1HNXO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hnxO00
1XNRO 1IBMO 1AILA 4DV0O 2DJVA 2VQEO 5LMNO 1F7YA 2UU9O 4JYAO 4LF9O 2UUBO 1YZBA 1R1BA 4AQYO 1N32O 4DV6O 1XNQO 2UXBO 2F4VO 4OX9O 4LF4O 3F5TA 4DV4O 3M8AA 4B3MO 1J5EO 4JI5O 4GKKO 3T1HO 1XMQO 4DR3O 1IBKO 4X62O 4B3TO 5A2QN 4LF7O 4LFCO 4YHHO 2LW7A 1HNWO 4LFAO 1FKAO 5H5NA 1N34O 1I94O 2VQFO 3J81N 4X65O 4OPAA 5IT9N 4DV7O 4K0KO 1DK1A 2JRIA 3JAMN 4LF5O 2ZKOA 1FYJA 2HHHO 4KHPO 4JV5O 1XMOO 1D2DA 1NS1A 4JI0O 4JI1O 4DV5O 4DV3O 1A32A 3T1YO 1G1XB 1R6TA 2UUCO 4A5UB 2AGAA 3OTOO 4DV1O 4DR7O 4DV2O 4DUZO 4DR5O 4X64O 4DR2O 4DR4O 4JI2O 5IWAO 4GKJO 1KUQA 2DOSA 2UUAO 1N33O 5BXZA 1HNZO 2N74A 1HR0O 4JI6O 3SDLA 4JI8O 4OPHA 2FKXA 3J7AU 1XEQA 3O65A 4DUYO 4DR1O 4X66O 3R66A 3J80N 4LFBO 5BR8O 1IBLO 1X59A 4LF6O 4LF8O 5LL6Y 2E5LO 5BY1A 1HNXO 1AB3A 3RT3C 2ZM6O 4DR6O 4JI3O 5LMUO 4JI4O 4B3RO 4YY3O 2Z0AA 2UXCO 4JI7O 5FLXN 2UXDO 1N36O 1FJGO 4NXMO 4NXNO 4B3SO
chains in the Genus database with same CATH superfamily
1O9GA 1N32B 1YIJV 2YC0A 2DJVA 4I5SA 5KHJA 1H8EG 4LF4B 1XUQA 2XAQA 3GWOA 3T1YB 1VQ6V 4QPJA 3ZRXA 1WP7A 4OX9O 5KA6A 2WPDG 5B3SB 3C3TA 1COWG 4U3JB 4XDJA 1F51A 5J2TA 3PN1A 2GHYA 1IBKO 1N34B 1SS3A 4EFEA 3RVYA 3CRQA 3OMIB 5IYZA 5KAIZ 3LUTB 2HHHO 3AK3A 3RYIB 3A0BZ 2IJHA 2LGWA 2XHBA 2JK5C 2QKCA 4JZGA 2A9HA 3TJTA 1M1KW 3IAYA 1NH2B 4OXSA 1HW7A 1QVGU 3ABUA 4FPPA 4DK0A 4K3AA 1Y4MA 4MTXA 4PDLA 4X1IA 1B06A 4PJ0Z 1ROPA 2MK3A 1U97A 2Q8VA 3O65A 5LMNB 2ILMA 1Z5VA 2ZXWB 4JTCB 3ICXA 4DV6B 4FMTA 3R66A 3ASOB 3IFXA 3BAAA 4LC1A 3SPCA 4GUNA 4X89A 2WLMA 3OMAB 3D8CA 5IDJA 2VS0A 4UVAA 3FFQA 4YHHB 1H38A 4JI7O 3HKBB 3SPIA 1SC5B 1KKDA 4Q20A 2N05A 1JPXA 3P3PA 2QKSA 3BPZA 3OR7C 2LQTA 2WA4A 1XREA 1MZFA 4PI0A 1CPYA 4EB6B 2X7RB 5JQGB 3N2GA 1XNQO 4O4HA 2WLLB 1ZL8B 3E8HA 4GKKO 1U96A 3JD4A 1PNKA 1SETA 3ABLB 1ENVA 3RWRD 4DR3O 4JF3A 4CC6A 2PZSA 3ML0A 4B3TO 1QBZA 1MG1A 4X65B 3JAWB 4MT8A 1P4RA 1K8AW 4UCVA 3OE7G 3CE2A 2Y69C 3M7MX 4KHPO 2FYUH 3JALA 4MVRA 2UUCB 3ZS8C 5KX5A 1NJIW 4Z1MG 3CRAA 5L3FA 3X2QC 3ZHRA 2V7QG 3LNNA 5KA5A 1QR9A 3G6BA 2EIKB 1ZUQA 1R3LC 2YS8A 3NXSA 4KXRA 1V55C 1KUQA 4JI6B 1GK9A 2DYSB 1N33O 3U10A 1B3QA 4GX2A 5JWPA 1HNZO 5TISZ 1WJZA 4JI8O 1W0KG 1EZJA 3NR7A 1W2BU 4XBFA 1N4CA 1KMIZ 3ABTA 1YEWA 4LF6O 2QR4A 3SGIA 4FFKA 1RPOA 2YDEA 3EHBB 1TUBB 1AR4A 4ZBMA 2WLIB 5EZYA 3ZEDA 1R3IC 3HKEA 4JAVA 3A2FA 4X9QA 3P32A 4ABMA 3IJ4A 1KECA 3OUFA 4YIPA 3B4SA 1LNQA 1XNRO 1Q6HA 1OCZB 5CA0B 1SQBH 2F4VB 4K35A 3CMAV 5JJJB 1N32O 2HP8A 5LXTB 2H8PC 2QM4A 2JEUA 1Q8IA 1I0HA 4LF4O 5L3EA 5IY5C 2W6JG 3ZRSA 2AZ0A 2QE7G 4TSFG 3SYPA 1XL4A 2PF4E 3FX7A 1XQ8A 2XAJA 1B6QA 2OTJV 2P67A 1AJQA 2K1EA 5C93A 1L0LH 3UO3A 1N34O 2UUAB 3UM7A 5D5PA 1YITV 4JI1B 3VQVA 2JRIA 4R6ZA 3FAVA 4B7EA 1S72V 3AG1C 4X8AA 1MNGA 2XT9A 2IU0A 5IYCO 4DR7O 3ZHTA 1MABG 5E1AC 2YEVB 1YDXA 4ASUG 3K03A 1SKVA 3E86A 4X88A 3UO2A 1M57C 4DR4O 1PD3A 5EBMC 5E79Z 1BGYH 1H2MA 4Z1VA 1TAEA 5LYJA 4ZI7B 4J80A 4UFZA 1VQOV 5ITZB 1VQ7V 3CPWU 5LOVA 4X20A 1HNXB 1ZTEA 1K34A 4UB8Z 1G4YB 3BA9A 1YHQV 4L87A 1IURA 5BY1A 1BQ0A 4YJ2A 3SR2C 2DN9A 2OCCC 1JX9A 4NXMB 3VQWA 4FVMA 5IJ9A 1YCIA 3U11A 1OCRC 2PYLA 1ZLZA 3BEHA 1IZ3A 4O4JA 3G67A 2FB5A 1K5SA 4H44B 1IBMO 4FLZA 1EN4A 1VQMV 1JA8A 2A0LA 2P4KA 3RYHA 2IJKA 4XDKA 2R70A 2EIJC 1NVPD 1FAFA 4MW8A 2V4DA 4YXWG 2X6AA 2OYQA 1SQPH 3OGIB 2OIGA 4F4LA 5IWAB 3ZX6A 1T5EA 5IYZB 3CCVV 2WAMA 3HKDA 4X65O 2GTAA 2P6JA 3L75H 1GN3A 1D2DA 2LGQA 2XAHA 1VQLV 5CMUA 3RYCA 1Q43A 1WB8A 2QWPB 1GMGA 1MMMA 2A3QA 2UUCO 1RSOA 5BMVA 4O2AA 4DR2B 3OD4A 4IL6Z 3P30A 1BL8A 2JGDB 5B1BC 1PNLA 1YJNV 2LO1A 2OCHA 3CS5A 4I4TA 2XUMA 4YIOA 4D7TA 2WLHA 2XTAA 2NNUA 4WFAV 1YI2V 1BHBA 2WSSG 4JI6O 5IE9A 2Q7EA 3BABA 2EILC 1YVWA 2A06H 2QWQB 2ZR2A 2UUBB 3E8BA 3J80N 1CP9A 2UXBB 1PPJH 4HNAB 5JVDA 3B77A 3ZJZA 1SQGA 4JYYA 1L8DA 4IYIA 3K04A 3GVMA 3TXSA 1M90W 3JD0A 4X1YA 3GWKC 3DC5A 3DGEA 4H33A 4WBNA 4W4LA 3EXAA 5B1NA 1S3JA 3N2GB 4LF5B 4TT3G 4JV5B 4RUEA 3GB7C 3JSLA 2EJ7A 2RMKB 2F93B 4BR6A 2ZE7A 4JI5B 2NLJC 1Q82W 3VQXA 1FFTB 2KB1A 1JJOA 4J9YB 1VQKV 3ABMC 3FB5C 3MAQA 4TV9A 2F4VO 2F23A 1XMQB 3C3SA 4UV8A 1GN6A 1Q5OA 4DRXA 3SJAC 4IHJA 4H13B 2Y69B 2OT5A 5B1AC 1NR1A 5EBLC 5B66Z 5DN6G 5C8YA 3J81N 3CYOA 3JALB 2V1DA 1HR0B 3LSSA 3X2QB 2C2AA 5CBGA 5KMGA 4JAAA 