1HNXO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hnxO00
4DR6O 2DOSA 1I94O 2UUAO 4DV2O 5BXZA 4B3MO 4JI0O 2UXDO 2UXCO 1AB3A 4DV1O 5LMNO 4DV6O 5IWAO 5IT9N 4B3SO 1J5EO 2UUCO 4X65O 1KUQA 5BR8O 2JRIA 2AGAA 2F4VO 4DR2O 5FLXN 4JI5O 2VQEO 4DR7O 1XMQO 3J80N 1HNXO 1N33O 1HNWO 4X62O 1YZBA 4OPAA 4OX9O 1FYJA 4X64O 4NXMO 1N36O 1FKAO 3JAMN 5H5NA 3R66A 4A5UB 4LF4O 5LL6Y 2Z0AA 4DR1O 3M8AA 2UU9O 1A32A 3F5TA 4DV5O 4LF7O 4LFCO 4B3TO 1N32O 1F7YA 1HNZO 4KHPO 4GKKO 4DR3O 4JI6O 4NXNO 4JYAO 1XEQA 5LMUO 4DV0O 2HHHO 4YY3O 4LF8O 4DV7O 4JV5O 4DUZO 4JI8O 4LF6O 2ZKOA 4YHHO 5A2QN 1XNRO 4LF5O 4K0KO 4OPHA 3O65A 1G1XB 1R6TA 1NS1A 2VQFO 4DR4O 2DJVA 4JI3O 1XMOO 2LW7A 5BY1A 1N34O 1FJGO 4DV4O 3T1HO 3SDLA 1R1BA 3OTOO 2E5LO 4LF9O 4DR5O 1AILA 4DV3O 1IBKO 3J7AU 1D2DA 4X66O 1XNQO 2ZM6O 4JI4O 4AQYO 1HR0O 4JI7O 2FKXA 4LFAO 1IBLO 3RT3C 2N74A 1X59A 3J81N 1IBMO 4JI2O 4LFBO 3T1YO 2UXBO 4DUYO 4GKJO 1DK1A 4JI1O 4B3RO 2UUBO
chains in the Genus database with same CATH superfamily
1V55C 1BSMA 4DV2O 5H6QA 2QDOA 2IH1C 4EEQA 4YJ2A 4B3TB 1AB3A 1FXKA 1GK9A 2F1MA 2E5LB 2QSAA 1K97A 1L0NH 1OCOB 3CC7V 3VQYA 5LOVA 3ZN1A 1SESA 4I50A 3TCUA 2PZSA 4FM2A 3ZRVA 2JGDB 3SYPA 1HNXO 1M56B 2PI4A 4BWAA 1P4RA 1OJHA 4PV1B 3JSLA 5KUKA 4LC1A 2R9AA 3W7WA 2ITCC 3K0DA 3L70H 2FTKA 4LF4O 2PI5A 4DW1A 4FFKA 5CN0A 2ZCEA 2Y69C 2GBOA 1GN3A 3H1KH 2EULA 2PYJA 4K3AA 3K5NA 3FD9A 3OGCC 1NVPD 4QGPA 3GVMA 3QG5A 1M90W 2GHYA 4YXWG 5LMUO 4YY3O 1HNXB 1GO3F 3LSQA 4G27B 4JV5O 5EBMC 2OT5A 1K34A 2RMKB 4PD4F 3GWKC 4QPJA 1AI5A 3ZN0A 3SYOA 3F5WC 4LF4B 4DV1B 2HLDG 1SA0B 3SJBC 1B3QA 1MOFA 1XMOO 4JGSA 5LHIA 2ZE7A 2MW2B 2W0FC 3APQA 1JPXA 1AP6A 4J42A 1KQSU 1VEWA 2CTQA 1KU9A 1Q7YW 2Q0OC 4NYKA 4JV5B 3OMNB 3KZIZ 4LFAO 3J81N 5JJNB 1OCZC 4UCRA 2QWRB 1B06A 5KHJA 2Y4TA 3FAVB 2UXDO 1WPXA 2QJ1A 1ZAUA 1M57C 1COWG 5FNVA 1J5EO 4UVBA 4K8ZA 4LR3A 4X65O 1KUQA 1SRYA 2ZQMA 3RYCA 3RGBA 5FLXN 4JI5O 4LFAB 3ABMB 1NR1A 4OX9O 1ZSPA 2LQTA 2ZE6A 4FFBB 4UCTA 1N34B 4U7OA 4AI8A 1H2MA 2EIJB 4TT3G 4LF9B 3EVKA 1KYOF 5L3BA 2JS5A 4IYHA 1SERA 3M8AA 1WA8A 4X65B 4LF7O 4XDLA 1RSOB 1S72V 1N32O 4JI2B 3BCCH 4LF8O 5CA0B 2QKSA 4O4IA 4OX9B 2YI8A 3RYHB 1TGOA 1Y74A 2DN9A 1BZKA 1ORQC 3RYFB 3H01A 5J9PC 2DWEC 2RJZA 3UM7A 1JOYA 1IX9A 1M9NA 4TQDA 2CH7B 1NS1A 4JI3O 1SS3A 1LUWA 3ZHUA 1BHBA 2IJHA 4PI2A 1SQVH 4DR7B 1N0NA 1N32B 1U96A 1R6NA 3Q4HB 4UB6Z 1EBOA 2A06H 4ZOLB 3TXSA 1VIBA 1NT2B 4JI7O 3X2QC 4MW8A 1Z5WA 3JAKA 1FFXA 1TUEB 2MK3A 3I55V 5LHHA 4Z2WA 5H2FZ 2GDSA 4I0XB 5CA1A 4IYIA 1K7DA 1V54B 4DV0B 3OT7A 4I55B 4FLWA 3G6BA 3K5MA 3AG2C 1L8DA 3BY6A 1SQXH 1YXBA 4N23A 3CRAA 5BR8O 3F7VC 2D2CB 4X89A 1PM9A 1YITV 4FIPC 4U3JB 3OR6C 3CRCA 1NTKH 1OCCC 4Z1MG 2XUMA 3K3WA 5A9GA 4QE9A 4KUMA 5E1AC 1QLNA 1NVPB 1HP8A 2DMXA 2QE7G 2QKAA 2X6CA 2HFEC 4DR1O 1G4YB 3VOUA 3B77A 4K8XA 4DRXB 3ABLC 3BPZA 4DV7O 4MTXA 1AR4A 1VQ9V 5LA6A 4JI1B 2Y4UA 4LF6O 5D5QA 4JF3A 3ABKC 3B2EE 1BCCH 4KL1A 1GN4A 4RQFA 4JYCA 4J7JA 3JALA 4B3SB 1MABG 1UPGA 4XDJA 1BQZA 1PL0A 3EXAA 5KAIZ 4DR5O 4O4LA 4JTCB 1V9PA 1NZ6A 2BOBC 1XNQO 2KG7B 4BW5A 4DV7B 3CC4V 3BA8A 1ENVA 1QR9A 4R7CA 3KCXA 4AQYO 4MVOA 3ZMVA 4MVMA 1BQ0A 2GTSA 4FJCC 4HZ3A 4P9OA 4LFBO 2KB1A 3H9VA 5EZYB 1YF2A 1IVSA 2XAGA 5GONA 2OWOA 2UUAO 5E79Z 1WNSA 1SQQH 2UXCO 4WFGA 3P30A 5DEDA 4DR5B 2HVKC 4UV9A 1NTMH 4UCUA 1H8EG 4AHCA 1QVGU 2YI9A 3CSXA 4AQYB 4O2AB 4YHHB 4K35A 4WFEA 5IYZA 2YXYA 1VQPV 2IW5A 5J2TA 4FLZA 2A0LA 4LFBB 4QE7A 1TVKB 1FYJA 3C90A 4HAMA 4X64O 3G67A 3KCYA 3FKSG 1L1FA 3CWBH 1QLEB 4UUJC 3T1HB 2UUAB 3OW2U 3L73H 5JCOC 3WB0A 2UXCB 2ZXWB 4JYYA 1FXKC 3HKCB 2QWQB 2ETNA 1Q86W 4EKWA 3WB2A 3HKEB 5LBQA 3H1HH 2HP8A 5B5EZ 4J80A 4CZZA 1XEQA 4IT5A 2BOCC 5LXTA 1NJIW 1B6QA 4X64B 2P06A 1QNMA 4I4TA 4O4HA 5A2QN 1XNRO 2EZPA 3K5OA 5FPRA 3NXSA 5IJ9B 2WAMA 4PJ0Z 2IU3A 3SDLA 2A3QA 4W4KA 1AILA 3ETDA 2WLLB 1E1QG 2R70A 2EIMB 4ZHQA 4TV9A 4DK0A 4R6ZA 2V7QG 2FKXA 4EFEA 1K5SA 4UCVA 4PHZA 4TV8B 1XNRB 2UXBO 5ITZB 1AI6A 4Q6GA 4FZ0A 4WFBV 1S0VA 1I94O 3VQVA 4B3MO 2CDYA 3RVYA 4MTFA 3E22B 1TUBB 1VQ8V 2BTQB 2UXXA 3DTUB 4DR3B 1SA0A 1F51A 4ZBMA 5IT9N 5LYJA 5B3SC 1Z2GA 1CEZA 2Z5UA 4UVAA 1YI2V 4O2BB 4UV8A 2DW4A 4FLYA 2CUGA 1WB7A 4IHJA 5H5NA 3JAMN 1FJGB 1QBZA 5JVDB 1I94B 1DF5A 4B3MB 5B1AB 3ZMUA 3CS5A 3JARB 2KSDA 2RQ6A 3OMIB 1O9GA 