1HDJA

Human hsp40 (hdj-1), nmr
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
77
structure length
77
Chain Sequence
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Molecular chaperone
molecule keywords HUMAN HSP40
publication title Nuclear magnetic resonance solution structure of the human Hsp40 (HDJ-1) J-domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1996-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1hdjA00
2L6LA 1XBLA 2EJ7A 2DN9A 1HDJA 2Y4TA 2CUGA 2QWQB 2QWRB 3APOA 1N4CA 2M6YA 2CTPA 4IT5A 2YS8A 4RWUA 1FPOA 2CTRA 1IURA 2GUZB 3UO2A 2QWNB 2DMXA 1BQ0A 1BQZA 4J80A 2PF4E 1FAFA 4J7ZA 2QWOB 1GH6A 2Y4UA 3APQA 2CTWA 3UCSC 2OCHA 2LGWA 2LO1A 2GUZA 2N05A 2QWPB 2KQXA 2CTQA 2N04A 1NZ6A 3BVOA 2YUAA 1WJZA 3AG7A 2QSAA 3UO3A
chains in the Genus database with same CATH superfamily
1AR5A 3ZRWA 3RYCB 5L3EA 3CCJV 2QKSA 4UXNA 3W7TA 2EINC 2V4DA 3RGBA 4TUYA 1KKDA 5EK0A 1QBZA 3WB0A 2VWKA 4RAIA 1YIJV 3BA9A 1N0NA 2HFEC 1BZKA 1YJ9V 1N8RW 4N21A 2UUBO 2EZPA 4H0LB 3D36C 1Q90D 2UUCB 3JARB 3AG4C 1OCZB 5H6RA 1VQ6V 4EFEA 2E5LB 1MA1A 2Q8VA 1HNZB 1TUBA 3CD6V 1QVFU 1AI5A 2BTQA 1CXZB 3ZBHA 1NT2B 1SRYA 2YUAA 1G8MA 3DGEA 1QLNA 2Z3YA 3JAMN 4CH5A 4DV1B 4MVZA 4K0KO 3BFRA 3SR2C 4DR5O 2GUZB 2MK3A 3SPCA 4QGPA 3MDSA 4CH6A 5C93A 4DUZB 1N36B 4J7JA 4W4LA 2VQFO 2AZ0A 5A9GA 5B1AC 4PA4A 4JAAA 4IYHA 1VF7A 3K9SA 1BHBA 1OCOB 3BHPA 4WFHA 2XAGA 2YICA 4J7KA 5KLVH 2GTSA 1XREA 3HKDB 2W0FC 3ZN0A 3TETA 1BHAA 2FB5A 5FL7G 4GX0A 2QM4A 2UUAO 1W59A 4QIWF 4TQFA 2E75B 2EIJC 1GMGA 1XI1A 2QKCA 4O4IA 5EC2C 4FM1A 4IL6Z 4O2BB 3ZN1A 4DRXB 3C3SA 4U3JA 1HP8A 4I50A 4X66O 3ABTA 1SA0B 2HG5C 4L87A 3BCCH 2P90A 1OCOC 1JVMA 1O9HA 1FYJA 4DV6O 4AI8A 3OW2U 3CEIA 4UV8A 3K0DA 1YF2A 4EKWA 1XMOB 4O2AB 1HR0B 2VRZA 5IJ0B 3AG3C 2WLJA 1QQCA 1SQFA 5HFLA 1NVPB 4UCSA 1GO3F 1Y66A 2RJZA 4PJ0Z 2OCCC 1FFXA 3ABMB 1V55C 3RYCA 4YJ2B 2IJHA 2EX3A 3RVZA 2Y48A 1YVWA 1PM9A 2F4VO 4X9QA 2YIAA 3EFFK 1Z5VA 1PPJH 4LBEC 4LF8B 4FM0A 3U0ZA 4FLZA 3UO2A 2EZOA 5L3CA 3MAQA 4F6RB 4U7OA 1N34O 3K5OA 4LF4O 3JARA 1WA8B 1EN5A 4DR1O 1IVSA 1JJOA 5LYJA 3VQVA 1M57B 3ABMC 1PL4A 2DE0X 1JJ2U 1CPYA 3FYIB 4LF5O 2HVJC 2QTOA 3FB5C 3RFRA 1GH6A 4I9QA 2CDYA 3NR7A 3VQYA 3HKCB 2GHYA 1SQVH 1HW7A 1CP9A 1EBOA 1OCCB 1KBHA 3L72H 2LQTA 3CRMA 4AILC 4FLWA 2UUBB 2LFRA 2Q73A 3ASOC 4JZGA 2YS8A 2JRIA 5H2FZ 4ZBMA 3U10A 3I5DA 2W0XA 2B5UA 1JX9A 5IY5C 4WFFA 3JD4A 2XT9A 3ML0A 1WAZA 4DR3O 1Y6XA 3SPHA 2X6AA 3OE7G 3HKDA 2EILB 4KFMA 4I55B 3SYAA 4ZKIA 5HFMA 5L3GA 5KMGB 1Y76B 1OCCC 3CP1A 1VQ4V 1KU9A 4DR5B 2JVDA 4PDVA 3EVKA 3HB3B 3FX7A 2ITDC 2A79B 1Q82W 4HZ3A 4O2BA 3RT3C 4DRXA 4ASUG 1AR1B 1ZL8B 4J11A 4PA6A 2VQFB 3AG1C 4UFZA 1SA0A 2ZQMA 1NZ6A 3O9OA 1XDCA 3VBBA 2ZR3A 1XNRO 4GCZA 3AG7A 4OPHA 2FMLA 1K8AW 1GN3A 5IT9N 1G4YB 1K5SA 2Y4TA 1N4CA 4IT5A 4DV4B 1BE3H 4P30A 2WLMA 4AHCA 5AG2A 3RYFB 4O2AA 4J10A 1VQOV 1TVKB 2XASA 5IJ0A 2UUAB 1H2SB 1VQNV 4GUNA 1OCRB 1NVPD 1RPOA 2HJDA 5K1XA 4JAVA 4WF9V 4J9ZB 3D3IA 3STZC 4YHHO 1QVGU 2UXBO 2CK3G 4GKJB 4X66B 2AHYA 5L3DA 3B09A 4OPAA 3T4ZA 1H8HG 3JAWB 5C8YA 5KA5A 3RYIB 4DV6B 5DEDA 3BPZA 4LNUB 2AZ2A 1TGOA 1D5NA 4GZRB 2UU9B 3L70H 3KCYA 4JI2O 3THOA 4DW0A 1CEZA 1SS3A 4BIUA 4QE9A 1OCRC 4F4LA 2GDSA 3CRAA 2OIEA 1NKDA 1GN2A 2PI5A 1WA8A 4NB5A 1JOYA 1GRJA 4PHZA 3UQ8A 3K5LA 3K03A 5IE9A 3SYQA 1YJNV 5IJ9B 1GM9A 4RQEA 4DR2O 2D2CB 3UM7A 1BL8A 3JD1A 2WLLB 4MVUA 5IYDO 3STLC 2HEPA 5CBHA 4PA7A 4NYKA 4UB6Z 1FXVA 2IU3A 1LUWA 3CJHB 1N34B 1H2GA 3K08A 3T1YO 2YIDA 4KHPO 4DR1B 1PD3A 1K33A 1NR7A 1KKCA 3JAKB 4JI1O 4LCUC 1P4RA 3R66A 5KAFZ 3M7MX 2P67A 1P49A 1S72V 4JYYA 4RWUA 2P7TC 2UXCO 3L74H 1VQ5V 3N2GB 1M4UA 1M56C 4I55A 3WB2A 2RCVA 2GBOA 1GAXA 1Y76A 2PTMA 3OUSA 3JD0A 3F5TA 2B9ZA 2BCCH 3E8HA 5DN6G 4DV2O 1GK9A 1K4CC 5H5NA 2DYSB 1DTOA 4MVRA 3E22A 4WFEA 4NXNO 1KD1W 4B3SB 4GLXA 2IW5A 4J80A 4X89A 2YSUB 4BIZA 2Q4PA 1D2DA 4I7ZB 2HHHB 3CC2V 4DXWA 4JI6O 4DV7O 4D6TH 5B1BB 1M1KW 4DR3B 1HNZO 2G38A 3OM3B 2LFSA 4MTXA 