3KZIZ

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein 1
total genus 22
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3kziZ00
4IL6Z 1S5LZ 3WU2Z 2AXTZ 4UB8Z 5B66Z 4PJ0Z 3A0BZ 5H2FZ 3A0HZ 3JCUZ 5E79Z 5GTHZ 5B5EZ 4UB6Z 3KZIZ 5TISZ 5KAIZ 5GTIZ 5KAFZ
chains in the Genus database with same CATH superfamily
4B3SB 1Y66A 4LC1A 3APOA 3B4SA 1HW7A 3B8MA 2LW7A 3D36A 3RYCA 4X20A 3W7TA 3VOUA 1RSOA 4JZGA 3VQWA 1Q8IA 4UB8Z 3G80A 2K1EA 2DYSC 1XI1A 2V4DA 2EINC 3E89A 3THOA 2QKAA 2IH3C 3WG7C 3AG1B 1IXBA 3X2QB 5L3DA 3ZX6A 4JI6O 4GLXA 4GT1A 4DV4B 2UXDB 5FPRA 5CBFA 1EM1A 2KKWA 3K04A 3SGIA 4J10A 5KLVH 4I0XB 3ICXA 3BA9A 2EIJB 3ML0A 4JI2B 2X0LA 4MSWC 3AK1A 3RWRD 3RYFB 1WA8B 4UV9A 3CYOA 4JV5B 2IJHA 2ZNIA 3OGCC 3ETQA 1ZWIC 4DW1A 4LWSB 3LSQA 1PM9A 2FB5A 2ZKOA 3RVYA 2JJ1G 3OMNB 1R6KA 1TAEA 3L75H 1VP7A 1UPGA 3MHHC 4PA3A 4JI5O 4PI2A 1VQ5V 1L0LH 3SPIA 1YXBA 2Y0IA 3F7YC 3R66A 5IE9A 1XREA 1NVPB 2DW4A 4YY3B 1H2NA 1RFYA 3LDEA 4AILC 2X6BA 1WJZA 2V1DA 1L1FA 1LUWA 5LP6A 2CH7B 5IY5C 4LFBB 2LP7A 4ZI7B 4D7TA 2BSKA 1M5IA 4NTYA 4IHJB 3HKDA 1AILA 1I5YA 1G1XB 4PI0A 4TWKA 4F6EA 3ABUA 4CH4A 2P6JA 1VF6C 3CB2A 3ZMVA 3OE7G 4J7JA 2UXCO 1R3LC 3ZRXA 4AI8A 4GX2A 2FYUH 5IWAO 5B5EZ 2CTQA 2OCCB 2M7WA 1G8MA 2PUSA 5CA1B 2ZIMA 1M57C 1XMOO 3H1LH 3CRAA 3JARB 1NTKH 2P5OA 2E3CA 2ADPA 4ZHQB 4UCVA 4A5UB 1T5EA 3E22B 2YI9A 4FFBA 4PHZA 2Q5ZA 2CDYA 3TCUA 2L6LA 3IGAC 1G4YB 1XHZA 2M6YA 4JTCB 3FKSG 4I55A 5LA6A 3ZRVA 2Z3YA 2D2CB 1EN6A 4X64O 1MOFA 3N2KB 4X1YB 5H6QA 4MTGA 2HP8A 1ZTEA 2H3OA 3A8TA 4IHJA 3JYCA 3L70H 3ZS8C 1PNKA 5AG2A 1W59A 4LFAO 4O4LB 3SYCA 3DC5A 1JCHA 4GX5A 4UVAA 1XHXA 4FPPA 2QM4A 1VQPV 1K3EA 4DXWA 4G28B 3RW0A 1JQ0A 2ATKC 1S5LZ 1IBMB 1VQ9V 3QO5A 4R50A 3J80N 4AQYB 3B8NA 3N2GA 3MAQA 3QNEA 4LF5O 3QG5A 3SJCC 1LNQA 1SQFA 3JATB 2DQ3A 4UUJC 4ZOLA 4IT5A 3GVMA 4DR4O 2QWOB 3J7AU 4E2LA 1QR9A 1YITV 1N4CA 1PKXA 1ZAUA 2Q4PA 4MW3A 2UUCO 3EFFK 1Y67A 5JWPA 4RQEA 2EX3A 5JCOC 5L3GA 2KG7B 4DV3O 2RQ6A 5FNVB 1OCOB 4FLXA 1Q7YW 1HWYA 2P06A 2UU9B 2QR4A 3LSUA 5B1OA 2BTQB 2XAGA 2YC0A 3AK3A 1V9PA 3SYAA 3RN4A 2DE0X 3LDDA 3TETA 1XMOB 5LP6C 3ZJZA 4JI1B 1IBKB 2AZ2A 1JJOA 4TV8B 1N32O 4YJ3B 3C90A 3E8HA 3BPZA 1VQNV 4LH7A 1Y74A 5KAIZ 2QGNA 1K4CC 1YJ9V 2JS5A 3NR7A 2Y48A 3EXAA 4FMTA 1VF6A 5IJ9B 3K5OA 3I5DA 3STZC 1R3IC 2WA4A 1Z5WA 1ROPA 2OCCC 2HFEC 4YIPA 3ASOB 1AROP 4K8ZA 3AG1C 1U96A 4B3TB 1ZSPA 4KFMA 3CMAV 5GW7A 1Y76B 4OPAA 2Y69B 3HKCB 3CS5A 1V54C 1LR1A 4PA6A 5JJJB 1KMIZ 4LP8A 2DYRB 5IT9N 3JCZA 4F6RB 1QVGU 4DR7B 1Z5VA 1SZXA 2RNBA 1XMQB 1K8AW 2FTKA 1FAFA 4DR7O 1PP9H 2F4VO 3FB8C 4I50B 2HR3A 2E5LO 4DO2A 4LR3A 1WN7A 2E76B 3T1CA 4JYAB 2NNUA 4B7KA 2RN9A 3ZHQA 2RCVA 2Y4UA 3JATA 2LO1A 3LUTB 3OTFA 2EIKB 3SR2C 3FAVA 5GONB 3CCRV 4MTFA 2AW9A 4EFEA 2ZT9B 1JPXA 4IYIA 2ZE8A 4JI8O 3W7XA 5BMVB 2XHBA 4TOIA 2RDCA 3HKEA 1H38A 4HAMA 1GO3F 1XL6A 3TGUH 3E83A 2XAJA 4QPKA 4D7SA 3M8AA 1KB9F 1TVKA 1V55C 1Q3EA 2EULA 1HR0B 4MVRA 5B66Z 2BSKB 2IJIA 5IJ0B 2CH7A 3D3QA 4MT8A 2EILC 3L72H 4UCUA 2UU9O 4GKKB 2LW1A 2JK5C 4UFZA 4DR1B 4ICGA 3HKEB 2JGDA 2NR5A 5CBGA 2P4KA 4WBNB 1YJNV 3CMEV 4JI3B 1IVSA 3K57A 1ENVA 3SPHA 1URFA 3UO2A 3JARA 3VBBA 5EBWC 4YXWG 4LF8O 3ETGA 5D5PA 3SDLA 4Z1VA 2HHHO 1VF5B 2UXCB 2EILB 1HNXB 3FD9A 3UM7A 3ABKC 4K3AA 4KXRA 1ZL8B 4Q20A 2OYQA 1KKDA 1CEZA 2R72A 2Q68A 4DV5B 4X62O 1M93A 3UKMA 3ZN1A 4FK5C 2NN4A 5IYCO 1BSMA 5KUMA 4DRXB 2QSAA 4FM2A 4L8JA 4BW9A 1SA0B 1ZLZA 3K79A 4LNUA 3E8GA 2UXDO 4LBEC 4W4LA 4DR4B 1AI5A 4NXNB 1FXHA 2QTSA 4CS4A 4B3RO 3JAWA 3H1JH 4ZBMA 4WFAV 4X20B 3L74H 2CAZC 2DYRC 3IJ4A 2XASA 3ABKB 2DMXA 3RYIB 2DWEC 3CD6V 4YJ3A 2ZDIC 5KX5B 1NS1A 3T2MA 2ZQMA 1MG1A 4G2KA 2Q7GA 3P3PA 2P4VA 1SESA 2ZE7A 1PD3A 4WCEV 2WA3A 3OEEG 4B3MB 1SRYA 4OX9B 1YTFD 3JASB 1XNQO 3IAYA 4K0KO 2YDEA 2DOSA 1VQ4V 3B2EE 5E79Z 1NTZH 3CRRA 