3ZIAG 4Q6GA 3AK2A 2KQXA 3QO8A 4JI1O 4CS4A 4J42A 2CAZC 1DLBA 1SQXH 3TGUH 3FYIB 3JD2A 1V55B 3H9VA 3HPLC 5KHIA 2Q7GA 2ZINA 5CB4B 4GKJO 3ZHQA 3OAAG 1N8RW 4I9QA 4RWUA 3RGBA 2CE4A 5H6QA 4OPHA 2FKXA 3I55V 4LF9B 1X59A 4UCRA 4WCEV 3JAKA 3KCYA 1Q6UA 3RFRA 3AG7A 2Y0PA 3QO5A 3MDSA 4FM1A 1HNXO 1JVMA 1OCOC 4JI4O 5EC1C 1VIBA 2HJFC 1FJGB 1YJ9V 3AEIA 1SERA 4LNUB 3HKCB 4GLXA 4NXMO 4TV8A 3G6EV 3JCUZ 3QO7A 4I0XA 1SQQH 5IY5B 1AILA 2AHZA 2WLKA 3AG3C 4BIOA 4UCTA 3EVKA 1NH2D 2HFEC 3QTCA 3DXRA 4O2BB 4DV4O 2B9ZA 3L71H 2QDOA 4X1KA 3K06A 2CTRA 3F7YC 5GW7A 4I50A 4X64B 4E4EA 4MVQA 1H2NA 1F4NA 3AG1B 5JH7A 2Y4UA 3L74H 1FD9A 4OPAA 2HR3A 1US6A 1BE3H 5LHHA 4P2ZA 1GM8A 4GYCB 1IX9A 5JJEB 2L35A 3OW2U 4I7ZB 5GONA 4G28B 1WA8A 3CHXA 1OCCC 4MVZA 2EINC 2M7WA 2X6CA 4NYKA 4DR5O 4G2KA 5LYJB 4DR2O 4TQFA 5HFMA 2DE0X 2DOSA 4DUYB 4DR1B 3W7TA 4MVUA 3BCCH 1I5XA 3S3WA 3STLC 5LOVB 1V54C 4X20B 1SF9A 2CTWA 2QM7A 3CWBH 3E83A 1NU1H 1OHHG 5J2UB 1PM9A 3BVOA 2IH3C 2OCCB 2LP7A 4LFBO 3OM3B 2HKOA 2GDSA 2E5LO 2ARHA 3DSQA 3I5DA 3L70H 1IDSA 3ZN1A 4CBCA 1J5EB 4GZRB 2NN4A 2YXHA 2UXDB 5LA6B 1MZEA 5DECA 3ZN0A 2OTLV 1S5LZ 4QE7A 4MTFA 4FLWA 2FMLA 3FB8C 2EIJB 3RYHB 3CMEV 3UQ8A 3CRRA 3JARA 1NI8A 1R1BA 3E89A 4PA7A 1TA8A 5LGTA 1M93A 4HBNA 3H1LH 4JZ2A 4B3MO 4JI5O 4X62B 2ADQB 1VQ9V 1YTFB 1FFXA 3WFVA 1QVFU 3WB2A 1QR8A 2BCCH 1XMQO 3K9AA 5A2QN 4CH3A 1N0JA 1PL4A 2Y4TA 2Z5UA 1TVKA 4R50A 2QM8A 2P4VA 5H5NA 2ATKC 2Z3YA 5KHKA 4IGGA 4DV7O 3CCUV 1NKDA 4BW5A 3RYCB 2YUAA 1RSOB 3MD0A 1RM1C 3RYFA 3CXCU 1QU7A 1VQ8V 2OWOA 3ABKB 2PI4A 1M9NA 1NTMH 1Z2GA 4LF8B 4UCUA 4A5UB 1QNMA 3F7VC 2QKAA 5LMUB 4BWAA 4I4TB 3RBZA 2H94A 2YIDA 4QE9A 2EILB 3A0HZ 4FZ0A 4H0LB 5BXZA 1WNSA 1Y76B 2DWDC 3U0ZA 2PI5A 4J41A 5BR8B 2EIMB 3D3IA 4JYAB 2BE3A 5IJ0A 2ODMA 1XOUA 3ZHUA 3CC4V 4XDLA 4ZOLA 5LL6Y 4PA4A 3JD1A 1AP5A 1NTZH 3JASA 2YIBA 1M56B 5DEDA 3ZMTA 4TUYA 4FJCC 3ZRWA 4BIUA 1FXHA 2A79B 4WBNB 3VBBA 4UVBA 2Q67A 4J10A 4AILC 4JTAB 2VQFB 2VQEB 1FJGO 1BHAA 3ABMB 3TCUA 4AQYB 3CJHA 4TV9B 1W0JG 2EULA 3CSXA 4JI0B 2IBZH 5LGNA 1WB7A 5EIBC 1G6UA 2XAGA 1FXKA 5B1AB 3OTOB 4ZHQB 2AW9A 2IJIA 4F6RB 1FXKC 3LDDA 4DO2A 2UXXA 4R7CA 4LFCO 1S0VA 1IXMA 1QHTA 4UCSA 2HVJC 2IM9A 5KMGB 1XILA 3L72H 3BY6A 4X66B 2YI8A 3K58A 2ZD9A 3T1YO 1IBLB 3OMNB 1EZVH 4YJ3A 3UCSC 4N21A 4DUZB 3CXHF 1XBLA 4MVMA 3UT5A 2MW2B 4RQEA 2Q9LA 3K5NA 4L8JA 2BTOA 2ZIMA 4FFBB 4FM2A 2P90A 2ITCC 3SPHA 3FB6C 4DUYO 4DR1O 2W0XA 4DK1A 3ZCCA 1AI4A 1K97A 2BTQA 4GX0A 1SZTA 2RN9A 1OCOB 1PL0A 1FXVA 2XOKG 5KHGA 4O4LA 1AB3A 4TQDA 3RT3C 4PDVA 3OR6C 4NTWA 1HWYA 4J7ZA 2B1IA 1SA0B 1Z5WA 3TK1A 1VQNV 5KUKA 1VF7A 3AG3B 4I0XB 2UXDO 2X6BA 3W7SA 2E76B 4DV0B 1Q7YW 2UU9B 2D2CB 4LBEC 3ZMVA 3K3WA 1XL6A 4LH7A 4JYCA 1B04A 5LMNO 3DXRB 4DV6O 4X1KB 3SYQA 5L3BA 4IIJA 3T1HB 1GH6A 3M8AA 3VQYA 1KB9F 4JAUA 1BZKA 4UV9A 3ETQA 4B08A 5JH7B 2YXLA 4X62O 1V9PA 4YHHO 3K0GA 5D5QA 2Q73A 1JFFA 3R65A 1QLEC 4DV5B 1KKCA 3EFFK 4J11A 5GONB 5J2TB 2JGUA 2EINB 3VOUA 4DV1B 1CEZA 1FPOA 2P7TC 1NR7A 1R6TA 2ZR3A 1CXZB 2AGAA 1VEWA 3BHPA 3H01A 3LSQA 1QQCA 4P9PA 1YXBA 1XHZA 2JJ1G 4YY3B 4IT5A 2RCVA 3ASOC 2VWKA 4BAYA 2JS5A 2Q5ZA 3FB7C 2ZNJA 1XHXA 2YSUB 1IVSA 1KP3A 2WA3A 1W59A 3HKBA 5BR8O 2ADPA 3AG2C 3SPJA 2YI9A 4OX9B 4X1IB 4CH5A 3B8NA 5BZBA 1F4MA 1JCHA 3M99B 3OEEG 1Q6IA 3CRCA 4FIPC 2ETNA 1IBKB 5JQGA 3CCEV 2OIEA 3KKYA 3K5MA 2DWEC 4WFGA 5FLXN 1K73W 3JARB 3CD6V 2EBOA 3ETGA 3H1HH 3N2KA 2HHHB 1K92A 3H1IH 2VQEO 3ABLC 4QPKA 3JAWA 3ZHVA 4AQYO 2GBOA 4MTGA 4MW3A 3K5LA 1QLNA 3ZMSA 4FM0A 1FFXB 1FS0G 2K9PA 5H9CA 1I7FA 1YSCA 1TVKB 1K4CC 5H2FZ 5B1OA 4J7JA 2WLNA 2QWNB 1BCCH 3JSNA 4I9WA 1RM1B 1PNMA 4O4HB 1XMOB 3RYFB 2EIKC 1DK1A 4PD4F 1WN7A 1Q3EA 3E35A 1AR5A 2PY5A 2QA4V 3A8TA 2ZT9B 1GN2A 4DW0A 1AJNA 1S77D 2DYSC 5F2VO 4FLXA 3FYEB 3T2MA 1AVMA 1P49A 4W4KA 4PELA 4DUZO 3THOA 3JATA 4P30A 4CC5A 4JI7B 5KX5B 4O4IA 2UUAO 4QGPA 2WLJA 4F6EA 1TUBA 1Y66A 5IJ0B 3W7XA 4ZOLB 4WFFA 4AHCA 2RNBA 3JASB 4NKGB 3T4DA 1VF5B 3CCSV 2EZPA 2PGGA 3ZRWB 1N0NA 4GKKB 5CA0A 2QSAA 4B3TB 5LXTA 4QJFB 5K1XA 1UPGA 1O9HA 5EC2C 1DTOA 1ZAUA 2CUGA 1LUVA 1HP8A 2YXYA 4LP8A 4DV0O 4KHPB 2F43G 2UU9O 2LFRA 5EZYB 1Y74A 1WPBA 3APQA 1VARA 3HKEB 4PDMA 5FL7G 3ZMUA 5FNVA 4DXWA 1MA1A 4LF7B 2HVKC 3T1HO 3BA8A 1P7BA 3L9DA 1VQ4V 5L3DA 3DTUB 2JIZG 1EM1A 2P5OA 4BIZA 