3KZIZ

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein 1
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
total genus 22
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3kziZ00
3KZIZ 3A0BZ 4UB6Z 4PJ0Z 5B66Z 3WU2Z 3JCUZ 3A0HZ 5E79Z 5TISZ 1S5LZ 4UB8Z 5KAFZ 5GTHZ 5H2FZ 2AXTZ 5B5EZ 5GTIZ 5KAIZ 4IL6Z
chains in the Genus database with same CATH superfamily
2B5UA 4N23A 5KUKA 4J9ZB 1F23A 2FYUH 2EIJC 3ZMTA 3JARB 4FM2A 1W59A 4OXSA 4NXMB 4DRXA 3VQXA 4CZZA 5LYJA 1SZXA 1CEZA 1HR0B 4U3JA 1N32O 3J81N 2UUCB 3ZN0A 3ASOB 4LF8O 2EULA 1N36O 3QTCA 2XUMA 1KP2A 2VRZA 2FMLA 3ZJZA 3K0GA 3B8MA 2A9HA 2Q4PA 4X8AA 4ZOLA 1WA8A 1PD3A 2QEXV 1V55B 2ZQMA 2GUZA 4X1KB 4ZBMA 1V9PA 4QPJA 2OYQA 3C3SA 1FFXB 5K1XA 2XT9A 3JYCA 3CRRA 3P3PA 3KG2A 4PJ0Z 3HKDB 1OCZB 5C8YA 1NTKH 1HNXB 1H2SB 4LF4B 4O4HB 2HJFC 2EJ7A 4JGSA 5GTHZ 2BTOA 4DV6B 1AB3A 3DTUB 3B2EE 2ZM6O 1N34B 5LMNB 2DMXA 5IYCO 1H2LA 1HR0O 1V54C 2UUCO 3CCLV 1NBMG 2YXLA 4ZHQB 3U11A 3D3IA 1MZFA 2CGNA 2QWRB 5IDJA 4CS3A 4NKGB 1NQTA 3HPLC 4UCVA 4TWKA 2D2CB 1Q7YW 3M99B 4RUFA 2JGDA 2HVKC 3DXRB 5GW7A 1TUBA 2DOSA 4FLTA 4BAYA 3MHSC 4YJ3B 1FAFA 3A0HZ 2QM8A 2N74A 1VQLV 2YEVB 2ZNIA 3CCJV 1IBMB 3RYFA 4Q20A 1HNXO 1P4RA 1TAEA 1TGOA 4LF4O 5IE9A 2PYLA 3U10A 3CXCU 3ZCCA 3B40A 3L70H 3QO7A 4DV6O 3ZRWA 4JI1B 4DV2B 3ASNC 5KMGB 2EZOA 3TJTA 1FPOA 1J5EB 2QM7A 3QF7A 1GH6A 1PNLA 3CC4V 1N34O 1VQKV 3RYHB 5LMNO 4D6TH 4K3AA 3FAVA 2V1DA 5LGNA 3MHHC 5JCOC 2ITCC 4TT3G 3ABLC 2P06A 4OX9O 3F7YC 3PN1A 3JSNA 4HBNA 5HFMA 4BW9A 4AI8A 2WLIA 4PD4F 4MVQA 3AG3B 1K34A 1VQ6V 2V7QG 2YIBD 3ZHTA 3ZBHA 1DK1A 2UU9O 1KYOF 3OMIB 2P7TC 1KD1W 4HNAA 3CX5F 3SPHA 1VQOV 4RO2A 4GKJB 3BAAA 1Y76B 1K9MW 1XL4A 1Y74B 1IBMO 4TUYB 3A2FA 1KKDA 1AROP 1KP3A 1S72V 1AJPA 2A0LA 3A0RA 1NTZH 2ZE7A 3OR6C 2Q9LA 1F4MA 1XQ8A 4I55A 4JI1O 3ZHRA 1H8HG 4ABMA 4CH3A 1DGSA 3VBBA 4ASUG 1XHZA 2ITDC 1US6A 4EB6A 4R7CA 4DR4B 3JALA 4XDKA 3CRCA 2DYRB 3WB2A 4JI8B 3BFRA 2XNDG 1Y4MA 4ZI7A 4GYCB 1K4CC 1E79G 4EKWA 3CC2V 5ITZA 1SQPH 4X62O 1Z2GA 5CA1A 4B3TB 1MABG 4K35A 2W0XA 2PYJA 2WLLA 3I55V 2IJJA 1JFFB 2ZDIC 2EIMB 1N33B 1JCHA 2X6BA 1I08A 2WAMA 2QR4A 2IJHA 5IJ9A 4JZ2A 3CCUV 2IJIA 3CRMA 4MT8A 1K73W 2ZKOA 1VQ8V 2C2AA 4UXNA 3JAKB 1BS3A 2D3OW 3M7MX 4JI4B 4FLZA 1JVMA 2JEXA 3BHPA 5BMVA 3UT5A 5IWAB 1CPYA 5LXTB 1P84F 2JS5A 4I50B 1NZ6A 3IFXA 5CMUA 1QLEB 3FB5C 5TISZ 3JSLA 1QR9A 5JVDA 3G6EV 1IBLB 2BTQA 4K0KB 2B1IA 4DR4O 1WB8A 2DYSC 2WLJA 4JI8O 2ZXWB 3N2GB 3AK2A 2Y0PA 4UCRA 3H1HH 1IZ3A 1XI1A 2YI8A 4DW0A 2BE3A 3CCMV 4IHJA 5LOVA 4JV5O 3K3WA 2YUAA 3RWRD 4B3SB 5F2VO 2R72A 3LDEA 4RQFA 1R3LC 3OMAB 4DV4B 3LDCA 4JYYA 1QBZA 1N33O 3L71H 1HNZB 3SJQC 3K04A 4TV8A 3OM3B 1H2MA 4MTOA 4FLUA 1PV0A 1SQGA 3G71V 3SYOA 4KL1A 2P4VA 3E22A 4JPRA 5D5PA 5LL6Y 4EFEA 4DR7B 4LFAB 4YIOA 2H94A 2WWWA 1X59A 3LSUA 3CCQV 5CBHA 3JAWA 3ZS8C 5LGTA 5IWAO 4GX5A 5IYZB 3AG3C 2YICA 5DN6G 3G80A 2LFSA 3OTOO 2ZE5A 3ABUA 1OCRB 3CRAA 3D36C 3UO2A 2ZT9B 4K0KO 5J2TB 2AW9A 1QR8A 1J95A 4J9YB 4X9QA 3T1HB 4X1IB 4JI5O 4LFBB 5L3DA 3WFVA 4HZ3A 3BCCH 5BZBA 2YI9A 4B3MO 4X64B 4X65B 4FJCC 3J80N 2LJ2A 2HP8A 1AI5A 4DUYB 2Z5UA 1KECA 4J7ZA 1GK9A 2ADQB 1MMMA 2HFEC 1L1FA 1K4DC 2DQ3A 4A5UB 1XMQB 3HKEB 5CA0B 1UPGA 2LFRA 5JJJB 3RFRA 3WB1A 4ZIBA 1KC8W 4DR7O 2Q7HA 3UKMA 2F95B 1XMOO 5J9PC 2HJDA 4YHHO 1XREA 2BOBC 2EIMC 3JD3A 5EIBD 2AXTZ 3F5WC 4AQYB 1KMIZ 3JD0A 1QQCA 1GTOA 3CSXA 3A0BZ 2LGQA 3H1LH 3X2QB 2OCCB 3T1HO 4H0LB 5LA6B 4LFBO 1N0NA 4I9WA 3W7SA 5EBLC 4JI0B 3CP1A 2UUAB 3AEIA 3EVKA 4CH4A 1B04A 1QLEC 1Z5WA 4JASA 4X65O 1FXVA 1OCOC 2HHHB 1XILA 2LW1A 4WCEV 3MAQA 4DUYO 1RSOB 1IDSA 4I5SA 1Q82W 1LNQA 1AI7A 1BSMA 2A79B 2PGGA 3L74H 3OUFA 2YIBA 2IU3A 4PV1B 1IX9A 1Q6UA 2V4DA 2ZXWC 1W0JG 1YVWA 2DJVA 4NR1A 4UCOA 2OT5A 1NTMH 4BW5A 1HWYA 3ABMC 1FJGB 2P6JA 1ZUQA 2PUSA 4I9QA 3B77A 2GV9A 1PNKA 