1VF6C

2.1 angstrom crystal structure of the pals-1-l27n and patj l27 heterodimer complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
51
structure length
51
Chain Sequence
QDPDVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/protein transport
molecule keywords PALS1-associated tight junction protein
publication title Structural basis for L27 domain-mediated assembly of signaling and cell polarity complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 51
sequence length 51
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09060 L27_N L27_N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1vf6C00
1Y76B 1Y74B 1ZL8B 3B40A 1ZL8A 1Y76A 1RSOB 1Y74A 1VF6C 1VF6A
chains in the Genus database with same CATH superfamily
5IYBO 4K3AA 2JK5C 2NLJC 2AHYA 1EZVH 3ETQA 4OXSA 3OMIB 5H2FZ 4ZKIA 3HKDB 3O9OA 3LNMB 2YI8A 1VQMV 2ARHA 4CH6A 5LA6B 3CC4V 4TWKA 2ZDIC 3W7TA 3RW0A 3SR2C 4J9ZB 1SZXA 2EIMC 3F7YC 1OJHA 3K06A 2ZDIA 1YITV 4FFBB 2OCCC 4C7UA 4PDMA 3B09A 2GTAA 4L87A 3JALB 4NTXA 3E22A 2QA4V 2ZM6B 1B04A 1VQOV 2Z3YA 4GYCB 4OX9O 2XUMA 1WP7A 3RYIB 1V55C 1E1QG 3CRAA 2JS5A 4F4LA 4FVMA 5KLVH 3OTFA 3MD0A 5IYZB 2EX3A 2WA4A 3WG7C 5L3GA 2RCVA 4GKJB 3RYFB 3G71V 5J9PC 4YJ3B 1S76D 2IJJA 3H1JH 1VQ7V 3BHPA 1DF4A 4J9YB 4B3TO 3AG2C 1K92A 3K0GA 2LW7A 3W7XA 1D5AA 3IFXA 3OUFA 3H1LH 4PDRA 4K35A 3NXSA 2N04A 1W59A 5LHIA 1TUEB 2YDEA 1N34O 1NR7A 2ADQB 4LF6B 1NH2D 3B40A 4X9QA 4IGGA 1AJQA 3B77A 1R6NA 1OCRC 1DF5A 3M7MX 1IZ3A 3VQYA 4CZZA 5D5QA 4X8AA 4JI4B 2D2CB 2EIMB 1VF5B 2GDSA 2YXHA 2JRIA 2RNBA 3K9SA 3E22B 2OCCB 2EIKB 3DTUB 3F5TA 1BZKA 2LP7A 2P67A 4X1KA 4YY3O 4DR2O 5JWPA 3ZN0A 1GM7A 3APOA 2JJ1G 3AG3C 4FLTA 2ZE5A 2QGNA 5FL7G 1R3IC 1V55B 4NB5A 1O9GA 3ZMUA 2P22C 1EZJA 4H33A 3C3SA 2PY5A 4X1IA 2QTOA 1WPXA 1X59A 4LF9B 4LH7A 2JIZG 2GSMB 5A9GA 3P30A 1SQGA 4ICGA 3DGEA 1AR5A 3JATA 3L71H 3L9DA 3X2QC 4D7SA 3UQ8A 1Q6UA 3AG2B 4JV5B 4IIJA 3ASOC 2RN9A 4YHHO 1P84F 5JJJB 4O4LB 5CBFA 2BTQB 1NTMH 3H9VA 4DV4B 2YXYA 1Y4MA 5LBQA 2VQFO 4KHPB 4EFEA 4DV0B 3WB0A 3OGCC 2OTJV 1AILA 2H3OA 2ZR2A 1QR8A 3B4SA 1QU7A 5FLXN 3G4SV 5H9CA 5LMNB 1LUVA 2YICA 4J42A 3CRQA 2RDCA 4RQFA 4JTDB 5CMUA 2WLLA 4I4TA 5CA1A 4X1KB 1Z5VA 2Z0AA 3JAKA 4MVUA 4CH4A 4XBFA 2DE0X 1MNGA 4X62O 1NBMG 3H1KH 1NTKH 5IJ0B 3AG3B 3FYEB 2WLHA 2WPDG 4X65O 2JEXA 4X89A 2GBOA 3LSQA 4BIZA 4FLVA 4PI2A 4D6TH 5JH7A 4X1IB 5LXTA 5BR8O 2NNUA 3B8NA 3D8CA 3K03A 1PNMA 1J5EB 1B3QA 3OGIB 4JPRA 5HFLA 3RFRA 5LGNA 1YJ9V 2DYRC 1FYJA 2QWNB 2QM7A 3JATB 2WSSG 3KKYA 1N33O 4AQYO 1MZFA 2HJDA 2PYJA 2R9AA 5BMVA 3UM7A 2DMXA 1AP6A 3X2QB 1XREA 1B06A 1XUQA 4DR4O 3ASOB 1JFFA 4PA3A 1OCOC 3L72H 1NJIW 3E8HA 4DXWA 2WLNA 1Y76A 1NT2B 2HFEC 4QGPA 5DEDA 1KKCA 2LGWA 3BAAA 2WLJA 1MG1A 4U7OA 3SPCA 2WLLB 4OX9B 3FD9A 4I4TB 3KZIZ 4EEQA 2AGAA 4JI5O 4N21A 3JAKB 1H2GA 1IX9A 2PZSA 2ZXWB 4JF3A 1S0VA 1QHTA 3K5MA 3RVYA 1VF7A 2Y4UA 4GZRB 3QVNA 1AI7A 3M99B 1K4CC 3MDSA 4CS2A 1SS3A 5IYCO 4B08A 5JH7B 1SQFA 5LXTB 1YVWA 5LGTA 1FXHA 1Y66A 4B3TB 3NR7A 1QLEC 2Q7EA 1CXZB 3GWOA 3CXHF 1HNWO 1N0JA 3JARA 4H0LB 2XOKG 2XAHA 2RJZA 1YI2V 2H8PC 4UVCA 2DYRB 1N34B 1QVGU 1CP9A 1URFA 4FFKA 5FNVA 4B7KA 2LQTA 4K0KO 1JFFB 3HB3B 2PUSA 2CE4A 1Y76B 4JYBA 4X64O 4JYCA 4NR1A 1Q81W 4JAAA 1RM1B 1TA8A 1M57C 3S3XA 2KB1A 3SYOA 5KA6A 4YY3B 4DR2B 2X6CA 1Q6IA 4F6RA 2CTRA 3RN4A 4OGQB 4DR7O 1EN4A 3P32A 1VQNV 3E8GA 1GN2A 3RBZA 1GKFA 3SYAA 4MVZA 1LNQA 1FJGO 1WN7A 3IJ4A 2F23A 2B5UA 3ZEDA 1RPOA 2X6BA 1PNLA 3D36C 3Q4HA 4BWAA 4UB8Z 2CGNA 3JARB 1QLEB 1YHQV 2EILC 1BHBA 2QWQB 4QPKA 3WFVA 1PKXA 4YHHB 3K59A 1ROPA 5KUKA 3SJQC 3WB1A 3SYPA 3CC7V 2Q0AA 2WWWA 2VQFB 5FNVB 3VQWA 2AXTZ 2NN4A 4WFGA 1GH6A 2JDIG 4LC1A 2HLDG 4DW0A 3TJTA 3SJAC 5GW7A 3ABLC 1TVKA 1WAZA 5B66Z 3G80A 1YTFD 3IAYA 1XNRO 3RVZA 1KB9F 3J80N 3MAQA 2K9PA 4QE7A 1M57B 2GV9A 5LHGA 3P3NA 