3KZIZ

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein 1
total genus 22
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3kziZ00
5KAFZ 1S5LZ 3KZIZ 3A0BZ 3A0HZ 3JCUZ 3WU2Z 5B66Z 5E79Z 5GTHZ 5H2FZ 5KAIZ 5TISZ 4PJ0Z 4UB8Z 5B5EZ 4UB6Z 5GTIZ 4IL6Z 2AXTZ
chains in the Genus database with same CATH superfamily
3CRAA 1JFFA 2Y4UA 3W7TA 1LNQA 1QU7A 3W7WA 4KP4A 4QE9A 4XDLA 5GTIZ 5LBQA 1IBKB 2LQTA 4L8JA 2ZE6A 3JATA 2FB5A 4I55B 2ZXWC 1DLBA 2WLIB 3ZMVA 3CC7V 2V4DA 4LF8B 4LF5B 2QR4A 3HKCA 4RAIA 1OCRC 3B8MA 2HVJC 3RBZA 4KFMA 4DV0O 5L3FA 2GDSA 2Q7EA 1YTFB 2P06A 1PV0A 4DYLA 3ZBHA 4K0KB 4CS2A 3SDLA 3BVOA 4FZ0A 5L3CA 3H1LH 1Q8IA 2E3CA 3LNMB 4X66B 5HFLA 1JFFB 1Q6UA 2LP7A 3QO7A 3ABLB 3B4SA 1CP9A 5JJNB 4QIWF 1YJWV 4DUZB 4I9WA 3D3IA 4U7NA 5D5QA 2BOBC 2YEVA 1S3JA 4LFAO 3FB6C 1FS0G 5JCOC 2Y69C 1BMFG 1P4RA 1K5SA 3L73H 3LSSA 5B1AC 1HW7A 2JGUA 3ABMB 4N21A 1Y74B 1SQPH 1P7GA 2EIKB 2JEUA 2EJRA 4FLXA 2A3QA 4MVUA 1S5LZ 2JJ1G 2HFEC 1NS1A 3JSNA 2JDIG 4LC1A 2P90A 2PF4E 3MD0A 2JS5A 1H2MA 2EIKC 5K1XA 4NXNO 2X6AA 3AG7A 4AQYO 2R72A 4CH5A 5B1AB 3K5OA 2B1IA 1XMOO 3ASOB 4X1YB 3CRMA 4X64B 1WP8A 2M6YA 2PZSA 2K1EA 2ZE5A 3RGBA 2F4VB 4AQYB 3CXCU 2DYSC 1Y74A 4O2BA 1GN4A 2QM8A 3HKDB 4IHJA 5IJ0A 4LCUC 4DV3B 5LMUB 3TGUH 1BE3H 1OCOB 4J7JA 1SQXH 5IT9N 2HEPA 4OX9O 2UXXA 2P6JA 5LA6A 4JI5B 5JJJB 5KAIZ 4J9ZB 2QKAA 3K59A 2OTLV 2ADPA 1B6QA 3ETEA 3APQA 5IJ9B 4MTOA 4YIPA 2QKSA 4NTWA 2BOCC 4AILC 4WBNB 4PELA 1H2SB 4UB6Z 1K3EA 5EZYB 1R1BA 5JQGB 3EVKA 4PA7A 4BIUA 3CCRV 2Q9LA 3S3WA 1GMGA 2JRIA 4HAMA 3SJBC 3ZHQA 1OHHG 1LUVA 2YI8A 2EIMB 3RVYA 4PDMA 2AZ0A 4JYAO 1PD3A 3K79A 2PYLA 2GTAA 4DR4B 2E75B 4WFEA 5LGTA 3H1IH 2YS8A 1YJNV 1FYJA 1QCEA 4BR6A 4DUYB 1I5XA 1HNWB 4JTAB 2ATKC 2DMXA 3DSQA 4BIZA 1IDSA 2V7QG 4DR5B 1MA1A 2Q0AA 4JV5O 1Q3EA 2KSDA 4NYKA 5LXTA 2W0FC 4OPHA 1J5EO 4HYOA 1N34O 4IGGA 5B5EZ 5L3GA 1B3QA 4NR1A 1Y66A 4DV7B 4FK5C 1PNKA 2RNBA 3ETDA 3AG3C 1WJZA 3ZRWA 1SQBH 3F5TA 1EZVH 5EC1C 2XAHA 1BSMA 4GX0A 4D6TH 2EZOA 4DR2B 3T4ZA 4BW5A 3T1HB 3CD6V 2OCCB 5BMVB 1KB9F 4YHHO 2RN9A 1OCZB 1QVFU 5IYZA 2EIMC 5EBMC 1BHAA 3FYEB 4B3MB 3RYHB 4QGPA 4WFGA 3Q4HB 5CMUA 4LFCB 2EULA 4I7ZB 5J2UA 5EIBD 3OT7A 2CH7A 3JAMN 1JQ0A 3WFVA 4FM1A 4PDVA 1TVKB 3VQVA 3PN1A 4B7KA 5FPOA 5KHJA 3QG5A 4WCEV 3E86A 2IJIA 3UM7A 2FYUH 3M99B 2P4KA 1IBLB 3L72H 2GBOA 2XHBA 1BT8A 2QE7G 3QO5A 2F66C 3MAQA 3CB2A 4FJCC 1FPOA 4QPJA 4LF6O 5FPRA 2DYSB 3FB8C 1M57C 2YUAA 5CA0B 2DJVA 2B5UA 1FXVA 1IZ3A 2ZNJA 2IJKA 5CA1B 3E8HA 1UPGA 1YTFD 2PGGA 1J5EB 2K9PA 4R7CA 4JV5B 3D8CA 4PJ0Z 2QA4V 1SA0A 3ETQA 1K9MW 5EK0A 4UVCA 1B04A 3SR2C 3CSXA 5GONB 2DWEC 5KX5B 1E79G 1Q81W 4MW3A 4LF9B 4EEQA 3RYFB 5JH7B 4I5SA 1PL0A 1SQGA 1KKDA 4TQFA 2Q67A 4DR6B 1FJGB 1S77D 3BPZA 1KD1W 2CTQA 4I9QA 2RMKB 1X59A 5ITZA 1K8AW 4AHCA 3CCVV 1GM9A 4I55A 1J95A 3CEIA 4EFBA 2L6LA 4FFKA 5IYDO 4UCVA 2Y0IA 1WA8A 5KHIA 1TA8A 3EFFK 2Q0OC 4J7KA 2OIEA 2UXCB 1TUBA 1I94B 1AP5A 3BRCA 1N36O 1DK1A 2KKWA 2IU0A 3WU2Z 1VF7A 1V54B 1ZL8A 5CN0A 1XMQB 3JD2A 3OW2U 4DXWA 1NH2D 4LFAB 4BAYA 2F93B 3BEHA 3E8GA 4LP8A 5H2FZ 4GT1A 3IC7A 1NT2B 3VQYA 1OCZC 1O9GA 2EINC 2XTAA 4O4IB 4J42A 1K33A 4DR4O 3IFXA 5LYJB 1M90W 4CZZA 1FXKC 1WPBA 2Q73A 3NR7A 3K57A 2FL4A 1DF4A 1WB7A 1OCRB 3P3NA 4LWSB 4X89A 2Q7GA 3QO8A 1URFA 5J2TB 4X65B 2EBOA 4L87A 1T5EA 2R9IA 3IJ4A 4WFAV 4NXNB 2UUAO 1OV9A 5B3SB 1N32O 1EFRG 4O2AA 1KP3A 4OPAA 1AR4A 5KMGB 1XL4A 1VQMV 3FB7C 2UXDO 4DK0A 3AG1B 5L3BA 2D2CB 4R8CA 1RM1C 2JJ2G 1IBKO 3ICXA 4DV3O 5KHGA 4DR1O 1FFXB 3SPGA 1JR9A 1BQZA 5B1BC 1DTOA 5C93A 2VRZA 4HNAA 5JH7A 5JVDA 3VQXA 4RQEA 1JX9A 2XNDG 5CBGA 1FXKB 2ZDIA 2P67A 4X62O 1G6UA 1XMOB 4O2AB 1KC8W 5L3EA 5E79Z 2YIBA 2Y48A 1BCCH 5F2VO 2DN9A 1AP6A 1S76D 5LP6A 3L9DA 3TK1A 4ZHQA 1IXMA 3K08A 4J10A 3G6BA 3LDEA 3LDCA 3SPIA 1HNZO 1ZL8B 4X1IB 1F4MA 