4R50A 3L72H 3K0DA 2CH7B 4QIWF 1GM7A 4QE9A 3T1YB 3TCUA 3RYIB 1XNQB 1Y66A 2QWOB 1K7DA 4PHZA 1ZL8A 1AJQA 4YY3O 2DE0X 4KXRA 3F5TA 4OPAA 4X1YB 4H44B 3OT7A 5B3SC 4FMTA 2XASA 4P9OA 3HB3B 3CJHA 4JI0O 2UUAO 2F66C 2AGAA 4CS4A 4X20A 2CTWA 4DV7B 4GX1A 4GCZA 2F23A 1OCRC 4NTYA 5FPRA 2ZCEA 2BCCH 1VARA 1K92A 4LC1A 3OGCC 3P3NA 5GONB 5LMUB 4L87A 5GTIZ 4D7TA 2A7WA 3JATA 1MZEA 4IL6Z 3STLC 3D3QA 2F4VB 4I0XB 3E89A 3JCUZ 1FJGO 2CK3G 5L3FA 3RYCB 3GWKC 1GM8A 2PY5A 1SA0A 5KHKA 4J11A 5CB4B 1MG1A 4JI7O 1AR5A 3BA8A 1L0NH 2M6YA 5JCOA 4DR1B 5B1NA 3T1YO 2ZE6A 4X66B 3KZIZ 1GAXA 2Y69C 4RQEA 2Q7GA 3PJSK 3JARA 3UO3A 1TVKA 5KX5B 3FYEB 4UVBA 2WLMA 4LNUB 4LF6B 1GRJA 5EYPA 2N05A 3SPIA 2PI5A 4IGGA 4KHPB 2RDCA 3HKCB 4MTFA 2DWDC 3ZMSA 1ZWIC 1M57B 2Y4UA 2P4KA 5LMUO 3ZHUA 4DRXB 2GBOA 2KKWA 3M8AA 2OIEA 3X2QC 2OCCC 3K5NA 3C3TA 3E86A 4X1KA 2WA3A 5BXZA 4U3JB 1AVMA 1I0HA 2F4VO 4F6RB 2WLKA 2E3CA 1SRYA 4F4LA 4WFGA 4FM0A 2KG7A 1AR1B 1FFXA 1OV9A 2RN9A 3ZX6A 3UCSC 3HKDA 5EC2C 2CTRA 1SETA 3W7XA 4O4LA 4X66O 3OD4A 4KP4A 1G1XB 3E83A 2ZDIA 1W0KG 4NXMO 3BRCA 1KBHA 1QU7A 4Q6GA 5C8YB 1WPXA 2WPDG 2IM9A 2JVDA 1YJWV 4B7KA 4J10A 2UXDB 4R8CA 1U97A 1N0JA 4LWSA 3SR2C 2DWEC 1K97A 1JOYA 3BA9A 4DV3B 4MVRA 2DN9A 1CXZB 2Q68A 2QKCA 3FD9A 1MSDA 5IJ0A 1H8EG 4WFEA 2VWKA 2QTOA 3VOUA 4CBCA 1O9GA 4WFFA 1EZJA 2R9RB 4W4LA 1YZBA 3E8GA 5IT9N 1LUWA 4LFCB 1DLBA 4P9PA 3CWBH 3AK3A 3N27A 3T2MA 2UXBB 1PNMA 2QKSA 4GX0A 1SERA 2Q67A 4WBNA 3RN4A 5JJNB 3T1CA 5L3EA 2X0LA 3WG7B 1TUBB 3GB7C 3RVYA 1XBLA 1NH2B 2A06H 2QTSA 4GX2A 1PPJH 3RYFB 4O4IB 1OCCB 3U0ZA 4DV1B 3K06A 2WLHA 2B9ZA 4H37A 1K5SA 1M9NA 3VQWA 3AG2B 3E8FA 5EK0A 2Q5ZA 3ZRWB 5B1BC 4DR3B 2JJ1G 5LHHA 2RQ6A 2UXNA 3ML0A 3R65A 1R3KC 4DV3O 3OAAG 3B09A 5D5QA 1ZLZA 2OTJV 4NXNB 3H01A 4LR3A 3D36A 3CMAV 4PDMA 5A9GA 3C90A 5EZYB 3ASOC 2GSMB 2WLIB 1NI8A 4TUYA 2UXBO 1MA1A 1URFA 4O4JA 3AK1A 1GO3F 5IY5B 1V55C 3RVZA 1ENVA 2EIKB 4TV9A 3CEIA 4DV2O 4EFBA 3OMNB 4CS2A 1J5EO 4HYOA 1WNSA 4BIUA 1XNRB 2Q6AA 4DV1O 3AG7A 1Q43A 1OCZC 4BIZA 4MTGA 2AZ2A 3FB6C 1Q81W 1RM1B 1OZ0A 4MVUA 1SESA 4DR3O 1NVPD 3UQ8A 1YCIA 3SJCC 1FFTB 2FB5A 1FKAO 3MDSA 1NR1A 3E35A 4NXNO 4PI0A 1AI6A 4G28B 4ZI7B 4QPKA 1W2BU 1RP3B 2PZSA 4B08A 5CA3A 1OHHG 3APOA 3O9OA 1SS3A 3JASB 3ZHVA 4BR6A 4MW8A 4GKJO 3T4DA 4B7EA 4J7KA 4MVOA 1I5YA 3NXSA 3JAKA 2R70A 3ETEA 1ZAUA 3CRQA 5BR8B 2BSKA 1VQPV 1SQVH 1PL0A 1WB7A 2O57A 4H13B 5LXTA 4FVMA 4UVAA 1OJHA 4P30A 4PA7A 5B1AB 5E79Z 5LBQA 4DK0A 1PKXA 4PDLA 2QWNB 4JAAA 1K8AW 4PDVA 4LBEC 4O2AA 2LP7A 3IJ4A 2CTQA 3CB2A 1O9HA 4FM1A 4GT1A 1EZVH 5JQGB 1EFRG 1HW7A 1VQ5V 3UT5B 3W7TA 3SYQA 1NT2B 4LCUC 1H2NA 2R9AA 3B4SA 4G27B 5FL7G 5JVDB 2L6LA 4YXWG 4B3TO 1FXKB 4X88A 5EIBC 1WAZA 2BTQB 3AG1B 3QG5A 3G6BA 3SPGA 5CN0A 1K3EA 3DGEA 1B06A 5JJEB 2KB1A 2ZE8A 3CHXA 3S3XA 4PA6A 1BMFG 4XBFA 1L0LH 1XOUA 3KCYA 3L9DA 1VQ4V 3E8BA 3K5OA 4JAUA 1WP7A 2R9IA 3ZMZA 4JI4O 5BR8O 1YDXA 1I94B 4D7SA 3F7VC 1IVSA 1EN4A 1JX9A 3ICXA 1VF6C 4AHCA 1CP9A 5LGUA 5IYZA 5LP6B 1RPRA 4TV8B 3SPJA 1IXMA 1F7YA 4JAVA 3FFQA 2FTKA 2PTMA 5K1PA 3E22B 1IBLO 1Q6HA 5J2TA 3BEHA 5H6QA 1AJNA 4UCUA 4NYKA 3LDDA 4X1IA 2F1MA 2RCVA 1EM1A 3LSQA 4AILC 4GLXA 4TOIA 4MTXA 1AP5A 4DK1A 5IY5C 3TGUH 3K79A 2P5OA 4B3SO 1YI2V 2EIKC 3STZC 4FFKA 3SDLA 4FPPA 2YIAA 4DV4O 4DO2A 1JR9A 4I4TA 1HNZO 5FNVA 4LF7B 5DECA 2DYRC 4QE7A 5CA0A 3JAMN 2CE4A 1XL6A 1COWG 2Q69A 3OGIB 2IH1C 4LFAO 3HKBA 1KKCA 2WA4A 3QVNA 1I94O 1R3JC 3OW2U 1G6UA 2ILMA 3BABA 4H33A 4JI6B 2Q7EA 4N21A 3ZIAG 1S3JA 4FZ0A 1NH2D 2EIJB 1Z5VA 1D2DA 2K1EA 4J42A 3SYPA 4WFAV 3SJAC 1BHAA 1SQFA 1S5JA 2IJKA 4DV5B 3CE2A 2ODMA 2GTSA 2E74B 2ARHA 1HNWB 5B1AC 2FKXA 4NTWA 4Z2WA 1H38A 2EZPA 4X64O 4MW3A 4MVMA 3OFNG 3LUTB 5JH7B 4IIJB 1RSOA 2CGOA 2F93B 1B3QA 5H9CA 2JRIA 3LSSA 1XMQO 2YS8A 1QVGU 4K8XA 4JF3A 2QJ1A 4YJ2A 1BE3H 3DSQA 4JI2B 1VEWA 