 4JI1O 2BCCH 3NXSA 5L3CA 4PA3A 4RUEA 1ZSPA 3JATA 5K1XA 1VQ9V 4O2AA 2Q4PA 1TUEB 2NN4A 2F66C 4BR6A 1S3JA 3IJ4A 5LP6A 1YITV 5JCOA 2JRIA 3B8NA 4O4LA 1SC5B 1S76D 3DSQA 1G1XB 3AG2B 4WFEA 2EJRA 2O57A 2OWOA 2HLDG 2BTQB 2A0LA 3U11A 3JD0A 4CH4A 1US6A 4KXRA 4YIPA 2BTQA 3FAVA 2AZ0A 5DECA 3BA9A 1KKDA 3OUSA 1MOFA 3CP1A 3VBBA 1OCOB 3R65A 4YIOA 4JI4O 4X1YB 1SKVA 1YI2V 4H33A 3E2EA 3JARB 4J42A 3VQXA 4PDVA 4TUYB 2YI8A 1XNRB 3A8TA 5CN0A 2Q7GA 3ASOC 3OT7A 4ASUG 1NH2D 2EULA 1OCRC 2WAMA 2FB5A 3RYHA 2M6YA 1NTMH 3ZMSA 5ITZA 4YJ3A 1FFXB 1NQTA 4X1IB 1V54C 5L3DA 1NU1H 2GUZA 1N36O 3M8AA 4GT1A 3E8HA 4ZKIA 3NR7A 3K59A 3AG1B 1B06A 4U7NA 1VQPV 4UB6Z 2V4DA 1KP2A 1IBKB 2VRZA 3AG3B 5IJ9B 1W59A 5CA3A 3GWKC 2DMXA 4QIWF 5HFMA 4FK5C 3Q4HB 2YSUB 5CA0B 3EVKA 3FB6C 2R9IA 3HB3B 3K9AA 3RGBA 5EZYB 1YF2A 4ZIBA 3LSQA 2UUCO 1M93A 4LF8O 4YY3O 3H1KH 3S3XA 2QM4A 3N2GA 3ZS8C 4QE9A 5LGTA 3AK2A 1XNQO 2CGOA 2DQ3A 5B1OA 3JSNA 5EC1C 4DR2B 2Q68A 4JGSA 5DM6V 4KUMA 4OX9O 2UUBO 2JK5C 4FM2A 2IU3A 4DR2O 2MW2B 2D2CB 1JOYA 1Q7YW 3SDLA 5ITZB 3L72H 2H94A 1QHTA 3L9DA 5JH7A 2R72A 5HFLA 3ASOB 2V1DA 3F5WC 3ZRWA 3SPJA 5JVDB 3W7UA 4GKJB 1MG1A 1PNLA 4J80A 4X65B 4N21A 2KKWA 1MZFA 2DYRB 4ABMA 4B3MB 5JVDA 2HVJC 1FXKA 3G4SV 5LOVB 2YEVA 3EFFK 4LNUB 2ZR3A 1VQLV 3HKEB 3FAVB 5BMVB 1GM8A 3AG3C 4I4TA 4U7OA 1H8EG 5LA6B 2V7QG 4R8CA 1IZ3A 3RFRA 4LP8A 4UCTA 1Y4MA 2YDEA 3E8FA 2E5LB 4NYKA 3BCCH 1KBHA 1ROPA 1RSOA 1H2GA 5EYPA 3SJAC 1M5IA 3K5MA 1HR0O 1OV9A 3O9OA 2HFEC 3BHPA 2UUAB 4GKKO 4CS2A 5LP6B 1HNWB 4TOIA 1EN5A 1RPRA 5LHGA 3F7VC 4MTGA 2EIJB 3SYQA 3X2QC 2N05A 3CJHA 4O4JB 2G38A 2PI5A 1ENVA 1F4MA 3E8GA 3AG4C 4JI3B 4DUZO 1PL4A 4HBNA 4NVPA 3ETGA 4NTYA 4B3RB 3UO2A 3WU2Z 3LUTB 2Q7EA 4JI0O 4X1IA 4UV8A 1G8MA 1PKXA 4TSFG 4FIPC 4O4HA 4KHPO 1GN3A 4O4IB 4X64O 4NKGB 5D5PA 2YXLA 4P30A 5CMUA 4DV2O 4BW5A 4DV7O 3CRQA 2A3QA 1IXBA 3TGUH 4DR7O 1EN4A 2JEXA 2ODMA 4X1YA 2CGNA 2A06H 5LXTB 4FLVA 1VF5B 5CA1B 4DV0O 4DR4O 1PP9H 3KZIZ 1M56B 1H38A 4JI8O 4LFCB 3UT5A 1I5XA 4FLXA 1XQ8A 4FFKA 5L3EA 4X20A 1PL0A 1V54B 1XMOO 3MAQA 3JD4A 2DOSA 1CEZA 3T1YO 1F51A 4GX2A 5GW7A 4I4TB 1AR1B 3ZHUA 4NXMO 1FD9A 5FNVB 1GMGA 4I55A 1D5NA 1H2SB 2GSMB 2IBZH 2P4KA 5JJEB 4CH6A 2Q7HA 2ZINA 2XHBA 1AI5A 4MVUA 1OCCC 2JDIG 2UXCO 2RJZA 1N34B 4G28B 1VP7A 3LNNA 1S77D 1BZKA 5EK0A 4IHJA 2LGWA 1GO3F 3UO3A 4DV5B 3L70H 2AGAA 3PJSK 4UVAA 2EJ7A 4B08A 4J9ZB 5BZBA 2UXNA 4AQYB 5J2UA 2LW7A 3OMNB 1I7FA 2F95B 4CC6A 5IYZB 4E2LA 3QTCA 3W7TA 1VF6A 2ZM6B 1YCIA 2H8PC 3RBZA 5LXTA 5B1NA 3BFRA 4ICGA 3E83A 2JJ2G 2Q8VA 2QKAA 1Q86W 3CCRV 1S5HC 1FYJA 1XMQB 4WFAV 4B3SB 5JCOC 1DLBA 3HKBB 1Q90D 1I5YA 1S5LZ 4IIJB 4JYYA 2YS8A 4O4IA 1GK9A 3FD9A 2K1EA 4JYBA 3RYFB 3JALA 1B6QA 1M4UA 3DTUB 4GX5A 2A9HA 1SQPH 5LHHA 4CZZA 3E35A 2RMKB 4MS2A 3RN4A 2VWKA 1KYOF 3EHBB 3D36A 1OCOC 5CA0A 3ZHRA 3T1HO 4OXSA 1LR1A 4FVMA 3CCLV 1Z5WA 1VF6C 2WLLB 4O4HB 1WA8A 1V55B 1J5EB 