4X62B 1KQSU 2YUAA 1Y6XA 1BT8A 4JZGA 4BIOA 2A7WA 4PI0A 1O9HA 2F66C 2CUGA 3QF7A 3STZC 4X65B 4GLXA 4LF5O 2YXLA 4DR6O 1THZA 4LF8O 1XHZA 4X88A 3T1CA 3CMAV 4D7TA 1I08A 2CK3G 5BR8B 3ZHSA 1JOYA 2DN9A 2E5LO 4MW8A 3CP1A 4BW5A 1K34A 3A0HZ 4OPHA 4AQYB 1VEWA 4JI0O 1P7GA 4O4HA 2DYSC 1XHXA 4KP4A 1IURA 1G6UA 3CB2A 1HNZO 4DR4B 2HR3A 2VWKA 2A9HA 3CX5F 1KUQA 2XAJA 3K04A 2UXBO 5L3CA 1GRJA 2QEXV 4JI3O 2NR5A 3ZX6A 3CD6V 3HKCA 3VQVA 2B1GA 2VQEO 2ZNIA 1TVKB 2LJ2A 4J41A 4JI5B 1AJPA 1SESA 2CTPA 3ZMZA 3CRRA 4PD4F 1F4MA 3U10A 1FFTB 1FS0G 2XAQA 3C90A 4P9OA 5LGUA 3CMEV 3OD4A 4DV5O 1RSOA 2IJKA 1GN6A 4O4JA 1VIBA 3FB6C 4CBCA 2ZR3A 1F23A 3B2EE 1P49A 5E1AC 2VWJA 1XMQO 3EFFK 5IDJA 3FB5C 5ITZA 2HP8A 1QBZA 2BCCH 5H6QA 1HNWB 1SERA 3T1HO 1MOFA 4O4HB 1AI5A 1OCCC 3EXAA 2P4VA 5J2TA 2HVKC 2QSAA 4K0KB 5B1NA 2DYSB 4JI1O 4MW3A 3IGAC 5CBGA 4X64B 4IHJA 4UCSA 2QJ1A 2EIJB 4RWUA 3HKCB 2CTQA 4GX1A 4MTOA 5D5PA 1KP3A 1XOUA 3QG5A 2HEPA 4WF9V 3CE2A 2P4KA 1R3JC 4DR7B 4FM0A 1GO3F 2EIKC 2WLMA 1SRYA 2BE3A 2IU3A 2P6JA 3UO3A 1FJGB 1P4RA 1S77D 1QNMA 3HKBA 1RSOB 4O4JB 4TV8A 4WFBV 1VQPV 1BGYH 1M93A 3GB7C 1VF6C 4HBNA 1D5NA 2WLKA 5ITZB 3ETEA 1PM9A 5LL6Y 4DR5O 1VF6A 3N2GA 1WNSA 1YF2A 1ZL8A 1UJWB 4X20B 3AG1B 5E79Z 4YIOA 4ZHQA 1BE3H 2DJVA 1AJNA 1CEZA 1R3LC 2Y4TA 5J2TB 4JI6O 4G28B 5FPRA 1Q43A 4LBEC 3R65A 1Q86W 1YTFB 3D3QA 3JASA 4DUYO 1AI4A 4I0XA 1OCCB 2ITDC 2F4VO 3JCUZ 5JQGA 1UFIA 4HNAA 2WA3A 3ZHTA 4X1YA 5LOVA 4IHJB 2QWRB 4I9QA 2IH3C 2Q73A 2AHZA 1D2DA 4R6ZA 4ZIBA 1XNRB 4G27B 3ETGA 1RFYA 2GTSA 3H01A 3F7VC 1EM1A 4GKKO 4FLZA 3G6EV 3ASNC 2B9ZA 1WA8A 4LF5B 4DR6B 2XAFA 4LF8B 2X7RB 2ZINA 1FXVA 4LFBO 5KHGA 5KMGA 1PV0A 3CCEV 1ENVA 2GHYA 2N05A 3HKBB 4TV8B 3FB7C 2P5OA 2E5LB 4EFBA 3K9AA 2Q0OC 1COWG 1V54C 3VOUA 5CB4A 4YIPA 4JI0B 3N2GB 5EK0A 4CC5A 1IBLO 3TK1A 1HNZB 4ZHQB 3A2FA 3OUSA 1MABG 1I7FA 2UXBB 3ZRWA 3JASB 4PA7A 3E86A 4I0XB 3U11A 2Y48A 1BQ0A 4JI8O 5JQGB 4JI3B 2QR4A 4MTGA 4HNAB 1RPRA 3CWBH 4X1YB 5LOVB 3ZS8C 4H44B 3STLC 1KC8W 2F93B 4MS2A 2ZCEA 2VQEB 5IE9A 1BS3A 1BQZA 4JTCB 3SPGA 1L8DA 4TQDA 3H1IH 4K8ZA 1K9MW 1NVPD 1S5HC 2EZPA 3ZJZA 1WP8A 3ZHUA 2YSUB 4WFAV 1BSMA 3U0ZA 2R9IA 3IC9A 2FKXA 3E89A 3APQA 2KQXA 2E75B 2JGDA 1YSCA 1XBLA 1PP9H 3FYIB 4UV9A 5KMGB 3ASNB 3SGIA 3RWRD 4DV5B 3DC5A 1V9PA 2EULA 2ZXWC 5B1BB 1XMQB 3FB8C 3E8FA 5EBMC 4QPJA 3LNNA 5BXZA 4DYLA 3T1HB 1MSWD 1YXBA 4E4EA 1V54B 4LFCO 1IBMO 4JI1B 3DSQA 2F95B 2QTSA 1HR0O 3ZRWB 1NU1H 1R6TA 1Y74A 5C93A 1H8EG 3O65A 4PA9A 5C8YA 2YEVA 1QLNA 1F7YA 3SJBC 2UXDO 1Q3EA 1VQ4V 2QM4A 2YIBD 3N2KA 1K97A 4HAMA 5H5NA 4IIJB 3OW2U 5EIBD 3EVKA 4P9PA 3PN1A 3W7WA 3OE7G 2EBOA 2V1DA 2X0LA 1RM1C 2CDYA 4PA6A 2ETNA 5EC1C 4BR6A 1ZX3A 4LFAO 4KXRA 1SQQH 3JAWA 3CSXA 2CAZC 5EBWC 2YIAA 3JD2A 3OTOO 5J2UA 3ML0A 4Q20A 4FK5C 2GUZA 1YIJV 3E2EA 2B1IA 4P2ZA 1H8HG 4R7CA 5CA1B 2W0XA 3K5NA 1M5IA 4I50A 4B3MO 4LH6A 4DR5B 3D3IA 3AG4C 4UCVA 1Q7YW 2QWPB 2R72A 3OFNG 4NVPA 2EZOA 3JD3A 4FZ1A 4JI6B 1XILA 1VQ5V 5A2QN 4DUYB 5CA0A 2V7QG 1R3KC 1VQKV 2F4VB 2PI5A 3BY6A 1NH2B 4X66O 1Y74B 3OEHG 2Q8VA 5C8YB 4FLYA 2YEVB 4HZ3A 4TOIA 1HDJA 2W0FC 3QO8A 1VQ9V 4PELA 4XDLA 3TXQA 1RP3B 5BMVB 3AK3A 1AI6A 2AZ0A 4GKKB 3B8MA 4UCTA 4UCOA 1H2KA 1PPJH 1AVMA 3T4DA 4LFBB 3JD1A 1JVMA 3JAWB 3UKMA 2Y0PA 2FL4A 5J2UB 4RUEA 3LSUA 2VS0A 3BRCA 1N32O 2UUCO 4CS4A 1K8AW 2UUAO 4J7ZA 1GN4A 2Y69B 4Q6GA 1SQVH 1H2MA 3CJHA 3L75H 4IYIA 1XMOO 4DV7O 1IBLB 2BSKA 2E74B 2A3QA 1J95A 3AG4B 2YIBA 5KAIZ 2QKSA 5TISZ 2A79B 4DR3O 4HYOA 5CA0B 4IT5A 4J7JA 4JI8B 1NVPB 4A5UB 5JCOA 3G6BA 2K1EA 3OT7A 5IJ9A 3RT3C 3CCUV 3JYCA 4YXWG 1G4YB 5IYDO 4MSWC 1QR9A 2IM9A 2QM8A 3CPWU 2H94A 1NR1A 1P7BA 3BFRA 1U97A 3E35A 1ZAUA 5B1AC 2HKOA 4JZ2A 1YZBA 2MW2B 1TUBA 5K1XA 1NQTA 3MHHC 2FYUH 1JQ0A 3RYHA 2WAMA 5KHHA 4F6RB 2OT5A 5IY5B 2EINB 4UVBA 5LP6A 2XHBA 4O2BA 3VBBA 5KUMA 1HW7A 1NS1A 2ZIOA 2O57A 