1I5YA 3FAVA 4LFCO 1SQFA 2A9HA 1XDCA 2ATKC 2FYUH 3STLC 1K4CC 4B7KA 2F43G 2E3CA 4FLVA 4X20B 2D3OW 1ROPA 4IL6Z 3ASNC 3UQ8A 1AJQA 4RUEA 3LUTB 2NNUA 1EN4A 3L74H 4K0KO 1WPBA 1S5HC 4PELA 4H0LB 3CC2V 4TQFA 1GKFA 1KMIZ 2EJ7A 1U97A 3CCMV 1ZL8A 3SYQA 2F66C 3CCEV 4DR2B 4LFCB 3CPWU 4WFAV 2RDCA 4CH3A 2RNBA 4ZI7B 3B8MA 2ZM6O 2BSKB 1RSOA 4KP4A 2N74A 3N2GB 5JH7B 5CB4B 2L35A 3G71V 5DM6V 1LNQA 4GZRB 3RYFA 3AG3C 1UJWB 4MVZA 3IGAC 4KHPB 3OGIB 3CCUV 4E2LA 3ASOC 1W0KG 3SGIA 2P5OA 2ZM6B 3BVOA 1FD9A 3DGEA 3F7YC 4TUYB 4JAVA 1XMQO 4HNAB 4GX0A 2NN4A 1I0HA 5KX5B 4MVSA 5JCOA 5HFMA 1JR9A 2CE4A 3A0RA 3L71H 1QVFU 3CCJV 1Q81W 4ZKIA 2Q7EA 1VQ5V 3SYAA 4FZ1A 3ZRXA 4EB6A 1EM1A 3OUFA 4LWSB 3N2KB 1ZX3A 3ZHTA 3K9SA 4OGQB 3CCQV 1PP9H 4JZ2A 1NQTA 3CHXA 3DXRB 4GKKO 4F6RA 1IBMB 2DQ3A 2HHHO 1XMQB 5L3FA 1CPYA 1PL4A 1SETA 1Q6HA 3SJAC 3AEIA 2X7RB 2IJIA 4DV2B 3PJSK 1Q3EA 4GUNA 1P7GA 3HKBB 5L3DA 4WBNB 1DLBA 2QTOA 4DR4O 3T1CA 3T4DA 2ZIOA 2XAQA 3GB7C 2F23A 1BGYH 3D3IA 2QM7A 4KFMA 4W4LA 5IY5C 4QNHB 4GKKB 1O9HA 5C8YB 5LP6B 2CTPA 2K9PA 1MA1A 3BFRA 4U3FH 3OEEG 1R3IC 3RW0A 4F6EA 2H94A 4JPRA 3OD4A 4CS3A 4GYCB 3I5DA 4B3RO 2PGGA 4DR4B 2B1GA 2XHBA 4CH5A 3ABUA 4DV6O 5LMUB 1W59A 4YY3B 4PDVA 1XL6A 2O57A 3DC5A 2A7WA 2WWWA 1XI1A 2VQEO 1N33O 3SYCA 1D5NA 3HKDA 1FAFA 1S5JA 1TAEA 1N36O 5GTHZ 1XMOB 4OXSA 4B3RB 2AHYA 4UXNA 1NU1H 5KHKA 3RVZA 3L9DA 3DC6A 1EZVH 2RN9A 1VF6C 5EZYA 4X1IB 2ZE5A 4DV6B 1HDJA 4FM1A 3F5TA 5JQGA 2ZE8A 3HPLC 3AG1B 2DWDC 1LUVA 2EILB 2EINB 3JCUZ 4NXNO 3ZJZA 2VQEB 2YS8A 3K0GA 3JAWB 2JS3A 3E8BA 2ZDIA 4PA9A 2ZT9B 1N36B 4DO2A 1AVMA 3CP1A 1SC5B 2UXDB 2W6IG 3ABKB 3JD0A 4RUFA 1JFFA 3ZHQA 5EIBC 3G80A 1J5EB 3WB1A 4RAIA 3ZX6A 3ZRWB 3B8NA 4TOIA 2YIBA 2V1DA 3U0ZA 4JI5B 2Q8VA 3HKCA 3AK3A 1OCOC 1BT8A 2DYSB 2KKWA 2WLMA 3FB8C 4NXNB 3HKEA 4JI4O 3LNNA 1HR0O 1Y67A 3SPHA 1VARA 1S5LZ 4PA6A 5CBGA 1LR1A 2K1EA 1M56C 2JIZG 2ITDC 2M7WA 4E4EA 3T1YO 4GKJO 3W7XA 1THZA 3NR7A 2N05A 4L87A 3UT5B 3K58A 4LF7B 3OEHG 5H6RA 1JJ2U 2EJRA 3CRRA 3E8GA 2DE0X 4LF8B 1US6A 3CMEV 4IIJA 1Y76A 4NB5A 1AJNA 1SQPH 1KKCA 1HR0B 3JD4A 3O9OA 1BL8A 1WP8A 4LNUB 2HVJC 3T1YB 3K03A 4JI3B 4GKJB 4P30A 5BZBA 1NKDA 1F23A 5ITZA 4YJ2B 1XHXA 1FXKB 1AR5A 2QA4V 5B1BC 4JI7B 1P49A 3UKMA 5LOVB 1AJPA 1TUBA 4MTOA 2W0XA 2P22C 4JYAO 1NH2D 3E86A 5L3GA 3A2FA 3ZIAG 1MZEA 2HJDA 1EFRG 3T4ZA 3R65A 1RPOA 2W6JG 2R9RB 4YIOA 1IXMA 1R3LC 4DK1A 2DJVA 2WLIB 4UFZA 2QWOB 1KECA 4FLTA 2QM4A 5BR8B 3T2MA 3WG7C 1ZLZA 5AG2A 3OE7G 2Q68A 2C2AA 1H2SB 4DV3O 4JYAB 1VQ4V 4LP8A 4UCSA 2Q0AA 3A8TA 5D5PA 3JYCA 5IJ0A 2AW9A 2JVDA 3P32A 2QGNA 1B04A 2WLJA 1R6KA 2WA4A 3AK2A 3BA9A 2CK3G 4DR1B 2BTOA 1RM1C 3QO8A 2P4VA 4LH6A 4ZIBA 3C3SA 4N21A 1OCRC 2GUZA 1JX9A 2EIJC 5EC2C 2ZR2A 1NR7A 2X6AA 5IWAO 3JATA 1VQNV 1W0JG 3P3PA 2UXNA 2Q5ZA 3FB7C 5KMGA 5EYPA 1TA8A 4MT8A 3CJHA 3K57A 1GMGA 4LF6B 1Y66A 1RP3B 3J80N 4FVMA 4J10A 1H2LA 2BSKA 3WFVA 4DYLA 4NXMO 4FLXA 3CMAV 2WA3A 1VF6A 1K3EA 4I9WA 2VWJA 4GX5A 3G4SV 3EHBB 1I5XA 3SR2C 3CCSV 4MVQA 2YEVA 4HYOA 2QWNB 3RYIA 3AG7A 1G8MA 1XNQB 2DQ0A 2Q69A 1SQBH 1X4TA 1RPRA 2VS0A 4EFBA 1FXHA 1XHZA 2HR3A 4GCZA 2QTSA 2OCCB 3QVNA 3TXQA 3LSSA 3JD1A 4QPKA 5J2UB 3AG4B 3PN1A 2FMLA 1YIJV 4BIUA 4NXMB 1BE3H 4TUYA 3ASNB 4QIWF 4OPHA 3MHSC 1R6TA 4BIOA 2JEUA 1DGSA 4WF9V 1AP5A 1FS0G 2LFSA 3CXCU 1QU7A 5HFLA 1WA8B 1YEWA 4GLXA 1VQOV 1QQCA 4GX1A 5IYCO 2IBZH 5EIBD 3K08A 1URFA 1IBKO 4X66O 1KP2A 1J95A 3BABA 2JGDA 1IBLO 1Y74B 1PV0A 2ZIMA 3OTFA 2CGOA 2QKCA 4JAAA 3M99B 2NR5A 2DOSA 2ZINA 5BXZA 1E1RG 4JI0O 4WBNA 5CBFA 2XASA 1WN7A 2XNDG 2ZD9A 1IBKB 2IH3C 4X66B 1XUQA 2DYRB 1CXZB 1G6UA 3LSUA 1EZJA 1IBLB 4J11A 4X62O 3JAKB 5C8YA 2L6LA 1FFXB 1V55B 5H9CA 3CYOA 5CA1B 1H8HG 5LL6Y 1JVMA 2XT9A 4G2KA 3ZHRA 5IYBO 2AHZA 3MD0A 1K5QA 4R50A 4U7NA 2EBOA 3N27A 1NH2B 1KP3A 4JTAB 4D7TA 2XAFA 5GW7A 2UXBB 2WLKA 1L0LH 4X62B 3K59A 3IC7A 3KG2A 5KLVH 4JI8O 1FFTB 1Q90D 4TWKA 1H2NA 5JJJB 1VQKV 3ZHSA 2P7TC 1IURA 3O65A 2Y69B 4PA4A 3SJQC 3H1JH 1PNLA 1K8AW 2E74B 2LW7A 2H3OA 2Q7HA 2QM8A 4DV4O 1AROP 3CEIA 3G6EV 2YIDA 2B1IA 4X1IA 3M7MX 1S3JA 2JDIG 4DW0A 2OTLV 5LA6B 2ZDIC 1YHQV 4JI8B 1RFYA 4NVPA 1ZWIC 3QO5A 3OAAG 4FFBA 2Q73A 2LGWA 3IC9A 2IM9A 3CE2A 3JALB 3TGUH 3TETA 2ZXWC 4PDMA 5LMNO 5TISZ 5LGUA 5KHIA 3ZRWA 1M93A 4MW3A 2E75B 1K9MW 5L3EA 3ZEDA 2JEXA 