3U10A

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
202
structure length
202
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 61
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u10A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u10A02
2QCSB 4P9GA 1I5ZA 4HZFA 5I8TA 4WVZA 4ZU7A 3QOPA 1H1MA 3I59B 2IXKA 4IEZA 3KCCA 1QY4A 4I0BA 2PYTA 3HIFA 4MGZE 2BNMA 2GAUA 3SCFA 4MH0E 1CAWB 1YUDA 1ZRDA 3SXWA 3DV8A 3H3UA 3ES1A 5FQ0A 3SHRA 3D82A 1UPIA 4HMZA 4UBGA 4F8AA 1XE8A 5C8WA 2QNKA 4EV0A 1EY2A 1UW8A 3IWZA 2H6BA 2BNOA 2GC3A 2PAKA 2QVSB 2PQQA 2EA7A 3EQEA 3USSA 3OGJA 3H3ZA 3B02A 3CJXA 3LAGA 4XFIA 5JSPA 5BUVA 5KHGA 2BNNA 3HT1A 1EYBA 5I8SA 4Q0VA 4Z82A 1ZRRA 3CLPA 1SFNA 3U0ZA 2Y0OA 2K0GA 1CAXA 4JTNA 4BYYA 4IEVA 3OD0A 3MDPA 4HSLA 3GYDA 3MZHA 2PAMA 2XGXA 1WLTA 4FAGA 4PIXA 2ET7A 2V09A 4DINB 4HVOA 4LLOA 1CAXB 1J3QA 2CV6A 2PA7A 1ZZ6A 5LRSA 4XETA 2ATFA 3E6CC 2GC0A 3M3IA 1YHFA 4K8FA 3KGZA 4JTOA 3E5QA 4HVQA 4LA3A 3OCPA 3DKWA 3TNQA 3H1WA 1LRHA 3NSTA 1X82A 1OMIA 4R8HA 2O1QA 3BB6A 5BPXA 1CAVA 2CGPA 1ZNPA 3ES4A 4XFGA 3S0MA 1ZVFA 1LB2A 4I01A 4QGMA 3RDIA 1YFXA 3CEWA 3IBMA 3RYRA 1O5LA 2XLAA 2E9QA 2Z69A 2XLFA 5T3NA 1Q5OA 3ROUA 4IETA 1GQHA 5JSOA 4MGYE 1VP6A 1CAVB 3PNAA 3LWCA 5BV6A 4LUMA 3S7EA 2XHKA 2O8QA 3M70A 4JV4A 1XRUA 2MPFA 2Q4SA 4LUKA 4OLLA 5I0UA 3BPZA 5FLIA 3H7JA 1EP0A 3RYPA 5FPXA 2GH2A 3FE5A 1YWKA 2HKXA 5KHKA 4HBNA 3NL1A 1X8MA 2P17A 3E5XA 4L2NA 3FFQA 1CAUA 5KBFA 3U10A 2C0ZA 3JZVA 4I3PA 4QM8A 4EWAA 2EAAA 4FT8A 3NVCA 5FLHA 5I93A 3PVBB 5FPZA 3LZZA 1IPKA 3KSCA 3FZ3A 2CAVA 4Q29A 1Q43A 4Q0QA 3VHRA 2GU9A 1CAUB 5D1IA 4IEXA 1FT9A 3E6BA 4I02A 3BU7A 4XF3A 4KWLA 2OA2A 4XF9A 4WZCA 3IIAA 5EZWA 1VR3A 1J1LA 4L11A 3BCWA 2IXIA 3KGLA 4HVRA 1UCXA 1OD5A 1RUOA 4LULA 2BEOA 1H1IA 4GULA 2MHFA 3SCHA 4LEJA 1J3PA 1RGSA 3R6SA 1ZZ8A 5FLJA 3IDCB 4Q0PA 4XFAA 4QM9A 1QXJA 1SEFA 2H6CA 3EO6A 1O3SA 3E97A 4JVAA 4BHPA 4HN1A 4NVPA 4XF1A 3HT2A 2QJVA 2D5HA 4MUVA 4YNIA 5FCCA 5KHJA 3ST7A 1O5UA 3CF6E 1RC6A 4QGNA 2OYZA 1L3JA 4D7TA 4E2SA 1CGPA 1O7FA 4IEOA 4ORFA 1DGWA 5J48A 2OPKA 1RUNA 2GC1A 3C3VA 2Q1ZB 1X8EA 3DN7A 1ZRCA 3D0SA 4BIFA 1QWRA 4ONUA 2D40A 4META 5KHIA 2IXLA 3WW1A 2CAUA 3D0JA 2I45A 4IERA 4ZU4A 4RD7A 5I0SA 1ZZ9A 2N7GA 2PFWA 4XFBA 5KHHA 1PMIA 4PIYA 3GBFA 3FWEA 3RPQA 2BYVE 2B9UA 1Q3EA 5HI0A 1GQGA 4N9IA 4I09A 5JR7B 4Z07A 2UY9A 2K9ZA 2VPVA 1O3TA 2XLGA 1ZREA 4QX5A 5JSRA 1I6XA 3LA2A 1ZZCA 1J59A 3LOIA 1OFNA 1ZZBA 4XF0A 3H8UA 2UYBA 4YSFA 1YFYA 2B8MA 1G6NA 4D7SA 3UKVA 4MX3A 1WGPA 2OZJA 3RYKA 2QDRA 2D93A 4UXAA 1FXZA 1UIJA 4KL1A 2D5FA 3U11A 1LR5A 3NKTA 4IEQA 4X6QB 4I0AA 5E1RA 3NW4A 1XE7A 4MGIE 1NE6A 3CO2A 4R52A 3SMHA 5CADA 3EJKA 1NYWA 1PM7A 3LA7A 3QACA 4IEYA 1OI6A 2XL7A 4MV2A 4IEUA 4F7ZA 2ET1A 4Q0SA 5BY5A 1X7NA 3NJZA 4Q0UA 4O9GA 4XFFA 5JCTA 2PTMA 4XFCA 2Q0AA 3I7DA 3DL3A 3IDBB 3H1YA 1RL3A 3G7DA 4IEPA 3RNSA 2MNGA 1RTVA 2UY8A 5I0RA 1WA4A 4OFGA 4QXKA 5JAXA 3FX3A 3EBRA 3E6DA 4O9EA 2XL9A 4N9HA 2PHDA 4XEZA 4HLTA 2IXCA 1SQ4A 2Q30A 1J3RA 3I54A 1YFWA 4AVBA 5LRRA 3ACLA 1NZCA 4I2OA 3BALA 3H7YA 3TNPB 3CL1A 4IEWA 3RZZA 2DCTA 5AVPA 2KXLA 1YFUA 3LA3A 4AVCA 2HJIA 1J58A 1DZRA 4CYDA 3WW3A 3O14A 1O4TA 3MYXA 5LEKA 2IXJA 2WFPA 3HQXA 5LEJA 3OTFA 3ELNA 2ETEA 2UYAA 5CU1A 5FQ0B 3WW4A 3UKNA 1DGRA 2FQPA 4E2QA 1UIKA 4KU7A 1QXRA 2ZCWA 2IC1A 5J3UA 3ETQA 1DZTA 2B5HA 5K8SA 5I91A 3E5UA 4QMAA 1Y3TA 3SCGA 5J7MA 4AXOA 3EHKA 1ZZ7A 3FJSA 4PIZA 4TLFA 4KWJA 1Y9QA 4AQ2A 4H7LA 1ZX5A 3N4MA 4XF4A 5I0TA 2WC2A 2XKPA 4LA2A 4EROA 1YLLA 5F1RA 2PHLA 1NXMA 2ZKLA 1HW5A 3H50A 4HN0A 2IXHA 1CX4A 3H1MA 1IPJA 4MGKE 2F4PA 3S7IA 3H9AA 4UBHA 4PJYA 1U12A 1TQ5A 3OF1A 1EPZA 2BGCA 4FAHA 4LTAA 4XFHA 4EWDA 5C6CA 1NE4A 1V70A 2Z2SB 4AQ6A 4YRDA 4B29A 2VQAA 4IESA 3FHIB 4HSJA 2FMYA 3WW2A 4ZU5A 1LKNA 3PLQA 4MZUA 4YYOA 1JUHA 4AVAA 2H0VA 4WBBA 2OZ6A 5FDBA 2GC2A 5E16A 1O3RA 5EFUA 1VJ2A 4J1WA 1FI2A 3ZDSA 4BH9A 3L2HA 4E2GA 2EVXA 4KWKA 2VECA 5CVRA 3UKTA 1ZRFA 4FBFA 1UD1A 4KU8A 4QGLA 3I59A 2XKOA 3MPBA 4X6RB 4EWEA 4YARA 5BXXA 1O3QA 2PAEA 2GZWA 5I8YA 3KMHA 4J1XA 1CAWA 4A2UA
chains in the Genus database with same CATH superfamily
2CTWA 1HX6A 4P9XA 4YVSA 4CPBA 3DXUA 5C9AC 5FPLA 1RVF2 3AG1C 4FPEA 3ASNB 2YFZA 5DUUA 4EEQA 1P7GA 2ZDIA 1HXS2 2BOCC 4MVZA 5KA5A 1TME3 3IWZA 4MW3A 1K4CC 3MUY1 1DDLA 3BY6A 4R7CA 3N7KA 5D8AA 3CLPA 1J1TA 1NCRB 5K0UB 1AJNA 3RGBA 3PTRB 1HRI2 3I2IA 3MDPA 3WDUA 4JI1B 2F4LA 4CEWC 3VZLA 5A32A 1DIWA 1SDWA 2EIKC 1NXD1 5FYYA 2V09A 4LBQA 2EZOA 1JYIA 5BNOB 5B2GB 4QD2A 2LFSA 4WFEA 4K8FA 4PLNA 3E5QA 1I08A 1Q6IA 1PO22 2X5IC 3H1WA 4OXSA 1OMIA 4AI3A 2VQEB 2YZ4A 1O5LA 3CCUV 2QGNA 1US3A 3I5DA 1VP6A 2W94A 4UI9L 4YZ2A 1OCCC 1ULOA 2BOBC 2BVBA 2XHKA 1PKXA 1OQEA 2BPA2 1LUWA 3C3SA 1WNSA 1AL23 1XB9A 1L7QA 3IZOA 3ZYHA 2A3XA 1IPSA 3RW0A 3JB4C 3LGRA 2Y6LA 3ZKUA 5IATA 2PGGA 1TNRA 2CE4A 4YW3A 1RIRA 2Y34A 4Q26A 2A75A 4I3PA 1XMQO 4CCLA 4UB6Z 2BRTA 1AB3A 4O4IA 2HWD3 4EB6B 5LXTB 4EKWA 2WNVC 2WFF1 4IE5A 3QH6A 5LY1A 5JIUA 4KGGA 2ARBA 2OA2A 4YWAA 4WZCA 4ZBMA 4S2GA 4AEDA 1N3QA 1VR3A 5L7OB 1NZIA 1J1LA 2MK3A 5LMUB 1KFUL 3UCSC 1HNZO 4XBQA 2D6OX 3R4UA 3G6BA 4F6EA 