2OIGA 2GUZB 2FTKA 2DYRC 1JJOA 5K1PA 2F95B 4H0LB 2JGDA 1GM8A 1F4NA 3BA9A 3E22B 4MVZA 4FLVA 3ABTA 2IU3A 3N2KB 4CH4A 2YIBD 3G71V 3BHPA 5EC2C 4K8ZA 4ZHQB 3K3WA 4MVMA 5A2QN 1U96A 2A06H 3WB1A 4QPKA 2AXTZ 5IYCO 2UXBO 5KAFZ 2DQ3A 1VMGA 3HKEA 3OM3B 3DTUB 5KLVH 1IX9A 2QTOA 5KA5A 3DC6A 5BR8O 4DV7O 1R6KA 3KKYA 4JAUA 1YHQV 1V55B 1ZTEA 1WPXA 3CRCA 2GHYA 4DV4O 4FLTA 2LFSA 4DV6O 2GSMB 3RVZA 2B1GA 2LFRA 1MSDA 3H1JH 3WG7B 5HFMA 1K5QA 3CCQV 1ZSPA 4J41A 3BY6A 1R3LC 4W4LA 3OTOB 3E8BA 3G67A 3UCSC 3AK1A 3CMAV 1FFXA 4LF4O 2AZ2A 1M57B 2XUMA 1BZKA 4MSWC 2EX3A 2VQEO 4FMTA 3T2MA 1KECA 5JWPA 4U7OA 4R6ZA 3R65A 3HKEB 1I08A 2FKXA 3F5WC 3MDSA 4BW9A 3FAVA 1M1KW 2DWDC 3CJHA 2HJDA 4GYCB 2UUCO 3QF7A 3ZCCA 2LO1A 2RQ6A 4CBCA 4PV1B 4JI8O 1D5AA 1WB8A 3ASNC 5KUMA 4JI2B 4YXWG 1I0HA 2AHYA 2UU9B 2ZD9A 4NXMO 2P5OA 1V55C 4G28B 2CDYA 2OYQA 1TVKA 4JI6B 4K35A 5B66Z 1VQ6V 3HKBB 5EYPB 1YITV 2ETNA 4XBFA 4X1IA 1HNZB 1EBOA 4JI6O 3X2QB 3OR6C 3ZN1A 1S5JA 4PHZA 4NXMB 4OX9B 2UXDB 3BABA 2WPDG 1FFTB 2ZR2A 3OEEG 1VQ9V 2UUBB 1AJNA 1BGYH 5B1NA 1HDJA 4KHPO 1VQNV 1KP2A 1SZXA 4JAAA 4CC6A 1XNQB 1N4CA 3F7VC 3N2GA 3JAKA 2PTMA 3H9VA 3JD0A 3ZRSA 2BTQB 1H8HG 4TV9A 1L0LH 1WN7A 3UQ8A 3OR7C 3CCMV 3JATB 1YIJV 3B2EE 3A0HZ 3SYPA 4EFEA 2YDEA 3K0GA 2QTSA 4Q6GA 2AHZA 1AB3A 1RPOA 2Q69A 3G4SV 1Q82W 4X1KA 4PDRA 1YSCA 5EIBC 3JD1A 4KL1A 3B8NA 3UT5A 4KHPB 1X4TA 1TGOA 4LF6B 5B1BB 3CHXA 1M5IA 2ARHA 3OFNG 1N0NA 5J9PC 2RDCA 3C3SA 2UUBO 3OGCC 4TT3G 3L71H 2OT5A 2JS3A 1UJWB 5H6RA 4K3AA 4Z2WA 2JVDA 4FVMA 5IY5B 3AG3B 3CPWU 2DW4A 1FAFA 1NKDA 4D7SA 5LMNB 1VQOV 2IH1C 1XI1A 1U97A 4DO2A 3TXQA 3K9SA 1VF6C 4JI8B 2YIAA 1AI4A 3E2EA 3K9AA 3OMAB 1VQKV 4IYHA 1NJIW 4YJ3A 1QQCA 4JASA 4FM2A 4DR1B 4E2LA 3KCXA 4PA9A 4ZOLA 1Q6IA 2NN4A 1GH6A 4MVRA 3HKBA 5EYPA 1XMQO 3JYCA 2XAGA 5EBLC 4QNHB 3K06A 2LJ2A 2FMLA 4PI2A 4MW8A 2RJZA 1GTOA 3X2QC 3G6EV 4N23A 3SYOA 1H2GA 1Y4MA 2XAQA 1V54C 4GKKO 3B77A 4WFHA 2A7WA 1R3KC 4DV6B 2ZIOA 1PP9H 5IYBO 4GX1A 4TV9B 1FJGO 1M56B 3JD3A 1NTMH 3SPCA 1GAXA 5D5PA 3STZC 4ZOLB 3CRRA 2ZNIA 3ABKC 1GKFA 2UXBB 4OGQB 4P30A 3STLC 1S72V 3WB2A 2H8PC 1VARA 4LNUB 1AR1B 5LGNA 1DGSA 1K73W 2OCHA 1AI5A 3A8TA 1HR0O 4YY3B 2A0LA 5BZBA 1L8DA 2UXCO 1UFIA 5JQGA 5KX5A 3ASNB 1SERA 1VF6A 3OUFA 4NVPA 5IWAO 4EB6B 1JCHA 5C8YB 1IBLO 4O4HB 4ZI7A 5DN6G 5LA6B 1VQ4V 4MVOA 2VS0A 1M56C 4JPRA 1SA0B 4DK1A 1H38A 4I4TB 2MK3A 3RYCB 1OJHA 4NTXA 1QLNA 1NBMG 3U0ZA 3LDDA 1K4CC 2IW5A 3FB5C 1BS3A 3SPHA 3BFRA 1G8MA 1VQLV 4QJFB 4KXRA 4MS2A 3OE7G 3MHSC 1GN3A 4MTGA 4DV1O 4FIPC 3ZJZA 1W59A 3CC4V 3RT3C 4UCUA 1SQQH 3HKCB 4DRXB 1NTKH 4DR3O 1Q86W 4ZIBA 4JI4B 3CCEV 4JI1O 4CH3A 4JF3A 1D2DA 3M7MX 1DF5A 1AJPA 4CC5A 1MABG 4O4IA 1MOFA 5H6QA 3CCSV 1EZJA 2HKOA 4UB8Z 2UXNA 3C90A 4X65O 4JZGA 2WLKA 1KMIZ 4AI8A 1FKAO 1MSWD 1QHTA 4GX5A 3B40A 1VQ5V 3S3XA 3JAWA 4JYYA 4F6RA 1QR9A 3JD4A 4LFBB 1K34A 1F51A 1Q5OA 2YEVB 4R50A 1AJQA 3DXRB 3LSUA 1NU1H 2Q6AA 4TQDA 2L35A 3MHHC 2C2AA 1M9NA 1QVGU 4X8AA 4UXNA 2ZQMA 3ZRXA 2ZM6O 4DR7B 2ZKOA 1P84F 4JTCB 2ADQB 4UFZA 5JCOA 5IY5C 4UCSA 2HLDG 1AROP 3OD4A 1PNLA 3CCLV 3E89A 3DGEA 1FXHA 3TETA 3ZMUA 4JYBA 4O4JB 1D5NA 2KQXA 4O4HA 3TCUA 3K5LA 1CEZA 2CE4A 3E83A 1XREA 3APOA 2BTOA 2CAZC 3JSLA 4H37A 4LF4B 2CTWA 1QLEB 2EJ7A 1JA8A 2ITCC 3JALB 2XAJA 2F1MA 4D7TA 4QE7A 5BY1A 4DV2B 3ZHVA 1H2LA 2YXLA 4DR3B 1BHBA 1ZLZA 4EKWA 3W7XA 1Z5WA 1RM1B 4JTDB 1RSOB 1US6A 1Y76A 1NI8A 4DUYO 4FLZA 4PDLA 3BCCH 3ML0A 4YHHB 2H94A 1R3IC 1XDCA 5LOVA 3J7AU 1R6NA 2QWOB 4ASUG 4O2BB 5IJ0B 3K04A 2ZIMA 4KUMA 2E5LB 3ZHUA 3ZS8C 4I0XA 4PI0A 3IGAC 1TUBB 4X1KB 4FLYA 3E8FA 2EIJB 3P30A 4F6RB 3FYIB 2Q68A 3SYAA 2Z3YA 3N2KA 3I55V 1IVSA 1QNMA 2CK3G 3ETGA 2ITDC 1H8EG 2HHHB 1O9HA 3GWOA 1NZ6A 3C3TA 4B3RO 3OTFA 4WBNA 3OAAG 3ASOC 5LOVB 2NR5A 4UVBA 5LMUO 5LHGA 2W6JG 1NVPD 3OMNB 4CS3A 1HNXB 1QBZA 2PI4A 1ZUQA 