1VF6C

2.1 angstrom crystal structure of the pals-1-l27n and patj l27 heterodimer complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
51
structure length
51
Chain Sequence
QDPDVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PALS1-associated tight junction protein
publication title Structural basis for L27 domain-mediated assembly of signaling and cell polarity complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/protein transport
total genus 24
structure length 51
sequence length 51
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09060 L27_N L27_N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1vf6C00
1Y74B 1Y76B 1Y74A 1Y76A 1RSOB 3B40A 1VF6C 1VF6A 1ZL8B 1ZL8A
chains in the Genus database with same CATH superfamily
1FFXA 1JFFA 3HPLC 4XDJA 2WA4A 5K1PA 4DR7B 2Q9LA 3OD4A 1AJQA 4UB8Z 2XAQA 4DV5O 1ENVA 3E22A 4PV1B 4TQFA 5LGTA 2F23A 5FNVB 2GBOA 2UXDO 2RNBA 4DXWA 3F7YC 1NVPD 3CC4V 1QVFU 2UXBB 4X62B 4DUYO 1Q6IA 2P90A 1K9MW 1MABG 3I56V 5CA3A 1K8AW 3CP1A 3W7WA 3P30A 1K33A 3CJHB 4CH4A 4KP4A 1FXHA 1JJOA 4DV1B 3BA9A 4JI1O 4PA4A 4LF5B 2JJ2G 2OTJV 2ZDIA 1S5HC 1G4YB 1VP7A 1PP9H 1B6QA 5JVDA 5AG2A 2L35A 1M4UA 4J7ZA 4RO2A 4I9QA 1QLEB 1XL6A 3ZRXA 2DN9A 4OX9O 4X65B 1GM7A 4UVCA 5KX5A 2HG5C 1XL4A 1W0KG 4X1KA 4OPAA 1YF2A 3MHHC 3K0DA 4U3FH 4PHZA 5L3CA 2ARHA 1KB9F 1YITV 4UCVA 3JAWB 4IHJB 1SZTA 5BXZA 1GMGA 1GRJA 1P7GA 1S5LZ 3U10A 3AG2C 4MT8A 3OUSA 3OMIB 1TUBA 3K5MA 3CRAA 5J2UB 2NN4A 2EILC 5JH7A 3DSQA 2GSMB 1M93A 3WG7C 4NTYA 3SPCA 4GUNA 3EVKA 5B66Z 2JEXA 5JJNB 3CPWU 4MVOA 4U3JB 2E5LB 4WF9V 1GM8A 2W0FC 2WLKA 2OTLV 1HNXB 2JRIA 1A32A 3JD1A 4JV5B 1K97A 3JCUZ 2FKXA 3NR7A 3TETA 4LWSA 3L9DA 2IJKA 3ZHSA 4P30A 2XASA 4UCRA 3ZCCA 1VEWA 2AXTZ 2DWEC 4UCTA 4FLTA 2YXYA 1EFRG 3IJ4A 4D7SA 1I0HA 2F4VO 1N33B 4MVSA 2F43G 4FFKA 4R50A 1ZLZA 1JVMA 4YIPA 2XT9A 5LBQA 3HKEA 1Z5VA 3SPHA 4LF7O 1AJNA 5J9PC 2PGGA 2A0LA 4QE9A 2UU9B 1ZTEA 4JI0B 1VQNV 2VQFB 1QVGU 4UVBA 3CE2A 5GTIZ 2BTOA 4DV2O 3MAQA 4Z2WA 3QTCA 4E4EA 4GX2A 1AI4A 2ADPA 1U97A 2YIAA 2HR3A 4WBNB 4GKJB 3SYOA 1T5EA 2Z3YA 4DR6B 4TT3G 5CBFA 1BL8A 1L0LH 1Q5OA 4BAYA 3RW0A 2W0XA 4CH3A 2CUGA 2QWPB 5CA1A 1OCRC 4JI2B 1FAFA 4MSWC 2IBZH 4JI3O 3SPGA 4LFCB 3ZRSA 5B1AB 3ETGA 4IIJB 1RPOA 1PKXA 3CC2V 3LDDA 1YEWA 4FM1A 3CS5A 4YY3O 4J42A 2LGWA 1K5SA 5EBLC 3MHSC 2DQ0A 4Z1MG 2HKOA 3S3XA 1N4CA 1M1KW 4B3RB 2PI4A 1YTFB 1QLNA 2A06H 4FIPC 3HKDB 4ICGA 3RYHB 4O2BA 5A9GA 1Q82W 3N2GB 3AG3C 1PNLA 3QG5A 3SJAC 3ABKB 2OIGA 1V54C 1YDXA 2Q5ZA 4F4LA 2EX3A 4ZOLB 1FPOA 4JAUA 2RQ6A 4E2LA 5IY5B 3HR0A 3ZX6A 1OCCB 4FPPA 4A5UB 2GUZB 2DE0X 4JI8O 3N2KB 1I7FA 1N8RW 4QGPA 4X1YB 4DR3B 3BRCA 3ABLB 2FL4A 4CH6A 4RUFA 5EYPA 5LA6A 1FXVA 1SS3A 4ABMA 5EBWC 5HFLA 1PNMA 3F7VC 4GX5A 3AG4B 3CCLV 1VARA 1COWG 3CXHF 4OGQB 3CCUV 4LFAO 3ABMB 4KFMA 1GAXA 1K5QA 3K08A 5E79Z 4O4LB 1N34O 2QM8A 1E1RG 2IH3C 4QPKA 1NTMH 2EIMB 1OJHA 1SQPH 1RP3B 4GKJO 5IJ0B 2Y4UA 3BEHA 4DV0B 4LF6O 3T4DA 4LCUC 5CB4A 1XMOB 1FXKB 2Y48A 1GN2A 4J11A 1L0NH 2YIBD 3SYCA 4JYBA 4LBEC 2CK3G 2F95B 3RYFB 1NR7A 3UO3A 4FLVA 4CS3A 2JGDB 1H2KA 1Y76B 2Q0OC 1SQBH 1OHHG 3ABUA 3SJBC 5LGUA 2CGOA 4BW9A 4RQFA 2EZPA 4BW5A 1P84F 1UJWB 1XBLA 2G38A 4K0KO 2QWQB 4I55A 3T1HO 1M57B 4BWAA 3JATA 2UUAO 4JI5B 3DXRB 1KKDA 1XREA 3K9SA 1H8EG 3UO2A 2HP8A 3BFRA 1NQTA 4R6ZA 2ZM6O 3Q4HA 4UV9A 5GONB 3RBZA 2ILMA 1NVPB 3RGBA 4XBFA 1D5NA 1XHXA 4JI6B 4EEQA 5LXTA 1VQ4V 5LMNB 3ZRWB 3K03A 3K59A 1W2BU 1N32O 2PI5A 4JI7B 4ZHQA 2LJ2A 1XNQO 3UKMA 2NR5A 4LF8B 1VQOV 3D36C 4AI8A 4U7OA 4EB6A 1PNKA 3X2QB 3ZMUA 3U0ZA 2JGUA 2QM7A 1SKVA 4W4KA 2YS8A 1YVWA 2EINC 4ZI7A 3FB8C 2JEUA 5KA5A 4LNUA 1IBLB 3CB2A 2YICA 2B5UA 1O9GA 4MS2A 3PN1A 3SYPA 5EIBC 4MTXA 3QNEA 2FMLA 1S76D 5LMUB 5B1NA 5IJ9B 1VQ8V 3OMNB 1BZKA 4GZRB 2ZXWB 2QTOA 4B3TO 1FJGB 2ITCC 1FFXB 3IC7A 1YXBA 1JFFB 