4LULA 3SJBC 1LOFC 2AZ2A 3QO7A 1LULA 4N23A 1HRV2 3J8F3 3R6SA 1W39A 2A71A 4RA0A 2Q0OC 5CISA 2N05A 2VGDA 4ZY9A 4FPGA 5BNOA 1V6MA 4KHPO 1D5AA 1O5UA 4CDWC 3CF6E 4XMAA 4DYLA 4U7OA 1OFSA 4ZZ8A 1A3KA 4LP8A 4JDOA 3RWNA 4OHVA 5CFDC 3GHNA 2IXLA 1TVGA 4NIIA 4OCTA 5LBCA 4AEJA 4RD7A 1NG0A 4XFBA 2MW2B 1YTFD 3SKVA 4PIYA 4LF9O 3FWEA 4FM0A 5L9VA 2UU9O 2EIJC 5JR7B 3VQWA 4JI0B 4QX5A 5FUIA 4NHXA 4UFMA 3B9IA 2QJ1A 1REEA 1H38A 4F3JA 2WWSA 1A8DA 3VHOA 3BABA 4Y5SA 5GZFA 4URTA 2P67A 4P30A 1N1SA 3OSDA 3ABLC 4Q4W3 1KQRA 4LO7A 1YCIA 4J7JA 3CEIA 1RUE1 5ERLA 3AZWA 3AC0A 4N7UA 2RS53 4EB6A 5LXTA 2OCCC 4JX0A 3CC7V 1FPN2 1V6OA 3J7LA 1TNFA 2J1AA 1XUQA 2QQMA 2RJ2A 1M93A 4G27B 3NMBA 2MNGA 3OUIA 1ULFA 4TV9B 1G9CA 1U97A 1RUG1 4NTWA 3A0KA 1KMIZ 2XT9A 4N9HA 1UY4A 3WNKA 4AILC 1EUTA 3HKBB 3THTA 1SQ4A 1CJPA 2JDMA 4AVBA 1Q56A 1NZCA 4FQZA 4QQHA 4CYDA 1OVSA 1RXFA 4UFKA 1W8NA 3HQXA 3SH4A 1RUI2 4KQ7A 3ZMUA 2D3SA 1W0KG 4NRMA 2JB4A 1QXRA 5EZYA 5J3UA 5AFBA 4NRQA 5L73A 4CA9A 4YY3B 3E5UA 4ZONA 1GOHA 3EHKA 3T09A 4PIZA 1MQTB 4LF7O 2Q7EA 3HKDB 4H7LA 4BXFA 2WC2A 1YQ6A 2ZKLA 1C28A 2NM1A 3H1MA 4PA6A 4MGKE 1J83A 3S7IA 4ZHQB 1VF5B 3OF1A 2EIMB 1TME1 4WFGA 1D0HA 2VQFO 3AX4A 2BUKA 2AZ0A 3WQ1A 4PQ9A 4AZZA 3E8HA 2VW1A 4WFBV 2FMYA 1FMD3 2JDKA 5B3SB 4DUXA 3SYPA 1HWYA 3B3QE 4LNVA 4XCBA 2FL4A 1ZSPA 4JTCB 3I8TA 2WBKA 1QJU2 4QX1A 1GV9A 3DYOA 2JEMA 2L35A 5C3SA 2E33A 1XI1A 1MR5A 4PDMA 3C7FA 2ZE8A 2WLIA 2GDSA 2JECA 3SC7X 2PELA 3POBA 1PM4A 4NOTA 2ZHLA 4OI1A 2UXCO 1Q8OA 5DAQA 4FZ1A 1H2LA 4DV7B 4MT8A 1XNCA 1U0AA 1MPXA 4FLWA 3NR7A 4AOCA 4TTGA 1FKAO 5C8YB 2CDYA 1SC5B 2EALA 1E5HA 4FP3A 4IW3A 2CGOA 4HMZA 2AEYA 3HN3A 1THZA 4DW1A 4K8ZA 2WZR3 1AL21 1MS8A 4KFMA 4XHXA 1XL4A 5LMNB 1CPYA 1IS6A 4BB3A 2XBO3 3O0XA 1MQTA 5L3DA 1GNZA 3HKDA 2WLHA 1OUSA 4O4JA 4EJRA 4FXGB 1CP9A 1APNA 3MF9A 2W1QA 1C57A 2BSKB 4GALA 5T5JA 1BZKA 2ZTNA 5IJ9A 4DV4B 2HWD1 2VZRA 1UPSA 5SV5A 2UUBB 5LCWL 2YYOA 4KH9A 2OTLV 3MLLA 4DV6O 2X53S 1M5IA 4LA3A 2J1UA 4YLZA 3S6PA 2JIGA 1CAVA 1W05A 3U75A 3J8F1 1HDKA 3H1JH 4XDOA 1KXGA 5F7UA 4UW4A 5FMDA 3HKEA 1Z78A 4H7MA 4MGYE 4MXWB 2CHHA 3HN1A 4LKDA 4Q2FA 3M7MX 4NUBA 5A1AA 2JKBA 1M9NA 4LUKA 2P5OA 4I0WB 3CBNA 2JJ6A 4LBJA 3RYPA 2VCMA 1UKRA 3MLJA 2HKXA 3GWOA 3P1IA 3FFQA 2W39A 1GZTA 2V72A 4QPJA 5KR7A 3M3EA 4BQ4A 3BTYA 2A6WA 2FMDA 4Q0QA 3IT8A 3POJA 2RMU2 3I2KA 3ZN6A 4LBMA 4YVWC 2ZR2A 2JG8A 4LWSB 5FZMA 3RYCB 5JQGA 3VBFA 1H4HA 2YGLA 5C8CB 3KGLA 2RR13 4LNUA 1OLQA 2LQTA 1DP0A 4Q4W1 1RUF2 3OD4A 4A7YA 5A3MA 4XVHA 1POQA 4DK0A 5A7WB 1AXYA 2RS51 1XNKA 3QH7A 5EC1C 2P4KA 2GSYA 2O0OA 3W7UA 4BHPA 4LIUA 1DU3D 4YNIA 4C91A 4FLTA 4UVCA 4ORFA 1V55B 2RN9A 1VBB3 2ZE7A 2A5ZA 1Y6XA 3V0AB 1IDSA 3WSOA 1DQ0A 1PX3A 1URXA 2VMEA 1W6PA 4AHXA 1DLBA 2AH2A 4GZRB 3N9MA 1RUC2 4UVBA 2X05A 3M7AA 1HB4A 1AR71 4PF1A 2OUHA 4IV1B 4AFAA 4JI7B 4BQYA 4N9IA 2VTFA 4I09A 2GTAA 3QVNA 3RBZA 2HLDG 3E89A 2GNDA 3VBHA 2Z79A 1LHUA 3WU2Z 1YFYA 1N0NA 3GXUA 4Q4Y1 1N36B 2D93A 4B4QA 1FXVA 3JCUZ 1HNXB 1S2KA 2CAZC 4D6TH 3OBTA 4JGZC 2TBVA 3N27A 4DV0B 4RGAA 1NA1C 4MV2A 5BNQA 1WB7A 1S0IA 1NTKH 3KZ4C 4X65O 3ZSEA 1VQ7V 2YUEA 3RYCA 1PMJX 1IX9A 1Y76B 2X6BA 3G7DA 4AW7A 4CP0A 3LOBA 4XJ9A 1JN2P 1Y4WA 1JUIA 1L0LH 5ANQA 4FLVA 4YW4A 3JASB 3AYDA 2XL9A 3ZX7A 1FMD1 4HYOA 4HLTA 4LFAO 1V6LA 2A70A 2WNUB 1D4M2 1LOEA 3BALA 1U5XA 4CZSA 2CDOA 2VUCA 4IEWA 3RZZA 3ZVXA 1POV3 3OPZA 3NV1A 1AILA 3ENRA 2RM22 1ULCA 4QPIB 3RZJA 4BE3A 3KCYA 3MHHC 1L7LA 1OOPB 3ELNA 2P6JA 5FQ0B 3UGFA 1PK6A 4J6GA 4XACA 5J96B 4FZ0A 2ITCC 1DZTA 1IG0A 2N04A 2JDAA 2VG9A 5GZEA 5J7MA 1WMXA 1Y9QA 5I0TA 3KHBA 1S5JA 1W8HA 3OB8A 5C4WB 5LBBA 4Y1YA 4UWDA 1U12A 3HKCB 5A7PA 5J1XA 3NNMA 2QTWB 4BJ0A 4QE9A 4GKKB 2VVDA 5LHIA 3TAYA 2XBO1 3APBA 2ZQMA 2KQXA 4IGPA 2Y6FA 1O8SA 2R72A 1H6YA 3ABTA 1V9U3 3ZPOA 5FDBA 3IDEA 4J1WA 2LJ2A 3BOWA 2YIBA 4BH9A 4M0NA 4KWKA 2TEPA 4DXRA 1W06A 4F6RA 5HCBA 3VKLA 3LDBA 5HBAA 1S0EA 1ULGA 1D5NA 1J84A 1WCQA 3VDDB 4J1XA 3LNNA 2CTQA 2IJKA 3TJTA 1MVEA 4ZXKA 5JOZA 1AI5A 3JD1A 3POEA 4I4TB 3ZHSA 1YUDA 4B1LA 4LJHA 2VD7A 2R043 4AQYO 4RR3A 3J81N 1MSWD 5FQ0A 1B3QA 2GN3A 3O65A 4F8AA 3M8AA 4YZ5A 3LIGA 2VQ0A 3OGRA 2X09A 3JD72 1VB4A 4R9CA 4FSJA 2PAKA 3PU8A 5F3IA 4AE2A 3SPIA 4XTMA 3ZRWA 5I8SA 2BWAA 3ABMB 4QXHA 4X64O 5C4WA 4G2KA 5CFDA 3NQHA 3IC9A 2VZ1A 3GB7C 1HR0B 2VCBA 4FVMA 5A1LA 2UWBA 3GJBA 2ADDA 1I0HA 1Y7BA 1PO12 1LENA 4AK3A 3U4XA 1DQ4A 5FZAA 4EN6B 1FFXB 4BQ1A 3HR9A 1RUD2 1H30A 5KLVH 2UXDO 4BIOA 3F95A 1R092 2P6HA 1E5RA 2RR11 1QJEA 1OPOA 4GA9A 1R73A 3AVRA 4IE7A 3J7MA 1LHVA 5C3OA 1JVMA 2UXBB 2BU9A 4TV8A 5GZGA 3GZTB 2IWGB 5BV6A 5DN6G 4JV4A 3M3OA 4CDUC 3LFIA 1VBB1 1MS4A 4OLLA 3F7YC 4NXNO 4XAAA 1KU9A 1X59A 4FM1A 4C1XA 3W58A 1V6NA 4INDA 1HW7A 1X8MA 1P84F 1BHAA 4GWNA 5JOYA 1H9WA 1OURA 1W2NA 3WB2A 1ZYBA 4Q29A 4JV5B 2YC4A 3VHRA 2YS8A 3LEGA 5FP9A 1FV2A 1W8ZA 3JARB 1FT9A 1D2QA 2IXIA 4TT3G 3AYEA 2QKCA 4HVRA 1RSOB 1OD5A 3CC4V 1SCSA 3WHUA 4XXPA 2Y26A 4LEJA 3FLPA 5IJ0A 4KBBA 5FREA 4QM9A 1Q6HA 3EO6A 3E86A 1FX5A 4YM0A 1CZVA 1LAJA 2WAOA 3WDTA 4OPHA 5KHJA 4DV3O 1OA2A 5EYXA 1JZ8A 1EFRG 3A0BZ 2Q6AA 1ASJ3 5LP6A 4NTYA 3AZXA 1JMKC 