1X4TA

Solution structure of isy1 domain in hypothetical protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
b'GSSGSSGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein LOC57905
publication title Solution structure of Isy1 domain in hypothetical protein
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1x4tA01
3QF7A 2CAZC 3B2EE 3ZS8C 1X4TA 2JS5A 3CSXA 1SKVA 3SJBC 3SJCC 1NT2B 2F66C 3SJAC 3THOA 2P22C 3QG5A 3ICXA
chains in the Genus database with same CATH superfamily
2QM4A 1Z2GA 3I5DA 5LGTA 4MVMA 1H38A 1S0VA 5B1BC 1US6A 1GMGA 2EIJC 1YHQV 3CC2V 1SQFA 3SPJA 2ZR2A 3SYOA 4X88A 3CRAA 1R6KA 2F4VB 3TETA 3JSNA 1H2KA 3BCCH 5EBMC 1VQ8V 4U7NA 5KA6A 1TAEA 4FZ1A 4TV8A 3KG2A 3MHSC 1R3KC 4DV1B 1XMQO 3TCUA 1SZTA 4FZ0A 1MZEA 3U11A 4LC1A 2YEVB 3C3SA 2E76B 4DR6B 1KB9F 2PUSA 4O2BB 5AG2A 1CXZB 5IYDO 3CEIA 3ZEDA 1Z5WA 3UQ8A 2CTQA 2X6BA 2R9RB 4N23A 3D36A 5KUMA 1XMOO 4PD4F 2ZXWB 2UU9B 4EKWA 2QTSA 2DYRB 2WPDG 1L1FA 1SRYA 3QVNA 5KHGA 5EIBD 1HP8A 1XREA 2ZNJA 4BIOA 4WFHA 4NXMB 1PNLA 3NXSA 3W7WA 1I7FA 4TUYA 4BR6A 2RCVA 3STLC 4K0KB 4PDLA 3RYHA 1R3LC 1NH2B 1K34A 4TV8B 1PP9H 2DE0X 1GN6A 4I4TA 1BQZA 2UXDO 2E3CA 5KHHA 3RGBA 4TT3G 1BE3H 1QBZA 1V54B 1MABG 2UXBB 4DR5O 1VQ5V 2B9ZA 3DXRA 1FFXA 4LF6B 2HHHB 2OCHA 1D5NA 4WBNA 1TGOA 1NQTA 2W6JG 1MG1A 1OCOB 3G80A 4O4JA 1PKXA 2A7WA 3WG7B 1XL6A 3SJBC 2XAJA 4ZOLA 4F6EA 2UUBB 1GN4A 3EXAA 4AILC 1QLEC 3HKCA 2QSAA 3L72H 3IFXA 1YDXA 3VQYA 3KZIZ 4JYBA 3BAAA 1S5JA 4BIZA 1R3IC 1WPXA 1KKCA 1Y4MA 1Q6UA 1SS3A 2WA3A 3ZN0A 4IHJB 5IWAO 5A9GA 5JJNB 2V1DA 1QHTA 3BVOA 4JI6O 1CP9A 3TJTA 3B2EE 4LWSB 1ENVA 3JD0A 3OMIB 4K35A 3G6BA 2Q69A 2XT9A 4BIUA 3K79A 1BGYH 3WB1A 4I9WA 4R6ZA 3RFRA 1ZL8A 2JS3A 5JJEB 5IY5B 3E35A 4DV7B 5E1AC 4GUNA 3RYCA 4JAAA 1OCZB 1MSDA 4WBNB 4LFAO 1GM9A 4NKGB 1H2MA 2IH1C 3SYCA 1B3QA 2W0XA 4UVBA 3T4DA 3LDEA 4B3TO 4MVRA 2FYUH 2PYJA 1QLNA 5JH7B 3ASNC 3RVZA 3OD4A 3LUTB 3JD1A 3Q4HB 5BR8B 2BCCH 4BAYA 4GKJB 5IYBO 5EYPA 1H2SB 1WNSA 1MNGA 3FD9A 4OXSA 2Y4UA 4DUZB 4MVUA 5CB4A 3OTFA 5B66Z 1SZXA 2WLIB 1GAXA 3LSUA 4I0XB 4HNAA 3HR0A 4RQFA 3X2QB 2CTPA 4LFBO 2AHZA 1KECA 2DMXA 1ZL8B 5B3SB 2QDOA 3S3WA 3CCRV 1BHBA 2Q7GA 4FFBB 4HBNA 3CPWU 5J2UB 5BMVB 1Y67A 2ARHA 2L35A 1HR0O 2YSUB 4LF5B 3ABTA 1NTKH 1GRJA 1NH2D 1H8HG 4B3SO 4XBFA 2D3OW 1K4CC 1B04A 1JR9A 4LR3A 4PI0A 3JALB 4UCVA 1H8EG 4JI2B 5GONB 1IBLB 4QNHB 1FJGB 1Q3EA 3JATB 2DWEC 2HR3A 2LGWA 4CH6A 1J5EB 4L87A 4RWUA 4JI4B 2QWQB 2E75B 2XAQA 2VS0A 2OIGA 1FFTB 2OT5A 2QWPB 2LGQA 3P3PA 2B1GA 2RNBA 2ZIMA 4FM2A 3HKDA 3ETEA 4ZKIA 4RO2A 4HNAB 3FB5C 2Q6AA 5HFLA 4DUYB 3CX5F 4DR7B 3E22A 1DTOA 1M56B 3M8AA 5BXZA 3LNNA 1I08A 2W6IG 1QU7A 4R50A 5C8YB 2YIBD 5IJ9B 1EN4A 4WCEV 3P30A 4X1IA 4LP8A 5IE9A 1OZ0A 2DN9A 5JWPA 4PJ0Z 3ZS8C 1BT8A 1YCIA 3K9SA 2UUAB 1ZTEA 2EIJB 5LGUA 1XBLA 4YY3B 2CH7B 1PNKA 5L3GA 2ADPA 5CBFA 1AR5A 4E2LA 4ASUG 4GKKO 3PJSK 4F4LA 1IDSA 4RAIA 3CCLV 1K3EA 4O4LB 1EBOA 4XDLA 2EX3A 4HAMA 3CS5A 2A79B 3C90A 4H44B 4JYCA 2Q5ZA 2YXLA 3A2FA 1FXKC 5JCOA 2Z5UA 4DR2O 4WFFA 1Q43A 2K1EA 1N36B 1LUVA 2WLMA 4LF9B 3T1YO 2ITDC 4NTYA 1WJZA 4DW0A 1KYOF 2BE3A 3ABMB 2JJ1G 2WLHA 3CC7V 5LGNA 5LYJB 3JASB 5IYZA 4ABMA 5CA3A 4O4HB 2R70A 1WAZA 5J9PC 1WA8B 1QQCA 5JVDB 4PELA 1TA8A 1NI8A 3QO8A 1JOYA 1NR7A 4I7ZB 3E8BA 3E2EA 1F51A 4B3MB 2HLDG 4J11A 3K06A 2IM9A 1EM1A 1LR1A 1JFFA 3DSQA 4GX0A 1N33B 3H1HH 3CJHB 4I55A 3IC9A 4TOIA 5LP6A 2P7TC 1OHHG 1R73A 2F43G 1G1XB 5JJJB 2ZM6B 5H2FZ 3DC5A 1YJWV 3JSLA 1N34O 4LFCO 1Z5VA 4UXNA 4CZZA 1E1RG 3JCUZ 4K8ZA 1IBMB 3UT5B 4CS4A 5LL6Y 2Q73A 1HNZO 2AHYA 2AW9A 4MW8A 2A9HA 3ABKC 3JARB 1XILA 2H8PC 4DO2A 4JTAB 4JI7B 2EBOA 3STZC 5JQGA 1JJ2U 3ZMVA 4X1YB 3HKEB 1JX9A 2P5OA 5KX5B 3N2GB 1VF5B 1QR8A 2YIDA 3KCXA 1QLEB 5C93A 2E5LO 1S3JA 3K5OA 3J80N 4FLYA 1NS1A 3ZRSA 3T1CA 4KHPB 3W7XA 2EJ7A 1CEZA 1GKFA 1BL8A 3K3WA 3K58A 3W7SA 5IYCO 4I55B 3K08A 3CCMV 2CTWA 4JI1B 2JGDB 4X89A 4YJ2B 2MK3A 3SPIA 1YTFB 2ILMA 3W7UA 2F93B 5LMUO 1SQBH 3SDLA 4MTFA 4P9PA 2YEVA 4LF8B 1J95A 1IXBA 4X9QA 4DYLA 3CP1A 4JI0B 1N32B 4JI3O 1W59A 4O2BA 1AI6A 3AG1C 3QO7A 4GX5A 4MSWC 4D7SA 2EINC 2DJVA 3APOA 2IU0A 5DN6G 3RW0A 3CB2A 4MTGA 2O57A 2KKWA 4OPAA 4P30A 4QE9A 3ASNB 4LF7O 4JV5B 4NXNO 3P3NA 5A2QN 2ZNIA 4DV2O 2RMKB 2OIEA 2PTMA 3A8TA 3QG5A 3RBZA 5LHIA 3E8FA 4CH4A 3CC4V 1OJHA 2P4KA 4G28B 4DRXB 4DR1O 1MA1A 4AQYB 2ADQB 5E79Z 1NKDA 2ZCEA 3SYQA 1HNWO 5H9CA 1HNXB 5B5EZ 2ZE5A 2CTRA 2ETNA 5CA1B 3IGAC 2UXXA 2XOKG 1ZAUA 4IIJB 4DV5O 1S5HC 3UKMA 4MVSA 2N05A 3OTOO 5LHHA 3E8GA 3JCZA 1TUEB 2WLLB 4FLWA 3UO3A 3F5TA 2Q4PA 4Z1MG 1E1QG 1GO3F 2Q68A 4GX1A 1Y74B 4FM0A 3G4SV 4DV0B 2QKAA 4B3RB 1WP7A 4YJ3B 1MZFA 1ZLZA 4DR3O 1KU9A 1FS0G 1HDJA 1OCRC 4I50B 5CBHA 1G4YB 4FPPA 3QF7A 1JJOA 3O65A 3ASOC 3BPZA 4IHJA 3A0RA 2YIBA 1NTZH 2QWOB 3ZHVA 