1HNXO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hnxO00
1N34O 3RT3C 3M8AA 3J81N 4DR2O 3T1YO 4X65O 4JV5O 1IBLO 1D2DA 3JAMN 1A32A 3T1HO 1I94O 4DV4O 4JI3O 3OTOO 4LF4O 1F7YA 2UXCO 2Z0AA 2ZM6O 4YY3O 1FJGO 4NXMO 5BR8O 4DV3O 5BY1A 4DR1O 4B3TO 1HR0O 1FKAO 2E5LO 4DR4O 4JI5O 1J5EO 4B3MO 4X62O 4AQYO 2UU9O 4DR7O 4DV6O 3J80N 4K0KO 4OPHA 1XNQO 4GKKO 5LMUO 1R1BA 4DV1O 4JI8O 1XMOO 1HNWO 1XNRO 4LF7O 4JI0O 3F5TA 4DR6O 2VQFO 4LF6O 2HHHO 3O65A 1AILA 4DV0O 4JI7O 1R6TA 4DUZO 4DV7O 4JI2O 1N32O 2DOSA 4LFAO 4JYAO 1NS1A 2N74A 2UUCO 2DJVA 2LW7A 4YHHO 2ZKOA 2UUBO 4OX9O 4KHPO 1DK1A 1AB3A 4X66O 5FLXN 1YZBA 4JI6O 5LL6Y 5A2QN 4DV5O 1XEQA 3SDLA 2VQEO 2JRIA 3R66A 4LF5O 4LF9O 3J7AU 2FKXA 4A5UB 2UXBO 5IT9N 2F4VO 1HNZO 1XMQO 4X64O 4B3SO 4JI4O 4JI1O 2UXDO 4B3RO 1N36O 1HNXO 4DR3O 4DR5O 2UUAO 1G1XB 4DV2O 1X59A 1KUQA 1IBMO 4LF8O 4OPAA 4NXNO 5H5NA 1IBKO 4LFBO 4LFCO 1N33O 5LMNO 5BXZA 4GKJO 4DUYO 5IWAO 1FYJA 2AGAA
chains in the Genus database with same CATH superfamily
2LW1A 3M8AA 4MS2A 3UCSC 4KP4A 3KCYA 4FZ1A 3RFRA 4X8AA 2YI9A 4LH6A 4FLTA 1JFFA 3ABLB 3ABLC 4WF9V 2QWNB 2ATKC 3OUFA 1NTMH 2YEVB 4UCUA 1WB8A 4O4IB 2XOKG 5KA6A 3SYAA 1MOFA 3H9VA 4B3MO 4U7OA 2C2AA 2LFRA 4FMTA 4RO2A 4J10A 5CB4A 4MVZA 2WLMA 4PDRA 4B3MB 1P49A 3SJAC 3APQA 3G6EV 2V1DA 1K7DA 2JJ2G 2E3CA 3JAKA 3PJSK 2WPDG 5J2TB 1K4CC 4DV1O 3RYCB 2VWKA 2FL4A 4DO2A 1YJ9V 4GT1A 4DR6O 2CH7B 1RSOA 4YJ3A 4DV1B 1KBHA 2WA4A 2HHHO 4DK1A 3G71V 4WCEV 4QE9A 5LYJB 4DR6B 3U0ZA 4DUZO 3B8NA 5LHHA 2HHHB 2AZ2A 4UB8Z 1OCCB 3SJCC 1D5NA 2DWEC 3E2EA 4DUZB 4X20B 4JI6O 3N2KB 2F23A 4LWSB 4I9WA 3OEEG 4JZ2A 4YIPA 4JI6B 1TAEA 1TUBB 4CC5A 1JOYA 4WBNA 1AI4A 3L73H 4J9YB 1VMGA 1XBLA 5B5EZ 4UB6Z 1K34A 4O4JA 4PA4A 4LFCO 3ETDA 4K3AA 2ADPA 5JCOC 2CK3G 3H1LH 2N04A 4LFCB 3SYQA 5IYZA 1N0JA 1LR1A 2RQ6A 3ASOC 3ASOB 5LA6B 1KKDA 3ZMVA 3JASB 3TJTA 2Q7GA 4DR2O 5L3FA 1RM1B 1RM1C 4D7TA 2F93B 4Z1MG 4I55B 5JH7B 4GX5A 5F2VO 3X2QB 4DR2B 1Y74A 3ZCCA 4FLZA 1SRYA 2ZM6O 5KX5A 4DV3O 2PZSA 4EB6B 1O9GA 4G2KA 2Y69B 1COWG 2ZM6B 4FLXA 4TWKA 4DV3B 3LSUA 4D6TH 4JYBA 2KSDA 1PD3A 1YSCA 3AG3B 1F51A 3AG3C 3JSNA 1FFXB 2ZXWB 2ZXWC 4R7CA 5CB4B 4GKKO 1HW7A 2ADQB 5B3SC 1H38A 4GKKB 1MG1A 1Q8IA 1HNWO 2GSMB 2BSKB 5EBMC 3QG5A 2QTSA 4FVMA 2QWPB 4IHJA 1HNWB 1YHQV 2R9AA 3CE2A 4QNHB 2DJVA 2UXXA 1K73W 4CS4A 2FTKA 5LBQA 2LP7A 4X66O 1YZBA 1NKDA 2JGDB 3SDLA 2P4VA 3DXRA 3OR7C 2P06A 4RQEA 5B1OA 4X66B 3BAAA 4BAYA 4YJ2A 5H6RA 1H8HG 3ABMB 4X64O 4JAAA 1N36O 3WFVA 2JDIG 4KL1A 4X64B 5C8YA 4K35A 3K0DA 3SYPA 4O2AA 4WFFA 2HJDA 3OW2U 1AR4A 5EK0A 2L35A 4GKJO 3SYCA 3JARA 4GKJB 4EFEA 1EFRG 2AW9A 1XL6A 2F66C 5LHIA 2OCHA 2DMXA 2UXDB 4IT5A 3SPJA 4MT8A 5EC1C 1BQ0A 4LF4O 2Z3YA 4I4TA 4N21A 2IJJA 1W2BU 2UXCO 3K5MA 1ZTEA 1VQ6V 4J9ZB 4ABMA 4LFBB 1MNGA 1AP5A 1QR9A 4LF4B 5KX5B 2PYJA 2UXCB 3QO7A 2QA4V 2ZE8A 2F1MA 1JJOA 5DEDA 3BFRA 2YICA 2A06H 4AQYO 3JD2A 5JJNB 4AQYB 3T1YB 2IW5A 2JGUA 4LNUA 4MTXA 4LF7O 4JI3B 4WFHA 1M9NA 2Q6AA 1PL0A 2VWJA 2ZR2A 4JI2O 2BTOA 5D5PA 4KHPO 2ZDIC 2RNBA 4JI2B 4K0KB 3FB7C 1DTOA 4KHPB 1IURA 3R66A 2QSAA 3FKSG 3TETA 3J7AU 2FYUH 4NVPA 3LDEA 1HNZO 4PDMA 4TUYB 3WB1A 1H2KA 2GBOA 4TV8B 4DV2O 1S0VA 1HNZB 3IC9A 2WA3A 4H44B 1OCRB 3K5OA 4UCRA 3W7WA 4DV0B 2PF4E 4DV2B 1N33O 1YXBA 5C8YB 3AG4B 3E8FA 3CWBH 1BT8A 3BPZA 1VARA 1N33B 3UO3A 3K79A 3B2EE 3NXSA 4PI0A 3NR7A 4JYYA 5ITZB 3LDCA 2QKAA 4U3JB 3LNMB 4C7UA 2WLLA 5BZBA 3T1HO 3RGBA 3FB8C 1ZL8A 3S3XA 4R50A 4I4TB 3T1HB 1SKVA 2BE3A 1YTFB 3ZRSA 3B40A 2EINB 4MW8A 2E76B 2YXYA 1VIBA 1L0NH 2ARHA 3OFNG 1Z2GA 2QE7G 3TXQA 4DR7O 4DV6O 1ZLZA 2QM8A 3RYHB 3MHSC 4DR7B 4DV6B 2Q8VA 3OTFA 4UV9A 4LNUB 2CTQA 1I94B 2P4KA 1IXBA 4MVOA 3W7XA 3VQVA 5EZYB 1NH2D 5L3BA 4JYAO 2B5UA 2R70A 1I7FA 1K5QA 3CYOA 5KHKA 2RJZA 1KP2A 1AB3A 4JYAB 1PNMA 3K5LA 1U97A 2IH1C 1JJ2U 3BHPA 3CMAV 3CSXA 3B77A 3ZMTA 2WLIA 1M93A 5EYPA 3AK1A 5CA3A 2AHZA 4DR5O 3G80A 3RYIA 1KYOF 1PPJH 1M57B 1M57C 2HKOA 4OPAA 4E2LA 1XQ8A 4JPRA 1GTOA 1NTKH 2WLKA 3BVOA 1VQPV 1PP9H 2LFSA 1OCOB 3ZHSA 5EBLC 2GDSA 2AGAA 2OYQA 3RN4A 2RDCA 3OMAB 1SQGA 4X65O 5CA1B 2JEXA 1US6A 3BABA 3CC4V 2AHYA 4X65B 2CAZC 3UO2A 1IVSA 2RMKB 3H1HH 3CCMV 5BY1A 4B3TO 1FKAO 1R3IC 1XL4A 1XILA 4B3TB 2EIKB 2EIKC 1RP3B 4BR6A 4RQFA 4O2BA 2WLNA 2IU3A 1UJWB 5A9GA 4PHZA 2YEVA 1T5EA 