2HEPA 3E86A 1OCZB 5CBGA 3ETQA 3OEEG 2WA4A 4LF7B 1Y74B 2EZPA 4HNAB 1XL6A 1URFA 1JVMA 4UFZA 2B1GA 4DYLA 3K0GA 1N33B 2EIMC 3K06A 3U0ZA 4MVMA 1BQ0A 3B8MA 2GTAA 4J9YB 5H6QA 2PYLA 4X89A 4JI7O 4LH6A 1H2MA 4Z2WA 4FLTA 4W4LA 2EINC 4JYAB 4O4JA 3ETEA 3ZN0A 2WLIA 1P7BA 3KKYA 3OM3B 2Q6AA 4Q20A 5EBWC 4LWSA 4X88A 1N33O 4KP4A 2YXHA 4JI6B 3K5OA 3HKCA 4WBNB 3K04A 2KQXA 3OTFA 2FMLA 2QKSA 3OGCC 2DJVA 3CYOA 5JWPA 3JCUZ 2NNUA 4OGQB 2HHHO 1H8HG 3HKDB 2W0XA 1T5EA 4D7TA 5IWAB 2ATKC 1XOUA 5BMVA 4UVCA 2GBOA 3G67A 4LNUA 1EZJA 3E8BA 3IC7A 4MT8A 2AZ2A 4DRXA 2JGUA 1AR5A 4EKWA 3ZBHA 4K0KO 3CMEV 1V55C 1R3LC 3SYPA 2Q9LA 4LF6B 4LF4O 3CWBH 2QWNB 3VOUA 3VQYA 3JD1A 1BQZA 3LNMB 2P5OA 4DR1O 3FKSG 1HNZO 3M99B 1K4CC 1JMKC 2X6AA 1IX9A 1UPGA 4W4KA 3AG4B 1TA8A 1RPOA 2Y4TA 4UVBA 5C93A 4C7UA 4HZ3A 4AQYO 1XI1A 2HVKC 4ZHQB 3QO7A 1FPOA 4LF6O 3DGEA 4MVZA 3DC6A 2R70A 4UUJC 4ZI7A 1NR1A 2E3CA 3FB8C 4DV6O 4FFBB 4FLWA 1N34O 4HAMA 2ZXWC 1LUWA 1F23A 1W0JG 1XILA 1L8DA 3JAKA 1BMFG 2DWDC 1CP9A 4DO2A 3VQVA 1OCZC 1M56C 4PDLA 2DE0X 4DW1A 5CBHA 1VQNV 3CX5F 2XT9A 1Q8IA
chains in the Genus database with same CATH topology
2M6YA 2QWPB 1WJZA 2QWRB 3APQA 2QWOB 1NZ6A 2KQXA 1FAFA 2DMXA 3UCSC 2QSAA 2LGWA 3APOA 1XBLA 3UO3A 2CTRA 1N4CA 4J80A 4J7ZA 2GUZA 4RWUA 2Y4TA 2CTWA 3UO2A 2CTQA 2Y4UA 2DN9A 2YUAA 2EJ7A 2N04A 3BVOA 2QWNB 2OCHA 1HDJA 1BQ0A 2LO1A 2GUZB 1BQZA 4IT5A 2CUGA 2QWQB 2L6LA 1FPOA 2PF4E 2YS8A 2CTPA 2N05A 1IURA 3AG7A 1GH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6Y A;  2QWP B;  1WJZ A;  2QWR B;  3APQ A;  2QWO B;  1NZ6 A;  2KQX A;  1FAF A;  2DMX A;  3UCS C;  2QSA A;  2LGW A;  3APO A;  1XBL A;  3UO3 A;  2CTR A;  1N4C A;  4J80 A;  4J7Z A;  2GUZ A;  4RWU A;  2Y4T A;  2CTW A;  3UO2 A;  2CTQ A;  2Y4U A;  2DN9 A;  2YUA A;  2EJ7 A;  2N04 A;  3BVO A;  2QWN B;  2OCH A;  1HDJ A;  1BQ0 A;  2LO1 A;  2GUZ B;  1BQZ A;  4IT5 A;  2CUG A;  2QWQ B;  2L6L A;  1FPO A;  2PF4 E;  2YS8 A;  2CTP A;  2N05 A;  1IUR A;  3AG7 A;  1GH6 A; 
#chains in the Genus database with same CATH topology
 2WLM A;  3H1H H;  3QG5 A;  2R9R B;  4PEL A;  1PD3 A;  4CBC A;  4LFB B;  4DXW A;  3CE2 A;  1AI7 A;  2EIK C;  4TUY A;  1N0N A;  4D6T H;  3JAR A;  1XMO B;  1M90 W;  4YJ3 B;  2P22 C;  1FJG O;  1M1K W;  3JAL B;  5KUK A;  1YDX A;  5CB4 B;  3APQ A;  4AIL C;  2ZE5 A;  2VQF O;  2LJ2 A;  1SF9 A;  2ILM A;  4FPP A;  4FJC C;  4NTX A;  3DXR B;  2Q0O C;  2IJK A;  3JAM N;  1Y6X A;  2IJJ A;  3CMA V;  4CC5 A;  4E4E A;  1BE3 H;  3UQ8 A;  1NI8 A;  2GV9 A;  3QO8 A;  4X64 B;  3L71 H;  2W6I G;  1YEW A;  1YJN V;  5TIS Z;  2LP7 A;  2DWE C;  4YJ2 A;  4JPR A;  1UJW B;  3T1H B;  2WLI B;  3JCZ A;  5C8Y A;  5CA1 A;  4H13 B;  4DR3 B;  3ZN1 A;  1E1Q G;  5L3B A;  2A79 B;  3BRC A;  1JFF A;  5GON A;  1N32 B;  3TJT A;  3OFN G;  4JAU A;  1QCE A;  4TQF A;  3TXQ A;  5AG2 A;  4XBF A;  1HWY A;  2QM8 A;  3MD0 A;  