1X4TA

Solution structure of isy1 domain in hypothetical protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
GSSGSSGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords hypothetical protein LOC57905
publication title Solution structure of Isy1 domain in hypothetical protein
rcsb
source organism Mus musculus
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1x4tA01
3CSXA 2F66C 3ICXA 3QF7A 3THOA 2P22C 3B2EE 3ZS8C 2CAZC 2JS5A 1SKVA 1NT2B 3SJAC 3SJBC 1X4TA 3SJCC 3QG5A
chains in the Genus database with same CATH superfamily
3N2GB 4QE9A 4LR3A 4DW1A 1O9HA 1Q81W 4X1YA 5H2FZ 5EZYA 1WJZA 3AG4B 4TSFG 2E3CA 1Q3EA 4AILC 3ZBHA 4P2ZA 4FM2A 3LSSA 3E22B 5EYPB 1PV0A 2UXDB 1BGYH 1IX9A 4N21A 3A2FA 4IIJA 3IC7A 1RSOB 2IW5A 2CTRA 1EN5A 3JARB 4PDLA 4PJ0Z 1VQMV 1HNXO 2EIKB 2F4VB 2UUAO 3X2QB 4TQDA 4HYOA 1SS3A 1W2BU 2XAHA 3KKYA 3TGUH 3ZEDA 3ZCCA 4JI6O 3U0ZA 2IU0A 1WN7A 5JWPA 1F7YA 3KG2A 4JZGA 2BTQB 2YSUB 1HNWB 4TV9A 5TISZ 3HKCB 3P3PA 3SPHA 3SYCA 3BA9A 4NTXA 4EEQA 1QLNA 4O4IB 3TK1A 4DRXB 1Q6UA 4JI3B 4BIOA 1BHBA 1YCIA 3CXHF 4X88A 3Q4HA 2IH3C 1IVSA 1FXKC 2OT5A 1OCOC 3G6EV 1Y67A 1HNXB 4Z2WA 1ROPA 2YXHA 3H1JH 4JGSA 3ABTA 2RCVA 3OD4A 4TUYB 2CGNA 4B3TO 1BMFG 5LP6C 3W7UA 2PYLA 1XMQO 2VWKA 5LMNB 1KUQA 1K5QA 1OJHA 1E1RG 1PPJH 4DO2A 1D2DA 3RYHA 2ZE7A 3HKDB 1G4YB 1GTOA 4X89A 3BA8A 3FAVA 4XDKA 1IBKB 2HHHB 1K5SA 1TA8A 1VF6C 1BHAA 1Q5OA 4OPHA 2R70A 1J5EO 3H1KH 2KQXA 1Q90D 4UV8A 1JPXA 1YSCA 2Q9LA 3GWOA 5HFLA 1NS1A 3MHHC 3LDEA 1QVGU 1K92A 2HJFC 3BAAA 5H6RA 4LF5B 4DV2B 1NR1A 1GMGA 3FB6C 4PHZA 4WFBV 3ZHVA 4J41A 4YY3O 3BY6A 1V54B 5IWAO 3N2KA 4X65B 3IC9A 4CH4A 2QA4V 2ODMA 4NB5A 1M56C 1KC8W 4I9WA 2UXBB 3ZHQA 2QM7A 4F6RA 1DLBA 3A0HZ 2OWOA 1UFIA 2R9AA 3K5NA 4NR1A 1Y76A 4UFZA 5LYJB 5GONA 5LXTA 2R9RB 3RYFA 3R65A 2AW9A 3N27A 2FTKA 5B66Z 3EVKA 1WPXA 3TXSA 4O4LA 3K57A 1AB3A 1YXBA 3CRQA 3JAKA 3OEEG 3ZIAG 1VQNV 5J2TA 1QVFU 2W6IG 5EIBC 1ZL8B 2ETNA 4JTCB 5L3GA 4FLYA 2Y0IA 1FXKA 3H9VA 2OCHA 3OTOB 4QE7A 3ICXA 2VQFB 4DR4O 4FM0A 1NR7A 3ZRWB 4DR6O 1EN4A 5LA6A 1SETA 2OIEA 1H8HG 2A0LA 3L70H 3AG3C 5CB4A 4DXWA 3JASB 5KAIZ 4U7OA 5LGNA 4UCRA 5LP6A 1NKDA 1ZAUA 1VP7A 2ADQB 1B04A 4X1YB 4IT5A 5EZYB 2LGQA 3BFRA 2BSKB 2ZXWC 2EIJB 1N34O 1HR0O 1NI8A 4DV5O 4F4LA 5BY1A 1KECA 3JCZA 4MW8A 4PELA 4JI7O 3T1CA 2V1DA 2FYUH 4IIJB 4CBCA 4EKWA 3SPGA 2YIAA 1W59A 1N33O 3IJ4A 2HVJC 3AK3A 4O4JA 4AQYB 4FFBB 4D7TA 5KHJA 3EFFK 1NJIW 5C93A 4LFBO 5IJ0A 4MVUA 3WB0A 2CH7B 4Z1MG 1K4CC 4I0XA 2DWDC 2H8PC 3JSNA 2IH1C 2QWNB 1HNZB 4TV9B 4CC5A 4JV5O 4D6TH 1RP3B 1KMIZ 3BPZA 4CH3A 4DV7O 1YJWV 3HKBB 3SPCA 2WLIB 3ML0A 4J10A 1UJWB 4FMTA 3RFRA 1S76D 3Q4HB 1YI2V 4O4HA 1EZJA 2F93B 1GRJA 1FJGB 4X62O 2OCCC 2JEUA 1QHTA 2JGDB 3SPIA 3ETQA 5B1AB 3DTUB 1NTKH 1DK1A 4B3SB 1S77D 3FB5C 1VEWA 3GWKC 2ZKOA 1JQ0A 5CN0A 1GKFA 2P06A 4KHPO 3RYHB 1D5NA 3P3NA 3ZMUA 3STZC 3FAVB 3ZMSA 4CS3A 1Q6IA 2RN9A 3MD0A 1RPRA 1TAEA 1QBZA 1I08A 1K3EA 1R6TA 3OM3B 3JATB 3SJQC 3MAQA 5C8YA 5EBLC 4DR3B 2LW7A 1AJQA 1MG1A 2EZOA 4MVOA 4UCSA 2B5UA 4CS2A 4J42A 1EFRG 2KG7A 3W7SA 3DC5A 1MSWD 5BZBA 1YEWA 1YJNV 4BWAA 3STLC 1SF9A 4H37A 1SQVH 5L3FA 4WFHA 4GYCB 1GO3F 3ZN0A 3QO5A 3VQWA 4PA7A 3G4SV 4QGPA 2HFEC 2QM8A 1IBMO 4PA6A 1N32B 5LGUA 4B7KA 2WLMA 2N74A 4XDLA 4F6RB 3RYCA 5KMGA 5LHIA 3SDLA 2L6LA 3CCEV 4UVBA 3I56V 5GONB 5LXTB 2YIDA 4DV0B 3RYFB 2PGGA 4UCUA 2Q5ZA 1JJOA 2QWOB 2PZSA 5LOVA 3JAWB 4LF9B 4ZIBA 5J2TB 4DR1B 3JD0A 5A9GA 1B3QA 1DF4A 3W7XA 1FXKB 2UU9O 1OCOB 3AG7A 2DJVA 3K59A 4G27B 1R6KA 5LA6B 1ZX3A 5L3BA 4JI0B 3E89A 2HR3A 4DUYB 1Q43A 5CB4B 4K0KB 1WLEA 5FNVA 3ZRVA 2C2AA 3ETEA 5LP6B 4B3MB 1BQ0A 2IJJA 2WLLA 3G80A 1H2KA 4TQFA 2X0LA 3LSQA 4JYYA 1FFXB 1I94O 2YC0A 4I5SA 1WP8A 3K3WA 2QKCA 3B40A 5LHGA 1S3JA 3G6BA 2JEXA 2XAFA 2P5OA 1KKDA 3U10A 2JVDA 3M8AA 4DYLA 1GN4A 3FB7C 4FLZA 2QWPB 1P4RA 2VQEO 4YJ3B 2YUAA 3CHXA 3ZMVA 1YZBA 1I7FA 4RUFA 1OZ0A 3F7YC 2LGWA 4NXMB 1WAZA 4O4JB 4G2KA 2GBOA 1JMKC 5KHKA 5IJ0B 4DR5O 3LDDA 3JYCA 2NN4A 1IXMA 4I0XB 1IXBA 2A79B 3W7TA 1QU7A 1EM1A 1I0HA 4JI1O 1Q8IA 5BXZA 4WCEV 2B1GA 3J7AU 4GX2A 3ZHTA 3F7VC 1M56B 2CE4A 2E5LB 3UM7A 2VWJA 1L8DA 1QR8A 4NYKA 1PL0A 1YTFD 3HKEA 2PY5A 2FKXA 2QKAA 3OEHG 2QGNA 1ORQC 1XNQB 3SPJA 4I55B 4PI0A 1AVMA 4JI2O 5IYZA 3NXSA 3CCRV 1FFTB 2V7QG 1BT8A 1FXHA 5JQGA 4GKJO 2RMKB 4GKKB 3JD3A 4QNHB 1K7DA 3T2MA 1XNRB 3QTCA 2ZM6B 1XOUA 1DTOA 1R3IC 3E8HA 1TUBA 3AG3B 1LUWA 4H33A 1RFYA 5LGTA 1R3LC 1AI7A 2BE3A 1WPBA 3QVNA 1K33A 2E74B 1KYOF 5C8YB 4FLVA 4DV4B 3G67A 2ZXWB 4LC1A 1SZXA 2MK3A 1NVPB 1COWG 1N0NA 2GTAA 1M1KW 2YEVA 4ZOLB 4I4TA 4MTOA 3BCCH 2UXCB 1N36O 4IHJB 1SERA 4DUZB 2ZE5A 4JYBA 3CPWU 4ICGA 2K1EA 4ABMA 5L3DA 4AHCA 5DEDA 3CWBH 3F5WC 1NU1H 3K06A 1K34A 5A2QN 5IYBO 1KD1W 5B1NA 3T4DA 2WLHA 2IJIA 3AEIA 1Q7YW 3RYCB 2W0FC 