2IVJA 3D0JA 3Q8BA 4ZU4A 5CFCB 1BMFG 5HCAA 5JZGB 1B35B 3AM2A 4CS4A 1UNBA 1W8FA 5GKAC 2DBNA 4G3YC 3TCUA 2E7QA 4GX0A 4Y20A 2UY9A 3AFKA 2K9ZA 5JSRA 2B9ZA 4N7IA 2G9ZA 3VBUC 1UMHA 2CTRA 4D7SA 3L74H 4IE6A 4U3FH 3B8MA 1JHNA 1XHXA 4BDVB 4DRVA 5JVDB 2HEVF 4NR1A 3JAKB 1AROP 2BQPA 4N43C 4R52A 5CADA 3EJKA 2JIJA 4RQPC 5C5UA 3VZMA 2Y64A 4J11A 3ZSMA 1DYOA 4XFFA 5JCTA 2K2SA 1QQP1 3SPJA 2VNGA 4ZPIA 4QQ2A 2W87A 1IBMO 3A0HZ 3WNMA 3ZLIA 3ZFEC 1CN1A 1E1RG 3DEMA 1JJOA 2CYFA 2GH8A 4J7KA 3VBRC 1RUH2 1UQXA 1V9U1 2LRPA 3ZR6A 1KEXA 2VUAA 1O9HA 4AAPA 1QKQA 3I2OA 3K08A 5JWPA 2MEV2 2J1TA 3AYCA 2F23A 5EBWC 1O4TA 1YNAA 1S0BA 1H8HG 4XDKA 5C3PA 5LEJA 3OTFA 3FLTA 2AYHA 5FXXA 1ZL8A 1LOAA 4CP2A 2ZCWA 2IC1A 1XEQA 3JBG3 3C8XA 4CDQC 3SCGA 2VMIA 4MVTA 1XMQB 3SKJE 1VMGA 2ZGLA 2DN9A 1YVWA 1N1YA 1ROPA 3QLQA 3MV01 3ZYPA 1WB8A 4H3WA 2JGUA 3JAKA 3NNLA 4FI9A 4V2VA 3DGTA 1HNZB 1OJHA 4ZI7A 4AQ6A 4YRDA 5IUQA 4KNCA 4YM2A 1SHWB 1OC1A 4EZHA 4GKYA 5IJRA 3D3QA 1CD3G 1K33A 1N3OA 2R7EB 1ACCA 4KHPB 3LPGA 4B7KA 5A1FA 4P9IA 4YW1A 4QGLA 3I59A 3V0BB 2LGWA 3WG2A 1HJGA 1OA3A 1RM1B 5EXOA 1W6NB 1T5EA 1BQPA 3HAGA 1IBKO 5F37A 5JLVA 1BBT3 2YBPA 5KMGB 4YVWA 3CWBH 1AR82 1W2AX 2QZ3A 2IXKA 1HN0A 4LF9B 3UJOA 2EAKA 2G9FA 4MSVA 4K40A 3ZXAC 1VRH1 3A0NA 4MH0E 2UU9B 1ZRDA 4BW5A 5E89A 2Q8CA 3AP5A 3ECQA 4XOGA 3E1F1 3WDXA 5GLWA 1HB2A 2E6VA 5FP8A 3T3YA 3KF3A 3JQWA 4C0HA 4AR2A 2DMXA 4PDWC 1EV12 2VM9A 3JXSA 1HQLA 3EQEA 4DR1O 2BTVC 3K51A 5JOWA 5LA6B 2BNNA 4JCKA 1XMOO 4TSFG 2I2SA 4LOTA 1DGLA 2KG7B 4BYYA 4IEVA 2VO5A 2QBXA 1ZLZA 1QMJA 1AXKA 3VL8A 4GJYA 4U2AA 4P9PA 1XE0A 3S3XA 4UXNA 1F5FA 1QOTA 1US6A 2ET7A 3FFZA 3RZGA 4NIGA 1VARA 3WF3A 5F32A 2OT7A 3HBKA 3OTOO 3AG4C 3M3IA 5ABJC 1ND3C 3KGZA 3N9LA 1WA8A 1EAH1 4X1KB 2X0LA 2A1XA 1LRHA 3ZYRA 2LO1A 5DEDA 4XFGA 2HHHO 3R0RA 4I01A 2JEXA 4Z1VA 4JYBA 2WS91 2Z69A 1AJKA 3PNAA 1K92A 4E4DX 1XRUA 3V56A 2YC0A 3HNYM 3BPZA 1ASJ1 4MVUA 4JZGA 5FPXA 1QCEA 1YWKA 1UZ0A 4LF7B 1WLEA 2VOKA 3D5OA 2B46X 3E5XA 3POFA 2J1VA 3OMNB 5DZGA 2PI4A 2HBTA 2BJSA 4EWAA 4FT8A 4RQFA 5JJJB 4CDXB 3KQRA 3SPCA 3O5SA 3UK9A 2VQFB 1QVFU 2HWE3 3A2FA 5FYCA 3S3WA 4AI2A 3MHSC 1SA0B 4WM8B 2AZ5A 5LYJB 5FYIA 3RS6A 1JS9A 4L11A 2OS2A 1XQNA 1UYPA 4MHUA 1QR8A 2AGAA 3BODA 4WM7B 1TMF2 4LHSA 4AFMA 4UCTA 2VCCA 4IYHA 3BAAA 5T5OA 3LE0A 2VU9A 3T4DA 5LGTA 4ZZ5A 3TN91 2R9RB 1FNZA 1DGWA 3POGA 5J48A 2OPKA 3N3HA 4O61A 4CCDA 2P2KA 2UXCB 1S72V 2V4VA 3F5TA 5FY7A 2CAUA 2QKSA 4X8AA 3H3LA 5FMCA 1ZZ9A 2BV4A 1BJQA 1WMDA 2PFWA 3IDAA 1SBDA 2BTOA 3C7EA 1Q3EA 1RINA 1COWG 1COV2 4NROA 4QPYA 1MS3A 1JOYA 4WFFA 1KP3A 1YQ5A 2UYBA 3ZHRA 4OI4A 3O9OA 1G6NA 2B4KA 4MX3A 2ZA9A 1HRI3 3CCVV 1BQZA 1GZ9A 1FXZA 2EXIA 2PLV2 5FZDA 4MGSA 5FZGA 1FJGO 1VAKA 2H3OA 2XNDG 4TYSA 1N33O 4CDXA 1OI6A 2XJSA 1EZVH 2ET1A 1PO23 4XABA 4E2LA 1SG3A 4P5YA 2LFRA 1H2KA 2R0FA 4J9ZB 1ALYA 5KX5B 1PIV2 5LHHA 5C5TA 5FZ4A 2WLNA 3DPRB 4DV6B 3AXEA 2FCTA 2ZX4A 5KAIZ 4CP9B 3HD8B 3LSDA 2IW5A 4I3GA 5CIRA 1AR93 3ZX6A 2PHDA 4JI4O 4XEZA 4CS2A 2ZM6O 4FOVA 1YFWA 4QE7A 1NY71 2DCTA 1WAZA 4X1YB 1K5JA 1UU4A 1FXKC 2GNBA 3FB6C 2WZEA 5KUKA 1W0OA 1RPOA 2X8KA 5CU1A 3RMXA 5DQ0A 5LB6A 2YEVB 4QKNA 2XWJB 1KP2A 2YSUB 4J10A 3IGAC 3CS5A 4NO4A 5E1AC 1UWWA 3N4MA 1CPMA 4JAUA 3OE7G 1YLLA 5F1RA 2PHLA 3B94A 3KVAA 5LATA 2KA3A 5EJ1B 2GMPA 4HL0A 4RUFA 2LP7A 4GAZA 3A0RA 4M01A 1HRV3 4NTXA 5FYHA 3INAA 5JI9A 1SQVH 1VBA3 2W0FC 3ASIA 4CTEA 1N0JA 5A2QN 1F31A 4YG6A 3ACFA 1ENXA 1HV0A 4YJ2B 2F95B 3LDRA 3OPTA 3QTCA 1DYKA 1YQ8A 2KB1A 2ZE5A 3FBMA 1PM9A 3CRAA 2JGDB 4RAIA 4TOIA 1AX2A 3PUAA 1O91A 1YIJV 5FNVB 5FBZA 4OUSA 4LKSA 5AG2A 3OUHA 3DCQA 4J25A 4FO9A 5C9AB 4N90A 3AG1B 1ZRIA 4AFCA 2ADPA 1XNAA 2FZ1A 3T2OA 1XBFA 1JYWA 3SPGA 1JYNA 2Z5UA 3IPVA 2HWB3 1VBC1 2JG9C 4D69A 3N2GA 1QNMA 1IG3A 1FPN3 2PQQA 4P02B 1Q86W 4R4XA 4X1IA 2E31A 2LUWA 5H9PA 1W6MA 3G6EV 1YIFA 1K3IA 4Q0VA 5ACA2 3KS7A 4LO6B 2VQUA 2PHXA 4M3CB 4X65B 1R6TA 5EV7A 5G04L 3SYOA 1M57B 1QJX2 4AWDA 2QE3A 1PZ7A 2QZ2A 2XDVA 2YI9A 4R9BA 2Q67A 2X10A 1VQ5V 1WW7A 1ENRA 2FDGA 1TVKA 2W95A 3ZDVA 1ZZ6A 1RHI1 4A5UB 3MW3A 5F39A 5EC2C 1RMU3 1VP7A 2CK3G 2PHWA 2F4VO 4EYUA 1A78A 1NBMG 4LFAB 3NSTA 3CSXA 2CGPA 4L87A 4OUEA 4H13B 3CEWA 3NAPC 2HJDA 2XLAA 1YDXA 4AFDA 4N43A 4AQTA 5JSOA 3N9NA 4ITCA 5H9RA 3ZHVA 1PVXA 2O8QA 3M70A 4DNYA 1F35A 3RVHA 1RVF1 1DF4A 2OIGA 4CH3A 5KXBA 3K3WA 1DTOA 1O9GA 2QQOA 1HLCA 4CH4A 5FZEA 3T0AA 1HXS1 3FKSG 1B04A 2QR4A 2ZGSA 3T08A 4B3RO 1LEMA 1QBZA 4JHZA 1VF7A 5FZ9A 1KKDA 5T54A 2WNVB 1AX1A 1AZDA 1PNFA 2YBKA 4XF9A 1HRI1 1BLZA 1LGCA 3RYHB 5H9CA 4M3CA 4XZPA 2CNAA 2NQYA 4XDJA 4P00B 1KECA 3BTZA 2XQXA 4DQAA 4DUVA 3WOGA 5T55A 1PO21 3C7OA 3RWRD 4CDWB 4KWUA 4AGVA 3G6JB 4Y1XA 2HYXA 5GZDA 1W8UA 4G28B 2ZGRA 2EBOA 2YBSA 5KAFZ 2I45A 2WWJA 2K9PA 1NZ6A 1JYXA 2EF6A 4AQYB 2WSVA 2IFWA 1TE1B 1ZWIC 2EIJB 1X50A 1UKGA 1XREA 1ND2C 3ZXDA 3C2UA 4N8MA 4X20B 4IV3C 5B1BC 1W2BU 4LE4A 4XF0A 5DUXA 1DCSA 2BOIA 3RVYA 5DDJ2 3MV11 4R8CA 2QDRA 3CX5F 1UIJA 1E79G 3ABLB 5DABA 4FTSA 4B3MO 5A3NA 1PMHX 1K42A 3K4AA 4X64B 3CDZB 5LBQA 3JB8A 1S0VA 3TETA 4QX8A 4DB5A 2OCCB 3THCA 2UWAA 2VOXA 3AZYA 3CJIC 4O9GA 3ZYFA 2Q0AA 