3U10A

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
202
structure length
202
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 61
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u10A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u10A02
3FZ3A 4QGMA 3D82A 4KU8A 3JZVA 3OCPA 1Q43A 2O1QA 4PIZA 4HBNA 1LKNA 1ZZ9A 3IWZA 3DL3A 4KU7A 1U12A 5D1IA 4EWDA 3RPQA 4FAGA 1EP0A 3UKVA 4N9HA 3SXWA 2H0VA 3FX3A 5I0SA 3DKWA 5FCCA 2XLFA 2D93A 2Z2SB 4XF3A 3H1WA 2I45A 2D40A 5C8WA 3MPBA 5JSOA 4IEQA 3FJSA 4QM9A 2B9UA 3ES4A 4IEPA 1GQHA 2IXKA 5KHJA 3ZDSA 4KWLA 1ZREA 3LWCA 3M3IA 3H9AA 2MPFA 2GU9A 1J3PA 3BB6A 1EPZA 4AVAA 3OD0A 1YWKA 2P17A 3LA3A 1JUHA 4JTOA 4XFGA 3SCGA 3MZHA 3EQEA 2O8QA 1G6NA 3RYKA 2OZJA 4ZU5A 3BALA 1VR3A 4TLFA 5FQ0B 5JAXA 2FMYA 3D0JA 5E16A 1QXJA 5CU1A 1VP6A 2E9QA 2VECA 1CAUB 3U0ZA 1CAVB 2UY9A 1XE7A 4BHPA 4ONUA 5BUVA 4PIXA 1H1MA 1NYWA 1UW8A 3ES1A 4XFFA 1RC6A 2ZCWA 3NKTA 4B29A 1LB2A 2BNOA 1Y3TA 4IEOA 4IEVA 3IDCB 2PFWA 1RUOA 3I59B 4I3PA 1J58A 4BYYA 1J3RA 2IXCA 1ZRCA 2BNMA 4MGZE 4EROA 4QGLA 2XKPA 2ATFA 2GAUA 1YHFA 1NZCA 4R52A 1DZTA 2CAVA 3KSCA 1OD5A 4HVOA 2CAUA 1PM7A 1X82A 2XLAA 1SEFA 2ET7A 2CV6A 3H7JA 3O14A 4Q0UA 4XF1A 3NVCA 2UYBA 5I0TA 1CAXA 3PVBB 3RYRA 4JVAA 1PMIA 4AVCA 3NL1A 2F4PA 4XFAA 1H1IA 4Q0VA 5KBFA 2B5HA 4PJYA 4IESA 4IEYA 4XF9A 4ZU4A 5BPXA 2IXIA 2VPVA 4XF0A 1O5UA 4L11A 1O7FA 2PAEA 4QX5A 4WBBA 3KMHA 4EV0A 1OFNA 1O3QA 3IIAA 1J3QA 3DV8A 4MGYE 1DGRA 2BNNA 1X8EA 4AQ2A 1OMIA 2BGCA 4IEUA 3H7YA 4K8FA 3E5UA 3L2HA 4J1WA 5F1RA 4QMAA 2PAMA 4MGKE 4FT8A 3ETQA 1YFUA 4MV2A 1CAWB 2ETEA 1UD1A 2C0ZA 3FFQA 4LLOA 2N7GA 4X6QB 4UXAA 1CAXB 2ET1A 4I0AA 2XGXA 4HZFA 2QVSB 3EJKA 4ZU7A 1LR5A 1DZRA 2MNGA 3MDPA 1ZX5A 2IC1A 1X7NA 4QM8A 3VHRA 1ZRFA 3D0SA 4LA3A 1ZVFA 5LRRA 2PA7A 4EWAA 5KHIA 4AXOA 4X6RB 2UYAA 2WC2A 5FPZA 3H3UA 4IERA 1LRHA 4OLLA 3H50A 1UIKA 4LA2A 4MUVA 2GH2A 5JSPA 4META 4MZUA 4QXKA 1Y9QA 4O9GA 4DINB 2K9ZA 3HQXA 1DGWA 4E2QA 5E1RA 5LEKA 2EA7A 2QNKA 3TNPB 4LULA 4IEXA 3RNSA 3OTFA 4XFBA 4LUKA 3CJXA 4I01A 3UKTA 1NE4A 5FPXA 2OPKA 3BPZA 4RD7A 1IPKA 1CAVA 1CAUA 4FAHA 4I2OA 1YFXA 5AVPA 5FDBA 2PTMA 2K0GA 4UBHA 3QACA 3TNQA 2BYVE 1QY4A 5BV6A 1UIJA 2D5HA 4L2NA 5LRSA 4KWKA 3M70A 2GC3A 1TQ5A 4AVBA 4KL1A 4YYOA 2GZWA 1EYBA 3IBMA 1O5LA 2XL7A 2EVXA 2GC2A 3C3VA 3CF6E 4KWJA 3N4MA 3ST7A 4XFHA 3E6DA 1J1LA 2VQAA 4QGNA 2HJIA 3PNAA 4R8HA 2PHDA 4ORFA 2Q4SA 4O9EA 2H6BA 1X8MA 4OFGA 3ELNA 2D5FA 3NSTA 3KGLA 5I0RA 3R6SA 4N9IA 1I5ZA 1CAWA 1NE6A 2IXJA 4YNIA 5J48A 4LUMA 4P9GA 5FLHA 4BIFA 4XETA 4WVZA 4UBGA 5I8TA 1ZZCA 3H1MA 2GC0A 4J1XA 5I93A 1O3TA 1FT9A 4Q29A 4MH0E 1I6XA 2EAAA 3CO2A 4PIYA 3OF1A 3ACLA 2BEOA 3KCCA 4IEWA 3H8UA 2IXHA 4IETA 3WW2A 1O3RA 4I09A 2PYTA 2ZKLA 5CADA 5FQ0A 1ZZ8A 4F7ZA 5JSRA 3HT1A 3CL1A 5BY5A 2XHKA 2Y0OA 3RZZA 1UPIA 1ZRDA 5KHKA 2Q0AA 2Q1ZB 1YFWA 2Q30A 3NJZA 1ZZ7A 1OI6A 2XLGA 1O3SA 5FLIA 3BCWA 1Q5OA 5J7MA 3E6CC 2IXLA 1UCXA 2Z69A 4D7TA 4HSJA 4AQ6A 3E5XA 2PAKA 1YFYA 1J59A 5I0UA 2KXLA 2WFPA 1Q3EA 1FI2A 5K8SA 3UKNA 4YARA 4Z82A 2V09A 3E97A 2FQPA 1CX4A 1EY2A 3H3ZA 2OYZA 3CLPA 4LTAA 1NXMA 3SCHA 2B8MA 4I0BA 4HVQA 1CGPA 4HN0A 3HT2A 4CYDA 1RL3A 3WW4A 4D7SA 1WLTA 4YSFA 5KHHA 4Q0PA 5J3UA 1VJ2A 3B02A 4H7LA 1GQGA 1IPJA 4XEZA 4F8AA 2HKXA 4YRDA 3H1YA 4HSLA 3FWEA 5C6CA 3DN7A 5LEJA 3G7DA 3PLQA 4XFIA 1RGSA 4JV4A 1V70A 3NW4A 3U11A 4HMZA 4Q0QA 5JCTA 3U10A 1XE8A 4E2SA 3E5QA 3FE5A 5CVRA 4XFCA 2OA2A 1SFNA 3EBRA 3KGZA 4HLTA 3SMHA 3I54A 3LAGA 3RDIA 2PHLA 2QDRA 5EFUA 4A2UA 4Z07A 2MHFA 5I91A 3S0MA 1SQ4A 3RYPA 2OZ6A 1HW5A 4FBFA 5I8YA 4IEZA 2QJVA 3ROUA 4E2GA 3GBFA 1ZZ6A 2H6CA 4HVRA 5FLJA 1WGPA 4XF4A 2QCSB 5EZWA 2XKOA 1QXRA 4WZCA 5HI0A 3MYXA 4NVPA 1QWRA 3LA7A 2CGPA 1ZNPA 4Q0SA 3FHIB 3CEWA 3LOIA 1ZRRA 1ZZBA 4HN1A 2PQQA 3I59A 4LEJA 3S7IA 4MGIE 3WW3A 5KHGA 5T3NA 3SHRA 3QOPA 3LZZA 1RTVA 4MX3A 1RUNA 1YLLA 4I02A 1FXZA 2XL9A 1L3JA 1XRUA 3GYDA 3WW1A 1YUDA 3BU7A 3EHKA 2UY8A 2GC1A 4JTNA 3USSA 5BXXA 3IDBB 3SCFA 3HIFA 4EWEA 3I7DA 2DCTA 3OGJA 3EO6A 5I8SA 1O4TA 5JR7B 4GULA 1WA4A 3S7EA 3E6BA 4BH9A 3LA2A
chains in the Genus database with same CATH superfamily
2WA4A 3RVYA 2XUEA 2GALA 3V0AB 1VQLV 4I50A 3JB4C 4PIZA 5FK8A 4DO2A 2ARBA 3WB0A 1DGSA 2RM21 5D1IA 1ULCA 3N7JA 1EP0A 4UB8Z 1IBMB 4N9HA 4GIQA 1BCCH 4AI1A 1AL0G 3DKWA 3U75A 2Q69A 3SYCA 1NVPD 5KXCA 2DTYA 4I7ZB 1IG3A 1QKQA 3DYPA 1SQBH 4P5HA 4GX0A 1B35A 3ENRA 2QWNB 3LWCA 2MPFA 2GU9A 3DYMA 4UW6A 3ZX6A 2DURA 4A41A 3NKGA 1ZA4A 1MS0A 2WLNA 1S3JA 1ZM1A 4XABA 2A6VA 2CGOA 3I3QA 4JTCB 2X29A 2LW7A 5JAXA 4OUMA 2FMYA 3D0JA 2YHJA 4HOOA 1NT2B 2UY9A 1NCQC 1GNZA 1ULDA 5A9GA 3WHTA 5CG9A 5KX5A 1BHGA 2RS53 2A7AA 5FR3A 5JVVA 2VZVA 4FPCA 2V4VA 1JR9A 1ULOA 2Z5WA 4Q4V1 4Q20A 4FI9A 2R9AA 1T5EA 3B5LB 1QJFA 4FLVA 1RXFA 1DFQA 4BPZA 1JZ2A 2Y6LA 5H9SA 1RUC3 2CY6A 1OCCB 5LA6A 1OD5A 1T2XA 5FMOS 4UFMA 3V0BB 2XLAA 5D8AA 2DVBA 3WNKA 2F4PA 1YIPA 2R72A 3RW0A 1JS9A 4IEYA 2DJVA 1OUSA 2JDHA 2W9XA 1HXS1 1RUH3 1Y76A 3VBUC 3ZN1A 4JI0O 3VZNA 5A3MA 1LHWA 2DN9A 4BW9A 1QMJA 2AZ5A 4YZ1A 3POGA 1QR8A 2J1VA 3CS5A 3I2FA 2OW4A 1LENA 3AXEA 3CJIC 1AYM1 3ZMUA 4BAYA 3T1YO 1I94B 