2WLKA 4UCTA 4OX9O 2JS3A 2Q69A 3J81N 4LF6O 2RJZA 3LDCA 3HB3B 2XASA 3ZMTA 3SJBC 4E4EA 1XMOO 4AI8A 5LMUO 1CXZB 4QPKA 5LOVB 4JASA 2IU3A 2KB1A 4FZ1A 5KUKA 3RYIB 2WAMA 2ZNJA 3ABLC 4NVPA 4X1KA 2EULA 4OPAA 1VQLV 4FFKA 4UCOA 2OCCB 3PJSK 2X6BA 2RNBA 3SYPA 3CB2A 2UUAB 4DW0A 2XAQA 1XREA 3ZHRA 1PM9A 2E76B 5H5NA 3JCUZ 4LWSB 4JI5O 1GM7A 3DXRA 4JI6B 5JCOA 3QNEA 2CAZC 4DR2O 4UV9A 1HP8A 4PDMA 3I55V 4B3RO 2ZDIA 4GCZA 4DV6O 1WNSA 2YXYA 3G71V 5K1XA 3UT5A 1URFA 2DQ0A 3AG1C 3WB2A 4LFCO 4U3JA 2KKWA 1MZEA 1B06A 1MNGA 1BE3H 1WA8A 2CTPA 2YS8A 4Z1VA 2GV9A 3WU2Z 2GUZA 2D3OW 4B3TB 1QLEC 4K3AA 4DR7O 1XMQB 1GM8A 3UQ8A 2D2CB 3CRAA 3OT7A 2AGAA 3B09A 4JI8O 3K5OA 3K08A 3CEIA 4LF7O 1P7BA 2XUMA 1JJ2U 4JF3A 2GHYA 4R7CA 1IDSA 1J5EB 1WP7A 4QPJA 5IYZB 3CRCA 3ETGA 5GTIZ 1I5XA 1S5HC 4B7EA 4KFMA 1HDJA 2IM9A 2ZD9A 1ENVA 3T1HO 4YJ2A 3E8BA 4LNUB 2ILMA 3WFVA 3DC6A 1XL4A 3IFXA 3FYEB 3TXQA 3NR7A 5B1BC 1WB7A 2FB5A 4X64O 3CC4V 4YY3B 2A9HA 4JTAB 1FKAO 5IWAB 1NBMG 5CA3A 1R3KC 3UO2A 3A0BZ 4X20A 1Q82W 2ZQMA 4BR6A 3I5DA 1VARA 2DN9A 1D5AA 4RO2A 1P7GA 2N05A 1SQPH 3JSLA 4K35A 4ZHQA 4LF8O 5LL6Y 2YEVB 2XNDG 2UUBO 3OMAB 4MVQA 5KA6A 2GTSA 5JVDA 1CP9A 4JYCA 4X66O 3P32A 3RWRD 1VQOV 2EINC 2WPDG 3CCLV 3AG2C 2P4VA 5D5QA 1MA1A 5BR8O 4DR4B 4UXNA 4BIUA 3GB7C 4DR6B 1LNQA 1AR5A 1IBLO 3CSXA 2DQ3A 2DYRC 3SYOA 1MABG 4U3FH 1F23A 2RQ6A 4JAAA 4O2BA 2A06H 2Q67A 3CD6V 4JYAO 3CCMV 4CC6A 2JJ2G 1N34B 1HR0B 4DV5B 3KCXA 1NH2D 4WBNA 2XTAA 4X1KB 4JI7B 3K58A 1XEQA 2RDCA 3QO7A 1NH2B 3S3XA 5ITZA 1GN6A 2X6AA 1N33B 4MTFA 1PD3A 2F43G 1PNMA 3CS5A 3OGCC 4JI4O 4J11A 4NXNO 3EHBB 5IJ9A 4RUEA 2ARHA 4LFBB 1UPGA 1L0LH 4HZ3A 2HG5C 4ZI7A 3CYOA 3DXRB 1V9PA 2XAGA 1N0JA 1CPYA 4G28B 2NR5A 2EX3A 3U11A 1VF5B 4H13B 5K1PA 4PV1B 2IBZH 2P90A 4JV5B 3UT5B 4DV7B 1GH6A 1W0JG 1W0KG 2DOSA 2F23A 1JCHA 2AZ0A 4U3JB 2QSAA 1YF2A 2NNUA 1K9MW 1NZ6A 1H8EG 2O57A 4X62B 2WA3A 1WA8B 1PNKA 4TV8A 5KHIA 1EZVH 3B4SA 1Y66A 2GUZB 4HNAA 2LFRA 3A0RA 3BABA 1Q6HA 1T5EA 1OCZC 1OV9A 1TVKA 3N2GA 4DV3O 4WFGA 3T1YO 2YI9A 2H3OA 1FXVA 2XOKG 3N2KB 5CBGA 4KHPB 4YHHO 2LP7A 4NTWA 5B3SC 1KKCA 5JJEB 2CDYA 5EC1C 4K8ZA 3RVZA 1MSDA 4QJFB 3PN1A 1Y76B 5DN6G 3ABKC 2WA4A 5KHGA 2ZCEA 2UUCO 4CH6A 2OTJV 4KXRA 5CA0A 3C90A 2HVKC 1H2NA 5DM6V 4I50A 2EJRA 4DV1O 4O4LB 2HKOA 4U7NA 5CMUA 3ABLB 3CX5F 3JAKB 4FPPA 1HWYA 1GK9A 4P9PA 4LFAO 1V55C 4YIPA 3AK2A 4N23A 3L9DA 4X20B 3LNNA 4O2AA 2W6JG 2ADPA 2OYQA 1RPOA 3RN4A 1IBMB 1F51A 1AI5A 1XHZA 2VS0A 3JD2A 1SQBH 4O4IA 1XILA 2BOCC 4L8JA 1BSMA 1B6QA 4W4KA 5FPOA 1M93A 4PI2A 4YIOA 5AG2A 3ZN1A 3TCUA 5JVDB 3J80N 4TWKA 3AG1B 1VMGA 2LW1A 3ABMC 4TUYA 1OCCC 4FK5C 2XT9A 1K73W 2Q0AA 1H2GA 2UU9B 1Q86W 4Q20A 1GN2A 1XQ8A 4W4LA 1KBHA 2Q7GA 5H9CA 3CCJV 5DECA 3HKDA 1BZKA 1S0VA 4KP4A 3QG5A 2UXNA 1QLEB 2W0XA 2UXXA 3K9SA 5LHHA 3L74H 3CCUV 1S5LZ 3WG7C 3K04A 2ZE6A 4WFFA 1AP6A 1I94B 3ASNC 2EBOA 4LP8A 2A7WA 1H2MA 1LUVA 5J2UA 4O4HB 4FJCC 2VQEB 2F1MA 5ITZB 2P67A 1U97A 3OFNG 1FYJA 3W7WA 3FKSG 1YTFB 5IJ9B 4A5UB 2LO1A 4MVSA 2JS5A 4F6EA 4ZI7B 4DR5B 4NKGB 3CJHA 5B1BB 2MW2B 2Q4PA 3OMIB 1X4TA 3CCSV 1VQ9V 3B8MA 5JCOC 4JI1B 2JGUA 3R66A 1F4NA 2JDIG 2YIBA 4ASUG 4MVRA 1A32A 1EN6A 1XI1A 2Q68A 5LYJA 2E75B 2ZDIC 2ZINA 4I9QA 2UXDO 1LR1A 4EFBA 2QDOA 1K4DC 5CBFA 2PI5A 3O65A 1O9GA 1SA0A 4XBFA 1THZA 1DF5A 2F4VO 3OR7C 1YHQV 2KG7B 2PF4E 2EIMC 2ZR3A 4JI2B 1U96A 1YDXA 1VQPV 3DGEA 1PP9H 4X1IA 3JASA 4D7SA 3H1HH 1M57C 4GKJB 1TVKB 1JA8A 2EINB 3AG2B 3M99B 3ZS8C 1SZTA 2Z0AA 2BSKA 1HNWO 2P7TC 4JAUA 1RM1C 4FLUA 1SQQH 1VQ8V 3CXCU 3L75H 5E1AC 4JI3O 2DYRB 5KHHA 5KMGB 2Q6AA 5J9PC 3FB8C 4FLWA 5CA0B 3L73H 5L3CA 2CGOA 1VQ4V 3SGIA 2L35A 3BHPA 4FFBA 4I50B 1N36B 5CBHA 3OGIB 2QWRB 3CRMA 3OMNB 3SJCC 1E1QG 1R6NA 3K03A 2CH7A 3APOA 3LSUA 1XUQA 1MMMA 5CA1A 5LMNO 4R6ZA 3BVOA 4PA9A 4JZ2A 5KLVH 4RWUA 3KCYA 2A3QA 3C3SA 2EILC 2Q73A 4O2AB 1SQXH 4KL1A 3HR0A 5FNVB 5BMVA 4R8CA 1IBKO 2HHHO 4DK1A 3HKBA 4J9ZB 2WLIA 5EBWC 5B1OA 1XHXA 2WLLB 4BW9A 1AROP 4OX9B 3C3TA 4OGQB 1OCRC 4PA4A 1IZ3A 4LF6B 1BL8A 1S72V 4LBEC 3TETA 1BQZA 1XMOB 5LMUB 3OE7G 2JGDA 1R73A 5FL7G 2Q8VA 1BS3A 3B77A 2X6CA 2EZPA 4LF5O 4DV2O 1X59A 1JX9A 4IYHA 4TT3G 5EC2C 1AR1B 1VQ5V 4WF9V 4FLTA 1R1BA 4X65O 5KX5A 4IYIA 5KUMA 3VQYA 2ZT9B 3M7MX 1G8MA 5IE9A 2UXBO 1OCZB 4H44B 2BCCH 4FZ0A 1BCCH 3B2EE 4JI5B 3JATA 5IY5C 4GLXA 4IGGA 5E79Z 1US6A 4X8AA 4DR2B 2WLJA 1R3JC 5B3SB 2GDSA 4B3RB 2BOBC 2WLNA 2K9PA 2F95B 2ZIOA 3VQXA 1MOFA 4DV6B 3OUFA 5J2UB 3CCVV 2QTSA 3HKEB 2QWQB 1ZTEA 2X7RB 3ABKB 3QF7A 2Z3YA 3OTOO 2VQFO 1YIJV 3LNMB 2AHYA 2ATKC 4MS2A 4LFCB 4RQEA 4OXSA 2XHBA 1H2LA 2FL4A 3SYQA 2YIBD 4BW5A 3THOA 1XBLA 3CJHB 3EXAA 5JQGB 2DYSC 4EFEA 4P30A 1EBOA 3AK1A 3MHSC 4MW3A 3OAAG 3D3IA 5FPRA 4WFAV 3ZRSA 4CZZA 1V55B 2Y69C 5KAFZ 3ASOC 4DR7B 5FLXN 1SQGA 1P84F 1TUBB 4PDRA 2QTOA 3OTFA 