4O4IA 1MZFA 4FLYA 2JIZG 3CMAV 2CTQA 2PYJA 3E22B 4DR2B 3C3TA 1HNWO 5B1OA 1GN6A 5J2TA 1N36O 3E89A 5H6QA 2Q8VA 3A2FA 3G71V 3OEEG 1MOFA 2XOKG 4GYCB 4YHHO 4MVMA 2E75B 1VQMV 1J5EB 3G80A 1R6NA 4DO2A 1SERA 3D3QA 1NBMG 4NVPA 3W7SA 3FB7C 4X64O 3FD9A 1TGOA 1KKCA 3T2MA 2IU3A 4UCOA 4P2ZA 3H1HH 2NNUA 1QU7A 3D36A 4JAVA 4HNAA 2QEXV 1Y74A 1HNZO 1YCIA 4KXRA 1H2GA 5CA0A 2XNDG 1QR9A 4JZ2A 4DV7B 3B77A 1PD3A 5KX5B 2ZIMA 1K4DC 4X1KB 2CH7A 1RSOB 2K1EA 4AQYB 1LR1A 3RWRD 3JYCA 5L3BA 1JQ0A 3T4ZA 2PY5A 2E76B 4PD4F 3ICXA 4LC1A 1G1XB 1SZXA 3W7TA 1QHTA 4WFHA 1SQXH 1TUBB 3TK1A 5JH7B 2WLNA 3ZMSA 2YDEA 4X66O 2RMKB 4H13B 1XNRB 4PDRA 2ZR3A 1AB3A 4KUMA 1JOYA 3OR6C 3JAKB 2JJ1G 2VQEB 2WLIA 3PJSK 2ETNA 2M7WA 4K35A 1EM1A 1I5XA 3RYIA 3CRRA 1IDSA 2FB5A 4IGGA 3ASOB 2AHYA 2ZQMA 2UUBO 4DR4O 4I5SA 1G6UA 2YXHA 4DK1A 3I55V 5B3SB 2Q7EA 2WAMA 5HFMA 3IFXA 4LF9B 3ASNC 1IBKB 1Y6XA 3ZJZA 4DV4B 1IURA 1WA8A 1L1FA 5L3FA 4I4TA 1NZ6A 4JASA 1TVKA 1QCEA 4K8ZA 2RCVA 3LSSA 4YJ2A 2P5OA 3WB0A 4DR5B 4JYAB 2YEVA 4L87A 2CTRA 2DQ3A 2AHZA 2XTAA 3HKEB 4DR1O 1GO3F 2XAFA 3AG1B 2DJVA 1VQ6V 2CTWA 1J95A 1I94O 3APQA 1SC5B 4LF4B 3GVMA 5H6RA 1V55C 2YI8A 3SPJA 4TV8A 5L3EA 3M99B 3VQXA 1VQLV 2EILB 4FLXA 5KUKA 1S72V 5C93A 2H8PC 2LFSA 4TOIA 5LOVA 1WPBA 2P67A 1GH6A 4JYYA 1NR1A 2ZNIA 2HJFC 4JI4O 5CBHA 3K9AA 4DV3B 2DYRB 1N0NA 4TWKA 1KP2A 2AGAA 3E86A 5H9CA 1RFYA 3SYQA 1K7DA 4EKWA 3ZHUA 4O2AB 4TUYA 4DV6O 1BCCH 2GV9A 5LL6Y 1EZVH 5FPRA 2X6CA 5A2QN 2ZT9B 1DTOA 1GTOA 1L8DA 4CS2A 2IJJA 1FFTB 2HEPA 2KG7B 3FYIB 3RFRA 1ROPA 4LFBO 5BR8B 3P32A 1NT2B 3AK1A 2WLLA 3T1YO 4MTOA 2WLHA 4UCSA 3RVYA 2X6BA 4H33A 4UV8A 3ZHRA 1NKDA 3P3PA 4LP8A 1MG1A 4TQDA 2ADQB 4UFZA 3GWKC 3DC6A 3D8CA 3CWBH 3UCSC 4JTDB 3UT5B 1OCOB 2LGQA 5BMVA 3ZIAG 1VF7A 4DR7O 2D2CB 1AR5A 2DMXA 1FYJA 4X20A 2PUSA 5E1AC 4KL1A 1QLEC 3FAVA 4MVRA 2UXBO 2ZCEA 3WFVA 4X62O 4B3SB 3OGIB 1Y66A 3MD0A 5EYPB 5LA6B 3P3NA 4DRXA 2MW2B 5DEDA 2ZE5A 5JJEB 1BGYH 2GTAA 2P4VA 4DV1O 5JQGA 1D5AA 1BQ0A 5LHGA 4DUZB 4CS4A 3W7XA 4LF5O 2ATKC 4HZ3A 2UXNA 5KMGB 4FFBA 2WA3A 1G8MA 1MNGA 2M6YA 4IYIA 4D6TH 5L3DA 4WFEA 5EZYA 1WAZA 2R9RB 5JWPA 3FB5C 2ZR2A 2GDSA 2Y0PA 3IAYA 1PL0A 4DV3O 5CB4B 4NXMB 1NH2B 4X65O 2LW1A 1H2SB 1THZA 4I0XA 5KHKA 3BHPA 3KKYA 4K3AA 1OCZC 1BHBA 1K3EA 1P7BA 5CN0A 3AG3B 1K34A 3CJHA 5KHGA 2EIJB 2ZINA 4DYLA 2KKWA 2XAJA 1Y4MA 1H38A 3WB2A 5FLXN 1KECA 4IT5A 2Q0AA 2EULA 3R65A 1MSWD 1PV0A 4IYHA 4QJFB 1V9PA 3K79A 4I55B 3TJTA 3CCRV 4FLWA 2XHBA 3JATB 4F6RA 2Q69A 4GX0A 4UUJC 2E5LO 3M8AA 1Q6UA 1CPYA 4O4HA 2Y0IA 2QWOB 3L71H 3ZMVA 1HNXO 3SYAA 4PA3A 4JV5O 1R1BA 1LUVA 3R66A 2HVJC 3LNNA 3VQVA 1IX9A 1AP6A 3HKBA 1JMKC 3I5DA 3CHXA 2P7TC 1NS1A 4I50B 1K92A 4ZHQB 3K3WA 2AW9A 3CX5F 2A79B 2A7WA 1LUWA 4P9OA 5LHIA 1N33O 2L6LA 5FL7G 1PL4A 4ZI7B 1EN6A 2UXCB 4L8JA 1HP8A 4HYOA 1K4CC 2WLJA 4JTCB 2R9IA 1MMMA 4JAAA 1YSCA 4ZIBA 4J7JA 2UU9O 3OTFA 5B1AC 1SQVH 1HR0B 3IC9A 4Q6GA 4JI0O 2VQFO 5IDJA 2AZ2A 4R8CA 4NYKA 2H3OA 5D5PA 4MTGA 5IWAB 1F7YA 2Q68A 4G27B 3CCSV 3ABTA 5J2TB 1NJIW 4FZ0A 5GTHZ 3BVOA 5TISZ 4DR6O 1Q7YW 1YJNV 2XAHA 2QWRB 2CAZC 4EFBA 1SA0A 5ITZB 4JI2O 1WP7A 3JSLA 3FFQA 4LFCO 4BR6A 2KQXA 3JD3A 4QPJA 3ABKC 3OTOB 5LYJA 3RYCA 2DYSB 3OM3B 2PZSA 2E3CA 5D5QA 1VQKV 2BE3A 4FLUA 2ZE7A 3STLC 1VQPV 5IYZA 3OR7C 1OCCC 5C8YA 4B08A 4NXNB 3MDSA 3OFNG 5B1BB 4HNAB 4YJ3A 2F66C 1Y74B 3NXSA 3EXAA 1I5YA 2GHYA 1SQFA 4B3RO 5CA0B 2Q7GA 3A8TA 3ABLC 1Z2GA 1EN5A 4PDMA 1JPXA 2Y69C 3QF7A 1XILA 3E8FA 1XI1A 2A3QA 3L74H 5LP6B 3HKCB 1RM1B 1ZL8A 5CMUA 3L73H 3O9OA 3CMEV 1U96A 1IBMB 3H1IH 4IIJA 1Y67A 3N27A 4PDVA 3B2EE 1X59A 1DK1A 4WCEV 4R7CA 4RWUA 1QNMA 2EIMC 2WLMA 2ZE8A 4B3MB 3JALB 3S3WA 2QDOA 3IGAC 1NH2D 3CSXA 4DR3O 1GM9A 4H37A 2RN9A 2CDYA 1B06A 2YI9A 1S3JA 3THOA 3EFFK 3HKDA 1URFA 2HVKC 2WLIB 4DK0A 4N23A 1JJ2U 1NI8A 5H5NA 3OMAB 3RYIB 1HR0O 2DOSA 5KHIA 4TV9B 