4WFGA 1Y66A 5CMUA 4UCSA 2Y4TA 4O4IA 1GN4A 3ETQA 4J41A 3SPGA 3F5TA 4JF3A 2Y0IA 2X0LA 3D36A 1H2NA 4JTCB 3RYFB 4MVMA 1P7BA 1GN6A 1N8RW 1GM8A 1THZA 1RPOA 1Z5VA 5LGTA 1GAXA 1Q6HA 3P32A 4O4LB 4UCOA 5J2TA 1QBZA 1JMKC 2QJ1A 2ZIOA 4LR3A 1B3QA 1VQNV 4F4LA 4X1IB 3HKBB 1SF9A 4LF9O 1W0JG 1AP6A 2ZINA 3P3NA 3SPCA 3ASNC 4JI4O 2GUZB 1SQQH 5LYJA 4LF9B 4DR3O 4X1YB 2LGWA 4AHCA 4JI4B 3JALA 4DR3B 3UM7A 4ZOLB 2ILMA 4X1KB 5GTIZ 4LWSA 5CA0B 5BXZA 4IIJB 1V9PA 2WAMA 3ABUA 1CP9A 3BRCA 3OE7G 2QDOA 1QLNA 1Q6UA 4ZBMA 2CGNA 1A32A 3H1IH 1AI5A 4CS3A 3F7YC 2DN9A 1OCZC 5IE9A 1KECA 3K0GA 1LNQA 5IJ0A 4NXMO 5LA6A 2DWDC 5FL7G 3IGAC 3CRAA 3P30A 4JTDB 1KMIZ 4NXMB 2W6JG 4NTWA 3ZN1A 3T4DA 5CBFA 4I55A 5JH7A 3AG7A 4O2BB 1XNQO 1KP3A 3UT5A 5DECA 1XNQB 1YITV 1Q6IA 4EB6A 3OR6C 1R73A 3CX5F 3RVYA 1K3EA 2IM9A 1B06A 1M1KW 2P5OA 3AG2B 1FFXA 3AG2C 3D36C 2CTRA 4PD4F 4FM2A 1VF7A 5KAIZ 2BSKA 3E86A 3K06A 3DC6A 1VQLV 3ZMZA 3HB3B 1B6QA 3VQXA 4PDLA 3CCSV 2XAGA 3CJHB 4P9OA 3K58A 2QM7A 2Q73A 1OCCC 3JALB 1SA0A 2JGDA 1V54B 1V54C 1L0LH 3RW0A 1QHTA 1R6NA 5KUMA 1KD1W 4NTYA 3H1KH 3EXAA 2LO1A 1V55B 3STZC 2FMLA 2D2CB 4I9QA 1AR1B 5B1AB 2YIDA 4IL6Z 4FM0A 1EZVH 2Q5ZA 1I08A 1QQCA 1F7YA 1CEZA 3CCEV 3VBBA 1FJGO 5IJ0B 1MA1A 2CGOA 1L1FA 2YXLA 1FJGB 2ZNJA 1VF5B 3QTCA 4BWAA 4X62O 4K8ZA 2WLHA 3T4ZA 5DM6V 1BGYH 2QWQB 1JCHA 5BMVB 2N05A 2KG7B 4X62B 3X2QC 1AROP 2OT5A 1SQVH 1VQ4V 3UT5B 4ICGA 1SETA 3OT7A 2F95B 3CCUV 4JAVA 5KHIA 1YI2V 2NR5A 3CP1A 1BSMA 2Y69C 2IJHA 3H1JH 1AILA 1S77D 1N32O 1BQZA 3K04A 4R8CA 4N23A 1N32B 3SPHA 1B04A 1GO3F 1WJZA 3CHXA 2JS5A 2A0LA 4LF5O 4LC1A 1K92A 2PYLA 2Q4PA 2HLDG 2X6AA 3ETEA 4B7EA 3I5DA 2ZDIA 4LF8O 2EBOA 4CH3A 1Q3EA 1XREA 1SA0B 4LF8B 2P90A 2F43G 2IH3C 1KC8W 3CRRA 4HNAB 4BIOA 1F23A 4DUYO 4CZZA 3ZHRA 4TUYA 3ABMC 4G28B 4LH7A 4TV8A 3CCJV 4DUYB 4WFEA 4TQFA 1QU7A 3JAMN 2HVJC 3ETGA 1KQSU 1N36B 2DYSB 2WLJA 4XDKA 1GM9A 1BZKA 4TSFG 1BCCH 1NJIW 4KUMA 4DR1O 2XTAA 5EC2C 4ZI7B 2YC0A 4LBEC 5ITZA 4EFBA 4DR1B 4XDJA 5IYDO 4U3JA 1VQ7V 1XDCA 4FFBA 2EULA 5LMUO 3A8TA 2H3OA 5C93A 1VEWA 2PUSA 2ZE7A 1VQ5V 3FD9A 3C3TA 1XMOO 3CRQA 2YSUB 4J7ZA 4UCVA 4JI0O 5LGNA 1VQ9V 2CUGA 5GW7A 4GLXA 4UCTA 4P2ZA 3VOUA 1XMOB 3O65A 4JI0B 4CBCA 4JI7O 1E1QG 1FFTB 5IY5B 4OX9O 2EZPA 5B1NA 3RYHA 3K57A 4JI7B 1ORQC 3G67A 4OX9B 3ZX6A 4PJ0Z 4J11A 4MTFA 4X9QA 5AG2A 5LP6C 5LP6B 3P3PA 4FLVA 2QGNA 5EZYA 5L3DA 3B4SA 3FAVB 4LF7B 1N0NA 3JCUZ 2UUAO 4J42A 3ZIAG 5IJ9B 2UUAB 5JJJB 1IXMA 3G6BA 4R6ZA 1BL8A 3QVNA 5EIBD 1WPBA 1HWYA 2XHBA 1R3LC 1H2LA 2D3OW 2A7WA 2W6IG 4KXRA 4MVSA 3LUTB 4FJCC 2GV9A 1QLEB 3IJ4A 1OCRC 1EN6A 1WA8B 5CBHA 3BCCH 1IX9A 3CCLV 3AG4C 4UV8A 3T1CA 2QM4A 4D7SA 3A0BZ 4CH5A 1U96A 1JVMA 4DR4O 1OJHA 4GX1A 5K1PA 3HKDB 1JQ0A 4YXWG 5KUKA 5CA1A 1P7GA 4DR4B 3J80N 1K4DC 4OPHA 1SZXA 3Q4HB 3E35A 2PI4A 3E8BA 4FFBB 4HBNA 1M90W 3HPLC 1KU9A 2LJ2A 2YIAA 2YXHA 1BHBA 2EINC 3HKCB 2V4DA 3MAQA 2N74A 3MD0A 4MTGA 1WNSA 3K59A 4J80A 2V7QG 4PA3A 5CBGA 3CC2V 1M5IA 3T2MA 1S3JA 2ITDC 2Y48A 4ZKIA 2NN4A 4AILC 3JCZA 1WAZA 1WN7A 2QWOB 3RYFA 2Q68A 4ASUG 1KUQA 2KB1A 1FPOA 1IBMO 4NXNO 5H5NA 3ZHQA 2EIJB 3W7SA 3CXCU 4O4LA 3JD1A 3HKEB 5LMNO 1IBMB 4NXNB 1R3JC 4I50B 4X1IA 3HKBA 4FPPA 3GVMA 1NH2B 3TCUA 5LMNB 3RVZA 5KMGA 1UFIA 3I56V 2GUZA 2Q9LA 3ZS8C 3J81N 3DSQA 3TK1A 4X1YA 3SGIA 2Q0OC 4MSWC 1MMMA 4TOIA 2PTMA 3JAWA 2MK3A 5KHHA 4DR5B 4ZOLA 1F4MA 3LDDA 4X1KA 2OTLV 1Y67A 2IBZH 3WG7B 3DTUB 3WG7C 1OZ0A 5CA0A 2EJRA 3E83A 4F6RB 1SC5B 4IIJA 1OCOC 4NYKA 2B9ZA 2EIMB 2EIMC 3N2GA 4B08A 3CC7V 1KKCA 1HDJA 3HR0A 4XDLA 4NR1A 2XT9A 1GH6A 5FNVB 3EHBB 3L71H 2O57A 4E4EA 4Z1VA 2B1GA 5J9PC 2DQ3A 2R9RB 1CXZB 4PI2A 4GX2A 2CDYA 3U10A 2UUCO 2UUBO 2DE0X 1ZWIC 1NVPD 3K08A 2ZT9B 3QF7A 2UUCB 2UUBB 2PY5A 1D5AA 2BTQB 1ZAUA 1WPXA 4LCUC 1S5HC 3ZHTA 3CPWU 1J95A 1NVPB 5IT9N 5TISZ 1M4UA 4FLWA 1YJNV 3E8GA 4NKGB 4DW1A 1JA8A 1X59A 1MABG 1W59A 3AK2A 2UXNA 1JX9A 3MDSA 2RN9A 4H0LB 3K03A 4U3FH 3OGCC 4MVQA 1WLEA 1URFA 3ZMSA 3L9DA 1AJQA 4ZIBA 4BW5A 2G38A 1FYJA 1TVKA 4JZGA 5KMGB 4CH6A 1AI6A 3L75H 2E74B 2PI5A 4TV9B 5KHGA 4JASA 4JV5O 1IBLO 2K1EA 3CJHA 2B1IA 2DQ0A 2QKCA 4TQDA 5HFLA 2LQTA 4BW9A 4DV4O 1IBLB 3JAWB 3E8HA 3SJQC 4F6EA 4DV4B 1FXKB 2H94A 1M56B 1M56C 1VQKV 4HZ3A 3FB5C 3UKMA 2EZOA 4Q20A 5LOVA 1EN4A 2XASA 1JPXA 4EEQA 1KB9F 2UU9O 3N2GB 