3U10A

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
202
structure length
202
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u10A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u10A02
3OF1A 4LUMA 1ZZBA 1WLTA 1X8EA 2C0ZA 2Q0AA 2PAMA 1UW8A 2EVXA 1ZZ9A 3MPBA 2BNOA 1OD5A 4XF9A 4PIZA 3C3VA 3S0MA 1YLLA 1Y3TA 1GQGA 4AVCA 4KWKA 1RL3A 3H3UA 4KU8A 1QWRA 5FPXA 4HSJA 3EO6A 2I45A 1CAVB 2CAUA 2GC0A 4I0BA 4KWJA 4FAHA 3I59B 2OPKA 1ZZ6A 4LA2A 3LWCA 4LUKA 3UKVA 5KHGA 3HT2A 4WVZA 1J3RA 4E2GA 4I01A 4AVAA 1G6NA 3LAGA 3VHRA 3ZDSA 2XL9A 4XF0A 4EWEA 3CLPA 5LRSA 4QXKA 3BU7A 3ES4A 4L2NA 1V70A 2OZJA 3USSA 5I8SA 3GBFA 3D0SA 5D1IA 3BPZA 3IWZA 2PTMA 3JZVA 4ONUA 4L11A 1Q3EA 4IEZA 4MUVA 2XHKA 3H7JA 4AXOA 4ZU7A 3NSTA 4E2SA 3OGJA 1Q43A 3N4MA 1NE6A 4Q29A 4IESA 5HI0A 1O3RA 2VPVA 3H1YA 4ZU4A 4I3PA 5JR7B 3GYDA 1J58A 2UYAA 2QCSB 3IDBB 1NYWA 4META 4XFGA 1QY4A 2BNMA 5C6CA 1UCXA 2ET7A 3E5QA 4QM8A 1SQ4A 3TNQA 2GAUA 1YFYA 4IEXA 2QNKA 2D5HA 2XKOA 1CAWB 1FXZA 1UD1A 4TLFA 4LLOA 1FT9A 3BCWA 2EAAA 3D82A 4XF3A 2E9QA 3NW4A 3FE5A 1CAUB 4BHPA 1ZRDA 2BEOA 2XLGA 4R8HA 5BXXA 4LTAA 3NJZA 4MV2A 3RYRA 3RDIA 2UYBA 3BB6A 2FQPA 5LEKA 3SCHA 1IPJA 4QMAA 2Q1ZB 4OFGA 1RUOA 4HLTA 5FQ0B 5EZWA 2PAKA 4N9IA 4EWAA 1LKNA 3QACA 4HVQA 5KHIA 3RPQA 2EA7A 5BPXA 2H6CA 2GC2A 1ZZ7A 3ELNA 5FLJA 3WW1A 3E6BA 4BH9A 4FAGA 4YARA 3FWEA 2MNGA 2PFWA 4XETA 3LZZA 4Q0VA 2GH2A 4GULA 1DGRA 1Y9QA 3RYPA 1NE4A 2OYZA 4AQ6A 4XEZA 4XFCA 1YWKA 3DV8A 1PM7A 1VJ2A 4PIXA 3RZZA 4MX3A 5AVPA 1WGPA 2XLFA 5T3NA 2MPFA 3E6DA 4FT8A 5E16A 4LA3A 2IXKA 3H7YA 2HKXA 3CL1A 1X82A 4Z82A 3IIAA 4HMZA 3M70A 2ET1A 5J7MA 3WW4A 4EWDA 1CGPA 2B9UA 2IXIA 1I6XA 5J48A 3I59A 5KBFA 4IERA 5EFUA 5K8SA 2Y0OA 3CJXA 4J1WA 1ZRCA 4MH0E 4Q0QA 5J3UA 4MGZE 4IEWA 1ZZCA 1RGSA 4JV4A 2FMYA 4MGIE 2GC1A 2PHDA 2XL7A 3SHRA 4UBGA 4D7TA 2CAVA 3H8UA 4HVOA 1XRUA 4YNIA 2MHFA 2XGXA 1SEFA 1L3JA 3NVCA 1ZVFA 1TQ5A 3CEWA 1CAXA 2GU9A 2UY8A 1ZNPA 3HIFA 4X6QB 4XFIA 1H1MA 1OFNA 1RTVA 3HQXA 3FX3A 3RNSA 4JTOA 1I5ZA 3R6SA 1UIJA 4HN1A 4LULA 1RC6A 3OTFA 4EROA 4HN0A 2QJVA 4WBBA 4K8FA 2CGPA 2ZKLA 3SXWA 2IXCA 3IDCB 3RYKA 1DGWA 5I93A 2PHLA 3KGLA 3D0JA 4BYYA 4HBNA 1OMIA 1O5LA 3U10A 4J1XA 1Q5OA 5JCTA 4XF4A 2QDRA 5BUVA 4I2OA 2PA7A 1EYBA 2HJIA 4QGLA 3FHIB 4IETA 3CF6E 4BIFA 2IXLA 2K9ZA 5E1RA 2GZWA 3H3ZA 4EV0A 1X8MA 2BGCA 4R52A 1YFWA 3DKWA 4AVBA 3LA2A 2WC2A 3KSCA 4QM9A 4KWLA 1PMIA 3M3IA 4AQ2A 4JVAA 4MZUA 3EHKA 5FQ0A 3H1MA 3I54A 2QVSB 3E5UA 3MDPA 3KMHA 4P9GA 5KHKA 4QGNA 3SCGA 1YUDA 1QXJA 5C8WA 1J1LA 4IEVA 2B5HA 1LB2A 3CO2A 4H7LA 2F4PA 3L2HA 3WW3A 1XE7A 3E5XA 3ST7A 5BY5A 3ETQA 1O4TA 1U12A 1VP6A 4IEUA 3UKNA 5FLHA 3FZ3A 1XE8A 3HT1A 2PYTA 2OZ6A 1YHFA 3H1WA 4Q0SA 1EY2A 1ZRRA 4YRDA 1ZZ8A 5BV6A 4XF1A 3IBMA 3I7DA 1J3PA 3U0ZA 2ATFA 2ZCWA 3DL3A 3UKTA 2PQQA 5CU1A 5I0SA 2XLAA 1LRHA 2O1QA 2H0VA 1JUHA 1OI6A 1QXRA 1CAVA 4XFFA 2BYVE 3KGZA 4IEYA 4RD7A 3ACLA 2B8MA 5FLIA 2D93A 3G7DA 1ZX5A 4IEQA 4XFBA 1IPKA 4ZU5A 2VECA 2WFPA 3WW2A 4HVRA 5LRRA 2XKPA 1RUNA 1ZREA 3ES1A 3H9AA 4MGKE 4Z07A 4ORFA 2K0GA 3LOIA 4HSLA 1UIKA 2CV6A 1ZRFA 3FFQA 4F8AA 2PAEA 5CADA 2Q4SA 2H6BA 5JSRA 2BNNA 2UY9A 2ETEA 1DZTA 4F7ZA 3OD0A 2KXLA 3LA3A 4I09A 1YFXA 1CX4A 5JSOA 3SMHA 4A2UA 3QOPA 2Z69A 3NL1A 2IC1A 1O5UA 5FPZA 3EQEA 3PLQA 1J59A 1EP0A 4YYOA 1O3SA 3PVBB 4IEPA 1CAXB 1O3TA 5FCCA 5KHJA 1HW5A 4DINB 1O3QA 1LR5A 5KHHA 5JAXA 4LEJA 4E2QA 3FJSA 1CAWA 1FI2A 3OCPA 4NVPA 5F1RA 3TNPB 4HZFA 5FDBA 3PNAA 1CAUA 3U11A 1YFUA 4QGMA 5I0UA 4KL1A 4B29A 5I91A 4D7SA 2Z2SB 3EBRA 4KU7A 1WA4A 3NKTA 2D5FA 4UBHA 4XFAA 3B02A 4QX5A 2N7GA 3S7IA 3DN7A 4N9HA 1J3QA 3O14A 4PJYA 4I0AA 3E97A 2V09A 3LA7A 4PIYA 2P17A 5I8YA 1H1IA 1NXMA 3EJKA 2O8QA 4WZCA 5I0RA 4CYDA 1O7FA 3E6CC 4JTNA 3BALA 3MYXA 5LEJA 2OA2A 2DCTA 5CVRA 4MGYE 5I0TA 4Q0PA 4X6RB 4FBFA 5JSPA 1SFNA 1X7NA 1UPIA 2VQAA 4IEOA 4Q0UA 4O9EA 1NZCA 4XFHA 5I8TA 2GC3A 3S7EA 2Q30A 1GQHA 1VR3A 4OLLA 3H50A 4I02A 4UXAA 4O9GA 3MZHA 4YSFA 1DZRA 3ROUA 2D40A 1EPZA 3SCFA 2IXHA 3KCCA 2IXJA
chains in the Genus database with same CATH superfamily
1WLTA 5ABJB 1GP6A 2J1SA 4J9ZB 4YZ2A 1N1VA 3L74H 3ZVXA 4GX0A 4FLWA 4LHNA 3JUUA 4KWKA 4YGBA 4O4JB 3ZXKA 2D3SA 3K08A 3WNXA 1DQ1A 3WU2Z 2VNGA 1CQ9A 2OPKA 4WVZA 2HYXA 4I01A 3GBWA 5IDJA 5FPLA 1DP0A 1JZ6A 3WB0A 3WLUA 1LAJA 1WCKA 1YJKA 2EZPA 3WZ1A 4YHHB 1AR93 4L11A 4X1KB 2HWF3 1CP9A 2LROA 4O2BA 5A6XA 4ZU4A 2B4KA 4G9SB 1K33A 3CYOA 5CFDA 1FX5A 2DUQA 3IAQA 2DURA 4XFGA 3ZN6B 4KG8A 2PLV2 2BNMA 5D8AB 3TNQA 1R1BA 3H8XA 5DZFA 2VMCA 2BGOA 3UQ8A 2ZA9A 4CCMA 3JCIA 1UD1A 5FMDA 4X66B 3C90A 1UX7A 1KFUL 3WNNA 3HNMA 1HDKA 2XLGA 3OUJA 3ETGA 1AXZA 1AYM2 3MI8A 1OA3A 1RUH1 5F5IA 2QFEA 3FD9A 4N9IA 1N1TA 1KD7A 4ZXEA 4EWAA 1JUIA 2NNUA 2DV9A 1QNMA 1W2UA 5C4WC 3K46A 1LHVA 3H42B 3B2EE 1G86A 3ZMNA 3OT7A 4COVA 1UN1A 2A5ZA 2RMKB 3VKMA 4XEZA 4XFCA 4XOGA 3P6BA 1VJ2A 4IGGA 4U3JB 3V65A 3TCUA 1KP2A 1E5IA 4X9QA 5ERLA 3T2TA 4FPYA 4WM8C 1CGPA 1ZM1A 4JKKA 1RVF1 4EYUA 5FYUA 3I97A 2PI5A 2UXCO 4IUGA 2ETNA 5L9VA 5HV4A 1XC6A 1LOFA 3O0XA 3FHAA 1N8RW 3O1OA 2OT5A 4LO4B 4JI6O 2XGXA 2Q8OA 2XJQA 3NQHA 4XFIA 1UZ0A 1JVMA 