3CJHB 4LFCB 1R73A 4LF7O 1GM9A 2ZE8A 2BSKB 5JVDA 1IBMB 3OEEG 1VQLV 1IXMA 1JX9A 1DK1A 3CEIA 2L6LA 1HR0B 4GUNA 4DR1O 4NYKA 2FB5A 4PA4A 4DW1A 3AG7A 3Q4HB 5AG2A 4DK1A 2UXDB 4TV9A 3RYCA 2IJHA 1VMGA 1N33B 1NZ6A 3ZN1A 5IJ9B 1ZWIC 3S3WA 5JJEB 2ZE7A 2Z5UA 4GX2A 3THOA 3OM3B 2V4DA 3HKEA 5K1PA 1OHHG 1KECA 2IH1C 1GK9A 1L0LH 2ZIMA 2EIJC 1Q5OA 3CXCU 2OWOA 4TT3G 1R6KA 4LFAB 4FIPC 3SPIA 4L8JA 3CCQV 1W0KG 2ZNJA 3TCUA 1XI1A 1KMIZ 3OTOB 2XNDG 3T1YO 1MZEA 5EC2C 4DK0A 1H2NA 1TUBB 3AEIA 2OIGA 4JYAO 3JSNA 5B1AB 3CCSV 2Q7GA 3CHXA 4B3MB 2A06H 4LNUA 4KFMA 3EHBB 3OR6C 2EJRA 5LP6B 4O2BB 2ATKC 4PDVA 4QIWF 1FD9A 3GWKC 1H2LA 2E76B 4UB6Z 2XASA 1JMKC 4BAYA 1GTOA 1SQXH 4U3FH 5JVDB 4EB6A 2C2AA 4KUMA 4NKGB 3AK2A 3ZRVA 3R66A 3C3TA 3CS5A 1JR9A 1SKVA 4GT1A 4X66B 3K0DA 2IBZH 3JALA 3AG1C 3SYCA 5LYJA 3TETA 5IWAO 3W7UA 3RYCB 3T2MA 4DV3O 1K73W 3SDLA 2A0LA 4FJCC 1Y67A 1K33A 4IYHA 2PTMA 3HKEB 3CCRV 3FX7A 4BW9A 2YI9A 3J81N 2D3OW 2UU9O 4ZI7A 5KHJA 5H6RA 1Q6HA 4PJ0Z 1S72V 3SYQA 1XL6A 4PV1B 2QKAA 1N32B 4DV1O 2UUCB 1AP5A 3MHSC 4FPPA 3T4ZA 1BHAA 1IVSA 2XTAA 1WJZA 1YCIA 2UUAB 2CTWA 1AB3A 3I5DA 5LMUO 4LNUB 4JASA 3WU2Z 1XMOB 4DV7B 4LWSA 1FXKC 4OPAA 2YS8A 1FKAO 2ZT9B 3ZRSA 4EB6B 1FXKA 4ZBMA 3ZMSA 4DR3B 1UPGA 4EKWA 2UXCO 3A0RA 1M56B 3ABUA 1KKDA 1I94O 2UUBO 4DV2O 3L73H 4CC6A 1YDXA 5L3EA 1WB8A 5LYJB 3CCJV 3SJCC 2ILMA 1SZTA 2KSDA 1F4NA 3ZHQA 5LHHA 1YJWV 4O2AA 3ZHVA 1LR1A 3QO5A 3SPHA 2E3CA 2QWOB 1E1RG 2F1MA 3BA9A 4AI8A 4ZI7B 4UVAA 1HP8A 1VP7A 3OMNB 3CC2V 2R70A 3ZBHA 1IXBA 2Q5ZA 3AK1A 1JPXA 1KP2A 1K5SA 1FFXA 2LO1A 4XDKA 1HWYA 2XT9A 5L3BA 5L3DA 3CCLV 1JJOA 2BTOA 2IU0A 2OIEA 5CBHA 2P7TC 3OAAG 4FLWA 1PL4A 4WFHA 3CCVV 4LF7B 4LWSB 3ZRXA 1ORQC 5B1BC 2Q68A 4JI7O 2ZD9A 2DQ0A 1U96A 4O4LA 1FXKB 2BTQA 1LUWA 3FKSG 5CA3A 1NKDA 4DR1B 1OCZC 4WCEV 2HVJC 3BA8A 4NTWA 1SQPH 3UT5A 1QQCA 4NTYA 5JJNB 4TSFG 1TGOA 1ZL8B 4I55A 2LGQA 3ABKC 4MVRA 4U3JA 4O2AB 1F51A 4B3SO 3W7SA 1K7DA 4I7ZB 5IJ0A 2M7WA 2OCHA 3ABTA 2MK3A 1AROP 4MT8A 2FTKA 2Q9LA 3T1YB 1JCHA 1YJNV 1EBOA 2JEUA 4JYAB 1DLBA 1VARA 3K58A 3LDDA 3WG7B 1FFXB 3ETDA 1DGSA 3JCZA 4RQEA 3K08A 3HR0A 2QKCA 4U7NA 3L74H 3QNEA 4RO2A 1WA8B 2KKWA 4ZOLA 3FAVA 4YJ2A 1ZSPA 2UXXA 3ABMC 1YEWA 3K3WA 5KA5A 5BY1A 1WPBA 4JI2O 2HJFC 1XL4A 3LSSA 1DTOA 3CCMV 1PNKA 1BCCH 4R50A 4JGSA 1MSDA 1Q82W 1GAXA 4J80A 3JSLA 3A8TA 3BPZA 5IWAB 2L35A 1OCRB 2R9RB 5F2VO 1OCZB 3CYOA 3UT5B 4DV3B 4LF4O 5CB4B 4CH5A 4WBNA 1G1XB 2F43G 4FLUA 1OV9A 1W0JG 4I55B 5KX5A 4G2KA 1N36O 1TAEA 3LDCA 4U3JB 4GX0A 2ZE6A 2PYLA 4H13B 2HHHO 3ABKB 2UU9B 2P06A 1PD3A 4MVSA 4E2LA 4DV1B 3JD0A 2IJIA 1SF9A 4PDLA 1SETA 1NI8A 4GCZA 1AR1B 5GONA 1PL0A 5LMUB 4LR3A 4MVOA 2UXNA 3K79A 4RUFA 5KAFZ 3H1HH 1M90W 4NXNO 1BL8A 2DWDC 2JVDA 3IC7A 3TXSA 1XNQO 1EFRG 2JGDB 2W6JG 4ZOLB 3FAVB 1L0NH 4YJ2B 1IBKO 2QE7G 4UFZA 2UXCB 1QVFU 2Y69C 2XAGA 3ABMB 1I94B 2UUBB 4DV2B 4TQFA 1VQ6V 5EBLC 5EYPA 4MVQA 3OR7C 3ICXA 4W4KA 1Z5WA 3BEHA 4K8XA 4WBNB 1US6A 2JJ2G 4LP8A 1B6QA 3M8AA 4DV6O 5KX5B 3ZMVA 1MMMA 4B3RO 3ZCCA 3PJSK 3G67A 3RGBA 3ZHRA 1CPYA 5DN6G 2KG7A 1N0NA 4NXMO 4DUZO 2WLIA 4Z2WA 1M9NA 3N2KB 4LCUC 2FMLA 3KCYA 3ZMTA 5GONB 4BIUA 1M4UA 3LDEA 4RAIA 2M6YA 1EN5A 4IL6Z 4JI7B 3P3PA 5KHIA 1HNXO 4UUJC 5IY5C 2GUZB 1SC5B 2EINC 1KYOF 3LUTB 2YIDA 2QDOA 3SPJA 4FLXA 3CRMA 4I50B 1OCOB 1WB7A 4I9WA 3JD4A 1ZTEA 5EYPB 1FAFA 1GMGA 1G8MA 1JJ2U 4GX5A 5EIBC 3GVMA 2RQ6A 4AHCA 1S5JA 1SA0A 4J11A 4QE9A 4B3SB 2P90A 4WFFA 5JCOC 3BVOA 2W6IG 2Q4PA 1I0HA 2KG7B 4UCUA 3A0BZ 4UXNA 4KL1A 4MVMA 3QO7A 2JGUA 2BOCC 1K4DC 4DO2A 4O4IA 2WLIB 4W4LA 2EJ7A 2ZM6O 1FPOA 3WB2A 1I5YA 1QCEA 4Z1VA 4UV8A 1R1BA 3K5OA 3UO2A 2VRZA 5B3SC 4TUYA 1XQ8A 2ZQMA 1GN3A 2AW9A 3D36A 4R8CA 1E79G 3J7AU 2DWEC 1Q90D 2YC0A 1N8RW 2CH7A 2HG5C 4GKJO 4JI2B 1JA8A 5LP6C 1W2BU 2PI4A 4MTXA 4J10A 4F6EA 4I5SA 1M1KW 4LF4B 4PHZA 3BABA 4DRXA 2LFRA 3KCXA 