1N8RW 2ATKC 4LWSA 4DXWA 2GHYA 4G2KA 1Q5OA 4WFGA 2VQEB 4MVQA 1U96A 5L3FA 4J10A 5B1OA 3E8HA 3SPGA 1VQ9V 1RM1B 3LDCA 2HVKC 4PA9A 4TSFG 3OAAG 4LF4B 3ZMZA 2YXYA 5LMNO 3D3QA 4NB5A 1KQSU 1YTFD 4UCSA 4DR4B 2YI8A 2EILC 3VQVA 3ZMTA 5KMGA 2XAGA 3CSXA 2LQTA 2EIMC 2CDYA 1WPBA 5JH7A 4EB6B 4N21A 3P32A 3ZRXA 4X65B 2HKOA 5L3BA 4OX9B 5H6RA 3Q4HA 2XNDG 1AB3A 3SPCA 2HFEC 1ROPA 3AEIA 5BZBA 5EIBC 5J2TB 1O9HA 1OCCB 1FXKB 4AI8A 2ZKOA 3DTUB 1YJ9V 4CBCA 4DK0A 2FTKA 2Q0AA 2WAMA 3LSQA 2AZ2A 1YXBA 2IJIA 3ZJZA 1QVFU 2WLIA 2ZDIA 1AI4A 1WP8A 2QM8A 4I0XA 3UCSC 1M90W 3ZIAG 2HVJC 1VF6A 3QTCA 5KHIA 4GX2A 2PF4E 3J81N 3E83A 2PYLA 2C2AA 2B1IA 1EZJA 1EN6A 5FPOA 5KA5A 1Y76B 4NVPA 4PA3A 4FFBA 1R3JC 3ZHTA 5J2UA 5BMVA 3OMNB 3WU2Z 2ZT9B 4X66B 4UCUA 4JI8O 3OEHG 4DV3B 1SKVA 1FYJA 3U10A 1RSOB 1M57C 3OM3B 1FAFA 1QVGU 4DV6O 3JALA 3M7MX 4NTWA 5KMGB 4UCOA 1N0NA 5GONA 3F7YC 2Q9LA 1BHAA 3N27A 4EFEA 2UXCB 3OEEG 3JATA 3SJCC 3CMEV 4J7KA 1PL0A 2VQFO 2ZR3A 4CC6A 4JI5O 2YI9A 4QPKA 4X64B 4X62O 1COWG 2IH3C 1P4RA 2LFSA 3RN4A 3ABLC 4LH6A 2ZQMA 1I5YA 3JYCA 1R6NA 2RN9A 1QNMA 4FIPC 1F7YA 1URFA 1AILA 2LP7A 2X0LA 1VQ4V 5EZYB 1MSWD 1EZVH 3OGCC 4PDRA 1DLBA 1IX9A 1SA0B 2JRIA 3IJ4A 4W4KA 4LNUB 5C8YA 1VMGA 5IJ9A 4DV4O 1XMQB 1AR4A 4QIWF 3ZCCA 3WB2A 4I9QA 4UFZA 4UV8A 2ZE8A 1DF4A 1PD3A 4U3JB 3MD0A 2CH7A 5B1AB 2YUAA 3T1HB 4X20B 3OR7C 4WFAV 1Q82W 2OYQA 1XNQO 3AG7A 3GWKC 1AROP 4O4LA 3JAKB 2XAFA 3CCQV 4XDJA 1XMOB 3FFQA 4YHHO 5IJ0B 1GH6A 1E79G 3CRRA 1S76D 2WA4A 1P84F 3THOA 4FM1A 2P22C 2QJ1A 2DYSB 4O2AB 3OFNG 2GTAA 4CH5A 2GV9A 4TV9B 1FD9A 1KUQA 3AG1B 2EINB 1I94O 4U3FH 2JK5C 5KAFZ 2UUCO 3OE7G 1KMIZ 1GN2A 2BOCC 2GUZB 4FLTA 5KLVH 5LBQA 5LYJA 3JASA 2LW1A 2YXHA 1VQLV 3CE2A 3HPLC 2V7QG 4O4HA 1FXVA 1WA8A 2UXDB 5JVDA 1XNRO 1NR1A 3W7TA 5H5NA 3H1KH 2DQ0A 5B1BB 3OMAB 4B7EA 4DR5B 4JPRA 1NTMH 4J9YB 3GWOA 3CRQA 1PL4A 1NU1H 4MT8A 3K04A 1RFYA 1V54C 3CJHA 5LHGA 5L3CA 1D5AA 3CCVV 2ZE6A 2F4VO 2PI4A 3T4ZA 4RQEA 2WSSG 3OUSA 4P9OA 1VQOV 2QWNB 4X1KB 1VQMV 4J7JA 1P49A 2H94A 1D2DA 3D36C 1DGSA 3UT5A 4DV1O 1V55C 2FMLA 3JARA 4JAUA 4R7CA 5DEDA 5FL7G 1K7DA 4DR6O 2QR4A 2N04A 5GTHZ 4X1YA 3HKEA 5IWAB 1TUBB 4YIPA 4JI6B 4MS2A 1SETA 3ZX6A 3N2KA 3N2GA 5KX5A 1Q90D 5K1XA 2IJKA 4X8AA 4UUJC 1OCRB 1P7GA 3AG3C 1EN5A 2Q67A 1VP7A 4GCZA 3BRCA 4O4IA 4IGGA 3FYIB 3SGIA 2UU9O 2PI5A 3H1IH 5EC2C 3A0BZ 5FNVB 2A3QA 1UPGA 4NXMO 3ZHSA 2HEPA 3B09A 1Y66A 4LFAB 2K9PA 4QGPA 2LO1A 2JGDA 4DW1A 3D3IA 4YJ2A 3FAVA 4E4EA 5L3EA 1G6UA 1OCZC 2KG7B 4B3TB 4K0KO 3JAWB 4ZHQB 3L70H 1FPOA 3FKSG 3ZBHA 4IYIA 4H33A 1LNQA 2IBZH 1K97A 1UJWB 5LA6B 1YEWA 1WLEA 2BTQA 2YIAA 2PGGA 2EILB 1M5IA 4UVCA 2AGAA 2UXBO 4UCTA 3VQXA 4LH7A 4K8XA 3ZRVA 2QTOA 3ZMUA 3B8NA 4LF6O 2HHHO 2P90A 3N2KB 1HW7A 2EIMB 5CA0B 5GTIZ 1AI7A 3JD3A 1PPJH 3TXQA 3ZRWB 2VWKA 4LFBB 1SC5B 3CYOA 1L8DA 2CK3G 3K57A 2UUBO 3HB3B 3ETQA 2RDCA 4O4IB 4K3AA 2Y0IA 2X7RB 3E86A 4PA6A 3H1JH 1HR0B 3K0GA 4RUEA 3FB6C 5B3SC 4B3SB 4JGSA 3RYFB 1XHZA 4DRXA 3ZHRA 1TVKA 1BCCH 1MOFA 2Y0PA 3FAVB 2F23A 2HJDA 1G8MA 4JZ2A 4F6RB 1B6QA 1Q86W 4MTXA 2YC0A 5CA1A 2BSKB 4IIJA 1EFRG 2FKXA 3GVMA 3MAQA 1K92A 1XEQA 4B08A 2WLLA 2BTQB 1I0HA 1M57B 1RP3B 3L75H 3CD6V 1Y74A 2OWOA 4DV7O 5IDJA 3I56V 2M6YA 1M4UA 2LW7A 1IXMA 2QEXV 4YJ3A 4KL1A 3RWRD 4PV1B 4HYOA 1K9MW 4FK5C 3CCJV 3R65A 1ZX3A 2RQ6A 3PN1A 3CCUV 5LXTB 4I5SA 4CH3A 1AJQA 4I50A 2GTSA 4QJFB 4IT5A 3BEHA 3B8MA 3AK2A 5CN0A 1M56C 3BHPA 2Q8VA 1JVMA 1WB7A 1VQ7V 2W0FC 5BR8O 4LBEC 3ABUA 1UFIA 4GKJO 1N0JA 3EVKA 1HWYA 1WN7A 1TVKB 2KSDA 2XAHA 4ICGA 1BMFG 4DUZO 1P7BA 3ZN1A 3I55V 2Y69C 4Q6GA 1W2BU 4YXWG 2QA4V 4Z1VA 3CRCA 4GKKB 3AK1A 5DECA 3B77A 1PM9A 3MHHC 4IYHA 3APQA 1IURA 3O9OA 1Q6IA 2Z3YA 3J7AU 1K4DC 4ZBMA 2B5UA 3B40A 5D5QA 2P6JA 5B1NA 2ZIOA 2ZINA 1DK1A 4NR1A 5FPRA 4BW9A 1AI5A 4LF5O 4TWKA 2CGOA 4DR2B 2WLNA 2N74A 4FLXA 2BTOA 4H37A 5TISZ 5F2VO 3MDSA 5ITZB 4WF9V 4CS3A 2XASA 4PHZA 1GN3A 1YZBA 3T1YB 3G6EV 1IBKB 5IT9N 2WLJA 4EB6A 4JI2O 1IBLO 4ZIBA 1FJGO 3AK3A 3T1HO 3L9DA 1Q6HA 4JYYA 4KUMA 1QR9A 2FL4A 5J2TA 1JPXA 3ABMC 1J5EO 1FXKA 2IJJA 1K8AW 4JI4O 1A32A 2IJHA 3BABA 5LOVB 1QCEA 4WFBV 1VEWA 3RYIB 3ZMSA 3BFRA 3TGUH 4H0LB 4NYKA 4UB8Z 2YS8A 1AP5A 2EIKC 5EBLC 3H1LH 2VRZA 1R6TA 1SF9A 1XQ8A 1JMKC 1NJIW 1S77D 3BA8A 2A0LA 1SESA 4L8JA 1KBHA 2PY5A 1Y76A 2JDIG 4DUYO 4DR7O 3L74H 2ODMA 4GZRB 4RUFA 4QPJA 4LFCB 1N34B 2KQXA 3CCSV 3IC7A 3GB7C 2DQ3A 1NVPB 2GDSA 3DC6A 1RSOA 1HNZB 1XHXA 4J41A 4EEQA 3OUFA 2CGNA 2RJZA 2UUAO 1X59A 4KXRA 5JCOC 4KFMA 2OCCC 4YY3O 1JQ0A 2DOSA 1NZ6A 3UM7A 1Y6XA 2E5LB 3SJQC 2JIZG 1V55B 2KB1A 3L73H 1W0KG 2H3OA 1AVMA 3F7VC 4JZGA 4C7UA 3SR2C 5EZYA 2BOBC 1YVWA 4JYAB 5EC1C 3OR6C 5GW7A 1RPRA 1N36O 1VIBA 3CCEV 1SA0A 4TUYB 4TQDA 1ZSPA 4LF9O 3FYEB 4LNUA 4CC5A 1THZA 3K59A 3AG3B 3RYHB 2R72A 5LMUB 1MMMA 