3KZIZ

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
b'MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
molecule tags Electron transport
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
total genus 22
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3kziZ00
5B5EZ 5KAFZ 5B66Z 3JCUZ 4UB6Z 3A0BZ 5GTHZ 5TISZ 1S5LZ 5H2FZ 4UB8Z 3A0HZ 4PJ0Z 5E79Z 3WU2Z 3KZIZ 4IL6Z 5GTIZ 5KAIZ 2AXTZ
chains in the Genus database with same CATH superfamily
3ZEDA 1K97A 4TSFG 5K1PA 1FJGO 4DUZB 4QJFB 3RYCA 1US6A 5JQGA 1RSOB 3CRRA 3F5TA 5KAIZ 1XHZA 2ILMA 4Q6GA 2JVDA 2NLJC 2DYRC 5IY5B 2PYLA 1IBKB 1GN3A 4TQFA 2ZNIA 1Q90D 1OHHG 3E22B 5LBQA 2AGAA 4JI8B 1XL4A 2KQXA 1Y76A 2EJ7A 3PJSK 4DK1A 4DW0A 3LDEA 4NTWA 1HR0B 1A32A 4XDJA 1JA8A 3M7MX 2V4DA 4DV6B 4LFBB 1W59A 5EYPA 4I0XA 4AILC 1F23A 4O2BA 3JAMN 4MTGA 2JGDB 1XREA 2Y69C 1Y76B 4LFAB 4I9WA 4DV6O 2CUGA 4DV0B 3IJ4A 5JH7A 1KYOF 4JI4B 1M57B 1U97A 5HFLA 1GM7A 4YJ2A 1M4UA 2UXCO 1M1KW 3RW0A 1NTZH 4PA3A 4F6EA 1XMQO 3CXHF 4OGQB 1J5EB 1HDJA 3ZRWA 2E5LO 2KG7A 2ITCC 4UCSA 2XNDG 2OYQA 1S72V 1QCEA 3R65A 3DXRB 3VQWA 3K5LA 1Y66A 3SYCA 2UUBB 2IU0A 4J9YB 2CTWA 4X65B 1ZUQA 5H6RA 3U10A 4EB6B 3UT5B 4K3AA 1WJZA 1TVKA 5J9PC 4GZRB 1Y6XA 5JVDB 5B5EZ 2VQFB 1H2SB 4QE7A 3OTOO 1VQPV 5EBMC 1MA1A 1ZTEA 1I94B 3HKDA 4I7ZB 3ABLC 3D36C 1XOUA 2QKAA 2ZE7A 2CTQA 1JJOA 3T1YB 4WFFA 1F7YA 4MW8A 5IE9A 1N33B 3QNEA 4LF9B 1YHQV 1BSMA 2AHYA 4GKKB 3BFRA 3GWKC 1L1FA 4BAYA 4E2LA 2YSUB 3P30A 1GM8A 2EINB 3MD0A 1PV0A 4IYIA 5F2VO 1S5HC 4O4IA 1H8HG 1VQOV 1GM9A 1KUQA 1XL6A 2P5OA 4JI7O 3D36A 2W0FC 2K9PA 3K06A 2N74A 5LXTA 3HKEB 2OTLV 1FFXA 3ETQA 4TV8A 4DRXB 3TGUH 4LWSB 1K5QA 1PNKA 1LNQA 4UB8Z 3LNMB 2ZM6O 3LSSA 1CP9A 2GV9A 4QPJA 2DOSA 3RT3C 2VQFO 5CMUA 3OTOB 4CH4A 1SKVA 5LMUO 3JAKB 1NQTA 2QWQB 2QDOA 2DQ0A 2F1MA 4WF9V 1JR9A 3QTCA 3T2MA 1OV9A 5L3FA 1QR9A 3IC9A 1RP3B 1BHAA 1XHXA 5LP6A 2YI8A 4DV2O 1V54C 3STLC 5LHHA 3O9OA 2X0LA 2Q4PA 2YXHA 1S5JA 2IJIA 3DTUB 4GX1A 1YSCA 2P6JA 4X20B 3HKBB 5CBGA 4TOIA 1RM1B 3L70H 4DV2B 2W0XA 5CN0A 4GKJB 3CRMA 1N0JA 4LF8O 2JIZG 4DR6O 1B3QA 1ENVA 3UT5A 2UUAB 3QF7A 2A79B 2LO1A 4FZ0A 3CMAV 3RVZA 1KB9F 4O4IB 4JYBA 3E8FA 1HW7A 3BHPA 4FFKA 1SESA 4EFEA 1YJ9V 3RN4A 1E79G 3TK1A 5GONA 3A0BZ 4F6RA 3UKMA 1PKXA 5LGNA 2VQEB 3APQA 1QHTA 2ZE5A 5LYJA 1YTFD 2EX3A 2OCCB 2UXDO 1KQSU 3MHHC 3ZRSA 2ZNJA 4H13B 2PTMA 2IJKA 4FLYA 1NTKH 2Q73A 2X6BA 5BXZA 2GUZA 1Y74A 3AG4C 4JI1B 4FLWA 5LOVA 1P84F 2NN4A 1XILA 2QTSA 3ZHQA 2IM9A 4NKGB 1XUQA 3OMIB 2OCCC 4J80A 1H2MA 4CBCA 1MNGA 4PV1B 3SYOA 1JFFA 1WAZA 3CD6V 4TV9B 5CA0B 2NNUA 2Y0PA 3G71V 4JI6B 3FAVB 4RQEA 4UVBA 4ZBMA 2Q0AA 4JV5B 3OEEG 2LW1A 3F7YC 4IYHA 2W6IG 4XDLA 4I9QA 1LUWA 1W0JG 4DV3O 4JI0B 2G38A 1Q8IA 3RWRD 3M99B 2FYUH 1HWYA 5BR8O 4DUYO 4RAIA 2Q6AA 2WPDG 2EBOA 2ZXWC 2ITDC 4BIOA 1TA8A 5DN6G 3MHSC 3N2KA 4DR3O 3OMAB 1NH2B 3OE7G 4DUYB 3H9VA 5LOVB 1QVGU 5DEDA 1BQ0A 1GO3F 2BTQA 3WFVA 3HPLC 4GT1A 5A9GA 1FXKB 1OCRC 3RYCB 1H2KA 4DO2A 4KXRA 4WFHA 1VQKV 3AG7A 4JI3O 4YIPA 5B1BB 3WB1A 1JFFB 3L71H 3FB8C 1NTMH 5EBLC 2CH7B 1EN4A 3BCCH 4DK0A 3KZIZ 2PGGA 2D3OW 1GN6A 4LF6B 2Y4TA 1K3EA 2V1DA 4UCUA 4O2BB 4JI1O 1L0LH 4I50B 1JJ2U 1OCCB 2OIEA 5KUMA 1ROPA 5KX5A 3RBZA 3AG3B 4CC6A 2Q5ZA 5KA6A 2R70A 3U11A 3LDCA 5L3GA 3IAYA 5B1AC 3L74H 3MAQA 5KX5B 4LFBO 2HHHB 3JD2A 3CHXA 2E75B 2GDSA 4O2AA 2DMXA 4GX2A 1P4RA 3OFNG 3LUTB 1R6KA 1UPGA 2KB1A 4DV4B 3ZS8C 3B2EE 2HHHO 5B1AB 4RUEA 4LWSA 3CCQV 2QTOA 4J10A 1RSOA 4R8CA 4MVSA 2P4KA 5CA3A 4NTXA 4PDRA 1SQVH 1I5YA 3P32A 3C3TA 2LP7A 2ZQMA 3GWOA 5JQGB 3CJHB 4ZI7B 5IJ0B 1JCHA 1F4NA 3ZHSA 2DYRB 4WFBV 3ASOC 2EINC 2QWRB 3APOA 1AP6A 4TV9A 4UUJC 4LFAO 1XMOB 2AZ0A 3CCSV 2BTOA 1XI1A 2XHBA 5H9CA 3SYQA 4IHJB 4HAMA 2PYJA 3H1KH 4DR4B 4RWUA 2YS8A 4ASUG 4P2ZA 5KAFZ 1SA0A 3E8HA 4UCRA 4KL1A 4UV9A 2JJ1G 1MABG 4BW5A 1YF2A 3K58A 4KUMA 5JJJB 1MOFA 2Q0OC 4DR4O 1VQ6V 1WA8A 2EILB 2WWWA 1AR5A 4PD4F 4D6TH 3S3WA 1K4CC 3CRCA 5L3CA 5B1NA 1B04A 4W4LA 4ZHQB 3OUSA 5KA5A 3TETA 4NXMO 1YTFB 4TV8B 4DRXA 2KG7B 1CXZB 2AZ2A 4FLVA 1SQQH 2ZDIA 4GX5A 4LCUC 4X1KB 5KMGA 1EM1A 2R9RB 1Q86W 3OR6C 4CH5A 2VWKA 4B3TO 1VP7A 1PL0A 2ZINA 4U3FH 1AI7A 1GN4A 4JTCB 2DYSB 4UB6Z 1VF5B 3N2GB 3SPCA 4Z1MG 2EIKB 3SPHA 3G6BA 4GYCB 1S77D 5IT9N 2CE4A 4X64B 3FB7C 3K0GA 4TQDA 1AP5A 2HG5C 4B3RB 1XNQO 2XAFA 2H8PC 4JI7B 4A5UB 3RYFB 1NJIW 2Z0AA 4ZOLA 2UUBO 1I08A 1ZX3A 3CCVV 1IBMO 3AG2B 1Z5VA 4TT3G 3B09A 2UXNA 1IXMA 5BMVB 4UFZA 2UUAO 4MTOA 1P7BA 2D2CB 2HR3A 2HVKC 3ZHVA 5LHIA 5IJ0A 4CH3A 1IZ3A 5D5PA 3T1YO 4H37A 4H33A 1M5IA 4DV1O 3T1HO 4JI5B 3BABA 1RFYA 1ZL8A 2DWEC 1L0NH 2WLIB 2UXDB 3N2KB 1LR1A 3WG7C 4YY3B 5BMVA 4DV5O 2JS3A 1IDSA 3K5MA 3WB0A 5FL7G 2ZCEA 3OUFA 2QWNB 1S3JA 4UVCA 2F95B 3FD9A 3U0ZA 4QPKA 5C8YB 3L9DA 1YZBA 2VQEO 3CYOA 4BWAA 4JAAA 1VQ7V 4JAVA 2ADPA 2GHYA 4WCEV 3UO3A 1WB7A 2Z5UA 2A0LA 4O4HB 3G4SV 4JTDB 4X20A 1NR7A 3BA9A 4MSWC 4QIWF 4DV7O 2P90A 2HLDG 4LF6O 1O9GA 5IJ9A 2RN9A 3ZX6A 2ZE8A 4DR3B 2XUMA 1G1XB 1BZKA 5JJNB 2X6AA 3RFRA 5IJ9B 5IWAO 5KHHA 3ZCCA 1ORQC 1HNXO 1OCCC 2QE7G 1ZL8B 3HKEA 1BE3H 2IH1C 2NR5A 1W2BU 1YJNV 4PDVA 4KP4A 1PNLA 1K34A 1D5AA 2F4VO 3CRQA 1Z2GA 1NI8A 4D7TA 5J2TA 1K7DA 2AXTZ 1DK1A 5C8YA 2CH7A 4UXNA 4GUNA 4UV8A 1MSWD 3JCZA 2BOCC 3P3NA 1AI5A 5GTIZ 4JYAO 3BRCA 4MVQA 2FB5A 3IFXA 3CCMV 3GB7C 1ZLZA 1SC5B 4NTYA 5EBWC 1HNZO 1PNMA 3TJTA 3D3IA 3EVKA 4MTFA 1N4CA 4FMTA 1Q82W 1KBHA 4L87A 1HNXB 4ZOLB 2B9ZA 3B4SA 1R73A 4B3SO 4LFCB 2CAZC 1VQ4V 1H2GA 2JGDA 3AG4B 4PA6A 4EFBA 4KHPB 1N32B 1BS3A 3W7XA 5H5NA 2QM8A 1AJPA 3CCUV 2YIDA 1NH2D 3SJBC 1R3KC 4J42A 3QVNA 1I0HA 2UXXA 3OT7A 4PJ0Z 2YI9A 3ABMB 1VF6C 4DR1O 1LUVA 4HNAB 3CCJV 4JV5O 4PI0A 4JI8O 1GK9A 2OT5A 3J7AU 1H38A 4FVMA 1YJWV 5LXTB 1AROP 2WLLB 3K9AA 4YHHO 2IW5A 2Z3YA 1K5SA 3CE2A 3ABTA 4UCTA 2R9IA 4DR1B 4RUFA 3ASNB 3B8NA 1XMOO 4FLTA 1B6QA 1KECA 1OZ0A 2PF4E 3VQVA 3A8TA 4X88A 4NXMB 3ABKB 1XNRB 4R6ZA 4X8AA 2F4VB 3T4DA 2N04A 3WG7B 3K0DA 5LGTA 5LMNB 1FD9A 3J80N 5FPRA 1BHBA 1JMKC 1M56C 4LF9O 3H1JH 1M93A 1XNRO 5IYZA 1N0NA 3NXSA 2ZD9A 1IBLO 3W7WA 2C2AA 3CCEV 1GRJA 5HFMA 5EIBC 4KFMA 1VQ9V 5EZYB 4EKWA 2XTAA 4DW1A 3EXAA 1CPYA 2EZPA 3OEHG 1Q6HA 2CK3G 1V9PA 2IU3A 2QA4V 5KHKA 5IYZB 4N23A 3CPWU 4U7OA 2UU9B 5H2FZ 4IT5A 3F5WC 1BGYH 1ZWIC 2M6YA 1SQGA 3D3QA 3HKCB 2QGNA 2RJZA 2DW4A 2HJDA 3CRAA 4J9ZB 1XEQA 2OWOA 2R9AA 1IBLB 1N36O 2DJVA 1J5EO 4ICGA 1FFTB 2WLHA 4O4JA 4P9OA 4GKJO 1XNQB 2EULA 2EIMB 2E3CA 4FLUA 1S76D 1WLEA 4PA4A 4F4LA 5IDJA 2P4VA 1VMGA 3OM3B 1GMGA 3RVYA 3JAWA 1RPRA 1F51A 3E83A 3ZMUA 2ZXWB 2IH3C 2EIMC 2JEXA 4UVAA 3K5NA 5L3EA 4FFBA 4DXWA 1SQXH 4FIPC 5LMUB 4B3TB 2B5UA 3JASB 4LNUB 1OCZB 1IXBA 3K04A 4DV1B 3SPGA 1N33O 1HNZB 3K08A 4YIOA 1CEZA 5B1BC 3CJHA 1N36B 1FXHA 4Q20A 3X2QB 2EILC 3SR2C 4K8XA 4BR6A 4RO2A 3KCYA 3JATA 3ZN0A 1IBMB 2CDYA 1G6UA 1MZFA 2GTAA 4BIZA 4FLXA 2Y69B 2DYSC 2MW2B 4DR5O 4FPPA 3ZHUA 3OGCC 3N27A 5LHGA 1K33A 4NR1A 1XBLA 1B06A 4I55B 3UQ8A 4F6RB 1MZEA 3H01A 3HKDB 2IJJA 3C3SA 2QEXV 1BCCH 2JJ2G 4PELA 3JALB 2B1IA 3CP1A 4LNUA 1NKDA 1AJNA 2F66C 3BA8A 5LL6Y 5IWAB 1FS0G 2XOKG 1NS1A 4YY3O 1EZVH 4HBNA 2EIKC 1E1RG 3KKYA 3ZMZA 1W0KG 2YEVA 1QVFU 3CSXA 2OCHA 3QO5A 1R3IC 4JI3B 4PA9A 2QR4A 4H44B 1KP3A 1FKAO 1R6NA 4X62B 3JCUZ 4JI2B 4AI8A 2UUCB 5EK0A 2XAHA 1X4TA 5JVDA 1SETA 2F93B 2ZR2A 1DF4A 2X6CA 1FJGB 2Y48A 5LYJB 3TXSA 1SQPH 5EIBD 1YIJV 4JI4O 3ETGA 1VQNV 4DV7B 4AQYO 1J95A 1SRYA 1OCOC 2M7WA 2WA4A 4LF7O 3WB2A 3G6EV 1XMQB 3D8CA 3AK2A 5IYDO 1T5EA 4YJ3A 5DM6V 3GVMA 4J7JA 1DF5A 3JYCA 3HKCA 1VEWA 2WAMA 2KSDA 1HP8A 1XDCA 3ZBHA 5KHIA 2V7QG 1SZXA 4DR5B 5CBFA 4B7EA 3OD4A 1MSDA 1YDXA 5EC1C 4LF4O 3BPZA 3AG3C 5FNVA 1MMMA 4KHPO 1N32O 4JYYA 3ML0A 3HR0A 3ZMTA 4Z2WA 4O2AB 2VWJA 4MVZA 