3KZIZ

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3kziZ00
5B66Z 3KZIZ 4PJ0Z 5GTIZ 4UB6Z 2AXTZ 5GTHZ 5KAIZ 5KAFZ 1S5LZ 3WU2Z 4UB8Z 3A0HZ 3JCUZ 5E79Z 4IL6Z 3A0BZ 5H2FZ 5TISZ 5B5EZ
chains in the Genus database with same CATH superfamily
2ILMA 2M7WA 1FYJA 5LMUB 4NTYA 3CC2V 1SA0A 4LF8B 1GN3A 4LFAB 3CJHA 2Y4UA 3JASB 4TOIA 4LF9O 4DK1A 1WB8A 2W0FC 2YI9A 2NR5A 1V9PA 4FMTA 2H3OA 4HZ3A 1F7YA 2JK5C 4FJCC 4RUFA 3CD6V 2PZSA 3FAVB 1LNQA 2CTPA 3GVMA 1Y4MA 5DECA 4YHHB 2XNDG 2F95B 3B77A 2P67A 4RUEA 2ZNIA 4IHJA 1MA1A 2ZT9B 3CPWU 1MABG 5EZYB 1ORQC 3TXQA 1NS1A 3CCJV 3D3QA 4I0XA 2DYSB 5IWAB 1KKCA 1Z5VA 2QWNB 4H13B 1QLEC 4MTXA 1V54B 3K5LA 2VS0A 2G38A 1Q6UA 1NVPD 4D7SA 5EIBC 2Q5ZA 1N0NA 4I50B 2CGOA 1RSOA 2NLJC 2LQTA 3OAAG 3D36C 1KBHA 3ZHUA 3HKEA 3CEIA 3I5DA 4FFBB 1W59A 1OV9A 2F4VB 5BR8B 2YI8A 3NR7A 1VQKV 4J7KA 5CMUA 4W4KA 1BMFG 5C8YA 3HKDB 2DJVA 2ZQMA 4TWKA 1KQSU 4JI5O 1KMIZ 3H1LH 3P3PA 1TUEB 3ABTA 4JI6B 3CCQV 3DC6A 1BQZA 1SESA 1I94B 4DR6B 1SKVA 2A7WA 4QNHB 4K8ZA 4TV8B 1QR8A 2JIZG 2WA4A 3ZMTA 4QIWF 4PA9A 1XI1A 3QO8A 4NTWA 2R72A 3VQXA 5KAFZ 2XAFA 1PM9A 3MHSC 4F4LA 3T1YO 2WLLB 1X59A 2XTAA 1YEWA 4GT1A 4ZI7B 4LF7B 1N36B 3TK1A 4DO2A 4EKWA 3ZN0A 5CBGA 2IJIA 1JR9A 4N23A 4B3RB 1VF6C 4GX1A 5EIBD 4TSFG 4JASA 2GUZA 1XEQA 2ZR3A 4LFBO 3ZCCA 1P4RA 2UUCB 1H38A 1D5AA 3APOA 5IYZA 4CS2A 3OMNB 1PNLA 3SYPA 4DUZB 2N04A 3SR2C 4XDJA 1B3QA 3EFFK 4TQFA 2GSMB 1KC8W 3QO7A 1Z5WA 1IBKO 2D2CB 2ZDIC 2X0LA 1VQ7V 2NNUA 4DR5O 3WB0A 2Q0OC 3CJHB 4X64B 4KL1A 4JI4O 1K3EA 5CBHA 2YSUB 2UXDO 4JI3B 5L3GA 4UVAA 3CRAA 4NKGB 5EC2C 3OFNG 4LC1A 3ASNC 3UO2A 1IZ3A 1XNQO 4NXNB 3BA8A 2A3QA 3QG5A 1Y67A 3VQVA 4DV5B 1VQ9V 3L75H 2HVJC 2QKCA 4PDMA 2YEVA 5CBFA 1ZUQA 2Y48A 3ETEA 4I0XB 5LL6Y 4U3JB 5EBWC 4G27B 4MTOA 4PD4F 4JAVA 1R6NA 3T4DA 5L3EA 3A0RA 2L35A 2XUMA 2E5LB 2CAZC 2P4KA 2Q67A 1CPYA 5LMUO 3JD2A 3SJBC 3CWBH 3VQYA 1RSOB 1EFRG 4LFAO 1V55B 1SZXA 2YUAA 5JVDA 2E3CA 3DTUB 2EINB 2ZCEA 3BEHA 4W4LA 3N2KB 2F66C 4I7ZB 4JI7B 2CTRA 3G71V 1XOUA 3EVKA 3K3WA 2WAMA 4DV3B 2N05A 3O65A 4YHHO 2MK3A 4KXRA 2IM9A 2QTOA 5GONA 2MW2B 4WBNA 3E8FA 3OEEG 2WA3A 1PNKA 3K03A 4QPJA 2QA4V 5IWAO 1WB7A 1BSMA 2HHHB 1NT2B 3RFRA 1M57B 4MVMA 1B04A 1MOFA 2DYRC 3W7WA 3ZX6A 1IBMO 3LDEA 2IU3A 2CUGA 3P32A 1DK1A 3OUSA 4LF6B 1WLEA 2HKOA 4O2BA 3T4ZA 2HP8A 1K5SA 2PI5A 5IYBO 3I55V 2JDIG 5D5QA 4UUJC 4G2KA 2AHZA 3IC9A 1OZ0A 3C3TA 2ARHA 5IYZB 1I94O 2BOBC 4OPHA 2HVKC 2C2AA 2Q7GA 2OCCB 2Y0IA 1VQPV 4I4TB 2EIMB 2IU0A 1RM1C 2JGUA 1JMKC 1MZEA 4X1KB 4F6EA 2Z5UA 1L0LH 1YZBA 1O9GA 2JRIA 5CB4B 3AEIA 3OUFA 1QQCA 4PA7A 3LDDA 4PA3A 4EB6B 4PA6A 3FX7A 4LF4B 4JF3A 3BFRA 5LHHA 5BMVB 1GO3F 1V54C 3E2EA 4B3RO 3ZEDA 4O4IA 3B40A 3OD4A 5B1AB 3FB8C 1H2KA 3E86A 1NTZH 1O9HA 1FXVA 3B8NA 2UUCO 2HG5C 2Q9LA 2ZE8A 3LUTB 4MVSA 2UUAB 2AGAA 5HFLA 4UV9A 4XDKA 2QE7G 3W7UA 3ZJZA 1IURA 2YDEA 4RWUA 3VOUA 4EEQA 2DOSA 1H2MA 3OTOB 5GTHZ 5LYJA 4X64O 3MDSA 4BAYA 4FPPA 3SYAA 5FPRA 4FZ0A 2OCHA 5JH7A 1EM1A 1I5YA 1WA8A 2FTKA 3RYHA 2QR4A 4NXNO 3BVOA 2KSDA 3CHXA 5JJJB 1IVSA 3CRCA 3L70H 3CCVV 4TT3G 4DK0A 1FXKC 1SRYA 2BOCC 1JPXA 3JCUZ 2FL4A 1Q82W 4B3SO 1NTKH 4O4LB 2LP7A 2DWDC 3CB2A 1L0NH 1EN6A 4X20A 3IAYA 3JATA 5K1XA 1FS0G 3GWKC 1JVMA 1QU7A 3WB2A 4MW3A 3ICXA 4TV9B 4I55A 2IJHA 1URFA 1VMGA 5J2TA 3HB3B 3T1HB 4MTGA 4UCSA 4JI7O 4R8CA 5B3SC 3IJ4A 4LFCO 4YY3O 4IT5A 3ZMVA 2FB5A 4DR4B 1VF7A 1MNGA 5DN6G 3L71H 3JALA 1Q8IA 4DV1B 3BHPA 4Z1VA 4HBNA 1SS3A 4OGQB 1BCCH 3MD0A 2RN9A 1HNWB 1XL4A 2ZIOA 5LGNA 1YITV 3ZIAG 5EBLC 4QPKA 1VF5B 2HHHO 1YDXA 3H1IH 2DN9A 2PF4E 1Q86W 3LNNA 1W0JG 4JYAB 2IH3C 2Q7HA 2X7RB 2VWJA 5A9GA 2JS3A 4BIOA 4CH3A 1NU1H 3K06A 4YJ2B 4DR7O 3ASOB 2EJ7A 3HKCA 4FLYA 3HR0A 4DR1B 4MVRA 4B3TB 1MSWD 3CS5A 3BABA 4F6RA 1K34A 2ZNJA 5LOVB 1N33B 2QDOA 2XOKG 1V55C 1Q3EA 4AHCA 1XILA 