3IAYA 5LP6C 3ETDA 1XUQA 1SQPH 1WB8A 1SERA 4NTXA 2GBOA 4I4TB 4ZI7A 4UB6Z 4U3JA 4JI3B 2JS5A 4Z2WA 1BQ0A 2F95B 4BW5A 3AG2C 3FB8C 3DXRB 4X20A 4B3MO 3WB0A 4QE7A 1K33A 3EFFK 3ICXA 2X6CA 1FFXB 2XHBA 2HP8A 3JAKA 2IU3A 1N33O 3T2MA 4FLVA 1NBMG 4KP4A 1Q8IA 5KHJA 4O4JB 5IJ0A 4LF7B 4G27B 2ZM6O 3CXHF 4O2AA 4NXNB 1AJPA 4ZOLB 4AHCA 3ABKB 3AG4C 3HKCB 4TV9A 1VF7A 2DW4A 4DV2B 1GK9A 3VQWA 1IBMO 1KKDA 1JCHA 1S5LZ 2AXTZ 4MW3A 2JEXA 2GUZA 4DR1B 4JI7O 3ETGA 3JD4A 1W0JG 3VOUA 4GLXA 3ZHQA 1YSCA 4PA4A 1HNWB 1K5QA 4PDVA 5HFMA 3CRMA 4DV5B 3FB7C 2P67A 1F4NA 4TQFA 3OTOB 1XOUA 5EBWC 1KC8W 4ZI7B 3CWBH 4KHPO 1O9GA 2ZD9A 3TK1A 3RVYA 3K9AA 3OW2U 2JGUA 1V9PA 3RYCB 1NVPD 1M1KW 3A0HZ 1H2NA 4DR3B 4JI1O 1X4TA 1Q81W 1Q7YW 5CMUA 4X1KA 1YITV 2Y48A 2Y4TA 3ZHUA 1YJNV 2YDEA 2ZXWC 1NT2B 4FMTA 2PZSA 4LF8O 1F23A 4JI0O 2DYRC 1N32O 3SYAA 1TUBA 5EYPB 2WWWA 4UV9A 3E89A 1GM7A 4U7OA 3R66A 5CB4B 2M7WA 3DGEA 4W4LA 3K5LA 2Q7EA 1L0LH 1K5SA 3KKYA 4J7ZA 2F1MA 3G71V 4JV5O 1AJNA 3KCYA 4WFEA 4LCUC 5LMNB 4JF3A 5FNVA 1RM1C 4HZ3A 1FKAO 4R8CA 2L6LA 2Y69B 3QNEA 3EHBB 4MTOA 2DWDC 2KG7A 4AQYO 1I5XA 1YF2A 3JAWA 3LNMB 1OCOC 2VWJA 4ZHQA 2EZPA 4MVZA 1B06A 3WG7C 1S72V 1HNXO 1H2GA 1IZ3A 3LSSA 4YIOA 4MVOA 3CMAV 5LA6A 4CS2A 2P06A 1ZUQA 4B7KA 1VQ6V 2XTAA 1T5EA 2OTLV 5K1PA 1K73W 2UXNA 5KHKA 2QKSA 2D2CB 1OCCC 2JJ2G 5CBGA 5CA0A 4DV0O 2QE7G 4B3RO 3ZRWA 3HKDB 3B4SA 4J80A 2NLJC 1ORQC 2HG5C 1AR1B 5H6QA 1IBKO 3E22B 2CUGA 2F66C 3SJAC 3NR7A 3D8CA 3ASOB 4JI8B 3OGIB 4H13B 4OGQB 2FB5A 5BY1A 2HJFC 1KP3A 1VARA 2V4DA 5IY5C 3JAMN 2WLKA 3RYFA 2EIKB 4X1IB 1VQPV 1PV0A 4DK1A 4DV6B 1U97A 4A5UB 1VQNV 5KUKA 4GT1A 2JEUA 2JVDA 4PA7A 3OT7A 1BS3A 4F6RA 4UCRA 1YIJV 2A06H 2OTJV 4BWAA 2BSKA 2CE4A 4PDMA 2NNUA 2GSMB 3L71H 3SPHA 3K5NA 1CPYA 2VQFB 5KAIZ 4J42A 4JI5B 2VQEO 3RT3C 3H01A 1R1BA 4X62B 3LDDA 1AP6A 2CAZC 4EFBA 2EJRA 4LF4O 3U0ZA 4FLZA 1SQXH 3WFVA 2Z0AA 3CHXA 1N4CA 2X6AA 1L0NH 1GTOA 1M93A 4DR4O 4PI2A 2QGNA 2OCCB 1JA8A 3UO2A 5LXTA 3CXCU 5L3DA 4IL6Z 4P2ZA 3TXSA 2R9IA 4JASA 5FLXN 2ZDIC 1SQQH 4FJCC 4GYCB 4DV4B 3H9VA 1VF6C 1YI2V 3X2QC 4X65O 4OX9O 1SQGA 3HKBA 5IYZB 3K0DA 4D7TA 3QO5A 2EULA 4UVAA 1RPOA 2Q7HA 3K03A 2QKCA 5D5PA 3VBBA 2Q0OC 1BZKA 1XL4A 3G67A 1LUWA 1XNQB 4OPHA 1F4MA 2NN4A 3C3TA 4Q20A 2EZOA 1KP2A 1JFFB 4JYAO 2YICA 4FFKA 5B1AC 5LP6B 4D6TH 4YHHB 1XDCA 4XDKA 2R9AA 2AZ0A 1VQKV 3BA9A 1H2LA 1ZWIC 1PNMA 2MW2B 3ML0A 2P4VA 2LFRA 2XUMA 3K5MA 4X66O 2QWRB 4J9ZB 3JD2A 3M99B 4DV3O 1IVSA 2E74B 2IW5A 2G38A 3BY6A 3AG2B 1I94B 2DYSC 5DM6V 5ITZA 4FLUA 2UUCB 1FXHA 5EK0A 2QM7A 5JQGB 1GM8A 2NR5A 1XI1A 2UXCO 3S3XA 1OV9A 3SYPA 3HKBB 1M9NA 1BSMA 3ABLB 1KD1W 1XNRB 1SQVH 2LJ2A 4JAVA 2ZE7A 4JTCB 3AG4B 3FX7A 4JTDB 5LOVA 3RYIA 4FVMA 4X64O 1DF5A 2ITCC 3F5WC
chains in the Genus database with same CATH topology
4O4LA 2IM9A 2QM4A 3JAKB 1JFFA 3DSQA 1N33B 1XMOB 4I55A 3FFQA 5IJ0B 4TOIA 5LP6A 4FM1A 3THOA 2P22C 2QJ1A 3SR2C 1SQFA 4O2AB 5JJJB 2ZM6B 4CH5A 5EZYA 2GV9A 4TV9B 2F4VB 3JSLA 4JYAB 1Z5VA 3JSNA 4K8ZA 1SA0A 4TUYB 4TQDA 1TAEA 4TV8A 1IBMB 4LNUA 4CC5A 3UT5B 4CS4A 4DV1B 3K59A 1KMIZ 3JARB 4FLTA 3RYHB 2R72A 5LMUB 3IAYA 5LP6C 4JI7B 5JQGA 3U11A 5LYJA 3JASA 4DR6B 4X1YB 3HKEB 4I4TB 4O4HA 2PUSA 4O2BB 4ZI7A 2P5OA 2UXDB 4U3JA 4JI3B 5JVDA 5KX5B 3N2GB 2JS5A 2F95B 3ZEDA 1Z5WA 4X20A 3WB0A 3UQ8A 3K5OA 4DR5B 3ICXA 4FLYA 1FFXB 4KHPB 2XHBA 3JAKA 4FLVA 5KHJA 1Q8IA 4O4JB 5IJ0A 4LF7B 2UU9B 1D5AA 4O2AA 3K58A 4NXNB 5KHGA 5EIBD 4ZOLB 2ZNJA 4AHCA 4TV9A 4NXMB 3HKCB 4I55B 1VF7A 4DV2B 4JI1B 1I7FA 4X1KB 3VQWA 4YJ2B 1P49A 4TUYA 1DGSA 3UT5A 2F93B 3JARA 4K0KB 4DR1B 3RYHA 4TV8B 4LF8B 4GLXA 4JI0B 4X1YA 1HNWB 3HKEA 1N32B 5IWAB 4I4TA 1TUBB 4JI6B 2E3CA 5KHHA 4O2BA 3RGBA 3N2KA 3N2GA 5KX5A 4D7SA 5K1XA 4DV5B 2UXBB 4TQFA 3OTOB 4ZI7B 1O9GA 1FFXA 3CB2A 2HHHB 4LF6B 3BRCA 2KKWA 4WBNA 4O4IA 1TGOA 3SGIA 4JV5B 4O4JA 2JGUA 1V9PA 3RYCB 5FNVB 3SJBC 2ZNIA 4DR3B 4ZOLA 2UUBB 2HEPA 4AILC 4LFAB 3HKCA 1X4TA 3VQYA 2PTMA 3QG5A 4X1KA 4YJ2A 3BAAA 4CH4A 1G6UA 1S5JA 4DRXB 4B3TB 3JAWB 4AQYB 4ZHQB 1NT2B 2PZSA 2ZCEA 4IHJB 1HNXB 5JJNB 1QHTA 1TUBA 3B2EE 5LA6B 5EYPB 1YEWA 5CA1B 1ZAUA 2BTQA 4IIJB 2YIAA 2PGGA 1M5IA 4UCTA 3VQXA 5CB4B 4LH7A 3WB1A 4FLWA 4K8XA 3RFRA 3K5LA 3N2KB 1HW7A 5JJEB 5CA0B 2Q7EA 4FM0A 4DV0B 2F1MA 4DV7B 4B3RB 4YJ3B 2VWKA 4LFBB 3RYCA 1L8DA 5LMNB 3K57A 5FNVA 3ETQA 1KU9A 4WBNB 4O4IB 1HR0B 4I50B 4B3SB 3QF7A 3RYFB 2PYJA 1XHZA 4DRXA 1JJOA 5JH7B 1TVKA 3JAWA 2VWJA 4ZHQA 5BR8B 3BPZA 4IHJA 4F6RB 4GKJB 2YIBA 5LA6A 4CS2A 5EYPA 1H2SB 5CA1A 1WNSA 4IIJA 4DUZB 1T5EA 3MAQA 1Q5OA 4B08A 5K1PA 5CB4A 5KHKA 3OTFA 2VQEB 2BTQB 5CA0A 4HNAA 2OWOA 4LF4B 3HKDB 1M4UA 4YJ3A 4KL1A 3RWRD 4UCSA 4DR4B 2Q7GA 2YI8A 4FFBB 4HBNA 5J2UB 3VQVA 5BMVB 3E22B 2F66C 4LF5B 3SJAC 2RQ6A 3PN1A 5LXTB 5KMGA 4JI8B 4CH3A 3CSXA 4I50A 2V4DA 