4DW0A 1MNGA 2WLLA 2KG7A 4OXSA 4O4JA 1S0VA 4PA6A 2XAFA 3J80N 3FAVB 3CE2A 3ABMC 3ZRWB 2CGOA 3WG7C 2IM9A 4GKJB 4JI7O 3VBBA 4DV5B 3SYCA 5GTHZ 4JI1B 2QGNA 3UO3A 3AEIA 4LF7O 3SJCC 2HP8A 2DYRB 1RP3B 3T1CA 2H3OA 4HNAB 4B7EA 5J2TA 1Z2GA 2EILB 4DV1B 1E1QG 2YSUB 2WLLB 1OCCB 5LGUA 1R3JC 2F4VO 5DEDA 4NB5A 4UVAA 1K4DC 4DR5O 4PA3A 1GN6A 3K5NA 4Z1VA 2NNUA 3L75H 3K0DA 3A0RA 5BMVA 1SESA 2F23A 2HJFC 1SZTA 1L0NH 1ZX3A 4Z1MG 2YXYA 1N33O 3SYQA 4WFBV 2Q8VA 3FD9A 1Q6HA 3CS5A 1L1FA 3W7UA 3AG4C 2WLNA 1PKXA 2CH7B 1MG1A 1WAZA 4F6EA 5CB4B 1I5YA 1IXBA 3H1KH 2HG5C 2QDOA 2OTJV 4F4LA 2GV9A 1LR1A 3FX7A 3GB7C 1TAEA 3SJAC 4LFBO 1S5HC 4MVQA 1AR5A 2WLJA 3JAKB 1I94O 3QNEA 3RYIA 1FXKA 1ROPA 3ZHTA 1HR0B 3RWRD 2JIZG 2BSKB 2E5LO 5FL7G 3F7YC 1WNSA 3AG2C 2A9HA 3CX5F 2VQFO 4JI5O 4JYCA 1GK9A 5JJEB 4ZKIA 4H33A 4FLUA 2NLJC 2ILMA 2P7TC 5C8YA 2PY5A 4O4LA 2IJJA 5CB4A 1N33B 3RYFA 3LUTB 2LW7A 3RN4A 1COWG 4G27B 4LF9O 2XT9A 2WLHA 3CCJV 5IJ9A 4X1YA 1WLEA 1HP8A 2ZR3A 3FFQA 2G38A 1K7DA 4X64O 1JJ2U 4DW1A 5KHHA 2WA4A 4H44B 2CUGA 3JARA 4DV2O 1SQFA 2EINB 2BSKA 4NKGB 1M93A 4FPPA 3HKDA 4IHJB 5EZYA 2VWKA 4PA4A 1H2NA 3HR0A 3H01A 4LF7B 3AK2A 5BR8B 3FKSG 1N0JA 4B3RB 1NR1A 1NR7A 2W0XA 1YEWA 1SQVH 3M8AA 3BAAA 3O9OA 2ODMA 5B1OA 1QR8A 4HBNA 2D3OW 2YIDA 1Q43A 4GLXA 3IC9A 4XDJA 3JARB 1MMMA 1W0JG 2QWPB 4JAVA 3WB0A 2Z0AA 2R9RB 4GCZA 1VF5B 2WLIA 3AG2B 4CH6A 4JI0O 2WLMA 1GM7A 3T4DA 4UCTA 4RUFA 1HNXO 3CP1A 1OCCC 4LWSA 4RQFA 4P2ZA 4YIOA 1BQ0A 3RW0A 1Q90D 3IAYA 2W6IG 4FFBB 2M7WA 2WWWA 3CXHF 4IYIA 3RYIB 4LFCO 2Q4PA 4TSFG 3OTOO 2B9ZA 3TXSA 4J9YB 2ZINA 1ZWIC 4WFFA 2DE0X 1OCOC 4PD4F 4K0KO 1YF2A 5GW7A 1AILA 4U3JA 3PJSK 2QSAA 1YVWA 2ZE7A 3H1HH 1XNRB 2Q5ZA 5LXTB 5DM6V 3Q4HA 4DV4B 3U11A 2KB1A 4UUJC 4BWAA 2Y0PA 4FZ1A 5H9CA 2CGNA 1LUWA 2GTSA 4HZ3A 4FFBA 3OEHG 2EILC 3I56V 4LH7A 3CWBH 3SJQC 1BL8A 2Y4TA 4LBEC 4WF9V 1XNQO 2R9AA 3ZX6A 1YCIA 1M4UA 2F43G 1VQ8V 3N2GB 4CS4A 5KHKA 4MT8A 1N32B 3A2FA 5J2UB 3GWKC 3SPJA 4EB6A 4UCRA 1VP7A 3D36A 1R6TA 1Y6XA 4ZI7B 1PPJH 4JI3B 4MTFA 2QM7A 4NTYA 4X20A 5LL6Y 4I4TA 4X9QA 3RYCA 1NTZH 4DRXA 1K92A 3AK3A 4GZRB 2DQ0A 2Z5UA 4B3TO 1Z5VA 2LW1A 1CXZB 3UT5B 2EZPA 1YZBA 1JPXA 4UV8A 2ZM6B 2XASA 4DR7O 1XBLA 2WAMA 5IE9A 2QWNB 1ZAUA 1N36B 1SRYA 3E22A 4X20B 1ORQC 2VQEB 2LGQA 1P7BA 2OCCC 2HR3A 3RFRA 4TOIA 2EIJC 1AI6A 3ZN0A 1IURA 2ZE8A 2YXHA 2YI9A 4C7UA 4U3JB 3QVNA 2QEXV 2QWRB 4JI7B 3U10A 2IJHA 1SKVA 2IBZH 4B08A 3A0BZ 3TJTA 2RCVA 3CYOA 1KYOF 3OMIB 1Q7YW 2QJ1A 3DXRA 4UCOA 5LP6C 3ABUA 2OWOA 3DC5A 1XQ8A 5ITZB 3R66A 2QM4A 2X6CA 5IWAB 2Q7HA 3JCZA 3QTCA 2ZDIC 3ZHSA 5LYJA 5CA3A 1K97A 1F7YA 1YDXA 1JMKC 3SGIA 1WA8B 4TV8A 4RWUA 2AGAA 2X6BA 1N8RW 1PL4A 5E1AC 5LHIA 3CCUV 2UU9O 5BXZA 4ZBMA 4Q20A 1EN4A 2CTRA 3ZRVA 1B06A 4J80A 2HHHO 1KUQA 2IH3C 1XOUA 4B3MO 4MVSA 1A32A 4MTXA 4J11A 3E35A 1YXBA 1EN6A 3AG4B 1H2KA 2BE3A 4B3SB 1SF9A 3ZMSA 1XUQA 4DUZO 3JALA 1XHXA 1FD9A 3CC2V 4G2KA 3LSQA 4I50B 4IT5A 1GN2A 3VOUA 1EM1A 2V1DA 3KG2A 3KCYA 3LNNA 3RYHA 1RSOA 1G4YB 1RFYA 1Y76B 1WP7A 5B3SC 2N05A 2E76B 2WA3A 3L70H 4ABMA 4A5UB 4K8XA 2BTQA 3B09A 1XNRO 4GKKB 4I0XB 1F23A 1I7FA 1SETA 3O65A 1XEQA 4DV0B 4YY3O 5KMGA 5L3DA 1R73A 3ZHRA 2ZT9B 1VQPV 4LF8O 2CTPA 4FLWA 1RPRA 1NVPB 1KKCA 3G80A 4JZ2A 2P4VA 2VWJA 4DR2O 1AVMA 2N04A 4FM0A 2MW2B 1JVMA 4X88A 1VIBA 2GUZA 2VQFB 5JVDB 5CBHA 2UUAB 3HB3B 4E4EA 4LH6A 2YICA 5CA0A 1W2BU 3ZMTA 1PM9A 2PUSA 5A9GA 5GONA 1IBMB 2E74B 1TUEB 5KUKA 1VEWA 3K5MA 3CMEV 1SC5B 3D36C 5CA1A 4W4KA 1W0KG 5LMNO 2QWQB 3D3QA 5KA6A 4YJ2A 4TV8B 3JASB 2X0LA 1E1RG 1YJ9V 5FNVA 1NH2B 4P9OA 1GO3F 3N27A 2LGWA 4UV9A 3L74H 4J7ZA 4B3SO 3K58A 2KG7B 4RO2A 4P9PA 5EBWC 3K03A 1VQ7V 2Y69B 1Y67A 3T1YO 3ZIAG 2JGDB 3NXSA 1ENVA 4X62B 3JAWB 5DECA 5IDJA 4YJ3B 3VQWA 4I50A 4JGSA 4YJ2B 2O57A 3ABLC 3JASA 1XHZA 3W7SA 1GRJA 2A79B 1THZA 4GX2A 5AG2A 