2QKCA 5FZHA 1BQ0A 3MDPA 1ZX5A 1QHTA 2R062 2E31A 3RI8A 4I30A 1X33A 4J41A 3M1HA 1JXNA 4M00A 2HWC3 4LF7O 3N9PA 3WG1A 1S2BA 3R0RA 3CYOA 4LA2A 3OUHA 4CS3A 3SH4A 5DDJ1 1DTOA 1LCLA 4P14A 3ZMOA 5A33B 5DDJ2 2VC9A 2HWC1 1XUQA 3ZIWA 2QZ2A 5FMOL 5EYPA 4AG4A 1JA8A 3VBOC 3ASNC 3GGLA 1I1EA 1KFUL 5BV6A 1UOGA 3HNMA 3M70A 2B1GA 1KRIA 1YQ2A 3RJ2X 1R3IC 4LF4O 2F17A 4R8HA 2H6BA 2RR11 2P7TC 1E1QG 1KDMA 4FFGA 2G9FA 2WQ4A 3JAKA 1CAWA 2IXJA 3ICXA 1IS4A 1RFYA 1VMFA 5DPNA 1EAH2 4X66O 2GP5A 1ZZCA 1OXCA 2ZX1A 3JAKB 1W2BU 5T52A 2DTWA 3GBGA 4HETA 1JZ6A 1I5XA 1V9PA 2B1IA 1WP8A 2BEOA 2AACA 1XQ8A 1F5FA 3TCUA 1RIRA 4AOCA 5H9PA 2ZHKA 3G4SV 3LEGA 3K75B 1H4GA 4P9YA 1H8TC 4KG8A 5KHKA 1P84F 5E79Z 1WPXA 4X1IA 2WABA 3M4FA 4BXSV 1UCXA 1AILA 3CCEV 5JZGA 3T0BA 1Q8IA 2BBVA 4M4RA 5K8SA 3UKNA 4XAEA 3OR6C 4Y5TA 3I2OA 1AR72 4EKWA 5KR7A 2LW1A 3H1IH 1W28A 4HPKA 4WF9V 2HWE2 3WF1A 3QD6A 4D7SA 3MO4A 3JBG1 1IPJA 4F8AA 4CEYA 5FWEA 3ZPOA 1JYVA 5LGTA 4JGYC 4NHKA 4XCAA 3WQ0A 4ZHNA 2PY5A 4OZOA 4ZY9A 1XMQO 4Q0QA 3OGCC 4E2SA 3E5QA 2VZRA 1LOAA 3WT3A 1HV1A 2AH2A 5L36A 2AC1A 2J1RA 2NN4A 1WW6A 3K06A 3K04A 4QNHB 3SJBC 3H0OA 2ZACA 2OZ6A 4ZI7A 5JUVA 2ZINA 2QJVA 3DXUA 5LGUA 4LBOA 2QTWB 1FFTB 5EZWA 4IV1A 2P5BA 3MYXA 1Z5VA 1Y74B 1NCRB 5DG2A 1PL0A 2VBBA 1M56B 3M7AA 4GZRB 4I0XA 1POV3 3DXRA 1NAEA 3MF9A 4I02A 1FXZA 5KC6A 5J96B 3W58A 2W0FC 1REDA 5BR8B 5FZ0A 1K5QA 5IJ9B 5GLTA 2WFF2 1M5IA 3W7XA 3VBRB 1GOFA 4BH9A 4PLOA 4B4QA 1UZ0A 4QGMA 1ND3A 5GTHZ 1PKXA 4KU8A 1BSMA 1RITA 1W6OA 3ASNB 3IWZA 4Y20A 2ORXA 1G9DA 1GNYA 3UO2A 5F3GA 1SBEA 4FVVA 3AP9A 2ZZQA 3PTRB 3PURA 1EAH3 4DMIA 3MPPG 3QH7A 1AR61 4C7UA 2PI5A 2DUPA 2BU9A 3WF2A 2P6JA 4JTAB 2RHPA 4BW5A 1PGSA 3H9AA 3BB6A 1W3VA 1MZEA 1OQDA 1SLIA 4XFGA 1MPXA 5LMNB 5DZFA 4FMTA 2UUAB 2XAJA 1Q81W 1AR1B 1GZWB 5A3WA 5FQ0B 4FTBA 5FP4A 1R6TA 2Z79A 1PX3A 4AHYA 2L6LA 1NU1H 4DR1B 1PL4A 4GKJB 2IH1C 2HVKC 3MI8A 5A7PA 1URXA 1DF5A 4QHBA 5JPNB 2RVAA 3CDZB 5FJHA 4LF6B 3DSQA 1RPOA 4MVRA 4TN7A 4TUYA 3SYQA 1LJ7A 2OIGA 3VOUA 3TETA 3RVZA 4C90A 2WSSG 5JXIA 4RR3C 1RUD2 5I0TA 4JVAA 3MIBA 4HKWA 2VULA 1NT0A 2DF7A 1FOD2 1V6KA 5GONB 2YIBA 3J8F2 2UXXA 4AWDA 4XDOA 1O3QA 5ITZA 4EN6B 1DGRA 4BJ0A 1SDWA 1G1XB 1J95A 1IBKO 1A8MA 1S0FA 1H6XA 2Q5ZA 4JZRA 2JS3A 2D6OX 4QKNA 5F1RA 4O4JA 1DGLA 1XNRB 4MV2A 4DV5O 3KV9A 1RMU3 5GLVA 5IYZB 5FYCA 4X6QB 2YEVA 2J7MA 1W8WA 2WAAA 3CCMV 3JATB 2VRZA 2WAMA 2AEZA 5AFEA 4FLTA 3NAPA 3K5OA 1IS5A 5A7WA 2W1SA 3KQRA 1LRHA 1Q82W 4MSVA 3D36A 3FMGA 3DYOA 5HV0A 1RUF3 4K0KB 4QXKA 4O9GA 1TGOA 4ITCA 2VQFO 4E4HA 3DXTA 5BXZA 4FK5C 3D8CA 2WS93 4I01A 1NE4A 3ZMSA 3WUCA 4DV7B 2C5DA 3BPZA 3QO5A 1LTEA 5K4LA 4ZHQA 1UY2A 2K0GA 1K3EA 4AHCA 5LYJB 1WA8B 5ACA1 3BABA 2WO7A 4Q4W1 1NA1C 1VBA1 1GAXA 2VMDA 1M57C 2XQRA 4OI4A 2Q4SA 5DAWA 4QJFB 5D5QA 3KWVA 1N0NA 3G6EV 2ZM6O 1UXXX 3BIEA 4NIGA 1XC6A 1K33A 5JZGC 1Y7BA 1VB2A 4QXBA 4JI3B 1IBLO 4A6SA 4X20B 1JZ7A 2PN5A 2WPDG 2VMEA 4D6RA 2QKSA 3E8HA 2DUQA 3TJTA 3WW2A 5CBGA 1MA1A 1AX1A 4HXCA 1DHKB 2RR12 3UM7A 2BGPA 1NBMG 2WZR3 3WNPA 2WKKA 2XHKA 4CH5A 2Q0AA 1CPMA 4PJ0Z 3WUDA 3I3BA 4QX2A 2YICA 1WLDA 4WZFA 2V09A 1UZWA 3AYCA 4DR3B 2WDBA 4QQ2A 1WCDJ 4K0KO 5JI7A 2XR4A 3VDAA 3IM0A 3AM2A 4GMP1 2WIIB 2GNBA 5F3IA 3JD1A 1V70A 1PZ9A 1MABG 3EBRA 2Q8EA 1YTFB 4OQ9A 1VIBA 1H2MA 5JR2A 1POQA 4ASKA 4AI2A 4BLIA 4ES9A 2MHFA 3V65A 5AC92 1XSQA 1MQTC 4FBFA 4UVCA 4LHNA 2ZGQA 3FX7A 2HJFC 2FZ1A 4E8DA 5FLJA 4XJWA 1S55A 3Q4HB 3D6EA 3K4AA 1MZFA 2PHWA 3TEXA 1GUIA 2CGPA 4Y5Z0 4L8QA 4RR3B 1JYCA 2DQ0A 2EILB 4DS0A 1VEWA 3LCPA 1XNDA 1BJQA 2PLV3 5A3OA 1TA8A 4EN7B 2P3JA 3RQ0A 4KBBA 3WW1A 1WD4A 3P32A 2UY8A 1WA6X 2QDNA 5AG2A 1GN3A 5CBFA 1XL4A 3EO6A 3E83A 5A1FA 4JGYA 3UESA 3D82A 2X5IB 4WFAV 3VKFC 1Q43A 1OURA 5FV3A 3RZJA 3BODA 2R072 1ZZ9A 4JI5O 1AI6A 2H0VA 3CRQA 3UO3A 5JWPA 1RXGA 3PVEA 2JB8A 3LDEA 4PDRA 3BA9A 3VBFB 2I45A 3RMXA 2VU9A 3VBOA 2RJ2A 2WYSA 1KB9F 5LBCA 4CCEA 2HEWF 4IE4A 4O2AB 5LY2A 3AYDA 4G3YC 4QWNA 1VQ7V 1VQ6V 5IK7A 4BQ3A 4GKKO 5DN2A 4AVTA 3SEPA 3ABKC 3WDXA 5CU1A 2UU9O 5A7SA 2ZBJA 5JVDB 1NYWA 1S5HC 4J42A 1BEV1 3M99B 5GJ6A 4XBFA 3B93A 5LP6B 1S0GA 1GM7A 4LC1A 2B39A 5IT9N 3IDCB 1GP4A 4CDUC 1LESA 4FTSA 3IN9A 4BIUA 1H8TB 5GKAC 4EROA 3WY6A 2BERA 5CYYA 1PD3A 2VS0A 5L3BA 3OMAB 1S2KA 2CTWA 2XWBB 4NXNO 3JD72 4YG6A 2HWD1 3O0XA 1HW7A 2CV6A 4Q0UA 3PUAA 5IYZA 3T0DA 1OVSA 1NUKA 1XNTA 3P1IA 3ZMTA 4YW3A 3IAYA 4CDQC 1AVBA 1H30A 2VPVA 3LSUA 1AR93 2EIJC 1S72V 1UY4A 2HYKA 4QKBA 1JCHA 3MHZA 2ZKNA 1WW4A 2PI4A 2UXCO 3H7YA 2H8PC 2ZE7A 5CFCA 1IHMA 4ZXEA 5FBJA 1YFUA 3VBBA 5JJNB 4RHV1 4LWSA 5A7OA 4JASA 5FL7G 5IVEA 4BQ4A 1WCQA 2DCKA 1QIQA 5A80A 5DECA 4UXAA 4LK6A 4I0AA 1UKGA 5A7NA 1IKPA 3MLLA 3TOJA 1T6BX 2EILC 4Z92B 4PBOA 4YVSA 2PA7A 2QA4V 4EWAA 3HPLC 4GQ7A 1IX9A 1XYNA 4ABMA 1ORQC 4PDWB 1RVF2 4FLYA 2PHUA 4E2QA 2UU9B 2ZJCA 4L99A 4XFBA 2HR3A 1NZIA 5FMBA 1QHDA 2ZTNA 3OBTA 3P5BA 3TNQA 3KV6A 1Z7S1 4XJ9A 5JLVA 1MSDA 4AFDA 4IL7A 3WG3A 4KL1A 3MHHC 2X8KA 5IJ9A 1EYBA 2JXAA 5J2UA 3KT7A 3WQBA 3MDSA 5C5UA 4UW3A 4JI8O 3THDA 4N9IA 4FCAA 1GLHA 1H1AA 3IGAC 1JODA 5FZFA 4ATEA 1VBB3 1FPN2 1W06A 1F9KA 5EHDA 3WG7C 4DR5O 2W1WA 