1B04A 1WPBA 3RYFA 5JH7A 4X1IB 3BHPA 4LR3A 4PI0A 3JALB 4UCVA 4DK1A 4EB6B 4DV6B 4X65B 4OX9B 4JI2B 5GONB 1IBLB 1FJGB 2JVDA 4F6RA 1Q3EA 5EIBC 1WN7A 1O9HA 1TVKB 3JATB 4UCRA 5J2TB 4BWAA 4CH6A 1J5EB 4Q6GA 4DK0A 4JI4B 2Q0AA 3K5NA 2VQFB 4JI5B 4X62B 4GKKB 2CAZC 4EFBA 2ZIMA 4FM2A 3U0ZA 4FLZA 3HKDA 3QTCA 5KHIA 3CHXA 5D5QA 2PYLA 5FPOA 1M93A 4NVPA 4PI2A 2ZIOA 2ZINA 4HNAB 4FFBA 5FPRA 5J2UA 4BW9A 4DUYB 5BMVA 3E22A 4DR7B 3LNNA 4DR2B 5LXTA 4X66B 4UCUA 4FLXA 4DV3B 2BTOA 1SKVA 5ITZB 5C8YB 3U10A 4CS3A 2YIBD 5IJ9B 4PHZA 3T1YB 1IBKB 4GYCB 4DV4B 4X1IA 4EB6A 3JALA 3M7MX 1SQGA 3HKBA 5KMGB 4UCOA 5GONA 5IYZB 4ZIBA 4D7TA 3ZS8C 2UUAB 4EFEA 2UXCB 5J2TA 3JATA 3SJCC 2Q7HA 4YY3B 5D5PA 3BABA 5LOVB 4CC6A 3RYIB 2YI9A 4X64B 1XNQB 4O4LB 1JFFB 1XQ8A 4LH6A 1JMKC 3BA8A 2EX3A 5LP6B 4YHHB 4L8JA 2R9AA 2PY5A 2YXLA 3A2FA 3BA9A 5EZYB 5JCOA 3K5MA 4LFCB 1N34B 1Q43A 1SA0B 1N36B 1I94B 4LNUB 5ITZA 5C8YA 4LF9B 1RSOA 5IJ9A 4FLUA 2UUCB 1HNZB 1XHXA 1XMQB 4EEQA 5JQGB 3WB2A 3JASB 5LYJB 5IYZA 2RJZA 1XI1A 4I9QA 4UFZA 5JCOC 4O4HB 2R70A 1QQCA 4U3JB 5JVDB 3HKBB 1TA8A 1XNRB 5LOVA 3RYIA 4FVMA 3T1HB 4X20B 2OYQA 2E5LB 4B3MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QF7 A;  2CAZ C;  3B2E E;  3ZS8 C;  1X4T A;  2JS5 A;  3CSX A;  1SKV A;  3SJB C;  3SJC C;  1NT2 B;  2F66 C;  3SJA C;  3THO A;  2P22 C;  3QG5 A;  3ICX A; 
#chains in the Genus database with same CATH topology
 2QM4 A;  1Z2G A;  3I5D A;  5LGT A;  4MVM A;  1H38 A;  1S0V A;  5B1B C;  1US6 A;  1GMG A;  2EIJ C;  1YHQ V;  3CC2 V;  1SQF A;  3SPJ A;  2ZR2 A;  3SYO A;  4X88 A;  3CRA A;  1R6K A;  2F4V B;  3TET A;  3JSN A;  1H2K A;  3BCC H;  5EBM C;  1VQ8 V;  4U7N A;  5KA6 A;  1TAE A;  4FZ1 A;  4TV8 A;  3KG2 A;  3MHS C;  1R3K C;  4DV1 B;  1XMQ O;  3TCU A;  1SZT A;  4FZ0 A;  1MZE A;  3U11 A;  4LC1 A;  2YEV B;  3C3S A;  2E76 B;  4DR6 B;  1KB9 F;  2PUS A;  4O2B B;  5AG2 A;  1CXZ B;  5IYD O;  3CEI A;  3ZED A;  1Z5W A;  3UQ8 A;  2CTQ A;  2X6B A;  2R9R B;  4N23 A;  3D36 A;  5KUM A;  1XMO O;  4PD4 F;  2ZXW B;  2UU9 B;  4EKW A;  2QTS A;  2DYR B;  2WPD G;  1L1F A;  1SRY A;  3QVN A;  5KHG A;  5EIB D;  1HP8 A;  1XRE A;  2ZNJ A;  4BIO A;  4WFH A;  4NXM B;  1PNL A;  3NXS A;  3W7W A;  1I7F A;  4TUY A;  4BR6 A;  2RCV A;  3STL C;  4K0K B;  4PDL A;  3RYH A;  1R3L C;  1NH2 B;  1K34 A;  4TV8 B;  1PP9 H;  2DE0 X;  1GN6 A;  4I4T A;  1BQZ A;  2UXD O;  2E3C A;  5KHH A;  3RGB A;  4TT3 G;  1BE3 H;  1QBZ A;  1V54 B;  1MAB G;  2UXB B;  4DR5 O;  1VQ5 V;  2B9Z A;  3DXR A;  1FFX A;  4LF6 B;  2HHH B;  2OCH A;  1D5N A;  4WBN A;  1TGO A;  1NQT A;  2W6J G;  1MG1 A;  1OCO B;  3G80 A;  4O4J A;  1PKX A;  2A7W A;  3WG7 B;  1XL6 A;  3SJB C;  2XAJ A;  4ZOL A;  4F6E A;  2UUB B;  1GN4 A;  3EXA A;  4AIL C;  1QLE C;  3HKC A;  2QSA A;  3L72 H;  3IFX A;  1YDX A;  3VQY A;  3KZI Z;  4JYB A;  3BAA A;  1S5J A;  4BIZ A;  1R3I C;  1WPX A;  1KKC A;  1Y4M A;  1Q6U A;  1SS3 A;  2WA3 A;  3ZN0 A;  4IHJ B;  5IWA O;  5A9G A;  5JJN B;  2V1D A;  1QHT A;  3BVO A;  4JI6 O;  1CP9 A;  3TJT A;  3B2E E;  4LWS B;  1ENV A;  3JD0 A;  3OMI B;  4K35 A;  3G6B A;  2Q69 A;  2XT9 A;  4BIU A;  3K79 A;  1BGY H;  3WB1 A;  4I9W A;  4R6Z A;  3RFR A;  1ZL8 A;  2JS3 A;  5JJE B;  5IY5 B;  3E35 A;  4DV7 B;  5E1A C;  4GUN A;  3RYC A;  4JAA A;  1OCZ B;  1MSD A;  4WBN B;  4LFA O;  1GM9 A;  4NKG B;  1H2M A;  2IH1 C;  3SYC A;  1B3Q A;  2W0X A;  4UVB A;  3T4D A;  3LDE A;  4B3T O;  4MVR A;  2FYU H;  2PYJ A;  1QLN A;  5JH7 B;  3ASN C;  3RVZ A;  3OD4 A;  3LUT B;  3JD1 A;  3Q4H B;  5BR8 B;  2BCC H;  4BAY A;  4GKJ B;  5IYB O;  5EYP A;  1H2S B;  1WNS A;  1MNG A;  3FD9 A;  4OXS A;  2Y4U A;  4DUZ B;  4MVU A;  5CB4 A;  3OTF A;  5B66 Z;  1SZX A;  2WLI B;  1GAX A;  3LSU A;  4I0X B;  4HNA A;  3HR0 A;  4RQF A;  3X2Q B;  2CTP A;  4LFB O;  2AHZ A;  1KEC A;  2DMX A;  1ZL8 B;  5B3S B;  2QDO A;  3S3W A;  3CCR V;  1BHB A;  2Q7G A;  4FFB B;  4HBN A;  3CPW U;  5J2U B;  5BMV B;  1Y67 A;  2ARH A;  2L35 A;  1HR0 O;  2YSU B;  4LF5 B;  3ABT A;  1NTK H;  1GRJ A;  1NH2 D;  1H8H G;  4B3S O;  4XBF A;  2D3O W;  1K4C C;  1B04 A;  1JR9 A;  4LR3 A;  4PI0 A;  3JAL B;  4UCV A;  1H8E G;  4JI2 B;  5GON B;  1IBL B;  4QNH B;  1FJG B;  1Q3E A;  3JAT B;  2DWE C;  2HR3 A;  2LGW A;  4CH6 A;  1J5E B;  4L87 A;  4RWU A;  4JI4 B;  2QWQ B;  2E75 B;  2XAQ A;  2VS0 A;  2OIG A;  1FFT B;  2OT5 A;  2QWP B;  2LGQ A;  3P3P A;  2B1G A;  2RNB A;  2ZIM A;  4FM2 A;  3HKD A;  3ETE A;  4ZKI A;  4RO2 A;  4HNA B;  3FB5 C;  2Q6A A;  5HFL A;  4DUY B;  3CX5 F;  4DR7 B;  3E22 A;  1DTO A;  1M56 B;  3M8A A;  5BXZ A;  3LNN A;  1I08 A;  2W6I G;  1QU7 A;  4R50 A;  5C8Y B;  2YIB D;  5IJ9 B;  1EN4 A;  4WCE V;  3P30 A;  4X1I A;  4LP8 A;  5IE9 A;  1OZ0 A;  2DN9 A;  5JWP