3U10A

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
202
structure length
202
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 61
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u10A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u10A02
3E97A 5I0RA 4XF0A 2BNMA 3I59A 4TLFA 3NL1A 2B9UA 3IDBB 1X82A 3B02A 4OLLA 4I02A 3LOIA 4OFGA 2D5FA 1DGRA 4EWEA 2IXLA 2VQAA 1O3TA 2CV6A 2K0GA 2EVXA 2UYBA 3ETQA 1CAWA 2GC1A 2PHDA 3CF6E 4AVAA 2ET7A 2GH2A 1YFUA 5EZWA 1H1MA 1ZZ8A 1O3SA 1XRUA 5JSRA 2K9ZA 3BPZA 4EROA 4HLTA 2CAVA 4FAGA 3IDCB 2XGXA 4JTOA 3VHRA 1ZZ6A 2MNGA 1ZREA 1CAWB 3FFQA 4XFCA 3CLPA 2OPKA 4KWLA 4PJYA 3L2HA 4E2GA 2BNOA 1ZZ7A 4MX3A 5J48A 5EFUA 1ZRDA 2ETEA 5I8YA 4WBBA 4Q0QA 4AXOA 1RTVA 2UY8A 2Z69A 2IXJA 3H50A 4PIZA 4Q0UA 5CVRA 5FQ0A 2Q0AA 4IEVA 3IWZA 2H6CA 3NSTA 3ES1A 1PM7A 1L3JA 3S0MA 4UXAA 3PNAA 3ROUA 1RL3A 5D1IA 2PAMA 4PIYA 4LTAA 2XL9A 3SXWA 3DL3A 3D82A 3H7YA 4H7LA 3E5QA 1J1LA 3H8UA 1CAUB 5KHGA 5K8SA 4XF9A 2EAAA 1H1IA 2VECA 3EO6A 5FQ0B 4BIFA 2GC2A 3LA2A 4PIXA 2P17A 1CAXA 5JR7B 4HVQA 1QXRA 1TQ5A 2QCSB 3SMHA 4XFFA 4AQ2A 4GULA 3CL1A 3U11A 3LA3A 3H9AA 2H6BA 3FX3A 2Q4SA 1LRHA 3EQEA 5FLIA 2OA2A 1ZRFA 2PHLA 3ZDSA 3QACA 4LEJA 1VR3A 5BY5A 1J59A 3USSA 4X6RB 1RUOA 3RZZA 4F8AA 1WGPA 1GQHA 3M70A 2UY9A 1YHFA 1FT9A 1CAVB 3JZVA 3I7DA 3H3UA 4L11A 3GYDA 2PAKA 4JVAA 4Q0PA 1XE7A 2IXHA 5CADA 3LA7A 1YFXA 5KHJA 4XFAA 2PTMA 4HVRA 2XLAA 5LEJA 4QXKA 3OCPA 2PQQA 2GC3A 1VJ2A 5T3NA 2XKOA 3EBRA 4ZU5A 2CGPA 3RNSA 1Q5OA 3TNPB 2Z2SB 1SQ4A 4QX5A 4RD7A 2IC1A 3ACLA 4KWJA 4Z07A 2I45A 2IXKA 1ZRRA 4I2OA 2OZJA 4P9GA 4J1WA 2ET1A 4IEZA 1FXZA 1OD5A 4AVBA 1J3RA 3H7JA 1DZRA 3OTFA 3SCHA 4K8FA 2OYZA 4MGYE 3EJKA 3U0ZA 3NJZA 2EA7A 2ATFA 4EWDA 1QY4A 3M3IA 3NVCA 3I59B 4IEPA 4IEOA 1RUNA 1ZNPA 3PVBB 4EV0A 3MYXA 4XEZA 3CJXA 4I01A 2IXIA 4MV2A 3H1YA 3KCCA 2WC2A 2F4PA 3ST7A 4O9GA 4LUKA 5FCCA 2VPVA 1SEFA 4MUVA 1UD1A 4HSLA 5J3UA 1O5LA 2V09A 3H3ZA 3UKTA 4D7SA 2GU9A 4QM9A 3SCFA 1QXJA 2FQPA 4FBFA 5KHKA 1YFYA 2Q30A 3TNQA 4MGIE 1EPZA 3E5UA 2D93A 2UYAA 1ZRCA 5C6CA 3NW4A 3DV8A 1Y9QA 3EHKA 1J3QA 4QM8A 1OFNA 4KWKA 1ZZCA 3LZZA 1V70A 5FLJA 5FPXA 2PAEA 2GAUA 3FE5A 1J3PA 4JTNA 4UBHA 4YSFA 3I54A 1NE6A 4QGNA 4WVZA 4LUMA 4YNIA 2WFPA 4JV4A 3RYRA 5I91A 2B5HA 4HMZA 4ZU4A 3DN7A 3BB6A 3DKWA 3KGZA 2OZ6A 1UCXA 4R8HA 4IETA 5F1RA 3S7IA 4XFIA 2BNNA 1O7FA 2Y0OA 4KU8A 4META 5BUVA 2O8QA 4KU7A 4CYDA 1X7NA 4LA3A 4E2QA 4FT8A 3WW1A 5E16A 4HBNA 4N9IA 2BEOA 4HN0A 3RYPA 4YARA 5FLHA 4LA2A 4Q0SA 4N9HA 1ZZ9A 2PA7A 4IESA 1HW5A 2FMYA 4A2UA 2XHKA 4IEYA 4I0AA 5JCTA 5JSPA 1ZX5A 4AQ6A 1CAXB 4MH0E 4XF4A 1UW8A 4L2NA 5JSOA 5I93A 4HSJA 1Q3EA 1UIJA 1CX4A 1WA4A 2IXCA 5BXXA 4FAHA 4XF3A 2B8MA 3WW3A 5BV6A 5J7MA 2HKXA 3KMHA 3UKNA 1LB2A 1CGPA 3KGLA 3MDPA 4IEXA 4BYYA 1J58A 1YUDA 2XL7A 1EYBA 1NE4A 1LR5A 2QNKA 4I3PA 2MHFA 3OD0A 4IERA 1JUHA 3HQXA 1I5ZA 4XETA 1OMIA 5BPXA 4IEUA 4DINB 2KXLA 3LAGA 4Z82A 5I8SA 4R52A 3SCGA 1RC6A 3G7DA 4ZU7A 5I8TA 4ONUA 5E1RA 1O3QA 2MPFA 3E5XA 3O14A 5C8WA 1O4TA 4J1XA 4QGMA 2H0VA 2QJVA 3OF1A 1X8MA 3IIAA 4IEWA 1EY2A 2XKPA 3LWCA 3RYKA 1NZCA 5LRRA 2D5HA 3H1MA 3SHRA 4E2SA 1GQGA 4AVCA 3RPQA 1OI6A 5HI0A 4LLOA 3U10A 1G6NA 4B29A 2C0ZA 1YLLA 4HVOA 5KBFA 1O5UA 5JAXA 4BH9A 3BALA 3CEWA 3KSCA 2ZCWA 3FHIB 2CAUA 1PMIA 3E6BA 4MGKE 3ELNA 1UPIA 2PFWA 5FDBA 4ORFA 4IEQA 4I0BA 3C3VA 1IPJA 1IPKA 1CAUA 1XE8A 3H1WA 3HIFA 5I0UA 2DCTA 3R6SA 1ZZBA 4O9EA 4LULA 4EWAA 2HJIA 2PYTA 5LEKA 2Q1ZB 3OGJA 1VP6A 5CU1A 4MGZE 2GZWA 5I0SA 4WZCA 4MZUA 1NYWA 4KL1A 2BGCA 1Q43A 3HT2A 3NKTA 4HN1A 1O3RA 2BYVE 2N7GA 1WLTA 4XFHA 2ZKLA 1X8EA 3FZ3A 3WW2A 1YFWA 4D7TA 4NVPA 4UBGA 2O1QA 3E6CC 1LKNA 4Q29A 3BU7A 4XFGA 2D40A 4YRDA 3QOPA 4Q0VA 1CAVA 1Y3TA 1DZTA 5AVPA 1I6XA 2QDRA 3D0JA 1RGSA 2E9QA 1YWKA 4QMAA 4BHPA 3BCWA 5I0TA 5FPZA 3S7EA 3FJSA 1DGWA 2XLGA 1U12A 4I09A 3CO2A 1SFNA 3ES4A 3WW4A 4X6QB 1NXMA 4F7ZA 3HT1A 5LRSA 1EP0A 3IBMA 1UIKA 5KHIA 3UKVA 5KHHA 4XFBA 4QGLA 3MPBA 2QVSB 4HZFA 2GC0A 1FI2A 4YYOA 1QWRA 3N4MA 3FWEA 3D0SA 4XF1A 3MZHA 3GBFA 1ZVFA 3RDIA 3PLQA 3E6DA 2XLFA
chains in the Genus database with same CATH superfamily
3STLC 3APBA 2BNMA 1VMGA 2CDYA 3NL1A 2B9UA 5BY1A 3IDBB 4U36A 3VKFC 2QQWA 5DG2A 1ASJ2 4CZZA 1F23A 3O1MA 2JEUA 3ETQA 4LFAB 1I08A 5LP6A 5DUVA 2JJ1G 3SPIA 4TWKA 1WCKA 4LF5B 3PU3A 4FM2A 2EF6A 2WL1A 1OA3A 1CPYA 1XMOO 5C8YB 2O14A 4CDXA 5ITZB 2MNGA 2DTWA 4RQPC 2W08A 5ACA3 4GX0A 1GANA 1UYYA 1L0LH 5CA3A 4RYDA 1MSWD 2UUAO 2Z69A 3P6BA 4KXRA 2DBNA 1PZ7A 1H8TA 5J9PC 1MZEA 3LF7A 4ASKA 5IT9N 4CDUA 3P32A 4NAOA 1JU4A 2QFEA 4LTAA 1SERA 3M1HA 4YIPA 4TT3G 4L92A 1UAIA 4B4RA 3HKBA 1MZFA 2RMU2 5C5UA 3ZCCA 3AL5A 4X88A 1KECA 1MZ6A 3LGRA 5AC92 5A33B 4LF5O 3W7SA 3FX3A 2BDRA 5FLIA 2YU2A 4NTWA 3GCXA 2PHLA 4K8RB 3KWVA 4UFJA 1F4HA 4U7OA 5BY5A 1UU5A 3ZXGA 1GN4A 3K5MA 4RFT0 3O1PA 1B35C 3K9AA 3RZZA 3PJQA 1RUJ2 2R043 3ETDA 3I7DA 1AYM2 4YGDA 3UJOA 3L2YA 4Q0PA 2RMKB 2ZKOA 4XHBA 2BU9A 1APNA 5HBAA 4JYYA 4RQPB 2JE8A 2RV9A 4HANA 3CD6V 4I2OA 3POWA 1OD5A 1RPRA 2ES3A 1WLDA 3M3IA 1XB9A 3I59B 4IEPA 4IEOA 1TZOA 1RUNA 2FD8A 