1VF6C

2.1 angstrom crystal structure of the pals-1-l27n and patj l27 heterodimer complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
51
structure length
51
Chain Sequence
QDPDVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PALS1-associated tight junction protein
publication title Structural basis for L27 domain-mediated assembly of signaling and cell polarity complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/protein transport
total genus 24
structure length 51
sequence length 51
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09060 L27_N L27_N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1vf6C00
1ZL8A 1ZL8B 3B40A 1Y74B 1Y74A 1Y76B 1Y76A 1RSOB 1VF6C 1VF6A
chains in the Genus database with same CATH superfamily
1N0JA 3G4SV 2HHHO 2P67A 5EBMC 2DJVA 5KX5A 1PPJH 5EK0A 2R9RB 1GO3F 5KAFZ 3ZMZA 3X2QB 1KMIZ 1H2GA 4JI2O 2VS0A 3T4ZA 3QO7A 3AK3A 5JCOC 4OX9O 3OGCC 3RWRD 1Y4MA 1K7DA 4WFBV 1R3IC 4Z1MG 5CMUA 4PELA 2Q9LA 3P3NA 3QO8A 1S3JA 2PYLA 5IY5B 5IJ0A 4KL1A 4PD4F 1XBLA 1HDJA 4G2KA 4LR3A 3SJAC 4PA3A 1Q82W 1SQQH 4JYAO 1HNXB 4R7CA 3FB6C 3WG7B 5HFMA 2X6CA 1N34O 3AG7A 3HKDB 1AP5A 3ZCCA 1RSOB 3K9SA 1NVPB 4PA6A 1A32A 2PZSA 2A7WA 3ZHTA 1XEQA 4MVOA 4P9OA 4B3MO 3C90A 1SETA 3CRQA 4X89A 4TOIA 4LF7O 2F43G 2RQ6A 1JJOA 4U3JB 4O2BB 3APOA 1FS0G 4JYBA 5BR8O 3OEHG 2UUCB 5LL6Y 4JTAB 3OR6C 2DWDC 1Q90D 1Q86W 1FJGO 1ORQC 1QVFU 1CP9A 5DM6V 3MHSC 1IBLO 3OM3B 3UT5B 1NQTA 4P2ZA 2QTSA 4F6RA 3E86A 3LSUA 4DR7O 1VQ8V 2XAJA 3K5LA 3IFXA 1E79G 4TV8A 1SQBH 5KA5A 4J9YB 4UCTA 1K97A 1M90W 5JVDA 2UXBB 1V9PA 3CSXA 2HVKC 2ZINA 4DR4B 2YIBA 3EFFK 4J9ZB 2ZM6O 2HP8A 4QNHB 3GVMA 3FYIB 2PGGA 4X88A 3CCLV 3K0DA 1SQGA 1QU7A 3AG2B 2ZR3A 3JD2A 2A0LA 1NVPD 2QWPB 1JCHA 3OAAG 4QGPA 1Y76A 2JVDA 3NXSA 2FTKA 1VF6A 2WA4A 1I5XA 1IBKB 1IXBA 5JH7B 4NR1A 1LUWA 3S3XA 2HR3A 1AR5A 4FM2A 1SF9A 4R8CA 1JFFA 1X59A 2ARHA 2YICA 2DE0X 1FD9A 2QWQB 4DV4B 3MDSA 1BT8A 4UCUA 1ZTEA 3M8AA 1DLBA 4UCOA 3ABTA 3THOA 1GN2A 4MVUA 2Y48A 2NR5A 4AQYO 4B3SO 3WFVA 1GM8A 3RYFB 4DV7O 2MK3A 2WA3A 2UUBO 4PV1B 5L3CA 2RCVA 3GWKC 4DXWA 4LH7A 4NTXA 5FLXN 3OMIB 4PDLA 1E1RG 1HW7A 3LDCA 3M99B 3RYHB 4J41A 1I94O 4CH3A 2M7WA 2RNBA 4TSFG 3OEEG 2HFEC 2UXCB 4BIZA 1XMQB 2PI4A 2JJ1G 3T1HB 1YSCA 1J95A 1Z5WA 1RSOA 2F4VB 1GAXA 4IL6Z 2ZT9B 3APQA 3CRAA 2BCCH 3RBZA 3SDLA 1WPXA 1WB8A 5B3SB 4O4IB 2JRIA 3N2GB 4YJ3B 3HPLC 2IJJA 4AHCA 4JV5B 1M93A 1M57C 4UB6Z 2AZ0A 4U3JA 4O2BA 4X1YB 2XAFA 4LFBO 1W2BU 1YXBA 4YXWG 1Y6XA 4XDKA 3PN1A 3ZHUA 1VQKV 1ENVA 1AI6A 2GTAA 1PNLA 1NJIW 3UT5A 4BW9A 1WJZA 1X4TA 2B1GA 4YY3B 4E2LA 3CRRA 2B5UA 2UU9B 5BXZA 4QPKA 3ETQA 2JEUA 3ABLC 1L8DA 3IJ4A 4R50A 2CUGA 2JS5A 1Z2GA 4DK1A 5BY1A 2HG5C 3A0HZ 3OUSA 4X20B 3CP1A 4GKKB 3TCUA 1SRYA 1XNQO 3CEIA 4DUYB 4LWSB 4BW5A 1T5EA 4CS2A 4GX1A 1N32B 2LO1A 4KUMA 1JR9A 3N2KB 1AJQA 4EFBA 1DF5A 3HKEA 1XI1A 3QO5A 3ETGA 3H1HH 5D5QA 5LXTB 1SA0B 4X62O 1GRJA 4LC1A 5JCOA 4TT3G 4O4LB 3D36A 1ZWIC 3J81N 2HHHB 1WLEA 4JYYA 4ZI7B 1CPYA 2V4DA 3H9VA 3AG1C 4YIPA 2L6LA 4DW0A 4DV3O 1BSMA 2ITDC 3GWOA 5FPRA 1FFXB 4FLXA 3G6BA 2EILB 2Y4UA 3RYCB 2P5OA 4FM1A 4JI2B 1P49A 3QNEA 2UXDO 5KUKA 4OX9B 1B6QA 4JI1O 4X65O 4NYKA 3RYFA 3SPHA 3B09A 4MTOA 4UFZA 3KKYA 2W6IG 3JCUZ 4OXSA 2QKAA 1K34A 3BABA 5E1AC 1BGYH 3RYHA 1M57B 4GT1A 4JYAB 4G27B 2EX3A 4DV5O 2E3CA 1N34B 1DK1A 5JWPA 5GTHZ 3L70H 4FLVA 5IYZA 4TWKA 4I9QA 3E8BA 4X1IA 4MT8A 5LHGA 2Q7GA 1P7GA 4RAIA 2OTJV 4IGGA 4B3MB 4J80A 2Y69B 5LMNO 2GSMB 4LF7B 5KX5B 1H2LA 3N2GA 4K8XA 1JPXA 3SPIA 3K04A 3L71H 1H2NA 5LGUA 3UO3A 4I5SA 5BR8B 1VF6C 1RPOA 4HAMA 4DV4O 4X1YA 1F23A 3JD1A 2F95B 4RWUA 3OMNB 1FJGB 4IYHA 1YJ9V 4UV8A 4WFFA 3T1CA 4QPJA 4HNAB 1OCZC 1IBLB 1TA8A 1S5JA 4DR7B 4FFKA 1GN4A 1YI2V 4O4JB 3ZHVA 3ZHRA 1EZJA 4CC6A 3ZX6A 2QKSA 3W7SA 2LFSA 3LSSA 1SKVA 3DSQA 1WA8B 2ZM6B 2BOBC 