3UKMA 5LA6A 3SGIA 5H5NA 2QKAA 4GCZA 4I9WA 1S5LZ 4JI0O 3LNMB 4FFKA 4X1YB 5K1PA 1K9MW 1J5EB 2RCVA 1E1RG 5CN0A 3RYFA 2F43G 3THOA 1THZA 1VQLV 2ZR2A 3DXRA 1GAXA 2BTQB 4IIJB 4JAAA 4PI0A 3OE7G 3UM7A 4MW8A 2AW9A 1Z2GA 4B7EA 5IY5B 1KUQA 3K59A 4KUMA 3CC4V 4GKKB 4DV6B 1MSDA 5H6RA 2XAGA 2EZOA 1VARA 3BPZA 5DM6V 1XNRB 1S76D 1RPRA 3K0DA 1N34O 4CC6A 4E2LA 2RMKB 5F2VO 5GTIZ 1HNXB 5KHGA 1YSCA 3E22A 4AQYB 3VBBA 1JOYA 1XMQB 3CCEV 3UT5B 4J10A 4C7UA 2UUAO 2Q7EA 1R3JC 3AK1A 1HR0B 1JA8A 4X20B 2CH7A 2BSKA 2Q8VA 1YJ9V 2UU9B 3J80N 1RM1B 5L3FA 5GW7A 3CCUV 5JCOA 2UUBO 3TETA 3ZRWA 1Y76A 2P7TC 1JFFA 5J2UB 1D2DA 1S72V 2OCCC 2LGWA 3JSNA 4QJFB 2CGNA 2F93B 2EIMC 5LGUA 2UXBB 1KYOF 3AK3A 3RW0A 2AZ0A 4MT8A 2Q73A 3BCCH 1ROPA 1QBZA 5D5PA 2ATKC 4JZGA 1S0VA 3ZRSA 1ZX3A 5AG2A 4PHZA 3WB1A 1K4CC 4UVBA 2PYLA 4WFEA 4JI8O 1NQTA 4AI8A 3U0ZA 1Y6XA 3JAWB 1FFXA 3CCSV 1QR9A 1UFIA 5B1AC 3WG7B 2FYUH 4PI2A 1WJZA 4O4HA 2JGDA 4JPRA 2VWKA 2KG7A 2YC0A 3TJTA 1IXMA 4FLXA 1XHZA 3ZBHA 4GX0A 1UJWB 3T1HO 3UCSC 3FKSG 3CCMV 3SPHA 4O2AB 4JYYA 1WN7A 4DV0B 2UXCB 2ZM6B 1M5IA 1BL8A 4B7KA 1YXBA 5KX5A 5EYPB 4LH7A 1YTFB 4MSWC 2OIEA 3CCLV 1FXHA 4FIPC 1S5HC 4UB8Z 1SETA 2FMLA 2IW5A 1FXKB 4DV7B 4FZ1A 2DQ0A 4LNUB 2ZXWB 3RVZA 2F23A 2YXYA 4GKJB 2GHYA 2E76B 1VQ4V 1TA8A 1M90W 2X6AA 4DR1O 1RPOA 5E79Z 1VIBA 5FL7G 1VQOV 4YJ3B 1M56B 3JARA 5H2FZ 3G6EV 1S77D 2EZPA 1SA0B 1OCRC 5B3SB 2R9AA 1HP8A 2ADQB 3KZIZ 1AJPA 5LXTA 1OCCB 1VQ5V 5FNVA 1NKDA 2HFEC 1Q81W 4BW9A 1ZWIC 3FYIB 4EFBA 2E74B 4CH4A 4PDLA 1J5EO 2RJZA 2CH7B 5LBQA 1GM8A 3RBZA 4FLWA 2WSSG 1TUBA 3ZHQA 1SQXH 1W0KG 5IE9A 3ZRWB 4ZIBA 5KLVH 1PL4A 4GKKO 4IHJB 4DV6O 5LMNB 1K92A 2YXHA 4H44B 5IT9N 3TXSA 2Z3YA 4L8JA 4TUYA 2HJDA 5IDJA 5KA5A 2VQEB 3KCYA 1Q7YW 1K7DA 2WLNA 3D36A 5IJ9A 1WNSA 3IC7A 2ODMA 1R3LC 3EXAA 2QTSA 1U97A 1XDCA 5JQGA 4J80A 4LF8O 4ZHQA 3N27A 3ASOC 3DGEA 4P9PA 2EX3A 4FLUA 2ETNA 3HKEB 4AQYO 2QGNA 1I5XA 2QWOB 1Y74A 3H9VA 4DUYB 5CA1A 1K33A 4CH5A 1LUWA 5C8YB 3JAKA 3E83A 2LO1A 2PGGA 4J7ZA 3QVNA 3RVYA 4X89A 1ZSPA 1F23A 3M8AA 3Q4HA 4ZOLA 2P90A 2CTWA 2WPDG 1W2BU 2UXBO 1FAFA 2DE0X 1FFTB 5IY5C 5IYCO 3M7MX 3ABMB 2YXLA 1HNZB 3CP1A 3K5NA 1MMMA 4PDRA 2LW1A 1YJNV 2QM7A 1RFYA 4X65B 2A9HA 4UCTA 1TVKA 2F4VO 5BR8O 1JJOA 4GX2A 3KCXA 4JAUA 1VQ6V 3H1JH 3DC5A 1BHBA 3OM3B 3CMAV 2GUZB 4H0LB 4KHPB 4J41A 4P30A 4TQDA 1R1BA 3SJQC 1YJWV 4HNAA 4JI6O 1VQNV 5KHHA 1WPBA 5EC1C 4DR6O 3KKYA 2PY5A 4LH6A 4LCUC 3ABUA 2OYQA 1SQBH 3QNEA 2YS8A 4DV0O 3LSUA 1R3KC 2ZM6O 2ZIMA 1I7FA 4UVCA 4PJ0Z 4GZRB 5LP6A 4J9ZB 5KHJA 1WP7A 3STZC 1XMOB 1GK9A 4LF7O 1XREA 1Q5OA 1N36O 4DV7O 1NR7A 4X66B 1YI2V 2WLHA 4B3MB 3H1HH 4G28B 1IBLB 3R65A 5B1NA 4PA4A 4H37A 3C3SA 4K0KB 4WF9V 2JEUA 2YEVB 2BTOA 1GN4A 4TUYB 1SQVH 4UV8A 4YIPA 1FD9A 1R6KA 2YIBD 2WLIA 3UO3A 2EIJB 3AG7A 4ABMA 2EIKC 3SYQA 4DUZO 2PYJA 4LWSA 3DSQA 3OMIB 4P9OA 3WG7C 3E8GA 1ZLZA 3RYCA 5HFMA 2UXXA 3RYIA 4D7TA 4NXMB 3UQ8A 3B8MA 1XBLA 1BT8A 5JVDB 5KHIA 5JWPA 2GV9A 3CSXA 1G1XB 4JI3O 1NBMG 2XHBA 3JYCA 2WLKA 3SPIA 1M1KW 4JV5B 1WPXA 3F5TA 4NTXA 2V4DA 4E4EA 2OT5A 4DV5O 1IXBA 4J42A 5GONB 4WBNB 2Q69A 4DRXA 1PL0A 2QM4A 2X6BA 2PI4A 4K3AA 4JTDB 4HAMA 5B1OA 1AR4A 3KG2A 4QE9A 4YXWG 2V1DA 4IYIA 3QF7A 2ZXWC 1GRJA 2W0XA 1UPGA 2E5LO 3OW2U 1OCRB 5KA6A 1KECA 4UCVA 4R50A 3OMAB 2EULA 2DQ3A 4O2BB 4K8XA 4AILC 1YCIA 3JASA 2QSAA 1NI8A 4CC5A 3E89A 1M56C 1Q43A 3K5MA 3K79A 2DMXA 1G6UA 4QGPA 1OCCC 3L9DA 4CZZA 3OR6C 3AG3B 3GWOA 4DV3O 2AXTZ 1CEZA 1BZKA 1XL6A 4UXNA 2QJ1A 2P6JA 2JJ1G 1H8HG 3SPCA 1GKFA 5EZYA 3AG2B 1ENVA 1G8MA 4DXWA 1ZTEA 1SC5B 5L3DA 3ABLB 2VQFB 1OCOB 4BR6A 4FLTA 4WCEV 3SDLA 4A5UB 4RQFA 1HNZO 3CYOA 1SQFA 2CK3G 4PDVA 4BW5A 3T1YB 2JVDA 4FM2A 3JD1A 4X65O 4LF6O 3LSQA 2WLJA 1TGOA 3AG4C 4FFBA 3O9OA 3K04A 3FB5C 2ZE6A 1SQGA 1OHHG 2GTSA 2Z0AA 4D6TH 5KHKA 1HW7A 4O4IB 5E1AC 