1S3JA 3K57A 2PF4E 4FMTA 1N36B 1S5LZ 5HFMA 5EZYA 1SA0B 4FM2A 4LF6O 2HHHB 2PGGA 3L70H 1BMFG 2Q67A 4MTFA 1A32A 2AZ2A 1H2SB 5DECA 2ZKOA 4JI4O 3KG2A 3JAMN 1ZLZA 4O4IB 1SQBH 4WFEA 2Y0IA 3E83A 1EN6A 4B7EA 1MA1A 1K5QA 1Z2GA 1H38A 4ABMA 2RMKB 2CGOA 5L3FA 5B1OA 1KD1W 5GTHZ 3CRCA 4QJFB 1OZ0A 4JTAB 2BOBC 3N27A 1K3EA 5BZBA 4NXNB 1NTZH 4TUYB 1KBHA 2Q6AA 1XNQB 3K5LA 3DXRA 1IBKB 2Q69A 3HPLC 5B3SB 4CH3A 2CH7B 2JS3A 4FZ0A 2EILB 5CN0A 4AILC 3BCCH 3RYHB 1I5XA 4FM1A 2DQ3A 4LF9O 2ODMA 3QTCA 1VQ8V 1IDSA 3DC6A 2ITCC 2G38A 2DOSA 3I56V 3HKDA 2LW1A 4DRXB 4H37A 4DV6B 4JV5O 5LA6A 4JAUA 2OTLV 1M56C 4P30A 5EZYB 5B5EZ 4B3RB 4N23A 2IW5A 3F5WC 5DM6V 1GM8A 5GTIZ 3ABLB 4DV4O 4KHPO 4FFBA 4Z1MG 4DV0O 4J7KA 1WLEA 4UCRA 3ZIAG 4NXMB 2OYQA 5LMNO 4TV9B 5KHKA 4DUZB 4ASUG 2LFSA 4JYYA 3RYIA 1L1FA 4QNHB 3UCSC 2ADPA 2Q7HA 1KU9A 3FFQA 2DW4A 2N74A 1ZUQA 1AR4A 5FPOA 5IYZA 4CS3A 3VQXA 4X20A 2X6AA 3DXRB 1HNXB 1XEQA 3I55V 3RYFA 3TGUH 1T5EA 1N4CA 1Q8IA 1XDCA 4YJ3A 4XDJA 3E8BA 3OMAB 4JAVA 1J5EO 5IT9N 1X4TA
chains in the Genus database with same CATH topology
1Y76B 1Y74B 1ZL8B 3B40A 1ZL8A 1Y76A 1RSOB 1Y74A 1VF6C 1VF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y76 B;  1Y74 B;  1ZL8 B;  3B40 A;  1ZL8 A;  1Y76 A;  1RSO B;  1Y74 A;  1VF6 C;  1VF6 A; 
#chains in the Genus database with same CATH topology
 5IYB O;  4K3A A;  2JK5 C;  2NLJ C;  2AHY A;  1EZV H;  3ETQ A;  4OXS A;  3OMI B;  5H2F Z;  4ZKI A;  3HKD B;  3O9O A;  3LNM B;  2YI8 A;  1VQM V;  2ARH A;  4CH6 A;  5LA6 B;  3CC4 V;  4TWK A;  2ZDI C;  3W7T A;  3RW0 A;  3SR2 C;  4J9Z B;  1SZX A;  2EIM C;  3F7Y C;  1OJH A;  3K06 A;  2ZDI A;  1YIT V;  4FFB B;  2OCC C;  4C7U A;  4PDM A;  3B09 A;  2GTA A;  4L87 A;  3JAL B;  4NTX A;  3E22 A;  2QA4 V;  2ZM6 B;  1B04 A;  1VQO V;  2Z3Y A;  4GYC B;  4OX9 O;  2XUM A;  1WP7 A;  3RYI B;  1V55 C;  1E1Q G;  3CRA A;  2JS5 A;  4F4L A;  4FVM A;  5KLV H;  3OTF A;  3MD0 A;  5IYZ B;  2EX3 A;  2WA4 A;  3WG7 C;  5L3G A;  2RCV A;  4GKJ B;  3RYF B;  3G71 V;  5J9P C;  4YJ3 B;  1S76 D;  2IJJ A;  3H1J H;  1VQ7 V;  3BHP A;  1DF4 A;  4J9Y B;  4B3T O;  3AG2 C;  1K92 A;  3K0G A;  2LW7 A;  3W7X A;  1D5A A;  3IFX A;  3OUF A;  3H1L H;  4PDR A;  4K35 A;  3NXS A;  2N04 A;  1W59 A;  5LHI A;  1TUE B;  2YDE A;  1N34 O;  1NR7 A;  2ADQ B;  4LF6 B;  1NH2 D;  3B40 A;  4X9Q A;  4IGG A;  1AJQ A;  3B77 A;  1R6N A;  1OCR C;  1DF5 A;  3M7M X;  1IZ3 A;  3VQY A;  4CZZ A;  5D5Q A;  4X8A A;  4JI4 B;  2D2C B;  2EIM B;  1VF5 B;  2GDS A;  2YXH A;  2JRI A;  2RNB A;  3K9S A;  3E22 B;  2OCC B;  2EIK B;  3DTU B;  3F5T A;  1BZK A;  2LP7 A;  2P67 A;  4X1K A;  4YY3 O;  4DR2 O;  5JWP A;  3ZN0 A;  1GM7 A;  3APO A;  2JJ1 G;  3AG3 C;  4FLT A;  2ZE5 A;  2QGN A;  5FL7 G;  1R3I C;  1V55 B;  4NB5 A;  1O9G A;  3ZMU A;  2P22 C;  1EZJ A;  4H33 A;  3C3S A;  2PY5 A;  4X1I A;  2QTO A;  1WPX A;  1X59 A;  4LF9 B;  4LH7 A;  2JIZ G;  2GSM B;  5A9G A;  3P30 A;  1SQG A;  4ICG A;  3DGE A;  1AR5 A;  3JAT A;  3L71 H;  3L9D A;  3X2Q C;  4D7S A;  3UQ8 A;  1Q6U A;  3AG2 B;  4JV5 B;  4IIJ A;  3ASO C;  2RN9 A;  4YHH O;  1P84 F;  5JJJ B;  4O4L B;  5CBF A;  2BTQ B;  1NTM H;  3H9V A;  4DV4 B;  2YXY A;  1Y4M A;  5LBQ A;  2VQF O;  4KHP B;  4EFE A;  4DV0 B;  3WB0 A;  3OGC C;  2OTJ V;  1AIL A;  2H3O A;  2ZR2 A;  1QR8 A;  3B4S A;  1QU7 A;  5FLX N;  3G4S V;  5H9C A;  5LMN B;  1LUV A;  2YIC A;  4J42 A;  3CRQ A;  2RDC A;  4RQF A;  4JTD B;  5CMU A;  2WLL A;  4I4T A;  5CA1 A;  4X1K B;  1Z5V A;  2Z0A A;  3JAK A;  4MVU A;  4CH4 A;  4XBF A;  2DE0 X;  1MNG A;  4X62 O;  1NBM G;  3H1K H;  1NTK H;  5IJ0 B;  3AG3 B;  3FYE B;  2WLH A;  2WPD G;  4X65 O;  2JEX A;  4X89 A;  2GBO A;  3LSQ A;  4BIZ A;  4FLV A;  4PI2 A;  4D6T H;  5JH7 A;  4X1I B;  5LXT A;  5BR8 O;  2NNU A;  3B8N A;  3D8C A;  3K03 A;  1PNM A;  