1R3JC 2A0LA 1OJHA 3B4SA 4FZ1A 3WG7C 1TVKA 1U97A 4FK5C 3OUFA 2ZINA 2YXHA 4DV1O 4DK0A 2DYSC 2JJ1G 1U96A 3DXRA 4JTCB 4UV9A 1F4MA 4BWAA 1BT8A 1DLBA 4CS3A 4BW5A 1N36O 2QWPB 3LSSA 3AG2B 1XNRB 3JAWA 3U11A 4X1YA 3RYIA 4D7TA 1WN7A 2ZIMA 4O4LA 3B77A 4LNUA 1QNMA 1X59A 2RDCA 1TUBB 3AK2A 4E2LA 2E76B 2PY5A 2KB1A 2ZE7A 4OXSA 3LSUA 2ZNIA 2LGWA 3UKMA 1XHZA 4MVQA 3DSQA 1AROP 3Q4HB 3J7AU 4YHHB 5IJ9A 3ZCCA 2UXBB 3EHBB 1SETA 3CRRA 4JI0O 4DO2A 5LL6Y 4U7NA 1TUEB 1XHXA 3E8FA 2D3OW 1JMKC 1RM1C 2CGNA 5BXZA 2JGUA 2N74A 1FAFA 1R1BA 3GWKC 2WLLA 3OD4A 4N23A 3G6EV 4IGGA 4KP4A 3T4DA 1AP6A 5BR8O 1NTMH 4JI2B 1E1RG 3CJHA 3OMNB 1XMOO 2WLNA 4R6ZA 1FKAO 3JAKA 1IURA 2W6IG 1FXKB 5ITZA 2H3OA 1G1XB 3CXHF 2WSSG 4ZIBA 3N2GA 4DR7O 3DC6A 4NXMO 3G4SV 1IDSA 1SQBH 2PGGA 1FD9A 4JYBA 2PYLA 2EINB 3TXSA 1AVMA 3JATA 5EBLC 4BW9A 2X6BA 3T1YB 5KHHA 2ILMA 1FXKC 1AJPA 2HLDG 2V1DA 4JI1B 1R3LC 4K35A 2XAJA 1QLEC 5EBMC 1BGYH 1K97A 1US6A 2P06A 2YIBD 3A2FA 2K1EA 4FZ0A 1YZBA 2QJ1A 2VS0A 3HPLC 3AG4B 2UXCB 4UCUA 4X1IB 3SDLA 2AGAA 1FFXB 3ZHVA 4YIPA 4NKGB 2LJ2A 2EJRA 1W0JG 1BQ0A 1AI4A 1BQZA 5BY1A 2A06H 1S5LZ 1VEWA 5D5PA 1K3EA 2WAMA 5FPRA 1Y74B 4X20A 4DV2B 2IJKA 3ETDA 4AQYO 2R70A 4NXNB 2CUGA 3APOA 1XMQO 4LF7O 3WB1A 3CWBH 2QM7A 1EM1A 2X6CA 4JI6B 5KHIA 3E86A 3L75H 5LYJB 4DV7B 2ZIOA 2WLKA 5B1AB 2NLJC 4B3TO 4PI2A 2KQXA 2IU0A 3UT5B 3E8BA 3G6BA 3LDDA 1GTOA 2XAQA 1YHQV 4MVSA 3LSQA 1ENVA 4ZHQB 1V54C 1EN4A 3CE2A 1Y67A 2Z0AA 3Q4HA 2KG7B 4NVPA 4NR1A 1MSDA 1S3JA 2QWOB 4ICGA 1VMGA 4JI3O 2EIJB 2IM9A 2F23A 1OV9A 2UXXA 2N05A 1GKFA 1PNMA 2LP7A 3ZHSA 4K3AA 3LUTB 3QF7A 1DF5A 1XBLA 2JS3A 1AILA 1SQPH 5KHKA 2JEUA 1I5YA 2VQEO 4DV4O 3FB8C 1NR1A 4ABMA 3L71H 3ZX6A 5H9CA 3QNEA 4QNHB 3K06A 1VQ8V 5LP6C 2Q69A 3BRCA 1XL6A 1FXKA 3AG3B 3HKEB 1PNKA 4C7UA 3CSXA 4JI0B 4HYOA 1K34A 3JD3A 5JVDB 3T2MA 4GKJO 5JJEB 1YXBA 1F51A 2OCCB 2PF4E 2ZE5A 1V55B 1N33B 3OEEG 1H2LA 1DF4A 5LHHA 4YJ3B 5BR8B 2P6JA 4UCOA 4B3RO 4UCTA 2X7RB 2PZSA 2UU9O 5FPOA 4CZZA 1D5AA 4LF6O 1HNWO 3ZHRA 1YI2V 2RN9A 4DYLA 3R65A 5GONB 1KUQA 3D36A 3CRCA 1YEWA 3QO7A 1VIBA 4FFKA 4X1IA 1K7DA 3SJQC 4DR7B 4XDKA 5LMUO 3P32A 4WBNA 4ZOLB 2A7WA 4NXMB 1K9MW 2QA4V 5JQGA 4FLXA 3E8GA 5C8YB 3ZIAG 1Y74A 1Q43A 1YSCA 1SZTA 4XDJA 5A2QN 3OTFA 3BEHA 1VQ7V 5CA3A 4PDRA 5JJNB 2WLHA 1Z5WA 3KKYA 1AB3A 3ASOB 1YCIA 4R7CA 2H8PC 1UFIA 4GX2A 4MVMA 4RUFA 3UT5A 5IYBO 1LUVA 5IY5B 3ICXA 5KHJA 2ZDIC 2UXNA 3IC9A 2ZE8A 5L3BA 5JH7B 5E79Z 1YJWV 3MD0A 4E4EA 1K5QA 4ZHQA 2JDIG 2KG7A 5LGNA 3ETQA 2JK5C 4J41A 3AK3A 2YDEA 1W2BU 1HWYA 4AQYB 2EBOA 1XMQB 4Q6GA 1HDJA 4LF7B 2DYRC 2ARHA 4B3SO 2CGOA 1NI8A 2XHBA 3E2EA 3AG1B 3L9DA 3BAAA 2RNBA 4B3TB 2ZKOA 5FNVB 1F23A 3RYHB 2HHHO 2GTAA 1QR8A 3OR6C 1SQQH 3DC5A 2JJ2G 4UVBA 5JWPA 4KUMA 1T5EA 3HKEA 4JASA 4JTDB 1EN6A 3IJ4A 1XNQO 4JI3B 4LFAO 1GM8A 5JVDA 2AHZA 1I94O 2OCHA 5B3SC 1NJIW 3E22B 5IDJA 1VQPV 1BMFG 3C90A 1VF6C 4FJCC 1Y4MA 4YJ3A 4PI0A 2VQEB 4KXRA 1PV0A 1ZWIC 4MW3A 1RP3B 2M7WA 3QG5A 4J9YB 2FKXA 1L8DA 1PL0A 1ZX3A 1OZ0A 3BABA 5GONA 1KYOF 5IWAO 4X1KB 2Q68A 3DXRB 3FYEB 5LXTB 4DK1A 2PUSA 1AJNA 3E35A 4ZOLA 2YXLA 2ZM6O 4UB8Z 4B7KA 2OTJV 3K04A 4UVCA 2ZDIA 4X1YB 1K73W 4CC6A 4Z2WA 1SQGA 4O4LB 1L0NH 3LNMB 3LDEA 2WPDG 2HP8A 4B3RB 4OX9O 5J2TB 3CCUV 4LF6B 1HNWB 2E74B 2X0LA 3H1IH 4FIPC 3VQXA 3A0BZ 3ZHTA 3SYPA 1IBMB 4XBFA 4FLTA 5LHGA 1ZAUA 4GYCB 4JTAB 5LMUB 4X65O 1GN6A 3C3TA 5JH7A 4GX5A 1RFYA 2OWOA 1M56B 3KG2A 3OGIB 3MHSC 3AEIA 1XQ8A 1IXBA 4QE7A 4XDLA 4EFBA 1NH2B 5CBFA 3JCUZ 3K79A 3CB2A 2BOCC 3SPIA 5FNVA 4HNAA 3RYHA 3OFNG 3ZRVA 4EEQA 5ITZB 2EJ7A 5KUMA 1SKVA 1VF6A 5EZYA 1TA8A 2CH7B 1JA8A 1VF5B 1Q6UA 2EULA 1VQ9V 5GTHZ 3RN4A 2LO1A 3WG7B 1LR1A 1ZTEA 4NTWA 5B66Z 5BZBA 3BY6A 1VQKV 1I0HA 4TWKA 3W7UA 4UCRA 3FFQA 3JATB 4X88A 3HKBB 1SQXH 1BSMA 2IJJA 4G27B 2DMXA 4LWSB 4LC1A 5LGTA 1SZXA 3H9VA 3ZRSA 5GW7A 1TAEA 4DV5O 2QWQB 3K58A 2ITCC 5CBGA 3CCMV 4X1KA 4X20B 1XNQB 2DQ3A 4LFAB 1Q5OA 4J7ZA 5LXTA 4X8AA 4DR4B 1I94B 4KL1A 3IFXA 1AI6A 1XILA 4DW1A 1MG1A 