1H1MA 2ZGLA 2WYSA 2HWB2 1WLDA 4IYIA 5H9SA 2JDUA 2WLIA 4R8CA 3I2KA 1AX2A 1BGYH 1KEXA 4XC9A 4CDQA 3SXWA 3R05A 3RYKA 4IE0A 2R1DA 5A3WA 2MEV3 3ZXJA 2VCMA 1OCCC 3TEWA 4IV3A 1MEC3 3FHIB 4FOYA 2VZQA 3HWJA 4BLIA 2DQ0A 4L8JA 1NXD1 2BGCA 1PNMA 5C8YB 2CTWA 4AVBA 2QTSA 3WDYA 3ZN0A 3OGIB 1PGSA 1ZBE2 3UJQA 4W8JA 5FQ0A 1PD3A 5HFMA 4OHYA 4WFBV 3JQXA 3QH6A 3AYEA 1VBB2 3C3SA 4GD4A 4GZRB 1KC8W 2RS52 3H0OA 1RUJ2 4N8MA 1C5HA 3CO2A 4DV4B 4PJ0Z 2QA4V 3E5XA 3ST7A 1VP6A 3H1WA 4XCBA 5FO9B 3TGUH 2GALA 4SBVA 1M5IA 4BISA 1RYYA 3DL3A 5CU1A 4UW6A 4DV0O 1GZ9A 1LRHA 4M4PA 2KQXA 4RD7A 2JB8A 2EJ7A 2W87A 3J8F1 4XFBA 2VUAA 4TUYA 1POV0 1TUEB 2WLQA 5T50A 3ES1A 2BWCA 4DOUA 1S0VA 1UIKA 4LFCO 5FOJB 1XHZA 1ND2A 3AP9A 2H6BA 4XUPA 2PQSA 2YPJA 4RFRB 5LOVA 3LA3A 4ISRA 2RHPA 4I09A 4TN7A 1F31A 2HWD2 3LIHA 3HEIA 1JCHA 1EFRG 5SV5A 4UCVA 5BZBA 4YYOA 1O3SA 4UVCA 1PM9A 4AFMA 3LPGA 1W6PB 3SLIA 2NP0A 4HOOA 4WVVA 3JXSA 1NVPB 4OMDA 1RHI1 3GXUA 2PF4E 2ZE7A 3OSDA 1CAUA 1NZ6A 4RR3C 1YIFA 3CXHF 1WA4A 1FFXB 4I9WA 4UB8Z 2LUWA 4QU2A 4OPAA 2HG5C 1O59A 4PIYA 3ACGA 5IVCA 2IFRA 5JOXA 3I4IA 2VW2A 4WZCA 4YIPA 3ZM8A 3VKLA 4DV3B 4CDWA 3SYQA 3VKOA 3HKDB 2AH2A 4E4DX 3I5DA 4ZY9A 1OPMA 5GLUA 3ASOC 4LBKA 5JWPA 1IS5A 4XFHA 4RGKA 2Q30A 1OZ0A 1RUE2 1AI6A 2CL2A 2YC4A 4U7NA 4TT3G 4O9GA 1DFQA 1W2BU 2UXBB 2JIZG 2C9KA 2ORZA 4LUMA 3PMEA 3TBDA 1DQ5A 3MPBA 1Y74B 5IVEA 5KWRA 2Q8VA 5FPUA 3ZO0B 1YLLA 4YM1A 4LWSB 1GQGA 4B3NA 2YDEA 1E57A 4HNAA 1LHUA 5J1XA 4I0BA 3LWCA 4XVHA 1IZ3A 2WNVC 1S5JA 2CTPA 2OT7A 4NHLA 2CGOA 4YW1A 5LWBA 4EWEA 1JTZX 3GJAA 2QKAA 1QJFA 1YTFB 3IC7A 3IWZA 3ZHRA 4JRLA 1XMQB 1SA0A 2O0OA 4IEZA 3W21A 4UCUA 4FFIA 4RR3B 3N36A 4Q4W3 2XMLA 1L7QA 4Q29A 4YG6A 3APOA 2GUZB 4N43B 4XABA 4L87A 1NYWA 3SYAA 2QM8A 1Q86W 3DKQA 1OKOA 2QQKA 2ZGQA 3CHXA 1CXZB 3GZAA 4PELA 3HB3B 2K1EA 2FZ2A 2WRAA 4TQDA 3KD4A 3UESA 1WA8A 1UKRA 3D4KA 4HLTA 3OPTA 1FV2A 3WSOA 5JXHA 5GJ6A 3QACA 4HVQA 1PMHX 2YG0A 1UU6A 1GMGA 1GK9A 3WW1A 3E6BA 1XPWA 4YARA 5EBWC 2PHUA 4XTPA 4DK0A 4BW9A 1TNFA 2G19A 3GGLA 4ZKIA 3RYPA 2ILMA 4AEJA 1UMHA 3UJOA 3DV8A 3U07A 2C5DA 3EB7A 4G3YC 3AP4A 3ZS8C 2WNVB 4FQ4A 3E6DA 3UT5B 1F35A 1PL4A 3CDZB 1QVGU 3HVDA 3G80A 4IHJB 1ZRIA 1VRBA 1NTMH 1KU9A 4IGPA 1XBLA 2PLV3 3ZFGC 2JIGA 4M0HA 1ZYBA 4DMIA 2VOKA 4YLZA 5FRAA 2D6KA 3I2FA 4DV1O 3GJBA 5B3SB 4YNIA 3I3DA 4CE8A 1XYNA 1LNSA 3OBZA 3FN9A 2XBO1 3HIFA 4UB6Z 1OFNA 3N7JA 2BQPA 3R6SA 1PGL1 1S1AA 4DUXA 2VTXJ 2P34A 1K4CC 3JD71 5BNOA 5EIYB 4S2GA 3VDAA 2IJIA 5I93A 1KQSU 5CYYA 3ILNA 1Q5OA 4ZI7B 3L71H 2X05A 5FYSA 3A21A 1G7YA 1PVXA 2VZSA 1K4DC 4FK5C 1RUD3 4K3UA 3TYJA 3VZJA 1OH3A 2EILC 4JI0B 1SERA 4LORA 3SCGA 5EYPA 5KX5B 1BCCH 2D6OX 4TXWA 1YJNV 4IGOA 1M06G 3H9VA 1MS4A 2BTQA 4JTDB 1VAVA 2CTRA 2J1EA 2R32A 4BIUA 1XE7A 1GH6A 4AQYO 1U12A 1XU2A 1PO21 5F3GA 3ZFGB 1UU4A 5EZYB 3TN91 3HJRA 4QPIA 4LF7O 2VOXA 4P9OA 1TME1 1LECA 5LP6B 1XNDA 2WWJA 3S5QA 1SFYA 4J10A 1CAVA 4LNVA 3G7DA 1R093 2WLHA 3JAMN 4LE4A 4JI7O 1RVF2 1LEMA 1MS3A 1JZ8A 1WD4A 2XKPA 4HG6B 5L9RA 3RN4A 3AM2A 2VMIA 3KT4A 1CESA 4Q4V3 1K97A 1DBNA 4DR4O 4UCSA 3W5NA 2AREA 5EWSA 1YFXA 3K4ZA 1R73A 3ZKUA 5CA0B 2Z69A 5KUKA 4A5UB 4AEMA 3ZR5A 4DINB 5IE9A 2YGLA 3E83A 3NWKA 3ACHA 3FJSA 4EB6B 5FZLA 3IN9A 2L9LA 2YEVB 4KBBA 2JGDA 1I5PA 2ZGMA 4JDNA 1G9FA 3KVBA 2R9AA 5FXWA 1W8NA 4R7CA 2VL4A 2CWMA 1MOFA 3H1IH 4XJAA 1AYN3 1IS6A 5FY5A 1YXBA 2P17A 1I9RA 3X2QB 4E8CA 4AZZA 5CVRA 4H44B 3T1HB 4GJZA 3JSNA 2BOJA 2Y69C 4X1IB 1KUQA 5JSPA 1X7NA 5FBZA 2AZ2A 2E7QA 1UY0A 1ULOA 5JH7A 4MT8A 3JASB 3ABMC 1B35C 1SDDB 4GKXA 3OYWB 4RQFA 2ZINA 3HBKA 3ROUA 4M0NA 3JD4A 1EPZA 2ERFA 1XNRB 4KFMA 1H8HG 4W6WA 3PIJA 1QJU1 2HWD3 2UUAO 5CBGA 1RITA 3C3VA 2YU2A 4IV1B 3PDQA 3J8F2 1MS1A 1RL3A 1VB2A 5DZEA 3I3EA 4XXAA 1ENXA 1SZBA 1TVGA 5FZCA 4JHTA 4QX0A 3ZDSA 3OE7G 1R1A1 3CEIA 1H2MA 2E7AA 4ONUA 2CY6A 1JS9A 1Q3EA 3UNPA 4YVSA 3WT3A 4B3RO 4DRVA 4OI4A 5IJ0A 3FLRA 4UW3A 4EN7B 5HI0A 4GKKB 1N0JA 5KAIZ 4MHRA 4X1YA 3B00A 4WBNA 1MABG 2WLLA 4KI5M 4QKFA 1GKFA 4QM8A 1XDCA 1JYWA 5GONB 5A33A 1S0CA 1YCIA 4AI8A 2Y69B 1W3XA 2JGUA 2R1BA 1FT9A 3K5MA 3D82A 4XF3A 4BHPA 1B35B 1W8ZA 4JYAO 1COV1 4ET7A 1GZCA 4FOVA 4COWA 5FYMA 5IT6A 3NAPB 4NTXA 4HK9A 3BY6A 3ZMOA 2VNRA 2OCCB 3FWEA 2ZR3A 2DUPA 4Q0VA 5DAXA 3EHBB 2G4IA 4G27B 5C3SA 2ADDA 4GWMA 4FLUA 2GMEA 1YWKA 2JG8C 2X53S 2ZKOA 2PHWA 3RYIB 1FXVA 1Q6HA 2UXDB 5L3GA 5GZCA 2KG7A 3E8FA 3MUY1 4CEYB 3CL1A 4AHZA 4NB5A 3A0HZ 1HB2A 2C1FA 1WW6A 1WKYA 2B9UA 5FTTC 5K4LA 1VE0A 3CJXA 3ALQA 2VOWA 4TSFG 5J3UA 2WNOA 1VMGA 4X8AA 1NLQA 4X8NA 5B1BC 5FY8A 5K1PA 2XL7A 4LNUB 2A6XA 2CAVA 2YXYA 3UO2A 2OWOA 1AL23 3Q8AA 4PF1A 4GH4A 4PLMA 4QKNA 1VQKV 1YEWA 3NVCA 1HB3A 4X6QB 5LA6B 4BQ3A 2ADEA 3MGUA 4XDJA 1PIV1 4DV5O 1N47A 3U10A 4FLXA 1G1XB 4J1XA 2BVBA 2VWKA 4BAYA 2WT2A 2QQPA 1HNZB 4I2OA 4E9KA 1B06A 3SH3A 4DV6O 2YZ4A 4HKLA 3KF3A 4BIFA 1DQ0A 5L9BA 2UXXA 4RS5C 2Y34A 1F4HA 1WLCA 2ZAHA 4GB31 3N7LA 4XBLA 5FR3A 4XZPA 5JZGC 3IB3A 2C6SA 1OFSA 1LU2A 4MZUA 2RG4A 1NS1A 2A6ZA 5FL7G 2JG8B 4XILA 2DCJA 2KM2A 1OLMA 2XQXA 1OLME 5BNPA 3BAAA 1UOFA 1YVWA 2XAFA 2R16A 3AG4C 1VALA 3C7GA 3BYWA 2WNUA 4C8DA 4AF9A 