1NR1A 2XAFA 5B1BB 5B1BC 2UU9B 1K97A 3IFXA 4H37A 1YEWA 4QJFB 1Z5WA 5JWPA 1X4TA 2ZNIA 5B66Z 4UXNA 3ZHVA 3APOA 2XAQA 3AG1B 3AG1C 1AJPA 2YIBD 1Y4MA 3IC7A 4L87A 1R6KA 1DGSA 5GONB 1P4RA 5BMVA 2KG7A 2HFEC 2Y4UA 2AZ0A 3MHHC 3LSQA 4GCZA 5LL6Y 4DRXB 1XEQA 2JIZG 3OGIB 2ZR3A 4A5UB 1GM7A 2XUMA 2F4VO 4B3SO 1VF6A 1HNXO 2LGQA 2DYRB 2DYRC 2F4VB 4B3SB 4MW3A 4Q6GA 3QNEA 5H6QA 3JATB 5J2UA 1HNXB 3K5NA 1G6UA 4QPJA 3WU2Z 2X7RB 2BOCC 1OHHG 4L8JA 2EILB 2EILC 5L3GA 3ZN0A 5DN6G 4HAMA 1I5XA 4ZHQA 5IWAO 3FB6C 4RUEA 3THOA 2QEXV 1TVKB 2IJKA 5E79Z 1SQXH 5IWAB 2A79B 1D2DA 2VS0A 1TUEB 3JD4A 3L70H 3ZJZA 3OEHG 1NZ6A 2M7WA 4QIWF 1FXHA 1H2GA 3ZMUA 5LXTB 4YY3O 4HNAA 5BR8O 3KG2A 3A2FA 1DLBA 3ZRXA 2E5LO 2EX3A 4YY3B 4OXSA 1J5EO 2EJ7A 5BR8B 4DXWA 1V55C 5LOVB 5LHGA 1QVFU 2E5LB 1MZFA 3B8MA 5B1AC 1J5EB 1Y6XA 5K1XA 5JJEB 3G4SV 2IU0A 2R9IA 5H9CA 4PA7A 3ZBHA 2GTSA 4H33A 1K9MW 1TA8A 4KFMA 2AXTZ 1IDSA 4G27B 5JQGB 4LF6O 4ZI7A 5HFMA 4LF6B 4UVBA 4DV7O 3LNNA 3C90A 4PDVA 4YHHO 3FYEB 1E79G 3DGEA 1DK1A 4PA6A 4CS2A 1XI1A 4DV7B 2WSSG 3KKYA 4YHHB 1UPGA 4DV5O 4IYHA 3I55V 1NI8A 1YF2A 3C3SA 4GX0A 5JVDB 4RUFA 3BY6A 4DV5B 1GN2A 1K5SA 4X89A 4JI1O 1XOUA 1Q90D 1NR7A 1WB7A 1VF6C 4JI1B 1JFFB 1GN3A 1K33A 1P84F 5J2UB 3JYCA 3AEIA 1F4NA 4U7NA 1AI7A 5LP6A 3EFFK 1S72V 2Z5UA 2RCVA 2KQXA 2YDEA 4ZHQB 4WFBV 4LF5B 3FAVA 3RWRD 1EM1A 3WB2A 2W0XA 5IJ9A 2CTPA 5B3SB 3KCXA 2Q67A 3F7VC 4PA9A 4FK5C 3JAKB 1Q7YW 3H01A 4OGQB 1NTZH 1RSOB 4YJ3B 4JI5O 3CB2A 4JI5B 5E1AC 1VP7A 1R3KC 4IYIA 2IJIA 1WA8A 2DYSC 4JAUA 5H2FZ 1R1BA 3OUSA 2XAHA 2VQFO 3HKDA 1EZJA 4WBNB 1RPRA 4UVCA 2VQFB 5KHJA 3CCVV 3Q4HA 3E89A 2YI8A 2ZKOA 3A0RA 4MVUA 2MW2B 4O4JB 4QPKA 5FLXN 1SERA 2P22C 4YIOA 1GMGA 5IYZB 4K8XA 5LMUB 1QVGU 4DYLA 4P9PA 3HKCA 1XMQO 1NBMG 1Q82W 2UXDO 3KZIZ 4B3RO 3UQ8A 3CRCA 4BIUA 1Y76A 1BE3H 2ZD9A 3JSLA 1XMQB 2GTAA 4B3RB 5IY5C 2ZQMA 5IDJA 2Q0AA 4LFBO 1ZUQA 1I5YA 1QR8A 1Y74B 2OIGA 2JK5C 4BIZA 1AVMA 1MSWD 2M6YA 3ABKB 1NU1H 3ABKC 1L8DA 1QNMA 3DC5A 3RT3C 3JD0A 1GKFA 3T1YO 3RBZA 4W4KA 3WB0A 1I0HA 1N4CA 4JTAB 4I5SA 3SR2C 2Q69A 4JI3O 3HKEA 4IGGA 3IAYA 3ML0A 4I50A 5FPOA 3FYIB 3N27A 1YVWA 4IHJB 4DK0A 2Y0PA 5FPRA 3JD3A 4UUJC 4K0KO 1VQOV 2X6BA 3ABTA 4RWUA 5EIBC 1O9HA 2CE4A 2QR4A 4DW0A 1QLEC 3GWKC 2CTWA 1YCIA 4X88A 5KA5A 4JI8O 3DXRB 3W7TA 4WFAV 4F6RA 2WWWA 1Q43A 1RFYA 1AJNA 2KKWA 4JGSA 1ENVA 2JVDA 1YDXA 4TT3G 4JI8B 3SJBC 4YJ2B 4J7KA 4DV0O 1R6TA 3K9SA 4O4HA 2ZIMA 4AI8A 3OMNB 5A2QN 5FNVA 3ZRWA 4O2AB 4CH4A 2PGGA 4P30A 3FFQA 2UXBO 1CPYA 1ZX3A 1SQPH 3STLC 1G4YB 1PNKA 4HYOA 3JARB 2UXBB 1FD9A 1YTFD 1Y76B 1FXVA 2QKSA 2A9HA 3EVKA 2ITCC 2OCCB 2OCCC 3ZRVA 2JS3A 4I0XA 3GWOA 1DF5A 3M99B 4FFKA 3S3WA 2YUAA 2OTJV 2BTQA 3OMIB 1WP7A 1ZSPA 3LSSA 3BA8A 4FLYA 1SS3A 4GZRB 3ICXA 3D3IA 1G8MA 3W7UA 5L3EA 1K8AW 1N34O 1FAFA 3OM3B 2ETNA 2HEPA 2VRZA 2JJ1G 2HP8A 4QGPA 4EKWA 1N34B 1Q5OA 3D8CA 1S76D 4I7ZB 2P7TC 5GTHZ 1I94O 2EIJC 2QTOA 4GUNA 3OTOO 2HJFC 1H2SB 2Z0AA 1QCEA 5L3CA 3QO8A 3OTOB 1PL4A 4MVRA 1HR0O 3TGUH 4TV9A 4RAIA 1EBOA 3CD6V 3K9AA 1HR0B 3QO5A 3A0HZ 1H2MA 3SPIA 2A3QA 3CS5A 3GB7C 1FXKA 4MTOA 1VQ8V 1SQFA 2X6CA 1W0KG 1ROPA 1PKXA 1YIJV 1IZ3A 2JEUA 3D3QA 2H8PC 2YS8A 1NQTA 2HG5C 3E22A 3CRMA 3CCRV 4NB5A 4Z2WA 4O4HB 3F5WC 2OWOA 2NNUA 1YJWV 2P67A 2ZCEA 4NTXA 3ZRWB 5LGUA 4FLUA 1S5LZ 1LUVA 2BOBC 1FS0G 5IYCO 2XAJA 3L72H 2K9PA 1HP8A 2Q7EA 3K3WA 1PM9A 4QE7A 5GONA 2WLLB 1IBKO 4GYCB 4I0XB 5CN0A 1ZL8B 4DRXA 3ZEDA 2HR3A 2YIBA 3U11A 1E1RG 1IBKB 2L6LA 1WP8A 4XBFA 1BS3A 1Q81W 1TGOA 3L74H 2NLJC 2HVKC 3VQYA 4FIPC 3OAAG 1MSDA 1H8EG 3JATA 4CC6A 2P6JA 2ZE6A 3CMEV 4FM1A 1BHAA 2ZE5A 5EBWC 1NT2B 2R72A 2DW4A 1AR5A 3R65A 4H13B 1PNLA 3TXSA 3B09A 1MZEA 3CXHF 1SZTA 1BMFG 1JR9A 4PELA 3PN1A 1SQBH 4JV5B 1SESA 4UVAA 3BA9A 1GK9A 1S5JA 3RYCA 5LXTA 2FB5A 2BCCH 1XHZA 2E75B 1XNRO 2CH7A 1FXKC 5D5QA 3ASNB 1EN5A 4W4LA 3CCQV 1XNRB 3SYOA 2WLIB 5EYPB 4JYCA 2Q7HA 3FX7A 2DOSA 2GHYA 2OIEA 3RYIB 4LFAO 1NS1A 2LW7A 3E22B 2XNDG 4X20A 1LUWA 3BEHA 3N2KA 1VQMV 4LFAB 1Q86W 2VQEO 2JRIA 2ODMA 3O9OA 5JQGA 1TUBA 3AK3A 2FKXA 2QWRB 4J7JA 2VQEB 2W0FC 1DF4A 3M7MX 5KLVH 4B7KA 1G1XB 4LP8A 4FZ0A 1OCZB 1GRJA 4UFZA 3CEIA 5IYBO 3OD4A 5JCOA 5KAFZ 3ZHUA 1XHXA 1OV9A 1PV0A 5JVDA 1XUQA 4PV1B 3VQWA 3JASA
chains in the Genus database with same CATH topology