3D36A 4CC5A 4WFFA 4C7UA 5CA0A 4K0KB 1OCZB 1PNMA 3RYHA 3SJCC 4B08A 4I7ZB 3L72H 3SPIA 1XOUA 2CAZC 1XL4A 2CH7A 2Z0AA 5GONB 3D3QA 5LHGA 3ZMTA 2HEPA 1YTFD 1M57B 5KHHA 1T5EA 2ADPA 2UU9O 3UT5A 3E8FA 4B3TO 1KKDA 3Q4HA 5IYDO 1EN5A 4LH7A 4BR6A 3RN4A 4ZOLA 5JWPA 1VF5B 3FX7A 2EIMC 3QO7A 1XREA 1K4DC 2Y48A 2IU0A 4BIZA 3AK1A 2R72A 3CCVV 4I0XA 1ZTEA 4PA7A 2OIGA 4P9PA 2HJFC 3ZMSA 1HWYA 4PDRA 3K79A 3APOA 4I55A 2BE3A 3A0HZ 5FL7G 1YJNV 2FB5A 3BAAA 1XBLA 2Q67A 4BW9A 3I56V 1QCEA 2EIKC 2N04A 5LXTB 3RT3C 4U3JA 4I4TB 2B9ZA 4O4HB 4DUYO 3ABTA 1GN2A 2UUBO 4DR6O 1D2DA 1D5AA 3STZC 1VQ7V 4D6TH 4WFHA 2YICA 3RBZA 1AI7A 2X0LA 4CS2A 3SPGA 2YIAA 5B1AC 4DV1O 2HHHB 3E35A 2WLIA 4DRXA 1NI8A 4X88A 2YDEA 1DF4A 3QTCA 5B66Z 3X2QB 4ZHQB 4TV9B 1Q43A 3ZBHA 3MHHC 4H44B 2LO1A 1OV9A 2LJ2A 3VBBA 4Z1VA 1YJWV 1WLEA 4DUYB 2UUBB 4DR6B 2PUSA 1DTOA 4CH4A 2P4KA 1MNGA 2JK5C 4JASA 4X1KB 3AG2B 4RWUA 5B1BB 1GN6A 5LYJB 1F4MA 2IJJA 5BMVB 2KG7A 4UCOA 3UCSC 4R8CA 3CB2A 1OCCB 4DUZO 1I7FA 2Z3YA 4YJ3B 2GTAA 2ZNJA 4FMTA 4IHJB 5B1NA 2Q6AA 2LW1A 1QR8A 3SPJA 2VQFO 2QEXV 1PD3A 1MMMA 3FB6C 5BY1A 1N34O 1Q82W 1JJOA 3THOA 3ABLB 1R1BA 3QNEA 4LF9O 5K1XA 3CD6V 1GH6A 1M1KW 1H38A 2OIEA 3WG7B 4PI0A 1MSWD 3RFRA 1N33B 2Q4PA 4CH6A 1JQ0A 4CC6A 5LGNA 1GRJA 4O2AA 2AZ2A 4J9ZB 4JTDB 2RCVA 4DUZB 4MVUA 5CA3A 2Y0IA 4XDKA 4X1YB 1KBHA 1TVKA 2YSUB 3B4SA 3H1IH 4B7EA 4JI2O 1R3KC 5J2UA 2P90A 4JZGA 1DK1A 2NLJC 1RM1B 2VQFB 1SF9A 3OMAB 1OCRB 2JJ1G 3UO2A 1FPOA 1ZL8B 1GAXA 1PNKA 2YXHA 2KQXA 4NKGB 2CTRA 2UUCO 3CCRV 2YIBD 2AGAA 3E2EA 4DR7O 4PA3A 2LGQA 1S76D 1OZ0A 2XAJA 4OPAA 4JYBA 3JASB 1IDSA 1M4UA 1YTFB 2ARHA 2V4DA 1KB9F 3CCLV 4O4JB 1S77D 5IJ9A 3BRCA 4MS2A 2YUAA 1SZXA 3QF7A 1Y4MA 4JI4B 2UUCB 3JSNA 2WLLA 2CTWA 4MTGA 4AILC 1F7YA 4DV0O 2QR4A 3BEHA 1WP7A 1XQ8A 5LP6C 1YDXA 4PDLA 4ICGA 3TJTA 5EBLC 4TV8A 4NTWA 1VQMV 1GM7A 2LP7A 3MDSA 4KXRA 4LF5O 5IDJA 3ZMZA 2P6JA 3HB3B 3E22A 5EBWC 2BTQA 4EB6B 2OTJV 4CS4A 2PF4E 2WSSG 4I50B 1KC8W 1N4CA 3H1LH 3P3NA 2P67A 4IGGA 1I08A 4F6RB 4LBEC 1BMFG 3B09A 4O2BA 1K92A 3DSQA 1Q6IA 1VQLV 1YSCA 4LF5B 3FYEB 3D8CA 1XILA 4X9QA 4JI1O 5JVDA 2F95B 5DN6G 1KD1W 3JARA 1M5IA 4UB8Z 4B3SO 4GX2A 5IE9A 3AG1C 3LDDA 3ABMC 3FYIB 2E76B 5EC1C 2EILC 2EINC 1YVWA 4X20A 2AZ0A 1EN6A 2JJ2G 2FL4A 1Q5OA 1FKAO 3IAYA 5L3CA 3RWRD 3E8HA 4G28B 4H37A 4I9QA 1BHAA 1OHHG 3ZS8C 4DV3B 1AI4A 1WB8A 3ZRSA 4J7KA 1JMKC 1VP7A 2VWKA 5B3SB 3IFXA 4NTXA 3EFFK 4FK5C 5KUMA 1HNZO 2ADQB 4ZI7A 3D36C 4J7ZA 4JI6O 2DYSC 5KAFZ 3JCZA 3CRMA 2OCHA 3ICXA 1Y6XA 3HKDB 4CBCA 3CRQA 3N2GA 5JH7A 5CB4A 4YHHO 5IWAB 1G1XB 4QJFB 3A0BZ 1AR1B 4HBNA 5KA5A 2AXTZ 2LFRA 1HW7A 3JD3A 5FNVB 1H2KA 1YCIA 3T1HO 2XAHA 3OTOO 2G38A 2X6BA 3RYCB 5JQGB 1SQGA 1FXVA 4NR1A 1HNZB 2R9IA 4JI6B 5KHGA 3CXHF 1WJZA 4P2ZA 3TK1A 2PTMA 4FLUA 2M6YA 1SZTA 4HNAA 1X59A 2EX3A 2B5UA 5KX5A 4MSWC 2A79B 4XBFA 5GTIZ 2PYLA 1JFFB 1V54C 1CP9A 3HR0A 3OUSA 3OTOB 4LWSA 3N2KA 4NTYA 3MAQA 5LGTA 1PPJH 3VQXA 4YIPA 4O4IB 3DXRA 2JRIA 2F4VO 2WLHA 1HNWO 3C3TA 3OM3B 2BCCH 4WCEV 4ABMA 5B1OA 1Q6UA 3AG3B 3LNMB 3R66A 3HKBA 4A5UB 1MZFA 1E79G 2Y0PA 3E83A 1ZUQA 3VQWA 4BAYA 1PKXA 3ML0A 1Q8IA 5K1PA 1P84F 3ASOB 4TSFG 4DV5O 4IIJB 4J41A 1Y76B 5CBHA 1WAZA 3K9AA 3BHPA 1K73W 4DR3O 1H2GA 2F4VB 5LP6A 1HNWB 4DXWA 1GTOA 3ETEA 2PY5A 3U11A 1JA8A 1R73A 4JI0B 1JCHA 4D7SA 1P7BA 2F93B 2WLNA 4I5SA 3LDEA 1SKVA 3FFQA 1FJGO 4H33A 5C93A 1N0JA 4DV5B 3FB5C 1NBMG 3SPCA 3B40A 2ZR3A 2Q7GA 2XOKG 5FPOA 4X1KA 1N8RW 3J7AU 4H13B 1GM9A 2IJKA 3W7TA 2HKOA 2WPDG 3OR7C 2ZNIA 3GWOA 5BMVA 4RQEA 2EIKB 5KA6A 4L8JA 4LCUC 5JJEB 4YJ3A 1BS3A 3WU2Z 3W7SA 1VMGA 1NTZH 3K5LA 1IZ3A 5F2VO 5IY5B 3K06A 4ASUG 3CX5F 1MG1A 1R3JC 4F4LA 4UVCA 2ODMA 5EK0A 3ETQA 3K04A 5DECA 4DR2O 2OCCC 5IJ0B 2YC0A 3KKYA 3JAWA 1YZBA 1VQ6V 1VF7A 2JGUA 2VRZA 3AG4C 1QLEC 3OFNG 4DV4B 4X1YA 2GUZB 2GV9A 2YXLA 4O4LB 4X8AA 2GSMB 1A32A 3JD2A 3JATB 1F4NA 1W2BU 5KMGB 1Z5VA 1GM8A 3S3WA 5EYPB 4KHPO 3L75H 3CJHB 1IXBA 4JAUA 3ZCCA 1MSDA 2Q9LA 2QWPB 5CMUA 3ZHVA 2ZKOA 2OYQA 3LDCA 2EZOA 3S3XA 5LMNB 3JASA 2ILMA 2YEVB 3RYIB 4O4JA 3W7UA 3UO3A 1K33A 2E5LO 4RO2A 3ETGA 1QHTA 2CGNA 4Q20A 4FM0A 5IYZB 4GT1A 2H8PC 1UFIA 5J2TB 2DYRC 4LNUA 1YJ9V 4MVRA 4FPPA 2XTAA 1IBMO 3IJ4A 3U10A 4J9YB 2HG5C 2UU9B 3E89A
chains in the Genus database with same CATH topology