5GW7A 3CRMA 1F23A 2BCCH 1H2NA 1W59A 1WJZA 1R73A 4BIOA 3D3IA 5H2FZ 1M56C 1WA8B 4I4TB 4DV0O 1TVKB 3ZMTA 2GUZA 1CEZA 1M57C 1TUEB 1XMOO 3LUTB 3N2KA 3JASA 4YJ2B 3WU2Z 4MVZA 2Q67A 4CBCA 3K5NA 2P6JA 4KHPB 1UPGA 1SQGA 4J9YB 4FZ1A 1BQZA 2H94A 2WSSG 5BZBA 3TCUA 4B7KA 3QO7A 4QE7A 4O4JA 3K58A 2ZKOA 4WFFA 4YIOA 2OCCC 4PJ0Z 2EIKC 3A0BZ 1SF9A 4O4LA 3HB3B 5F2VO 2CE4A 3G4SV 4TV8B 3AEIA 3OEHG 2HHHB 3L75H 5IE9A 4J80A 1CXZB 2JS3A 3ZEDA 4JI5O 5LOVB 3JSNA 3X2QC 2BOCC 2Z5UA 5JVDB 4DV5B 1YJ9V 1D2DA 1Q3EA 2LW7A 1MA1A 2UXDB 1VQ9V 5KLVH 3RYFA 1IXBA 2JGDA 2N05A 4JI6O 2CTPA 4DUYB 4TUYB 5LMNO 3G67A 1W0JG 3ASNB 4AILC 1OZ0A 1P4RA 4JI7O 2ZXWC 2OWOA 2N74A 5DN6G 4LF8O 1KBHA 3H1LH 4X88A 2QWNB 4JI1B 2R9AA 2EJRA 4UB6Z 5DECA 4WFAV 2GTSA 2YUAA 2WLLB 1UFIA 2X6AA 1Q90D 1AR4A 1JR9A 1IBLO 1JA8A 5EBMC 3ZBHA 5GONA 5KA6A 1AP5A 4OX9B 3DC5A 5LMUO 2BTQA 3ZRWA 5JCOC 4CH5A 3CRCA 1FJGO 1Q43A 3KZIZ 4FMTA 2ZDIC 2B1IA 3GB7C 4X20B 2ITDC 3UQ8A 4LWSB 3CYOA 4DR2O 3CCQV 2YC0A 3CRQA 3W7UA 2RJZA 2A9HA 1XQ8A 3T1CA 1BMFG 3B4SA 1ZAUA 5EIBD 4NTWA 4J7KA 1TA8A 1I08A 2HLDG 1J5EO 4TSFG 3AK3A 5IJ9A 5JQGB 3K5OA 5KHHA 2HJDA 1Q8IA 5K1XA 4FFBB 4LH7A 1YJWV 5EZYB 4W4LA 2V7QG 2XUMA 3SR2C 2PTMA 3AG2B 2JS5A 4X1IA 2WPDG 4JYCA 4DV7O 1RPRA 3WG7B 3CCEV 1MZEA 4I0XB 1VF5B 1DF4A 3TGUH 1AVMA 4AQYO 4JTAB 2F4VB 5JCOA 3ASOC 5IT9N 1M5IA 1NU1H 2KB1A 2ODMA 1CP9A 5B3SC 3CXCU 4GLXA 2E74B 1R3JC 5CA1B 2VWJA 4LF7B 3E8GA 4G28B 2MK3A 5CBGA 3J81N 1XNRO 4F6RB 2RDCA 2YSUB 1R3KC 3A0HZ 3CD6V 4GX1A 3TXQA 2VQEO 4DV2B 4O4HB 3QVNA 1BSMA 1RSOA 4NR1A 3OW2U 1ZSPA 2OCHA 4LF9O 3AG1C 3QO8A 4O2BB 1IBKO 1FS0G 4DV4O 3HKBB 1GN3A 1AI7A 3JARA 4JI3B 1GK9A 4QIWF 1DLBA 2OYQA 1Q86W 1QQCA 3OUFA 1VF6C 4DR5O 1WN7A 3OAAG 4JYAO 4Q20A 3JD2A 4YY3B 4AHCA 3FX7A 4G2KA 3VBBA 3JAKA 1OCZB 2P06A 1M9NA 3CC7V 3U11A 2DYRC 4D7TA 1S77D 2BSKA 1WLEA 1ZX3A 1VQ5V 4PA7A 2CGNA 3ZMZA 3B8NA 3KCXA 2JK5C 4BIUA 1OCRB 2IJIA 2QR4A 4PDLA 4LF4O 3BA8A 5L3GA 1Q6HA 4IL6Z 5DM6V 1R6KA 2Q4PA 3A0RA 4ZKIA 3ETDA 3DGEA 3RT3C 3AG7A 2QKAA 1O9HA 5FNVA 1AI6A 1IZ3A 1P49A 3L72H 4JI8B 4PI0A 3J80N 4OPHA 2HFEC 1HW7A 3F5TA 1SA0B 2F1MA 3KCYA 4FM0A 4MVUA 1YHQV 2R72A 5LYJB 4J9ZB 1JCHA 3RYCB 1V54B 3M7MX 1OCOC 1VF6A 4LFAB 2VS0A 2PYLA 2JDIG 1H2MA 4OXSA 5IYZB 5BR8O 2YIDA 5C8YB 3ZRVA 4YJ3B 1N34B 2IJHA 2ZD9A 1AILA 3H9VA 4LF6B 2XAGA 3LNMB 1TAEA 1F4NA 4O2AA 3SJCC 4X9QA 1ZL8B 3B40A 4N21A 2V1DA 3JD0A 3B09A 3Q4HB 2R70A 3JAMN 3E35A 1B04A 5B5EZ 4H0LB 3G6EV 2Y4TA 2IW5A 1KMIZ 4X89A 3JAWA 4IHJA 1S0VA 2IH1C 5LXTB 1AJPA 1EN4A 2KG7A 2VRZA 1BS3A 2KSDA 1XUQA 4UCUA 5LHHA 4JF3A 4RAIA 4CC6A 1KU9A 4K0KB 4B3SO 5J2UA 3T1HB 1WB7A 4EB6B 3RN4A 2UXXA 4U3JA 1OV9A 2LQTA 1SESA 4CZZA 3ZHQA 4WFBV 2UUAB 3O65A 2X7RB 4BIZA 5KAIZ 2Q73A 4NB5A 3BPZA 2YIBA 2EIJC 3FB6C 4DUZO 2ZM6B 4LNUB 2K9PA 5IYBO 2LO1A 1VMGA 3ML0A 1XEQA 3UT5A 1IXMA 4ZBMA 1VIBA 3ZHTA 2D3OW 2FYUH 3E2EA 3J7AU 1WB8A 5BY1A 4XDLA 1N32B 4NXMO 2C2AA 3LSQA 4J10A 1ZWIC 3JASB 3ETEA 2UUCB 2O57A 4O4IB 4K8XA 3ZN0A 4MVQA 1XNQB 5LGNA 2Y69B 2FTKA 2V4DA 1F4MA 4FM2A 1M90W 4JPRA 3E8BA 1EBOA 1PPJH 4YXWG 4UXNA 4HBNA 3VOUA 3CCMV 1XMQB 5KMGA 3K0GA 4O4JB 3OE7G 2DWDC 4PI2A 3ETQA 4DW0A 4J41A 1GN4A 3H01A 3E8HA 4P9PA 2QTSA 4B3TB 1NTKH 1NTZH 5IY5C 3SGIA 1K73W 3EHBB 1YI2V 1F51A 3H1KH 1KUQA 1R3LC 1HNWB 4WBNA 1BE3H 1N36B 2EINB 3C90A 3B8MA 4B7EA 1R3IC 1KP3A 4YHHB 2W6IG 1KD1W 2CH7B 3AG4C 2ZIOA 1HDJA 1M56B 2EZOA 2P4KA 1FD9A 1XOUA 4QNHB 1KC8W 3ABMC 4X64B 2ZE6A 1AR1B 2Q6AA 3SJQC 2IU0A 1WNSA 3FYEB 4DW1A 1HNZB 1PM9A 2UXCO 3TXSA 3G6BA 1FXKC 2VWKA 1XHZA 2OIEA 5IYDO 4I7ZB 4HAMA 4LR3A 1ZUQA 3AK2A 2PF4E 1EZJA 1YZBA 2OCCB 3RYHA 2BTQB 3BABA 2EIKB 3N2GA 3SPIA 5KUMA 4RQEA 4FVMA 4I50A 2DYSC 3F5WC 4LH6A 2UUCO 4UVAA 4ZOLA 5IWAO 1ORQC 3CCVV 5B1BC 1FKAO 5KHJA 2QGNA 2NLJC 3LDCA 3C3SA 3OGCC 5KAFZ 1QR8A 5EC2C 1KYOF 2Q7HA 3K04A 4X1YA 1XDCA 3SDLA 1XMQO 