1NS1A 3ETGA 2ZNJA 5IYCO 1RM1B 1L1FA 1MMMA 3A0HZ 2R9RB 5J2TA 4DR6O 1E1QG 2FTKA 2B1GA 1EFRG 3M8AA 5EIBC 1S5HC 4UUJC 3RBZA 4JYAO 4JI5O 3K59A 3GB7C 4PV1B 5CA1B 2FL4A 2KSDA 5IWAB 2Y69B 4O4JA 3JSLA 3SJBC 3ZS8C 3MHHC 2YI8A 3TCUA 1AJQA 1GN4A 3OEHG 2ZM6B 1M90W 5JJJB 3CC4V 3OT7A 4DUYO 5B1NA 1M93A 3FB6C 3D8CA 3WU2Z 1JR9A 3K3WA 3TK1A 5LOVA 1N33O 4FLYA 4MTGA 1E79G 2EIKC 3J81N 1NBMG 4OX9B 1JPXA 1WB8A 2QDOA 5GTIZ 3CPWU 3ETEA 2PYJA 2L6LA 4FVMA 2Y69C 4GKKO 2XAFA 4P9OA 5D5QA 2ZD9A 3KCXA 3H1HH 4JV5O 4JZ2A 4K8ZA 4NTYA 4FMTA 4DV3O 2HJFC 3ZMTA 4X65B 2CH7A 1QLEB 2EIMC 2ADQB 4PD4F 4WFAV 1KP3A 3ABLC 3ZHQA 2QTSA 1UJWB 4I5SA 3F5WC 5CN0A 2ZXWC 3CMEV 4IHJA 2BE3A 1A32A 3OAAG 4MW8A 3HKBA 3CCSV 2DQ0A 2WLIA 2IH1C 4LWSA 3A0RA 2ATKC 2Y0PA 3CXCU 3E89A 3G80A 3E83A 3GVMA 4YY3O 3QVNA 2M6YA 1RSOB 1EZJA 4BR6A 4WBNB 3X2QC 5EIBD 1XL4A 4Q20A 5JQGB 3SJCC 1KQSU 4I4TB 3K0GA 5CB4A 3W7XA 1VP7A 1DGSA 5LGUA 1GM7A 2HKOA 1XOUA 1V54B 3H1JH 2ADPA 1VQMV 2LW1A 3TJTA 4DV0B 2OYQA 1I5XA 1IBLO 3I56V 3FD9A 3BA8A 3I55V 1HNXO 1AI7A 1Q7YW 4YXWG 4QJFB 2B1IA 5F2VO 2GSMB 3P3NA 2K9PA 1PKXA 2Q7HA 3BVOA 3O65A 3LDCA 1WJZA 1Q86W 3UO3A 4DV5B 2WWWA 5CA1A 5LP6B 5CA0B 2QWNB 5L3FA 3H1LH 1S5JA 3ZMSA 4X64O 2ZCEA 2E3CA 1URFA 4HBNA 4BIOA 1R3IC 4Z1VA 4LFCO 5J2UB 1Z2GA 4F6EA 3SYOA 1K4DC 1AP5A 4DR6B 4L8JA 1WP7A 2AW9A 3T1HO 1FJGB 4JYAB 3M99B 1Q6HA 4JI5B 1IBKO 3JALB 1YTFB 4WFGA 2CE4A 1OCZC 1IZ3A 4WCEV 1NU1H 4G28B 5EBWC 4HAMA 2O57A 2QWRB 2KKWA 4TV9B 4ZI7A 1SC5B 2NNUA 3OGCC 4DUYB 2CTWA 3SPGA 4K8XA 1B3QA 1P7GA 1ORQC 3OTOO 4LH6A 1R73A 1Q3EA 1R3KC 4FFBB 1I08A 4GKKB 3CX5F 1QCEA 5H6QA 4JV5B 2OIGA 1THZA 1LNQA 2YI9A 3APQA 2ZE6A 4DV3B 1IBMO 2A9HA 1Q8IA 3K57A 1RSOA 2QR4A 4TT3G 4GT1A 4A5UB 2W6JG 1P84F 4CBCA 2BOBC 4PA9A 5KAIZ 2DW4A 4TSFG 2QE7G 4JGSA 4JPRA 3SYCA 2NN4A 2QEXV 4I4TA 4PELA 3RVYA 2L35A 3JSNA 3K5MA 2A3QA 4X62O 4BAYA 4O4HB 3ZEDA 3LNNA 3B40A 2DWDC 3ZMZA 2RQ6A 1F7YA 1MSWD 3CCEV 3P3PA 1M9NA 1B06A 3FAVB 5J9PC 1P7BA 1SF9A 2DYRB 1Q81W 2QSAA 3ZJZA 4MS2A 4TOIA 3CRQA 4YY3B 4B3MO 2YXYA 4H44B 1JFFB 1BCCH 4FPPA 1S0VA 1KMIZ 3SJAC 4Z1MG 2R72A 5LP6A 4LFBB 2CTQA 5CA0A 4TV8B 2DJVA 1L0LH 5EYPB 5TISZ 3CHXA 3VQWA 2QKAA 1IBLB 2UXDO 4FM2A 2HVKC 1O9GA 1HNXB 5J2UA 3G71V 4RO2A 5B3SB 1F4NA 1WLEA 3NXSA 5B1OA 5FLXN 4TQDA 4HNAB 4JI8O 2GUZA 2XTAA 3ZRXA 4PDLA 2Z5UA 4JI7O 5EZYB 4EB6B 1RPRA 1MOFA 1J5EO 1YTFD 3JALA 2F93B 4I0XB 2YC0A 3FB7C 1M57C 1Q6IA 2Y0IA 4LF9O 2XOKG 4MVOA 2NR5A 3S3XA 4D7SA 2Y4UA 2XUMA 2ZR2A 3CS5A 3CC7V 4TV9A 4X64B 4DR4O 3QTCA 1H2MA 4LFCB 1VQLV 5B5EZ 1ROPA 1XUQA 1G6UA 4K0KB 1N32O 2CAZC 1WB7A 1W0KG 3CCQV 4FLVA 3D3QA 1V9PA 1PNLA 4MTFA 4FFBA 3T1HB 2WA3A 4LP8A 1IBKB 4P2ZA 3ABKB 3CCRV 2P4VA 2ZT9B 4MSWC 1OHHG 2EILC 4FLUA 4R50A 4CS2A 3OMIB 1R6NA 4U3FH 2LW7A 2P22C 5E1AC 1MZEA 2HR3A 3EXAA 2Q6AA 4O4HA 5LMNO 3OTOB 4YIOA 5LA6B 3K9AA 5DM6V 1MZFA 2IH3C 4OGQB 3ABKC 1XEQA 4RUEA 3B8MA 3JASB 5JCOC 1QHTA 4YJ2A 4IIJB 3FAVA 1SESA 2DWEC 3SPJA 2BSKB 4WFBV 4O4JB 2DOSA 1K92A 1WNSA 1JFFA 2BTOA 3B2EE 1JCHA 4F6RA 3OMAB 1H8EG 2R9AA 2YEVB 4UVAA 4X62B 5LOVB 4JI4O 4TV8A 1KECA 1COWG 1J95A 2CTRA 4P9PA 3CMAV 3ABUA 1ZUQA 1FS0G 5EYPA 1YITV 2JIZG 2F4VB 3RWRD 2Q67A 3HKCA 4B3MB 3QO8A 1YDXA 4PA3A 4EB6A 5IYZB 3K5NA 1NTKH 2R9IA 4CC5A 4I0XA 4JF3A 4LF4B 1S77D 4LH7A 5KX5B 2JEXA 4GX1A 4IHJB 2OTLV 1VARA 3HR0A 3OR7C 1MNGA 4LF5B 2UXDB 3N2KB 3F7YC 1WPXA 2CTPA 4DV0O 3JD2A 3SGIA 2WLIB 2Q5ZA 5KMGA 1AR4A 5BMVB 5K1PA 1H2KA 2XAHA 4JI8B 1B6QA 5KA6A 1S76D 2C2AA 4JI7B 2N04A 3ZMUA 3IC7A 1J5EB 3CCVV 1ZL8A 2JGDB 3GWOA 4NTXA 4JAUA 3VOUA 5LHIA 4LR3A 4LF9B 2V7QG 5JCOA 3TXQA 2UUCO 5CB4B 1KP2A 3G67A 3ASNB 4H37A 1H38A 3CYOA 1QR9A 2E5LO 2F43G 3ZRWB 1EZVH 4J42A 3F7VC 4UCVA 3RYFA 2FYUH 1IX9A 1SERA 1N32B 2MW2B 1DK1A 3DTUB 5LA6A 1FPOA 4H33A 4TUYB 3ZHUA 2H94A 1R6TA 2EIKB 3JASA 3CCLV 2P4KA 3IAYA 1FJGO 5EC1C 4DUZO 4IIJA 4MT8A 2IJIA 2Q0OC 2BSKA 3WFVA 3FKSG 3AK1A 3ASNC 1PP9H 3T1CA 3JCZA 5B1BC 3J80N 1MABG 1N0JA 2IBZH 4CS4A 1NTZH 1QU7A 2F1MA 4G2KA 