1HNXO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hnxO00
4DV6O 4DR2O 2N74A 4OPHA 4DR5O 4DV4O 5LMUO 4LF7O 4LF8O 4DR3O 2UU9O 4OX9O 4B3RO 2UUCO 3J80N 2F4VO 1AILA 4YY3O 3SDLA 1AB3A 1HR0O 4JI3O 4DV3O 4JI7O 4JI4O 2UUBO 1J5EO 4LFAO 4DR1O 1N34O 1DK1A 1YZBA 4LF4O 2VQFO 4B3MO 4JI1O 5BY1A 2VQEO 1F7YA 5BXZA 2ZM6O 4K0KO 1D2DA 1G1XB 3F5TA 1XMQO 1A32A 1FKAO 4DV0O 4LF5O 4JI2O 2ZKOA 1I94O 4B3TO 4AQYO 4GKJO 3R66A 1X59A 5H5NA 4JI0O 4GKKO 1NS1A 4X62O 5A2QN 4OPAA 4LFCO 4KHPO 4DV5O 2JRIA 2DJVA 4JV5O 5IWAO 3JAMN 5IT9N 1IBMO 3T1HO 4NXMO 5LL6Y 1HNZO 4DR6O 1XNRO 4LFBO 4X66O 4X64O 1R1BA 4B3SO 4JI8O 1IBLO 4DV7O 1XMOO 2UXCO 2UXDO 1HNXO 3RT3C 4DR7O 2UUAO 1XEQA 2Z0AA 1R6TA 2LW7A 3J81N 2DOSA 3O65A 4JI6O 1KUQA 2FKXA 1IBKO 2UXBO 1FYJA 3M8AA 4JYAO 4DV1O 1N33O 2E5LO 4DUZO 4YHHO 4X65O 1XNQO 2AGAA 1N36O 2HHHO 5BR8O 5FLXN 1HNWO 1FJGO 4DR4O 4JI5O 5LMNO 4A5UB 4DUYO 1N32O 3J7AU 4NXNO 4DV2O 3T1YO 4LF6O 3OTOO 4LF9O
chains in the Genus database with same CATH superfamily
1HP8A 1VIBA 3CRRA 2P06A 1R6KA 4LF8O 2GUZB 4MTGA 2X6CA 5J9PC 1YHQV 3UO3A 1D5NA 5J2TB 1NTKH 4JI7O 2JS3A 3WG7C 1P84F 4LFAO 4LF4O 4IT5A 5LYJB 3JD1A 2Z5UA 4JF3A 1RM1B 4UFZA 2BE3A 4DYLA 2VQFB 1MZFA 1FKAO 3VQWA 2JGUA 3CD6V 4DR2B 5BZBA 4D7TA 2BSKA 2DWDC 1K9MW 2GTAA 2AW9A 4X62O 3OM3B 1YTFB 1Y76A 3C3SA 3QO7A 1HW7A 4ZIBA 1AI5A 5EYPA 5LA6A 4AQYB 4I0XA 4JASA 4LFAB 4DR6O 1LNQA 4BW5A 4F6RB 4DV1B 4LFBO 4YXWG 1KD1W 2FYUH 1S77D 2GSMB 1EFRG 1YDXA 1L8DA 5E79Z 1WPXA 3CCEV 2EIKC 2GV9A 3CMAV 4LF8B 3ETQA 4JI8B 3GVMA 3LUTB 1HR0B 2RDCA 5JVDB 2YXHA 3FAVB 3JATB 4DRXB 2Q8VA 1AR1B 5KLVH 4RO2A 4WFFA 1KQSU 1SC5B 3OEEG 4CC5A 4K35A 3OTOB 1DF4A 5LGUA 4ZHQB 2BCCH 1FS0G 2R9IA 2QM7A 5LP6A 1KYOF 1EZJA 1BSMA 2ZIMA 3C90A 1JJOA 4J41A 4J9YB 4UB8Z 3RVZA 1VQ5V 2P4KA 4J7JA 3CCLV 4F4LA 2ARHA 3H1LH 1GTOA 3OUSA 1R73A 3LDDA 2YEVA 3JALB 1N0JA 5CBHA 5B3SC 1SQXH 5B5EZ 3A0HZ 1EN6A 2V1DA 3OR6C 3UT5B 2ZM6O 1D2DA 1YJ9V 3D3IA 3ZN0A 4LBEC 1QR9A 2CGOA 1G6UA 3ZRXA 3BHPA 2EIJB 2ZKOA 2AHYA 4E2LA 3G80A 4BIZA 1QVGU 1BL8A 1FJGB 4W4KA 2QE7G 5H5NA 4TV8A 4DV5O 5GTHZ 4EB6A 3ZHVA 1VP7A 5DM6V 4IIJB 1PKXA 1N34B 1R3KC 1VQ9V 3FB8C 1N33B 5E1AC 4X64O 2QJ1A 2ZINA 4MVQA 1Q6IA 2P7TC 2QWQB 3O9OA 3RT3C 3K5OA 2P67A 3R65A 4XBFA 3CHXA 5FPRA 3E22B 3O65A 2ADQB 1KUQA 2EIMC 3RGBA 2WAMA 1JFFB 5B3SB 4RQEA 4ABMA 4UVAA 2YSUB 1IURA 2QWNB 4EKWA 3CCUV 1TAEA 3N2GB 4MVZA 4LP8A 1VQMV 2EBOA 2CAZC 3HR0A 3B8MA 4DUYO 2Z3YA 3J7AU 2ZDIA 2JGDA 4PDMA 5LHIA 1Q6HA 3KCXA 1MNGA 1M5IA 3T2MA 1AR4A 3KG2A 5CN0A 3L70H 2N74A 1J95A 4JV5B 2CUGA 5EBLC 2UUCO 2QKAA 3J80N 3RW0A 2HVJC 1ENVA 1VF7A 1Y4MA 1SQBH 3RYCA 5L3DA 1YZBA 3L9DA 4I0XB 1ORQC 1I08A 3F7VC 4ZHQA 4TUYA 2EIJC 5LMUB 2RMKB 5KA5A 1KP3A 2F93B 2ATKC 1Q43A 3JSNA 3A2FA 2IBZH 1Y74B 1L0NH 4PDRA 4PHZA 1U97A 2PF4E 3CWBH 2F66C 5D5QA 5EZYA 2DYRC 3OMNB 5LYJA 3UT5A 5KX5A 5CBGA 3WB1A 2ILMA 2XT9A 1VMGA 1EM1A 4BR6A 4UVCA 1URFA 2LW7A 2DOSA 4I55A 2BSKB 3TJTA 5LXTA 2DQ0A 5H2FZ 2ZE6A 1GH6A 4DV1O 4DUZO 2WLIA 2AGAA 2Q7GA 1DGSA 2Q7HA 3BVOA 2VS0A 3CB2A 4O4JA 3K03A 4LWSA 4JYCA 3FD9A 3T1YO 2XHBA 2QTOA 1GAXA 1GKFA 5B1OA 3SPGA 1FAFA 1KECA 4DR5O 5LMUO 4EFBA 2YXLA 4X89A 4GYCB 1GN3A 1K5QA 1GRJA 3CC7V 3SYQA 3QVNA 1FXKC 4PDVA 3ZMZA 2L35A 3JAWA 4O2AB 4JI3O 1G4YB 2DYRB 4JI4O 2HKOA 2X6AA 5JJJB 5L3EA 2K9PA 1QLEC 5KAFZ 1Q3EA 4C7UA 4FM1A 3HKDA 1B04A 1P7BA 1RPRA 1QLEB 4CS3A 2PGGA 4JI6B 1OCZC 2IJJA 2YICA 3DXRB 3UQ8A 1OCRB 3HKBA 2EINB 1NTZH 1Z5WA 4GCZA 4PV1B 4KL1A 4G27B 2KB1A 2KSDA 1JCHA 2YIBD 3LSSA 1B06A 2ITCC 2XAQA 3K5MA 5KHIA 4UUJC 1E1QG 3QTCA 1R3LC 1HNWB 3ABKB 1BQ0A 3N2GA 3SR2C 4LNUA 2LGQA 4BWAA 5IJ9B 1K33A 3M7MX 3CP1A 2IJIA 4FLTA 3ZMUA 4YIPA 4WFGA 3CRQA 1IBLO 1VQNV 4FLWA 4H44B 2P22C 2WPDG 2OCCB 3CRMA 5ITZA 2FKXA 4GX1A 4J7KA 3BEHA 1N33O 1YXBA 1Q6UA 4CH3A 3W7XA 3IC9A 1P49A 4JI3B 2Y69C 2M7WA 5CMUA 4JAVA 1BQZA 4FLYA 2QTSA 3RWRD 5KHKA 2EIMB 4PA7A 1OCOB 5HFMA 4DW0A 2CE4A 2PTMA 1VF5B 3K5LA 4U7OA 4OPHA 2DN9A 4K8XA 2FTKA 2P5OA 1K3EA 2OCHA 2HJFC 4LR3A 4H0LB 3L73H 3F5WC 4JI1B 1TVKA 3M99B 4TV8B 1KKDA 1Y74A 3MHHC 1ZLZA 3GWKC 2BTQB 3SGIA 2UUCB 2B1IA 4QGPA 2MW2B 4PD4F 5IJ0B 2F4VB 3BCCH 4MVRA 1QNMA 4ZI7A 1QLNA 1G1XB 3ZMVA 4PDLA 3RYIB 3DC5A 4YJ3A 3G4SV 4ASUG 3ML0A 1NTMH 3SPJA 3SJAC 2W0XA 4JI2O 1IXMA 4B3TO 5GTIZ 5F2VO 