A;  4PJ0 Z;  3ZS8 C;  1BT8 A;  1YCI A;  3K9S A;  2UUA B;  1ZTE A;  2EIJ B;  5LGU A;  1XBL A;  4YY3 B;  2CH7 B;  1PNK A;  5L3G A;  2ADP A;  5CBF A;  1AR5 A;  4E2L A;  4ASU G;  4GKK O;  3PJS K;  4F4L A;  1IDS A;  4RAI A;  3CCL V;  1K3E A;  4O4L B;  1EBO A;  4XDL A;  2EX3 A;  4HAM A;  3CS5 A;  2A79 B;  3C90 A;  4H44 B;  4JYC A;  2Q5Z A;  2YXL A;  3A2F A;  1FXK C;  5JCO A;  2Z5U A;  4DR2 O;  4WFF A;  1Q43 A;  2K1E A;  1N36 B;  1LUV A;  2WLM A;  4LF9 B;  3T1Y O;  2ITD C;  4NTY A;  1WJZ A;  4DW0 A;  1KYO F;  2BE3 A;  3ABM B;  2JJ1 G;  2WLH A;  3CC7 V;  5LGN A;  5LYJ B;  3JAS B;  5IYZ A;  4ABM A;  5CA3 A;  4O4H B;  2R70 A;  1WAZ A;  5J9P C;  1WA8 B;  1QQC A;  5JVD B;  4PEL A;  1TA8 A;  1NI8 A;  3QO8 A;  1JOY A;  1NR7 A;  4I7Z B;  3E8B A;  3E2E A;  1F51 A;  4B3M B;  2HLD G;  4J11 A;  3K06 A;  2IM9 A;  1EM1 A;  1LR1 A;  1JFF A;  3DSQ A;  4GX0 A;  1N33 B;  3H1H H;  3CJH B;  4I55 A;  3IC9 A;  4TOI A;  5LP6 A;  2P7T C;  1OHH G;  1R73 A;  2F43 G;  1G1X B;  5JJJ B;  2ZM6 B;  5H2F Z;  3DC5 A;  1YJW V;  3JSL A;  1N34 O;  4LFC O;  1Z5V A;  4UXN A;  4CZZ A;  1E1R G;  3JCU Z;  4K8Z A;  1IBM B;  3UT5 B;  4CS4 A;  5LL6 Y;  2Q73 A;  1HNZ O;  2AHY A;  2AW9 A;  4MW8 A;  2A9H A;  3ABK C;  3JAR B;  1XIL A;  2H8P C;  4DO2 A;  4JTA B;  4JI7 B;  2EBO A;  3STZ C;  5JQG A;  1JJ2 U;  3ZMV A;  4X1Y B;  3HKE B;  1JX9 A;  2P5O A;  5KX5 B;  3N2G B;  1VF5 B;  1QR8 A;  2YID A;  3KCX A;  1QLE B;  5C93 A;  2E5L O;  1S3J A;  3K5O A;  3J80 N;  4FLY A;  1NS1 A;  3ZRS A;  3T1C A;  4KHP B;  3W7X A;  2EJ7 A;  1CEZ A;  1GKF A;  1BL8 A;  3K3W A;  3K58 A;  3W7S A;  5IYC O;  4I55 B;  3K08 A;  3CCM V;  2CTW A;  4JI1 B;  2JGD B;  4X89 A;  4YJ2 B;  2MK3 A;  3SPI A;  1YTF B;  2ILM A;  3W7U A;  2F93 B;  5LMU O;  1SQB H;  3SDL A;  4MTF A;  4P9P A;  2YEV A;  4LF8 B;  1J95 A;  1IXB A;  4X9Q A;  4DYL A;  3CP1 A;  4JI0 B;  1N32 B;  4JI3 O;  1W59 A;  4O2B A;  1AI6 A;  3AG1 C;  3QO7 A;  4GX5 A;  4MSW C;  4D7S A;  2EIN C;  2DJV A;  3APO A;  2IU0 A;  5DN6 G;  3RW0 A;  3CB2 A;  4MTG A;  2O57 A;  2KKW A;  4OPA A;  4P30 A;  4QE9 A;  3ASN B;  4LF7 O;  4JV5 B;  4NXN O;  3P3N A;  5A2Q N;  2ZNI A;  4DV2 O;  2RMK B;  2OIE A;  2PTM A;  3A8T A;  3QG5 A;  3RBZ A;  5LHI A;  3E8F A;  4CH4 A;  3CC4 V;  1OJH A;  2P4K A;  4G28 B;  4DRX B;  4DR1 O;  1MA1 A;  4AQY B;  2ADQ B;  5E79 Z;  1NKD A;  2ZCE A;  3SYQ A;  1HNW O;  5H9C A;  1HNX B;  5B5E Z;  2ZE5 A;  2CTR A;  2ETN A;  5CA1 B;  3IGA C;  2UXX A;  2XOK G;  1ZAU A;  4IIJ B;  4DV5 O;  1S5H C;  3UKM A;  4MVS A;  2N05 A;  3OTO O;  5LHH A;  3E8G A;  3JCZ A;  1TUE B;  2WLL B;  4FLW A;  3UO3 A;  3F5T A;  2Q4P A;  4Z1M G;  1E1Q G;  1GO3 F;  2Q68 A;  4GX1 A;  1Y74 B;  4FM0 A;  3G4S V;  4DV0 B;  2QKA A;  4B3R B;  1WP7 A;  4YJ3 B;  1MZF A;  1ZLZ A;  4DR3 O;  1KU9 A;  1FS0 G;  1HDJ A;  1OCR C;  4I50 B;  5CBH A;  1G4Y B;  4FPP A;  3QF7 A;  1JJO A;  3O65 A;  3ASO C;  3BPZ A;  4IHJ A;  3A0R A;  2YIB A;  1NTZ H;  2QWO B;  3ZHV A;  1N8R W;  2ATK C;  4LWS A;  4DXW A;  2GHY A;  4G2K A;  1Q5O A;  4WFG A;  2VQE B;  4MVQ A;  1U96 A;  5L3F A;  4J10 A;  5B1O A;  3E8H A;  3SPG A;  1VQ9 V;  1RM1 B;  3LDC A;  2HVK C;  4PA9 A;  4TSF G;  3OAA G;  4LF4 B;  3ZMZ A;  2YXY A;  5LMN O;  3D3Q A;  4NB5 A;  1KQS U;  1YTF D;  4UCS A;  4DR4 B;  2YI8 A;  2EIL C;  3VQV A;  3ZMT A;  5KMG A;  2XAG A;  3CSX A;  2LQT A;  2EIM C;  2CDY A;  1WPB A;  5JH7 A;  4EB6 B;  4N21 A;  3P32 A;  3ZRX A;  4X65 B;  2HKO A;  5L3B A;  4OX9 B;  5H6R A;  3Q4H A;  2XND G;  1AB3 A;  3SPC A;  2HFE C;  1ROP A;  3AEI A;  5BZB A;  5EIB C;  5J2T B;  1O9H A;  1OCC B;  1FXK B;  4AI8 A;  2ZKO A;  3DTU B;  1YJ9 V;  4CBC A;  4DK0 A;  2FTK A;  2Q0A A;  2WAM A;  3LSQ A;  2AZ2 A;  1YXB A;  2IJI A;  3ZJZ A;  1QVF U;  2WLI A;  2ZDI A;  1AI4 A;  1WP8 A;  2QM8 A;  4I0X A;  3UCS C;  1M90 W;  3ZIA G;  2HVJ C;  1VF6 A;  3QTC A;  5KHI A;  4GX2 A;  2PF4 E;  3J81 N;  3E83 A;  2PYL A;  2C2A A;  2B1I A;  1EZJ A;  1EN6 A;  5FPO A;  5KA5 A;  1Y76 B;  4NVP A;  4PA3 A;  4FFB A;  1R3J C;  3ZHT A;  5J2U A;  5BMV A;  3OMN B;  3WU2 Z;  2ZT9 B;  4X66 B;  4UCU A;  4JI8 O;  3OEH G;  4DV3 B;  1SKV A;  1FYJ A;  3U10 A;  1RSO B;  1M57 C;  3OM3 B;  1FAF A;  1QVG U;  4DV6 O;  3JAL A;  3M7M X;  4NTW A;  5KMG B;  4UCO A;  1N0N A;  5GON A;  3F7Y C;  2Q9L A;  1BHA A;  3N27 A;  4EFE A;  2UXC B;  3OEE G;  3JAT A;  3SJC C;  3CME V;  4J7K A;  1PL0 A;  2VQF O;  2ZR3 A;  4CC6 A;  4JI5 O;  2YI9 A;  4QPK A;  4X64 B;  4X62 O;  1COW G;  2IH3 C;  1P4R A;  2LFS A;  3RN4 A;  3ABL C;  4LH6 A;  2ZQM A;  1I5Y A;  3JYC A;  1R6N A;  2RN9 A;  1QNM A;  4FIP C;  1F7Y A;  1URF A;  1AIL A;  2LP7 A;  2X0L A;  1VQ4 V;  5EZY B;  1MSW D;  1EZV H;  3OGC