1JOYA 4TWKA 3P3PA 2P22C 4JI4O 4GKJO 1G1XB 2DOSA 1OZ0A 5IYZB 4BIOA 2ZXWB 3CJHB 1NQTA 2JK5C 4IIJA 4IL6Z 1N34B 1MZFA 3UO2A 2AW9A 2ZCEA 4XDKA 1QLEC 3OUSA 4ICGA 1V9PA 3ABKB 2X7RB 5TISZ 5FLXN 1HNWO 1EN5A 1KQSU 1P49A 2WSSG 2PI5A 1SS3A 4TUYA 1KBHA 4JI2O 3CRQA 4JYAB 4LNUA 3EXAA 4GUNA 4U3FH 1XILA 2PYJA 1MZEA 1HWYA 2JEXA 3ZMZA 3T1YB 4IIJB 3P32A 5H5NA 2BCCH 3HPLC 1PNMA 2QKCA 4B3TB 3GVMA 2N74A 4RUEA 5CBFA 5FNVB 4LR3A 3EHBB 4O4LB 3KZIZ 3BA8A 4H13B 1YI2V 4LF5O 2R70A 2XOKG 2HVKC 1XL6A 3UKMA 4TUYB 3OGIB 3JCUZ 4JI3O 1KU9A 4DV5O 4JI0B 3J81N 1IBMO 1CPYA 3THOA 3AG1C 4DR6O 5LHHA 1AI7A 3I5DA 5LP6B 4X66O 2YC0A 3ZEDA 2UUCB 3T1HO
chains in the Genus database with same CATH topology
5KAFZ 1S5LZ 3KZIZ 3A0BZ 3A0HZ 3JCUZ 3WU2Z 5B66Z 5E79Z 5GTHZ 5H2FZ 5KAIZ 5TISZ 4PJ0Z 4UB8Z 5B5EZ 4UB6Z 5GTIZ 4IL6Z 2AXTZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF Z;  1S5L Z;  3KZI Z;  3A0B Z;  3A0H Z;  3JCU Z;  3WU2 Z;  5B66 Z;  5E79 Z;  5GTH Z;  5H2F Z;  5KAI Z;  5TIS Z;  4PJ0 Z;  4UB8 Z;  5B5E Z;  4UB6 Z;  5GTI Z;  4IL6 Z;  2AXT Z; 
#chains in the Genus database with same CATH topology
 3CRA A;  1JFF A;  2Y4U A;  3W7T A;  1LNQ A;  1QU7 A;  3W7W A;  4KP4 A;  4QE9 A;  4XDL A;  5GTI Z;  5LBQ A;  1IBK B;  2LQT A;  4L8J A;  2ZE6 A;  3JAT A;  2FB5 A;  4I55 B;  2ZXW C;  1DLB A;  2WLI B;  3ZMV A;  3CC7 V;  2V4D A;  4LF8 B;  4LF5 B;  2QR4 A;  3HKC A;  4RAI A;  1OCR C;  3B8M A;  2HVJ C;  3RBZ A;  4KFM A;  4DV0 O;  5L3F A;  2GDS A;  2Q7E A;  1YTF B;  2P06 A;  1PV0 A;  4DYL A;  3ZBH A;  4K0K B;  4CS2 A;  3SDL A;  3BVO A;  4FZ0 A;  5L3C A;  3H1L H;  1Q8I A;  2E3C A;  3LNM B;  4X66 B;  5HFL A;  1JFF B;  1Q6U A;  2LP7 A;  3QO7 A;  3ABL B;  3B4S A;  1CP9 A;  5JJN B;  4QIW F;  1YJW V;  4DUZ B;  4I9W A;  3D3I A;  4U7N A;  5D5Q A;  2BOB C;  2YEV A;  1S3J A;  4LFA O;  3FB6 C;  1FS0 G;  5JCO C;  2Y69 C;  1BMF G;  1P4R A;  1K5S A;  3L73 H;  3LSS A;  5B1A C;  1HW7 A;  2JGU A;  3ABM B;  4N21 A;  1Y74 B;  1SQP H;  1P7G A;  2EIK B;  2JEU A;  2EJR A;  4FLX A;  2A3Q A;  4MVU A;  1S5L Z;  2JJ1 G;  2HFE C;  1NS1 A;  3JSN A;  2JDI G;  4LC1 A;  2P90 A;  2PF4 E;  3MD0 A;  2JS5 A;  1H2M A;  2EIK C;  5K1X A;  4NXN O;  2X6A A;  3AG7 A;  4AQY O;  2R72 A;  4CH5 A;  5B1A B;  3K5O A;  2B1I A;  1XMO O;  3ASO B;  4X1Y B;  3CRM A;  4X64 B;  1WP8 A;  2M6Y A;  2PZS A;  2K1E A;  2ZE5 A;  3RGB A;  2F4V B;  4AQY B;  3CXC U;  2DYS C;  1Y74 A;  4O2B A;  1GN4 A;  2QM8 A;  3HKD B;  4IHJ A;  5IJ0 A;  4LCU C;  4DV3 B;  5LMU B;  3TGU H;  1BE3 H;  1OCO B;  4J7J A;  1SQX H;  5IT9 N;  2HEP A;  4OX9 O;  2UXX A;  2P6J A;  5LA6 A;  4JI5 B;  5JJJ B;  5KAI Z;  4J9Z B;  2QKA A;  3K59 A;  2OTL V;  2ADP A;  1B6Q A;  3ETE A;  3APQ A;  5IJ9 B;  4MTO A;  4YIP A;  2QKS A;  4NTW A;  2BOC C;  4AIL C;  4WBN B;  4PEL A;  1H2S B;  4UB6 Z;  1K3E A;  5EZY B;  1R1B A;  5JQG B;  3EVK A;  4PA7 A;  4BIU A;  3CCR V;  2Q9L A;  3S3W A;  1GMG A;  2JRI A;  4HAM A;  3SJB C;  3ZHQ A;  1OHH G;  1LUV A;  2YI8 A;  2EIM B;  3RVY A;  4PDM A;  2AZ0 A;  4JYA O;  1PD3 A;  3K79 A;  2PYL A;  2GTA A;  4DR4 B;  2E75 B;  4WFE A;  5LGT A;  3H1I H;  2YS8 A;  1YJN V;  1FYJ A;  1QCE A;  4BR6 A;  4DUY B;  1I5X A;  1HNW B;  4JTA B;  2ATK C;  2DMX A;  3DSQ A;  4BIZ A;  1IDS A;  2V7Q G;  4DR5 B;  1MA1 A;  2Q0A A;  4JV5 O;  1Q3E A;  2KSD A;  4NYK A;  5LXT A;  2W0F C;  4OPH A;  1J5E O;  4HYO A;  1N34 O;  4IGG A;  5B5E Z;  5L3G A;  1B3Q A;  4NR1 A;  1Y66 A;  4DV7 B;  4FK5 C;  1PNK A;  2RNB A;  3ETD A;  3AG3 C;  1WJZ A;  3ZRW A;  1SQB H;  3F5T A;  1EZV H;  5EC1 C;  2XAH A;  1BSM A;  4GX0 A;  4D6T H;  2EZO A;  4DR2 B;  3T4Z A;  4BW5 A;  3T1H B;  3CD6 V;  2OCC B;  5BMV B;  1KB9 F;  4YHH O;  2RN9 A;  1OCZ B;  1QVF U;  5IYZ A;  2EIM C;  5EBM C;  1BHA A;  3FYE B;  