4N23A 2AHYA 4FLUA 3K59A 2P22C 1KYOF 3CEIA 3ZHSA 1Q90D 2F66C 2YEVA 4D7SA 4JI8B 3H1KH 2HEPA 2IU3A 3FD9A 4YJ3B 3CC7V 4DV5O 3WG7C 4K8ZA 1A32A 3QG5A 3SJQC 4DV2B 1VQ5V 1KQSU 2L6LA 4MTOA 3UT5B 1JR9A 4ZI7A 4DV1O 1SRYA 1K7DA 4JI2B 2X0LA 2IH1C 3FAVB 1UJWB 2EX3A 5IWAO 2GUZA 1RFYA 3OGCC 2DYRC 3SYAA 1SQVH 1KC8W 5CBFA 3OT7A 1GM7A 3SDLA 3MHHC 4PDRA 5CA1A 3QF7A 1XEQA 5KLVH 5B5EZ 1M57B 3WU2Z 3CX5F 4DR6B 1YTFD 1R3KC 3RN4A 4U7NA 2ZE8A 2ZQMA 3CCRV 4B3RB 4GT1A 1BT8A 4EFBA 5A9GA 4HYOA 4DW1A 1ORQC 4UVCA 3TXQA 1BMFG 1AP6A 2QJ1A 3ZMZA 3ZBHA 3E2EA 3WB0A 5J9PC 1UFIA 2RDCA 3HR0A 4IIJB 1H2SB 1GKFA 1F7YA 4YJ2B 4KFMA 2UUBO 1YZBA 1NBMG 3DC6A 4ZKIA 2UXBO 1OCRB 5IJ9B 3LNMB 4CS2A 4DR7B 3I56V 2KKWA 2ZDIA 2CGNA 4O4JB 1QLEB 2CH7A 2Y0IA 2ZDIC 3AK1A 4LFAB 3JCZA 3SJCC 3ZRVA 1HNWB 1I94B 1JFFB 2W0FC 4DR4B 1AI6A 1K5QA 2JJ2G 4K0KB 2LW7A 2KG7A 2BSKA 4WFEA 5JCOA 1FKAO 1VP7A 1WLEA 5JCOC 2JGDA 2QTOA 4LF5O 4EEQA 4JV5O 4UB6Z 1XMOO 2ITDC 2BOBC 1BQZA 5KUMA 1SZXA 3SYOA 3D36A 3HKDB 3D36C 4I55A 2YIAA 2Q7HA 3KG2A 2RJZA 4QIWF 3S3XA 1AI5A 5GTHZ 3SJBC 2KSDA 4DYLA 4FZ1A 4HNAA 3P3NA 1KP2A 5HFLA 1KD1W 3AG2B 1JJ2U 2R9AA 1HR0O 5BMVB 1GTOA 3OEHG 4O2AB 5B1BB 1IBMB 2RQ6A 2P06A 2VRZA 1K33A 3FKSG 3CRMA 2QWOB 4H37A 1VQPV 4JI3B 4FLVA 3T4ZA 1GAXA 2DQ3A 1N36B 5KAFZ 1AROP 2GSMB 4NTYA 1EN5A 2ZE6A 4AI8A 3N2KB 3ASNC 1ZSPA 4KP4A 5JVDB 2JDIG 1Y67A 1PV0A 1NZ6A 1H2KA 3K5OA 4LF9O 3IC9A 4QNHB 4JASA 4K8XA 2AXTZ 4X1YB 2JS3A 3C90A 4GCZA 1R6NA 4NR1A 3W7WA 4NTXA 2PTMA 4LF7O 4ICGA 3BRCA 1S76D 4RO2A 2QTSA 1Q81W 2CTPA 1TUEB 4WFHA 1EN6A 5CB4A 1XI1A 3RW0A 4DV3B 2ZKOA 1FYJA 4DRXB 4IHJB 1NS1A 4PHZA 1H2GA 4FK5C 4ZIBA 1PKXA 1X4TA 4U3FH 5CA3A 1GRJA 1DF4A 5C8YB 3QNEA 4DV2O 1WP8A 3JATB 3K0DA 5L3CA 4O4IB 3K08A 4X64O 2Q68A 1E1RG 4JI2O 2YICA 2Q0AA 1QCEA 4LWSA 3B09A 1LUWA 2GV9A 3STZC 3APOA 2B1GA 1YF2A 4RUFA 3AG4C 3CCLV 5EYPA 1M5IA 2DQ0A 2ZE5A 5LGUA 4LNUA 1DGSA 2LJ2A 3HKCA 1EFRG 1E1QG 1MSDA 4G27B 4DR6O 2HLDG 1I08A 3ETEA 1Q86W 5LP6A 3A0RA 3N27A 4B3RO 5LP6C 2Q4PA 5IYBO 4NXNB 4O2BA 4B3SB 2VWJA 4NB5A 5KHHA 3JAKB 1Y74B 2XNDG 3RVZA 5CBHA 3CCQV 1J95A 3OFNG 3G4SV 5FNVB 3Q4HA 3E22A 1Y6XA 1L0NH 1THZA 1H2LA 2Q0OC 4JTDB 3F5TA 1R73A 1J5EO 1RPRA 1M4UA 4NVPA 1KU9A 4TV8B 1OZ0A 1D5NA 3MHSC 4J9ZB 1NQTA 3QVNA 4U3JA 5K1PA 4GKJB 3O9OA 1HNWO 4LFAO 5B3SC 3WG7B 2CGOA 1I94O 2CTQA 4KUMA 5IT9N 4K0KO 1AI7A 3ETDA 1MOFA 1AR1B 3JAMN 4B7KA 2H3OA 2CK3G 1LR1A 4PV1B 1K9MW 4I50B 3RYIA 4FLYA 3SPGA 2GUZB 2DYRB 4Z2WA 4PA9A 4JI4B 5J2UA 5FPOA 5CA1B 1MSWD 1R3JC 3HB3B 3JD3A 2N74A 1OCCB 1EBOA 1XDCA 4UCOA 1G8MA 2GTSA 1WA8B 5LA6A 3LDEA 2JVDA 2FL4A 1R6KA 2ZM6B 4LF8O 4EKWA 4DV4B 1V54B 2ZXWC 4JI3O 5LMUO 2UXCB 4CS3A 3W7UA 5FPRA 2Z0AA 2F1MA 1L1FA 2ZCEA 1N36O 3CCMV 4PI2A 2W6IG 2A7WA 2B5UA 3UKMA 2AZ2A 2QEXV 4JYAO 3KZIZ 1BS3A 1URFA 3JYCA 1JMKC 4UUJC 1KBHA 1D5AA 2CH7B 4GX5A 2DW4A 2IW5A 2R9RB 4GX1A 4EB6A 1K3EA 5GTIZ 5LBQA 1S5HC 2KG7B 2IJJA 2BSKB 2WWWA 5EK0A 2WLLA 1ZL8A 4DR5B 2ZIOA 3OTFA 2E3CA 3L73H 4TWKA 3ABKC 2VQFO 4WF9V 1ZX3A 2QGNA 3IC7A 3G80A 3LDCA 4FLTA 2YIBD 4BW9A 5H6RA 4JI0O 4DV3O 4LFBB 4I55B 3WB1A 1F23A 4IYHA 3K79A 2E5LB 1IXBA 1Y76A 5L3GA 2D3OW 2LFSA 3B8MA 5JJNB 3OTOO 4HAMA 2PYJA 1NVPB 1GN4A 4E2LA 2EIMC 4CH6A 1NT2B 1S5JA 1P7GA 1K4DC 3CP1A 3E8GA 5EIBD 3H1JH 1PP9H 3TETA 4LR3A 1M56C 3J7AU 4X66O 4MSWC 1IBLO 1VMGA 4WFBV 4R8CA 4KL1A 4P9OA 2QWRB 4B3MB 3ASNB 5LHIA 4LH6A 3D3QA 2ZNIA 2G38A 3OUSA 4D6TH 2FTKA 4U7OA 5DM6V 1GO3F 2WLIA 2CDYA 4ZHQA 4J7KA 3F5WC 4LCUC 1DF5A 2E74B 4F6RA 4NXNO 1SQFA 2F95B 2N04A 4DV7B 4B3SO 2EJRA 1XNQB 4TUYB 5LHGA 5CN0A 3K9SA 4PA3A 1TGOA 4JPRA 2NR5A 4DR3B 1OCZC 2HG5C 4UXNA 1HDJA 1BSMA 3KCXA 5IYDO 2E75B 3CJHB 4JYBA 1JOYA 2XASA 4MVOA 1SESA 4RAIA 2DMXA 2EZOA 4PA6A 3T1CA 4CZZA 2R9IA 4TOIA 1FXKB 2XAFA 5EBWC 4MS2A 2LW1A 1OJHA 1I5YA 3E8FA 1WPXA 3IGAC 4FFBA 1OV9A 3B2EE 1G1XB 2M6YA 3E22B 4HZ3A 2Y48A 3LSUA 3PJSK 4LWSB 1N33B 5AG2A 1HNZB 2PUSA 3AG4B 3K57A 2R72A 4OGQB 1JQ0A 3B40A 4MVSA 4C7UA 1E79G 5EYPB 3G71V 1SA0A 1GM9A 4LF6B 1AJPA 4CH4A 1WAZA 5ITZA 2BOCC 1P84F 2JEXA 5LP6B 1YJWV 3CB2A 2Q69A 1RP3B 2HJDA 2ZM6O 1VF6A 1NTKH 2UXNA 3BFRA 3SYCA 3CCJV 1VF6C 4RQFA 4YY3O 4LFCB 1H8HG 2BTQB 2UXCO 1XNRB 2O57A 1ZWIC 3Q4HB 3CC2V 4O4LB 4JGSA 2Q6AA
chains in the Genus database with same CATH topology