2QE7G 3I7DA 1S4CA 3WG1A 2FTKA 1HRV1 3RYHA 3BA9A 3D3AA 3RNSA 2UXDB 5FZ3A 2OWOA 1W04A 1F4MA 5KC5A 1K5MC 4DEQA 2D2CB 4JI2O 1HJFA 3ZXJA 5FXWA 1SQBH 1J3RA 1BS3A 4UF0A 1GSLA 5FAXA 3P5BA 5CA0A 2GNMA 3KD4A 2KXLA 3KB5A 1H8TB 4D3WA 1PVC2 1YEWA 2E26A 5JUVA 5H9SA 4NXNB 5A3TA 5F2WA 4EFEA 4BQ3A 1URFA 4QQLA 4I55B 3ETQA 2NPIA 1DLLA 2RMU3 5LBFA 2A0LA 3FJSA 4XIOA 4JYAO 4YZ4A 1JOBA 4TWTA 2DYRC 4DEVA 2XKPA 4PDVA 2A7AA 3MW4A 3TYJA 4CXYA 2IXHA 1V54C 4H14A 1OH3A 1FAFA 1ZM1A 1RUF3 4DY5A 1W6OA 5EHDA 5FXZA 4P9JA 4XCAA 2ZCEA 2WPDG 3WF1A 2HWC3 4DRXA 5JMCA 1FPN1 1NE4A 4XURA 1LOBA 3JYCA 2DWEC 5IFPA 4JAAA 2SBAA 1WLWA 3PLQA 3L73H 4FK5C 2QKAA 2C2AA 1IKPA 2PHTA 2ZE6A 1MSDA 2GC2A 1MZFA 3VBBA 1NAEA 4LK7A 1XC6A 3OEBA 4FIPC 4DV3B 4W6XA 2EVXA 5FY5A 2IH3C 2YU2A 4QHZA 5DG2A 1RUC3 1QLEC 3HPLC 1W2TA 2WWUA 3NO8A 5F8PA 2E76B 4TZDA 5DAXA 3MFAA 2QCSB 4DV5O 1I5ZA 2Q8OA 3QOPA 2PY5A 4ZHNA 1K34A 1QJZA 1RUI1 4RSUA 1QY4A 5JOXA 3HIFA 1H8TA 1LGBA 5LL6Y 3GCWA 1UU5A 3SXWA 1PNLA 1WPXA 1GAXA 3RI8A 4NIDA 2RJLA 4YVSC 1OCRC 3W59A 4RFRB 4WVMB 5IYZB 2YDEA 3LEKA 3WCSA 3BKZA 2ZAHA 4UCVA 3KHCA 1JYTA 2QVSB 2W52A 3N2KB 3I2FA 3K5OA 1QOSA 2VZOA 2VBBA 4WV8A 3FBYA 2ZDIC 1VF6A 2A3YA 3PUQA 1HNWO 4K8RB 1WN7A 4CUBA 2DYSC 5FYZA 4CVUA 5E88A 1K3EA 3MZHA 3K04A 1I9RA 1PGW2 4FAGA 2BTQA 3HNMA 1PD3A 2JS5A 2ZABA 1IBMB 5DN2A 5D8AC 1JBCA 3AK2A 1I1EA 3CRQA 5LRSA 1VBE2 2GN7A 5EQUA 2A7WA 3J26N 1QJU1 3CC2V 3TNQA 1X82A 1GKFA 3B2EE 1ZNPA 3GZAA 4LR4A 5FPVA 3K79A 4I0XB 4IT5A 4LUMA 3OGIB 2Q4SA 3WP3A 5LHGA 5LMNO 1GBGA 2Y60A 5FZ7A 2ZZQA 4YGEA 4AI9A 3VB9A 3CIHA 3ZOIA 1ZA4A 1R6KA 2ZEXA 2WT2A 2C0ZA 4NXMO 1DQ1A 2BGOA 5IWAO 1SDDB 5C7GA 3MDSA 3LZZA 3TBDA 3MIEA 3ASNC 2FHRA 3GGLA 4XF3A 2JVDA 5EK0A 5ITZA 4M0HA 3AP7A 4NB5A 4DUZO 1C8M2 4JTDB 4LBLA 5EYPA 1UCXA 2UWCA 3WB0A 2MHFA 5BMVB 5FOBB 3KT1A 3APQA 1AYN2 3SEEA 3HR0A 5IK5A 4AEDC 1MNGA 1OCOC 4W4ZA 1NCRC 4JI8O 2FDKA 3DC6A 2VULA 2UU8A 5G05L 1IBKB 1GFF2 3IAYA 1AJPA 3JSNA 2VH9A 4LO5B 1K9MW 4K0KO 4DR2O 2D40A 3K03A 3E83A 3ZFGA 5BNOC 2WLKA 3RYIB 2GALA 1S55A 5A7NA 3JD73 5DAPA 4Y22A 1OKQA 4GLXA 4N53B 3IB3A 2VPVA 4CC5A 4JDNA 1YI9A 2QM7A 3FAVB 3VV1A 2GP3A 4UW3A 2FYUH 3H1KH 1W3XA 3FYEB 3N7JA 3OFNG 2YXSA 1BKZA 4COZA 4DR1B 1BMV2 5CB4A 1XMOB 1PO13 3U11A 4JGZB 4XDPA 2PYJA 3JD0A 2RMU1 2ORZA 1KC8W 1NA1B 2JDYA 4P5HA 3N9PA 1X9TA 4WFHA 1VAMA 3ZMOA 4F7ZA 2NN8A 4X8PA 2XJQA 2ZEYA 3M99B 2DTWA 1JODA 4YW5A 1RUF1 3ZRVA 1M4WA 1F23A 3OTOB 2XJTA 3BYWA 4Q1RA 3WF0A 2R9IA 5EYYA 2I07B 1HIXA 5KA6A 5FY4A 3LDCA 1TGOA 1SKVA 3VZKA 2HHHB 4QQPA 3T2TA 5A6ZA 3L70H 2ZX1A 3RQ0A 4W6WA 4LC1A 1E57A 2ZR3A 3THDA 4BQ2A 5JPNB 3S30A 3LKJA 4CCMA 2QQKA 5J98B 1RUC1 4XQDA 3SJQC 3FB8C 2VZTA 4PBPA 4KU7A 5FZCA 4S2DA 3U07A 2DCKA 2D6KA 2XAGA 1RYYA 3DXRA 2Q5ZA 4Z92B 4E9KA 1EM1A 4N53A 5FUPA 1OA4A 3AEIA 4KWJA 3FAVA 2D6PA 1QLNA 2DQ0A 2HEWF 1G8WA 3H9AA 4JGSA 2PZSA 1TQ5A 3JALB 3ZM8A 3BOPA 5BNNA 3ILRA 4R9AA 4XXAA 1UYXA 1XU1A 4EWDA 1M56C 1V70A 1GOGA 3Q4HB 3STLC 4YW2A 4DR5O 5EBLC 4ZU5A 1Z0HA 4NHLA 1VBD2 3FHQA 3CKHA 2LM3A 3P30A 4FXKB 1UD1A 3EMRA 4X6RB 4EWEA 1D4M1 4LF6O 1MMMA 5M0TA 4UFIA 2C9AA 3VBSA 1OQ1A 4J42A 2WO2A 3SH3A 4NAMA 4HZFA 2RM21 3B5LB 1H1MA 1XQ8A 2DU0A 4EE2A 3SJCC 4MGZE 3L2YA 5HFMA 1CAWB 3JQXA 4OPAA 4ASMB 1F8VA 3UETA 4NN0A 1SQGA 3AKSA 1VB2A 2FB5A 2WQ8A 5IVFA 2BNOA 5JPMB 1FJGB 2DU1A 2EA7A 3MEPA 3FMGA 3LAGA 1R3IC 3ABZA 1N33B 3HT1A 1EYBA 3ZN0A 3OEAA 3BFRA 4L8JA 4LBOA 2FMLA 1K7DA 4C8DA 4DPNA 1W3VA 1NCQA 5A9GA 2R49A 1MQTC 2AHZA 1NLQA 1REFA 1FXHA 1F15A 1V6JA 2N74A 3O1PA 1RUH3 1ND2A 5HXMA 2Y69C 2QEXV 4XETA 1NUKA 3QD6A 3OYWA 2VZQA 3K75B 3ACIA 4JTOA 2EIMC 4CU6A 4JI4B 3OCPA 4MYEA 2ZM6B 1GOFA 5CA1A 1UYZA 4R8HA 3NJVA 2YXLA 4KUMA 2A6YA 4QGMA 3H1HH 1RPRA 3ZHUA 1RUJ2 3QF7A 2XASA 2J22A 3J4UH 1VQLV 5KXEA 2EXKA 1MS9A 4CDUB 2F17A 3QNEA 4DK1A 1VPHA 4OMCA 3ZRSA 1A6CA 1ZA7A 3I3DA 5TISZ 2W46A 1WP8A 2EILC 4UVAA 1XYNA 2IJJA 1WBFA 2PF4E 3NL1A 1CWPA 2VAUA 4DZGA 3VD5A 3JD71 5KBFA 3VDAA 4TUYB 1BYHA 5D5QA 2VNVA 4J9YB 3MIFA 1QIQA 1PGL2 2D3PA 5JI7A 1SPPB 3FHAA 2BZDA 3HMYA 3ZIWA 3VBOB 4UYBA 4IEXA 4FCAA 5LK7B 4XHBA 1ODMA 1QU7A 2KD7A 1PO11 1RUOA 3R05A 3ZN4A 2ZXQA 5FZBA 4ISRA 1N4CA 2JG8C 3LQCA 4E27A 4CCJA 5CKQA 3VBFC 1RUD1 3FYIB 2ZGUA 1R091 2J42A 5CEHA 2XQRA 4IIJA 4K8XA 3N35A 2GC1A 1X8EA 4BISA 4PD4F 1RUE3 5L3BA 3WW1A 1QVGU 3HJRA 4O2AB 1W6QB 1EV13 4AHWA 4CBCA 4O4LA 1GQGA 2YXYA 3M3CA 1QHDA 3VBUB 4CP1A 1ZZCA 4YFWA 4P9LA 2WSUA 1JZ7A 5E79Z 3O1RA 3KG2A 5EJZB 2QQVA 1NT2B 4X6QB 5FZOB 3O12A 3VBHC 1E5SA 3B93A 4EFBA 3CO2A 4RQPB 4NPRA 2YC2A 3VBOA 2WNEA 4PBOA 4TLGA 4SBVA 2DVGA 4Q0UA 4OHZA 1E1QG 4XBLA 1WZXA 3I49A 4UFHA 2QQIA 5CA3A 3A8TA 3ZFEB 4CEYA 3DYPA 4NHKA 2F4VB 3I3EA 3VKMA 5JAXA 3AMNA 5K1XA 2RDNA 3SPHA 1UYYA 3VBRB 2IXCA 4J80A 3D4KA 2Q30A 4FPOB 4HPKB 3MUZ1 1AR5A 1SS3A 5FY0A 1MS1A 3IAPA 5A6QA 2JXAA 1DZRA 5DMYA 4Y4YA 1NTMH 4BCUA 3JAWB 5J37A 1N8RW 3WG3A 1SLIA 4CCOA 4HG6B 2P6CA 3ABUA 3USUB 5FR3A 1W6QA 3M4FA 3RRDA 2VXRA 4CDQB 5I91A 3K06A 1SZTA 5BR8O 1SLTA 2FDJA 5IYDO 3B69A 4B3RB 3CMEV 5FRAA 5C3QA 1IZ3A 4O4HB 2A3WA 1PK6C 3K4ZA 4C7UA 5A33B 4DO2A 4XF4A 3HWJA 2RS12 3PIJA 1KDMA 