1H2SB 1F4NA 4OXSA 4LF5B 4KHPO 3HKDA 2QWRB 2IH1C 3ZHVA 2WLIB 1NZ6A 4X1IA 1H2GA 2OTJV 3G4SV 2RDCA 3JCZA 4LWSB 3B2EE 1K4DC 4TV8A 4L87A 1NH2B 1ZAUA 5KMGA 2KB1A 3OT7A 3OGCC 1IBKB 1KB9F 2R70A 5IJ0A 4B08A 1I08A 5LYJB 3CRRA 1BHAA 2B9ZA 2K9PA 2CTQA 4JI4B 4FK5C 1XMOO 5JH7B 1WA8B 4ZI7A 4LF4O 1KD1W 3RYHB 4X66O 4JTCB 1IBLO 4I5SA 1QCEA 1US6A 4K0KO 1E79G 3ABMC 4DRXB 3K58A 1DF4A 2K1EA 5BY1A 1Q6HA 3B4SA 1YVWA 5CA3A 2RQ6A 3K08A 3BA9A 3EHBB 3ZHSA 1HWYA 1Q6IA 1AI7A 5EK0A 4UFZA 4WFFA 1PKXA 2VRZA 1H2LA 3E8HA 2L6LA 4FM1A 1T5EA 2A06H 3OTOO 3JATB 4NXMO 5C93A 3TGUH 4OPAA 4I55B 3F5WC 1XHXA 5J2TB 1N32B 4DV2B 1IX9A 4JV5O 1L1FA 1N4CA 4NR1A 5LGTA 3L73H 4MVUA 5B66Z 3JALB 1AJNA 4JI1B 3R66A 3TCUA 2PTMA 1B6QA 4MVZA 2QWPB 4ZBMA 3JD4A 4JI2B 1DGSA 4R7CA 3X2QB 3STLC 2HLDG 1P7BA 3G6BA 4U3JA 2XT9A 1N0JA 3ABKB 2EIKB 1GH6A 1AILA 3AK2A 1HDJA 1IBMB 2R9RB 3PN1A 1AR5A 3HKCB 4JYBA 3ZMUA 3CRQA 2EIJC 1AJQA 1DTOA 1MG1A 2Y69B 5EBMC 2Q0AA 4K35A 4F6RB 3RGBA 3SYOA 3A0BZ 1K97A 1YF2A 3N2KA 4JGSA 4MS2A 3F7VC 3J81N 2HJFC 4ASUG 4DR4O 1BGYH 2JS5A 5LA6B 1CXZB 3SYCA 4X1IB 4KP4A 1Y66A 3MHHC 4DV1O 3QO5A 3ML0A 4LBEC 1Q90D 3J7AU 4GUNA 1HNWO 1GM9A 3S3WA 2AHYA 1K8AW 5B1BB 4PV1B 1PD3A 1YIJV 2P22C 5KMGB 3RYFB 2GTAA 5JJEB 3JSLA 1H8EG 5IJ0B 3DXRB 4U7OA 2ZKOA 3U11A 3LSSA 2VQFO 3BY6A 1AVMA 4JYAO 2Y0PA 4IGGA 5CA0A 3FB6C 3N2GA 2N74A 1QVFU 2IBZH 4KFMA 4DW0A 2XAQA 2EJRA 3B09A 5FPOA 1VEWA 3RT3C 1SERA 4B3TO 1WP8A 1H2NA 2FKXA 1SF9A 1AR1B 3CE2A 1B06A 1R3IC 2YIAA 4DV4B 2O57A 1SZTA 1OJHA 1VQ8V 2Q68A 1N33O 3H1KH 4LF5O 2E75B 2HR3A 2JEXA 3E22B 1AI6A 4QE7A 4RAIA 1PV0A 4FM0A 1K5QA 2EILB 5L3BA 4XDLA 5KUKA 4JZ2A 2QM8A 1FJGB 1F51A 4MVOA 4I4TA 5TISZ 4Z2WA 3JD0A 2BSKB 3AG3C 1FKAO 3ETGA 2W6JG 3K57A 4X1KA 3I56V 1Y76B 3IFXA 5KAIZ 1JFFB 1LR1A 2B5UA 5CB4A 4X62B 1KU9A 3AG2C 1CP9A 1X4TA 3AG1B 3K5OA 4EB6A 1AROP 1S5JA 3ABLC 3AG4B 1XNRO 3SPGA 5B5EZ 1OCOC 3P30A 4UCRA 4CBCA 5BMVA 5LP6C 1EN4A 4UB6Z 3QTCA 3C90A 4N21A 2PUSA 1HNXO 2ADPA 2ZINA 3W7XA 3CX5F 4GX5A 2DW4A 3VQWA 1XMQO 4U3FH 5FLXN 2H8PC 1AB3A 4B3SB 1BQ0A 1FFXB 1L8DA 2KQXA 1EZJA 1HR0O 1KP3A 4GYCB 4H33A 1P49A 2UU9O 3BAAA 1JCHA 4XBFA 4O4HB 1J95A 5LHIA 5DEDA 2JGDB 4Q20A 2KG7B 3PJSK 5LHGA 1GM7A 4J7JA 1QHTA 5BZBA 4BWAA 3ZHRA 1YHQV 3A8TA 1N32O 4DV2O 2QWQB 4YIOA 2ZE5A 4LFCB 4YY3B 3K9SA 4JTAB 1OCZB 1AP5A 1JQ0A 4UCUA 5KX5B 4JI1O 2IJKA 4JI2O 1VF6A 1NVPB 1QLNA 3E8BA 3A0HZ 4O4JA 5ITZA 3CRMA 4P2ZA 3W7TA 2Q6AA 5H6QA 2H94A 5CA0B 3OGIB 4O4LA 1TAEA 4I9QA 4DR2B 3N2GB 2WLMA 2YIDA 4WFAV 2YICA 4OX9B 3P3NA 4DR7B 1U96A 2ZDIA 3E35A 4WFBV 1QVGU 4BIZA 4TV9A 1EZVH 3JARB 5IYDO 3M99B 2HEPA 3BRCA 4X88A 4FLVA 2RNBA 4R6ZA 1EBOA 5LXTB 3MAQA 1N8RW 2UXCO 4DR3B 5FNVB 1QNMA 3FYEB 2LGQA 3HPLC 3A2FA 4JI0B 1NH2D 4MVQA 3GB7C 3OTFA 4IL6Z 5H9CA 1TUBB 1KKDA 4ICGA 2B1IA 2ZD9A 1QLEB 3ZS8C 2LJ2A 1XQ8A 3CC7V 4X8AA 4GKJO 3X2QC 4YJ2A 2P4VA 2DYSC 3F7YC 3FFQA 3ZRXA 3D8CA 5IJ9B 3ABKC 3T1CA 1BS3A 1E1QG 1M9NA 4DV4O 1ZL8A 5JQGB 1N34B 1P84F 3L74H 3RN4A 1GN2A 2IJJA 1VQMV 1D5NA 2DWEC 4ZHQB 5L3CA 5LOVA 1NTMH 1VP7A 3HKBA 4RQEA 3U10A 3CMEV 4LR3A 2XASA 2Y69C 1Y74B 4Z1MG 2A79B 4LF9B 2D3OW 4IYHA 1P7GA 3SJAC 1NJIW 2B1GA 1FJGO 5CA1B 4X1YA 4LP8A 3JAKB 1AI4A 1PNMA 2Y4TA 2LFRA 3H01A 4NVPA 2LFSA 2P06A 2BTQA 4IIJA 4BIUA 2UUBB 1FPOA 3LDCA 5LMNO 1AI5A 5B1BC 4X62O 3ZMSA 3Q4HB 4ZOLB 4J11A 3L72H 4ZKIA 2VQEO 1I0HA 2YIBA 2XAJA 4PELA 4GLXA 4U7NA 3G80A 1DLBA 2V7QG 1SQQH 3W7SA 3CXCU 2BE3A 3ZRVA 1BE3H 1F4MA 3FB7C 4O4JB 5ITZB 4Q6GA 5JJNB 2OTLV 1TVKB 3UT5A 4DUYO 5KUMA 4JI8B 1MZFA 1GMGA 1EN5A 2OIGA 4DW1A 2QKSA 3K9AA 1PPJH 2F1MA 3FAVA 4JI5B 4HNAB 2EILC 3RWRD 2ITCC 3JAMN 3S3XA 3WU2Z 4CS3A 5J2UA 2X6CA 1SQPH 3APQA 4MTFA 3D3IA 2LW7A 2M6YA 2NN4A 2AZ2A 3ASNB 1XUQA 5JCOC 1YTFD 1PP9H 2CDYA 2BCCH 5LP6B 2P5OA 2CE4A 1JJ2U 3CXHF 1K73W 3AG1C 3K0GA 4I50A 