2B5UA 1U96A 1NU1H 2JJ1G 4WBNA 4JZGA 2P4VA 2DJVA 1XL4A 3JD2A 4K3AA 2YIAA 3QNEA 3T1HO 5KAIZ 3IAYA 3CRCA 4PA9A 1M56B 2JEXA 2Y4TA 1XMOO 1HNXO 4D6TH 1K7DA 2YC0A 1OV9A 1XNRB 4I5SA 1XNQB 4O4LA 4U3FH 2VWKA 4NXNB 4J7ZA 1IBMB 2HHHO 1EN4A 1H8EG 1LR1A 1GMGA 1PNKA 1XL6A 5IY5C 3IGAC 2EX3A 3EXAA 3OTFA 4GT1A 1GK9A 2LFSA 3G6BA 1MSWD 4P9OA 2KG7A 4Q20A 4I55B 2YS8A 3MAQA 1BE3H 4D7SA 1CP9A 1H2LA 4HYOA 2Q5ZA 3H9VA 3B2EE 4H33A 3W7TA 2WLIB 1AB3A 1KKCA 3C3TA 1V55C 1J5EO 3ZBHA 3D36A 2EJRA 5IJ9A 4B7EA 1QR8A 1IBLB 1QU7A 4DK1A 1SQFA 1YSCA 2OYQA 5BMVA 3GB7C 4ZOLB 5KA6A 2D3OW 2ZNIA 1OHHG 1RFYA 4RQFA 3ZRVA 1H2MA 1I94O 4QPJA 1H8HG 5DECA 1WB7A 4UXNA 1NI8A 1Y67A 3E8HA 1M57B 3SYAA 4HBNA 4FK5C 4CH4A 4CS4A 2YUAA 4DO2A 2E74B 3APOA 2FMLA 1QCEA 1R6NA 3PJSK 4ZI7B 2ODMA 5TISZ 4YIOA 3NR7A 3HKEB 4DV7O 3OW2U 1NT2B 4KUMA 2JJ2G 2NNUA 1EBOA 2JIZG 1XUQA 3CX5F 4LFBB 4K8ZA 1XBLA 2H3OA 2HLDG 1H2KA 4LF6B 4AILC 2V4DA 1LUWA 2AHZA 2Y4UA 4AI8A 3ASOB 5EYPB 2R70A 5LA6B 4LFCB 5GW7A 1XHXA 1IDSA 1MA1A 1VQPV 2WLJA 2OCCC 1N32O 4ZBMA 4KHPB 1AI6A 5IJ0A 3WFVA 1TUEB 4HZ3A 4DUZB 2PZSA 4DR6B 4FZ0A 3FYIB 4UCTA 1K4DC 1JVMA 4I9QA 4CH5A 3SJBC 2PUSA 2GDSA 3ABKC 1D5AA 1PD3A 1YI2V 3A0BZ 3K06A 1VQ8V 1AILA 3DSQA 3IJ4A 1RP3B 4TWKA 4O4IB 1RM1C 5KMGA 2HR3A 4JTDB 3K08A 1L1FA 1WN7A 4B3MO 3ZMSA 1SERA 5EK0A 4MW8A 4JI1O 2DMXA 3RYFB 1K34A 1VQ7V 1F7YA 4F6RA 2ZE5A 3ZRSA 4LCUC 3B8NA 4XDLA 4TOIA 5DN6G 4HAMA 1COWG 4NTYA 1NKDA 3RN4A 3DTUB 1V55B 4YJ2A 1GM9A 1KB9F 1Q86W 2EINC 1OZ0A 1ZL8A 4HNAA 2ZD9A 5A2QN 4TV9B 4GUNA 4JI5B 3CMEV 2NN4A 4MS2A 3JAMN 4H37A 1OJHA 4QIWF 2XASA 2CH7A 3ZRWA 5L3FA 1SQPH 3UM7A 5J2UB 4R8CA 2UXXA 5BMVB 4YJ3B 2HEPA 1S5LZ 1JA8A 4DR7O 4H13B 1F51A 1I0HA 2Q67A 3ZIAG 3OGCC 4DK0A 2QEXV 2E76B 5CA0A 1WNSA 3M8AA 2RN9A 1SZXA 4DV2B 1VQ4V 1YTFD 3AG2C 4X20A 2X7RB 1PM9A 2F95B 2IH3C 1KP2A 4XDJA 1OCCC 4FJCC 1AJPA 1DF5A 4MT8A 5JCOC 3K57A 4PJ0Z 2IW5A 2B1GA 4P30A 3D8CA 3OD4A 1V54C 4LH7A 2CK3G 1HNZB 4DW1A 4BIUA 4UCVA 1XQ8A 3B09A 3SJQC 1S5JA 5JQGB 1YJNV 3BA9A 3EVKA 1FFXB 3JSLA 3JCUZ 4F6EA 4MVUA 4K0KB 3QO8A 1M1KW 4DRXA 2PYJA 4AHCA 4FVMA 1JX9A 4Z1MG 2K1EA 4FLXA 4EB6B 2WA3A 1L0LH 1OCZB 4B08A 2ZIOA 2EZOA 2IU3A 1PL4A 2WLMA 4I50A 1AI4A 3E86A 1YIJV 1B6QA 1NZ6A 4QE7A 3E8BA 4DV0O 4LF5O 3TGUH 2DE0X 5H6QA 1NVPD 1GM7A 4AQYO 4GKJO 4G2KA 4O4LB 1ZSPA 3BFRA 4J80A 5K1XA 1JFFA 2EZPA 5IYDO 2JRIA 5KMGB 3E8FA 2GTSA 3RYCB 2NR5A 2W6IG 5EBWC 5LL6Y 3LNNA 5KUKA 2RCVA 2DYSB 4UCOA 4MTOA 4B7KA 2XAHA 4FPPA 2UXDO 2ZNJA 1XMOB 4JAAA 1ZAUA 4DXWA 2H94A 4X1KA 1VQ6V 3B77A 4X1IB 3J81N 2Y0PA 2A3QA 2ZM6B 1SKVA 4TV9A 2Q4PA 1IZ3A 2FB5A 1BT8A 1YITV 2A9HA 4I7ZB 5FLXN 4DR4O 3CJHA 5KX5B 2XTAA 3UO2A 3RYFA 1H2GA 3OTOO 1BHBA 1BHAA 4FFBB 2QWOB 1CEZA 1SS3A 3ZHTA 3MD0A 5C93A 5CA0B 4I9WA 3CXHF 2F4VO 3K59A 2QWRB 1I7FA 3FFQA 3SDLA 3I5DA 1VEWA 1UFIA 4DR1B 3ZJZA 3FYEB 4FMTA 5GONB 5L3BA 2YDEA 5LBQA 2Y0IA 2JGDB 3AK3A 2IJHA 3L75H 3W7UA 3OMAB 4O2BA 4JYBA 3SJCC 5IY5B 5J2UA 2F23A 1A32A 4TSFG 4IHJA 3PN1A 3SYOA 1PP9H 2HFEC 2Q69A 2BTOA 1NJIW 4DUYB 2L6LA 2CTWA 1NR7A 1GN4A 3KCYA 5BR8B 5JCOA 1IBMO 3HKDB 1GN2A 1H2SB 4X62B 5H9CA 5CA1B 3CSXA 3KZIZ 4LF5B 1YCIA 3DXRA 4DV3B 4NYKA 2QA4V 2UXNA 2HVKC 3FB7C 4ICGA 5IE9A 4DV7B 4UCRA 2DW4A 2XOKG 3OMIB 5B66Z 3RFRA 2ETNA 3ZHQA 1T5EA 4QE9A 2X0LA 2OIGA 5IDJA 1R3JC 4J10A 3L72H 2WSSG 1MZEA 5EZYB 2HG5C 4FLUA 3ZN1A 5LMNO 4A5UB 2YIDA 3STLC 3X2QB 4DR3B 4X65B 4LF9B 4GZRB 4LF6O 3AG3B 1X4TA 2R9RB 4TUYB 2XUMA 3A8TA 1H38A 5DEDA 3CCQV 2OT5A 2QKSA 5LXTB 3G6EV 1AJQA 2JS5A 4WFHA 2Q68A 1XOUA 3OAAG 2A7WA 3TXSA 3T4DA 1LUVA 4YY3O 1AP6A 2AZ0A 2ZR2A 2Q6AA 2BOBC 5KUMA 2IM9A 1NBMG 2CTRA 4I4TA 3APQA 4L87A 1SF9A 4QJFB 4GLXA 1K97A 1RPOA 2Q73A 2H8PC 3BAAA 3FX7A 4G28B 2N04A 4U3JA 5JQGA 2Y69B 4Z2WA 2WLLA 2GUZA 3P32A 2CTQA 4UV8A 3JD4A 3H1IH 3BABA 3T1YB 2WA4A 1NS1A 5AG2A 3ZCCA 2ZDIC 3CCJV 3AK2A 1G8MA 4TQDA 1KC8W 3Q4HB 3IC7A 3AG7A 4N23A 3X2QC 1JR9A 5FPOA 2EJ7A 4O4JB 2LP7A 4LWSB 4B3SO 4Q6GA 4JTAB 4UV9A 1PNMA 3ZS8C 3WB0A 3OR7C 2Q7EA 4WF9V 1BZKA 2A06H 1YEWA 4JI7B 3LDEA 5LGNA 3JAWB 4O4HA 3K9AA 4X9QA 4LNUB 1WLEA 3QO5A 4NVPA 2D2CB 3VOUA 3HPLC 1AJNA 4JI2B 4DV6B 4NXNO 4DV2O 3LSUA 3SYCA 5A9GA 1OCCB 1N32B 5LMNB 1KBHA 1Q7YW 5IYZB 3N2KA 1NQTA 3HKCA 3AEIA 3LDCA 3T1CA 4ZKIA 1VQOV 4U7NA 1BCCH 3AG1B 3A0RA 1WP7A 2ZR3A 