3ACGA 3M99B 1REDA 2F4PA 3VD9A 4LBQB 3W7XA 1VQ8V 1VBA1 3K3OA 4IV1A 4FBFA 1GAXA 1AL21 1LHNA 1AHSA 2ADPA 3NW4A 4YZ1A 1RVF3 1Y66A 4JTCB 3DC6A 3A22A 4QM8A 3ASIA 1DF4A 4CP0A 4X8NA 3TGUH 3AKSA 2PAEA 1U96A 4UUJC 3WNKA 4JTNA 1WB7A 1PIV1 2DVBA 4Y5SA 2PXJA 1B35B 2VMHA 4CXYA 4NIGA 2J1VA 1LGNA 4GALA 2P22C 4E4HA 4RR3C 1UCXA 2WNVA 4OI4A 3FB8C 1NUKA 3UM7A 1VQ4V 5LZ6A 1VIBA 3IJ4A 4NUBA 4O4LB 1VBD2 3J7LA 3ABTA 3AG2C 3N36A 1NLRA 1DQ0A 5LYJA 4TTGA 4TV8B 4WM8C 1U5IA 2RNBA 4D6RA 1YI2V 2HHHB 5BNPC 3APQA 5C70A 1EZVH 2CU5A 4UI9L 2ZOEB 1AL23 3PVNA 3ABKC 3UKNA 3BKZA 2YI8A 1W6OB 1FV2A 4W8JA 1SLAA 2RDSA 3T09A 1JUHA 3HQXA 4DR6B 4MVSA 1P8JA 2DMXA 1PIV3 1K33A 4IEUA 3E22B 1VRH3 3LAGA 1JX9A 2XHBA 1YQ2A 2ZACA 3GBWA 4O2AA 4OYUA 1N0JA 1JHJA 4Y22B 1X8MA 4RQFA 1EY2A 2XG3A 4UW5A 4TZDA 1ORQC 4AOCA 1GQGA 1OI6A 3ZYIB 2ZJCA 1RUE1 4LLOA 1A78A 4RR3B 1EBOA 1AR82 5BNQA 3PTYA 2V5DA 4DUZB 2EX3A 3BALA 2QWRB 5FP8A 3WOGA 3OBTA 3FHIB 2DURA 2DQ0A 1XI1A 4NIDA 3PMSA 1KXGA 2HHHO 3ZSLA 5FYTA 3JD71 1VBC2 1ULCA 1V54C 3PU8A 4PDVA 1UPGA 4BQXA 5K9YA 4WM8B 5F5CA 1M1KW 4CUAA 3MIGA 1VBE2 4WM7A 4DR6O 2AGAA 2HEPA 1JTZX 2BTVC 3GDBA 1W0JG 3WDTA 4G28B 2BTOA 1R6KA 1KDMA 2B9ZA 5CA6A 5KXDA 1DGWA 1NT2B 1W8NA 3A8TA 4K6BA 4NE9A 4W6YA 1EAH1 3DPRC 1X9TA 2IH3C 3JD1A 3KD4A 4DUZO 2OCHA 1P49A 4KQ7A 3N4MA 3FWEA 2BPA2 4PLNA 4B1LA 1ZBE3 2R061 2QUOA 3J8F1 5IYCO 4A42A 4OFGA 2FDGA 5SV5A 1WD3A 1YXBA 5IJRA 3IC7A 1V54B 2RN9A 3K77A 1YJ9V 1AR62 5EIBD 1W6NA 5FYIA 2WT0A 5A70A 2LW1A 4FAGA 2ZEZA 3FAVA 1ZZ6A 2FCTA 4D6SA 2EXIA 4N43C 2GH8A 4IUGA 1RUF2 2BFUL 2J7MA 2GNTA 1FMD3 4YG3A 3A0BZ 3C3SA 4XTMA 2ETEA 3I2KA 4BQ4A 3JAWB 1QIQA 1V6OA 3LFIA 2E7AA 4QPIC 3VHNA 4CEWC 1C5HA 3QD6A 4BQ2A 4HAMA 2RJKA 3WU2Z 1OH3A 1PM7A 5FO7B 4IYIA 1UZ0A 4Q27A 1LJ7A 3MHSC 1MACA 4YGEA 4DW0A 3BFRA 2EZOA 3DPRB 4V1PA 4IE5A 1CAUB 1HJFA 1W28A 3B8NA 3AYCA 3UO2A 1S0IA 1MS0A 3OMAB 4UV9A 1W0KG 1CAXA 1FPN1 1AI7A 3SMHA 2R1DA 3ZMTA 1JUIA 3U11A 2W3JA 3NAPA 3LA3A 3MF9A 1Z0HA 4QPWA 2OA2A 3RVHA 4DRXA 1AX2A 1RB8G 5LOVA 1RUOA 1W6MB 3UESA 2UY9A 1VPHA 5JMOA 1H8TC 5A7QA 4DFSA 3QLQA 1ROPA 2CH7A 1Q5OA 2CHHA 4N43B 1UN1A 2IXKA 4P9GA 4AGVA 1FXZA 1J3RA 5DXDA 1N8RW 3OYWA 4NOTA 5D21A 4DK0A 5K1XA 3KHBA 1IQAA 1T5EA 1FPN3 2X29A 5C33A 3AYEA 5LP6B 2DUOA 3L9DA 2BWCA 3IFXA 2GU9A 4FVVA 1QXJA 5F6LB 3TNQA 1G9BA 4MGIE 4P2ZA 5H9CA 4YW3A 1ASJ3 1PX4A 5EV7A 3JYCA 3U37A 2RJLA 2FKXA 4NPRA 3CMGA 1V70A 2DWDC 1X33A 2FCUA 1IX9A 1W8OA 1NE6A 2WFPA 4JV4A 5GLZA 1DGSA 3HKDA 5BZBA 1C1LA 5FPVA 3RGBA 1H8TB 3HKEB 4R9AA 4BK5A 4CDUB 3T4VA 1I9RA 2BNNA 2VUJA 2PI4A 4KU8A 2VOTA 4JI4B 3POIA 1I3HA 4RL7A 4E2QA 2YBKA 3JB4C 4RGKA 1XQNA 1SQQH 1IBMO 1ZZ9A 5A7NA 5TSWA 3HKBB 5JCTA 3ASNC 3BTAA 3ILFA 1ENSA 1UW8A 2N74A 3VD5A 4CH4A 2P06A 4PI2A 2B8MA 5KX5A 1SLBA 1LB2A 2A7AA 1MA1A 2W1SA 4LBKA 5FO9B 2FL4A 2QNKA 2RMU3 1RP3B 2KA3A 4R8CA 1E5SA 4A7ZA 4C0HA 4M3CE 3ZN6A 2UUBB 4UB6Z 2WNVC 5AC93 2QM4A 3HQRA 2X0LA 4Q4W1 4AHZA 1VAVA 2ZGLA 3FHAA 3A0RA 4XDKA 1MS5A 1O3QA 3THOA 3JBG2 2IH1C 4FPOB 3E1F1 1CPMA 1O59A 1RUJ3 3ENRA 1AYM3 4JI4O 3HB3B 1FV3A 2UWAA 1OZ0A 1SQFA 2ORXA 2XVKA 1YNAA 4IQPA 5FZAA 1XU2A 1GZTA 1I0HA 3VKLA 5HPOA 3RFRA 3CCRV 2YG0A 1UF2C 1NQDA 1S76D 2I2SA 2A3XA 4WFEA 5FZ0A 1Y74B 1M57B 4NPLA 5T5OA 5EK0A 3OEBA 2F43G 4I0WB 1IPJA 1E79G 1MZ5A 2RS12 3H1WA 3LDCA 2VQEB 3ASNB 4OHWA 1G9DA 1M06G 1VBD1 1WP8A 2TNFA 2E7TA 3MF6A 3ZSJA 4JKLA 4JTDB 1SA0B 3WF4A 5LL6Y 3KV4A 2BGCA 1Q43A 4B3MB 2UUBO 1EZJA 3K5NA 5CB4A 2QQKA 4ZY9A 3D36A 1ZTEA 1HNZB 3IGAC 2A75A 2D40A 1Y3TA 3H3LA 2WNVB 3OPZA 4X1IB 4YJ3A 4XAAA 1RPOA 3ZXDA 5BMVB 2WUHA 3IAQA 1CXZB 3AFKA 1G9CA 4Y4YA 3K4AA 5LRSA 4F6RA 4CS3A 5LYJB 4XFBA 4P00B 2WA3A 5B4XA 2GC0A 4ISRA 2VG9A 2VXRA 4LBQD 3E97A 2JGDA 3WNOA 2X6BA 3NNFA 4B3SB 3ZFGA 1VBD3 2VQEO 2D5FA 1DGRA 2IXLA 4BQ1A 2K0GA 1CAWA 2CGOA 2PHDA 1KITA 4MYEA 4AVAA 4YW5A 4B3MO 2WBKA 1VQ7V 1VBC1 4JAAA 5EQUA 2A79B 2OUHA 4FOYA 1HNZO 1XNBA 1MS4A 1VBE1 1W3XA 3WG4A 1IS3A 4NRQA 2JJ2G 3AG7A 5FYCA 2ZGSA 1RTVA 4K3AA 4PIZA 1BL8A 2IM9A 5L3DA 1GP6A 1SQPH 1YCIA 3RRDA 3TAYA 5KUMA 3L9JT 2BTQB 3CCMV 1UOGA 3KQ4B 2JG8A 4O2BA 4D6QA 3RQ0A 4K0KB 3HBKA 3E5QA 5GONB 1J1LA 5KHGA 4B3SO 4YGCA 3EO6A 1BMV1 2J1AA 3K75B 1AR83 2CK3G 2WN3A 3RG0A 4WM7B 1HQWA 1FJGB 4GULA 2V4AA 2A6XA 3H9AA 2H6BA 1GMGA 1LRHA 2JDYA 3AXEA 1VBC3 4E4DX 1O8SA 2VMIA 4QXCA 4Q4V1 1F5FA 3CC7V 3G71V 4YW4A 5CBGA 1J83A 1J1TA 1XXNA 1NAEA 1VBE3 1S0FA 4L11A 4JVAA 3CZUA 4M4PA 2BOIA 1COV2 2PHRA 3EBRA 1AR61 1Q82W 3TNPB 1WCUA 1UYZA 1XHXA 2F4VB 1FYJA 5LBFA 3ME2A 1ULGA 4K8FA 3Q4HB 2F66C 2VZRA 3ZS8C 4SBVA 5IUQA 3N2GB 1VARA 4JDMA 1PHMA 2UWBA 3NVCA 5FRAA 4K0KO 3NAPC 1ZNPA 1HQNA 2YFUA 5EJ1B 2YS8A 1QCEA 4HL0A 3V56A 1ENVA 1AR71 4FLTA 2VPVA 3CPWU 4QKNA 1OKOA 1CZVA 5FZKA 4D7SA 4PA4A 1EPZA 1Y9MA 3OGIB 3AVRA 4M0HA 3J80N 2YI9A 3FAVB 1H30A 4OHXA 4M3CF 4MGQA 1UMIA 3EHKA 1US6A 3KQRA 5FZ1A 5B3SC 2PYJA 2CUGA 1QLEB 4ZZ5A 1FD9A 2JXAA 2GAUA 1J3PA 3F5WC 1GH6A 2WZEA 3V64A 1AR63 4YNIA 4NO4A 5LBBA 1JXNA 5B1BC 3JU9A 5FMCA 1GZWA 4INDA 4L8JA 4K1ZA 1DYPA 4NMIA 3VBHC 2F4VO 3B01A 4AEDC 1RUF3 1KFUL 4WFHA 