1KYOF 5KA5A 1F7YA 1GMGA 1V54B 3QO7A 3FFQA 4X1KA 5BZBA 4FJCC 5ITZB 1JA8A 2F23A 4FLWA 4LF6O 2Q69A 2WLJA 4DV0O 5EBLC 1KQSU 3U10A 1YF2A 3QO8A 4XDJA 2F95B 3ETEA 1H2GA 1VQKV 2VWKA 4WFGA 4IIJA 2WPDG 3ASNB 5B3SB 4AQYO 5LGNA 5C8YB 2XAQA 5KUKA 4H13B 1WPBA 1P49A 3CXHF 3AG3B 2EIJC 2C2AA 4B7EA 4TUYB 2DN9A 3ASNC 1BHAA 3APQA 3QTCA 3F5TA 4PD4F 1F4MA 4WBNA 1KU9A 4JF3A 4MVOA 4FLUA 2WWWA 1BT8A 3P30A 3W7WA 1Q82W 5JCOA 3ZHRA 4DUZB 2GUZA 5CN0A 2EZPA 3S3WA 1JJ2U 3K9AA 1P7BA 3OFNG 1J95A 1S77D 1FXKC 1VQ8V 2PI4A 2R9RB 4CBCA 1S72V 4B3SO 3OUFA 3JD3A 4X66B 4ABMA 1K7DA 3ZBHA 2R9IA 4Q6GA 2WAMA 1D5NA 2X6AA 5EK0A 3I56V 4WFFA 5IJ0A 2BCCH 3JAKB 3T1HB 1RP3B 4J41A 4RAIA 2QTOA 4YHHO 4DV1B 1N33O 3W7SA 4WF9V 1AR5A 4H33A 1S76D 2PTMA 2GUZB 1SQVH 2KB1A 2XUMA 3SYOA 2HLDG 4LFAB 3JSLA 4CC6A 5B1AC 2UUAB 4UXNA 3QF7A 3UQ8A 1D5AA 4IYHA 3BFRA 4LCUC 5EZYA 3ZMTA 4LF9O 2MK3A 2ZDIA 4IIJB 2VQFB 1VQOV 5CA1A 4JI7B 2EIMB 1AJPA 1SZTA 1JFFA 4JPRA 1BQZA 4HBNA 2W6IG 5K1XA 5LMNB 1FFXA 4I9WA 3IC9A 4QGPA 1HNWB 4NTWA 1N33B 2UUBO 4DR6O 3HB3B 1Y76A 3SPGA 3VQYA 3BAAA 3DC6A 1KKCA 3FX7A 5KHJA 1VEWA 2EINB 4JI0B 4UCTA 4JI7O 3BRCA 1K73W 1YHQV 5L3EA 2OIGA 3CRMA 3E86A 2XT9A 1YJWV 2ZR3A 2YEVB 3N2GB 1CPYA 3AG4C 3B09A 5CMUA 1TUEB 3F7VC 5IYZA 1NT2B 4B3TO 1SKVA 5BR8O 5LP6B 3VQXA 1E79G 1OCRB 3JD4A 1WP7A 3KCYA 4NYKA 4DR3O 5LOVA 2HJDA 4WFHA 2DYSB 5EBMC 3G6BA 1N34O 2LGQA 2A7WA 1OCZC 5EIBD 2QM7A 2EZOA 2WLLB 4EB6B 2UXNA 1SA0A 4I4TA 2F66C 3M99B 2H94A 4GKKO 2A9HA 3AK2A 2EBOA 1JVMA 2YIDA 4JYBA 1B3QA 3Q4HA 1DF4A 1SERA 2F93B 3WU2Z 1XNRO 3OTOB 2JEXA 4RUEA 3DSQA 3K5MA 1VQMV 2QKCA 1ZX3A 3DXRA 4U7NA 4BIUA 1YEWA 2A0LA 5IDJA 5JH7A 1QLEC 3LSSA 3H01A 1BE3H 5B1AB 4Z1MG 3E2EA 1N36O 1VMGA 4TUYA 4P9PA 4LF7O 3FAVB 3MHSC 2KG7A 3T1HO 5DEDA 3O65A 1NVPD 4EEQA 2Y4TA 1R3KC 3HR0A 5KHGA 3UCSC 1S5HC 1S0VA 5LGUA 2Q9LA 1H2LA 3FYEB 1S5JA 3DGEA 1RPOA 3K58A 4X9QA 2A79B 2FKXA 2Q7HA 1O9HA 2ODMA 2JGUA 1EN5A 1AR1B 1FKAO 5J9PC 5JQGB 4KP4A 3K5LA 1OHHG 4IL6Z 1YIJV 3WB1A 4JTDB 1GTOA 2JRIA 4ZKIA 4QNHB 3B77A 3G6EV 1W2BU 2FMLA 4FVMA 4MVMA 1R6TA 2ZM6O 2XAHA 3GWOA 4MW8A 3H1IH 1K34A 2OWOA 1AI6A 2DWDC 3JCUZ 2GDSA 4DV7O 1OZ0A 5EYPB 1NTMH 4TV9B 1OCCC 5A2QN 2QE7G 4HYOA 4B3MO 2Q6AA 4PDVA 3C3SA 4LWSA 4X88A 3CJHA 4RO2A 3MD0A 4K35A 5D5QA 4MVUA 1OCCB 2B1GA 3CPWU 4HNAB 4NXMO 2BTQA 1Q81W 3H9VA 5FPOA 4X66O 1RM1B 3LDCA 3ABMB 4X65O 1OCOC 3IFXA 2CK3G 4GYCB 2Q0AA 2XNDG 1WNSA 4JI6B 1IDSA 1GM7A 2B9ZA 2ZNJA 2HVJC 1IZ3A 2OT5A 2E75B 3O9OA 5DECA 3SPJA 3ABTA 4FLVA 5EC2C 2EIMC 1N32B 2H8PC 4TQFA 5B1BB 5EZYB 4J9YB 1IBMO 4MVSA 5TISZ 2LGWA 3G71V 4UVBA 4OX9O 1BHBA 1U97A 3K03A 1SQQH 1IBLB 5LL6Y 1PNMA 1VQ7V 4I50A 3EVKA 1HNXO 2PYJA 1TGOA 3JAKA 2ILMA 4NVPA 4CS2A 1QQCA 5HFLA 1EN4A 3GWKC 3RBZA 2WLNA 3ZMSA 2F1MA 2YXHA 2ZE6A 4KHPB 2GTSA 1SS3A 2ADQB 4UCSA 1F4NA 5FLXN 5IYDO 1SQGA 3CC4V 1AR4A 5L3CA 4I9QA 4LF5B 1Q6UA 1GN4A 3CEIA 2ZR2A 1V55B 2WLLA 4XDKA 4CH5A 3T1YO 1XQ8A 2Y0PA 1KP2A 3HPLC 1P7GA 2KQXA 1Q43A 4LF4B 1CP9A 4X62B 3ZRWA 1YTFB 1MNGA 3P3NA 3K08A 3SJQC 2JIZG 2QA4V 2JVDA 3ZIAG 1NZ6A 4DV7B 1DF5A 2EIKC 3HKBB 2HHHB 2OTJV 2VWJA 2OIEA 1BL8A 3TK1A 3CHXA 2IU0A 4BIOA 3BHPA 1E1RG 2ZCEA 2IBZH 1WP8A 2VQEB 3ZHTA 5L3FA 3JALB 3AG7A 4JI4B 5J2UA 3UT5A 4JI0O 1XMQO 3AG4B 1MSDA 4X64B 4DR2O 2IW5A 2VRZA 1XDCA 3SJBC 2HVKC 2UUAO 4I0XA 4JI2O 4J9ZB 4KUMA 5A9GA 1HNWO 4GZRB 3GB7C 3HKBA 1FJGO 4X1KB 3HKCA 2JJ2G 1M57B 5JJEB 4X1IB 3WB2A 4JZ2A 4I4TB 1SETA 1F23A 2ZIOA 3ZHUA 4H0LB 4MVZA 2GV9A 5JJNB 3CP1A 4CS3A 5BY1A 1Y4MA 1KP3A 4JGSA 4H44B 2KSDA 4U7OA 2AXTZ 1I08A 4MVQA 3M7MX 4LF8B 2XTAA 2LQTA 3UO3A 5LHHA 3A2FA 4O4IA 2RJZA 4MTOA 4DV2B 1BS3A 4DK1A 3FB6C 3JAWB 4CZZA 4RUFA 1I0HA 1QR8A 1I7FA 5EYPA 5LA6B 3OD4A 4DW0A 3CRQA 1ORQC 2W0XA 4QIWF 4GKJB 1GN2A 2L35A 4P2ZA 4YY3O 1Y74B 4I7ZB 2BTOA 4FLZA 1RM1C 2PGGA 2NLJC 3OAAG 4DR5O 