1ZX3A 5JH7A 1HR0O 3FB6C 2E75B 3QG5A 2BOCC 3OEHG 1PNLA 2R72A 2XAJA 4P2ZA 3K9SA 4BIOA 4FM2A 4JI4B 1DK1A 1RSOB 4MTXA 1Q8IA 2EIKB 5BXZA 3OUFA 4NB5A 3JYCA 2CTPA 5EC1C 4NR1A 5LP6C 4X1KB 4UVBA 1OCRC 1FD9A 4WFBV 2QDOA 4OPAA 4W4LA 1FXHA 2IU0A 4MVSA 3FAVA 3JATA 5LOVA 1SQGA 3LSQA 5IT9N 3DGEA 1MABG 2YIBA 3ASNB 1W0KG 2PI4A 1BS3A 4B3TB 3ZHUA 4IL6Z 1VQLV 1SETA 1XEQA 2G38A 1W2BU 1S5HC 2JVDA 3TCUA 1MMMA 2LFRA 1ROPA 1R3IC 1VF6C 3ETDA 4WBNB 2P90A 4NTXA 3SYPA 2Q0AA 2YEVB 3JALA 4DV5B 1HWYA 4GX0A 5BR8O 5CA1A 2UUAB 1FJGO 3W7SA 2ITDC 3AG4C 3OT7A 4B3SB 2Q0OC 2UU9B 4E4EA 3CE2A 2RJZA 1IXBA 3CRAA 3P30A 4DR2O 1K73W 3ETEA 2LQTA 4KFMA 1K5SA 2QR4A 4ZOLA 4DR4B 3D3QA 2WLHA 1SQQH 3TXQA 5IYCO 4OX9O 5EIBD 1THZA 1BMFG 4YHHB 3LNMB 3I55V 3BRCA 3BY6A 1W59A 5B1NA 2DQ3A 2Q9LA 4DR1O 2ZCEA 3CCMV 1SA0B 4OX9B 3VBBA 3ZX6A 5B1BC 3CCSV 1NVPB 4JYYA 2FL4A 3F5TA 5LP6B 2WLNA 2IJKA 2GHYA 2DWEC 5FL7G 1F4MA 1Y6XA 1UJWB 3W7WA 1WB8A 4JI0O 4GKKO 4J42A 1NH2D 3E2EA 1VARA 2JK5C 3ABTA 3ZHRA 3E8GA 4XDKA 3JAKB 3ETGA 4FLVA 1RSOA 3ABMC 3IFXA 4IYIA 4O4HB 4CC6A 1QBZA 3E35A 1E1RG 3AG1C 1KU9A 4X66O 3CCVV 4JI8O 1IVSA 3WB2A 4U3JB 3SPIA 2IH1C 3P3PA 2UUAO 3BPZA 1KMIZ 4MW3A 1R6TA 2YXYA 4KXRA 1ZL8B 4HNAB 3UKMA 1PPJH 1J5EB 4PI2A 1NH2B 4UB6Z 2OIEA 4IIJA 1M4UA 2LJ2A 2RNBA 1M57C 5IWAB 3EFFK 3CC2V 1ZWIC 1V54B 4DV4B 4I4TB 2QKCA 2OTJV 3H1KH 4WFEA 3I56V 2RQ6A 3E22A 2VRZA 1Z2GA 2UU9O 4X88A 3VQVA 1F23A 5EBMC 4R50A 4LC1A 4MVMA 1P7GA 4JZ2A 4JGSA 1N36B 3G71V 5LOVB 1FXVA 3B4SA 4CH6A 1TGOA 3DC6A 2VQFO 2AZ2A 2W0FC 2QSAA 3ASOC 2VWJA 5LGTA 2VQEO 1N8RW 2QM4A 1JMKC 1K4CC 2PYLA 3VQXA 1VF6A 3AG2B 1X59A 1CPYA 1QVFU 5JJNB 2R9AA 4JV5O 1K92A 2N05A 3RVYA 4NTWA 1SA0A 4PA6A 3ICXA 4N21A 3STZC 1Q82W 4WFAV 3JD0A 5LHHA 3S3XA 1JJ2U 4PELA 3S3WA 1R1BA 3L74H 3JASA 4RUEA 2UXCO 1HDJA 1SQVH 4X64B 1UPGA 4EFEA 2F1MA 3B40A 4YJ2B 1F4NA 5IYZA 4UCSA 1SRYA 1AP5A 4X8AA 4JYAO 5B1BB 2YI8A 3ABLB 3RYHB 3WU2Z 1XREA 4MSWC 1N36O 2OTLV 5JH7B 3JAKA 1XI1A 2EILB 1B3QA 3G67A 2ZE8A 4JPRA 4DV0B 1JPXA 1WA8A 4FZ1A 4TQFA 3EHBB 4LF7O 3WG7B 1S3JA 3ASNC 1MOFA 3SPHA 3CC4V 3THOA 1NR1A 5C8YA 1W0JG 3K04A 2LGWA 4JAUA 1XILA 2ZXWB 1TA8A 2PI5A 2WWWA 2X6BA 4JYAB 1M56C 2E3CA 2UUBO 4YY3B 2F43G 2EULA 3CJHB 2QM8A 5KHGA 5FNVA 3UCSC 1FXKB 5BY1A 4K0KO 4X1YB 2UXCB 1I5YA 4X66B 4JI0B 4GKKB 1VQKV 1AVMA 2V7QG 5ITZB 1Q81W 1TUBA 1S72V 2GBOA 3K3WA 4FFKA 4OXSA 3ABUA 4O2AA 3T4ZA 4PA3A 1N0NA 2BTQA 1GO3F 4X20B 1ZUQA 1QHTA 4I50B 1ZTEA 1WPBA 5EC2C 4KP4A 4TT3G 1HNZO 2E5LB 5CB4B 4O2BB 5JWPA 4RAIA 1O9HA 4LH6A 3RYIA 1FPOA 2YI9A 2CDYA 3D36C 4FFBA 5JJEB 4DR7B 2ZXWC 4QPKA 4JI6O 2LO1A 1YJWV 1FFXA 1WJZA 4L8JA 3QF7A 4J11A 1AROP 4YHHO 5CA3A 1FFTB 1S0VA 3E83A 4LF7B 4JI5O 5LHGA 4CS2A 3JARA 2XNDG 4QNHB 1EN5A 3K58A 4RUFA 1GN6A 4GKJB 4DR5B 3HKBB 1I94B 4DV6O 2M6YA 4X1IA 4DV4O 5EIBC 1XMQB 3ZMTA 3CPWU 4DR3O 4B3RO 2EILC 4LF4B 5B1AB 5KHHA 3JCZA 3HB3B 2VQEB 4R6ZA 3K0GA 4DV3O 1JOYA 4FIPC 3FKSG 4BW9A 2C2AA 2ZQMA 3OFNG 1HNXB 4BAYA 2A79B 1S76D 1WA8B 1XDCA 4B3MB 4Z1VA 3CCRV 1H2NA 5K1PA 3F7YC 1MSDA 3OE7G 1OCOC 2NLJC 2QGNA 3R66A 2ADPA 4WCEV 3K0DA 4PA4A 2OWOA 1Y66A 4LFCO 4R7CA 4KHPO 1YF2A 5D5PA 3MDSA 5CBFA 3NXSA 3TETA 4CZZA 1AR5A 4GX5A 3RBZA 5FNVB 3E89A 4FM0A 2P6JA 2KKWA 3K5NA 2HJDA 1DTOA 4MTFA 1V9PA 2WLLB 3U0ZA 3CXCU 4J9ZB 2XAGA 3FB5C 3AK1A 4GX2A 1E79G 3K79A 1IBKO 5H6RA 2UXBO 2O57A 4EEQA 1Y76B 1N4CA 1PV0A 2E5LO 2JDIG 1TVKB 3ZHSA 3Q4HA 5IYBO 1AI7A 5J2TA 4OGQB 2HP8A 5GONA 5CB4A 3ABMB 3JASB 1GM8A 4LF9O 3CEIA 4IYHA 1M93A 4IHJB 4RWUA 5JVDA 2UXDB 1M90W 4MVOA 3BA8A 4JTCB 3TK1A 5KHJA 3ABLC 1Z5VA 4NXMB 4IGGA 2MK3A 1N34O 1MG1A 3JARB 2XAFA 2DYSC 1M9NA 4B3RB 5L3CA 2WLKA 3N27A 1XMQO 1WAZA 4P9PA 3N2KB 2UUBB 3AG3C 1Q5OA 3GWOA 1WP8A 1JQ0A 3U10A 3H1HH 1XHZA 1CXZB 4UCUA 2HHHB 3OGIB 3RYHA 2KQXA 5HFLA 5IWAO 3U11A 4CBCA 1P4RA 4NKGB 1IX9A 2B9ZA 1EZVH 1FXKA 2AXTZ 1IBKB 2UXBB 4NXMO 3AG4B 2ZT9B 1XNRO 1BGYH 1SESA 3SPCA 2PY5A 1Q90D 3ZEDA 1I5XA 1YVWA 2ZE7A 3JD3A 3P3NA 2JEUA 2Z0AA 2KG7B 1TUBB 4FLZA 1FYJA 3HKCB 5C8YB 3L71H 1QQCA 3VQYA 1SZTA 2A0LA 2QWPB 1DLBA 4X65O 1XNQO 1US6A 3KKYA 2LW1A 1O9GA 5L3GA 1PL0A 3H01A 4O4IA 3T1HB 3CYOA 1HNWO 2Y48A 3MHSC 5B1AC 2W6JG 2CH7B 2CGNA 3ZRWB 1K8AW 3HKEA 4PI0A 4X1YA 3H1JH 3CS5A
chains in the Genus database with same CATH topology