2RDCA 4DV5B 4LBLA 2WLNA 4B08A 3HR9A 4N9IA 5CKMA 3UQ8A 4AEKA 4LA2A 1F5JA 5FZCA 1RUG1 4AF9A 4FFBA 5FAXA 3AK0A 1ODMA 1WCDJ 2ENRA 1CAXB 4JQRA 2A0LA 4H0LB 4AK3A 4Y20B 4ZHNA 3NAPB 1SG3A 3AVSA 4H3WA 2XAHA 1WA4A 5T54A 1HXS1 3W58A 4FPYA 4FAHA 4DRXB 5I0DA 1PO12 1UZYA 5LOVB 1M5IA 5DMYA 1F4MA 3KGLA 5IK7A 5KAFZ 2ZXWC 1DF0A 3ZM8A 3H1LH 1ENQA 1F4NA 2VMCA 4CH5A 3RWNA 4H55A 3TN91 1IDSA 3CXCU 4YVWC 2CH7B 2BV4A 5B3SB 3MDSA 2P4KA 4BQWA 3O14A 4YHHB 4UWDA 2G9FA 2JEXA 4XW3A 1X4TA 1B6QA 5DPNA 3J4UH 3OYWB 2R0HA 3FBYA 3K57A 3ML0A 4XUPA 5FY8A 3VBHB 2P34A 4GWJA 4AEDB 1D2SA 5GKAC 4PBOA 3K0DA 3E6BA 4LNVA 3ELNA 1UU4A 4X1YA 1UPSA 1R082 1H38A 4LE3A 3R6SA 4LULA 4MVOA 2QE3A 4XC9A 2Q67A 3POYA 2V1DA 2BW8A 5J2UB 1CX1A 3IKWA 4LF6B 2YY1A 2WLJA 4FPEA 5JQGB 1NYWA 2UXDB 3I56V 2XJVA 1ZBA2 2NPIA 3W9AA 3EYPA 1V00A 3ZXFA 3E6CC 4QX2A 4AHCA 3HKDB 1NS1A 3T1YO 4GJYA 1QJZA 2DWRA 5GM0A 4YHHO 3QOPA 5AVPA 1N3QA 4C91A 2FDFA 5I0TA 4YW1A 3F7VC 1ULPA 2VS0A 3ES4A 3PIGA 3I3MA 3K03A 3R4SA 1QDCA 5KHHA 5JI7A 1LU2A 3JBG1 4DO2A 3WX5A 2G1MA 5F7UA 4QGPA 3I8TA 4H33A 3ZN0A 1ZVFA 4GWNA 2RM22 4QKDA 2YIAA 5FZGA 1HB4A 5KX5B 1ONAA 1HV0A 2QWPB 1IKQA 3ZIWA 5CFDC 3POGA 4X62B 4FFKA 4LF6O 3HMYA 1IBKB 3ZN6B 5L9VA 3RI9A 2D3OW 2CAVA 4FFIA 4AFAA 5CKQA 3DXUA 1ZREA 2XJPA 4XFCA 5HV4A 1F9KA 5L3CA 4MX3A 5J48A 4ARXA 3APOA 4AR2A 2VQFB 1H2GA 3IDAA 1QH7A 3ZRSA 2HVJC 2WR9A 2Q0AA 1KC8W 5FZLA 3JBG3 2VOWA 5E79Z 2KR2A 4OPAA 2XT9A 4JX0A 3AG1C 3H8UA 2HH9A 1NU1H 1FXKC 2Z42A 1SLTA 1UY4A 4FPCA 2QDOA 1SBFA 1NZIA 4X62O 3CL1A 4MVMA 2Y26A 4ZBMA 1IBKO 1IS4A 3WD5A 3ORJA 2VOKA 2ZDIA 3K48A 2RS13 3O1SA 1DLLA 1NVPB 2LM3A 1SHWB 4QPGA 3WG2A 1S3JA 4YJ3B 2NNUA 1YFXA 5LBEA 3ZXLA 1F51A 2VQFO 1PL4A 3CU7A 2XKOA 4UW4A 1JW6A 4F6RB 5FY9A 1ZRRA 4NWWA 1OOPC 3QH7A 4FFGA 5B1AC 2R1BA 1ULDA 1G6UA 3I49A 4DV2B 2Y64A 3SCHA 5EBLC 2IU3A 2OKXA 3K08A 3UNPA 3EVKA 1P4RA 3UETA 3ZFGB 5CB7A 4H44B 5JVVA 1DTOA 3AG1B 4C1XA 2WQ8A 4HG6B 1XL4A 1OKQA 2YUEA 1WBLA 4MGTA 3KLSA 2HWD1 4FPJA 2P6HA 3S3WA 1UY0A 2R072 3SLIA 4A5UB 3D8CA 4FLZA 2YIDA 4Q8KA 4H14A 4ABMA 4X66B 4JYAO 1VF6C 2WAMA 4YVSA 1H8EG 1NA1A 4ZU4A 1H2SB 1R1A2 4KU7A 4CYDA 4DO0A 4RA0A 1X36A 4LBEC 4O2BB 1AX1A 4HN0A 3N9MA 2QQIA 2X05A 5DM6V 5B1AB 2Q5ZA 2FMYA 1JOBA 4X8AA 2BOBC 4OI0A 3PIJA 1U5ZA 1K97A 2LW7A 4YFWA 4K20A 5FP4A 5I93A 1A32A 3OUSA 2CY6A 4MOAA 4UT5A 2R7EB 5B1NA 4WF9V 2IFWA 2HVKC 1FNZA 1B06A 4BYYA 4LFBB 2P4VA 2MHFA 4YZ5A 4LHLA 5JLVA 2XB6C 2C4XA 4R52A 1A3KA 3QG5A 5I8TA 1E5IA 4OGQB 4X66O 4Y24A 4QGMA 3OF1A 2FYUH 4XCBA 2Q69A 1RITA 2RCVA 3U07A 1K34A 1P84F 3OUFA 4NYKA 3M4FA 2YHJA 1P7BA 5IWAO 1COV3 1CN1A 2VBBA 5L19A 4B3RB 2W2IA 2AEZA 4QDRA 2RS32 2ZCWA 2BERA 3ABLC 2BZDA 1PV0A 5A32A 3OGVA 4MGKE 4CUBA 4GKKO 1IGOA 1QJX2 2HWE1 3CCQV 1XE8A 1XNCA 1PVC2 1ND2C 3RZMA 3ZEDA 3K5LA 3IMMA 2DFCA 4C90A 5IFPA 3SISA 5EYPA 4LFBO 3MHHC 1VBB3 4WZCA 4GA9A 2G19A 3AZZA 1QQP2 4XXPA 4J10A 2HJFC 1WLTA 2ZKLA 1RMU2 3FZ3A 3MAQA 4UBGA 3VZLA 2O1QA 2E5LO 1LOFA 4LBNA 1PO11 1GZWB 3RVYA 1G8WA 4YXWG 1W9YA 2EINC 3STZC 3OBRA 1D5NA 3ZPYA 2ID4A 4P9LA 4AW7A 4FQZA 5FPZA 1MG1A 3WDUA 4YM0A 1N32B 1HX6A 3AG3C 4WBNA 2WRAA 5FZ7A 4B3RO 2VUCA 2QVSB 4HZFA 2ZINA 1WUVA 2WWSA 2GMPA 2QBXA 3VBOA 1W2NA 2N05A 4B4QA 3E6DA 4OMCA 5I0RA 1MNGA 1X82A 4UF0A 5LHIA 3BVOA 2Q4PA 3ABLB 1F15A 4DOUA 1CZTA 2EXHA 4GB32 4LO5B 4BAYA 3GJAA 2GH2A 1WA8B 4ZXKA 5EZWA 1D2DA 2HWC2 2VULA 2IW5A 2CGNA 4UB8Z 3WNXA 5JSRA 4RAIA 5J37A 1S2BA 1R081 3RJ2X 5GTHZ 1ODNA 5HV0A 3B94A 2W9XA 2WNEA 1PGSA 1JZ4A 3H1KH 3IC9A 3BOPA 4NHMA 1PO13 3JALA 3DTUB 2VE1A 2PQSA 4XQDA 2VVFA 2YMZA 3MHZA 2FBEA 4CCCA 1KS4A 3SPGA 1IHMA 1W8TA 1S2KA 4HOOA 4XOGA 2BNOA 1C8M1 2WT2A 3VBUC 4XZPA 3AMQA 2VNRA 3PVEA 1GBGA 4LO8A 2GN7A 5HCAA 3I2FA 5FL7G 3F5TA 3H50A 3LKJA 1N32O 2D97A 1WAZA 4BIZA 5JJEB 4ET7A 5GTIZ 3PNAA 4GKYA 3OD4A 1DQ2A 3H7YA 3AG3B 4PI0A 5CNAA 2NMOA 5FQ0B 3T1LA 1VP7A 2YC2A 1R3LC 4J9ZB 1U97A 5B4NA 3INAA 2P17A 4HVQA 1TQ5A 1UNBA 4XFFA 4DRRA 1AXKA 1B3QA 3LSSA 3VBBA 4W50A 2LTNA 4Q1RA 3ZDSA 5T55A 1R083 2Q73A 2B39A 1T2XA 2G9ZA 1QXPA 1KD1W 4CUCA 1WP7A 3EMRA 5CAZA 4JGSA 5EYYA 3NV1A 5FZOA 4JAUA 4RHV1 2PTMA 2XNDG 1ZBA3 3IB3A 4DEVA 1E57A 4QXKA 1TME1 3M8LA 4N7IA 1ENXA 1Z78A 1YJWV 2Z2SB 5J96B 2B1IA 4CPBA 4K3UA 4ATFA 3CRAA 4J1WA 3B40A 4S2HA 1N4CA 2B4KA 2XBO2 4RN5A 1SDDB 2JKXA 3U75A 4CEYA 3QBQA 2WQZC 2B46X 3TWIA 2ZE8A 5FCCA 3IM0A 2Z0AA 2YZ4A 5E88A 5FY4A 3LEMA 1PNKA 1MS9A 1WMFA 4LNUA 3UKTA 2P90A 4TQDA 4NXNB 3PUQA 2XOMA 2RM23 3CMEV 3K51A 2W47A 3E5UA 3ZHUA 2E75B 1SQVH 3UCSC 2WFF2 2VD7A 2W68A 3LZZA 2X53S 2YDEA 4YSFA 4XJ8A 3T4DA 4JZ2A 4F3JA 1ZM1A 5LBCA 2EIBA 1S77D 3NNLA 4HMZA 3HAGA 3L72H 1O91A 2WZR1 2YC4A 3MV01 1O7FA 2Y0OA 1BSMA 2OT5A 1TG7A 3V0BA 1JN2P 5LY2A 4Y3OA 5FLXN 1OCRB 1FNYA 5FMOS 4I0AA 4Q4X2 4XILA 4AQTA 3O0XA 1QU7A 1XOUA 4CDWA 4JZGA 1CX4A 3B2EE 2QQMA 2D3SA 5J7MA 4XF3A 3WW3A 4XCAA 3WFVA 4AHWA 2HKXA 4JGYA 1YVWA 3O9OA 2EXKA 4QPGB 4EQVA 4E9KA 3OD0A 2ZABA 4YVSC 1SESA 4HK8A 4BQ3A 5A3PA 1MQTA 2W94A 3VDDA 4CU8A 4LP8A 3ZIAG 4OUSA 5FZ3A 1O4YA 5DAWA 5EZYA 3AYAA 1I1EA 2EZPA 2ZEYA 5IJ0A 3URFA 1US2A 