1Y67A 2MW2B 4O2BB 1VF7A 5KHJA 2A3QA 1FXKC 3IC7A 3E8HA 5HFLA 4PA4A 2CH7A 4OPHA 4QJFB 4AQYO 3N2KB 2XOKG 1BHBA 3RYIA 1M4UA 1S5LZ 1QVFU 2XAHA 2AHZA 1QLNA 1D5NA 4DV0B 3D8CA 1Q90D 2NNUA 5JWPA 3Q4HA 5BY1A 1DTOA 5H6RA 2BOCC 1V54B 4FFBA 1GMGA 3TXSA 4E2LA 4DV5O 3FB7C 2P90A 5LP6C 2UXCB 1R1BA 4JZGA 4MVZA 3J7AU 1HNWO 3CCEV 3IAYA 3DC6A 2HHHO 1NVPB 4X89A 1ZL8B 3RGBA 2OCHA 1VP7A 5GONA 4JTCB 1M5IA 2H8PC 2JGUA 2DQ0A 4JI2O 2QDOA 5IYBO 4P2ZA 3ZMUA 5J2UA 4J80A 3IGAC 1U96A 1PP9H 1WPBA 4I0XA 4LF8B 1NJIW 3JD1A 1Q8IA 3G67A 2E75B 3SYCA 3ZRXA 1BZKA 3MD0A 4CC6A 3JD4A 2QM4A 1XHXA 2M7WA 3JATB 3CD6V 3ABKB 2RJZA 3OR7C 3CXHF 1JMKC 1XNQO 5KHIA 3CYOA 4U7NA 2YC0A 4DV0O 1SA0B 5L3CA 4LNUA 1SQBH 3O65A 4UB8Z 2ZIOA 2CUGA 3NR7A 2OTLV 3FYIB 4DV7O 3K58A 4W4KA 3HKCA 4NB5A 1Q6IA 2NLJC 4E4EA 3HR0A 3QNEA 4WFHA 1TVKB 2ZM6B 3P32A 2IU0A 3G4SV 5EYPB 5LYJB 4JYAB 3APQA 1AILA 3IC9A 4F6EA 1BT8A 4MVSA 4RWUA 4C7UA 1ZSPA 4RUEA 3ZRVA 4F6RA 2JS3A 4UFZA 4PELA 2LO1A 3ETGA 1S76D 4ZOLB 1WA8B 1Q5OA 1G4YB 4XDJA 3CCSV 4DR1O 1UFIA 3OE7G 4IT5A 2ZR3A 4LH7A 4O4HA 4J41A 5FPOA 4QNHB 2GUZB 4DUZB 2ATKC 3ETQA 4UUJC 1R6TA 1ORQC 1IURA 3OEHG 2XAFA 1P7BA 3FB8C 3AG4B 2KG7B 4NVPA 2EINB 3E2EA 2YDEA 1TA8A 1GN3A 3ETDA 4LF6O 3H9VA 2UXXA 4O4LB 2GTAA 4EEQA 2QWPB 4UCSA 1HP8A 4ZHQA 4KHPO 1JQ0A 1N4CA 1YITV 1RPOA 2IH3C 2Y4TA 2NR5A 1D5AA 2EX3A 5KA5A 3SYAA 5CBGA 1VQ9V 3DXRA 4JYAO 1NR7A 1XDCA 4DYLA 3K03A 3CC7V 4YJ3A 5KHHA 1NU1H 2ZINA 3THOA 4LWSB 5LHIA 4OX9B 1LR1A 4WFBV 1LUVA 5FLXN 3ZN1A 1P49A 2YEVA 2Z0AA 1DF5A 1MOFA 1M56B 1SQQH 3RT3C 5IJ0B 1FD9A 3SJBC 2JGDB 2F43G 3ZMVA 4DR6B 2WLNA 4DUZO 2UU9B 1RFYA 2Y0IA 1PM9A 1XUQA 3EFFK 1GKFA 5KMGA 3TK1A 4I7ZB 2DYSB 3SGIA 4O4IA 2W6JG 1SZTA 1WLEA 3RYHA 3I5DA 4WBNB 4R6ZA 4UVCA 1B6QA 3L73H 4GZRB 4HAMA 2UXDO 1Y6XA 3ABKC 4XDLA 4JI3B 1Q3EA 1AR4A 3WB0A 3H1KH 1TUEB 1AI4A 5A2QN 1VF6A 4DR2B 1YXBA 2ZD9A 3FAVB 3BPZA 1R3IC 3QO5A 1FXHA 2YXYA 3DC5A 2OWOA 4X62B 4LFCO 3K59A 1EBOA 5EZYA 3A8TA 1Y76A 2VS0A 4JYCA 2WSSG 1R73A 1BQ0A 1Y74A 5KA6A 1A32A 5KHGA 4IYHA 1G8MA 1M57C 4FIPC 4ICGA 4DR6O 3TETA 2Z3YA 4LF9B 2L35A 1I7FA 2GDSA 2XAJA 1N8RW 4HNAB 3TXQA 4JTAB 3W7UA 2X7RB 4TQDA 3JD2A 4U7OA 4O4JB 3ZHQA 2OIGA 1PL4A 2QWQB 4I55B 4QGPA 4TV9B 1JJ2U 4JI3O 2IBZH 1E1QG 4LF5B 3AG4C 4IYIA 4EB6B 2YSUB 4DR2O 3JALB 2EINC 3RW0A 1JFFA 1EN5A 3OEEG 4U3FH 1I5XA 3K57A 4OGQB 2XHBA 5ITZB 1UJWB 3CMEV 4UV9A 1S77D 3JASA 1VQ7V 2B1GA 5EC1C 5KAIZ 4FK5C 2XAQA 5CA1B 4JV5B 1VQNV 2NN4A 1MSWD 2PI4A 1QCEA 1SF9A 2WLLB 1R6NA 2CDYA 3W7WA 3EHBB 4LF9O 4I50A 4J7JA 1ZTEA 4CH6A 5IJ9B 5H2FZ 2UUBB 4PA3A 1YEWA 1T5EA 3CPWU 1XNRO 2BSKB 5JQGA 2QA4V 1M56C 5BMVB 3N2GA 3BVOA 3WU2Z 1NS1A 4MSWC 1YTFB 2AHYA 3OTOB 2W0FC 1ZX3A 1OCOB 2EILB 1GN2A 1QNMA 4FLXA 4RAIA 3WG7C 4O2AB 1FXKA 1Q86W 1IXBA 4LF5O 2G38A 1VIBA 4TSFG 4Z1MG 1H2GA 1WJZA 4JI5B 3FKSG 1OCCC 2JDIG 1KQSU 3ABMB 2YXHA 4B3MB 3AG2C 3K5LA 2XAGA 4IHJB 1BQZA 5LOVB 4PA9A 2ETNA 5H5NA 1K33A 3K9AA 3I56V 3CS5A 3VQVA 5KLVH 2H3OA 4BWAA 2AZ0A 3ZRSA 5LP6A 4DW1A 3JCZA 4K8ZA 2HR3A 2Y48A 1NKDA 1BL8A 3LNMB 2UUBO 2KQXA 3KKYA 1WN7A 1YJNV 2GHYA 4DR5B 5B3SB 2Q73A 1XMOB 4UCTA 2XTAA 1M93A 3JAWB 3K5MA 4YHHB 2CAZC 5CBFA 2HG5C 1EN6A 3QO8A 3ZEDA 3EXAA 1IBKB 2QE7G 3KCXA 4GUNA 2HEPA 2E5LB 1ROPA 5IYDO 2Q0OC 1F51A 3K08A 4FLVA 4CC5A 2PF4E 1GN6A 4FLWA 2QGNA 2P22C 5B5EZ 3HKEA 5C93A 3OTFA 2ZIMA 1RM1C 1WP8A 1FYJA 1GM9A 4UB6Z 1YJ9V 3L75H 1SQXH 1QHTA 3CCVV 2HKOA 4MS2A 2CTPA 1THZA 4I4TB 4LH6A 5AG2A 5FNVB 5E1AC 2Y69B 4B3RB 1BCCH 1JPXA 5L3GA 5B1OA 4L8JA 2DW4A 4DR5O 3HKBB 2Q0AA 5LA6A 5LHGA 3ABTA 1JJOA 5KAFZ 4Z1VA 1IBKO 3T4ZA 5JH7A 2KSDA 2QKAA 4IIJA 5DEDA 2Q8VA 2E5LO 2E76B 3OUSA 4YY3B 1S0VA 3GWOA 2VWJA 4PDRA 2JEUA 1KB9F 4LF7O 1H2KA 2RNBA 1JA8A 1MNGA 1VF5B 2ZNJA 4O2BA 1VMGA 4JTDB 2EILC 5EBMC 4GKKB 2X6CA 3AG1C 1SC5B 4JI6O 1M90W 3B8NA 1GN4A 3RBZA 2W6IG 