1W0NA 2Q1FA 5DUWA 2JD4A 2PN5A 5FBJA 3M3QA 1TMF3 1JFFB 2BGCA 3SEPA 2DW4A 4HNAB 1G8MA 1UMIA 2GMEA 4DR6O 2FZ2A 5GTIZ 4U3JB 3NV3A 4GB32 1FV3A 4FFBB 2WIIB 4YYOA 3DKQA 4LT5A 2NN4A 4WBBA 4XZUG 2UXXA 4LBEC 4AHCA 3T4VA 2IZWA 2D97A 2ZGTA 2WZR2 3WX5A 1XL6A 3E2EA 3WF4A 4FBFA 4Q4V2 4B08A 1NTZH 2DTYA 1NS1A 1RUH1 5BXXA 2G19A 1COV3 1QF3A 5L9RA 1U5YA 3BN6A 1WA6X 4OHWA 2MEV1 2ADQB 2WRAA 1Z5VA 1QHTA 5H5NA 3AKTA 4DXZA 1NQTA 2BERA 4AYUA 4D8MA 4BK4A 2AREA 4D6QA 2WNUC 5C8WA 1VMFA 2QNKA 3LNMB 2YIAA 4PDWB 1EY2A 2WYFA 1NCRA 5K0UA 4K35A 5F2SA 4B3MB 2OXBA 4RR3C 3GWKC 2YU1A 4I30A 1PIV3 3O0VA 5A33A 2OQ6A 4UUJC 3GALA 4Y1UA 4IGGA 3U0ZA 3B4SA 4HFSA 3ZRXA 2QTSA 4HSLA 2XWBB 1JFFA 4HNAA 3PVNA 3K0DA 2VW2A 4PIXA 4HKWA 5IVYA 4DINB 4IL6Z 3ZCCA 1CAXB 1J3QA 3UO2A 2PA7A 3AG4B 4PHZA 5C4WC 4OQ8A 4WBNB 3ITQA 3VOUA 4JI2B 4U7NA 3AMMA 3KKYA 4KXRA 3BB6A 4A7ZA 4A45A 3NJXA 3OMIB 3CD6V 3AP6A 4COYA 2VTXJ 4OQ9A 1WD3A 5T3NA 3LSEA 1AR81 2XAHA 1F4AA 2E75B 2LROA 5HCFA 4S2HA 1CIWA 2W2IA 3KQ4B 1DZQA 4QHBA 1EPWA 1LESA 1PNMA 2V7QG 2AR6A 1B06A 5GLUA 3WLUA 4JYAB 4MTOA 1I5XA 2F43G 4BOWA 1EV11 3JZVA 2A9HA 4GT1A 5A70A 5IY5B 1JR9A 5L7OA 1R1ZA 4MVRA 3UKMA 2GDFA 1Q82W 4UFJA 1CAUB 1UO9A 3AL5A 1QNWA 4K21A 3T4HB 2NLRA 3LDKA 1G86A 5F9TA 3WFVA 1CEZA 5LK5A 4LFCO 2VMGA 1AR73 2ILMA 2WN2A 1VQMV 4RS5B 4O65A 2V4DA 1SFYA 3WNPA 3VUOA 4C0BA 2P7TC 1JZ2A 1OBNA 1BK0A 1DQ5A 2NYYA 5FCCA 1NQJA 3VQXA 4Q4Y3 5KXCA 2NZ9A 1CR7A 1S0FA 1O7FA 4IEOA 5DZEA 3AL6A 4NAOA 1RUNA 4MS2A 4DV5B 3A4UA 1QWRA 2ZX0A 5KHIA 1AI4A 4QU2A 1W90A 3W7XA 4LITA 3E22B 5I0SA 4B4PA 2AC1A 3OUJA 5F5IA 2BE3A 2KKWA 3MHZA 5LP6C 2JX9A 4HKOA 5EIBD 2NNUA 3RZMA 1CZSA 5HPOA 3PJSK 3VN4A 4L9BA 5ACA3 2P22C 3BVCA 2UUAO 3JUUA 1W0JG 2JB8A 1QJY2 2OZJA 3B77A 1QJX3 2EIDA 2WDBA 2ZS6B 5F3EA 1KB9F 1LR5A 3NKTA 3CRMA 4A6SA 1HNWB 4JKKA 4X88A 3DSQA 3QO5A 1ZBA2 1YI7A 4CSWA 3MIDA 4TV9A 3PUHA 2GMMA 3OM3B 3GJAA 1S1AA 1HV1A 1IS5A 1TMF1 3HKBA 4L97A 2ZKOA 1WA4A 2RHPA 2VWKA 4RS5A 1R1A2 1I5YA 3CQOA 4LHKA 1JW6A 3OG2A 1AVMA 4AI8A 1Q8SA 5EPAA 5LOVB 2KSDA 1Y74B 4RHV2 3I2GA 4I2OA 1VMJA 2Q9LA 2B45X 4FFHA 5F3CA 4LO8A 4ZKTB 3LF7A 1Q8PA 1XXNA 3V65A 1STMA 1YRZA 4DR3O 4AVCA 1K12A 1LU1A 1YHQV 3TXSA 3O14A 3OAAG 1GN6A 2AACA 1S3JA 4XJAA 3WW4A 3WZ1A 1COV1 4PJ0Z 3KV5A 2RJKA 2B1IA 1D7PM 3DXTA 3DYMA 3TEZA 1Y3TA 4FLZA 4ZHQA 4NXMB 2YV8A 5IWAB 4FPPA 2VTXA 2PLV1 1WD4A 1WWYA 2VXJA 4LA2A 5IVJA 1NXMA 4HAMA 4UCRA 2NR5A 2E5LB 2ARXA 4Y4RA 2ZJCA 4PA4A 4DUZB 1TG7A 3OGSA 3H9VA 2FDFA 4GZ9A 4LMFA 4UT5A 4LTAA 3WVJA 1PNKA 2W68A 2Z2SB 4B29A 3AJZA 2G9GA 1PIV1 4EQVA 1H0BA 2R042 1UOFA 5EFUA 4BMBA 2LW1A 2V1DA 4JI8B 1Z7S2 5J09A 1MEC2 4DUYO 2WABA 2P3JA 1F2NA 2PHUA 4B3NA 5B1NA 3BUCA 1PNGA 3N9QA 2XKOA 3CXHF 4K0KB 3A7QA 3AMHA 4DR2B 3O0WA 3BGAA 5C8YA 2R072 1QH6A 4GX2A 4WVZA 1UX6A 4AQSA 3LSQA 3MO4A 1HB3A 5DDJ3 1W03A 1L1FA 2DVFA 2PYTA 3GVMA 4CUCA 4QPGB 1GM9A 4LORA 3MICA 1RJ8A 4JI3O 1OXCA 1XE8A 4TWKA 3ZXEA 3A21A 2G4IA 3WP5A 2OQ7A 4PA3A 2FDHA 2Z5WA 1FAYA 3MAQA 2BSKA 3JD2A 4WVWA 1DGWX 3OGJA 1KGYA 4AL9A 4XFIA 1NKDA 4CH5A 2L9LA 4GIQA 1U96A 4PI2A 2X29A 5CYYA 2K0GA 4X66O 2JE7A 3T1MA 5BNPB 4FPKA 3UT5B 4MVSA 3BCCH 1GTOA 3QG5A 3ZYIB 5J2TB 3HNBM 4QAWA 3J9SA 1SQPH 1OH4A 3MBWA 2IM9A 4HVQA 4Y3OA 1JZ4A 2EJRA 3G80A 3DKWA 3Q8FA 4CXWA 4MXWA 3NAPB 3WNOA 3JU9A 3JCZA 3TXQA 4Q6GA 3K5MA 2OTJV 1SLLA 3AK3A 2MPFA 4UFLA 2WKKA 2JS3A 4OZOA 1DLCA 5LWBA 1EP0A 2GH2A 2G38A 4Z8BA 2EIBA 2QDNA 1QH7A 4QPGA 4AGRA 5C70A 3RZHA 2A3QA 1Z2GA 1QEXA 2VZ3A 2G1MA 3UO3A 1O4ZA 3K3OA 2C1FA 4XUOA 4LWSA 3U10A 2WLPA 2ZIMA 4K9SA 2R16A 5C8CA 1G7YA 1AR4A 2CAVA 1Q43A 3RYFB 5ACA1 3BU7A 1SMVA 5JDBA 5A7WA 5FK8A 1QJX1 4DR5B 2GV9A 1T6BX 4NJ4A 1YXWA 3IFXA 2Z3YA 2IUWA 5DZFA 1US2A 5A3UA 2R1BA 1P4RA 1XNRO 2XJVA 5FJHA 3V0AA 3WUCA 4UCUA 4JVAA 2OUJA 4NVPA 3ZYGA 3WDYA 2QQWA 4LF6B 3P3NA 4GWMA 2XTAA 3PN1A 4QWNA 2A6XA 3ALQA 4AVVA 1QJFA 4IV1A 2JE8A 2HP8A 4ONUA 4O2BB 3AK0A 5T5PA 1NI8A 3AG3C 3KZIZ 4FMTA 3TB0A 1X9PA 1QQP3 4UOJA 4IV3B 5B1BB 3K5NA 4K20A 4JC1A 2WLLB 4YSFA 1H8EG 1CZTA 1I5PA 4BAYA 3BPSA 4JGYB 2VNRA 1IS3A 4FLUA 3D3IA 5LA2A 5AC92 4K6BA 5IYYA 2B9VA 4I0AA 1XE7A 5IVVA 1OKOA 1TUEB 1JZ6A 1VBE3 1WKYA 1Y76A 5DAVA 5BY5A 4ES8A 3CJIB 2EINC 3SNMA 1NR7A 2SLIA 2WLMA 1I94O 1K5QA 3JASA 2HYKA 3WT3A 3JBG2 2VS0A 4CDXC 1GZCA 3G67A 2WNUA 4YPJA 2RDQA 1K5MB 1S0JA 3WY6A 3BTXA 2XB6C 4MOAA 1OCZC 2NMOA 3WD5A 4A7KA 2IJHA 2C26A 3WEZA 4QPIA 1OOPA 3PDQA 4ISQA 1OV9A 3VKFC 2W1UA 1YFUA 4WM7C 2M6YA 1MZ5A 3IKWA 5GONB 1WPBA 5IVBA 3PL0A 4UCSA 2HWF2 1Y9GA 3U1XA 5K8SA 1MZ6A 3R65A 3I56V 4ASUG 4QPWA 2ZHKA 1FFTB 3N7MA 2WT0A 1OLME 5DDJ1 1Q8VA 1GZWB 4TLFA 3HKCA 1SLCA 2RDCA 1Y9MA 2DYRB 1C8M3 1SCRA 5FYBA 4BLJA 1B09A 4EROA 1EBOA 5F3GA 1PZ9A 1V54B 1CX4A 4JGYA 3T1HO 1F5JA 1WW5A 2GUZB 4PJYA 5FK7A 1BBT2 4ASKA 1GNHA 3HEIA 3EXAA 5CKNA 2Y6JA 5T52A 1VRH3 2LW8A 4QX7A 1XILA 2R9AA 4RL7A 2H0VA 1JQ0A 1MVQA 1S2BA 1VJ2A 2QWPB 2A06H 3VDDA 2CH7B 1QLEB 4D6SA 3O1OA 5B5EZ 2ZHMA 4KU8A 3ZXFA 2AW9A 3ZEDA 3J7AU 4I4TA 5CBHA 5FMOS 2EXHA 1PVC1 1OF3A 3ZYJB 1X33A 3L9DA 3I2JA 1AI7A 3D36A 1N34O 2GAUA 2QDOA 1DK1A 4YJ3B 3POSA 2DUPA 2VVFA 1OHHG 2HJFC 