2BOBC 4X66B 1SETA 5LP6C 2YEVB 1RM1C 4PA6A 2DW4A 3H1JH 1JX9A 2QKSA 1WP8A 5FPOA 2AZ0A 3OTOO 4I9WA 3QO5A 1N0JA 2QSAA 1SQQH 4FLZA 2UUBB 4DR4B 1VQ7V 4NXNO 4U7NA 1IVSA 5JJJB 2QE7G 3BY6A 4PA9A 4X1IB 5IJ0A 4XDKA 3RVZA 5EC1C 1YTFD 4GKKB 1H2LA 2YXLA 4JGSA 3K5LA 1GKFA 3ZHVA 1FXKA 3JD4A 1R6TA 4F6EA 3GWOA 5ITZA 2IM9A 1IBMO 2P22C 1DGSA 3UM7A 5EK0A 1SRYA 1HWYA 3LDEA 2EBOA 2N04A 3WB1A 2LFRA 1Z5WA 1Y76A 4JZGA 3K06A 3L70H 4NTXA 1KQSU 4DR1B 4B3MO 1E1QG 1LNQA 3BCCH 1WPXA 1I94B 1QBZA 4C7UA 3STZC 4EFEA 4H44B 3APOA 5IYCO 3K57A 1H8HG 4Z1VA 3DXRA 1B3QA 3E83A 5LP6A 3HKCA 4MW3A 4ASUG 1E79G 4FJCC 2QM4A 4JI4B 3LSUA 3CCJV 3OT7A 3BAAA 1AROP 4X8AA 3VQYA 2WWWA 1X4TA 3CEIA 2QKCA 4DV6B 3JARB 3KG2A 2EJ7A 3JALA 1DF5A 1V55B 4CC5A 2X0LA 5BMVB 2F93B 4MW8A 2LP7A 3ZS8C 4KHPO 2ZNJA 2B1GA 4LFBB 2OT5A 2QJ1A 3T1YB 3FAVB 1AI5A 4TV9A 4GT1A 4WFGA 2BSKB 1US6A 4DRXB 4FK5C 3DTUB 1S5JA 2QA4V 3JCZA 4MTFA 4NKGB 2HHHO 4GKKO 1MSDA 3FKSG 4RUEA 1BHAA 2B9ZA 4GCZA 3VQWA 2JVDA 1YIJV 1BT8A 3ZN1A 2W6JG 2Z0AA 1Q81W 4PELA
chains in the Genus database with same CATH topology
1Y74B 1Y76B 1Y74A 1Y76A 1RSOB 3B40A 1VF6C 1VF6A 1ZL8B 1ZL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y74 B;  1Y76 B;  1Y74 A;  1Y76 A;  1RSO B;  3B40 A;  1VF6 C;  1VF6 A;  1ZL8 B;  1ZL8 A; 
#chains in the Genus database with same CATH topology
 1FFX A;  1JFF A;  3HPL C;  4XDJ A;  2WA4 A;  5K1P A;  4DR7 B;  2Q9L A;  3OD4 A;  1AJQ A;  4UB8 Z;  2XAQ A;  4DV5 O;  1ENV A;  3E22 A;  4PV1 B;  4TQF A;  5LGT A;  2F23 A;  5FNV B;  2GBO A;  2UXD O;  2RNB A;  4DXW A;  3F7Y C;  1NVP D;  3CC4 V;  1QVF U;  2UXB B;  4X62 B;  4DUY O;  1Q6I A;  2P90 A;  1K9M W;  1MAB G;  3I56 V;  5CA3 A;  1K8A W;  3CP1 A;  3W7W A;  3P30 A;  1K33 A;  3CJH B;  4CH4 A;  4KP4 A;  1FXH A;  1JJO A;  4DV1 B;  3BA9 A;  4JI1 O;  4PA4 A;  4LF5 B;  2JJ2 G;  2OTJ V;  2ZDI A;  1S5H C;  1G4Y B;  1VP7 A;  1PP9 H;  1B6Q A;  5JVD A;  5AG2 A;  2L35 A;  1M4U A;  4J7Z A;  4RO2 A;  4I9Q A;  1QLE B;  1XL6 A;  3ZRX A;  2DN9 A;  4OX9 O;  4X65 B;  1GM7 A;  4UVC A;  5KX5 A;  2HG5 C;  1XL4 A;  1W0K G;  4X1K A;  4OPA A;  1YF2 A;  3MHH C;  3K0D A;  4U3F H;  4PHZ A;  5L3C A;  2ARH A;  1KB9 F;  1YIT V;  4UCV A;  3JAW B;  4IHJ B;  1SZT A;  5BXZ A;  1GMG A;  1GRJ A;  1P7G A;  1S5L Z;  3U10 A;  3AG2 C;  4MT8 A;  3OUS A;  3OMI B;  1TUB A;  3K5M A;  3CRA A;  5J2U B;  2NN4 A;  2EIL C;  5JH7 A;  3DSQ A;  2GSM B;  1M93 A;  3WG7 C;  4NTY A;  3SPC A;  4GUN A;  3EVK A;  5B66 Z;  2JEX A;  5JJN B;  3CPW U;  4MVO A;  4U3J B;  2E5L B;  4WF9 V;  1GM8 A;  2W0F C;  2WLK A;  2OTL V;  1HNX B;  2JRI A;  1A32 A;  3JD1 A;  4JV5 B;  1K97 A;  3JCU Z;  2FKX A;  3NR7 A;  3TET A;  4LWS A;  3L9D A;  2IJK A;  3ZHS A;  4P30 A;  2XAS A;  4UCR A;  3ZCC A;  1VEW A;  2AXT Z;  2DWE C;  4UCT A;  4FLT A;  2YXY A;  1EFR G;  3IJ4 A;  4D7S A;  1I0H A;  2F4V O;  1N33 B;  4MVS A;  2F43 G;  4FFK A;  4R50 A;  1ZLZ A;  1JVM A;  4YIP A;  2XT9 A;  5LBQ A;  3HKE A;  1Z5V A;  3SPH A;  4LF7 O;  1AJN A;  5J9P C;  2PGG A;  2A0L A;  4QE9 A;  2UU9 B;  1ZTE A;  4JI0 B;  1VQN V;  2VQF B;  1QVG U;  4UVB A;  3CE2 A;  5GTI Z;  2BTO A;  4DV2 O;  3MAQ A;  4Z2W A;  3QTC A;  4E4E A;  4GX2 A;  1AI4 A;  2ADP A;  1U97 A;  2YIA A;  2HR3 A;  4WBN B;  4GKJ B;  3SYO A;  1T5E A;  2Z3Y A;  4DR6 B;  4TT3 G;  5CBF A;  1BL8 A;  1L0L H;  1Q5O A;  4BAY A;  3RW0 A;  2W0X A;  4CH3 A;  2CUG A;  2QWP B;  5CA1 A;  1OCR C;  4JI2 B;  1FAF A;  4MSW C;  2IBZ H;  4JI3 O;  3SPG A;  4LFC B;  3ZRS A;  5B1A B;  3ETG A;  4IIJ B;  1RPO A;  1PKX A;  3CC2 V;  3LDD A;  1YEW A;  4FM1 A;  3CS5 A;  4YY3 O;  4J42 A;  2LGW A;  1K5S A;  5EBL C;  3MHS C;  2DQ0 A;  4Z1M G;  2HKO A;  3S3X A;  1N4C A;  1M1K W;  4B3R B;  2PI4 A;  1YTF B;  1QLN A;  2A06 H;  4FIP C;  3HKD B;  4ICG A;  3RYH B;  