1NR1A 2W6IG 4UCOA 2GBOA 1IDSA 3G67A 1LUVA 3ETDA 1AP6A 2OWOA 1S3JA 3JAWA 3JD3A 2WWWA 1KP2A 3OEHG 3OR7C 1R73A 3ZHTA 4DR2O 1DF5A 4OX9O 1GN6A 2QEXV 1JX9A 4CS4A 4LFBB 3IGAC 4X9QA 5J9PC 1R6TA 1GTOA 1ZL8B 1RP3B 3RYCB 4WFGA 4O2AA 4RO2A 2KKWA 3WFVA 4DR3O 3HKBB 3RYIB 4DR5B 2EBOA 2A0LA 5EYPA 4WFHA 4NB5A 5BXZA 1A32A 2EINC 4DYLA 2UXDB 2GDSA 2XAHA 2WLLA 1FXKA 1XNQB 1G4YB 1M93A 1OCZC 4B3MO 5A2QN 3FD9A 3NXSA 1WAZA 4LNUA 1COWG 4J9YB 3CCRV 3SPJA 4FVMA 2DYRB 4FLZA 2JJ2G 3T2MA 4CH6A 4HYOA 4EFEA 2R9IA 4NYKA 3ZMZA 3SJCC 3ZN1A 1M4UA 4JYCA 2Q4PA 2ITDC 1M57C 3ETQA 2ZE7A 2UXNA 4YJ3A
chains in the Genus database with same CATH topology
5B66Z 3KZIZ 4PJ0Z 5GTIZ 4UB6Z 2AXTZ 5GTHZ 5KAIZ 5KAFZ 1S5LZ 3WU2Z 4UB8Z 3A0HZ 3JCUZ 5E79Z 4IL6Z 3A0BZ 5H2FZ 5TISZ 5B5EZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 Z;  3KZI Z;  4PJ0 Z;  5GTI Z;  4UB6 Z;  2AXT Z;  5GTH Z;  5KAI Z;  5KAF Z;  1S5L Z;  3WU2 Z;  4UB8 Z;  3A0H Z;  3JCU Z;  5E79 Z;  4IL6 Z;  3A0B Z;  5H2F Z;  5TIS Z;  5B5E Z; 
#chains in the Genus database with same CATH topology
 2ILM A;  2M7W A;  1FYJ A;  5LMU B;  4NTY A;  3CC2 V;  1SA0 A;  4LF8 B;  1GN3 A;  4LFA B;  3CJH A;  2Y4U A;  3JAS B;  4TOI A;  4LF9 O;  4DK1 A;  1WB8 A;  2W0F C;  2YI9 A;  2NR5 A;  1V9P A;  4FMT A;  2H3O A;  4HZ3 A;  1F7Y A;  2JK5 C;  4FJC C;  4RUF A;  3CD6 V;  2PZS A;  3FAV B;  1LNQ A;  2CTP A;  3GVM A;  1Y4M A;  5DEC A;  4YHH B;  2XND G;  2F95 B;  3B77 A;  2P67 A;  4RUE A;  2ZNI A;  4IHJ A;  1MA1 A;  2ZT9 B;  3CPW U;  1MAB G;  5EZY B;  1ORQ C;  3TXQ A;  1NS1 A;  3CCJ V;  3D3Q A;  4I0X A;  2DYS B;  5IWA B;  1KKC A;  1Z5V A;  2QWN B;  4H13 B;  1QLE C;  4MTX A;  1V54 B;  3K5L A;  2VS0 A;  2G38 A;  1Q6U A;  1NVP D;  4D7S A;  5EIB C;  2Q5Z A;  1N0N A;  4I50 B;  2CGO A;  1RSO A;  2NLJ C;  2LQT A;  3OAA G;  3D36 C;  1KBH A;  3ZHU A;  3HKE A;  3CEI A;  3I5D A;  4FFB B;  1W59 A;  1OV9 A;  2F4V B;  5BR8 B;  2YI8 A;  3NR7 A;  1VQK V;  4J7K A;  5CMU A;  4W4K A;  1BMF G;  5C8Y A;  3HKD B;  2DJV A;  2ZQM A;  4TWK A;  1KQS U;  4JI5 O;  1KMI Z;  3H1L H;  3P3P A;  1TUE B;  3ABT A;  4JI6 B;  3CCQ V;  3DC6 A;  1BQZ A;  1SES A;  1I94 B;  4DR6 B;  1SKV A;  2A7W A;  4QNH B;  4K8Z A;  4TV8 B;  1QR8 A;  2JIZ G;  2WA4 A;  3ZMT A;  4QIW F;  4PA9 A;  1XI1 A;  3QO8 A;  4NTW A;  2R72 A;  3VQX A;  5KAF Z;  2XAF A;  1PM9 A;  3MHS C;  4F4L A;  3T1Y O;  2WLL B;  1X59 A;  2XTA A;  1YEW A;  4GT1 A;  4ZI7 B;  4LF7 B;  1N36 B;  3TK1 A;  4DO2 A;  4EKW A;  3ZN0 A;  5CBG A;  2IJI A;  1JR9 A;  4N23 A;  4B3R B;  1VF6 C;  4GX1 A;  5EIB D;  4TSF G;  4JAS A;  2GUZ A;  1XEQ A;  2ZR3 A;  4LFB O;  3ZCC A;  1P4R A;  2UUC B;  1H38 A;  1D5A A;  3APO A;  5IYZ A;  4CS2 A;  3OMN B;  1PNL A;  3SYP A;  4DUZ B;  2N04 A;  3SR2 C;  4XDJ A;  1B3Q A;  3EFF K;  4TQF A;  2GSM B;  1KC8 W;  3QO7 A;  1Z5W A;  1IBK O;  2D2C B;  2ZDI C;  2X0L A;  1VQ7 V;  2NNU A;  4DR5 O;  3WB0 A;  2Q0O C;  3CJH B;  4X64 B;  4KL1 A;  4JI4 O;  1K3E A;  5CBH A;  2YSU B;  2UXD O;  4JI3 B;  5L3G A;  4UVA A;  3CRA A;  4NKG B;  5EC2 C;  3OFN G;  4LC1 A;  3ASN C;  3UO2 A;  1IZ3 A;  1XNQ O;  4NXN B;  3BA8 A;  2A3Q A;  3QG5 A;  1Y67 A;  3VQV A;  4DV5 B;  1VQ9 V;  3L75 H;  2HVJ C;  2QKC A;  4PDM A;  2YEV A;  5CBF A;  1ZUQ A;  2Y48 A;  3ETE A;  4I0X B;  5LL6 Y;  4U3J B;  5EBW C;  4G27 B;  4MTO A;  4PD4 F;  4JAV A;  1R6N A;  3T4D A;  5L3E A;  3A0R A;  2L35 A;  2XUM A;  2E5L B;  2CAZ C;  2P4K A;  2Q67 A;  1CPY A;  5LMU O;  3JD2 A;  3SJB C;  3CWB H;  3VQY A;  1RSO B;  1EFR G;  4LFA O;  1V55 B;  1SZX A;  2YUA A;  5JVD A;  2E3C A;  3DTU B;  2EIN B;  2ZCE A;  3BEH A;  4W4L A;  3N2K B;  2F66 C;  4I7Z B;  4JI7 B;  2CTR A;  3G71 V;  1XOU A;  3EVK A;  3K3W A;  2WAM A;  4DV3 B;  2N05 A;  3O65 A;  4YHH O;  2MK3 