3FB7C 1FYJA 3T4DA 4O4HB 5KMGB 4KHPO 1N8RW 1Q5OA 1N0NA 5LXTB 1GRJA 1SQXH 3VQVA 1IBKO 2BOCC 2YXLA 1VIBA 3L73H 1YCIA 1PPJH 3SYQA 4YJ2A 1WPXA 5CB4B 1QVFU 2OTLV 3OTOO 4ZHQA 5FNVA 4PDLA 4JAVA 1FFXB 1H2MA 2UXBO 1UFIA 3ZCCA 1BMFG 4CC5A 1KUQA 1I94B 3K0DA 4WFEA 5E1AC 1GN3A 1K5SA 4PDMA 3CCVV 3H1KH 2UXBB 1PNLA 3CXCU 3UT5B 1GK9A 4J7ZA 5H5NA 1AJNA 1WLEA 5LMNO 1AI4A 2YIAA 1HP8A 1JOYA 3H1HH 3KKYA 4DR2B 2E5LB 4ZIBA 4RWUA 1MSWD 1YZBA 1XOUA 1XUQA 5KX5A 3AEIA 1XBLA 3L9DA 3RYIA 1AP6A 1HNZO 3STLC 3CCUV 4LF9B 3G4SV 3ZRSA 1QCEA 3D3IA 2WLMA 2CGOA 4QPJA 1TUBB 5EIBC 4LFCO 1F51A 4K0KB 5CA0B 4X1YA 2GSMB 4N21A 1K4DC 1ZUQA 1K33A 1QLEB 1DGSA 1QU7A 5LMUO 1VQ6V 1R1BA 4DRXA 4NR1A 1WB7A 4TSFG 1OCRC 3ZHSA 4JAAA 3RGBA 1NJIW 5F2VO 1K5QA 4JI4O 1NU1H 4B3RB 4UCRA 2ZXWC 4I55B 1LUVA 2A06H 1KC8W 1SC5B 3D8CA 4JTAB 4J11A 2QWQB 3N27A 3ZMZA 1WA8A 1W0KG 2ZD9A 3S3XA 2N04A 1QBZA 4BW5A 3B40A 4JYCA 3ZN0A 2ZE5A 2YI8A 3JAMN 1ZL8A 4OPHA 2ITCC 1X4TA 3QVNA 1L8DA 3OMIB 1KECA 3DXRB 1AI7A 1JMKC 1TA8A 5CA3A 3CWBH 5KHIA 1M56B 3K59A 2LFSA 3KZIZ 4CH3A 4J42A 2YIBA 3OW2U 3CCLV 2N74A 3IC7A 5CBHA 4FLTA 1QLNA 4UB6Z 4XBFA 5B1NA 2F4VB 1VF7A 4UVCA 4FM1A 1H8EG 5IYZB 3W7UA 2Z5UA 5KAFZ 2IH1C 4QJFB 4NXNO 1P4RA 2PYLA 5HFMA 1US6A 4DUZO 4X8AA 1B04A 2P22C 2N05A 1D2DA 4X65B 3J81N 4LH6A 1HDJA 3A0RA 4XDLA 4TV9A 1Q6HA 1IBLO 1X59A 4R8CA 2R9AA 1AVMA 3MDSA 1XILA 2O57A 2QDOA 4LFCB 4DR6B 4TT3G 2ZM6B 1AJQA 3T4ZA 4W4KA 2ARHA 2CTPA 2R70A 3CCJV 1HNZB 3U11A 3OUSA 2WLIA 4I5SA 4ASUG 4FZ1A 5KHKA 3BVOA 2ZXWB 3G67A 4TQDA 1A32A 4X1IA 4DV0B 2ETNA 1P84F 1M1KW 4B08A 4FIPC 3DTUB 3R65A 4O2BA 5LYJB 2MW2B 5KHHA 1YSCA 2ZINA 4F6RA 4GKJO 1NH2D 3RYHA 3OEHG 5C8YA 3CCSV 4PA7A 3RYCB 2YIBD 4DV6B 3CCMV 1QNMA 2CTWA 3WB0A 4DR1O 4FFKA 4DV5O 2F43G 4DV2O 5J2TA 3PJSK 1K92A 2WLIB 3SJAC 5LXTA 1SQBH 1RPRA 4O4HA 1WAZA 1EBOA 4Z2WA 3ABLC 5K1PA 4FM0A 5LHGA 2VS0A 1H2SB 3CC7V 1B6QA 2JGDB 4JAUA 3X2QC 4EB6A 2AHYA 2A3QA 2XAFA 4JYYA 5JVDB 2XOKG 3SYPA 1MMMA 5IY5B 3K3WA 3CCEV 1DLBA 4BWAA 1N34B 1BGYH 2GBOA 4LFBO 4J80A 5J2TB 3A0HZ 5LMUB 3TXSA 1DTOA 2GHYA 4DUYB 1I5XA 1MZEA 2IJKA 3A0BZ 2QM8A 5BMVA 4CH6A 1FXKB 2Z0AA 2YSUB 5C93A 1GM8A 1GH6A 4MTXA 4L87A 2YXYA 3RFRA 1W0JG 5B1BC 3E8BA 4QE7A 5H9CA 2CGNA 4NTXA 3CC2V 3KCXA 1E1QG 5B3SC 2D3OW 1GAXA 1FS0G 3P32A 4YIOA 2JEUA 4LNUB 3ASOC 1IXMA 2K9PA 3ZMUA 3CCQV 2DJVA 1J5EO 2G38A 5H6RA 5FL7G 2ITDC 2YICA 5GONA 2X6CA 3RYHB 5LHIA 4R6ZA 4DUYO 1RSOB 2W0FC 4DYLA 4RQFA 3C3TA 2Q7EA 4DV3B 1AP5A 3EHBB 2CUGA 3OM3B 1K97A 3K0GA 4P30A 1MA1A 4DR3B 2CTRA 3KG2A 4ZOLB 1QHTA 1OCZB 3WG7B 4PA9A 2EJRA 5LBQA 2P7TC 1EFRG 1EZJA 4E4EA 1COWG 5LOVB 5ITZA 2AHZA 2JDIG 4G27B 1EZVH 5H2FZ 1GKFA 4JI5B 3HKDB 1GN6A 5IYBO 5GTIZ 2LFRA 2GTAA 3BY6A 1OJHA 2IU3A 4JI1O 3RT3C 4IGGA 1FXVA 3JASA 4OXSA 4DR5B 3CJHB 4YHHB 1H8HG 2WLHA 1G6UA 2YEVA 3TXQA 2BOBC 3RVZA 5CA0A 5KA6A 3ETDA 4F4LA 3BEHA 4JI8B 2RMKB 1IX9A 3FB5C 1JX9A 2QWPB 1R3JC 1THZA 4PELA 3FYIB 3BCCH 1PL4A 2WLKA 3I55V 3RYFA 4FFBB 4GUNA 2Y69C 3F5WC 4NB5A 1Q90D 1SQPH 1NQTA 2Q73A 4LF7B 2IJJA 2PY5A 4R7CA 3CX5F 4BAYA 4O2BB 4GX0A 1HR0O 5LGTA 1Q86W 1Y6XA 1GM9A 1FPOA 4YJ2B 1M9NA 4WFBV 4PV1B 4O4JA 4U3FH 4QE9A 3CE2A 2QWNB 2IM9A 4N23A 1S3JA 2QWRB 3AG2B 3E22A 2E74B 1PL0A 2Q0OC 2LJ2A 4NXMB 1DK1A 1AB3A 4UCOA 4EFBA 2QJ1A 3ABMC 2BE3A 2P67A 1MZFA 5LYJA 1H2KA 3D36C 3Q4HB 3L71H 4DV6O 4JI3O 1YVWA 1N0JA 4O4JB 3OT7A 4ZI7A 5J2UB 4NKGB 3K9SA 4AHCA 4PDRA 1NR1A 4U3JA 4JYAO 3OR6C 1XL4A 2HKOA 4HZ3A 5BR8B 1FFTB 4LF6B 2HG5C 1R73A 1FD9A 1NKDA 1Z2GA 3NXSA 4O4LA 5EC1C 4O4IB 1PV0A 2VQEO 2UXXA 1NR7A 1K9MW 2CE4A 2B5UA 4HNAA 2EJ7A 1UJWB 2QEXV 1IURA 5BXZA 4X89A 5DM6V 4DK0A 3AG2C 4BIZA 3ZRWB 2Q8VA 3K5NA 3PN1A 1KD1W 4UV8A 3BABA 2B1IA 4DV1O 3TJTA 4PA4A 1XEQA 3OR7C 4GCZA 1BQ0A 1FJGB 4KL1A 1NBMG 2HJFC 4EKWA 1TVKB 3OGIB 5L3BA 3LNNA 5JQGA 4DV4O 4FLYA 