1D0HA 5H6QA 1K5SA 5EP9A 2E76B 1BEV1 4NXMO 1AR61 2E6VA 5B1BB 1MQTA 5T5LA 1QXRA 2P22C 2DF7A 3WG4A 1VBC2 2Q7EA 4DR3B 2OYQA 1TUBB 2W3JA 1CZVA 2WFPA 3IMMA 2X6CA 1UPSA 2XAJA 1HJGA 5LYJB 2IZWA 3ZPOA 5CMUA 1HRV1 2RJKA 1ZRFA 2W68A 5BXZA 2BNNA 1I94B 4F7ZA 3THOA 1MZ6A 3NMBA 4HANA 4H3WA 2TNFA 2XBO2 2JEMA 1RUH3 3QO5A 1DF4A 3HBZA 1PGL2 2IC1A 3BRCA 1FYUA 4RS5B 3UYJA 1EP0A 2XT9A 3JD72 1CAXB 3OG2A 4HKWA 4AR2A 3VBFA 2FKXA 4ZOLA 2JENA 5JZGB 3P5BA 1GN4A 1W6OB 3POEA 3SKVA 1RUI1 5B5EZ 3CZJA 1U5IA 2FD8A 5J2TA 2FHRA 1H38A 1S3JA 3ABLC 4XFAA 5IW0A 1IKQA 3JD1A 3O14A 3A0KA 4Z2WA 1RUG1 3AG4B 3RZKA 2Z79A 5LHIA 3WB1A 1JU3A 4FCAA 3VHOA 4QPJA 3FB6C 3JATA 2XVKA 4FBFA 1R081 2JDYA 4UFIA 2UU9O 5CB7A 5I8TA 3CC7V 3H50A 1NAEA 4R6ZA 1PO22 3MF9A 1DZRA 1QDCA 1GU3A 3TN92 3ATGA 1S55A 3D36C 4JKLA 3K79A 4CPBA 1UX6A 3ZXAC 5DEDA 1E1RG 1TME2 3SC7X 5KXEA 2SBAA 3LEKA 1M9NA 1OD5A 4TQFA 4CUAA 1Y3TA 4DEQA 4JASA 2VWJA 4NPRA 1MMMA 3N2KA 1GZWB 4QPKA 1OJHA 1WW4A 4KU8A 1QWRA 5EHDA 3I56V 4KWJA 2QQNA 1ZZ6A 2EICA 2X09A 4CC5A 2YMZA 2FZ1A 2YXHA 4D3WA 2PHFA 4EN0A 4GAZA 2XL9A 1GLHA 4XE9A 3VDDB 5I8SA 5FREA 5IK7A 2CSGA 3W7XA 3ZFEA 1JA8A 3MFCA 3OUFA 1F15A 1A32A 2RDSA 3H7JA 3KM5A 2BDRA 2DTYA 3NSTA 2OKXA 2PHTA 3ABLB 2YSUB 3DTUB 3M7MX 2VPVA 3H01A 3N7MA 5FYVA 1Y7BA 2CH7B 3RYCA 1VBD3 3HOBA 1FJGB 3M4FA 4NIDA 1B6QA 1TA8A 1R3LC 5F5QA 2B45X 1CAWB 2EXJA 3NNFA 2ZIMA 4Y20B 4B3TO 2F4VB 4GQ7A 1S0DA 1RJ8A 2I07B 1OQDA 3M99B 4OQ9A 5DUVA 5FZOA 2JD4A 5EYYA 2LP7A 4COZA 4X88A 2V1DA 2P3IA 5F8PA 4I0XB 4K40A 1PX4A 1OCZC 5FZMA 2FDJA 2WO3A 1AR82 1PM7A 3ECQA 5GLWA 5CN0A 5AVPA 1KJLA 1OF4A 2F93B 1QJU2 3CCRV 2MPFA 1DLCA 1ZUQA 4JZRA 4LA3A 2IXKA 3MO4A 4N53A 5A7WB 4CEWC 1XNTA 2UXCB 3U14A 2W2IA 1G9DA 1S0IA 4P9JA 4OXSA 1QR9A 1RHI3 4OMCA 1RUF1 5BNPC 5L3EA 2EBOA 3AKQA 1ZRCA 1OOPC 1UYXA 1CPNA 2D6LX 1S77D 1H9PA 5JVDA 4JI6B 3RMYA 4PA3A 4XMAA 1R1A2 1QHDA 4NMIA 2VY0A 1DDLA 3R65A 2XJRA 1NT2B 2WNUC 3APQA 4E4HA 1IS4A 3WDUA 1MQTC 1SLCA 5LGNA 1O91A 2XB6C 1W6MB 2RQ6A 3H8RA 2Z5UA 4BQ2A 2BBAA 4XUTA 1VQ5V 2PHLA 4DXRA 4B4QA 4CCDA 2C26A 3M7AA 4MXVA 4YW5A 5HBAA 1S0FA 3LSEA 4CC6A 3E86A 3OJBA 1SFPA 2QWRB 4FLZA 4IETA 3SR2C 1BBT1 1NH2D 3VV1A 2ZGSA 1X8MA 1ENRA 3HR9A 4QQHA 2RR11 1POQA 5IHRA 1COV2 2PZSA 4O4LB 3AKTA 2RDRA 3OPWA 2R073 4Q5OA 2Q5TA 4AVSA 5CFCB 1I0HA 3EYPA 3K51A 3T0DA 1Y76B 1QXJA 5JOWA 3SYPA 4BIOA 2Q1MA 3FAVA 4QQOA 1ZL8B 5BMVA 1W0PA 5CA6A 3WNOA 3ZEDA 4YVWC 4CEWB 2VZTA 4H7LA 1VQ9V 1RIRA 2F4PA 3IPVA 4D8MA 4QDQA 1KKCA 1WPXA 3GWOA 1VMHA 2YI8A 4AOCA 2VUJA 2Q8CA 4JGZB 2QQUA 2YB7A 2BPA2 3N2GB 4P5YA 5LY1A 2JG9C 2DBNA 1V6IA 3RWRD 2YIBA 4K8XA 2BTOA 4XF1A 4M3CF 3WNLA 5LGUA 1OOPB 1X9TA 3I7DA 2WJSA 4PLOA 1QGLA 2VMDA 4FFGA 4WM7A 2QJ1A 2HWC1 3WCRA 2OVUA 3M8LA 4HYOA 1AX0A 2Q73A 5DUUA 2RS11 5LZ6A 1WLWA 2XNDG 3ZYGA 2HWE1 1UOGA 1MZFA 1P7GA 1CR7A 1STMA 2LTNA 3NNMA 4EN6B 4XJ9A 4LFCB 2RMU1 2WIIB 1RUNA 5CAZA 2Z42A 4RUFA 2WS93 1REEA 2XJPA 4NTWA 2V72A 4Y1ZA 1XSRA 5CADA 1H30A 1AJNA 1PNLA 5L36A 3OD0A 2BE3A 4K8RB 1WN7A 5FP3A 2ZHMA 4EJRA 1M1KW 4BIZA 2R0FA 1K12A 2ZR2A 3LEMA 1N1YA 1YQCA 5CFDB 1D4M2 1FPN3 3JAWA 1K7DA 4GMP1 1M57C 1H9WA 3D3QA 5EJZB 1K5MA 3AXEA 4CPBD 4D7SA 2RJ2A 2ZQMA 4I50A 3ZYBA 3K3WA 3K3OA 4YVWB 4QX5A 3ZFEC 5CBFA 4BXFA 3ZN5A 1NZIA 3H1JH 5B1AC 1UMZA 3GZTB 2JG9B 3V56A 4CYDA 2XDVA 1UY3A 2J1VA 4G4FA 5FP4A 4X66O 2QZ3A 5KXBA 4Y3OA 4MXWB 5IFPA 1I1EA 2GSMB 5FPOA 1UPIA 3VQVA 3TK1A 4IEOA 1V6NA 2FTKA 3AZWA 1H2LA 3OGCC 3SKJE 5C3QA 1K3IA 3Q8BA 1HV0A 3NV1A 4AI9A 5FY1A 3OMNB 4UFJA 2P37A 1XQ8A 4P9XA 1YJLA 2XOMA 4A6OA 2XBO3 3E8GA 2C0ZA 1GBGA 4OUSA 1RM1B 1BEV2 1AR62 2QBXA 1H2NA 5G05L 4OHWA 2YIDA 3OUSA 3DXTA 1N1SA 3O1MA 4LH7A 2FBEA 3H3LA 1AJKA 4XBFA 1DLBA 4BLJA 1KP3A 5FPXA 4HSJA 2BUKA 2H94A 3WF1A 4FP3A 3WHTA 4MTGA 2BOBC 4CU7A 4E2GA 5ACA3 2F66C 1HRV2 4CCOA 3HPNA 2YI9A 5LRSA 3BU7A 3ENRA 3VD9A 1W2TA 5A32B 4CH5A 1SCRA 3BEHA 1NY71 3W20A 1SBEA 4CDUA 4QPGC 2B39A 1O3RA 1KFXL 2PUSA 3SH5A 1SESA 1ONAA 2EJRA 3UO3A 1MZ5A 2UYAA 5FZIA 2QCSB 4CDQB 3JD2A 5K0UC 3F7VC 5B1AB 1RUI2 1A8MA 4JI2O 2E63A 1D4VB 1YIPA 2NMNA 1FOD2 3MBWA 1GN6A 1GNYA 3NW4A 3FE5A 1JYIA 1ZRDA 4H7MA 1RUG2 5DG1A 1X36A 2H8PC 1ZA4A 1CPYA 2Y0PA 2B9VA 4AVVA 1DF5A 5CA1B 5B4NA 3WHUA 1FS0G 1IG3A 3RJ2X 1FXKB 5FQ0B 3ETDA 1AR91 1IVSA 1H0BA 4MTFA 1W2AX 2XG3A 2DTWA 4ZHQB 1R082 4PF5A 2ZX2A 2ZMKA 3CJHB 3VDBA 4B3SO 1HRI1 3WF4A 1B3QA 2YUAA 1GANA 4OUMA 1W9FA 3T1LA 2LGWA 3EVKA 1UY2A 4OPHA 5FUPA 3ABUA 4AEDA 3K59A 3AX4A 3QO7A 1FV3A 2XWBB 1NA1B 4Y1UA 3ZR6A 4CVUA 1SLIA 4Z82A 4GWJA 2W6IG 4R4ZA 2JDIG 2Y6LA 4ASKA 1MR5A 4JYCA 1OKQA 4IE6A 1DQ6A 5EFUA 4A7YA 5J2UB 4TUYB 2P7TC 4MTXA 3KV4A 1ZZCA 5JOYA 2D3PA 3VQYA 1KB9F 3CCVV 1B04A 4J41A 5DAVA 1XNQO 3CE2A 4KQ7A 5A3PA 1ND2B 2Y33A 2JXAA 5JDBA 4X8PA 1ZVFA 5LOVB 2ZHLA 1NUKA 2UY8A 2DYSB 3MIDA 1QQCA 3DECA 5FZ4A 3CWBH 4DXSA 4YFWA 1CZSA 1RMU3 4LF8B 4QE7A 2IW5A 2JS3A 5A2QN 3DYOA 4FM1A 2P06A 3P1IA 5FY0A 1JU4A 1JFFA 3SITA 4FTEA 2K9PA 2VZ3A 1HXS3 3P3PA 2EIEA 4QU1A 2YIBD 2IXLA 3OY8A 1R3KC 2R9IA 4G2KA 4EV0A 4R52A 5DQ0A 4CZZA 1CJDA 1OA2A 5CG8A 3PVNA 3BGAA 4QM9A 1UOJA 2VUDA 4Y5Z0 3WINE 4JI1B 