3N27A 2BTQB 1ZSPA 2GV9A 5LBQA 3IGAC 2Q7EA 2EIMB 1KB9F 4PDMA 2YEVA 5LMNB 3S3WA 3TGUH 1ZLZA 3ABLB 2ETNA 4H13B 1WPBA 1B04A 4CH4A 1WP8A 1NH2D 2ZXWB 3AG2C 3ZMVA 2PI4A 4QPKA 5KHGA 3P30A 3H01A 2RMKB 2P5OA 2Q7GA 3L73H 4RQFA 2AXTZ 2XNDG 5IYZA 5KUKA 4ZI7B 1NQTA 4B08A 5CMUA 1H2NA 3RW0A 1FFTB 1HR0O 3B8NA 1R6KA 2ODMA 4JYCA 2OT5A 4JI4B 3X2QB 1M5IA 2QGNA 4B7EA 5KX5A 2Q9LA 4CH3A 1JQ0A 2QM8A 2F95B 4O4IB 3N2KA 3PN1A 3JYCA 4IYIA 4U3JB 4DR2B 4QPJA 4I50B 1IXMA 1BS3A 3KZIZ 2WA4A 4MTOA 2Q0AA 2LGQA 5BMVA 3W7WA 1I7FA 2DN9A 3H1KH 2JS5A 4LF8O 5DECA 1KC8W 3PJSK 1FXHA 2VWJA 2JGDA 4R8CA 4I9WA 3QO5A 3UCSC 4KHPB 4W4KA 1X4TA 2F66C 4LFBO 3A8TA 1UPGA 3W7SA 2YIBA
chains in the Genus database with same CATH topology
2L6LA 1XBLA 2EJ7A 2DN9A 1HDJA 2Y4TA 2CUGA 2QWQB 2QWRB 3APOA 1N4CA 2M6YA 2CTPA 4IT5A 2YS8A 4RWUA 1FPOA 2CTRA 1IURA 2GUZB 3UO2A 2QWNB 2DMXA 1BQ0A 1BQZA 4J80A 2PF4E 1FAFA 4J7ZA 2QWOB 1GH6A 2Y4UA 3APQA 2CTWA 3UCSC 2OCHA 2LGWA 2LO1A 2GUZA 2N05A 2QWPB 2KQXA 2CTQA 2N04A 1NZ6A 3BVOA 2YUAA 1WJZA 3AG7A 2QSAA 3UO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6L A;  1XBL A;  2EJ7 A;  2DN9 A;  1HDJ A;  2Y4T A;  2CUG A;  2QWQ B;  2QWR B;  3APO A;  1N4C A;  2M6Y A;  2CTP A;  4IT5 A;  2YS8 A;  4RWU A;  1FPO A;  2CTR A;  1IUR A;  2GUZ B;  3UO2 A;  2QWN B;  2DMX A;  1BQ0 A;  1BQZ A;  4J80 A;  2PF4 E;  1FAF A;  4J7Z A;  2QWO B;  1GH6 A;  2Y4U A;  3APQ A;  2CTW A;  3UCS C;  2OCH A;  2LGW A;  2LO1 A;  2GUZ A;  2N05 A;  2QWP B;  2KQX A;  2CTQ A;  2N04 A;  1NZ6 A;  3BVO A;  2YUA A;  1WJZ A;  3AG7 A;  2QSA A;  3UO3 A; 
#chains in the Genus database with same CATH topology
 1AR5 A;  3ZRW A;  3RYC B;  5L3E A;  3CCJ V;  2QKS A;  4UXN A;  3W7T A;  2EIN C;  2V4D A;  3RGB A;  4TUY A;  1KKD A;  5EK0 A;  1QBZ A;  3WB0 A;  2VWK A;  4RAI A;  1YIJ V;  3BA9 A;  1N0N A;  2HFE C;  1BZK A;  1YJ9 V;  1N8R W;  4N21 A;  2UUB O;  2EZP A;  4H0L B;  3D36 C;  1Q90 D;  2UUC B;  3JAR B;  3AG4 C;  1OCZ B;  5H6R A;  1VQ6 V;  4EFE A;  2E5L B;  1MA1 A;  2Q8V A;  1HNZ B;  1TUB A;  3CD6 V;  1QVF U;  1AI5 A;  2BTQ A;  1CXZ B;  3ZBH A;  1NT2 B;  1SRY A;  2YUA A;  1G8M A;  3DGE A;  1QLN A;  2Z3Y A;  3JAM N;  4CH5 A;  4DV1 B;  4MVZ A;  4K0K O;  3BFR A;  3SR2 C;  4DR5 O;  2GUZ B;  2MK3 A;  3SPC A;  4QGP A;  3MDS A;  4CH6 A;  5C93 A;  4DUZ B;  1N36 B;  4J7J A;  4W4L A;  2VQF O;  2AZ0 A;  5A9G A;  5B1A C;  4PA4 A;  4JAA A;  4IYH A;  1VF7 A;  3K9S A;  1BHB A;  1OCO B;  3BHP A;  4WFH A;  2XAG A;  2YIC A;  4J7K A;  5KLV H;  2GTS A;  1XRE A;  3HKD B;  2W0F C;  3ZN0 A;  3TET A;  1BHA A;  2FB5 A;  5FL7 G;  4GX0 A;  2QM4 A;  2UUA O;  1W59 A;  4QIW F;  4TQF A;  2E75 B;  2EIJ C;  1GMG A;  1XI1 A;  2QKC A;  4O4I A;  5EC2 C;  4FM1 A;  4IL6 Z;  4O2B B;  3ZN1 A;  4DRX B;  3C3S A;  4U3J A;  1HP8 A;  4I50 A;  4X66 O;  3ABT A;  1SA0 B;  2HG5 C;  4L87 A;  3BCC H;  2P90 A;  1OCO C;  1JVM A;  1O9H A;  1FYJ A;  4DV6 O;  4AI8 A;  3OW2 U;  3CEI A;  4UV8 A;  3K0D A;  1YF2 A;  4EKW A;  1XMO B;  4O2A B;  1HR0 B;  2VRZ A;  5IJ0 B;  3AG3 C;  2WLJ A;  1QQC A;  1SQF A;  5HFL A;  1NVP B;  4UCS A;  1GO3 F;  1Y66 A;  2RJZ A;  4PJ0 Z;  2OCC C;  1FFX A;  3ABM B;  1V55 C;  3RYC A;  4YJ2 B;  2IJH A;  2EX3 A;  3RVZ A;  2Y48 A;  1YVW A;  1PM9 A;  2F4V O;  4X9Q A;  2YIA A;  3EFF K;  1Z5V A;  1PPJ H;  4LBE C;  4LF8 B;  4FM0 A;  3U0Z A;  4FLZ A;  3UO2 A;  2EZO A;  5L3C A;  3MAQ A;  4F6R B;  4U7O A;  1N34 O;  3K5O A;  4LF4 O;  3JAR A;  1WA8 B;  1EN5 A;  4DR1 O;  1IVS A;  1JJO A;  5LYJ A;  3VQV A;  1M57 B;  3ABM C;  1PL4 A;  2DE0 X;  1JJ2 U;  1CPY A;  3FYI B;  4LF5 O;  2HVJ C;  2QTO A;  3FB5 C;  3RFR A;  1GH6 A;  4I9Q A;  2CDY A;  3NR7 A;  3VQY A;  3HKC B;  2GHY A;  1SQV H;  1HW7 A;  1CP9 A;  1EBO A;  1OCC B;  1KBH A;  3L72 H;  2LQT A;  3CRM A;  4AIL C;  4FLW A;  2UUB B;  2LFR A;  2Q73 A;  3ASO C;  4JZG A;  2YS8 A;  2JRI A;  5H2F Z;  4ZBM A;  3U10 A;  3I5D A;  2W0X A;  2B5U A;  1JX9 A;  