1X4TA

Solution structure of isy1 domain in hypothetical protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
GSSGSSGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein LOC57905
publication title Solution structure of Isy1 domain in hypothetical protein
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1x4tA01
3B2EE 3QG5A 3SJCC 3ICXA 1X4TA 3CSXA 1NT2B 2CAZC 2JS5A 3THOA 3ZS8C 2F66C 2P22C 3SJBC 3QF7A 1SKVA 3SJAC
chains in the Genus database with same CATH superfamily
5B1BC 3CRMA 4ZI7B 5JWPA 1HNZB 3AG4B 4YHHO 2BTQA 5KA6A 4RWUA 4JYCA 1FXKB 1IBLB 1WA8A 5KHIA 4DV1B 2DYRC 2XUMA 1H2GA 4X88A 3ABUA 3RN4A 1YHQV 3K08A 4K8XA 4F6RB 5LOVA 2EIKC 5GONB 5L3GA 1PD3A 3G80A 1SESA 3G6EV 1T5EA 1SETA 3OUFA 3QO5A 4TUYB 3CWBH 2XNDG 5J2UA 3SYAA 2F4VO 3CCQV 1N34O 4W4KA 1KP2A 2P90A 3E22B 1Q8IA 1DGSA 2FMLA 1EN6A 2R70A 1N36B 1SQVH 2XT9A 2LW1A 3BPZA 3CXHF 1F4MA 4DV0O 4XDLA 4JTAB 4QE7A 3QO7A 2QDOA 3E8HA 3I55V 1XBLA 1XL6A 4O4HB 1VQ5V 4KP4A 1QU7A 3CCUV 1K4CC 5KLVH 4RQEA 1RM1B 1J5EO 1S0VA 4UCTA 2X6BA 4DV3B 4P9PA 5DECA 5JQGA 2XAQA 5JJJB 4LCUC 1FYJA 2BE3A 1WAZA 3RW0A 2ZT9B 5JJNB 2R72A 1NVPB 1SQXH 2ZR2A 3K57A 4UV8A 1E1QG 3CMEV 3ASOB 3HKCA 1P4RA 3ZRWA 1HNWB 4YXWG 3OGCC 2OCHA 2OT5A 1MZFA 1VQ7V 4PA6A 4DR6O 1HW7A 4U3JA 1OHHG 4AHCA 1MMMA 1F23A 2NR5A 5CB4A 3OTOO 3K03A 4DR1O 3E89A 1FPOA 1BCCH 4LWSB 1M56C 3OTFA 1NJIW 2ARHA 5IJ9A 2QWQB 3Q4HA 4TOIA 2OCCC 1GN2A 1FXVA 2ILMA 4FM2A 1IBMB 1TAEA 4RUEA 1P7GA 3K5LA 2UUAB 2V7QG 1GH6A 1A32A 3OMAB 5B1AC 2P06A 2ZNIA 1Y6XA 4X62B 3E86A 3WG7B 3ZCCA 2Y0PA 4B3RB 3G6BA 3SYCA 2PTMA 2LJ2A 4QIWF 4FJCC 4LF4O 4PI0A 2EINC 2AXTZ 3RBZA 2YIDA 4BW5A 4DO2A 4W4LA 4Z1MG 1V55B 3B8NA 2ITCC 2DYSC 3D36A 4DR7O 4OGQB 2JEUA 1KKCA 3LSQA 1QLNA 1AI7A 3BCCH 4NB5A 1WP7A 1Q82W 3F5TA 4YJ2A 4B3SB 3AG1B 4B7KA 2RQ6A 4PA3A 2IM9A 3OM3B 2YC0A 4CBCA 4X1IA 2CH7B 4PA7A 4ZOLA 4MS2A 4R50A 4WF9V 2RMKB 4KHPB 3B09A 1KECA 3WU2Z 3JD1A 4ZHQA 2UXDO 5BMVB 4LF9O 3CP1A 3OT7A 1YJ9V 2N05A 4GX5A 1YDXA 3JALA 5L3FA 1VQ9V 1GK9A 4I7ZB 2XASA 4JPRA 3FKSG 2E5LO 1YSCA 1Q6IA 2JVDA 2LP7A 1R6NA 4D7SA 2JS5A 3K79A 5IYBO 1N32O 4JI0B 3DSQA 4CC5A 1L0LH 3HKEB 3FB8C 1Z2GA 2W6JG 4EB6A 1BE3H 1OCOB 2JIZG 2RDCA 3CC4V 4NXMB 1XOUA 3L71H 1I94B 4WFGA 3CC7V 4GCZA 4HNAA 1K9MW 2WWWA 1OCCC 2B9ZA 4LF6B 2ZIOA 3N27A 5H6QA 3LDCA 3UT5B 3QTCA 3JASB 3GB7C 2EIMB 1IVSA 4JF3A 5FL7G 1SS3A 4TV9A 1GN3A 4X1KA 1J95A 4GKKO 3HKBA 1BZKA 3E8FA 3SJBC 2YI8A 4H33A 2K9PA 5CA0B 2F93B 3ZHQA 2P7TC 1SQGA 5H9CA 4DR3B 1I08A 4Q20A 4DV6O 1YTFD 2N04A 3P32A 5L3BA 1SQPH 2ZXWC 1AP6A 3KCYA 1Y76B 1QVFU 2QWOB 1BMFG 2YIBA 1OCZB 3VQVA 2Q6AA 1Y74A 3X2QB 5C8YA 1OCRC 4GKJB 1OV9A 5LL6Y 3CJHB 1DK1A 1FS0G 1H2KA 3CS5A 4FZ0A 2P4VA 4WFAV 1P7BA 1CP9A 1QBZA 3ETEA 4UCRA 1NBMG 2YSUB 1E79G 3K5NA 3ETGA 2DE0X 1WB8A 2LO1A 5LA6A 3P3NA 4K0KO 3JARB 4DV4B 2Q0OC 3ZS8C 3SYOA 4RUFA 4UUJC 2WAMA 4JTDB 4LFBB 4IT5A 4HYOA 5CA1B 1FKAO 2ZD9A 3K5MA 4LFAB 2VS0A 5C93A 1THZA 2CGNA 4DXWA 2A7WA 3I5DA 4O4LB 2Q9LA 3APOA 2R9RB 3L75H 3JAWA 4PDLA 5LGUA 4DV5B 4LC1A 5KAIZ 4QJFB 5L3CA 3A0BZ 1X59A 1HNXB 2GHYA 1XILA 4JI3B 4KXRA 3SYPA 5KX5B 1FXHA 4J7KA 4NXNB 2L35A 1HWYA 4PV1B 3QG5A 4NTXA 1Q6UA 2LFRA 5LGNA 1Y4MA 2F23A 2UXXA 2OIGA 3TJTA 2RNBA 4I0XB 1VQMV 1NR1A 2QWRB 4G28B 1MSDA 3RYFA 1Q90D 3N2GA 3L72H 5B3SC 1YI2V 1KQSU 4Z2WA 1MOFA 3WB0A 3PN1A 4LF5O 4X1YA 1H8EG 2YXHA 5JVDA 5EYPB 4MVRA 4X89A 4JV5O 2A0LA 5LYJB 4X9QA 1NTZH 4EKWA 3JATA 1KC8W 1EFRG 1AP5A 4LBEC 1VIBA 4YJ3B 4FLVA 3H9VA 4DUZB 4UCVA 4LF7B 3LNMB 1NT2B 1VQOV 4LF8O 5BXZA 4DRXA 5DN6G 5LGTA 2GTSA 2R9AA 5GTHZ 1MABG 1H2NA 5J2TB 4UB6Z 3H01A 2YS8A 2IJKA 2QR4A 3E8BA 4BW9A 5EZYA 3U10A 2QTSA 3RVZA 4JI8B 3ZN0A 4P2ZA 3ASNB 3BA9A 1Z5WA 4J9ZB 2G38A 4LFCB 4NVPA 5KA5A 1PKXA 3H1JH 4O4JA 2R9IA 2OIEA 1AR1B 5IYZA 5IWAB 1DF4A 4DR5O 1JJ2U 2Z5UA 5BR8O 4DUYB 1RPRA 1H2SB 2BTOA 5FPOA 3K9AA 4R6ZA 2WLIA 3E2EA 3K3WA 3ZIAG 1Q3EA 4NYKA 1SRYA 1HNZO 4B3MB 2EIJB 4JI4B 3T1CA 1FD9A 4A5UB 1R6KA 3ABLC 2DWEC 3A0RA 1ORQC 1TUBB 4HBNA 1IBLO 4WBNB 4DV1O 3JD3A 1JR9A 2WLNA 2QM4A 1OCOC 4ZI7A 2V4DA 5LP6C 1WNSA 3VOUA 2ATKC 4GUNA 2ZE8A 3FB6C 2BSKA 5CN0A 3BHPA 5LMUB 4FK5C 2JK5C 4DV7B 1B6QA 4F6RA 1N36O 2UUCB 1M57B 5GONA 2HG5C 2EBOA 1XNRB 4MTGA 4D7TA 3F7YC 2NNUA 1ZLZA 4X20A 4GX1A 1PP9H 4JTCB 4TUYA 5EBMC 2QGNA 4FFBB 2IH1C 3JAKA 3LDEA 1CPYA 1KMIZ 1GTOA 3JAMN 1V54B 3NXSA 1EN4A 3DGEA 4JYAB 3SPCA 4BAYA 2QM8A 2ZM6B 3OR7C 2EJ7A 3CCLV 3NR7A 1OCZC 2UU9B 2PF4E 1H38A 1W2BU 4X64B 1HDJA 4DV3O 5LHGA 2WLLA 5L3DA 3E35A 3BAAA 1NZ6A 4O4HA 4UCUA 2Y48A 2DWDC 1VF7A 3CD6V 3JD2A 2UXNA 2P67A 4TV8B 1X4TA 4DR4B 3DTUB 3KKYA 3QVNA 3G71V 1O9HA 2RCVA 1HNWO 3U0ZA 3WB1A 1N33B 4MT8A 3GVMA 2QM7A 2ZNJA 1NR7A 5KHKA 1VARA 1GM9A 2N74A 4CC6A 3L70H 2ZKOA 1CEZA 2ETNA 4MVSA 5BZBA 4EEQA 2AHYA 4FLZA 