3S3WA 1L8DA 4YJ2B 2RMKB 4B3RO 2JK5C 3N2KA 1KUQA 3UM7A 1FS0G 2VQFB 1BGYH 2VQEB 2FL4A 3SPCA 4X1YA 1YSCA 4JI7B 1YF2A 4PI2A 2LW7A 5EBWC 3K9SA 2ADPA 1YIJV 1K5QA 2HLDG 4YIPA 1HDJA 3FX7A 5KUMA 3Q4HB 2N04A 4UV8A 5L3BA 2QSAA 2JIZG 4FFBB 2X6AA 3CJHB 1E1RG 2EJRA 3ZHSA 4G2KA 2JJ2G 5B66Z 1N32B 1XEQA 2EBOA 4X20B 1P7GA 4FLYA 4DXWA 4FZ1A 3RYCA 2MK3A 1M1KW 4GKKO 2YIDA 1N36B 1VQMV 5CB4A 3R66A 1KU9A 3P30A 4JYBA 1R6KA 4NTXA 2ZR2A 4BIOA 2P67A 1AP6A 5J2UB 1SKVA 2HVJC 3ASNB 2LGWA 4KFMA 1YHQV 4WF9V 2VQFO 3BY6A 1F4NA 2VQEO 4LP8A 4KUMA 2K9PA 5KX5A 1X4TA 4TQFA 4CH5A 1S5HC 3CCRV 2LQTA 1YTFD 5B1BB 1DF4A 5DM6V 2IW5A 2UXCO 3ABLB 4ZKIA 3H1JH 3LNNA 3VQYA 3GVMA 3H1IH
chains in the Genus database with same CATH topology
3KZIZ 3A0BZ 4UB6Z 4PJ0Z 5B66Z 3WU2Z 3JCUZ 3A0HZ 5E79Z 5TISZ 1S5LZ 4UB8Z 5KAFZ 5GTHZ 5H2FZ 2AXTZ 5B5EZ 5GTIZ 5KAIZ 4IL6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI Z;  3A0B Z;  4UB6 Z;  4PJ0 Z;  5B66 Z;  3WU2 Z;  3JCU Z;  3A0H Z;  5E79 Z;  5TIS Z;  1S5L Z;  4UB8 Z;  5KAF Z;  5GTH Z;  5H2F Z;  2AXT Z;  5B5E Z;  5GTI Z;  5KAI Z;  4IL6 Z; 
#chains in the Genus database with same CATH topology
 2B5U A;  4N23 A;  5KUK A;  4J9Z B;  1F23 A;  2FYU H;  2EIJ C;  3ZMT A;  3JAR B;  4FM2 A;  1W59 A;  4OXS A;  4NXM B;  4DRX A;  3VQX A;  4CZZ A;  5LYJ A;  1SZX A;  1CEZ A;  1HR0 B;  4U3J A;  1N32 O;  3J81 N;  2UUC B;  3ZN0 A;  3ASO B;  4LF8 O;  2EUL A;  1N36 O;  3QTC A;  2XUM A;  1KP2 A;  2VRZ A;  2FML A;  3ZJZ A;  3K0G A;  3B8M A;  2A9H A;  2Q4P A;  4X8A A;  4ZOL A;  1WA8 A;  1PD3 A;  2QEX V;  1V55 B;  2ZQM A;  2GUZ A;  4X1K B;  4ZBM A;  1V9P A;  4QPJ A;  2OYQ A;  3C3S A;  1FFX B;  5K1X A;  2XT9 A;  3JYC A;  3CRR A;  3P3P A;  3KG2 A;  4PJ0 Z;  3HKD B;  1OCZ B;  5C8Y A;  1NTK H;  1HNX B;  1H2S B;  4LF4 B;  4O4H B;  2HJF C;  2EJ7 A;  4JGS A;  5GTH Z;  2BTO A;  4DV6 B;  1AB3 A;  3DTU B;  3B2E E;  2ZM6 O;  1N34 B;  5LMN B;  2DMX A;  5IYC O;  1H2L A;  1HR0 O;  1V54 C;  2UUC O;  3CCL V;  1NBM G;  2YXL A;  4ZHQ B;  3U11 A;  3D3I A;  1MZF A;  2CGN A;  2QWR B;  5IDJ A;  4CS3 A;  4NKG B;  1NQT A;  3HPL C;  4UCV A;  4TWK A;  2D2C B;  1Q7Y W;  3M99 B;  4RUF A;  2JGD A;  2HVK C;  3DXR B;  5GW7 A;  1TUB A;  2DOS A;  4FLT A;  4BAY A;  3MHS C;  4YJ3 B;  1FAF A;  3A0H Z;  2QM8 A;  2N74 A;  1VQL V;  2YEV B;  2ZNI A;  3CCJ V;  1IBM B;  3RYF A;  4Q20 A;  1HNX O;  1P4R A;  1TAE A;  1TGO A;  4LF4 O;  5IE9 A;  2PYL A;  3U10 A;  3CXC U;  3ZCC A;  3B40 A;  3L70 H;  3QO7 A;  4DV6 O;  3ZRW A;  4JI1 B;  4DV2 B;  3ASN C;  5KMG B;  2EZO A;  3TJT A;  1FPO A;  1J5E B;  2QM7 A;  3QF7 A;  1GH6 A;  1PNL A;  3CC4 V;  1N34 O;  1VQK V;  3RYH B;  5LMN O;  4D6T H;  4K3A A;  3FAV A;  2V1D A;  5LGN A;  3MHH C;  5JCO C;  2ITC C;  4TT3 G;  3ABL C;  2P06 A;  4OX9 O;  3F7Y C;  3PN1 A;  3JSN A;  4HBN A;  5HFM A;  4BW9 A;  4AI8 A;  2WLI A;  4PD4 F;  4MVQ A;  3AG3 B;  1K34 A;  1VQ6 V;  2V7Q G;  2YIB D;  3ZHT A;  3ZBH A;  1DK1 A;  2UU9 O;  1KYO F;  3OMI B;  2P7T C;  1KD1 W;  4HNA A;  3CX5 F;  3SPH A;  1VQO V;  4RO2 A;  4GKJ B;  3BAA A;  1Y76 B;  1K9M W;  1XL4 A;  1Y74 B;  1IBM O;  4TUY B;  3A2F A;  1KKD A;  1ARO P;  1KP3 A;  1S72 V;  1AJP A;  2A0L A;  3A0R A;  1NTZ H;  2ZE7 A;  3OR6 C;  2Q9L A;  1F4M A;  1XQ8 A;  4I55 A;  4JI1 O;  3ZHR A;  1H8H G;  4ABM A;  4CH3 A;  1DGS A;  3VBB A;  4ASU G;  1XHZ A;  2ITD C;  1US6 A;  4EB6 A;  4R7C A;  4DR4 B;  3JAL A;  4XDK A;  3CRC A;  2DYR B;  3WB2 A;  4JI8 B;  3BFR A;  2XND G;  1Y4M A;  4ZI7 A;  4GYC B;  1K4C C;  1E79 G;  4EKW A;  3CC2 V;  5ITZ A;  1SQP H;  4X62 O;  1Z2G A;  5CA1 A;  4B3T B;  1MAB G;  4K35 A;  2W0X A;  2PYJ A;  2WLL A;  3I55 V;  2IJJ A;  1JFF B;  2ZDI C;  2EIM B;  1N33 B;  1JCH A;  2X6B A;  1I08 A;  2WAM A;  2QR4 A;  2IJH A;  5IJ9 A;  