4B7KA 1PKXA 2IU0A 1G8MA 1K33A 2MW2B 1Q81W 4CC5A 5CA1A 4N21A 4X20A 2F1MA 4LWSA 2ZE8A 3FB5C 4TV9B 5EIBD 2Q7EA 4X66O 3N2KA 4QE7A 5IY5C 4CS3A 4JI7O 1KECA 4JI3O 4Q20A 1BQZA 2ZQMA 2F66C 5LXTA 1SA0A 1WPBA 3U11A 1EBOA 2KQXA 3WG7C 4CH5A 1G4YB 4O4LA 5A9GA 3HKCB 2ZD9A 3CJHB 4LNUB 4E4EA 1EN4A 1S77D 4ZI7A 3DC5A 2A79B 4FJCC 2YXYA 2QWRB 5EZYA 4J7KA 3ZRVA 4DR2O 4KP4A 4B7EA 1B06A 5KAIZ 1XQ8A 3ZRXA 5K1XA 1FFXA 1HP8A 3SPJA 3RYCA 2CAZC 3UKMA 4TV8B 1TUBA 4I50A 4MVMA 1TAEA 4Z1VA 3P30A 4AQYB 4B3SB 4DV7B 4EEQA 2UUBB 3MHHC 4QIWF 2LP7A 3B77A 5C8YB 4XDLA 3P32A 1K92A 2Q69A 3ML0A 1OZ0A 1WAZA 1VQ4V 1I94B 3E8HA 3ZIAG 4PDMA 1VQLV 1N0NA 4FMTA 3CCJV 5HFLA 3E22B 3SR2C 2JK5C 2N74A 2XNDG 4JPRA 1DGSA 4NVPA 4ZHQA 4IHJB 4UUJC 2DN9A 1ZX3A 2XUMA 2RDCA 2WSSG 3A0RA 1L0LH 1FXKA 2Q7HA 1KKDA 1P4RA 4UVCA 4BAYA 1I7FA 1M9NA 3AG2C 1JFFB 3BA8A 3ZRWB 2LFRA 4JAUA 3EHBB 1S72V 4FM0A 3E83A 4LFBB 5KHGA 2Q67A 4U7OA 1FFTB 2CTWA 3FAVB 5L3GA 2X6BA 3BY6A 1AROP 1B04A 1GH6A 1M56C 2ADPA 5IT9N 1V54B 3KG2A 1OCRB 2Q0AA 3D36C 3SJQC 4HNAA 2RJZA 3STZC 1R3KC 2YIDA 1YITV 1O9GA 1NH2B 3A8TA 3B40A 3BAAA 1JOYA 2WLKA 5CBHA 5CB4B 3K9AA 1HNWO 4O4JA 3JAKA 3ABUA 4K35A 2X6AA 4MVZA 4RO2A 3K57A 1XOUA 1K3EA 1RFYA 4LF4O 2WLHA 2JJ2G 4ICGA 2C2AA 1MG1A 1IURA 4JTCB 4OPAA 1WA8A 1QR9A 3CCQV 1ZUQA 4JZ2A 5BMVB 5IWAO 3ABMC 1XNQB 4DR3O 1US6A 3CC7V 2WLIB 2W6JG 1XL4A 2FMLA 3ZMSA 1S76D 3CS5A 5DN6G 2UXXA 4QE9A 2ZIMA 4TV9A 3TXQA 3AG3B 2CTPA 1NKDA 4PA4A 3JAMN 1ZL8B 1DF4A 1R6TA 4X62B 2CH7B 1S5LZ 1K8AW 1YCIA 2FL4A 2B1IA 3ASOB 3FKSG 1D2DA 4JI6O 5B1AC 3HKCA 3CJHA 3SJCC 2NN4A 4LNUA 4DV3B 3LDDA 1WP8A 1ROPA 1OJHA 3CX5F 4K3AA 2UXDB 5B3SC 1OV9A 4D7SA 4HZ3A 1NH2D 2YXLA 4TQFA 3FFQA 3BRCA 4JI1B 3AEIA 4KHPO 4X65B 5H5NA 4JI0O 4YJ2B 1GMGA 2QWOB 4D7TA 5C8YA 2CTRA 2GTSA 2O57A 3E89A 2PI5A 2ZE6A 4DYLA 1MA1A 1XMOO 3HKEB 1FPOA 1R6KA 4DV5B 4DV6O 2Z3YA 1XILA 2PYJA 3E22A 1U97A 4FLUA 2AGAA 1M56B 4IHJA 5LHIA 2OCHA 2F93B 2ODMA 5LMNB 2IH1C 4X64O 2F23A 2FKXA 2XTAA 4HBNA 3GB7C 3UO2A 1QQCA 2YS8A 4UB8Z 3ZRWA 4X9QA 1GN6A 2P4VA 3FD9A 4XDJA 3TXSA 3OTOO 5B1NA 3FAVA 3ABMB 4MW3A 5ITZB 1NTKH 1VIBA 4ZIBA 1B3QA 1F7YA 1UPGA 2YXHA 5IDJA 1NTMH 1VQ7V 3F5WC 3CXCU 5CA0A 1SZTA 4UCSA 3K5NA 5CB4A 1EFRG 4P9PA 5KHJA 1QCEA 4DV0O 2EINB 2EIJC 2NNUA 2EILC 2ZE5A 4PJ0Z 1N36O 1W0KG 5IYZB 1Q43A 4X1IB 5JQGB 2A3QA 4YHHO 5BMVA 5B1AB 5C93A 3JALB 3K58A 1VQPV 3BEHA 1O9HA 4DK0A 3CXHF 3F5TA 4X66B 1MSDA 3QTCA 2WLIA 5LA6B 4O2AB 5L3BA 3OUFA 4JI7B 2DOSA 4JI3B 1MOFA 4J42A 4HYOA 1FYJA 3KCXA 1Z5VA 3KCYA 1ZL8A 3M7MX 2ITCC 1R6NA 2CH7A 2OWOA 3JASB 3JATB 3LNMB 4DRXB 5EIBC 5J2TB 1SC5B 1FXKC 4DR2B 2Y69C 4DR1O 4MTFA 4DV1O 1VQ6V 4EB6A 4B08A 3JD3A 3K03A 3JD0A 1AR1B 3FB8C 5LHHA 3RFRA 1RM1B 4D6TH 2Q4PA 2QDOA 1D5NA 2LW7A 4RUEA 4LP8A 4ZKIA 2QSAA 3W7WA 4GYCB 4NXNO 1YTFD 1EN6A 5CA1B 2UUAO 4GUNA 4PDRA 4JASA 4B3TO 4U7NA 4YJ2A 2K1EA 4KXRA 3SPCA 2EULA 1VQNV 2EZPA 4H0LB 1MNGA 2KKWA 2OT5A 1MZEA 5FNVA 2R70A 3IC7A 3H1JH 3CWBH 3BHPA 3CE2A 1F51A 3CB2A 1XDCA 3IAYA 1SQXH 1LR1A 4PA9A 3B2EE 1ZAUA 1TVKB 2BOCC 1XHXA 3OTFA 5EZYB 1MMMA 1R73A 4RUFA 2V7QG 2AXTZ 2CK3G 1VF5B 2EIJB 3VQVA 5CBGA 3CRCA 4CBCA 2ZDIA 3A0BZ 1TUBB 4I50B 1VQ5V 3OT7A 3VOUA 1J5EO 3LNNA 3E8GA 4TUYA 2ZXWB 4B3RO 4JGSA 4I7ZB 4DW1A 5LP6A 4MS2A 5ITZA 4YIOA 3CC4V 2Q6AA 2VWKA 1QNMA 1AJNA 2DQ0A 2R9IA 1SS3A 1VF7A 1AVMA 1HNWB 1I5YA 1YIJV 3VQWA 1FXVA 1PV0A 3ZHQA 3CCVV 3JD4A 4AILC 4LF4B 3R66A 3AK1A 4NTWA 4LF5O 3D8CA 2JDIG 5IWAB 3E8FA 1L1FA 4ZHQB 4LF8O 5JQGA 4DR3B 4MW8A 2HLDG 1AB3A 3FYEB 3JALA 2PTMA 1HR0O 2XHBA 1FXKB 1Q6UA 5H9CA 2HKOA 3LDEA 1NU1H 4FIPC 4UCVA 1YJWV 5LA6A 4O2AA 4FLTA 1COWG 5H6QA 4WF9V 5H2FZ 1KUQA 1BS3A 1WN7A 4J7ZA 2WAMA 4FVMA 2JS3A 4FLZA 2AZ2A 3C3SA 2BTOA 1UJWB 2WPDG 3H1LH 4GLXA 1SESA 3JASA 4JI6B 3JATA 3RN4A 2JIZG 4DRXA 3ZJZA 2G38A 3CCSV 5LMUO 2QR4A 1BQ0A 4LH6A 5J2TA 4DR5O 