1DGSA 4JI8B 1P49A 1SQFA 2EJ7A 3UCSC 3JAWA 3CMAV 1SA0B 4LF7B 1NQTA 1NT2B 4LF4O 3FD9A 4FM1A 4AQYO 1VQKV 4I4TB 5KA5A 3K5LA 4X1IB 3FFQA 4UB8Z 1VQ7V 4B08A 5IT9N 1G1XB 3WB1A 1YVWA 2HEPA 4UCVA 3ABMB 3T1HB 1OCCB 1VF7A 2G38A 1JFFA 3ZX6A 1L0NH 2PI4A 2HLDG 1ZLZA 1AJPA 2LJ2A 1HNZO 3E86A 5GW7A 4X64B 2CTQA 1FFXA 4MVZA 4YXWG 3K9AA 4QIWF 3AG4C 1KP3A 3IGAC 4R50A 3L72H 2ZR2A 3JAMN 1SESA 1AI6A 2QM4A 5IYDO 1FS0G 1VF6A 2OTLV 1AILA 3WG7B 1N4CA 2QR4A 3A8TA 4YJ3A 1H38A 2AHZA 1FJGO 4HBNA 4L87A 4LF4B 1M4UA 2B1IA 3ASNB 4LF8B 2ITDC 4P9OA 2EIKC 4J7ZA 1J95A 2UUBB 4EB6A 3X2QC 3D8CA 4MTGA 3DSQA 4B3SO 1AI4A 4X66B 5CA1B 4WFEA 3HPLC 1Y6XA 4ZKIA 4J9YB 5BR8B 4MVMA 5BMVB 3K0DA 2P22C 3ETDA 3TJTA 2H94A 3UKMA 1YJ9V 4HAMA 3ZHUA 1IBLB 2Y4UA 1H2SB 4DR3O 2YICA 1AJNA 2ZIMA 5HFMA 2M7WA 2QJ1A 1IURA 4ZBMA 1S5JA 4JYAB 2NLJC 4I55A 5D5PA 1PNLA 3L71H 2YI8A 2BTOA 2F66C 3JALA 3CE2A 5H6QA 3OR6C 3MDSA 1KP2A 1SC5B 1Y4MA 2GSMB 3ZRXA 1FD9A 2EIMB 1MZFA 4J80A 5KX5B 4GUNA 3GVMA 1I5YA 1N32O 2P4KA 5JH7A 4TOIA 1QR9A 4LH7A 4JI4B 4FVMA 4NXNB 1M57B 4KUMA 3VQVA 3RVYA 1NTMH 1HW7A 4PA3A 1Y74A 5JJJB 5GTHZ 5IDJA 1K8AW 3SYAA 1RM1B 1Z2GA 4DV0O 5IYCO 4CH5A 3E2EA 1ZSPA 4GX0A 3ZMZA 4Q6GA 1E79G 4ZOLA 5EK0A 2JJ1G 3JD1A 4CS4A 3E22A 1N8RW 4IHJA 1VIBA 5EYPA 4LF9O 2P6JA 1GN3A 3OUSA 4DR1O 1AP5A 4FIPC 2QE7G 2VRZA 4E2LA 1PKXA 3BRCA 4PDVA 4MSWC 3OW2U 1RSOA 4BIZA 4MT8A 4UUJC 3JARA 1FAFA 4JI0O 1VQ6V 4DUYO 4K0KO 1V54C 5JJNB 2AZ2A 3F5TA 3D36C 1FPOA 3ZHSA 4YJ2B 4UVAA 2V4DA 3BEHA 1ZUQA 3CC2V 2XAJA 3RT3C 4B3MO 1JVMA 3FYIB 1M9NA 1JOYA 2Q7EA 3UO3A 3RW0A 4DV3B 3T1YB 3K5MA 2EILB 2IJHA 2ZE8A 2BTQA 2ITCC 4PD4F 3CCQV 2HP8A 3VOUA 1YITV 4YHHB 3CRRA 1QCEA 3HKCA 2ZNIA 3RYIA 1F4MA 1M90W 3K79A 4DRXA 1OCRB 2WSSG 2AXTZ 2DE0X 3H1LH 2LQTA 1JR9A 2PTMA 2JRIA 4ZHQB 2M6YA 4NXMO 2Q7HA 1KQSU 4JAVA 3QO8A 5F2VO 2UUCB 4I7ZB 3RBZA 4GT1A 3T4ZA 5LBQA 3LUTB 4UVCA 3E83A 1GAXA 4RQFA 2CK3G 2R9IA 2OIGA 2WWWA 1JFFB 4DV1B 1NTZH 1Z5WA 1QQCA 1L1FA 4LWSA 3S3WA 1PL4A 2Y0PA 2DMXA 5EBMC 4LFAB 3P30A 4JTDB 4FLXA 2EIJC 4MTXA 5L3EA 1SRYA 2E5LO 3H01A 4NTYA 2Z5UA 1SKVA 3SJAC 2LFSA 2QKSA 2YXLA 2Y4TA 3APQA 4O2BB 5IY5B 1XNQO 3RGBA 4H0LB 3IAYA 1QNMA 2PUSA 4DK0A 1TGOA 4EB6B 1K97A 1GM9A 4LCUC 4WBNB 4GZRB 4GKKO 1XDCA 3CP1A 4K8XA 4LH6A 3KZIZ 2QEXV 1XNRO 2IJKA 4J7JA 2ZM6O 2R72A 3ABUA 2HJDA 3D3QA 4XDJA 5B5EZ 2DYSB 3D36A 3FX7A 1WB8A 2PYJA 2N04A 3JD4A 3O9OA 3E8GA 4X9QA 2Y69B 3ASOB 2CTWA 4DV4O 1M5IA 1CEZA 2Y48A 3CC7V 1TUEB 2DWEC 2B9ZA 4C7UA 3SR2C 5EIBD 3VBBA 1XL6A 2UXCO 4UB6Z 1KB9F 3JALB 3E35A 3ZJZA 2DW4A 4DUZO 4IL6Z 3H1IH 1Z5VA 5B1AC 3E8FA 4LNUA 2JIZG 4GX1A 2Q0OC 2YDEA 1ZWIC 1OHHG 2JK5C 4BAYA 1KU9A 1ZL8A 1G6UA 3CMEV 2FMLA 4JPRA 3B8NA 5JH7B 2CUGA 4GX5A 4TV8B 3ZRWA 2KSDA 1NVPD 4HNAB 3K0GA 4J7KA 1AR4A 1Y74B 4RAIA
chains in the Genus database with same CATH topology
3N2GB 4DUYB 4B3RB 1Q43A 5CB4B 4K0KB 4LR3A 1O9HA 2F95B 2ZIOA 4X1YA 5FNVA 3VQXA 4DV6B 5EZYA 5ITZA 5LP6B 1N33B 5J2UB 3HKEB 2E3CA 4B3MB 1Q3EA 4AILC 4FM2A 4TQFA 3E22B 3QF7A 5EYPB 5IJ9A 1FFXB 4LFBB 2UXDB 4ZI7A 4LFCB 1V9PA 3A2FA 2XHBA 4IIJA 2YIBD 2P5OA 2EX3A 3U10A 2JVDA 3JARB 3THOA 3U11A 5K1PA 5JQGB 4EFEA 4FLZA 2F4VB 4YJ3B 4TQDA 5FPRA 4JV5B 3CHXA 1I7FA 3UT5B 4DV7B 4DR7B 4NXMB 4O4JB 1SQGA 1TUBB 1JMKC 3ZEDA 5KHKA 3OTFA 1DGSA 5IJ0B 3U0ZA 4JI8B 1WN7A 4U3JB 1P49A 1SQFA 2BTQB 1HNWB 4X62B 3JAWA 4TV9A 1SA0B 4LF7B 4TV8A 3HKCB 1Q8IA 1NT2B 5KHIA 3BA9A 4EEQA 4O4IB 4DRXB 4FM1A 4JI3B 4HNAA 3BABA 4I4TB 1T5EA 1TVKA 3N2GA 3K5LA 4X1IB 3FFQA 4B08A 2E5LB 2YI9A 3WB1A 2VWJA 2HEPA 4UCVA 3T1HB 1HNXB 3N2KB 1L8DA 1VF7A 4KHPB 1JFFA 2PY5A 3HKEA 5JJEB 1XNQB 4X64B 4K8ZA 4I55B 4PI0A 1FFXA 4TUYB 5LP6C 2PYLA 5IYZA 3PN1A 2VWKA 5KHGA 5LMNB 2ZCEA 4CH6A 5JQGA 2QM4A 4GKKB 5CA0A 3RYHA 4YJ3A 3HKDB 1XNRB 3BA8A 4HBNA 4I50A 1M4UA 3QTCA 2ZM6B 4O4LB 1IBKB 2HHHB 4LF4B 4LF8B 1TA8A 3JAKB 1TUBA 2UUBB 1Q5OA 4EB6A 2R70A 3DSQA 4X66B 5CA1B 1WPBA 4X20B 3LNNA 5C8YB 4O2AA 4FLVA 2OYQA 4DV4B 1IBMB 1XHZA 3BAAA 4O4IA 4LF5B 4DV2B 4L8JA 5BR8B 4ZOLB 5BMVB 4PHZA 4I4TA 2P22C 2UXCB 4IHJB 5FPOA 1M93A 4PI2A 4DUZB 1IBLB 3N2KA 1H2SB 4X65B 4CH4A 5JVDB 2ZIMA 4AHCA 2QJ1A 1S5JA 4JYAB 2UXBB 4I55A 5D5PA 4TUYA 2YI8A 4F6RA 2OWOA 2Q0AA 2BTOA 2F66C 2R9AA 3K5NA 3JALA 2UU9B 1XQ8A 4UFZA 3RYCB 5LYJB 4UCTA 5GONA 5LXTA 3RYFA 2Q7GA 3HKDA 2RJZA 4O4LA 3SJBC 5KX5B 3K57A 3QG5A 3JAKA 5LOVB 5J2TA 5EIBC 5JH7A 4FLYA 4TOIA 4LH7A 4JI4B 4FVMA 4NXNB 3OTOB 3RYIB 3ICXA 2VQFB 3VQVA 4FM0A 1I94B 2ZNJA 4NVPA 4X1KA 1HW7A 5LA6A 5JJJB 4UCOA 5CB4A 3JASB 4CH5A 4UCRA 4Q6GA 5LP6A 1ZAUA 5J2UA 4O4HB 3CB2A 2UUAB 1B04A 4X1YB 4ZOLA 2VQEB 5EZYB 2F1MA 4CS4A 5ITZB 3E22A 4IHJA 5EYPA 5IJ9B 3BRCA 4JI6B 5JCOA 1RSOA 2CAZC 2JS5A 4ZI7B 4DR5B 3JARA 4IIJB 5JJNB 1X4TA 2YIAA 5JCOC 4JI1B 2JGUA 4YJ2B 1WNSA 2V4DA 2YIBA 5K1XA 3UT5A 