1VQ8V 4MLOA 1UPIA 4RN5A 4UBGA 5F6LB 4FQ4A 4YVSB 1OCRB 4EN8B 4CU8A 4CXXA 4EV0A 1ULDA 1EAH3 3MGUA 3BTAA 1D2DA 3J7NA 3H3ZA 2RMKB 3LDEA 1N1VA 2BFUL 2WS93 4JF3A 3AMPA 1NQDA 1IQDC 1XYOA 1QDOA 1FFXA 1LJ7A 1ODNA 2OCHA 1WLTA 1ZUQA 3O1MA 5EJ3A 1UZYA 4Q8KA 5D8AB 4LLOA 2Q8VA 2WA3A 2YGMA 5A32B 1OZ0A 1BQ0A 3ZPYA 2Y6HA 3VDBA 4LBQB 1UU6A 1JX9A 4WCEV 1N1TA 3VKNA 2Q68A 1GM7A 2Q5TA 5APAA 3RYRA 2XLFA 4AGGA 2W9XA 4MHRA 2HWE2 3ROUA 2PMWB 2W1WA 4QB2A 4IGOA 1WMFA 5FZ1A 1FYUA 4WF9V 3K5LA 3Q8EA 3H7JA 4YM3A 1QR9A 5BR8B 4JI6O 3ZFFB 4UB8Z 3SLIA 1BCXA 4A41A 2XJPA 1QOOA 5KHKA 3CCSV 5J2UB 1W9SA 1SERA 4I5SA 3JARA 2H0BA 4DO0A 2EAAA 3TN93 4K1YA 1ENVA 5IVCA 1AR1B 5CAZA 2PXJA 2ZBJA 1RSOA 2P4EA 1GN4A 1PL0A 2GU9A 4RGGA 4JQTA 1VBD3 3E6BA 5FZHA 4DR6B 2B42B 4O4IB 1PGW1 3ACGA 3RSJA 4GWIA 2Y0IA 1HB1A 4AEDB 1VBE1 2BW8A 1OCOB 1QXJA 1UY2A 4IDZA 4R9DA 3HT2A 4MUVA 1RC6A 4CH6A 1M57C 5CFCA 2JENA 1IS4A 5FO9B 5JZGA 1B35A 3AG2C 1UAIA 1XNDA 3C3VA 2KR2A 2OYQA 3D0SA 3PIGA 4P9YA 4D6RA 4E4HA 5JXGA 1G9FA 4BM8A 3MPPG 3POIA 5FXVA 4IERA 2RCVA 2QTOA 1ULPA 5CKMA 3P6BA 5K1PA 2N7GA 4PT6A 1IXMA 4MTGA 2ZXWC 5JVDA 4FPYA 5LA1A 5AFEA 3ZFFA 1AR92 5FY8A 1UY1A 4JQRA 3IN9A 5H9QA 5JCOA 4L0PA 5J2UA 5E1RA 1GWMA 3IMMA 4OULA 2W3JA 3LA7A 1GMMA 1CPNA 3ACHA 1C8M1 2BWCA 1IXBA 2YI8A 3DC5A 4P9WA 2ZGOA 1UL9A 2YPJA 4QB1A 1AYN1 5FFOC 4DV2O 1RUJ3 5I0RA 2O14A 1OSGA 3HB3B 4QXKA 1LHWA 3ZIAG 5IAVA 3WR0A 1M90W 3I54A 2JDIG 3H01A 1OLRA 4DR7O 4JHTA 2EZPA 2J1SA 5L19A 3M1HA 1J95A 3GDBA 4XW3A 1QU0A 3ML0A 1VBA2 5LEKA 4LBKA 4NPMA 1M1KW 1W99A 1YJKA 5JMOA 3UKNA 1DGRA 3LEMA 3UM7A 3WG4A 5FMOL 3AZVA 3HQUA 4NRPA 1SQQH 4EN0A 5EWSA 1BMV1 4BU2A 1UOGA 1BGYH 1ZX5A 4HONA 5EZYB 4DR4O 3RMYA 5GLVA 1XNBA 4UBHA 2Q69A 4CRQA 3CRCA 2XHNA 3OEHG 1M56B 4LFCB 1PV0A 4QGPA 2A79B 4FPJA 3ZMTA 4GH4B 4OHXA 3WINE 1YZBA 4LF8O 4YG3A 4OVEA 4JRLA 2W47A 3CPWU 1YQCA 5IFTA 3V0BA 1WCUA 1WJZA 1W6NA 3ZDSA 4J41A 3ZKYA 2HWB2 1VBC3 3WG7B 2QWRB 2ZKNA 4Z1MG 3BIWE 2VECA 5KMGA 5LW9A 3B7MA 3MPBA 2F1MA 3VKOA 1WCSA 3CNAA 5I8YA 2VZUA 5L3GA 1UY3A 2ES3A 2V4AA 4FPFA 1PHMA 5GLTA 3GZUC 3CXCU 2VC9A 3KV9A 4ZU7A 4GX1A 4IEZA 3CCQV 3WQ0A 2WLIB 1OPMA 1TZOA 1S0CA 4XUTA 1TA8A 3H8XA 5F5CA 3H3UA 4B3TB 1SZXA 3K4DA 3SHRA 3D82A 2WL1A 2AGSA 4FOQA 2UUAB 5LA6A 1RHI3 4FOYA 3ZMVA 1RMU2 1JCHA 2KG7A 1H8TC 4PCRA 1AR62 5FZIA 2GC3A 2JK5C 1DGRN 4SLIA 4A44A 3FUQA 3NWKA 1V0AA 5BUVA 3ASOC 1FD9A 2YICA 4N21A 4Z82A 1ZRRA 2TNFA 4TQFA 3W7SA 1SFNA 4DXTA 2P5BA 4B7EA 2DF7A 2P37A 4OZXA 4NIHA 1W28A 2RVAA 1Q7YW 4O4JB 4B3SO 4X1KA 1RVF3 4RYDA 4CCEA 3PJQA 1VF6C 4GH4A 4LH7A 2Y69B 2VR4A 1VBD1 4IQPA 4D94A 1HXS3 3E6CC 4MXVA 5IJ9B 2DVDA 2A6ZA 5BXZA 1VQPV 2P34A 2DYCA 1SLBA 2Y38A 1SBFA 4G4FA 1WW6A 4OX9O 1UFIA 2ERFA 2E9QA 4DR3B 5FZKA 5A3LA 4FLXA 2ID4A 2XUMA 2RJZA 4BXSV 1GQHA 1CAVB 2WA4A 2RQ6A 3S7EA 4DXSA 1G1XB 1LR1A 3K59A 1R3KC 2RS13 3RWKX 3D8CA 2EILB 3BVOA 3HKEB 2OIIA 2VNOA 1D2SA 3W9AA 4PELA 1BVP1 5FPBA 4ES9A 3T0BA 1F7YA 1W9TA 1SA0A 4WM8A 5LYJA 3ZJZA 4GB33 1S0GA 1YI2V 3UJQA 2DBIA 4MADA 4WM7A 3J80N 3IIAA 4Y1ZA 4C90A 2Y4TA 5A6YA 1GANA 3ZXGA 1I3HA 4Q4V3 3POWA 2VMDA 1GK9A 4GULA 3ZN6B 2JG8B 2JIZG 3CMGA 1YSCA 5JQGB 3VBFB 1VQ6V 4DUYB 3CZJA 1O3SA 3E97A 5FV3A 1WCKA 4LNUB 4LLFA 4D7TA 5F2VO 1S2EA 4X89A 1KDKA 3DN7A 1MA1A 1RUJ1 1K4DC 1M4UA 4JZ2A 2UUCO 3DGEA 4GMP3 2JJ1G 5EBMC 2V5DA 3VD7A 4H44B 1KS4A 3ZN1A 3B40A 4JI3B 1W6PB 3O1VA 2AHYA 3ZFGC 5FZFA 3H8RA 2XAQA 3C7HA 3F2ZA 2HFEC 5D5PA 1IBLO 2B8MA 2VJXA 4LH6A 4GKJO 5A7QA 2DE0X 1PGL1 4KL1A 4ZXEA 5GLZA 2EXJA 3VBHB 2B7YA 5KX5A 4X66B 3DECA 1NYWA 3A22A 2VL4A 5F6KA 1QNYA 4NWVA 3DPRA 1G9DA 2PHRA 1JJ2U 4CC6A 4Q0SA 1W59A 3NJZA 4CP9A 3T1YO 3ABKC 4I7ZB 4XYXA 4FFKA 3DL3A 3C3TA 2CL2A 3CP1A 4QDRA 5IVEA 1AUYA 5HCHA 3CZUA 3PMEA 3OGGA 3ZMNA 4Q20A 5CB7A 3C90A 4X1YA 4OUMA 1XSRA 1BT8A 5J36A 4DXWA 3L75H 4W4KA 4ZS3A 3T1LA 2GP5A 5H2FZ 3TNPB 3CCLV 1H1AA 5A7SA 2YEVA 1OF4A 3GF6A 1IVSA 2HWC2 3W5MA 1ORQC 3ME2A 4Q4X2 4BQWA 4XQWA 3OY8B 4Z2WA 1YJWV 2FQPA 3MIHA 4E2QA 4U36A 4BIZA 1KKCA 2PHFA 2ZGKA 2B5UA 5C93A 1KQSU 1GR3A 3VZNA 4XDQA 3MD0A 3OT7A 3CB2A 1ZZ7A 2HLEA 4CEWB 4DMIA 1JXNA 1PK6B 4M00A 5LBEA 2EIKB 4A6OA 2DCJA 2VWJA 2XPJA 1PZ8A 1AF9A 5FPRA 4N53C 4P14A 4YJ2A 4CUGA 1VIBA 4JRAA 2BOJA 2RS32 3WNXA 3EVKA 4Y26A 2X5IB 2Z0AA 2J1RA 1GWLA 5C33A 3VDCA 3P3PA 1RUI3 2R6QA 3SYQA 3WW2A 3S57A 1XNRB 1LKNA 3TEWA 4MZUA 2ZEZA 5JXIA 2JGDA 3FUOA 3VHPA 5E16A 2LALA 5BNNC 1OCCB 1VE0A 5IT9N 1TAEA 5FNVA 3NJYA 1BEV2 2V73A 5CVRA 1SLAA 4HKLA 4FOWA 4Q27A 5C9AA 4DW0A 1LTEA 1TEIA 5FOJB 5CNAA 2HVKC 4OHYA 2PAEA 2GZWA 3TK1A 4IYIA 1A8MA 3HQRA 4CCNA 1Y4MA 2ZD9A 4F6RB 3WP6A 1QJY3 3SCFA 2LW7A 4JYCA 4HANA 5ISLA 4KG8A 2Z4FA 1DYPA 3DV8A 1H9PA 1LECA 2VZSA 3VBSC 1YC61 3OY8A 4QDQA 3WQBA 2XOMA 4QKDA 1ZBA3 4Q8LA 4WVVA 4YHHO 2ZMKA 1UW8A 1QJU3 4L99A 4RR3B 1NOVA 2RS11 5D21A 2GHYA 4CEWA 5JSPA 5T50A 1FYJA 2D43A 2ZGPA 4KGQA 4MG2A 2B39A 2VMFA 3AFGA 2Y0OA 4JZRA 1R1A3 4TSVA 1I94B 2X5IA 4GB31 3ZRWB 4NMIA 1U5IA 3B09A 5E8AA 4RHV3 3SH5A 2CY6A 5CFDB 1AJOA 4Y24A 2ARCA 2JE9A 2WZR1 1F4NA 1NCQC 4QKBA 4XMIA 5SV8A 4Q4V1 3SR2C 4RQEA 2DFCA 1LB2A 1YFXA 3AK1A 2DQ3A 3U4SA 2D98A 