1XNRO 1IBMO 1AILA 4DV0O 2DJVA 2VQEO 5LMNO 1F7YA 2UU9O 4JYAO 4LF9O 2UUBO 1YZBA 1R1BA 4AQYO 1N32O 4DV6O 1XNQO 2UXBO 2F4VO 4OX9O 4LF4O 3F5TA 4DV4O 3M8AA 4B3MO 1J5EO 4JI5O 4GKKO 3T1HO 1XMQO 4DR3O 1IBKO 4X62O 4B3TO 5A2QN 4LF7O 4LFCO 4YHHO 2LW7A 1HNWO 4LFAO 1FKAO 5H5NA 1N34O 1I94O 2VQFO 3J81N 4X65O 4OPAA 5IT9N 4DV7O 4K0KO 1DK1A 2JRIA 3JAMN 4LF5O 2ZKOA 1FYJA 2HHHO 4KHPO 4JV5O 1XMOO 1D2DA 1NS1A 4JI0O 4JI1O 4DV5O 4DV3O 1A32A 3T1YO 1G1XB 1R6TA 2UUCO 4A5UB 2AGAA 3OTOO 4DV1O 4DR7O 4DV2O 4DUZO 4DR5O 4X64O 4DR2O 4DR4O 4JI2O 5IWAO 4GKJO 1KUQA 2DOSA 2UUAO 1N33O 5BXZA 1HNZO 2N74A 1HR0O 4JI6O 3SDLA 4JI8O 4OPHA 2FKXA 3J7AU 1XEQA 3O65A 4DUYO 4DR1O 4X66O 3R66A 3J80N 4LFBO 5BR8O 1IBLO 1X59A 4LF6O 4LF8O 5LL6Y 2E5LO 5BY1A 1HNXO 1AB3A 3RT3C 2ZM6O 4DR6O 4JI3O 5LMUO 4JI4O 4B3RO 4YY3O 2Z0AA 2UXCO 4JI7O 5FLXN 2UXDO 1N36O 1FJGO 4NXMO 4NXNO 4B3SO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR O;  1IBM O;  1AIL A;  4DV0 O;  2DJV A;  2VQE O;  5LMN O;  1F7Y A;  2UU9 O;  4JYA O;  4LF9 O;  2UUB O;  1YZB A;  1R1B A;  4AQY O;  1N32 O;  4DV6 O;  1XNQ O;  2UXB O;  2F4V O;  4OX9 O;  4LF4 O;  3F5T A;  4DV4 O;  3M8A A;  4B3M O;  1J5E O;  4JI5 O;  4GKK O;  3T1H O;  1XMQ O;  4DR3 O;  1IBK O;  4X62 O;  4B3T O;  5A2Q N;  4LF7 O;  4LFC O;  4YHH O;  2LW7 A;  1HNW O;  4LFA O;  1FKA O;  5H5N A;  1N34 O;  1I94 O;  2VQF O;  3J81 N;  4X65 O;  4OPA A;  5IT9 N;  4DV7 O;  4K0K O;  1DK1 A;  2JRI A;  3JAM N;  4LF5 O;  2ZKO A;  1FYJ A;  2HHH O;  4KHP O;  4JV5 O;  1XMO O;  1D2D A;  1NS1 A;  4JI0 O;  4JI1 O;  4DV5 O;  4DV3 O;  1A32 A;  3T1Y O;  1G1X B;  1R6T A;  2UUC O;  4A5U B;  2AGA A;  3OTO O;  4DV1 O;  4DR7 O;  4DV2 O;  4DUZ O;  4DR5 O;  4X64 O;  4DR2 O;  4DR4 O;  4JI2 O;  5IWA O;  4GKJ O;  1KUQ A;  2DOS A;  2UUA O;  1N33 O;  5BXZ A;  1HNZ O;  2N74 A;  1HR0 O;  4JI6 O;  3SDL A;  4JI8 O;  4OPH A;  2FKX A;  3J7A U;  1XEQ A;  3O65 A;  4DUY O;  4DR1 O;  4X66 O;  3R66 A;  3J80 N;  4LFB O;  5BR8 O;  1IBL O;  1X59 A;  4LF6 O;  4LF8 O;  5LL6 Y;  2E5L O;  5BY1 A;  1HNX O;  1AB3 A;  3RT3 C;  2ZM6 O;  4DR6 O;  4JI3 O;  5LMU O;  4JI4 O;  4B3R O;  4YY3 O;  2Z0A A;  2UXC O;  4JI7 O;  5FLX N;  2UXD O;  1N36 O;  1FJG O;  4NXM O;  4NXN O;  4B3S O; 
#chains in the Genus database with same CATH topology
 1O9G A;  1N32 B;  1YIJ V;  2YC0 A;  2DJV A;  4I5S A;  5KHJ A;  1H8E G;  4LF4 B;  1XUQ A;  2XAQ A;  3GWO A;  3T1Y B;  1VQ6 V;  4QPJ A;  3ZRX A;  1WP7 A;  4OX9 O;  5KA6 A;  2WPD G;  5B3S B;  3C3T A;  1COW G;  4U3J B;  4XDJ A;  1F51 A;  5J2T A;  3PN1 A;  2GHY A;  1IBK O;  1N34 B;  1SS3 A;  4EFE A;  3RVY A;  3CRQ A;  3OMI B;  5IYZ A;  5KAI Z;  3LUT B;  2HHH O;  3AK3 A;  3RYI B;  3A0B Z;  2IJH A;  2LGW A;  2XHB A;  2JK5 C;  2QKC A;  4JZG A;  2A9H A;  3TJT A;  1M1K W;  3IAY A;  1NH2 B;  4OXS A;  1HW7 A;  1QVG U;  3ABU A;  4FPP A;  4DK0 A;  4K3A A;  1Y4M A;  4MTX A;  4PDL A;  4X1I A;  1B06 A;  4PJ0 Z;  1ROP A;  2MK3 A;  1U97 A;  2Q8V A;  3O65 A;  5LMN B;  2ILM A;  1Z5V A;  2ZXW B;  4JTC B;  3ICX A;  4DV6 B;  4FMT A;  3R66 A;  3ASO B;  3IFX A;  3BAA A;  4LC1 A;  3SPC A;  4GUN A;  4X89 A;  2WLM A;  3OMA B;  3D8C A;  5IDJ A;  2VS0 A;  4UVA A;  3FFQ A;  4YHH B;  1H38 A;  4JI7 O;  3HKB B;  3SPI A;  1SC5 B;  1KKD A;  4Q20 A;  2N05 A;  1JPX A;  3P3P A;  2QKS A;  3BPZ A;  3OR7 C;  2LQT A;  2WA4 A;  1XRE A;  1MZF A;  4PI0 A;  1CPY A;  4EB6 B;  2X7R B;  5JQG B;  3N2G A;  1XNQ O;  4O4H A;  2WLL B;  1ZL8 B;  3E8H A;  4GKK O;  1U96 A;  3JD4 A;  1PNK A;  1SET A;  3ABL B;  1ENV A;  3RWR D;  4DR3 O;  4JF3 A;  4CC6 A;  2PZS A;  3ML0 A;  4B3T O;  1QBZ A;  1MG1 A;  4X65 B;  3JAW B;  4MT8 A;  1P4R A;  1K8A W;  4UCV A;  3OE7 G;  3CE2 A;  2Y69 C;  3M7M X;  4KHP O;  2FYU H;  3JAL A;  4MVR A;  2UUC B;  3ZS8 C;  5KX5 A;  1NJI W;  4Z1M G;  3CRA A;  5L3F A;  3X2Q C;  3ZHR A;  2V7Q G;  3LNN A;  5KA5 A;  1QR9 A;  3G6B A;  2EIK B;  1ZUQ A;  1R3L C;  2YS8 A;  3NXS A;  4KXR A;  1V55 C;  1KUQ A;  4JI6 B;  1GK9 A;  2DYS B;  1N33 O;  3U10 A;  1B3Q A;  4GX2 A;  5JWP A;  1HNZ O;  5TIS Z;  1WJZ A;  4JI8 O;  1W0K G;  1EZJ A;  3NR7 A;  1W2B U;  4XBF A;  1N4C A;  1KMI Z;  3ABT A;  1YEW A;  4LF6 O;  2QR4 A;  3SGI A;  4FFK A;  1RPO A;  2YDE A;  3EHB B;  1TUB B;  