4O4JA 4AQYB 1XI1A 5LYJA 4FFBB 3WB2A 4D7TA 5KHJA 2Q7EA 2ZINA 4I9QA 5IJ0A 4DV3B 3T1YB 4EFBA 3WB0A 4U3JA 3K5MA 2KKWA 2BTQA 1O9GA 4YHHB 1SA0A 3JSNA 3HKCA 2ZNIA 3RYIA 1HNZB 4TV9B 4CC5A 2GV9A 4DRXA 1KMIZ 3BPZA 4CH3A 4B3TB 4JI2B 2PTMA 3HKBB 1XMQB 4ZHQB 2Q7HA 2UUCB 4X1IA 3JASA 4D7SA 3UQ8A 4GKJB 1TVKB 3RFRA 4O4HA 3K5OA 3ZS8C 2F93B 1FJGB 1JFFB 4DV1B 1Z5WA 1QQCA 4FLUA 1QHTA 3ETQA 4LFAB 1J5EB 5IYZB 4FLXA 5KHHA 5KMGB 4B3SB 4FLWA 2IM9A 4YJ2A 1SKVA 5CA0B 4LNUB 3SJAC 3RYHB 3SGIA 2YXLA 4O2BB 3BHPA 4FFBA 3RGBA 4I50B 4CS3A 3IAYA 2PUSA 1N36B 4DK0A 1TAEA 4YY3B 3SJCC 1TGOA 4EB6B 5IWAB 5CA1A 3JATB 4X20A 4WBNB 5C8YA 3MAQA 4DR3B 4UCSA 1D5AA 4CS2A 4K8XA 4LH6A 4O2AB 4KL1A 5FNVB 5BMVA 3JSLA 4DK1A 3HKBA 2R72A 4ZHQA 1YEWA 4BWAA 1XHXA 4BW9A 4OX9B 4GYCB 4LF6B 5JVDA 2PYJA 3VQWA 3RWRD 1XMOB 1M5IA 5LMUB 1N32B 5D5QA 4DR4B 3SR2C 5EIBD 4F6RB 3RYCA 5KMGA 4DR6B 3JALB 4FLTA 5GONB 1Z5VA 5LXTB 4DV0B 3CSXA 4LNUA 3RYFB 2PGGA 4UCUA 5KX5A 1JJOA 2RQ6A 4O2BA 2PZSA 5LOVA 3VQYA 1KU9A 1G6UA 3M7MX 4CC6A 3JAWB 4LF9B 4ZIBA 1N34B 5J2TB 4DR1B 1HR0B 5JH7B 4TV8B 4DV5B 3B2EE 4JI5B 3JATA 4GLXA 4WBNA 3K59A 4HNAB 4X1KB 4DR2B 4JI7B 3K58A 5LA6B 4JI0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSX A;  2F66 C;  3ICX A;  3QF7 A;  3THO A;  2P22 C;  3B2E E;  3ZS8 C;  2CAZ C;  2JS5 A;  1SKV A;  1NT2 B;  3SJA C;  3SJB C;  1X4T A;  3SJC C;  3QG5 A; 
#chains in the Genus database with same CATH topology
 3N2G B;  4QE9 A;  4LR3 A;  4DW1 A;  1O9H A;  1Q81 W;  4X1Y A;  5H2F Z;  5EZY A;  1WJZ A;  3AG4 B;  4TSF G;  2E3C A;  1Q3E A;  4AIL C;  3ZBH A;  4P2Z A;  4FM2 A;  3LSS A;  3E22 B;  5EYP B;  1PV0 A;  2UXD B;  1BGY H;  1IX9 A;  4N21 A;  3A2F A;  4IIJ A;  3IC7 A;  1RSO B;  2IW5 A;  2CTR A;  1EN5 A;  3JAR B;  4PDL A;  4PJ0 Z;  1VQM V;  1HNX O;  2EIK B;  2F4V B;  2UUA O;  3X2Q B;  4TQD A;  4HYO A;  1SS3 A;  1W2B U;  2XAH A;  3KKY A;  3TGU H;  3ZED A;  3ZCC A;  4JI6 O;  3U0Z A;  2IU0 A;  1WN7 A;  5JWP A;  1F7Y A;  3KG2 A;  4JZG A;  2BTQ B;  2YSU B;  1HNW B;  4TV9 A;  5TIS Z;  3HKC B;  3P3P A;  3SPH A;  3SYC A;  3BA9 A;  4NTX A;  4EEQ A;  1QLN A;  4O4I B;  3TK1 A;  4DRX B;  1Q6U A;  4JI3 B;  4BIO A;  1BHB A;  1YCI A;  3CXH F;  4X88 A;  3Q4H A;  2IH3 C;  1IVS A;  1FXK C;  2OT5 A;  1OCO C;  3G6E V;  1Y67 A;  1HNX B;  4Z2W A;  1ROP A;  2YXH A;  3H1J H;  4JGS A;  3ABT A;  2RCV A;  3OD4 A;  4TUY B;  2CGN A;  4B3T O;  1BMF G;  5LP6 C;  3W7U A;  2PYL A;  1XMQ O;  2VWK A;  5LMN B;  1KUQ A;  1K5Q A;  1OJH A;  1E1R G;  1PPJ H;  4DO2 A;  1D2D A;  3RYH A;  2ZE7 A;  3HKD B;  1G4Y B;  1GTO A;  4X89 A;  3BA8 A;  3FAV A;  4XDK A;  1IBK B;  2HHH B;  1K5S A;  1TA8 A;  1VF6 C;  1BHA A;  1Q5O A;  4OPH A;  2R70 A;  1J5E O;  3H1K H;  2KQX A;  1Q90 D;  4UV8 A;  1JPX A;  1YSC A;  2Q9L A;  3GWO A;  5HFL A;  1NS1 A;  3MHH C;  3LDE A;  1QVG U;  1K92 A;  2HJF C;  3BAA A;  5H6R A;  4LF5 B;  4DV2 B;  1NR1 A;  1GMG A;  3FB6 C;  4PHZ A;  4WFB V;  3ZHV A;  4J41 A;  4YY3 O;  3BY6 A;  1V54 B;  5IWA O;  3N2K A;  4X65 B;  3IC9 A;  4CH4 A;  2QA4 V;  2ODM A;  4NB5 A;  1M56 C;  1KC8 W;  4I9W A;  2UXB B;  3ZHQ A;  2QM7 A;  4F6R A;  1DLB A;  3A0H Z;  2OWO A;  1UFI A;  2R9A A;  3K5N A;  4NR1 A;  1Y76 A;  4UFZ A;  5LYJ B;  5GON A;  5LXT A;  2R9R B;  3RYF A;  3R65 A;  2AW9 A;  3N27 A;  2FTK A;  5B66 Z;  3EVK A;  1WPX A;  3TXS A;  4O4L A;  3K57 A;  1AB3 A;  1YXB A;  3CRQ A;  3JAK A;  3OEE G;  3ZIA G;  1VQN V;  5J2T A;  1QVF U;  2W6I G;  5EIB C;  1ZL8 B;  2ETN A;  4JTC B;  5L3G A;  4FLY A;  2Y0I A;  1FXK A;  3H9V A;  2OCH A;  3OTO B;  4QE7 A;  3ICX A;  2VQF B;  4DR4 O;  4FM0 A;  1NR7 A;  3ZRW B;  4DR6 O;  1EN4 A;  5LA6 A;  1SET A;  2OIE A;  1H8H G;  2A0L A;  3L70 H;  3AG3 C;  5CB4 A;  4DXW A;  3JAS B;  5KAI Z;  4U7O A;  5LGN A;  4UCR A;  5LP6 A;  1NKD A;  1ZAU A;  1VP7 A;  2ADQ B;  1B04 A;  4X1Y B;  4IT5 A;  5EZY B;  2LGQ A;  3BFR A;  2BSK B;  2ZXW C;  2EIJ B;  1N34 O;  1HR0 O;  1NI8 A;  4DV5 O;  4F4L A;  5BY1 A;  1KEC A;  3JCZ A;  4MW8 A;  4PEL A;  4JI7 O;  3T1C A;  2V1D A;  2FYU H;  4IIJ B;  4CBC A;  4EKW A;  3SPG A;  2YIA A;  1W59 A;  1N33 O;  3IJ4 A;  2HVJ C;  3AK3 A;  4O4J A;  4AQY B;  4FFB B;  4D7T A;  5KHJ A;  3EFF K;  1NJI W;  5C93 A;  4LFB O;  5IJ0 A;  4MVU A;  3WB0 A;  2CH7 B;  4Z1M G;  1K4C C;  4I0X A;  2DWD C;  2H8P C;  3JSN A;  2IH1 C;  2QWN B;  1HNZ B;  4TV9 B;  4CC5 A;  4JV5 O;  4D6T H;  1RP3 B;  1KMI Z;  3BPZ A;  4CH3 A;  4DV7 O;  1YJW V;  3HKB B;  3SPC A;  2WLI B;  3ML0 A;  4J10 A;  1UJW B;  4FMT A;  3RFR A;  1S76 D;  3Q4H B;  1YI2 V;  4O4H A;  1EZJ A;  2F93 B;  1GRJ A;  1FJG B;  4X62 O;  2OCC C;  2JEU A;  1QHT A;  2JGD B;  3SPI A;  3ETQ A;  5B1A B;  3DTU B;  1NTK H;  1DK1 A;  4B3S B;  1S77 D;  3FB5 