4O2B A;  5A9G A;  1Q82 W;  3N2G B;  3AG3 C;  1PNL A;  3QG5 A;  3SJA C;  3ABK B;  2OIG A;  1V54 C;  1YDX A;  2Q5Z A;  4F4L A;  2EX3 A;  4ZOL B;  1FPO A;  4JAU A;  2RQ6 A;  4E2L A;  5IY5 B;  3HR0 A;  3ZX6 A;  1OCC B;  4FPP A;  4A5U B;  2GUZ B;  2DE0 X;  4JI8 O;  3N2K B;  1I7F A;  1N8R W;  4QGP A;  4X1Y B;  4DR3 B;  3BRC A;  3ABL B;  2FL4 A;  4CH6 A;  4RUF A;  5EYP A;  5LA6 A;  1FXV A;  1SS3 A;  4ABM A;  5EBW C;  5HFL A;  1PNM A;  3F7V C;  4GX5 A;  3AG4 B;  3CCL V;  1VAR A;  1COW G;  3CXH F;  4OGQ B;  3CCU V;  4LFA O;  3ABM B;  4KFM A;  1GAX A;  1K5Q A;  3K08 A;  5E79 Z;  4O4L B;  1N34 O;  2QM8 A;  1E1R G;  2IH3 C;  4QPK A;  1NTM H;  2EIM B;  1OJH A;  1SQP H;  1RP3 B;  4GKJ O;  5IJ0 B;  2Y4U A;  3BEH A;  4DV0 B;  4LF6 O;  3T4D A;  4LCU C;  5CB4 A;  1XMO B;  1FXK B;  2Y48 A;  1GN2 A;  4J11 A;  1L0N H;  2YIB D;  3SYC A;  4JYB A;  4LBE C;  2CK3 G;  2F95 B;  3RYF B;  1NR7 A;  3UO3 A;  4FLV A;  4CS3 A;  2JGD B;  1H2K A;  1Y76 B;  2Q0O C;  1SQB H;  1OHH G;  3ABU A;  3SJB C;  5LGU A;  2CGO A;  4BW9 A;  4RQF A;  2EZP A;  4BW5 A;  1P84 F;  1UJW B;  1XBL A;  2G38 A;  4K0K O;  2QWQ B;  4I55 A;  3T1H O;  1M57 B;  4BWA A;  3JAT A;  2UUA O;  4JI5 B;  3DXR B;  1KKD A;  1XRE A;  3K9S A;  1H8E G;  3UO2 A;  2HP8 A;  3BFR A;  1NQT A;  4R6Z A;  2ZM6 O;  3Q4H A;  4UV9 A;  5GON B;  3RBZ A;  2ILM A;  1NVP B;  3RGB A;  4XBF A;  1D5N A;  1XHX A;  4JI6 B;  4EEQ A;  5LXT A;  1VQ4 V;  5LMN B;  3ZRW B;  3K03 A;  3K59 A;  1W2B U;  1N32 O;  2PI5 A;  4JI7 B;  4ZHQ A;  2LJ2 A;  1XNQ O;  3UKM A;  2NR5 A;  4LF8 B;  1VQO V;  3D36 C;  4AI8 A;  4U7O A;  4EB6 A;  1PNK A;  3X2Q B;  3ZMU A;  3U0Z A;  2JGU A;  2QM7 A;  1SKV A;  4W4K A;  2YS8 A;  1YVW A;  2EIN C;  4ZI7 A;  3FB8 C;  2JEU A;  5KA5 A;  4LNU A;  1IBL B;  3CB2 A;  2YIC A;  2B5U A;  1O9G A;  4MS2 A;  3PN1 A;  3SYP A;  5EIB C;  4MTX A;  3QNE A;  2FML A;  1S76 D;  5LMU B;  5B1N A;  5IJ9 B;  1VQ8 V;  3OMN B;  1BZK A;  4GZR B;  2ZXW B;  2QTO A;  4B3T O;  1FJG B;  2ITC C;  1FFX B;  3IC7 A;  1YXB A;  1JFF B;  4O4I A;  1MZF A;  4FLY A;  2JIZ G;  3CMA V;  2CTQ A;  2PYJ A;  3E22 B;  4DR2 B;  3C3T A;  1HNW O;  5B1O A;  1GN6 A;  5J2T A;  1N36 O;  3E89 A;  5H6Q A;  2Q8V A;  3A2F A;  3G71 V;  3OEE G;  1MOF A;  2XOK G;  4GYC B;  4YHH O;  4MVM A;  2E75 B;  1VQM V;  1J5E B;  3G80 A;  1R6N A;  4DO2 A;  1SER A;  3D3Q A;  1NBM G;  4NVP A;  3W7S A;  3FB7 C;  4X64 O;  3FD9 A;  1TGO A;  1KKC A;  3T2M A;  2IU3 A;  4UCO A;  4P2Z A;  3H1H H;  2NNU A;  1QU7 A;  3D36 A;  4JAV A;  4HNA A;  2QEX V;  1Y74 A;  1HNZ O;  1YCI A;  4KXR A;  1H2G A;  5CA0 A;  2XND G;  1QR9 A;  4JZ2 A;  4DV7 B;  3B77 A;  1PD3 A;  5KX5 B;  2ZIM A;  1K4D C;  4X1K B;  2CH7 A;  1RSO B;  2K1E A;  4AQY B;  1LR1 A;  3RWR D;  3JYC A;  5L3B A;  1JQ0 A;  3T4Z A;  2PY5 A;  2E76 B;  4PD4 F;  3ICX A;  4LC1 A;  1G1X B;  1SZX A;  3W7T A;  1QHT A;  4WFH A;  1SQX H;  1TUB B;  3TK1 A;  5JH7 B;  2WLN A;  3ZMS A;  2YDE A;  4X66 O;  2RMK B;  4H13 B;  1XNR B;  4PDR A;  2ZR3 A;  1AB3 A;  4KUM A;  1JOY A;  3OR6 C;  3JAK B;  2JJ1 G;  2VQE B;  2WLI A;  3PJS K;  2ETN A;  2M7W A;  4K35 A;  1EM1 A;  1I5X A;  3RYI A;  3CRR A;  1IDS A;  2FB5 A;  4IGG A;  3ASO B;  2AHY A;  2ZQM A;  2UUB O;  4DR4 O;  4I5S A;  1G6U A;  2YXH A;  4DK1 A;  3I55 V;  5B3S B;  2Q7E A;  2WAM A;  5HFM A;  3IFX A;  4LF9 B;  3ASN C;  1IBK B;  1Y6X A;  3ZJZ A;  4DV4 B;  1IUR A;  1WA8 A;  1L1F A;  5L3F A;  4I4T A;  1NZ6 A;  4JAS A;  1TVK A;  1QCE A;  4K8Z A;  2RCV A;  3LSS A;  4YJ2 A;  2P5O A;  3WB0 A;  4DR5 B;  4JYA B;  2YEV A;  4L87 A;  2CTR A;  2DQ3 A;  2AHZ A;  2XTA A;  3HKE B;  4DR1 O;  1GO3 F;  2XAF A;  3AG1 B;  2DJV A;  1VQ6 V;  2CTW A;  1J95 A;  1I94 O;  3APQ A;  1SC5 B;  4LF4 B;  3GVM A;  5H6R A;  1V55 C;  2YI8 A;  3SPJ A;  4TV8 