2V4DA 2X5IC 5KUMA 1FATA 3ORJA 5EYYA 4FOQA 4JDOA 4CH3A 5CNAA 1M56C 1HRV3 1HNWO 2JGDA 3AKRA 3K79A 5K0UB 4JKMA 3F7VC 1DBNA 2ZGOA 1GOHA 4LKDA 2VXJA 2XJSA 3AJYA 1HV0A 1MEC3 4HNAB 4J80A 3MBWA 2VR4A 4PA6A 5FZBA 1S0BA 1Q3EA 3AKSA 4BQXA 4QIWF 1UFIA 1LGNA 1PMJX 5CBLA 1TMF3 4Z1MG 1SLBA 4GZ9A 1Y74A 5FXWA 2PQSA 5KXDA 2IH3C 1WCKA 3S5QA 4XEZA 2OYQA 3TN93 3ZSEA 3ML0A 2CH7A 5FMDA 1XL6A 1ENVA 4LXLA 3T4VA 3U14A 5HCAA 2HKOA 3S0MA 3CPWU 1W6QB 1S0CA 1IBLB 1C57A 3DKQA 3KQ4B 1O9HA 2H6CA 1R6NA 1L0LH 2C24A 5FPRA 4HT1T 3AZYA 3OFNG 4BLJA 5ABJA 5ISLA 1COV2 1ZZBA 4U7NA 2Q1MA 4YJ3A 1YNAA 2G9GA 3RZMA 2XJVA 2UXDB 3ZMNA 1OCOC 3JCUZ 3Q8EA 4DV3O 3IFXA 3B8NA 1RUG1 4DUVA 4I50B 3H3LA 1XRUA 4WM8C 3HR9A 1A8DA 4UI9L 1YJNV 1AX2A 4V1PA 1UPGA 1N34B 2Q73A 2JD4A 2HWF2 4NTWA 3WQ7A 1UMIA 2JECA 2H94A 3OEHG 2LALA 2YU1A 3CSXA 3K59A 2WN2A 1GN4A 1IVSA 2QWRB 4D6SA 1X59A 4IUGA 2W95A 2ODMA 3ZRSA 1RM1C 5C8WA 4G9SB 3T2PA 2BOJA 3WP5A 3T4ZA 1ZSPA 1R73A 4LF9B 1NY71 4DR2O 2QZ3A 3BU0A 4O4LA 2EXIA 3ZYFA 3ZHVA 4UYBA 1SPPB 2B9ZA 3AG3C 1V6JA 1K45A 2HFEC 2E9QA 3U1XA 1KJRA 4BHPA 4EN0A 2XVLA 1PVXA 2GMEA 5B4XA 3JASB 1WB8A 2RDQA 4Q1RA 5FMCA 4JI6B 3UGHA 1XNRO 4TT3G 1ZA7A 1W2TA 4QXHA 3I3MA 5FY0A 4BYYA 1J3RA 1KQRA 4YHHB 3I2JA 1W6PA 4O2BB 2EIDA 2OTJV 1GSLA 1YHFA 4FLUA 4AFBA 3AL6A 4RA0A 3U4XA 5F5QA 4NIIA 4J9YB 1TEIA 3M2MA 3ABUA 5KXBA 4ISQA 3UJOA 1RUD1 2VTFA 3I2DA 5F7UA 1DU3D 3SPCA 2Y0PA 1RJ8A 3KV5A 2B5UA 2W87A 2FDHA 4QQPA 2QKAA 2NNUA 4O4JB 1ND2B 3POSA 4DQAA 5K9YA 4EV0A 4R6ZA 1OFNA 3FAVB 3DV8A 5FXXA 2CTVA 2QM8A 5EZYB 4NXMB 1ZYBA 3SYOA 3CWBH 3JD71 3IMMA 3JAWB 3T1HB 3R4SA 2EIJB 5BNNA 4I9QA 1H8VA 1NH2B 3P3NA 5FPAA 3ON7A 4GJZA 4AEDB 2VCMA 5FO8B 3WF3A 2P6HA 3AG4C 3CMEV 2E76B 5EIBD 1F8VA 3NNGA 4B08A 5LA1A 2EIEA 2ZGPA 4NWVA 4UW5A 4PLMA 4MUVA 2KQXA 3O5SA 1W8FA 2VAUA 1B06A 4QPKA 3HQXA 3OBRA 1KYOF 4YW4A 5LEKA 2Y4UA 2XXZA 1LU1A 4BQYA 3T0AA 2A71A 3OGRA 4X88A 5FYIA 3ZOIA 3N9OA 1CAVA 3BEHA 1RJ7A 5AVPA 1OQ1A 2VQEO 3N27A 1APNA 2AEYA 2YFZA 4COUA 5K0UA 2WZPP 2Z3YA 4MLOA 2ZMKA 4KWJA 3OGIB 4AQYO 2GC2A 4R9CA 5IK4A 3KZ4C 2MEV1 1AR81 2KR2A 5GTIZ 4OHWA 3CIHA 3ZR6A 1O91A 1BQPA 1AJQA 5JCOA 1W9SA 4A3ZA 4BIFA 4LH6A 4LF8O 4NRMA 1POV1 1FT9A 1WW7A 2EAAA 4GYCB 1KJLA 4KMQA 1VMGA 4URAA 3MUZ1 2YUAA 5ERLA 4MGQA 4A6OA 4IETA 2ZZJA 1SBFA 2WNEA 4WFBV 2J1TA 5FQ0A 1GZWA 1PIV3 2GTSA 1FXHA 1LHNA 1O6UA 4N53C 2GP3A 3IDAA 4NROA 1UPIA 3R4DB 1AJKA 1AJPA 5FY4A 3BTAA 2Z5UA 4LF6O 1FV2A 1R082 5IJRA 5L7OA 4BK4A 2F95B 4JI4O 4P02B 1J59A 1RSOB 4LBNA 3RSJA 4NKGB 1WBFA 1K5JA 4I0XB 4KI5M 1EY2A 2JWPA 3A22A 2B8MA 4I0BA 4EB6A 1HN0A 1TAEA 1Y66A 2X7RB 4CCCA 1UN1A 4COYA 3I56V 3JBG2 4QX1A 4Q0PA 2BOBC 3CZJA 5IE9A 3B02A 3ZFEC 1GRJA 2EZOA 4YVSB 2WFF3 1XNKA 2OT5A 1REFA 1ZBA1 5CKQA 1RGSA 1VBB2 3NW4A 1VRBA 1BVP1 2D98A 3FE5A 5CVRA 4N43C 4XFCA 2YXSA 4Q4X1 3AP6A 5IVVA 1I7FA 4OUSA 3UQ8A 5LZ6A 3NV2A 4Y4YA 1OA3A 3LKJA 4D7YA 1RM1B 1EV13 3A7QA 1RINA 1KP3A 4AQYB 3VUOA 2RMU3 1MS1A 3NQHA 1REEA 5J9PC 2R6QA 1KD7A 4L87A 1QXPA 2MW2B 2FBEA 1LOFC 1W99A 4FP2A 1QJX2 2GNDA 1BS3A 2RS51 3QOPA 3JD3A 1L7QA 3JARB 2VVDA 3AX4A 4LO7A 1Q7YW 3FL7A 2WLLB 4I3GA 3AZZA 2WWWA 1WPBA 3LDKA 4M01A 1QJU1 3HD8B 1YTFD 5DQ0A 3SCFA 4X9QA 3GZEA 1OH3A 3HIFA 3LEIA 5L3FA 4JGYB 3O1UA 1E79G 2F4VO 3MICA 4EWEA 3VBHB 5B1AB 3AZVA 5JR7B 2D43A 1TUBA 3RZHA 4LFBB 2QQIA 4JI0B 2PXJA 5DAVA 5LA0A 2O1QA 2O8OA 2A9HA 3AG3B 3ZFFC 4Q4Y1 4KU7A 3QNEA 4CEYB 4FAGA 4K8ZA 4YGCA 3VDDB 2ZR3A 3MW3A 4XW3A 2ZE6A 1GP6A 3MPBA 1QQCA 1TME3 5SV8A 2B9UA 1Z2GA 1VQ5V 2F4LA 1HN1A 2ZM6B 4LO4B 5JOZA 3JSLA 2VJXA 3RI9A 5ANQA 1PZ7A 1AR63 3ASIA 2A6WA 4ZU5A 4DEQA 4JGZA 1OC1A 5BNPA 1W8HA 1R083 4DUZB 3EYPA 4CC5A 3O65A 5FJKA 3PUHA 2IFRA 5CA3A 5BMVA 4IEVA 1RUOA 5HFMA 3WHUA 3OJBA 2EICA 3NRUA 1US3A 3T4DA 5J2TA 1QJY1 2XHNA 2DWRA 3J9SA 3ZLIA 1DZTA 5A2QN 2XJQA 1MEC2 2IJJA 3BIWE 4HVOA 2ADPA 2CAUA 2QM7A 4N53B 1J5EB 5JDBA 1SEFA 4XF1A 1AYN3 3SDLA 4RFT0 2WLKA 4ZU4A 3J8F1 1HRV2 4QKDA 1YJLA 5BMVB 5L3EA 3IB3A 3FLTA 4M3CF 5DDJ3 2GMPA 1SC5B 4XYXA 2O14A 4LK7A 3Q4HA 2RDSA 3C7OA 2ZR2A 4NIDA 1CJDA 1VRH2 3G6BA 3SH5A 4AFCA 3C90A 4J1WA 2B9VA 3UT5A 3KHCA 3SYPA 2HWE1 1H9WA 5H6QA 4DZGA 2CTQA 3FYEB 3S5AA 2ETEA 3B77A 5JQGA 2C0ZA 5EJZB 5IAVA 2UWAA 1X7NA 1QNMA 3OEEG 2P4VA 1XOYA 4DUZO 2A3XA 2JGUA 4FOWA 1V6IA 4MTGA 3D4KA 1JFFB 4KXRA 4DINB 3R65A 2FKXA 5C8CB 2HH9A 4X8PA 3SPIA 3RNSA 3OOXA 5AVAA 3BVOA 1JZ5A 3LQCA 4OHZA 1RHI1 5IAXA 4FAHA 5FZ9A 3RZKA 3WOGA 5GZFA 4LFAO 4DR7B 4WM8A 2KG7A 3OUSA 1MVQA 5LXTB 1H4HA 4XJUA 4DUXA 2YXHA 1PNMA 2XL7A 1UZZA 4URTA 3ZXAC 4LF4B 4OYUA 2NQYA 1QOOA 5C4WB 3TGUH 2WLLA 4ZS3A 1S0JA 1M4UA 1J5EO 4N43B 4HKOA 1KQSU 3R6SA 4JGZC 3K4ZA 2ZGUA 4U7OA 1YO8A 2DBIA 4KHPB 2W6JG 5FYHA 1LEMA 3H1MA 1PO11 2AENA 5D8AC 5GZGA 4MVZA 3AZWA 3STZC 3KCCA 3WNMA 1FMD2 4ZKTB 1OD3A 2B7YA 2IXHA 4MT8A 1VBA2 3ZRWA 4Y26A 4CEYC 3BKZA 3Q8AA 2GH8A 1W8TA 1N3OA 4NAMA 3SGIA 1NQTA 5GONA 4GB33 2PYTA 3HBKA 3MLJA 3HT1A 1ULEA 4WM8B 4DXZA 5H9QA 1BMFG 1ZRDA 5CFDB 1RMU2 4Y1ZA 4B3TB 2N74A 2JGDB 2V72A 5J7MA 2P3IA 3NV3A 2LM3A 4OX9B 2R9RB 1C8M3 3RBZA 3E5XA 3E97A 3PUIA 3GZTB 3SCHA 3J4UH 1QF3A 4DRXA 3J7NA 