1N34O 3RT3C 3M8AA 3J81N 4DR2O 3T1YO 4X65O 4JV5O 1IBLO 1D2DA 3JAMN 1A32A 3T1HO 1I94O 4DV4O 4JI3O 3OTOO 4LF4O 1F7YA 2UXCO 2Z0AA 2ZM6O 4YY3O 1FJGO 4NXMO 5BR8O 4DV3O 5BY1A 4DR1O 4B3TO 1HR0O 1FKAO 2E5LO 4DR4O 4JI5O 1J5EO 4B3MO 4X62O 4AQYO 2UU9O 4DR7O 4DV6O 3J80N 4K0KO 4OPHA 1XNQO 4GKKO 5LMUO 1R1BA 4DV1O 4JI8O 1XMOO 1HNWO 1XNRO 4LF7O 4JI0O 3F5TA 4DR6O 2VQFO 4LF6O 2HHHO 3O65A 1AILA 4DV0O 4JI7O 1R6TA 4DUZO 4DV7O 4JI2O 1N32O 2DOSA 4LFAO 4JYAO 1NS1A 2N74A 2UUCO 2DJVA 2LW7A 4YHHO 2ZKOA 2UUBO 4OX9O 4KHPO 1DK1A 1AB3A 4X66O 5FLXN 1YZBA 4JI6O 5LL6Y 5A2QN 4DV5O 1XEQA 3SDLA 2VQEO 2JRIA 3R66A 4LF5O 4LF9O 3J7AU 2FKXA 4A5UB 2UXBO 5IT9N 2F4VO 1HNZO 1XMQO 4X64O 4B3SO 4JI4O 4JI1O 2UXDO 4B3RO 1N36O 1HNXO 4DR3O 4DR5O 2UUAO 1G1XB 4DV2O 1X59A 1KUQA 1IBMO 4LF8O 4OPAA 4NXNO 5H5NA 1IBKO 4LFBO 4LFCO 1N33O 5LMNO 5BXZA 4GKJO 4DUYO 5IWAO 1FYJA 2AGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 O;  3RT3 C;  3M8A A;  3J81 N;  4DR2 O;  3T1Y O;  4X65 O;  4JV5 O;  1IBL O;  1D2D A;  3JAM N;  1A32 A;  3T1H O;  1I94 O;  4DV4 O;  4JI3 O;  3OTO O;  4LF4 O;  1F7Y A;  2UXC O;  2Z0A A;  2ZM6 O;  4YY3 O;  1FJG O;  4NXM O;  5BR8 O;  4DV3 O;  5BY1 A;  4DR1 O;  4B3T O;  1HR0 O;  1FKA O;  2E5L O;  4DR4 O;  4JI5 O;  1J5E O;  4B3M O;  4X62 O;  4AQY O;  2UU9 O;  4DR7 O;  4DV6 O;  3J80 N;  4K0K O;  4OPH A;  1XNQ O;  4GKK O;  5LMU O;  1R1B A;  4DV1 O;  4JI8 O;  1XMO O;  1HNW O;  1XNR O;  4LF7 O;  4JI0 O;  3F5T A;  4DR6 O;  2VQF O;  4LF6 O;  2HHH O;  3O65 A;  1AIL A;  4DV0 O;  4JI7 O;  1R6T A;  4DUZ O;  4DV7 O;  4JI2 O;  1N32 O;  2DOS A;  4LFA O;  4JYA O;  1NS1 A;  2N74 A;  2UUC O;  2DJV A;  2LW7 A;  4YHH O;  2ZKO A;  2UUB O;  4OX9 O;  4KHP O;  1DK1 A;  1AB3 A;  4X66 O;  5FLX N;  1YZB A;  4JI6 O;  5LL6 Y;  5A2Q N;  4DV5 O;  1XEQ A;  3SDL A;  2VQE O;  2JRI A;  3R66 A;  4LF5 O;  4LF9 O;  3J7A U;  2FKX A;  4A5U B;  2UXB O;  5IT9 N;  2F4V O;  1HNZ O;  1XMQ O;  4X64 O;  4B3S O;  4JI4 O;  4JI1 O;  2UXD O;  4B3R O;  1N36 O;  1HNX O;  4DR3 O;  4DR5 O;  2UUA O;  1G1X B;  4DV2 O;  1X59 A;  1KUQ A;  1IBM O;  4LF8 O;  4OPA A;  4NXN O;  5H5N A;  1IBK O;  4LFB O;  4LFC O;  1N33 O;  5LMN O;  5BXZ A;  4GKJ O;  4DUY O;  5IWA O;  1FYJ A;  2AGA A; 
#chains in the Genus database with same CATH topology
 2LW1 A;  3M8A A;  4MS2 A;  3UCS C;  4KP4 A;  3KCY A;  4FZ1 A;  3RFR A;  4X8A A;  2YI9 A;  4LH6 A;  4FLT A;  1JFF A;  3ABL B;  3ABL C;  4WF9 V;  2QWN B;  2ATK C;  3OUF A;  1NTM H;  2YEV B;  4UCU A;  1WB8 A;  4O4I B;  2XOK G;  5KA6 A;  3SYA A;  1MOF A;  3H9V A;  4B3M O;  4U7O A;  2C2A A;  2LFR A;  4FMT A;  4RO2 A;  4J10 A;  5CB4 A;  4MVZ A;  2WLM A;  4PDR A;  4B3M B;  1P49 A;  3SJA C;  3APQ A;  3G6E V;  2V1D A;  1K7D A;  2JJ2 G;  2E3C A;  3JAK A;  3PJS K;  2WPD G;  5J2T B;  1K4C C;  4DV1 O;  3RYC B;  2VWK A;  2FL4 A;  4DO2 A;  1YJ9 V;  4GT1 A;  4DR6 O;  2CH7 B;  1RSO A;  4YJ3 A;  4DV1 B;  1KBH A;  2WA4 A;  2HHH O;  4DK1 A;  3G71 V;  4WCE V;  4QE9 A;  5LYJ B;  4DR6 B;  3U0Z A;  4DUZ O;  3B8N A;  5LHH A;  2HHH B;  2AZ2 A;  4UB8 Z;  1OCC B;  3SJC C;  1D5N A;  2DWE C;  3E2E A;  4DUZ B;  4X20 B;  4JI6 O;  3N2K B;  2F23 A;  4LWS B;  4I9W A;  3OEE G;  4JZ2 A;  4YIP A;  4JI6 B;  1TAE A;  1TUB B;  4CC5 A;  1JOY A;  4WBN A;  1AI4 A;  3L73 H;  4J9Y B;  1VMG A;  1XBL A;  5B5E Z;  4UB6 Z;  1K34 A;  4O4J A;  4PA4 A;  4LFC O;  3ETD A;  4K3A A;  2ADP A;  5JCO C;  2CK3 G;  3H1L H;  2N04 A;  4LFC B;  3SYQ A;  5IYZ A;  1N0J A;  1LR1 A;  2RQ6 A;  3ASO C;  3ASO B;  5LA6 B;  1KKD A;  3ZMV A;  3JAS B;  3TJT A;  2Q7G A;  4DR2 O;  5L3F A;  1RM1 B;  1RM1 C;  4D7T A;  2F93 B;  4Z1M G;  4I55 B;  5JH7 B;  4GX5 A;  5F2V O;  3X2Q B;  4DR2 B;  1Y74 A;  3ZCC A;  4FLZ A;  1SRY A;  2ZM6 O;  5KX5 A;  4DV3 O;  2PZS A;  4EB6 B;  1O9G A;  4G2K A;  2Y69 B;  1COW G;  2ZM6 B;  4FLX A;  4TWK A;  4DV3 B;  3LSU A;  4D6T H;  4JYB A;  2KSD A;  1PD3 A;  1YSC A;  3AG3 B;  1F51 A;  3AG3 C;  3JSN A;  1FFX B;  2ZXW B;  2ZXW C;  4R7C A;  5CB4 B;  4GKK O;  1HW7 A;  2ADQ B;  5B3S C;  1H38 A;  4GKK B;  1MG1 A;  1Q8I A;  1HNW O;  2GSM B;  2BSK B;  5EBM C;  3QG5 A;  2QTS A;  4FVM A;  2QWP B;  4IHJ A;  1HNW B;  1YHQ V;  2R9A A;  3CE2 A;  4QNH B;  2DJV A;  2UXX A;  1K73 W;  