C;  1VEW A;  3GWK C;  2ZKO A;  1JQ0 A;  5CN0 A;  1GKF A;  2P06 A;  4KHP O;  3RYH B;  1D5N A;  3P3N A;  3ZMU A;  3STZ C;  3FAV B;  3ZMS A;  4CS3 A;  1Q6I A;  2RN9 A;  3MD0 A;  1RPR A;  1TAE A;  1QBZ A;  1I08 A;  1K3E A;  1R6T A;  3OM3 B;  3JAT B;  3SJQ C;  3MAQ A;  5C8Y A;  5EBL C;  4DR3 B;  2LW7 A;  1AJQ A;  1MG1 A;  2EZO A;  4MVO A;  4UCS A;  2B5U A;  4CS2 A;  4J42 A;  1EFR G;  2KG7 A;  3W7S A;  3DC5 A;  1MSW D;  5BZB A;  1YEW A;  1YJN V;  4BWA A;  3STL C;  1SF9 A;  4H37 A;  1SQV H;  5L3F A;  4WFH A;  4GYC B;  1GO3 F;  3ZN0 A;  3QO5 A;  3VQW A;  4PA7 A;  3G4S V;  4QGP A;  2HFE C;  2QM8 A;  1IBM O;  4PA6 A;  1N32 B;  5LGU A;  4B7K A;  2WLM A;  2N74 A;  4XDL A;  4F6R B;  3RYC A;  5KMG A;  5LHI A;  3SDL A;  2L6L A;  3CCE V;  4UVB A;  3I56 V;  5GON B;  5LXT B;  2YID A;  4DV0 B;  3RYF B;  2PGG A;  4UCU A;  2Q5Z A;  1JJO A;  2QWO B;  2PZS A;  5LOV A;  3JAW B;  4LF9 B;  4ZIB A;  5J2T B;  4DR1 B;  3JD0 A;  5A9G A;  1B3Q A;  1DF4 A;  3W7X A;  1FXK B;  2UU9 O;  1OCO B;  3AG7 A;  2DJV A;  3K59 A;  4G27 B;  1R6K A;  5LA6 B;  1ZX3 A;  5L3B A;  4JI0 B;  3E89 A;  2HR3 A;  4DUY B;  1Q43 A;  5CB4 B;  4K0K B;  1WLE A;  5FNV A;  3ZRV A;  2C2A A;  3ETE A;  5LP6 B;  4B3M B;  1BQ0 A;  2IJJ A;  2WLL A;  3G80 A;  1H2K A;  4TQF A;  2X0L A;  3LSQ A;  4JYY A;  1FFX B;  1I94 O;  2YC0 A;  4I5S A;  1WP8 A;  3K3W A;  2QKC A;  3B40 A;  5LHG A;  1S3J A;  3G6B A;  2JEX A;  2XAF A;  2P5O A;  1KKD A;  3U10 A;  2JVD A;  3M8A A;  4DYL A;  1GN4 A;  3FB7 C;  4FLZ A;  2QWP B;  1P4R A;  2VQE O;  4YJ3 B;  2YUA A;  3CHX A;  3ZMV A;  1YZB A;  1I7F A;  4RUF A;  1OZ0 A;  3F7Y C;  2LGW A;  4NXM B;  1WAZ A;  4O4J B;  4G2K A;  2GBO A;  1JMK C;  5KHK A;  5IJ0 B;  4DR5 O;  3LDD A;  3JYC A;  2NN4 A;  1IXM A;  4I0X B;  1IXB A;  2A79 B;  3W7T A;  1QU7 A;  1EM1 A;  1I0H A;  4JI1 O;  1Q8I A;  5BXZ A;  4WCE V;  2B1G A;  3J7A U;  4GX2 A;  3ZHT A;  3F7V C;  1M56 B;  2CE4 A;  2E5L B;  3UM7 A;  2VWJ A;  1L8D A;  1QR8 A;  4NYK A;  1PL0 A;  1YTF D;  3HKE A;  2PY5 A;  2FKX A;  2QKA A;  3OEH G;  2QGN A;  1ORQ C;  1XNQ B;  3SPJ A;  4I55 B;  4PI0 A;  1AVM A;  4JI2 O;  5IYZ A;  3NXS A;  3CCR V;  1FFT B;  2V7Q G;  1BT8 A;  1FXH A;  5JQG A;  4GKJ O;  2RMK B;  4GKK B;  3JD3 A;  4QNH B;  1K7D A;  3T2M A;  1XNR B;  3QTC A;  2ZM6 B;  1XOU A;  1DTO A;  1R3I C;  3E8H A;  1TUB A;  3AG3 B;  1LUW A;  4H33 A;  1RFY A;  5LGT A;  1R3L C;  1AI7 A;  2BE3 A;  1WPB A;  3QVN A;  1K33 A;  2E74 B;  1KYO F;  5C8Y B;  4FLV A;  4DV4 B;  3G67 A;  2ZXW B;  4LC1 A;  1SZX A;  2MK3 A;  1NVP B;  1COW G;  1N0N A;  2GTA A;  1M1K W;  2YEV A;  4ZOL B;  4I4T A;  4MTO A;  3BCC H;  2UXC B;  1N36 O;  4IHJ B;  1SER A;  4DUZ B;  2ZE5 A;  4JYB A;  3CPW U;  4ICG A;  2K1E A;  4ABM A;  5L3D A;  4AHC A;  5DED A;  3CWB H;  3F5W C;  1NU1 H;  3K06 A;  1K34 A;  5A2Q N;  5IYB O;  1KD1 W;  5B1N A;  3T4D A;  2WLH A;  2IJI A;  3AEI A;  1Q7Y W;  3RYC B;  2W0F C;  2WLK A;  4UCT A;  4OX9 O;  2JS3 A;  2Q69 A;  3J81 N;  4LF6 O;  2RJZ A;  3LDC A;  3HB3 B;  2XAS A;  3ZMT A;  3SJB C;  4E4E A;  1XMO O;  4AI8 A;  5LMU O;  1CXZ B;  4QPK A;  5LOV B;  4JAS A;  2IU3 A;  2KB1 A;  4FZ1 A;  5KUK A;  3RYI B;  2WAM A;  2ZNJ A;  3ABL C;  4NVP A;  4X1K A;  2EUL A;  4OPA A;  1VQL V;  4FFK A;  4UCO A;  2OCC B;  3PJS K;  2X6B A;  2RNB A;  3SYP A;  3CB2 A;  2UUA B;  4DW0 A;  2XAQ A;  1XRE A;  3ZHR A;  1PM9 A;  2E76 B;  5H5N A;  3JCU Z;  4LWS B;  4JI5 O;  1GM7 A;  3DXR A;  4JI6 B;  5JCO A;  3QNE A;  2CAZ C;  4DR2 O;  4UV9 A;  1HP8 A;  4PDM A;  3I55 V;  4B3R O;  2ZDI A;  4GCZ A;  4DV6 O;  1WNS A;  2YXY A;  3G71 V;  5K1X A;  3UT5 A;  1URF A;  2DQ0 A;  3AG1 C;  3WB2 A;  4LFC O;  4U3J A;  2KKW A;  1MZE A;  1B06 A;  1MNG A;  1BE3 H;  1WA8 A;  2CTP A;  2YS8 A;  4Z1V A;  2GV9 A;  3WU2 Z;  2GUZ A;  2D3O W;  4B3T B;  1QLE C;  4K3A A;  4DR7 O;  1XMQ B;  1GM8 A;  3UQ8 A;  2D2C B;  3CRA A;  3OT7 A;  2AGA A;  3B09 A;  4JI8 O;  3K5O A;  3K08 A;  3CEI A;  4LF7 O;  1P7B A;  2XUM A;  1JJ2 U;  4JF3 A;  2GHY A;  4R7C A;  1IDS A;  1J5E B;  1WP7 A;  4QPJ A;  5IYZ B;  3CRC A;  3ETG A;  5GTI Z;  1I5X A;  1S5H C;  4B7E A;  4KFM A;  1HDJ A;  2IM9 A;  2ZD9 A;  1ENV A;  3T1H O;  4YJ2 A;  3E8B A;  4LNU B;  2ILM A;  3WFV A;  3DC6 A;  1XL4 A;  3IFX A;  3FYE B;  3TXQ A;  3NR7 A;  5B1B C;  1WB7 A;  2FB5 A;  4X64 O;  3CC4 V;  4YY3 B;  2A9H A;  4JTA B;  1FKA O;  5IWA B;  1NBM G;  5CA3 A;  1R3K C;  3UO2 A;  3A0B Z;  4X20 A;  1Q82 W;  2ZQM A;  4BR6 A;  3I5D A;  1VAR A;  2DN9 A;  1D5A A;  4RO2 A;  1P7G A;  2N05 A;  1SQP H;  3JSL A;  4K35 A;  4ZHQ A;  4LF8 O;  5LL6 Y;  2YEV B;  2XND G;  2UUB O;  3OMA B;  4MVQ A;  5KA6 A;  2GTS A;  5JVD A;  1CP9 A;  4JYC A;  4X66 O;  3P32 A;  