4P00B 2E63A 5KHHA 3WEZA 5F3CA 1A32A 2EULA 3FWEA 2CK3G 5EIYB 1SQPH 3MLKA 4UCUA 1RUF2 4UVBA 1SFNA 2VCBA 2VY0A 4IW3A 1W0OA 1QCEA 1TVGA 3RDIA 4XQ4A 4XJZA 1U5IA 4NMIA 2JDMA 1SDDB 1UOFA 3RYPA 3W21A 2JS5A 3ETEA 2QJ1A 4FFIA 3SPJA 3A8TA 5F2WA 4RGGA 1FOD1 4Y3OA 3ZN0A 2LO1A 3WG4A 2JVDA 1UU4A 4DXTA 3KT4A 4CCDA 1GANA 1PNGA 5L3DA 2JE9A 4YXWG 1WMEA 2LQTA 5I8SA 4E4SA 2FCUA 5EJ1B 5LHGA 5FFOC 2QQUA 3VGIA 2R071 4C8DA 2E7QA 1LKNA 2ZX3A 1EN4A 5FPOA 3W20A 1JOYA 1U12A 3GXUA 3UKVA 3JCZA 3SXWA 4AI8A 3CCUV 4IDZA 3WINE 5DN6G 1IOAA 3DGEA 4DR4B 5IYBO 4XUOA 5JSOA 4XDKA 5LMUB 4AVSA 3IJ4A 4L8JA 2WZR1 1RHI2 2DVGA 3UNPA 2W94A 1YWKA 4J9ZB 4DUYB 4OI0A 3CC2V 5A6XA 1JMUB 5LASA 1W8OA 4X62B 1OUXA 2JJ6A 1PPJH 4A44A 2KD7A 4CXXA 4K3AA 1D4M2 3VZKA 1RC6A 2RDCA 1YXWA 1N3QA 4NWWA 2VE1A 4LNUA 2G1MA 1XYOA 5JH7A 4YFZA 4LH7A 2PFWA 5JXHA 1FX5A 4O61A 1KXGA 3SISA 2ATFA 3G71V 3WNXA 2YV8A 4GCZA 3LDRA 4O2AA 1UOJA 4DY3A 1JZ4A 3O14A 4K40A 4Y22B 2QWPB 3PVBB 1PMIA 4AVCA 4CXYA 1W6PB 2RJZA 3PVOA 5LATA 3VBFA 4IESA 4DR2B 4Q2FA 3R4UA 2IXIA 2VUCA 3DPRC 4L11A 1O7FA 2PAEA 3CCVV 4RQPB 2C4XA 4ZPIA 2HBTA 5FP3A 1WCUA 4INDA 3NNFA 5FZ6A 1FYJA 1GNHA 2W1UA 4M3CE 2J1SA 4FVMA 4JRLA 4XAAA 4D94A 4IGGA 5FKBA 5FPUA 1OPOA 4JI6O 3IMNA 3MD0A 1V54C 2RS32 1WMDA 3M8LA 1UD1A 2RS31 4DR4O 4Y4RA 4CDUA 3PJYA 3MIGA 1BT8A 2VNOA 3ILRA 4LLFA 2QE7G 3VQVA 5L9BA 4YHHO 2QUOA 1UY3A 2IC1A 1N47A 4RFRB 5FAXA 3T30A 3RZLA 2UYAA 3CE2A 4PV1B 4IERA 5EBLC 4P9OA 4GKJO 4CVUA 4DR3O 3I2IA 3KCXA 3AK3A 4W6WA 1DGWA 4YGDA 1CQ9A 2EA7A 4N7IA 4LULA 4IEXA 3OTFA 1B3QA 1AYN1 3UKTA 1PX4A 1XSRA 5JMCA 4CPBA 4I2OA 4PHZA 1JZ8A 2VBDA 4NHYA 3HN1A 3B8MA 5CKMA 3MFCA 2DE0X 3ZHTA 1TQ5A 2B45X 3ECQA 3RWKX 2GN3A 1P8JA 4XUQA 2WLPA 3E6DA 3VBHC 3K0GA 4X66B 4PA9A 1RUJ3 3SKVA 2RR13 3B3QE 4CDUB 5IJ0B 4CBCA 4W65A 5C93A 2HEVF 4YM2A 3ZX7A 1JZ3A 1M9NA 1LOEA 3IIIA 3ZXJA 1R081 3QLQA 4OUEA 2UXBB 5I93A 2WINB 3BUCA 5ABJB 4QU1A 3H9VA 2JIJA 3MF6A 2Q9LA 5JCOC 1EZVH 4BCUA 1NKGA 2AW9A 5IYCO 2ZGKA 1FXKB 3N9QA 4A45A 4NTYA 4B7KA 1YXBA 2UXDO 2Y0OA 3RZZA 1S5LZ 4GA9A 2Q1ZB 3DCQA 5EYPB 4GKYA 2IXLA 1W0NA 1BYHA 2A0LA 4ZBMA 1MQTA 1WWYA 4YVWA 1AL23 4AQ6A 5L9RA 3MHSC 5C70A 4PA7A 4YM1A 5I0UA 3LF7A 2YC2A 1JN2P 4DV0O 3A0RA 3TRSB 2RG4A 3H3ZA 1YZBA 4HVQA 3A23A 3GVMA 3VDBA 5FTTC 2CE4A 4JYCA 3ZYPA 4LF8B 3H1YA 5LEJA 4XVHA 1VBD3 3JQWA 1GU3A 4JV4A 1H8EG 1WUVA 2DYSC 4ASUG 2Z0AA 1W6NA 1QU7A 3LAGA 2VZSA 1OA2A 1SQ4A 3RWNA 3ZRVA 5DUWA 3CEIA 4UFZA 4XDJA 3ZKYA 1G8MA 1LUVA 4V2WA 2ZEYA 4ICGA 4C0HA 1MNGA 2AREA 1COV1 4N7UA 3B9IA 3VBUA 4NVPA 1E57A 2ZS6B 4NIAA 4UCRA 3JAMN 3BA8A 5CN0A 1CN1A 4F4LA 1GFF2 2ADEA 5KHGA 1Z7S2 2PHFA 2Y8KA 3RYHA 3MIDA 4FPYA 1WAZA 1W9WA 5C5TA 5CA0B 1ZWIC 4ASLA 1RP3B 3A0NA 1DLBA 3AG1B 2CUGA 5SV5A 1RVF3 5IFTA 3H8XA 2KA3A 1IKQA 2HWC2 4DRRA 3I7DA 4K9SA 2ZD9A 1IDSA 2JJ1G 4UFHA 4E9KA 3FZ3A 3N9MA 4H14A 3CMAV 5FYYA 1FJGO 1JYWA 1ENSA 1W6MB 3T2OA 2P37A 4B4RA 5JXGA 4EWDA 4G2KA 3OM3B 2DUOA 3ZR5A 4B3RO 1AR82 4PDWA 5FCCA 4DPNA 3M7MX 4JAUA 1RUJ1 1NTKH 3AVRA 4QPGA 3WNNA 2UUAO 4JI1O 5BNOB 5B3SB 2YBPA 5FP9A 1A3KA 5EBWC 3HQUA 3SPHA 3MZHA 5J2TB 2FTKA 1AP5A 4JYAB 2BGOA 1VR3A 5FZCA 1K73W 4K1YA 1VP6A 3SLIA 2YUEA 1GO3F 5CFCB 3S3XA 1PO13 4YZ3A 4FIPC 4ONUA 1VBC3 5BUVA 3K3NA 1UW8A 3ES1A 1EV12 4R50A 4BA6A 3I5DA 4D6QA 3RYHB 1GOGA 1UZVA 3J7LA 4AILC 1NCRA 1EBOA 4XPVA 1MSWD 2OKXA 4J11A 3DPRB 2VZUA 4R9DA 3U37A 4X65O 3LOBA 3EVKA 2YIBD 3WB2A 3KSCA 3RT3C 4GXLA 3MIFA 3E35A 4R9BA 3ZM8A 3ABLC 2RN9A 2J1AA 4E4DX 5DUUA 3ABTA 4JYYA 4BQ1A 5JJJB 4M3CA 1K92A 1Q6IA 4FPKA 2ZGRA 3ZXDA 5KAIZ 4WBBA 4E4EA 2CHHA 3BY6A 3N2GB 1VBE3 1MS4A 2BOIA 2BWAA 5CB4B 1ND3B 2HWF3 3KT1A 2L35A 4O4HB 2XJRA 2BTQB 4L97A 3ZMZA 3B4SA 1JPXA 1SQXH 1VF5B 2N7GA 3EJKA 2YBKA 2VTXJ 1Q56A 3I2KA 5BYNA 2EX3A 4B1LA 4MW8A 4IV3B 3DXRB 4BIOA 5DAQA 4UCSA 1W8NA 4JZGA 3JUUA 2QWOB 3RN4A 5EK0A 3O1OA 5C33A 3NNJA 3LSQA 1XMOO 5JH7B 2YS8A 4K1ZA 5E1RA 4QX3A 2AR6A 2TUNA 2XVGA 4B4PA 4IV1B 4AEJA 1IBMO 4WV8A 3LD8A 1AX0A 3NJVA 2WYFA 4LFCB 4AW7A 5L9VA 4AYUA 2D5HA 1CESA 3J7AU 1K5SA 1XB9A 4L2NA 1VQ8V 1VPHA 1MR5A 3K5LA 1RUG2 2WNUC 3C3VA 1LODA 3FHAA 4BMBA 2DOSA 4O4LB 3N4MA 3ST7A 4QGNA 3J8F3 1AR62 1V9U3 4AAPA 2ENRA 5ANNA 4P30A 1PM4A 5DEDA 1RUI3 4YLZA 2QQNA 3NMBA 4Z2AA 2OIEA 4O65A 4ET7A 2XTAA 4MH0E 4FFBB 3TYJA 4QPIB 1UMHA 3SITA 1AXYA 2YBSA 3CO2A 4MGTA 4PIYA 1VAKA 2WNVA 3J80N 4Q4W2 1RUH2 2X5IA 2JEMA 1M06G 4CRQA 3WXPA 3I3DA 2D6NA 3CRAA 5FXVA 4Q1PA 3RYFA 1US6A 4CE8A 1WLCA 1MS9A 3NJZA 4LO5B 3PIJA 4PQQA 2I07B 4DV6O 4DR7O 5BNOA 2RMKB 2G4IA 3VD9A 2BJSA 4CUBA 2ZGLA 4W6XA 4H2AA 3KVAA 4CEWA 4OGQB 1XBFA 1KUQA 4HN0A 1G7YA 1AR92 1SG3A 1OPMA 1VJ2A 1FNYA 1U97A 3ZBHA 4HSLA 4CU6A 4CDQA 5T5LA 4AF9A 5KAFZ 4HMZA 4K20A 3KKYA 2WSVA 4NE9A 4JF3A 4Q4X2 1W2OA 5F2VO 3GHMA 1H8HG 3K9SA 4GWNA 1NR7A 3QO7A 4IGOA 1HIXA 3AP7A 1DF4A 3BRCA 4E2GA 2EINC 5FO9B 3CKHA 1AR91 5T5JA 2XONA 4WZCA 3APBA 3LA7A 2DDUA 3CHXA 4F6RA 1N1VA 2YYOA 4HN1A 3TN91 2XH6A 3I59A 4LP8A 4OX9O 2V1DA 3HKCA 1RUNA 4PDWC 3J26N 2D7FA 4AQTA 1TMF1 4DUYO 5HCBA 4LF7B 2WBKA 4GX2A 5LL6Y 3VBRC 2V7QG 1JTZX 3IDBB 1GP5A 4EEQA 3C8XA 3ZSLA 4UWDA 5LXTA 3JAWA 1YFWA 