4B3M B;  3RYH B;  4QGP A;  4WFG A;  3Q4H B;  5CMU A;  4LFC B;  2EUL A;  4I7Z B;  5J2U A;  5EIB D;  3OT7 A;  2CH7 A;  3JAM N;  1JQ0 A;  3WFV A;  4FM1 A;  4PDV A;  1TVK B;  3VQV A;  3PN1 A;  4B7K A;  5FPO A;  5KHJ A;  3QG5 A;  4WCE V;  3E86 A;  2IJI A;  3UM7 A;  2FYU H;  3M99 B;  2P4K A;  1IBL B;  3L72 H;  2GBO A;  2XHB A;  1BT8 A;  2QE7 G;  3QO5 A;  2F66 C;  3MAQ A;  3CB2 A;  4FJC C;  1FPO A;  4QPJ A;  4LF6 O;  5FPR A;  2DYS B;  3FB8 C;  1M57 C;  2YUA A;  5CA0 B;  2DJV A;  2B5U A;  1FXV A;  1IZ3 A;  2ZNJ A;  2IJK A;  5CA1 B;  3E8H A;  1UPG A;  1YTF D;  2PGG A;  1J5E B;  2K9P A;  4R7C A;  4JV5 B;  3D8C A;  4PJ0 Z;  2QA4 V;  1SA0 A;  3ETQ A;  1K9M W;  5EK0 A;  4UVC A;  1B04 A;  3SR2 C;  3CSX A;  5GON B;  2DWE C;  5KX5 B;  1E79 G;  1Q81 W;  4MW3 A;  4LF9 B;  4EEQ A;  3RYF B;  5JH7 B;  4I5S A;  1PL0 A;  1SQG A;  1KKD A;  4TQF A;  2Q67 A;  4DR6 B;  1FJG B;  1S77 D;  3BPZ A;  1KD1 W;  2CTQ A;  4I9Q A;  2RMK B;  1X59 A;  5ITZ A;  1K8A W;  4AHC A;  3CCV V;  1GM9 A;  4I55 A;  1J95 A;  3CEI A;  4EFB A;  2L6L A;  4FFK A;  5IYD O;  4UCV A;  2Y0I A;  1WA8 A;  5KHI A;  1TA8 A;  3EFF K;  2Q0O C;  4J7K A;  2OIE A;  2UXC B;  1TUB A;  1I94 B;  1AP5 A;  3BRC A;  1N36 O;  1DK1 A;  2KKW A;  2IU0 A;  3WU2 Z;  1VF7 A;  1V54 B;  1ZL8 A;  5CN0 A;  1XMQ B;  3JD2 A;  3OW2 U;  4DXW A;  1NH2 D;  4LFA B;  4BAY A;  2F93 B;  3BEH A;  3E8G A;  4LP8 A;  5H2F Z;  4GT1 A;  3IC7 A;  1NT2 B;  3VQY A;  1OCZ C;  1O9G A;  2EIN C;  2XTA A;  4O4I B;  4J42 A;  1K33 A;  4DR4 O;  3IFX A;  5LYJ B;  1M90 W;  4CZZ A;  1FXK C;  1WPB A;  2Q73 A;  3NR7 A;  3K57 A;  2FL4 A;  1DF4 A;  1WB7 A;  1OCR B;  3P3N A;  4LWS B;  4X89 A;  2Q7G A;  3QO8 A;  1URF A;  5J2T B;  4X65 B;  2EBO A;  4L87 A;  1T5E A;  2R9I A;  3IJ4 A;  4WFA V;  4NXN B;  2UUA O;  1OV9 A;  5B3S B;  1N32 O;  1EFR G;  4O2A A;  1KP3 A;  4OPA A;  1AR4 A;  5KMG B;  1XL4 A;  1VQM V;  3FB7 C;  2UXD O;  4DK0 A;  3AG1 B;  5L3B A;  2D2C B;  4R8C A;  1RM1 C;  2JJ2 G;  1IBK O;  3ICX A;  4DV3 O;  5KHG A;  4DR1 O;  1FFX B;  3SPG A;  1JR9 A;  1BQZ A;  5B1B C;  1DTO A;  5C93 A;  2VRZ A;  4HNA A;  5JH7 A;  5JVD A;  3VQX A;  4RQE A;  1JX9 A;  2XND G;  5CBG A;  1FXK B;  2ZDI A;  2P67 A;  4X62 O;  1G6U A;  1XMO B;  4O2A B;  1KC8 W;  5L3E A;  5E79 Z;  2YIB A;  2Y48 A;  1BCC H;  5F2V O;  2DN9 A;  1AP6 A;  1S76 D;  5LP6 A;  3L9D A;  3TK1 A;  4ZHQ A;  1IXM A;  3K08 A;  4J10 A;  3G6B A;  3LDE A;  3LDC A;  3SPI A;  1HNZ O;  1ZL8 B;  4X1I B;  1F4M A;  2OIG A;  2GUZ B;  2FTK A;  2DYR C;  1JJO A;  5K1P A;  2F95 B;  4H0L B;  2JGD A;  1GM8 A;  1F4N A;  3BA9 A;  3E22 B;  4MVZ A;  4FLV A;  3ABT A;  2IU3 A;  3N2K B;  4CH4 A;  2YIB D;  3G71 V;  3BHP A;  5EC2 C;  4K8Z A;  4ZHQ B;  3K3W A;  4MVM A;  5A2Q N;  1U96 A;  2A06 H;  3WB1 A;  4QPK A;  2AXT Z;  5IYC O;  2UXB O;  5KAF Z;  2DQ3 A;  1VMG A;  3HKE A;  3OM3 B;  3DTU B;  5KLV H;  1IX9 A;  2QTO A;  5KA5 A;  3DC6 A;  5BR8 O;  4DV7 O;  1R6K A;  3KKY A;  4JAU A;  1YHQ V;  1V55 B;  1ZTE A;  1WPX A;  3CRC A;  2GHY A;  4DV4 O;  4FLT A;  2LFS A;  4DV6 O;  2GSM B;  3RVZ A;  2B1G A;  2LFR A;  1MSD A;  3H1J H;  3WG7 B;  5HFM A;  1K5Q A;  3CCQ V;  1ZSP A;  4J41 A;  3BY6 A;  1R3L C;  4W4L A;  3OTO B;  3E8B A;  3G67 A;  3UCS C;  3AK1 A;  3CMA V;  1FFX A;  4LF4 O;  2AZ2 A;  1M57 B;  2XUM A;  1BZK A;  4MSW C;  2EX3 A;  2VQE O;  4FMT A;  3T2M A;  1KEC A;  5JWP A;  4U7O A;  4R6Z A;  3R65 A;  3HKE B;  1I08 A;  2FKX A;  3F5W C;  3MDS A;  4BW9 A;  3FAV A;  1M1K W;  2DWD C;  3CJH A;  2HJD A;  4GYC B;  2UUC O;  3QF7 A;  3ZCC A;  2LO1 A;  2RQ6 A;  4CBC A;  4PV1 B;  4JI8 O;  1D5A A;  1WB8 A;  3ASN C;  5KUM A;  4JI2 B;  4YXW G;  1I0H A;  2AHY A;  2UU9 B;  2ZD9 A;  4NXM O;  2P5O A;  1V55 C;  4G28 B;  2CDY A;  2OYQ A;  