5IY5 C;  4WFF A;  3JD4 A;  2XT9 A;  3ML0 A;  1WAZ A;  4DR3 O;  1Y6X A;  3SPH A;  2X6A A;  3OE7 G;  3HKD A;  2EIL B;  4KFM A;  4I55 B;  3SYA A;  4ZKI A;  5HFM A;  5L3G A;  5KMG B;  1Y76 B;  1OCC C;  3CP1 A;  1VQ4 V;  1KU9 A;  4DR5 B;  2JVD A;  4PDV A;  3EVK A;  3HB3 B;  3FX7 A;  2ITD C;  2A79 B;  1Q82 W;  4HZ3 A;  4O2B A;  3RT3 C;  4DRX A;  4ASU G;  1AR1 B;  1ZL8 B;  4J11 A;  4PA6 A;  2VQF B;  3AG1 C;  4UFZ A;  1SA0 A;  2ZQM A;  1NZ6 A;  3O9O A;  1XDC A;  3VBB A;  2ZR3 A;  1XNR O;  4GCZ A;  3AG7 A;  4OPH A;  2FML A;  1K8A W;  1GN3 A;  5IT9 N;  1G4Y B;  1K5S A;  2Y4T A;  1N4C A;  4IT5 A;  4DV4 B;  1BE3 H;  4P30 A;  2WLM A;  4AHC A;  5AG2 A;  3RYF B;  4O2A A;  4J10 A;  1VQO V;  1TVK B;  2XAS A;  5IJ0 A;  2UUA B;  1H2S B;  1VQN V;  4GUN A;  1OCR B;  1NVP D;  1RPO A;  2HJD A;  5K1X A;  4JAV A;  4WF9 V;  4J9Z B;  3D3I A;  3STZ C;  4YHH O;  1QVG U;  2UXB O;  2CK3 G;  4GKJ B;  4X66 B;  2AHY A;  5L3D A;  3B09 A;  4OPA A;  3T4Z A;  1H8H G;  3JAW B;  5C8Y A;  5KA5 A;  3RYI B;  4DV6 B;  5DED A;  3BPZ A;  4LNU B;  2AZ2 A;  1TGO A;  1D5N A;  4GZR B;  2UU9 B;  3L70 H;  3KCY A;  4JI2 O;  3THO A;  4DW0 A;  1CEZ A;  1SS3 A;  4BIU A;  4QE9 A;  1OCR C;  4F4L A;  2GDS A;  3CRA A;  2OIE A;  1NKD A;  1GN2 A;  2PI5 A;  1WA8 A;  4NB5 A;  1JOY A;  1GRJ A;  4PHZ A;  3UQ8 A;  3K5L A;  3K03 A;  5IE9 A;  3SYQ A;  1YJN V;  5IJ9 B;  1GM9 A;  4RQE A;  4DR2 O;  2D2C B;  3UM7 A;  1BL8 A;  3JD1 A;  2WLL B;  4MVU A;  5IYD O;  3STL C;  2HEP A;  5CBH A;  4PA7 A;  4NYK A;  4UB6 Z;  1FXV A;  2IU3 A;  1LUW A;  3CJH B;  1N34 B;  1H2G A;  3K08 A;  3T1Y O;  2YID A;  4KHP O;  4DR1 B;  1PD3 A;  1K33 A;  1NR7 A;  1KKC A;  3JAK B;  4JI1 O;  4LCU C;  1P4R A;  3R66 A;  5KAF Z;  3M7M X;  2P67 A;  1P49 A;  1S72 V;  4JYY A;  4RWU A;  2P7T C;  2UXC O;  3L74 H;  1VQ5 V;  3N2G B;  1M4U A;  1M56 C;  4I55 A;  3WB2 A;  2RCV A;  2GBO A;  1GAX A;  1Y76 A;  2PTM A;  3OUS A;  3JD0 A;  3F5T A;  2B9Z A;  2BCC H;  3E8H A;  5DN6 G;  4DV2 O;  1GK9 A;  1K4C C;  5H5N A;  2DYS B;  1DTO A;  4MVR A;  3E22 A;  4WFE A;  4NXN O;  1KD1 W;  4B3S B;  4GLX A;  2IW5 A;  4J80 A;  4X89 A;  2YSU B;  4BIZ A;  2Q4P A;  1D2D A;  4I7Z B;  2HHH B;  3CC2 V;  4DXW A;  4JI6 O;  4DV7 O;  4D6T H;  5B1B B;  1M1K W;  4DR3 B;  1HNZ O;  2G38 A;  3OM3 B;  2LFS A;  4MTX A;  1R3J C;  2A0L A;  1OJH A;  3B4S A;  4FZ1 A;  3WG7 C;  1TVK A;  1U97 A;  4FK5 C;  3OUF A;  2ZIN A;  2YXH A;  4DV1 O;  4DK0 A;  2DYS C;  2JJ1 G;  1U96 A;  3DXR A;  4JTC B;  4UV9 A;  1F4M A;  4BWA A;  1BT8 A;  1DLB A;  4CS3 A;  4BW5 A;  1N36 O;  2QWP B;  3LSS A;  3AG2 B;  1XNR B;  3JAW A;  3U11 A;  4X1Y A;  3RYI A;  4D7T A;  1WN7 A;  2ZIM A;  4O4L A;  3B77 A;  4LNU A;  1QNM A;  1X59 A;  2RDC A;  1TUB B;  3AK2 A;  4E2L A;  2E76 B;  2PY5 A;  2KB1 A;  2ZE7 A;  4OXS A;  3LSU A;  2ZNI A;  2LGW A;  3UKM A;  1XHZ A;  4MVQ A;  3DSQ A;  1ARO P;  3Q4H B;  3J7A U;  4YHH B;  5IJ9 A;  3ZCC A;  2UXB B;  3EHB B;  1SET A;  3CRR A;  4JI0 O;  4DO2 A;  5LL6 Y;  4U7N A;  1TUE B;  1XHX A;  3E8F A;  2D3O W;  1JMK C;  1RM1 C;  2CGN A;  5BXZ A;  2JGU A;  2N74 A;  1FAF A;  1R1B A;  3GWK C;  2WLL A;  3OD4 A;  4N23 A;  3G6E V;  4IGG A;  4KP4 A;  3T4D A;  1AP6 A;  5BR8 O;  1NTM H;  4JI2 B;  1E1R G;  3CJH A;  3OMN B;  1XMO O;  2WLN A;  4R6Z A;  1FKA O;  3JAK A;  1IUR A;  2W6I G;  1FXK B;  5ITZ A;  2H3O A;  1G1X B;  3CXH F;  2WSS G;  4ZIB A;  3N2G A;  4DR7 O;  3DC6 A;  4NXM O;  3G4S V;  1IDS A;  1SQB H;  2PGG A;  1FD9 A;  4JYB A;  2PYL A;  2EIN B;  3TXS A;  1AVM A;  3JAT A;  5EBL C;  4BW9 A;  2X6B A;  3T1Y B;  5KHH A;  2ILM A;  1FXK C;  1AJP A;  2HLD G;  2V1D A;  4JI1 B;  1R3L C;  4K35 A;  2XAJ A;  1QLE C;  5EBM C;  1BGY H;  1K97 A;  1US6 A;  2P06 A;  2YIB D;  3A2F A;  2K1E A;  4FZ0 A;  1YZB A;  2QJ1 A;  2VS0 A;  3HPL C;  3AG4 B;  2UXC B;  4UCU A;  4X1I B;  3SDL A;  2AGA A;  1FFX B;  3ZHV A;  4YIP A;  4NKG B;  2LJ2 A;  2EJR