3RWR D;  1VQO V;  2EIN C;  2WPD G;  3CCL V;  3AG2 C;  2P4V A;  5D5Q A;  1MA1 A;  5BR8 O;  4DR4 B;  4UXN A;  4BIU A;  3GB7 C;  4DR6 B;  1LNQ A;  1AR5 A;  1IBL O;  3CSX A;  2DQ3 A;  2DYR C;  3SYO A;  1MAB G;  4U3F H;  1F23 A;  2RQ6 A;  4JAA A;  4O2B A;  2A06 H;  2Q67 A;  3CD6 V;  4JYA O;  3CCM V;  4CC6 A;  2JJ2 G;  1N34 B;  1HR0 B;  4DV5 B;  3KCX A;  1NH2 D;  4WBN A;  2XTA A;  4X1K B;  4JI7 B;  3K58 A;  1XEQ A;  2RDC A;  3QO7 A;  1NH2 B;  3S3X A;  5ITZ A;  1GN6 A;  2X6A A;  1N33 B;  4MTF A;  1PD3 A;  2F43 G;  1PNM A;  3CS5 A;  3OGC C;  4JI4 O;  4J11 A;  4NXN O;  3EHB B;  5IJ9 A;  4RUE A;  2ARH A;  4LFB B;  1UPG A;  1L0L H;  4HZ3 A;  2HG5 C;  4ZI7 A;  3CYO A;  3DXR B;  1V9P A;  2XAG A;  1N0J A;  1CPY A;  4G28 B;  2NR5 A;  2EX3 A;  3U11 A;  1VF5 B;  4H13 B;  5K1P A;  4PV1 B;  2IBZ H;  2P90 A;  4JV5 B;  3UT5 B;  4DV7 B;  1GH6 A;  1W0J G;  1W0K G;  2DOS A;  2F23 A;  1JCH A;  2AZ0 A;  4U3J B;  2QSA A;  1YF2 A;  2NNU A;  1K9M W;  1NZ6 A;  1H8E G;  2O57 A;  4X62 B;  2WA3 A;  1WA8 B;  1PNK A;  4TV8 A;  5KHI A;  1EZV H;  3B4S A;  1Y66 A;  2GUZ B;  4HNA A;  2LFR A;  3A0R A;  3BAB A;  1Q6H A;  1T5E A;  1OCZ C;  1OV9 A;  1TVK A;  3N2G A;  4DV3 O;  4WFG A;  3T1Y O;  2YI9 A;  2H3O A;  1FXV A;  2XOK G;  3N2K B;  5CBG A;  4KHP B;  4YHH O;  2LP7 A;  4NTW A;  5B3S C;  1KKC A;  5JJE B;  2CDY A;  5EC1 C;  4K8Z A;  3RVZ A;  1MSD A;  4QJF B;  3PN1 A;  1Y76 B;  5DN6 G;  3ABK C;  2WA4 A;  5KHG A;  2ZCE A;  2UUC O;  4CH6 A;  2OTJ V;  4KXR A;  5CA0 A;  3C90 A;  2HVK C;  1H2N A;  5DM6 V;  4I50 A;  2EJR A;  4DV1 O;  4O4L B;  2HKO A;  4U7N A;  5CMU A;  3ABL B;  3CX5 F;  3JAK B;  4FPP A;  1HWY A;  1GK9 A;  4P9P A;  4LFA O;  1V55 C;  4YIP A;  3AK2 A;  4N23 A;  3L9D A;  4X20 B;  3LNN A;  4O2A A;  2W6J G;  2ADP A;  2OYQ A;  1RPO A;  3RN4 A;  1IBM B;  1F51 A;  1AI5 A;  1XHZ A;  2VS0 A;  3JD2 A;  1SQB H;  4O4I A;  1XIL A;  2BOC C;  4L8J A;  1BSM A;  1B6Q A;  4W4K A;  5FPO A;  1M93 A;  4PI2 A;  4YIO A;  5AG2 A;  3ZN1 A;  3TCU A;  5JVD B;  3J80 N;  4TWK A;  3AG1 B;  1VMG A;  2LW1 A;  3ABM C;  4TUY A;  1OCC C;  4FK5 C;  2XT9 A;  1K73 W;  2Q0A A;  1H2G A;  2UU9 B;  1Q86 W;  4Q20 A;  1GN2 A;  1XQ8 A;  4W4L A;  1KBH A;  2Q7G A;  5H9C A;  3CCJ V;  5DEC A;  3HKD A;  1BZK A;  1S0V A;  4KP4 A;  3QG5 A;  2UXN A;  1QLE B;  2W0X A;  2UXX A;  3K9S A;  5LHH A;  3L74 H;  3CCU V;  1S5L Z;  3WG7 C;  3K04 A;  2ZE6 A;  4WFF A;  1AP6 A;  1I94 B;  3ASN C;  2EBO A;  4LP8 A;  2A7W A;  1H2M A;  1LUV A;  5J2U A;  4O4H B;  4FJC C;  2VQE B;  2F1M A;  5ITZ B;  2P67 A;  1U97 A;  3OFN G;  1FYJ A;  3W7W A;  3FKS G;  1YTF B;  5IJ9 B;  4A5U B;  2LO1 A;  4MVS A;  2JS5 A;  4F6E A;  4ZI7 B;  4DR5 B;  4NKG B;  3CJH A;  5B1B B;  2MW2 B;  2Q4P A;  3OMI B;  1X4T A;  3CCS V;  1VQ9 V;  3B8M A;  5JCO C;  4JI1 B;  2JGU A;  3R66 A;  1F4N A;  2JDI G;  2YIB A;  4ASU G;  4MVR A;  1A32 A;  1EN6 A;  1XI1 A;  2Q68 A;  5LYJ A;  2E75 B;  2ZDI C;  2ZIN A;  4I9Q A;  2UXD O;  1LR1 A;  4EFB A;  2QDO A;  1K4D C;  5CBF A;  2PI5 A;  3O65 A;  1O9G A;  1SA0 A;  4XBF A;  1THZ A;  1DF5 A;  2F4V O;  3OR7 C;  1YHQ V;  2KG7 B;  2PF4 E;  2EIM C;  2ZR3 A;  4JI2 B;  1U96 A;  1YDX A;  1VQP V;  3DGE A;  1PP9 H;  4X1I A;  3JAS A;  4D7S A;  3H1H H;  1M57 C;  4GKJ B;  1TVK B;  1JA8 A;  2EIN B;  3AG2 B;  3M99 B;  3ZS8 C;  1SZT A;  2Z0A A;  2BSK A;  1HNW O;  2P7T C;  4JAU A;  1RM1 C;  4FLU A;  1SQQ H;  1VQ8 V;  3CXC U;  3L75 H;  5E1A C;  4JI3 O;  2DYR B;  5KHH A;  5KMG B;  2Q6A A;  5J9P C;  3FB8 C;  4FLW A;  5CA0 B;  3L73 H;  5L3C A;  2CGO A;  1VQ4 V;  3SGI A;  2L35 A;  3BHP A;  4FFB A;  4I50 B;  1N36 B;  5CBH A;  3OGI B;  2QWR B;  3CRM A;  3OMN B;  3SJC C;  1E1Q G;  1R6N A;  3K03 A;  2CH7 A;  3APO A;  3LSU A;  1XUQ A;  1MMM A;  5CA1 A;  5LMN O;  4R6Z A;  3BVO A;  4PA9 A;  4JZ2 A;  5KLV H;  4RWU A;  3KCY A;  2A3Q A;  3C3S A;  2EIL C;  2Q73 A;  4O2A B;  1SQX H;  4KL1 A;  3HR0 A;  5FNV B;  5BMV A;  4R8C A;  1IBK O;  2HHH O;  4DK1 A;  3HKB A;  4J9Z B;  2WLI A;  5EBW C;  5B1O A;  1XHX A;  2WLL B;  4BW9 A;  1ARO P;  4OX9 B;  3C3T A;  4OGQ B;  1OCR C;  4PA4 A;  1IZ3 A;  4LF6 B;  1BL8 A;  1S72 V;  4LBE C;  3TET A;  1BQZ A;  1XMO B;  5LMU B;  3OE7 G;  2JGD A;  1R73 A;  5FL7 G;  2Q8V A;  1BS3 A;  3B77 A;  2X6C A;  2EZP A;  4LF5 O;  4DV2 O;  1X59 A;  1JX9 A;  4IYH A;  4TT3 G;  5EC2 C;  1AR1 B;  1VQ5 V;  4WF9 V;  4FLT A;  1R1B A;  4X65 O;  5KX5 A;  4IYI A;  5KUM A;  3VQY A;  2ZT9 B;  3M7M X;  1G8M A;  5IE9 A;  2UXB O;  1OCZ B;  4H44 B;  2BCC H;  4FZ0 A;  1BCC H;  3B2E E;  4JI5 B;  3JAT A;  5IY5 C;  4GLX A;  4IGG A;  5E79 Z;  1US6 A;  4X8A A;  4DR2 B;  2WLJ A;  1R3J C;  5B3S B;  2GDS A;  4B3R B;  2BOB C;  2WLN A;  2K9P A;  