3T1YO 1Q5OA 3ABKC 2M6YA 1W59A 3JAKB 1XUQA 2UXNA 2YDEA 1N33B 2EZOA 4KHPB 1R1BA 2ZNJA 2GUZB 2KB1A 1EM1A 3ZMUA 2W0XA 1AI5A 4JI0B 3SYPA 1BHAA 3CMAV 3RW0A 1V54C 3IGAC 1OCRC 2AHYA 3L9DA 5B66Z 1XMOB 4CH6A 3WB1A 2XT9A 4DV6B 2XAQA 5GTIZ 4BIOA 3H01A 1Q6IA 1K9MW 1MZFA 1LUVA 4W4KA 4JYCA 1BE3H 1MABG 3U0ZA 1IBMO 2XAHA 1V55B 2YSUB 5TISZ 5B1BC 4F4LA 1SZXA 4X64B 2Q68A 1BHBA 1Y67A 1GM9A 3B4SA 1BL8A 2IBZH 5KMGB 1HWYA 1Y74B 4GZRB 1RPRA 1TVKA 3BVOA 4JAAA 1VARA 3AG3C 3OTOB 3L75H 2LJ2A 1QLNA 2X0LA 1I0HA 3O65A 4NXMO 1PM9A 5JJEB 1HNZO 4DUZO 2W0FC 3WU2Z 4NB5A 4IYIA 4LF9O 3RVYA 5E79Z 4DR6O 3ASOC 3L72H 4IIJB 4R6ZA 4U3FH 4CZZA 4WFAV 3K5MA 3G67A 3L74H 2D3OW 4LF6O 3ZEDA 2DWEC 2P4KA 4DV0B 3G6EV 1JQ0A 4J11A 3CHXA 3F7VC 3SJBC 1BMFG 2FYUH 4UVAA 2QJ1A 3ZRSA 3JSLA 1N36B 4PI0A 4N23A 5GONB 4LBEC 1K4DC 4YHHB 1GN3A 5IE9A 3LSQA 1JVMA 4PI2A 1XL6A 3N27A 2K9PA 1QBZA 4XBFA 3ABKB 3SYAA 4I55A 1KQSU 2KSDA 4LFAO 4NTYA 3NR7A 4GX5A 5K1PA 3ETDA 3ASNB 1VEWA 3L73H 3ZHSA 4MVSA 1YVWA 3TK1A 5LOVB 1JJ2U 3BPZA 3Q4HA 1D5AA 1Y66A 2OCCC 1N4CA 1EN5A 3KZIZ 3ZN1A 1RP3B 3IC9A 4O4HA 2RN9A 3OFNG 1NR7A 5EC1C 4DR1B 1U96A 3FB7C 4DV1B 2IJIA 4PDVA 2ZKOA 5CA0B 2RMKB 1W0JG 1SQPH 2LQTA 1JX9A 1WNSA 4H13B 1JA8A 2DYSC 3K06A 3ZS8C 3RVZA 1AILA 2BTQB 3CPWU 2ZDIC 2VWJA 1S5HC 2GUZA 1L0NH 2KG7B 1G6UA 4NXNB 1YEWA 2A06H 2DYRC 5B1BB 2YIBD 2UUAB 1KB9F 4B3TB 1XREA 1PNMA 5LP6C 1F4MA 1P7BA 1AJPA 4AI8A 1VP7A 4ASUG 4JI5O 1I08A 3VQYA 3HKBB 5EC2C 4BIUA 3MAQA 4G28B 4MVQA 2L35A 1KP2A 3CCRV 2EINC 2CE4A 4I0XB 1GK9A 1CEZA 3BA9A 1N8RW 1PL4A 2AHZA 3QF7A 1H8HG 2DQ3A 1VMGA 4K0KO 5KMGA 1Y74A 1KC8W 1E1QG 1Q3EA 5A2QN 4EB6B 3T4DA 4L87A 1KBHA 2XOKG 1NBMG 1G1XB 2YEVB 5DEDA 1KYOF 3ZMTA 4LFCO 1J5EB 2QGNA 1N33O 4FZ1A 3ZMVA 4B3RB 1NI8A 4MVRA 1FKAO 3JARB 3J7AU 2QM8A 2D2CB 5KHKA 4H37A 4IIJA 5IJ9A 2X7RB 2WLLA 3SYOA 4JI8O 2GHYA 4GX0A 2BSKA 4CH4A 3DXRA 4LF5B 2IM9A 5FNVB 2Q0OC 3DGEA 4DV2O 3OE7G 5KLVH 5LGNA 4EKWA 1RM1C 1TGOA 4LF8B 1P84F 2B9ZA 2H3OA 2OCCB 5GONA 5L3DA 1SQVH 3O9OA 1M4UA 1HR0B 4X8AA 4DO2A 1CXZB 2P7TC 3UCSC 1NZ6A 5IYDO 1K5SA 2EIMC 3RT3C 3K59A 3LUTB 2DYSB 3JYCA 1FAFA 4ZOLA 1H2KA 4MSWC 4X1KB 3W7UA 1BCCH 2OYQA 1PP9H 3EVKA 4QJFB 2EJRA 3R65A 1WB7A 5KA6A 5LOVA 2DYRB 3K5OA 4BWAA 2Q73A 4J7JA 1GKFA 4TUYB 2JGUA 3STLC 2Y4TA 4JZGA 5LP6B 5LMUB 3C3TA 1DTOA 2OIEA 2IH3C 4I4TB 4DR5B 3T1YB 3A2FA 2ZE7A 5CBFA 2VQEO 1K5QA 2N04A 4IT5A 3K3WA 4MTXA 4RQFA 2EIKC 2VQFO 1F4NA 1M5IA 1IXMA 2LGWA 2QA4V 2E76B 3DTUB 1YTFB 2BTQA 4H33A 2YUAA 3JCZA 5H6RA 1H38A 2WLJA 2KG7A 5FPOA 2GDSA 2ZNIA 2ZXWC 1PD3A 3CCMV 4GKJO 4UXNA 4WBNB 4LCUC 1H2SB 3HKBA 4UVBA 3BCCH 3K0GA 2FB5A 3HKDA 2ZCEA 4RQEA 1IBMB 5LYJB 4WCEV 1XNRO 4EFEA 1M1KW 4I0XA 2JGDB 5IYCO 3K79A 1FXHA 4WFEA 2YC0A 4ZBMA 1WP7A 3OR7C 3PJSK 2YI8A 3UM7A 1IX9A 1OCOC 4JF3A 2V1DA 3OW2U 3JAWB 2GBOA 4ABMA 1XHZA 3WB0A 1THZA 2CGOA 4NXMB 3MD0A 3E35A 1HNZB 4DUZB 2YEVA 3CMEV 3B8NA 2VRZA 1QVGU 2XASA 4LF9B 1GM7A 1KU9A 4BR6A 2CTQA 4DR6B 1SERA 2ILMA 2QE7G 4LF6B 2LGQA 2R9AA 3JARA 3CD6V 2PF4E 2EIMB 5KHIA 1YJNV 2WLNA 2ZIOA 3SYQA 2PUSA 2QKCA 2DMXA 4H44B 3CCEV 4I9WA 2R72A 1HNXO 3BFRA 2P06A 3TJTA 1K73W 1TUEB 4OGQB 2H94A 1QR8A 2OTLV 5JJJB 3J80N 3AG4C 1VQMV 3QVNA 2Q8VA 1OCCC 4LFAB 3AK2A 3I55V 1AI7A 3SPGA 5F2VO 2EIKB 3G71V 2BE3A 4Q6GA 2WWWA 3CCUV 4OPHA 3CYOA 5JJNB 2WLMA 3RGBA 2QWNB 2HJFC 4JI4B 4X1KA 1H8EG 4FFBB 4UV9A 5JH7A 2E5LB 2UUCO 3WB2A 4FZ0A 2NLJC 3ZBHA 2JEXA 3D3QA 3OGIB 1V55C 1K4CC 4F6EA 3TGUH 5EYPB 5KUMA 3UQ8A 5J2UB 4I4TA 1R3JC 2YI9A 2IW5A 5LGTA 2P22C 2QM7A 1NT2B 1YF2A 3TETA 2IJKA 2UXBO 4DR4O 3ZN0A 2P90A 3D3IA 4PA7A 1AI4A 2PY5A 1OCOB 4WFGA 4A5UB 4JI5B 5FL7G 2ZR2A 4I55B 5CA3A 4WBNA 4C7UA 1R3LC 1IBKO 3JSNA 4GX2A 3RYIB 5EBLC 3H1IH 4MTGA 1VQ9V 5LYJA 3CRMA 3Q4HB 2JGDA 2AW9A 3FX7A 3ETEA 5L3EA 4TQDA 4O4HB 4K0KB 2ATKC 3OD4A 4Z2WA 4FLYA 3QG5A 2P6JA 4O4IA 3VQXA 1MSWD 