1J5E B;  1B3Q A;  3OGI B;  4JPR A;  5HFL A;  3RFR A;  5LGN A;  1YJ9 V;  2DYR C;  1FYJ A;  2QWN B;  2QM7 A;  3JAT B;  2WSS G;  3KKY A;  1N33 O;  4AQY O;  1MZF A;  2HJD A;  2PYJ A;  2R9A A;  5BMV A;  3UM7 A;  2DMX A;  1AP6 A;  3X2Q B;  1XRE A;  1B06 A;  1XUQ A;  4DR4 O;  3ASO B;  1JFF A;  4PA3 A;  1OCO C;  3L72 H;  1NJI W;  3E8H A;  4DXW A;  2WLN A;  1Y76 A;  1NT2 B;  2HFE C;  4QGP A;  5DED A;  1KKC A;  2LGW A;  3BAA A;  2WLJ A;  1MG1 A;  4U7O A;  3SPC A;  2WLL B;  4OX9 B;  3FD9 A;  4I4T B;  3KZI Z;  4EEQ A;  2AGA A;  4JI5 O;  4N21 A;  3JAK B;  1H2G A;  1IX9 A;  2PZS A;  2ZXW B;  4JF3 A;  1S0V A;  1QHT A;  3K5M A;  3RVY A;  1VF7 A;  2Y4U A;  4GZR B;  3QVN A;  1AI7 A;  3M99 B;  1K4C C;  3MDS A;  4CS2 A;  1SS3 A;  5IYC O;  4B08 A;  5JH7 B;  1SQF A;  5LXT B;  1YVW A;  5LGT A;  1FXH A;  1Y66 A;  4B3T B;  3NR7 A;  1QLE C;  2Q7E A;  1CXZ B;  3GWO A;  3CXH F;  1HNW O;  1N0J A;  3JAR A;  4H0L B;  2XOK G;  2XAH A;  2RJZ A;  1YI2 V;  2H8P C;  4UVC A;  2DYR B;  1N34 B;  1QVG U;  1CP9 A;  1URF A;  4FFK A;  5FNV A;  4B7K A;  2LQT A;  4K0K O;  1JFF B;  3HB3 B;  2PUS A;  2CE4 A;  1Y76 B;  4JYB A;  4X64 O;  4JYC A;  4NR1 A;  1Q81 W;  4JAA A;  1RM1 B;  1TA8 A;  1M57 C;  3S3X A;  2KB1 A;  3SYO A;  5KA6 A;  4YY3 B;  4DR2 B;  2X6C A;  1Q6I A;  4F6R A;  2CTR A;  3RN4 A;  4OGQ B;  4DR7 O;  1EN4 A;  3P32 A;  1VQN V;  3E8G A;  1GN2 A;  3RBZ A;  1GKF A;  3SYA A;  4MVZ A;  1LNQ A;  1FJG O;  1WN7 A;  3IJ4 A;  2F23 A;  2B5U A;  3ZED A;  1RPO A;  2X6B A;  1PNL A;  3D36 C;  3Q4H A;  4BWA A;  4UB8 Z;  2CGN A;  3JAR B;  1QLE B;  1YHQ V;  2EIL C;  1BHB A;  2QWQ B;  4QPK A;  3WFV A;  1PKX A;  4YHH B;  3K59 A;  1ROP A;  5KUK A;  3SJQ C;  3WB1 A;  3SYP A;  3CC7 V;  2Q0A A;  2WWW A;  2VQF B;  5FNV B;  3VQW A;  2AXT Z;  2NN4 A;  4WFG A;  1GH6 A;  2JDI G;  4LC1 A;  2HLD G;  4DW0 A;  3TJT A;  3SJA C;  5GW7 A;  3ABL C;  1TVK A;  1WAZ A;  5B66 Z;  3G80 A;  1YTF D;  3IAY A;  1XNR O;  3RVZ A;  1KB9 F;  3J80 N;  3MAQ A;  2K9P A;  4QE7 A;  1M57 B;  2GV9 A;  5LHG A;  3P3N A;  4X62 B;  1KQS U;  2YUA A;  1Y6X A;  1BT8 A;  4JZG A;  4BIO A;  2A7W A;  4PI0 A;  1O9H A;  2F66 C;  2CUG A;  3QF7 A;  3STZ C;  4X65 B;  4GLX A;  4LF5 O;  2YXL A;  4DR6 O;  1THZ A;  4LF8 O;  1XHZ A;  4X88 A;  3T1C A;  3CMA V;  4D7T A;  1I08 A;  2CK3 G;  5BR8 B;  3ZHS A;  1JOY A;  2DN9 A;  2E5L O;  4MW8 A;  3CP1 A;  4BW5 A;  1K34 A;  3A0H Z;  4OPH A;  4AQY B;  1VEW A;  4JI0 O;  1P7G A;  4O4H A;  2DYS C;  1XHX A;  4KP4 A;  1IUR A;  1G6U A;  3CB2 A;  1HNZ O;  4DR4 B;  2HR3 A;  2VWK A;  2A9H A;  3CX5 F;  1KUQ A;  2XAJ A;  3K04 A;  2UXB O;  5L3C A;  1GRJ A;  2QEX V;  4JI3 O;  2NR5 A;  3ZX6 A;  3CD6 V;  3HKC A;  3VQV A;  2B1G A;  2VQE O;  2ZNI A;  1TVK B;  2LJ2 A;  4J41 A;  4JI5 B;  1AJP A;  1SES A;  2CTP A;  3ZMZ A;  3CRR A;  4PD4 F;  1F4M A;  3U10 A;  1FFT B;  1FS0 G;  2XAQ A;  3C90 A;  4P9O A;  5LGU A;  3CME V;  3OD4 A;  4DV5 O;  1RSO A;  2IJK A;  1GN6 A;  4O4J A;  1VIB A;  3FB6 C;  4CBC A;  2ZR3 A;  1F23 A;  3B2E E;  1P49 A;  5E1A C;  2VWJ A;  1XMQ O;  3EFF K;  5IDJ A;  3FB5 C;  5ITZ A;  2HP8 A;  1QBZ A;  2BCC H;  5H6Q A;  1HNW B;  1SER A;  3T1H O;  1MOF A;  4O4H B;  1AI5 A;  1OCC C;  3EXA A;  2P4V A;  5J2T A;  2HVK C;  2QSA A;  4K0K B;  5B1N A;  2DYS B;  4JI1 O;  4MW3 A;  3IGA C;  5CBG A;  4X64 B;  4IHJ A;  4UCS A;  2QJ1 A;  2EIJ B;  4RWU A;  3HKC B;  2CTQ A;  4GX1 A;  4MTO A;  5D5P A;  1KP3 A;  1XOU A;  3QG5 A;  2HEP A;  4WF9 V;  3CE2 A;  2P4K A;  1R3J C;  4DR7 B;  4FM0 A;  1GO3 F;  2EIK C;  2WLM A;  1SRY A;  2BE3 A;  2IU3 A;  2P6J A;  3UO3 A;  1FJG B;  1P4R A;  1S77 D;  1QNM A;  3HKB A;  1RSO B;  4O4J B;  4TV8 A;  4WFB V;  1VQP V;  1BGY H;  1M93 A;  3GB7 C;  1VF6 C;  4HBN A;  1D5N A;  2WLK A;  5ITZ B;  3ETE A;  