A;  4KXR A;  2IM9 A;  2QTO A;  5GON A;  2MW2 B;  4WBN A;  3E8F A;  3OEE G;  2WA3 A;  1PNK A;  3K03 A;  4QPJ A;  2QA4 V;  5IWA O;  1WB7 A;  1BSM A;  2HHH B;  1NT2 B;  3RFR A;  1M57 B;  4MVM A;  1B04 A;  1MOF A;  2DYR C;  3W7W A;  3ZX6 A;  1IBM O;  3LDE A;  2IU3 A;  2CUG A;  3P32 A;  1DK1 A;  3OUS A;  4LF6 B;  1WLE A;  2HKO A;  4O2B A;  3T4Z A;  2HP8 A;  1K5S A;  2PI5 A;  5IYB O;  3I55 V;  2JDI G;  5D5Q A;  4UUJ C;  4G2K A;  2AHZ A;  3IC9 A;  1OZ0 A;  3C3T A;  2ARH A;  5IYZ B;  1I94 O;  2BOB C;  4OPH A;  2HVK C;  2C2A A;  2Q7G A;  2OCC B;  2Y0I A;  1VQP V;  4I4T B;  2EIM B;  2IU0 A;  1RM1 C;  2JGU A;  1JMK C;  1MZE A;  4X1K B;  4F6E A;  2Z5U A;  1L0L H;  1YZB A;  1O9G A;  2JRI A;  5CB4 B;  3AEI A;  3OUF A;  1QQC A;  4PA7 A;  3LDD A;  4PA3 A;  4EB6 B;  4PA6 A;  3FX7 A;  4LF4 B;  4JF3 A;  3BFR A;  5LHH A;  5BMV B;  1GO3 F;  1V54 C;  3E2E A;  4B3R O;  3ZED A;  4O4I A;  3B40 A;  3OD4 A;  5B1A B;  3FB8 C;  1H2K A;  3E86 A;  1NTZ H;  1O9H A;  1FXV A;  3B8N A;  2UUC O;  2HG5 C;  2Q9L A;  2ZE8 A;  3LUT B;  4MVS A;  2UUA B;  2AGA A;  5HFL A;  4UV9 A;  4XDK A;  2QE7 G;  3W7U A;  3ZJZ A;  1IUR A;  2YDE A;  4RWU A;  3VOU A;  4EEQ A;  2DOS A;  1H2M A;  3OTO B;  5GTH Z;  5LYJ A;  4X64 O;  3MDS A;  4BAY A;  4FPP A;  3SYA A;  5FPR A;  4FZ0 A;  2OCH A;  5JH7 A;  1EM1 A;  1I5Y A;  1WA8 A;  2FTK A;  3RYH A;  2QR4 A;  4NXN O;  3BVO A;  2KSD A;  3CHX A;  5JJJ B;  1IVS A;  3CRC A;  3L70 H;  3CCV V;  4TT3 G;  4DK0 A;  1FXK C;  1SRY A;  2BOC C;  1JPX A;  3JCU Z;  2FL4 A;  1Q82 W;  4B3S O;  1NTK H;  4O4L B;  2LP7 A;  2DWD C;  3CB2 A;  1L0N H;  1EN6 A;  4X20 A;  3IAY A;  3JAT A;  5K1X A;  1FS0 G;  3GWK C;  1JVM A;  1QU7 A;  3WB2 A;  4MW3 A;  3ICX A;  4TV9 B;  4I55 A;  2IJH A;  1URF A;  1VMG A;  5J2T A;  3HB3 B;  3T1H B;  4MTG A;  4UCS A;  4JI7 O;  4R8C A;  5B3S C;  3IJ4 A;  4LFC O;  4YY3 O;  4IT5 A;  3ZMV A;  2FB5 A;  4DR4 B;  1VF7 A;  1MNG A;  5DN6 G;  3L71 H;  3JAL A;  1Q8I A;  4DV1 B;  3BHP A;  4Z1V A;  4HBN A;  1SS3 A;  4OGQ B;  1BCC H;  3MD0 A;  2RN9 A;  1HNW B;  1XL4 A;  2ZIO A;  5LGN A;  1YIT V;  3ZIA G;  5EBL C;  4QPK A;  1VF5 B;  2HHH O;  1YDX A;  3H1I H;  2DN9 A;  2PF4 E;  1Q86 W;  3LNN A;  1W0J G;  4JYA B;  2IH3 C;  2Q7H A;  2X7R B;  2VWJ A;  5A9G A;  2JS3 A;  4BIO A;  4CH3 A;  1NU1 H;  3K06 A;  4YJ2 B;  4DR7 O;  3ASO B;  2EJ7 A;  3HKC A;  4FLY A;  3HR0 A;  4DR1 B;  4MVR A;  4B3T B;  1MSW D;  3CS5 A;  3BAB A;  4F6R A;  1K34 A;  2ZNJ A;  5LOV B;  1N33 B;  2QDO A;  2XOK G;  1V55 C;  1Q3E A;  4AHC A;  1XIL A;  3UKM A;  5LA6 A;  3SGI A;  5H5N A;  2QKA A;  4GCZ A;  4I9W A;  1S5L Z;  4JI0 O;  3LNM B;  4FFK A;  4X1Y B;  5K1P A;  1K9M W;  1J5E B;  2RCV A;  1E1R G;  5CN0 A;  3RYF A;  2F43 G;  3THO A;  1THZ A;  1VQL V;  2ZR2 A;  3DXR A;  1GAX A;  2BTQ B;  4IIJ B;  4JAA A;  4PI0 A;  3OE7 G;  3UM7 A;  4MW8 A;  2AW9 A;  1Z2G A;  4B7E A;  5IY5 B;  1KUQ A;  3K59 A;  4KUM A;  3CC4 V;  4GKK B;  4DV6 B;  1MSD A;  5H6R A;  2XAG A;  2EZO A;  1VAR A;  3BPZ A;  5DM6 V;  1XNR B;  1S76 D;  1RPR A;  3K0D A;  1N34 O;  4CC6 A;  4E2L A;  2RMK B;  5F2V O;  5GTI Z;  1HNX B;  5KHG A;  1YSC A;  3E22 A;  4AQY B;  3VBB A;  1JOY A;  1XMQ B;  3CCE V;  3UT5 B;  4J10 A;  4C7U A;  2UUA O;  2Q7E A;  1R3J C;  3AK1 A;  1HR0 B;  1JA8 A;  4X20 B;  2CH7 A;  2BSK A;  2Q8V A;  1YJ9 V;  2UU9 B;  3J80 N;  1RM1 B;  5L3F A;  5GW7 A;  3CCU V;  5JCO A;  2UUB O;  3TET A;  3ZRW A;  1Y76 A;  2P7T C;  1JFF A;  5J2U B;  1D2D A;  1S72 V;  2OCC C;  2LGW A;  3JSN A;  4QJF B;  2CGN A;  2F93 B;  2EIM C;  5LGU A;  2UXB B;  1KYO F;  3AK3 A;  3RW0 A;  2AZ0 A;  4MT8 A;  2Q73 A;  3BCC H;  1ROP A;  1QBZ A;  5D5P A;  2ATK C;  4JZG A;  1S0V A;  3ZRS A;  1ZX3 A;  5AG2 A;  4PHZ A;  3WB1 A;  