2WA3A 5FNVB 1IBMO 3UO2A 2UUAO 3ZMVA 2DOSA 3WB2A 2CUGA 2EILC 2VQFB 1M90W 1G6UA 2Q7GA 3D3IA 4LWSA 2UUBB 1R3LC 3HR0A 1LUVA 2Q5ZA 1PNKA 4B3RO 2F95B 2RJZA 3CCJV 1GN4A 2P22C 3FB7C 1B06A 5LOVB 2Q8VA 2X6AA 1BSMA 1EBOA 1QR8A 4JI6B 1K5SA 1NH2D 1KB9F 2E75B 3E8GA 5CBGA 5IY5B 4JYBA 3ZJZA 3AK3A 1L1FA 4ABMA 4L87A 5GTIZ 5LXTB 4OX9B 4UB8Z 5LMNB 2D3OW 4JAVA 1YITV 1SKVA 4WFBV 4WCEV 4TQFA 3FFQA 4B3SO 3OGIB 2XAHA 3LSUA 4J7JA 5HFMA 1BQZA 1N0JA 3CYOA 4J41A 4YY3B 2VQEB 3CMAV 5EC1C 3CCMV 4FLWA 4YIOA 4CZZA 3A8TA 4KHPO 2Y69B 1U97A 1AJQA 3EHBB 3OAAG 4FM0A 1XI1A 2OTLV 4LH7A 5LBQA 3GWOA 3R65A 2F43G 3CC2V 1ZL8A 4LNUB 1H2MA 2CH7A 2UXCB 4AQYO 4G27B 3EVKA 1ZSPA 1BGYH 5H6RA 4JI0O 2JGDA 2GDSA 1K97A 5BMVA 3RYHB 5K1XA 2K1EA 4NXMO 3ABTA 4O2BB 5D5QA 1VP7A 2EZPA 1I7FA 1I5YA 3M7MX 1P84F 2D2CB 2KB1A 2MW2B 3JCZA 1Q5OA 2Q4PA 4LF6O 1RSOA 2W0XA 4IIJA 1YVWA 2LGWA 5FPRA 4H13B 1QLEB 1XMQB 3ABKB 5LP6A 3IC9A 2YIBD 4I9WA 1GN6A 1Z5VA 1S72V 1AROP 2BOBC 1K5QA 3ZHVA 3ABMB 4DR3O 4UFZA 2ZCEA 1AR4A 1SQBH 3UT5A 1WPBA 3B2EE 3T1HB 1SF9A 3AG2C 2HVKC 5KUMA 5FLXN 2KKWA 3T1YO 1JFFB 5L3EA 4GKJO 3N2KA 3RYIB 2CDYA 1VQKV 2HHHB 4I50B 3K58A 4DYLA 1NTMH 3L9DA 2AZ0A 4IHJB 4P30A 2HLDG 3CXCU 3JD0A 4LR3A 1NU1H 1K8AW 3ETQA 2QKSA 3C3SA 2OTJV 4FVMA 1SA0B 3W7TA 1SQQH 4DV4O 5IJ0B 1F4NA 1E1RG 4YJ2B 4O2AA 3T4ZA 4LF4B 2IH3C 1K33A 4JZGA 4EFBA 4N21A 4C7UA 2CTRA 4LFBO 1MG1A 2Y4TA 1OZ0A 4LFAO 2DQ3A 1VQPV 1D5NA 3H1HH 2QKCA 1IBKB 1IURA 1N0NA 2IBZH 4ZHQB 2P5OA 4UCSA 4DV5O 1XMOB 3OEHG 1AI4A 2VRZA 3CCRV 3AG4C 1KD1W 4G2KA 1JJOA 4FM1A 2Q67A 2YEVA 2PUSA 4FLTA 2X6CA 5CA1A 5AG2A 1AVMA 2VWKA 1FXKC 1XL4A 3JALB 2XOKG 4X8AA 3FAVB 4N23A 2E3CA 2QJ1A 4O4LA 1TVKA 2B1GA 4CH5A 2QEXV 3ZRSA 1AR5A 5K1PA 1XUQA 5B1BB 3O9OA 5KAFZ 1YJWV 4PI2A 1GRJA 1MA1A 1URFA 1VQNV 1QR9A 1S5HC 4HNAB 1PL0A 1R1BA 5KX5A 2OWOA 3FYIB 1M4UA 4ZKIA 1HR0B 3ZMUA 1NI8A 5KMGB 4X1KB 2YXLA 3SR2C 1S76D 3C90A 2ZE6A 4JGSA 1M1KW 4PDVA 2KSDA 4UVCA 2ZE5A 1SZTA 4QPKA 2KG7B 4JZ2A 4JI7B 1RM1C 2EX3A 5EC2C 2Q69A 3G67A 2A06H 3F7VC 4DUZO 1UJWB 2XHBA 4LF7O 1QNMA 5LYJA 3BEHA 4PHZA 1FFXB 5B5EZ 1EM1A 1WLEA 1R3IC 4CH4A 3T4DA 1GMGA 2MK3A 3ASOC 4JI8O 4YJ3A 3CCVV 4IYIA 5LA6B 3CRQA 2GSMB 5LHIA 3KG2A 1R6TA 5E1AC 2BOCC 3CRAA 4B3TB 4B08A 4KUMA 1RFYA 5J2TA 2JGUA 1VQLV 1BS3A 3QNEA 2IJIA 5IWAO 4DW0A 1LR1A 3UO3A 1QVGU 1MNGA 1LUWA 3RYCB 4DUYO 2Q0AA 4JI2B 2Y4UA 2Z3YA 2PYJA 4WFHA 4F4LA 1QQCA 5HFLA 3OUSA 4FZ1A 4HZ3A 2DW4A 1Y67A 3JAWB 3TETA 4P9OA 4B3MO 3DC5A 4DV2B 4JI4O 5B1OA 4E4EA 4KL1A 2GBOA 1JA8A 1M56B 3WG7C 1XNQB 5BY1A 4NR1A 2PYLA 1VMGA 1CXZB 4JAUA 4WFEA 1AI5A 4DR2B 1RP3B 4GLXA 1YTFB 2P6JA 2WLKA 4I55A 1MZEA 4FIPC 5B1AB 1V55C 4NTYA 3ZEDA 4UVAA 2W0FC 1TUBA 1XHZA 3K5OA 4WBNA 5LMUO 4DV7O 2UXBB 2QKAA 3N2GB 2HR3A 3SPHA 1PL4A 2UUCO 3AG1C 1AB3A 1ENVA 2O57A 1XNRO 2CGOA 2WPDG 3STZC 3ABKC 4QPJA 4X1YB 4PA9A 1N4CA 4PD4F 5JVDB 3DXRA 1D2DA 2DYSB 1D5AA 5ITZB 2LQTA 3HPLC 3I56V 4BIUA 4MW3A 3CX5F 3ABMC 4J7ZA 4JYAO 3JSLA 3SPJA 4PA4A 3JATB 2ZM6O 4JI1B 3UQ8A 2UU9O 5DEDA 5IYCO 4X64O 3FD9A 3HKDA 1G4YB 4NKGB 2QTOA 2AZ2A 1FAFA 3R66A 4DR4O 3BRCA 3AK1A 2FL4A 3L73H 3JYCA 1ROPA 1BT8A 2YICA 3A2FA 3TCUA 3ZHUA 1NVPD 1B3QA 1ZWIC 5KHGA 1IXMA 3HB3B 1GAXA 2CTQA 1FXKA 5JCOA 3OFNG 1US6A 2PI5A 1DF5A 3L74H 4ASUG 4LF8B 4I4TB 4TV8A 1PPJH 4O4IB 2EIMC 4X66B 3AG7A 2Q7HA 4MVMA 4JI5B 4K8ZA 2JS3A 1W0JG 1XHXA 5CMUA 5E79Z 4AI8A 2DN9A 1P49A 1FJGB 2GUZB 3RWRD 1K34A 2ZDIC 3BABA 1GM8A 3SJCC 1UFIA 2A79B 3E22A 4UVBA 1Q43A 1OCCB 1S3JA 4MSWC 1VQ8V 5CA3A 3ZHRA 4BWAA 2DQ0A 4MTOA 5FNVA 2HJDA 4OPAA 1GKFA 1ZAUA 3JD4A 3X2QC 1Q6HA 1BHAA 2PZSA 5EBWC 5A9GA 2CAZC 2AGAA 2QE7G 4JI6O 3ZMSA 1WJZA 1YCIA 3J80N 3WFVA 3ICXA 3THOA 2ZXWB 1BHBA 3DC6A 4OX9O 4K35A 2BSKB 5LMNO 4X65B 1NS1A 3F5WC 2PGGA 1OCRB 1XQ8A 4UCOA 3U11A 1WPXA 5KUKA 4GX0A 3J81N 4YY3O 2VQEO 1AILA 4X20B 1F7YA 5LXTA 1COWG 3JAKB 2ZR3A 3ML0A 3CEIA 5JH7B 1IZ3A 3ZRVA 4MVZA 3W7SA 3PJSK 1PM9A 4X62O 1Q81W 2BTQB 2XAGA 2UXCO 1AI6A 1WB7A 3CHXA 2WA4A 2WLLB 5EIBC 1YJNV 2FTKA 1WA8B 3IC7A 1WP8A 4AILC 4J42A 3EXAA 5DM6V 3VBBA 4FLUA 4JASA 1G8MA 2QWNB 2YIAA 2ADQB 4LNUA 1KUQA 2B1IA 2XAJA 4YHHB 5CBFA 1OJHA 1AJNA 2GV9A 5J2UB 1EZVH 2LW7A 3FX7A 3ZN1A 3SDLA 3G4SV 4KFMA 1NTKH 2LFSA 3S3WA 3RYHA 1XMQO 4FPPA 4WFFA 1KKDA 2JJ2G 1KP3A 4BR6A 2RN9A 4O2BA 2Y0IA 2ZQMA 3CRCA 3VQWA 4YIPA 2M6YA 2F4VB 1N34B 4F6EA 3LDDA 5B3SB 1IDSA 3AK2A 1R73A 3T1HO 1JX9A 4GX2A 2BCCH 5IDJA 4DV0B 2NLJC 5H2FZ 1IXBA 3TXSA 3ZMZA 1ZUQA 1LNQA 4R8CA 5JQGB 3LSSA 5IT9N 2FB5A 2HHHO 1TA8A 1QCEA 3O65A 3JCUZ 5IYDO 2EULA 3ASNC 4CS4A 3HKCB 5GW7A 3ZRWB 3MHSC 1JFFA 1J5EB 3M8AA 1I94O 4J11A 1M5IA 4U3JB 2GTAA 5CB4B 3RYIA 1L8DA 3UM7A 2DJVA 4U7NA 3CSXA 3RFRA 3TXQA 3HKEA 4I50A 2PI4A 5IJ9B 4IHJA 3Q4HB 1SQFA 3SYQA 1SZXA 2ZIMA 1IBKO 2Q73A 4DR6B 1SA0A 1UPGA 5IJ0A 