1RUC2 2XAJA 1GLHA 3BTXA 1IXBA 4I7ZB 1H8VA 3HEIA 2R071 3O0WA 3PJSK 4DR7B 5DAXA 2VNGA 4E8DA 4QPKA 2QQOA 1AJPA 3P3NA 5LB6A 3CEWA 1US3A 4PDWA 1R1A1 5D8AA 4JI5B 3VD3A 2ZGRA 5DAVA 1NY72 4ORFA 4IEQA 4BA6A 1W6PB 5I0UA 3UT5A 1AJKA 3QF7A 3ZX6A 1Q6HA 3VDCA 4AYUA 4LH6A 4XDPA 4XABA 3VBRA 4CZSA 4FIPC 2ZZJA 2RDQA 4O7XA 4XFHA 1F2NA 2JDIG 2HBTA 3JQWA 3U4XA 3AKPA 4FP2A 2R30A 4RGAA 3P3PA 2ADDA 4YVSB 1M4WA 4A44A 4Q0VA 4DUYB 1IPSA 1YWKA 4XBFA 1QJY1 4BHPA 1JCHA 4MVRA 2M6YA 2R073 4AI1A 2UXBB 3N2KA 1LHUA 3CO2A 1QBZA 4DR7O 3OE7G 3B9IA 3LSUA 2BE3A 1NXMA 4DR1B 2ZGOA 4RO2A 4UFIA 2GTAA 5F3GA 3ABUA 5KXBA 2BRTA 4MTXA 1R3IC 2WPDG 1R1A3 4TSVA 3WF2A 3GZTB 4JI5O 1WCQA 4IHJA 4UW3A 3MZHA 4XUQA 1IS6A 2KKWA 1GN3A 1XBFA 4TLFA 1XC6A 1MS3A 4EWEA 4Y33A 2VQAA 3JD4A 4CRQA 4JAVA 1JMUB 4TOIA 2UYBA 4J7ZA 3CJIC 4AFMA 2TEPA 2RS31 3S3XA 4DZGA 2CYFA 2ZZQA 3N35A 3POJA 1XREA 4GT1A 2EAKA 1H1MA 1O3SA 3AP7A 5L7OA 2IVIB 4UFZA 4BXFA 3VBSC 1LOEA 2TUNA 3N9NA 4DR4B 5CBLA 5LATA 5IK4A 5CISA 5FZHA 1NT0A 4B8EA 1Y6XA 4KWLA 2JIZG 5FZFA 4PJYA 1YDXA 5BYNA 3Q8BA 1FPOA 5J1XA 3ZX7A 1RHI1 4IV3A 4Q0QA 2UXBO 1QQP1 1LTEA 4UOJA 4YM2A 1KD7A 1RMU1 4Q0UA 1EFRG 3MBWA 4DR1O 2ATKC 1AYN2 4BMEA 3R05A 3WNMA 4DV0B 1IQDC 5JDBA 2LGQA 1L3JA 3RS6A 3ZFEC 1JPXA 1UO9A 5F3EA 1CJPA 4FTSA 5A32B 4PIYA 4AWDA 2RR12 1M4UA 3SPCA 2F6BA 3U1XA 4Y1ZA 2W39A 2ZMKA 3WLUA 3JCUZ 5EYPB 4K35A 2A73B 5LA0A 2C2AA 1KYOF 4R6ZA 1QJX3 1CZSA 1LOCA 4IE7A 1POV3 3USUA 1PVC3 2M7WA 4X6RB 1DFQA 4F8AA 1GQHA 2B5UA 4DR4O 2JD9A 4BIUA 5EP9A 3GYDA 3DUIA 2XOKG 4GB31 4JI3B 1S0VA 2HWC1 5JI9A 1QQP3 1MVQA 3ZIXA 4LITA 4MSVA 1RMU3 3HPNA 3B69A 3S5AA 4MSWC 3AXDA 2GBOA 4WBNB 4MW8A 2WZPP 1M56B 4DV0O 1GOGA 4FXGB 2VR4A 2JS3A 2ET1A 2AREA 3RZHA 3TXSA 4OMDA 3VBOB 2OYZA 2WO7A 2UU8A 4ARYA 1VQ5V 4MVUA 4X9QA 1LODA 4EWDA 3UO3A 4NN0A 3MPPG 3LSDA 3N7MA 4AAXA 5KC5A 1AR92 5E89A 3UGHA 3ST7A 2ZNJA 3ETPA 1MS8A 2B45X 2V09A 1OQDA 2Y6HA 2FQPA 1YFYA 3CRMA 5C9AC 3AP9A 4JHTA 1ZAUA 2NM1A 3I3DA 4DUXA 2ILMA 5FPAA 3JALB 4XQ4A 1HNXB 1QR8A 1V6IA 4GB33 1HJGA 1EN5A 3ZYBA 4JI3O 3WF3A 5KA5A 4TWTA 1V6MA 4JI6O 4WVZA 4JZRA 2D7FA 4Z1MG 5FUNA 3MO4A 4LF4B 2OZ6A 1POV0 1DF5A 4EJRA 3RWKX 3HD8B 5F5IA 1MMMA 1S5JA 5GZEA 4CS2A 1DQ4A 4EEQA 4Y1VA 2ZGUA 1AL0G 4CCLA 3OEAA 1HW5A 1XEQA 4MVZA 4KI5M 1K45A 4XF4A 5T52A 2CTQA 3I2DA 1OPOA 2QKSA 1R64A 1JYTA 2WO3A 3ZMSA 1SFPA 5IJ9A 2AC1A 4ZIBA 1TGOA 1VIWB 2VTXJ 1V6LA 1XOYA 3MDPA 5IK5A 3POSA 1KU9A 3THDA 4UFKA 1JFFA 5LMUB 1S55A 2DCKA 2UXXA 3CCLV 3ASOC 1PGL2 2HWF3 4QNHB 4CSWA 2KXLA 3I2GA 2X8KA 1TUBB 1C8NA 4ZU7A 1OCZC 5EHDA 2MPFA 3E5XA 2QZ3A 1TMF1 4EN0A 1AF9A 4LF4O 3N9QA 1JS9A 3IIAA 2QE7G 4B3TB 3LD8A 1I5XA 1ZRIA 4E2SA 1GOFA 4YJ2A 3RPQA 2XUMA 3H42B 2RJZA 1W03A 5KBFA 1BHAA 4CP2A 3OMIB 4GKJB 1PMIA 2XBO3 2N04A 4UCRA 3AL6A 5FYSA 4K1YA 3F2ZA 4O9EA 2E74B 1S0EA 3MLLA 1LHOA 1PO21 3O1TA 2K1EA 2PF4E 5LMUO 2ZHNA 4AI9A 1FOD1 4QE7A 1VQLV 4ICGA 4Q1PA 2WYFA 5FMBA 5LW9A 2WLMA 2YPJA 5DQ0A 3JD0A 5JMCA 4Q29A 2WLPA 3BU7A 3QO5A 1CAVA 2Q8VA 2WFF3 3L73H 3D0JA 1RGSA 2VMFA 3N9PA 4LKEA 3VQVA 3V0BB 1ZL8A 5JZGA 2DE0X 4B3TO 5FNVA 2XLGA 4XE9A 1OCZB 1OJHA 4PDWC 4SLIA 4LO7A 4XJ9A 3NNJA 4KUMA 1PK6A 1YITV 2IWGB 2HKOA 3ZRWB 1RUC1 3MFAA 5ABJC 4GKJO 4I55A 2EIKC 4ZXEA 3DXRA 2VO5A 1Q6UA 4CDWB 2JB8A 3FLTA 4XF0A 3WDWA 5BR8B 4NR1A 1LGCA 1FS0G 4JGYB 1XYPA 2OS2A 1L7RA 3TEYA 1TVKA 4NWVA 1HLCA 2D6KA 3MD0A 2UXCB 4Q4X3 1QNMA 1XBLA 4WFFA 2JE9A 1RXGA 4A41A 5EIYB 3VDDB 3RN4A 1K3IA 1NY71 4EZHA 1N36B 5A3TA 3A7QA 1QDOA 2QM8A 3M8AA 2VTFA 3RT3C 3GXUA 2VZSA 4E2GA 1ZZ7A 4Q2FA 4JCKA 5C3OA 1DLBA 1JOJA 1KRIA 1NR1A 3DXTA 1S5HC 1UMHA 2HBUA 5HCFA 4GH4C 3K3WA 5A7SA 5E8AA 3NSTA 1RUC3 3S0MA 4PDWB 1WZXA 2EIGA 4CBCA 2OQ6A 4E4SA 5IVCA 2W46A 3KB5A 4XF9A 1HDJA 3T2QA 3EB7A 4EN9B 5ERLA 1HB3A 4O4JA 5ABJB 2ZAAA 4XBQA 4OUMA 4ZOLA 1TNFA 2VBDA 4AZZA 1DLCA 1AI5A 1H2LA 3GHNA 1YJNV 1V55C 1D4M2 5GJ6A 3FB6C 4IV3C 1QU0A 4BW5A 5FP7A 3H01A 4JYBA 3TOJA 3JZVA 1OURA 5C93A 2RG4A 2EICA 4BB3A 3N2KB 4KG8A 1VJ2A 5T3NA 2CGPA 1JYXA 5BNOC 1C1FA 1JZ7A 1SQ4A 4RD7A 5FY7A 3ACLA 4CP1A 1YC61 5F3CA 3CS5A 3WB0A 2DYCA 5IAXA 5DZGA 1Z7S2 2VCAA 2ZKNA 4IHJB 3NJZA 4GH4B 3ZYRA 2VNOA 2OYQA 1NCQA 3AKQA 4AHXA 1G1XB 1AYN1 4GJZA 3FYIB 4U2AA 3ZYGA 3T2OA 1HNWO 1T6BX 1RSOA 1XNRB 2ZX4A 2RR11 3N27A 4WFBV 5JH7A 2D6NA 1OCCB 4YW6A 2DW4A 1OD3A 3F95A 1Y9QA 1JZ8A 1SCRA 5H6QA 2VOXA 2DOSA 3VQYA 3WCRA 1MABG 4IV3B 2SBAA 3ZOIA 2ZXQA 3DN7A 1JYCA 2R32A 2JENA 3TK1A 2P1BA 1ND3A 4XPVA 5BNOB 4AFCA 4LFCB 1L8DA 5E16A 4HBNA 1AP6A 4XDQA 5J09A 4JKKA 5H9RA 3LSQA 4YARA 4Q0SA 2W91A 2P67A 1AYN3 3HNBM 2GDFA 5L9BA 2XHNA 1JYNA 2X5IA 1A8MA 5A1FA 1PVXA 2GHYA 2RR13 3HNYM 3E8GA 4TUYA 4G3YC 3USUB 3UGGA 3A0HZ 3VBFC 4X64B 4MADA 1Z5VA 1XYOA 1JJOA 5FJHA 5DAPA 4I4TA 1GFF2 3BRCA 4AHYA 4OQ8A 4FLVA 3SEPA 1S0GA 3I5DA 4DXRA 3OBAA 3ZSKA 4DINB 1TAEA 5FZMA 5KMGA 3G7DA 3AMHA 2OIIA 1JZ2A 1SC5B 5A6YA 4FLUA 4XTPA 3FLRA 5C8WA 3H9VA 4IEWA 4LHKA 3A2FA 1BCXA 2DV9A 2W95A 1Q8OA 3H0OA 2CAZC 4S2DA 3WQ7A 1G6NA 3H8OA 1CWPA 1VMHA 4ZS3A 2W1QA 4WFAV 2R041 4N23A 1W0PA 1SCSA 4BQYA 1CP9A 1IPKA 4NROA 1QOSA 