2VMHA 3LA2A 4AHXA 4WFEA 2XOMA 4CU7A 1I3HA 5KXEA 1RPRA 4TSFG 1OQEA 2JX9A 2C6SA 1M93A 1S0IA 2VNGA 2WUHA 2VGDA 4ZZ8A 3ABLB 5FY5A 2XLFA 1R093 2Q8OA 3AC0A 2O57A 3LE0A 2QM4A 4PQ9A 2OS2A 5IW0A 4IEQA 2GN7A 2ZCEA 3ES4A 5D2AA 4YGBA 3VV1A 1RUI2 2QQMA 1J3PA 3HEIA 4LF9O 3AXDA 2ZXQA 4Q6GA 4IIJB 1V6MA 3O0VA 4MO3M 2NZ9A 1TME1 5FZMA 5A3PA 1QU0A 3CRCA 4PF5A 1GICA 4AZZA 4JAVA 1YEWA 2SBAA 4QHOA 1FKAO 2WJSA 3QO8A 1WZXA 5FPBA 3EMRA 2ZA9A 3VKOA 2BNOA 3S57A 1YF2A 1YQ5A 3HNBM 1ASJ2 2BW8A 1AROP 5A7WB 4XUPA 2YPJA 5CFCC 1ZRCA 3TEZA 5FIXA 5IVJA 1VBD2 3E89A 3LDDA 3ZIAG 4R52A 1AXKA 4R7CA 4YW5A 3NWKA 3ZSMA 1YIFA 4UF0A 1RUH1 1NG0A 3H7JA 2J1EA 4W8JA 3RYRA 1CVNA 1GKBA 2WNUA 5FYZA 3CRMA 1ENXA 4LPLA 3PMEA 3KLSA 5BPXA 3GHNA 5FUIA 1GM9A 2JE7A 3AKPA 4XDLA 3KMHA 1JYNA 3WR0A 2CDOA 2YFUA 4KUMA 1EPWA 1TUEB 5E1AC 1VRH3 3INAA 3JB8A 4W4KA 2E6VA 4PA4A 1QJU3 3FLRA 1BK1A 2ZABA 3E8GA 3QTCA 5IYYA 1UKRA 2DYRC 1XYPA 5C4WC 4MOAA 4TWTA 3NXSA 1NOVA 1ST8A 3ASOC 3POFA 5FZKA 3U4SA 2XGXA 4M4PA 1UU5A 4AE2A 4UVAA 4QU2A 3IPVA 3GF6A 1UU6A 2JDAA 4XMIA 3P30A 1HQWA 1N32O 4LOTA 4K8XA 3UT0A 1DYOA 3NJXA 4OLLA 3WVJA 5T5OA 1C1LA 2Y6GA 2GH2A 5C8YB 1RUJ2 3K0DA 1Z0HA 3WU2Z 4LBKA 2OPKA 3HMYA 3IT8A 4D0QA 3T1CA 1CAUA 1K5MC 1YFXA 4AGVA 2ZE5A 4B1MA 5FDBA 4FXGB 1XNCA 4AVBA 4RUFA 4CU9A 1AF9A 1WCSA 2BTOA 3GZUC 2BBAA 1W9YA 4COZA 5K7PA 2VQAA 3WQ1A 4AEDA 1G86A 1CJPA 1FFXB 1OV9A 1IXBA 4YFWA 5FZLA 3DC5A 3POWA 1NA1A 2ZEZA 4OMDA 3OD4A 4YNIA 4DIQA 2E3CA 1PP9H 4JTDB 1JW6A 2JDZA 1OH4A 3N35A 1X9PA 4TV8A 1URFA 3BGAA 2K9PA 3CU7A 1GM8A 4HNAA 4PD4F 3B09A 2E5LB 5F2SA 2DFBA 1ODNA 2IJIA 2CWMA 3CL1A 3ZYRA 2JDKA 1VBE2 2ZT9B 1FD9A 2D3SA 1UY1A 1DQ5A 2XLGA 5FLIA 4GKXA 2Y6KA 3DGTA 1Q5OA 4QGPA 5A1LA 5FZIA 1UWWA 4D7TA 4HSJA 4NR1A 3RJRA 2WR9A 2LROA 2HG5C 1VIWB 2OYZA 4LTAA 5CMUA 2DWEC 2NLJC 3NAPC 3LSDA 1JMKC 1XXNA 5J3UA 2JEXA 1G8WA 2VQEB 3HVDA 3POEA 1VQKV 1SACA 2P34A 1RMU1 2PHXA 4YPJA 2DV9A 2Y34A 3ZHRA 4D6TH 1Q8PA 3VB9A 1C5HA 4G28B 1JUIA 2X09A 4IGQA 3ZYJB 2VUAA 2XHBA 1O4ZA 3STLC 2JG8A 1HW5A 1UL9A 2PHRA 4WM7B 5FOJB 3ROUA 4GWMA 2AGAA 1YIJV 1S1AA 3JALA 1SQFA 3Q8CA 1WJZA 5FY1A 4JHZA 4M0HA 1ZRRA 3OY8B 5FBZA 2WWSA 4KH9A 3SNMA 4TOIA 5FP8A 4JI1B 2CAZC 2WLIA 4OHXA 3GZAA 2IW5A 1RB8G 1YLLA 3HKEB 3LPGA 3ACHA 2YIDA 3IDEA 4DNYA 2XT9A 1P7GA 1QJU2 3PN1A 1OA4A 1YUDA 4JTNA 2VMIA 1VBC1 2QFEA 3IAQA 2Y48A 1SZXA 2Q6AA 2VQUA 5LK5A 5IK8A 1PGW1 2ZAHA 4AEDC 2FDGA 3WCRA 4HBNA 3AYAA 3PU8A 4Y1UA 2WWJA 1Y4MA 1KGYA 4AQSA 1W05A 4OHVA 4X65B 4OCTA 4IV1C 3NV4A 2YY1A 1PMHX 1ROPA 3ME2A 2XAGA 4FPHA 4EFBA 3CCRV 1F4AA 4LQRA 4QM9A 1GQHA 1HDJA 1EPZA 2EIKC 1GMGA 2VM9A 3B2EE 1K5MB 4D69A 4O4IB 1COV3 2UUBB 2VOKA 5F5IA 5GM0A 1N0JA 5E16A 1BKZA 4K8RB 5FNVB 5EYXA 5GLZA 4NYKA 1KEXA 5K1XA 2X10A 2W1QA 1XE7A 1HNXB 3VQXA 1S5JA 5LB6A 2ZHMA 2W91A 1I5PA 1W9FA 4XFFA 4IT5A 3ACGA 4NHMA 3PIGA 1M1KW 4OQ8A 1XILA 2ES3A 1Y3TA 4LFAB 2H0BA 2OUHA 5A6ZA 3NR7A 3N2KB 3I59B 2QSAA 1J58A 1EM1A 1PM9A 1YVWA 5IK5A 2XJTA 3K77A 3JQXA 4QGLA 2XKPA 5AC91 5C9AC 1B04A 2ORZA 5FPVA 5EQUA 2ZEXA 3CP1A 1AR71 1FPN3 2VVEA 2WT2A 4RHV2 1QOTA 1PGL1 4J7JA 2B5HA 5LYJA 1QJZA 5EBMC 4OXSA 1QNYA 1RUF1 4CH4A 2HVJC 2LUWA 3CBNA 3VZJA 4IYIA 1NJIW 1N33B 5EV7A 3VBUB 1OF3A 5LY1A 3SJCC 2QQOA 2OIIA 3BOWA 4HANA 1Y4WA 4XTMA 3E5UA 2BDRA 5JXJA 1G9CA 2B4KA 2PAMA 4FJCC 3OGGA 1GTOA 3T2QA 1J83A 3GJBA 5KMGB 3K5NA 2UXBO 1FMD3 1XREA 5B4NA 4LF5B 1TE1B 1LHOA 1CXZB 1GV9A 2UUBO 2IJHA 5DUVA 4BE3A 4JHTA 1F2NA 3THOA 2FDFA 2WA3A 3C7FA 4UB6Z 2RS11 2VL4A 4WVVA 2IWGB 3OMNB 5JSPA 2ZEWA 4MADA 4DV3B 3LNNA 1ZX3A 2XAFA 1BBT1 3K5MA 4RD7A 1HX6A 2TEPA 2NPIA 5KC5A 3ZHUA 1JOBA 3RYCB 4S2HA 3QVNA 1J84A 4JI5B 1P4RA 3VZOA 2GC3A 4DV7O 3RRDA 1CZVA 2R30A 4JRAA 4N53A 1HJFA 2E26A 5CA1A 1TG7A 1S76D 1HJGA 1FNZA 4H7MA 4EYUA 3ELNA 1SETA 5I0RA 1VBE1 2VOXA 4FXKB 4DY5A 2DCZA 2K46A 3ZPYA 3L71H 1MS5A 3GM8A 4LUMA 3MIHA 3OYWB 4NPLA 3ZFGB 2P5OA 3OYWA 3ZFGA 4UBGA 4YJ3B 1M57B 3BPSA 2EIMC 1IQDC 3FC0A 1NCRC 4TQDA 3RWRD 4OI2A 2HP8A 1GBGA 1AR73 2FL4A 3VHOA 2JKXA 1O3RA 4JGSA 1EN5A 3LIHA 3VKNA 1NQDA 1ZZ8A 2JKBA 3MFAA 5GALA 4XBLA 5G04L 3ABZA 2A3WA 1F35A 1YSCA 2BQPA 3PDQA 4FTEA 1SFPA 2VOVA 4NAOA 2BPA2 4RS5B 5G05L 2RDNA 1LAJA 1FOD3 5T5PA 3OBZA 1NS1A 1JYIA 5CISA 1NXMA 2CDYA 4ZS2A 5JIUA 1Q8QA 4K35A 3WW4A 4YSFA 1P49A 4FPLA 4NPRA 1IS6A 3VQWA 3QH6A 3N2GA 3JALB 2D6MA 3VZMA 4QPYA 3KF3A 4CP1A 4OHYA 4QD2A 2X6AA 2QR4A 5C7GA 1DG6A 4YZ4A 3T3YA 4D3WA 2ZXWC 3I54A 5EIBC 3SC7X 4C0BA 3VZLA 3Q8FA 3VBFC 4LCUC 1QQP1 4MVQA 4X1YB 1HQNA 4RHV3 4KHPO 4EE2A 3ZN4A 1NI8A 4EN9B 4BDVB 3FHIB 3TN92 3ZXGA 4QHZA 2GDSA 2PQQA 4YJ2A 2YG0A 3WP3A 1Q8SA 1VQMV 2WNOA 1HRI2 4HK9A 1E1RG 2GNMA 1Y43B 1B09A 3LGRA 3BU7A 1RUE2 5J2UB 5BR8O 1WP7A 1ASJ3 1Z78A 5H9CA 5LP6C 1WB7A 4LE3A 5C71A 5C3RA 4HL0A 5E88A 3M3EA 1PNFA 1CZSA 3ILFA 4FFFA 2DYSB 4S2GA 3IC9A 3ZYBA 4UCTA 1QVGU 4KFMA 1P7BA 3ZO0B 3C7EA 1K4CC 4CDXB 3DL3A 4JI8B 1QLEB 3T4HB 3RPQA 2XMLA 3L75H 3N7MA 5K1PA 1B6QA 3WDWA 2F6BA 4LBEC 4BR6A 2Z2SB 5FWJA 4M3CB 1YI2V 1SQGA 4Z2WA 3FJSA 3APOA 5KHJA 3ZDSA 2WZEA 4C1WA 1UZYA 2R063 3UCSC 2Y0IA 2VOTA 4QDRA 2R7EB 2P17A 3I55V 1B35B 1PO21 1HLCA 2ITDC 