1TVK A;  4JI6 B;  4K35 A;  5B66 Z;  1VQ6 V;  3HKB B;  5EYP B;  1YIT V;  2ETN A;  4XBF A;  4X1I A;  1HNZ B;  1EBO A;  4JI6 O;  3X2Q B;  3OR6 C;  3ZN1 A;  1S5J A;  4PHZ A;  4NXM B;  4OX9 B;  2UXD B;  3BAB A;  2WPD G;  1FFT B;  2ZR2 A;  3OEE G;  1VQ9 V;  2UUB B;  1AJN A;  1BGY H;  5B1N A;  1HDJ A;  4KHP O;  1VQN V;  1KP2 A;  1SZX A;  4JAA A;  4CC6 A;  1XNQ B;  1N4C A;  3F7V C;  3N2G A;  3JAK A;  2PTM A;  3H9V A;  3JD0 A;  3ZRS A;  2BTQ B;  1H8H G;  4TV9 A;  1L0L H;  1WN7 A;  3UQ8 A;  3OR7 C;  3CCM V;  3JAT B;  1YIJ V;  3B2E E;  3A0H Z;  3SYP A;  4EFE A;  2YDE A;  3K0G A;  2QTS A;  4Q6G A;  2AHZ A;  1AB3 A;  1RPO A;  2Q69 A;  3G4S V;  1Q82 W;  4X1K A;  4PDR A;  1YSC A;  5EIB C;  3JD1 A;  4KL1 A;  3B8N A;  3UT5 A;  4KHP B;  1X4T A;  1TGO A;  4LF6 B;  5B1B B;  3CHX A;  1M5I A;  2ARH A;  3OFN G;  1N0N A;  5J9P C;  2RDC A;  3C3S A;  2UUB O;  3OGC C;  4TT3 G;  3L71 H;  2OT5 A;  2JS3 A;  1UJW B;  5H6R A;  4K3A A;  4Z2W A;  2JVD A;  4FVM A;  5IY5 B;  3AG3 B;  3CPW U;  2DW4 A;  1FAF A;  1NKD A;  4D7S A;  5LMN B;  1VQO V;  2IH1 C;  1XI1 A;  1U97 A;  4DO2 A;  3TXQ A;  3K9S A;  1VF6 C;  4JI8 B;  2YIA A;  1AI4 A;  3E2E A;  3K9A A;  3OMA B;  1VQK V;  4IYH A;  1NJI W;  4YJ3 A;  1QQC A;  4JAS A;  4FM2 A;  4DR1 B;  4E2L A;  3KCX A;  4PA9 A;  4ZOL A;  1Q6I A;  2NN4 A;  1GH6 A;  4MVR A;  3HKB A;  5EYP A;  1XMQ O;  3JYC A;  2XAG A;  5EBL C;  4QNH B;  3K06 A;  2LJ2 A;  2FML A;  4PI2 A;  4MW8 A;  2RJZ A;  1GTO A;  3X2Q C;  3G6E V;  4N23 A;  3SYO A;  1H2G A;  1Y4M A;  2XAQ A;  1V54 C;  4GKK O;  3B77 A;  4WFH A;  2A7W A;  1R3K C;  4DV6 B;  2ZIO A;  1PP9 H;  5IYB O;  4GX1 A;  4TV9 B;  1FJG O;  1M56 B;  3JD3 A;  1NTM H;  3SPC A;  1GAX A;  5D5P A;  3STZ C;  4ZOL B;  3CRR A;  2ZNI A;  3ABK C;  1GKF A;  2UXB B;  4OGQ B;  4P30 A;  3STL C;  1S72 V;  3WB2 A;  2H8P C;  1VAR A;  4LNU B;  1AR1 B;  5LGN A;  1DGS A;  1K73 W;  2OCH A;  1AI5 A;  3A8T A;  1HR0 O;  4YY3 B;  2A0L A;  5BZB A;  1L8D A;  2UXC O;  1UFI A;  5JQG A;  5KX5 A;  3ASN B;  1SER A;  1VF6 A;  3OUF A;  4NVP A;  5IWA O;  4EB6 B;  1JCH A;  5C8Y B;  1IBL O;  4O4H B;  4ZI7 A;  5DN6 G;  5LA6 B;  1VQ4 V;  4MVO A;  2VS0 A;  1M56 C;  4JPR A;  1SA0 B;  4DK1 A;  1H38 A;  4I4T B;  2MK3 A;  3RYC B;  1OJH A;  4NTX A;  1QLN A;  1NBM G;  3U0Z A;  3LDD A;  1K4C C;  2IW5 A;  3FB5 C;  1BS3 A;  3SPH A;  3BFR A;  1G8M A;  1VQL V;  4QJF B;  4KXR A;  4MS2 A;  3OE7 G;  3MHS C;  1GN3 A;  4MTG A;  4DV1 O;  4FIP C;  3ZJZ A;  1W59 A;  3CC4 V;  3RT3 C;  4UCU A;  1SQQ H;  3HKC B;  4DRX B;  1NTK H;  4DR3 O;  1Q86 W;  4ZIB A;  4JI4 B;  3CCE V;  4JI1 O;  4CH3 A;  4JF3 A;  1D2D A;  3M7M X;  1DF5 A;  1AJP A;  4CC5 A;  1MAB G;  4O4I A;  1MOF A;  5H6Q A;  3CCS V;  1EZJ A;  2HKO A;  4UB8 Z;  2UXN A;  3C90 A;  4X65 O;  4JZG A;  2WLK A;  1KMI Z;  4AI8 A;  1FKA O;  1MSW D;  1QHT A;  4GX5 A;  3B40 A;  1VQ5 V;  3S3X A;  3JAW A;  4JYY A;  4F6R A;  1QR9 A;  3JD4 A;  4LFB B;  1K34 A;  1F51 A;  1Q5O A;  2YEV B;  4R50 A;  1AJQ A;  3DXR B;  3LSU A;  1NU1 H;  2Q6A A;  4TQD A;  2L35 A;  3MHH C;  2C2A A;  1M9N A;  1QVG U;  4X8A A;  4UXN A;  2ZQM A;  3ZRX A;  2ZM6 O;  4DR7 B;  2ZKO A;  1P84 F;  4JTC B;  2ADQ B;  4UFZ A;  5JCO A;  5IY5 C;  4UCS A;  2HLD G;  1ARO P;  3OD4 A;  1PNL A;  3CCL V;  3E89 A;  3DGE A;  1FXH A;  3TET A;  3ZMU A;  4JYB A;  4O4J B;  1D5N A;  2KQX A;  4O4H A;  3TCU A;  3K5L A;  1CEZ A;  2CE4 A;  3E83 A;  1XRE A;  3APO A;  2BTO A;  2CAZ C;  3JSL A;  4H37 A;  4LF4 B;  2CTW A;  1QLE B;  2EJ7 A;  1JA8 A;  2ITC C;  3JAL B;  2XAJ A;  2F1M A;  4D7T A;  4QE7 A;  5BY1 A;  4DV2 B;  3ZHV A;  1H2L A;  2YXL A;  4DR3 B;  1BHB A;  1ZLZ A;  4EKW A;  3W7X A;  1Z5W A;  1RM1 B;  4JTD B;  1RSO B;  1US6 A;  1Y76 A;  1NI8 A;  4DUY O;  4FLZ A;  4PDL A;  3BCC H;  3ML0 A;  4YHH B;  2H94 A;  1R3I C;  1XDC A;  5LOV A;  3J7A U;  1R6N A;  2QWO B;  4ASU G;  4O2B B;  5IJ0 B;  3K04 A;  2ZIM A;  4KUM A;  2E5L B;  3ZHU A;  3ZS8 C;  4I0X A;  4PI0 A;  3IGA C;  1TUB B;  4X1K B;  4FLY A;  3E8F A;  2EIJ B;  3P30 A;  4F6R B;  3FYI B;  2Q68 A;  3SYA A;  2Z3Y A;  3N2K A;  3I55 V;  1IVS A;  1QNM A;  2CK3 G;  3ETG A;  2ITD C;  1H8E G;  2HHH B;  1O9H A;  3GWO A;  1NZ6 A;  3C3T A;  4B3R O;  3OTF A;  4WBN A;  3OAA G;  3ASO C;  5LOV B;  2NR5 A;  4UVB A;  5LMU O;  5LHG A;  2W6J G;  1NVP D;  3OMN B;  4CS3 A;  1HNX B;  1QBZ A;  2PI4 A;  1ZUQ A;  4DW0 A;  1MNG A;  2WLL A;  2KG7 A;  4OXS A;  4O4J A;  1S0V A;  4PA6 A;  2XAF A;  3J80 N;  3FAV B;  3CE2 A;  3ABM C;  3ZRW B;  2CGO A;  3WG7 C;  2IM9 A;  4GKJ B;  4JI7 O;  3VBB A;  4DV5 B;  3SYC A;  5GTH Z;  4JI1 B;  2QGN A;  3UO3 A;  3AEI A;  4LF7 O;  3SJC C;  2HP8 A;  2DYR B;  1RP3 B;  3T1C A;  2H3O A;  4HNA B;  4B7E A;  5J2T A;  1Z2G A;  2EIL B;  4DV1 B;  1E1Q G;  2YSU B;  2WLL B;  1OCC B;  5LGU A;  1R3J C;  2F4V O;  5DED A;  4NB5 A;  4UVA A;  1K4D C;  4DR5 O;  4PA3 A;  1GN6 A;  3K5N A;  4Z1V A;  2NNU A;  3L75 H;  3K0D A;  3A0R A;  5BMV A;  1SES A;  2F23 A;  2HJF C;  1SZT A;  1L0N H;  1ZX3 A;  4Z1M G;  2YXY A;  1N33 O;  3SYQ A;  4WFB V;  2Q8V A;  3FD9 A;  1Q6H A;  3CS5 A;  1L1F A;  3W7U A;  3AG4 C;  2WLN A;  1PKX A;  2CH7 B;  1MG1 A;  1WAZ A;  4F6E A;  5CB4 B;  1I5Y A;  1IXB A;  3H1K H;  2HG5 C;  2QDO A;  2OTJ V;  4F4L A;  2GV9 A;  1LR1 A;  3FX7 A;  3GB7 C;  1TAE A;  3SJA C;  4LFB O;  1S5H C;  4MVQ A;  1AR5 A;  2WLJ A;  3JAK B;  1I94 O;  3QNE A;  3RYI A;  1FXK A;  1ROP A;  3ZHT A;  1HR0 B;  3RWR D;  2JIZ G;  2BSK B;  2E5L O;  5FL7 G;  3F7Y C;  1WNS A;  3AG2 C;  2A9H A;  3CX5 F;  2VQF O;  4JI5 O;  4JYC A;  1GK9 A;  5JJE B;  4ZKI A;  4H33 A;  4FLU A;  2NLJ C;  2ILM A;  2P7T C;  5C8Y A;  2PY5 A;  4O4L A;  2IJJ A;  5CB4 A;  1N33 B;  3RYF A;  3LUT B;  2LW7 A;  3RN4 A;  1COW G;  4G27 B;  4LF9 O;  2XT9 A;  2WLH A;  3CCJ V;  5IJ9 A;  4X1Y A;  1WLE A;  1HP8 A;  2ZR3 A;  3FFQ A;  2G38 A;  1K7D A;  4X64 O;  1JJ2 U;  4DW1 A;  5KHH A;  2WA4 A;  4H44 B;  2CUG A;  3JAR A;  4DV2 O;  1SQF A;  2EIN B;  2BSK A;  4NKG B;  1M93 A;  4FPP A;  3HKD A;  4IHJ B;  5EZY A;  2VWK A;  4PA4 A;  1H2N A;  3HR0 A;  3H01 A;  4LF7 B;  3AK2 A;  5BR8 B;  3FKS G;  1N0J A;  4B3R B;  1NR1 A;  1NR7 A;  2W0X A;  1YEW A;  1SQV H;  3M8A A;  3BAA A;  3O9O A;  2ODM A;  5B1O A;  1QR8 A;  4HBN A;  2D3O W;  2YID A;  1Q43 A;  4GLX A;  3IC9 A;  4XDJ A;  3JAR B;  1MMM A;  1W0J G;  2QWP B;  4JAV A;  3WB0 A;  2Z0A A;  2R9R B;  4GCZ A;  1VF5 B;  2WLI A;  3AG2 B;  4CH6 A;  4JI0 O;  2WLM A;  1GM7 A;  3T4D A;  4UCT A;  4RUF A;  1HNX O;  3CP1 A;  1OCC C;  4LWS A;  4RQF A;  4P2Z A;  4YIO A;  1BQ0 A;  3RW0 A;  1Q90 D;  3IAY A;  2W6I G;  4FFB B;  2M7W A;  2WWW A;  3CXH F;  4IYI A;  3RYI B;  4LFC O;  2Q4P A;  4TSF G;  3OTO O;  2B9Z A;  3TXS A;  4J9Y B;  2ZIN A;  1ZWI C;  4WFF A;  2DE0 X;  1OCO C;  4PD4 F;  4K0K O;  1YF2 A;  5GW7 A;  1AIL A;  4U3J A;  3PJS K;  2QSA A;  1YVW A;  2ZE7 A;  3H1H H;  1XNR B;  2Q5Z A;  5LXT B;  5DM6 V;  3Q4H A;  4DV4 B;  3U11 A;  2KB1 A;  4UUJ C;  4BWA A;  2Y0P A;  4FZ1 A;  5H9C A;  2CGN A;  1LUW A;  2GTS A;  4HZ3 A;  4FFB A;  3OEH G;  2EIL C;  3I56 V;  4LH7 A;  3CWB H;  3SJQ C;  1BL8 A;  2Y4T A;  4LBE C;  4WF9 V;  1XNQ O;  2R9A A;  3ZX6 A;  1YCI A;  1M4U A;  2F43 G;  1VQ8 V;  3N2G B;  4CS4 A;  5KHK A;  4MT8 A;  1N32 B;  3A2F A;  5J2U B;  3GWK C;  3SPJ A;  4EB6 A;  4UCR A;  1VP7 A;  3D36 A;  1R6T A;  1Y6X A;  4ZI7 B;  1PPJ H;  4JI3 B;  4MTF A;  2QM7 A;  4NTY A;  4X20 A;  5LL6 Y;  4I4T A;  4X9Q A;  3RYC A;  1NTZ H;  4DRX A;  1K92 A;  3AK3 A;  4GZR B;  2DQ0 A;  2Z5U A;  