2UUCB 3JSNA 2YUAA 3JD2A 4H37A 3ZEDA 3U0ZA 4U3JB 1BZKA 1J5EB 2YS8A 5CB4A 2QKSA 3ABLB 1JFFB 2JS3A 4O2AB 4D6TH 4MS2A 1M4UA 2OCHA 1OV9A 3LNMB 2HEPA 3OMAB 3JALA 1KBHA 4OGQB 2PZSA 5KMGA 3BA8A 2UUBB 1I94O 1SF9A 4J7KA 4PJ0Z 3ZHVA 2PI5A 1VARA 1B06A 4FZ0A 1M90W 1FXKA 1CXZB 1N36B 3CRCA 5JH7B 1MABG 5GTHZ 4LF4O 4O2AA 2W6JG 4K8XA 2FL4A 5DN6G 2AGAA 2WSSG 3SPCA 2VQFO 1YI2V 2X7RB 1BCCH 2PF4E 1L0NH 1M56C 5JVDA 4C7UA 1JR9A 3JD1A 3AG3C 1XNRB 4GX1A 1TUBA 2AZ0A 1YDXA 5IWAB 4P9OA 1NI8A 1Q6IA 3WFVA 2P90A 3E8FA 2V7QG 4JV5O 3N2KA 4TV8A 4BR6A 1R6NA 1NH2B 1WB8A 3E35A 3K06A 3JD0A 3CSXA 4JASA 2DQ0A 1XNQB 1VQLV 3T1YB 5IJ9A 1O9GA 2Q67A
chains in the Genus database with same CATH topology
4IL6Z 1S5LZ 3WU2Z 2AXTZ 4UB8Z 5B66Z 4PJ0Z 3A0BZ 5H2FZ 3A0HZ 3JCUZ 5E79Z 5GTHZ 5B5EZ 4UB6Z 3KZIZ 5TISZ 5KAIZ 5GTIZ 5KAFZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL6 Z;  1S5L Z;  3WU2 Z;  2AXT Z;  4UB8 Z;  5B66 Z;  4PJ0 Z;  3A0B Z;  5H2F Z;  3A0H Z;  3JCU Z;  5E79 Z;  5GTH Z;  5B5E Z;  4UB6 Z;  3KZI Z;  5TIS Z;  5KAI Z;  5GTI Z;  5KAF Z; 
#chains in the Genus database with same CATH topology
 4B3S B;  1Y66 A;  4LC1 A;  3APO A;  3B4S A;  1HW7 A;  3B8M A;  2LW7 A;  3D36 A;  3RYC A;  4X20 A;  3W7T A;  3VOU A;  1RSO A;  4JZG A;  3VQW A;  1Q8I A;  4UB8 Z;  3G80 A;  2K1E A;  2DYS C;  1XI1 A;  2V4D A;  2EIN C;  3E89 A;  3THO A;  2QKA A;  2IH3 C;  3WG7 C;  3AG1 B;  1IXB A;  3X2Q B;  5L3D A;  3ZX6 A;  4JI6 O;  4GLX A;  4GT1 A;  4DV4 B;  2UXD B;  5FPR A;  5CBF A;  1EM1 A;  2KKW A;  3K04 A;  3SGI A;  4J10 A;  5KLV H;  4I0X B;  3ICX A;  3BA9 A;  2EIJ B;  3ML0 A;  4JI2 B;  2X0L A;  4MSW C;  3AK1 A;  3RWR D;  3RYF B;  1WA8 B;  4UV9 A;  3CYO A;  4JV5 B;  2IJH A;  2ZNI A;  3OGC C;  3ETQ A;  1ZWI C;  4DW1 A;  4LWS B;  3LSQ A;  1PM9 A;  2FB5 A;  2ZKO A;  3RVY A;  2JJ1 G;  3OMN B;  1R6K A;  1TAE A;  3L75 H;  1VP7 A;  1UPG A;  3MHH C;  4PA3 A;  4JI5 O;  4PI2 A;  1VQ5 V;  1L0L H;  3SPI A;  1YXB A;  2Y0I A;  3F7Y C;  3R66 A;  5IE9 A;  1XRE A;  1NVP B;  2DW4 A;  4YY3 B;  1H2N A;  1RFY A;  3LDE A;  4AIL C;  2X6B A;  1WJZ A;  2V1D A;  1L1F A;  1LUW A;  5LP6 A;  2CH7 B;  5IY5 C;  4LFB B;  2LP7 A;  4ZI7 B;  4D7T A;  2BSK A;  1M5I A;  4NTY A;  4IHJ B;  3HKD A;  1AIL A;  1I5Y A;  1G1X B;  4PI0 A;  4TWK A;  4F6E A;  3ABU A;  4CH4 A;  2P6J A;  1VF6 C;  3CB2 A;  3ZMV A;  3OE7 G;  4J7J A;  2UXC O;  1R3L C;  3ZRX A;  4AI8 A;  4GX2 A;  2FYU H;  5IWA O;  5B5E Z;  2CTQ A;  2OCC B;  2M7W A;  1G8M A;  2PUS A;  5CA1 B;  2ZIM A;  1M57 C;  1XMO O;  3H1L H;  3CRA A;  3JAR B;  1NTK H;  2P5O A;  2E3C A;  2ADP A;  4ZHQ B;  4UCV A;  4A5U B;  1T5E A;  3E22 B;  2YI9 A;  4FFB A;  4PHZ A;  2Q5Z A;  2CDY A;  3TCU A;  2L6L A;  3IGA C;  1G4Y B;  1XHZ A;  2M6Y A;  4JTC B;  3FKS G;  4I55 A;  5LA6 A;  3ZRV A;  2Z3Y A;  2D2C B;  1EN6 A;  4X64 O;  1MOF A;  3N2K B;  4X1Y B;  5H6Q A;  4MTG A;  2HP8 A;  1ZTE A;  2H3O A;  3A8T A;  4IHJ A;  3JYC A;  3L70 H;  3ZS8 C;  1PNK A;  5AG2 A;  1W59 A;  4LFA O;  4O4L B;  3SYC A;  3DC5 A;  1JCH A;  4GX5 A;  4UVA A;  1XHX A;  4FPP A;  2QM4 A;  1VQP V;  1K3E A;  4DXW A;  4G28 B;  3RW0 A;  1JQ0 A;  2ATK C;  1S5L Z;  1IBM B;  1VQ9 V;  3QO5 A;  4R50 A;  3J80 N;  4AQY B;  3B8N A;  3N2G A;  3MAQ A;  3QNE A;  4LF5 O;  3QG5 A;  3SJC C;  1LNQ A;  1SQF A;  3JAT B;  2DQ3 A;  4UUJ C;  4ZOL A;  4IT5 A;  3GVM A;  4DR4 O;  2QWO B;  3J7A U;  4E2L A;  1QR9 A;  1YIT V;  1N4C A;  1PKX A;  1ZAU A;  2Q4P A;  4MW3 A;  2UUC O;  3EFF K;  1Y67 A;  5JWP A;  4RQE A;  2EX3 A;  5JCO C;  5L3G A;  2KG7 B;  4DV3 O;  2RQ6 A;  5FNV B;  1OCO B;  4FLX A;  1Q7Y W;  1HWY A;  2P06 A;  2UU9 B;  2QR4 A;  3LSU A;  5B1O A;  2BTQ B;  2XAG A;  2YC0 A;  3AK3 A;  1V9P A;  3SYA A;  3RN4 A;  2DE0 X;  3LDD A;  3TET A;  1XMO B;  