1KQRA 1RSOA 1W3VA 4CDWB 5JUVA 4AQYB 1J1LA 4DUZO 5GALA 3HQRA 3VBRA 1HV1A 1XB9A 3KCYA 3VBSA 1HNWO 4QXCA 3ETEA 3LOBA 1XMOB 4ARYA 1QMJA 3I3BA 4NHKA 2ZHKA 1REFA 3IBMA 1UXZA 3RS6A 2VVEA 2P3YA 4BW5A 4JI7B 3LDBA 4XFFA 4YM0A 3ACLA 1JODA 2D93A 1O8PA 1RUF2 4J7KA 1PKXA 4MOAA 2W0XA 2LFSA 1XYOA 2YBKA 4DR4B 1VQPV 4PT6A 5EJ3A 2K0GA 5FWJA 1LTEA 2ZGRA 2W9XA 2PAEA 1KYOF 4Y22A 5H9QA 1P4RA 1YRZA 3ACFA 4TV9A 1AJOA 1XJAA 1SA0B 3JB4C 3U78A 3H1KH 2N74A 4A2UA 2LW7A 3ZXGA 5C93A 1O9GA 3L73H 2WLPA 1J59A 1UOBA 1H4HA 3G6EV 5KHHA 4BOWA 1K34A 1XMQO 2I2SA 3U37A 1C5IA 3ZFFC 4MVSA 1MS5A 2HKOA 4LFBO 3WP6A 1BBT2 2RDQA 5GTIZ 1VQMV 4ASMB 3AZZA 5DG2A 1FKAO 5C8CC 2RR12 3FB8C 4XIKA 4AYUA 2DVBA 1SS3A 3VOUA 5I8YA 1WA8B 3Q4HA 1WAZA 2DCTA 5B1OA 2HH9A 4FFBA 2DN9A 1SKVA 1QEXA 4CDXA 2UU8A 1PVC3 1DZQA 4ES9A 1NCRB 2UUAB 1CIWA 2RS33 3VUOA 4O7XA 3O1VA 2HEYF 2DYRB 1M4WA 1VF7A 4AEKA 2HWC2 1ACCA 4PIZA 1US2A 3PN1A 4XJUA 3CCSV 1PIV3 3UKMA 3KCXA 5KUMA 2HWE2 1HWYA 3DGEA 3P30A 5JMCA 2GC0A 4YZ3A 5FZKA 4W6XA 3A22A 5A6ZA 1PK6C 2P3KA 3UKVA 4AVAA 4NROA 4FLYA 4AFDA 2X29A 4GB33 4AFBA 2XAHA 2ADQB 4YJ2B 2EIMB 4B3RB 4LPLA 3BPZA 4JQRA 2PTMA 4MSWC 4DR6B 1LCLA 3SJBC 2CDYA 2F95B 1TMF2 3GF6A 3OGJA 2EIGA 4P02B 1UMIA 1S0BA 4JGYA 4NO4A 4NHMA 4X62B 1OF3A 4WVWA 4WVMA 1AR72 5BNOB 3IDBB 4A3ZA 1IBMB 1V0AA 4GKJO 4UFZA 5FZAA 3RYFB 2JB4A 1JZ4A 4SLIA 1CONA 1DQ2A 1U5XA 1SQBH 1AR63 4OHVA 2ZGOA 1UPGA 2ATKC 4Q6GA 1UQXA 3PU8A 3PMSA 5LW9A 1RFYA 2UWBA 4OGQB 4P30A 3ZYJB 5FIXA 3ZN1A 4Q4W1 2AHYA 2BTQB 4OX9B 1SZXA 2DVGA 3ZYRA 3SEEA 4M00A 3ASNC 1PK6B 1WGPA 5IAXA 3ITQA 2F17A 3JALB 1I5XA 4OZXA 3R4UA 1W2OA 2BW8A 4ISQA 2WT0A 1W8UA 1LODA 4U2AA 1HR0B 4CU6A 4GA9A 1E5SA 4XAAA 4OZOA 1AP5A 2I74A 3Q8EA 4JYBA 5L7OC 4Y1VA 2EIDA 4MH0E 3LSUA 2FL4A 1XOUA 4JZGA 3DPRA 4AILC 5BY1A 2WLJA 2NN8A 1IXBA 1VPHA 4TV8A 1GZTA 3UGFA 2XOKG 1W28A 3C7FA 1F4NA 3K06A 2Y8KA 4RWUA 2DVDA 5FKCA 3SHRA 3IKWA 2Z0AA 2E53A 1L3JA 1X33A 1NY72 4Q4Y3 4DV5B 4UCTA 3NNJA 3RNSA 4AFCA 3RWNA 4CU8A 1RC6A 1AHSA 4DV6B 5GZGA 5CB4B 3RMXA 4DRXB 1SLAA 3WUCA 5JCTA 2ZTNA 1NT0A 4LIVA 1ND3A 4QPYA 3CCJV 3KHBA 3RYHB 4QD2A 4CS3A 4D7YA 4GLXA 1LJ7A 5JOZA 5FYTA 1VBE3 3N9PA 1SG3A 4KWLA 1OQEA 4XW3A 1CIYA 3WG2A 3ASNB 1URXA 3VQWA 3I54A 2ENRA 1AR92 3AYAA 1IQAA 3BA8A 4WCEV 2Q67A 4YY3O 3OTOB 3A2FA 3E8HA 3H1HH 4FOWA 2IWGB 1YI2V 3M3EA 5JCOC 3UKNA 3VBHA 3KKYA 3CRAA 5ABJA 1YHFA 4UV8A 5FP7A 1NQDA 1TNRA 1ZZ8A 2LM3A 5A1FA 2FDKA 4O4JA 4H14A 5I0SA 4A42A 1JYCA 2PXJA 3CP1A 2H0VA 4RO2A 4CUCA 1RUD1 4EQVA 1XNRO 5FLIA 5J9PC 2XJSA 5FPAA 4W65A 5IJRA 3ACIA 4CTEA 2GP3A 2CNAA 2WAMA 1YQ8A 3LDCA 3UETA 1MSDA 3T1YO 3H9AA 4BWOA 1V6MA 4Z07A 4KGQA 4ORFA 2O8OA 3AG1C 1JXNA 1VMFA 1MVQA 3FFQA 2XUMA 1SHWB 2BVVA 4MVRA 3S57A 3T4ZA 3LFMA 2R063 5JPNB 2JEUA 1BXHA 4A6SA 3QOPA 1O5UA 1BHGA 4IXLA 3ZPYA 5FLXN 3ZN6A 1YDXA 1Z7S3 5D8AA 1O3QA 2VBBA 4X1YB 3T08A 3K5NA 2BV4A 2OQ7A 2JE8A 1D2SA 3TRSB 3G71V 3KQ4B 1R091 5FDBA 3PNAA 2ZEWA 4GKKO 4KU7A 4XXPA 2W92A 3VZNA 2FCTA 2YFUA 3DN7A 1N4CA 4PI0A 3WQ7A 4NKGB 2NZ9A 3CJIC 2AGSA 3LA7A 4K1ZA 4LLFA 3UT0A 5A7OA 2O8QA 1AF9A 2JVDA 2DUOA 4DUYO 2ZACA 3WOGA 3ZIWA 1SQXH 4O4IB 2FB5A 1SFNA 5JXGA 1LULA 2VMFA 4O9EA 1H2KA 3I3QA 3S7EA 3EXAA 1UZZA 4H55A 3OEEG 1AI4A 4I02A 2YU1A 2MEV2 3SCFA 3SISA 2JJ1G 4A41A 3GCXA 1MEC2 3S3WA 4DXWA 5AC91 1XILA 1VMJA 2PAMA 2HBTA 5FO7B 1W0NA 2KG7B 4BB3A 3AG1B 3TEXA 3S0MA 3STZC 5FFOC 1LNQA 1GWKA 2Y6JA 1G8WA 1QXPA 4FAHA 5LBCA 4DIQA 4LA2A 5LXTB 3F5WC 2BGPA 2FDHA 2Q0OC 1R3JC 3HKEB 3WDXA 5EC2C 1V54B 1GMMA 1SBFA 3D0SA 4C91A 1AX1A 3AL6A 5HV0A 1MSWD 4GH4B 1BL8A 4I9QA 4FSJA 3O1SA 2Q5ZA 5LY2A 1JPXA 2VZRA 2MK3A 3NNLA 4META 3DC6A 2CE4A 2ET7A 5C4WA 4D6TH 1L7LA 3CSXA 5C8YA 4AGVA 3CPWU 1NKGA 4XDPA 4X65B 4B3TB 4CCNA 4WFFA 3K3NA 1BKZA 3ML0A 1JI6A 4XDKA 3RYRA 4Q8LA 4YWAA 4JI8O 2VQFO 2RS13 5CBLA 1ZBA1 2VZPA 1GOHA 4OFGA 1LOEA 1OLRA 2AZ5A 2EA7A 5BPXA 1MG1A 2RMU3 3BA9A 1MACA 4WM8A 4FAGA 5DUXA 3RWKX 3J7NA 2R70A 4FPLA 2BFUS 3TAYA 1L0NH 2VGDA 1NE4A 2OYZA 1BHAA 1GO3F 1GP5A 2AUYA 3OEBA 4QXHA 3PURA 5F32A 1ZSPA 2XLFA 5JVVA 4MGSA 3OUHA 1UF2C 3PTYA 3FLPA 4XMIA 2BFUL 3W9AA 2ZE8A 3RRDA 3JAKB 1ZLZA 4CCJA 3I59A 5KBFA 1JHNA 4GMP3 4X89A 2Q4PA 4JX0A 3NJYA 3Q9OA 4QPWA 1YNAA 4D0QA 3NO8A 4JV4A 3OR7C 2DWDC 1C28A 1WZXA 4DR3O 3C8XA 2R49A 4DW1A 2ZXQA 3SH4A 4HVOA 3HQUA 5JJNB 4OUEA 1IG0A 1OSGA 3JD3A 2P4VA 4UXNA 3ZYIB 1W6PA 3O1RA 5ITZA 1I5ZA 5KR7A 3Q8FA 4IL7A 1W0KG 1SLTA 4QB6A 2OUHA 2AENA 2UUBB 3IDCB 3VBFB 4BYYA 2BCCH 3ABKC 1OMIA 1NG0A 4AFAA 1K42A 1FFXA 5IATA 2W1QA 2PA7A 4C1WA 5AFEA 2ZXWC 5J2TB 1DG6A 2RV9A 2WC2A 2YYOA 1C1FA 4AQ2A 2VVFA 3H1MA 5ANQA 2QVSB 3E5UA 5FNVB 1QJY1 1W6NB 3NKGA 5KHKA 5BYNA 3GM8A 3BUCA 2E5LB 4V1PA 4JDMA 4Q4W2 2VNVA 5DXDA 1BQPA 2QQIA 3ETQA 4NWWA 4UFKA 2LRPA 4OYUA 4Q0SA 4QX1A 1HB1A 1LOBA 4PI2A 5LBFA 1ULGA 3MIBA 4LWSA 3UKTA 1CJPA 1S2EA 5EXOA 2QQLA 2O1QA 5FPRA 2CDOA 1W9YA 3HKBA 3VBUC 4IT5A 4IEQA 2Y26A 1J95A 1KDMA 2N05A 1JQ0A 4AI2A 2P6JA 4J6GA 2V7QG 3TOJA 4X64B 2DWEC 5CBHA 3LOIA 4HSLA 2OPWA 3B69A 3P3NA 2CV6A 2BU9A 4RR3A 3ABKB 3AG7A 1Y9MA 4JCKA 5IVBA 2BP6A 3NV2A 4QIWF 1H6YA 2R043 2GUZA 4YM3A 