4RS5A 1Q8IA 5EXOA 5DEDA 1S0CA 1AR93 4X64O 5IVYA 4OI1A 2CSGA 2E53A 4Q5OA 1NCRA 3OG2A 4DR2B 5FPOA 3OEEG 2BYVE 3WW2A 3G6JB 4O4HB 4D7TA 3VBFB 5J2TA 1UOBA 4CDQA 1SF9A 4QQHA 1LAJA 1V9PA 4W4LA 2JK5C 3K0GA 4LFAO 3VN4A 4I0XA 3ZHQA 5AFEA 1RJ7A 4DS0A 1BBT2 2XR4A 2DDUA 2GSMB 3GVMA 1AJOA 1NTZH 4F7ZA 3J9SA 4Q4Y3 2ZE6A 1RVF1 3X29B 2I74A 4NHKA 2W0XA 4QHOA 1DK1A 5EC2C 3D0SA 5C8CC 4Q6GA 1GNZA 2JIGA 4EN7B 1YTFD 3E86A 3WXPA 5IJ9B 4KBZA 2G4IA 1W0NA 2ZPXA 4G2KA 1N34B 1O4ZA 2WSVA 2HLEA 1UYXA 4DR2O 4QU2A 3J81N 1QQCA 3X2QC 2BVBA 4EROA 4Y4RA 1O6UA 5FY0A 2YICA 5JZGC 3KT1A 1X9PA 3ZKUA 5FZIA 1KB9F 2BOCC 3CLPA 3LOBA 2IU0A 1RJ8A 4TN7A 4CA9A 3ZLIA 1ZRDA 4HNAA 4AXOA 4YJ2B 1LNQA 5CVRA 2QTWB 1VEWA 1REFA 2EIDA 4D6TH 5LGNA 4AFDA 1KUQA 4LMFA 4XVHA 3GJBA 2ZEXA 2XL9A 1VRH1 1LHWA 4JI8B 3TETA 4ZONA 2BSKB 2Q1FA 5C8CB 2GUZA 1W99A 4PQ9A 1G8MA 3WHTA 2P2KA 1N34O 2V5YA 1LOGA 2Q4SA 4LOSA 4FPLA 4AI2A 4MVTA 4N53C 2JVDA 5F37A 2VZVA 3KT4A 1KKDA 4COYA 2R9AA 1NH2B 4DXTA 3HQUA 2Y6GA 3UL2A 2P3IA 4BM8A 1CAVB 1GK9A 3X2QB 2X6AA 4LWSA 1ZL8B 5JZGB 3LDEA 5FNVB 4I5SA 1GRJA 1CESA 2NQYA 3UJQA 4RGGA 4XJWA 3JAKA 2LP7A 2K46A 1SS3A 2YYOA 1PK6B 3G4SV 2P6JA 1ZA7A 3PL0A 2TBVA 4IGGA 3PUSA 1Y76A 3VQWA 2WT1A 3VUOA 4Z92B 1JYIA 4MGYE 2XAFA 3DXRB 4XMAA 1QY4A 2JIJA 3OTOB 2DYSC 4GCZA 3PVBB 4LH7A 4B3NA 4I01A 3Q9OA 4ZI7A 2ZGKA 1Q86W 5EJZB 2VXJA 1TVKB 1SEFA 5F2SA 4Y1XA 5J3UA 2OCCB 4GYCB 1CIYA 4P9XA 2EIJC 2O57A 5DDJ2 5KHKA 4AI8A 2QGNA 4N8MA 3GNEA 1YO8A 1RUH2 5C6CA 4BMBA 2YSUB 2WABA 1RUD2 4MGSA 3NRUA 4DXWA 2ZGQA 1FAFA 1QVFU 3ALQA 2AZ0A 4N53B 1SLCA 4NTYA 3H8XA 4FLYA 1ZBE1 3MIEA 4E8CA 4LOTA 2ZMLA 4NTXA 4E4EA 3ZR5A 4HETA 2F93B 4C0BA 5FPRA 5F1RA 2CWMA 1LOAA 2XTAA 2ETNA 1BJQA 3J7AU 3E89A 4YIOA 3ICXA 3BIWE 5FZ6A 2BEOA 4U3JA 3OTOO 2J42A 4IESA 1AXYA 1I5PA 2OW4A 4O4JB 2XHKA 5JSPA 5SV8A 1W90A 4MH0E 2AEYA 1V6KA 2OPWA 1FMD1 1BCCH 1VMFA 4FOVA 4BLJA 2DYSB 4ZOLB 3UK9A 4CCNA 2QQVA 1WPXA 3VQXA 3WP5A 1L7LA 4R9CA 2MW2B 1IZ3A 2HYXA 2EIJB 3C2UA 1RUI2 1VLNA 4Z8BA 5A3LA 3O1UA 4XZUG 2E26A 3B00A 3SH3A 1VAKA 1O9HA 1W3VA 3BPSA 1QHTA 5LGUA 4COWA 4TYSA 1D4M3 1D2QA 1S1AA 2JDUA 1O4TA 1JH5A 2UU9B 2ZGPA 3FB5C 2XKPA 1B09A 3RYKA 4MXVA 2D5HA 5EBWC 4J25A 5KC6A 3JQXA 1VF5B 3CC4V 3FHQA 1XYNA 3LQCA 1BK0A 2VW1A 4QU1A 5K0UA 4OZOA 4I50B 1URFA 2VC9A 5BNNA 1HN0A 4BWOA 3MIDA 1NQJA 4HKLA 3ZVXA 2F23A 1JODA 1Z7S3 4XDJA 5IHRA 1E1RG 3MV11 1WLWA 3WT3A 2O0OA 3LB9A 2ADQB 3RVZA 3BCCH 2JDPA 1DQ1A 3D3AA 2ZEWA 4CUGA 2V7QG 4KL1A 3A0NA 3VD4A 3HT2A 5FPBA 4LXLA 5LP6C 4FJCC 4OXSA 1DQ5A 2ZE7A 2ZGTA 2MK3A 4PF1A 1EPWA 4JDNA 4CDXC 2BBVA 3KHCA 1H0BA 2UU9O 3KS7A 1D4VB 1ND3B 4N21A 5EPAA 3SJQC 5FYVA 2V4VA 4Q20A 4P9JA 1SFNA 1D0GA 5A3MA 3LE0A 3WW4A 5LHGA 3QCWA 3MIBA 3HT1A 1PZ8A 2Y69B 4A6OA 4MVQA 5DN6G 1ASJ1 3ZDVA 1XNDA 2RVAA 2C24A 2GP3A 1OV9A 4K8ZA 4QKBA 4XF1A 4CDUC 4FZ1A 3HR0A 5JVDB 5F39A 3MICA 3AP6A 4JGZA 1G4YB 4TUYB 4I02A 4ZHQA 2ZMNA 1W06A 4IE4A 4LE4A 3L75H 4CDQC 2VZTA 3DSQA 4QKFA 4I4TB 4GZRB 5FY1A 1HR0B 2KSDA 5KMGB 1GMMA 3I3QA 5KA6A 2K2SA 1W2TA 2A70A 3JSNA 3BTZA 3DYPA 4JI1B 3H1HH 3T0BA 2JDZA 4J9YB 4H37A 4CDXB 4XIKA 5FV3A 1NKGA 1ZWIC 3GWOA 3CRRA 2JDMA 2RMU1 1KP2A 3R4DB 1RL3A 5AC91 4L99A 1HRI2 4H7LA 2K9PA 4B4PA 3K46A 3S57A 4FCAA 4J7KA 5K8SA 2FDJA 2Q0OC 4RS5B 2WWWA 1OF4A 3ZRVA 3VKNA 1W6QA 1RUJ1 4AQ2A 1D7PM 1AYM1 3CX5F 4QD2A 1M57C 3ON7A 5JJNB 5A3OA 1CR7A 5FZBA 3QACA 5A7WA 4Q26A 5J2TB 4IV1C 4PD4F 2YIBA 2XJSA 1NKDA 3BOWA 4CDQB 2BFUS 4IGOA 2OVUA 1XPWA 1C3HA 2GALA 4I0XB 4FPGA 1UX6A 3LA7A 2Y6LA 4JI1O 3W7UA 4IIJA 3ABMC 1UU6A 4FO9A 4XJUA 3ZMVA 2BWAA 4QX5A 2QJ1A 2G9GA 1V6NA 1W8WA 4QXHA 1M90W 1A6CA 2ZHLA 4LBQA 4AVBA 1PZ9A 5LCWL 3H7JA 4AEMA 4QX0A 3BA8A 3LDKA 1LUWA 5C3QA 1I94B 1IG3A 1BBT3 1F7YA 3BI3A 3CJXA 4DIQA 3AP4A 5FMDA 4O9GA 1K9MW 3M2MA 2DWEC 4Y1YA 1PP9H 4J80A 1XNKA 3THPA 5C3SA 4IYHA 5CZKA 1EUTA 2CL2A 4BCUA 1B35A 5L3GA 4XQWA 3U4SA 3CZJA 2GP5A 1PM4A 1K8AW 1COWG 2E3CA 4QIWF 3NJVA 1VBA2 4AG4A 2WS92 4WFGA 3DYMA 3E2EA 3DCQA 2YFZA 3NXSA 1BXHA 3OPTA 4IV1B 4F6EA 1HKDA 4AGGA 3SPJA 5CA1A 2R72A 3RYRA 3HJRA 3AC0A 1AJQA 3RYIA 1IBLB 4EE2A 3BB6A 5L73A 4LC1A 5CMUA 4IETA 4OHZA 3T3YA 3ACHA 3ABMB 2DBIA 4EN6B 3ZYFA 2ZR3A 1I94O 3V0AA 3L70H 2V73A 4U3FH 2WWUA 3O0VA 4Y1UA 2WWJA 2Y6JA 2GUZB 2LJ2A 1DP0A 4UCOA 2WYSA 3KVBA 2XUEA 3SYAA 1GUIA 2JDNA 3AJZA 1LR5A 1LCLA 4UW6A 2LUWA 1Q90D 4IERA 1I5ZA 4R9DA 1CEZA 4WM7C 2F95B 3OM3B 4LWSB 4XETA 1QR9A 1OUXA 1IKPA 3UKMA 5LBQA 4RR3A 1QOOA 1AR81 5C3PA 3VKOA 2RJ2A 4BXSV 2H0VA 2WINB 1Y76B 3CJHA 4FTEA 2LGWA 1J5EB 1NZCA 3R4UA 4Y5Z0 3UYJA 4J41A 3GWKC 2L6LA 3CIHA 4WM8A 4O2AB 4DV3B 3CB2A 5BNPA 1AILA 4C7UA 1QJFA 5FDBA 1KDKA 1RUE2 5APAA 3CE2A 2DCTA 3FLPA 1MPXA 2RQ6A 4EWAA 3NKGA 2RE9A 2DFBA 5CU1A 2BBAA 3W20A 2WLKA 4MZUA 2P7TC 3JD72 1DGRN 3RW0A 4JHZA 4HN1A 4A4AA 4NAMA 4LCUC 2F4LA 5DDJ3 3NWKA 3SKVA 1FXHA 1RUH3 3UV9A 4EFBA 2QSAA 5FZDA 1RUD3 3U78A 1N33B 3OJBA 1WD4A 5JR2A 4W6WA 1J5EO 1QLEC 4NJ4A 3N7JA 5LASA 4U3JB 2B1GA 2YROA 2GNMA 4DV3O 1N47A 3LDBA 1Q81W 2P3KA 3FD9A 1LOBA 1FI2A 2SLIA 1VB2A 2J1RA 2FTKA 3WQ1A 5F6KA 2ARCA 1EAH2 5D5PA 