4DV6O 4DR2O 2N74A 4OPHA 4DR5O 4DV4O 5LMUO 4LF7O 4LF8O 4DR3O 2UU9O 4OX9O 4B3RO 2UUCO 3J80N 2F4VO 1AILA 4YY3O 3SDLA 1AB3A 1HR0O 4JI3O 4DV3O 4JI7O 4JI4O 2UUBO 1J5EO 4LFAO 4DR1O 1N34O 1DK1A 1YZBA 4LF4O 2VQFO 4B3MO 4JI1O 5BY1A 2VQEO 1F7YA 5BXZA 2ZM6O 4K0KO 1D2DA 1G1XB 3F5TA 1XMQO 1A32A 1FKAO 4DV0O 4LF5O 4JI2O 2ZKOA 1I94O 4B3TO 4AQYO 4GKJO 3R66A 1X59A 5H5NA 4JI0O 4GKKO 1NS1A 4X62O 5A2QN 4OPAA 4LFCO 4KHPO 4DV5O 2JRIA 2DJVA 4JV5O 5IWAO 3JAMN 5IT9N 1IBMO 3T1HO 4NXMO 5LL6Y 1HNZO 4DR6O 1XNRO 4LFBO 4X66O 4X64O 1R1BA 4B3SO 4JI8O 1IBLO 4DV7O 1XMOO 2UXCO 2UXDO 1HNXO 3RT3C 4DR7O 2UUAO 1XEQA 2Z0AA 1R6TA 2LW7A 3J81N 2DOSA 3O65A 4JI6O 1KUQA 2FKXA 1IBKO 2UXBO 1FYJA 3M8AA 4JYAO 4DV1O 1N33O 2E5LO 4DUZO 4YHHO 4X65O 1XNQO 2AGAA 1N36O 2HHHO 5BR8O 5FLXN 1HNWO 1FJGO 4DR4O 4JI5O 5LMNO 4A5UB 4DUYO 1N32O 3J7AU 4NXNO 4DV2O 3T1YO 4LF6O 3OTOO 4LF9O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 O;  4DR2 O;  2N74 A;  4OPH A;  4DR5 O;  4DV4 O;  5LMU O;  4LF7 O;  4LF8 O;  4DR3 O;  2UU9 O;  4OX9 O;  4B3R O;  2UUC O;  3J80 N;  2F4V O;  1AIL A;  4YY3 O;  3SDL A;  1AB3 A;  1HR0 O;  4JI3 O;  4DV3 O;  4JI7 O;  4JI4 O;  2UUB O;  1J5E O;  4LFA O;  4DR1 O;  1N34 O;  1DK1 A;  1YZB A;  4LF4 O;  2VQF O;  4B3M O;  4JI1 O;  5BY1 A;  2VQE O;  1F7Y A;  5BXZ A;  2ZM6 O;  4K0K O;  1D2D A;  1G1X B;  3F5T A;  1XMQ O;  1A32 A;  1FKA O;  4DV0 O;  4LF5 O;  4JI2 O;  2ZKO A;  1I94 O;  4B3T O;  4AQY O;  4GKJ O;  3R66 A;  1X59 A;  5H5N A;  4JI0 O;  4GKK O;  1NS1 A;  4X62 O;  5A2Q N;  4OPA A;  4LFC O;  4KHP O;  4DV5 O;  2JRI A;  2DJV A;  4JV5 O;  5IWA O;  3JAM N;  5IT9 N;  1IBM O;  3T1H O;  4NXM O;  5LL6 Y;  1HNZ O;  4DR6 O;  1XNR O;  4LFB O;  4X66 O;  4X64 O;  1R1B A;  4B3S O;  4JI8 O;  1IBL O;  4DV7 O;  1XMO O;  2UXC O;  2UXD O;  1HNX O;  3RT3 C;  4DR7 O;  2UUA O;  1XEQ A;  2Z0A A;  1R6T A;  2LW7 A;  3J81 N;  2DOS A;  3O65 A;  4JI6 O;  1KUQ A;  2FKX A;  1IBK O;  2UXB O;  1FYJ A;  3M8A A;  4JYA O;  4DV1 O;  1N33 O;  2E5L O;  4DUZ O;  4YHH O;  4X65 O;  1XNQ O;  2AGA A;  1N36 O;  2HHH O;  5BR8 O;  5FLX N;  1HNW O;  1FJG O;  4DR4 O;  4JI5 O;  5LMN O;  4A5U B;  4DUY O;  1N32 O;  3J7A U;  4NXN O;  4DV2 O;  3T1Y O;  4LF6 O;  3OTO O;  4LF9 O; 
#chains in the Genus database with same CATH topology
 1HP8 A;  1VIB A;  3CRR A;  2P06 A;  1R6K A;  4LF8 O;  2GUZ B;  4MTG A;  2X6C A;  5J9P C;  1YHQ V;  3UO3 A;  1D5N A;  5J2T B;  1NTK H;  4JI7 O;  2JS3 A;  3WG7 C;  1P84 F;  4LFA O;  4LF4 O;  4IT5 A;  5LYJ B;  3JD1 A;  2Z5U A;  4JF3 A;  1RM1 B;  4UFZ A;  2BE3 A;  4DYL A;  2VQF B;  1MZF A;  1FKA O;  3VQW A;  2JGU A;  3CD6 V;  4DR2 B;  5BZB A;  4D7T A;  2BSK A;  2DWD C;  1K9M W;  2GTA A;  2AW9 A;  4X62 O;  3OM3 B;  1YTF B;  1Y76 A;  3C3S A;  3QO7 A;  1HW7 A;  4ZIB A;  1AI5 A;  5EYP A;  5LA6 A;  4AQY B;  4I0X A;  4JAS A;  4LFA B;  4DR6 O;  1LNQ A;  4BW5 A;  4F6R B;  4DV1 B;  4LFB O;  4YXW G;  1KD1 W;  2FYU H;  1S77 D;  2GSM B;  1EFR G;  1YDX A;  1L8D A;  5E79 Z;  1WPX A;  3CCE V;  2EIK C;  2GV9 A;  3CMA V;  4LF8 B;  3ETQ A;  4JI8 B;  3GVM A;  3LUT B;  1HR0 B;  2RDC A;  5JVD B;  2YXH A;  3FAV B;  3JAT B;  4DRX B;  2Q8V A;  1AR1 B;  5KLV H;  4RO2 A;  4WFF A;  1KQS U;  1SC5 B;  3OEE G;  4CC5 A;  4K35 A;  3OTO B;  1DF4 A;  5LGU A;  4ZHQ B;  2BCC H;  1FS0 G;  2R9I A;  2QM7 A;  5LP6 A;  1KYO F;  1EZJ A;  1BSM A;  2ZIM A;  3C90 A;  1JJO A;  4J41 A;  4J9Y B;  4UB8 Z;  3RVZ A;  1VQ5 V;  2P4K A;  4J7J A;  3CCL V;  4F4L A;  2ARH A;  3H1L H;  1GTO A;  3OUS A;  1R73 A;  3LDD A;  2YEV A;  3JAL B;  1N0J A;  5CBH A;  5B3S C;  1SQX H;  5B5E Z;  3A0H Z;  1EN6 A;  2V1D A;  3OR6 C;  3UT5 B;  2ZM6 O;  1D2D A;  1YJ9 V;  3D3I A;  3ZN0 A;  4LBE C;  1QR9 A;  2CGO A;  1G6U A;  3ZRX A;  3BHP A;  2EIJ B;  2ZKO A;  2AHY A;  4E2L A;  3G80 A;  4BIZ A;  1QVG U;  1BL8 A;  1FJG B;  4W4K A;  2QE7 G;  5H5N A;  4TV8 A;  4DV5 O;  5GTH Z;  4EB6 A;  3ZHV A;  1VP7 A;  5DM6 V;  4IIJ B;  1PKX A;  1N34 B;  1R3K C;  1VQ9 V;  3FB8 C;  1N33 B;  5E1A C;  4X64 O;  2QJ1 A;  2ZIN A;  4MVQ A;  1Q6I A;  2P7T C;  2QWQ B;  3O9O A;  3RT3 C;  3K5O A;  2P67 A;  3R65 A;  4XBF A;  3CHX A;  5FPR A;  3E22 B;  3O65 A;  2ADQ B;  1KUQ A;  2EIM C;  3RGB A;  2WAM A;  1JFF B;  5B3S B;  