5LP6 C;  3ZJZ A;  4JI1 B;  1IBK B;  2AZ2 A;  1JJO A;  4TV8 B;  1N32 O;  4YJ3 B;  3C90 A;  3E8H A;  3BPZ A;  1VQN V;  4LH7 A;  1Y74 A;  5KAI Z;  2QGN A;  1K4C C;  1YJ9 V;  2JS5 A;  3NR7 A;  2Y48 A;  3EXA A;  4FMT A;  1VF6 A;  5IJ9 B;  3K5O A;  3I5D A;  3STZ C;  1R3I C;  2WA4 A;  1Z5W A;  1ROP A;  2OCC C;  2HFE C;  4YIP A;  3ASO B;  1ARO P;  4K8Z A;  3AG1 C;  1U96 A;  4B3T B;  1ZSP A;  4KFM A;  3CMA V;  5GW7 A;  1Y76 B;  4OPA A;  2Y69 B;  3HKC B;  3CS5 A;  1V54 C;  1LR1 A;  4PA6 A;  5JJJ B;  1KMI Z;  4LP8 A;  2DYR B;  5IT9 N;  3JCZ A;  4F6R B;  1QVG U;  4DR7 B;  1Z5V A;  1SZX A;  2RNB A;  1XMQ B;  1K8A W;  2FTK A;  1FAF A;  4DR7 O;  1PP9 H;  2F4V O;  3FB8 C;  4I50 B;  2HR3 A;  2E5L O;  4DO2 A;  4LR3 A;  1WN7 A;  2E76 B;  3T1C A;  4JYA B;  2NNU A;  4B7K A;  2RN9 A;  3ZHQ A;  2RCV A;  2Y4U A;  3JAT A;  2LO1 A;  3LUT B;  3OTF A;  2EIK B;  3SR2 C;  3FAV A;  5GON B;  3CCR V;  4MTF A;  2AW9 A;  4EFE A;  2ZT9 B;  1JPX A;  4IYI A;  2ZE8 A;  4JI8 O;  3W7X A;  5BMV B;  2XHB A;  4TOI A;  2RDC A;  3HKE A;  1H38 A;  4HAM A;  1GO3 F;  1XL6 A;  3TGU H;  3E83 A;  2XAJ A;  4QPK A;  4D7S A;  3M8A A;  1KB9 F;  1TVK A;  1V55 C;  1Q3E A;  2EUL A;  1HR0 B;  4MVR A;  5B66 Z;  2BSK B;  2IJI A;  5IJ0 B;  2CH7 A;  3D3Q A;  4MT8 A;  2EIL C;  3L72 H;  4UCU A;  2UU9 O;  4GKK B;  2LW1 A;  2JK5 C;  4UFZ A;  4DR1 B;  4ICG A;  3HKE B;  2JGD A;  2NR5 A;  5CBG A;  2P4K A;  4WBN B;  1YJN V;  3CME V;  4JI3 B;  1IVS A;  3K57 A;  1ENV A;  3SPH A;  1URF A;  3UO2 A;  3JAR A;  3VBB A;  5EBW C;  4YXW G;  4LF8 O;  3ETG A;  5D5P A;  3SDL A;  4Z1V A;  2HHH O;  1VF5 B;  2UXC B;  2EIL B;  1HNX B;  3FD9 A;  3UM7 A;  3ABK C;  4K3A A;  4KXR A;  1ZL8 B;  4Q20 A;  2OYQ A;  1KKD A;  1CEZ A;  2R72 A;  2Q68 A;  4DV5 B;  4X62 O;  1M93 A;  3UKM A;  3ZN1 A;  4FK5 C;  2NN4 A;  5IYC O;  1BSM A;  5KUM A;  4DRX B;  2QSA A;  4FM2 A;  4L8J A;  4BW9 A;  1SA0 B;  1ZLZ A;  3K79 A;  4LNU A;  3E8G A;  2UXD O;  4LBE C;  4W4L A;  4DR4 B;  1AI5 A;  4NXN B;  1FXH A;  2QTS A;  4CS4 A;  4B3R O;  3JAW A;  3H1J H;  4ZBM A;  4WFA V;  4X20 B;  3L74 H;  2CAZ C;  2DYR C;  3IJ4 A;  2XAS A;  3ABK B;  2DMX A;  3RYI B;  2DWE C;  3CD6 V;  4YJ3 A;  2ZDI C;  5KX5 B;  1NS1 A;  3T2M A;  2ZQM A;  1MG1 A;  4G2K A;  2Q7G A;  3P3P A;  2P4V A;  1SES A;  2ZE7 A;  1PD3 A;  4WCE V;  2WA3 A;  3OEE G;  4B3M B;  1SRY A;  4OX9 B;  1YTF D;  3JAS B;  1XNQ O;  3IAY A;  4K0K O;  2YDE A;  2DOS A;  1VQ4 V;  3B2E E;  5E79 Z;  1NTZ H;  3CRR A;  1KYO F;  5KA5 A;  1F7Y A;  1GMG A;  1V54 B;  3QO7 A;  3FFQ A;  4X1K A;  5BZB A;  4FJC C;  5ITZ B;  1JA8 A;  2F23 A;  4FLW A;  4LF6 O;  2Q69 A;  2WLJ A;  4DV0 O;  5EBL C;  1KQS U;  3U10 A;  1YF2 A;  3QO8 A;  4XDJ A;  2F95 B;  3ETE A;  1H2G A;  1VQK V;  2VWK A;  4WFG A;  4IIJ A;  2WPD G;  3ASN B;  5B3S B;  4AQY O;  5LGN A;  5C8Y B;  2XAQ A;  5KUK A;  4H13 B;  1WPB A;  1P49 A;  3CXH F;  3AG3 B;  2EIJ C;  2C2A A;  4B7E A;  4TUY B;  2DN9 A;  3ASN C;  1BHA A;  3APQ A;  3QTC A;  3F5T A;  4PD4 F;  1F4M A;  4WBN A;  1KU9 A;  4JF3 A;  4MVO A;  4FLU A;  2WWW A;  1BT8 A;  3P30 A;  3W7W A;  1Q82 W;  5JCO A;  3ZHR A;  4DUZ B;  2GUZ A;  5CN0 A;  2EZP A;  3S3W A;  1JJ2 U;  3K9A A;  1P7B A;  3OFN G;  1J95 A;  1S77 D;  1FXK C;  1VQ8 V;  2PI4 A;  2R9R B;  4CBC A;  1S72 V;  4B3S O;  3OUF A;  3JD3 A;  4X66 B;  4ABM A;  1K7D A;  3ZBH A;  2R9I A;  4Q6G A;  2WAM A;  1D5N A;  2X6A A;  5EK0 A;  3I56 V;  4WFF A;  5IJ0 A;  2BCC H;  3JAK B;  3T1H B;  1RP3 B;  4J41 A;  4RAI A;  2QTO A;  4YHH O;  4DV1 B;  1N33 O;  3W7S A;  4WF9 V;  1AR5 A;  4H33 A;  1S76 D;  2PTM A;  2GUZ B;  1SQV H;  2KB1 A;  2XUM A;  3SYO A;  2HLD G;  4LFA B;  3JSL A;  4CC6 A;  5B1A C;  2UUA B;  4UXN A;  3QF7 A;  3UQ8 A;  1D5A A;  4IYH A;  3BFR