4P14A 1QHDA 1UZVA 4DK1A 2EBOA 2B42B 2WKKA 5HXVA 1RM1C 2D3PA 2W1WA 2W0FC 3W7WA 2PI5A 2Y0PA 3B3QE 1RUF1 2FZ1A 2ZX0A 5B2GB 2R062 1BEV2 3JAWA 3J8F2 4GXLA 3BPZA 1UFIA 1H1AA 2A5ZA 1T6GC 2ZD9A 3RZKA 1WW6A 1FXVA 1VBB2 1V6JA 4YM1A 4DYLA 4OZXA 1ZX3A 1N33O 1FJGO 1R092 1RUI3 3SYPA 3WR0A 3DPRA 4P5HA 1SQGA 1W6NB 5H9PA 3ITQA 4ISQA 4MHUA 5T50A 1ZYBA 5A7PA 1SQBH 4JGZC 1W8HA 3B5LB 5CG9A 3GHMA 5K0UB 5JXIA 1OSGA 2NLRA 1YJLA 1QJU3 4XURA 2PAMA 5JWPA 3SYCA 1XMOB 1YXWA 4DUVA 4HONA 3AK1A 5JOWA 4OQ9A 3HVDA 5A6XA 1S0BA 1QJEA 5CKNA 2J1UA 1N3OA 3CCUV 4R4XA 3M3QA 5HCBA 4BW9A 4R7CA 1UY1A 2UUAB 4K21A 1RM1B 1W0OA 4LT5A 3ZFFA 1VR3A 1LNSA 3AB0A 3WZ1A 4FOQA 1FAYA 1WBFA 2JG9A 4NRMA 2ZHKA 1CJDA 4AAPA 1Q8SA 3FX7A 4PT6A 5CADA 4IT5A 3ZHSA 2XWBB 5KHJA 4QPIA 1WMEA 4CEWA 2GC3A 3RSJA 3THTA 2AR6A 1OF3A 2FMLA 2I45A 1PMHX 4IEZA 3OTFA 1HQLA 5IAVA 3EJKA 3FUOA 3KT7A 1GU3A 4PA3A 1R3KC 3JASA 1UMZA 4JGZB 1R3JC 3MYXA 4GWMA 3D3QA 3K9SA 2WIIB 3K4ZA 5BXZA 5IW0A 4ZHQB 3G6EV 4LUKA 4MUVA 3KCYA 4EN8B 3NV4A 4DV5O 1CQ9A 2E33A 4PA9A 1HRI1 1OFSA 2ZE5A 1UJWB 1JBCA 1OLMA 2E51A 5K7PA 1VAMA 3MFCA 2JB4A 2BOJA 5LA2A 1JZ6A 5DZFA 3OGCC 3DV8A 3HKEA 5JOXA 1ZUQA 1GO3F 5IT6A 1SLLA 4F83A 3NJXA 1XHZA 4QE9A 2HEWF 1YIJV 5I91A 4WVVA 5EWSA 1Y4WA 2WJSA 1DQ6A 1YRZA 3PUAA 2YBSA 1SETA 2W52A 1KKCA 2NN4A 3FN9A 3WG3A 2A9HA 4R4ZA 2VOVA 3WW1A 3SH4A 4AQYB 4AVSA 3G6BA 2CDOA 3O7OA 4DV1B 2VM9A 2H94A 4UCSA 5FLHA 5FJKA 2PA7A 5JUVA 4A2UA 3LNMB 1ZX5A 1LENA 4AL9A 2CTRA 1UY2A 1W6QB 2YC0A 5B1OA 4B1MA 3ILNA 2RDNA 1UYPA 3S30A 5BXXA 1HRI3 5A7WB 2D6MA 3KMHA 1AVBA 4AI0A 1AZDA 4A7KA 2ARBA 5FIXA 3NNGA 4GQ7A 1NLSA 3RJRA 2P37A 2ZS6B 5I8SA 4IIJB 1XILA 3PN1A 3C7GA 5FWEA 3VZNA 3Q8FA 3R66A 2QJVA 3D36C 1W2UA 4W6XA 3POBA 1Y74A 3DC5A 1J84A 2UXDO 1GKFA 1Y67A 3O5SA 4Q4W2 2WS91 5LRRA 3M7MX 2NR5A 3ZHTA 4IL6Z 2RHPA 1HDKA 2XMLA 4AQYO 2AGSA 4DV1O 2RS11 5E6HA 5CA0A 4QDQA 1SZBA 2YB7A 1PMJX 4P9WA 3CHXA 1SA0A 4M00A 2VQUA 4NIAA 2W1UA 2H0BA 4LK7A 5IVJA 3WINE 1RIRA 1PKXA 1QMJA 2XVGA 3ZFGC 1OC1A 4A6SA 3B09A 5AVAA 4X1IA 3C7FA 2AUYA 2R16A 5BMVA 2OX0A 5JIUA 4A3ZA 4RQEA 1QEXA 3WSOA 1HP8A 1YFWA 4PF5A 4S2GA 5CA1B 4QX8A 3RYIB 3BA9A 1OHFA 3WEZA 1VBA3 2WS93 4L8QA 4RWUA 5CB4B 3I2OA 5CBHA 4P9PA 3V0AB 1H4GA 1W2OA 1UIKA 4URTA 1AXZA 4COUA 4QGLA 4QX1A 3ZMZA 4NIIA 5HCHA 1Y43B 3RMXA 5HFMA 2XLFA 3PMEA 1I5YA 4IGPA 2JG8C 4OX9B 5GALA 2WO2A 2VBPA 2JICA 5G05L 4DR3B 3E83A 4ZKIA 1QVGU 3SQOA 2CV6A 2VMDA 5KR7A 4JI7B 1HW7A 2P6CA 2ET7A 1ZZ8A 3BTYA 2JGDB 2K9ZA 5EJ3A 4I3GA 4TQFA 1JU3A 4V2VA 4LR3A 2D2CB 1XUQA 3AMPA 3JARA 4R50A 4YLZA 1CAWB 2BTQA 3N9OA 2X6CA 2P5OA 3CJHB 3AKTA 3ZXJA 5FR3A 3C90A 2DF7A 3OR7C 5GONA 3AG2B 2EALA 3N9LA 5TISZ 4G27B 4BQ5A 4KGQA 1UKRA 2WLIA 2XJUA 3WNNA 4CC5A 5BNPB 2UXNA 1WA6X 5IVBA 4UXAA 3ROUA 1OBNA 1JYVA 1OVSA 1SRYA 3ABKB 3AMNA 2EAAA 4OX9O 4OULA 1H1IA 4J7JA 4BIFA 4DR3O 1AJNA 2OT7A 1QXRA 3O1OA 1ALYA 4JI7O 4DV2O 1F31A 2JG8B 2GNBA 1QNYA 1PL0A 3TCUA 1PM9A 3CWBH 1COV1 1RUE3 1BMV2 3J7MA 3LDRA 2QEXV 4UVBA 3IAYA 3MW2A 1SBEA 2PAKA 3Q4HA 4XACA 4CCJA 3N2GA 3SNMA 1AB3A 3JD73 4BOWA 2VL4A 4CU6A 1WN7A 1EN6A 1YQ6A 1BEV1 5JXJA 2QKAA 4Q4V2 1URXA 1UX7A 5LY1A 3ILRA 1FYUA 5DZEA 1VBB1 4PQQA 1H6YA 4A3XA 2WQ4A 2QKDA 2E76B 1R091 2DVAA 1MVEA 5CYYA 4PV1B 2Q8OA 4X65B 3ZFFC 2VWKA 5KWRA 1THZA 1XU1A 2JG9C 4QM9A 2EJ7A 3M3EA 1EAH3 4CE8A 1EM1A 1AR72 4PDLA 4L0PA 1KJRA 4D7YA 2PHUA 1OFNA 5AG2A 2QTOA 4NXMB 3FE5A 5J36A 3I54A 2HLDG 2R063 1BEV3 3J8F3 2Q8CA 1BT8A 4O61A 1AR5A 2RS52 1X59A 3S7IA 4P30A 4Y20A 1R093 4GAZA 2AACA 3HNMA 3S6PA 4W4ZA 4X20A 5A3WA 5DUWA 4MW3A 4IEYA 3AJYA 4X65O 1YZBA 3CDZB 5IY5C 1W39A 2QQPA 3R65A 1DGLA 4RFRB 1UIJA 3EHBB 1BS3A 2P4EA 3ZFFB 4F4LA 1RUG2 4MXWA 3IAPA 4FFBB 1UOFA 2XVLA 1YUDA 2VWJA 2FDKA 2XL7A 3JSLA 1NE4A 2JG9B 3K04A 1SMVA 4UXNA 2QWNB 1LU1A 4NXMO 2WZ8A 1HXS2 3D6EA 4QPIB 4CEWB 3L71H 4Z82A 5LA9A 1IBMB 4CH3A 3VBHA 1K5MA 3I2HA 1UWWA 4AEDA 5FPLA 5A3NA 2OWOA 3K79A 1FX5A 3TN92 3PJYA 5FKCA 3H1MA 3SHRA 2VUDA 4XAEA 2Y38A 4GMP1 5HI0A 2BQPA 3JASB 2C0ZA 1YLLA 5IYDO 4CVUA 5J2UA 4DQAA 1PD3A 1ACCA 3KSCA 5DABA 3T08A 5JQGA 1ZBA1 4LJHA 2LFRA 3HIFA 3QNEA 2NZ9A 2A6VA 5IY5B 2J1TA 2ZIOA 1LEDA 5GW7A 4RSUA 4CCMA 5LA6A 3OGJA 3CQOA 4IXLA 3ZSEA 4YVWA 2IUWA 4QPJA 5GZCA 4X1YB 5CEHA 3GZAA 5DUUA 2JDHA 1F8VA 1YF2A 4LF8B 5FWJA 3BAAA 4QMAA 3MGUA 2HWF2 4QB6A 1AP5A 2Z5WA 1JR9A 3MLKA 5FXXA 2RM21 4GMP3 2DVDA 3SR2C 4X6QB 2VZUA 1EP0A 3WB2A 3O12A 5LMNB 1GWMA 2BUKA 3T30A 3NMBA 5FO8B 1MS1A 1UQXA 1XSRA 4BJ0A 4Q8LA 3B02A 4OLLA 1YQ5A 2YBPA 4FP3A 3VDAA 4O4IA 2BCCH 3ZN4A 1O3TA 1OCRC 3CF6E 3FC0A 3AEIA 1R6NA 3QH6A 2AHYA 2D44A 1XRUA 1VQMV 3FUQA 3ZMUA 2C1FA 1M9NA 1E5RA 4JRLA 3PUIA 1FKAO 1H2MA 4MTOA 4JTOA 2ZDIC 3I97A 1KMIZ 1GM8A 2R0FA 3OR6C 4LF8O 4QPGC 5I8YA 2Y48A 2Y4TA 1PPJH 1QNWA 1S2EA 5CA0B 4LO4B 1OUSA 2BP6A 4WZFA 1GNHA 3I55V 1NTKH 2VUAA 5IE9A 4GKXA 5LMNO 3JB8A 1XL6A 5FYBA 1GKBA 3SXWA 4Q4W3 2IZWA 2ZX1A 4CP9A 2VECA 4MTGA 5CFDA 2GC2A 4GMP0 1K5QA 2YIBD 2Q9LA 2PHTA 4Z1VA 3EQEA 5H9QA 1OXCA 4P5YA 1J59A 1NBMG 3GALA 4KP4A 3SDLA 5F3IA 3M70A 1U5YA 2GNDA 3GBGA 2D43A 2AYHA 4NXNO 