1D5NA 4K8ZA 3L75H 2EIJB 3A2FA 2HJFC 4I55A 1JOYA 2WLMA 3FYEB 1THZA 1YITV 1QLEB 5CB4B 3JARB 2N05A 2JEUA 1WNSA 3RGBA 1V54B 3TXQA 5IYCO 4CH6A 1TUBB 2EIJC 1S0VA 1BT8A 4U3JA 5LA6A 3JSLA 1RM1C 2PI4A 1QBZA 1YEWA 4J7ZA 3ZJZA 1K9MW 3ZN1A 5JCOC 2UUCO 1GKFA 5LMNO 3TCUA 4K0KB 1XQ8A 4J41A 3ZHTA 1BQZA 2ZIMA 1WN7A 2Q69A 4YHHB 3QG5A 4I4TB 2YIBA 1I5XA 1U96A 4GLXA 1RPOA 2Q7GA 2BOBC 2RCVA 5KHJA 1SQBH 2YEVB 4HYOA 4WFAV 3RYHB 3Q4HA 1WA8B 2ZIOA 3CX5F 4MVUA 3AG1C 5ITZB 3JAKA 2P06A 2E76B 1Y67A 1I7FA 4X1IB 4O4LA 2F23A 3W7UA 2Y4UA 3JALA 2Y0IA 3JD0A 1JPXA 1QR8A 2YIBD 2H3OA 4NB5A 2ETNA 5B3SB 3SJAC 4QGPA 3DXRA 1JX9A 4TUYB 4NYKA 4OPAA 3Q4HB 1EFRG 4FFBB 2BCCH 3CB2A 1VQ8V 3IC7A 4MVRA 4MVMA 2HEPA 4EB6A 4DV0O 4D7SA 4LH7A 1WPBA 2QWOB 3CS5A 4LC1A 2ZM6B 1DTOA 2EZOA 2WLNA 1R3JC 3FX7A 1EN5A 3ABKC 2QM4A 4B3RO 1QU7A 1K4DC 2PI5A 4DR2B 2YIAA 4X9QA 1G8MA 1H2LA 1M9NA 1COWG 1I94O 4IIJB 2FL4A 3QO8A 5FPOA 5CA0A 2E5LB 1JQ0A 2ZR3A 1QNMA 2PZSA 5L3DA 4DR7B 3SPIA 4X62O 4ZKIA 5J2UB 1VF7A 4I50A 2UXBB 3K3WA 3LNNA 4GKKO 1FXKC 3JASA 5D5QA 4JASA 4FJCC 4IGGA 2ADQB 2HFEC 3QO7A 3JSNA 4W4KA 4OX9O 4LF8B 4RQFA 3JARA 3B77A 4G27B 4GX0A 3FYIB 3RYIA 2AHZA 2Q7HA 4O4HA 5LP6B 4JI0O 4DV3B 3RYIB 3OR7C 4JGSA 4UCVA 5BY1A 3FAVA 1BL8A 2BE3A 1D2DA 4K35A 5CA1B 4WBNB 1GAXA 1R6TA 4MW3A 2GSMB 1QLEC 1FYJA 2ATKC 1NR1A 3ABLB 3R66A 4I4TA 3H1HH 5J2UA 1N34B 3OW2U 1Q43A 3K79A 2Q67A 4ABMA 3AK1A 1EBOA 3WU2Z 1SF9A 4LF5O 4OX9B 5B66Z 4QNHB 1URFA 3CC7V 3I56V 3J81N 5TISZ 2ODMA 5GONB 5ITZA 1R3LC 2VS0A 2P22C 4PI2A 4DR6B 1HNWB 5L3BA 3MDSA 4B3MO 1OJHA 2CTRA 2A06H 1Y74B 2ZKOA 1L8DA 4LFCO 1FFXB 4JAUA 1Z5WA 4I0XB 4CS3A 3ASOB 2JRIA 1AILA 4PDLA 1WP8A 3SDLA 5FLXN 4JYCA 1K8AW 1X59A 2ZT9B 3I55V 3X2QC 3T1CA 1VQ5V 1Q81W 1TVKB 3LSQA 1K73W 3STZC 5GW7A 2MK3A 4IL6Z 1P49A 3KG2A 2LFSA 3DC5A 1FPOA 3FB6C 1DGSA 1HNWO 3UCSC 4B3SB 1TGOA 5AG2A 1YVWA 3K59A 3ZRWB 4JI5O 2OTJV 2ARHA 2K1EA 3ZHRA 1M56B 1NBMG 3DSQA 4TWKA 4LR3A 4YXWG 4IHJA 3VOUA 2DE0X 4AHCA 3THOA 4EEQA 4YJ2B 4X1IA 1WPXA 1HR0O 2KKWA 1ZAUA 1QLNA 4MVOA 1S5LZ 2QM7A 3A0HZ 4WFGA 4NVPA 1N8RW 4GCZA 3SJQC 4G2KA 4CC5A 2P67A 4ZI7A 4X1KA 3UM7A 5KMGB 4P9PA 2YICA 4FK5C 4JPRA 1WB8A 1BMFG 3K57A 4NXNB 2LJ2A 4FM2A 3E2EA 1H8EG 2ZDIC 3ABUA 2FKXA 2WLLA 2A9HA 2FTKA 1IVSA 2AW9A 4LF7B 4JZGA 5CA1A 2PUSA 5C93A 3JATB 1AI4A 2DQ3A 4LH6A 4UCOA 5BR8B 1NT2B 5EZYA 2WLKA 1VARA 2A3QA 4FLZA 2RDCA 2P7TC 3I5DA 3RYFA 3AG1B 3SYAA 3ZMSA 1Q6IA 1OCOB 2Q9LA 3CC4V 3CCRV 4IIJA 3ASNC 2W6JG 4DUZO 4JF3A 4XDKA 3C90A 4HZ3A 1M90W 2CTPA 2YXLA 5B3SC 3BEHA 4L8JA 2XT9A 2WSSG 1NVPB 2B1GA 3ICXA 2WLJA 3E8BA 4X65O 2VRZA 3L72H 3M8AA 3HB3B 2JS5A 2QKCA 1KC8W 2A7WA 4X66O 2UXCB 3W7SA 1Q6UA 3UO2A 1KU9A 3A0RA 1FXKA 3E86A 4JTAB 5A2QN 1G4YB 3H1LH 1YCIA 1NZ6A 3BVOA 2RNBA 3T4ZA 2X7RB 2OIGA 3DC6A 5DECA 2LQTA 4B08A 4X66B 1ZSPA 4K0KO 4X1YB 1R1BA 4WBNA 3E8GA 4QE9A 3VQXA 4HNAA 2HVJC 4U7NA 1AJQA 3OMNB 2WA3A 3ZIAG 1M57C 1GTOA 2LGWA 4MTXA 4LF4B 3E89A 1NVPD 1DLBA 2EJRA 3PN1A 4OXSA 3SYPA 3E22A 1AB3A 4ZIBA 2FMLA 2LGQA 2ZE6A 4OPHA 4B7KA 1MG1A 1SA0B 2L6LA 5H6QA 4XBFA 4N21A 2YUAA 2RMKB 4DYLA 1PP9H 2GUZB 1EZJA 4WFEA 3JD3A 1TAEA 5LP6C 4FM0A 3S3XA 1GN2A 2L35A 4I5SA 5KUKA 1F4MA 4BW9A 2BSKA 2F43G 5B1OA 1PL4A 3VQYA 2QWPB 5LGUA 3ZRVA 5LA6B 5CBHA 2BSKB 4R50A 1NU1H 1VF6A 2E74B 2BTQB 1Q5OA 1SQFA 2QSAA 4LBEC 2Q8VA 3BAAA 3FB5C 2CGNA 3F7VC 1VQLV 4O4LB 5K1XA 3L73H 3AK3A 1PD3A 3ABMC 3OGIB 3EHBB 3O65A 4DR2O 2GTSA 3IGAC 5EYPB 3ZMVA 1UFIA 4FZ1A 2GBOA 1KMIZ 1OCZC 3CEIA 4U3JB 4TUYA 1UJWB 3EFFK 3OAAG 3N2GA 3OTFA 3CXCU 4DR7O 2XAJA 3NR7A 3RYHA 1AR4A 1VQMV 1YXBA 1AR1B 2O57A 3AEIA 2HKOA 1IURA 3FFQA 5E1AC 1SZTA 3ETDA 4J11A 4JI2O 3B8MA 3DGEA 2UU9O 4BIUA 3HKBA 4MS2A 4NXNO 3JD4A 4C7UA 3LSUA 1GH6A 4PA7A 2PY5A 4P30A 4LP8A 3H1IH 3CCLV 1E1QG 2Q68A 2QJ1A 4CZZA 2XASA 1VIBA 5KLVH 4ZHQA 1AVMA 4FM1A 1Y4MA 2LFRA 