4CS4 A;  2FTK A;  5LBQ A;  2LP7 A;  4X66 O;  1YZB A;  1NKD A;  2JGD B;  3SDL A;  2P4V A;  3DXR A;  3OR7 C;  2P06 A;  4RQE A;  5B1O A;  4X66 B;  3BAA A;  4BAY A;  4YJ2 A;  5H6R A;  1H8H G;  3ABM B;  4X64 O;  4JAA A;  1N36 O;  3WFV A;  2JDI G;  4KL1 A;  4X64 B;  5C8Y A;  4K35 A;  3K0D A;  3SYP A;  4O2A A;  4WFF A;  2HJD A;  3OW2 U;  1AR4 A;  5EK0 A;  2L35 A;  4GKJ O;  3SYC A;  3JAR A;  4GKJ B;  4EFE A;  1EFR G;  2AW9 A;  1XL6 A;  2F66 C;  5LHI A;  2OCH A;  2DMX A;  2UXD B;  4IT5 A;  3SPJ A;  4MT8 A;  5EC1 C;  1BQ0 A;  4LF4 O;  2Z3Y A;  4I4T A;  4N21 A;  2IJJ A;  1W2B U;  2UXC O;  3K5M A;  1ZTE A;  1VQ6 V;  4J9Z B;  4ABM A;  4LFB B;  1MNG A;  1AP5 A;  1QR9 A;  4LF4 B;  5KX5 B;  2PYJ A;  2UXC B;  3QO7 A;  2QA4 V;  2ZE8 A;  2F1M A;  1JJO A;  5DED A;  3BFR A;  2YIC A;  2A06 H;  4AQY O;  3JD2 A;  5JJN B;  4AQY B;  3T1Y B;  2IW5 A;  2JGU A;  4LNU A;  4MTX A;  4LF7 O;  4JI3 B;  4WFH A;  1M9N A;  2Q6A A;  1PL0 A;  2VWJ A;  2ZR2 A;  4JI2 O;  2BTO A;  5D5P A;  4KHP O;  2ZDI C;  2RNB A;  4JI2 B;  4K0K B;  3FB7 C;  1DTO A;  4KHP B;  1IUR A;  3R66 A;  2QSA A;  3FKS G;  3TET A;  3J7A U;  2FYU H;  4NVP A;  3LDE A;  1HNZ O;  4PDM A;  4TUY B;  3WB1 A;  1H2K A;  2GBO A;  4TV8 B;  4DV2 O;  1S0V A;  1HNZ B;  3IC9 A;  2WA3 A;  4H44 B;  1OCR B;  3K5O A;  4UCR A;  3W7W A;  4DV0 B;  2PF4 E;  4DV2 B;  1N33 O;  1YXB A;  5C8Y B;  3AG4 B;  3E8F A;  3CWB H;  1BT8 A;  3BPZ A;  1VAR A;  1N33 B;  3UO3 A;  3K79 A;  3B2E E;  3NXS A;  4PI0 A;  3NR7 A;  4JYY A;  5ITZ B;  3LDC A;  2QKA A;  4U3J B;  3LNM B;  4C7U A;  2WLL A;  5BZB A;  3T1H O;  3RGB A;  3FB8 C;  1ZL8 A;  3S3X A;  4R50 A;  4I4T B;  3T1H B;  1SKV A;  2BE3 A;  1YTF B;  3ZRS A;  3B40 A;  2EIN B;  4MW8 A;  2E76 B;  2YXY A;  1VIB A;  1L0N H;  2ARH A;  3OFN G;  1Z2G A;  2QE7 G;  3TXQ A;  4DR7 O;  4DV6 O;  1ZLZ A;  2QM8 A;  3RYH B;  3MHS C;  4DR7 B;  4DV6 B;  2Q8V A;  3OTF A;  4UV9 A;  4LNU B;  2CTQ A;  1I94 B;  2P4K A;  1IXB A;  4MVO A;  3W7X A;  3VQV A;  5EZY B;  1NH2 D;  5L3B A;  4JYA O;  2B5U A;  2R70 A;  1I7F A;  1K5Q A;  3CYO A;  5KHK A;  2RJZ A;  1KP2 A;  1AB3 A;  4JYA B;  1PNM A;  3K5L A;  1U97 A;  2IH1 C;  1JJ2 U;  3BHP A;  3CMA V;  3CSX A;  3B77 A;  3ZMT A;  2WLI A;  1M93 A;  5EYP A;  3AK1 A;  5CA3 A;  2AHZ A;  4DR5 O;  3G80 A;  3RYI A;  1KYO F;  1PPJ H;  1M57 B;  1M57 C;  2HKO A;  4OPA A;  4E2L A;  1XQ8 A;  4JPR A;  1GTO A;  1NTK H;  2WLK A;  3BVO A;  1VQP V;  1PP9 H;  2LFS A;  1OCO B;  3ZHS A;  5EBL C;  2GDS A;  2AGA A;  2OYQ A;  3RN4 A;  2RDC A;  3OMA B;  1SQG A;  4X65 O;  5CA1 B;  2JEX A;  1US6 A;  3BAB A;  3CC4 V;  2AHY A;  4X65 B;  2CAZ C;  3UO2 A;  1IVS A;  2RMK B;  3H1H H;  3CCM V;  5BY1 A;  4B3T O;  1FKA O;  1R3I C;  1XL4 A;  1XIL A;  4B3T B;  2EIK B;  2EIK C;  1RP3 B;  4BR6 A;  4RQF A;  4O2B A;  2WLN A;  2IU3 A;  1UJW B;  5A9G A;  4PHZ A;  2YEV A;  1T5E A;  4WFG A;  1Y66 A;  5CMU A;  4UCS A;  2Y4T A;  4O4I A;  1GN4 A;  3ETQ A;  4J41 A;  3SPG A;  3F5T A;  4JF3 A;  2Y0I A;  2X0L A;  3D36 A;  1H2N A;  4JTC B;  3RYF B;  4MVM A;  1P7B A;  1GN6 A;  1N8R W;  1GM8 A;  1THZ A;  1RPO A;  1Z5V A;  5LGT A;  1GAX A;  1Q6H A;  3P32 A;  4O4L B;  4UCO A;  5J2T A;  1QBZ A;  1JMK C;  2QJ1 A;  2ZIO A;  4LR3 A;  1B3Q A;  1VQN V;  4F4L A;  4X1I B;  3HKB B;  1SF9 A;  4LF9 O;  1W0J G;  1AP6 A;  2ZIN A;  3P3N A;  3SPC A;  3ASN C;  4JI4 O;  2GUZ B;  1SQQ H;  5LYJ A;  4LF9 B;  4DR3 O;  4X1Y B;  2LGW A;  4AHC A;  4JI4 B;  3JAL A;  4DR3 B;  3UM7 A;  4ZOL B;  2ILM A;  4X1K B;  5GTI Z;  4LWS A;  5CA0 B;  5BXZ A;  4IIJ B;  1V9P A;  2WAM A;  3ABU A;  1CP9 A;  3BRC A;  3OE7 G;  2QDO A;  1QLN A;  1Q6U A;  4ZBM A;  2CGN A;  1A32 A;  3H1I H;  1AI5 A;  4CS3 A;  3F7Y C;  2DN9 A;  1OCZ C;  5IE9 A;  1KEC A;  3K0G A;  1LNQ A;  5IJ0 A;  4NXM O;  5LA6 A;  2DWD C;  5FL7 G;  3IGA C;  3CRA A;  3P30 A;  4JTD B;  1KMI Z;  4NXM B;  2W6J G;  4NTW A;  3ZN1 A;  3T4D A;  5CBF A;  4I55 A;  5JH7 A;  3AG7 A;  4O2B B;  1XNQ O;  1KP3 A;  3UT5 A;  5DEC A;  1XNQ B;  1YIT V;  1Q6I A;  4EB6 A;  3OR6 C;  1R73 A;  3CX5 F;  3RVY A;  1K3E A;  2IM9 A;  1B06 A;  1M1K W;  2P5O A;  3AG2 B;  1FFX A;  3AG2 C;  3D36 C;  2CTR A;  4PD4 F;  4FM2 A;  1VF7 A;  5KAI Z;  2BSK