1AR4 A;  4ZBM A;  2WLI B;  5EZY A;  3ZED A;  1R3I C;  3HKE A;  4JAV A;  3A2F A;  4X9Q A;  3P32 A;  4ABM A;  3IJ4 A;  1KEC A;  3OUF A;  4YIP A;  3B4S A;  1LNQ A;  1XNR O;  1Q6H A;  1OCZ B;  5CA0 B;  1SQB H;  2F4V B;  4K35 A;  3CMA V;  5JJJ B;  1N32 O;  2HP8 A;  5LXT B;  2H8P C;  2QM4 A;  2JEU A;  1Q8I A;  1I0H A;  4LF4 O;  5L3E A;  5IY5 C;  2W6J G;  3ZRS A;  2AZ0 A;  2QE7 G;  4TSF G;  3SYP A;  1XL4 A;  2PF4 E;  3FX7 A;  1XQ8 A;  2XAJ A;  1B6Q A;  2OTJ V;  2P67 A;  1AJQ A;  2K1E A;  5C93 A;  1L0L H;  3UO3 A;  1N34 O;  2UUA B;  3UM7 A;  5D5P A;  1YIT V;  4JI1 B;  3VQV A;  2JRI A;  4R6Z A;  3FAV A;  4B7E A;  1S72 V;  3AG1 C;  4X8A A;  1MNG A;  2XT9 A;  2IU0 A;  5IYC O;  4DR7 O;  3ZHT A;  1MAB G;  5E1A C;  2YEV B;  1YDX A;  4ASU G;  3K03 A;  1SKV A;  3E86 A;  4X88 A;  3UO2 A;  1M57 C;  4DR4 O;  1PD3 A;  5EBM C;  5E79 Z;  1BGY H;  1H2M A;  4Z1V A;  1TAE A;  5LYJ A;  4ZI7 B;  4J80 A;  4UFZ A;  1VQO V;  5ITZ B;  1VQ7 V;  3CPW U;  5LOV A;  4X20 A;  1HNX B;  1ZTE A;  1K34 A;  4UB8 Z;  1G4Y B;  3BA9 A;  1YHQ V;  4L87 A;  1IUR A;  5BY1 A;  1BQ0 A;  4YJ2 A;  3SR2 C;  2DN9 A;  2OCC C;  1JX9 A;  4NXM B;  3VQW A;  4FVM A;  5IJ9 A;  1YCI A;  3U11 A;  1OCR C;  2PYL A;  1ZLZ A;  3BEH A;  1IZ3 A;  4O4J A;  3G67 A;  2FB5 A;  1K5S A;  4H44 B;  1IBM O;  4FLZ A;  1EN4 A;  1VQM V;  1JA8 A;  2A0L A;  2P4K A;  3RYH A;  2IJK A;  4XDK A;  2R70 A;  2EIJ C;  1NVP D;  1FAF A;  4MW8 A;  2V4D A;  4YXW G;  2X6A A;  2OYQ A;  1SQP H;  3OGI B;  2OIG A;  4F4L A;  5IWA B;  3ZX6 A;  1T5E A;  5IYZ B;  3CCV V;  2WAM A;  3HKD A;  4X65 O;  2GTA A;  2P6J A;  3L75 H;  1GN3 A;  1D2D A;  2LGQ A;  2XAH A;  1VQL V;  5CMU A;  3RYC A;  1Q43 A;  1WB8 A;  2QWP B;  1GMG A;  1MMM A;  2A3Q A;  2UUC O;  1RSO A;  5BMV A;  4O2A A;  4DR2 B;  3OD4 A;  4IL6 Z;  3P30 A;  1BL8 A;  2JGD B;  5B1B C;  1PNL A;  1YJN V;  2LO1 A;  2OCH A;  3CS5 A;  4I4T A;  2XUM A;  4YIO A;  4D7T A;  2WLH A;  2XTA A;  2NNU A;  4WFA V;  1YI2 V;  1BHB A;  2WSS G;  4JI6 O;  5IE9 A;  2Q7E A;  3BAB A;  2EIL C;  1YVW A;  2A06 H;  2QWQ B;  2ZR2 A;  2UUB B;  3E8B A;  3J80 N;  1CP9 A;  2UXB B;  1PPJ H;  4HNA B;  5JVD A;  3B77 A;  3ZJZ A;  1SQG A;  4JYY A;  1L8D A;  4IYI A;  3K04 A;  3GVM A;  3TXS A;  1M90 W;  3JD0 A;  4X1Y A;  3GWK C;  3DC5 A;  3DGE A;  4H33 A;  4WBN A;  4W4L A;  3EXA A;  5B1N A;  1S3J A;  3N2G B;  4LF5 B;  4TT3 G;  4JV5 B;  4RUE A;  3GB7 C;  3JSL A;  2EJ7 A;  2RMK B;  2F93 B;  4BR6 A;  2ZE7 A;  4JI5 B;  2NLJ C;  1Q82 W;  3VQX A;  1FFT B;  2KB1 A;  1JJO A;  4J9Y B;  1VQK V;  3ABM C;  3FB5 C;  3MAQ A;  4TV9 A;  2F4V O;  2F23 A;  1XMQ B;  3C3S A;  4UV8 A;  1GN6 A;  1Q5O A;  4DRX A;  3SJA C;  4IHJ A;  4H13 B;  2Y69 B;  2OT5 A;  5B1A C;  1NR1 A;  5EBL C;  5B66 Z;  5DN6 G;  5C8Y A;  3J81 N;  3CYO A;  3JAL B;  2V1D A;  1HR0 B;  3LSS A;  3X2Q B;  2C2A A;  5CBG A;  5KMG A;  4JAA A;  3ZIA G;  4Q6G A;  3AK2 A;  2KQX A;  3QO8 A;  4JI1 O;  4CS4 A;  4J42 A;  2CAZ C;  1DLB A;  1SQX H;  3TGU H;  3FYI B;  3JD2 A;  1V55 B;  3H9V A;  3HPL C;  5KHI A;  2Q7G A;  2ZIN A;  5CB4 B;  4GKJ O;  3ZHQ A;  3OAA G;  1N8R W;  4I9Q A;  4RWU A;  3RGB A;  2CE4 A;  5H6Q A;  4OPH A;  2FKX A;  3I55 V;  4LF9 B;  1X59 A;  4UCR A;  4WCE V;  3JAK A;  3KCY A;  1Q6U A;  3RFR A;  3AG7 A;  2Y0P A;  3QO5 A;  3MDS A;  4FM1 A;  1HNX O;  1JVM A;  1OCO C;  4JI4 O;  5EC1 C;  1VIB A;  2HJF C;  1FJG B;  1YJ9 V;  3AEI A;  1SER A;  4LNU B;  3HKC B;  4GLX A;  4NXM O;  4TV8 A;  3G6E V;  3JCU Z;  3QO7 A;  4I0X A;  1SQQ H;  5IY5 B;  1AIL A;  2AHZ A;  2WLK A;  3AG3 C;  4BIO A;  4UCT A;  3EVK A;  1NH2 D;  2HFE C;  3QTC A;  3DXR A;  4O2B B;  4DV4 O;  2B9Z A;  3L71 H;  2QDO A;  4X1K A;  3K06 A;  2CTR A;  3F7Y C;  5GW7 A;  4I50 A;  4X64 B;  4E4E A;  4MVQ A;  1H2N A;  1F4N A;  3AG1 B;  5JH7 A;  2Y4U A;  3L74 H;  1FD9 A;  4OPA A;  2HR3 A;  1US6 A;  1BE3 H;  5LHH A;  4P2Z A;  1GM8 A;  4GYC B;  1IX9 A;  5JJE B;  2L35 A;  3OW2 U;  4I7Z B;  5GON A;  4G28 B;  1WA8 A;  3CHX A;  1OCC C;  4MVZ A;  2EIN C;  2M7W A;  2X6C A;  4NYK A;  4DR5 O;  4G2K A;  5LYJ B;  4DR2 O;  4TQF A;  5HFM A;  2DE0 X;  2DOS A;  4DUY B;  4DR1 B;  3W7T A;  4MVU A;  3BCC H;  1I5X A;  3S3W A;  3STL C;  5LOV B;  1V54 