1PM9 A;  5LL6 Y;  4DR5 O;  1VF6 A;  3N2G A;  1WNS A;  1YF2 A;  1ZL8 A;  1UJW B;  4X20 B;  3AG1 B;  5E79 Z;  4YIO A;  4ZHQ A;  1BE3 H;  2DJV A;  1AJN A;  1CEZ A;  1R3L C;  2Y4T A;  5J2T B;  4JI6 O;  4G28 B;  5FPR A;  1Q43 A;  4LBE C;  3R65 A;  1Q86 W;  1YTF B;  3D3Q A;  3JAS A;  4DUY O;  1AI4 A;  4I0X A;  1OCC B;  2ITD C;  2F4V O;  3JCU Z;  5JQG A;  1UFI A;  4HNA A;  2WA3 A;  3ZHT A;  4X1Y A;  5LOV A;  4IHJ B;  2QWR B;  4I9Q A;  2IH3 C;  2Q73 A;  2AHZ A;  1D2D A;  4R6Z A;  4ZIB A;  1XNR B;  4G27 B;  3ETG A;  1RFY A;  2GTS A;  3H01 A;  3F7V C;  1EM1 A;  4GKK O;  4FLZ A;  3G6E V;  3ASN C;  2B9Z A;  1WA8 A;  4LF5 B;  4DR6 B;  2XAF A;  4LF8 B;  2X7R B;  2ZIN A;  1FXV A;  4LFB O;  5KHG A;  5KMG A;  1PV0 A;  3CCE V;  1ENV A;  2GHY A;  2N05 A;  3HKB B;  4TV8 B;  3FB7 C;  2P5O A;  2E5L B;  4EFB A;  3K9A A;  2Q0O C;  1COW G;  1V54 C;  3VOU A;  5CB4 A;  4YIP A;  4JI0 B;  3N2G B;  5EK0 A;  4CC5 A;  1IBL O;  3TK1 A;  1HNZ B;  4ZHQ B;  3A2F A;  3OUS A;  1MAB G;  1I7F A;  2UXB B;  3ZRW A;  3JAS B;  4PA7 A;  3E86 A;  4I0X B;  3U11 A;  2Y48 A;  1BQ0 A;  4JI8 O;  5JQG B;  4JI3 B;  2QR4 A;  4MTG A;  4HNA B;  1RPR A;  3CWB H;  4X1Y B;  5LOV B;  3ZS8 C;  4H44 B;  3STL C;  1KC8 W;  2F93 B;  4MS2 A;  2ZCE A;  2VQE B;  5IE9 A;  1BS3 A;  1BQZ A;  4JTC B;  3SPG A;  1L8D A;  4TQD A;  3H1I H;  4K8Z A;  1K9M W;  1NVP D;  1S5H C;  2EZP A;  3ZJZ A;  1WP8 A;  3ZHU A;  2YSU B;  4WFA V;  1BSM A;  3U0Z A;  2R9I A;  3IC9 A;  2FKX A;  3E89 A;  3APQ A;  2KQX A;  2E75 B;  2JGD A;  1YSC A;  1XBL A;  1PP9 H;  3FYI B;  4UV9 A;  5KMG B;  3ASN B;  3SGI A;  3RWR D;  4DV5 B;  3DC5 A;  1V9P A;  2EUL A;  2ZXW C;  5B1B B;  1XMQ B;  3FB8 C;  3E8F A;  5EBM C;  4QPJ A;  3LNN A;  5BXZ A;  4DYL A;  3T1H B;  1MSW D;  1YXB A;  4E4E A;  1V54 B;  4LFC O;  1IBM O;  4JI1 B;  3DSQ A;  2F95 B;  2QTS A;  1HR0 O;  3ZRW B;  1NU1 H;  1R6T A;  1Y74 A;  5C93 A;  1H8E G;  3O65 A;  4PA9 A;  5C8Y A;  2YEV A;  1QLN A;  1F7Y A;  3SJB C;  2UXD O;  1Q3E A;  1VQ4 V;  2QM4 A;  2YIB D;  3N2K A;  1K97 A;  4HAM A;  5H5N A;  4IIJ B;  3OW2 U;  5EIB D;  3EVK A;  4P9P A;  3PN1 A;  3W7W A;  3OE7 G;  2EBO A;  2V1D A;  2X0L A;  1RM1 C;  2CDY A;  4PA6 A;  2ETN A;  5EC1 C;  4BR6 A;  1ZX3 A;  4LFA O;  4KXR A;  1SQQ H;  3JAW A;  3CSX A;  2CAZ C;  5EBW C;  2YIA A;  3JD2 A;  3OTO O;  5J2U A;  3ML0 A;  4Q20 A;  4FK5 C;  2GUZ A;  1YIJ V;  3E2E A;  2B1I A;  4P2Z A;  1H8H G;  4R7C A;  5CA1 B;  2W0X A;  3K5N A;  1M5I A;  4I50 A;  4B3M O;  4LH6 A;  4DR5 B;  3D3I A;  3AG4 C;  4UCV A;  1Q7Y W;  2QWP B;  2R72 A;  3OFN G;  4NVP A;  2EZO A;  3JD3 A;  4FZ1 A;  4JI6 B;  1XIL A;  1VQ5 V;  5A2Q N;  4DUY B;  5CA0 A;  2V7Q G;  1R3K C;  1VQK V;  2F4V B;  2PI5 A;  3BY6 A;  1NH2 B;  4X66 O;  1Y74 B;  3OEH G;  2Q8V A;  5C8Y B;  4FLY A;  2YEV B;  4HZ3 A;  4TOI A;  1HDJ A;  2W0F C;  3QO8 A;  1VQ9 V;  4PEL A;  4XDL A;  3TXQ A;  1RP3 B;  5BMV B;  3AK3 A;  1AI6 A;  2AZ0 A;  4GKK B;  3B8M A;  4UCT A;  4UCO A;  1H2K A;  1PPJ H;  1AVM A;  3T4D A;  4LFB B;  3JD1 A;  1JVM A;  3JAW B;  3UKM A;  2Y0P A;  2FL4 A;  5J2U B;  4RUE A;  3LSU A;  2VS0 A;  3BRC A;  1N32 O;  2UUC O;  4CS4 A;  1K8A W;  2UUA O;  4J7Z A;  1GN4 A;  2Y69 B;  4Q6G A;  1SQV H;  1H2M A;  3CJH A;  3L75 H;  4IYI A;  1XMO O;  4DV7 O;  1IBL B;  2BSK A;  2E74 B;  2A3Q A;  1J95 A;  3AG4 B;  2YIB A;  5KAI Z;  2QKS A;  5TIS Z;  2A79 B;  4DR3 O;  4HYO A;  5CA0 B;  4IT5 A;  4J7J A;  4JI8 B;  1NVP B;  4A5U B;  5JCO A;  3G6B A;  2K1E A;  3OT7 A;  5IJ9 A;  3RT3 C;  3CCU V;  3JYC A;  4YXW G;  1G4Y B;  5IYD O;  4MSW C;  1QR9 A;  2IM9 A;  2QM8 A;  3CPW U;  2H94 A;  1NR1 A;  1P7B A;  3BFR A;  1U97 A;  3E35 A;  1ZAU A;  5B1A C;  2HKO A;  4JZ2 A;  1YZB A;  2MW2 B;  1TUB A;  5K1X A;  1NQT A;  3MHH C;  2FYU H;  1JQ0 