3OTOB 1XMOO 3CCEV 4DR1B 4RO2A 2EIJC 3JASA 1K92A 2X0LA 1ZL8B 3JSNA 4K3AA 3W7XA 3B4SA 1IX9A 1XEQA 2ZE7A 3W7UA 5EK0A 2F1MA 4QE9A 1TUEB 5CA0A 1KU9A 2YUAA 2ZDIA 5EIBD 2JGDB 4CH6A 3KZIZ 3SPIA 2QWPB 1M9NA 5KHHA 2A9HA 1Y76A 3ABLB 3FAVA 4BIOA 4AQYB 3ZMTA 4E2LA 3BA8A 1EN5A 4TT3G 1XREA 4OPHA 1RSOB 4GYCB 1M57C 3AG3B 2AHZA 3CJHA 3LUTB 4IIJB 1GO3F 1NH2B 1ZX3A 1HR0O 4XBFA 1AJPA 2B5UA 4X1IB 5LP6B 1EZJA 2X7RB 3OW2U 4ZOLB 1G1XB 2W6IG 3H1LH 4DR7B 1V54C 2DMXA 4H44B 4PDRA 4LH6A 1BQ0A 4MW8A 1YIJV 2WLHA 3JARA 1VF6C 1K4DC 3K04A 4J10A 4JI7O 2IW5A 3SPGA 1VQ6V 3ETDA 2QA4V 3IJ4A 5KMGA 5JCOC 1HNXO 4JI3O 4H0LB 2CTWA 1JCHA 3D8CA 2NN4A 1JMKC 4UV9A 3N2KB 4NXNO 1M93A 3RVYA 2VWJA 4CH3A 1JPXA 2YXYA 2UXDB 4LF9B 2HVJC 4PJ0Z 2KG7A 1RPOA 4EB6B 3MHHC 2QSAA 1JQ0A 4FLXA 3T1YB 4J80A 4Z1VA 3IAYA 4DW1A 1B04A 5KHJA 2E5LB 4TWKA 2DYRB 4B3TO 1FFXA 4CS3A 4O2AB 1N32B 3K9SA 2EIKB 1YEWA 2YI9A 4JAAA 1BL8A 1VQ4V 1W59A 4L8JA 4I0XA 4ZIBA 1O9GA 1V9PA 4JI2O 1I0HA 3OR6C 4TV9B 5EBLC 3HKBB 3TGUH 1ZTEA 4H37A 3BVOA 2L6LA 3QO8A 2Q68A 4NTWA 1DLBA 2JDIG 5B1NA 4DV2O 4DK0A 5TISZ 2Q7EA 2YEVB 3P3PA 2JJ1G 3SJAC 3E83A 1XNQO 4TQDA 3RYCA 2M7WA 3FYEB 3FB5C 3VQYA 2PY5A 5EYPA 1S5JA 1Y74B 4Q6GA 2FYUH 4GKKB 4XDKA 1Q86W 1TVKB 5C8YB 1Y66A 4DR2O 3APQA 3CE2A 3EFFK 4I5SA 3M99B 2EILB 1SERA 2V1DA 4U7OA 4BIZA 2LGQA 4DV6B 5IY5C 2P4KA 3GWKC 4LP8A 2CTPA 3SJQC 2ITDC 1VF5B 2UXBO 2HJFC 1PNMA 4LFCO 3OE7G 2CK3G 5LHHA 1K7DA 4MVQA 1NKDA 2XTAA 4IGGA 1HP8A 2H8PC 3P30A 3OMIB 2HEPA 3SGIA 2Y69C 1L0NH 3MD0A 4FFKA 3OEEG 3K0DA 2ADPA 4K0KB 5A2QN 4JI1O 1H8HG 1YZBA 1R3KC 4MVOA 2E74B 4PELA 1GM7A 5F2VO 5JJEB 4JYYA 2OCCB 1PNLA 5ITZA 1JOYA 4HAMA 4D6TH 1MSWD 2WSSG 1K3EA 3B77A 2Z0AA 3OD4A 4QNHB 1F51A 1W0KG 3RT3C 4IL6Z 3H1KH 4RQFA 2HKOA 3ZX6A 4I9QA 5CBHA 1H2LA 1FFTB 2ODMA 3RYFB 2H94A 2IJJA 3W7WA 2EINB 4X66O 1QLEC 4JI5O 1WN7A 4FLYA 1R3JC 4IYHA 4MVUA 3UCSC 3STLC 2AW9A 1FJGO 2CE4A 3AEIA 1KBHA 2F66C 3LNNA 3D3QA 2HFEC 4DK1A 4I4TA 2IJHA 4TSFG 5H5NA 1TGOA 4UXNA 3K0GA 4O4IA 2IU0A 2WLJA 4ICGA 3B8MA 3ZRXA 1YF2A 3UKMA 4LF5B 3B40A 3ZBHA 1N8RW 4FFBA 3BY6A 2GUZA 2ZINA 4JV5B 2OYQA 4U3FH 3RGBA 4DRXB 2WLMA 1U96A 4FMTA 4I55B 4PDMA 1QHTA 1SC5B 2HP8A 1VF6A 3CCSV 4MTFA 1I5XA 3S3XA 3J7AU 1KYOF 5EZYB 3D36C 4QGPA 3AG2B 1DTOA 1Q7YW 3C3TA 3K59A 4X65O 3K06A 1N33O 4MTXA 3CPWU 2JRIA 1YXBA 3T2MA 3AG3C 2JEXA 4GT1A 3IFXA 1NQTA 3ZHSA 4O4JB 5IYZB 3QF7A 1S5LZ 3KCXA 3DXRB 3A0HZ 4J9YB 4R7CA 2IU3A 1JVMA 4B7EA 4EFEA 5J9PC 3CB2A 1XDCA 2KQXA 3OMNB 3BFRA 2E76B 2WLIB 3VQXA 2VQFO 3TK1A 2A3QA 2EZOA 4GZRB 5IE9A 2XAFA 2H3OA 1S77D 2C2AA 2UUBO 4ZBMA 4DR5B 3IGAC 3CRRA 3HKDB 5BR8B 1K73W 3MDSA 4XDJA 2YDEA 5B66Z 1PV0A 4RAIA 2EJRA 3ZHTA 1VEWA 4OXSA 4CS2A 3H1IH 3MAQA 5D5PA 5JH7A 2FKXA
chains in the Genus database with same CATH topology
1TA8A 1HNZB 4ZI7B 2E3CA 2QJ1A 4O4LA 1TVKA 4YJ3B 4FLVA 2BTQA 4DUZB 4UCVA 4CH5A 4LF7B 1NT2B 4DRXA 5K1PA 1IBLB 4CS4A 3HKCB 5KHIA 1JFFA 2R9AA 4DV1B 1J5EB 5J2TB 1M5IA 4K8XA 4F6RB 4BW9A 4PI2A 4U3JB 5LOVA 5GONB 5CB4B 5EZYA 3U10A 4JI8B 3RYIA 1L8DA 4HNAB 3CSXA 3RFRA 5KX5A 3BA9A 1Z5WA 1T5EA 3HKEA 4I50A 2OWOA 4TUYB 4LFCB 4IHJA 5IJ9B 1SQFA 5J2UA 4NVPA 1M4UA 2ZIMA 1HR0B 3E22B 4O4JA 1Q8IA 5KMGB 1DGSA 5IYZA 5IWAB 4DR6B 1SA0A 2R70A 4X1KB 1N36B 5IJ0A 2YXLA 3OTOB 3SR2C 4DUYB 1H2SB 2BTOA 4DR1B 3BPZA 3JASA 5FPOA 3JSNA 1Q3EA 4O4HB 4JI7B 2EX3A 2F1MA 4B3MB 4JI4B 5CA0A 2XHBA 1KU9A 5EIBD 5LYJA 4CH6A 1TUBB 4HBNA 4PHZA 4WBNB 1FFXB 5KHHA 4CH4A 4UCTA 4DV3B 5JQGA 5JJJB 4AQYB 2QM4A 3BA8A 4ZI7A 5LP6C 2V4DA 4YJ3A 1WNSA 5JJNB 2R72A 4GYCB 3K57A 5LA6B 4IIJB 3BHPA 3HKCA 4B3TB 5LMUB 1HNWB 4B08A 4DV7B 5J2TA 2JGUA 5LP6B 4X1IB 4F6RA 4ZOLB 1HW7A 4U3JA 2UUCB 5GONA 4AHCA 5CB4A 4DR7B 3RYCB 2Q0AA 1XNRB 4LH6A 4D7TA 4JI2B 3JARA 2PYJA 4X20A 3OTFA 1QQCA 4TUYA 4FFBB 3JAKA 5IJ9A 4TOIA 1KMIZ 3JAWB 4DV2B 4FM2A 1IBMB 4JYAB 1TAEA 4KL1A 5KMGA 2UUAB 5JCOC 3K5LA 1XNQB 2ZM6B 1JMKC 3N2KB 1M93A 2UU9B 2PYLA 2ZNIA 2VWJA 4CH3A 4X64B 4X62B 2UXDB 4DR2B 4GLXA 4LF9B 3BAAA 4EB6B 4O4HA 4I55A 4B3RB 4UCUA 1VF7A 4FLXA 2PTMA 4TV8B 1X4TA 4DR4B 3T1YB 3IAYA 1B04A 3ZEDA 5KHJA 4PI0A 2E5LB 1TUBA 1O9HA 1XHZA 3K5OA 4WBNA 1FFXA 3U0ZA 4CS3A 4O2AB 1N32B 3WB1A 2UXBB 3N2GB 2YI9A 1YEWA 1N33B 2ZNJA 4L8JA 5KHKA 4ZIBA 1O9GA 1V9PA 4CC6A 4TV9B 4X1YB 3HKBB 5JVDB 4EEQA 4YJ2A 4FLZA 4B3SB 2RQ6A 1D5AA 2IM9A 5ITZB 5FNVB 4DK0A 4X1IA 3JSLA 4ZOLA 2Q7EA 3WB2A 3SJAC 3JATB 4TQDA 4JI1B 3RYCA 2VQFB 4KHPB 3UQ8A 3VQYA 2PY5A 5EYPA 1S5JA 1G6UA 4Q6GA 4ZHQA 4GKKB 2Q7GA 1TVKB 5C8YB 3HKDA 5BMVB 2UUBB 2F95B 2RJZA 2P22C 4DV6B 3BRCA 3JALA 3A2FA 5LOVB 2JVDA 4D7SA 2JS5A 4JI6B 5KHGA 4JI0B 3DSQA 4CC5A 5JCOA 3HKEB 5LXTB 4EB6A 4OX9B 4LF8B 5LMNB 4NXMB 4I4TB 4TV8A 1SKVA 1I94B 2HEPA 4O4IB 4TQFA 3FFQA 4X66B 3SGIA 2Q7HA 4HNAA 4JI5B 4K8ZA 1XHXA 4LF6B 