5JH7 B;  4B3T O;  4GKK B;  2HJD A;  2VQE B;  3P32 A;  4IYH A;  4LBE C;  1R6T A;  1HR0 B;  2ZM6 O;  1XBL A;  2VS0 A;  1RM1 B;  2UXX A;  5IDJ A;  1RFY A;  4RWU A;  3SPG A;  4LFA B;  1R3I C;  1O9H A;  4WCE V;  2BTO A;  2IJI A;  3SGI A;  4R6Z A;  1SER A;  4FZ1 A;  2BOB C;  2UU9 O;  3SJB C;  3TK1 A;  2VQF B;  1QQC A;  4WFB V;  4PA9 A;  3FFQ A;  1K97 A;  3QF7 A;  2QWP B;  1WAZ A;  5LL6 Y;  1E79 G;  1O9G A;  2QA4 V;  2ZT9 B;  2ZD9 A;  4J7Z A;  4IIJ A;  1QR9 A;  5EZY A;  3T4D A;  2B5U A;  1WB8 A;  1Y67 A;  2OYQ A;  4K8Z A;  1MA1 A;  1AB3 A;  3ZHQ A;  1YTF B;  3LSS A;  3ABK C;  4JAV A;  3VQW A;  4QNH B;  1PPJ H;  4XDJ A;  3OW2 U;  5KHI A;  3N2K B;  2QGN A;  1S0V A;  5KLV H;  4DR5 O;  1XHX A;  4WFH A;  1KQS U;  1QLE B;  3GVM A;  5LYJ B;  2ZQM A;  4O2B A;  2ADP A;  1I94 O;  2Y0I A;  1WNS A;  4I0X B;  5LHI A;  5B66 Z;  3TCU A;  5JJJ B;  3CC2 V;  4IT5 A;  3ZHS A;  1JFF B;  5B5E Z;  1S72 V;  4IHJ B;  4DV4 O;  1E1R G;  1K3E A;  4DV6 B;  2BSK A;  4UCV A;  2P7T C;  1AI6 A;  3RYH B;  3ZHT A;  3KCX A;  4X1K A;  5KAI Z;  4CS4 A;  4JI5 B;  1JCH A;  4EFE A;  4F6R B;  3TET A;  1DF5 A;  2CTW A;  4BW9 A;  3STL C;  3I55 V;  2RQ6 A;  2ZE8 A;  4B3S O;  1XMQ O;  4DV7 B;  2ZKO A;  5JQG B;  3KCY A;  3HKC B;  4MTO A;  2DYS B;  2WSS G;  3M7M X;  4I50 B;  1YJW V;  1IVS A;  2EX3 A;  5DED A;  1SES A;  2Y4U A;  1FXK C;  2CAZ C;  2LQT A;  1I94 B;  2EIN B;  5FPO A;  2YIB A;  5IJ0 B;  5EC2 C;  4TV8 A;  4I5S A;  1ARO P;  4P9P A;  1IXM A;  3K03 A;  3ZRS A;  4MW3 A;  3CXH F;  1WP8 A;  5CB4 A;  2WLN A;  2QTS A;  4JI3 O;  3ABL C;  3APO A;  3F5T A;  3T1C A;  3CCM V;  2BOC C;  1R3K C;  3AK3 A;  3K5N A;  3CC7 V;  2WLJ A;  1XRE A;  3CB2 A;  2ARH A;  1TUB A;  2CUG A;  1KP3 A;  4HNA A;  3ZRW B;  4Z1M G;  2JJ1 G;  5J2T A;  4OPH A;  1SET A;  2F93 B;  1Y66 A;  4JI4 B;  1AR4 A;  2Z5U A;  4JI6 O;  3UM7 A;  4BIZ A;  4XDK A;  1SZT A;  3T2M A;  5KMG B;  4LFA O;  1FFT B;  2X6C A;  1FXH A;  2ZDI A;  4WF9 V;  5J9P C;  1K5Q A;  5DN6 G;  5JJN B;  1F7Y A;  1L0L H;  3G80 A;  2AHY A;  1WPB A;  3OAA G;  1FAF A;  4JI7 B;  3J7A U;  3CRA A;  1NH2 B;  2KSD A;  4ZHQ A;  1OCR B;  3HKB A;  3SR2 C;  4X66 O;  3WFV A;  4GLX A;  4DV1 B;  1AP5 A;  3L75 H;  1XUQ A;  3PN1 A;  1VQK V;  4DV2 B;  4MVQ A;  1N32 O;  2LO1 A;  2Q0A A;  2WLH A;  4TT3 G;  4HYO A;  4JTD B;  5LMN O;  4YHH O;  1XEQ A;  3LDE A;  4FFB A;  4GKJ O;  1G4Y B;  3AK1 A;  1JQ0 A;  5EYP B;  1BL8 A;  5L3G A;  3L74 H;  3RVY A;  4GUN A;  1SRY A;  1U97 A;  3BEH A;  3WB0 A;  1EN6 A;  5B3S B;  3ABL B;  1K92 A;  1K5S A;  4ZBM A;  5A9G A;  1BCC H;  2YIB D;  4TV9 A;  3HKE A;  2CH7 B;  1RM1 C;  4DUZ B;  5GTI Z;  4YHH B;  1H2L A;  5LMN B;  2PI4 A;  4J11 A;  5B1A B;  1JJO A;  1XNQ B;  1TGO A;  4DV1 O;  2ITC C;  3CRM A;  5E1A C;  1TUB B;  4TWK A;  4X66 B;  2E76 B;  1DGS A;  4GYC B;  4UCR A;  4H44 B;  