A;  3E86 A;  3K06 A;  3DC6 A;  1VQL V;  3ZMZ A;  3HB3 B;  1B6Q A;  3VQX A;  4PDL A;  3CCS V;  2XAG A;  3CJH B;  4P9O A;  3K58 A;  2QM7 A;  2Q73 A;  1OCC C;  3JAL B;  1SA0 A;  2JGD A;  1V54 B;  1V54 C;  1L0L H;  3RW0 A;  1QHT A;  1R6N A;  5KUM A;  1KD1 W;  4NTY A;  3H1K H;  3EXA A;  2LO1 A;  1V55 B;  3STZ C;  2FML A;  2D2C B;  4I9Q A;  1AR1 B;  5B1A B;  2YID A;  4IL6 Z;  4FM0 A;  1EZV H;  2Q5Z A;  1I08 A;  1QQC A;  1F7Y A;  1CEZ A;  3CCE V;  3VBB A;  1FJG O;  5IJ0 B;  1MA1 A;  2CGO A;  1L1F A;  2YXL A;  1FJG B;  2ZNJ A;  1VF5 B;  3QTC A;  4BWA A;  4X62 O;  4K8Z A;  2WLH A;  3T4Z A;  5DM6 V;  1BGY H;  2QWQ B;  1JCH A;  5BMV B;  2N05 A;  2KG7 B;  4X62 B;  3X2Q C;  1ARO P;  2OT5 A;  1SQV H;  1VQ4 V;  3UT5 B;  4ICG A;  1SET A;  3OT7 A;  2F95 B;  3CCU V;  4JAV A;  5KHI A;  1YI2 V;  2NR5 A;  3CP1 A;  1BSM A;  2Y69 C;  2IJH A;  3H1J H;  1AIL A;  1S77 D;  1N32 O;  1BQZ A;  3K04 A;  4R8C A;  4N23 A;  1N32 B;  3SPH A;  1B04 A;  1GO3 F;  1WJZ A;  3CHX A;  2JS5 A;  2A0L A;  4LF5 O;  4LC1 A;  1K92 A;  2PYL A;  2Q4P A;  2HLD G;  2X6A A;  3ETE A;  4B7E A;  3I5D A;  2ZDI A;  4LF8 O;  2EBO A;  4CH3 A;  1Q3E A;  1XRE A;  1SA0 B;  4LF8 B;  2P90 A;  2F43 G;  2IH3 C;  1KC8 W;  3CRR A;  4HNA B;  4BIO A;  1F23 A;  4DUY O;  4CZZ A;  3ZHR A;  4TUY A;  3ABM C;  4G28 B;  4LH7 A;  4TV8 A;  3CCJ V;  4DUY B;  4WFE A;  4TQF A;  1QU7 A;  3JAM N;  2HVJ C;  3ETG A;  1KQS U;  1N36 B;  2DYS B;  2WLJ A;  4XDK A;  1GM9 A;  1BZK A;  4TSF G;  1BCC H;  1NJI W;  4KUM A;  4DR1 O;  2XTA A;  5EC2 C;  4ZI7 B;  2YC0 A;  4LBE C;  5ITZ A;  4EFB A;  4DR1 B;  4XDJ A;  5IYD O;  4U3J A;  1VQ7 V;  1XDC A;  4FFB A;  2EUL A;  5LMU O;  3A8T A;  2H3O A;  5C93 A;  1VEW A;  2PUS A;  2ZE7 A;  1VQ5 V;  3FD9 A;  3C3T A;  1XMO O;  3CRQ A;  2YSU B;  4J7Z A;  4UCV A;  4JI0 O;  5LGN A;  1VQ9 V;  2CUG A;  5GW7 A;  4GLX A;  4UCT A;  4P2Z A;  3VOU A;  1XMO B;  3O65 A;  4JI0 B;  4CBC A;  4JI7 O;  1E1Q G;  1FFT B;  5IY5 B;  4OX9 O;  2EZP A;  5B1N A;  3RYH A;  3K57 A;  4JI7 B;  1ORQ C;  3G67 A;  4OX9 B;  3ZX6 A;  4PJ0 Z;  4J11 A;  4MTF A;  4X9Q A;  5AG2 A;  5LP6 C;  5LP6 B;  3P3P A;  4FLV A;  2QGN A;  5EZY A;  5L3D A;  3B4S A;  3FAV B;  4LF7 B;  1N0N A;  3JCU Z;  2UUA O;  4J42 A;  3ZIA G;  5IJ9 B;  2UUA B;  5JJJ B;  1IXM A;  3G6B A;  4R6Z A;  1BL8 A;  3QVN A;  5EIB D;  1WPB A;  1HWY A;  2XHB A;  1R3L C;  1H2L A;  2D3O W;  2A7W A;  2W6I G;  4KXR A;  4MVS A;  3LUT B;  4FJC C;  2GV9 A;  1QLE B;  3IJ4 A;  1OCR C;  1EN6 A;  1WA8 B;  5CBH A;  3BCC H;  1IX9 A;  3CCL V;  3AG4 C;  4UV8 A;  3T1C A;  2QM4 A;  4D7S A;  3A0B Z;  4CH5 A;  1U96 A;  1JVM A;  4DR4 O;  1OJH A;  4GX1 A;  5K1P A;  3HKD B;  1JQ0 A;  4YXW G;  5KUK A;  5CA1 A;  1P7G A;  4DR4 B;  3J80 N;  1K4D C;  4OPH A;  1SZX A;  3Q4H B;  3E35 A;  2PI4 A;  3E8B A;  4FFB B;  4HBN A;  1M90 W;  3HPL C;  1KU9 A;  2LJ2 A;  2YIA A;  2YXH A;  1BHB A;  2EIN C;  3HKC B;  2V4D A;  3MAQ A;  2N74 A;  3MD0 A;  4MTG A;  1WNS A;  3K59 A;  4J80 A;  2V7Q G;  4PA3 A;  5CBG A;  3CC2 V;  1M5I A;  3T2M A;  1S3J A;  2ITD C;  2Y48 A;  4ZKI A;  2NN4 A;  4AIL C;  3JCZ A;  1WAZ A;  1WN7 A;  2QWO B;  3RYF A;  2Q68 A;  4ASU G;  1KUQ A;  2KB1 A;  1FPO A;  1IBM O;  4NXN O;  5H5N A;  3ZHQ A;  2EIJ B;  3W7S A;  3CXC U;  4O4L A;  3JD1 A;  3HKE B;  5LMN O;  1IBM B;  4NXN B;  1R3J C;  4I50 B;  4X1I A;  3HKB A;  4FPP A;  3GVM A;  1NH2 B;  3TCU A;  5LMN B;  3RVZ A;  5KMG A;  1UFI A;  3I56 V;  2GUZ A;  2Q9L A;  3ZS8 C;  3J81 N;  3DSQ A;  3TK1 A;  4X1Y A;  3SGI A;  2Q0O C;  4MSW C;  1MMM A;  4TOI A;  2PTM A;  3JAW A;  2MK3 A;  5KHH A;  4DR5 B;  4ZOL A;  1F4M A;  3LDD A;  4X1K A;  2OTL V;  1Y67 A;  2IBZ H;  3WG7 B;  3DTU B;  3WG7 C;  1OZ0 A;  5CA0 A;  2EJR A;  3E83 A;  4F6R B;  1SC5 B;  4IIJ A;  1OCO C;  4NYK A;  2B9Z A;  2EIM B;  2EIM C;  3N2G A;  4B08 A;  3CC7 V;  1KKC A;  1HDJ A;  3HR0 A;  4XDL A;  4NR1 A;  2XT9 A;  1GH6 A;  5FNV B;  3EHB B;  3L71 H;  2O57 A;  4E4E A;  4Z1V A;  2B1G A;  5J9P C;  2DQ3 A;  2R9R B;  1CXZ B;  4PI2 A;  4GX2 A;  2CDY A;  3U10 A;  2UUC O;  2UUB O;  2DE0 X;  1ZWI C;  1NVP D;  3K08 A;  2ZT9 B;  3QF7 A;  2UUC B;  2UUB B;  2PY5 A;  1D5A A;  2BTQ B;  1ZAU A;  1WPX A;  4LCU C;  