2ZIOA 4YY3B 3UT5B 1P49A 3QTCA 3JASB 2VQEB 1FJGB 4K0KB 3RWRD 3BABA 4FLWA 3SJCC 3E22A 1Q43A 4TV9A 4FM0A 4X1KA 3HKBA 3SJBC 2YI8A 5CA0B 4BWAA 1XI1A 2F93B 5JJEB 4LH7A 1SQGA 5ITZA 5FNVA 4DR3B 4LNUB 1ZAUA 2PZSA 2UXCB 2YIBA 2CAZC 3VQVA 3ICXA 3THOA 5C8YA 5BMVA 3RYHB 5K1XA 4I9QA 4GKJB 3RYFB 4X65B 4O2BB 5D5QA 1I7FA 2PGGA 3M7MX 4UCRA 1XQ8A 4UCOA 1WN7A 4FLYA 1Q5OA 3U11A 1RSOA 3K5NA 5LA6A 4IIJA 3JARB 5FPRA 4DV4B 4X20B 2F66C 3LNNA 5LXTA 3ZS8C 1XMQB 3JAKB 5LP6A 4DK1A 4I4TA 4LFBB 2YIBD 1TGOA 5CA1B 4O4IA 1Z5VA 5JH7B 3K5MA 4LFAB 4LF5B 4UFZA 2ZCEA 4O4LB 3UT5A 2BTQB 4FFBA 1WPBA 3B2EE 3T1HB 2ZINA 3JAWA 4JV5B 2OYQA 3CHXA 3RGBA 4DRXB 4DV5B 5EIBC 2KKWA 1JFFB 4I55B 1QHTA 4AILC 3N2KA 5EZYB 1HNXB 3RYIB 4FLUA 4JI3B 2HHHB 3K59A 2YIAA 5KX5B 4LNUA 4YHHB 4NXNB 4I50B 3K58A 3QG5A 4IHJB 2GV9A 5J2UB 4LR3A 4O4JB 3ETQA 5IYZB 4FVMA 1SA0B 3QF7A 3RYHA 5IJ0B 4YJ2B 4LF4B 4O2AA 3RYFA 4EFEA 3N2GA 4EFBA 3CB2A 4O2BA 3VQWA 3VQXA 3WB0A 3PN1A 2F4VB 4X1YA 1N34B 1IBKB 5JVDA 5EYPB 4DR5B 4ZHQB 5LYJB 2P5OA 3HKDB 5BR8B 4UCSA 1XMOB 1JJOA 4DV0B 4FM1A 2PUSA 4FLTA 5CA1A 3JATA 5JQGB 4CS2A 2VWKA 3MAQA 5D5PA 3JALB 5JH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2E E;  3QG5 A;  3SJC C;  3ICX A;  1X4T A;  3CSX A;  1NT2 B;  2CAZ C;  2JS5 A;  3THO A;  3ZS8 C;  2F66 C;  2P22 C;  3SJB C;  3QF7 A;  1SKV A;  3SJA C; 
#chains in the Genus database with same CATH topology
 5B1B C;  3CRM A;  4ZI7 B;  5JWP A;  1HNZ B;  3AG4 B;  4YHH O;  2BTQ A;  5KA6 A;  4RWU A;  4JYC A;  1FXK B;  1IBL B;  1WA8 A;  5KHI A;  4DV1 B;  2DYR C;  2XUM A;  1H2G A;  4X88 A;  3ABU A;  3RN4 A;  1YHQ V;  3K08 A;  4K8X A;  4F6R B;  5LOV A;  2EIK C;  5GON B;  5L3G A;  1PD3 A;  3G80 A;  1SES A;  3G6E V;  1T5E A;  1SET A;  3OUF A;  3QO5 A;  4TUY B;  3CWB H;  2XND G;  5J2U A;  3SYA A;  2F4V O;  3CCQ V;  1N34 O;  4W4K A;  1KP2 A;  2P90 A;  3E22 B;  1Q8I A;  1DGS A;  2FML A;  1EN6 A;  2R70 A;  1N36 B;  1SQV H;  2XT9 A;  2LW1 A;  3BPZ A;  3CXH F;  1F4M A;  4DV0 O;  4XDL A;  4JTA B;  4QE7 A;  3QO7 A;  2QDO A;  3E8H A;  3I55 V;  1XBL A;  1XL6 A;  4O4H B;  1VQ5 V;  4KP4 A;  1QU7 A;  3CCU V;  1K4C C;  5KLV H;  4RQE A;  1RM1 B;  1J5E O;  1S0V A;  4UCT A;  2X6B A;  4DV3 B;  4P9P A;  5DEC A;  5JQG A;  2XAQ A;  5JJJ B;  4LCU C;  1FYJ A;  2BE3 A;  1WAZ A;  3RW0 A;  2ZT9 B;  5JJN B;  2R72 A;  1NVP B;  1SQX H;  2ZR2 A;  3K57 A;  4UV8 A;  1E1Q G;  3CME V;  3ASO B;  3HKC A;  1P4R A;  3ZRW A;  1HNW B;  4YXW G;  3OGC C;  2OCH A;  2OT5 A;  1MZF A;  1VQ7 V;  4PA6 A;  4DR6 O;  1HW7 A;  4U3J A;  1OHH G;  4AHC A;  1MMM A;  1F23 A;  2NR5 A;  5CB4 A;  3OTO O;  3K03 A;  4DR1 O;  3E89 A;  1FPO A;  1BCC H;  4LWS B;  1M56 C;  3OTF A;  1NJI W;  2ARH A;  5IJ9 A;  2QWQ B;  3Q4H A;  4TOI A;  2OCC C;  1GN2 A;  1FXV A;  2ILM A;  4FM2 A;  1IBM B;  1TAE A;  4RUE A;  1P7G A;  3K5L A;  2UUA B;  2V7Q G;  1GH6 A;  1A32 A;  3OMA B;  5B1A C;  2P06 A;  2ZNI A;  1Y6X A;  4X62 B;  3E86 A;  3WG7 B;  3ZCC A;  2Y0P A;  4B3R B;  3G6B A;  3SYC A;  2PTM A;  2LJ2 A;  4QIW F;  4FJC C;  4LF4 O;  4PI0 A;  2EIN C;  2AXT Z;  3RBZ A;  2YID A;  4BW5 A;  4DO2 A;  4W4L A;  4Z1M G;  1V55 B;  3B8N A;  2ITC C;  2DYS C;  3D36 A;  4DR7 O;  4OGQ B;  2JEU A;  1KKC A;  3LSQ A;  1QLN A;  1AI7 A;  3BCC H;  4NB5 A;  1WP7 A;  1Q82 W;  3F5T A;  4YJ2 A;  4B3S B;  3AG1 B;  4B7K A;  2RQ6 A;  4PA3 A;  2IM9 A;  3OM3 B;  2YC0 A;  4CBC A;  4X1I A;  2CH7 B;  4PA7 A;  4ZOL A;  4MS2 A;  4R50 A;  4WF9 V;  2RMK B;  4KHP B;  3B09 A;  1KEC A;  3WU2 Z;  3JD1 A;  4ZHQ A;  2UXD O;  5BMV B;  4LF9 O;  3CP1 A;  3OT7 A;  1YJ9 V;  2N05 A;  4GX5 A;  1YDX A;  3JAL A;  5L3F A;  1VQ9 V;  1GK9 A;  4I7Z B;  2XAS A;  4JPR A;  3FKS G;  2E5L O;  1YSC A;  1Q6I A;  2JVD A;  2LP7 A;  1R6N A;  4D7S A;  2JS5 A;  3K79 A;  5IYB O;  1N32 O;  4JI0 B;  3DSQ A;  4CC5 A;  1L0L H;  3HKE B;  3FB8 C;  1Z2G A;  2W6J G;  4EB6 A;  1BE3 H;  1OCO B;  2JIZ G;  2RDC A;  3CC4 V;  4NXM B;  1XOU A;  3L71 H;  1I94 B;  4WFG A;  3CC7 V;  4GCZ A;  4HNA A;  1K9M W;  2WWW A;  1OCC C;  2B9Z A;  4LF6 B;  2ZIO A;  3N27 A;  5H6Q A;  3LDC A;  3UT5 B;  3QTC A;  3JAS B;  3GB7 C;  2EIM B;  1IVS A;  4JF3 A;  5FL7 G;  1SS3 A;  4TV9 A;  1GN3 A;  4X1K A;  1J95 A;  4GKK O;  3HKB A;  1BZK A;  3E8F A;  3SJB C;  2YI8 A;  4H33 A;  2K9P A;  5CA0 B;  2F93 B;  3ZHQ A;  2P7T C;  1SQG A;  5H9C A;  4DR3 B;  1I08 A;  4Q20 A;  4DV6 O;  1YTF D;  2N04 A;  3P32 A;  5L3B A;  1SQP H;  2ZXW C;  1AP6 A;  3KCY A;  1Y76 B;  1QVF U;  2QWO B;  1BMF G;  2YIB A;  1OCZ B;  3VQV A;  2Q6A A;  1Y74 A;  3X2Q B;  5C8Y A;  1OCR C;  4GKJ B;  1OV9 A;  5LL6 Y;  3CJH B;  1DK1 A;  1FS0 G;  1H2K A;  3CS5 A;  4FZ0 A;  2P4V A;  4WFA V;  1P7B A;  1CP9 A;  1QBZ A;  3ETE A;  4UCR