4RQE A;  4ABM A;  4UVA A;  2YSU B;  1IUR A;  2QWN B;  4EKW A;  3CCU V;  1TAE A;  3N2G B;  4MVZ A;  4LP8 A;  1VQM V;  2EBO A;  2CAZ C;  3HR0 A;  3B8M A;  4DUY O;  2Z3Y A;  3J7A U;  2ZDI A;  2JGD A;  4PDM A;  5LHI A;  1Q6H A;  3KCX A;  1MNG A;  1M5I A;  3T2M A;  1AR4 A;  3KG2 A;  5CN0 A;  3L70 H;  2N74 A;  1J95 A;  4JV5 B;  2CUG A;  5EBL C;  2UUC O;  2QKA A;  3J80 N;  3RW0 A;  2HVJ C;  1ENV A;  1VF7 A;  1Y4M A;  1SQB H;  3RYC A;  5L3D A;  1YZB A;  3L9D A;  4I0X B;  1ORQ C;  1I08 A;  3F7V C;  4ZHQ A;  4TUY A;  2EIJ C;  5LMU B;  2RMK B;  5KA5 A;  1KP3 A;  2F93 B;  2ATK C;  1Q43 A;  3JSN A;  3A2F A;  2IBZ H;  1Y74 B;  1L0N H;  4PDR A;  4PHZ A;  1U97 A;  2PF4 E;  3CWB H;  2F66 C;  5D5Q A;  5EZY A;  2DYR C;  3OMN B;  5LYJ A;  3UT5 A;  5KX5 A;  5CBG A;  3WB1 A;  2ILM A;  2XT9 A;  1VMG A;  1EM1 A;  4BR6 A;  4UVC A;  1URF A;  2LW7 A;  2DOS A;  4I55 A;  2BSK B;  3TJT A;  5LXT A;  2DQ0 A;  5H2F Z;  2ZE6 A;  1GH6 A;  4DV1 O;  4DUZ O;  2WLI A;  2AGA A;  2Q7G A;  1DGS A;  2Q7H A;  3BVO A;  2VS0 A;  3CB2 A;  4O4J A;  3K03 A;  4LWS A;  4JYC A;  3FD9 A;  3T1Y O;  2XHB A;  2QTO A;  1GAX A;  1GKF A;  5B1O A;  3SPG A;  1FAF A;  1KEC A;  4DR5 O;  5LMU O;  4EFB A;  2YXL A;  4X89 A;  4GYC B;  1GN3 A;  1K5Q A;  1GRJ A;  3CC7 V;  3SYQ A;  3QVN A;  1FXK C;  4PDV A;  3ZMZ A;  2L35 A;  3JAW A;  4O2A B;  4JI3 O;  1G4Y B;  2DYR B;  4JI4 O;  2HKO A;  2X6A A;  5JJJ B;  5L3E A;  2K9P A;  1QLE C;  5KAF Z;  1Q3E A;  4C7U A;  4FM1 A;  3HKD A;  1B04 A;  1P7B A;  1RPR A;  1QLE B;  4CS3 A;  2PGG A;  4JI6 B;  1OCZ C;  2IJJ A;  2YIC A;  3DXR B;  3UQ8 A;  1OCR B;  3HKB A;  2EIN B;  1NTZ H;  1Z5W A;  4GCZ A;  4PV1 B;  4KL1 A;  4G27 B;  2KB1 A;  2KSD A;  1JCH A;  2YIB D;  3LSS A;  1B06 A;  2ITC C;  2XAQ A;  3K5M A;  5KHI A;  4UUJ C;  1E1Q G;  3QTC A;  1R3L C;  1HNW B;  3ABK B;  1BQ0 A;  3N2G A;  3SR2 C;  4LNU A;  2LGQ A;  4BWA A;  5IJ9 B;  1K33 A;  3M7M X;  3CP1 A;  2IJI A;  4FLT A;  3ZMU A;  4YIP A;  4WFG A;  3CRQ A;  1IBL O;  1VQN V;  4FLW A;  4H44 B;  2P22 C;  2WPD G;  2OCC B;  3CRM A;  5ITZ A;  2FKX A;  4GX1 A;  4J7K A;  3BEH A;  1N33 O;  1YXB A;  1Q6U A;  4CH3 A;  3W7X A;  3IC9 A;  1P49 A;  4JI3 B;  2Y69 C;  2M7W A;  5CMU A;  4JAV A;  1BQZ A;  4FLY A;  2QTS A;  3RWR D;  5KHK A;  2EIM B;  4PA7 A;  1OCO B;  5HFM A;  4DW0 A;  2CE4 A;  2PTM A;  1VF5 B;  3K5L A;  4U7O A;  4OPH A;  2DN9 A;  4K8X A;  2FTK A;  2P5O A;  1K3E A;  2OCH A;  2HJF C;  4LR3 A;  4H0L B;  3L73 H;  3F5W C;  4JI1 B;  1TVK A;  3M99 B;  4TV8 B;  1KKD A;  1Y74 A;  3MHH C;  1ZLZ A;  3GWK C;  2BTQ B;  3SGI A;  2UUC B;  2B1I A;  4QGP A;  2MW2 B;  4PD4 F;  5IJ0 B;  2F4V B;  3BCC H;  4MVR A;  1QNM A;  4ZI7 A;  1QLN A;  1G1X B;  3ZMV A;  4PDL A;  3RYI B;  3DC5 A;  4YJ3 A;  3G4S V;  4ASU G;  3ML0 A;  1NTM H;  3SPJ A;  3SJA C;  2W0X A;  4JI2 O;  1IXM A;  4B3T O;  5GTI Z;  5F2V O;  2B5U A;  1U96 A;  1NU1 H;  2JJ1 G;  4WBN A;  4JZG A;  2P4V A;  2DJV A;  1XL4 A;  3JD2 A;  4K3A A;  2YIA A;  3QNE A;  3T1H O;  5KAI Z;  3IAY A;  3CRC A;  4PA9 A;  1M56 B;  2JEX A;  2Y4T A;  1XMO O;  1HNX O;  4D6T H;  1K7D A;  2YC0 A;  1OV9 A;  1XNR B;  4I5S A;  1XNQ B;  4O4L A;  4U3F H;  2VWK A;  4NXN B;  4J7Z A;  1IBM B;  2HHH O;  1EN4 A;  1H8E G;  1LR1 A;  1GMG A;  1PNK A;  1XL6 A;  5IY5 C;  3IGA C;  2EX3 A;  3EXA A;  3OTF A;  4GT1 A;  1GK9 A;  2LFS A;  3G6B A;  1MSW D;  4P9O A;  2KG7 A;  4Q20 A;  4I55 B;  2YS8 A;  3MAQ A;  1BE3 H;  4D7S A;  1CP9 A;  1H2L A;  4HYO A;  2Q5Z A;  3H9V A;  3B2E E;  4H33 A;  3W7T A;  2WLI B;  1AB3 A;  1KKC A;  3C3T A;  1V55 C;  1J5E O;  3ZBH A;  3D36 A;  2EJR A;  5IJ9 A;  4B7E A;  1QR8 A;  1IBL B;  1QU7 A;  4DK1 A;  1SQF A;  1YSC A;  2OYQ A;  5BMV A;  3GB7 C;  4ZOL B;  5KA6 A;  2D3O W;  2ZNI A;  1OHH G;  1RFY A;  4RQF A;  3ZRV A;  1H2M A;  1I94 O;  4QPJ A;  1H8H G;  5DEC A;  1WB7 A;  4UXN A;  1NI8 A;  1Y67 A;  3E8H A;  1M57 B;  3SYA A;  4HBN A;  4FK5 C;  4CH4 A;  4CS4 A;  2YUA A;  4DO2 A;  2E74 B;  3APO A;  2FML A;  1QCE A;  1R6N A;  3PJS K;  4ZI7 B;  2ODM A;  5TIS Z;  4YIO A;  3NR7 A;  3HKE B;  4DV7 O;  3OW2 U;  1NT2 B;  4KUM A;  2JJ2 G;  2NNU A;  1EBO A;  2JIZ G;  1XUQ A;  3CX5 F;  4LFB B;  4K8Z A;  1XBL A;  2H3O