4DR6O 2DOSA 1I94O 2UUAO 4DV2O 5BXZA 4B3MO 4JI0O 2UXDO 2UXCO 1AB3A 4DV1O 5LMNO 4DV6O 5IWAO 5IT9N 4B3SO 1J5EO 2UUCO 4X65O 1KUQA 5BR8O 2JRIA 2AGAA 2F4VO 4DR2O 5FLXN 4JI5O 2VQEO 4DR7O 1XMQO 3J80N 1HNXO 1N33O 1HNWO 4X62O 1YZBA 4OPAA 4OX9O 1FYJA 4X64O 4NXMO 1N36O 1FKAO 3JAMN 5H5NA 3R66A 4A5UB 4LF4O 5LL6Y 2Z0AA 4DR1O 3M8AA 2UU9O 1A32A 3F5TA 4DV5O 4LF7O 4LFCO 4B3TO 1N32O 1F7YA 1HNZO 4KHPO 4GKKO 4DR3O 4JI6O 4NXNO 4JYAO 1XEQA 5LMUO 4DV0O 2HHHO 4YY3O 4LF8O 4DV7O 4JV5O 4DUZO 4JI8O 4LF6O 2ZKOA 4YHHO 5A2QN 1XNRO 4LF5O 4K0KO 4OPHA 3O65A 1G1XB 1R6TA 1NS1A 2VQFO 4DR4O 2DJVA 4JI3O 1XMOO 2LW7A 5BY1A 1N34O 1FJGO 4DV4O 3T1HO 3SDLA 1R1BA 3OTOO 2E5LO 4LF9O 4DR5O 1AILA 4DV3O 1IBKO 3J7AU 1D2DA 4X66O 1XNQO 2ZM6O 4JI4O 4AQYO 1HR0O 4JI7O 2FKXA 4LFAO 1IBLO 3RT3C 2N74A 1X59A 3J81N 1IBMO 4JI2O 4LFBO 3T1YO 2UXBO 4DUYO 4GKJO 1DK1A 4JI1O 4B3RO 2UUBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 O;  2DOS A;  1I94 O;  2UUA O;  4DV2 O;  5BXZ A;  4B3M O;  4JI0 O;  2UXD O;  2UXC O;  1AB3 A;  4DV1 O;  5LMN O;  4DV6 O;  5IWA O;  5IT9 N;  4B3S O;  1J5E O;  2UUC O;  4X65 O;  1KUQ A;  5BR8 O;  2JRI A;  2AGA A;  2F4V O;  4DR2 O;  5FLX N;  4JI5 O;  2VQE O;  4DR7 O;  1XMQ O;  3J80 N;  1HNX O;  1N33 O;  1HNW O;  4X62 O;  1YZB A;  4OPA A;  4OX9 O;  1FYJ A;  4X64 O;  4NXM O;  1N36 O;  1FKA O;  3JAM N;  5H5N A;  3R66 A;  4A5U B;  4LF4 O;  5LL6 Y;  2Z0A A;  4DR1 O;  3M8A A;  2UU9 O;  1A32 A;  3F5T A;  4DV5 O;  4LF7 O;  4LFC O;  4B3T O;  1N32 O;  1F7Y A;  1HNZ O;  4KHP O;  4GKK O;  4DR3 O;  4JI6 O;  4NXN O;  4JYA O;  1XEQ A;  5LMU O;  4DV0 O;  2HHH O;  4YY3 O;  4LF8 O;  4DV7 O;  4JV5 O;  4DUZ O;  4JI8 O;  4LF6 O;  2ZKO A;  4YHH O;  5A2Q N;  1XNR O;  4LF5 O;  4K0K O;  4OPH A;  3O65 A;  1G1X B;  1R6T A;  1NS1 A;  2VQF O;  4DR4 O;  2DJV A;  4JI3 O;  1XMO O;  2LW7 A;  5BY1 A;  1N34 O;  1FJG O;  4DV4 O;  3T1H O;  3SDL A;  1R1B A;  3OTO O;  2E5L O;  4LF9 O;  4DR5 O;  1AIL A;  4DV3 O;  1IBK O;  3J7A U;  1D2D A;  4X66 O;  1XNQ O;  2ZM6 O;  4JI4 O;  4AQY O;  1HR0 O;  4JI7 O;  2FKX A;  4LFA O;  1IBL O;  3RT3 C;  2N74 A;  1X59 A;  3J81 N;  1IBM O;  4JI2 O;  4LFB O;  3T1Y O;  2UXB O;  4DUY O;  4GKJ O;  1DK1 A;  4JI1 O;  4B3R O;  2UUB O; 
#chains in the Genus database with same CATH topology
 1V55 C;  1BSM A;  4DV2 O;  5H6Q A;  2QDO A;  2IH1 C;  4EEQ A;  4YJ2 A;  4B3T B;  1AB3 A;  1FXK A;  1GK9 A;  2F1M A;  2E5L B;  2QSA A;  1K97 A;  1L0N H;  1OCO B;  3CC7 V;  3VQY A;  5LOV A;  3ZN1 A;  1SES A;  4I50 A;  3TCU A;  2PZS A;  4FM2 A;  3ZRV A;  2JGD B;  3SYP A;  1HNX O;  1M56 B;  2PI4 A;  4BWA A;  1P4R A;  1OJH A;  4PV1 B;  3JSL A;  5KUK A;  4LC1 A;  2R9A A;  3W7W A;  2ITC C;  3K0D A;  3L70 H;  2FTK A;  4LF4 O;  2PI5 A;  4DW1 A;  4FFK A;  5CN0 A;  2ZCE A;  2Y69 C;  2GBO A;  1GN3 A;  3H1K H;  2EUL A;  2PYJ A;  4K3A A;  3K5N A;  3FD9 A;  3OGC C;  1NVP D;  4QGP A;  3GVM A;  3QG5 A;  1M90 W;  2GHY A;  4YXW G;  5LMU O;  4YY3 O;  1HNX B;  1GO3 F;  3LSQ A;  4G27 B;  4JV5 O;  5EBM C;  2OT5 A;  1K34 A;  2RMK B;  4PD4 F;  3GWK C;  4QPJ A;  1AI5 A;  3ZN0 A;  3SYO A;  3F5W C;  4LF4 B;  4DV1 B;  2HLD G;  1SA0 B;  3SJB C;  1B3Q A;  1MOF A;  1XMO O;  4JGS A;  5LHI A;  2ZE7 A;  2MW2 B;  2W0F C;  3APQ A;  1JPX A;  1AP6 A;  4J42 A;  1KQS U;  1VEW A;  2CTQ A;  1KU9 A;  1Q7Y W;  2Q0O C;  4NYK A;  4JV5 B;  3OMN B;  3KZI Z;  4LFA O;  3J81 N;  5JJN B;  1OCZ C;  4UCR A;  2QWR B;  1B06 A;  5KHJ A;  2Y4T A;  3FAV B;  2UXD O;  1WPX A;  2QJ1 A;  1ZAU A;  1M57 C;  1COW G;  5FNV A;  1J5E O;  4UVB A;  4K8Z A;  4LR3 A;  4X65 O;  1KUQ A;  1SRY A;  2ZQM A;  3RYC A;  3RGB A;  5FLX N;  4JI5 O;  4LFA B;  3ABM B;  1NR1 A;  4OX9 O;  1ZSP A;  2LQT A;  2ZE6 A;  4FFB B;  4UCT A;  1N34 B;  4U7O A;  4AI8 A;  1H2M A;  2EIJ B;  4TT3 G;  4LF9 B;  3EVK A;  1KYO F;  5L3B A;  2JS5 A;  4IYH A;  1SER A;  3M8A A;  1WA8 A;  4X65 B;  4LF7 O;  4XDL A;  1RSO B;  1S72 V;  1N32 O;  4JI2 B;  3BCC H;  4LF8 O;  5CA0 B;  2QKS A;  4O4I A;  4OX9 B;  2YI8 A;  3RYH B;  1TGO A;  1Y74 A;  2DN9 A;  1BZK A;  1ORQ C;  3RYF B;  3H01 A;  5J9P C;  2DWE C;  2RJZ A;  3UM7 A;  1JOY A;  1IX9 A;  1M9N A;  4TQD A;  2CH7 B;  1NS1 A;  4JI3 O;  1SS3 A;  1LUW A;  3ZHU A;  1BHB A;  2IJH A;  