4B3T O;  1Z5V A;  2LW1 A;  1CXZ B;  3UT5 B;  2EZP A;  1YZB A;  1JPX A;  4UV8 A;  2ZM6 B;  2XAS A;  4DR7 O;  1XBL A;  2WAM A;  5IE9 A;  2QWN B;  1ZAU A;  1N36 B;  1SRY A;  3E22 A;  4X20 B;  1ORQ C;  2VQE B;  2LGQ A;  1P7B A;  2OCC C;  2HR3 A;  3RFR A;  4TOI A;  2EIJ C;  1AI6 A;  3ZN0 A;  1IUR A;  2ZE8 A;  2YXH A;  2YI9 A;  4C7U A;  4U3J B;  3QVN A;  2QEX V;  2QWR B;  4JI7 B;  3U10 A;  2IJH A;  1SKV A;  2IBZ H;  4B08 A;  3A0B Z;  3TJT A;  2RCV A;  3CYO A;  1KYO F;  3OMI B;  1Q7Y W;  2QJ1 A;  3DXR A;  4UCO A;  5LP6 C;  3ABU A;  2OWO A;  3DC5 A;  1XQ8 A;  5ITZ B;  3R66 A;  2QM4 A;  2X6C A;  5IWA B;  2Q7H A;  3JCZ A;  3QTC A;  2ZDI C;  3ZHS A;  5LYJ A;  5CA3 A;  1K97 A;  1F7Y A;  1YDX A;  1JMK C;  3SGI A;  1WA8 B;  4TV8 A;  4RWU A;  2AGA A;  2X6B A;  1N8R W;  1PL4 A;  5E1A C;  5LHI A;  3CCU V;  2UU9 O;  5BXZ A;  4ZBM A;  4Q20 A;  1EN4 A;  2CTR A;  3ZRV A;  1B06 A;  4J80 A;  2HHH O;  1KUQ A;  2IH3 C;  1XOU A;  4B3M O;  4MVS A;  1A32 A;  4MTX A;  4J11 A;  3E35 A;  1YXB A;  1EN6 A;  3AG4 B;  1H2K A;  2BE3 A;  4B3S B;  1SF9 A;  3ZMS A;  1XUQ A;  4DUZ O;  3JAL A;  1XHX A;  1FD9 A;  3CC2 V;  4G2K A;  3LSQ A;  4I50 B;  4IT5 A;  1GN2 A;  3VOU A;  1EM1 A;  2V1D A;  3KG2 A;  3KCY A;  3LNN A;  3RYH A;  1RSO A;  1G4Y B;  1RFY A;  1Y76 B;  1WP7 A;  5B3S C;  2N05 A;  2E76 B;  2WA3 A;  3L70 H;  4ABM A;  4A5U B;  4K8X A;  2BTQ A;  3B09 A;  1XNR O;  4GKK B;  4I0X B;  1F23 A;  1I7F A;  1SET A;  3O65 A;  1XEQ A;  4DV0 B;  4YY3 O;  5KMG A;  5L3D A;  1R73 A;  3ZHR A;  2ZT9 B;  1VQP V;  4LF8 O;  2CTP A;  4FLW A;  1RPR A;  1NVP B;  1KKC A;  3G80 A;  4JZ2 A;  2P4V A;  2VWJ A;  4DR2 O;  1AVM A;  2N04 A;  4FM0 A;  2MW2 B;  1JVM A;  4X88 A;  1VIB A;  2GUZ A;  2VQF B;  5JVD B;  5CBH A;  2UUA B;  3HB3 B;  4E4E A;  4LH6 A;  2YIC A;  5CA0 A;  1W2B U;  3ZMT A;  1PM9 A;  2PUS A;  5A9G A;  5GON A;  1IBM B;  2E74 B;  1TUE B;  5KUK A;  1VEW A;  3K5M A;  3CME V;  1SC5 B;  3D36 C;  5CA1 A;  4W4K A;  1W0K G;  5LMN O;  2QWQ B;  3D3Q A;  5KA6 A;  4YJ2 A;  4TV8 B;  3JAS B;  2X0L A;  1E1R G;  1YJ9 V;  5FNV A;  1NH2 B;  4P9O A;  1GO3 F;  3N27 A;  2LGW A;  4UV9 A;  3L74 H;  4J7Z A;  4B3S O;  3K58 A;  2KG7 B;  4RO2 A;  4P9P A;  5EBW C;  3K03 A;  1VQ7 V;  2Y69 B;  1Y67 A;  3T1Y O;  3ZIA G;  2JGD B;  3NXS A;  1ENV A;  4X62 B;  3JAW B;  5DEC A;  5IDJ A;  4YJ3 B;  3VQW A;  4I50 A;  4JGS A;  4YJ2 B;  2O57 A;  3ABL C;  3JAS A;  1XHZ A;  3W7S A;  1GRJ A;  2A79 B;  1THZ A;  4GX2 A;  5AG2 A;  1JOY A;  4TWK A;  3P3P A;  2P22 C;  4JI4 O;  4GKJ O;  1G1X B;  2DOS A;  1OZ0 A;  5IYZ B;  4BIO A;  2ZXW B;  3CJH B;  1NQT A;  2JK5 C;  4IIJ A;  4IL6 Z;  1N34 B;  1MZF A;  3UO2 A;  2AW9 A;  2ZCE A;  4XDK A;  1QLE C;  3OUS A;  4ICG A;  1V9P A;  3ABK B;  2X7R B;  5TIS Z;  5FLX N;  1HNW O;  1EN5 A;  1KQS U;  1P49 A;  2WSS G;  2PI5 A;  1SS3 A;  4TUY A;  1KBH A;  4JI2 O;  3CRQ A;  4JYA B;  4LNU A;  3EXA A;  4GUN A;  4U3F H;  1XIL A;  2PYJ A;  1MZE A;  1HWY A;  2JEX A;  3ZMZ A;  3T1Y B;  4IIJ B;  3P32 A;  5H5N A;  2BCC H;  3HPL C;  1PNM A;  2QKC A;  4B3T B;  3GVM A;  2N74 A;  4RUE A;  5CBF A;  5FNV B;  4LR3 A;  3EHB B;  4O4L B;  3KZI Z;  3BA8 A;  4H13 B;  1YI2 V;  4LF5 O;  2R70 A;  2XOK G;  2HVK C;  1XL6 A;  3UKM A;  4TUY B;  3OGI B;  3JCU Z;  4JI3 O;  1KU9 A;  4DV5 O;  4JI0 B;  3J81 N;  1IBM O;  1CPY A;  3THO A;  3AG1 C;  4DR6 O;  5LHH A;  1AI7 A;  3I5D A;  5LP6 B;  4X66 O;  2YC0 A;  3ZED A;  2UUC B;  3T1H O; 
#chains in the Genus database with same CATH homology
 5KAF Z;  1S5L Z;  3KZI Z;  3A0B Z;  3A0H Z;  3JCU Z;  3WU2 Z;  5B66 Z;  5E79 Z;  5GTH Z;  5H2F Z;  5KAI Z;  5TIS Z;  4PJ0 Z;  4UB8 Z;  5B5E Z;  4UB6 Z;  5GTI Z;  4IL6 Z;  2AXT Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...