3JAWA 4YJ3A 1Q8IA 3ABLB 2DW4A 2QM4A 1KP3A 2ADQB 2QTOA 4LFCB 4PHZA 3ICXA 5CN0A 5EBWC 5L3FA 2IJHA 3W7TA 1AP6A 1OHHG 3ASNC 3U10A 3HB3B 2ETNA 1QLEC 2Z0AA 2CGNA 2XAGA 3AG4B 4GCZA 1H2MA 4L8JA 1OCCB 5IJ0B 4JTDB 3DC6A 1IZ3A 4JI8B 4FPPA 4KFMA 4WFHA 3F7YC 4NKGB 3CC2V 5KHHA 1YHQV 2E75B 4DV2B 3X2QC 4W4LA 1BZKA 1URFA 2OIGA 4FK5C 1YDXA 2UXCO 1NTZH 3E2EA 2IU3A 1XMQO 3T1HO 1NR1A 5IYBO 2Y0PA 2F4VO 3AG1B 4CS4A 1PNKA 1GTOA 2QEXV 4FLWA 1JMKC 4P30A 5B1OA 2A9HA 1VQOV 2Z5UA 2EBOA 3I56V 3SYCA 3P3PA 3W7XA 1ZSPA 4JAVA 1KKCA 4JV5O 5DECA 2CDYA 3SGIA 4FFBA 2Q5ZA 2EJ7A 1UFIA 4J10A 2GV9A 2E74B 5J9PC 1Q6HA 1AR4A 4F6RB 2VQEB 5EYPA 5IJ9B 2HVJC 5J2UA 1PL0A 2WLLB 4YY3O 2VQFB 1QHTA 1LNQA 2BSKB 2UU9O 2H8PC 1SQFA 5JVDB 3DXRB 3T2MA 2LW1A 5B5EZ 3HR0A 1Q7YW 3B8MA 3K08A 2YIAA 2HEPA 1IVSA 3H1KH 5D5PA 5LBQA 2HJDA 3VBBA 4GKKO 4GKJB 4DUYO 5AG2A 1N32O 5GW7A 3I5DA 1NS1A 1Y76B 2N05A 3OMAB 1EZVH 3G80A 3EXAA 1IDSA 4ZOLB 4K8ZA 2Y0IA 4UCRA 1KD1W 1XNRB 1S0VA 3S3WA 5BZBA 3RYIA 1OCZB 1QLEB 4JI4O 1YZBA 1ZLZA 2E5LO
chains in the Genus database with same CATH topology
1ZL8A 1ZL8B 3B40A 1Y74B 1Y74A 1Y76B 1Y76A 1RSOB 1VF6C 1VF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZL8 A;  1ZL8 B;  3B40 A;  1Y74 B;  1Y74 A;  1Y76 B;  1Y76 A;  1RSO B;  1VF6 C;  1VF6 A; 
#chains in the Genus database with same CATH topology
 1N0J A;  3G4S V;  2HHH O;  2P67 A;  5EBM C;  2DJV A;  5KX5 A;  1PPJ H;  5EK0 A;  2R9R B;  1GO3 F;  5KAF Z;  3ZMZ A;  3X2Q B;  1KMI Z;  1H2G A;  4JI2 O;  2VS0 A;  3T4Z A;  3QO7 A;  3AK3 A;  5JCO C;  4OX9 O;  3OGC C;  3RWR D;  1Y4M A;  1K7D A;  4WFB V;  1R3I C;  4Z1M G;  5CMU A;  4PEL A;  2Q9L A;  3P3N A;  3QO8 A;  1S3J A;  2PYL A;  5IY5 B;  5IJ0 A;  4KL1 A;  4PD4 F;  1XBL A;  1HDJ A;  4G2K A;  4LR3 A;  3SJA C;  4PA3 A;  1Q82 W;  1SQQ H;  4JYA O;  1HNX B;  4R7C A;  3FB6 C;  3WG7 B;  5HFM A;  2X6C A;  1N34 O;  3AG7 A;  3HKD B;  1AP5 A;  3ZCC A;  1RSO B;  3K9S A;  1NVP B;  4PA6 A;  1A32 A;  2PZS A;  2A7W A;  3ZHT A;  1XEQ A;  4MVO A;  4P9O A;  4B3M O;  3C90 A;  1SET A;  3CRQ A;  4X89 A;  4TOI A;  4LF7 O;  2F43 G;  2RQ6 A;  1JJO A;  4U3J B;  4O2B B;  3APO A;  1FS0 G;  4JYB A;  5BR8 O;  3OEH G;  2UUC B;  5LL6 Y;  4JTA B;  3OR6 C;  2DWD C;  1Q90 D;  1Q86 W;  1FJG O;  1ORQ C;  1QVF U;  1CP9 A;  5DM6 V;  3MHS C;  1IBL O;  3OM3 B;  3UT5 B;  1NQT A;  4P2Z A;  2QTS A;  4F6R A;  3E86 A;  3LSU A;  4DR7 O;  1VQ8 V;  2XAJ A;  3K5L A;  3IFX A;  1E79 G;  4TV8 A;  1SQB H;  5KA5 A;  4J9Y B;  4UCT A;  1K97 A;  1M90 W;  5JVD A;  2UXB B;  1V9P A;  3CSX A;  2HVK C;  2ZIN A;  4DR4 B;  2YIB A;  3EFF K;  4J9Z B;  2ZM6 O;  2HP8 A;  4QNH B;  3GVM A;  3FYI B;  2PGG A;  4X88 A;  3CCL V;  3K0D A;  1SQG A;  1QU7 A;  3AG2 B;  2ZR3 A;  3JD2 A;  2A0L A;  1NVP D;  2QWP B;  1JCH A;  3OAA G;  4QGP A;  1Y76 A;  2JVD A;  3NXS A;  2FTK A;  1VF6 A;  2WA4 A;  1I5X A;  1IBK B;  1IXB A;  5JH7 B;  4NR1 A;  1LUW A;  3S3X A;  2HR3 A;  1AR5 A;  4FM2 A;  1SF9 A;  4R8C A;  1JFF A;  1X59 A;  2ARH A;  2YIC A;  2DE0 X;  1FD9 A;  2QWQ B;  4DV4 B;  3MDS A;  1BT8 A;  4UCU A;  1ZTE A;  3M8A A;  1DLB A;  4UCO A;  3ABT A;  3THO A;  1GN2 A;  4MVU A;  2Y48 A;  2NR5 A;  4AQY O;  4B3S O;  3WFV A;  1GM8 A;  3RYF B;  4DV7 O;  2MK3 A;  2WA3 A;  2UUB O;  4PV1 B;  5L3C A;  2RCV A;  3GWK C;  4DXW A;  4LH7 A;  4NTX A;  5FLX N;  3OMI B;  4PDL A;  1E1R G;  1HW7 A;  3LDC A;  3M99 B;  3RYH B;  4J41 A;  1I94 O;  4CH3 A;  2M7W A;  2RNB A;  4TSF G;  3OEE G;  2HFE C;  2UXC B;  4BIZ A;  1XMQ B;  2PI4 A;  2JJ1 G;  3T1H B;  1YSC A;  1J95 A;  1Z5W A;  1RSO A;  2F4V B;  1GAX A;  4IL6 Z;  2ZT9 B;  3APQ A;  3CRA A;  2BCC H;  3RBZ A;  3SDL A;  1WPX A;  1WB8 A;  5B3S B;  4O4I B;  2JRI A;  3N2G B;  4YJ3 B;  3HPL C;  2IJJ A;  4AHC A;  4JV5 B;  1M93 A;  1M57 C;  4UB6 Z;  