4YY3 B;  3SPC A;  1PNM A;  3A0B Z;  4PI2 A;  2OIE A;  1VF7 A;  3QO5 A;  3A2F A;  3CSX A;  1SQV H;  1L0N H;  2UUA O;  3AG7 A;  3WG7 B;  1JPX A;  3SYO A;  2LFR A;  4U3J A;  2JGD B;  3RYI B;  1MAB G;  3ZMV A;  2HP8 A;  1FJG B;  2CE4 A;  4DV4 B;  5IT9 N;  5IJ0 A;  2JVD A;  4K8X A;  3AG2 C;  1JR9 A;  4X20 B;  5B1A C;  4LFB O;  4UCS A;  3JD2 A;  2JEU A;  3BPZ A;  4PDM A;  4RQF A;  3DC5 A;  2Z3Y A;  4Z1V A;  4WBN A;  2ZIM A;  1Q6I A;  5FPR A;  1YVW A;  1HW7 A;  3D3Q A;  3P3N A;  5BY1 A;  3K58 A;  2D3O W;  4LWS B;  3K5L A;  3X2Q B;  2B9Z A;  3ZRV A;  2W0F C;  1M57 B;  3DXR A;  3FB7 C;  1P49 A;  2WPD G;  4X65 O;  4UB8 Z;  4DK0 A;  2IJH A;  3JAS A;  3HPL C;  4PA7 A;  2QJ1 A;  1KU9 A;  2ZE6 A;  5H5N A;  1YSC A;  1I0H A;  4TQD A;  1CXZ B;  3FX7 A;  1QLN A;  1AJN A;  2A7W A;  2VQE O;  2NR5 A;  1U96 A;  1JX9 A;  2WLL A;  2AXT Z;  4DR1 B;  3MHS C;  3SYC A;  2QR4 A;  4DR7 B;  2P4V A;  3RW0 A;  4MSW C;  3BVO A;  3UKM A;  1HDJ A;  4P2Z A;  3C3T A;  2XAH A;  4DR6 B;  5LGN A;  5FL7 G;  4IYI A;  4DR3 O;  3IAY A;  4KHP B;  4L8J A;  2H3O A;  1RSO B;  2GHY A;  1WN7 A;  1YHQ V;  3LDC A;  1TAE A;  5J2U B;  5IWA O;  1VQ5 V;  1XHZ A;  2HHH B;  2IU0 A;  2Y69 C;  2YIC A;  1QVG U;  2CTP A;  4DR5 B;  4FM0 A;  5GTH Z;  5KX5 A;  1VEW A;  3FB5 C;  4U3J B;  3SPH A;  4EEQ A;  1FXK B;  2QWO B;  5J2T B;  3R66 A;  5JQG A;  1H2N A;  2F1M A;  5H9C A;  2RDC A;  3E22 A;  3W7X A;  1W0K G;  2ZDI C;  1GN6 A;  1KEC A;  2X7R B;  1HNW O;  1QNM A;  2JS5 A;  4O2A B;  2HKO A;  4JYA O;  4I55 B;  3WB1 A;  3H9V A;  3OE7 G;  4FLY A;  1N8R W;  3B77 A;  4LH7 A;  1ZL8 B;  4JV5 O;  2KG7 A;  1SA0 B;  1QU7 A;  1Q6U A;  5IYD O;  1P7G A;  2F4V O;  5IY5 B;  3IFX A;  1NVP D;  4YJ2 B;  2ITD C;  3G6B A;  3CS5 A;  4LF7 O;  1B3Q A;  4X62 B;  3S3W A;  1J5E O;  4RO2 A;  4J41 A;  1YTF D;  4F6E A;  1Q5O A;  4B3M O;  4EB6 B;  1BT8 A;  2YUA A;  1LNQ A;  4WFG A;  1K73 W;  4J7K A;  1QLE C;  2LW1 A;  1G6U A;  1M9N A;  1SQF A;  2PZS A;  3AG1 C;  2Q73 A;  5BR8 B;  1H2K A;  2XTA A;  1VIB A;  2ZNJ A;  1OCC B;  1VQ4 V;  3FYI B;  4I9Q A;  3MHH C;  4LF5 B;  2M7W A;  1OHH G;  5KAF Z;  5EIB C;  4PV1 B;  5A2Q N;  2GUZ B;  5LBQ A;  1PM9 A;  4RQE A;  2WA3 A;  4JYC A;  2WWW A;  4OPA A;  4K3A A;  4BAY A;  1DF4 A;  1AVM A;  2DYR C;  1L1F A;  5KHH A;  1KUQ A;  2DQ0 A;  1GN4 A;  4IGG A;  3JAS B;  1GRJ A;  3N2K A;  1HNZ B;  4R7C A;  5KHJ A;  2EIM B;  3I5D A;  5L3F A;  3ETD A;  5EBL C;  1IBM B;  2CTR A;  3SJQ C;  1R1B A;  1FKA O;  4LF8 B;  1HNX B;  4ZOL A;  2UXB B;  4I9W A;  4JI5 O;  1IBL B;  4EB6 A;  1XL4 A;  3BY6 A;  1X59 A;  1K4D C;  1KMI Z;  4LCU C;  4G27 B;  1N0J A;  2UXC B;  2OCC B;  1HP8 A;  2F43 G;  2LGQ A;  4X8A A;  2HR3 A;  3CJH B;  1MMM A;  1V9P A;  3FYE B;  1KD1 W;  2E75 B;  1GAX A;  4K35 A;  4FLU A;  1K33 A;  1NTK H;  2QWQ B;  3ABT A;  3K57 A;  1MSD A;  1K34 