3K5OA 4B3MB 1EN6A 3SGIA 1IX9A 4J7KA 2IJHA 5JH7B 1JVMA 4LF5B 4JYAB 1IBKO 4DV5B 3JD1A 1SS3A 5J2TB 2WLIA 5GTHZ 3E35A 3JAWB 1AI6A 3K9SA 3G67A 1V55C 1OCRB 4PDMA 1QQCA 2DWDC 2Q7EA 3VBBA 1P7GA 1KD1W 5CB4A 1KKCA 4X64O 3P3PA 4PHZA 2RQ6A 5E79Z 5BZBA 1N34O 4X89A 3FKSG 3SPJA 1TUBA 2HP8A 5IYBO 3G80A 2JDIG 3B40A 2UXBO 4JI6O 1V55B 1O9HA 4AQYB 2XAGA 1PM9A 3BY6A 1SERA 1KP2A 5FNVB 4DV4O 3KCXA 1PPJH 1FXVA 4JZ2A 2H94A 2QKSA 4CS2A 2JGUA 3LDDA 5KHGA 3SJCC 5EC2C 2YC0A 3K03A 2LW7A 4CS4A 4H0LB 3CC2V 4YJ3B 3CMEV 5JJEB 1FAFA 1KKDA 4E4EA 3CWBH 1TUEB 1Q3EA 1H2NA 1WP7A 4R7CA 3ZRXA 1K92A 3T1HB 2DN9A 2JK5C 3W7TA 4O4JB 2XAQA 4Z1VA 5JCOA 1YI2V 3ETEA 3AG2C 2CGOA 5JWPA 4MT8A 2YDEA 4G28B 2IBZH 1Q7YW 2R72A 4X1YA 2YXYA 5IY5C
chains in the Genus database with same CATH topology
5B5EZ 5KAFZ 5B66Z 3JCUZ 4UB6Z 3A0BZ 5GTHZ 5TISZ 1S5LZ 5H2FZ 4UB8Z 3A0HZ 4PJ0Z 5E79Z 3WU2Z 3KZIZ 4IL6Z 5GTIZ 5KAIZ 2AXTZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E Z;  5KAF Z;  5B66 Z;  3JCU Z;  4UB6 Z;  3A0B Z;  5GTH Z;  5TIS Z;  1S5L Z;  5H2F Z;  4UB8 Z;  3A0H Z;  4PJ0 Z;  5E79 Z;  3WU2 Z;  3KZI Z;  4IL6 Z;  5GTI Z;  5KAI Z;  2AXT Z; 
#chains in the Genus database with same CATH topology
 3ZED A;  1K97 A;  4TSF G;  5K1P A;  1FJG O;  4DUZ B;  4QJF B;  3RYC A;  1US6 A;  5JQG A;  1RSO B;  3CRR A;  3F5T A;  5KAI Z;  1XHZ A;  2ILM A;  4Q6G A;  2JVD A;  2NLJ C;  2DYR C;  5IY5 B;  2PYL A;  1IBK B;  1GN3 A;  4TQF A;  2ZNI A;  1Q90 D;  1OHH G;  3E22 B;  5LBQ A;  2AGA A;  4JI8 B;  1XL4 A;  2KQX A;  1Y76 A;  2EJ7 A;  3PJS K;  4DK1 A;  4DW0 A;  3LDE A;  4NTW A;  1HR0 B;  1A32 A;  4XDJ A;  1JA8 A;  3M7M X;  2V4D A;  4DV6 B;  4LFB B;  1W59 A;  5EYP A;  4I0X A;  4AIL C;  1F23 A;  4O2B A;  3JAM N;  4MTG A;  2JGD B;  1XRE A;  2Y69 C;  1Y76 B;  4LFA B;  4I9W A;  4DV6 O;  2CUG A;  4DV0 B;  3IJ4 A;  5JH7 A;  1KYO F;  4JI4 B;  1M57 B;  1U97 A;  5HFL A;  1GM7 A;  4YJ2 A;  1M4U A;  2UXC O;  1M1K W;  3RW0 A;  1NTZ H;  4PA3 A;  4F6E A;  1XMQ O;  3CXH F;  4OGQ B;  1J5E B;  1HDJ A;  3ZRW A;  2E5L O;  2KG7 A;  2ITC C;  4UCS A;  2XND G;  2OYQ A;  1S72 V;  1QCE A;  3R65 A;  3DXR B;  3VQW A;  3K5L A;  1Y66 A;  3SYC A;  2UUB B;  2IU0 A;  4J9Y B;  2CTW A;  4X65 B;  1ZUQ A;  5H6R A;  3U10 A;  4EB6 B;  3UT5 B;  4K3A A;  1WJZ A;  1TVK A;  5J9P C;  4GZR B;  1Y6X A;  5JVD B;  5B5E Z;  2VQF B;  1H2S B;  4QE7 A;  3OTO O;  1VQP V;  5EBM C;  1MA1 A;  1ZTE A;  1I94 B;  3HKD A;  4I7Z B;  3ABL C;  3D36 C;  1XOU A;  2QKA A;  2ZE7 A;  2CTQ A;  1JJO A;  3T1Y B;  4WFF A;  1F7Y A;  4MW8 A;  5IE9 A;  1N33 B;  3QNE A;  4LF9 B;  1YHQ V;  1BSM A;  2AHY A;  4GKK B;  3BFR A;  3GWK C;  1L1F A;  4BAY A;  4E2L A;  2YSU B;  3P30 A;  1GM8 A;  2EIN B;  3MD0 A;  1PV0 A;  4IYI A;  5F2V O;  1S5H C;  4O4I A;  1H8H G;  1VQO V;  1GM9 A;  1KUQ A;  1XL6 A;  2P5O A;  4JI7 O;  3D36 A;  2W0F C;  2K9P A;  3K06 A;  2N74 A;  5LXT A;  3HKE B;  2OTL V;  1FFX A;  3ETQ A;  4TV8 A;  4DRX B;  3TGU H;  4LWS B;  1K5Q A;  1PNK A;  1LNQ A;  4UB8 Z;  3LNM B;  2ZM6 O;  3LSS A;  1CP9 A;  2GV9 A;  4QPJ A;  2DOS A;  3RT3 C;  2VQF O;  5CMU A;  3OTO B;  4CH4 A;  1SKV A;  5LMU O;  3JAK B;  1NQT A;  2QWQ B;  2QDO A;  2DQ0 A;  2F1M A;  4WF9 V;  1JR9 A;  3QTC A;  3T2M A;  1OV9 A;  5L3F A;  1QR9 A;  3IC9 A;  1RP3 B;  1BHA A;  1XHX A;  5LP6 A;  2YI8 A;  4DV2 O;  1V54 C;  3STL C;  5LHH A;  3O9O A;  2X0L A;  2Q4P A;  2YXH A;  1S5J A;  2IJI A;  3DTU B;  4GX1 A;  1YSC A;  2P6J A;  4X20 B;  3HKB B;  5CBG A;  4TOI A;  1RM1 B;  3L70 H;  4DV2 B;  2W0X A;  5CN0 A;  4GKJ B;  3CRM A;  1N0J A;  4LF8 O;  2JIZ G;  4DR6 O;  1B3Q A;  1ENV A;  3UT5 A;  2UUA B;  3QF7 A;  2A79 B;  2LO1 A;  4FZ0 A;  3CMA V;  3RVZ A;  1KB9 F;  4O4I B;  4JYB A;  3E8F A;  1HW7 A;  3BHP A;  4FFK A;  1SES A;  4EFE A;  1YJ9 