4XFAA 2VVEA 3H1IH 3RYFA 3WDXA 1OA2A 2OUJA 1CPNA 2WNUA 2JE7A 5F2VO 3KF5A 2VTXA 3NV2A 1DZQA 1NA1C 1OPMA 1XE0A 5A80A 4L97A 3G80A 3CMAV 1FXKA 3HN3A 1QH6A 4YZ2A 2A6YA 1NOVA 4HYOA 3OOXA 4EV0A 4XEZA 2L9LA 3E8HA 4EYUA 3KCCA 1DYKA 1KBHA 4KHPB 3SKJE 2FZ2A 4R9BA 5J98B 1NTMH 3CKHA 1YIFA 1N1TA 3H3ZA 1J95A 2QTSA 2LFSA 4LKDA 3OGRA 4DPNA 3FB7C 2VMEA 3POFA 3TYJA 1PGW2 3JARB 2IJKA 1J3QA 5FP9A 5G04L 5CBFA 4Y5TA 2ORZA 2FMDA 4YFZA 1JHNA 5IYZA 1KQRA 2VCCA 2B5HA 1OOPA 2OTJV 2HWD2 1B04A 1V0AA 2WLIB 1NVPD 4R8HA 5C7GA 3ZYPA 4PHZA 4H2AA 2Y60A 4DV4B 2QM7A 5LXTA 3NO8A 4FT8A 1JA8A 3J26N 3UGFA 5GZGA 1KEXA 2OQ7A 3RYPA 5JXHA 1NA1B 2FDHA 2AZ5A 5FKBA 1LGBA 1OVPA 3HKCA 4KHPO 5LGTA 3AK3A 5JSOA 4P9IA 3SC7X 3CRCA 4WVWA 2AH2A 2FCVA 4MHRA 1L1FA 4ASLA 5BV6A 2R9RB 4E2LA 1GTOA 4MO3M 1CGPA 4IEXA 2MEV2 5JXGA 5CFCA 1G7YA 3NR7A 4EFEA 2BVVA 2CTPA 4ES9A 1BZWA 4FVMA 4I3PA 4C8DA 5JPMB 1WLCA 1OMIA 2EJRA 2FHRA 1VF6A 2A71A 1A8DA 3CCJV 1SKVA 1LOFC 1JMKC 3UT0A 4J1XA 3LSEA 2LS6A 2W92A 2X09A 4X8PA 2ARAA 4RUEA 4DV4O 5B5EZ 2E7QA 4AEJA 1QJX1 4AVCA 3ZYJB 2JGUA 2Z79A 1OCOC 1POV1 4HK9A 3CP1A 5IFTA 1PVC1 2J1EA 2W87A 4L87A 1AI6A 2C6SA 2G38A 4UYBA 2QA4V 3ECQA 4Q4V3 2DQ3A 5JOZA 4DUYO 4UCVA 1M56C 2RS51 3JCZA 2ZGMA 3LUTB 5JPNB 4MS2A 3GF6A 3DKQA 3VBOC 4I0BA 4XBNA 3GZUC 2B9VA 5GLVA 3CXHF 5EC1C 5LEKA 2HP8A 1VP6A 3CC2V 5FYMA 1RYYA 1K5MC 2WAAA 1HV1A 2HWE2 1N3PA 2N7GA 4D3WA 1X8EA 1K42A 4NVPA 2AENA 3BN6A 4JC1A 1STMA 4UVAA 4TXWA 3C3TA 4YG0A 1YHQV 1AR73 3F7YC 1QOTA 1OQ1A 4EB6A 1W9FA 1SPPA 1I7FA 3M7AA 4BE3A 2UWCA 1UY3A 1K5SA 1GNYA 4X20B 2VCBA 4HKWA 3TEWA 1WJZA 2ERFA 4LPLA 1YI7A 4XBLA 2PMWB 2RS53 4MTFA 1LEMA 1WA8A 3GBFA 1OCOB 3DYOA 1ND2A 2KB1A 3CCSV 3T2PA 1LR1A 4YW2A 1F4AA 4OUEA 2H8PC 4MXWB 3T1YB 1XDCA 1XSQA 3WF0A 2IJJA 3FL7A 5FXWA 5IK8A 5IVEA 1OT5A 5A7OA 4K7JA 2PHFA 3OUIA 3E35A 5FPUA 5B1BB 1OHHG 1VALA 5FY5A 4UF0B 4DXSA 2HG5C 3IPVA 3VHRA 1RUG3 3WB1A 1K5MB 3ZXAC 3VL9A 5F8PA 1H9PA 2JDAA 2CNAA 4BWAA 1HXS3 2WLLA 2ARHA 3R0RA 3SH5A 2ZTNA 3KCXA 2IXJA 2A3YA 5FQ0A 1Z5WA 4FLXA 3OUHA 3ES1A 1C8M2 1RXFA 3A21A 2HWF1 2D98A 3TN93 2XAQA 2PZSA 1FATA 1UZWA 1QGLA 4Q4Y2 4OHYA 4WVMA 4CEYC 4BU2A 2ZXWB 2C9AA 3NV3A 1GP5A 4XJAA 4NB5A 5LA6B 2QWQB 2QCSB 4COZA 4LKFA 3AZWA 4YVWB 5A6ZA 5A1AA 3CSXA 5F32A 3BUCA 2ZA9A 2D6PA 3LEKA 1WGPA 3OSDA 1L0NH 3VBUA 1YHFA 3OGSA 1FT9A 3D5OA 1XE7A 4H7MA 2XBO1 4IL7A 2DJVA 2O8OA 2QQUA 1WMXA 4FMTA 2XLAA 5LEJA 2A3QA 3OCPA 3B9CA 4I30A 3RNSA 3WG1A 2DVFA 2RDRA 4YPJA 1XMQB 2NLJC 5T5PA 1H4HA 1HNXO 4PELA 5DAQA 2YXYA 5FZOB 4XXAA 4RHV2 4PA6A 4N7UA 4U7NA 2ATFA 4FM0A 1TME2 3AZYA 3OEHG 3WDYA 2P5BA 2WN2A 2PN5A 1YQ8A 3CEIA 4O4IB 3JD3A 2ITDC 4HSLA 2WFF1 4PJ0Z 4FFHA 3AFGA 3J7NA 4AQSA 3BY6A 1NR7A 4CEYB 4CDWC 5ANNA 4DB5A 1FFTB 4HFSA 1DIWA 3D4KA 2JWPA 2ZHMA 4FPHA 4JGYC 2WNUC 4JKMA 3MI8A 1JOYA 1XJAA 3JCIA 4LNUB 2VAUA 5FLJA 5FPXA 4UBHA 2Y34A 2QQJA 1MQTC 1YJKA 3VDDC 4GUNA 3O1RA 5FZEA 2QDNA 4JV5B 3DKWA 1XMQO 3KGZA 3ZR6A 5IVFA 4XFIA 4Q4X1 3KVAA 2O8QA 2GMMA 1YI9A 4N90A 2JEMA 4GX1A 3ZXKA 2AZ2A 3FKSG 2ARXA 3CBNA 1BGYH 4AE2A 3RMYA 3EXUA 3B8MA 2Q7GA 2YXHA 4CP9B 2E32A 5KUKA 3MEPA 5CFDB 2WZR2 1K12A 4O65A 2HEYF 2PY5A 3LEIA 3AX4A 1Q3EA 4OCTA 5D8AC 3ZHVA 2WDBA 2OIGA 1PX3A 2CE4A 2YGMA 4JYAB 4FFFA 4JI0B 1ULFA 1HIXA 1J58A 3OY8A 1Q8VA 2LALA 1MOFA 2VRZA 1HB1A 2R9IA 3GZEA 2GV9A 4M3CA 4FXKB 1OH4A 2F1MA 3VBRC 1TA8A 3P5BA 3ZMOA 4CCDA 3RYFB 2QQNA 4HT1T 3K4DA 5F9TA 2WNUB 4X1KA 2IVJA 3HN1A 1ENRA 3ABZA 4JV5O 4BIOA 3SEEA 1PGW1 1U5XA 2D3RA 3WP6A 1EUUA 1FFXA 1MQTB 2XONA 1FXKB 4IE6A 1W6PA 2XDVA 3LDDA 5EZYB 5FYHA 4GIQA 5IJ0B 5E1AC 4LO6B 1VMJA 3QO8A 5CG8A 4DEQA 5LK5A 1PNMA 2NN8A 5EBMC 3FFZA 2CAUA 2HYKA 5CFCC 1R1ZA 1MR5A 4IE0A 3C3VA 4S2FA 1NI8A 1POQA 4DY5A 2J1SA 1ULEA 4KH9A 4FTBA 3EXAA 4JI0O 3TJTA 2GZWA 4W65A 5D8AB 5IDJA 3AMMA 4OVEA 1NX9A 2OTLV 2DVGA 3NKTA 4IDZA 1O3RA 1QLNA 4FPPA 5IWAB 4ASUG 5BR8O 4YZ3A 3UT5B 1CVNA 4NPMA 1G9AA 4M01A 3WQ0A 5FXVA 5IYZB 4XDLA 3BGAA 1OOPB 1LKNA 5L7OC 3WV6A 3WG7C 2MEV1 5C4WA 5GLTA 3VBRB 2UXCO 1OCCC 1IS5A 2E6VA 3S7EA 4GKKB 1W04A 4JF3A 4E27A 5LXTB 1U12A 4ZKTB 4K8XA 4QHZA 1N36O 1DCSA 4P08A 2HWB2 3ZPOA 3HBZA 2HWD3 3HKCB 1QJY2 4JQTA 4KBBA 3IN9A 4Z2AA 1BVVA 4D0QA 2KG7A 3WHUA 2E5LB 5K4LA 4I9QA 4LIUA 1TVGA 5CFCB 2Y6FA 5F2WA 3J7HA 3B77A 2EVXA 3OGGA 4ZS2A 1W8FA 5D2AA 3RZLA 1DBNA 4NHYA 2C9KA 1LULA 1W9SA 4UFLA 4ZPIA 4DNYA 2FB5A 3BYWA 3NNMA 2MEV3 2GSYA 2E31A 1Q56A 3Q8AA 5FZ4A 1TNRA 1BVP1 1F35A 2WO1A 5FOJB 3PTRB 5L7OB 1BKZA 3WG7B 1YYNA 5A6QA 4IEVA 1BHGA 1VQNV 2VZPA 2H6CA 5C71A 1GWKA 1D0HA 1RHI2 4BPZA 5L36A 3DL3A 3D82A 3WVJA 4CCKA 3I2IA 2VQ0A 3CJIA 5IYYA 3TEXA 1E5HA 4URAA 4PIXA 1C5IA 2PLV2 4M4RA 2DCYA 1D5AA 5EYXA 5DUXA 1XNTA 3N7LA 3VBSA 3RYCA 2BGPA 5IVVA 3RZGA 2QKCA 3JATA 1LUVA 2YXLA 1BZKA 4AGRA 3QVNA 2GMEA 3FMGA 5A9GA 3DGEA 2CWSA 3H3UA 1DGWX 4EB6B 4D8MA 2HWE3 1XNRO 1SPPB 3GCWA 4NHLA 1KS5A 3P1IA 1HRV2 3ZHRA 2Q5TA 2V72A 3G67A 5FUPA 3ZFEA 4Z07A 3E8BA 2ZAHA 1AR91 2XQRA 5JIAA 2XXZA 4BZ4A 5FTTC 2IBZH 1SZXA 1AROP 1DZRA 2JS5A 5LWBA 2OIEA 1ND2B 4UAPA 2LO1A 4HPKA 1SFYA 4HZ3A 3AZXA 3T2TA 1UD1A 