A;  1W0J G;  1BQ0 A;  1AI4 A;  1BQZ A;  5BY1 A;  2A06 H;  1S5L Z;  1VEW A;  5D5P A;  1K3E A;  2WAM A;  5FPR A;  1Y74 B;  4X20 A;  4DV2 B;  2IJK A;  3ETD A;  4AQY O;  2R70 A;  4NXN B;  2CUG A;  3APO A;  1XMQ O;  4LF7 O;  3WB1 A;  3CWB H;  2QM7 A;  1EM1 A;  2X6C A;  4JI6 B;  5KHI A;  3E86 A;  3L75 H;  5LYJ B;  4DV7 B;  2ZIO A;  2WLK A;  5B1A B;  2NLJ C;  4B3T O;  4PI2 A;  2KQX A;  2IU0 A;  3UT5 B;  3E8B A;  3G6B A;  3LDD A;  1GTO A;  2XAQ A;  1YHQ V;  4MVS A;  3LSQ A;  1ENV A;  4ZHQ B;  1V54 C;  1EN4 A;  3CE2 A;  1Y67 A;  2Z0A A;  3Q4H A;  2KG7 B;  4NVP A;  4NR1 A;  1MSD A;  1S3J A;  2QWO B;  4ICG A;  1VMG A;  4JI3 O;  2EIJ B;  2IM9 A;  2F23 A;  1OV9 A;  2UXX A;  2N05 A;  1GKF A;  1PNM A;  2LP7 A;  3ZHS A;  4K3A A;  3LUT B;  3QF7 A;  1DF5 A;  1XBL A;  2JS3 A;  1AIL A;  1SQP H;  5KHK A;  2JEU A;  1I5Y A;  2VQE O;  4DV4 O;  3FB8 C;  1NR1 A;  4ABM A;  3L71 H;  3ZX6 A;  5H9C A;  3QNE A;  4QNH B;  3K06 A;  1VQ8 V;  5LP6 C;  2Q69 A;  3BRC A;  1XL6 A;  1FXK A;  3AG3 B;  3HKE B;  1PNK A;  4C7U A;  3CSX A;  4JI0 B;  4HYO A;  1K34 A;  3JD3 A;  5JVD B;  3T2M A;  4GKJ O;  5JJE B;  1YXB A;  1F51 A;  2OCC B;  2PF4 E;  2ZE5 A;  1V55 B;  1N33 B;  3OEE G;  1H2L A;  1DF4 A;  5LHH A;  4YJ3 B;  5BR8 B;  2P6J A;  4UCO A;  4B3R O;  4UCT A;  2X7R B;  2PZS A;  2UU9 O;  5FPO A;  4CZZ A;  1D5A A;  4LF6 O;  1HNW O;  3ZHR A;  1YI2 V;  2RN9 A;  4DYL A;  3R65 A;  5GON B;  1KUQ A;  3D36 A;  3CRC A;  1YEW A;  3QO7 A;  1VIB A;  4FFK A;  4X1I A;  1K7D A;  3SJQ C;  4DR7 B;  4XDK A;  5LMU O;  3P32 A;  4WBN A;  4ZOL B;  2A7W A;  4NXM B;  1K9M W;  2QA4 V;  5JQG A;  4FLX A;  3E8G A;  5C8Y B;  3ZIA G;  1Y74 A;  1Q43 A;  1YSC A;  1SZT A;  4XDJ A;  5A2Q N;  3OTF A;  3BEH A;  1VQ7 V;  5CA3 A;  4PDR A;  5JJN B;  2WLH A;  1Z5W A;  3KKY A;  1AB3 A;  3ASO B;  1YCI A;  4R7C A;  2H8P C;  1UFI A;  4GX2 A;  4MVM A;  4RUF A;  3UT5 A;  5IYB O;  1LUV A;  5IY5 B;  3ICX A;  5KHJ A;  2ZDI C;  2UXN A;  3IC9 A;  2ZE8 A;  5L3B A;  5JH7 B;  5E79 Z;  1YJW V;  3MD0 A;  4E4E A;  1K5Q A;  4ZHQ A;  2JDI G;  2KG7 A;  5LGN A;  3ETQ A;  2JK5 C;  4J41 A;  3AK3 A;  2YDE A;  1W2B U;  1HWY A;  4AQY B;  2EBO A;  1XMQ B;  4Q6G A;  1HDJ A;  4LF7 B;  2DYR C;  2ARH A;  4B3S O;  2CGO A;  1NI8 A;  2XHB A;  3E2E A;  3AG1 B;  3L9D A;  3BAA A;  2RNB A;  4B3T B;  2ZKO A;  5FNV B;  1F23 A;  3RYH B;  2HHH O;  2GTA A;  1QR8 A;  3OR6 C;  1SQQ H;  3DC5 A;  2JJ2 G;  4UVB A;  5JWP A;  4KUM A;  1T5E A;  3HKE A;  4JAS A;  4JTD B;  1EN6 A;  3IJ4 A;  1XNQ O;  4JI3 B;  4LFA O;  1GM8 A;  5JVD A;  2AHZ A;  1I94 O;  2OCH A;  5B3S C;  1NJI W;  3E22 B;  5IDJ A;  1VQP V;  1BMF G;  3C90 A;  1VF6 C;  4FJC C;  1Y4M A;  4YJ3 A;  4PI0 A;  2VQE B;  4KXR A;  1PV0 A;  1ZWI C;  4MW3 A;  1RP3 B;  2M7W A;  3QG5 A;  4J9Y B;  2FKX A;  1L8D A;  1PL0 A;  1ZX3 A;  1OZ0 A;  3BAB A;  5GON A;  1KYO F;  5IWA O;  4X1K B;  2Q68 A;  3DXR B;  3FYE B;  5LXT B;  4DK1 A;  2PUS A;  1AJN A;  3E35 A;  4ZOL A;  2YXL A;  2ZM6 O;  4UB8 Z;  4B7K A;  2OTJ V;  3K04 A;  4UVC A;  2ZDI A;  4X1Y B;  1K73 W;  4CC6 A;  4Z2W A;  1SQG A;  4O4L B;  1L0N H;  3LNM B;  3LDE A;  2WPD G;  2HP8 A;  4B3R B;  4OX9 O;  5J2T B;  3CCU V;  4LF6 B;  1HNW B;  2E74 B;  2X0L A;  3H1I H;  4FIP C;  3VQX A;  3A0B Z;  3ZHT A;  3SYP A;  1IBM B;  4XBF A;  4FLT A;  5LHG A;  1ZAU A;  4GYC B;  4JTA B;  5LMU B;  4X65 O;  1GN6 A;  3C3T A;  5JH7 A;  4GX5 A;  1RFY A;  2OWO A;  1M56 B;  3KG2 A;  3OGI B;  3MHS C;  3AEI A;  1XQ8 A;  1IXB A;  4QE7 A;  4XDL A;  4EFB A;  1NH2 B;  5CBF A;  3JCU Z;  3K79 A;  3CB2 A;  2BOC C;  3SPI A;  5FNV A;  4HNA A;  3RYH A;  3OFN G;  3ZRV A;  4EEQ A;  5ITZ B;  2EJ7 A;  5KUM A;  1SKV A;  1VF6 A;  5EZY A;  1TA8 A;  2CH7 B;  1JA8 A;  1VF5 B;  1Q6U A;  2EUL A;  1VQ9 V;  5GTH Z;  3RN4 A;  2LO1 A;  3WG7 B;  1LR1 A;  1ZTE A;  4NTW A;  5B66 Z;  5BZB A;  3BY6 A;  1VQK V;  1I0H A;  4TWK A;  3W7U A;  4UCR A;  3FFQ A;  