4PI2 A;  1SQV H;  4DR7 B;  1N0N A;  1N32 B;  1U96 A;  1R6N A;  3Q4H B;  4UB6 Z;  1EBO A;  2A06 H;  4ZOL B;  3TXS A;  1VIB A;  1NT2 B;  4JI7 O;  3X2Q C;  4MW8 A;  1Z5W A;  3JAK A;  1FFX A;  1TUE B;  2MK3 A;  3I55 V;  5LHH A;  4Z2W A;  5H2F Z;  2GDS A;  4I0X B;  5CA1 A;  4IYI A;  1K7D A;  1V54 B;  4DV0 B;  3OT7 A;  4I55 B;  4FLW A;  3G6B A;  3K5M A;  3AG2 C;  1L8D A;  3BY6 A;  1SQX H;  1YXB A;  4N23 A;  3CRA A;  5BR8 O;  3F7V C;  2D2C B;  4X89 A;  1PM9 A;  1YIT V;  4FIP C;  4U3J B;  3OR6 C;  3CRC A;  1NTK H;  1OCC C;  4Z1M G;  2XUM A;  3K3W A;  5A9G A;  4QE9 A;  4KUM A;  5E1A C;  1QLN A;  1NVP B;  1HP8 A;  2DMX A;  2QE7 G;  2QKA A;  2X6C A;  2HFE C;  4DR1 O;  1G4Y B;  3VOU A;  3B77 A;  4K8X A;  4DRX B;  3ABL C;  3BPZ A;  4DV7 O;  4MTX A;  1AR4 A;  1VQ9 V;  5LA6 A;  4JI1 B;  2Y4U A;  4LF6 O;  5D5Q A;  4JF3 A;  3ABK C;  3B2E E;  1BCC H;  4KL1 A;  1GN4 A;  4RQF A;  4JYC A;  4J7J A;  3JAL A;  4B3S B;  1MAB G;  1UPG A;  4XDJ A;  1BQZ A;  1PL0 A;  3EXA A;  5KAI Z;  4DR5 O;  4O4L A;  4JTC B;  1V9P A;  1NZ6 A;  2BOB C;  1XNQ O;  2KG7 B;  4BW5 A;  4DV7 B;  3CC4 V;  3BA8 A;  1ENV A;  1QR9 A;  4R7C A;  3KCX A;  4AQY O;  4MVO A;  3ZMV A;  4MVM A;  1BQ0 A;  2GTS A;  4FJC C;  4HZ3 A;  4P9O A;  4LFB O;  2KB1 A;  3H9V A;  5EZY B;  1YF2 A;  1IVS A;  2XAG A;  5GON A;  2OWO A;  2UUA O;  5E79 Z;  1WNS A;  1SQQ H;  2UXC O;  4WFG A;  3P30 A;  5DED A;  4DR5 B;  2HVK C;  4UV9 A;  1NTM H;  4UCU A;  1H8E G;  4AHC A;  1QVG U;  2YI9 A;  3CSX A;  4AQY B;  4O2A B;  4YHH B;  4K35 A;  4WFE A;  5IYZ A;  2YXY A;  1VQP V;  2IW5 A;  5J2T A;  4FLZ A;  2A0L A;  4LFB B;  4QE7 A;  1TVK B;  1FYJ A;  3C90 A;  4HAM A;  4X64 O;  3G67 A;  3KCY A;  3FKS G;  1L1F A;  3CWB H;  1QLE B;  4UUJ C;  3T1H B;  2UUA B;  3OW2 U;  3L73 H;  5JCO C;  3WB0 A;  2UXC B;  2ZXW B;  4JYY A;  1FXK C;  3HKC B;  2QWQ B;  2ETN A;  1Q86 W;  4EKW A;  3WB2 A;  3HKE B;  5LBQ A;  3H1H H;  2HP8 A;  5B5E Z;  4J80 A;  4CZZ A;  1XEQ A;  4IT5 A;  2BOC C;  5LXT A;  1NJI W;  1B6Q A;  4X64 B;  2P06 A;  1QNM A;  4I4T A;  4O4H A;  5A2Q N;  1XNR O;  2EZP A;  3K5O A;  5FPR A;  3NXS A;  5IJ9 B;  2WAM A;  4PJ0 Z;  2IU3 A;  3SDL A;  2A3Q A;  4W4K A;  1AIL A;  3ETD A;  2WLL B;  1E1Q G;  2R70 A;  2EIM B;  4ZHQ A;  4TV9 A;  4DK0 A;  4R6Z A;  2V7Q G;  2FKX A;  4EFE A;  1K5S A;  4UCV A;  4PHZ A;  4TV8 B;  1XNR B;  2UXB O;  5ITZ B;  1AI6 A;  4Q6G A;  4FZ0 A;  4WFB V;  1S0V A;  1I94 O;  3VQV A;  4B3M O;  2CDY A;  3RVY A;  4MTF A;  3E22 B;  1TUB B;  1VQ8 V;  2BTQ B;  2UXX A;  3DTU B;  4DR3 B;  1SA0 A;  1F51 A;  4ZBM A;  5IT9 N;  5LYJ A;  5B3S C;  1Z2G A;  1CEZ A;  2Z5U A;  4UVA A;  1YI2 V;  4O2B B;  4UV8 A;  2DW4 A;  4FLY A;  2CUG A;  1WB7 A;  4IHJ A;  5H5N A;  3JAM N;  1FJG B;  1QBZ A;  5JVD B;  1I94 B;  1DF5 A;  4B3M B;  5B1A B;  3ZMU A;  3CS5 A;  3JAR B;  2KSD A;  2RQ6 A;  3OMI B;  1O9G A;  1I5Y A;  3FAV A;  4LFC O;  1SQF A;  2A9H A;  1XDC A;  2ATK C;  2FYU H;  3STL C;  1K4C C;  4B7K A;  2F43 G;  2E3C A;  4FLV A;  4X20 B;  2D3O W;  1ROP A;  4IL6 Z;  3ASN C;  3UQ8 A;  1AJQ A;  4RUE A;  3LUT B;  2NNU A;  1EN4 A;  3L74 H;  4K0K O;  1WPB A;  1S5H C;  4PEL A;  4H0L B;  3CC2 V;  4TQF A;  1GKF A;  1KMI Z;  2EJ7 A;  1U97 A;  3CCM V;  1ZL8 A;  3SYQ A;  2F66 C;  3CCE V;  4DR2 B;  4LFC B;  3CPW U;  4WFA V;  2RDC A;  4CH3 A;  2RNB A;  4ZI7 B;  3B8M A;  2ZM6 O;  2BSK B;  1RSO A;  4KP4 A;  2N74 A;  3N2G B;  5JH7 B;  5CB4 B;  2L35 A;  3G71 V;  5DM6 V;  1LNQ A;  4GZR B;  3RYF A;  3AG3 C;  1UJW B;  4MVZ A;  3IGA C;  4KHP B;  3OGI B;  3CCU V;  4E2L A;  3ASO C;  1W0K G;  3SGI A;  2P5O A;  2ZM6 B;  3BVO A;  1FD9 A;  3DGE A;  3F7Y C;  4TUY B;  4JAV A;  1XMQ O;  4HNA B;  4GX0 A;  2NN4 A;  1I0H A;  5KX5 B;  4MVS A;  5JCO A;  5HFM A;  1JR9 A;  2CE4 A;  3A0R A;  3L71 H;  1QVF U;  3CCJ V;  1Q81 W;  4ZKI A;  2Q7E A;  1VQ5 V;  3SYA A;  4FZ1 A;  3ZRX A;  4EB6 A;  1EM1 A;  3OUF A;  4LWS B;  3N2K B;  1ZX3 A;  3ZHT A;  3K9S A;  4OGQ B;  3CCQ V;  1PP9 H;  4JZ2 A;  1NQT A;  3CHX A;  3DXR B;  4GKK O;  4F6R A;  1IBM B;  2DQ3 A;  2HHH O;  1XMQ B;  5L3F A;  1CPY A;  1PL4 A;  1SET A;  1Q6H A;  3SJA C;  3AEI A;  2X7R B;  2IJI A;  4DV2 B;  3PJS K;  1Q3E A;  4GUN A;  1P7G