A;  2RN9 A;  4JZ2 A;  3ABU A;  3WB2 A;  4MVR A;  3GWO A;  1COW G;  2EIJ C;  2P6J A;  4NXM B;  3G6E V;  2QSA A;  2Y0P A;  1W2B U;  5IYZ A;  4LR3 A;  2XAQ A;  3K08 A;  3P30 A;  3T1Y B;  3OTO B;  1XNR O;  4LC1 A;  3QNE A;  4JI2 B;  2YC0 A;  2XND G;  4F6R A;  1A32 A;  1SA0 A;  2Q5Z A;  4DRX B;  4JI8 B;  2PYJ A;  1GH6 A;  2N74 A;  2FL4 A;  2QE7 G;  4LF9 O;  4NXN O;  1AI4 A;  3CCE V;  1AJQ A;  2UU9 B;  5LOV A;  1R6N A;  4TV9 B;  1SZX A;  1ZAU A;  1QBZ A;  2YID A;  4B7K A;  2KB1 A;  2E74 B;  3HKD A;  4MW8 A;  1YZB A;  2X0L A;  4JZG A;  2XAG A;  2HG5 C;  4B3T B;  5IY5 C;  1K8A W;  5D5Q A;  5KA6 A;  2P90 A;  5KX5 B;  4DUY O;  3C3S A;  1SS3 A;  3H01 A;  4YXW G;  3ZCC A;  1AP6 A;  4FMT A;  1KB9 F;  1GN2 A;  4LF4 B;  1N4C A;  1EZV H;  4JI0 B;  2FYU H;  3ZJZ A;  2P06 A;  2PTM A;  3SPI A;  4K0K B;  3F7Y C;  4CH3 A;  1X4T A;  4QJF B;  1Q3E A;  2OCH A;  4X9Q A;  3Q4H A;  4XDL A;  5H2F Z;  3SJC C;  3J81 N;  3K3W A;  2GTS A;  4JI1 B;  1Q43 A;  1DTO A;  4NXN B;  1VMG A;  3IC9 A;  2Q69 A;  2ZNI A;  1GTO A;  2LFS A;  2ZCE A;  3E89 A;  4CS3 A;  4ZOL B;  1NKD A;  1XDC A;  3QVN A;  5LMU B;  4JI2 O;  5KMG A;  3OR7 C;  4NB5 A;  2PF4 E;  2B1I A;  4J10 A;  3SYA A;  1VQ6 V;  5IYB O;  2Z0A A;  4KL1 A;  2YIA A;  3W7S A;  1WJZ A;  4WFF A;  1KC8 W;  2E5L O;  3U10 A;  2XAJ A;  4JF3 A;  3K0D A;  2DYS C;  3JAK B;  4FM1 A;  3BA8 A;  3ZX6 A;  3ZMZ A;  1FFX A;  5K1P A;  2YI9 A;  4L87 A;  3ABM B;  1NT2 B;  4GZR B;  5EBM C;  4MTX A;  4P9O A;  4PD4 F;  3CEI A;  3ZHV A;  1YIJ V;  1THZ A;  5KUM A;  5KA5 A;  2QTO A;  1KKC A;  3UCS C;  1YXB A;  4JTA B;  2IH1 C;  2CTQ A;  3LSU A;  3CD6 V;  1D2D A;  1TVK A;  4IL6 Z;  1EM1 A;  2GDS A;  1VQ8 V;  2UXB O;  1HNX O;  1OJH A;  3THO A;  1IBM O;  2JGD A;  3RYI A;  4UXN A;  3ZMT A;  1I08 A;  2QDO A;  2K9P A;  4TV8 B;  4JAA A;  3EXA A;  3ZIA G;  1ZTE A;  2XAS A;  1Q82 W;  1TVK B;  3ABK B;  4I7Z B;  4N23 A;  1AJP A;  2UXD B;  1JA8 A;  2EIK B;  3JYC A;  4A5U B;  4NTW A;  2QWR B;  4JAS A;  4CH5 A;  4O4L B;  3H1J H;  4F4L A;  5EIB D;  5CBF A;  4GX1 A;  4RAI A;  1JJ2 U;  4QPJ A;  2UXD O;  1NTZ H;  1CPY A;  2FTK A;  2QKC A;  3JD3 A;  4I0X A;  1Y76 A;  3B4S A;  3E22 B;  2F23 A;  1AIL A;  1Z2G A;  4QPK A;  4X1K B;  1Y74 A;  3ASN C;  3CPW U;  3JAT B;  2ZXW B;  3D36 C;  3STZ C;  1IBK O;  2CH7 A;  1UFI A;  4DK1 A;  4Q6G A;  2BE3 A;  5B3S C;  2IM9 A;  5KHG A;  4DV5 O;  3K79 A;  3OGI B;  3OMI B;  1SQB H;  3JAW A;  4B3R O;  2ZIO A;  1N36 B;  4MVO A;  5LYJ A;  3UT5 B;  2PY5 A;  2RNB A;  2ZE7 A;  1GKF A;  2YXY A;  2JIZ G;  2DW4 A;  1QVF U;  4JV5 B;  2C2A A;  4ZI7 B;  1NR7 A;  3N2G B;  2Y69 B;  2VWJ A;  1FS0 G;  4QGP A;  3H1I H;  3RYC A;  1YJ9 V;  3CRC A;  3ML0 A;  3GB7 C;  3JAW B;  3ZRX A;  4B7E A;  5LGU A;  3A0H Z;  5IE9 A;  1ZLZ A;  4PHZ A;  2IW5 A;  1WB7 A;  2EIL B;  3C90 A;  1LUV A;  5F2V