3JAT B;  4X88 A;  3HKB B;  1SQX H;  1BSM A;  2IJJ A;  4G27 B;  2DMX A;  4LWS B;  4LC1 A;  5LGT A;  1SZX A;  3H9V A;  3ZRS A;  5GW7 A;  1TAE A;  4DV5 O;  2QWQ B;  3K58 A;  2ITC C;  5CBG A;  3CCM V;  4X1K A;  4X20 B;  1XNQ B;  2DQ3 A;  4LFA B;  1Q5O A;  4J7Z A;  5LXT A;  4X8A A;  4DR4 B;  1I94 B;  4KL1 A;  3IFX A;  1AI6 A;  1XIL A;  4DW1 A;  1MG1 A;  1NS1 A;  3ETG A;  2ZNJ A;  5IYC O;  1RM1 B;  1L1F A;  1MMM A;  3A0H Z;  2R9R B;  5J2T A;  4DR6 O;  1E1Q G;  2FTK A;  2B1G A;  1EFR G;  3M8A A;  5EIB C;  1S5H C;  4UUJ C;  3RBZ A;  4JYA O;  4JI5 O;  3K59 A;  3GB7 C;  4PV1 B;  5CA1 B;  2FL4 A;  2KSD A;  5IWA B;  2Y69 B;  4O4J A;  3JSL A;  3SJB C;  3ZS8 C;  3MHH C;  2YI8 A;  3TCU A;  1AJQ A;  1GN4 A;  3OEH G;  2ZM6 B;  1M90 W;  5JJJ B;  3CC4 V;  3OT7 A;  4DUY O;  5B1N A;  1M93 A;  3FB6 C;  3D8C A;  3WU2 Z;  1JR9 A;  3K3W A;  3TK1 A;  5LOV A;  1N33 O;  4FLY A;  4MTG A;  1E79 G;  2EIK C;  3J81 N;  1NBM G;  4OX9 B;  1JPX A;  1WB8 A;  2QDO A;  5GTI Z;  3CPW U;  3ETE A;  2PYJ A;  2L6L A;  4FVM A;  2Y69 C;  4GKK O;  2XAF A;  4P9O A;  5D5Q A;  2ZD9 A;  3KCX A;  3H1H H;  4JV5 O;  4JZ2 A;  4K8Z A;  4NTY A;  4FMT A;  4DV3 O;  2HJF C;  3ZMT A;  4X65 B;  2CH7 A;  1QLE B;  2EIM C;  2ADQ B;  4PD4 F;  4WFA V;  1KP3 A;  3ABL C;  3ZHQ A;  2QTS A;  1UJW B;  4I5S A;  3F5W C;  5CN0 A;  2ZXW C;  3CME V;  4IHJ A;  2BE3 A;  1A32 A;  3OAA G;  4MW8 A;  3HKB A;  3CCS V;  2DQ0 A;  2WLI A;  2IH1 C;  4LWS A;  3A0R A;  2ATK C;  2Y0P A;  3CXC U;  3E89 A;  3G80 A;  3E83 A;  3GVM A;  4YY3 O;  3QVN A;  2M6Y A;  1RSO B;  1EZJ A;  4BR6 A;  4WBN B;  3X2Q C;  5EIB D;  1XL4 A;  4Q20 A;  5JQG B;  3SJC C;  1KQS U;  4I4T B;  3K0G A;  5CB4 A;  3W7X A;  1VP7 A;  1DGS A;  5LGU A;  1GM7 A;  2HKO A;  1XOU A;  1V54 B;  3H1J H;  2ADP A;  1VQM V;  2LW1 A;  3TJT A;  4DV0 B;  2OYQ A;  1I5X A;  1IBL O;  3I56 V;  3FD9 A;  3BA8 A;  3I55 V;  1HNX O;  1AI7 A;  1Q7Y W;  4YXW G;  4QJF B;  2B1I A;  5F2V O;  2GSM B;  3P3N A;  2K9P A;  1PKX A;  2Q7H A;  3BVO A;  3O65 A;  3LDC A;  1WJZ A;  1Q86 W;  3UO3 A;  4DV5 B;  2WWW A;  5CA1 A;  5LP6 B;  5CA0 B;  2QWN B;  5L3F A;  3H1L H;  1S5J A;  3ZMS A;  4X64 O;  2ZCE A;  2E3C A;  1URF A;  4HBN A;  4BIO A;  1R3I C;  4Z1V A;  4LFC O;  5J2U B;  1Z2G A;  4F6E A;  3SYO A;  1K4D C;  1AP5 A;  4DR6 B;  4L8J A;  1WP7 A;  2AW9 A;  3T1H O;  1FJG B;  4JYA B;  3M99 B;  1Q6H A;  4JI5 B;  1IBK O;  3JAL B;  1YTF B;  4WFG A;  2CE4 A;  1OCZ C;  1IZ3 A;  4WCE V;  1NU1 H;  4G28 B;  5EBW C;  4HAM A;  2O57 A;  2QWR B;  2KKW A;  4TV9 B;  4ZI7 A;  1SC5 B;  2NNU A;  3OGC C;  4DUY B;  2CTW A;  3SPG A;  4K8X A;  1B3Q A;  1P7G A;  1ORQ C;  3OTO O;  4LH6 A;  1R73 A;  1Q3E A;  1R3K C;  4FFB B;  1I08 A;  4GKK B;  3CX5 F;  1QCE A;  5H6Q A;  4JV5 B;  2OIG A;  1THZ A;  1LNQ A;  2YI9 A;  3APQ A;  2ZE6 A;  4DV3 B;  1IBM O;  2A9H A;  1Q8I A;  3K57 A;  1RSO A;  2QR4 A;  4TT3 G;  4GT1 A;  4A5U B;  2W6J G;  1P84 F;  4CBC A;  2BOB C;  4PA9 A;  5KAI Z;  2DW4 A;  4TSF G;  2QE7 G;  4JGS A;  4JPR A;  3SYC A;  2NN4 A;  2QEX V;  4I4T A;  4PEL A;  3RVY A;  2L35 A;  3JSN A;  3K5M A;  2A3Q A;  4X62 O;  4BAY A;  4O4H B;  3ZED A;  3LNN A;  3B40 A;  2DWD C;  3ZMZ A;  2RQ6 A;  1F7Y A;  1MSW D;  3CCE V;  3P3P A;  1M9N A;  1B06 A;  3FAV B;  5J9P C;  1P7B A;  1SF9 A;  2DYR B;  1Q81 W;  2QSA A;  3ZJZ A;  4MS2 A;  4TOI A;  3CRQ A;  4YY3 B;  4B3M O;  2YXY A;  4H44 B;  1JFF B;  1BCC H;  4FPP A;  1S0V A;  1KMI Z;  3SJA C;  4Z1M G;  2R72 A;  5LP6 A;  4LFB B;  2CTQ A;  5CA0 A;  4TV8 B;  2DJV A;  1L0L H;  5EYP B;  5TIS Z;  3CHX A;  3VQW A;  2QKA A;  1IBL B;  2UXD O;  4FM2 A;  2HVK C;  1O9G A;  1HNX B;  5J2U A;  3G71 V;  4RO2 A;  5B3S B;  1F4N A;  1WLE A;  3NXS A;  5B1O A;  5FLX N;  4TQD A;  4HNA B;  4JI8 O;  2GUZ A;  2XTA A;  3ZRX A;  4PDL A;  2Z5U A;  4JI7 O;  5EZY B;  4EB6 B;  1RPR A;  1MOF A;  1J5E O;  1YTF D;  3JAL A;  2F93 B;  4I0X B;  2YC0 A;  3FB7 C;  