1K4C C;  4UVB A;  2PYL A;  4WFE A;  4JI8 O;  1NQT A;  4AI8 A;  3U0Z A;  1Y6X A;  3JAW B;  1FFX A;  3CCS V;  1QR9 A;  1UFI A;  5B1A C;  3WG7 B;  2FYU H;  4PI2 A;  1WJZ A;  4O4H A;  2JGD A;  4JPR A;  2VWK A;  2KG7 A;  2YC0 A;  3TJT A;  1IXM A;  4FLX A;  1XHZ A;  3ZBH A;  4GX0 A;  1UJW B;  3T1H O;  3UCS C;  3FKS G;  3CCM V;  3SPH A;  4O2A B;  4JYY A;  1WN7 A;  4DV0 B;  2UXC B;  2ZM6 B;  1M5I A;  1BL8 A;  4B7K A;  1YXB A;  5KX5 A;  5EYP B;  4LH7 A;  1YTF B;  4MSW C;  2OIE A;  3CCL V;  1FXH A;  4FIP C;  1S5H C;  4UB8 Z;  1SET A;  2FML A;  2IW5 A;  1FXK B;  4DV7 B;  4FZ1 A;  2DQ0 A;  4LNU B;  2ZXW B;  3RVZ A;  2F23 A;  2YXY A;  4GKJ B;  2GHY A;  2E76 B;  1VQ4 V;  1TA8 A;  1M90 W;  2X6A A;  4DR1 O;  1RPO A;  5E79 Z;  1VIB A;  5FL7 G;  1VQO V;  4YJ3 B;  1M56 B;  3JAR A;  5H2F Z;  3G6E V;  1S77 D;  2EZP A;  1SA0 B;  1OCR C;  5B3S B;  2R9A A;  1HP8 A;  2ADQ B;  3KZI Z;  1AJP A;  5LXT A;  1OCC B;  1VQ5 V;  5FNV A;  1NKD A;  2HFE C;  1Q81 W;  4BW9 A;  1ZWI C;  3FYI B;  4EFB A;  2E74 B;  4CH4 A;  4PDL A;  1J5E O;  2RJZ A;  2CH7 B;  5LBQ A;  1GM8 A;  3RBZ A;  4FLW A;  2WSS G;  1TUB A;  3ZHQ A;  1SQX H;  1W0K G;  5IE9 A;  3ZRW B;  4ZIB A;  5KLV H;  1PL4 A;  4GKK O;  4IHJ B;  4DV6 O;  5LMN B;  1K92 A;  2YXH A;  4H44 B;  5IT9 N;  3TXS A;  2Z3Y A;  4L8J A;  4TUY A;  2HJD A;  5IDJ A;  5KA5 A;  2VQE B;  3KCY A;  1Q7Y W;  1K7D A;  2WLN A;  3D36 A;  5IJ9 A;  1WNS A;  3IC7 A;  2ODM A;  1R3L C;  3EXA A;  2QTS A;  1U97 A;  1XDC A;  5JQG A;  4J80 A;  4LF8 O;  4ZHQ A;  3N27 A;  3ASO C;  3DGE A;  4P9P A;  2EX3 A;  4FLU A;  2ETN A;  3HKE B;  4AQY O;  2QGN A;  1I5X A;  2QWO B;  1Y74 A;  3H9V A;  4DUY B;  5CA1 A;  1K33 A;  4CH5 A;  1LUW A;  5C8Y B;  3JAK A;  3E83 A;  2LO1 A;  2PGG A;  4J7Z A;  3QVN A;  3RVY A;  4X89 A;  1ZSP A;  1F23 A;  3M8A A;  3Q4H A;  4ZOL A;  2P90 A;  2CTW A;  2WPD G;  1W2B U;  2UXB O;  1FAF A;  2DE0 X;  1FFT B;  5IY5 C;  5IYC O;  3M7M X;  3ABM B;  2YXL A;  1HNZ B;  3CP1 A;  3K5N A;  1MMM A;  4PDR A;  2LW1 A;  1YJN V;  2QM7 A;  1RFY A;  4X65 B;  2A9H A;  4UCT A;  1TVK A;  2F4V O;  5BR8 O;  1JJO A;  4GX2 A;  3KCX A;  4JAU A;  1VQ6 V;  3H1J H;  3DC5 A;  1BHB A;  3OM3 B;  3CMA V;  2GUZ B;  4H0L B;  4KHP B;  4J41 A;  4P30 A;  4TQD A;  1R1B A;  3SJQ C;  1YJW V;  4HNA A;  4JI6 O;  1VQN V;  5KHH A;  1WPB A;  5EC1 C;  4DR6 O;  3KKY A;  2PY5 A;  4LH6 A;  4LCU C;  3ABU A;  2OYQ A;  1SQB H;  3QNE A;  2YS8 A;  4DV0 O;  3LSU A;  1R3K C;  2ZM6 O;  2ZIM A;  1I7F A;  4UVC A;  4PJ0 Z;  4GZR B;  5LP6 A;  4J9Z B;  5KHJ A;  1WP7 A;  3STZ C;  1XMO B;  1GK9 A;  4LF7 O;  1XRE A;  1Q5O A;  1N36 O;  4DV7 O;  1NR7 A;  4X66 B;  1YI2 V;  2WLH A;  4B3M B;  3H1H H;  4G28 B;  1IBL B;  3R65 A;  5B1N A;  4PA4 A;  4H37 A;  3C3S A;  4K0K B;  4WF9 V;  2JEU A;  2YEV B;  2BTO A;  1GN4 A;  4TUY B;  1SQV H;  4UV8 A;  4YIP A;  1FD9 A;  1R6K A;  2YIB D;  2WLI A;  3UO3 A;  2EIJ B;  3AG7 A;  4ABM A;  2EIK C;  3SYQ A;  4DUZ O;  2PYJ A;  4LWS A;  3DSQ A;  3OMI B;  4P9O A;  3WG7 C;  3E8G A;  1ZLZ A;  3RYC A;  5HFM A;  2UXX A;  3RYI A;  4D7T A;  4NXM B;  3UQ8 A;  3B8M A;  1XBL A;  1BT8 A;  5JVD B;  5KHI A;  5JWP A;  2GV9 A;  3CSX A;  1G1X B;  4JI3 O;  1NBM G;  2XHB A;  3JYC A;  2WLK A;  3SPI A;  1M1K W;  4JV5 B;  1WPX A;  3F5T A;  4NTX A;  2V4D A;  4E4E A;  2OT5 A;  4DV5 O;  1IXB A;  4J42 A;  5GON B;  4WBN B;  2Q69 A;  4DRX A;  1PL0 A;  2QM4 A;  2X6B A;  2PI4 A;  4K3A A;  4JTD B;  4HAM A;  5B1O A;  1AR4 A;  3KG2 A;  4QE9 A;  4YXW G;  2V1D A;  4IYI A;  3QF7 A;  2ZXW C;  1GRJ A;  2W0X A;  1UPG A;  2E5L O;  3OW2 U;  1OCR B;  5KA6 A;  1KEC A;  4UCV A;  4R50 A;  3OMA B;  2EUL A;  2DQ3 A;  4O2B B;  4K8X A;  4AIL C;  1YCI A;  3JAS A;  2QSA A;  1NI8 A;  4CC5 A;  3E89 