4JZ2 A;  3CCU V;  2IJI A;  3CRM A;  4MT8 A;  1K73 W;  2ZKO A;  1VQ8 V;  2C2A A;  4UXN A;  3JAK B;  1BS3 A;  2D3O W;  3M7M X;  4JI4 B;  4FLZ A;  1JVM A;  2JEX A;  3BHP A;  5BMV A;  3UT5 A;  5IWA B;  1CPY A;  5LXT B;  1P84 F;  2JS5 A;  4I50 B;  1NZ6 A;  3IFX A;  5CMU A;  1QLE B;  3FB5 C;  5TIS Z;  3JSL A;  1QR9 A;  5JVD A;  3G6E V;  1IBL B;  2BTQ A;  4K0K B;  2B1I A;  4DR4 O;  1WB8 A;  2DYS C;  2WLJ A;  4JI8 O;  2ZXW B;  3N2G B;  3AK2 A;  2Y0P A;  4UCR A;  3H1H H;  1IZ3 A;  1XI1 A;  2YI8 A;  4DW0 A;  2BE3 A;  3CCM V;  4IHJ A;  5LOV A;  4JV5 O;  3K3W A;  2YUA A;  3RWR D;  4B3S B;  5F2V O;  2R72 A;  3LDE A;  4RQF A;  1R3L C;  3OMA B;  4DV4 B;  3LDC A;  4JYY A;  1QBZ A;  1N33 O;  3L71 H;  1HNZ B;  3SJQ C;  3K04 A;  4TV8 A;  3OM3 B;  1H2M A;  4MTO A;  4FLU A;  1PV0 A;  1SQG A;  3G71 V;  3SYO A;  4KL1 A;  2P4V A;  3E22 A;  4JPR A;  5D5P A;  5LL6 Y;  4EFE A;  4DR7 B;  4LFA B;  4YIO A;  2H94 A;  2WWW A;  1X59 A;  3LSU A;  3CCQ V;  5CBH A;  3JAW A;  3ZS8 C;  5LGT A;  5IWA O;  4GX5 A;  5IYZ B;  3AG3 C;  2YIC A;  5DN6 G;  3G80 A;  2LFS A;  3OTO O;  2ZE5 A;  3ABU A;  1OCR B;  3CRA A;  3D36 C;  3UO2 A;  2ZT9 B;  4K0K O;  5J2T B;  2AW9 A;  1QR8 A;  1J95 A;  4J9Y B;  4X9Q A;  3T1H B;  4X1I B;  4JI5 O;  4LFB B;  5L3D A;  3WFV A;  4HZ3 A;  3BCC H;  5BZB A;  2YI9 A;  4B3M O;  4X64 B;  4X65 B;  4FJC C;  3J80 N;  2LJ2 A;  2HP8 A;  1AI5 A;  4DUY B;  2Z5U A;  1KEC A;  4J7Z A;  1GK9 A;  2ADQ B;  1MMM A;  2HFE C;  1L1F A;  1K4D C;  2DQ3 A;  4A5U B;  1XMQ B;  3HKE B;  5CA0 B;  1UPG A;  2LFR A;  5JJJ B;  3RFR A;  3WB1 A;  4ZIB A;  1KC8 W;  4DR7 O;  2Q7H A;  3UKM A;  2F95 B;  1XMO O;  5J9P C;  2HJD A;  4YHH O;  1XRE A;  2BOB C;  2EIM C;  3JD3 A;  5EIB D;  2AXT Z;  3F5W C;  4AQY B;  1KMI Z;  3JD0 A;  1QQC A;  1GTO A;  3CSX A;  3A0B Z;  2LGQ A;  3H1L H;  3X2Q B;  2OCC B;  3T1H O;  4H0L B;  5LA6 B;  4LFB O;  1N0N A;  4I9W A;  3W7S A;  5EBL C;  4JI0 B;  3CP1 A;  2UUA B;  3AEI A;  3EVK A;  4CH4 A;  1B04 A;  1QLE C;  1Z5W A;  4JAS A;  4X65 O;  1FXV A;  1OCO C;  2HHH B;  1XIL A;  2LW1 A;  4WCE V;  3MAQ A;  4DUY O;  1RSO B;  1IDS A;  4I5S A;  1Q82 W;  1LNQ A;  1AI7 A;  1BSM A;  2A79 B;  2PGG A;  3L74 H;  3OUF A;  2YIB A;  2IU3 A;  4PV1 B;  1IX9 A;  1Q6U A;  2V4D A;  2ZXW C;  1W0J G;  1YVW A;  2DJV A;  4NR1 A;  4UCO A;  2OT5 A;  1NTM H;  4BW5 A;  1HWY A;  3ABM C;  1FJG B;  2P6J A;  1ZUQ A;  2PUS A;  4I9Q A;  3B77 A;  2GV9 A;  1PNK A;  4R50 A;  3L72 H;  3K0D A;  2CH7 B;  4QIW F;  1GM7 A;  4QE9 A;  3T1Y B;  3TCU A;  3RYI B;  1XNQ B;  1Y66 A;  2QWO B;  1K7D A;  4PHZ A;  1ZL8 A;  1AJQ A;  4YY3 O;  2DE0 X;  4KXR A;  3F5T A;  4OPA A;  4X1Y B;  4H44 B;  3OT7 A;  5B3S C;  4FMT A;  2XAS A;  4P9O A;  3HB3 B;  3CJH A;  4JI0 O;  2UUA O;  2F66 C;  2AGA A;  4CS4 A;  4X20 A;  2CTW A;  4DV7 B;  4GX1 A;  4GCZ A;  2F23 A;  1OCR C;  4NTY A;  5FPR A;  2ZCE A;  2BCC H;  1VAR A;  1K92 A;  4LC1 A;  3OGC C;  3P3N A;  5GON B;  5LMU B;  4L87 A;  5GTI Z;  4D7T A;  2A7W A;  3JAT A;  1MZE A;  4IL6 Z;  3STL C;  3D3Q A;  2F4V B;  4I0X B;  3E89 A;  3JCU Z;  1FJG O;  2CK3 G;  5L3F A;  3RYC B;  3GWK C;  1GM8 A;  2PY5 A;  1SA0 A;  5KHK A;  4J11 A;  5CB4 B;  1MG1 A;  4JI7 O;  1AR5 A;  3BA8 A;  1L0N H;  2M6Y A;  5JCO A;  4DR1 B;  5B1N A;  3T1Y O;  2ZE6 A;  4X66 B;  3KZI Z;  1GAX A;  2Y69 C;  4RQE A;  2Q7G A;  3PJS K;  3JAR A;  3UO3 A;  1TVK A;  5KX5 B;  3FYE B;  4UVB A;  2WLM A;  4LNU B;  4LF6 B;  1GRJ A;  5EYP A;  2N05 A;  3SPI A;  2PI5 A;  4IGG A;  4KHP B;  2RDC A;  3HKC B;  4MTF A;  2DWD C;  3ZMS A;  1ZWI C;  1M57 B;  2Y4U A;  2P4K A;  5LMU O;  3ZHU A;  4DRX B;  2GBO A;  2KKW A;  3M8A A;  2OIE A;  3X2Q C;  2OCC C;  3K5N A;  3C3T A;  3E86 A;  4X1K A;  2WA3 A;  5BXZ A;  4U3J B;  1AVM A;  1I0H