1M57 C;  1Q6I A;  2Y0I A;  4LF9 O;  2XOK G;  4MVO A;  2NR5 A;  3S3X A;  4D7S A;  2Y4U A;  2XUM A;  2ZR2 A;  3CS5 A;  3CC7 V;  4TV9 A;  4X64 B;  4DR4 O;  3QTC A;  1H2M A;  4LFC B;  1VQL V;  5B5E Z;  1ROP A;  1XUQ A;  1G6U A;  4K0K B;  1N32 O;  2CAZ C;  1WB7 A;  1W0K G;  3CCQ V;  4FLV A;  3D3Q A;  1V9P A;  1PNL A;  4MTF A;  4FFB A;  3T1H B;  2WA3 A;  4LP8 A;  1IBK B;  4P2Z A;  3ABK B;  3CCR V;  2P4V A;  2ZT9 B;  4MSW C;  1OHH G;  2EIL C;  4FLU A;  4R50 A;  4CS2 A;  3OMI B;  1R6N A;  4U3F H;  2LW7 A;  2P22 C;  5E1A C;  1MZE A;  2HR3 A;  3EXA A;  2Q6A A;  4O4H A;  5LMN O;  3OTO B;  4YIO A;  5LA6 B;  3K9A A;  5DM6 V;  1MZF A;  2IH3 C;  4OGQ B;  3ABK C;  1XEQ A;  4RUE A;  3B8M A;  3JAS B;  5JCO C;  1QHT A;  4YJ2 A;  4IIJ B;  3FAV A;  1SES A;  2DWE C;  3SPJ A;  2BSK B;  4WFB V;  4O4J B;  2DOS A;  1K92 A;  1WNS A;  1JFF A;  2BTO A;  3B2E E;  1JCH A;  4F6R A;  3OMA B;  1H8E G;  2R9A A;  2YEV B;  4UVA A;  4X62 B;  5LOV B;  4JI4 O;  4TV8 A;  1KEC A;  1COW G;  1J95 A;  2CTR A;  4P9P A;  3CMA V;  3ABU A;  1ZUQ A;  1FS0 G;  5EYP A;  1YIT V;  2JIZ G;  2F4V B;  3RWR D;  2Q67 A;  3HKC A;  4B3M B;  3QO8 A;  1YDX A;  4PA3 A;  4EB6 A;  5IYZ B;  3K5N A;  1NTK H;  2R9I A;  4CC5 A;  4I0X A;  4JF3 A;  4LF4 B;  1S77 D;  4LH7 A;  5KX5 B;  2JEX A;  4GX1 A;  4IHJ B;  2OTL V;  1VAR A;  3HR0 A;  3OR7 C;  1MNG A;  4LF5 B;  2UXD B;  3N2K B;  3F7Y C;  1WPX A;  2CTP A;  4DV0 O;  3JD2 A;  3SGI A;  2WLI B;  2Q5Z A;  5KMG A;  1AR4 A;  5BMV B;  5K1P A;  1H2K A;  2XAH A;  4JI8 B;  1B6Q A;  5KA6 A;  1S76 D;  2C2A A;  4JI7 B;  2N04 A;  3ZMU A;  3IC7 A;  1J5E B;  3CCV V;  1ZL8 A;  2JGD B;  3GWO A;  4NTX A;  4JAU A;  3VOU A;  5LHI A;  4LR3 A;  4LF9 B;  2V7Q G;  5JCO A;  3TXQ A;  2UUC O;  5CB4 B;  1KP2 A;  3G67 A;  3ASN B;  4H37 A;  1H38 A;  3CYO A;  1QR9 A;  2E5L O;  2F43 G;  3ZRW B;  1EZV H;  4J42 A;  3F7V C;  4UCV A;  3RYF A;  2FYU H;  1IX9 A;  1SER A;  1N32 B;  2MW2 B;  1DK1 A;  3DTU B;  5LA6 A;  1FPO A;  4H33 A;  4TUY B;  3ZHU A;  2H94 A;  1R6T A;  2EIK B;  3JAS A;  3CCL V;  2P4K A;  3IAY A;  1FJG O;  5EC1 C;  4DUZ O;  4IIJ A;  4MT8 A;  2IJI A;  2Q0O C;  2BSK A;  3WFV A;  3FKS G;  3AK1 A;  3ASN C;  1PP9 H;  3T1C A;  3JCZ A;  5B1B C;  3J80 N;  1MAB G;  1N0J A;  2IBZ H;  4CS4 A;  1NTZ H;  1QU7 A;  2F1M A;  4G2K A;  3N27 A;  2BTQ B;  1ZSP A;  2GV9 A;  5LBQ A;  3IGA C;  2Q7E A;  2EIM B;  1KB9 F;  4PDM A;  2YEV A;  5LMN B;  3S3W A;  3TGU H;  1ZLZ A;  3ABL B;  2ETN A;  4H13 B;  1WPB A;  1B04 A;  4CH4 A;  1WP8 A;  1NH2 D;  2ZXW B;  3AG2 C;  3ZMV A;  2PI4 A;  4QPK A;  5KHG A;  3P30 A;  3H01 A;  2RMK B;  2P5O A;  2Q7G A;  3L73 H;  4RQF A;  2AXT Z;  2XND G;  5IYZ A;  5KUK A;  4ZI7 B;  1NQT A;  4B08 A;  5CMU A;  1H2N A;  3RW0 A;  1FFT B;  1HR0 O;  3B8N A;  1R6K A;  2ODM A;  4JYC A;  2OT5 A;  4JI4 B;  3X2Q B;  1M5I A;  2QGN A;  4B7E A;  5KX5 A;  2Q9L A;  4CH3 A;  1JQ0 A;  2QM8 A;  2F95 B;  4O4I B;  3N2K A;  3PN1 A;  3JYC A;  4IYI A;  4U3J B;  4DR2 B;  4QPJ A;  4I50 B;  1IXM A;  1BS3 A;  3KZI Z;  2WA4 A;  4MTO A;  2Q0A A;  2LGQ A;  5BMV A;  3W7W A;  1I7F A;  2DN9 A;  3H1K H;  2JS5 A;  4LF8 O;  5DEC A;  1KC8 W;  3PJS K;  1FXH A;  2VWJ A;  2JGD A;  4R8C A;  4I9W A;  3QO5 A;  3UCS C;  4KHP B;  4W4K A;  1X4T A;  2F66 C;  4LFB O;  3A8T A;  1UPG A;  3W7S A;  2YIB A; 
#chains in the Genus database with same CATH homology
 2L6L A;  1XBL A;  2EJ7 A;  2DN9 A;  1HDJ A;  2Y4T A;  2CUG A;  2QWQ B;  2QWR B;  3APO A;  1N4C A;  2M6Y A;  2CTP A;  4IT5 A;  2YS8 A;  4RWU A;  1FPO A;  2CTR A;  1IUR A;  2GUZ B;  3UO2 A;  2QWN B;  2DMX A;  1BQ0 A;  1BQZ A;  4J80 A;  2PF4 E;  1FAF A;  4J7Z A;  2QWO B;  1GH6 A;  2Y4U A;  3APQ A;  2CTW A;  3UCS C;  2OCH A;  2LGW A;  2LO1 A;  2GUZ A;  2N05 A;  2QWP B;  2KQX A;  2CTQ A;  2N04 A;  1NZ6 A;  3BVO A;  2YUA A;  1WJZ A;  3AG7 A;  2QSA A;  3UO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...