A;  4LCU C;  5EZY A;  3ZMT A;  4LF9 O;  2MK3 A;  2ZDI A;  4IIJ B;  2VQF B;  1VQO V;  5CA1 A;  4JI7 B;  2EIM B;  1AJP A;  1SZT A;  1JFF A;  4JPR A;  1BQZ A;  4HBN A;  2W6I G;  5K1X A;  5LMN B;  1FFX A;  4I9W A;  3IC9 A;  4QGP A;  1HNW B;  4NTW A;  1N33 B;  2UUB O;  4DR6 O;  3HB3 B;  1Y76 A;  3SPG A;  3VQY A;  3BAA A;  3DC6 A;  1KKC A;  3FX7 A;  5KHJ A;  1VEW A;  2EIN B;  4JI0 B;  4UCT A;  4JI7 O;  3BRC A;  1K73 W;  1YHQ V;  5L3E A;  2OIG A;  3CRM A;  3E86 A;  2XT9 A;  1YJW V;  2ZR3 A;  2YEV B;  3N2G B;  1CPY A;  3AG4 C;  3B09 A;  5CMU A;  1TUE B;  3F7V C;  5IYZ A;  1NT2 B;  4B3T O;  1SKV A;  5BR8 O;  5LP6 B;  3VQX A;  1E79 G;  1OCR B;  3JD4 A;  1WP7 A;  3KCY A;  4NYK A;  4DR3 O;  5LOV A;  2HJD A;  4WFH A;  2DYS B;  5EBM C;  3G6B A;  1N34 O;  2LGQ A;  2A7W A;  1OCZ C;  5EIB D;  2QM7 A;  2EZO A;  2WLL B;  4EB6 B;  2UXN A;  1SA0 A;  4I4T A;  2F66 C;  3M99 B;  2H94 A;  4GKK O;  2A9H A;  3AK2 A;  2EBO A;  1JVM A;  2YID A;  4JYB A;  1B3Q A;  3Q4H A;  1DF4 A;  1SER A;  2F93 B;  3WU2 Z;  1XNR O;  3OTO B;  2JEX A;  4RUE A;  3DSQ A;  3K5M A;  1VQM V;  2QKC A;  1ZX3 A;  3DXR A;  4U7N A;  4BIU A;  1YEW A;  2A0L A;  5IDJ A;  5JH7 A;  1QLE C;  3LSS A;  3H01 A;  1BE3 H;  5B1A B;  4Z1M G;  3E2E A;  1N36 O;  1VMG A;  4TUY A;  4P9P A;  4LF7 O;  3FAV B;  3MHS C;  2KG7 A;  3T1H O;  5DED A;  3O65 A;  1NVP D;  4EEQ A;  2Y4T A;  1R3K C;  3HR0 A;  5KHG A;  3UCS C;  1S5H C;  1S0V A;  5LGU A;  2Q9L A;  1H2L A;  3FYE B;  1S5J A;  3DGE A;  1RPO A;  3K58 A;  4X9Q A;  2A79 B;  2FKX A;  2Q7H A;  1O9H A;  2ODM A;  2JGU A;  1EN5 A;  1AR1 B;  1FKA O;  5J9P C;  5JQG B;  4KP4 A;  3K5L A;  1OHH G;  4IL6 Z;  1YIJ V;  3WB1 A;  4JTD B;  1GTO A;  2JRI A;  4ZKI A;  4QNH B;  3B77 A;  3G6E V;  1W2B U;  2FML A;  4FVM A;  4MVM A;  1R6T A;  2ZM6 O;  2XAH A;  3GWO A;  4MW8 A;  3H1I H;  1K34 A;  2OWO A;  1AI6 A;  2DWD C;  3JCU Z;  2GDS A;  4DV7 O;  1OZ0 A;  5EYP B;  1NTM H;  4TV9 B;  1OCC C;  5A2Q N;  2QE7 G;  4HYO A;  4B3M O;  2Q6A A;  4PDV A;  3C3S A;  4LWS A;  4X88 A;  3CJH A;  4RO2 A;  3MD0 A;  4K35 A;  5D5Q A;  4MVU A;  1OCC B;  2B1G A;  3CPW U;  4HNA B;  4NXM O;  2BTQ A;  1Q81 W;  3H9V A;  5FPO A;  4X66 O;  1RM1 B;  3LDC A;  3ABM B;  4X65 O;  1OCO C;  3IFX A;  2CK3 G;  4GYC B;  2Q0A A;  2XND G;  1WNS A;  4JI6 B;  1IDS A;  1GM7 A;  2B9Z A;  2ZNJ A;  2HVJ C;  1IZ3 A;  2OT5 A;  2E75 B;  3O9O A;  5DEC A;  3SPJ A;  3ABT A;  4FLV A;  5EC2 C;  2EIM C;  1N32 B;  2H8P C;  4TQF A;  5B1B B;  5EZY B;  4J9Y B;  1IBM O;  4MVS A;  5TIS Z;  2LGW A;  3G71 V;  4UVB A;  4OX9 O;  1BHB A;  1U97 A;  3K03 A;  1SQQ H;  1IBL B;  5LL6 Y;  1PNM A;  1VQ7 V;  4I50 A;  3EVK A;  1HNX O;  2PYJ A;  1TGO A;  3JAK A;  2ILM A;  4NVP A;  4CS2 A;  1QQC A;  5HFL A;  1EN4 A;  3GWK C;  3RBZ A;  2WLN A;  3ZMS A;  2F1M A;  2YXH A;  2ZE6 A;  4KHP B;  2GTS A;  1SS3 A;  2ADQ B;  4UCS A;  1F4N A;  5FLX N;  5IYD O;  1SQG A;  3CC4 V;  1AR4 A;  5L3C A;  4I9Q A;  4LF5 B;  1Q6U A;  1GN4 A;  3CEI A;  2ZR2 A;  1V55 B;  2WLL A;  4XDK A;  4CH5 A;  3T1Y O;  1XQ8 A;  2Y0P A;  1KP2 A;  3HPL C;  1P7G A;  2KQX A;  1Q43 A;  4LF4 B;  1CP9 A;  4X62 B;  3ZRW A;  1YTF B;  1MNG A;  3P3N A;  3K08 A;  3SJQ C;  2JIZ G;  2QA4 V;  2JVD A;  3ZIA G;  1NZ6 A;  4DV7 B;  1DF5 A;  2EIK C;  3HKB B;  2HHH B;  2OTJ V;  2VWJ A;  2OIE A;  1BL8 A;  3TK1 A;  3CHX A;  2IU0 A;  4BIO A;  3BHP A;  1E1R G;  2ZCE A;  2IBZ H;  1WP8 A;  2VQE B;  3ZHT A;  5L3F A;  3JAL B;  3AG7 A;  4JI4 B;  5J2U A;  3UT5 A;  4JI0 O;  1XMQ O;  3AG4 B;  1MSD A;  4X64 B;  4DR2 O;  2IW5 A;  2VRZ A;  1XDC A;  3SJB C;  2HVK C;  2UUA O;  4I0X A;  4JI2 O;  4J9Z B;  4KUM A;  5A9G A;  1HNW O;  4GZR B;  3GB7 C;  3HKB A;  1FJG O;  4X1K B;  3HKC A;  2JJ2 G;  1M57 B;  5JJE B;  4X1I