A;  2F4V O;  4F6R B;  2WLK A;  2E3C A;  1SRY A;  4F4L A;  4WFG A;  4FM0 A;  2KG7 A;  1AR1 B;  1FFX A;  1OV9 A;  2RN9 A;  3ZX6 A;  3UCS C;  3HKD A;  5EC2 C;  2CTR A;  1SET A;  3W7X A;  4O4L A;  4X66 O;  3OD4 A;  4KP4 A;  1G1X B;  3E83 A;  2ZDI A;  1W0K G;  4NXM O;  3BRC A;  1KBH A;  1QU7 A;  4Q6G A;  5C8Y B;  1WPX A;  2WPD G;  2IM9 A;  2JVD A;  1YJW V;  4B7K A;  4J10 A;  2UXD B;  4R8C A;  1U97 A;  1N0J A;  4LWS A;  3SR2 C;  2DWE C;  1K97 A;  1JOY A;  3BA9 A;  4DV3 B;  4MVR A;  2DN9 A;  1CXZ B;  2Q68 A;  2QKC A;  3FD9 A;  1MSD A;  5IJ0 A;  1H8E G;  4WFE A;  2VWK A;  2QTO A;  3VOU A;  4CBC A;  1O9G A;  4WFF A;  1EZJ A;  2R9R B;  4W4L A;  1YZB A;  3E8G A;  5IT9 N;  1LUW A;  4LFC B;  1DLB A;  4P9P A;  3CWB H;  3AK3 A;  3N27 A;  3T2M A;  2UXB B;  1PNM A;  2QKS A;  4GX0 A;  1SER A;  2Q67 A;  4WBN A;  3RN4 A;  5JJN B;  3T1C A;  5L3E A;  2X0L A;  3WG7 B;  1TUB B;  3GB7 C;  3RVY A;  1XBL A;  1NH2 B;  2A06 H;  2QTS A;  4GX2 A;  1PPJ H;  3RYF B;  4O4I B;  1OCC B;  3U0Z A;  4DV1 B;  3K06 A;  2WLH A;  2B9Z A;  4H37 A;  1K5S A;  1M9N A;  3VQW A;  3AG2 B;  3E8F A;  5EK0 A;  2Q5Z A;  3ZRW B;  5B1B C;  4DR3 B;  2JJ1 G;  5LHH A;  2RQ6 A;  2UXN A;  3ML0 A;  3R65 A;  1R3K C;  4DV3 O;  3OAA G;  3B09 A;  5D5Q A;  1ZLZ A;  2OTJ V;  4NXN B;  3H01 A;  4LR3 A;  3D36 A;  3CMA V;  4PDM A;  5A9G A;  3C90 A;  5EZY B;  3ASO C;  2GSM B;  2WLI B;  1NI8 A;  4TUY A;  2UXB O;  1MA1 A;  1URF A;  4O4J A;  3AK1 A;  1GO3 F;  5IY5 B;  1V55 C;  3RVZ A;  1ENV A;  2EIK B;  4TV9 A;  3CEI A;  4DV2 O;  4EFB A;  3OMN B;  4CS2 A;  1J5E O;  4HYO A;  1WNS A;  4BIU A;  1XNR B;  2Q6A A;  4DV1 O;  3AG7 A;  1Q43 A;  1OCZ C;  4BIZ A;  4MTG A;  2AZ2 A;  3FB6 C;  1Q81 W;  1RM1 B;  1OZ0 A;  4MVU A;  1SES A;  4DR3 O;  1NVP D;  3UQ8 A;  1YCI A;  3SJC C;  1FFT B;  2FB5 A;  1FKA O;  3MDS A;  1NR1 A;  3E35 A;  4NXN O;  4PI0 A;  1AI6 A;  4G28 B;  4ZI7 B;  4QPK A;  1W2B U;  1RP3 B;  2PZS A;  4B08 A;  5CA3 A;  1OHH G;  3APO A;  3O9O A;  1SS3 A;  3JAS B;  3ZHV A;  4BR6 A;  4MW8 A;  4GKJ O;  3T4D A;  4B7E A;  4J7K A;  4MVO A;  1I5Y A;  3NXS A;  3JAK A;  2R70 A;  3ETE A;  1ZAU A;  3CRQ A;  5BR8 B;  2BSK A;  1VQP V;  1SQV H;  1PL0 A;  1WB7 A;  2O57 A;  4H13 B;  5LXT A;  4FVM A;  4UVA A;  1OJH A;  4P30 A;  4PA7 A;  5B1A B;  5E79 Z;  5LBQ A;  4DK0 A;  1PKX A;  4PDL A;  2QWN B;  4JAA A;  1K8A W;  4PDV A;  4LBE C;  4O2A A;  2LP7 A;  3IJ4 A;  2CTQ A;  3CB2 A;  1O9H A;  4FM1 A;  4GT1 A;  1EZV H;  5JQG B;  1EFR G;  1HW7 A;  1VQ5 V;  3UT5 B;  3W7T A;  3SYQ A;  1NT2 B;  4LCU C;  1H2N A;  2R9A A;  3B4S A;  4G27 B;  5FL7 G;  5JVD B;  2L6L A;  4YXW G;  4B3T O;  1FXK B;  4X88 A;  5EIB C;  1WAZ A;  2BTQ B;  3AG1 B;  3QG5 A;  3G6B A;  3SPG A;  5CN0 A;  1K3E A;  3DGE A;  1B06 A;  5JJE B;  2KB1 A;  2ZE8 A;  3CHX A;  3S3X A;  4PA6 A;  1BMF G;  4XBF A;  1L0L H;  1XOU A;  3KCY A;  3L9D A;  1VQ4 V;  3E8B A;  3K5O A;  4JAU A;  1WP7 A;  2R9I A;  3ZMZ A;  4JI4 O;  5BR8 O;  1YDX A;  1I94 B;  4D7S A;  3F7V C;  1IVS A;  1EN4 A;  1JX9 A;  3ICX A;  1VF6 C;  4AHC A;  1CP9 A;  5LGU A;  5IYZ A;  5LP6 B;  1RPR A;  4TV8 B;  3SPJ A;  1IXM A;  1F7Y A;  4JAV A;  3FFQ A;  2FTK A;  2PTM A;  5K1P A;  3E22 B;  1IBL O;  1Q6H A;  5J2T A;  3BEH A;  5H6Q A;  1AJN A;  4UCU A;  4NYK A;  3LDD A;  4X1I A;  2F1M A;  2RCV A;  1EM1 A;  3LSQ A;  4AIL C;  4GLX A;  4TOI A;  4MTX A;  1AP5 A;  4DK1 A;  5IY5 C;  3TGU H;  3K79 A;  2P5O A;  4B3S O;  1YI2 V;  2EIK C;  3STZ C;  4FFK A;  3SDL A;  4FPP A;  2YIA A;  4DV4 O;  4DO2 A;  1JR9 A;  4I4T A;  1HNZ O;  5FNV A;  4LF7 B;  5DEC A;  2DYR C;  4QE7 A;  5CA0 A;  3JAM N;  2CE4 A;  1XL6 A;  1COW G;  2Q69 A;  3OGI B;  2IH1 C;  4LFA O;  3HKB A;  1KKC A;  2WA4 A;  3QVN A;  1I94 O;  1R3J C;  3OW2 U;  1G6U A;  