A;  2HLD G;  1H2K A;  4LF6 B;  4AIL C;  2V4D A;  1LUW A;  2AHZ A;  2Y4U A;  4AI8 A;  3ASO B;  5EYP B;  2R70 A;  5LA6 B;  4LFC B;  5GW7 A;  1XHX A;  1IDS A;  1MA1 A;  1VQP V;  2WLJ A;  2OCC C;  1N32 O;  4ZBM A;  4KHP B;  1AI6 A;  5IJ0 A;  3WFV A;  1TUE B;  4HZ3 A;  4DUZ B;  2PZS A;  4DR6 B;  4FZ0 A;  3FYI B;  4UCT A;  1K4D C;  1JVM A;  4I9Q A;  4CH5 A;  3SJB C;  2PUS A;  2GDS A;  3ABK C;  1D5A A;  1PD3 A;  1YI2 V;  3A0B Z;  3K06 A;  1VQ8 V;  1AIL A;  3DSQ A;  3IJ4 A;  1RP3 B;  4TWK A;  4O4I B;  1RM1 C;  5KMG A;  2HR3 A;  4JTD B;  3K08 A;  1L1F A;  1WN7 A;  4B3M O;  3ZMS A;  1SER A;  5EK0 A;  4MW8 A;  4JI1 O;  2DMX A;  3RYF B;  1K34 A;  1VQ7 V;  1F7Y A;  4F6R A;  2ZE5 A;  3ZRS A;  4LCU C;  3B8N A;  4XDL A;  4TOI A;  5DN6 G;  4HAM A;  1COW G;  4NTY A;  1NKD A;  3RN4 A;  3DTU B;  1V55 B;  4YJ2 A;  1GM9 A;  1KB9 F;  1Q86 W;  2EIN C;  1OZ0 A;  1ZL8 A;  4HNA A;  2ZD9 A;  5A2Q N;  4TV9 B;  4GUN A;  4JI5 B;  3CME V;  2NN4 A;  4MS2 A;  3JAM N;  4H37 A;  1OJH A;  4QIW F;  2XAS A;  2CH7 A;  3ZRW A;  5L3F A;  1SQP H;  3UM7 A;  5J2U B;  4R8C A;  2UXX A;  5BMV B;  4YJ3 B;  2HEP A;  1S5L Z;  1JA8 A;  4DR7 O;  4H13 B;  1F51 A;  1I0H A;  2Q67 A;  3ZIA G;  3OGC C;  4DK0 A;  2QEX V;  2E76 B;  5CA0 A;  1WNS A;  3M8A A;  2RN9 A;  1SZX A;  4DV2 B;  1VQ4 V;  1YTF D;  3AG2 C;  4X20 A;  2X7R B;  1PM9 A;  2F95 B;  2IH3 C;  1KP2 A;  4XDJ A;  1OCC C;  4FJC C;  1AJP A;  1DF5 A;  4MT8 A;  5JCO C;  3K57 A;  4PJ0 Z;  2IW5 A;  2B1G A;  4P30 A;  3D8C A;  3OD4 A;  1V54 C;  4LH7 A;  2CK3 G;  1HNZ B;  4DW1 A;  4BIU A;  4UCV A;  1XQ8 A;  3B09 A;  3SJQ C;  1S5J A;  5JQG B;  1YJN V;  3BA9 A;  3EVK A;  1FFX B;  3JSL A;  3JCU Z;  4F6E A;  4MVU A;  4K0K B;  3QO8 A;  1M1K W;  4DRX A;  2PYJ A;  4AHC A;  4FVM A;  1JX9 A;  4Z1M G;  2K1E A;  4FLX A;  4EB6 B;  2WA3 A;  1L0L H;  1OCZ B;  4B08 A;  2ZIO A;  2EZO A;  2IU3 A;  1PL4 A;  2WLM A;  4I50 A;  1AI4 A;  3E86 A;  1YIJ V;  1B6Q A;  1NZ6 A;  4QE7 A;  3E8B A;  4DV0 O;  4LF5 O;  3TGU H;  2DE0 X;  5H6Q A;  1NVP D;  1GM7 A;  4AQY O;  4GKJ O;  4G2K A;  4O4L B;  1ZSP A;  3BFR A;  4J80 A;  5K1X A;  1JFF A;  2EZP A;  5IYD O;  2JRI A;  5KMG B;  3E8F A;  2GTS A;  3RYC B;  2NR5 A;  2W6I G;  5EBW C;  5LL6 Y;  3LNN A;  5KUK A;  2RCV A;  2DYS B;  4UCO A;  4MTO A;  4B7K A;  2XAH A;  4FPP A;  2UXD O;  2ZNJ A;  1XMO B;  4JAA A;  1ZAU A;  4DXW A;  2H94 A;  4X1K A;  1VQ6 V;  3B77 A;  4X1I B;  3J81 N;  2Y0P A;  2A3Q A;  2ZM6 B;  1SKV A;  4TV9 A;  2Q4P A;  1IZ3 A;  2FB5 A;  1BT8 A;  1YIT V;  2A9H A;  4I7Z B;  5FLX N;  4DR4 O;  3CJH A;  5KX5 B;  2XTA A;  3UO2 A;  3RYF A;  1H2G A;  3OTO O;  1BHB A;  1BHA A;  4FFB B;  2QWO B;  1CEZ A;  1SS3 A;  3ZHT A;  3MD0 A;  5C93 A;  5CA0 B;  4I9W A;  3CXH F;  2F4V O;  3K59 A;  2QWR B;  1I7F A;  3FFQ A;  3SDL A;  3I5D A;  1VEW A;  1UFI A;  4DR1 B;  3ZJZ A;  3FYE B;  4FMT A;  5GON B;  5L3B A;  2YDE A;  5LBQ A;  2Y0I A;  2JGD B;  3AK3 A;  2IJH A;  3L75 H;  3W7U A;  3OMA B;  4O2B A;  4JYB A;  3SJC C;  5IY5 B;  5J2U A;  2F23 A;  1A32 A;  4TSF G;  4IHJ A;  3PN1 A;  3SYO A;  1PP9 H;  2HFE C;  2Q69 A;  2BTO A;  1NJI W;  4DUY B;  2L6L A;  2CTW A;  1NR7 A;  1GN4 A;  3KCY A;  5BR8 B;  5JCO A;  1IBM O;  3HKD B;  1GN2 A;  1H2S B;  4X62 B;  5H9C A;  5CA1 B;  3CSX A;  3KZI Z;  4LF5 B;  1YCI A;  3DXR A;  4DV3 B;  4NYK A;  2QA4 V;  2UXN A;  2HVK C;  3FB7 C;  4ICG A;  5IE9 A;  4DV7 B;  4UCR A;  2DW4 A;  2XOK G;  3OMI B;  5B66 Z;  3RFR A;  2ETN A;  3ZHQ A;  1T5E A;  4QE9 A;  2X0L A;  2OIG A;  5IDJ A;  1R3J C;  4J10 A;  3L72 H;  2WSS G;  1MZE A;  5EZY B;  2HG5 C;  4FLU A;  3ZN1 A;  5LMN O;  4A5U B;  2YID A;  3STL C;  3X2Q B;  4DR3 B;  4X65 B;  4LF9 B;  4GZR B;  4LF6 O;  3AG3 B;  1X4T A;  2R9R B;  4TUY B;  2XUM A;  3A8T A;  1H38 A;  5DED A;  3CCQ V;  2OT5 A;  2QKS A;  5LXT B;  3G6E V;  1AJQ A;  2JS5 A;  4WFH A;  2Q68 A;  1XOU A;  3OAA G;  2A7W A;  3TXS A;  3T4D A;  1LUV A;  4YY3 O;  1AP6 A;  2AZ0 A;  2ZR2 A;  2Q6A A;  2BOB C;  5KUM A;  2IM9 A;  1NBM G;  2CTR A;  4I4T A;  3APQ A;  4L87 A;  1SF9 A;  4QJF B;  4GLX A;  1K97 A;  1RPO A;  2Q73 A;  2H8P C;  3BAA A;  3FX7 A;  4G28 B;  2N04 A;  4U3J A;  5JQG A;  2Y69 B;  4Z2W A;  2WLL A;  2GUZ A;  3P32 