4JTOA 3K4DA 1WLEA 1G6NA 2GV9A 4TLFA 5FYTA 4BB3A 3ZFFB 4CCKA 1CAUB 2XB6C 2EXKA 2P90A 5FREA 3E22B 4GKKB 1Y9MA 4OPAA 2E74B 3L74H 2EIGA 4I55B 2EBOA 3OEAA 1R3JC 2FHRA 2D6LX 2BNMA 3BFRA 1JU4A 2ZGMA 3OPTA 2GAUA 4CCJA 1NXD1 2GDFA 3IPVB 2UU8A 3WF4A 4JI2O 4CP9B 3AK2A 1W8UA 2R042 3OPWA 3WLUA 2HWE3 3F95A 1OKOA 4D8MA 1O8SA 1E5RA 2ADDA 3TBDA 3KG2A 2RM23 4Q4Y3 4BXFA 1W6NB 4XF9A 1S4CA 4JQTA 4XZPA 2A1XA 4XQWA 1F5JA 4GAZA 2VBPA 4QX5A 4XHBA 2HHHO 3ZS8C 3EHBB 4P9JA 2UXNA 1G9FA 3DEMA 4WM7A 3L2HA 1RVF1 4QMAA 4Q4V3 2P3YA 3BHPA 1Q90D 2IM9A 5FP7A 3S3WA 3ZXEA 1F31A 3AG7A 1ENRA 1TNRA 2JICA 5M0TA 4RAIA 1R3KC 1NLRA 2LP7A 4YVWB 3WP6A 1K42A 3MAQA 4ZU7A 4MTFA 1DZRA 1PK6B 2LW8A 5CZKA 2FDIA 4Y33A 4BZ4A 2D2CB 2E7AA 1ZRFA 2XBO1 2W3JA 1VF6A 1WKYA 2JE8A 3T1LA 2YIAA 4IGPA 1CPNA 4ZOLA 1H0BA 4CCLA 3H50A 1Q86W 4K6BA 3HB3B 5FPLA 2VQFB 1DYKA 4DV6B 1XE0A 1TVKA 1BBT2 3LEKA 4QQHA 1FAYA 2DVDA 3VL8A 1LOBA 1UIJA 1NCQB 4YGEA 4KWKA 3C3TA 3WG7B 2W46A 4LFBO 1AJOA 1F51A 3LDCA 1O5LA 4LORA 1K3IA 1SCSA 2JENA 1PK6A 4XIOA 3OGVA 4BMEA 1OT5A 1AL22 2D5FA 3NSTA 1UPSA 2DVAA 1AL21 1VAVA 4Q27A 3N2KA 5FLHA 4XXAA 5GZDA 4XBNA 3ZN6A 3K03A 4FSJA 3L72H 3UGFA 1D2QA 4RR3A 3CXHF 5DAPA 2ARAA 4LF5O 1VQPV 2BWCA 3O1TA 5C3SA 3IKWA 5LGNA 1RYYA 5KUKA 3FBMA 1F4HA 3HJRA 5BY5A 3AL5A 1BQZA 2RE9A 2Y4TA 3DECA 3K46A 3CC7V 2P3KA 1PV0A 4LIUA 4CUAA 5FZGA 3NNLA 3AP4A 3FYIB 2W6IG 3LUTB 3LFMA 1YFYA 2EALA 4RGKA 2M7WA 1MZ6A 3O9OA 4J10A 4LWSB 3SH3A 4DV0B 5FZAA 2WAOA 3W5MA 1AI4A 3ZN5A 5C3QA 1XMQB 3TB0A 3M3CA 1SRYA 4PA3A 4LHSA 1AYM2 3BYWA 3DN7A 3U10A 3VN4A 5B1AC 1UYXA 5A7QA 5LHIA 3ABMB 4AR2A 4A4AA 2KSDA 3KF5A 1SF9A 4A2UA 3QF7A 5I91A 4XZUG 5F6LB 3F5WC 2WN3A 4X64O 3CJHA 3ABKB 4L92A 4QT6A 5LBEA 3ZDVA 3N7KA 3CB2A 3DTUB 2R70A 4FFBA 1L8DA 1XBLA 3K08A 1OOPA 3CEWA 5J1XA 3ZEDA 3PJQA 1U96A 4A5UB 5FZDA 1SBDA 4UFKA 3SHRA 1NR1A 5TISZ 3TXQA 4LNUB 3ZMVA 1BK0A 2YXLA 1YJ9V 2RS33 2P1BA 1LGCA 2XL9A 4M0NA 4CA9A 2GC1A 2QQVA 2CNAA 1DQ4A 2J22A 3L73H 2Q4PA 5DUXA 3AB0A 3T1MA 4H0LB 1WA4A 1D5AA 4E27A 3S7EA 1N4CA 1MS3A 3POBA 4B8EA 1LR1A 4FLZA 4GB32 2VZPA 1BZKA 1KBHA 3E2EA 2J1UA 4RQPA 1EUTA 2WS92 5I0SA 2R0FA 3EXUA 3CJIA 4XF3A 1XNAA 1CP9A 3L2YA 4ZONA 4JCKA 4YM3A 2DQ3A 4CUCA 2NR5A 1W3XA 5L3CA 1NQJA 3V64A 4IE7A 2QDOA 5FOBB 4ZI7B 4MHUA 3VKMA 2YEVB 4ZXKA 3O1PA 3AG2C 1QJY2 2OUJA 2O8QA 4FOVA 1KITA 1XPWA 4BWOA 4PI0A 3CMGA 1HDKA 1VF7A 2FB5A 4RQFA 4DK0A 1JBCA 1US2A 2DBNA 1TVKB 4PIXA 4U3FH 4PBPA 4P08A 1GR3A 5CKNA 3FN9A 1VB4A 3S6PA 5C8YA 4ZOLB 4I3PA 2BRTA 1V0AA 1C3HA 1ND2C 1LOFA 3JD4A 1ACCA 4B3TO 3ZXLA 3WF0A 1YCIA 4TZDA 2HLDG 5LBQA 1X82A 1DQ1A 4H3WA 4MW3A 1AR4A 4JPRA 1FJGB 1BEV3 4YW7A 3THCA 4CCNA 2BVVA 2D3RA 4F83A 4DW0A 4DOUA 2D6KA 2BSKB 4GJYA 1X8EA 2HBUA 1OLMA 4LE4A 1YJWV 1R1A1 4CCMA 2FYUH 5A3NA 4HZ3A 3JSNA 2W5FA 1BL8A 4WCEV 2QEXV 1O59A 3GDBA 4FT8A 1CAWB 1QDCA 3DUIA 3R66A 4IXLA 5FYMA 3T09A 2WNUB 3I8TA 4BK5A 1CR7A 1SFYA 1XI1A 2HYXA 3B69A 3T1HO 3H8OA 1NVPB 3VHRA 3GBWA 3D0SA 2EIBA 2E5LO 2F4VB 2WC2A 5FYSA 4LHKA 5APAA 3WG2A 4XQDA 1QQP2 1S2EA 4XJAA 3ETDA 1UNBA 3ZRWB 5F39A 4I55A 3RFRA 1JJOA 1WN7A 4GALA 3FB7C 4LUKA 4XDPA 4DV1B 1G4YB 3THTA 2HWB2 3CJXA 5L7OB 2JD9A 4TV9A 2ZQMA 2R9IA 4A7ZA 4CS4A 4CZSA 2PTMA 1B35C 2WNVC 3RYIB 1X50A 3UL2A 2ZHLA 2WRAA 2GZWA 4WVMB 3MUY1 1KMIZ 3ZSKA 5B66Z 1RUC1 1BE3H 3ZHSA 1AHSA 2FMDA 2GMMA 5C4WA 3ZVXA 3AG2B 4CP2A 1FYUA 2OQ7A 3CCQV 5IWFA 5JMOA 5HXVA 1NCQA 2GHYA 1NE6A 1CZTA 5IY5C 1FPN1 1SLCA 2UUCB 5FZEA 4QE7A 1QLEC 1K12A 4J1XA 4PCRA 1E5IA 1I6XA 4JV5B 1QJY3 2Q7GA 4LBLA 5LMUO 2RM22 2WQ8A 3ACLA 1W6OB 5DAXA 3D36C 4IEWA 1COWG 3H8UA 4X1YA 5C8CA 5B1OA 5F6KA 3JU9A 4ES8A 4DR1O 1W8ZA 5CADA 1C8NA 3IAPA 1QJEA 2BCCH 4FPJA 4CPBD 1K7DA 4DO0A 3M8AA 2WLQA 4DXWA 4AHWA 1OI6A 2JRIA 1F23A 3N36A 5IT6A 2Z69A 3AJZA 1OCRC 1BBT3 4DV1O 3B40A 1NA1B 3A0KA 1OOPB 3ZKUA 1MQTB 1V54B 2RS13 3PLQA 1OCZC 1HKDA 3ETGA 1Q6HA 3KGZA 1ZL8B 4Y1YA 1SPPA 2LRPA 5J09A 4MYEA 1SHWB 1DGWX 3OPZA 2SLIA 4G27B 4H44B 3ZJZA 4R8CA 1C28A 2WSUA 5HCHA 2W08A 4LO6B 2VZOA 2NM1A 5FY8A 1PNLA 1W0KG 2E53A 2R061 1F4MA 2PYLA 4TLGA 3LDBA 5FLXN 4YVWC 1XJAA 1GZTA 4WM7C 2ZGNA 3C7GA 1JOJA 4N23A 2VZ1A 2OX0A 2RS12 5IVFA 2W0XA 4QPGC 1GWMA 4JZ2A 4XJ8A 3OGJA 1OLME 1D2SA 2Q7EA 1ZUQA 3UT5B 1N34O 2CWSA 1CWPA 3P6BA 1Y67A 5FYUA 1HRI3 4QQLA 1FPOA 2VMFA 1W0PA 1IZ3A 3HKEA 1L0NH 4J6GA 1DQ2A 5EXOA 3UJQA 2UWCA 2CYFA 4CEWB 3HKBA 4JI2B 3OY8A 4DYLA 4XILA 2WFF1 5B2GB 4GWJA 2ZMLA 5T55A 2BE3A 2IXKA 3B7MA 2E32A 3WDUA 3FFZA 1ZREA 5GLUA 5EC1C 5C8CC 4NHLA 3NNMA 2ZE8A 3T08A 3W59A 4YG3A 4AVAA 1W2UA 3BTZA 4E4ZA 1AR5A 2Q1FA 1PK6C 2LFRA 4CXWA 3HOBA 2UWBA 4HONA 1D4VB 4LBQA 1PZ8A 1N36O 3O1RA 1UF2C 1EUUA 2QTOA 2WNVB 2RCVA 1H1MA 2FCVA 4RSUA 3AK1A 3OSDA 3NKTA 1C1FA 1SA0A 3LNMB 4LNVA 3JD2A 5BNPB 5IWAO 1V9U2 2AGSA 3UETA 1X36A 2A6XA 1O8PA 4IIJA 3RVHA 1NZCA 1UX7A 1VP7A 5IVYA 4Y22A 3H8RA 2YROA 3ALQA 3LFIA 2XAHA 4FLWA 3PHMA 4Q26A 1ENQA 2RQ6A 3D3IA 1JYTA 1SLTA 1YQ8A 2QKDA 2CDPA 4Q0VA 1G9AA 5BNQA 3E8FA 2UXCB 1JH5A 3BTXA 1O5UA 5KA6A 5LBBA 2JEUA 1YRZA 2CL2A 2XUMA 2BGCA 3LPFA 3HPNA 3AP5A 4TTGA 4HFSA 2R49A 1RUE1 2JDNA 1TUBB 2VTXA 4MXVA 3BN6A 