2ZXWB 1OVSA 3NL1A 3KF5A 4U3FH 1JN2P 1SF9A 3X29B 3RVYA 5F5CA 1HRI3 4Q27A 4K7JA 3QH7A 2WN2A 2XONA 1A3KA 2HHHB 2QM4A 1AJPA 3BI3A 2WZ8A 1K73W 4CP1A 5EBLC 1HKDA 5LK7B 1YC61 2VMHA 4AI3A 1POV3 2D5FA 2RJZA 3S6PA 1FJGO 2DCZA 2V5DA 4E2LA 2ZOEB 4CU9A 4I0AA 2JWPA 4EE2A 1NI8A 2Y64A 5TISZ 1LU1A 2ZT9B 1ZTEA 2DBIA 4K3AA 3BALA 2HBUA 2LALA 4XYXA 4J11A 1PM4A 2F4VO 2GC3A 4ZBMA 5JJEB 3VBUB 1YQ6A 4TSVA 5IFTA 2WNVA 1N36O 2PGGA 3UT5A 4EFBA 4H0LB 4G28B 3WXPA 1G4YB 4TLFA 1AI5A 2QQWA 4X20A 4B7KA 5FZHA 4IHJA 1KJRA 1UYYA 3VD4A 3K5OA 1WCDJ 2ARAA 3MHZA 2J7MA 3T4VA 1RUD2 3VHNA 4PLNA 4NPMA 1NX9A 3IT8A 1R6NA 3PU3A 3H3UA 5LK5A 1IURA 4LBLA 2XVGA 4LK7A 4KHPB 3IDEA 3NV4A 5JVDB 2QUOA 4WFEA 1WP8A 5LGTA 2WZEA 1W04A 1IHMA 3LE0A 1H1AA 3JZVA 1PHMA 4DR1O 1JOPA 4LE3A 4ZU7A 1QHTA 5E1AC 4FXGB 1URFA 4JI2B 4Q8KA 4ZZ8A 4ZI7A 5APAA 2WAAA 2HEPA 4LKFA 1R092 2NQYA 2PHRA 2A7WA 2YS8A 2ZBJA 3V0AA 1KECA 3RSJA 1YITV 2QKCA 4Q4V2 5KX5A 3RDIA 5HCHA 1P8JA 5LEKA 3KT7A 3K04A 1RUOA 1EV11 1XI1A 2EZOA 3AG3B 2NYYA 1P84F 4B3SB 2OIGA 4H13B 1QDOA 3ELNA 4A3XA 4LOTA 1SMVA 3ZFGA 2PFWA 2ZDIC 1K3EA 5IVYA 2VVDA 3LF7A 4LBQB 1O4ZA 5FY4A 3T2QA 2E3CA 1Y9QA 1VBD1 2DQ3A 3D3AA 3MW3A 4MX3A 2Y48A 1W03A 4P00B 5DMYA 5A9GA 3NRUA 4FM0A 1KDKA 3QF7A 3AC0A 3U1XA 3H7YA 1L1FA 2AW9A 3IC9A 2HP8A 5FMBA 1BE3H 1NVPD 3OGVA 1AYN2 1C4RA 1W0OA 2HYKA 1XNQB 3CC4V 2Y0OA 1DIWA 3HMYA 1Q8PA 2QQJA 4IEWA 4DV2O 1JR9A 3AVRA 4V2WA 2WO7A 2IH3C 2Y6GA 4FFHA 3N27A 2ZEYA 1B09A 3CRCA 2B42B 4MS2A 1XRUA 3JB8A 5CA0A 1BZKA 5JXJA 2W08A 3V64A 3VLBB 5EV7A 1RTVA 4H37A 5FYBA 4HN1A 4EB6A 2A7AA 1X9PA 3ZSEA 2QJVA 4BPZA 3NV3A 2W1WA 5LMNB 4HBNA 4Y33A 2OIEA 3JAWB 1SZTA 5BUVA 2DFBA 1EYBA 3SPJA 4MW3A 3CF6E 3FB5C 4AVTA 5C9AB 2YY1A 4XUOA 5E1RA 4CXWA 4XTMA 4I50B 2NR5A 1ZA7A 1FYJA 1RP3B 4DUZB 2IH1C 4N43C 1K9MW 4QGNA 4C0BA 5B4XA 3I49A 1YUDA 3AFGA 4DYLA 1HNWB 4RQPC 3AMNA 3MW4A 3OYWA 2D43A 3ZYPA 1YTFD 2YICA 4YW4A 1YSCA 2Q8EA 2E31A 2ZS6B 1UXXX 2W6JG 3AP6A 4PA4A 1HIXA 4IL6Z 1ZRRA 3T2PA 2WWSA 4LJHA 4K8ZA 1AXKA 4IQPA 2GTAA 4HONA 2VZOA 2BRTA 1Q82W 4QHOA 3THDA 1OCRC 2BJSA 3ZMZA 2A6YA 3LSQA 4XAEA 4YJ3A 1UZYA 3QO8A 1VF5B 3FUQA 3THPA 5F3IA 2VECA 4BZ4A 2JE9A 2R071 1C8NA 5EPAA 4O4HB 5FPVA 1Q6UA 2ZX0A 2OTJV 3K9SA 3WNKA 3ZSKA 1CVNA 3I2JA 1YI9A 4NUBA 4W50A 2HVJC 4D6SA 2A71A 2B1GA 1CWPA 4CDUB 1IBLO 4IEPA 4Q4X3 4LFBB 1F9KA 1NTZH 5GONA 4LEJA 1E1QG 2W0FC 1QOSA 1K5JA 2WSSG 3MV01 4QHBA 3CB2A 4ZPIA 5B3SC 4NHYA 5LA0A 4RQPB 1B35A 2KR2A 5JLVA 2G1MA 3UGGA 2WL1A 4MADA 3V0BB 3DC5A 2XHBA 1J3QA 2ZGUA 2KKWA 2WS91 3OEHG 1JZ3A 1QU7A 4FJCC 2B9ZA 2BBVA 1QJY2 3EJKA 2GNTA 3RW0A 5LA1A 4H2AA 1AL22 3K77A 5LEJA 4XPVA 4Q0PA 4UF0B 1DGWX 4X6RB 2E74B 1L0LH 3O12A 1LHOA 1OCRB 2R0HA 1LUVA 4N7UA 2QE7G 2AR6A 1R6TA 3RYIA 2Z3YA 1FPN1 4M3CA 2OTLV 4PQ9A 2TBVA 4M3CE 4DPNA 2EAKA 4PDWB 4CEYA 1ZZBA 1Z5WA 1XBFA 3AP5A 3JARA 1BVP1 2WZPP 5D5PA 4I30A 4BCUA 4KWUA 4R9CA 2NLJC 4AVCA 4GZ9A 2RM23 1S2KA 3FKSG 2ZABA 1QJX1 1GM8A 3WNMA 4LNUA 4JF3A 3VDCA 1W8TA 3VHRA 4CP9B 3K58A 4QJFB 4LFAO 2R6QA 1YXWA 4QDSA 2OZJA 5LP6C 1XREA 5LA6A 2OW4A 1KS5A 3MDSA 2R72A 1XEQA 3VB9A 2KA3A 2G38A 2IU0A 4GKJB 1PZ7A 4I3PA 5K7PA 1SCSA 5JR7B 1WW7A 4KUMA 4PHZA 3OGSA 2Y4TA 3E5QA 1TG7A 1SQ4A 3OBTA 2B1IA 1YFYA 2ADPA 4IEXA 4ZIBA 1JFFB 4COUA 4LF8O 3BVCA 2ZNIA 3OY8B 5AFBA 5ACA1 2JG8A 5FZ0A 5IT9N 1YF2A 4UI9L 1AYM1 5L3DA 3WP4A 4GX2A 4OI0A 5LATA 1W9TA 3ZXFA 3JSLA 1RUH2 5A70A 1V6OA 4TOIA 2UURA 1C8M3 4FO9A 4BH9A 3VBRB 4JI1O 3VBSB 3B3QE 4NYKA 4GWIA 3J80N 3PJSK 3X2QC 2A75A 4FMTA 1HN0A 3WP3A 3ZRXA 4FPFA 3FC0A 2XASA 1XMOO 4HMZA 3WP5A 3PUQA 3UM7A 3U75A 4GWNA 3WF2A 5DECA 3D5OA 5LYJA 4NPLA 3O5SA 1O9HA 4IW3A 4J1WA 3OD4A 4MVOA 4Q0QA 2ZGKA 1RGSA 1W8WA 3N3HA 1FMD3 2VOTA 3K5LA 4ES8A 1ENSA 3ABTA 1AZDA 2QQOA 4I55B 5C33A 4IV1C 4RS5A 2NMOA 1TQ5A 2HWB1 1VP7A 1CAXA 5IY5C 1VQLV 2PELA 1QH6A 4JTOA 5JZGA 1UIJA 4Y5SA 1W6OA 1E79G 3JU9A 2A6VA 4GYCB 5E6HA 2XJUA 2L35A 5A3NA 5AC93 3AJYA 5KXDA 2VQEO 3WY6A 2K9ZA 2ARCA 4EN9B 1DGLA 3RVHA 2UUCB 1WMXA 1N3OA 3KSCA 5LBEA 2ES3A 1SBDA 1EAH3 3M3IA 4JVAA 3WR0A 1YYNA 2YXLA 3N35A 4YY3B 1WMEA 3W7TA 2X5IB 4CCKA 3WG1A 1REDA 4K6BA 1RUJ1 3K57A 5GZDA 4FFBB 2YBPA 4EN8B 1RMU1 4FVMA 3CCUV 1VBD2 3LPFA 1ULDA 2HLEA 4RHV1 1MA1A 2QTWB 1TGOA 2Y38A 2OUJA 1THZA 3N9NA 3B4SA 1XQNA 1HXS1 3NAPC 1C57A 3K0GA 4F6RA 4LBJA 5DPNA 1K92A 2KB1A 5F2SA 2OCCC 5FOBB 5EYXA 3NR7A 3N9OA 2E32A 1DGRN 3T1YB 1H2SB 3RZLA 2FCVA 4HT1T 3HNBM 3K48A 3T4DA 5IY5B 3WW2A 2BTVC 1ZREA 3J9SA 3ICXA 3A0RA 5CG9A 2TUNA 4CEYC 4HETA 3RJRA 4DK1A 1ZBA3 4F4LA 5LA2A 1HLCA 3D3IA 2N04A 5LHGA 2ID4A 1JOJA 3VGIA 1W9WA 5D2AA 2CH7A 4LO8A 2PYJA 4UW4A 1KMIZ 5FZGA 4JGYB 4TTGA 3ZHSA 4DR6O 3WF0A 2GHYA 2J1AA 3JBG3 1CAWA 4WVMB 4ATEA 1W6QB 1F5JA 4EEQA 3CC2V 1JMUB 3IIIA 1BYHA 2VULA 3TNPB 2YPDA 3IM0A 3POFA 5ANNA 1RHI2 4Y20A 1APNA 4X62O 4DNYA 1G9CA 1SLBA 4DUYB 2N7GA 1IBMO 3D36A 3LB9A 5CZKA 5IYZB 2B5UA 2V09A 2D44A 4UT5A 4QT6A 3JCZA 1VAKA 4MTOA 1BQZA 4XBQA 3AMMA 3WVJA 1UL9A 2JECA 5I0TA 4I0XA 5FMOS 4DR5B 3KV6A 2VQAA 2ZAAA 1DHKB 2P5OA 1VQNV 1GQHA 2WWWA 4MG2A 4KBZA 1UFIA 1W99A 1WCSA 1OHHG 3AK0A 2D40A 4CP2A 4FLTA 1JW6A 3OF1A 