1XNQO 1PP9H 4UCOA 1Q5OA 2VMHA 4XBFA 1NX9A 2PUSA 3FN9A 4YZ1A 4UW5A 1VRBA 1LODA 5IHRA 5GTHZ 3OEEG 1E5IA 3THPA 4TV8B 1QGLA 2JDHA 2M7WA 5FYUA 5GALA 4JTAB 3ZIXA 1ZBE2 2WNVA 4GMP1 1SQXH 5B1AC 2IH1C 3IJ4A 2P06A 3WP4A 4W8JA 4PA9A 3T1HB 3NVCA 3PVBB 3VD9A 5DG1A 3WDWA 3L72H 3VHNA 1Q81W 1LOFA 1NR1A 2BVVA 5CN0A 1YYNA 4TQDA 3M2MA 5A6XA 3LPFA 1B6QA 1Z7S3 1MEC3 3HPNA 2QQJA 4GJZA 3VD3A 2X6AA 2OW4A 1FOD2 3QCWA 2R062 3VGIA 4CDWA 2E32A 4AVSA 3SCHA 1J3PA 1DQ6A 1KRIA 3ETPA 3IDCB 3K48A 2P90A 2R073 3AG7A 4HN1A 1Y66A 3K57A 1YITV 4YW7A 1GUIA 2WZPP 4B8EA 3PVEA 2ZNJA 5HV4A 4IHJB 4QGNA 2OYZA 1LOGA 2VOWA 5IJ0B 4PDLA 2ZX3A 2W0XA 4ICGA 3GZEA 2XJRA 1VQNV 3EHBB 1IQAA 3UNPA 4MGQA 2FKXA 1WBLA 1BHGA 4LF4O 5FTTC 5FY1A 1EN5A 1N34B 1R3LC 4X20A 2WZ8A 1WLCA 2J7MA 3JD3A 3GBFA 3UT0A 1WUVA 3RPQA 5LP6B 1XOYA 1D4VB 1O3TA 1ZREA 1SQFA 3PHMA 3LA2A 1NLSA 1OFNA 1ZZBA 3H8UA 1JOJA 5B66Z 2E53A 3RZLA 3RG0A 4Y20B 3SQOA 5FJKA 4AEKA 1AYM2 4L92A 4H37A 2ZZJA 2BGPA 5FYMA 2AUYA 5IDJA 1PM7A 1VQ9V 4JDMA 1OD3A 4E8CA 4ZKIA 2XL7A 3B01A 4IEUA 1EN6A 1ENQA 1X7NA 1JZ3A 2Q1MA 1R082 3OUFA 4A42A 1MACA 3IMNA 2GBOA 1REDA 3H1YA 1GP5A 1P7BA 4IEPA 5GZCA 1UOJA 1RTVA 3VBOC 2BDRA 3FX3A 3MIGA 3VQYA 1ZAUA 4JAVA 3ACLA 1GN2A 4ET7A 4IHJA 4CEYC 2D7FA 1W9WA 4IUGA 1IURA 3SGIA 1KD7A 4I55A 1J58A 2O57A 3L71H 1EUUA 2ETEA 4XJUA 2AENA 5K9YA 4JI6B 3DF0A 3F7VC 4ZS2A 2NLJC 4C1WA 3RVZA 4HT1T 1GMGA 3AKQA 3FB5C 1C1FA 1K45A 1QJY1 1ZL8B 5F5AA 2XOKG 4LHNA 5B4NA 2QWOB 4AFBA 4ASLA 5HV0A 3NNJA 4YZ3A 1D4M3 2NMNA 1IPJA 1JI6A 2F4PA 4P08A 1POV1 4QPKA 1ZBA1 1EPZA 1QDCA 4FAHA 3FX7A 4XFHA 2RM23 3D6EA 5CBGA 3X2QC 2I74A 2W6JG 2ARAA 2XAFA 4H33A 4AVAA 4ZI7B 5HFLA 1O3RA 1FI2A 1IGOA 1R1A1 4LXLA 4P9OA 3T1CA 4LF5O 1ZRFA 2BBVA 2P4VA 1N32O 2RNBA 5GM0A 2H8PC 1MZEA 3ZXKA 4RHV1 1AXZA 2R32A 2F93B 4K3UA 4X62O 1C5IA 4P9GA 4AG4A 2HKOA 4LKFA 4YW6A 2WNOA 4QX3A 4QKFA 3I59B 4I0BA 4WVMA 4W50A 1GN3A 4QX0A 5IYZA 1KUQA 5AC93 4YVWB 3N2KA 2Y6KA 2ZEWA 3AMQA 2E5LO 4QQOA 2VQTA 2VUJA 1GQPA 1SETA 1A34A 2Q4PA 1MABG 3KWVA 1G9AA 2H6BA 2JD9A 2NP0A 2XVLA 1NVPD 2AEZA 4PA7A 5LA9A 2WAAA 1H2GA 1XNTA 2WFF2 3KV4A 3T2QA 2QQUA 1AHSA 1OVPA 5K0UC 3GYDA 1W2UA 1W9FA 3AKPA 4K3AA 4S2FA 4A4AA 2XHBA 2R041 3KT4A 4DV2B 1LNSA 2P3KA 4COWA 2GNTA 3ZMZA 1Z7S1 1MEC1 1YHFA 3R4SA 2W1SA 2DDUA 5BPXA 2ATKC 4I0XA 5FO7B 4DR7B 1ZVFA 2WN3A 1KD1W 1LCLA 3JAMN 4K7JA 4EZ4A 3BRCA 2HWF3 4P2ZA 5DUVA 2FCVA 3F5WC 1WA8B 2R071 1Q8QA 4XDLA 3O1SA 2K1EA 4GQ7A 2JRIA 1LGNA 3OGVA 1LUVA 1QQCA 4UV9A 1MG1A 1JU3A 2WT1A 4ATFA 5CA6A 2WJSA 4Z2AA 3I2HA 3ETEA 3APOA 4MGTA 3PJYA 5FYTA 1RUD3 3RZKA 1OHFA 4DR4B 1R64A 1R093 4GUNA 5C71A 2R30A 1XDCA 2XR4A 3TEXA 1OT5A 5FLHA 5I93A 4MTXA 2XXZA 4RWUA 3KSCA 3FZ3A 1GWKA 1GYKA 4BPZA 2ZINA 3VZJA 1RUE2 2QQNA 4I02A 2DCYA 5BMVA 4LR3A 5IK7A 4LF8B 3EB7A 2V5YA 5L7OC 1N3PA 3PMSA 3E8BA 3KCXA 1H1IA 4PLOA 4XC9A 4NIAA 4CS3A 3S5QA 3IC7A 4HETA 3H42B 1U5ZA 4XFAA 2H6CA 1W9YA 3NV4A 4JKLA 5IK4A 4TN7A 1RUG2 1YTFB 4B1MA 3RYIA 2DUOA 1SRYA 2E7TA 2ZMNA 1JU4A 4Q5OA 5JJEB 3I97A 4GYCB 5L3FA 4BIFA 4ABMA 3WNLA 4XJ8A 4X9QA 4DIQA 3AG3B 2VE1A 3CMAV 2W91A 5FWJA 2BBAA 3W5NA 4KP4A 4YGBA 3CU7A 2WYSA 2BYVE 5HI0A 3CCEV 2ZT9B 1WCDJ 4XE9A 3LSSA 4JGZA 3LUTB 1BXHA 1NA1A 2QWQB 3AYAA 2YG0A 5JJNB 5JR2A 3NW4A 4MTFA 3UV9A 1NE6A 4HK8A 1BL8A 1TME2 3TGUH 4MVMA 1JH5A 5DECA 4LFBO 4LBNA 4FPCA 2EINB 4B3SB 3STZC 4I50B 3ORJA 3HOBA 3E35A 1L0NH 1AVBA 5IY5C 4QIWF 1RL3A 3K77A 3PURA 1ZTEA 3GM8A 4DY3A 1OCZB 2WWWA 3EBRA 3ZS8C 3K9SA 4MSWC 4OX9B 1JOPA 5LRRA 4NYKA 5LGUA 4XPVA 2ENRA 5H6QA 4HZ3A 5AVPA 4RS5C 4DOUA 3DTUB 3WW3A 1DQ2A 1GLHA 4KMQA 1K73W 4NKGB 3MW2A 3O1UA 4MVOA 4H0LB 4EN9B 4JASA 1DGSA 1YJNV 1GRJA 2YUAA 1G4YB 1J5EO 2YY1A 5CMUA 3AVSA 3JALA 1AL22 4AQ2A 5LGNA 4CCCA 1G9BA 5IE9A 5AC91 3T4ZA 1UOBA 1KITA 5FZ8A 1HW5A 5DAWA 2VOVA 3T0DA 3NNGA 3Q4HA 1CIYA 2VCAA 5IWFA 3ETDA 3UGGA 4NHYA 2MEV3 2LGQA 4HXCA 5FMBA 4FFFA 2JDPA 3ZO0B 4HSJA 2JDNA 3OJBA 4E4EA 2HWD2 1F51A 3WF2A 4J7ZA 5CG8A 3JBG1 4I50A 5B3SC 1JUHA 1NH2D 4LHLA 4LIVA 1V6IA 1W2OA 3T30A 3WUDA 2Y6GA 4PLMA 2XVKA 4ZOLB 4GCZA 1HN1A 3L2HA 3W7TA 2ITDC 1GM8A 1DF5A 3AZZA 3HVDA 1PL4A 1GNYA 1BCCH 2E7AA 1BZWA 3J8F2 1CAWA 2UUCB 2YFUA 3LD8A 1FPOA 4DV1O 5I8TA 4ARYA 1BSMA 3PUIA 2ZGMA 4Y33A 2IU3A 1H8VA 2HWF1 2WO1A 1RP3B 1IBLB 3EFFK 2VMCA 3MI8A 3MF6A 4GKJB 2BCCH 1RJ7A 1Q90D 4TXWA 2CDPA 2VZPA 4Y1VA 1RFYA 3B02A 3U78A 4CU9A 2CU5A 3ZN5A 4ARXA 3ILFA 3K2OA 3IPVB 5IAXA 1SFPA 1BBT1 2WR9A 2VBPA 4BQXA 2E63A 3N2GB 1YQ2A 4CPBD 1AR83 2VOTA 3B8NA 3OD0A 3OR6C 3T1YB 1KJLA 2PAMA 5JXJA 1O4YA 4X1IB 2CTVA 3KF5A 4W6YA 5FUNA 1W6MB 4QXBA 4Q4W2 3OW2U 2CV6A 1UJWB 2RS52 2GC0A 2XONA 4NWWA 2VW0A 3PTYA 1CX1A 1TVKB 4ZOLA 2WAMA 3ES4A 3MIBA 3S0MA 4CDUA 4LPLA 4JI5O 1W8WA 3Q9OA 4XUNA 4KBZA 4DRRA 2XG3A 5DXDA 2JKXA 4M3CE 3LWCA 2F66C 5FIXA 4RO2A 1AR72 4RUEA 5B1OA 4QXCA 2O8OA 5IYCO 4LBQD 4TUYA 4N43B 2D3OW 3FE5A 4Y5TA 3T2PA 5K7PA 5FZ0A 4YG0A 2DCZA 1SPPA 4XJZA 2ZNIA 3AJYA 2P17A 4L2NA 5BY1A 3BHPA 2IJIA 2EIGA 1HKDA 4Q4Y2 3RFRA 4QM8A 5FPZA 1IKQA 1R6NA 3OBAA 2XH6A 1L8DA 4QPGC 4IE4A 2D6NA 3WXPA 1VQ4V 3V64A 4FPLA 4UFZA 5DPNA 1CJDA 3CE2A 5A3PA 5C8CC 