2AZ0 A;  4U3J A;  4O2B A;  4X1Y B;  2XAF A;  4LFB O;  1W2B U;  1YXB A;  4YXW G;  1Y6X A;  4XDK A;  3PN1 A;  3ZHU A;  1VQK V;  1ENV A;  1AI6 A;  2GTA A;  1PNL A;  1NJI W;  3UT5 A;  4BW9 A;  1WJZ A;  1X4T A;  2B1G A;  4YY3 B;  4E2L A;  3CRR A;  2B5U A;  2UU9 B;  5BXZ A;  4QPK A;  3ETQ A;  2JEU A;  3ABL C;  1L8D A;  3IJ4 A;  4R50 A;  2CUG A;  2JS5 A;  1Z2G A;  4DK1 A;  5BY1 A;  2HG5 C;  3A0H Z;  3OUS A;  4X20 B;  3CP1 A;  4GKK B;  3TCU A;  1SRY A;  1XNQ O;  3CEI A;  4DUY B;  4LWS B;  4BW5 A;  1T5E A;  4CS2 A;  4GX1 A;  1N32 B;  2LO1 A;  4KUM A;  1JR9 A;  3N2K B;  1AJQ A;  4EFB A;  1DF5 A;  3HKE A;  1XI1 A;  3QO5 A;  3ETG A;  3H1H H;  5D5Q A;  5LXT B;  1SA0 B;  4X62 O;  1GRJ A;  4LC1 A;  5JCO A;  4TT3 G;  4O4L B;  3D36 A;  1ZWI C;  3J81 N;  2HHH B;  1WLE A;  4JYY A;  4ZI7 B;  1CPY A;  2V4D A;  3H9V A;  3AG1 C;  4YIP A;  2L6L A;  4DW0 A;  4DV3 O;  1BSM A;  2ITD C;  3GWO A;  5FPR A;  1FFX B;  4FLX A;  3G6B A;  2EIL B;  2Y4U A;  3RYC B;  2P5O A;  4FM1 A;  4JI2 B;  1P49 A;  3QNE A;  2UXD O;  5KUK A;  4OX9 B;  1B6Q A;  4JI1 O;  4X65 O;  4NYK A;  3RYF A;  3SPH A;  3B09 A;  4MTO A;  4UFZ A;  3KKY A;  2W6I G;  3JCU Z;  4OXS A;  2QKA A;  1K34 A;  3BAB A;  5E1A C;  1BGY H;  3RYH A;  1M57 B;  4GT1 A;  4JYA B;  4G27 B;  2EX3 A;  4DV5 O;  2E3C A;  1N34 B;  1DK1 A;  5JWP A;  5GTH Z;  3L70 H;  4FLV A;  5IYZ A;  4TWK A;  4I9Q A;  3E8B A;  4X1I A;  4MT8 A;  5LHG A;  2Q7G A;  1P7G A;  4RAI A;  2OTJ V;  4IGG A;  4B3M B;  4J80 A;  2Y69 B;  5LMN O;  2GSM B;  4LF7 B;  5KX5 B;  1H2L A;  3N2G A;  4K8X A;  1JPX A;  3SPI A;  3K04 A;  3L71 H;  1H2N A;  5LGU A;  3UO3 A;  4I5S A;  5BR8 B;  1VF6 C;  1RPO A;  4HAM A;  4DV4 O;  4X1Y A;  1F23 A;  3JD1 A;  2F95 B;  4RWU A;  3OMN B;  1FJG B;  4IYH A;  1YJ9 V;  4UV8 A;  4WFF A;  3T1C A;  4QPJ A;  4HNA B;  1OCZ C;  1IBL B;  1TA8 A;  1S5J A;  4DR7 B;  4FFK A;  1GN4 A;  1YI2 V;  4O4J B;  3ZHV A;  3ZHR A;  1EZJ A;  4CC6 A;  3ZX6 A;  2QKS A;  3W7S A;  2LFS A;  3LSS A;  1SKV A;  3DSQ A;  1WA8 B;  2ZM6 B;  2BOB C;  4B7K A;  1PKX A;  2IU0 A;  1G8M A;  1K33 A;  2MW2 B;  1Q81 W;  4CC5 A;  5CA1 A;  4N21 A;  4X20 A;  2F1M A;  4LWS A;  2ZE8 A;  3FB5 C;  4TV9 B;  5EIB D;  2Q7E A;  4X66 O;  3N2K A;  4QE7 A;  5IY5 C;  4CS3 A;  4JI7 O;  1KEC A;  4JI3 O;  4Q20 A;  1BQZ A;  2ZQM A;  2F66 C;  5LXT A;  1SA0 A;  1WPB A;  3U11 A;  1EBO A;  2KQX A;  3WG7 C;  4CH5 A;  1G4Y B;  4O4L A;  5A9G A;  3HKC B;  2ZD9 A;  3CJH B;  4LNU B;  4E4E A;  1EN4 A;  1S77 D;  4ZI7 A;  3DC5 A;  2A79 B;  4FJC C;  2YXY A;  2QWR B;  5EZY A;  4J7K A;  3ZRV A;  4DR2 O;  4KP4 A;  4B7E A;  1B06 A;  5KAI Z;  1XQ8 A;  3ZRX A;  5K1X A;  1FFX A;  1HP8 A;  3SPJ A;  3RYC A;  2CAZ C;  3UKM A;  4TV8 B;  1TUB A;  4I50 A;  4MVM A;  1TAE A;  4Z1V A;  3P30 A;  4AQY B;  4B3S B;  4DV7 B;  4EEQ A;  2UUB B;  3MHH C;  4QIW F;  2LP7 A;  3B77 A;  5C8Y B;  4XDL A;  3P32 A;  1K92 A;  2Q69 A;  3ML0 A;  1OZ0 A;  1WAZ A;  1VQ4 V;  1I94 B;  3E8H A;  3ZIA G;  4PDM A;  1VQL V;  1N0N A;  4FMT A;  3CCJ V;  5HFL A;  3E22 B;  3SR2 C;  2JK5 C;  2N74 A;  2XND G;  4JPR A;  1DGS A;  4NVP A;  4ZHQ A;  4IHJ B;  4UUJ C;  2DN9 A;  1ZX3 A;  2XUM A;  2RDC A;  2WSS G;  3A0R A;  1L0L H;  1FXK A;  2Q7H A;  1KKD A;  1P4R A;  4UVC A;  4BAY A;  1I7F A;  1M9N A;  3AG2 C;  1JFF B;  3BA8 A;  3ZRW B;  2LFR A;  4JAU A;  3EHB B;  1S72 V;  4FM0 A;  3E83 A;  4LFB B;  5KHG A;  2Q67 A;  4U7O A;  1FFT B;  2CTW A;  3FAV B;  5L3G A;  2X6B A;  3BY6 A;  1ARO P;  1B04 A;  1GH6 A;  1M56 C;  2ADP A;  5IT9 N;  1V54 B;  3KG2 A;  1OCR B;  2Q0A A;  3D36 C;  3SJQ C;  4HNA A;  2RJZ A;  3STZ C;  1R3K C;  2YID A;  1YIT V;  1O9G A;  1NH2 B;  3A8T A;  3B40 A;  3BAA A;  1JOY A;  2WLK A;  5CBH A;  5CB4 B;  3K9A A;  1HNW O;  4O4J A;  3JAK A;  3ABU A;  4K35 