A;  1NBM G;  2YSU B;  1E79 G;  3K5N A;  3ETG A;  2DE0 X;  1WB8 A;  2LO1 A;  5LA6 A;  3P3N A;  4K0K O;  3JAR B;  4DV4 B;  2Q0O C;  3ZS8 C;  3SYO A;  4RUF A;  4UUJ C;  2WAM A;  4JTD B;  4LFB B;  4IT5 A;  4HYO A;  5CA1 B;  1FKA O;  2ZD9 A;  3K5M A;  4LFA B;  2VS0 A;  5C93 A;  1THZ A;  2CGN A;  4DXW A;  2A7W A;  3I5D A;  4O4L B;  2Q9L A;  3APO A;  2R9R B;  3L75 H;  3JAW A;  4PDL A;  5LGU A;  4DV5 B;  4LC1 A;  5KAI Z;  4QJF B;  5L3C A;  3A0B Z;  1X59 A;  1HNX B;  2GHY A;  1XIL A;  4JI3 B;  4KXR A;  3SYP A;  5KX5 B;  1FXH A;  4J7K A;  4NXN B;  2L35 A;  1HWY A;  4PV1 B;  3QG5 A;  4NTX A;  1Q6U A;  2LFR A;  5LGN A;  1Y4M A;  2F23 A;  2UXX A;  2OIG A;  3TJT A;  2RNB A;  4I0X B;  1VQM V;  1NR1 A;  2QWR B;  4G28 B;  1MSD A;  3RYF A;  1Q90 D;  3N2G A;  3L72 H;  5B3S C;  1YI2 V;  1KQS U;  4Z2W A;  1MOF A;  3WB0 A;  3PN1 A;  4LF5 O;  4X1Y A;  1H8E G;  2YXH A;  5JVD A;  5EYP B;  4MVR A;  4X89 A;  4JV5 O;  2A0L A;  5LYJ B;  4X9Q A;  1NTZ H;  4EKW A;  3JAT A;  1KC8 W;  1EFR G;  1AP5 A;  4LBE C;  1VIB A;  4YJ3 B;  4FLV A;  3H9V A;  4DUZ B;  4UCV A;  4LF7 B;  3LNM B;  1NT2 B;  1VQO V;  4LF8 O;  5BXZ A;  4DRX A;  5DN6 G;  5LGT A;  2GTS A;  2R9A A;  5GTH Z;  1MAB G;  1H2N A;  5J2T B;  4UB6 Z;  3H01 A;  2YS8 A;  2IJK A;  2QR4 A;  3E8B A;  4BW9 A;  5EZY A;  3U10 A;  2QTS A;  3RVZ A;  4JI8 B;  3ZN0 A;  4P2Z A;  3ASN B;  3BA9 A;  1Z5W A;  4J9Z B;  2G38 A;  4LFC B;  4NVP A;  5KA5 A;  1PKX A;  3H1J H;  4O4J A;  2R9I A;  2OIE A;  1AR1 B;  5IYZ A;  5IWA B;  1DF4 A;  4DR5 O;  1JJ2 U;  2Z5U A;  5BR8 O;  4DUY B;  1RPR A;  1H2S B;  2BTO A;  5FPO A;  3K9A A;  4R6Z A;  2WLI A;  3E2E A;  3K3W A;  3ZIA G;  1Q3E A;  4NYK A;  1SRY A;  1HNZ O;  4B3M B;  2EIJ B;  4JI4 B;  3T1C A;  1FD9 A;  4A5U B;  1R6K A;  3ABL C;  2DWE C;  3A0R A;  1ORQ C;  1TUB B;  4HBN A;  1IBL O;  4WBN B;  4DV1 O;  3JD3 A;  1JR9 A;  2WLN A;  2QM4 A;  1OCO C;  4ZI7 A;  2V4D A;  5LP6 C;  1WNS A;  3VOU A;  2ATK C;  4GUN A;  2ZE8 A;  3FB6 C;  2BSK A;  5CN0 A;  3BHP A;  5LMU B;  4FK5 C;  2JK5 C;  4DV7 B;  1B6Q A;  4F6R A;  1N36 O;  2UUC B;  1M57 B;  5GON A;  2HG5 C;  2EBO A;  1XNR B;  4MTG A;  4D7T A;  3F7Y C;  2NNU A;  1ZLZ A;  4X20 A;  4GX1 A;  1PP9 H;  4JTC B;  4TUY A;  5EBM C;  2QGN A;  4FFB B;  2IH1 C;  3JAK A;  3LDE A;  1CPY A;  1KMI Z;  1GTO A;  3JAM N;  1V54 B;  3NXS A;  1EN4 A;  3DGE A;  4JYA B;  3SPC A;  4BAY A;  2QM8 A;  2ZM6 B;  3OR7 C;  2EJ7 A;  3CCL V;  3NR7 A;  1OCZ C;  2UU9 B;  2PF4 E;  1H38 A;  1W2B U;  4X64 B;  1HDJ A;  4DV3 O;  5LHG A;  2WLL A;  5L3D A;  3E35 A;  3BAA A;  1NZ6 A;  4O4H A;  4UCU A;  2Y48 A;  2DWD C;  1VF7 A;  3CD6 V;  3JD2 A;  2UXN A;  2P67 A;  4TV8 B;  1X4T A;  4DR4 B;  3DTU B;  3KKY A;  3QVN A;  3G71 V;  1O9H A;  2RCV A;  1HNW O;  3U0Z A;  3WB1 A;  1N33 B;  4MT8 A;  3GVM A;  2QM7 A;  2ZNJ A;  1NR7 A;  5KHK A;  1VAR A;  1GM9 A;  2N74 A;  4CC6 A;  3L70 H;  2ZKO A;  1CEZ A;  2ETN A;  4MVS A;  5BZB A;  4EEQ A;  2AHY A;  4FLZ A;  2WA3 A;  5FNV B;  1IBM O;  3UO2 A;  2UUA O;  3ZMV A;  2DOS A;  3WB2 A;  2CUG A;  2EIL C;  2VQF B;  1M90 W;  1G6U A;  2Q7G A;  3D3I A;  4LWS A;  2UUB B;  1R3L C;  3HR0 A;  1LUV A;  2Q5Z A;  1PNK A;  4B3R O;  2F95 B;  2RJZ A;  3CCJ V;  1GN4 A;  2P22 C;  3FB7 C;  1B06 A;  5LOV B;  2Q8V A;  2X6A A;  1BSM A;  1EBO A;  1QR8 A;  4JI6 B;  1K5S A;  1NH2 D;  1KB9 F;  2E75 B;  3E8G A;  5CBG A;  5IY5 B;  4JYB A;  3ZJZ A;  3AK3 A;  1L1F A;  4ABM A;  4L87 A;  5GTI Z;  5LXT B;  4OX9 B;  4UB8 Z;  5LMN B;  2D3O W;  4JAV A;  1YIT V;  1SKV A;  4WFB V;  4WCE V;  4TQF A;  3FFQ A;  4B3S O;  3OGI B;  2XAH A;  3LSU A;  4J7J A;  5HFM A;  1BQZ A;  1N0J A;  3CYO A;  4J41 A;  4YY3 B;  2VQE B;  3CMA V;  5EC1 C;  3CCM V;  4FLW A;  4YIO A;  4CZZ A;  3A8T A;  4KHP O;  2Y69 B;  1U97 A;  1AJQ A;  3EHB B;  3OAA G;  4FM0 A;  1XI1 A;  2OTL V;  4LH7 A;  5LBQ A;  3GWO A;  3R65 A;  2F43 G;  3CC2 V;  1ZL8 A;  4LNU B;  1H2M A;  2CH7 A;  2UXC B;  4AQY O;  4G27 B;  3EVK A;  1ZSP A;  1BGY H;  5H6R A;  4JI0 O;  2JGD A;  2GDS A;  1K97 A;  5BMV A;  3RYH B;  5K1X A;  2K1E A;  4NXM O;  3ABT A;  4O2B B;  5D5Q A;  1VP7 A;  2EZP A;  1I7F A;  1I5Y A;  3M7M X;  1P84 F;  2D2C B;  2KB1 A;  2MW2 B;  3JCZ A;  1Q5O A;  2Q4P A;  4LF6 O;  1RSO A;  2W0X A;  4IIJ A;  1YVW A;  2LGW A;  5FPR A;  4H13 B;  1QLE B;  1XMQ B;  3ABK B;  5LP6 A;  3IC9 A;  2YIB D;  4I9W A;  1GN6 A;  1Z5V A;  1S72 V;  1ARO P;  2BOB C;  1K5Q A;  3ZHV A;  3ABM B;  4DR3 O;  4UFZ A;  2ZCE A;  1AR4 A;  1SQB H;  3UT5 A;  1WPB A;  3B2E E;  3T1H B;  1SF9 A;  3AG2 C;  2HVK C;  5KUM A;  5FLX N;  2KKW A;  3T1Y O;  1JFF B;  5L3E A;  4GKJ O;  3N2K A;  3RYI B;  2CDY A;  1VQK V;  2HHH B;  4I50 B;  3K58 A;  4DYL