A;  2CTQ A;  4UV8 A;  3JD4 A;  3H1I H;  3BAB A;  3T1Y B;  2WA4 A;  1NS1 A;  5AG2 A;  3ZCC A;  2ZDI C;  3CCJ V;  3AK2 A;  1G8M A;  4TQD A;  1KC8 W;  3Q4H B;  3IC7 A;  3AG7 A;  4N23 A;  3X2Q C;  1JR9 A;  5FPO A;  2EJ7 A;  4O4J B;  2LP7 A;  4LWS B;  4B3S O;  4Q6G A;  4JTA B;  4UV9 A;  1PNM A;  3ZS8 C;  3WB0 A;  3OR7 C;  2Q7E A;  4WF9 V;  1BZK A;  2A06 H;  1YEW A;  4JI7 B;  3LDE A;  5LGN A;  3JAW B;  4O4H A;  3K9A A;  4X9Q A;  4LNU B;  1WLE A;  3QO5 A;  4NVP A;  2D2C B;  3VOU A;  3HPL C;  1AJN A;  4JI2 B;  4DV6 B;  4NXN O;  4DV2 O;  3LSU A;  3SYC A;  5A9G A;  1OCC B;  1N32 B;  5LMN B;  1KBH A;  1Q7Y W;  5IYZ B;  3N2K A;  1NQT A;  3HKC A;  3AEI A;  3LDC A;  3T1C A;  4ZKI A;  1VQO V;  4U7N A;  1BCC H;  3AG1 B;  3A0R A;  1WP7 A;  2ZR3 A;  1ZX3 A;  5JH7 A;  1HR0 O;  3FB6 C;  2E75 B;  3QG5 A;  2BOC C;  3OEH G;  1PNL A;  2R72 A;  2XAJ A;  4P2Z A;  3K9S A;  4BIO A;  4FM2 A;  4JI4 B;  1DK1 A;  1RSO B;  4MTX A;  1Q8I A;  2EIK B;  5BXZ A;  3OUF A;  4NB5 A;  3JYC A;  2CTP A;  5EC1 C;  4NR1 A;  5LP6 C;  4X1K B;  4UVB A;  1OCR C;  1FD9 A;  4WFB V;  2QDO A;  4OPA A;  4W4L A;  1FXH A;  2IU0 A;  4MVS A;  3FAV A;  3JAT A;  5LOV A;  1SQG A;  3LSQ A;  5IT9 N;  3DGE A;  1MAB G;  2YIB A;  3ASN B;  1W0K G;  2PI4 A;  1BS3 A;  4B3T B;  3ZHU A;  4IL6 Z;  1VQL V;  1SET A;  1XEQ A;  2G38 A;  1W2B U;  1S5H C;  2JVD A;  3TCU A;  1MMM A;  2LFR A;  1ROP A;  1R3I C;  1VF6 C;  3ETD A;  4WBN B;  2P90 A;  4NTX A;  3SYP A;  2Q0A A;  2YEV B;  3JAL A;  4DV5 B;  1HWY A;  4GX0 A;  5BR8 O;  5CA1 A;  2UUA B;  1FJG O;  3W7S A;  2ITD C;  3AG4 C;  3OT7 A;  4B3S B;  2Q0O C;  2UU9 B;  4E4E A;  3CE2 A;  2RJZ A;  1IXB A;  3CRA A;  3P30 A;  4DR2 O;  1K73 W;  3ETE A;  2LQT A;  4KFM A;  1K5S A;  2QR4 A;  4ZOL A;  4DR4 B;  3D3Q A;  2WLH A;  1SQQ H;  3TXQ A;  5IYC O;  4OX9 O;  5EIB D;  1THZ A;  1BMF G;  4YHH B;  3LNM B;  3I55 V;  3BRC A;  3BY6 A;  1W59 A;  5B1N A;  2DQ3 A;  2Q9L A;  4DR1 O;  2ZCE A;  3CCM V;  1SA0 B;  4OX9 B;  3VBB A;  3ZX6 A;  5B1B C;  3CCS V;  1NVP B;  4JYY A;  2FL4 A;  3F5T A;  5LP6 B;  2WLN A;  2IJK A;  2GHY A;  2DWE C;  5FL7 G;  1F4M A;  1Y6X A;  1UJW B;  3W7W A;  1WB8 A;  4JI0 O;  4GKK O;  4J42 A;  1NH2 D;  3E2E A;  1VAR A;  2JK5 C;  3ABT A;  3ZHR A;  3E8G A;  4XDK A;  3JAK B;  3ETG A;  4FLV A;  1RSO A;  3ABM C;  3IFX A;  4IYI A;  4O4H B;  4CC6 A;  1QBZ A;  3E35 A;  1E1R G;  3AG1 C;  1KU9 A;  4X66 O;  3CCV V;  4JI8 O;  1IVS A;  3WB2 A;  4U3J B;  3SPI A;  2IH1 C;  3P3P A;  2UUA O;  3BPZ A;  1KMI Z;  4MW3 A;  1R6T A;  2YXY A;  4KXR A;  1ZL8 B;  4HNA B;  3UKM A;  1PPJ H;  1J5E B;  4PI2 A;  1NH2 B;  4UB6 Z;  2OIE A;  4IIJ A;  1M4U A;  2LJ2 A;  2RNB A;  1M57 C;  5IWA B;  3EFF K;  3CC2 V;  1ZWI C;  1V54 B;  4DV4 B;  4I4T B;  2QKC A;  2OTJ V;  3H1K H;  4WFE A;  3I56 V;  2RQ6 A;  3E22 A;  2VRZ A;  1Z2G A;  2UU9 O;  4X88 A;  3VQV A;  1F23 A;  5EBM C;  4R50 A;  4LC1 A;  4MVM A;  1P7G A;  4JZ2 A;  4JGS A;  1N36 B;  3G71 V;  5LOV B;  1FXV A;  3B4S A;  4CH6 A;  1TGO A;  3DC6 A;  2VQF O;  2AZ2 A;  2W0F C;  2QSA A;  3ASO C;  2VWJ A;  5LGT A;  2VQE O;  1N8R W;  2QM4 A;  1JMK C;  1K4C C;  2PYL A;  3VQX A;  1VF6 A;  3AG2 B;  1X59 A;  1CPY A;  1QVF U;  5JJN B;  2R9A A;  4JV5 O;  1K92 A;  2N05 A;  3RVY A;  4NTW A;  1SA0 A;  4PA6 A;  3ICX A;  4N21 A;  3STZ C;  1Q82 W;  4WFA V;  3JD0 A;  5LHH A;  3S3X A;  1JJ2 U;  4PEL A;  3S3W A;  1R1B A;  3L74 H;  3JAS A;  4RUE A;  2UXC O;  1HDJ A;  1SQV H;  4X64 B;  1UPG A;  4EFE A;  2F1M A;  3B40 A;  4YJ2 B;  1F4N A;  5IYZ A;  4UCS A;  1SRY A;  1AP5 A;  4X8A A;  4JYA O;  5B1B B;  2YI8 A;  3ABL B;  3RYH B;  3WU2 Z;  1XRE A;  4MSW C;  1N36 O;  2OTL V;  5JH7 B;  3JAK A;  1XI1 A;  2EIL B;  1B3Q A;  3G67 A;  2ZE8 A;  4JPR A;  4DV0 B;  1JPX A;  1WA8 A;  4FZ1 A;  4TQF A;  3EHB B;  4LF7 O;  3WG7 B;  1S3J A;  3ASN C;  1MOF A;  3SPH A;  3CC4 V;  3THO A;  1NR1 A;  5C8Y A;  1W0J G;  3K04 A;  2LGW A;  4JAU A;  1XIL A;  2ZXW B;  1TA8 A;  2PI5 A;  2WWW A;  2X6B A;  4JYA B;  1M56 C;  2E3C A;  2UUB O;  4YY3 B;  2F43 G;  2EUL A;  3CJH B;  2QM8 A;  5KHG A;  5FNV A;  3UCS C;  1FXK B;  5BY1 A;  4K0K O;  4X1Y B;  2UXC B;  1I5Y A;  4X66 B;  4JI0 B;  4GKK B;  1VQK V;  1AVM A;  