1S5H C;  3ZHT A;  3CPW U;  1J95 A;  1NVP B;  5IT9 N;  5TIS Z;  1M4U A;  4FLW A;  1YJN V;  3E8G A;  4NKG B;  4DW1 A;  1JA8 A;  1X59 A;  1MAB G;  1W59 A;  3AK2 A;  2UXN A;  1JX9 A;  3MDS A;  2RN9 A;  4H0L B;  3K03 A;  4U3F H;  3OGC C;  4MVQ A;  1WLE A;  1URF A;  3ZMS A;  3L9D A;  1AJQ A;  4ZIB A;  4BW5 A;  2G38 A;  1FYJ A;  1TVK A;  4JZG A;  5KMG B;  4CH6 A;  1AI6 A;  3L75 H;  2E74 B;  2PI5 A;  4TV9 B;  5KHG A;  4JAS A;  4JV5 O;  1IBL O;  2K1E A;  3CJH A;  2B1I A;  2DQ0 A;  2QKC A;  4TQD A;  5HFL A;  2LQT A;  4BW9 A;  4DV4 O;  1IBL B;  3JAW B;  3E8H A;  3SJQ C;  4F6E A;  4DV4 B;  1FXK B;  2H94 A;  1M56 B;  1M56 C;  1VQK V;  4HZ3 A;  3FB5 C;  3UKM A;  2EZO A;  4Q20 A;  5LOV A;  1EN4 A;  2XAS A;  1JPX A;  4EEQ A;  1KB9 F;  2UU9 O;  3N2G B;  1NR1 A;  2XAF A;  5B1B B;  5B1B C;  2UU9 B;  1K97 A;  3IFX A;  4H37 A;  1YEW A;  4QJF B;  1Z5W A;  5JWP A;  1X4T A;  2ZNI A;  5B66 Z;  4UXN A;  3ZHV A;  3APO A;  2XAQ A;  3AG1 B;  3AG1 C;  1AJP A;  2YIB D;  1Y4M A;  3IC7 A;  4L87 A;  1R6K A;  1DGS A;  5GON B;  1P4R A;  5BMV A;  2KG7 A;  2HFE C;  2Y4U A;  2AZ0 A;  3MHH C;  3LSQ A;  4GCZ A;  5LL6 Y;  4DRX B;  1XEQ A;  2JIZ G;  3OGI B;  2ZR3 A;  4A5U B;  1GM7 A;  2XUM A;  2F4V O;  4B3S O;  1VF6 A;  1HNX O;  2LGQ A;  2DYR B;  2DYR C;  2F4V B;  4B3S B;  4MW3 A;  4Q6G A;  3QNE A;  5H6Q A;  3JAT B;  5J2U A;  1HNX B;  3K5N A;  1G6U A;  4QPJ A;  3WU2 Z;  2X7R B;  2BOC C;  1OHH G;  4L8J A;  2EIL B;  2EIL C;  5L3G A;  3ZN0 A;  5DN6 G;  4HAM A;  1I5X A;  4ZHQ A;  5IWA O;  3FB6 C;  4RUE A;  3THO A;  2QEX V;  1TVK B;  2IJK A;  5E79 Z;  1SQX H;  5IWA B;  2A79 B;  1D2D A;  2VS0 A;  1TUE B;  3JD4 A;  3L70 H;  3ZJZ A;  3OEH G;  1NZ6 A;  2M7W A;  4QIW F;  1FXH A;  1H2G A;  3ZMU A;  5LXT B;  4YY3 O;  4HNA A;  5BR8 O;  3KG2 A;  3A2F A;  1DLB A;  3ZRX A;  2E5L O;  2EX3 A;  4YY3 B;  4OXS A;  1J5E O;  2EJ7 A;  5BR8 B;  4DXW A;  1V55 C;  5LOV B;  5LHG A;  1QVF U;  2E5L B;  1MZF A;  3B8M A;  5B1A C;  1J5E B;  1Y6X A;  5K1X A;  5JJE B;  3G4S V;  2IU0 A;  2R9I A;  5H9C A;  4PA7 A;  3ZBH A;  2GTS A;  4H33 A;  1K9M W;  1TA8 A;  4KFM A;  2AXT Z;  1IDS A;  4G27 B;  5JQG B;  4LF6 O;  4ZI7 A;  5HFM A;  4LF6 B;  4UVB A;  4DV7 O;  3LNN A;  3C90 A;  4PDV A;  4YHH O;  3FYE B;  1E79 G;  3DGE A;  1DK1 A;  4PA6 A;  4CS2 A;  1XI1 A;  4DV7 B;  2WSS G;  3KKY A;  4YHH B;  1UPG A;  4DV5 O;  4IYH A;  3I55 V;  1NI8 A;  1YF2 A;  3C3S A;  4GX0 A;  5JVD B;  4RUF A;  3BY6 A;  4DV5 B;  1GN2 A;  1K5S A;  4X89 A;  4JI1 O;  1XOU A;  1Q90 D;  1NR7 A;  1WB7 A;  1VF6 C;  4JI1 B;  1JFF B;  1GN3 A;  1K33 A;  1P84 F;  5J2U B;  3JYC A;  3AEI A;  1F4N A;  4U7N A;  1AI7 A;  5LP6 A;  3EFF K;  1S72 V;  2Z5U A;  2RCV A;  2KQX A;  2YDE A;  4ZHQ B;  4WFB V;  4LF5 B;  3FAV A;  3RWR D;  1EM1 A;  3WB2 A;  2W0X A;  5IJ9 A;  2CTP A;  5B3S B;  3KCX A;  2Q67 A;  3F7V C;  4PA9 A;  4FK5 C;  3JAK B;  1Q7Y W;  3H01 A;  4OGQ B;  1NTZ H;  1RSO B;  4YJ3 B;  4JI5 O;  3CB2 A;  4JI5 B;  5E1A C;  1VP7 A;  1R3K C;  4IYI A;  2IJI A;  1WA8 A;  2DYS C;  4JAU A;  5H2F Z;  1R1B A;  3OUS A;  2XAH A;  2VQF O;  3HKD A;  1EZJ A;  4WBN B;  1RPR A;  4UVC A;  2VQF B;  5KHJ A;  3CCV V;  3Q4H A;  3E89 A;  2YI8 A;  2ZKO A;  3A0R A;  4MVU A;  2MW2 B;  4O4J B;  4QPK A;  5FLX N;  1SER A;  2P22 C;  4YIO A;  1GMG A;  5IYZ B;  4K8X A;  5LMU B;  1QVG U;  4DYL A;  4P9P A;  3HKC A;  1XMQ O;  1NBM G;  1Q82 W;  2UXD O;  3KZI Z;  4B3R O;  3UQ8 A;  3CRC A;  4BIU A;  1Y76 A;  1BE3 H;  2ZD9 A;  3JSL A;  1XMQ B;  2GTA A;  4B3R B;  5IY5 C;  2ZQM A;  5IDJ A;  2Q0A A;  4LFB O;  1ZUQ A;  1I5Y A;  1QR8 A;  1Y74 B;  2OIG A;  2JK5 C;  4BIZ A;  1AVM A;  1MSW D;  2M6Y A;  3ABK B;  1NU1 H;  3ABK C;  1L8D A;  1QNM A;  3DC5 A;  3RT3 C;  3JD0 A;  1GKF A;  3T1Y O;  3RBZ A;  4W4K A;  3WB0 A;  1I0H A;  1N4C A;  4JTA B;  4I5S A;  3SR2 C;  2Q69 A;  4JI3 O;  3HKE A;  4IGG A;  3IAY A;  3ML0 A;  4I50 A;  5FPO A;  3FYI B;  3N27 A;  1YVW A;  4IHJ B;  4DK0 A;  2Y0P A;  5FPR A;  3JD3 A;  4UUJ C;  4K0K O;  1VQO V;  2X6B A;  3ABT A;  4RWU A;  5EIB C;  1O9H A;  2CE4 A;  2QR4 A;  4DW0 A;  1QLE C;  3GWK C;  2CTW A;  1YCI A;  4X88 A;  5KA5 A;  4JI8 O;  3DXR B;  3W7T A;  4WFA V;  4F6R A;  2WWW A;  1Q43 A;  