A;  1NTM H;  3L9D A;  2AZ0 A;  4IHJ B;  4P30 A;  2HLD G;  3CXC U;  3JD0 A;  4LR3 A;  1NU1 H;  1K8A W;  3ETQ A;  2QKS A;  3C3S A;  2OTJ V;  4FVM A;  1SA0 B;  3W7T A;  1SQQ H;  4DV4 O;  5IJ0 B;  1F4N A;  1E1R G;  4YJ2 B;  4O2A A;  3T4Z A;  4LF4 B;  2IH3 C;  1K33 A;  4JZG A;  4EFB A;  4N21 A;  4C7U A;  2CTR A;  4LFB O;  1MG1 A;  2Y4T A;  1OZ0 A;  4LFA O;  2DQ3 A;  1VQP V;  1D5N A;  3H1H H;  2QKC A;  1IBK B;  1IUR A;  1N0N A;  2IBZ H;  4ZHQ B;  2P5O A;  4UCS A;  4DV5 O;  1XMO B;  3OEH G;  1AI4 A;  2VRZ A;  3CCR V;  3AG4 C;  1KD1 W;  4G2K A;  1JJO A;  4FM1 A;  2Q67 A;  2YEV A;  2PUS A;  4FLT A;  2X6C A;  5CA1 A;  5AG2 A;  1AVM A;  2VWK A;  1FXK C;  1XL4 A;  3JAL B;  2XOK G;  4X8A A;  3FAV B;  4N23 A;  2E3C A;  2QJ1 A;  4O4L A;  1TVK A;  2B1G A;  4CH5 A;  2QEX V;  3ZRS A;  1AR5 A;  5K1P A;  1XUQ A;  5B1B B;  3O9O A;  5KAF Z;  1YJW V;  4PI2 A;  1GRJ A;  1MA1 A;  1URF A;  1VQN V;  1QR9 A;  1S5H C;  4HNA B;  1PL0 A;  1R1B A;  5KX5 A;  2OWO A;  3FYI B;  1M4U A;  4ZKI A;  1HR0 B;  3ZMU A;  1NI8 A;  5KMG B;  4X1K B;  2YXL A;  3SR2 C;  1S76 D;  3C90 A;  2ZE6 A;  4JGS A;  1M1K W;  4PDV A;  2KSD A;  4UVC A;  2ZE5 A;  1SZT A;  4QPK A;  2KG7 B;  4JZ2 A;  4JI7 B;  1RM1 C;  2EX3 A;  5EC2 C;  2Q69 A;  3G67 A;  2A06 H;  3F7V C;  4DUZ O;  1UJW B;  2XHB A;  4LF7 O;  1QNM A;  5LYJ A;  3BEH A;  4PHZ A;  1FFX B;  5B5E Z;  1EM1 A;  1WLE A;  1R3I C;  4CH4 A;  3T4D A;  1GMG A;  2MK3 A;  3ASO C;  4JI8 O;  4YJ3 A;  3CCV V;  4IYI A;  5LA6 B;  3CRQ A;  2GSM B;  5LHI A;  3KG2 A;  1R6T A;  5E1A C;  2BOC C;  3CRA A;  4B3T B;  4B08 A;  4KUM A;  1RFY A;  5J2T A;  2JGU A;  1VQL V;  1BS3 A;  3QNE A;  2IJI A;  5IWA O;  4DW0 A;  1LR1 A;  3UO3 A;  1QVG U;  1MNG A;  1LUW A;  3RYC B;  4DUY O;  2Q0A A;  4JI2 B;  2Y4U A;  2Z3Y A;  2PYJ A;  4WFH A;  4F4L A;  1QQC A;  5HFL A;  3OUS A;  4FZ1 A;  4HZ3 A;  2DW4 A;  1Y67 A;  3JAW B;  3TET A;  4P9O A;  4B3M O;  3DC5 A;  4DV2 B;  4JI4 O;  5B1O A;  4E4E A;  4KL1 A;  2GBO A;  1JA8 A;  1M56 B;  3WG7 C;  1XNQ B;  5BY1 A;  4NR1 A;  2PYL A;  1VMG A;  1CXZ B;  4JAU A;  4WFE A;  1AI5 A;  4DR2 B;  1RP3 B;  4GLX A;  1YTF B;  2P6J A;  2WLK A;  4I55 A;  1MZE A;  4FIP C;  5B1A B;  1V55 C;  4NTY A;  3ZED A;  4UVA A;  2W0F C;  1TUB A;  1XHZ A;  3K5O A;  4WBN A;  5LMU O;  4DV7 O;  2UXB B;  2QKA A;  3N2G B;  2HR3 A;  3SPH A;  1PL4 A;  2UUC O;  3AG1 C;  1AB3 A;  1ENV A;  2O57 A;  1XNR O;  2CGO A;  2WPD G;  3STZ C;  3ABK C;  4QPJ A;  4X1Y B;  4PA9 A;  1N4C A;  4PD4 F;  5JVD B;  3DXR A;  1D2D A;  2DYS B;  1D5A A;  5ITZ B;  2LQT A;  3HPL C;  3I56 V;  4BIU A;  4MW3 A;  3CX5 F;  3ABM C;  4J7Z A;  4JYA O;  3JSL A;  3SPJ A;  4PA4 A;  3JAT B;  2ZM6 O;  4JI1 B;  3UQ8 A;  2UU9 O;  5DED A;  5IYC O;  4X64 O;  3FD9 A;  3HKD A;  1G4Y B;  4NKG B;  2QTO A;  2AZ2 A;  1FAF A;  3R66 A;  4DR4 O;  3BRC A;  3AK1 A;  2FL4 A;  3L73 H;  3JYC A;  1ROP A;  1BT8 A;  2YIC A;  3A2F A;  3TCU A;  3ZHU A;  1NVP D;  1B3Q A;  1ZWI C;  5KHG A;  1IXM A;  3HB3 B;  1GAX A;  2CTQ A;  1FXK A;  5JCO A;  3OFN G;  1US6 A;  2PI5 A;  1DF5 A;  3L74 H;  4ASU G;  4LF8 B;  4I4T B;  4TV8 A;  1PPJ H;  4O4I B;  2EIM C;  4X66 B;  3AG7 A;  2Q7H A;  4MVM A;  4JI5 B;  4K8Z A;  2JS3 A;  1W0J G;  1XHX A;  5CMU A;  5E79 Z;  4AI8 A;  2DN9 A;  1P49 A;  1FJG B;  2GUZ B;  3RWR D;  1K34 A;  2ZDI C;  3BAB A;  1GM8 A;  3SJC C;  1UFI A;  2A79 B;  3E22 A;  4UVB A;  1Q43 A;  1OCC B;  1S3J A;  4MSW C;  1VQ8 V;  5CA3 A;  3ZHR A;  4BWA A;  2DQ0 A;  4MTO A;  5FNV A;  2HJD A;  4OPA A;  1GKF A;  1ZAU A;  3JD4 A;  3X2Q C;  1Q6H A;  1BHA A;  2PZS A;  5EBW C;  5A9G A;  2CAZ C;  2AGA A;  2QE7 G;  4JI6 O;  3ZMS A;  1WJZ A;  1YCI A;  3J80 N;  3WFV A;  3ICX A;  3THO A;  2ZXW B;  1BHB A;  3DC6 A;  4OX9 O;  4K35 A;  2BSK B;  5LMN O;  4X65 B;  1NS1 A;  3F5W C;  2PGG A;  1OCR B;  1XQ8 A;  4UCO A;  3U11 A;  1WPX A;  5KUK A;  4GX0 A;  3J81 N;  4YY3 O;  2VQE O;  1AIL A;  4X20 B;  1F7Y A;  5LXT A;  1COW G;  3JAK B;  2ZR3 A;  3ML0 A;  3CEI A;  5JH7 B;  1IZ3 A;  3ZRV A;  4MVZ A;  3W7S A;  3PJS K;  1PM9 A;  4X62 O;  1Q81 W;  2BTQ B;  2XAG A;  2UXC O;  1AI6 A;  1WB7 A;  3CHX A;  2WA4 A;  2WLL B;  5EIB C;  1YJN V;  2FTK A;  1WA8 B;  3IC7 A;  1WP8 A;  4AIL C;  4J42 A;  3EXA A;  5DM6 V;  3VBB A;  4FLU A;  4JAS A;  1G8M A;  2QWN B;  2YIA A;  2ADQ B;  4LNU A;  1KUQ A;  2B1I A;  2XAJ A;  4YHH B;  5CBF A;  1OJH A;  1AJN A;  2GV9 A;  5J2U B;  1EZV H;  2LW7 A;  3FX7 A;  3ZN1 A;  3SDL A;  3G4S V;  4KFM A;  1NTK H;  2LFS A;  3S3W A;  3RYH A;  1XMQ O;  4FPP A;  4WFF A;  1KKD A;  2JJ2 G;  1KP3 A;  4BR6 A;  2RN9 A;  4O2B A;  2Y0I A;  2ZQM A;  3CRC A;  3VQW A;  4YIP A;  2M6Y A;  2F4V B;  1N34 B;  4F6E A;  3LDD A;  5B3S