A;  3HKB B;  5L3D A;  4WBN B;  1DLB A;  2QTO A;  4DR4 O;  3T1C A;  3T4D A;  2ZIO A;  2XAQ A;  3GB7 C;  2F23 A;  1BGY H;  3D3I A;  2QM7 A;  4KFM A;  4W4L A;  5IY5 C;  4QNH B;  4GKK B;  1O9H A;  5C8Y B;  5LP6 B;  2CTP A;  2K9P A;  1MA1 A;  3BFR A;  4U3F H;  3OEE G;  1R3I C;  3RW0 A;  4F6E A;  2H94 A;  4JPR A;  3OD4 A;  4CS3 A;  4GYC B;  3I5D A;  4B3R O;  2PGG A;  4DR4 B;  2B1G A;  2XHB A;  4CH5 A;  3ABU A;  4DV6 O;  5LMU B;  1W59 A;  4YY3 B;  4PDV A;  1XL6 A;  2O57 A;  3DC5 A;  2A7W A;  2WWW A;  1XI1 A;  2VQE O;  1N33 O;  3SYC A;  1D5N A;  3HKD A;  1FAF A;  1S5J A;  1TAE A;  1N36 O;  5GTH Z;  1XMO B;  4OXS A;  4B3R B;  2AHY A;  4UXN A;  1NU1 H;  5KHK A;  3RVZ A;  3L9D A;  3DC6 A;  1EZV H;  2RN9 A;  1VF6 C;  5EZY A;  4X1I B;  2ZE5 A;  4DV6 B;  1HDJ A;  4FM1 A;  3F5T A;  5JQG A;  2ZE8 A;  3HPL C;  3AG1 B;  2DWD C;  1LUV A;  2EIL B;  2EIN B;  3JCU Z;  4NXN O;  3ZJZ A;  2VQE B;  2YS8 A;  3K0G A;  3JAW B;  2JS3 A;  3E8B A;  2ZDI A;  4PA9 A;  2ZT9 B;  1N36 B;  4DO2 A;  1AVM A;  3CP1 A;  1SC5 B;  2UXD B;  2W6I G;  3ABK B;  3JD0 A;  4RUF A;  1JFF A;  3ZHQ A;  5EIB C;  3G80 A;  1J5E B;  3WB1 A;  4RAI A;  3ZX6 A;  3ZRW B;  3B8N A;  4TOI A;  2YIB A;  2V1D A;  3U0Z A;  4JI5 B;  2Q8V A;  3HKC A;  3AK3 A;  1OCO C;  1BT8 A;  2DYS B;  2KKW A;  2WLM A;  3FB8 C;  4NXN B;  3HKE A;  4JI4 O;  3LNN A;  1HR0 O;  1Y67 A;  3SPH A;  1VAR A;  1S5L Z;  4PA6 A;  5CBG A;  1LR1 A;  2K1E A;  1M56 C;  2JIZ G;  2ITD C;  2M7W A;  4E4E A;  3T1Y O;  4GKJ O;  3W7X A;  1THZ A;  3NR7 A;  2N05 A;  4L87 A;  3UT5 B;  3K58 A;  4LF7 B;  3OEH G;  5H6R A;  1JJ2 U;  2EJR A;  3CRR A;  3E8G A;  2DE0 X;  4LF8 B;  1US6 A;  3CME V;  4IIJ A;  1Y76 A;  4NB5 A;  1AJN A;  1SQP H;  1KKC A;  1HR0 B;  3JD4 A;  3O9O A;  1BL8 A;  1WP8 A;  4LNU B;  2HVJ C;  3T1Y B;  3K03 A;  4JI3 B;  4GKJ B;  4P30 A;  5BZB A;  1NKD A;  1F23 A;  5ITZ A;  4YJ2 B;  1XHX A;  1FXK B;  1AR5 A;  2QA4 V;  5B1B C;  4JI7 B;  1P49 A;  3UKM A;  5LOV B;  1AJP A;  1TUB A;  4MTO A;  2W0X A;  2P22 C;  4JYA O;  1NH2 D;  3E86 A;  5L3G A;  3A2F A;  3ZIA G;  1MZE A;  2HJD A;  1EFR G;  3T4Z A;  3R65 A;  1RPO A;  2W6J G;  2R9R B;  4YIO A;  1IXM A;  1R3L C;  4DK1 A;  2DJV A;  2WLI B;  4UFZ A;  2QWO B;  1KEC A;  4FLT A;  2QM4 A;  5BR8 B;  3T2M A;  3WG7 C;  1ZLZ A;  5AG2 A;  3OE7 G;  2Q68 A;  2C2A A;  1H2S B;  4DV3 O;  4JYA B;  1VQ4 V;  4LP8 A;  4UCS A;  2Q0A A;  3A8T A;  5D5P A;  3JYC A;  5IJ0 A;  2AW9 A;  2JVD A;  3P32 A;  2QGN A;  1B04 A;  2WLJ A;  1R6K A;  2WA4 A;  3AK2 A;  3BA9 A;  2CK3 G;  4DR1 B;  2BTO A;  1RM1 C;  3QO8 A;  2P4V A;  4LH6 A;  4ZIB A;  3C3S A;  4N21 A;  1OCR C;  2GUZ A;  1JX9 A;  2EIJ C;  5EC2 C;  2ZR2 A;  1NR7 A;  2X6A A;  5IWA O;  3JAT A;  1VQN V;  1W0J G;  3P3P A;  2UXN A;  2Q5Z A;  3FB7 C;  5KMG A;  5EYP A;  1TA8 A;  4MT8 A;  3CJH A;  3K57 A;  1GMG A;  4LF6 B;  1Y66 A;  1RP3 B;  3J80 N;  4FVM A;  4J10 A;  1H2L A;  2BSK A;  3WFV A;  4DYL A;  4NXM O;  4FLX A;  3CMA V;  2WA3 A;  1VF6 A;  1K3E A;  4I9W A;  2VWJ A;  4GX5 A;  3G4S V;  3EHB B;  1I5X A;  3SR2 C;  3CCS V;  4MVQ A;  2YEV A;  4HYO A;  2QWN B;  3RYI A;  3AG7 A;  1G8M A;  1XNQ B;  2DQ0 A;  2Q69 A;  1SQB H;  1X4T A;  1RPR A;  2VS0 A;  4EFB A;  1FXH A;  1XHZ A;  2HR3 A;  4GCZ A;  2QTS A;  2OCC B;  3QVN A;  3TXQ A;  3LSS A;  3JD1 A;  4QPK A;  5J2U B;  3AG4 B;  3PN1 A;  2FML A;  1YIJ V;  4BIU A;  4NXM B;  1BE3 H;  4TUY A;  3ASN B;  4QIW F;  4OPH A;  3MHS C;  1R6T A;  4BIO A;  2JEU A;  1DGS A;  4WF9 V;  1AP5 A;  1FS0 G;  2LFS A;  3CXC U;  1QU7 A;  5HFL A;  1WA8 B;  1YEW A;  4GLX A;  1VQO V;  1QQC A;  4GX1 A;  5IYC O;  2IBZ H;  5EIB D;  3K08 A;  1URF A;  1IBK O;  4X66 O;  1KP2 A;  1J95 A;  3BAB A;  2JGD A;  1IBL O;  1Y74 B;  1PV0 A;  2ZIM A;  3OTF A;  2CGO A;  2QKC A;  4JAA A;  3M99 B;  2NR5 A;  2DOS A;  2ZIN A;  5BXZ A;  1E1R G;  4JI0 O;  4WBN A;  5CBF A;  2XAS A;  1WN7 A;  2XND G;  2ZD9 A;  1IBK B;  2IH3 C;  4X66 B;  1XUQ A;  2DYR B;  1CXZ B;  1G6U A;  3LSU A;  1EZJ A;  1IBL B;  4J11 A;  4X62 O;  3JAK B;  5C8Y A;  2L6L A;  1FFX B;  1V55 B;  5H9C A;  3CYO A;  5CA1 B;  1H8H G;  5LL6 Y;  1JVM A;  2XT9 A;  4G2K A;  3ZHR A;  5IYB O;  2AHZ A;  3MD0 A;  1K5Q A;  4R50 A;  4U7N