1RFY A;  1AJN A;  2KKW A;  4JGS A;  1ENV A;  2JVD A;  1YDX A;  4TT3 G;  4JI8 B;  3SJB C;  4YJ2 B;  4J7K A;  4DV0 O;  1R6T A;  3K9S A;  4O4H A;  2ZIM A;  4AI8 A;  3OMN B;  5A2Q N;  5FNV A;  3ZRW A;  4O2A B;  4CH4 A;  2PGG A;  4P30 A;  3FFQ A;  2UXB O;  1CPY A;  1ZX3 A;  1SQP H;  3STL C;  1G4Y B;  1PNK A;  4HYO A;  3JAR B;  2UXB B;  1FD9 A;  1YTF D;  1Y76 B;  1FXV A;  2QKS A;  2A9H A;  3EVK A;  2ITC C;  2OCC B;  2OCC C;  3ZRV A;  2JS3 A;  4I0X A;  3GWO A;  1DF5 A;  3M99 B;  4FFK A;  3S3W A;  2YUA A;  2OTJ V;  2BTQ A;  3OMI B;  1WP7 A;  1ZSP A;  3LSS A;  3BA8 A;  4FLY A;  1SS3 A;  4GZR B;  3ICX A;  3D3I A;  1G8M A;  3W7U A;  5L3E A;  1K8A W;  1N34 O;  1FAF A;  3OM3 B;  2ETN A;  2HEP A;  2VRZ A;  2JJ1 G;  2HP8 A;  4QGP A;  4EKW A;  1N34 B;  1Q5O A;  3D8C A;  1S76 D;  4I7Z B;  2P7T C;  5GTH Z;  1I94 O;  2EIJ C;  2QTO A;  4GUN A;  3OTO O;  2HJF C;  1H2S B;  2Z0A A;  1QCE A;  5L3C A;  3QO8 A;  3OTO B;  1PL4 A;  4MVR A;  1HR0 O;  3TGU H;  4TV9 A;  4RAI A;  1EBO A;  3CD6 V;  3K9A A;  1HR0 B;  3QO5 A;  3A0H Z;  1H2M A;  3SPI A;  2A3Q A;  3CS5 A;  3GB7 C;  1FXK A;  4MTO A;  1VQ8 V;  1SQF A;  2X6C A;  1W0K G;  1ROP A;  1PKX A;  1YIJ V;  1IZ3 A;  2JEU A;  3D3Q A;  2H8P C;  2YS8 A;  1NQT A;  2HG5 C;  3E22 A;  3CRM A;  3CCR V;  4NB5 A;  4Z2W A;  4O4H B;  3F5W C;  2OWO A;  2NNU A;  1YJW V;  2P67 A;  2ZCE A;  4NTX A;  3ZRW B;  5LGU A;  4FLU A;  1S5L Z;  1LUV A;  2BOB C;  1FS0 G;  5IYC O;  2XAJ A;  3L72 H;  2K9P A;  1HP8 A;  2Q7E A;  3K3W A;  1PM9 A;  4QE7 A;  5GON A;  2WLL B;  1IBK O;  4GYC B;  4I0X B;  5CN0 A;  1ZL8 B;  4DRX A;  3ZED A;  2HR3 A;  2YIB A;  3U11 A;  1E1R G;  1IBK B;  2L6L A;  1WP8 A;  4XBF A;  1BS3 A;  1Q81 W;  1TGO A;  3L74 H;  2NLJ C;  2HVK C;  3VQY A;  4FIP C;  3OAA G;  1MSD A;  1H8E G;  3JAT A;  4CC6 A;  2P6J A;  2ZE6 A;  3CME V;  4FM1 A;  1BHA A;  2ZE5 A;  5EBW C;  1NT2 B;  2R72 A;  2DW4 A;  1AR5 A;  3R65 A;  4H13 B;  1PNL A;  3TXS A;  3B09 A;  1MZE A;  3CXH F;  1SZT A;  1BMF G;  1JR9 A;  4PEL A;  3PN1 A;  1SQB H;  4JV5 B;  1SES A;  4UVA A;  3BA9 A;  1GK9 A;  1S5J A;  3RYC A;  5LXT A;  2FB5 A;  2BCC H;  1XHZ A;  2E75 B;  1XNR O;  2CH7 A;  1FXK C;  5D5Q A;  3ASN B;  1EN5 A;  4W4L A;  3CCQ V;  1XNR B;  3SYO A;  2WLI B;  5EYP B;  4JYC A;  2Q7H A;  3FX7 A;  2DOS A;  2GHY A;  2OIE A;  3RYI B;  4LFA O;  1NS1 A;  2LW7 A;  3E22 B;  2XND G;  4X20 A;  1LUW A;  3BEH A;  3N2K A;  1VQM V;  4LFA B;  1Q86 W;  2VQE O;  2JRI A;  2ODM A;  3O9O A;  5JQG A;  1TUB A;  3AK3 A;  2FKX A;  2QWR B;  4J7J A;  2VQE B;  2W0F C;  1DF4 A;  3M7M X;  5KLV H;  4B7K A;  1G1X B;  4LP8 A;  4FZ0 A;  1OCZ B;  1GRJ A;  4UFZ A;  3CEI A;  5IYB O;  3OD4 A;  5JCO A;  5KAF Z;  3ZHU A;  1XHX A;  1OV9 A;  1PV0 A;  5JVD A;  1XUQ A;  4PV1 B;  3VQW A;  3JAS A; 
#chains in the Genus database with same CATH homology
 1N34 O;  3RT3 C;  3M8A A;  3J81 N;  4DR2 O;  3T1Y O;  4X65 O;  4JV5 O;  1IBL O;  1D2D A;  3JAM N;  1A32 A;  3T1H O;  1I94 O;  4DV4 O;  4JI3 O;  3OTO O;  4LF4 O;  1F7Y A;  2UXC O;  2Z0A A;  2ZM6 O;  4YY3 O;  1FJG O;  4NXM O;  5BR8 O;  4DV3 O;  5BY1 A;  4DR1 O;  4B3T O;  1HR0 O;  1FKA O;  2E5L O;  4DR4 O;  4JI5 O;  1J5E O;  4B3M O;  4X62 O;  4AQY O;  2UU9 O;  4DR7 O;  4DV6 O;  3J80 N;  4K0K O;  4OPH A;  1XNQ O;  4GKK O;  5LMU O;  1R1B A;  4DV1 O;  4JI8 O;  1XMO O;  1HNW O;  1XNR O;  4LF7 O;  4JI0 O;  3F5T A;  4DR6 O;  2VQF O;  4LF6 O;  2HHH O;  3O65 A;  1AIL A;  4DV0 O;  4JI7 O;  1R6T A;  4DUZ O;  4DV7 O;  4JI2 O;  1N32 O;  2DOS A;  4LFA O;  4JYA O;  1NS1 A;  2N74 A;  2UUC O;  2DJV A;  2LW7 A;  4YHH O;  2ZKO A;  2UUB O;  4OX9 O;  4KHP O;  1DK1 A;  1AB3 A;  4X66 O;  5FLX N;  1YZB A;  4JI6 O;  5LL6 Y;  5A2Q N;  4DV5 O;  1XEQ A;  3SDL A;  2VQE O;  2JRI A;  3R66 A;  4LF5 O;  4LF9 O;  3J7A U;  2FKX A;  4A5U B;  2UXB O;  5IT9 N;  2F4V O;  1HNZ O;  1XMQ O;  4X64 O;  4B3S O;  4JI4 O;  4JI1 O;  2UXD O;  4B3R O;  1N36 O;  1HNX O;  4DR3 O;  4DR5 O;  2UUA O;  1G1X B;  4DV2 O;  1X59 A;  1KUQ A;  1IBM O;  4LF8 O;  4OPA A;  4NXN O;  5H5N A;  1IBK O;  4LFB O;  4LFC O;  1N33 O;  5LMN O;  5BXZ A;  4GKJ O;  4DUY O;  5IWA O;  1FYJ A;  2AGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...