A;  5L3E A;  3M99 B;  3VQX A;  1VQL V;  2EIL B;  4FLX A;  5KUK A;  1S72 V;  5C93 A;  2H8P C;  2LFS A;  4TOI A;  5LOV A;  1WPB A;  2P67 A;  1GH6 A;  4JYY A;  1NR1 A;  2ZNI A;  2HJF C;  4JI4 O;  5CBH A;  3K9A A;  4DV3 B;  2DYR B;  1N0N A;  4TWK A;  1KP2 A;  2AGA A;  3E86 A;  5H9C A;  1RFY A;  3SYQ A;  1K7D A;  4EKW A;  3ZHU A;  4O2A B;  4TUY A;  4DV6 O;  1BCC H;  2GV9 A;  5LL6 Y;  1EZV H;  5FPR A;  2X6C A;  5A2Q N;  2ZT9 B;  1DTO A;  1GTO A;  1L8D A;  4CS2 A;  2IJJ A;  1FFT B;  2HEP A;  2KG7 B;  3FYI B;  3RFR A;  1ROP A;  4LFB O;  5BR8 B;  3P32 A;  1NT2 B;  3AK1 A;  2WLL A;  3T1Y O;  4MTO A;  2WLH A;  4UCS A;  3RVY A;  2X6B A;  4H33 A;  4UV8 A;  3ZHR A;  1NKD A;  3P3P A;  4LP8 A;  1MG1 A;  4TQD A;  2ADQ B;  4UFZ A;  3GWK C;  3DC6 A;  3D8C A;  3CWB H;  3UCS C;  4JTD B;  3UT5 B;  1OCO B;  2LGQ A;  5BMV A;  3ZIA G;  1VF7 A;  4DR7 O;  2D2C B;  1AR5 A;  2DMX A;  1FYJ A;  4X20 A;  2PUS A;  5E1A C;  4KL1 A;  1QLE C;  3FAV A;  4MVR A;  2UXB O;  2ZCE A;  3WFV A;  4X62 O;  4B3S B;  3OGI B;  1Y66 A;  3MD0 A;  5EYP B;  5LA6 B;  3P3N A;  4DRX A;  2MW2 B;  5DED A;  2ZE5 A;  5JJE B;  1BGY H;  2GTA A;  2P4V A;  4DV1 O;  5JQG A;  1D5A A;  1BQ0 A;  5LHG A;  4DUZ B;  4CS4 A;  3W7X A;  4LF5 O;  2ATK C;  4HZ3 A;  2UXN A;  5KMG B;  4FFB A;  2WA3 A;  1G8M A;  1MNG A;  2M6Y A;  4IYI A;  4D6T H;  5L3D A;  4WFE A;  5EZY A;  1WAZ A;  2R9R B;  5JWP A;  3FB5 C;  2ZR2 A;  2GDS A;  2Y0P A;  3IAY A;  1PL0 A;  4DV3 O;  5CB4 B;  4NXM B;  1NH2 B;  4X65 O;  2LW1 A;  1H2S B;  1THZ A;  4I0X A;  5KHK A;  3BHP A;  3KKY A;  4K3A A;  1OCZ C;  1BHB A;  1K3E A;  1P7B A;  5CN0 A;  3AG3 B;  1K34 A;  3CJH A;  5KHG A;  2EIJ B;  2ZIN A;  4DYL A;  2KKW A;  2XAJ A;  1Y4M A;  1H38 A;  3WB2 A;  5FLX N;  1KEC A;  4IT5 A;  2Q0A A;  2EUL A;  3R65 A;  1MSW D;  1PV0 A;  4IYH A;  4QJF B;  1V9P A;  3K79 A;  4I55 B;  3TJT A;  3CCR V;  4FLW A;  2XHB A;  3JAT B;  4F6R A;  2Q69 A;  4GX0 A;  4UUJ C;  2E5L O;  3M8A A;  1Q6U A;  1CPY A;  4O4H A;  2Y0I A;  2QWO B;  3L71 H;  3ZMV A;  1HNX O;  3SYA A;  4PA3 A;  4JV5 O;  1R1B A;  1LUV A;  3R66 A;  2HVJ C;  3LNN A;  3VQV A;  1IX9 A;  1AP6 A;  3HKB A;  1JMK C;  3I5D A;  3CHX A;  2P7T C;  1NS1 A;  4I50 B;  1K92 A;  4ZHQ B;  3K3W A;  2AW9 A;  3CX5 F;  2A79 B;  2A7W A;  1LUW A;  4P9O A;  5LHI A;  1N33 O;  2L6L A;  5FL7 G;  1PL4 A;  4ZI7 B;  1EN6 A;  2UXC B;  4L8J A;  1HP8 A;  4HYO A;  1K4C C;  2WLJ A;  4JTC B;  2R9I A;  1MMM A;  4JAA A;  1YSC A;  4ZIB A;  4J7J A;  2UU9 O;  3OTF A;  5B1A C;  1SQV H;  1HR0 B;  3IC9 A;  4Q6G A;  4JI0 O;  2VQF O;  5IDJ A;  2AZ2 A;  4R8C A;  4NYK A;  2H3O A;  5D5P A;  4MTG A;  5IWA B;  1F7Y A;  2Q68 A;  4G27 B;  3CCS V;  3ABT A;  5J2T B;  1NJI W;  4FZ0 A;  5GTH Z;  3BVO A;  5TIS Z;  4DR6 O;  1Q7Y W;  1YJN V;  2XAH A;  2QWR B;  2CAZ C;  4EFB A;  1SA0 A;  5ITZ B;  4JI2 O;  1WP7 A;  3JSL A;  3FFQ A;  4LFC O;  4BR6 A;  2KQX A;  3JD3 A;  4QPJ A;  3ABK C;  3OTO B;  5LYJ A;  3RYC A;  2DYS B;  3OM3 B;  2PZS A;  2E3C A;  5D5Q A;  1VQK V;  2BE3 A;  4FLU A;  2ZE7 A;  3STL C;  1VQP V;  5IYZ A;  3OR7 C;  1OCC C;  5C8Y A;  4B08 A;  4NXN B;  3MDS A;  3OFN G;  5B1B B;  4HNA B;  4YJ3 A;  2F66 C;  1Y74 B;  3NXS A;  3EXA A;  1I5Y A;  2GHY A;  1SQF A;  4B3R O;  5CA0 B;  2Q7G A;  3A8T A;  3ABL C;  1Z2G A;  1EN5 A;  4PDM A;  1JPX A;  2Y69 C;  3QF7 A;  1XIL A;  3E8F A;  1XI1 A;  2A3Q A;  3L74 H;  5LP6 B;  3HKC B;  1RM1 B;  1ZL8 A;  5CMU A;  3L73 H;  3O9O A;  3CME V;  1U96 A;  1IBM B;  3H1I H;  4IIJ A;  1Y67 A;  3N27 A;  4PDV A;  3B2E E;  1X59 A;  1DK1 A;  4WCE V;  4R7C A;  4RWU A;  1QNM A;  2EIM C;  2WLM A;  2ZE8 A;  4B3M B;  3JAL B;  3S3W A;  2QDO A;  3IGA C;  1NH2 D;  3CSX A;  4DR3 O;  1GM9 A;  4H37 A;  2RN9 A;  2CDY A;  1B06 A;  2YI9 A;  1S3J A;  3THO A;  