A;  3RYH A;  2WAM A;  5KHH A;  4F6R B;  2OT5 A;  5IY5 B;  2EIN B;  4UVB A;  5LP6 A;  2XHB A;  4O2B A;  3VBB A;  5KUM A;  1HW7 A;  1NS1 A;  2ZIO A;  2O57 A;  3CJH B;  4LFC B;  1R73 A;  4LF7 O;  1GM9 A;  2ZE8 A;  2BSK B;  5JVD A;  1IBM B;  3OEE G;  1VQL V;  1IXM A;  1JX9 A;  1DK1 A;  3CEI A;  2L6L A;  1HR0 B;  4GUN A;  4DR1 O;  4NYK A;  2FB5 A;  4PA4 A;  4DW1 A;  3AG7 A;  3Q4H B;  5AG2 A;  4DK1 A;  2UXD B;  4TV9 A;  3RYC A;  2IJH A;  1VMG A;  1N33 B;  1NZ6 A;  3ZN1 A;  5IJ9 B;  1ZWI C;  3S3W A;  5JJE B;  2ZE7 A;  2Z5U A;  4GX2 A;  3THO A;  3OM3 B;  2V4D A;  3HKE A;  5K1P A;  1OHH G;  1KEC A;  2IH1 C;  1GK9 A;  1L0L H;  2ZIM A;  2EIJ C;  1Q5O A;  3CXC U;  2OWO A;  4TT3 G;  1R6K A;  4LFA B;  4FIP C;  3SPI A;  4L8J A;  3CCQ V;  1W0K G;  2ZNJ A;  3TCU A;  1XI1 A;  1KMI Z;  3OTO B;  2XND G;  3T1Y O;  1MZE A;  5EC2 C;  4DK0 A;  1H2N A;  1TUB B;  3AEI A;  2OIG A;  4JYA O;  3JSN A;  5B1A B;  3CCS V;  2Q7G A;  3CHX A;  4B3M B;  2A06 H;  4LNU A;  4KFM A;  3EHB B;  3OR6 C;  2EJR A;  5LP6 B;  4O2B B;  2ATK C;  4PDV A;  4QIW F;  1FD9 A;  3GWK C;  1H2L A;  2E76 B;  4UB6 Z;  2XAS A;  1JMK C;  4BAY A;  1GTO A;  1SQX H;  4U3F H;  5JVD B;  4EB6 A;  2C2A A;  4KUM A;  4NKG B;  3AK2 A;  3ZRV A;  3R66 A;  3C3T A;  3CS5 A;  1JR9 A;  1SKV A;  4GT1 A;  4X66 B;  3K0D A;  2IBZ H;  3JAL A;  3AG1 C;  3SYC A;  5LYJ A;  3TET A;  5IWA O;  3W7U A;  3RYC B;  3T2M A;  4DV3 O;  1K73 W;  3SDL A;  2A0L A;  4FJC C;  1Y67 A;  1K33 A;  4IYH A;  2PTM A;  3HKE B;  3CCR V;  3FX7 A;  4BW9 A;  2YI9 A;  3J81 N;  2D3O W;  2UU9 O;  4ZI7 A;  5KHJ A;  5H6R A;  1Q6H A;  4PJ0 Z;  1S72 V;  3SYQ A;  1XL6 A;  4PV1 B;  2QKA A;  1N32 B;  4DV1 O;  2UUC B;  1AP5 A;  3MHS C;  4FPP A;  3T4Z A;  1BHA A;  1IVS A;  2XTA A;  1WJZ A;  1YCI A;  2UUA B;  2CTW A;  1AB3 A;  3I5D A;  5LMU O;  4LNU B;  4JAS A;  3WU2 Z;  1XMO B;  4DV7 B;  4LWS A;  1FXK C;  4OPA A;  2YS8 A;  1FKA O;  2ZT9 B;  3ZRS A;  4EB6 B;  1FXK A;  4ZBM A;  3ZMS A;  4DR3 B;  1UPG A;  4EKW A;  2UXC O;  3A0R A;  1M56 B;  3ABU A;  1KKD A;  1I94 O;  2UUB O;  4DV2 O;  3L73 H;  4CC6 A;  1YDX A;  5L3E A;  1WB8 A;  5LYJ B;  3CCJ V;  3SJC C;  2ILM A;  1SZT A;  2KSD A;  1F4N A;  3ZHQ A;  5LHH A;  1YJW V;  4O2A A;  3ZHV A;  1LR1 A;  3QO5 A;  3SPH A;  2E3C A;  2QWO B;  1E1R G;  2F1M A;  3BA9 A;  4AI8 A;  4ZI7 B;  4UVA A;  1HP8 A;  1VP7 A;  3OMN B;  3CC2 V;  2R70 A;  3ZBH A;  1IXB A;  2Q5Z A;  3AK1 A;  1JPX A;  1KP2 A;  1K5S A;  1FFX A;  2LO1 A;  4XDK A;  1HWY A;  2XT9 A;  5L3B A;  5L3D A;  3CCL V;  1JJO A;  2BTO A;  2IU0 A;  2OIE A;  5CBH A;  2P7T C;  3OAA G;  4FLW A;  1PL4 A;  4WFH A;  3CCV V;  4LF7 B;  4LWS B;  3ZRX A;  1ORQ C;  5B1B C;  2Q68 A;  4JI7 O;  2ZD9 A;  2DQ0 A;  1U96 A;  4O4L A;  1FXK B;  2BTQ A;  1LUW A;  3FKS G;  5CA3 A;  1NKD A;  4DR1 B;  1OCZ C;  4WCE V;  2HVJ C;  3BA8 A;  4NTW A;  1SQP H;  3UT5 A;  1QQC A;  4NTY A;  5JJN B;  4TSF G;  1TGO A;  1ZL8 B;  4I55 A;  2LGQ A;  3ABK C;  4MVR A;  4U3J A;  4O2A B;  1F51 A;  4B3S O;  3W7S A;  1K7D A;  4I7Z B;  5IJ0 A;  2M7W A;  2OCH A;  3ABT A;  2MK3 A;  1ARO P;  4MT8 A;  2FTK A;  2Q9L A;  3T1Y B;  1JCH A;  1YJN V;  1EBO A;  2JEU A;  4JYA B;  1DLB A;  1VAR A;  3K58 A;  3LDD A;  3WG7 B;  1FFX B;  3ETD A;  1DGS A;  3JCZ A;  4RQE A;  3K08 A;  3HR0 A;  2QKC A;  4U7N A;  3L74 H;  3QNE A;  4RO2 A;  1WA8 B;  2KKW A;  4ZOL A;  3FAV A;  4YJ2 A;  1ZSP A;  2UXX A;  3ABM C;  1YEW A;  3K3W A;  5KA5 A;  5BY1 A;  1WPB A;  4JI2 O;  2HJF C;  1XL4 A;  3LSS A;  1DTO A;  3CCM V;  1PNK A;  1BCC H;  4R50 A;  4JGS A;  1MSD A;  1Q82 W;  1GAX A;  4J80 A;  3JSL A;  3A8T A;  3BPZ A;  5IWA B;  2L35 A;  1OCR B;  2R9R B;  5F2V O;  1OCZ B;  3CYO A;  3UT5 B;  4DV3 B;  4LF4 O;  5CB4 B;  4CH5 A;  4WBN A;  1G1X B;  2F43 G;  4FLU