4MGKE 3I49A 3O1MA 5FXZA 5IHRA 4UOJA 1OZ0A 3JYCA 2QQKA 3BAAA 1K5MA 2VO5A 1JHJA 4QB2A 5JOYA 5D8AB 4GMP3 4RS5A 2DW4A 2EXHA 1U5XA 4HZFA 4OVEA 1VBB1 3ZSJA 1PGW2 3WFVA 4H13B 2JDIG 1JHNA 2VQTA 4WVMA 3P3PA 2RMU2 4X6RB 1R1A3 1AP6A 3VBSB 5CBHA 2RMU1 3QG5A 5BNOC 2WLHA 4EFEA 4K7JA 4OI1A 1VRH1 1AJNA 2P6CA 2Y64A 4META 5I0DA 3HR0A 4MVSA 1LHUA 2VZQA 5A3UA 3GCWA 1H2KA 4AK3A 4AI0A 3ETPA 1RUI1 2DVFA 3V0AA 1BZWA 2VD7A 4YZ2A 2D3PA 1UAIA 4E2LA 1GYKA 4UBHA 4BQ2A 5HV4A 2BYVE 1PIV2 5CIRA 3ZFFA 5LRSA 3POYA 1Y9GA 5IWAB 5CA6A 2XJPA 2YI9A 1SQQH 2D3OW 2ZGTA 3PNAA 2P2KA 1GKFA 1BCXA 3WCSA 4OFGA 1PVC3 1VMHA 4QPGB 2WO2A 3CCJV 5LMNO 4P9GA 4ASMB 3CRRA 5CAZA 3AMMA 2DYCA 5I8TA 1O3TA 5FY9A 1KKCA 5LCWL 3GB7C 2JG9B 4MVTA 1IXMA 4FPGA 3I2HA 4LOSA 2R0HA 3UK9A 4I09A 2JG8B 2WWUA 4OZXA 2RJKA 2E51A 3UYJA 2YGMA 3TXSA 3VBRA 3CX5F 4FM1A 2Z42A 3BCWA 4Q8LA 2ZXWB 4U2AA 4GX1A 3A0BZ 2DMXA 4I9WA 3ZHQA 5H2FZ 1D5NA 5CA0A 3GNEA 2YMZA 4PLNA 1CX4A 4LT5A 3ZYHA 2A73B 3AVSA 4QKFA 4QAWA 1QOSA 4IHJB 1I08A 3WB1A 3ZFGC 2NYYA 3OW2U 3ZFEA 2O0OA 1IS3A 4BU2A 1CX1A 1ND2A 1HRV1 3SMHA 3O1SA 4DR6O 2A75A 2BZDA 1G9BA 1GK9A 2IBZH 2OTLV 2IFWA 4RS5C 2PZSA 3GCXA 4UCOA 2X6CA 2Q67A 4LMFA 1JX9A 3FHQA 3N9LA 3V0BA 2OCCC 4XF4A 5DG1A 5D21A 1ZBE2 2BSKA 2WZ8A 4I4TA 1XQNA 4U3JA 3URFA 5BY1A 4YJ2B 4CDXC 1R1BA 4CH6A 1XHZA 3VBSA 4MX3A 3VKLA 1DCSA 5JZGB 3HNYM 1H38A 4QB6A 2CTRA 1LUWA 5L73A 2UURA 1STMA 3K2OA 4LBQB 5F9TA 1DK1A 4FPFA 1UQXA 2Y6JA 2C1FA 4FQZA 4IV3C 1CEZA 1U5ZA 3E6BA 4I0WB 3ACIA 1JI6A 4QX8A 4XUTA 5FZ3A 5JIAA 3JZVA 1HB4A 3LIGA 1YJKA 3OE7G 2GSMB 2ZKOA 1OLQA 1QH7A 5LK7B 1XOUA 3FAVA 2XG3A 1DQ6A 3HKCB 2HLEA 4YM0A 3FX3A 1CD3G 2WQZC 4XXPA 2D40A 1C8M2 4Y5SA 3H1LH 5H6RA 1KKDA 2PLV2 1WD3A 1SESA 3H1JH 4GLXA 4QX7A 4RWUA 4N21A 4NUBA 3CJHB 1Y6XA 1R1ZA 5CA1B 2XWJB 2QTSA 3LA3A 3OGSA 2Q5TA 1JUHA 4LR4A 3USUA 1DQ0A 1Q8OA 3BALA 4B3MO 3OTOB 3RYCA 2JG9C 2WS91 1HB2A 2Y38A 3W5NA 5C3OA 2QQWA 1IQAA 4KP4A 2R1BA 2BP6A 4FLXA 1SQVH 3I97A 1YQ6A 2NMOA 5GZEA 5J37A 3U78A 1QR9A 1HNWB 4ARXA 2XPJA 2HWD3 2VZTA 3N9NA 3POIA 5LOVB 2IXCA 1N3PA 1XU2A 4MGZE 3PMSA 2A5ZA 4PDLA 1GWLA 1YI7A 5FZ1A 5LW9A 1BLZA 5FUPA 4HYOA 4LHLA 1XDCA 2A3YA 3SEEA 1OSGA 4UF0B 4BWAA 2YZ4A 2WLMA 3AKTA 4EN8B 2K1EA 1ZBE1 3GALA 2BFUS 4PJYA 3AZXA 5D5PA 2N04A 3KV4A 1HNZB 4W50A 4HK8A 2WL1A 2RJLA 1VF6C 4EQVA 4MGYE 1PVC2 4YW1A 4BQWA 3RS6A 3A2FA 2ZMNA 4QPIA 1WMFA 3D3AA 3HAGA 5JJEB 4NRQA 4K8FA 1M90W 3KB5A 4OULA 5CG8A 3ZN6B 1Y76B 1F7YA 3WNOA 3TK1A 3LB9A 4MSWC 5J98B 4K3UA 3FFQA 1H9PA 1YI9A 4MTOA 3G6JB 4G4FA 1CAXB 2ET1A 3F5TA 3Q8BA 2LFSA 4OMCA 2EF6A 4EJRA 2MNGA 5IVBA 4SBVA 5FZOA 4LA3A 5T54A 2PF4E 1KC8W 1PVC1 2GUZA 1R1A2 1HB3A 3H3UA 4DUWA 4TQFA 5FRAA 1S0VA 3K3WA 3VQYA 3OTOO 1FS0G 4JX0A 4AEMA 5DZGA 3SJAC 1E5HA 1TZOA 1S0DA 3TNPB 5E8AA 3ZXKA 3BOPA 1IPKA 1GQPA 4B3RB 2HWF1 1C5IA 4LKSA 2YGLA 3AG4B 1Q6UA 1N1TA 3W7TA 1PNKA 2WT0A 3AMPA 3C2UA 3USUB 2AHZA 4O4IA 4CS2A 2W39A 3UGGA 4X8NA 2EINB 1JOPA 2MEV2 2Q8VA 2EVXA 2CTPA 3EB7A 1HXS3 1OVPA 4DB5A 1VBC2 2AZ0A 2EIKB 4J7ZA 2HWB3 2VCAA 5L19A 3TAYA 4MXWB 4LJHA 2BTQA 2VG9A 5JOXA 3NV1A 3EXAA 5A32B 4U3JB 5H5NA 1R3LC 4WVZA 4YW6A 2GC0A 1VLNA 1K8AW 4X8AA 4Q29A 4X64B 1KFXL 4JYAO 4UXNA 3PUSA 2VNVA 4AGRA 3LSSA 1U0AA 2Y60A 2HEPA 4Q8KA 5FNVA 4V2VA 3WD5A 5FY7A 2ZKLA 2DU1A 5FZ7A 2WLJA 2NMNA 4YG0A 4JI4B 1DIWA 1EZJA 2C26A 1ZZ7A 1I5YA 4KNCA 5C9AB 4JI7O 1SLAA 3ACFA 4WFGA 2EZPA 3VD4A 3ABMC 2PGGA 1JQ0A 4BQ5A 1Z7S3 2IVJA 3ITQA 5CEHA 2JG8C 4B3NA 3OUJA 2ERFA 1V6OA 4XTPA 3QBQA 5EP9A 4FPPA 1VBD1 3UKMA 4RYDA 4UT5A 3VDCA 3O12A 1BVVA 4CTEA 1AI7A 3OMIB 3ZRXA 2R1DA 1RL3A 4R4ZA 2OVUA 1ZLZA 1BEV2 3J7MA 1XNQB 2FZ2A 3E22A 3G7DA 1SCRA 1XE8A 1JYXA 1DZQA 1HXS2 4PDVA 2QBXA 2R043 5KWRA 5CB7A 4KBZA 1L1FA 1BGYH 3K9AA 2JDUA 5A6YA 4DV2O 1K4DC 2VVFA 4CDWB 5FO7B 2YI8A 1KDKA 3I3EA 5TSWA 2A7WA 2BOCC 5F5CA 4YVSC 2D97A 3ZFEB 1OLRA 3WDTA 5KLVH 1RUD3 4TV9B 1N8RW 4CDQB 2QCSB 3TWIA 3B01A 2DCYA 4Y1XA 5HI0A 3VD3A 1QWRA 5FZ8A 3L9DA 2C2AA 1PO23 2FD8A 2YC0A 3O7OA 1IURA 4LR3A 4EB6B 3S7IA 4LEJA 1QJX1 3LZZA 1YC61 1LGBA 3CZUA 3OAAG 4J25A 3USSA 3KVBA 4LFCO 3ATGA 3WDVA 2HWB1 1GWKA 2DCTA 4N8MA 3NJYA 3MEPA 5F37A 2Y69C 4GULA 1BXHA 1VBA3 2WZR2 5A3TA 3FBYA 2IZWA 2PYJA 3FKSG 3OCPA 1V6LA 2JG9A 2DCJA 4GB31 5JOWA 2XBO2 2BVBA 1W2AX 3WZ1A 3AK0A 1ONAA 4TV8B 1JU3A 4P9XA 1N1SA 3ZIXA 2D93A 1XNQO 2A6ZA 3PU3A 2ZIMA 4QE9A 3FD9A 2G19A 2ZGSA 3T2MA 4JKLA 3WV6A 2F23A 1XEQA 3ZXFA 4IEPA 4IV3A 4KWLA 1OCOB 4YY3O 2ZX0A 2P4EA 1NY72 4AAXA 3OD0A 2LS6A 3HWJA 4TSVA 3VBSC 2D44A 2X0LA 1H8TA 1ODMA 3RYKA 2OZJA 4O4HA 2W47A 1MS8A 1QXJA 3VD7A 1W39A 4C91A 2GTAA 3U0ZA 1CAVB 3AFGA 4QXCA 1IPSA 2E33A 4Y20B 3J81N 2VMCA 4XBQA 1KS4A 1NKDA 4B29A 2A70A 5FYVA 4IEOA 1JFFA 3D3QA 1OF4A 1BHBA 1QJX3 1WBLA 4JDNA 5FYBA 1W2NA 1R64A 3OB8A 3DF0A 1AB3A 4XMAA 3OR7C 2TBVA 2UYBA 1AI5A 1CAXA 2PUSA 4ZZ5A 3NL1A 4XFAA 1N33O 1IGOA 3DPRA 4IL6Z 5KBFA 4LIVA 4A3XA 1DGRN 3CJIB 1FXKA 1FV3A 4AFAA 2BTVC 1SA0B 5DMYA 3IIAA 4QB1A 4IEUA 2XOKG 3FUQA 1S77D 2F1MA 2P67A 2IUWA 4RQEA 3JBG3 2VXRA 3ETQA 5B1NA 1WLWA 4YW2A 4Z1VA 2ILMA 1D0GA 4CCOA 4COWA 1ZBA3 4DRVA 3AMQA 3K3OA 4IE0A 5T50A 1CIYA 