B;  1IDS A;  3AK2 A;  1R73 A;  3T1H O;  1JX9 A;  4GX2 A;  2BCC H;  5IDJ A;  4DV0 B;  2NLJ C;  5H2F Z;  1IXB A;  3TXS A;  3ZMZ A;  1ZUQ A;  1LNQ A;  4R8C A;  5JQG B;  3LSS A;  5IT9 N;  2FB5 A;  2HHH O;  1TA8 A;  1QCE A;  3O65 A;  3JCU Z;  5IYD O;  2EUL A;  3ASN C;  4CS4 A;  3HKC B;  5GW7 A;  3ZRW B;  3MHS C;  1JFF A;  1J5E B;  3M8A A;  1I94 O;  4J11 A;  1M5I A;  4U3J B;  2GTA A;  5CB4 B;  3RYI A;  1L8D A;  3UM7 A;  2DJV A;  4U7N A;  3CSX A;  3RFR A;  3TXQ A;  3HKE A;  4I50 A;  2PI4 A;  5IJ9 B;  4IHJ A;  3Q4H B;  1SQF A;  3SYQ A;  1SZX A;  2ZIM A;  1IBK O;  2Q73 A;  4DR6 B;  1SA0 A;  1UPG A;  5IJ0 A;  3OTO B;  1XMO O;  3CCE V;  4DR1 B;  4RO2 A;  2EIJ C;  3JAS A;  1K92 A;  2X0L A;  1ZL8 B;  3JSN A;  4K3A A;  3W7X A;  3B4S A;  1IX9 A;  1XEQ A;  2ZE7 A;  3W7U A;  5EK0 A;  2F1M A;  4QE9 A;  1TUE B;  5CA0 A;  1KU9 A;  2YUA A;  2ZDI A;  5EIB D;  2JGD B;  4CH6 A;  3KZI Z;  3SPI A;  2QWP B;  1M9N A;  5KHH A;  2A9H A;  1Y76 A;  3ABL B;  3FAV A;  4BIO A;  4AQY B;  3ZMT A;  4E2L A;  3BA8 A;  1EN5 A;  4TT3 G;  1XRE A;  4OPH A;  1RSO B;  4GYC B;  1M57 C;  3AG3 B;  2AHZ A;  3CJH A;  3LUT B;  4IIJ B;  1GO3 F;  1NH2 B;  1ZX3 A;  1HR0 O;  4XBF A;  1AJP A;  2B5U A;  4X1I B;  5LP6 B;  1EZJ A;  2X7R B;  3OW2 U;  4ZOL B;  1G1X B;  2W6I G;  3H1L H;  4DR7 B;  1V54 C;  2DMX A;  4H44 B;  4PDR A;  4LH6 A;  1BQ0 A;  4MW8 A;  1YIJ V;  2WLH A;  3JAR A;  1VF6 C;  1K4D C;  3K04 A;  4J10 A;  4JI7 O;  2IW5 A;  3SPG A;  1VQ6 V;  3ETD A;  2QA4 V;  3IJ4 A;  5KMG A;  5JCO C;  1HNX O;  4JI3 O;  4H0L B;  2CTW A;  1JCH A;  3D8C A;  2NN4 A;  1JMK C;  4UV9 A;  3N2K B;  4NXN O;  1M93 A;  3RVY A;  2VWJ A;  4CH3 A;  1JPX A;  2YXY A;  2UXD B;  4LF9 B;  2HVJ C;  4PJ0 Z;  2KG7 A;  1RPO A;  4EB6 B;  3MHH C;  2QSA A;  1JQ0 A;  4FLX A;  3T1Y B;  4J80 A;  4Z1V A;  3IAY A;  4DW1 A;  1B04 A;  5KHJ A;  2E5L B;  4TWK A;  2DYR B;  4B3T O;  1FFX A;  4CS3 A;  4O2A B;  1N32 B;  3K9S A;  2EIK B;  1YEW A;  2YI9 A;  4JAA A;  1BL8 A;  1VQ4 V;  1W59 A;  4L8J A;  4I0X A;  4ZIB A;  1O9G A;  1V9P A;  4JI2 O;  1I0H A;  3OR6 C;  4TV9 B;  5EBL C;  3HKB B;  3TGU H;  1ZTE A;  4H37 A;  3BVO A;  2L6L A;  3QO8 A;  2Q68 A;  4NTW A;  1DLB A;  2JDI G;  5B1N A;  4DV2 O;  4DK0 A;  5TIS Z;  2Q7E A;  2YEV B;  3P3P A;  2JJ1 G;  3SJA C;  3E83 A;  1XNQ O;  4TQD A;  3RYC A;  2M7W A;  3FYE B;  3FB5 C;  3VQY A;  2PY5 A;  5EYP A;  1S5J A;  1Y74 B;  4Q6G A;  2FYU H;  4GKK B;  4XDK A;  1Q86 W;  1TVK B;  5C8Y B;  1Y66 A;  4DR2 O;  3APQ A;  3CE2 A;  3EFF K;  4I5S A;  3M99 B;  2EIL B;  1SER A;  2V1D A;  4U7O A;  4BIZ A;  2LGQ A;  4DV6 B;  5IY5 C;  2P4K A;  3GWK C;  4LP8 A;  2CTP A;  3SJQ C;  2ITD C;  1VF5 B;  2UXB O;  2HJF C;  1PNM A;  4LFC O;  3OE7 G;  2CK3 G;  5LHH A;  1K7D A;  4MVQ A;  1NKD A;  2XTA A;  4IGG A;  1HP8 A;  2H8P C;  3P30 A;  3OMI B;  2HEP A;  3SGI A;  2Y69 C;  1L0N H;  3MD0 A;  4FFK A;  3OEE G;  3K0D A;  2ADP A;  4K0K B;  5A2Q N;  4JI1 O;  1H8H G;  1YZB A;  1R3K C;  4MVO A;  2E74 B;  4PEL A;  1GM7 A;  5F2V O;  5JJE B;  4JYY A;  2OCC B;  1PNL A;  5ITZ A;  1JOY A;  4HAM A;  4D6T H;  1MSW D;  2WSS G;  1K3E A;  3B77 A;  2Z0A A;  3OD4 A;  4QNH B;  1F51 A;  1W0K G;  3RT3 C;  4IL6 Z;  3H1K H;  4RQF A;  2HKO A;  3ZX6 A;  4I9Q A;  5CBH A;  1H2L A;  1FFT B;  2ODM A;  3RYF B;  2H94 A;  2IJJ A;  3W7W A;  2EIN B;  4X66 O;  1QLE C;  4JI5 O;  1WN7 A;  4FLY A;  1R3J C;  4IYH A;  4MVU A;  3UCS C;  3STL C;  2AW9 A;  1FJG O;  2CE4 A;  3AEI A;  1KBH A;  2F66 C;  3LNN A;  3D3Q A;  2HFE C;  4DK1 A;  4I4T A;  2IJH A;  4TSF G;  5H5N A;  1TGO A;  4UXN A;  3K0G A;  4O4I A;  2IU0 A;  2WLJ A;  4ICG A;  3B8M A;  3ZRX A;  1YF2 A;  3UKM A;  4LF5 B;  3B40 A;  3ZBH A;  1N8R W;  4FFB A;  3BY6 A;  2GUZ A;  2ZIN A;  4JV5 B;  2OYQ A;  4U3F H;  3RGB A;  4DRX B;  2WLM A;  1U96 A;  4FMT A;  4I55 B;  4PDM A;  1QHT A;  1SC5 B;  2HP8 A;  1VF6 A;  3CCS V;  4MTF A;  1I5X A;  3S3X A;  3J7A U;  1KYO F;  5EZY B;  3D36 C;  4QGP A;  3AG2 B;  1DTO A;  1Q7Y W;  3C3T A;  3K59 A;  4X65 O;  3K06 A;  1N33 O;  4MTX A;  3CPW U;  2JRI A;  1YXB A;  3T2M A;  3AG3 C;  2JEX A;  4GT1 A;  3IFX A;  1NQT A;  3ZHS A;  4O4J B;  5IYZ B;  3QF7 A;  1S5L Z;  3KCX A;  3DXR B;  3A0H Z;  4J9Y B;  4R7C A;  2IU3 A;  1JVM A;  4B7E A;  4EFE A;  5J9P C;  3CB2 A;  1XDC A;  2KQX A;  3OMN B;  3BFR A;  2E76 B;  2WLI B;  3VQX A;  2VQF O;  3TK1 A;  2A3Q A;  2EZO A;  4GZR B;  5IE9 A;  2XAF A;  2H3O A;  1S77 D;  2C2A A;  2UUB O;  4ZBM A;  4DR5 B;  3IGA C;  3CRR A;  3HKD B;  5BR8 B;  1K73 W;  3MDS A;  4XDJ A;  2YDE A;  5B66 Z;  1PV0 A;  4RAI A;  2EJR A;  3ZHT A;  1VEW A;  4OXS A;  4CS2 A;  3H1I H;  3MAQ A;  5D5P A;  5JH7 A;  2FKX A; 