A;  1OV9 A;  1W0J G;  4I55 B;  5KX5 A;  4G2K A;  1N36 O;  1TAE A;  3LDC A;  4U3J B;  4GX0 A;  2ZE6 A;  2PYL A;  4H13 B;  2HHH O;  3ABK B;  2UU9 B;  2P06 A;  1PD3 A;  4MVS A;  4E2L A;  4DV1 B;  3JD0 A;  2IJI A;  1SF9 A;  4PDL A;  1SET A;  1NI8 A;  4GCZ A;  1AR1 B;  5GON A;  1PL0 A;  5LMU B;  4LR3 A;  4MVO A;  2UXN A;  3K79 A;  4RUF A;  5KAF Z;  3H1H H;  1M90 W;  4NXN O;  1BL8 A;  2DWD C;  2JVD A;  3IC7 A;  3TXS A;  1XNQ O;  1EFR G;  2JGD B;  2W6J G;  4ZOL B;  3FAV B;  1L0N H;  4YJ2 B;  1IBK O;  2QE7 G;  4UFZ A;  2UXC B;  1QVF U;  2Y69 C;  2XAG A;  3ABM B;  1I94 B;  2UUB B;  4DV2 B;  4TQF A;  1VQ6 V;  5EBL C;  5EYP A;  4MVQ A;  3OR7 C;  3ICX A;  4W4K A;  1Z5W A;  3BEH A;  4K8X A;  4WBN B;  1US6 A;  2JJ2 G;  4LP8 A;  1B6Q A;  3M8A A;  4DV6 O;  5KX5 B;  3ZMV A;  1MMM A;  4B3R O;  3ZCC A;  3PJS K;  3G67 A;  3RGB A;  3ZHR A;  1CPY A;  5DN6 G;  2KG7 A;  1N0N A;  4NXM O;  4DUZ O;  2WLI A;  4Z2W A;  1M9N A;  3N2K B;  4LCU C;  2FML A;  3KCY A;  3ZMT A;  5GON B;  4BIU A;  1M4U A;  3LDE A;  4RAI A;  2M6Y A;  1EN5 A;  4IL6 Z;  4JI7 B;  3P3P A;  5KHI A;  1HNX O;  4UUJ C;  5IY5 C;  2GUZ B;  1SC5 B;  2EIN C;  1KYO F;  3LUT B;  2YID A;  2QDO A;  3SPJ A;  4FLX A;  3CRM A;  4I50 B;  1OCO B;  1WB7 A;  4I9W A;  3JD4 A;  1ZTE A;  5EYP B;  1FAF A;  1GMG A;  1G8M A;  1JJ2 U;  4GX5 A;  5EIB C;  3GVM A;  2RQ6 A;  4AHC A;  1S5J A;  1SA0 A;  4J11 A;  4QE9 A;  4B3S B;  2P90 A;  4WFF A;  5JCO C;  3BVO A;  2W6I G;  2Q4P A;  1I0H A;  2KG7 B;  4UCU A;  3A0B Z;  4UXN A;  4KL1 A;  4MVM A;  3QO7 A;  2JGU A;  2BOC C;  1K4D C;  4DO2 A;  4O4I A;  2WLI B;  4W4L A;  2EJ7 A;  2ZM6 O;  1FPO A;  3WB2 A;  1I5Y A;  1QCE A;  4Z1V A;  4UV8 A;  1R1B A;  3K5O A;  3UO2 A;  2VRZ A;  5B3S C;  4TUY A;  1XQ8 A;  2ZQM A;  1GN3 A;  2AW9 A;  3D36 A;  4R8C A;  1E79 G;  3J7A U;  2DWE C;  1Q90 D;  2YC0 A;  1N8R W;  2CH7 A;  2HG5 C;  4GKJ O;  4JI2 B;  1JA8 A;  5LP6 C;  1W2B U;  2PI4 A;  4MTX A;  4J10 A;  4F6E A;  4I5S A;  1M1K W;  4LF4 B;  4PHZ A;  3BAB A;  4DRX A;  2LFR A;  3KCX A;  1S3J A;  3K57 A;  2PF4 E;  4FMT A;  1N36 B;  1S5L Z;  5HFM A;  5EZY A;  1SA0 B;  4FM2 A;  4LF6 O;  2HHH B;  2PGG A;  3L70 H;  1BMF G;  2Q67 A;  4MTF A;  1A32 A;  2AZ2 A;  1H2S B;  5DEC A;  2ZKO A;  4JI4 O;  3KG2 A;  3JAM N;  1ZLZ A;  4O4I B;  1SQB H;  4WFE A;  2Y0I A;  3E83 A;  1EN6 A;  4B7E A;  1MA1 A;  1K5Q A;  1Z2G A;  1H38 A;  4ABM A;  2RMK B;  2CGO A;  5L3F A;  5B1O A;  1KD1 W;  5GTH Z;  3CRC A;  4QJF B;  1OZ0 A;  4JTA B;  2BOB C;  3N27 A;  1K3E A;  5BZB A;  4NXN B;  1NTZ H;  4TUY B;  1KBH A;  2Q6A A;  1XNQ B;  3K5L A;  3DXR A;  1IBK B;  2Q69 A;  3HPL C;  5B3S B;  4CH3 A;  2CH7 B;  2JS3 A;  4FZ0 A;  2EIL B;  5CN0 A;  4AIL C;  3BCC H;  3RYH B;  1I5X A;  4FM1 A;  2DQ3 A;  4LF9 O;  2ODM A;  3QTC A;  1VQ8 V;  1IDS A;  3DC6 A;  2ITC C;  2G38 A;  2DOS A;  3I56 V;  3HKD A;  2LW1 A;  4DRX B;  4H37 A;  4DV6 B;  4JV5 O;  5LA6 A;  4JAU A;  2OTL V;  1M56 C;  4P30 A;  5EZY B;  5B5E Z;  4B3R B;  4N23 A;  2IW5 A;  3F5W C;  5DM6 V;  1GM8 A;  5GTI Z;  3ABL B;  4DV4 O;  4KHP O;  4FFB A;  4Z1M G;  4DV0 O;  4J7K A;  1WLE A;  4UCR A;  3ZIA G;  4NXM B;  2OYQ A;  5LMN O;  4TV9 B;  5KHK A;  4DUZ B;  4ASU G;  2LFS A;  4JYY A;  3RYI A;  1L1F A;  4QNH B;  3UCS C;  2ADP A;  2Q7H A;  1KU9 A;  3FFQ A;  2DW4 A;  2N74 A;  1ZUQ A;  1AR4 A;  5FPO A;  5IYZ A;  4CS3 A;  3VQX A;  4X20 A;  2X6A A;  3DXR B;  1HNX B;  1XEQ A;  3I55 V;  3RYF A;  3TGU H;  1T5E A;  1N4C A;  1Q8I A;  1XDC A;  4YJ3 A;  4XDJ A;  3E8B A;  3OMA B;  4JAV A;  1J5E O;  5IT9 N;  1X4T A; 
#chains in the Genus database with same CATH homology
 1Y76 B;  1Y74 B;  1ZL8 B;  3B40 A;  1ZL8 A;  1Y76 A;  1RSO B;  1Y74 A;  1VF6 C;  1VF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...