2ILM A;  3BAB A;  4H33 A;  4JI6 B;  2Q7E A;  4N21 A;  3ZIA G;  1S3J A;  4FZ0 A;  1NH2 D;  2EIJ B;  1Z5V A;  1D2D A;  2K1E A;  4J42 A;  3SYP A;  4WFA V;  3SJA C;  1BHA A;  1SQF A;  1S5J A;  2IJK A;  4DV5 B;  3CE2 A;  2ODM A;  2GTS A;  2E74 B;  2ARH A;  1HNW B;  5B1A C;  2FKX A;  4NTW A;  4Z2W A;  1H38 A;  2EZP A;  4X64 O;  4MW3 A;  4MVM A;  3OFN G;  3LUT B;  5JH7 B;  4IIJ B;  1RSO A;  2CGO A;  2F93 B;  1B3Q A;  5H9C A;  2JRI A;  3LSS A;  1XMQ O;  2YS8 A;  1QVG U;  4K8X A;  4JF3 A;  2QJ1 A;  4YJ2 A;  1BE3 H;  3DSQ A;  4JI2 B;  1VEW A;  1Y67 A;  2MW2 B;  4O2B B;  1VF7 A;  5KHJ A;  2A3Q A;  1FXK C;  3IC7 A;  3E8H A;  5HFL A;  4PA4 A;  2CH7 A;  4OPH A;  4QJF B;  4AQY O;  3N2K B;  2XOK G;  1BHB A;  3RYI A;  1M4U A;  1S5L Z;  1QVF U;  2XAH A;  2AHZ A;  1QLN A;  1D5N A;  4DV0 B;  3D8C A;  1Q90 D;  2NNU A;  5JWP A;  3Q4H A;  5BY1 A;  1DTO A;  5H6R A;  2BOC C;  1V54 B;  4FFB A;  1GMG A;  3TXS A;  4E2L A;  4DV5 O;  3FB7 C;  2P90 A;  5LP6 C;  2UXC B;  1R1B A;  4JZG A;  4MVZ A;  3J7A U;  1HNW O;  3CCE V;  3IAY A;  3DC6 A;  2HHH O;  1NVP B;  4X89 A;  1ZL8 B;  3RGB A;  2OCH A;  1VP7 A;  5GON A;  4JTC B;  1M5I A;  2H8P C;  2JGU A;  2DQ0 A;  4JI2 O;  2QDO A;  5IYB O;  4P2Z A;  3ZMU A;  5J2U A;  4J80 A;  3IGA C;  1U96 A;  1PP9 H;  1WPB A;  4I0X A;  4LF8 B;  1NJI W;  3JD1 A;  1Q8I A;  3G67 A;  2E75 B;  3SYC A;  3ZRX A;  1BZK A;  3MD0 A;  4CC6 A;  3JD4 A;  2QM4 A;  1XHX A;  2M7W A;  3JAT B;  3CD6 V;  3ABK B;  2RJZ A;  3OR7 C;  3CXH F;  1JMK C;  1XNQ O;  5KHI A;  3CYO A;  4U7N A;  2YC0 A;  4DV0 O;  1SA0 B;  5L3C A;  4LNU A;  1SQB H;  3O65 A;  4UB8 Z;  2ZIO A;  2CUG A;  3NR7 A;  2OTL V;  3FYI B;  4DV7 O;  3K58 A;  4W4K A;  3HKC A;  4NB5 A;  1Q6I A;  2NLJ C;  4E4E A;  3HR0 A;  3QNE A;  4WFH A;  1TVK B;  2ZM6 B;  3P32 A;  2IU0 A;  3G4S V;  5EYP B;  5LYJ B;  4JYA B;  3APQ A;  1AIL A;  3IC9 A;  4F6E A;  1BT8 A;  4MVS A;  4RWU A;  4C7U A;  1ZSP A;  4RUE A;  3ZRV A;  4F6R A;  2JS3 A;  4UFZ A;  4PEL A;  2LO1 A;  3ETG A;  1S76 D;  4ZOL B;  1WA8 B;  1Q5O A;  1G4Y B;  4XDJ A;  3CCS V;  4DR1 O;  1UFI A;  3OE7 G;  4IT5 A;  2ZR3 A;  4LH7 A;  4O4H A;  4J41 A;  5FPO A;  4QNH B;  2GUZ B;  4DUZ B;  2ATK C;  3ETQ A;  4UUJ C;  1R6T A;  1ORQ C;  1IUR A;  3OEH G;  2XAF A;  1P7B A;  3FB8 C;  3AG4 B;  2KG7 B;  4NVP A;  2EIN B;  3E2E A;  2YDE A;  1TA8 A;  1GN3 A;  3ETD A;  4LF6 O;  3H9V A;  2UXX A;  4O4L B;  2GTA A;  4EEQ A;  2QWP B;  4UCS A;  1HP8 A;  4ZHQ A;  4KHP O;  1JQ0 A;  1N4C A;  1YIT V;  1RPO A;  2IH3 C;  2Y4T A;  2NR5 A;  1D5A A;  2EX3 A;  5KA5 A;  3SYA A;  5CBG A;  1VQ9 V;  3DXR A;  4JYA O;  1NR7 A;  1XDC A;  4DYL A;  3K03 A;  3CC7 V;  4YJ3 A;  5KHH A;  1NU1 H;  2ZIN A;  3THO A;  4LWS B;  5LHI A;  4OX9 B;  1LR1 A;  4WFB V;  1LUV A;  5FLX N;  3ZN1 A;  1P49 A;  2YEV A;  2Z0A A;  1DF5 A;  1MOF A;  1M56 B;  1SQQ H;  3RT3 C;  5IJ0 B;  1FD9 A;  3SJB C;  2JGD B;  2F43 G;  3ZMV A;  4DR6 B;  2WLN A;  4DUZ O;  2UU9 B;  1RFY A;  2Y0I A;  1PM9 A;  1XUQ A;  3EFF K;  1GKF A;  5KMG A;  3TK1 A;  4I7Z B;  2DYS B;  3SGI A;  4O4I A;  2W6J G;  1SZT A;  1WLE A;  3RYH A;  3I5D A;  4WBN B;  4R6Z A;  4UVC A;  1B6Q A;  3L73 H;  4GZR B;  4HAM A;  2UXD O;  1Y6X A;  3ABK C;  4XDL A;  4JI3 B;  1Q3E A;  1AR4 A;  3WB0 A;  3H1K H;  1TUE B;  1AI4 A;  5A2Q N;  1VF6 A;  4DR2 B;  1YXB A;  2ZD9 A;  3FAV B;  3BPZ A;  1R3I C;  3QO5 A;  1FXH A;  2YXY A;  3DC5 A;  2OWO A;  4X62 B;  4LFC O;  3K59 A;  1EBO A;  5EZY A;  3A8T A;  1Y76 A;  2VS0 A;  4JYC A;  2WSS G;  1R73 A;  1BQ0 A;  1Y74 A;  5KA6 A;  1A32 A;  5KHG A;  4IYH A;  1G8M A;  1M57 C;  4FIP C;  4ICG A;  4DR6 O;  3TET A;  2Z3Y A;  4LF9 B;  2L35 A;  1I7F A;  2GDS A;  2XAJ A;  1N8R W;  4HNA B;  3TXQ A;  4JTA B;  3W7U A;  2X7R B;  4TQD A;  3JD2 