#chains in the Genus database with same CATH homology
 1TA8 A;  1HNZ B;  4ZI7 B;  2E3C A;  2QJ1 A;  4O4L A;  1TVK A;  4YJ3 B;  4FLV A;  2BTQ A;  4DUZ B;  4UCV A;  4CH5 A;  4LF7 B;  1NT2 B;  4DRX A;  5K1P A;  1IBL B;  4CS4 A;  3HKC B;  5KHI A;  1JFF A;  2R9A A;  4DV1 B;  1J5E B;  5J2T B;  1M5I A;  4K8X A;  4F6R B;  4BW9 A;  4PI2 A;  4U3J B;  5LOV A;  5GON B;  5CB4 B;  5EZY A;  3U10 A;  4JI8 B;  3RYI A;  1L8D A;  4HNA B;  3CSX A;  3RFR A;  5KX5 A;  3BA9 A;  1Z5W A;  1T5E A;  3HKE A;  4I50 A;  2OWO A;  4TUY B;  4LFC B;  4IHJ A;  5IJ9 B;  1SQF A;  5J2U A;  4NVP A;  1M4U A;  2ZIM A;  1HR0 B;  3E22 B;  4O4J A;  1Q8I A;  5KMG B;  1DGS A;  5IYZ A;  5IWA B;  4DR6 B;  1SA0 A;  2R70 A;  4X1K B;  1N36 B;  5IJ0 A;  2YXL A;  3OTO B;  3SR2 C;  4DUY B;  1H2S B;  2BTO A;  4DR1 B;  3BPZ A;  3JAS A;  5FPO A;  3JSN A;  1Q3E A;  4O4H B;  4JI7 B;  2EX3 A;  2F1M A;  4B3M B;  4JI4 B;  5CA0 A;  2XHB A;  1KU9 A;  5EIB D;  5LYJ A;  4CH6 A;  1TUB B;  4HBN A;  4PHZ A;  4WBN B;  1FFX B;  5KHH A;  4CH4 A;  4UCT A;  4DV3 B;  5JQG A;  5JJJ B;  4AQY B;  2QM4 A;  3BA8 A;  4ZI7 A;  5LP6 C;  2V4D A;  4YJ3 A;  1WNS A;  5JJN B;  2R72 A;  4GYC B;  3K57 A;  5LA6 B;  4IIJ B;  3BHP A;  3HKC A;  4B3T B;  5LMU B;  1HNW B;  4B08 A;  4DV7 B;  5J2T A;  2JGU A;  5LP6 B;  4X1I B;  4F6R A;  4ZOL B;  1HW7 A;  4U3J A;  2UUC B;  5GON A;  4AHC A;  5CB4 A;  4DR7 B;  3RYC B;  2Q0A A;  1XNR B;  4LH6 A;  4D7T A;  4JI2 B;  3JAR A;  2PYJ A;  4X20 A;  3OTF A;  1QQC A;  4TUY A;  4FFB B;  3JAK A;  5IJ9 A;  4TOI A;  1KMI Z;  3JAW B;  4DV2 B;  4FM2 A;  1IBM B;  4JYA B;  1TAE A;  4KL1 A;  5KMG A;  2UUA B;  5JCO C;  3K5L A;  1XNQ B;  2ZM6 B;  1JMK C;  3N2K B;  1M93 A;  2UU9 B;  2PYL A;  2ZNI A;  2VWJ A;  4CH3 A;  4X64 B;  4X62 B;  2UXD B;  4DR2 B;  4GLX A;  4LF9 B;  3BAA A;  4EB6 B;  4O4H A;  4I55 A;  4B3R B;  4UCU A;  1VF7 A;  4FLX A;  2PTM A;  4TV8 B;  1X4T A;  4DR4 B;  3T1Y B;  3IAY A;  1B04 A;  3ZED A;  5KHJ A;  4PI0 A;  2E5L B;  1TUB A;  1O9H A;  1XHZ A;  3K5O A;  4WBN A;  1FFX A;  3U0Z A;  4CS3 A;  4O2A B;  1N32 B;  3WB1 A;  2UXB B;  3N2G B;  2YI9 A;  1YEW A;  1N33 B;  2ZNJ A;  4L8J A;  5KHK A;  4ZIB A;  1O9G A;  1V9P A;  4CC6 A;  4TV9 B;  4X1Y B;  3HKB B;  5JVD B;  4EEQ A;  4YJ2 A;  4FLZ A;  4B3S B;  2RQ6 A;  1D5A A;  2IM9 A;  5ITZ B;  5FNV B;  4DK0 A;  4X1I A;  3JSL A;  4ZOL A;  2Q7E A;  3WB2 A;  3SJA C;  3JAT B;  4TQD A;  4JI1 B;  3RYC A;  2VQF B;  4KHP B;  3UQ8 A;  3VQY A;  2PY5 A;  5EYP A;  1S5J A;  1G6U A;  4Q6G A;  4ZHQ A;  4GKK B;  2Q7G A;  1TVK B;  5C8Y B;  3HKD A;  5BMV B;  2UUB B;  2F95 B;  2RJZ A;  2P22 C;  4DV6 B;  3BRC A;  3JAL A;  3A2F A;  5LOV B;  2JVD A;  4D7S A;  2JS5 A;  4JI6 B;  5KHG A;  4JI0 B;  3DSQ A;  4CC5 A;  5JCO A;  3HKE B;  5LXT B;  4EB6 A;  4OX9 B;  4LF8 B;  5LMN B;  4NXM B;  4I4T B;  4TV8 A;  1SKV A;  1I94 B;  2HEP A;  4O4I B;  4TQF A;  3FFQ A;  4X66 B;  3SGI A;  2Q7H A;  4HNA A;  4JI5 B;  4K8Z A;  1XHX A;  4LF6 B;  2ZIO A;  4YY3 B;  3UT5 B;  1P49 A;  3QTC A;  3JAS B;  2VQE B;  1FJG B;  4K0K B;  3RWR D;  3BAB A;  4FLW A;  3SJC C;  3E22 A;  1Q43 A;  4TV9 A;  4FM0 A;  4X1K A;  3HKB A;  3SJB C;  2YI8 A;  5CA0 B;  4BWA A;  1XI1 A;  2F93 B;  5JJE B;  4LH7 A;  1SQG A;  5ITZ A;  5FNV A;  4DR3 B;  4LNU B;  1ZAU A;  2PZS A;  2UXC B;  2YIB A;  2CAZ C;  3VQV A;  3ICX A;  3THO A;  5C8Y A;  5BMV A;  3RYH B;  5K1X A;  4I9Q A;  4GKJ B;  3RYF B;  4X65 B;  4O2B B;  5D5Q A;  1I7F A;  2PGG A;  3M7M X;  4UCR A;  1XQ8 A;  4UCO A;  1WN7 A;  4FLY A;  1Q5O A;  3U11 A;  1RSO A;  3K5N A;  5LA6 A;  4IIJ A;  3JAR B;  5FPR A;  4DV4 B;  4X20 B;  2F66 C;  3LNN A;  5LXT A;  3ZS8 C;  1XMQ B;  3JAK B;  5LP6 A;  4DK1 A;  4I4T A;  4LFB B;  2YIB D;  1TGO A;  5CA1 B;  4O4I A;  1Z5V A;  5JH7 B;  3K5M A;  4LFA B;  4LF5 B;  4UFZ A;  2ZCE A;  4O4L B;  3UT5 A;  2BTQ B;  4FFB A;  1WPB A;  3B2E E;  3T1H B;  2ZIN A;  3JAW A;  4JV5 B;  2OYQ A;  3CHX A;  3RGB A;  4DRX B;  4DV5 B;  5EIB C;  2KKW A;  1JFF B;  4I55 B;  1QHT A;  4AIL C;  3N2K A;  5EZY B;  1HNX B;  3RYI B;  4FLU A;  4JI3 B;  2HHH B;  3K59 A;  2YIA A;  5KX5 B;  4LNU A;  4YHH B;  4NXN B;  4I50 B;  3K58 A;  3QG5 A;  4IHJ B;  2GV9 A;  5J2U B;  4LR3 A;  4O4J B;  3ETQ A;  5IYZ B;  4FVM A;  1SA0 B;  3QF7 A;  3RYH A;  5IJ0 B;  4YJ2 B;  4LF4 B;  4O2A A;  3RYF A;  4EFE A;  3N2G A;  4EFB A;  3CB2 A;  4O2B A;  3VQW A;  3VQX A;  3WB0 A;  3PN1 A;  2F4V B;  4X1Y A;  1N34 B;  1IBK B;  5JVD A;  5EYP B;  4DR5 B;  4ZHQ B;  5LYJ B;  2P5O A;  3HKD B;  5BR8 B;  4UCS A;  1XMO B;  1JJO A;  4DV0 B;  4FM1 A;  2PUS A;  4FLT A;  5CA1 A;  3JAT A;  5JQG B;  4CS2 A;  2VWK A;  3MAQ A;  5D5P A;  3JAL B;  5JH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...