B;  3WB2 A;  4JZ2 A;  4I4T B;  1SET A;  1F23 A;  2ZIO A;  3ZHU A;  4H0L B;  4MVZ A;  2GV9 A;  5JJN B;  3CP1 A;  4CS3 A;  5BY1 A;  1Y4M A;  1KP3 A;  4JGS A;  4H44 B;  2KSD A;  4U7O A;  2AXT Z;  1I08 A;  4MVQ A;  3M7M X;  4LF8 B;  2XTA A;  2LQT A;  3UO3 A;  5LHH A;  3A2F A;  4O4I A;  2RJZ A;  4MTO A;  4DV2 B;  1BS3 A;  4DK1 A;  3FB6 C;  3JAW B;  4CZZ A;  4RUF A;  1I0H A;  1QR8 A;  1I7F A;  5EYP A;  5LA6 B;  3OD4 A;  4DW0 A;  3CRQ A;  1ORQ C;  2W0X A;  4QIW F;  4GKJ B;  1GN2 A;  2L35 A;  4P2Z A;  4YY3 O;  1Y74 B;  4I7Z B;  2BTO A;  4FLZ A;  1RM1 C;  2PGG A;  2NLJ C;  3OAA G;  4DR5 O;  3FB7 C;  1FYJ A;  3T4D A;  4O4H B;  5KMG B;  4KHP O;  1N8R W;  1Q5O A;  1N0N A;  5LXT B;  1GRJ A;  1SQX H;  3VQV A;  1IBK O;  2BOC C;  2YXL A;  1VIB A;  3L73 H;  1YCI A;  1PPJ H;  3SYQ A;  4YJ2 A;  1WPX A;  5CB4 B;  1QVF U;  2OTL V;  3OTO O;  4ZHQ A;  5FNV A;  4PDL A;  4JAV A;  1FFX B;  1H2M A;  2UXB O;  1UFI A;  3ZCC A;  1BMF G;  4CC5 A;  1KUQ A;  1I94 B;  3K0D A;  4WFE A;  5E1A C;  1GN3 A;  1K5S A;  4PDM A;  3CCV V;  3H1K H;  2UXB B;  1PNL A;  3CXC U;  3UT5 B;  1GK9 A;  4J7Z A;  5H5N A;  1AJN A;  1WLE A;  5LMN O;  1AI4 A;  2YIA A;  1HP8 A;  1JOY A;  3H1H H;  3KKY A;  4DR2 B;  2E5L B;  4ZIB A;  4RWU A;  1MSW D;  1YZB A;  1XOU A;  1XUQ A;  5KX5 A;  3AEI A;  1XBL A;  3L9D A;  3RYI A;  1AP6 A;  1HNZ O;  3STL C;  3CCU V;  4LF9 B;  3G4S V;  3ZRS A;  1QCE A;  3D3I A;  2WLM A;  2CGO A;  4QPJ A;  1TUB B;  5EIB C;  4LFC O;  1F51 A;  4K0K B;  5CA0 B;  4X1Y A;  2GSM B;  4N21 A;  1K4D C;  1ZUQ A;  1K33 A;  1QLE B;  1DGS A;  1QU7 A;  5LMU O;  1VQ6 V;  1R1B A;  4DRX A;  4NR1 A;  1WB7 A;  4TSF G;  1OCR C;  3ZHS A;  4JAA A;  3RGB A;  1NJI W;  5F2V O;  1K5Q A;  4JI4 O;  1NU1 H;  4B3R B;  4UCR A;  2ZXW C;  4I55 B;  1LUV A;  2A06 H;  1KC8 W;  1SC5 B;  3D8C A;  4JTA B;  4J11 A;  2QWQ B;  3N27 A;  3ZMZ A;  1WA8 A;  1W0K G;  2ZD9 A;  3S3X A;  2N04 A;  1QBZ A;  4BW5 A;  3B40 A;  4JYC A;  3ZN0 A;  2ZE5 A;  2YI8 A;  3JAM N;  1ZL8 A;  4OPH A;  2ITC C;  1X4T A;  3QVN A;  1L8D A;  3OMI B;  1KEC A;  3DXR B;  1AI7 A;  1JMK C;  1TA8 A;  5CA3 A;  3CWB H;  5KHI A;  1M56 B;  3K59 A;  2LFS A;  3KZI Z;  4CH3 A;  4J42 A;  2YIB A;  3OW2 U;  3CCL V;  2N74 A;  3IC7 A;  5CBH A;  4FLT A;  1QLN A;  4UB6 Z;  4XBF A;  5B1N A;  2F4V B;  1VF7 A;  4UVC A;  4FM1 A;  1H8E G;  5IYZ B;  3W7U A;  2Z5U A;  5KAF Z;  2IH1 C;  4QJF B;  4NXN O;  1P4R A;  2PYL A;  5HFM A;  1US6 A;  4DUZ O;  4X8A A;  1B04 A;  2P22 C;  2N05 A;  1D2D A;  4X65 B;  3J81 N;  4LH6 A;  1HDJ A;  3A0R A;  4XDL A;  4TV9 A;  1Q6H A;  1IBL O;  1X59 A;  4R8C A;  2R9A A;  1AVM A;  3MDS A;  1XIL A;  2O57 A;  2QDO A;  4LFC B;  4DR6 B;  4TT3 G;  2ZM6 B;  1AJQ A;  3T4Z A;  4W4K A;  2ARH A;  2CTP A;  2R70 A;  3CCJ V;  1HNZ B;  3U11 A;  3OUS A;  2WLI A;  4I5S A;  4ASU G;  4FZ1 A;  5KHK A;  3BVO A;  2ZXW B;  3G67 A;  4TQD A;  1A32 A;  4X1I A;  4DV0 B;  2ETN A;  1P84 F;  1M1K W;  4B08 A;  4FIP C;  3DTU B;  3R65 A;  4O2B A;  5LYJ B;  2MW2 B;  5KHH A;  1YSC A;  2ZIN A;  4F6R A;  4GKJ O;  1NH2 D;  3RYH A;  3OEH G;  5C8Y A;  3CCS V;  4PA7 A;  3RYC B;  2YIB D;  4DV6 B;  3CCM V;  1QNM A;  2CTW A;  3WB0 A;  4DR1 O;  4FFK A;  4DV5 O;  2F43 G;  4DV2 O;  5J2T A;  3PJS K;  1K92 A;  2WLI B;  3SJA C;  5LXT A;  1SQB H;  1RPR A;  4O4H A;  1WAZ A;  1EBO A;  4Z2W A;  3ABL C;  5K1P A;  4FM0 A;  5LHG A;  2VS0 A;  1H2S B;  3CC7 V;  1B6Q A;  2JGD B;  4JAU A;  3X2Q C;  4EB6 A;  2AHY A;  2A3Q A;  2XAF A;  4JYY A;  5JVD B;  2XOK G;  3SYP A;  1MMM A;  5IY5 B;  3K3W A;  3CCE V;  1DLB A;  4BWA A;  1N34 B;  1BGY H;  2GBO A;  4LFB O;  4J80 A;  5J2T B;  3A0H Z;  5LMU B;  3TXS A;  1DTO A;  2GHY A;  4DUY B;  1I5X A;  1MZE A;  2IJK A;  3A0B Z;  2QM8 A;  5BMV A;  