A;  2X6A A;  4MVZ A;  4RO2 A;  3K57 A;  1XOU A;  1K3E A;  1RFY A;  4LF4 O;  2WLH A;  2JJ2 G;  4ICG A;  2C2A A;  1MG1 A;  1IUR A;  4JTC B;  4OPA A;  1WA8 A;  1QR9 A;  3CCQ V;  1ZUQ A;  4JZ2 A;  5BMV B;  5IWA O;  3ABM C;  1XNQ B;  4DR3 O;  1US6 A;  3CC7 V;  2WLI B;  2W6J G;  1XL4 A;  2FML A;  3ZMS A;  1S76 D;  3CS5 A;  5DN6 G;  2UXX A;  4QE9 A;  2ZIM A;  4TV9 A;  3TXQ A;  3AG3 B;  2CTP A;  1NKD A;  4PA4 A;  3JAM N;  1ZL8 B;  1DF4 A;  1R6T A;  4X62 B;  2CH7 B;  1S5L Z;  1K8A W;  1YCI A;  2FL4 A;  2B1I A;  3ASO B;  3FKS G;  1D2D A;  4JI6 O;  5B1A C;  3HKC A;  3CJH A;  3SJC C;  2NN4 A;  4LNU A;  4DV3 B;  3LDD A;  1WP8 A;  1ROP A;  1OJH A;  3CX5 F;  4K3A A;  2UXD B;  5B3S C;  1OV9 A;  4D7S A;  4HZ3 A;  1NH2 D;  2YXL A;  4TQF A;  3FFQ A;  3BRC A;  4JI1 B;  3AEI A;  4KHP O;  4X65 B;  5H5N A;  4JI0 O;  4YJ2 B;  1GMG A;  2QWO B;  4D7T A;  5C8Y A;  2CTR A;  2GTS A;  2O57 A;  3E89 A;  2PI5 A;  2ZE6 A;  4DYL A;  1MA1 A;  1XMO O;  3HKE B;  1FPO A;  1R6K A;  4DV5 B;  4DV6 O;  2Z3Y A;  1XIL A;  2PYJ A;  3E22 A;  1U97 A;  4FLU A;  2AGA A;  1M56 B;  4IHJ A;  5LHI A;  2OCH A;  2F93 B;  2ODM A;  5LMN B;  2IH1 C;  4X64 O;  2F23 A;  2FKX A;  2XTA A;  4HBN A;  3GB7 C;  3UO2 A;  1QQC A;  2YS8 A;  4UB8 Z;  3ZRW A;  4X9Q A;  1GN6 A;  2P4V A;  3FD9 A;  4XDJ A;  3TXS A;  3OTO O;  5B1N A;  3FAV A;  3ABM B;  4MW3 A;  5ITZ B;  1NTK H;  1VIB A;  4ZIB A;  1B3Q A;  1F7Y A;  1UPG A;  2YXH A;  5IDJ A;  1NTM H;  1VQ7 V;  3F5W C;  3CXC U;  5CA0 A;  1SZT A;  4UCS A;  3K5N A;  5CB4 A;  1EFR G;  4P9P A;  5KHJ A;  1QCE A;  4DV0 O;  2EIN B;  2EIJ C;  2NNU A;  2EIL C;  2ZE5 A;  4PJ0 Z;  1N36 O;  1W0K G;  5IYZ B;  1Q43 A;  4X1I B;  5JQG B;  2A3Q A;  4YHH O;  5BMV A;  5B1A B;  5C93 A;  3JAL B;  3K58 A;  1VQP V;  3BEH A;  1O9H A;  4DK0 A;  3CXH F;  3F5T A;  4X66 B;  1MSD A;  3QTC A;  2WLI A;  5LA6 B;  4O2A B;  5L3B A;  3OUF A;  4JI7 B;  2DOS A;  4JI3 B;  1MOF A;  4J42 A;  4HYO A;  1FYJ A;  3KCX A;  1Z5V A;  3KCY A;  1ZL8 A;  3M7M X;  2ITC C;  1R6N A;  2CH7 A;  2OWO A;  3JAS B;  3JAT B;  3LNM B;  4DRX B;  5EIB C;  5J2T B;  1SC5 B;  1FXK C;  4DR2 B;  2Y69 C;  4DR1 O;  4MTF A;  4DV1 O;  1VQ6 V;  4EB6 A;  4B08 A;  3JD3 A;  3K03 A;  3JD0 A;  1AR1 B;  3FB8 C;  5LHH A;  3RFR A;  1RM1 B;  4D6T H;  2Q4P A;  2QDO A;  1D5N A;  2LW7 A;  4RUE A;  4LP8 A;  4ZKI A;  2QSA A;  3W7W A;  4GYC B;  4NXN O;  1YTF D;  1EN6 A;  5CA1 B;  2UUA O;  4GUN A;  4PDR A;  4JAS A;  4B3T O;  4U7N A;  4YJ2 A;  2K1E A;  4KXR A;  3SPC A;  2EUL A;  1VQN V;  2EZP A;  4H0L B;  1MNG A;  2KKW A;  2OT5 A;  1MZE A;  5FNV A;  2R70 A;  3IC7 A;  3H1J H;  3CWB H;  3BHP A;  3CE2 A;  1F51 A;  3CB2 A;  1XDC A;  3IAY A;  1SQX H;  1LR1 A;  4PA9 A;  3B2E E;  1ZAU A;  1TVK B;  2BOC C;  1XHX A;  3OTF A;  5EZY B;  1MMM A;  1R73 A;  4RUF A;  2V7Q G;  2AXT Z;  2CK3 G;  1VF5 B;  2EIJ B;  3VQV A;  5CBG A;  3CRC A;  4CBC A;  2ZDI A;  3A0B Z;  1TUB B;  4I50 B;  1VQ5 V;  3OT7 A;  3VOU A;  1J5E O;  3LNN A;  3E8G A;  4TUY A;  2ZXW B;  4B3R O;  4JGS A;  4I7Z B;  4DW1 A;  5LP6 A;  4MS2 A;  5ITZ A;  4YIO A;  3CC4 V;  2Q6A A;  2VWK A;  1QNM A;  1AJN A;  2DQ0 A;  2R9I A;  1SS3 A;  1VF7 A;  1AVM A;  1HNW B;  1I5Y A;  1YIJ V;  3VQW A;  1FXV A;  1PV0 A;  3ZHQ A;  3CCV V;  3JD4 A;  4AIL C;  4LF4 B;  3R66 A;  3AK1 A;  4NTW A;  4LF5 O;  3D8C A;  2JDI G;  5IWA B;  3E8F A;  1L1F A;  4ZHQ B;  4LF8 O;  5JQG A;  4DR3 B;  4MW8 A;  2HLD G;  1AB3 A;  3FYE B;  3JAL A;  2PTM A;  1HR0 O;  2XHB A;  1FXK B;  1Q6U A;  5H9C A;  2HKO A;  3LDE A;  1NU1 H;  4FIP C;  4UCV A;  1YJW V;  5LA6 A;  4O2A A;  4FLT A;  1COW G;  5H6Q A;  4WF9 V;  5H2F Z;  1KUQ A;  1BS3 A;  1WN7 A;  4J7Z A;  2WAM A;  4FVM A;  2JS3 A;  4FLZ A;  2AZ2 A;  3C3S A;  2BTO A;  1UJW B;  2WPD G;  3H1L H;  4GLX A;  