A;  1M56 C;  1Q43 A;  3K5M A;  3K79 A;  2DMX A;  1G6U A;  4QGP A;  1OCC C;  3L9D A;  4CZZ A;  3OR6 C;  3AG3 B;  3GWO A;  4DV3 O;  2AXT Z;  1CEZ A;  1BZK A;  1XL6 A;  4UXN A;  2QJ1 A;  2P6J A;  2JJ1 G;  1H8H G;  3SPC A;  1GKF A;  5EZY A;  3AG2 B;  1ENV A;  1G8M A;  4DXW A;  1ZTE A;  1SC5 B;  5L3D A;  3ABL B;  2VQF B;  1OCO B;  4BR6 A;  4FLT A;  4WCE V;  3SDL A;  4A5U B;  4RQF A;  1HNZ O;  3CYO A;  1SQF A;  2CK3 G;  4PDV A;  4BW5 A;  3T1Y B;  2JVD A;  4FM2 A;  3JD1 A;  4X65 O;  4LF6 O;  3LSQ A;  2WLJ A;  1TGO A;  3AG4 C;  4FFB A;  3O9O A;  3K04 A;  3FB5 C;  2ZE6 A;  1SQG A;  1OHH G;  2GTS A;  2Z0A A;  4D6T H;  5KHK A;  1HW7 A;  4O4I B;  5E1A C;  1H2S B;  1F4N A;  4OXS A;  4LF5 B;  4KHP O;  3HKD A;  2QWR B;  2IH1 C;  3ZHV A;  2WLI B;  1NZ6 A;  4X1I A;  1H2G A;  2OTJ V;  3G4S V;  2RDC A;  3JCZ A;  4LWS B;  3B2E E;  1K4D C;  4TV8 A;  4L87 A;  1NH2 B;  1ZAU A;  5KMG A;  2KB1 A;  3OT7 A;  3OGC C;  1IBK B;  1KB9 F;  2R70 A;  5IJ0 A;  4B08 A;  1I08 A;  5LYJ B;  3CRR A;  1BHA A;  2B9Z A;  2K9P A;  2CTQ A;  4JI4 B;  4FK5 C;  1XMO O;  5JH7 B;  1WA8 B;  4ZI7 A;  4LF4 O;  1KD1 W;  3RYH B;  4X66 O;  4JTC B;  1IBL O;  4I5S A;  1QCE A;  1US6 A;  4K0K O;  1E79 G;  3ABM C;  4DRX B;  3K58 A;  1DF4 A;  2K1E A;  5BY1 A;  1Q6H A;  3B4S A;  1YVW A;  5CA3 A;  2RQ6 A;  3K08 A;  3BA9 A;  3EHB B;  3ZHS A;  1HWY A;  1Q6I A;  1AI7 A;  5EK0 A;  4UFZ A;  4WFF A;  1PKX A;  2VRZ A;  1H2L A;  3E8H A;  2L6L A;  4FM1 A;  1T5E A;  2A06 H;  3OTO O;  3JAT B;  4NXM O;  5C93 A;  3TGU H;  4OPA A;  4I55 B;  3F5W C;  1XHX A;  5J2T B;  1N32 B;  4DV2 B;  1IX9 A;  4JV5 O;  1L1F A;  1N4C A;  4NR1 A;  5LGT A;  3L73 H;  4MVU A;  5B66 Z;  3JAL B;  1AJN A;  4JI1 B;  3R66 A;  3TCU A;  2PTM A;  1B6Q A;  4MVZ A;  2QWP B;  4ZBM A;  3JD4 A;  4JI2 B;  1DGS A;  4R7C A;  3X2Q B;  3STL C;  2HLD G;  1P7B A;  3G6B A;  4U3J A;  2XT9 A;  1N0J A;  3ABK B;  2EIK B;  1GH6 A;  1AIL A;  3AK2 A;  1HDJ A;  1IBM B;  2R9R B;  3PN1 A;  1AR5 A;  3HKC B;  4JYB A;  3ZMU A;  3CRQ A;  2EIJ C;  1AJQ A;  1DTO A;  1MG1 A;  2Y69 B;  5EBM C;  2Q0A A;  4K35 A;  4F6R B;  3RGB A;  3SYO A;  3A0B Z;  1K97 A;  1YF2 A;  3N2K A;  4JGS A;  4MS2 A;  3F7V C;  3J81 N;  2HJF C;  4ASU G;  4DR4 O;  1BGY H;  2JS5 A;  5LA6 B;  1CXZ B;  3SYC A;  4X1I B;  4KP4 A;  1Y66 A;  3MHH C;  4DV1 O;  3QO5 A;  3ML0 A;  4LBE C;  1Q90 D;  3J7A U;  4GUN A;  1HNW O;  1GM9 A;  3S3W A;  2AHY A;  1K8A W;  5B1B B;  4PV1 B;  1PD3 A;  1YIJ V;  2P22 C;  5KMG B;  3RYF B;  2GTA A;  5JJE B;  3JSL A;  1H8E G;  5IJ0 B;  3DXR B;  4U7O A;  2ZKO A;  3U11 A;  3LSS A;  2VQF O;  3BY6 A;  1AVM A;  4JYA O;  2Y0P A;  4IGG A;  5CA0 A;  3FB6 C;  3N2G A;  2N74 A;  1QVF U;  2IBZ H;  4KFM A;  4DW0 A;  2XAQ A;  2EJR A;  3B09 A;  5FPO A;  1VEW A;  3RT3 C;  1SER A;  4B3T O;  1WP8 A;  1H2N A;  2FKX A;  1SF9 A;  1AR1 B;  3CE2 A;  1B06 A;  1R3I C;  2YIA A;  4DV4 B;  2O57 A;  1SZT A;  1OJH A;  1VQ8 V;  2Q68 A;  1N33 O;  3H1K H;  4LF5 O;  2E75 B;  2HR3 A;  2JEX A;  3E22 B;  1AI6 A;  4QE7 A;  4RAI A;  1PV0 A;  4FM0 A;  1K5Q A;  2EIL B;  5L3B A;  4XDL A;  5KUK A;  4JZ2 A;  2QM8 A;  1FJG B;  1F51 A;  4MVO A;  4I4T A;  5TIS Z;  4Z2W A;  3JD0 A;  2BSK B;  3AG3 C;  1FKA O;  3ETG A;  2W6J G;  3K57 A;  4X1K A;  3I56 V;  1Y76 B;  3IFX A;  5KAI Z;  1JFF B;  1LR1 A;  2B5U A;  5CB4 A;  4X62 B;  1KU9 A;  3AG2 C;  1CP9 A;  1X4T A;  3AG1 B;  3K5O A;  4EB6 A;  1ARO P;  1S5J A;  3ABL C;  3AG4 B;  1XNR O;  3SPG A;  5B5E Z;  1OCO C;  3P30 A;  4UCR A;  4CBC A;  5BMV A;  5LP6 C;  1EN4 A;  4UB6 Z;  3QTC A;  3C90 A;  4N21 A;  2PUS A;  1HNX O;  2ADP A;  2ZIN A;  3W7X A;  3CX5 F;  4GX5 A;  2DW4 A;  3VQW A;  1XMQ O;  4U3F H;  5FLX N;  2H8P C;  1AB3 A;  4B3S B;  1BQ0 A;  1FFX B;  