2YMZA 1YJ9V 2RG4A 1JPXA 1UX7A 5HXVA 5KUMA 4MW8A 2WSSG 1RGSA 2YB7A 2WUHA 3S5AA 3WNNA 5FLJA 4Q0PA 2QFEA 4EN7B 2HEPA 3SITA 4GXLA 4QHOA 5L9BA 3PU3A 1SBEA 1SACA 3ZSKA 1CESA 2OX0A 1RITA 1FMD2 4E2SA 5BNPC 2E51A 5FPAA 3B00A 3AG2B 4O2AA 3OPWA 1V55C 2Q1ZB 3N36A 1H2NA 4AEMA 2HWE1 4JKMA 4XUPA 1YF2A 1LHNA 4META 3JSLA 5T5LA 3ICXA 3IAQA 3VBUA 3RN4A 5LY2A 1AR63 2QWNB 1XPWA 3RI9A 1H2SB 3CYOA 2ZXWB 4IV1C 3K3NA 3HBZA 3ZHQA 4RGKA 1GICA 1XJAA 4YHHB 5FZOA 1XSQA 2ZOEB 5FKBA 1WGPA 4RQPA 1GU3A 4UXAA 2HR3A 5FYVA 3QO8A 1ONAA 2ZGQA 1C5HA 2RDRA 2UXNA 3CRRA 2FCUA 3WDVA 3ZFEA 4FM2A 4YM1A 1AX0A 3UESA 3ZYBA 4I9QA 5L3CA 4JI1O 2XBO2 3O7OA 2PTMA 2ZGNA 4XFCA 2WO7A 4FFIA 3TWIA 2D6LX 3VBRA 3IDBB 1XYPA 3P32A 2EJ7A 3EYPA 4HPKA 2UY8A 4H2AA 2A6VA 4OFGA 1JHJA 1ENSA 3M8LA 2YXHA 4O9EA 1UZZA 2ZHNA 2PLV3 2DVBA 3RT3C 1AI6A 1XNQB 2W08A 2VQEO 3JAWA 2HEYF 2ZMLA 3H7YA 3VD4A 1RXGA 4F83A 2OKXA 5JIAA 3USUA 3ZHTA 3LA3A 4CDQA 2H94A 2Q73A 2OVUA 3C7GA 4BA6A 2Y33A 2WFPA 4QPIC 4UF0B 3LEIA 3H8OA 1OOPC 4O4HA 3KT7A 1UIKA 5I0DA 3BIEA 5CA0B 3GBGA 3KVBA 2WLJA 1DF0A 3I3BA 3K46A 1S5LZ 4E4ZA 1AR91 5FP3A 2ARHA 4QX2A 1GP4A 3OGCC 1UZVA 5F5QA 4HN0A 4U3JA 2ADEA 3UYJA 3H1LH 5ABJB 1ND3B 4FFBA 1AP5A 5A80A 1VQKV 1LHOA 5C6CA 4ZIBA 1ST8A 2R70A 3FB7C 2VBDA 1PPJH 5LMUO 1W6OB 4PQQA 4JGYC 2QA4V 5FWEA 5H6RA 1F9KA 4DRXB 3POYA 4LCUC 4BLIA 3K58A 1NJIW 1LOCA 4E2GA 2P3YA 3UKTA 2RR12 3VLBB 4FVVA 1GH6A 3G71V 2XVGA 4B4RA 1O3QA 2WINB 4WZFA 4LF4B 1WLDA 3VDDC 4M4RA 1AL0G 1AJQA 2VVEA 1P49A 1UN1A 1VBA1 1WP7A 3KCCA 2ETNA 2BNMA 4PDWA 1GKBA 3AKRA 2OPWA 3DUIA 1VBB2 4CZZA 5JXHA 1C8NA 3LFMA 3WV6A 3ES1A 2EULA 1Q6UA 4XTPA 1H4GA 2FD8A 2DJVA 4V1PA 4JI0O 1S5HC 4M3CF 3D36C 3SYCA 5CBLA 1UY0A 4IL7A 4GX5A 2HH9A 3SISA 2CGNA 3ASOB 5LASA 1GO3F 1C4RA 1W8TA 4FFGA 3ABMC 1CAXA 2GSMB 5AVAA 5ABJA 1VLNA 1ND3A 4WBNA 5CG9A 5CZKA 4FP2A 4HVOA 3ETGA 2HWB1 4A3ZA 2ATFA 5FKCA 4OYUA 3J7HA 5L36A 2BTQB 4GMP0 5LA0A 5TSWA 2DVAA 3W7WA 5L3EA 1UF2C 4Q4X3 5BZBA 1CONA 1EN4A 3RDIA 2HG5C 2D3RA 3W21A 3FLRA 4B3TO 3WCRA 2QKDA 2X7RB 3ZR5A 2B1GA 3GCXA 5FLIA 3BEHA 4GD4A 4FJCC 3OBZA 2R1DA 1T2XA 1RMU1 2RS33 4YY3O 1C3HA 3SYAA 4BW9A 1AR61 4OMDA 1CAUA 3N7LA 2Y8KA 1BHBA 3Q8CA 2XAJA 2AXTZ 1AP6A 4QNHB 2E3CA 4PI0A 1VIWB 5FPOA 4A3XA 4I9WA 4JYYA 2RV9A 5A3OA 2XUEA 4KWLA 3UL2A 5KXDA 1DBNA 3H0OA 3BCWA 1BEV3 1KS5A 4YXWG 1QQP2 4CU7A 3I3QA 5ITZB 2EX3A 1VAVA 1FXKB 1ZZ8A 2QQPA 3LCPA 5D2AA 2QQLA 3OUSA 5CBFA 1XOUA 1SEFA 4LF5B 1IHMA 4AHZA 5EYPB 1N32B 2QJVA 2D5HA 2DURA 3ST7A 2XMLA 1PGSA 1CGPA 3E22A 5FP4A 2VRZA 1SF9A 5FZ6A 4DFSA 4X62B 4BQ5A 1ZRCA 1V9U2 2W92A 5KWRA 5FY9A 4XIKA 2WLQA 4NHMA 1KBHA 1CVNA 1QXPA 1YIPA 5LZ6A 5CFCC 3PUSA 1MS0A 1HQWA 1PMIA 1R1BA 5JZGC 2HVJC 1B35C 2B9UA 3U37A 4DV7O 3CCRV 4DUWA 4OI0A 3UGHA 4QB6A 3JATB 2BP6A 3ZFGB 2JICA 2XLGA 2E74B 1LNQA 1I6XA 5JVVA 3QBQA 5KC6A 4MO3M 2FBEA 4Y22B 3RYKA 1KJRA 3NRUA 3AP4A 2D5FA 4XQ4A 1MS5A 1JYVA 4MGIE 3LDDA 3ZFFC 4BZ4A 3SMHA 5FPUA 4IEYA 3IIIA 3BU0A 5CB4B 1SESA 1K8AW 2VUDA 3GNEA 5JCOC 3ABKB 1Y43B 4OGQB 4COVA 4KI5M 5FZLA 4DV4O 5LOVA 1CXZB 5EP9A 1Y74A 3FD9A 2UUBO 5A3WA 2ZAAA 4LQRA 1FXKA 1H2MA 1NVPB 4GWJA 1V9PA 3MLKA 1VEWA 4UW6A 5EIYB 3NNFA 4PV1B 1D0GA 2JG9B 1POV0 1ZBE3 2HJIA 1K97A 3MYXA 1OUXA 2PQSA 2UYAA 2YHJA 1VRH2 2HBUA 4QDSA 3LSUA 2B5HA 1BE3H 5K4LA 5JH7B 4AXOA 3JATA 4AAXA 4O7XA 4DS0A 2YPDA 2C24A 5B4XA 1JA8A 1JZ5A 2CTPA 5A7OA 1FOD3 2PI5A 2Y4UA 2R063 3DXRB 3NKGA 2QM8A 2WQ4A 1PVC3 2TUNA 2WO3A 2VY0A 1NKGA 4BWOA 2VQAA 4IESA 4BMEA 1I7FA 2DV9A 1VALA 1FS0G 5BNNB 5IYBO 2UURA 3GHMA 4LE3A 3I4IA 2DUQA 1SZBA 3MFCA 1O6UA 2RE9A 4AI0A 2JEUA 1EAH2 3OOXA 1RB8G 2YROA 3U14A 1S76D 1XHZA 2CWMA 2W5FA 2EICA 1S77D 3B9CA 3H1IH 1BVVA 1RM1C 2BFUS 5C3RA 2WS92 1YXBA 4NE9A 3WQ7A 3O1TA 1W0PA 2HWC1 3AP9A 1L7RA 2YIDA 2Q8EA 1F4HA 2KM2A 3VZOA 4JPRA 3CCJV 2ZX2A 4Q1PA 2JG9A 4R50A 4Q4X1 5FYSA 1X36A 2P1BA 3JCIA 2OIEA 2IVIB 4XUQA 3VBSB 1AYM3 1ASJ2 3RJ2X 2YIBD 2IU0A 4JI7O 5FP7A 3W20A 3ZXLA 1NU1H 1T6GC 1VMHA 4LO4B 3ZSJA 5JH7A 1UMZA 3USSA 2FDIA 3CJXA 1N36O 1R083 5BNPA 3UT5A 5KHGA 3CJHB 1HNXO 2J1EA 4BIUA 3JD4A 2IFRA 3G4SV 2RS31 4LFBB 2D44A 4JTNA 5J2TA 3ILNA 1CQ9A 4FLYA 5IK8A 4DV0O 1UZWA 2XGXA 5DM6V 3R4DB 1V00A 3NAPA 4H55A 1X4TA 1LU2A 1NCQB 1NLRA 2IBZH 2DWDC 1C1LA 4XJWA 1GP6A 1BEV1 4HK9A 4LK6A 3KLSA 2O1QA 3TN92 1ND2B 2P3IA 3URFA 4L8QA 1W8OA 4GH4C 3TEYA 1KYOF 2C9KA 1HP8A 3IM0A 4URAA 3IBMA 3OYWB 3K0GA 4R4ZA 2GTSA 3LIHA 4IETA 1FNYA 5CA1B 5GJ6A 3I55V 4PDRA 1KFXL 1HQNA 4R6ZA 3WG7C 3ON7A 5I0UA 1UXZA 1R3JC 4FPHA 1N47A 1J5EB 1OQDA 3KM5A 3VL9A 2LTNA 4FTEA 4E8DA 3CCMV 5B1AB 5IT6A 4HBNA 2DFBA 3RYFA 3ATGA 4NPLA 4FTBA 3KV6A 5FLXN 2XJUA 4ATEA 2Z42A 4YFZA 1IPKA 2EIEA 4UV8A 4LKEA 4MVQA 1JTZX 5D1IA 2DOSA 4IGQA 4YIPA 1ZX3A 3CJHA 5EZWA 3A23A 4UAPA 2OT5A 4WM8C 2JDUA 3SJAC 4GKKO 1UXXX 3L9JT 2BEOA 2ORXA 4QJFB 4COUA 1JYCA 3PVOA 3EXUA 1ULEA 4CCKA 4GKXA 2L6LA 2Q7GA 4YGCA 2QSAA 2R0HA 4XF1A 4Y5Z0 4O2BA 4XAEA 2X6CA 5FL7G 2WQZC 4CE8A 3BA8A 1L3JA 3N9OA 3NV2A 1YJLA 3AB0A 1TUBB 4AVTA 1VQOV 4XILA 4DV1B 1Q8IA 2D6MA 4X8NA 2ZIOA 5EIBC 1NY72 1Z5WA 4AF9A 3WHTA 2CWSA 4IV3A 4CUAA 4IIJB 1PX4A 2WLLA 3ZMSA 5KHHA