1SES A;  3JAS A;  4JI6 B;  3JAT A;  3RN4 A;  2JIZ G;  4DRX A;  3ZJZ A;  2G38 A;  3CCS V;  5LMU O;  2QR4 A;  1BQ0 A;  4LH6 A;  5J2T A;  4DR5 O;  3T1Y O;  1Q5O A;  3ABK C;  2M6Y A;  1W59 A;  3JAK B;  1XUQ A;  2UXN A;  2YDE A;  1N33 B;  2EZO A;  4KHP B;  1R1B A;  2ZNJ A;  2GUZ B;  2KB1 A;  1EM1 A;  3ZMU A;  2W0X A;  1AI5 A;  4JI0 B;  3SYP A;  1BHA A;  3CMA V;  3RW0 A;  1V54 C;  3IGA C;  1OCR C;  2AHY A;  3L9D A;  5B66 Z;  1XMO B;  4CH6 A;  3WB1 A;  2XT9 A;  4DV6 B;  2XAQ A;  5GTI Z;  4BIO A;  3H01 A;  1Q6I A;  1K9M W;  1MZF A;  1LUV A;  4W4K A;  4JYC A;  1BE3 H;  1MAB G;  3U0Z A;  1IBM O;  2XAH A;  1V55 B;  2YSU B;  5TIS Z;  5B1B C;  4F4L A;  1SZX A;  4X64 B;  2Q68 A;  1BHB A;  1Y67 A;  1GM9 A;  3B4S A;  1BL8 A;  2IBZ H;  5KMG B;  1HWY A;  1Y74 B;  4GZR B;  1RPR A;  1TVK A;  3BVO A;  4JAA A;  1VAR A;  3AG3 C;  3OTO B;  3L75 H;  2LJ2 A;  1QLN A;  2X0L A;  1I0H A;  3O65 A;  4NXM O;  1PM9 A;  5JJE B;  1HNZ O;  4DUZ O;  2W0F C;  3WU2 Z;  4NB5 A;  4IYI A;  4LF9 O;  3RVY A;  5E79 Z;  4DR6 O;  3ASO C;  3L72 H;  4IIJ B;  4R6Z A;  4U3F H;  4CZZ A;  4WFA V;  3K5M A;  3G67 A;  3L74 H;  2D3O W;  4LF6 O;  3ZED A;  2DWE C;  2P4K A;  4DV0 B;  3G6E V;  1JQ0 A;  4J11 A;  3CHX A;  3F7V C;  3SJB C;  1BMF G;  2FYU H;  4UVA A;  2QJ1 A;  3ZRS A;  3JSL A;  1N36 B;  4PI0 A;  4N23 A;  5GON B;  4LBE C;  1K4D C;  4YHH B;  1GN3 A;  5IE9 A;  3LSQ A;  1JVM A;  4PI2 A;  1XL6 A;  3N27 A;  2K9P A;  1QBZ A;  4XBF A;  3ABK B;  3SYA A;  4I55 A;  1KQS U;  2KSD A;  4LFA O;  4NTY A;  3NR7 A;  4GX5 A;  5K1P A;  3ETD A;  3ASN B;  1VEW A;  3L73 H;  3ZHS A;  4MVS A;  1YVW A;  3TK1 A;  5LOV B;  1JJ2 U;  3BPZ A;  3Q4H A;  1D5A A;  1Y66 A;  2OCC C;  1N4C A;  1EN5 A;  3KZI Z;  3ZN1 A;  1RP3 B;  3IC9 A;  4O4H A;  2RN9 A;  3OFN G;  1NR7 A;  5EC1 C;  4DR1 B;  1U96 A;  3FB7 C;  4DV1 B;  2IJI A;  4PDV A;  2ZKO A;  5CA0 B;  2RMK B;  1W0J G;  1SQP H;  2LQT A;  1JX9 A;  1WNS A;  4H13 B;  1JA8 A;  2DYS C;  3K06 A;  3ZS8 C;  3RVZ A;  1AIL A;  2BTQ B;  3CPW U;  2ZDI C;  2VWJ A;  1S5H C;  2GUZ A;  1L0N H;  2KG7 B;  1G6U A;  4NXN B;  1YEW A;  2A06 H;  2DYR C;  5B1B B;  2YIB D;  2UUA B;  1KB9 F;  4B3T B;  1XRE A;  1PNM A;  5LP6 C;  1F4M A;  1P7B A;  1AJP A;  4AI8 A;  1VP7 A;  4ASU G;  4JI5 O;  1I08 A;  3VQY A;  3HKB B;  5EC2 C;  4BIU A;  3MAQ A;  4G28 B;  4MVQ A;  2L35 A;  1KP2 A;  3CCR V;  2EIN C;  2CE4 A;  4I0X B;  1GK9 A;  1CEZ A;  3BA9 A;  1N8R W;  1PL4 A;  2AHZ A;  3QF7 A;  1H8H G;  2DQ3 A;  1VMG A;  4K0K O;  5KMG A;  1Y74 A;  1KC8 W;  1E1Q G;  1Q3E A;  5A2Q N;  4EB6 B;  3T4D A;  4L87 A;  1KBH A;  2XOK G;  1NBM G;  1G1X B;  2YEV B;  5DED A;  1KYO F;  3ZMT A;  4LFC O;  1J5E B;  2QGN A;  1N33 O;  4FZ1 A;  3ZMV A;  4B3R B;  1NI8 A;  4MVR A;  1FKA O;  3JAR B;  3J7A U;  2QM8 A;  2D2C B;  5KHK A;  4H37 A;  4IIJ A;  5IJ9 A;  2X7R B;  2WLL A;  3SYO A;  4JI8 O;  2GHY A;  4GX0 A;  2BSK A;  4CH4 A;  3DXR A;  4LF5 B;  2IM9 A;  5FNV B;  2Q0O C;  3DGE A;  4DV2 O;  3OE7 G;  5KLV H;  5LGN A;  4EKW A;  1RM1 C;  1TGO A;  4LF8 B;  1P84 F;  2B9Z A;  2H3O A;  2OCC B;  5GON A;  5L3D A;  1SQV H;  3O9O A;  1M4U A;  1HR0 B;  4X8A A;  4DO2 A;  1CXZ B;  2P7T C;  3UCS C;  1NZ6 A;  5IYD O;  1K5S A;  2EIM C;  3RT3 C;  3K59 A;  3LUT B;  2DYS B;  3JYC A;  1FAF A;  4ZOL A;  1H2K A;  4MSW C;  4X1K B;  3W7U A;  1BCC H;  2OYQ A;  1PP9 H;  3EVK A;  4QJF B;  2EJR A;  3R65 A;  1WB7 A;  5KA6 A;  5LOV A;  2DYR B;  3K5O A;  4BWA A;  2Q73 A;  4J7J A;  1GKF A;  4TUY B;  2JGU A;  3STL C;  2Y4T A;  4JZG A;  5LP6 B;  5LMU B;  3C3T A;  1DTO A;  2OIE A;  2IH3 C;  4I4T B;  4DR5 B;  3T1Y B;  3A2F A;  2ZE7 A;  5CBF A;  2VQE O;  1K5Q A;  2N04 A;  4IT5 A;  3K3W A;  4MTX A;  4RQF A;  2EIK C;  2VQF O;  1F4N A;  1M5I A;  1IXM A;  2LGW A;  2QA4 V;  2E76 