5FMOL 2EVXA 3PIGA 4OX9O 4YW3A 2BNOA 4YGCA 4O2AA 3MLJA 5J96B 4RSUA 3MIFA 3CBNA 4DXZA 3WG7B 3PJYA 2OIIA 4L9BA 5BNNC 1WB8A 2R072 2XTAA 1QLNA 1GAXA 1AXYA 4D69A 1HR0O 3DPRB 3FL7A 3WFVA 4L2NA 3L9DA 3USSA 2M7WA 2WFF1 1V55C 5LB6A 2ZX3A 5F9TA 1PVC1 3C3TA 1QJY3 1W6MA 3AZYA 1I5YA 1NKDA 4AXOA 1OT5A 4E2SA 1Q43A 5C3OA 2RS31 1LHNA 2A06H 4FP2A 4IESA 1XL4A 1BCXA 1PZ8A 1OH4A 2HJDA 3WV6A 1XYPA 5H2FZ 2ZGNA 3VZOA 2VO5A 4LITA 5C6CA 2GAUA 3PUIA 2IVIB 1K8AW 2P5BA 3GHNA 4JI8B 2VQFB 1ND3B 2D6PA 2VR4A 4O4LA 1W90A 4ZHNA 2WS92 1Y76A 3OGGA 1IPJA 4R9DA 4AI0A 1BQ0A 4L92A 1H8VA 2G9FA 4LHKA 4CEWA 2AACA 5KHIA 3B77A 2FDGA 3USUB 1FAFA 4OHXA 1F51A 1Q8QA 3N2GA 2XWJB 4CBCA 1U0AA 4XETA 4GULA 1FPN2 1OOPA 3VBHB 4QQPA 4AQ6A 3CRRA 5DN6G 2DVAA 5BNNB 4XHXA 1N33B 4NAOA 3OTOO 2HVKC 1RJ7A 1UAIA 4BQ4A 5A7NA 5HXVA 3WW4A 3O1TA 4B3MB 1V55B 4IIJB 2PI4A 1QJX2 3T1MA 3IDAA 3IAPA 3K4AA 5FZ8A 4BJ0A 3BTYA 3NXSA 1FPOA 1Q81W 5F3CA 4FLVA 1NCQC 2P6CA 4HKOA 2VXJA 2JDNA 1OURA 1A8DA 3KV5A 2KSDA 2IXCA 4JYYA 2CAZC 1AROP 3WCSA 2F43G 2VMGA 3VDDC 2QEXV 4QX7A 4YVWA 5KAFZ 4N21A 2HJIA 5D21A 2EINB 2VJXA 3QTCA 4XDLA 5ACA2 2XXZA 2CTVA 2JG9A 3LA2A 4GMP0 3J7AU 4K9SA 3OFNG 4MXWA 3MDPA 3KMHA 5FUIA 4I0WB 2VTXA 3ZDVA 5C3RA 1NQTA 1VRH1 4Q4Y1 4K0KO 5CKQA 4XCAA 5A6YA 1LEDA 4XQ4A 2NM1A 2R9RB 2K2SA 1V9U3 4D6QA 1ASJ3 3FZ3A 1XE8A 2OZ6A 2W46A 1EY2A 3DXRB 4LR3A 1S72V 5FXXA 1J3PA 1G6UA 3CRMA 3TWIA 1FATA 2WPDG 1FAYA 5GW7A 1OI6A 1ST8A 5H9RA 2LS6A 4XURA 3BOPA 1OV9A 1NCQB 1VBE1 4Y4RA 4QHZA 5J37A 3AFKA 4ZU5A 2AC1A 4FXKB 3AP7A 4LP8A 3CCQV 3GZEA 1O4YA 4K20A 5A32A 3POSA 1PO13 1W2NA 5FP8A 5FZDA 2ETEA 4NXNO 2HJFC 1EV13 3HKCB 3LSDA 4V2VA 4HXCA 5FPZA 2IJHA 3AMHA 1Y6XA 3ZHUA 4RA0A 3B40A 2J42A 3FYIB 5CIRA 3TXQA 3E22B 1G9AA 1ODMA 1RUC3 5C4WB 3VBOC 3GDBA 3WEZA 1SPPA 4P2ZA 5CA1A 4UCOA 1VQ4V 2HLDG 3LEGA 3S7IA 1FXKA 3A0NA 3SPCA 3PL0A 1E5HA 3KZ4C 5KC5A 1OQ1A 1H1IA 4ZHQA 4X65O 5I0RA 3CJHA 5DDJ3 2EX3A 3SJAC 2JDMA 4CCLA 2R061 1N36B 3CMGA 2J1TA 4WM8B 2IBZH 1RMU2 1Z7S1 1BSMA 4OLLA 2IM9A 4RHV2 1L7RA 1D5NA 1NA1A 2ARHA 4IE7A 1YJ9V 4XJZA 1Y4WA 3KCCA 3POBA 2Q0AA 4W4LA 5CFCC 1HXS2 3E1F1 3CCEV 4PCRA 4DR2O 4ABMA 1Q8OA 5J2UA 1VF6C 4LR4A 2WO1A 4QPGA 5FJHA 2V5YA 4WV8A 1GICA 4JGZC 4YGDA 4LXLA 3I59B 1R3IC 5FY9A 3BTXA 1HNXB 4AQSA 2Y6HA 3STLC 2EIKC 1BT8A 1H8TC 1LGBA 5K0UA 2FMLA 4DR1B 1A78A 1OCCB 3GBFA 3OR6C 3S30A 4C0HA 4MUVA 3VBOB 5C71A 3ZLIA 4FPPA 5FV3A 5T52A 3QLQA 1NE6A 3WQ1A 4CCEA 5ITZB 2J1UA 1QU0A 2YXSA 5T5OA 4YXWG 1J58A 3C7HA 1EUTA 1WP7A 3ZHTA 2D5HA 1AJQA 2EIJC 5IWAO 2XHNA 3ZYFA 1D0GA 3W58A 2VU9A 3O65A 4LLOA 5IJ9B 5A3UA 2UUBO 4HFSA 2BEOA 3OEAA 5F3EA 4Y24A 2WO2A 4UVBA 3BB6A 4JGSA 2ORXA 2Q69A 2XQRA 4QB1A 5CFDC 4P9PA 1W39A 1EM1A 1S4CA 5AVAA 3ZMUA 3ZKYA 3UL2A 3A7QA 3PTRB 3W7UA 5EC1C 4CH4A 4ASUG 1QNYA 4YW2A 3LZZA 3UCSC 4FPCA 4AL9A 3K9AA 2E5LO 4PQQA 1N32O 1SQQH 4UFHA 1TVKB 5A3TA 3MD0A 3KHCA 2EIKB 1H8TB 5E16A 2JE7A 4TYSA 2BSKA 4S2DA 3ZXLA 5J7MA 2WYFA 4LKDA 1DK1A 2DU1A 3HKBB 2NLRA 4Z1VA 1J5EB 4DV2B 1UZWA 2GNBA 4JRAA 4JHZA 1RM1C 1COWG 2GC1A 2WFF2 4Q26A 3BIEA 3F2ZA 4WFAV 1PVC2 3SPHA 2MHFA 2XAGA 5FYHA 1XNBA 1SEFA 3T09A 1ENVA 4I4TA 1P7BA 2EIJB 4XDQA 2RDNA 1IGOA 2RS32 4X64O 2WBKA 4LK6A 3FHQA 2ZX4A 3OBAA 4WFGA 5HXMA 3THTA 3MIEA 1F23A 4C90A 4YG0A 2Z4FA 2VD7A 4O2BB 2WZR3 2OXBA 1PIV2 1NQJA 2QWQB 3BVOA 1LOFC 2ZZJA 4XF4A 3ASOB 4QGLA 2RN9A 5F6LB 5JIAA 5L73A 1F7YA 2VBDA 1YFWA 4WF9V 5DAPA 1JX9A 4GB32 4E4SA 2HHHO 1GN3A 3WUDA 5GZEA 2LQTA 1JHJA 3WDWA 5CISA 3FBYA 1XOYA 4P9GA 4A4AA 4CDQC 2GH8A 1QJX3 2X8KA 2O14A 3BKZA 3WD5A 2CK3G 4NOTA 2XVLA 4CSWA 4DFSA 4IV3C 1NCRA 3AEIA 1HP8A 3FFZA 2PYLA 3RZMA 4EFEA 1BVVA 4CUGA 5EBMC 4QE9A 3B93A 1FXKC 4X20B 3U0ZA 2ATFA 2A3WA 2WKKA 1FXHA 1KXGA 1VBC1 4UUJC 2B8MA 3CCLV 2Q7HA 5BR8B 5FPBA 5AG2A 1ZX5A 5H9PA 3J81N 1OHFA 3HNYM 2Y6FA 2IFWA 4YJ2A 4DR7O 5E89A 1Y4MA 4JI3O 5LMUO 4FIPC 3ZFFA 2OX0A 3M3OA 2GV9A 1NA1C 1V00A 1AYM3 1IBLB 4KHPO 1GUIA 3OW2U 5A7SA 1JBCA 5C8CA 1GSLA 3SEPA 4BK5A 5KHJA 4DY3A 1LR5A 1HN1A 4J25A 3RYFA 1HQLA 2WLIB 3RG0A 2A79B 2L6LA 3OCPA 2QZ2A 4AAXA 3FYEB 3DXUA 1VQ8V 4B29A 1ND2C 1T2XA 5I91A 2W1UA 4UBHA 4JI4B 4IV3B 2DYSC 3V0AB 3AL5A 1YJWV 1YI7A 3SJQC 3G6BA 4LKSA 1U96A 4PA7A 1XSQA 2YROA 3SYCA 2DDUA 5JR2A 2QDNA 3E6CC 1YQ5A 1NTKH 1ULEA 1VRH2 2ZX1A 4Q4Y2 1IBKO 2R041 4O61A 4UOJA 4PV1B 4M01A 4Q0UA 3MV11 2OS2A 2Q8DA 1PK6A 4UXAA 1UNBA 1TEIA 3JALA 1PP9H 2HWB3 1X8EA 4W6YA 2B7YA 2MW2B 5A7PA 4CDWC 1T6GC 1A6CA 1POV1 5IK4A 3VZLA 4LT5A 1F5FA 4Q1RA 3VBBA 1VBE2 3AMQA 5FZBA 4FQZA 3EO6A 4LFAB 1Q7YW 1UZVA 4KMQA 3LKJA 1M4UA 3SPGA 3QG5A 5GLVA 3LAGA 3ZHVA 1YZBA 1ALYA 2WUHA 3S3XA 4QB2A 2RNBA 3ETPA 1ZBE3 1IPSA 1NOVA 4LF5B 2SLIA 3I55V 2XHKA 2M6YA 4BWAA 3T0BA 1VBB3 2ZMNA 1Z0HA 3N4MA 2RS53 1GQPA 1RUJ3 2VMEA 5CB4A 3VHPA 1V6JA 2Q68A 4DRXA 3H1YA 3ILFA 4DEVA 2EILB 2FDIA 1NLRA 3GYDA 5J09A 1K45A 1EUUA 2HR3A 3O7OA 3BIWE 1YIJV 3RYHA 5FZ7A 4RHV3 3FMGA 1MNGA 1BHBA 1FXZA 4DO0A 1K5QA 3R4SA 2QE3A 5LMNO 1CAUB 1QJEA 5FYIA 1W8OA 2CWSA 4QGPA 3NJZA 5CKMA 2WQZC 1GR3A 2P90A 4QMAA 2VNOA 2Q1ZB 4P14A 3GNEA 1VARA 3MFAA 3SQOA 2R062 3RPQA 3T4HB 1Z7S2 3ZHQA 4FTBA 