2F95 B;  2ZIO A;  3VQX A;  1MOF A;  4DV6 B;  3OUF A;  5J2U B;  3CCV V;  2QTS A;  3HKE B;  2QWQ B;  1ZTE A;  2X7R B;  3ABK B;  3QF7 A;  2Z3Y A;  3OTO O;  2VQF O;  1YIJ V;  3LNM B;  2AHY A;  2ATK C;  4MS2 A;  4LFC B;  4RQE A;  4OXS A;  2XHB A;  1H2L A;  2FL4 A;  3SYQ A;  2YIB D;  4BW5 A;  3THO A;  1XBL A;  3CJH B;  3EXA A;  5JQG B;  2DYS C;  4EFE A;  4P30 A;  1EBO A;  3AK1 A;  3MHS C;  4MW3 A;  3OAA G;  3D3I A;  5FPR A;  4WFA V;  3ZRS A;  4CZZ A;  1V55 B;  2Y69 C;  5KAF Z;  3ASO C;  4DR7 B;  5FLX N;  1SQG A;  1P84 F;  1TUB B;  4PDR A;  2QTO A;  3OTF A;  1DGS A;  4JI8 B;  1P49 A;  1SQF A;  2EJ7 A;  3UCS C;  3JAW A;  3CMA V;  1SA0 B;  4LF7 B;  1NQT A;  1NT2 B;  4LF4 O;  3FD9 A;  4FM1 A;  4AQY O;  1VQK V;  4I4T B;  5KA5 A;  3K5L A;  4X1I B;  3FFQ A;  4UB8 Z;  1VQ7 V;  4B08 A;  5IT9 N;  1G1X B;  3WB1 A;  1YVW A;  2HEP A;  4UCV A;  3ABM B;  3T1H B;  1OCC B;  1VF7 A;  2G38 A;  1JFF A;  3ZX6 A;  1L0N H;  2PI4 A;  2HLD G;  1ZLZ A;  1AJP A;  2LJ2 A;  1HNZ O;  3E86 A;  5GW7 A;  4X64 B;  2CTQ A;  1FFX A;  4MVZ A;  4YXW G;  3K9A A;  4QIW F;  3AG4 C;  1KP3 A;  3IGA C;  4R50 A;  3L72 H;  2ZR2 A;  3JAM N;  1SES A;  1AI6 A;  2QM4 A;  5IYD O;  1FS0 G;  1VF6 A;  2OTL V;  1AIL A;  3WG7 B;  1N4C A;  2QR4 A;  3A8T A;  4YJ3 A;  1H38 A;  2AHZ A;  1FJG O;  4HBN A;  4L87 A;  4LF4 B;  1M4U A;  2B1I A;  3ASN B;  4LF8 B;  2ITD C;  4P9O A;  2EIK C;  4J7Z A;  1J95 A;  2UUB B;  4EB6 A;  3X2Q C;  3D8C A;  4MTG A;  3DSQ A;  4B3S O;  1AI4 A;  4X66 B;  5CA1 B;  4WFE A;  3HPL C;  1Y6X A;  4ZKI A;  4J9Y B;  5BR8 B;  4MVM A;  5BMV B;  3K0D A;  2P22 C;  3ETD A;  3TJT A;  2H94 A;  3UKM A;  1YJ9 V;  4HAM A;  3ZHU A;  1IBL B;  2Y4U A;  1H2S B;  4DR3 O;  2YIC A;  1AJN A;  2ZIM A;  5HFM A;  2M7W A;  2QJ1 A;  1IUR A;  4ZBM A;  1S5J A;  4JYA B;  2NLJ C;  4I55 A;  5D5P A;  1PNL A;  3L71 H;  2YI8 A;  2BTO A;  2F66 C;  3JAL A;  3CE2 A;  5H6Q A;  3OR6 C;  3MDS A;  1KP2 A;  1SC5 B;  1Y4M A;  2GSM B;  3ZRX A;  1FD9 A;  2EIM B;  1MZF A;  4J80 A;  5KX5 B;  4GUN A;  3GVM A;  1I5Y A;  1N32 O;  2P4K A;  5JH7 A;  4TOI A;  1QR9 A;  4LH7 A;  4JI4 B;  4FVM A;  4NXN B;  1M57 B;  4KUM A;  3VQV A;  3RVY A;  1NTM H;  1HW7 A;  4PA3 A;  1Y74 A;  5JJJ B;  5GTH Z;  5IDJ A;  1K8A W;  3SYA A;  1RM1 B;  1Z2G A;  4DV0 O;  5IYC O;  4CH5 A;  3E2E A;  1ZSP A;  4GX0 A;  3ZMZ A;  4Q6G A;  1E79 G;  4ZOL A;  5EK0 A;  2JJ1 G;  3JD1 A;  4CS4 A;  3E22 A;  1N8R W;  4IHJ A;  1VIB A;  5EYP A;  4LF9 O;  2P6J A;  1GN3 A;  3OUS A;  4DR1 O;  1AP5 A;  4FIP C;  2QE7 G;  2VRZ A;  4E2L A;  1PKX A;  3BRC A;  4PDV A;  4MSW C;  3OW2 U;  1RSO A;  4BIZ A;  4MT8 A;  4UUJ C;  3JAR A;  1FAF A;  4JI0 O;  1VQ6 V;  4DUY O;  4K0K O;  1V54 C;  5JJN B;  2AZ2 A;  3F5T A;  3D36 C;  1FPO A;  3ZHS A;  4YJ2 B;  4UVA A;  2V4D A;  3BEH A;  1ZUQ A;  3CC2 V;  2XAJ A;  3RT3 C;  4B3M O;  1JVM A;  3FYI B;  1M9N A;  1JOY A;  2Q7E A;  3UO3 A;  3RW0 A;  4DV3 B;  3T1Y B;  3K5M A;  2EIL B;  2IJH A;  2ZE8 A;  2BTQ A;  2ITC C;  4PD4 F;  3CCQ V;  2HP8 A;  3VOU A;  1YIT V;  4YHH B;  3CRR A;  1QCE A;  3HKC A;  2ZNI A;  3RYI A;  1F4M A;  1M90 W;  3K79 A;  4DRX A;  1OCR B;  2WSS G;  2AXT Z;  2DE0 X;  3H1L H;  2LQT A;  1JR9 A;  2PTM A;  2JRI A;  4ZHQ B;  2M6Y A;  4NXM O;  2Q7H A;  1KQS U;  4JAV A;  3QO8 A;  5F2V O;  2UUC B;  4I7Z B;  3RBZ A;  4GT1 A;  3T4Z A;  5LBQ A;  3LUT B;  4UVC A;  3E83 A;  1GAX A;  4RQF A;  2CK3 G;  2R9I A;  2OIG A;  2WWW A;  1JFF B;  4DV1 B;  1NTZ H;  1Z5W A;  1QQC A;  1L1F A;  4LWS A;  3S3W A;  1PL4 A;  2Y0P A;  2DMX A;  5EBM C;  4LFA B;  3P30 A;  4JTD B;  4FLX A;  2EIJ C;  4MTX A;  5L3E A;  1SRY A;  2E5L O;  3H01 A;  4NTY A;  2Z5U A;  1SKV A;  3SJA C;  2LFS A;  2QKS A;  2YXL A;  2Y4T A;  3APQ A;  4O2B B;  5IY5 B;  1XNQ O;  3RGB A;  4H0L B;  3IAY A;  1QNM A;  2PUS A;  4DK0 A;  1TGO A;  4EB6 B;  1K97 A;  1GM9 A;  4LCU C;  4WBN B;  4GZR B;  4GKK O;  1XDC A;  3CP1 A;  4K8X A;  4LH6 A;  3KZI Z;  2QEX V;  1XNR O;  2IJK A;  4J7J A;  2ZM6 O;  2R72 A;  3ABU A;  2HJD A;  3D3Q A;  4XDJ A;  5B5E Z;  2DYS B;  3D36 A;  3FX7 A;  1WB8 A;  2PYJ A;  2N04 A;  3JD4 A;  3O9O A;  3E8G A;  4X9Q A;  2Y69 B;  3ASO B;  2CTW A;  4DV4 O;  1M5I A;  1CEZ A;  2Y48 A;  3CC7 V;  1TUE B;  2DWE C;  2B9Z A;  4C7U A;  3SR2 C;  5EIB D;  3VBB A;  1XL6 A;  2UXC O;  4UB6 Z;  1KB9 F;  3JAL B;  3E35 A;  3ZJZ A;  2DW4 A;  4DUZ O;  4IL6 Z;  3H1I H;  1Z5V A;  5B1A C;  3E8F A;  4LNU A;  2JIZ G;  4GX1 A;  2Q0O C;  2YDE A;  1ZWI C;  1OHH G;  2JK5 C;  4BAY A;  1KU9 A;  1ZL8 A;  1G6U A;  3CME V;  2FML A;  4JPR A;  3B8N A;  5JH7 B;  2CUG A;  4GX5 A;  4TV8 B;  3ZRW A;  2KSD A;  1NVP D;  4HNA B;  3K0G A;  4J7K A;  1AR4 A;  1Y74 B;  4RAI A; 