V;  3RN4 A;  1E79 G;  3TK1 A;  5GON A;  3A0B Z;  4F6R A;  3UKM A;  1PKX A;  5LGN A;  2VQE B;  3APQ A;  1QHT A;  2ZE5 A;  5LYJ A;  1YTF D;  2EX3 A;  2OCC B;  2UXD O;  1KQS U;  3MHH C;  3ZRS A;  2ZNJ A;  4H13 B;  2PTM A;  2IJK A;  4FLY A;  1NTK H;  2Q73 A;  2X6B A;  5BXZ A;  2GUZ A;  1Y74 A;  3AG4 C;  4JI1 B;  4FLW A;  5LOV A;  1P84 F;  2NN4 A;  1XIL A;  2QTS A;  3ZHQ A;  2IM9 A;  4NKG B;  1XUQ A;  3OMI B;  2OCC C;  4J80 A;  1H2M A;  4CBC A;  1MNG A;  4PV1 B;  3SYO A;  1JFF A;  1WAZ A;  3CD6 V;  4TV9 B;  5CA0 B;  2NNU A;  2Y0P A;  3G71 V;  4JI6 B;  3FAV B;  4RQE A;  4UVB A;  4ZBM A;  2Q0A A;  4JV5 B;  3OEE G;  2LW1 A;  3F7Y C;  4IYH A;  2W6I G;  4XDL A;  4I9Q A;  1LUW A;  1W0J G;  4DV3 O;  4JI0 B;  2G38 A;  1Q8I A;  3RWR D;  3M99 B;  2FYU H;  1HWY A;  5BR8 O;  4DUY O;  4RAI A;  2Q6A A;  2WPD G;  2EBO A;  2ZXW C;  2ITD C;  4BIO A;  1TA8 A;  5DN6 G;  3MHS C;  3N2K A;  4DR3 O;  3OMA B;  1NH2 B;  3OE7 G;  4DUY B;  3H9V A;  5LOV B;  1QVG U;  5DED A;  1BQ0 A;  1GO3 F;  2BTQ A;  3WFV A;  3HPL C;  4GT1 A;  5A9G A;  1FXK B;  1OCR C;  3RYC B;  1H2K A;  4DO2 A;  4KXR A;  4WFH A;  1VQK V;  3AG7 A;  4JI3 O;  4YIP A;  5B1B B;  3WB1 A;  1JFF B;  3L71 H;  3FB8 C;  1NTM H;  5EBL C;  2CH7 B;  1EN4 A;  3BCC H;  4DK0 A;  3KZI Z;  2PGG A;  2D3O W;  1GN6 A;  4LF6 B;  2Y4T A;  1K3E A;  2V1D A;  4UCU A;  4O2B B;  4JI1 O;  1L0L H;  4I50 B;  1JJ2 U;  1OCC B;  2OIE A;  5KUM A;  1ROP A;  5KX5 A;  3RBZ A;  3AG3 B;  4CC6 A;  2Q5Z A;  5KA6 A;  2R70 A;  3U11 A;  3LDC A;  5L3G A;  3IAY A;  5B1A C;  3L74 H;  3MAQ A;  5KX5 B;  4LFB O;  2HHH B;  3JD2 A;  3CHX A;  2E75 B;  2GDS A;  4O2A A;  2DMX A;  4GX2 A;  1P4R A;  3OFN G;  3LUT B;  1R6K A;  1UPG A;  2KB1 A;  4DV4 B;  3ZS8 C;  3B2E E;  2HHH O;  5B1A B;  4RUE A;  4LWS A;  3CCQ V;  2QTO A;  4J10 A;  1RSO A;  4R8C A;  4MVS A;  2P4K A;  5CA3 A;  4NTX A;  4PDR A;  1SQV H;  1I5Y A;  3P32 A;  3C3T A;  2LP7 A;  2ZQM A;  3GWO A;  5JQG B;  3CJH B;  4ZI7 B;  5IJ0 B;  1JCH A;  1F4N A;  3ZHS A;  2DYR B;  4WFB V;  3ASO C;  2EIN C;  2QWR B;  3APO A;  1AP6 A;  4TV9 A;  4UUJ C;  4LFA O;  1XMO B;  2AZ0 A;  3CCS V;  2BTO A;  1XI1 A;  2XHB A;  5H9C A;  3SYQ A;  4IHJ B;  4HAM A;  2PYJ A;  3H1K H;  4DR4 B;  4RWU A;  2YS8 A;  4ASU G;  4P2Z A;  5KAF Z;  1SA0 A;  3E8H A;  4UCR A;  4KL1 A;  4UV9 A;  2JJ1 G;  1MAB G;  4BW5 A;  1YF2 A;  3K58 A;  4KUM A;  5JJJ B;  1MOF A;  2Q0O C;  4DR4 O;  1VQ6 V;  1WA8 A;  2EIL B;  2WWW A;  1AR5 A;  4PD4 F;  4D6T H;  3S3W A;  1K4C C;  3CRC A;  5L3C A;  5B1N A;  1B04 A;  4W4L A;  4ZHQ B;  3OUS A;  5KA5 A;  3TET A;  4NXM O;  1YTF B;  4TV8 B;  4DRX A;  2KG7 B;  1CXZ B;  2AZ2 A;  4FLV A;  1SQQ H;  2ZDI A;  4GX5 A;  4LCU C;  4X1K B;  5KMG A;  1EM1 A;  2R9R B;  1Q86 W;  3OR6 C;  4CH5 A;  2VWK A;  4B3T O;  1VP7 A;  1PL0 A;  2ZIN A;  4U3F H;  1AI7 A;  1GN4 A;  4JTC B;  2DYS B;  4UB6 Z;  1VF5 B;  3N2G B;  3SPC A;  4Z1M G;  2EIK B;  3SPH A;  3G6B A;  4GYC B;  1S77 D;  5IT9 N;  2CE4 A;  4X64 B;  3FB7 C;  3K0G A;  4TQD A;  1AP5 A;  2HG5 C;  4B3R B;  1XNQ O;  2XAF A;  2H8P C;  4JI7 B;  4A5U B;  3RYF B;  1NJI W;  2Z0A A;  4ZOL A;  2UUB O;  1I08 A;  1ZX3 A;  3CCV V;  1IBM O;  3AG2 B;  1Z5V A;  4TT3 G;  3B09 A;  2UXN A;  1IXM A;  5BMV B;  4UFZ A;  2UUA O;  4MTO A;  1P7B A;  2D2C B;  2HR3 A;  2HVK C;  3ZHV A;  5LHI A;  5IJ0 A;  4CH3 A;  1IZ3 A;  5D5P A;  3T1Y O;  4H37 A;  4H33 A;  1M5I A;  4DV1 O;  3T1H O;  4JI5 B;  3BAB A;  1RFY A;  1ZL8 A;  2DWE C;  1L0N H;  2WLI B;  2UXD B;  3N2K B;  1LR1 A;  3WG7 C;  4YY3 B;  5BMV A;  4DV5 O;  2JS3 A;  1IDS A;  3K5M A;  3WB0 A;  5FL7 G;  2ZCE A;  3OUF A;  2QWN B;  1S3J A;  4UVC A;  2F95 B;  3FD9 A;  3U0Z A;  4QPK A;  5C8Y B;  3L9D A;  1YZB A;  2VQE O;  3CYO A;  4BWA A;  4JAA A;  1VQ7 V;  