A;  2EBO A;  3N27 A;  1NH2 B;  1KP3 A;  4JTA B;  4D7T A;  2XAF A;  5GW7 A;  2UXB B;  2WLK A;  1L0L H;  4X62 B;  3K59 A;  3IC7 A;  3KG2 A;  5KLV H;  4JI8 O;  1FFT B;  1Q90 D;  4TWK A;  1H2N A;  5JJJ B;  1VQK V;  3ZHS A;  2P7T C;  1IUR A;  3O65 A;  2Y69 B;  4PA4 A;  3SJQ C;  3H1J H;  1PNL A;  1K8A W;  2E74 B;  2LW7 A;  2H3O A;  2Q7H A;  2QM8 A;  4DV4 O;  1ARO P;  3CEI A;  3G6E V;  2YID A;  2B1I A;  4X1I A;  3M7M X;  1S3J A;  2JDI G;  4DW0 A;  2OTL V;  5LA6 B;  2ZDI C;  1YHQ V;  4JI8 B;  1RFY A;  4NVP A;  1ZWI C;  3QO5 A;  3OAA G;  4FFB A;  2Q73 A;  2LGW A;  3IC9 A;  2IM9 A;  3CE2 A;  3JAL B;  3TGU H;  3TET A;  2ZXW C;  4PDM A;  5LMN O;  5TIS Z;  5LGU A;  5KHI A;  3ZRW A;  1M93 A;  4MW3 A;  2E75 B;  1K9M W;  5L3E A;  3ZED A;  2JEX A;  3D36 A;  4CC5 A;  4WFF A;  4C7U A;  5CA0 A;  4K0K B;  1OCZ B;  1PNM A;  3RYH A;  3SJC C;  4B08 A;  4I7Z B;  3L72 H;  3SPI A;  1XOU A;  2CAZ C;  1XL4 A;  2CH7 A;  2Z0A A;  5GON B;  3D3Q A;  5LHG A;  3ZMT A;  2HEP A;  1YTF D;  1M57 B;  5KHH A;  1T5E A;  2ADP A;  2UU9 O;  3UT5 A;  3E8F A;  4B3T O;  1KKD A;  3Q4H A;  5IYD O;  1EN5 A;  4LH7 A;  4BR6 A;  3RN4 A;  4ZOL A;  5JWP A;  1VF5 B;  3FX7 A;  2EIM C;  3QO7 A;  1XRE A;  1K4D C;  2Y48 A;  2IU0 A;  4BIZ A;  3AK1 A;  2R72 A;  3CCV V;  4I0X A;  1ZTE A;  4PA7 A;  2OIG A;  4P9P A;  2HJF C;  3ZMS A;  1HWY A;  4PDR A;  3K79 A;  3APO A;  4I55 A;  2BE3 A;  3A0H Z;  5FL7 G;  1YJN V;  2FB5 A;  3BAA A;  1XBL A;  2Q67 A;  4BW9 A;  3I56 V;  1QCE A;  2EIK C;  2N04 A;  5LXT B;  3RT3 C;  4U3J A;  4I4T B;  2B9Z A;  4O4H B;  4DUY O;  3ABT A;  1GN2 A;  2UUB O;  4DR6 O;  1D2D A;  1D5A A;  3STZ C;  1VQ7 V;  4D6T H;  4WFH A;  2YIC A;  3RBZ A;  1AI7 A;  2X0L A;  4CS2 A;  3SPG A;  2YIA A;  5B1A C;  4DV1 O;  2HHH B;  3E35 A;  2WLI A;  4DRX A;  1NI8 A;  4X88 A;  2YDE A;  1DF4 A;  3QTC A;  5B66 Z;  3X2Q B;  4ZHQ B;  4TV9 B;  1Q43 A;  3ZBH A;  3MHH C;  4H44 B;  2LO1 A;  1OV9 A;  2LJ2 A;  3VBB A;  4Z1V A;  1YJW V;  1WLE A;  4DUY B;  2UUB B;  4DR6 B;  2PUS A;  1DTO A;  4CH4 A;  2P4K A;  1MNG A;  2JK5 C;  4JAS A;  4X1K B;  3AG2 B;  4RWU A;  5B1B B;  1GN6 A;  5LYJ B;  1F4M A;  2IJJ A;  5BMV B;  2KG7 A;  4UCO A;  3UCS C;  4R8C A;  3CB2 A;  1OCC B;  4DUZ O;  1I7F A;  2Z3Y A;  4YJ3 B;  2GTA A;  2ZNJ A;  4FMT A;  4IHJ B;  5B1N A;  2Q6A A;  2LW1 A;  1QR8 A;  3SPJ A;  2VQF O;  2QEX V;  1PD3 A;  1MMM A;  3FB6 C;  5BY1 A;  1N34 O;  1Q82 W;  1JJO A;  3THO A;  3ABL B;  1R1B A;  3QNE A;  4LF9 O;  5K1X A;  3CD6 V;  1GH6 A;  1M1K W;  1H38 A;  2OIE A;  3WG7 B;  4PI0 A;  1MSW D;  3RFR A;  1N33 B;  2Q4P A;  4CH6 A;  1JQ0 A;  4CC6 A;  5LGN A;  1GRJ A;  4O2A A;  2AZ2 A;  4J9Z B;  4JTD B;  2RCV A;  4DUZ B;  4MVU A;  5CA3 A;  2Y0I A;  4XDK A;  4X1Y B;  1KBH A;  1TVK A;  2YSU B;  3B4S A;  3H1I H;  4B7E A;  4JI2 O;  1R3K C;  5J2U A;  2P90 A;  4JZG A;  1DK1 A;  2NLJ C;  1RM1 B;  2VQF B;  1SF9 A;  3OMA B;  1OCR B;  2JJ1 G;  3UO2 A;  1FPO A;  1ZL8 B;  1GAX A;  1PNK A;  2YXH A;  2KQX A;  4NKG B;  2CTR A;  2UUC O;  3CCR V;  2YIB D;  2AGA A;  3E2E A;  4DR7 O;  4PA3 A;  2LGQ A;  1S76 D;  1OZ0 A;  2XAJ A;  4OPA A;  4JYB A;  3JAS B;  1IDS A;  1M4U A;  1YTF B;  2ARH A;  2V4D A;  1KB9 F;  3CCL V;  4O4J B;  1S77 D;  5IJ9 A;  3BRC A;  4MS2 A;  2YUA A;  1SZX A;  3QF7 A;  1Y4M A;  4JI4 B;  2UUC B;  3JSN A;  2WLL A;  2CTW A;  4MTG A;  4AIL C;  1F7Y A;  4DV0 O;  2QR4 A;  3BEH A;  1WP7 A;  1XQ8 A;  5LP6 C;  1YDX A;  4PDL A;  4ICG A;  3TJT A;  5EBL C;  4TV8 A;  4NTW A;  1VQM V;  1GM7 A;  2LP7 A;  3MDS A;  4KXR A;  4LF5 O;  5IDJ A;  3ZMZ A;  2P6J A;  3HB3 B;  3E22 A;  5EBW C;  2BTQ A;  4EB6 B;  2OTJ V;  4CS4 A;  2PF4 E;  2WSS G;  4I50 B;  1KC8 W;  1N4C A;  3H1L H;  3P3N A;  2P67 A;  4IGG A;  1I08 A;  4F6R B;  4LBE C;  1BMF G;  3B09 A;  4O2B A;  1K92 A;  3DSQ A;  1Q6I A;  1VQL V;  1YSC A;  4LF5 B;  3FYE B;  3D8C A;  1XIL A;  4X9Q A;  4JI1 O;  5JVD A;  2F95 B;  5DN6 G;  1KD1 W;  3JAR A;  1M5I A;  4UB8 Z;  4B3S O;  4GX2 A;  5IE9 A;  3AG1 C;  3LDD A;  3ABM C;  3FYI B;  2E76 B;  5EC1 C;  2EIL C;  2EIN C;  1YVW A;  4X20 A;  2AZ0 A;  1EN6 A;  2JJ2 G;  2FL4 A;  1Q5O A;  1FKA O;  3IAY A;  5L3C A;  3RWR D;  3E8H A;  4G28 B;  4H37 A;  4I9Q A;  