A;  4U7O A;  4O4J B;  3ZHQ A;  2OIG A;  1PL4 A;  2QWQ B;  4I55 B;  4QGP A;  4TV9 B;  1JJ2 U;  4JI3 O;  2IBZ H;  1E1Q G;  4LF5 B;  3AG4 C;  4IYI A;  4EB6 B;  2YSU B;  4DR2 O;  3JAL B;  2EIN C;  3RW0 A;  1JFF A;  1EN5 A;  3OEE G;  4U3F H;  1I5X A;  3K57 A;  4OGQ B;  2XHB A;  5ITZ B;  1UJW B;  3CME V;  4UV9 A;  1S77 D;  3JAS A;  1VQ7 V;  2B1G A;  5EC1 C;  5KAI Z;  4FK5 C;  2XAQ A;  5CA1 B;  4JV5 B;  1VQN V;  2NN4 A;  1MSW D;  2PI4 A;  1QCE A;  1SF9 A;  2WLL B;  1R6N A;  2CDY A;  3W7W A;  3EHB B;  4LF9 O;  4I50 A;  4J7J A;  1ZTE A;  4CH6 A;  5IJ9 B;  5H2F Z;  2UUB B;  4PA3 A;  1YEW A;  1T5E A;  3CPW U;  1XNR O;  2BSK B;  5JQG A;  2QA4 V;  1M56 C;  5BMV B;  3N2G A;  3BVO A;  3WU2 Z;  1NS1 A;  4MSW C;  1YTF B;  2AHY A;  3OTO B;  2W0F C;  1ZX3 A;  1OCO B;  2EIL B;  1GN2 A;  1QNM A;  4FLX A;  4RAI A;  3WG7 C;  4O2A B;  1FXK A;  1Q86 W;  1IXB A;  4LF5 O;  2G38 A;  1VIB A;  4TSF G;  4Z1M G;  1H2G A;  1WJZ A;  4JI5 B;  3FKS G;  1OCC C;  2JDI G;  1KQS U;  3ABM B;  2YXH A;  4B3M B;  3AG2 C;  3K5L A;  2XAG A;  4IHJ B;  1BQZ A;  5LOV B;  4PA9 A;  2ETN A;  5H5N A;  1K33 A;  3K9A A;  3I56 V;  3CS5 A;  3VQV A;  5KLV H;  2H3O A;  4BWA A;  2AZ0 A;  3ZRS A;  5LP6 A;  4DW1 A;  3JCZ A;  4K8Z A;  2HR3 A;  2Y48 A;  1NKD A;  1BL8 A;  3LNM B;  2UUB O;  2KQX A;  3KKY A;  1WN7 A;  1YJN V;  2GHY A;  4DR5 B;  5B3S B;  2Q73 A;  1XMO B;  4UCT A;  2XTA A;  1M93 A;  3JAW B;  3K5M A;  4YHH B;  2CAZ C;  5CBF A;  2HG5 C;  1EN6 A;  3QO8 A;  3ZED A;  3EXA A;  1IBK B;  2QE7 G;  3KCX A;  4GUN A;  2HEP A;  2E5L B;  1ROP A;  5IYD O;  2Q0O C;  1F51 A;  3K08 A;  4FLV A;  4CC5 A;  2PF4 E;  1GN6 A;  4FLW A;  2QGN A;  2P22 C;  5B5E Z;  3HKE A;  5C93 A;  3OTF A;  2ZIM A;  1RM1 C;  1WP8 A;  1FYJ A;  1GM9 A;  4UB6 Z;  1YJ9 V;  3L75 H;  1SQX H;  1QHT A;  3CCV V;  2HKO A;  4MS2 A;  2CTP A;  1THZ A;  4I4T B;  4LH6 A;  5AG2 A;  5FNV B;  5E1A C;  2Y69 B;  4B3R B;  1BCC H;  1JPX A;  5L3G A;  5B1O A;  4L8J A;  2DW4 A;  4DR5 O;  3HKB B;  2Q0A A;  5LA6 A;  5LHG A;  3ABT A;  1JJO A;  5KAF Z;  4Z1V A;  1IBK O;  3T4Z A;  5JH7 A;  2KSD A;  2QKA A;  4IIJ A;  5DED A;  2Q8V A;  2E5L O;  2E76 B;  3OUS A;  4YY3 B;  1S0V A;  3GWO A;  2VWJ A;  4PDR A;  2JEU A;  1KB9 F;  4LF7 O;  1H2K A;  2RNB A;  1JA8 A;  1MNG A;  1VF5 B;  2ZNJ A;  4O2B A;  1VMG A;  4JTD B;  2EIL C;  5EBM C;  4GKK B;  2X6C A;  3AG1 C;  1SC5 B;  4JI6 O;  1M90 W;  3B8N A;  1GN4 A;  3RBZ A;  2W6I G;  3S3W A;  1L8D A;  4YJ2 B;  2RMK B;  4B3R O;  2JK5 C;  3N2K A;  1KUQ A;  3UM7 A;  1FS0 G;  2VQF B;  1BGY H;  2VQE B;  2FL4 A;  3SPC A;  4X1Y A;  1YSC A;  4JI7 B;  1YF2 A;  4PI2 A;  2LW7 A;  5EBW C;  3K9S A;  2ADP A;  1YIJ V;  1K5Q A;  2HLD G;  4YIP A;  1HDJ A;  3FX7 A;  5KUM A;  3Q4H B;  2N04 A;  4UV8 A;  5L3B A;  2QSA A;  2JIZ G;  4FFB B;  2X6A A;  3CJH B;  1E1R G;  2EJR A;  3ZHS A;  4G2K A;  2JJ2 G;  5B66 Z;  1N32 B;  1XEQ A;  2EBO A;  4X20 B;  1P7G A;  4FLY A;  4DXW A;  4FZ1 A;  3RYC A;  2MK3 A;  1M1K W;  4GKK O;  2YID A;  1N36 B;  1VQM V;  5CB4 A;  3R66 A;  1KU9 A;  3P30 A;  4JYB A;  1R6K A;  4NTX A;  2ZR2 A;  4BIO A;  2P67 A;  1AP6 A;  5J2U B;  1SKV A;  2HVJ C;  3ASN B;  2LGW A;  4KFM A;  1YHQ V;  4WF9 V;  2VQF O;  3BY6 A;  1F4N A;  2VQE O;  4LP8 A;  4KUM A;  2K9P A;  5KX5 A;  1X4T A;  4TQF A;  4CH5 A;  1S5H C;  3CCR V;  2LQT A;  1YTF D;  5B1B B;  1DF4 A;  5DM6 V;  2IW5 A;  2UXC O;  3ABL B;  4ZKI A;  3H1J H;  3LNN A;  3VQY A;  3GVM A;  3H1I H; 
#chains in the Genus database with same CATH homology
 3KZI Z;  3A0B Z;  4UB6 Z;  4PJ0 Z;  5B66 Z;  3WU2 Z;  3JCU Z;  3A0H Z;  5E79 Z;  5TIS Z;  1S5L Z;  4UB8 Z;  5KAF Z;  5GTH Z;  5H2F Z;  2AXT Z;  5B5E Z;  5GTI Z;  5KAI Z;  4IL6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...