4JAV A;  2ADP A;  2GHY A;  4WCE V;  3UO3 A;  1WB7 A;  2Z5U A;  2A0L A;  4O4H B;  3G4S V;  4JTD B;  4X20 A;  1NR7 A;  3BA9 A;  4MSW C;  4QIW F;  4DV7 O;  2P90 A;  2HLD G;  4LF6 O;  1O9G A;  5IJ9 A;  2RN9 A;  3ZX6 A;  2ZE8 A;  4DR3 B;  2XUM A;  1G1X B;  1BZK A;  5JJN B;  2X6A A;  3RFR A;  5IJ9 B;  5IWA O;  5KHH A;  3ZCC A;  1ORQ C;  1HNX O;  1OCC C;  2QE7 G;  1ZL8 B;  3HKE A;  1BE3 H;  2IH1 C;  2NR5 A;  1W2B U;  1YJN V;  4PDV A;  4KP4 A;  1PNL A;  1K34 A;  1D5A A;  2F4V O;  3CRQ A;  1Z2G A;  1NI8 A;  4D7T A;  5J2T A;  1K7D A;  2AXT Z;  1DK1 A;  5C8Y A;  2CH7 A;  4UXN A;  4GUN A;  4UV8 A;  1MSW D;  3JCZ A;  2BOC C;  3P3N A;  1AI5 A;  5GTI Z;  4JYA O;  3BRC A;  4MVQ A;  2FB5 A;  3IFX A;  3CCM V;  3GB7 C;  1ZLZ A;  1SC5 B;  4NTY A;  5EBW C;  1HNZ O;  1PNM A;  3TJT A;  3D3I A;  3EVK A;  4MTF A;  1N4C A;  4FMT A;  1Q82 W;  1KBH A;  4L87 A;  1HNX B;  4ZOL B;  2B9Z A;  3B4S A;  1R73 A;  4B3S O;  4LFC B;  2CAZ C;  1VQ4 V;  1H2G A;  2JGD A;  3AG4 B;  4PA6 A;  4EFB A;  4KHP B;  1N32 B;  1BS3 A;  3W7X A;  5H5N A;  2QM8 A;  1AJP A;  3CCU V;  2YID A;  1NH2 D;  3SJB C;  1R3K C;  4J42 A;  3QVN A;  1I0H A;  2UXX A;  3OT7 A;  4PJ0 Z;  2YI9 A;  3ABM B;  1VF6 C;  4DR1 O;  1LUV A;  4HNA B;  3CCJ V;  4JV5 O;  4PI0 A;  4JI8 O;  1GK9 A;  2OT5 A;  3J7A U;  1H38 A;  4FVM A;  1YJW V;  5LXT B;  1ARO P;  2WLL B;  3K9A A;  4YHH O;  2IW5 A;  2Z3Y A;  1K5S A;  3CE2 A;  3ABT A;  4UCT A;  2R9I A;  4DR1 B;  4RUF A;  3ASN B;  3B8N A;  1XMO O;  4FLT A;  1B6Q A;  1KEC A;  1OZ0 A;  2PF4 E;  3VQV A;  3A8T A;  4X88 A;  4NXM B;  3ABK B;  1XNR B;  4R6Z A;  4X8A A;  2F4V B;  3T4D A;  2N04 A;  3WG7 B;  3K0D A;  5LGT A;  5LMN B;  1FD9 A;  3J80 N;  5FPR A;  1BHB A;  1JMK C;  1M56 C;  4LF9 O;  3H1J H;  1M93 A;  1XNR O;  5IYZ A;  1N0N A;  3NXS A;  2ZD9 A;  1IBL O;  3W7W A;  2C2A A;  3CCE V;  1GRJ A;  5HFM A;  5EIB C;  4KFM A;  1VQ9 V;  5EZY B;  4EKW A;  2XTA A;  4DW1 A;  3EXA A;  1CPY A;  2EZP A;  3OEH G;  1Q6H A;  2CK3 G;  1V9P A;  2IU3 A;  2QA4 V;  5KHK A;  5IYZ B;  4N23 A;  3CPW U;  4U7O A;  2UU9 B;  5H2F Z;  4IT5 A;  3F5W C;  1BGY H;  1ZWI C;  2M6Y A;  1SQG A;  3D3Q A;  3HKC B;  2QGN A;  2RJZ A;  2DW4 A;  2HJD A;  3CRA A;  4J9Z B;  1XEQ A;  2OWO A;  2R9A A;  1IBL B;  1N36 O;  2DJV A;  1J5E O;  4ICG A;  1FFT B;  2WLH A;  4O4J A;  4P9O A;  4GKJ O;  1XNQ B;  2EUL A;  2EIM B;  2E3C A;  4FLU A;  1S76 D;  1WLE A;  4PA4 A;  4F4L A;  5IDJ A;  2P4V A;  1VMG A;  3OM3 B;  1GMG A;  3RVY A;  3JAW A;  1RPR A;  1F51 A;  3E83 A;  3ZMU A;  2ZXW B;  2IH3 C;  2EIM C;  2JEX A;  4UVA A;  3K5N A;  5L3E A;  4FFB A;  4DXW A;  1SQX H;  4FIP C;  5LMU B;  4B3T B;  2B5U A;  3JAS B;  4LNU B;  1OCZ B;  1IXB A;  3K04 A;  4DV1 B;  3SPG A;  1N33 O;  1HNZ B;  3K08 A;  4YIO A;  1CEZ A;  5B1B C;  3CJH A;  1N36 B;  1FXH A;  4Q20 A;  3X2Q B;  2EIL C;  3SR2 C;  4K8X A;  4BR6 A;  4RO2 A;  3KCY A;  3JAT A;  3ZN0 A;  1IBM B;  2CDY A;  1G6U A;  1MZF A;  2GTA A;  4BIZ A;  4FLX A;  2Y69 B;  2DYS C;  2MW2 B;  4DR5 O;  4FPP A;  3ZHU A;  3OGC C;  3N27 A;  5LHG A;  1K33 A;  4NR1 A;  1XBL A;  1B06 A;  4I55 B;  3UQ8 A;  4F6R B;  1MZE A;  3H01 A;  3HKD B;  2IJJ A;  3C3S A;  2QEX V;  1BCC H;  2JJ2 G;  4PEL A;  3JAL B;  2B1I A;  3CP1 A;  4LNU A;  1NKD A;  1AJN A;  2F66 C;  3BA8 A;  5LL6 Y;  5IWA B;  1FS0 G;  2XOK G;  1NS1 A;  4YY3 O;  1EZV H;  4HBN A;  2EIK C;  1E1R G;  3KKY A;  3ZMZ A;  1W0K G;  2YEV A;  1QVF U;  3CSX A;  2OCH A;  3QO5 A;  1R3I C;  4JI3 B;  4PA9 A;  2QR4 A;  4H44 B;  1KP3 A;  1FKA O;  1R6N A;  4X62 B;  3JCU Z;  4JI2 B;  4AI8 A;  2UUC B;  5EK0 A;  2XAH A;  1X4T A;  5JVD A;  1SET A;  2F93 B;  2ZR2 A;  1DF4 A;  2X6C A;  1FJG B;  2Y48 A;  5LYJ B;  3TXS A;  1SQP H;  5EIB D;  1YIJ V;  4JI4 O;  3ETG A;  1VQN V;  4DV7 