C;  4PDR A;  1DLB A;  1IX9 A;  1SA0 B;  2JRI A;  3IJ4 A;  4W4K A;  4LNU B;  5C8Y A;  1VMG A;  5IJ9 A;  4DV4 O;  1XMQ B;  1AR4 A;  4QIW F;  3ZCC A;  3WB2 A;  4I9Q A;  4UFZ A;  4UV8 A;  2ZE8 A;  1DF4 A;  1PD3 A;  4U3J B;  3MD0 A;  2CH7 A;  5B1A B;  2YUA A;  3T1H B;  4X20 B;  3OR7 C;  4WFA V;  1Q82 W;  2OYQ A;  1XNQ O;  3AG7 A;  3GWK C;  1ARO P;  4O4L A;  3JAK B;  2XAF A;  3CCQ V;  4XDJ A;  1XMO B;  3FFQ A;  4YHH O;  5IJ0 B;  1GH6 A;  1E79 G;  3CRR A;  1S76 D;  2WA4 A;  1P84 F;  3THO A;  4FM1 A;  2P22 C;  2QJ1 A;  2DYS B;  4O2A B;  3OFN G;  2GTA A;  4CH5 A;  2GV9 A;  4TV9 B;  1FD9 A;  1KUQ A;  3AG1 B;  2EIN B;  1I94 O;  4U3F H;  2JK5 C;  5KAF Z;  2UUC O;  3OE7 G;  1KMI Z;  1GN2 A;  2BOC C;  2GUZ B;  4FLT A;  5KLV H;  5LBQ A;  5LYJ A;  3JAS A;  2LW1 A;  2YXH A;  1VQL V;  3CE2 A;  3HPL C;  2V7Q G;  4O4H A;  1FXV A;  1WA8 A;  2UXD B;  5JVD A;  1XNR O;  1NR1 A;  3W7T A;  5H5N A;  3H1K H;  2DQ0 A;  5B1B B;  3OMA B;  4B7E A;  4DR5 B;  4JPR A;  1NTM H;  4J9Y B;  3GWO A;  3CRQ A;  1PL4 A;  1NU1 H;  4MT8 A;  3K04 A;  1RFY A;  1V54 C;  3CJH A;  5LHG A;  5L3C A;  1D5A A;  3CCV V;  2ZE6 A;  2F4V O;  2PI4 A;  3T4Z A;  4RQE A;  2WSS G;  3OUS A;  4P9O A;  1VQO V;  2QWN B;  4X1K B;  1VQM V;  4J7J A;  1P49 A;  2H94 A;  1D2D A;  3D36 C;  1DGS A;  3UT5 A;  4DV1 O;  1V55 C;  2FML A;  3JAR A;  4JAU A;  4R7C A;  5DED A;  5FL7 G;  1K7D A;  4DR6 O;  2QR4 A;  2N04 A;  5GTH Z;  4X1Y A;  3HKE A;  5IWA B;  1TUB B;  4YIP A;  4JI6 B;  4MS2 A;  1SET A;  3ZX6 A;  3N2K A;  3N2G A;  5KX5 A;  1Q90 D;  5K1X A;  2IJK A;  4X8A A;  4UUJ C;  1OCR B;  1P7G A;  3AG3 C;  1EN5 A;  2Q67 A;  1VP7 A;  4GCZ A;  3BRC A;  4O4I A;  4IGG A;  3FYI B;  3SGI A;  2UU9 O;  2PI5 A;  3H1I H;  5EC2 C;  3A0B Z;  5FNV B;  2A3Q A;  1UPG A;  4NXM O;  3ZHS A;  2HEP A;  3B09 A;  1Y66 A;  4LFA B;  2K9P A;  4QGP A;  2LO1 A;  2JGD A;  4DW1 A;  3D3I A;  4YJ2 A;  3FAV A;  4E4E A;  5L3E A;  1G6U A;  1OCZ C;  2KG7 B;  4B3T B;  4K0K O;  3JAW B;  4ZHQ B;  3L70 H;  1FPO A;  3FKS G;  3ZBH A;  4IYI A;  4H33 A;  1LNQ A;  2IBZ H;  1K97 A;  1UJW B;  5LA6 B;  1YEW A;  1WLE A;  2BTQ A;  2YIA A;  2PGG A;  2EIL B;  1M5I A;  4UVC A;  2AGA A;  2UXB O;  4UCT A;  3VQX A;  4LH7 A;  4K8X A;  3ZRV A;  2QTO A;  3ZMU A;  3B8N A;  4LF6 O;  2HHH O;  2P90 A;  3N2K B;  1HW7 A;  2EIM B;  5CA0 B;  5GTI Z;  1AI7 A;  3JD3 A;  1PPJ H;  3TXQ A;  3ZRW B;  2VWK A;  4LFB B;  1SC5 B;  3CYO A;  1L8D A;  2CK3 G;  3K57 A;  2UUB O;  3HB3 B;  3ETQ A;  2RDC A;  4O4I B;  4K3A A;  2Y0I A;  2X7R B;  3E86 A;  4PA6 A;  3H1J H;  1HR0 B;  3K0G A;  4RUE A;  3FB6 C;  5B3S C;  4B3S B;  4JGS A;  3RYF B;  1XHZ A;  4DRX A;  3ZHR A;  1TVK A;  1BCC H;  1MOF A;  2Y0P A;  3FAV B;  2F23 A;  2HJD A;  1G8M A;  4JZ2 A;  4F6R B;  1B6Q A;  1Q86 W;  4MTX A;  2YC0 A;  5CA1 A;  2BSK B;  4IIJ A;  1EFR G;  2FKX A;  3GVM A;  3MAQ A;  1K92 A;  1XEQ A;  4B08 A;  2WLL A;  2BTQ B;  1I0H A;  1M57 B;  1RP3 B;  3L75 H;  3CD6 V;  1Y74 A;  2OWO A;  4DV7 O;  5IDJ A;  3I56 V;  2M6Y A;  1M4U A;  2LW7 A;  1IXM A;  2QEX V;  4YJ3 A;  4KL1 A;  3RWR D;  4PV1 B;  4HYO A;  1K9M W;  4FK5 C;  3CCJ V;  3R65 A;  1ZX3 A;  2RQ6 A;  3PN1 A;  3CCU V;  5LXT B;  4I5S A;  4CH3 A;  1AJQ A;  4I50 A;  2GTS A;  4QJF B;  4IT5 A;  3BEH A;  3B8M A;  3AK2 A;  5CN0 A;  1M56 C;  3BHP A;  2Q8V A;  1JVM A;  1WB7 A;  1VQ7 V;  2W0F C;  5BR8 O;  4LBE C;  3ABU A;  1UFI A;  4GKJ O;  1N0J A;  3EVK A;  1HWY A;  1WN7 A;  1TVK B;  2KSD A;  2XAH A;  4ICG A;  1BMF G;  4DUZ O;  1P7B A;  3ZN1 A;  3I55 V;  2Y69 C;  4Q6G A;  1W2B U;  4YXW G;  2QA4 V;  4Z1V A;  3CRC A;  4GKK B;  3AK1 A;  5DEC A;  3B77 A;  1PM9 A;  3MHH C;  4IYH A;  3APQ A;  1IUR A;  3O9O A;  1Q6I A;  2Z3Y A;  3J7A U;  1K4D C;  4ZBM A;  2B5U A;  3B40 A;  5D5Q A;  2P6J A;  5B1N A;  2ZIO A;  2ZIN A;  1DK1 A;  4NR1 A;  5FPR A;  4BW9 A;  1AI5 A;  4LF5 O;  4TWK A;  2CGO A;  4DR2 B;  2WLN A;  2N74 A;  4FLX A;  2BTO A;  4H37 A;  5TIS Z;  5F2V O;  3MDS A;  5ITZ B;  4WF9 V;  4CS3 A;  2XAS A;  4PHZ A;  1GN3 A;  1YZB A;  3T1Y B;  3G6E V;  1IBK B;  5IT9 N;  2WLJ A;  4EB6 A;  4JI2 O;  1IBL O;  4ZIB A;  1FJG O;  3AK3 A;  3T1H O;  3L9D A;  1Q6H A;  4JYY A;  4KUM A;  1QR9 A;  2FL4 A;  5J2T A;  1JPX A;  3ABM C;  1J5E O;  1FXK A;  2IJJ A;  1K8A W;  4JI4 O;  1A32 A;  2IJH A;  3BAB A;  5LOV B;  1QCE A;  4WFB V;  1VEW A;  3RYI B;  3ZMS A;  3BFR A;  3TGU H;  4H0L B;  4NYK A;  4UB8 Z;  2YS8 A;  1AP5 A;  2EIK C;  5EBL C;  3H1L H;  2VRZ A;  1R6T A;  1SF9 A;  1XQ8 A;  1JMK C;  1NJI W;  1S77 D;  3BA8 A;  2A0L A;  1SES A;  4L8J A;  1KBH A;  2PY5 A;  1Y76 A;  2JDI G;  4DUY O;  4DR7 O;  3L74 H;  2ODM A;  4GZR B;  4RUF A;  4QPJ A;  4LFC B;  1N34 B;  2KQX