3EFF K;  3HKD A;  1URF A;  2HVK C;  2WLI B;  4DK0 A;  4N23 A;  1JJ2 U;  1NI8 A;  5H5N A;  3OMA B;  3RYI B;  1HR0 O;  2DOS A;  5KHI A;  4TV9 B;  5GW7 A;  3CRM A;  1F23 A;  2BCC H;  1H2N A;  1W59 A;  1WJZ A;  1R73 A;  4BIO A;  3D3I A;  5H2F Z;  1M56 C;  1WA8 B;  4I4T B;  4DV0 O;  1TVK B;  3ZMT A;  2GUZ A;  1CEZ A;  1M57 C;  1TUE B;  1XMO O;  3LUT B;  3N2K A;  3JAS A;  4YJ2 B;  3WU2 Z;  4MVZ A;  2Q67 A;  4CBC A;  3K5N A;  2P6J A;  4KHP B;  1UPG A;  1SQG A;  4J9Y B;  4FZ1 A;  1BQZ A;  2H94 A;  2WSS G;  5BZB A;  3TCU A;  4B7K A;  3QO7 A;  4QE7 A;  4O4J A;  3K58 A;  2ZKO A;  4WFF A;  4YIO A;  2OCC C;  4PJ0 Z;  2EIK C;  3A0B Z;  1SF9 A;  4O4L A;  3HB3 B;  5F2V O;  2CE4 A;  3G4S V;  4TV8 B;  3AEI A;  3OEH G;  2HHH B;  3L75 H;  5IE9 A;  4J80 A;  1CXZ B;  2JS3 A;  3ZED A;  4JI5 O;  5LOV B;  3JSN A;  3X2Q C;  2BOC C;  2Z5U A;  5JVD B;  4DV5 B;  1YJ9 V;  1D2D A;  1Q3E A;  2LW7 A;  1MA1 A;  2UXD B;  1VQ9 V;  5KLV H;  3RYF A;  1IXB A;  2JGD A;  2N05 A;  4JI6 O;  2CTP A;  4DUY B;  4TUY B;  5LMN O;  3G67 A;  1W0J G;  3ASN B;  4AIL C;  1OZ0 A;  1P4R A;  4JI7 O;  2ZXW C;  2OWO A;  2N74 A;  5DN6 G;  4LF8 O;  1KBH A;  3H1L H;  4X88 A;  2QWN B;  4JI1 B;  2R9A A;  2EJR A;  4UB6 Z;  5DEC A;  4WFA V;  2GTS A;  2YUA A;  2WLL B;  1UFI A;  2X6A A;  1Q90 D;  1AR4 A;  1JR9 A;  1IBL O;  1JA8 A;  5EBM C;  3ZBH A;  5GON A;  5KA6 A;  1AP5 A;  4OX9 B;  3DC5 A;  5LMU O;  2BTQ A;  3ZRW A;  5JCO C;  4CH5 A;  3CRC A;  1FJG O;  1Q43 A;  3KZI Z;  4FMT A;  2ZDI C;  2B1I A;  3GB7 C;  4X20 B;  2ITD C;  3UQ8 A;  4LWS B;  3CYO A;  4DR2 O;  3CCQ V;  2YC0 A;  3CRQ A;  3W7U A;  2RJZ A;  2A9H A;  1XQ8 A;  3T1C A;  1BMF G;  3B4S A;  1ZAU A;  5EIB D;  4NTW A;  4J7K A;  1TA8 A;  1I08 A;  2HLD G;  1J5E O;  4TSF G;  3AK3 A;  5IJ9 A;  5JQG B;  3K5O A;  5KHH A;  2HJD A;  1Q8I A;  5K1X A;  4FFB B;  4LH7 A;  1YJW V;  5EZY B;  4W4L A;  2V7Q G;  2XUM A;  3SR2 C;  2PTM A;  3AG2 B;  2JS5 A;  4X1I A;  2WPD G;  4JYC A;  4DV7 O;  1RPR A;  3WG7 B;  3CCE V;  1MZE A;  4I0X B;  1VF5 B;  1DF4 A;  3TGU H;  1AVM A;  4AQY O;  4JTA B;  2F4V B;  5JCO A;  3ASO C;  5IT9 N;  1M5I A;  1NU1 H;  2KB1 A;  2ODM A;  1CP9 A;  5B3S C;  3CXC U;  4GLX A;  2E74 B;  1R3J C;  5CA1 B;  2VWJ A;  4LF7 B;  3E8G A;  4G28 B;  2MK3 A;  5CBG A;  3J81 N;  1XNR O;  4F6R B;  2RDC A;  2YSU B;  1R3K C;  3A0H Z;  3CD6 V;  4GX1 A;  3TXQ A;  2VQE O;  4DV2 B;  4O4H B;  3QVN A;  1BSM A;  1RSO A;  4NR1 A;  3OW2 U;  1ZSP A;  2OCH A;  4LF9 O;  3AG1 C;  3QO8 A;  4O2B B;  1IBK O;  1FS0 G;  4DV4 O;  3HKB B;  1GN3 A;  1AI7 A;  3JAR A;  4JI3 B;  1GK9 A;  4QIW F;  1DLB A;  2OYQ A;  1Q86 W;  1QQC A;  3OUF A;  1VF6 C;  4DR5 O;  1WN7 A;  3OAA G;  4JYA O;  4Q20 A;  3JD2 A;  4YY3 B;  4AHC A;  3FX7 A;  4G2K A;  3VBB A;  3JAK A;  1OCZ B;  2P06 A;  1M9N A;  3CC7 V;  3U11 A;  2DYR C;  4D7T A;  1S77 D;  2BSK A;  1WLE A;  1ZX3 A;  1VQ5 V;  4PA7 A;  2CGN A;  3ZMZ A;  3B8N A;  3KCX A;  2JK5 C;  4BIU A;  1OCR B;  2IJI A;  2QR4 A;  4PDL A;  4LF4 O;  3BA8 A;  5L3G A;  1Q6H A;  4IL6 Z;  5DM6 V;  1R6K A;  2Q4P A;  3A0R A;  4ZKI A;  3ETD A;  3DGE A;  3RT3 C;  3AG7 A;  2QKA A;  1O9H A;  5FNV A;  1AI6 A;  1IZ3 A;  1P49 A;  3L72 H;  4JI8 B;  4PI0 A;  3J80 N;  4OPH A;  2HFE C;  1HW7 A;  3F5T A;  1SA0 B;  2F1M A;  3KCY A;  4FM0 A;  4MVU A;  1YHQ V;  2R72 A;  5LYJ B;  4J9Z B;  1JCH A;  3RYC B;  1V54 B;  3M7M X;  1OCO C;  1VF6 A;  4LFA B;  2VS0 A;  2PYL A;  2JDI G;  1H2M A;  4OXS A;  5IYZ B;  5BR8 O;  2YID A;  5C8Y B;  3ZRV A;  4YJ3 B;  1N34 B;  2IJH A;  2ZD9 A;  1AIL A;  3H9V A;  4LF6 B;  2XAG A;  3LNM B;  1TAE A;  1F4N A;  4O2A A;  3SJC C;  4X9Q A;  1ZL8 B;  3B40 A;  4N21 A;  2V1D A;  3JD0 A;  3B09 A;  3Q4H B;  2R70 A;  3JAM N;  3E35 A;  1B04 A;  5B5E Z;  4H0L B;  3G6E V;  2Y4T