2ZE5A 5LHHA 4NE9A 5L7OA 4P08A 2GNMA 1AR81 3CX5F 3POIA 1O6UA 3RZZA 5T3NA 3N7KA 4JPRA 1OUXA 4ASLA 2JX9A 2RCVA 5FO8B 4FFFA 1ROPA 1NJIW 1MVEA 3MIGA 2ITCC 1IQDC 3IGAC 5EQUA 5FK8A 4YJ3B 2IXIA 1ULPA 5J48A 5DN2A 4IERA 5L19A 1MZEA 5EK0A 1NR1A 2ZM6O 3O1UA 1GOGA 1NCRC 1I08A 1ORQC 4HNAB 2QKDA 5FP9A 3I8TA 3A23A 2DYRC 4PBPA 2PHDA 3IJ4A 3CMAV 3H8UA 3ZRWA 1WMDA 4BR6A 3G6JB 2VZUA 3CEWA 1ULCA 1ZNPA 4PA9A 4CA9A 3FB7C 2AEYA 3K4DA 4EROA 4HN0A 2D6MA 1RUE3 1GFF2 2VZVA 3D0JA 4F6EA 2VQEB 2VRZA 2EIMC 2W95A 3OM3B 5F39A 4RFT0 3WDTA 3RI8A 5JCOA 4Y26A 3ABMB 5L3BA 2YUEA 4LKEA 4DV7O 2GZWA 3DKWA 4UFMA 3SGIA 4EZHA 2IVJA 4O4IA 5BNOC 4UV9A 2RE9A 4CCCA 2BOIA 1SQGA 3OGRA 3R4DB 4BDVB 4E4ZA 4PA6A 1LB2A 1QQP1 4JC1A 3RZHA 3WDVA 4I3GA 4MYEA 2F1MA 5DZGA 2WFF3 2FCUA 4LQRA 4M3CB 4JAVA 2XUEA 5A1LA 1GTOA 3KG2A 4MSVA 2CHHA 1QIQA 2YIAA 2PQQA 4DUVA 3JARB 2F23A 1ENQA 1JUHA 3KGZA 1LR1A 4R50A 4F83A 4HPKA 1BMFG 5LXTA 2RS12 2GDFA 4J7ZA 1IPKA 4FPKA 1S0EA 3J7MA 1QJZA 4P9LA 3HKEA 2ZGPA 3LGRA 4AGGA 1HQNA 2RMU2 4IE4A 1WCQA 5B66Z 2DWRA 4QPIC 2GN7A 2B46X 5JSRA 5JQGA 1JZ5A 1ODNA 3OMIB 3QD6A 2D6NA 3DYMA 1UY1A 5JSOA 3SMHA 1UWWA 3CJIA 1X50A 3PVBB 1Y43B 1IDSA 1D4M1 3CKHA 2JD9A 4QKBA 1UJWB 4UYBA 3AZVA 2ZNJA 2PN5A 4MLOA 2W39A 4FZ1A 4NVPA 1WW5A 2WQ8A 1KD1W 4QGMA 4HL0A 2VH9A 5IUQA 4NN0A 2PMWB 5FUNA 3B02A 2ZKNA 1H2GA 5FKBA 4E8DA 3E97A 5FYYA 3M8AA 4LO5B 4JV5O 5GM0A 4JTNA 2G9ZA 2D7FA 4QWNA 4MGYE 4MVTA 1H6XA 1W59A 2LFRA 4J9YB 4KXRA 2WQ4A 5EYPB 4AGRA 2HEVF 1VR3A 4Q4X1 4NR1A 5KLVH 3GVMA 2DE0X 2OQ6A 1FNZA 4ATFA 1IKPA 3HN1A 5DAWA 1ZZ9A 3JAKA 2Q9LA 4RL7A 4QPIB 4LF4B 1N34B 4OHZA 2YC0A 4N90A 3L9JT 1CAVB 2CAUA 1AP6A 3URFA 4I5SA 3TEYA 4ITCA 3GCWA 5IVJA 3KZIZ 4U7OA 4BM8A 3PUSA 3AK2A 5FBJA 3AVSA 5KMGA 3T2OA 3ZRVA 2WLNA 1VBA1 1WD3A 4XIOA 5A80A 4LO7A 2X10A 1U5YA 3AYDA 1VRH3 2RVAA 4LF6O 1D2DA 4JDOA 1I7FA 2LO1A 3TJTA 3MW2A 4A45A 2VAUA 2C4XA 4R9BA 3A8TA 5C7GA 2RM21 2XKOA 3M3QA 1FOD1 3AYCA 4ARXA 2JGDB 3LFIA 4YGEA 1VB4A 3M2MA 2JKXA 4YVSC 5FNVA 1W6NA 3L70H 1GM9A 5F2VO 5K9YA 1LESA 2VQUA 1NBMG 2VG9A 3BOWA 2R7EB 1RVF3 3VD7A 4LOSA 2PAKA 3PVEA 4AHXA 1X59A 2UUCO 2R042 5T5JA 4KNCA 2GC2A 2ZD9A 4P5HA 1Q56A 3PHMA 4QNHB 4LF9O 1HRI2 5JH7B 3GB7C 1JMKC 4CH3A 5CA3A 1H8EG 3ZJZA 1WBLA 5HCFA 4DO2A 1X82A 4LHLA 3OOXA 4F6RB 2A1XA 1PMJX 1C1LA 3B8NA 3VN4A 5FXZA 4ICGA 2Y0IA 1S2BA 2QR4A 4Q2FA 5J98B 3AK3A 1C8M1 3R0RA 4Z1MG 2R30A 4WFHA 2EALA 5KC6A 4UBGA 4X1KA 4UVAA 1WLEA 3ZSMA 4JI5O 4GT1A 1OXCA 1Q90D 3B5LB 3ZXDA 3ILRA 5JI7A 4LULA 1JOBA 4YVSB 1AL0G 1OLQA 3AG2C 1KITA 1VQ6V 5IJ0B 5LL6Y 2DCKA 3CNAA 1V54C 3QBQA 4WBNB 5H6RA 5JMOA 2JDAA 2WLLB 1M90W 3O9OA 3MLKA 4GH4C 3GBGA 3POGA 4GXLA 5A33B 1ZAUA 1AR5A 1YHQV 2CTQA 1CZTA 3J8F3 1FMD1 2C2AA 3EHKA 1DYKA 1XUQA 4K0KB 3SPIA 1YQ2A 3BABA 3MHHC 4UAPA 1BMV1 3VKFC 4KG0A 3VBUA 4MVUA 1GKBA 2HFEC 2EIBA 4YG3A 3H1LH 3WW3A 5BY5A 3O1PA 1O4TA 1EPWA 5C5UA 2PYTA 5IYCO 2VCBA 1XU1A 2AYHA 2FMDA 3T30A 4U3JA 1WB7A 2ZJCA 2DVFA 5BV6A 1RPOA 4DR5O 1OUSA 5F2WA 3VZMA 3NJXA 3OUIA 3MPPG 5FZFA 2QQVA 1PX3A 2VTFA 4E4EA 1WUVA 4DY5A 4NRQA 3EFFK 4O2AB 3R66A 2D3OW 4QX2A 5B2GB 1EAH1 4XHBA 4JZ2A 1QOOA 4CRQA 4FFKA 2GSYA 4FTSA 1VLNA 4MGKE 4QQLA 4AG4A 3TXSA 4NXNB 4URAA 3CCMV 3AG2B 3LNMB 1R1ZA 3LDRA 4C1XA 4BQYA 1UU5A 3J7LA 5F6KA 2A9HA 4O65A 3KV9A 1D7PM 2AGAA 1US3A 3JD0A 5A6QA 3EQEA 5A7QA 3BCCH 1H4GA 1HW5A 5GLZA 3JQWA 4LC1A 4BQXA 4UFLA 2WN3A 4E2QA 1AB3A 3N9MA 4PDLA 3OAAG 3ZXEA 5F1RA 4HZFA 4KL1A 4QXBA 3KS7A 5EJ1B 4L8QA 1OCZB 4CXXA 2GN3A 1Y66A 3UK9A 3B9IA 4BMBA 4TWKA 4NTYA 1BLZA 1SRYA 4DUWA 3VBFC 2OA2A 3HN3A 4PDVA 5HCBA 4A7KA 4B7EA 3OMAB 2UXNA 1QQP2 3BU0A 2ZEXA 4LBQA 1JZ7A 5A3OA 2VM9A 5FAXA 3FX7A 4DV0B 5BNPB 2W94A 4YSFA 1IX9A 3ZMVA 1XL6A 3JBG1 4W4ZA 3BODA 4Z8BA 3FUOA 2BZDA 2RDCA 4DR2B 1DYPA 1D5AA 2XJTA 3KQRA 2GBOA 1XNCA 3C2UA 5DUWA 3I2OA 2WNUB 5B1NA 4AHCA 1NH2B 1GRJA 3F5TA 1V6LA 2V4VA 3SDLA 4YFZA 3OBRA 1N33O 3QNEA 1MQTB 4LBOA 3A4UA 5A3MA 1GOFA 2P4EA 4YZ5A 3HT2A 2Y6KA 1G6NA 4N7IA 3BTZA 4B3MO 2ARBA 4QXKA 3ES4A 2GMPA 3C7OA 3ZRSA 2YC2A 4TWTA 4CZSA 1WNSA 1TMF1 1CX1A 2VE1A 3F7YC 2KD7A 4YHHO 1T6BX 2QTOA 4L0PA 3W5MA 4HK8A 2J1RA 1AR71 5IWAB 2P3JA 2WSUA 2QQMA 5C9AA 2C24A 1Z78A 3CIHA 1L8DA 4ZOLB 1J83A 2PHXA 3APBA 2W52A 2ZDIA 3RVZA 1Z2GA 1GYKA 3B8MA 1VBC3 4LTAA 1I3HA 1RINA 3SCHA 4XBNA 2ZGTA 4B08A 1F4AA 3HKDA 2JJ6A 3HD8B 3E35A 1NLSA 4NHXA 1KRIA 1MS0A 4LBEC 1ZZ7A 1N32B 2QSAA 5JJJB 2Y4UA 3JATB 5HFLA 1BK1A 2ZIOA 2JDKA 4Q4X2 3HR0A 2GH2A 3WQBA 1M56C 1F8VA 1SQPH 1EN6A 4DS0A 1PZ9A 4CUBA 1SQVH 2WABA 2WLMA 2E51A 4RGAA 3WNPA 1Y74A 4FT8A 3JD73 4P9WA 1AUYA 5E79Z 3KT1A 2HKXA 3IIAA 5I0DA 3AK1A 1VQOV 2ZMLA 1WMFA 3OPZA 4EWDA 3ZOIA 5JXIA 4O4HA 1FFTB 3K0DA 1ZX3A 1I6XA 3ZIAG 3N2KB 2A3QA 1WCUA 4MGZE 5IK5A 3LCPA 3TETA 4D94A 2FMYA 3JYCA 2ARXA 4B4RA 5FY7A 2GDSA 2JIJA 4MGIE 1GWLA 3JCUZ 1LOCA 4YZ4A 1VBA2 1M57B 3M3CA 4NIAA 4N53C 2HEWF 2XJVA 5KA6A 2AEZA 2A3XA 4XJ8A 5H9CA 3ZFEB 4N43A 3INAA 4J7JA 2CGPA 2H0BA 5FK7A 1PO23 5JI9A 4RQPA 3TN93 3MIHA 2RM22 5L3CA 4WZFA 2P4KA 2QDRA 3RYCB 3V0BA 4YIOA 1ULFA 1TME3 1SPPB 4GX1A 3DF0A 2EXKA 2JDZA 4P9IA 3MAQA 2JJ2G 1QF3A 1M56B 