A;  3CCS V;  3IC7 A;  3GB7 C;  2DQ3 A;  1NVP B;  2GDS A;  3DC6 A;  1RSO A;  1HNZ B;  1XHX A;  4J41 A;  4EEQ A;  3OUF A;  2CGN A;  2RJZ A;  2UUA O;  1X59 A;  4KXR A;  5JCO C;  4KFM A;  2OCC C;  4YY3 O;  1JQ0 A;  2DOS A;  1NZ6 A;  3UM7 A;  1Y6X A;  2E5L B;  3SJQ C;  2JIZ G;  1V55 B;  2KB1 A;  3L73 H;  1W0K G;  2H3O A;  1AVM A;  3F7V C;  4JZG A;  4C7U A;  3SR2 C;  5EZY A;  2BOB C;  1YVW A;  4JYA B;  5EC1 C;  3OR6 C;  5GW7 A;  1RPR A;  1N36 O;  1VIB A;  3CCE V;  1SA0 A;  4TUY B;  4TQD A;  1ZSP A;  4LF9 O;  3FYE B;  4LNU A;  4CC5 A;  1THZ A;  3K59 A;  3AG3 B;  3RYH B;  2R72 A;  5LMU B;  1MMM A;  3IAY A;  5LP6 C;  3ETD A;  1XUQ A;  1SQP H;  1WB8 A;  1SER A;  4NTX A;  2GBO A;  4I4T B;  4ZI7 A;  4UB6 Z;  4U3J A;  4JI3 B;  2JS5 A;  4Z2W A;  1BQ0 A;  2F95 B;  4BW5 A;  3AG2 C;  3FB8 C;  3DXR B;  4X20 A;  4B3M O;  3WB0 A;  4QE7 A;  1K33 A;  3EFF K;  3ICX A;  2X6C A;  1FFX B;  2XHB A;  2HP8 A;  3JAK A;  2IU3 A;  1N33 O;  3T2M A;  4FLV A;  1NBM G;  4KP4 A;  1Q8I A;  5KHJ A;  4O4J B;  5IJ0 A;  4LF7 B;  4G27 B;  2ZM6 O;  3CXH F;  4O2A A;  4NXN B;  1AJP A;  4ZOL B;  4AHC A;  3ABK B;  3AG4 C;  3HKC B;  4TV9 A;  1VF7 A;  2DW4 A;  4DV2 B;  1GK9 A;  3VQW A;  1IBM O;  1KKD A;  1JCH A;  1S5L Z;  2AXT Z;  4MW3 A;  2JEX A;  2GUZ A;  4DR1 B;  4JI7 O;  3ETG A;  3JD4 A;  1W0J G;  3VOU A;  4GLX A;  3ZHQ A;  1YSC A;  4PA4 A;  1HNW B;  1K5Q A;  4PDV A;  5HFM A;  3CRM A;  4DV5 B;  3FB7 C;  2P67 A;  1F4N A;  4TQF A;  3OTO B;  1XOU A;  5EBW C;  1KC8 W;  4ZI7 B;  3CWB H;  4KHP O;  1O9G A;  2ZD9 A;  3TK1 A;  3RVY A;  3K9A A;  3OW2 U;  2JGU A;  1V9P A;  3RYC B;  1NVP D;  1M1K W;  3A0H Z;  1H2N A;  4DR3 B;  4JI1 O;  1X4T A;  1Q81 W;  1Q7Y W;  5CMU A;  4X1K A;  1YIT V;  2Y48 A;  2Y4T A;  3ZHU A;  1YJN V;  2YDE A;  2ZXW C;  1NT2 B;  4FMT A;  2PZS A;  4LF8 O;  1F23 A;  4JI0 O;  2DYR C;  1N32 O;  3SYA A;  1TUB A;  5EYP B;  2WWW A;  4UV9 A;  3E89 A;  1GM7 A;  4U7O A;  3R66 A;  5CB4 B;  2M7W A;  3DGE A;  4W4L A;  3K5L A;  2Q7E A;  1L0L H;  1K5S A;  3KKY A;  4J7Z A;  2F1M A;  3G71 V;  4JV5 O;  1AJN A;  3KCY A;  4WFE A;  4LCU C;  5LMN B;  4JF3 A;  5FNV A;  1RM1 C;  4HZ3 A;  1FKA O;  4R8C A;  2L6L A;  2Y69 B;  3QNE A;  3EHB B;  4MTO A;  2DWD C;  2KG7 A;  4AQY O;  1I5X A;  1YF2 A;  3JAW A;  3LNM B;  1OCO C;  2VWJ A;  4ZHQ A;  2EZP A;  4MVZ A;  1B06 A;  3WG7 C;  1S72 V;  1HNX O;  1H2G A;  1IZ3 A;  3LSS A;  4YIO A;  4MVO A;  3CMA V;  5LA6 A;  4CS2 A;  2P06 A;  1ZUQ A;  4B7K A;  1VQ6 V;  2XTA A;  1T5E A;  2OTL V;  5K1P A;  1K73 W;  2UXN A;  5KHK A;  2QKS A;  2D2C B;  1OCC C;  2JJ2 G;  5CBG A;  5CA0 A;  4DV0 O;  2QE7 G;  4B3R O;  3ZRW A;  3HKD B;  3B4S A;  4J80 A;  2NLJ C;  1ORQ C;  2HG5 C;  1AR1 B;  5H6Q A;  1IBK O;  3E22 B;  2CUG A;  2F66 C;  3SJA C;  3NR7 A;  3D8C A;  3ASO B;  4JI8 B;  3OGI B;  4H13 B;  4OGQ B;  2FB5 A;  5BY1 A;  2HJF C;  1KP3 A;  1VAR A;  2V4D A;  5IY5 C;  3JAM N;  2WLK A;  3RYF A;  2EIK B;  4X1I B;  1VQP V;  1PV0 A;  4DK1 A;  4DV6 B;  1U97 A;  4A5U B;  1VQN V;  5KUK A;  4GT1 A;  2JEU A;  2JVD A;  4PA7 A;  3OT7 A;  1BS3 A;  4F6R A;  4UCR A;  1YIJ V;  2A06 H;  2OTJ V;  4BWA A;  2BSK A;  2CE4 A;  4PDM A;  2NNU A;  2GSM B;  3L71 H;  3SPH A;  3K5N A;  1CPY A;  2VQF B;  5KAI Z;  4J42 A;  4JI5 B;  2VQE O;  3RT3 C;  3H01 A;  1R1B A;  4X62 B;  3LDD A;  1AP6 A;  2CAZ C;  4EFB A;  2EJR A;  4LF4 O;  3U0Z A;  4FLZ A;  1SQX H;  3WFV A;  2Z0A A;  3CHX A;  1N4C A;  2X6A A;  1L0N H;  1GTO A;  1M93 A;  4DR4 O;  4PI2 A;  2QGN A;  2OCC B;  1JA8 A;  3UO2 A;  5LXT A;  3CXC U;  5L3D A;  4IL6 Z;  4P2Z A;  3TXS A;  2R9I A;  4JAS A;  5FLX N;  2ZDI C;  1SQQ H;  4FJC C;  4GYC B;  4DV4 B;  3H9V A;  1VF6 C;  1YI2 V;  3X2Q C;  4X65 O;  4OX9 O;  1SQG A;  3HKB A;  5IYZ B;  3K0D A;  4D7T A;  3QO5 A;  2EUL A;  4UVA A;  1RPO A;  2Q7H A;  3K03 A;  2QKC A;  5D5P A;  3VBB A;  2Q0O C;  1BZK A;  1XL4 A;  3G67 A;  1LUW A;  1XNQ B;  4OPH A;  1F4M A;  2NN4 A;  3C3T A;  4Q20 A;  2EZO A;  1KP2 A;  1JFF B;  4JYA O;  2YIC A;  4FFK A;  5B1A C;  5LP6 B;  4D6T H;  4YHH B;  1XDC A;  4XDK A;  2R9A A;  2AZ0 A;  1VQK V;  3BA9 A;  1H2L A;  1ZWI C;  1PNM A;  2MW2 B;  3ML0 A;  2P4V A;  2LFR A;  2XUM A;  3K5M A;  4X66 O;  2QWR B;  4J9Z B;  3JD2 A;  3M99 B;  4DV3 O;  1IVS A;  2E74 B;  2IW5 A;  2G38 A;  3BY6 A;  3AG2 B;  1I94 B;  2DYS C;  5DM6 V;  5ITZ A;  4FLU A;  2UUC B;  1FXH A;  5EK0 A;  2QM7 A;  5JQG B;  1GM8 A;  2NR5 A;  1XI1 A;  2UXC O;  3S3X A;  1OV9 A;  3SYP A;  3HKB B;  1M9N A;  1BSM A;  3ABL B;  1KD1 W;  1XNR B;  1SQV H;  2LJ2 A;  4JAV A;  2ZE7 A;  4JTC B;  3AG4 B;  3FX7 A;  4JTD B;  5LOV A;  3RYI A;  4FVM A;  4X64 O;  1DF5 A;  2ITC C;  3F5W C; 