4CH6 A;  1FXK B;  2Z0A A;  2YSU B;  5C93 A;  1GM8 A;  1GH6 A;  4MTX A;  4L87 A;  2YXY A;  3RFR A;  1W0J G;  5B1B C;  3E8B A;  4QE7 A;  5H9C A;  2CGN A;  4NTX A;  3CC2 V;  3KCX A;  1E1Q G;  5B3S C;  2D3O W;  1GAX A;  1FS0 G;  3P32 A;  4YIO A;  2JEU A;  4LNU B;  3ASO C;  1IXM A;  2K9P A;  3ZMU A;  3CCQ V;  2DJV A;  1J5E O;  2G38 A;  5H6R A;  5FL7 G;  2ITD C;  2YIC A;  5GON A;  2X6C A;  3RYH B;  5LHI A;  4R6Z A;  4DUY O;  1RSO B;  2W0F C;  4DYL A;  4RQF A;  3C3T A;  2Q7E A;  4DV3 B;  1AP5 A;  3EHB B;  2CUG A;  3OM3 B;  1K97 A;  3K0G A;  4P30 A;  1MA1 A;  4DR3 B;  2CTR A;  3KG2 A;  4ZOL B;  1QHT A;  1OCZ B;  3WG7 B;  4PA9 A;  2EJR A;  5LBQ A;  2P7T C;  1EFR G;  1EZJ A;  4E4E A;  1COW G;  5LOV B;  5ITZ A;  2AHZ A;  2JDI G;  4G27 B;  1EZV H;  5H2F Z;  1GKF A;  4JI5 B;  3HKD B;  1GN6 A;  5IYB O;  5GTI Z;  2LFR A;  2GTA A;  3BY6 A;  1OJH A;  2IU3 A;  4JI1 O;  3RT3 C;  4IGG A;  1FXV A;  3JAS A;  4OXS A;  4DR5 B;  3CJH B;  4YHH B;  1H8H G;  2WLH A;  1G6U A;  2YEV A;  3TXQ A;  2BOB C;  3RVZ A;  5CA0 A;  5KA6 A;  3ETD A;  4F4L A;  3BEH A;  4JI8 B;  2RMK B;  1IX9 A;  3FB5 C;  1JX9 A;  2QWP B;  1R3J C;  1THZ A;  4PEL A;  3FYI B;  3BCC H;  1PL4 A;  2WLK A;  3I55 V;  3RYF A;  4FFB B;  4GUN A;  2Y69 C;  3F5W C;  4NB5 A;  1Q90 D;  1SQP H;  1NQT A;  2Q73 A;  4LF7 B;  2IJJ A;  2PY5 A;  4R7C A;  3CX5 F;  4BAY A;  4O2B B;  4GX0 A;  1HR0 O;  5LGT A;  1Q86 W;  1Y6X A;  1GM9 A;  1FPO A;  4YJ2 B;  1M9N A;  4WFB V;  4PV1 B;  4O4J A;  4U3F H;  4QE9 A;  3CE2 A;  2QWN B;  2IM9 A;  4N23 A;  1S3J A;  2QWR B;  3AG2 B;  3E22 A;  2E74 B;  1PL0 A;  2Q0O C;  2LJ2 A;  4NXM B;  1DK1 A;  1AB3 A;  4UCO A;  4EFB A;  2QJ1 A;  3ABM C;  2BE3 A;  2P67 A;  1MZF A;  5LYJ A;  1H2K A;  3D36 C;  3Q4H B;  3L71 H;  4DV6 O;  4JI3 O;  1YVW A;  1N0J A;  4O4J B;  3OT7 A;  4ZI7 A;  5J2U B;  4NKG B;  3K9S A;  4AHC A;  4PDR A;  1NR1 A;  4U3J A;  4JYA O;  3OR6 C;  1XL4 A;  2HKO A;  4HZ3 A;  5BR8 B;  1FFT B;  4LF6 B;  2HG5 C;  1R73 A;  1FD9 A;  1NKD A;  1Z2G A;  3NXS A;  4O4L A;  5EC1 C;  4O4I B;  1PV0 A;  2VQE O;  2UXX A;  1NR7 A;  1K9M W;  2CE4 A;  2B5U A;  4HNA A;  2EJ7 A;  1UJW B;  2QEX V;  1IUR A;  5BXZ A;  4X89 A;  5DM6 V;  4DK0 A;  3AG2 C;  4BIZ A;  3ZRW B;  2Q8V A;  3K5N A;  3PN1 A;  1KD1 W;  4UV8 A;  3BAB A;  2B1I A;  4DV1 O;  3TJT A;  4PA4 A;  1XEQ A;  3OR7 C;  4GCZ A;  1BQ0 A;  1FJG B;  4KL1 A;  1NBM G;  2HJF C;  4EKW A;  1TVK B;  3OGI B;  5L3B A;  3LNN A;  5JQG A;  4DV4 O;  4FLY A;  2UUC B;  3JSN A;  2YUA A;  3JD2 A;  4H37 A;  3ZED A;  3U0Z A;  4U3J B;  1BZK A;  1J5E B;  2YS8 A;  5CB4 A;  2QKS A;  3ABL B;  1JFF B;  2JS3 A;  4O2A B;  4D6T H;  4MS2 A;  1M4U A;  2OCH A;  1OV9 A;  3LNM B;  2HEP A;  3OMA B;  3JAL A;  1KBH A;  4OGQ B;  2PZS A;  5KMG A;  3BA8 A;  2UUB B;  1I94 O;  1SF9 A;  4J7K A;  4PJ0 Z;  3ZHV A;  2PI5 A;  1VAR A;  1B06 A;  4FZ0 A;  1M90 W;  1FXK A;  1CXZ B;  1N36 B;  3CRC A;  5JH7 B;  1MAB G;  5GTH Z;  4LF4 O;  4O2A A;  2W6J G;  4K8X A;  2FL4 A;  5DN6 G;  2AGA A;  2WSS G;  3SPC A;  2VQF O;  1YI2 V;  2X7R B;  1BCC H;  2PF4 E;  1L0N H;  1M56 C;  5JVD A;  4C7U A;  1JR9 A;  3JD1 A;  3AG3 C;  1XNR B;  4GX1 A;  1TUB A;  2AZ0 A;  1YDX A;  5IWA B;  4P9O A;  1NI8 A;  1Q6I A;  3WFV A;  2P90 A;  3E8F A;  2V7Q G;  4JV5 O;  3N2K A;  4TV8 A;  4BR6 A;  1R6N A;  1NH2 B;  1WB8 A;  3E35 A;  3K06 A;  3JD0 A;  3CSX A;  4JAS A;  2DQ0 A;  1XNQ B;  1VQL V;  3T1Y B;  5IJ9 A;  1O9G A;  2Q67 A; 
#chains in the Genus database with same CATH homology
 4IL6 Z;  1S5L Z;  3WU2 Z;  2AXT Z;  4UB8 Z;  5B66 Z;  4PJ0 Z;  3A0B Z;  5H2F Z;  3A0H Z;  3JCU Z;  5E79 Z;  5GTH Z;  5B5E Z;  4UB6 Z;  3KZI Z;  5TIS Z;  5KAI Z;  5GTI Z;  5KAF Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...