B;  4AQY O;  1J95 A;  1SRY A;  1OCO C;  2M7W A;  2WA4 A;  4LF7 O;  3WB2 A;  3G6E V;  1XMQ B;  3D8C A;  3AK2 A;  5IYD O;  1T5E A;  4YJ3 A;  5DM6 V;  3GVM A;  4J7J A;  1DF5 A;  3JYC A;  3HKC A;  1VEW A;  2WAM A;  2KSD A;  1HP8 A;  1XDC A;  3ZBH A;  5KHI A;  2V7Q G;  1SZX A;  4DR5 B;  5CBF A;  4B7E A;  3OD4 A;  1MSD A;  1YDX A;  5EC1 C;  4LF4 O;  3BPZ A;  3AG3 C;  5FNV A;  1MMM A;  4KHP O;  1N32 O;  4JYY A;  3ML0 A;  3HR0 A;  3ZMT A;  4Z2W A;  4O2A B;  2VWJ A;  4MVZ A;  1D5N A;  4K8Z A;  3L75 H;  2EIJ B;  3A2F A;  2HJF C;  4I55 A;  1JOY A;  2WLM A;  3FYE B;  1THZ A;  1YIT V;  1QLE B;  5CB4 B;  3JAR B;  2N05 A;  2JEU A;  1WNS A;  3RGB A;  1V54 B;  3TXQ A;  5IYC O;  4CH6 A;  1TUB B;  2EIJ C;  1S0V A;  1BT8 A;  4U3J A;  5LA6 A;  3JSL A;  1RM1 C;  2PI4 A;  1QBZ A;  1YEW A;  4J7Z A;  3ZJZ A;  1K9M W;  3ZN1 A;  5JCO C;  2UUC O;  1GKF A;  5LMN O;  3TCU A;  4K0K B;  1XQ8 A;  4J41 A;  3ZHT A;  1BQZ A;  2ZIM A;  1WN7 A;  2Q69 A;  4YHH B;  3QG5 A;  4I4T B;  2YIB A;  1I5X A;  1U96 A;  4GLX A;  1RPO A;  2Q7G A;  2BOB C;  2RCV A;  5KHJ A;  1SQB H;  2YEV B;  4HYO A;  4WFA V;  3RYH B;  3Q4H A;  1WA8 B;  2ZIO A;  3CX5 F;  4MVU A;  3AG1 C;  5ITZ B;  3JAK A;  2P06 A;  2E76 B;  1Y67 A;  1I7F A;  4X1I B;  4O4L A;  2F23 A;  3W7U A;  2Y4U A;  3JAL A;  2Y0I A;  3JD0 A;  1JPX A;  1QR8 A;  2YIB D;  2H3O A;  4NB5 A;  2ETN A;  5B3S B;  3SJA C;  4QGP A;  3DXR A;  1JX9 A;  4TUY B;  4NYK A;  4OPA A;  3Q4H B;  1EFR G;  4FFB B;  2BCC H;  3CB2 A;  1VQ8 V;  3IC7 A;  4MVR A;  4MVM A;  2HEP A;  4EB6 A;  4DV0 O;  4D7S A;  4LH7 A;  1WPB A;  2QWO B;  3CS5 A;  4LC1 A;  2ZM6 B;  1DTO A;  2EZO A;  2WLN A;  1R3J C;  3FX7 A;  1EN5 A;  3ABK C;  2QM4 A;  4B3R O;  1QU7 A;  1K4D C;  2PI5 A;  4DR2 B;  2YIA A;  4X9Q A;  1G8M A;  1H2L A;  1M9N A;  1COW G;  1I94 O;  4IIJ B;  2FL4 A;  3QO8 A;  5FPO A;  5CA0 A;  2E5L B;  1JQ0 A;  2ZR3 A;  1QNM A;  2PZS A;  5L3D A;  4DR7 B;  3SPI A;  4X62 O;  4ZKI A;  5J2U B;  1VF7 A;  4I50 A;  2UXB B;  3K3W A;  3LNN A;  4GKK O;  1FXK C;  3JAS A;  5D5Q A;  4JAS A;  4FJC C;  4IGG A;  2ADQ B;  2HFE C;  3QO7 A;  3JSN A;  4W4K A;  4OX9 O;  4LF8 B;  4RQF A;  3JAR A;  3B77 A;  4G27 B;  4GX0 A;  3FYI B;  3RYI A;  2AHZ A;  2Q7H A;  4O4H A;  5LP6 B;  4JI0 O;  4DV3 B;  3RYI B;  3OR7 C;  4JGS A;  4UCV A;  5BY1 A;  3FAV A;  1BL8 A;  2BE3 A;  1D2D A;  4K35 A;  5CA1 B;  4WBN B;  1GAX A;  1R6T A;  4MW3 A;  2GSM B;  1QLE C;  1FYJ A;  2ATK C;  1NR1 A;  3ABL B;  3R66 A;  4I4T A;  3H1H H;  5J2U A;  1N34 B;  3OW2 U;  1Q43 A;  3K79 A;  2Q67 A;  4ABM A;  3AK1 A;  1EBO A;  3WU2 Z;  1SF9 A;  4LF5 O;  4OX9 B;  5B66 Z;  4QNH B;  1URF A;  3CC7 V;  3I56 V;  3J81 N;  5TIS Z;  2ODM A;  5GON B;  5ITZ A;  1R3L C;  2VS0 A;  2P22 C;  4PI2 A;  4DR6 B;  1HNW B;  5L3B A;  3MDS A;  4B3M O;  1OJH A;  2CTR A;  2A06 H;  1Y74 B;  2ZKO A;  1L8D A;  4LFC O;  1FFX B;  4JAU A;  1Z5W A;  4I0X B;  4CS3 A;  3ASO B;  2JRI A;  1AIL A;  4PDL A;  1WP8 A;  3SDL A;  5FLX N;  4JYC A;  1K8A W;  1X59 A;  2ZT9 B;  3I55 V;  3X2Q C;  3T1C A;  1VQ5 V;  1Q81 W;  1TVK B;  3LSQ A;  1K73 W;  3STZ C;  5GW7 A;  2MK3 A;  4IL6 Z;  1P49 A;  3KG2 A;  2LFS A;  3DC5 A;  1FPO A;  3FB6 C;  1DGS A;  1HNW O;  3UCS C;  4B3S B;  1TGO A;  5AG2 A;  1YVW A;  3K59 A;  3ZRW B;  4JI5 O;  2OTJ V;  2ARH A;  2K1E A;  3ZHR A;  1M56 B;  1NBM G;  3DSQ A;  4TWK A;  4LR3 A;  4YXW G;  4IHJ A;  3VOU A;  2DE0 X;  4AHC A;  3THO A;  4EEQ A;  4YJ2 B;  4X1I A;  1WPX A;  1HR0 O;  2KKW A;  1ZAU A;  1QLN A;  4MVO A;  1S5L Z;  2QM7 A;  3A0H Z;  4WFG A;  4NVP A;  1N8R W;  4GCZ A;  3SJQ C;  4G2K A;  4CC5 A;  2P67 A;  4ZI7 A;  4X1K A;  3UM7 A;  5KMG B;  4P9P A;  2YIC A;  4FK5 C;  4JPR A;  1WB8 A;  1BMF G;  3K57 A;  4NXN B;  2LJ2 A;  4FM2 A;  3E2E A;  1H8E G;  