O;  2XUM A;  2QEX V;  3RWR D;  3WG7 C;  5LMU O;  1MNG A;  3ZMU A;  1OZ0 A;  5E79 Z;  1NVP B;  3CCU V;  1EBO A;  3H1L H;  2KG7 B;  4AI8 A;  3IGA C;  1ZL8 A;  1R6K A;  3RYF A;  1S5J A;  2OTL V;  2EBO A;  2ETN A;  2CK3 G;  2OT5 A;  3OEH G;  3P3P A;  4BIU A;  3J80 N;  1M57 C;  3O65 A;  3OMA B;  2AW9 A;  1EFR G;  1RP3 B;  1J95 A;  1MSW D;  3OD4 A;  4DR6 O;  1Z5V A;  1Q81 W;  5BXZ A;  3K9S A;  1K7D A;  2R9A A;  1R3J C;  1VAR A;  3L73 H;  5LP6 C;  2IH3 C;  1ZX3 A;  4DUY B;  2ZR2 A;  4I50 A;  2XAF A;  5IYC O;  5C8Y B;  2NLJ C;  3OR6 C;  1IDS A;  1QR8 A;  1BHB A;  3CCQ V;  1SQG A;  1FXV A;  4R50 A;  4UCO A;  4UCU A;  2ADQ B;  2X6B A;  4H37 A;  4OX9 B;  4U3F H;  5H6R A;  2FKX A;  2OCC C;  4MTF A;  3A0R A;  4AHC A;  4DW0 A;  4BWA A;  1Q6H A;  1BSM A;  4LF5 O;  3ABM C;  1PNK A;  2MK3 A;  3CRR A;  2YEV B;  1NJI W;  1R73 A;  3AEI A;  4LF9 B;  3B09 A;  1PV0 A;  1VQO V;  1GM9 A;  1VQM V;  2UUC B;  1WP7 A;  2EIL C;  5BR8 O;  1F4N A;  4QE7 A;  2N04 A;  4BIO A;  1B04 A;  4DV3 B;  4GX0 A;  3OTO O;  3D8C A;  4O2B B;  2P67 A;  1D5A A;  1BGY H;  3JSL A;  5FNV A;  3CC4 V;  2BSK B;  1WPX A;  1WA8 B;  3CCV V;  3I56 V;  4FLZ A;  3B2E E;  3RT3 C;  3G71 V;  4H0L B;  4X62 O;  3ASN B;  2L35 A;  2W6J G;  3RVZ A;  2OTJ V;  3B40 A;  2DN9 A;  4GCZ A;  1GM7 A;  3HR0 A;  4PA6 A;  4KFM A;  4PJ0 Z;  1K9M W;  3CCS V;  3BAB A;  3T4Z A;  4PI0 A;  2Y48 A;  2L6L A;  1NBM G;  1SQX H;  2F4V B;  1NS1 A;  5B1B B;  3CXC U;  3OUF A;  2XOK G;  4MVS A;  3LDD A;  4PDR A;  3CCJ V;  1NZ6 A;  3CHX A;  4UV9 A;  1MZE A;  2CDY A;  3W7W A;  2RCV A;  4DV3 O;  1P4R A;  2JS3 A;  1IBL O;  3TXS A;  4D7S A;  2AHZ A;  4J7J A;  3RYC B;  4PA4 A;  2OIG A;  4FZ0 A;  4JTC B;  1BS3 A;  2EZO A;  3MDS A;  1P84 F;  5IJ9 A;  5FLX N;  2HJF C;  2WLK A;  4RUF A;  2Q67 A;  2PUS A;  3BAA A;  2UUB B;  1SQQ H;  5B1B C;  1WLE A;  3N27 A;  1VQ7 V;  2QM7 A;  2PGG A;  1Y76 B;  1DK1 A;  5KHK A;  4NR1 A;  4G2K A;  4LFC O;  4EFB A;  5LA6 A;  1ZUQ A;  3D3I A;  3ICX A;  1ORQ C;  5GON B;  4DV0 B;  4DR4 B;  1BHA A;  3KG2 A;  1IUR A;  1ZWI C;  3ZED A;  4JI1 O;  2BCC H;  3NXS A;  5L3C A;  4PA3 A;  4RUE A;  1ZSP A;  3JAT A;  5K1X A;  1VQ9 V;  4O2A A;  2Q4P A;  1TUE B;  2NN4 A;  2F66 C;  4BR6 A;  1S3J A;  3IJ4 A;  5LP6 A;  1YIT V;  5JCO A;  2JRI A;  3B8N A;  4O4L A;  1SC5 B;  1S76 D;  3DSQ A;  1G1X B;  3AG2 B;  4WFE A;  2EJR A;  2O57 A;  2OWO A;  2HLD G;  2BTQ B;  2A0L A;  3U11 A;  3JD0 A;  4CH4 A;  1US6 A;  4KXR A;  4YIP A;  2BTQ A;  3FAV A;  2AZ0 A;  5DEC A;  3BA9 A;  1KKD A;  3OUS A;  1MOF A;  3CP1 A;  3VBB A;  1OCO B;  3R65 A;  4YIO A;  4JI4 O;  4X1Y B;  1SKV A;  1YI2 V;  4H33 A;  3E2E A;  3JAR B;  4J42 A;  3VQX A;  4PDV A;  4TUY B;  2YI8 A;  1XNR B;  3A8T A;  5CN0 A;  2Q7G A;  3ASO C;  3OT7 A;  4ASU G;  1NH2 D;  2EUL A;  1OCR C;  2WAM A;  2FB5 A;  3RYH A;  2M6Y A;  