#chains in the Genus database with same CATH homology
 4O4L A;  2IM9 A;  2QM4 A;  3JAK B;  1JFF A;  3DSQ A;  1N33 B;  1XMO B;  4I55 A;  3FFQ A;  5IJ0 B;  4TOI A;  5LP6 A;  4FM1 A;  3THO A;  2P22 C;  2QJ1 A;  3SR2 C;  1SQF A;  4O2A B;  5JJJ B;  2ZM6 B;  4CH5 A;  5EZY A;  2GV9 A;  4TV9 B;  2F4V B;  3JSL A;  4JYA B;  1Z5V A;  3JSN A;  4K8Z A;  1SA0 A;  4TUY B;  4TQD A;  1TAE A;  4TV8 A;  1IBM B;  4LNU A;  4CC5 A;  3UT5 B;  4CS4 A;  4DV1 B;  3K59 A;  1KMI Z;  3JAR B;  4FLT A;  3RYH B;  2R72 A;  5LMU B;  3IAY A;  5LP6 C;  4JI7 B;  5JQG A;  3U11 A;  5LYJ A;  3JAS A;  4DR6 B;  4X1Y B;  3HKE B;  4I4T B;  4O4H A;  2PUS A;  4O2B B;  4ZI7 A;  2P5O A;  2UXD B;  4U3J A;  4JI3 B;  5JVD A;  5KX5 B;  3N2G B;  2JS5 A;  2F95 B;  3ZED A;  1Z5W A;  4X20 A;  3WB0 A;  3UQ8 A;  3K5O A;  4DR5 B;  3ICX A;  4FLY A;  1FFX B;  4KHP B;  2XHB A;  3JAK A;  4FLV A;  5KHJ A;  1Q8I A;  4O4J B;  5IJ0 A;  4LF7 B;  2UU9 B;  1D5A A;  4O2A A;  3K58 A;  4NXN B;  5KHG A;  5EIB D;  4ZOL B;  2ZNJ A;  4AHC A;  4TV9 A;  4NXM B;  3HKC B;  4I55 B;  1VF7 A;  4DV2 B;  4JI1 B;  1I7F A;  4X1K B;  3VQW A;  4YJ2 B;  1P49 A;  4TUY A;  1DGS A;  3UT5 A;  2F93 B;  3JAR A;  4K0K B;  4DR1 B;  3RYH A;  4TV8 B;  4LF8 B;  4GLX A;  4JI0 B;  4X1Y A;  1HNW B;  3HKE A;  1N32 B;  5IWA B;  4I4T A;  1TUB B;  4JI6 B;  2E3C A;  5KHH A;  4O2B A;  3RGB A;  3N2K A;  3N2G A;  5KX5 A;  4D7S A;  5K1X A;  4DV5 B;  2UXB B;  4TQF A;  3OTO B;  4ZI7 B;  1O9G A;  1FFX A;  3CB2 A;  2HHH B;  4LF6 B;  3BRC A;  2KKW A;  4WBN A;  4O4I A;  1TGO A;  3SGI A;  4JV5 B;  4O4J A;  2JGU A;  1V9P A;  3RYC B;  5FNV B;  3SJB C;  2ZNI A;  4DR3 B;  4ZOL A;  2UUB B;  2HEP A;  4AIL C;  4LFA B;  3HKC A;  1X4T A;  3VQY A;  2PTM A;  3QG5 A;  4X1K A;  4YJ2 A;  3BAA A;  4CH4 A;  1G6U A;  1S5J A;  4DRX B;  4B3T B;  3JAW B;  4AQY B;  4ZHQ B;  1NT2 B;  2PZS A;  2ZCE A;  4IHJ B;  1HNX B;  5JJN B;  1QHT A;  1TUB A;  3B2E E;  5LA6 B;  5EYP B;  1YEW A;  5CA1 B;  1ZAU A;  2BTQ A;  4IIJ B;  2YIA A;  2PGG A;  1M5I A;  4UCT A;  3VQX A;  5CB4 B;  4LH7 A;  3WB1 A;  4FLW A;  4K8X A;  3RFR A;  3K5L A;  3N2K B;  1HW7 A;  5JJE B;  5CA0 B;  2Q7E A;  4FM0 A;  4DV0 B;  2F1M A;  4DV7 B;  4B3R B;  4YJ3 B;  2VWK A;  4LFB B;  3RYC A;  1L8D A;  5LMN B;  3K57 A;  5FNV A;  3ETQ A;  1KU9 A;  4WBN B;  4O4I B;  1HR0 B;  4I50 B;  4B3S B;  3QF7 A;  3RYF B;  2PYJ A;  1XHZ A;  4DRX A;  1JJO A;  5JH7 B;  1TVK A;  3JAW A;  2VWJ A;  4ZHQ A;  5BR8 B;  3BPZ A;  4IHJ A;  4F6R B;  4GKJ B;  2YIB A;  5LA6 A;  4CS2 A;  5EYP A;  1H2S B;  5CA1 A;  1WNS A;  4IIJ A;  4DUZ B;  1T5E A;  3MAQ A;  1Q5O A;  4B08 A;  5K1P A;  5CB4 A;  5KHK A;  3OTF A;  2VQE B;  2BTQ B;  5CA0 A;  4HNA A;  2OWO A;  4LF4 B;  3HKD B;  1M4U A;  4YJ3 A;  4KL1 A;  3RWR D;  4UCS A;  4DR4 B;  2Q7G A;  2YI8 A;  4FFB B;  4HBN A;  5J2U B;  3VQV A;  5BMV B;  3E22 B;  2F66 C;  4LF5 B;  3SJA C;  2RQ6 A;  3PN1 A;  5LXT B;  5KMG A;  4JI8 B;  4CH3 A;  3CSX A;  4I50 A;  2V4D A;  1B04 A;  1WPB A;  3RYF A;  5JH7 A;  4X1I B;  3BHP A;  4LR3 A;  4PI0 A;  3JAL B;  4UCV A;  4DK1 A;  4EB6 B;  4DV6 B;  4X65 B;  4OX9 B;  4JI2 B;  5GON B;  1IBL B;  1FJG B;  2JVD A;  4F6R A;  1Q3E A;  5EIB C;  1WN7 A;  1O9H A;  1TVK B;  3JAT B;  4UCR A;  5J2T B;  4BWA A;  4CH6 A;  1J5E B;  4Q6G A;  4DK0 A;  4JI4 B;  2Q0A A;  3K5N A;  2VQF B;  4JI5 B;  4X62 B;  4GKK B;  2CAZ C;  4EFB A;  2ZIM A;  4FM2 A;  3U0Z A;  4FLZ A;  3HKD A;  3QTC A;  5KHI A;  3CHX A;  5D5Q A;  2PYL A;  5FPO A;  1M93 A;  4NVP A;  4PI2 A;  2ZIO A;  2ZIN A;  4HNA B;  4FFB A;  5FPR A;  5J2U A;  4BW9 A;  4DUY B;  5BMV A;  3E22 A;  4DR7 B;  3LNN A;  4DR2 B;  5LXT A;  4X66 B;  4UCU A;  4FLX A;  4DV3 B;  2BTO A;  1SKV A;  5ITZ B;  5C8Y B;  3U10 A;  4CS3 A;  2YIB D;  5IJ9 B;  4PHZ A;  3T1Y B;  1IBK B;  4GYC B;  4DV4 B;  4X1I A;  4EB6 A;  3JAL A;  3M7M X;  1SQG A;  3HKB A;  5KMG B;  4UCO A;  5GON A;  5IYZ B;  4ZIB A;  4D7T A;  3ZS8 C;  2UUA B;  4EFE A;  2UXC B;  5J2T A;  3JAT A;  3SJC C;  2Q7H A;  4YY3 B;  5D5P A;  3BAB A;  5LOV B;  4CC6 A;  3RYI B;  2YI9 A;  4X64 B;  1XNQ B;  4O4L B;  1JFF B;  1XQ8 A;  4LH6 A;  1JMK C;  3BA8 A;  2EX3 A;  5LP6 B;  4YHH B;  4L8J A;  2R9A A;  2PY5 A;  2YXL A;  3A2F A;  3BA9 A;  5EZY B;  5JCO A;  3K5M A;  4LFC B;  1N34 B;  1Q43 A;  1SA0 B;  1N36 B;  1I94 B;  4LNU B;  5ITZ A;  5C8Y A;  4LF9 B;  1RSO A;  5IJ9 A;  4FLU A;  2UUC B;  1HNZ B;  1XHX A;  1XMQ B;  4EEQ A;  5JQG B;  3WB2 A;  3JAS B;  5LYJ B;  5IYZ A;  2RJZ A;  1XI1 A;  4I9Q A;  4UFZ A;  5JCO C;  4O4H B;  2R70 A;  1QQC A;  4U3J B;  5JVD B;  3HKB B;  1TA8 A;  1XNR B;  5LOV A;  3RYI A;  4FVM A;  3T1H B;  4X20 B;  2OYQ A;  2E5L B;  4B3M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...