A;  2IW5 A;  1KMI Z;  4X89 A;  3JAW A;  4IHJ A;  1S0V A;  2IH1 C;  5LXT B;  1AJP A;  1EN4 A;  2KG7 A;  2VRZ A;  1BS3 A;  2KSD A;  1XUQ A;  4UCU A;  5LHH A;  4JF3 A;  4RAI A;  4CC6 A;  1KU9 A;  4K0K B;  4B3S O;  5J2U A;  3T1H B;  1WB7 A;  4EB6 B;  3RN4 A;  2UXX A;  4U3J A;  1OV9 A;  2LQT A;  1SES A;  4CZZ A;  3ZHQ A;  4WFB V;  2UUA B;  3O65 A;  2X7R B;  4BIZ A;  5KAI Z;  2Q73 A;  4NB5 A;  3BPZ A;  2YIB A;  2EIJ C;  3FB6 C;  4DUZ O;  2ZM6 B;  4LNU B;  2K9P A;  5IYB O;  2LO1 A;  1VMG A;  3ML0 A;  1XEQ A;  3UT5 A;  1IXM A;  4ZBM A;  1VIB A;  3ZHT A;  2D3O W;  2FYU H;  3E2E A;  3J7A U;  1WB8 A;  5BY1 A;  4XDL A;  1N32 B;  4NXM O;  2C2A A;  3LSQ A;  4J10 A;  1ZWI C;  3JAS B;  3ETE A;  2UUC B;  2O57 A;  4O4I B;  4K8X A;  3ZN0 A;  4MVQ A;  1XNQ B;  5LGN A;  2Y69 B;  2FTK A;  2V4D A;  1F4M A;  4FM2 A;  1M90 W;  4JPR A;  3E8B A;  1EBO A;  1PPJ H;  4YXW G;  4UXN A;  4HBN A;  3VOU A;  3CCM V;  1XMQ B;  5KMG A;  3K0G A;  4O4J B;  3OE7 G;  2DWD C;  4PI2 A;  3ETQ A;  4DW0 A;  4J41 A;  1GN4 A;  3H01 A;  3E8H A;  4P9P A;  2QTS A;  4B3T B;  1NTK H;  1NTZ H;  5IY5 C;  3SGI A;  1K73 W;  3EHB B;  1YI2 V;  1F51 A;  3H1K H;  1KUQ A;  1R3L C;  1HNW B;  4WBN A;  1BE3 H;  1N36 B;  2EIN B;  3C90 A;  3B8M A;  4B7E A;  1R3I C;  1KP3 A;  4YHH B;  2W6I G;  1KD1 W;  2CH7 B;  3AG4 C;  2ZIO A;  1HDJ A;  1M56 B;  2EZO A;  2P4K A;  1FD9 A;  1XOU A;  4QNH B;  1KC8 W;  3ABM C;  4X64 B;  2ZE6 A;  1AR1 B;  2Q6A A;  3SJQ C;  2IU0 A;  1WNS A;  3FYE B;  4DW1 A;  1HNZ B;  1PM9 A;  2UXC O;  3TXS A;  3G6B A;  1FXK C;  2VWK A;  1XHZ A;  2OIE A;  5IYD O;  4I7Z B;  4HAM A;  4LR3 A;  1ZUQ A;  3AK2 A;  2PF4 E;  1EZJ A;  1YZB A;  2OCC B;  3RYH A;  2BTQ B;  3BAB A;  2EIK B;  3N2G A;  3SPI A;  5KUM A;  4RQE A;  4FVM A;  4I50 A;  2DYS C;  3F5W C;  4LH6 A;  2UUC O;  4UVA A;  4ZOL A;  5IWA O;  1ORQ C;  3CCV V;  5B1B C;  1FKA O;  5KHJ A;  2QGN A;  2NLJ C;  3LDC A;  3C3S A;  3OGC C;  5KAF Z;  1QR8 A;  5EC2 C;  1KYO F;  2Q7H A;  3K04 A;  4X1Y A;  1XDC A;  3SDL A;  1XMQ O;  2BOB C;  4X66 B;  1SET A;  5LP6 C;  2YEV B;  1RM1 C;  4PA6 A;  2DW4 A;  3H1J H;  1JX9 A;  2QKS A;  1WP8 A;  5FPO A;  2AZ0 A;  3OTO O;  4I9W A;  3QO5 A;  1N0J A;  2QSA A;  1SQQ H;  4FLZ A;  2UUB B;  4DR4 B;  1VQ7 V;  4NXN O;  4U7N A;  1IVS A;  5JJJ B;  2QE7 G;  3BY6 A;  4PA9 A;  4X1I B;  5IJ0 A;  4XDK A;  3RVZ A;  5EC1 C;  1YTF D;  4GKK B;  1H2L A;  2YXL A;  4JGS A;  3K5L A;  1GKF A;  3ZHV A;  1FXK A;  3JD4 A;  1R6T A;  4F6E A;  3GWO A;  5ITZ A;  2IM9 A;  1IBM O;  2P22 C;  1DGS A;  3UM7 A;  5EK0 A;  1SRY A;  1HWY A;  3LDE A;  2EBO A;  2N04 A;  3WB1 A;  2LFR A;  1Z5W A;  1Y76 A;  4JZG A;  3K06 A;  3L70 H;  4NTX A;  1KQS U;  4DR1 B;  4B3M O;  1E1Q G;  1LNQ A;  3BCC H;  1WPX A;  1I94 B;  1QBZ A;  4C7U A;  3STZ C;  4EFE A;  4H44 B;  3APO A;  5IYC O;  3K57 A;  1H8H G;  4Z1V A;  3DXR A;  1B3Q A;  3E83 A;  5LP6 A;  3HKC A;  4MW3 A;  4ASU G;  1E79 G;  4FJC C;  2QM4 A;  4JI4 B;  3LSU A;  3CCJ V;  3OT7 A;  3BAA A;  1ARO P;  4X8A A;  3VQY A;  2WWW A;  1X4T A;  3CEI A;  2QKC A;  4DV6 B;  3JAR B;  3KG2 A;  2EJ7 A;  3JAL A;  1DF5 A;  1V55 B;  4CC5 A;  2X0L A;  5BMV B;  2F93 B;  4MW8 A;  2LP7 A;  3ZS8 C;  4KHP O;  2ZNJ A;  2B1G A;  4LFB B;  2OT5 A;  2QJ1 A;  3T1Y B;  3FAV B;  1AI5 A;  4TV9 A;  4GT1 A;  4WFG A;  2BSK B;  1US6 A;  4DRX B;  4FK5 C;  3DTU B;  1S5J A;  2QA4 V;  3JCZ A;  4MTF A;  4NKG B;  2HHH O;  4GKK O;  1MSD A;  3FKS G;  4RUE A;  1BHA A;  2B9Z A;  4GCZ A;  3VQW A;  2JVD A;  1YIJ V;  1BT8 A;  3ZN1 A;  2W6J G;  2Z0A A;  1Q81 W;  4PEL A; 
#chains in the Genus database with same CATH homology
 1Y74 B;  1Y76 B;  1Y74 A;  1Y76 A;  1RSO B;  3B40 A;  1VF6 C;  1VF6 A;  1ZL8 B;  1ZL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...