#chains in the Genus database with same CATH homology
 3N2G B;  4DUY B;  4B3R B;  1Q43 A;  5CB4 B;  4K0K B;  4LR3 A;  1O9H A;  2F95 B;  2ZIO A;  4X1Y A;  5FNV A;  3VQX A;  4DV6 B;  5EZY A;  5ITZ A;  5LP6 B;  1N33 B;  5J2U B;  3HKE B;  2E3C A;  4B3M B;  1Q3E A;  4AIL C;  4FM2 A;  4TQF A;  3E22 B;  3QF7 A;  5EYP B;  5IJ9 A;  1FFX B;  4LFB B;  2UXD B;  4ZI7 A;  4LFC B;  1V9P A;  3A2F A;  2XHB A;  4IIJ A;  2YIB D;  2P5O A;  2EX3 A;  3U10 A;  2JVD A;  3JAR B;  3THO A;  3U11 A;  5K1P A;  5JQG B;  4EFE A;  4FLZ A;  2F4V B;  4YJ3 B;  4TQD A;  5FPR A;  4JV5 B;  3CHX A;  1I7F A;  3UT5 B;  4DV7 B;  4DR7 B;  4NXM B;  4O4J B;  1SQG A;  1TUB B;  1JMK C;  3ZED A;  5KHK A;  3OTF A;  1DGS A;  5IJ0 B;  3U0Z A;  4JI8 B;  1WN7 A;  4U3J B;  1P49 A;  1SQF A;  2BTQ B;  1HNW B;  4X62 B;  3JAW A;  4TV9 A;  1SA0 B;  4LF7 B;  4TV8 A;  3HKC B;  1Q8I A;  1NT2 B;  5KHI A;  3BA9 A;  4EEQ A;  4O4I B;  4DRX B;  4FM1 A;  4JI3 B;  4HNA A;  3BAB A;  4I4T B;  1T5E A;  1TVK A;  3N2G A;  3K5L A;  4X1I B;  3FFQ A;  4B08 A;  2E5L B;  2YI9 A;  3WB1 A;  2VWJ A;  2HEP A;  4UCV A;  3T1H B;  1HNX B;  3N2K B;  1L8D A;  1VF7 A;  4KHP B;  1JFF A;  2PY5 A;  3HKE A;  5JJE B;  1XNQ B;  4X64 B;  4K8Z A;  4I55 B;  4PI0 A;  1FFX A;  4TUY B;  5LP6 C;  2PYL A;  5IYZ A;  3PN1 A;  2VWK A;  5KHG A;  5LMN B;  2ZCE A;  4CH6 A;  5JQG A;  2QM4 A;  4GKK B;  5CA0 A;  3RYH A;  4YJ3 A;  3HKD B;  1XNR B;  3BA8 A;  4HBN A;  4I50 A;  1M4U A;  3QTC A;  2ZM6 B;  4O4L B;  1IBK B;  2HHH B;  4LF4 B;  4LF8 B;  1TA8 A;  3JAK B;  1TUB A;  2UUB B;  1Q5O A;  4EB6 A;  2R70 A;  3DSQ A;  4X66 B;  5CA1 B;  1WPB A;  4X20 B;  3LNN A;  5C8Y B;  4O2A A;  4FLV A;  2OYQ A;  4DV4 B;  1IBM B;  1XHZ A;  3BAA A;  4O4I A;  4LF5 B;  4DV2 B;  4L8J A;  5BR8 B;  4ZOL B;  5BMV B;  4PHZ A;  4I4T A;  2P22 C;  2UXC B;  4IHJ B;  5FPO A;  1M93 A;  4PI2 A;  4DUZ B;  1IBL B;  3N2K A;  1H2S B;  4X65 B;  4CH4 A;  5JVD B;  2ZIM A;  4AHC A;  2QJ1 A;  1S5J A;  4JYA B;  2UXB B;  4I55 A;  5D5P A;  4TUY A;  2YI8 A;  4F6R A;  2OWO A;  2Q0A A;  2BTO A;  2F66 C;  2R9A A;  3K5N A;  3JAL A;  2UU9 B;  1XQ8 A;  4UFZ A;  3RYC B;  5LYJ B;  4UCT A;  5GON A;  5LXT A;  3RYF A;  2Q7G A;  3HKD A;  2RJZ A;  4O4L A;  3SJB C;  5KX5 B;  3K57 A;  3QG5 A;  3JAK A;  5LOV B;  5J2T A;  5EIB C;  5JH7 A;  4FLY A;  4TOI A;  4LH7 A;  4JI4 B;  4FVM A;  4NXN B;  3OTO B;  3RYI B;  3ICX A;  2VQF B;  3VQV A;  4FM0 A;  1I94 B;  2ZNJ A;  4NVP A;  4X1K A;  1HW7 A;  5LA6 A;  5JJJ B;  4UCO A;  5CB4 A;  3JAS B;  4CH5 A;  4UCR A;  4Q6G A;  5LP6 A;  1ZAU A;  5J2U A;  4O4H B;  3CB2 A;  2UUA B;  1B04 A;  4X1Y B;  4ZOL A;  2VQE B;  5EZY B;  2F1M A;  4CS4 A;  5ITZ B;  3E22 A;  4IHJ A;  5EYP A;  5IJ9 B;  3BRC A;  4JI6 B;  5JCO A;  1RSO A;  2CAZ C;  2JS5 A;  4ZI7 B;  4DR5 B;  3JAR A;  4IIJ B;  5JJN B;  1X4T A;  2YIA A;  5JCO C;  4JI1 B;  2JGU A;  4YJ2 B;  1WNS A;  2V4D A;  2YIB A;  5K1X A;  3UT5 A;  4O4J A;  4AQY B;  1XI1 A;  5LYJ A;  4FFB B;  3WB2 A;  4D7T A;  5KHJ A;  2Q7E A;  2ZIN A;  4I9Q A;  5IJ0 A;  4DV3 B;  3T1Y B;  4EFB A;  3WB0 A;  4U3J A;  3K5M A;  2KKW A;  2BTQ A;  1O9G A;  4YHH B;  1SA0 A;  3JSN A;  3HKC A;  2ZNI A;  3RYI A;  1HNZ B;  4TV9 B;  4CC5 A;  2GV9 A;  4DRX A;  1KMI Z;  3BPZ A;  4CH3 A;  4B3T B;  4JI2 B;  2PTM A;  3HKB B;  1XMQ B;  4ZHQ B;  2Q7H A;  2UUC B;  4X1I A;  3JAS A;  4D7S A;  3UQ8 A;  4GKJ B;  1TVK B;  3RFR A;  4O4H A;  3K5O A;  3ZS8 C;  2F93 B;  1FJG B;  1JFF B;  4DV1 B;  1Z5W A;  1QQC A;  4FLU A;  1QHT A;  3ETQ A;  4LFA B;  1J5E B;  5IYZ B;  4FLX A;  5KHH A;  5KMG B;  4B3S B;  4FLW A;  2IM9 A;  4YJ2 A;  1SKV A;  5CA0 B;  4LNU B;  3SJA C;  3RYH B;  3SGI A;  2YXL A;  4O2B B;  3BHP A;  4FFB A;  3RGB A;  4I50 B;  4CS3 A;  3IAY A;  2PUS A;  1N36 B;  4DK0 A;  1TAE A;  4YY3 B;  3SJC C;  1TGO A;  4EB6 B;  5IWA B;  5CA1 A;  3JAT B;  4X20 A;  4WBN B;  5C8Y A;  3MAQ A;  4DR3 B;  4UCS A;  1D5A A;  4CS2 A;  4K8X A;  4LH6 A;  4O2A B;  4KL1 A;  5FNV B;  5BMV A;  3JSL A;  4DK1 A;  3HKB A;  2R72 A;  4ZHQ A;  1YEW A;  4BWA A;  1XHX A;  4BW9 A;  4OX9 B;  4GYC B;  4LF6 B;  5JVD A;  2PYJ A;  3VQW A;  3RWR D;  1XMO B;  1M5I A;  5LMU B;  1N32 B;  5D5Q A;  4DR4 B;  3SR2 C;  5EIB D;  4F6R B;  3RYC A;  5KMG A;  4DR6 B;  3JAL B;  4FLT A;  5GON B;  1Z5V A;  5LXT B;  4DV0 B;  3CSX A;  4LNU A;  3RYF B;  2PGG A;  4UCU A;  5KX5 A;  1JJO A;  2RQ6 A;  4O2B A;  2PZS A;  5LOV A;  3VQY A;  1KU9 A;  1G6U A;  3M7M X;  4CC6 A;  3JAW B;  4LF9 B;  4ZIB A;  1N34 B;  5J2T B;  4DR1 B;  1HR0 B;  5JH7 B;  4TV8 B;  4DV5 B;  3B2E E;  4JI5 B;  3JAT A;  4GLX A;  4WBN A;  3K59 A;  4HNA B;  4X1K B;  4DR2 B;  4JI7 B;  3K58 A;  5LA6 B;  4JI0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...