C;  4X20 B;  1SF9 A;  2CTW A;  2QM7 A;  3CWB H;  3E83 A;  1NU1 H;  1OHH G;  5J2U B;  1PM9 A;  3BVO A;  2IH3 C;  2OCC B;  2LP7 A;  4LFB O;  3OM3 B;  2HKO A;  2GDS A;  2E5L O;  2ARH A;  3DSQ A;  3I5D A;  3L70 H;  1IDS A;  3ZN1 A;  4CBC A;  1J5E B;  4GZR B;  2NN4 A;  2YXH A;  2UXD B;  5LA6 B;  1MZE A;  5DEC A;  3ZN0 A;  2OTL V;  1S5L Z;  4QE7 A;  4MTF A;  4FLW A;  2FML A;  3FB8 C;  2EIJ B;  3RYH B;  3CME V;  3UQ8 A;  3CRR A;  3JAR A;  1NI8 A;  1R1B A;  3E89 A;  4PA7 A;  1TA8 A;  5LGT A;  1M93 A;  4HBN A;  3H1L H;  4JZ2 A;  4B3M O;  4JI5 O;  4X62 B;  2ADQ B;  1VQ9 V;  1YTF B;  1FFX A;  3WFV A;  1QVF U;  3WB2 A;  1QR8 A;  2BCC H;  1XMQ O;  3K9A A;  5A2Q N;  4CH3 A;  1N0J A;  1PL4 A;  2Y4T A;  2Z5U A;  1TVK A;  4R50 A;  2QM8 A;  2P4V A;  5H5N A;  2ATK C;  2Z3Y A;  5KHK A;  4IGG A;  4DV7 O;  3CCU V;  1NKD A;  4BW5 A;  3RYC B;  2YUA A;  1RSO B;  3MD0 A;  1RM1 C;  3RYF A;  3CXC U;  1QU7 A;  1VQ8 V;  2OWO A;  3ABK B;  2PI4 A;  1M9N A;  1NTM H;  1Z2G A;  4LF8 B;  4UCU A;  4A5U B;  1QNM A;  3F7V C;  2QKA A;  5LMU B;  4BWA A;  4I4T B;  3RBZ A;  2H94 A;  2YID A;  4QE9 A;  2EIL B;  3A0H Z;  4FZ0 A;  4H0L B;  5BXZ A;  1WNS A;  1Y76 B;  2DWD C;  3U0Z A;  2PI5 A;  4J41 A;  5BR8 B;  2EIM B;  3D3I A;  4JYA B;  2BE3 A;  5IJ0 A;  2ODM A;  1XOU A;  3ZHU A;  3CC4 V;  4XDL A;  4ZOL A;  5LL6 Y;  4PA4 A;  3JD1 A;  1AP5 A;  1NTZ H;  3JAS A;  2YIB A;  1M56 B;  5DED A;  3ZMT A;  4TUY A;  4FJC C;  3ZRW A;  4BIU A;  1FXH A;  2A79 B;  4WBN B;  3VBB A;  4UVB A;  2Q67 A;  4J10 A;  4AIL C;  4JTA B;  2VQF B;  2VQE B;  1FJG O;  1BHA A;  3ABM B;  3TCU A;  4AQY B;  3CJH A;  4TV9 B;  1W0J G;  2EUL A;  3CSX A;  4JI0 B;  2IBZ H;  5LGN A;  1WB7 A;  5EIB C;  1G6U A;  2XAG A;  1FXK A;  5B1A B;  3OTO B;  4ZHQ B;  2AW9 A;  2IJI A;  4F6R B;  1FXK C;  3LDD A;  4DO2 A;  2UXX A;  4R7C A;  4LFC O;  1S0V A;  1IXM A;  1QHT A;  4UCS A;  2HVJ C;  2IM9 A;  5KMG B;  1XIL A;  3L72 H;  3BY6 A;  4X66 B;  2YI8 A;  3K58 A;  2ZD9 A;  3T1Y O;  1IBL B;  3OMN B;  1EZV H;  4YJ3 A;  3UCS C;  4N21 A;  4DUZ B;  3CXH F;  1XBL A;  4MVM A;  3UT5 A;  2MW2 B;  4RQE A;  2Q9L A;  3K5N A;  4L8J A;  2BTO A;  2ZIM A;  4FFB B;  4FM2 A;  2P90 A;  2ITC C;  3SPH A;  3FB6 C;  4DUY O;  4DR1 O;  2W0X A;  4DK1 A;  3ZCC A;  1AI4 A;  1K97 A;  2BTQ A;  4GX0 A;  1SZT A;  2RN9 A;  1OCO B;  1PL0 A;  1FXV A;  2XOK G;  5KHG A;  4O4L A;  1AB3 A;  4TQD A;  3RT3 C;  4PDV A;  3OR6 C;  4NTW A;  1HWY A;  4J7Z A;  2B1I A;  1SA0 B;  1Z5W A;  3TK1 A;  1VQN V;  5KUK A;  1VF7 A;  3AG3 B;  4I0X B;  2UXD O;  2X6B A;  3W7S A;  2E76 B;  4DV0 B;  1Q7Y W;  2UU9 B;  2D2C B;  4LBE C;  3ZMV A;  3K3W A;  1XL6 A;  4LH7 A;  4JYC A;  1B04 A;  5LMN O;  3DXR B;  4DV6 O;  4X1K B;  3SYQ A;  5L3B A;  4IIJ A;  3T1H B;  1GH6 A;  3M8A A;  3VQY A;  1KB9 F;  4JAU A;  1BZK A;  4UV9 A;  3ETQ A;  4B08 A;  5JH7 B;  2YXL A;  4X62 O;  1V9P A;  4YHH O;  3K0G A;  5D5Q A;  2Q73 A;  1JFF A;  3R65 A;  1QLE C;  4DV5 B;  1KKC A;  3EFF K;  4J11 A;  5GON B;  5J2T B;  2JGU A;  2EIN B;  3VOU A;  4DV1 B;  1CEZ A;  1FPO A;  2P7T C;  1NR7 A;  1R6T A;  2ZR3 A;  1CXZ B;  2AGA A;  1VEW A;  3BHP A;  3H01 A;  3LSQ A;  1QQC A;  4P9P A;  1YXB A;  1XHZ A;  2JJ1 G;  4YY3 B;  4IT5 A;  2RCV A;  3ASO C;  2VWK A;  4BAY A;  2JS5 A;  2Q5Z A;  3FB7 C;  2ZNJ A;  1XHX A;  2YSU B;  1IVS A;  1KP3 A;  2WA3 A;  1W59 A;  3HKB A;  5BR8 O;  2ADP A;  3AG2 C;  3SPJ A;  2YI9 A;  4OX9 B;  4X1I B;  4CH5 A;  3B8N A;  5BZB A;  1F4M A;  1JCH A;  3M99 B;  3OEE G;  1Q6I A;  3CRC A;  4FIP C;  2ETN A;  1IBK B;  5JQG A;  3CCE V;  2OIE A;  3KKY A;  3K5M A;  2DWE C;  4WFG A;  5FLX N;  1K73 W;  3JAR B;  3CD6 V;  2EBO A;  3ETG A;  3H1H H;  3N2K A;  2HHH B;  1K92 A;  3H1I H;  2VQE O;  3ABL C;  4QPK A;  3JAW A;  3ZHV A;  4AQY O;  2GBO A;  4MTG A;  4MW3 A;  3K5L A;  1QLN A;  3ZMS A;  4FM0 A;  1FFX B;  1FS0 G;  2K9P A;  5H9C A;  1I7F A;  1YSC A;  1TVK B;  1K4C C;  5H2F Z;  5B1O A;  4J7J A;  2WLN A;  2QWN B;  1BCC H;  3JSN A;  4I9W A;  1RM1 B;  1PNM A;  4O4H B;  1XMO B;  3RYF B;  2EIK C;  1DK1 A;  4PD4 F;  1WN7 A;  1Q3E A;  3E35 A;  1AR5 A;  2PY5 A;  2QA4 V;  3A8T A;  2ZT9 B;  1GN2 A;  4DW0 A;  1AJN A;  1S77 D;  2DYS C;  5F2V O;  4FLX