B;  3DTU B;  1YTF B;  2BTQ A;  4H33 A;  2YUA A;  3JCZ A;  5H6R A;  1H38 A;  2WLJ A;  2KG7 A;  5FPO A;  2GDS A;  2ZNI A;  2ZXW C;  1PD3 A;  3CCM V;  4GKJ O;  4UXN A;  4WBN B;  4LCU C;  1H2S B;  3HKB A;  4UVB A;  3BCC H;  3K0G A;  2FB5 A;  3HKD A;  2ZCE A;  4RQE A;  1IBM B;  5LYJ B;  4WCE V;  1XNR O;  4EFE A;  1M1K W;  4I0X A;  2JGD B;  5IYC O;  3K79 A;  1FXH A;  4WFE A;  2YC0 A;  4ZBM A;  1WP7 A;  3OR7 C;  3PJS K;  2YI8 A;  3UM7 A;  1IX9 A;  1OCO C;  4JF3 A;  2V1D A;  3OW2 U;  3JAW B;  2GBO A;  4ABM A;  1XHZ A;  3WB0 A;  1THZ A;  2CGO A;  4NXM B;  3MD0 A;  3E35 A;  1HNZ B;  4DUZ B;  2YEV A;  3CME V;  3B8N A;  2VRZ A;  1QVG U;  2XAS A;  4LF9 B;  1GM7 A;  1KU9 A;  4BR6 A;  2CTQ A;  4DR6 B;  1SER A;  2ILM A;  2QE7 G;  4LF6 B;  2LGQ A;  2R9A A;  3JAR A;  3CD6 V;  2PF4 E;  2EIM B;  5KHI A;  1YJN V;  2WLN A;  2ZIO A;  3SYQ A;  2PUS A;  2QKC A;  2DMX A;  4H44 B;  3CCE V;  4I9W A;  2R72 A;  1HNX O;  3BFR A;  2P06 A;  3TJT A;  1K73 W;  1TUE B;  4OGQ B;  2H94 A;  1QR8 A;  2OTL V;  5JJJ B;  3J80 N;  3AG4 C;  1VQM V;  3QVN A;  2Q8V A;  1OCC C;  4LFA B;  3AK2 A;  3I55 V;  1AI7 A;  3SPG A;  5F2V O;  2EIK B;  3G71 V;  2BE3 A;  4Q6G A;  2WWW A;  3CCU V;  4OPH A;  3CYO A;  5JJN B;  2WLM A;  3RGB A;  2QWN B;  2HJF C;  4JI4 B;  4X1K A;  1H8E G;  4FFB B;  4UV9 A;  5JH7 A;  2E5L B;  2UUC O;  3WB2 A;  4FZ0 A;  2NLJ C;  3ZBH A;  2JEX A;  3D3Q A;  3OGI B;  1V55 C;  1K4C C;  4F6E A;  3TGU H;  5EYP B;  5KUM A;  3UQ8 A;  5J2U B;  4I4T A;  1R3J C;  2YI9 A;  2IW5 A;  5LGT A;  2P22 C;  2QM7 A;  1NT2 B;  1YF2 A;  3TET A;  2IJK A;  2UXB O;  4DR4 O;  3ZN0 A;  2P90 A;  3D3I A;  4PA7 A;  1AI4 A;  2PY5 A;  1OCO B;  4WFG A;  4A5U B;  4JI5 B;  5FL7 G;  2ZR2 A;  4I55 B;  5CA3 A;  4WBN A;  4C7U A;  1R3L C;  1IBK O;  3JSN A;  4GX2 A;  3RYI B;  5EBL C;  3H1I H;  4MTG A;  1VQ9 V;  5LYJ A;  3CRM A;  3Q4H B;  2JGD A;  2AW9 A;  3FX7 A;  3ETE A;  5L3E A;  4TQD A;  4O4H B;  4K0K B;  2ATK C;  3OD4 A;  4Z2W A;  4FLY A;  3QG5 A;  2P6J A;  4O4I A;  3VQX A;  1MSW D;  3JAW A;  4YJ3 A;  1Q8I A;  3ABL B;  2DW4 A;  2QM4 A;  1KP3 A;  2ADQ B;  2QTO A;  4LFC B;  4PHZ A;  3ICX A;  5CN0 A;  5EBW C;  5L3F A;  2IJH A;  3W7T A;  1AP6 A;  1OHH G;  3ASN C;  3U10 A;  3HB3 B;  2ETN A;  1QLE C;  2Z0A A;  2CGN A;  2XAG A;  3AG4 B;  4GCZ A;  1H2M A;  4L8J A;  1OCC B;  5IJ0 B;  4JTD B;  3DC6 A;  1IZ3 A;  4JI8 B;  4FPP A;  4KFM A;  4WFH A;  3F7Y C;  4NKG B;  3CC2 V;  5KHH A;  1YHQ V;  2E75 B;  4DV2 B;  3X2Q C;  4W4L A;  1BZK A;  1URF A;  2OIG A;  4FK5 C;  1YDX A;  2UXC O;  1NTZ H;  3E2E A;  2IU3 A;  1XMQ O;  3T1H O;  1NR1 A;  5IYB O;  2Y0P A;  2F4V O;  3AG1 B;  4CS4 A;  1PNK A;  1GTO A;  2QEX V;  4FLW A;  1JMK C;  4P30 A;  5B1O A;  2A9H A;  1VQO V;  2Z5U A;  2EBO A;  3I56 V;  3SYC A;  3P3P A;  3W7X A;  1ZSP A;  4JAV A;  1KKC A;  4JV5 O;  5DEC A;  2CDY A;  3SGI A;  4FFB A;  2Q5Z A;  2EJ7 A;  1UFI A;  4J10 A;  2GV9 A;  2E74 B;  5J9P C;  1Q6H A;  1AR4 A;  4F6R B;  2VQE B;  5EYP A;  5IJ9 B;  2HVJ C;  5J2U A;  1PL0 A;  2WLL B;  4YY3 O;  2VQF B;  1QHT A;  1LNQ A;  2BSK B;  2UU9 O;  2H8P C;  1SQF A;  5JVD B;  3DXR B;  3T2M A;  2LW1 A;  5B5E Z;  3HR0 A;  1Q7Y W;  3B8M A;  3K08 A;  2YIA A;  2HEP A;  1IVS A;  3H1K H;  5D5P A;  5LBQ A;  2HJD A;  3VBB A;  4GKK O;  4GKJ B;  4DUY O;  5AG2 A;  1N32 O;  5GW7 A;  3I5D A;  1NS1 A;  1Y76 B;  2N05 A;  3OMA B;  1EZV H;  3G80 A;  3EXA A;  1IDS A;  4ZOL B;  4K8Z A;  2Y0I A;  4UCR A;  1KD1 W;  1XNR B;  1S0V A;  3S3W A;  5BZB A;  3RYI A;  1OCZ B;  1QLE B;  4JI4 O;  1YZB A;  1ZLZ A;  2E5L O; 
#chains in the Genus database with same CATH homology
 1ZL8 A;  1ZL8 B;  3B40 A;  1Y74 B;  1Y74 A;  1Y76 B;  1Y76 A;  1RSO B;  1VF6 C;  1VF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...