4XZUG 4UF0A 4Y1XA 1RXGA 3K75B 4FPGA 1J1TA 2HWF1 5C8WA 2XH6A 4LH6A 2BWAA 3WB2A 2E26A 5LBBA 1QBZA 3MLLA 5FZOB 1QKQA 3TEZA 4PDWA 3W7SA 1BK0A 3MUZ1 1BJQA 1YO8A 1RPRA 4P9YA 4DV4O 3MEPA 2J22A 4LCUC 2WNEA 4YRDA 1W8FA 5GTHZ 2F6BA 2ITDC 2ODMA 2ZCWA 3AG3C 3RFRA 1Q8IA 2XLAA 2VQTA 4H33A 2BYVE 4TZDA 4DV1B 4DR7B 5FZ1A 3SJCC 4JQTA 1S5HC 4N53B 4JI3B 2W91A 5LMUB 2AXTZ 1JH5A 4QPGB 4CP9A 3NJVA 2WR9A 4HVRA 4OULA 1PNGA 5L3FA 1LUWA 4XQDA 1C8M2 5K0UB 2DU0A 4XDOA 2Q4SA 2UY9A 1V9U1 1DZTA 4BQ5A 4WM7C 1HNXO 1ASJ1 1DYOA 2KXLA 3EMRA 3O0WA 4MVMA 2QM7A 2QGNA 1CX4A 4AWDA 5TSWA 2X6BA 1WWYA 4NJ4A 2CGNA 3AXDA 2Q7GA 1NU1H 3CS5A 1KKDA 1PNFA 4LBQD 4S2HA 2EULA 5JAXA 1OBNA 2LW8A 2X7RB 3IAYA 4L97A 4FPHA 4K21A 1AR83 3U11A 5IYBO 1QJU3 2YV8A 3KWVA 1AVBA 1EZJA 1CD3G 1MS8A 3E89A 2PY5A 2DJVA 3NKTA 2Q6AA 1WBFA 4N9HA 5FZ6A 1FMD2 2AZ0A 1AR4A 2WA3A 5K1XA 3DYPA 3AZXA 2CUGA 1PO11 2UWAA 1IBKB 1NXMA 3RQ0A 5IYYA 5GLTA 1DQ4A 4AW7A 4GJYA 1CPMA 1JOYA 4QDRA 1LOGA 1BMV2 1OD3A 1PGW1 4LBNA 1TE1B 4CH6A 1S0GA 1R1A3 4DV3O 4JAAA 1NZCA 4LF7B 5C9AC 1G9BA 1K5MC 2RJLA 4FPOB 2G9GA 1OA4A 1TZOA 3FAVB 1JYNA 4HAMA 5BMVB 1EBOA 1XHXA 2MEV1 5LA9A 3VQXA 5EZYA 3IPVB 1MEC1 3L72H 5FYCA 2TEPA 1WPBA 2QWPB 1RUC1 4UCRA 5LP6A 2WWUA 5AC92 2IJJA 3L75H 4MW8A 2UXBO 2BERA 2BSKB 2JS5A 2VW1A 1EAH2 4PD4F 3RT3C 2YBSA 4WM7B 4MO3M 4LHSA 4Y1YA 2I45A 2LGQA 1DTOA 3AMPA 1U5ZA 5DDJ1 4I55A 3KVAA 1N0NA 3RZJA 1J5EO 1COV3 2LJ2A 1QNWA 4TLGA 5D1IA 5IVFA 1SACA 2ZE6A 1JJ2U 1CN1A 4MGTA 4YM2A 4GUNA 4I4TB 1OCOC 2VOVA 4IGQA 1SDWA 2WDBA 3MICA 1QQP3 2YEVA 1QY4A 3M1HA 4S2FA 1UCXA 4YW6A 1QR8A 4OQ8A 5FXVA 4L99A 4BU2A 4LIUA 3CQOA 5FZEA 5IWFA 2JDPA 1P49A 3BCWA 2EAAA 1HJFA 2AHZA 2E9QA 3LEIA 1K5MB 1X4TA 2X5IA 4R8HA 2E75B 4CDUC 3PUAA 2FQPA 4XJWA 4MVQA 1PV0A 2CYFA 2WAOA 3DCQA 4ZS2A 2VCAA 2WT1A 2NPIA 1ZBA2 4X1IA 4AK3A 4BK4A 1Q6IA 1XNKA 1LKNA 2H6CA 5FLJA 3JASA 4KH9A 3LNNA 1GN2A 5C5TA 5DM6V 3F95A 5D5QA 2V73A 4URTA 5T55A 3LUTB 5F7UA 3GZUC 3JBG2 5FZ3A 4E27A 3RBZA 3WF3A 4PIXA 1GWMA 3I3MA 2V4AA 2XAQA 3MHSC 1SQFA 4RN5A 3QVNA 2ZHNA 4RAIA 1IXMA 1J84A 4IV1A 1D4M3 3NNGA 2ZM6B 1F2NA 3MF6A 3WX5A 3PVOA 3IMNA 3AKSA 1DCSA 5FYZA 2UWCA 4XUQA 3I2DA 4BQWA 2DFCA 1OCOB 2CU5A 1S5LZ 4PDWC 2QKSA 4AEDC 5SV8A 2VBPA 5BR8O 4OI2A 3ZFFB 3W7WA 4PBOA 4J42A 4BE3A 4YZ1A 1DU3D 2VCCA 3VD3A 3T0AA 3ZSJA 2GMMA 5IAVA 4U36A 4AE2A 5C8CB 3ZSLA 3HQXA 4INDA 4Z92B 5JPMB 4CS2A 1VAMA 1W6QA 1EZVH 2GTSA 2X0LA 4D6RA 4WBBA 4DB5A 2ZKLA 4YPJA 1DGWA 3KGLA 1O5LA 1W0JG 1W9SA 4DV7B 1FD9A 4AI1A 1D2QA 4JYAB 3BFRA 1BEV3 1F4MA 4NRPA 1ZWIC 2DCYA 5F37A 5IYZA 2EF6A 5G04L 5F5AA 3H3ZA 3DEMA 3U4XA 4GIQA 4FI9A 1PMIA 5IK8A 5HCAA 2W5FA 3NAPA 3VKNA 3PUHA 3B7MA 1TAEA 4CXYA 2OCHA 4JI4O 3U4SA 4IE5A 3THCA 3SYOA 2V4DA 1AR1B 1GNHA 4JI0O 3RGBA 1HRV3 2B5HA 4IEVA 1GP4A 2Q1FA 1N3QA 3J26N 4IDZA 3P32A 3N9QA 2H3OA 4IEUA 4Q20A 1VBA3 1UKGA 2WZR1 4XUNA 4NIIA 3ZX7A 3B09A 1M93A 4FPJA 4UW5A 4AEDB 5E8AA 2DYCA 3UV9A 3ZX6A 4IEYA 3T3YA 1RUI3 2VS0A 3VBRC 1VQ7V 4K35A 1IOAA 3VBSC 1FOD3 1RXFA 4RGGA 2W1SA 3POWA 1RUG3 5HPOA 1VIWB 4I7ZB 4FOQA 2D98A 4NWVA 2F4LA 4F3JA 4B4PA 2CDPA 3HPLC 2GNDA 4UWDA 1R083 4QQ2A 4EKWA 3N9LA 3SNMA 1UY4A 1SC5B 5FCCA 4LF5O 1DLLA 2A0LA 3VZKA 1N3PA 4DQAA 4DW0A 2PLV1 4C7UA 2P1BA 3ON7A 1AVMA 1YFUA 5M0TA 3T2MA 4NRMA 1Z5VA 2Z2SB 4JV5B 4DRRA 1WJZA 1CEZA 3K2OA 4PJYA 1UYZA 4IYHA 2E33A 1R6KA 3WQ0A 3AB0A 2JDHA 4NAMA 1HX6A 1O7FA 3USUA 3FBMA 2HWF2 3C7EA 2IUWA 3ZYHA 2X6AA 2VUCA 4JAUA 1KS4A 1RSOB 4XACA 4JTAB 5BNNA 3T1HO 4NXMB 1KBHA 1HDJA 4BXSV 4COYA 2ZEZA 3CXCU 3ZCCA 5L7OB 2D2CB 3ZMTA 5FJKA 3DSQA 5H5NA 3AKPA 2DW4A 1JZ2A 3BN6A 5C3PA 3LSSA 2X5IC 4AHWA 1UW8A 4CS4A 3CZUA 2JRIA 4M4RA 4XF9A 1QVFU 4IIJA 4RYDA 4FVVA 4HZ3A 3POJA 5BNQA 4CDXC 3LQCA 3RI9A 5KXCA 3GWKC 1TUBA 5IYDO 3AKRA 1UO9A 3QCWA 1BS3A 1XXNA 1FNYA 5IVVA 2XPJA 4LUKA 3IFXA 5KHGA 1J3RA 1G8MA 5LCWL 3G67A 1Y9GA 4QX3A 1UYPA 4FZ0A 5T5PA 3LIGA 4EZ4A 4XF0A 1HW7A 3CLPA 1O8SA 3ZIXA 3UGHA 1V70A 1V9U2 4MVZA 4OI1A 5ISLA 1ASJ2 2JK5C 4LF6B 4J80A 2WA4A 1QH7A 2QDOA 3ZRWB 4GALA 4Y22B 3D8CA 2VZ1A 4TV9B 3POYA 2A73B 4Y4YA 4KGGA 5T54A 2QWNB 4AAPA 1AILA 4QKDA 3GALA 2ZZQA 3DGTA 4MGQA 1OC1A 2QNKA 5KA5A 5FZ9A 2JICA 1AI7A 3BHPA 1LGNA 4GKYA 2Z5WA 4Y5TA 4Q4V1 1LHWA 2WLKA 5BXXA 1PO12 4MV2A 2UU9B 1DGSA 2UYBA 1E5RA 4LMFA 3VD5A 3ASIA 4JGYC 1RUF3 1ZBE1 2FDFA 3HAGA 5EZWA 5C70A 3W59A 3ZMSA 1PGW2 4N23A 1EV12 3CRQA 2DMXA 3CU7A 4BA6A 1PNKA 1HQWA 1VBB1 4LF9B 2VXRA 4LO6B 3LDDA 2W47A 3Q4HB 2RS51 1JYXA 2P67A 2JEXA 2MNGA 2BOCC 1DF0A 3DXRA 2D97A 1S76D 4A7ZA 1DGRA 4CDXB 4FM2A 2K46A 5GKAC 3CMEV 4DXTA 3KB5A 4AHYA 1RUC2 1QCEA 2XR4A 4QAWA 1S0JA 1HB4A 2A70A 1NCQA 5LASA 1VIBA 1SETA 4JKMA 5J36A 1GZWA 3M70A 4K1YA 1AYN1 1W8HA 1A34A 2ET1A 3B9CA 3DUIA 3TB0A 2UXDO 3E8BA 4HPKB 3L2YA 1BBT3 3BTAA 2EXIA 5K8SA 2IU3A 4BMEA 5DDJ2 4ZONA 1EN4A 2RR13 4PDMA 4JI5B 3VDDA 1EN5A 3HKCA 1SLLA 1Q8VA 4D7TA 4R9AA 5GZFA 1U97A 5JQGB 4OCTA 1GV9A 3ZN4A 2GU9A 3WG7C 1R64A 2YHJA 2HWD1 3AJZA 3FLTA 4KP4A 3FX3A 5LBQA 3CJIB 3K03A 3OTFA 3G4SV 3E22A 2E7TA 3BPSA 3H8OA 4YW7A 4K8FA 1QOTA 3IZOA 3I2GA 4GCZA 3DPRC 3VL9A 3LDKA 4Q1PA 3S5AA 4A44A 2P6HA 2VC9A