2ZDI C;  3ABU A;  2FKX A;  2WLL A;  2A9H A;  2FTK A;  1IVS A;  2AW9 A;  4LF7 B;  4JZG A;  5CA1 A;  2PUS A;  5C93 A;  3JAT B;  1AI4 A;  2DQ3 A;  4LH6 A;  4UCO A;  5BR8 B;  1NT2 B;  5EZY A;  2WLK A;  1VAR A;  2A3Q A;  4FLZ A;  2RDC A;  2P7T C;  3I5D A;  3RYF A;  3AG1 B;  3SYA A;  3ZMS A;  1Q6I A;  1OCO B;  2Q9L A;  3CC4 V;  3CCR V;  4IIJ A;  3ASN C;  2W6J G;  4DUZ O;  4JF3 A;  4XDK A;  3C90 A;  4HZ3 A;  1M90 W;  2CTP A;  2YXL A;  5B3S C;  3BEH A;  4L8J A;  2XT9 A;  2WSS G;  1NVP B;  2B1G A;  3ICX A;  2WLJ A;  3E8B A;  4X65 O;  2VRZ A;  3L72 H;  3M8A A;  3HB3 B;  2JS5 A;  2QKC A;  1KC8 W;  2A7W A;  4X66 O;  2UXC B;  3W7S A;  1Q6U A;  3UO2 A;  1KU9 A;  3A0R A;  1FXK A;  3E86 A;  4JTA B;  5A2Q N;  1G4Y B;  3H1L H;  1YCI A;  1NZ6 A;  3BVO A;  2RNB A;  3T4Z A;  2X7R B;  2OIG A;  3DC6 A;  5DEC A;  2LQT A;  4B08 A;  4X66 B;  1ZSP A;  4K0K O;  4X1Y B;  1R1B A;  4WBN A;  3E8G A;  4QE9 A;  3VQX A;  4HNA A;  2HVJ C;  4U7N A;  1AJQ A;  3OMN B;  2WA3 A;  3ZIA G;  1M57 C;  1GTO A;  2LGW A;  4MTX A;  4LF4 B;  3E89 A;  1NVP D;  1DLB A;  2EJR A;  3PN1 A;  4OXS A;  3SYP A;  3E22 A;  1AB3 A;  4ZIB A;  2FML A;  2LGQ A;  2ZE6 A;  4OPH A;  4B7K A;  1MG1 A;  1SA0 B;  2L6L A;  5H6Q A;  4XBF A;  4N21 A;  2YUA A;  2RMK B;  4DYL A;  1PP9 H;  2GUZ B;  1EZJ A;  4WFE A;  3JD3 A;  1TAE A;  5LP6 C;  4FM0 A;  3S3X A;  1GN2 A;  2L35 A;  4I5S A;  5KUK A;  1F4M A;  4BW9 A;  2BSK A;  2F43 G;  5B1O A;  1PL4 A;  3VQY A;  2QWP B;  5LGU A;  3ZRV A;  5LA6 B;  5CBH A;  2BSK B;  4R50 A;  1NU1 H;  1VF6 A;  2E74 B;  2BTQ B;  1Q5O A;  1SQF A;  2QSA A;  4LBE C;  2Q8V A;  3BAA A;  3FB5 C;  2CGN A;  3F7V C;  1VQL V;  4O4L B;  5K1X A;  3L73 H;  3AK3 A;  1PD3 A;  3ABM C;  3OGI B;  3EHB B;  3O65 A;  4DR2 O;  2GTS A;  3IGA C;  5EYP B;  3ZMV A;  1UFI A;  4FZ1 A;  2GBO A;  1KMI Z;  1OCZ C;  3CEI A;  4U3J B;  4TUY A;  1UJW B;  3EFF K;  3OAA G;  3N2G A;  3OTF A;  3CXC U;  4DR7 O;  2XAJ A;  3NR7 A;  3RYH A;  1AR4 A;  1VQM V;  1YXB A;  1AR1 B;  2O57 A;  3AEI A;  2HKO A;  1IUR A;  3FFQ A;  5E1A C;  1SZT A;  3ETD A;  4J11 A;  4JI2 O;  3B8M A;  3DGE A;  2UU9 O;  4BIU A;  3HKB A;  4MS2 A;  4NXN O;  3JD4 A;  4C7U A;  3LSU A;  1GH6 A;  4PA7 A;  2PY5 A;  4P30 A;  4LP8 A;  3H1I H;  3CCL V;  1E1Q G;  2Q68 A;  2QJ1 A;  4CZZ A;  2XAS A;  1VIB A;  5KLV H;  4ZHQ A;  1AVM A;  4FM1 A;  1Y4M A;  2LFR A;  3K5O A;  4B3M B;  1EN6 A;  3SGI A;  1IX9 A;  4J7K A;  2IJH A;  5JH7 B;  1JVM A;  4LF5 B;  4JYA B;  1IBK O;  4DV5 B;  3JD1 A;  1SS3 A;  5J2T B;  2WLI A;  5GTH Z;  3E35 A;  3JAW B;  1AI6 A;  3K9S A;  3G67 A;  1V55 C;  1OCR B;  4PDM A;  1QQC A;  2DWD C;  2Q7E A;  3VBB A;  1P7G A;  1KD1 W;  5CB4 A;  1KKC A;  4X64 O;  3P3P A;  4PHZ A;  2RQ6 A;  5E79 Z;  5BZB A;  1N34 O;  4X89 A;  3FKS G;  3SPJ A;  1TUB A;  2HP8 A;  5IYB O;  3G80 A;  2JDI G;  3B40 A;  2UXB O;  4JI6 O;  1V55 B;  1O9H A;  4AQY B;  2XAG A;  1PM9 A;  3BY6 A;  1SER A;  1KP2 A;  5FNV B;  4DV4 O;  3KCX A;  1PPJ H;  1FXV A;  4JZ2 A;  2H94 A;  2QKS A;  4CS2 A;  2JGU A;  3LDD A;  5KHG A;  3SJC C;  5EC2 C;  2YC0 A;  3K03 A;  2LW7 A;  4CS4 A;  4H0L B;  3CC2 V;  4YJ3 B;  3CME V;  5JJE B;  1FAF A;  1KKD A;  4E4E A;  3CWB H;  1TUE B;  1Q3E A;  1H2N A;  1WP7 A;  4R7C A;  3ZRX A;  1K92 A;  3T1H B;  2DN9 A;  2JK5 C;  3W7T A;  4O4J B;  2XAQ A;  4Z1V A;  5JCO A;  1YI2 V;  3ETE A;  3AG2 C;  2CGO A;  5JWP A;  4MT8 A;  2YDE A;  4G28 B;  2IBZ H;  1Q7Y W;  2R72 A;  4X1Y A;  2YXY A;  5IY5 C; 
#chains in the Genus database with same CATH homology
 5B5E Z;  5KAF Z;  5B66 Z;  3JCU Z;  4UB6 Z;  3A0B Z;  5GTH Z;  5TIS Z;  1S5L Z;  5H2F Z;  4UB8 Z;  3A0H Z;  4PJ0 Z;  5E79 Z;  3WU2 Z;  3KZI Z;  4IL6 Z;  5GTI Z;  5KAI Z;  2AXT Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...