A;  3FYE B;  3T2M A;  1AVM A;  1P49 A;  4W4K A;  4PEL A;  4DUZ O;  3THO A;  3JAT A;  4P30 A;  4CC5 A;  4JI7 B;  5KX5 B;  4O4I A;  2UUA O;  4QGP A;  2WLJ A;  4F6E A;  1TUB A;  1Y66 A;  5IJ0 B;  3W7X A;  4ZOL B;  4WFF A;  4AHC A;  2RNB A;  3JAS B;  4NKG B;  3T4D A;  1VF5 B;  3CCS V;  2EZP A;  2PGG A;  3ZRW B;  1N0N A;  4GKK B;  5CA0 A;  2QSA A;  4B3T B;  5LXT A;  4QJF B;  5K1X A;  1UPG A;  1O9H A;  5EC2 C;  1DTO A;  1ZAU A;  2CUG A;  1LUV A;  1HP8 A;  2YXY A;  4LP8 A;  4DV0 O;  4KHP B;  2F43 G;  2UU9 O;  2LFR A;  5EZY B;  1Y74 A;  1WPB A;  3APQ A;  1VAR A;  3HKE B;  4PDM A;  5FL7 G;  3ZMU A;  5FNV A;  4DXW A;  1MA1 A;  4LF7 B;  2HVK C;  3T1H O;  3BA8 A;  1P7B A;  3L9D A;  1VQ4 V;  5L3D A;  3DTU B;  2JIZ G;  1EM1 A;  2P5O A;  4BIZ A;  4N23 A;  2AHY A;  4FLU A;  3K59 A;  2P22 C;  1KYO F;  3CEI A;  3ZHS A;  1Q90 D;  2F66 C;  2YEV A;  4D7S A;  4JI8 B;  3H1K H;  2HEP A;  2IU3 A;  3FD9 A;  4YJ3 B;  3CC7 V;  4DV5 O;  3WG7 C;  4K8Z A;  1A32 A;  3QG5 A;  3SJQ C;  4DV2 B;  1VQ5 V;  1KQS U;  2L6L A;  4MTO A;  3UT5 B;  1JR9 A;  4ZI7 A;  4DV1 O;  1SRY A;  1K7D A;  4JI2 B;  2X0L A;  2IH1 C;  3FAV B;  1UJW B;  2EX3 A;  5IWA O;  2GUZ A;  1RFY A;  3OGC C;  2DYR C;  3SYA A;  1SQV H;  1KC8 W;  5CBF A;  3OT7 A;  1GM7 A;  3SDL A;  3MHH C;  4PDR A;  5CA1 A;  3QF7 A;  1XEQ A;  5KLV H;  5B5E Z;  1M57 B;  3WU2 Z;  3CX5 F;  4DR6 B;  1YTF D;  1R3K C;  3RN4 A;  4U7N A;  2ZE8 A;  2ZQM A;  3CCR V;  4B3R B;  4GT1 A;  1BT8 A;  4EFB A;  5A9G A;  4HYO A;  4DW1 A;  1ORQ C;  4UVC A;  3TXQ A;  1BMF G;  1AP6 A;  2QJ1 A;  3ZMZ A;  3ZBH A;  3E2E A;  3WB0 A;  5J9P C;  1UFI A;  2RDC A;  3HR0 A;  4IIJ B;  1H2S B;  1GKF A;  1F7Y A;  4YJ2 B;  4KFM A;  2UUB O;  1YZB A;  1NBM G;  3DC6 A;  4ZKI A;  2UXB O;  1OCR B;  5IJ9 B;  3LNM B;  4CS2 A;  4DR7 B;  3I56 V;  2KKW A;  2ZDI A;  2CGN A;  4O4J B;  1QLE B;  2CH7 A;  2Y0I A;  2ZDI C;  3AK1 A;  4LFA B;  3JCZ A;  3SJC C;  3ZRV A;  1HNW B;  1I94 B;  1JFF B;  2W0F C;  4DR4 B;  1AI6 A;  1K5Q A;  2JJ2 G;  4K0K B;  2LW7 A;  2KG7 A;  2BSK A;  4WFE A;  5JCO A;  1FKA O;  1VP7 A;  1WLE A;  5JCO C;  2JGD A;  2QTO A;  4LF5 O;  4EEQ A;  4JV5 O;  4UB6 Z;  1XMO O;  2ITD C;  2BOB C;  1BQZ A;  5KUM A;  1SZX A;  3SYO A;  3D36 A;  3HKD B;  3D36 C;  4I55 A;  2YIA A;  2Q7H A;  3KG2 A;  2RJZ A;  4QIW F;  3S3X A;  1AI5 A;  5GTH Z;  3SJB C;  2KSD A;  4DYL A;  4FZ1 A;  4HNA A;  3P3N A;  1KP2 A;  5HFL A;  1KD1 W;  3AG2 B;  1JJ2 U;  2R9A A;  1HR0 O;  5BMV B;  1GTO A;  3OEH G;  4O2A B;  5B1B B;  1IBM B;  2RQ6 A;  2P06 A;  2VRZ A;  1K33 A;  3FKS G;  3CRM A;  2QWO B;  4H37 A;  1VQP V;  4JI3 B;  4FLV A;  3T4Z A;  1GAX A;  2DQ3 A;  1N36 B;  5KAF Z;  1ARO P;  2GSM B;  4NTY A;  1EN5 A;  2ZE6 A;  4AI8 A;  3N2K B;  3ASN C;  1ZSP A;  4KP4 A;  5JVD B;  2JDI G;  1Y67 A;  1PV0 A;  1NZ6 A;  1H2K A;  3K5O A;  4LF9 O;  3IC9 A;  4QNH B;  4JAS A;  4K8X A;  2AXT Z;  4X1Y B;  2JS3 A;  3C90 A;  4GCZ A;  1R6N A;  4NR1 A;  3W7W A;  4NTX A;  2PTM A;  4LF7 O;  4ICG A;  3BRC A;  1S76 D;  4RO2 A;  2QTS A;  1Q81 W;  2CTP A;  1TUE B;  4WFH A;  1EN6 A;  5CB4 A;  1XI1 A;  3RW0 A;  4DV3 B;  2ZKO A;  1FYJ A;  4DRX B;  4IHJ B;  1NS1 A;  4PHZ A;  1H2G A;  4FK5 C;  4ZIB A;  1PKX A;  1X4T A;  4U3F H;  5CA3 A;  1GRJ A;  1DF4 A;  5C8Y B;  3QNE A;  4DV2 O;  1WP8 A;  3JAT B;  3K0D A;  5L3C A;  4O4I B;  3K08 A;  4X64 O;  2Q68 A;  1E1R G;  4JI2 O;  2YIC A;  2Q0A A;  1QCE A;  4LWS A;  3B09 A;  1LUW A;  2GV9 A;  3STZ C;  3APO A;  2B1G A;  1YF2 A;  4RUF A;  3AG4 C;  3CCL V;  5EYP A;  1M5I A;  2DQ0 A;  2ZE5 A;  5LGU A;  4LNU A;  1DGS A;  2LJ2 A;  3HKC A;  1EFR G;  1E1Q G;  1MSD A;  4G27 B;  4DR6 O;  2HLD G;  1I08 A;  3ETE A;  1Q86 W;  5LP6 A;  3A0R A;  3N27 A;  4B3R O;  5LP6 C;  2Q4P A;  5IYB O;  4NXN B;  4O2B A;  4B3S B;  2VWJ A;  4NB5 A;  5KHH A;  3JAK B;  1Y74 B;  2XND G;  3RVZ A;  5CBH A;  3CCQ V;  1J95 A;  3OFN G;  3G4S V;  5FNV B;  3Q4H A;  3E22 A;  1Y6X A;  1L0N H;  1THZ A;  1H2L A;  2Q0O C;  4JTD B;  3F5T A;  1R73 A;  1J5E O;  1RPR A;  1M4U A;  4NVP A;  1KU9 A;  4TV8 B;  1OZ0 A;  1D5N A;  3MHS C;  4J9Z B;  1NQT A;  3QVN A;  4U3J A;  5K1P A;  4GKJ B;  3O9O A;  1HNW O;  4LFA O;  5B3S C;  3WG7 B;  2CGO A;  