1NTM H;  3ZMS A;  5ITZ A;  4YJ3 A;  1FFX B;  1NQT A;  4X1I B;  1V54 C;  5L3D A;  1NU1 H;  2GUZ A;  1N36 O;  3M8A A;  4GT1 A;  3E8H A;  4ZKI A;  3NR7 A;  3K59 A;  3AG1 B;  1B06 A;  4U7N A;  1VQP V;  4UB6 Z;  2V4D A;  1KP2 A;  1IBK B;  2VRZ A;  3AG3 B;  5IJ9 B;  1W59 A;  5CA3 A;  3GWK C;  2DMX A;  4QIW F;  5HFM A;  4FK5 C;  3Q4H B;  2YSU B;  5CA0 B;  3EVK A;  3FB6 C;  2R9I A;  3HB3 B;  3K9A A;  3RGB A;  5EZY B;  1YF2 A;  4ZIB A;  3LSQ A;  2UUC O;  1M93 A;  4LF8 O;  4YY3 O;  3H1K H;  3S3X A;  2QM4 A;  3N2G A;  3ZS8 C;  4QE9 A;  5LGT A;  3AK2 A;  1XNQ O;  2CGO A;  2DQ3 A;  5B1O A;  3JSN A;  5EC1 C;  4DR2 B;  2Q68 A;  4JGS A;  5DM6 V;  4KUM A;  4OX9 O;  2UUB O;  2JK5 C;  4FM2 A;  2IU3 A;  4DR2 O;  2MW2 B;  2D2C B;  1JOY A;  1Q7Y W;  3SDL A;  5ITZ B;  3L72 H;  2H94 A;  1QHT A;  3L9D A;  5JH7 A;  2R72 A;  5HFL A;  3ASO B;  2V1D A;  3F5W C;  3ZRW A;  3SPJ A;  5JVD B;  3W7U A;  4GKJ B;  1MG1 A;  1PNL A;  4J80 A;  4X65 B;  4N21 A;  2KKW A;  1MZF A;  2DYR B;  4ABM A;  4B3M B;  5JVD A;  2HVJ C;  1FXK A;  3G4S V;  5LOV B;  2YEV A;  3EFF K;  4LNU B;  2ZR3 A;  1VQL V;  3HKE B;  3FAV B;  5BMV B;  1GM8 A;  3AG3 C;  4I4T A;  4U7O A;  1H8E G;  5LA6 B;  2V7Q G;  4R8C A;  1IZ3 A;  3RFR A;  4LP8 A;  4UCT A;  1Y4M A;  2YDE A;  3E8F A;  2E5L B;  4NYK A;  3BCC H;  1KBH A;  1ROP A;  1RSO A;  1H2G A;  5EYP A;  3SJA C;  1M5I A;  3K5M A;  1HR0 O;  1OV9 A;  3O9O A;  2HFE C;  3BHP A;  2UUA B;  4GKK O;  4CS2 A;  5LP6 B;  1HNW B;  4TOI A;  1EN5 A;  1RPR A;  5LHG A;  3F7V C;  4MTG A;  2EIJ B;  3SYQ A;  3X2Q C;  2N05 A;  3CJH A;  4O4J B;  2G38 A;  2PI5 A;  1ENV A;  1F4M A;  3E8G A;  3AG4 C;  4JI3 B;  4DUZ O;  1PL4 A;  4HBN A;  4NVP A;  3ETG A;  4NTY A;  4B3R B;  3UO2 A;  3WU2 Z;  3LUT B;  2Q7E A;  4JI0 O;  4X1I A;  4UV8 A;  1G8M A;  1PKX A;  4TSF G;  4FIP C;  4O4H A;  4KHP O;  1GN3 A;  4O4I B;  4X64 O;  4NKG B;  5D5P A;  2YXL A;  4P30 A;  5CMU A;  4DV2 O;  4BW5 A;  4DV7 O;  3CRQ A;  2A3Q A;  1IXB A;  3TGU H;  4DR7 O;  1EN4 A;  2JEX A;  2ODM A;  4X1Y A;  2CGN A;  2A06 H;  5LXT B;  4FLV A;  1VF5 B;  5CA1 B;  4DV0 O;  4DR4 O;  1PP9 H;  3KZI Z;  1M56 B;  1H38 A;  4JI8 O;  4LFC B;  3UT5 A;  1I5X A;  4FLX A;  1XQ8 A;  4FFK A;  5L3E A;  4X20 A;  1PL0 A;  1V54 B;  1XMO O;  3MAQ A;  3JD4 A;  2DOS A;  1CEZ A;  3T1Y O;  1F51 A;  4GX2 A;  5GW7 A;  4I4T B;  1AR1 B;  3ZHU A;  4NXM O;  1FD9 A;  5FNV B;  1GMG A;  4I55 A;  1D5N A;  1H2S B;  2GSM B;  2IBZ H;  2P4K A;  5JJE B;  4CH6 A;  2Q7H A;  2ZIN A;  2XHB A;  1AI5 A;  4MVU A;  1OCC C;  2JDI G;  2UXC O;  2RJZ A;  1N34 B;  4G28 B;  1VP7 A;  3LNN A;  1S77 D;  1BZK A;  5EK0 A;  4IHJ A;  2LGW A;  1GO3 F;  3UO3 A;  4DV5 B;  3L70 H;  2AGA A;  3PJS K;  4UVA A;  2EJ7 A;  4B08 A;  4J9Z B;  5BZB A;  2UXN A;  4AQY B;  5J2U A;  2LW7 A;  3OMN B;  1I7F A;  2F95 B;  4CC6 A;  5IYZ B;  4E2L