1L8D A;  2KQX A;  1EZJ A;  1HR0 O;  1KP3 A;  4GYC B;  4H33 A;  1P49 A;  2UU9 O;  3BAA A;  1JCH A;  4XBF A;  4O4H B;  1J95 A;  5LHI A;  5DED A;  2JGD B;  4Q20 A;  2KG7 B;  3PJS K;  5LHG A;  1GM7 A;  4J7J A;  1QHT A;  5BZB A;  4BWA A;  3ZHR A;  1YHQ V;  3A8T A;  1N32 O;  4DV2 O;  2QWQ B;  4YIO A;  2ZE5 A;  4LFC B;  4YY3 B;  3K9S A;  4JTA B;  1OCZ B;  1AP5 A;  1JQ0 A;  4UCU A;  5KX5 B;  4JI1 O;  2IJK A;  4JI2 O;  1VF6 A;  1NVP B;  1QLN A;  3E8B A;  3A0H Z;  4O4J A;  5ITZ A;  3CRM A;  4P2Z A;  3W7T A;  2Q6A A;  5H6Q A;  2H94 A;  5CA0 B;  3OGI B;  4O4L A;  1TAE A;  4I9Q A;  4DR2 B;  3N2G B;  2WLM A;  2YID A;  4WFA V;  2YIC A;  4OX9 B;  3P3N A;  4DR7 B;  1U96 A;  2ZDI A;  3E35 A;  4WFB V;  1QVG U;  4BIZ A;  4TV9 A;  1EZV H;  3JAR B;  5IYD O;  3M99 B;  2HEP A;  3BRC A;  4X88 A;  4FLV A;  2RNB A;  4R6Z A;  1EBO A;  5LXT B;  3MAQ A;  1N8R W;  2UXC O;  4DR3 B;  5FNV B;  1QNM A;  3FYE B;  2LGQ A;  3HPL C;  3A2F A;  4JI0 B;  1NH2 D;  4MVQ A;  3GB7 C;  3OTF A;  4IL6 Z;  5H9C A;  1TUB B;  1KKD A;  4ICG A;  2B1I A;  2ZD9 A;  1QLE B;  3ZS8 C;  2LJ2 A;  1XQ8 A;  3CC7 V;  4X8A A;  4GKJ O;  3X2Q C;  4YJ2 A;  2P4V A;  2DYS C;  3F7Y C;  3FFQ A;  3ZRX A;  3D8C A;  5IJ9 B;  3ABK C;  3T1C A;  1BS3 A;  1E1Q G;  1M9N A;  4DV4 O;  1ZL8 A;  5JQG B;  1N34 B;  1P84 F;  3L74 H;  3RN4 A;  1GN2 A;  2IJJ A;  1VQM V;  1D5N A;  2DWE C;  4ZHQ B;  5L3C A;  5LOV A;  1NTM H;  1VP7 A;  3HKB A;  4RQE A;  3U10 A;  3CME V;  4LR3 A;  2XAS A;  2Y69 C;  1Y74 B;  4Z1M G;  2A79 B;  4LF9 B;  2D3O W;  4IYH A;  1P7G A;  3SJA C;  1NJI W;  2B1G A;  1FJG O;  5CA1 B;  4X1Y A;  4LP8 A;  3JAK B;  1AI4 A;  1PNM A;  2Y4T A;  2LFR A;  3H01 A;  4NVP A;  2LFS A;  2P06 A;  2BTQ A;  4IIJ A;  4BIU A;  2UUB B;  1FPO A;  3LDC A;  5LMN O;  1AI5 A;  5B1B C;  4X62 O;  3ZMS A;  3Q4H B;  4ZOL B;  4J11 A;  3L72 H;  4ZKI A;  2VQE O;  1I0H A;  2YIB A;  2XAJ A;  4PEL A;  4GLX A;  4U7N A;  3G80 A;  1DLB A;  2V7Q G;  1SQQ H;  3W7S A;  3CXC U;  2BE3 A;  3ZRV A;  1BE3 H;  1F4M A;  3FB7 C;  4O4J B;  5ITZ B;  4Q6G A;  5JJN B;  2OTL V;  1TVK B;  3UT5 A;  4DUY O;  5KUM A;  4JI8 B;  1MZF A;  1GMG A;  1EN5 A;  2OIG A;  4DW1 A;  2QKS A;  3K9A A;  1PPJ H;  2F1M A;  3FAV A;  4JI5 B;  4HNA B;  2EIL C;  3RWR D;  2ITC C;  3JAM N;  3S3X A;  3WU2 Z;  4CS3 A;  5J2U A;  2X6C A;  1SQP H;  3APQ A;  4MTF A;  3D3I A;  2LW7 A;  2M6Y A;  2NN4 A;  2AZ2 A;  3ASN B;  1XUQ A;  5JCO C;  1YTF D;  1PP9 H;  2CDY A;  2BCC H;  5LP6 B;  2P5O A;  2CE4 A;  1JJ2 U;  3CXH F;  1K73 W;  3AG1 C;  3K0G A;  4I50 A;  1NR1 A;  2W6I G;  4UCO A;  2GBO A;  1IDS A;  3G67 A;  1LUV A;  3ETD A;  1AP6 A;  2OWO A;  1S3J A;  3JAW A;  3JD3 A;  2WWW A;  1KP2 A;  3OEH G;  3OR7 C;  1R73 A;  3ZHT A;  4DR2 O;  1DF5 A;  4OX9 O;  1GN6 A;  2QEX V;  1JX9 A;  4CS4 A;  4LFB B;  3IGA C;  4X9Q A;  5J9P C;  1R6T A;  1GTO A;  1ZL8 B;  1RP3 B;  3RYC B;  4WFG A;  4O2A A;  4RO2 A;  2KKW A;  3WFV A;  4DR3 O;  3HKB B;  3RYI B;  4DR5 B;  2EBO A;  2A0L A;  5EYP A;  4WFH A;  4NB5 A;  5BXZ A;  1A32 A;  2EIN C;  4DYL A;  2UXD B;  2GDS A;  2XAH A;  2WLL A;  1FXK A;  1XNQ B;  1G4Y B;  1M93 A;  1OCZ C;  4B3M O;  5A2Q N;  3FD9 A;  3NXS A;  1WAZ A;  4LNU A;  1COW G;  4J9Y B;  3CCR V;  3SPJ A;  4FVM A;  2DYR B;  4FLZ A;  2JJ2 G;  3T2M A;  4CH6 A;  4HYO A;  4EFE A;  2R9I A;  4NYK A;  3ZMZ A;  3SJC C;  3ZN1 A;  1M4U A;  4JYC A;  2Q4P A;  2ITD C;  1M57 C;  3ETQ A;  2ZE7 A;  2UXN A;  4YJ3 A; 
#chains in the Genus database with same CATH homology
 5B66 Z;  3KZI Z;  4PJ0 Z;  5GTI Z;  4UB6 Z;  2AXT Z;  5GTH Z;  5KAI Z;  5KAF Z;  1S5L Z;  3WU2 Z;  4UB8 Z;  3A0H Z;  3JCU Z;  5E79 Z;  4IL6 Z;  3A0B Z;  5H2F Z;  5TIS Z;  5B5E Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...