2QVSB 3JCIA 3OEBA 1QNWA 3K48A 4Q4X3 2P4KA 5ACA2 3RYFB 2YPDA 3POJA 3RG0A 1UYPA 3A4UA 4XCBA 4KGGA 3HKBB 2OCCB 1Z5WA 3B9CA 1ZTEA 1A78A 1Y9QA 2YB7A 4TYSA 4UAPA 4GH4A 4UFJA 4CUGA 2QNKA 3TEWA 1AUYA 2B46X 1ZBE3 1W6MA 2LJ2A 4H55A 2YDEA 1E5SA 4RUEA 1QY4A 2RS52 2ADQB 3BVCA 1QH6A 1UOBA 2A3QA 4KGQA 1YHQV 3GWKC 2W52A 4O9EA 1X8MA 2ZNIA 3A0HZ 1ULFA 3KGLA 5KMGA 1DF0A 2ARXA 4JAAA 3AFKA 4RQPC 5J48A 3GJAA 1DLCA 4XETA 2Q8CA 5EWSA 4E8CA 1GH6A 2CU5A 2AUYA 4DV4B 4QDQA 1KS5A 4MGSA 3C7HA 4HKLA 3E1F1 2NLRA 5L7OC 2H3OA 3K51A 5JSRA 3SQOA 5B3SC 4FO9A 4FPEA 2Q30A 3B94A 4Q4V2 1O3SA 5E6HA 1HNXO 1DLLA 2Q8DA 5A33A 2PAKA 4QPWA 2WFPA 5GLWA 3L70H 4Z82A 1CPYA 3CLPA 3X2QC 2QGNA 4I5SA 3CXCU 1AR83 3VDDA 3HT2A 1OJHA 1LNSA 1IG0A 4F6RB 1KP2A 4YRDA 2VZ3A 5C6CA 1EV11 5KX5B 4LITA 3FB6C 3U11A 1R091 4NXMO 5A1AA 2EAKA 4W6YA 2KG7B 2IVIB 2NN8A 5EFUA 4Z07A 2JJ2G 1NX9A 2Y26A 1MG1A 2FDJA 4ZHQB 3KCYA 3WNLA 2VOWA 5EZYA 3CCSV 4IEZA 2HWD2 3GBFA 2D6PA 3SYAA 4NTXA 2XKOA 1N32B 4NOTA 4Q0SA 1SERA 2RV9A 1EFRG 2WO3A 2ITCC 4TUYB 3LOIA 2WT1A 4MGIE 1W90A 3CC4V 4FOYA 2N05A 5T3NA 1DYPA 1RTVA 2Y33A 2KM2A 1N36B 4HAMA 4JI7B 4S2FA 1W0JG 2X05A 2XJUA 3JATA 1L3JA 1A6CA 2VQ0A 1JVMA 4A42A 3J7HA 4FZ0A 1RUE3 5BXXA 1SKVA 2ZIOA 5IY5B 5LA6B 2F66C 4MG2A 1NLSA 5GZCA 2HEYF 2VUJA 2R16A 4NXNB 1OCZB 2VH9A 5JPMB 1HB1A 3W7UA 4JQRA 5HXMA 2VWKA 4ZIBA 2JK5C 1UYYA 4RGAA 4SLIA 2G38A 1V00A 4IHJA 1MVEA 2K2SA 4NRPA 2V73A 4TXWA 1U5YA 1V55C 4QQOA 4DV2B 3H1WA 5F8PA 3MIEA 5IATA 4ARYA 1O9GA 2PLV1 5IJ0A 4IYHA 3PUQA 5EC2C 3LSEA 5EJ3A 1HQLA 2ARHA 3M3IA 2I2SA 5BNPC 3G80A 2RDRA 4UW4A 5ACA3 2DFCA 4P9LA 4F3JA 4LBMA 2A79B 1YQCA 4CDWA 2PELA 4IE5A 3SCGA 3OT7A 2OPWA 4HG6B 2J42A 3RYIA 4LO8A 4Q4W3 4UV9A 1L7RA 2VECA 5DZEA 1KU9A 4MVOA 2XNDG 2EXJA 1YITV 3HN3A 3OUIA 5C3PA 2AHYA 2ZCWA 4R9AA 1SZBA 3BTYA 4J7KA 1LB2A 1NTMH 2AXTZ 2P22C 2Q68A 1JJ2U 2QWQB 3BI3A 3C3SA 4WBNB 1V9U1 4LBQD 1NTZH 2C9AA 4XHXA 3AMHA 3N7LA 3JXSA 4BIZA 1ALYA 2ZX2A 4QX0A 3WX5A 3MV01 1LEDA 1W04A 2ET7A 2VUDA 1VQ4V 1HWYA 5IYDO 4WVWA 3NVCA 4UFLA 1D0HA 1LOCA 2WO1A 2DWDC 4N90A 2WLIB 4Z8BA 4FQ4A 2ZDIA 3SJQC 3ASOB 4MVMA 5AC93 2TNFA 4NIHA 3QCWA 1THZA 4RN5A 4DR6B 4AQ2A 3VLBB 2BNNA 2QQPA 4EZ4A 4CDXA 5LBFA 2JB4A 4PT6A 1NH2D 5K0UC 1W6QA 2X53S 4CP0A 2EJ7A 1LECA 2R041 3AG1C 2L9LA 3VBHA 4MXWA 4UCVA 3T2TA 1FFXA 1AXZA 4LLOA 3DC6A 2JIZG 4PI2A 5HPOA 3X2QB 1PIV1 4BISA 1TNFA 3VHNA 3VD5A 2F43G 1ZVFA 5LRRA 4XDQA 4O2BA 3MW4A 2Z4FA 5FPZA 5BNNB 5B1BB 4P9IA 4R4XA 4H33A 5HCFA 4MTXA 1XMOB 5J36A 2I74A 4MZUA 4EZHA 4I4TB 2K9ZA 2CGNA 2E75B 5HFLA 2C9KA 4NHXA 4BOWA 4ISRA 1HNZO 1FXVA 3JASA 3VDDC 2KKWA 5F5AA 4JKKA 2ETNA 3FB8C 2JDYA 2ZPXA 1UY0A 4ZKIA 3F2ZA 1HRI1 1CIWA 2BFUL 3H1HH 4DFSA 1AVMA 4YYOA 1W59A 4X1KA 1TME2 4YWAA 1UMZA 4FP3A 2HJIA 4ORFA 4CDWC 1LULA 1BMV2 4GH4C 1V55B 3TEYA 1ULGA 4DK1A 1C8M1 1I5ZA 1DP0A 1QDOA 3H1KH 3W9AA 2QQLA 4AGGA 2Q7HA 4HPKB 1VALA 3VL9A 1M4WA 3FLPA 1PO12 1UYZA 4U36A 1CONA 4FFKA 3L9JT 4RO2A 3G67A 4B3MB 1ULPA 2F93B 4W4ZA 4Y24A 2IU3A 5FZ4A 3K57A 2IU0A 1O4YA 3WDYA 3MGUA 4FZ1A 4GX5A 1NZ6A 1K97A 3ZYGA 5EPAA 3D5OA 5DXDA 3IC7A 3KM5A 5FK7A 4MS2A 1WNSA 4FPOB 5IUQA 3MW2A 4IE6A 2FQPA 3OBAA 5LOVA 2ZX4A 2GSYA 3HKDB 4QPIC 1CGPA 1OOPC 4NB5A 4Y1VA 4DXRA 1LHVA 2CSGA 4XFIA 1QBZA 1PHMA 1ZBA2 3M3QA 2LTNA 1WMXA 1SS3A 2OA2A 4HLTA 1OHFA 1RHI3 1XHXA 3N3HA 4P5YA 2KB1A 1IBKB 1GN2A 3KHBA 4IQPA 1XNBA 3OUFA 1K34A 3HQRA 2ARCA 4RL7A 4JI3O 4PDMA 2ID4A 3MV11 3EFFK 1H2GA 5CFDC 4HVRA 2W2IA 1WGPA 4MHRA 5B1BC 2AYHA 1FXKC 4X20A 5DM6V 4CC6A 2OCHA 3W7SA 4DRXB 3ZYIB 3WW3A 4YY3B 4A7YA 2EIMB 1QQP3 4P9WA 4B3SO 1EN6A 4AVVA 3O0WA 1VQ9V 4PF1A 4DR5B 5HBAA 2VW1A 3K58A 4NJ4A 3A21A 2HJDA 5BZBA 1BMV1 1AYN2 1O4TA 2MEV3 1ZL8A 4GMP0 5ABJC 1H2LA 5LP6A 1QGLA 1K9MW 1UO9A 2IJKA 4AHZA 1TMF2 2LGWA 1HP8A 3JARA 2FMLA 1OCRB 5A32A 4F6EA 1T6GC 3CD6V 3GWOA 2AZ2A 1XU1A 3M3OA 4N43A 2VNRA 3UV9A 2ZAAA 4WFFA 3AMNA 2LGQA 5FZOB 5IVCA 5JI9A 1SMVA 4CEWC 1QVFU 3ZCCA 4XC9A 5A3LA 2XQXA 3V56A 1GMMA 3VBOB 3R05A 2W68A 3EQEA 4Q4Y2 4JDMA 1WA8A 1VQOV 4XIKA 4KWUA 3T1YB 1I94O 4Q5OA 1OCCC 3HBZA 4UFIA 4CU8A 2OQ6A 4DXSA 4XURA 2V4AA 3LEMA 1D2DA 4W4LA 3B00A 2BV4A 4DV5B 1A34A 1RUG3 3O1VA 3WSOA 3SPGA 1YDXA 2BUKA 2VW2A 5IDJA 1BHAA 4MVUA 1MOFA 1VAMA 4AFMA 3FB5C 2CAVA 4B3SB 2G9ZA 1GN6A 1FMD1 5E89A 1UXZA 3W7WA 1PM7A 2VW0A 2XDVA 5F3EA 2GBOA 5LA9A 4AL9A 4FM2A 2W92A 3CCLV 1D4M1 3KS7A 1S0EA 1H1IA 4NPMA 4COVA 4A7KA 4XF0A 2Y6HA 2V5DA 1MMMA 1R092 1POV0 1ZRIA 2M6YA 1FAFA 1J3QA 2QQJA 1OMIA 5LWBA 2XVKA 4GH4B 4XE9A 2YC4A 2FCTA 5BNNC 5F32A 2OWOA 1OKQA 5A6QA 1Q8VA 1X4TA 1R6KA 2R32A 1OHHG 1WW5A 4UV8A 1J1TA 3AKQA 3CNAA 5A70A 1ZAUA 2Y6FA 3S30A 5AFBA 4S2DA 1LR5A 3U07A 5H9RA 1YYNA 3X29B 5C9AA 4QM8A 4X1KB 4XACA 4WFHA 2PHTA 5KHIA 4AXOA 1ND3C 5FKCA 2XAQA 3KD4A 1VE0A 1W03A 2YXYA 3HKDA 1VARA 1UIKA 3NO8A 2P06A 1G6UA 4DV4O 1GZ9A 1QEXA 1GZCA 1QLNA 2A6YA 2EJRA 2QE3A 1LOGA 5FPXA 1DDLA 4YIOA 2XBO3 3F7YC 4TWKA 2VWJA 1EAH1 4AI3A 5JVDA 3JD73 4BM8A 5FUNA 3JD0A 3QACA 2VMGA 2VCCA 4GUNA 3AYEA 4K21A 1H2SB 2ZDIC 3IBMA 4CSWA 1F4NA 3CF6E 3I4IA 1UJWB 4GWIA 2OT7A 2CH7B 2UUCO 4XFHA 1J1LA 2PHDA 1VMJA 1H2NA 2ZHNA