1I94 O;  2CTQ A;  4KUM A;  5IT9 N;  4K0K O;  1AI7 A;  3ETD A;  1MOF A;  1AR1 B;  3JAM N;  4B7K A;  2H3O A;  2CK3 G;  1LR1 A;  4PV1 B;  1K9M W;  4I50 B;  3RYI A;  4FLY A;  3SPG A;  2GUZ B;  2DYR B;  4Z2W A;  4PA9 A;  4JI4 B;  5J2U A;  5FPO A;  5CA1 B;  1MSW D;  1R3J C;  3HB3 B;  3JD3 A;  2N74 A;  1OCC B;  1EBO A;  1XDC A;  4UCO A;  1G8M A;  2GTS A;  1WA8 B;  5LA6 A;  3LDE A;  2JVD A;  2FL4 A;  1R6K A;  2ZM6 B;  4LF8 O;  4EKW A;  4DV4 B;  1V54 B;  2ZXW C;  4JI3 O;  5LMU O;  2UXC B;  4CS3 A;  3W7U A;  5FPR A;  2Z0A A;  2F1M A;  1L1F A;  2ZCE A;  1N36 O;  3CCM V;  4PI2 A;  2W6I G;  2A7W A;  2B5U A;  3UKM A;  2AZ2 A;  2QEX V;  4JYA O;  3KZI Z;  1BS3 A;  1URF A;  3JYC A;  1JMK C;  4UUJ C;  1KBH A;  1D5A A;  2CH7 B;  4GX5 A;  2DW4 A;  2IW5 A;  2R9R B;  4GX1 A;  4EB6 A;  1K3E A;  5GTI Z;  5LBQ A;  1S5H C;  2KG7 B;  2IJJ A;  2BSK B;  2WWW A;  5EK0 A;  2WLL A;  1ZL8 A;  4DR5 B;  2ZIO A;  3OTF A;  2E3C A;  3L73 H;  4TWK A;  3ABK C;  2VQF O;  4WF9 V;  1ZX3 A;  2QGN A;  3IC7 A;  3G80 A;  3LDC A;  4FLT A;  2YIB D;  4BW9 A;  5H6R A;  4JI0 O;  4DV3 O;  4LFB B;  4I55 B;  3WB1 A;  1F23 A;  4IYH A;  3K79 A;  2E5L B;  1IXB A;  1Y76 A;  5L3G A;  2D3O W;  2LFS A;  3B8M A;  5JJN B;  3OTO O;  4HAM A;  2PYJ A;  1NVP B;  1GN4 A;  4E2L A;  2EIM C;  4CH6 A;  1NT2 B;  1S5J A;  1P7G A;  1K4D C;  3CP1 A;  3E8G A;  5EIB D;  3H1J H;  1PP9 H;  3TET A;  4LR3 A;  1M56 C;  3J7A U;  4X66 O;  4MSW C;  1IBL O;  1VMG A;  4WFB V;  4R8C A;  4KL1 A;  4P9O A;  2QWR B;  4B3M B;  3ASN B;  5LHI A;  4LH6 A;  3D3Q A;  2ZNI A;  2G38 A;  3OUS A;  4D6T H;  2FTK A;  4U7O A;  5DM6 V;  1GO3 F;  2WLI A;  2CDY A;  4ZHQ A;  4J7K A;  3F5W C;  4LCU C;  1DF5 A;  2E74 B;  4F6R A;  4NXN O;  1SQF A;  2F95 B;  2N04 A;  4DV7 B;  4B3S O;  2EJR A;  1XNQ B;  4TUY B;  5LHG A;  5CN0 A;  3K9S A;  4PA3 A;  1TGO A;  4JPR A;  2NR5 A;  4DR3 B;  1OCZ C;  2HG5 C;  4UXN A;  1HDJ A;  1BSM A;  3KCX A;  5IYD O;  2E75 B;  3CJH B;  4JYB A;  1JOY A;  2XAS A;  4MVO A;  1SES A;  4RAI A;  2DMX A;  2EZO A;  4PA6 A;  3T1C A;  4CZZ A;  2R9I A;  4TOI A;  1FXK B;  2XAF A;  5EBW C;  4MS2 A;  2LW1 A;  1OJH A;  1I5Y A;  3E8F A;  1WPX A;  3IGA C;  4FFB A;  1OV9 A;  3B2E E;  1G1X B;  2M6Y A;  3E22 B;  4HZ3 A;  2Y48 A;  3LSU A;  3PJS K;  4LWS B;  1N33 B;  5AG2 A;  1HNZ B;  2PUS A;  3AG4 B;  3K57 A;  2R72 A;  4OGQ B;  1JQ0 A;  3B40 A;  4MVS A;  4C7U A;  1E79 G;  5EYP B;  3G71 V;  1SA0 A;  1GM9 A;  4LF6 B;  1AJP A;  4CH4 A;  1WAZ A;  5ITZ A;  2BOC C;  1P84 F;  2JEX A;  5LP6 B;  1YJW V;  3CB2 A;  2Q69 A;  1RP3 B;  2HJD A;  2ZM6 O;  1VF6 A;  1NTK H;  2UXN A;  3BFR A;  3SYC A;  3CCJ V;  1VF6 C;  4RQF A;  4YY3 O;  4LFC B;  1H8H G;  2BTQ B;  2UXC O;  1XNR B;  2O57 A;  1ZWI C;  3Q4H B;  3CC2 V;  4O4L B;  4JGS A;  2Q6A A; 
#chains in the Genus database with same CATH homology
 1XNR O;  1IBM O;  1AIL A;  4DV0 O;  2DJV A;  2VQE O;  5LMN O;  1F7Y A;  2UU9 O;  4JYA O;  4LF9 O;  2UUB O;  1YZB A;  1R1B A;  4AQY O;  1N32 O;  4DV6 O;  1XNQ O;  2UXB O;  2F4V O;  4OX9 O;  4LF4 O;  3F5T A;  4DV4 O;  3M8A A;  4B3M O;  1J5E O;  4JI5 O;  4GKK O;  3T1H O;  1XMQ O;  4DR3 O;  1IBK O;  4X62 O;  4B3T O;  5A2Q N;  4LF7 O;  4LFC O;  4YHH O;  2LW7 A;  1HNW O;  4LFA O;  1FKA O;  5H5N A;  1N34 O;  1I94 O;  2VQF O;  3J81 N;  4X65 O;  4OPA A;  5IT9 N;  4DV7 O;  4K0K O;  1DK1 A;  2JRI A;  3JAM N;  4LF5 O;  2ZKO A;  1FYJ A;  2HHH O;  4KHP O;  4JV5 O;  1XMO O;  1D2D A;  1NS1 A;  4JI0 O;  4JI1 O;  4DV5 O;  4DV3 O;  1A32 A;  3T1Y O;  1G1X B;  1R6T A;  2UUC O;  4A5U B;  2AGA A;  3OTO O;  4DV1 O;  4DR7 O;  4DV2 O;  4DUZ O;  4DR5 O;  4X64 O;  4DR2 O;  4DR4 O;  4JI2 O;  5IWA O;  4GKJ O;  1KUQ A;  2DOS A;  2UUA O;  1N33 O;  5BXZ A;  1HNZ O;  2N74 A;  1HR0 O;  4JI6 O;  3SDL A;  4JI8 O;  4OPH A;  2FKX A;  3J7A U;  1XEQ A;  3O65 A;  4DUY O;  4DR1 O;  4X66 O;  3R66 A;  3J80 N;  4LFB O;  5BR8 O;  1IBL O;  1X59 A;  4LF6 O;  4LF8 O;  5LL6 Y;  2E5L O;  5BY1 A;  1HNX O;  1AB3 A;  3RT3 C;  2ZM6 O;  4DR6 O;  4JI3 O;  5LMU O;  4JI4 O;  4B3R O;  4YY3 O;  2Z0A A;  2UXC O;  4JI7 O;  5FLX N;  2UXD O;  1N36 O;  1FJG O;  4NXM O;  4NXN O;  4B3S O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...