1BHA A;  1OHH G;  3ZS8 C;  4DV3 B;  1AI4 A;  1WB8 A;  3ZRS A;  4J7K A;  1JMK C;  1VP7 A;  2VWK A;  5B3S B;  3IFX A;  4NTX A;  3EFF K;  4FK5 C;  5KUM A;  1HNZ O;  2ADQ B;  4ZI7 A;  3D36 C;  4J7Z A;  4JI6 O;  2DYS C;  5KAF Z;  3JCZ A;  3CRM A;  2OCH A;  3ICX A;  1Y6X A;  3HKD B;  4CBC A;  3CRQ A;  3N2G A;  5JH7 A;  5CB4 A;  4YHH O;  5IWA B;  1G1X B;  4QJF B;  3A0B Z;  1AR1 B;  4HBN A;  5KA5 A;  2AXT Z;  2LFR A;  1HW7 A;  3JD3 A;  5FNV B;  1H2K A;  1YCI A;  3T1H O;  2XAH A;  3OTO O;  2G38 A;  2X6B A;  3RYC B;  5JQG B;  1SQG A;  1FXV A;  4NR1 A;  1HNZ B;  2R9I A;  4JI6 B;  5KHG A;  3CXH F;  1WJZ A;  4P2Z A;  3TK1 A;  2PTM A;  4FLU A;  2M6Y A;  1SZT A;  4HNA A;  1X59 A;  2EX3 A;  2B5U A;  5KX5 A;  4MSW C;  2A79 B;  4XBF A;  5GTI Z;  2PYL A;  1JFF B;  1V54 C;  1CP9 A;  3HR0 A;  3OUS A;  3OTO B;  4LWS A;  3N2K A;  4NTY A;  3MAQ A;  5LGT A;  1PPJ H;  3VQX A;  4YIP A;  4O4I B;  3DXR A;  2JRI A;  2F4V O;  2WLH A;  1HNW O;  3C3T A;  3OM3 B;  2BCC H;  4WCE V;  4ABM A;  5B1O A;  1Q6U A;  3AG3 B;  3LNM B;  3R66 A;  3HKB A;  4A5U B;  1MZF A;  1E79 G;  2Y0P A;  3E83 A;  1ZUQ A;  3VQW A;  4BAY A;  1PKX A;  3ML0 A;  1Q8I A;  5K1P A;  1P84 F;  3ASO B;  4TSF G;  4DV5 O;  4IIJ B;  4J41 A;  1Y76 B;  5CBH A;  1WAZ A;  3K9A A;  3BHP A;  1K73 W;  4DR3 O;  1H2G A;  2F4V B;  5LP6 A;  1HNW B;  4DXW A;  1GTO A;  3ETE A;  2PY5 A;  3U11 A;  1JA8 A;  1R73 A;  4JI0 B;  1JCH A;  4D7S A;  1P7B A;  2F93 B;  2WLN A;  4I5S A;  3LDE A;  1SKV A;  3FFQ A;  1FJG O;  4H33 A;  5C93 A;  1N0J A;  4DV5 B;  3FB5 C;  1NBM G;  3SPC A;  3B40 A;  2ZR3 A;  2Q7G A;  2XOK G;  5FPO A;  4X1K A;  1N8R W;  3J7A U;  4H13 B;  1GM9 A;  2IJK A;  3W7T A;  2HKO A;  2WPD G;  3OR7 C;  2ZNI A;  3GWO A;  5BMV A;  4RQE A;  2EIK B;  5KA6 A;  4L8J A;  4LCU C;  5JJE B;  4YJ3 A;  1BS3 A;  3WU2 Z;  3W7S A;  1VMG A;  1NTZ H;  3K5L A;  1IZ3 A;  5F2V O;  5IY5 B;  3K06 A;  4ASU G;  3CX5 F;  1MG1 A;  1R3J C;  4F4L A;  4UVC A;  2ODM A;  5EK0 A;  3ETQ A;  3K04 A;  5DEC A;  4DR2 O;  2OCC C;  5IJ0 B;  2YC0 A;  3KKY A;  3JAW A;  1YZB A;  1VQ6 V;  1VF7 A;  2JGU A;  2VRZ A;  3AG4 C;  1QLE C;  3OFN G;  4DV4 B;  4X1Y A;  2GUZ B;  2GV9 A;  2YXL A;  4O4L B;  4X8A A;  2GSM B;  1A32 A;  3JD2 A;  3JAT B;  1F4N A;  1W2B U;  5KMG B;  1Z5V A;  1GM8 A;  3S3W A;  5EYP B;  4KHP O;  3L75 H;  3CJH B;  1IXB A;  4JAU A;  3ZCC A;  1MSD A;  2Q9L A;  2QWP B;  5CMU A;  3ZHV A;  2ZKO A;  2OYQ A;  3LDC A;  2EZO A;  3S3X A;  5LMN B;  3JAS A;  2ILM A;  2YEV B;  3RYI B;  4O4J A;  3W7U A;  3UO3 A;  1K33 A;  2E5L O;  4RO2 A;  3ETG A;  1QHT A;  2CGN A;  4Q20 A;  4FM0 A;  5IYZ B;  4GT1 A;  2H8P C;  1UFI A;  5J2T B;  2DYR C;  4LNU A;  1YJ9 V;  4MVR A;  4FPP A;  2XTA A;  1IBM O;  3IJ4 A;  3U10 A;  4J9Y B;  2HG5 C;  2UU9 B;  3E89 A; 
#chains in the Genus database with same CATH homology
 4DR6 O;  2DOS A;  1I94 O;  2UUA O;  4DV2 O;  5BXZ A;  4B3M O;  4JI0 O;  2UXD O;  2UXC O;  1AB3 A;  4DV1 O;  5LMN O;  4DV6 O;  5IWA O;  5IT9 N;  4B3S O;  1J5E O;  2UUC O;  4X65 O;  1KUQ A;  5BR8 O;  2JRI A;  2AGA A;  2F4V O;  4DR2 O;  5FLX N;  4JI5 O;  2VQE O;  4DR7 O;  1XMQ O;  3J80 N;  1HNX O;  1N33 O;  1HNW O;  4X62 O;  1YZB A;  4OPA A;  4OX9 O;  1FYJ A;  4X64 O;  4NXM O;  1N36 O;  1FKA O;  3JAM N;  5H5N A;  3R66 A;  4A5U B;  4LF4 O;  5LL6 Y;  2Z0A A;  4DR1 O;  3M8A A;  2UU9 O;  1A32 A;  3F5T A;  4DV5 O;  4LF7 O;  4LFC O;  4B3T O;  1N32 O;  1F7Y A;  1HNZ O;  4KHP O;  4GKK O;  4DR3 O;  4JI6 O;  4NXN O;  4JYA O;  1XEQ A;  5LMU O;  4DV0 O;  2HHH O;  4YY3 O;  4LF8 O;  4DV7 O;  4JV5 O;  4DUZ O;  4JI8 O;  4LF6 O;  2ZKO A;  4YHH O;  5A2Q N;  1XNR O;  4LF5 O;  4K0K O;  4OPH A;  3O65 A;  1G1X B;  1R6T A;  1NS1 A;  2VQF O;  4DR4 O;  2DJV A;  4JI3 O;  1XMO O;  2LW7 A;  5BY1 A;  1N34 O;  1FJG O;  4DV4 O;  3T1H O;  3SDL A;  1R1B A;  3OTO O;  2E5L O;  4LF9 O;  4DR5 O;  1AIL A;  4DV3 O;  1IBK O;  3J7A U;  1D2D A;  4X66 O;  1XNQ O;  2ZM6 O;  4JI4 O;  4AQY O;  1HR0 O;  4JI7 O;  2FKX A;  4LFA O;  1IBL O;  3RT3 C;  2N74 A;  1X59 A;  3J81 N;  1IBM O;  4JI2 O;  4LFB O;  3T1Y O;  2UXB O;  4DUY O;  4GKJ O;  1DK1 A;  4JI1 O;  4B3R O;  2UUB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...