A;  3QTC A;  3W7T A;  1VF6 A;  2ZM6 B;  1YCI A;  2H8P C;  3RBZ A;  5LXT A;  5B1N A;  3BFR A;  4ICG A;  3E83 A;  2JJ2 G;  2Q8V A;  2QKA A;  1Q86 W;  3CCR V;  1S5H C;  1FYJ A;  1XMQ B;  4WFA V;  4B3S B;  5JCO C;  1DLB A;  3HKB B;  1Q90 D;  1I5Y A;  1S5L Z;  4IIJ B;  4JYY A;  2YS8 A;  4O4I A;  1GK9 A;  3FD9 A;  2K1E A;  4JYB A;  3RYF B;  3JAL A;  1B6Q A;  1M4U A;  3DTU B;  4GX5 A;  2A9H A;  1SQP H;  5LHH A;  4CZZ A;  3E35 A;  2RMK B;  4MS2 A;  3RN4 A;  2VWK A;  1KYO F;  3EHB B;  3D36 A;  1OCO C;  5CA0 A;  3ZHR A;  3T1H O;  4OXS A;  1LR1 A;  4FVM A;  3CCL V;  1Z5W A;  1VF6 C;  2WLL B;  4O4H B;  1WA8 A;  1V55 B;  1J5E B;  2HEP A;  3E86 A;  1OCZ B;  5CBG A;  3ETQ A;  3OEE G;  2WA4 A;  4LF7 B;  1Y74 B;  2EZP A;  4HNA B;  1XL6 A;  1URF A;  1JVM A;  4UFZ A;  2B1G A;  4DYL A;  3K0G A;  1N33 B;  2EIM C;  3K06 A;  3U0Z A;  4MVM A;  1BQ0 A;  3B8M A;  2GTA A;  4J9Y B;  5H6Q A;  2PYL A;  4X89 A;  4JI7 O;  4LH6 A;  1H2M A;  4Z2W A;  4FLT A;  4W4L A;  2EIN C;  4JYA B;  4O4J A;  3ETE A;  3ZN0 A;  2WLI A;  1P7B A;  3KKY A;  3OM3 B;  2Q6A A;  4Q20 A;  5EBW C;  4LWS A;  4X88 A;  1N33 O;  4KP4 A;  2YXH A;  4JI6 B;  3K5O A;  3HKC A;  4WBN B;  3K04 A;  2KQX A;  3OTF A;  2FML A;  2QKS A;  3OGC C;  2DJV A;  3CYO A;  5JWP A;  3JCU Z;  2NNU A;  4OGQ B;  2HHH O;  1H8H G;  3HKD B;  2W0X A;  1T5E A;  4D7T A;  5IWA B;  2ATK C;  1XOU A;  5BMV A;  4UVC A;  2GBO A;  3G67 A;  4LNU A;  1EZJ A;  3E8B A;  3IC7 A;  4MT8 A;  2AZ2 A;  4DRX A;  2JGU A;  1AR5 A;  4EKW A;  3ZBH A;  4K0K O;  3CME V;  1V55 C;  1R3L C;  3SYP A;  2Q9L A;  4LF6 B;  4LF4 O;  3CWB H;  2QWN B;  3VOU A;  3VQY A;  3JD1 A;  1BQZ A;  3LNM B;  2P5O A;  4DR1 O;  3FKS G;  1HNZ O;  3M99 B;  1K4C C;  1JMK C;  2X6A A;  1IX9 A;  1UPG A;  4W4K A;  3AG4 B;  1TA8 A;  1RPO A;  2Y4T A;  4UVB A;  5C93 A;  4C7U A;  4HZ3 A;  4AQY O;  1XI1 A;  2HVK C;  4ZHQ B;  3QO7 A;  1FPO A;  4LF6 O;  3DGE A;  4MVZ A;  3DC6 A;  2R70 A;  4UUJ C;  4ZI7 A;  1NR1 A;  2E3C A;  3FB8 C;  4DV6 O;  4FFB B;  4FLW A;  1N34 O;  4HAM A;  2ZXW C;  1LUW A;  1F23 A;  1W0J G;  1XIL A;  1L8D A;  3JAK A;  1BMF G;  2DWD C;  1CP9 A;  4DO2 A;  3VQV A;  1OCZ C;  1M56 C;  4PDL A;  2DE0 X;  4DW1 A;  5CBH A;  1VQN V;  3CX5 F;  2XT9 A;  1Q8I A; 
#chains in the Genus database with same CATH homology
 2M6Y A;  2QWP B;  1WJZ A;  2QWR B;  3APQ A;  2QWO B;  1NZ6 A;  2KQX A;  1FAF A;  2DMX A;  3UCS C;  2QSA A;  2LGW A;  3APO A;  1XBL A;  3UO3 A;  2CTR A;  1N4C A;  4J80 A;  4J7Z A;  2GUZ A;  4RWU A;  2Y4T A;  2CTW A;  3UO2 A;  2CTQ A;  2Y4U A;  2DN9 A;  2YUA A;  2EJ7 A;  2N04 A;  3BVO A;  2QWN B;  2OCH A;  1HDJ A;  1BQ0 A;  2LO1 A;  2GUZ B;  1BQZ A;  4IT5 A;  2CUG A;  2QWQ B;  2L6L A;  1FPO A;  2PF4 E;  2YS8 A;  2CTP A;  2N05 A;  1IUR A;  3AG7 A;  1GH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...