2V7Q G;  5ITZ B;  1Q81 W;  1TUB A;  1S72 V;  2GBO A;  3K3W A;  4FFK A;  4OXS A;  3ABU A;  4O2A A;  3T4Z A;  4PA3 A;  1N0N A;  2BTQ A;  1GO3 F;  4X20 B;  1ZUQ A;  1QHT A;  4I50 B;  1ZTE A;  1WPB A;  5EC2 C;  4KP4 A;  4TT3 G;  1HNZ O;  2E5L B;  5CB4 B;  4O2B B;  5JWP A;  4RAI A;  1O9H A;  4LH6 A;  3RYI A;  1FPO A;  2YI9 A;  2CDY A;  3D36 C;  4FFB A;  5JJE B;  4DR7 B;  2ZXW C;  4QPK A;  4JI6 O;  2LO1 A;  1YJW V;  1FFX A;  1WJZ A;  4L8J A;  3QF7 A;  4J11 A;  1ARO P;  4YHH O;  5CA3 A;  1FFT B;  1S0V A;  3E83 A;  4LF7 B;  4JI5 O;  5LHG A;  4CS2 A;  3JAR A;  2XND G;  4QNH B;  1EN5 A;  3K58 A;  4RUF A;  1GN6 A;  4GKJ B;  4DR5 B;  3HKB B;  1I94 B;  4DV6 O;  2M6Y A;  4X1I A;  4DV4 O;  5EIB C;  1XMQ B;  3ZMT A;  3CPW U;  4DR3 O;  4B3R O;  2EIL C;  4LF4 B;  5B1A B;  5KHH A;  3JCZ A;  3HB3 B;  2VQE B;  4R6Z A;  3K0G A;  4DV3 O;  1JOY A;  4FIP C;  3FKS G;  4BW9 A;  2C2A A;  2ZQM A;  3OFN G;  1HNX B;  4BAY A;  2A79 B;  1S76 D;  1WA8 B;  1XDC A;  4B3M B;  4Z1V A;  3CCR V;  1H2N A;  5K1P A;  3F7Y C;  1MSD A;  3OE7 G;  1OCO C;  2NLJ C;  2QGN A;  3R66 A;  2ADP A;  4WCE V;  3K0D A;  4PA4 A;  2OWO A;  1Y66 A;  4LFC O;  4R7C A;  4KHP O;  1YF2 A;  5D5P A;  3MDS A;  5CBF A;  3NXS A;  3TET A;  4CZZ A;  1AR5 A;  4GX5 A;  3RBZ A;  5FNV B;  3E89 A;  4FM0 A;  2P6J A;  2KKW A;  3K5N A;  2HJD A;  1DTO A;  4MTF A;  1V9P A;  2WLL B;  3U0Z A;  3CXC U;  4J9Z B;  2XAG A;  3FB5 C;  3AK1 A;  4GX2 A;  1E79 G;  3K79 A;  1IBK O;  5H6R A;  2UXB O;  2O57 A;  4EEQ A;  1Y76 B;  1N4C A;  1PV0 A;  2E5L O;  2JDI G;  1TVK B;  3ZHS A;  3Q4H A;  5IYB O;  1AI7 A;  5J2T A;  4OGQ B;  2HP8 A;  5GON A;  5CB4 A;  3ABM B;  3JAS B;  1GM8 A;  4LF9 O;  3CEI A;  4IYH A;  1M93 A;  4IHJ B;  4RWU A;  5JVD A;  2UXD B;  1M90 W;  4MVO A;  3BA8 A;  4JTC B;  3TK1 A;  5KHJ A;  3ABL C;  1Z5V A;  4NXM B;  4IGG A;  2MK3 A;  1N34 O;  1MG1 A;  3JAR B;  2XAF A;  2DYS C;  1M9N A;  4B3R B;  5L3C A;  2WLK A;  3N27 A;  1XMQ O;  1WAZ A;  4P9P A;  3N2K B;  2UUB B;  3AG3 C;  1Q5O A;  3GWO A;  1WP8 A;  1JQ0 A;  3U10 A;  3H1H H;  1XHZ A;  1CXZ B;  4UCU A;  2HHH B;  3OGI B;  3RYH A;  2KQX A;  5HFL A;  5IWA O;  3U11 A;  4CBC A;  1P4R A;  4NKG B;  1IX9 A;  2B9Z A;  1EZV H;  1FXK A;  2AXT Z;  1IBK B;  2UXB B;  4NXM O;  3AG4 B;  2ZT9 B;  1XNR O;  1BGY H;  1SES A;  3SPC A;  2PY5 A;  1Q90 D;  3ZED A;  1I5X A;  1YVW A;  2ZE7 A;  3JD3 A;  3P3N A;  2JEU A;  2Z0A A;  2KG7 B;  1TUB B;  4FLZ A;  1FYJ A;  3HKC B;  5C8Y B;  3L71 H;  1QQC A;  3VQY A;  1SZT A;  2A0L A;  2QWP B;  1DLB A;  4X65 O;  1XNQ O;  1US6 A;  3KKY A;  2LW1 A;  1O9G A;  5L3G A;  1PL0 A;  3H01 A;  4O4I A;  3T1H B;  3CYO A;  1HNW O;  2Y48 A;  3MHS C;  5B1A C;  2W6J G;  2CH7 B;  2CGN A;  3ZRW B;  1K8A W;  3HKE A;  4PI0 A;  4X1Y A;  3H1J H;  3CS5 A; 
#chains in the Genus database with same CATH homology
 4DV6 O;  4DR2 O;  2N74 A;  4OPH A;  4DR5 O;  4DV4 O;  5LMU O;  4LF7 O;  4LF8 O;  4DR3 O;  2UU9 O;  4OX9 O;  4B3R O;  2UUC O;  3J80 N;  2F4V O;  1AIL A;  4YY3 O;  3SDL A;  1AB3 A;  1HR0 O;  4JI3 O;  4DV3 O;  4JI7 O;  4JI4 O;  2UUB O;  1J5E O;  4LFA O;  4DR1 O;  1N34 O;  1DK1 A;  1YZB A;  4LF4 O;  2VQF O;  4B3M O;  4JI1 O;  5BY1 A;  2VQE O;  1F7Y A;  5BXZ A;  2ZM6 O;  4K0K O;  1D2D A;  1G1X B;  3F5T A;  1XMQ O;  1A32 A;  1FKA O;  4DV0 O;  4LF5 O;  4JI2 O;  2ZKO A;  1I94 O;  4B3T O;  4AQY O;  4GKJ O;  3R66 A;  1X59 A;  5H5N A;  4JI0 O;  4GKK O;  1NS1 A;  4X62 O;  5A2Q N;  4OPA A;  4LFC O;  4KHP O;  4DV5 O;  2JRI A;  2DJV A;  4JV5 O;  5IWA O;  3JAM N;  5IT9 N;  1IBM O;  3T1H O;  4NXM O;  5LL6 Y;  1HNZ O;  4DR6 O;  1XNR O;  4LFB O;  4X66 O;  4X64 O;  1R1B A;  4B3S O;  4JI8 O;  1IBL O;  4DV7 O;  1XMO O;  2UXC O;  2UXD O;  1HNX O;  3RT3 C;  4DR7 O;  2UUA O;  1XEQ A;  2Z0A A;  1R6T A;  2LW7 A;  3J81 N;  2DOS A;  3O65 A;  4JI6 O;  1KUQ A;  2FKX A;  1IBK O;  2UXB O;  1FYJ A;  3M8A A;  4JYA O;  4DV1 O;  1N33 O;  2E5L O;  4DUZ O;  4YHH O;  4X65 O;  1XNQ O;  2AGA A;  1N36 O;  2HHH O;  5BR8 O;  5FLX N;  1HNW O;  1FJG O;  4DR4 O;  4JI5 O;  5LMN O;  4A5U B;  4DUY O;  1N32 O;  3J7A U;  4NXN O;  4DV2 O;  3T1Y O;  4LF6 O;  3OTO O;  4LF9 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...