1WWYA 5FMOL 1ZA4A 3VZMA 2Q7EA 1S72V 1N1YA 4RUFA 4QX3A 4LFCO 3JXSA 3SPHA 3LPFA 3RYHA 3O65A 2EINB 4YY3B 4Q4Y1 3W5MA 3IPVB 3SJCC 1EV12 1KFXL 2H3OA 5IWFA 2IFRA 4QX7A 1GN2A 5LA1A 1VQOV 4GWIA 1IURA 1PNLA 4QGNA 1VRBA 2WLLB 4LUMA 2Y4UA 1NXD1 1LHVA 2XPJA 3OBZA 3OT7A 2Q1MA 4YG6A 2WLHA 4OHVA 2PGGA 1NZ6A 5FYUA 2C26A 2VH9A 3VDBA 4OPHA 4YWAA 1AR1B 4AILC 5FUIA 4N9HA 4WVMB 3VLBB 5A3UA 4LF7B 2Z5UA 1MSDA 4KFMA 3SJAC 5C9AA 4WV8A 1C8M3 4BK4A 4TV9A 4HSJA 3C7EA 3CCVV 1TE1B 1PGL1 3ZN5A 2IXCA 1W2BU 3CNAA 2A06H 1TUBA 2AW9A 1E1QG 3T4HB 4P02B 4YY3O 1H9WA 3T4ZA 1P7GA 2ZCEA 3P30A 1EYBA 2XJTA 3VBUB 4HKOA 1Q8PA 5K1PA 3S5QA 2LW8A 2NMNA 2A6ZA 2JECA 3N3HA 1EN4A 1O8PA 2E63A 2EIEA 5JOYA 4UCTA 4DRVA 3SCGA 5KLVH 3K2OA 2CTVA 5F5AA 3VZOA 4J6GA 4E4ZA 1JFFB 4I9WA 3N7KA 3AP5A 4PA7A 3LWCA 1S5LZ 4JPRA 1UL9A 2DU0A 4LBOA 4LBJA 2JD4A 4YM3A 1CONA 3U10A 4PBPA 3CRQA 1O9GA 4J11A 1TMF2 4XDOA 3TXQA 1WB8A 1H2KA 1JI6A 4LF7O 1PK6C 3WP4A 4RHV3 2GN3A 1PNFA 1IXMA 3WP3A 1TME3 2FDIA 4TSFG 5HFLA 2AXTZ 2XAGA 2EILC 4KMQA 2VGDA 3NQHA 2Z3YA 1SZTA 3VOUA 4JTAB 2XH6A 2DN9A 5I0SA 4PDRA 1VF7A 2JX9A 2OCCC 2W6IG 2ZX2A 4G9SB 5M0TA 3WNPA 1U0AA 3K59A 3KV6A 1Y4MA 2F17A 2D6LX 3K06A 3K5OA 1PO22 4XFGA 3ZRWA 3IZOA 5B66Z 4ZZ8A 1FOD2 2QWOB 3FJSA 3A23A 3VV1A 4UV8A 5KXCA 1WLEA 4UFMA 3PHMA 1K73W 4LQRA 1XQ8A 4XHXA 4QQOA 3UKVA 3MPBA 1SACA 1GWLA 4CPBD 3SJBC 1HWYA 5T5LA 5DECA 2ZT9B 4LBMA 2QR4A 3H8RA 2VMGA 2A7WA 3LOIA 3ZXEA 5DG1A 5GZFA 5AFBA 3OY8B 2IJHA 2WZR3 2GC1A 1H2NA 4I55B 1AUYA 1GOHA 4C1WA 4M3CB 5C4WC 3C7HA 1GZCA 2ZNIA 5FOBB 4HLTA 1SQXH 2EILB 3IDCB 4JI8O 3OPWA 3RZJA 1BYHA 4X1KB 4MLOA 1W9WA 3RWRD 3OB8A 4LHSA 3U14A 2GTSA 1BLZA 1CIWA 1UXXX 3FFQA 3L2HA 4M0NA 4DY3A 1FFXB 4JYCA 3AYDA 2Q8EA 5L3EA 4YGBA 5KAIZ 4WBBA 3PUHA 1WNSA 2Y8KA 2W6JG 1WMDA 2UY8A 1KQSU 4GX5A 1VQKV 1WKYA 2UUCB 4AVTA 2ZBJA 2VY0A 5ABJA 2XWJB 2VZ3A 5L3FA 1S0DA 4EZ4A 1MEC2 5D1IA 1JJ2U 1DU3D 3WUDA 1K7DA 3BU0A 3CYOA 4Z2WA 4QQLA 1DHKB 1D4M1 2WSSG 3WDVA 2PHWA 4CCOA 2ADEA 1NCQC 2HWB1 1VQPV 4IW3A 1Q6IA 4DUWA 3OMNB 2HFEC 5GLUA 1VQ6V 1ZRFA 2HEVF 4MG2A 1UXZA 4LEJA 5IATA 4QT6A 2DU1A 4ES8A 1Y9GA 3BEHA 1BQ0A 3MW4A 4QQPA 4D94A 5C4WB 1N1VA 4DW1A 1Z7S1 4GH4A 4HVRA 1G9FA 3DEMA 5ISLA 4COVA 2IC1A 2VZOA 2UUCO 4KG0A 4KWJA 3LIGA 2LRPA 1SBDA 4FM1A 3K58A 2PYLA 1AX0A 2Y6KA 1JZ3A 2R6QA 2EA7A 2KG7B 4LK6A 3K3NA 1GR3A 1ND3C 3AG4C 3AK2A 4XUOA 3MUZ1 1IG0A 3KZ4C 2YXSA 1A34A 5T5JA 1L7QA 4MV2A 1H8HG 5KXEA 2WC2A 3VB9A 3QO7A 5H2FZ 3BVCA 4CC6A 1Y7BA 3I3EA 2HWB3 2Y69C 1QJU2 5CIRA 1O5LA 2VZQA 4UCUA 1SDWA 1QJY3 1HB2A 3CCEV 4FK5C 2BGOA 3SYQA 1OLQA 4TLGA 2Q30A 2X5IC 1OLME 1NCQB 3WY6A 4D69A 3POEA 4NRPA 2KD7A 3VD7A 3JAMN 2PLV1 5FZ9A 4CXWA 2Y0IA 2Q6AA 1RSOB 5BNOA 1M93A 4KGGA 3T0AA 2Q68A 3W59A 2JDKA 2YEVA 3VKMA 5JH7B 5CN0A 2PUSA 2A6WA 1V9U2 2ZR2A 1UZZA 1H6XA 2RS33 2VCMA 4META 1JYWA 1X7NA 4LA3A 3OAAG 4DXZA 3LIHA 3M3CA 5FYYA 3D3IA 4QDSA 1HRV1 3CJIB 3MIHA 3I4IA 1DDLA 5FREA 1DG6A 4AQ6A 3WQBA 1KJLA 3AG4B 4AVVA 2X10A 2DTYA 1RHI3 3PURA 3VBSB 1LESA 3RYCB 4GZ9A 4JI6B 4XUTA 3JATB 4P9YA 3B93A 5ACA2 4FI9A 4RS5C 3AZVA 5A2QN 2PLV3 2X5IB 3IIIA 2PHXA 1OLRA 5C8YA 1NCRC 4IGQA 5JCOA 1GZ9A 1RC6A 1QF3A 4JRAA 3JD2A 5ITZA 2ODMA 3ZFEB 1G86A 3VL8A 3HPLC 1EV11 1RINA 1ZLZA 1NG0A 1WPBA 1IVSA 2Z4FA 1YTFB 1CD3G 3ACIA 4HPKB 2LROA 4B29A 3T1HB 1HRV3 2ZIMA 4BH9A 4CS4A 4V2WA 2WLQA 5C5TA 2CDPA 4KNCA 4CU9A 1UPIA 3LFMA 1GYKA 5FK7A 5ANQA 2HWC3 4O4HA 1BQPA 1ST8A 3ATGA 4DR5B 2EIMC 3VBFA 3RYHB 3C8XA 3SITA 1VE0A 4Y26A 2R042 5A33A 2YPDA 3FYEB 4OI2A 4FPFA 4B7KA 2YGLA 3MLJA 1BBT1 3MIFA 4LORA 4XUNA 4L9BA 2KQXA 2JJ6A 3DGTA 3AM2A 1X50A 2GDSA 1DZTA 1EV13 1BK1A 2QDRA 2E9QA 3ZRXA 1TEIA 1ULOA 1NCRB 3KV9A 3GB7C 1XNQB 3IDEA 1HR0O 2Q7HA 1BMFG 4RQPA 3SGIA 3IBMA 3T1HO 4QJFB 5KHIA 1BHBA 2BJSA 3M3OA 3WNLA 4FSJA 1W05A 1K92A 1YQCA 2XJQA 3PVOA 3VZKA 5C9AB 3JUUA 3PLQA 3OW2U 4TV9B 3I59A 3ZO0B 3TB0A 4LR4A 3OUJA 3QTCA 4DR5O 1WW5A 1RVF2 4FQ4A 3I2JA 3Q8CA 5FYZA 3TEZA 3EFFK 3IT8A 1GQPA 3KM5A 4CXXA 2VZ1A 4YW7A 1YFUA 2EIMB 1AR4A 3A0KA 4XJZA 4FOWA 3O1VA 2ZQMA 5A1LA 3ZKYA 2DCZA 1GM7A 2XGXA 3T1CA 1NLQA 5H6RA 3W5NA 2P3YA 1IOAA 4LIVA 2PELA 5L3BA 2OPKA 3WUCA 4QPYA 5FZ8A 1SLIA 3HOBA 5EFUA 1XNQO 1GN6A 4JI2B 4FZ0A 3LNNA 4XYXA 1W2AX 1WCSA 2R70A 3C7OA 4XIOA 4DMIA 4PLMA 2BSKA 2A1XA 3IWZA 5C8CA 2HJDA 3E8FA 1WW4A 5FXZA 4GX2A 4O4LA 4QB2A 4A7YA 3LEGA 3VHOA 1AL22 4HNAB 3KG2A 3VZJA 2W5FA 4J42A 1JVMA 3RBZA 3LA2A 3LPGA 5HXMA 1TMF3 3ZN1A 4TV8A 1N0NA 5JR7B 2IJIA 3ASOB 2VVDA 4QB1A 1REEA 1LECA 1PIV2 1K4CC 1VRH2 1WW7A 2ZGNA 3TBDA 1OQEA 2R49A 5EIBC 1AI4A 1PNGA 2ZM6B 3DF0A 2VW2A 1JZ5A 1Q7YW 3USSA 1W6OA 2D6OX 1BQZA 4JASA 2VU9A 4B7EA 4K9SA 1S0JA 4CCEA 2IXHA 2XASA 4BDVB 1KGYA 3E22A 1W9TA 2PQQA 4JI2O 4ZU5A 4LLFA 4PDMA 1C57A 3IMNA 3SYOA 4GLXA 4P9OA 2J22A 2OZJA 4Y22A 3BODA 1PO23 3T0DA 2LQTA 5C3RA 4JDOA 3U0ZA 1FOD3 2OXBA 1R6TA 5DDJ1 4CH6A 2CTWA 2DUPA 3JAKB 2WNOA 5LK7B 4WCEV 2IXIA 1RUH1 3H1YA 1IBLO 1RUD1 4XMIA 4K40A 1N1SA 3AKRA 4N53A 1ZSPA 4NKGB 1MEC1 3SCFA 2VJXA 4LF9B 3A4UA 3OFNG 2ZM6O 2D93A 2UYAA 1ZRCA 3ZMNA 4ZI7B 2XQXA 1KP3A 4X89A 1VQ9V 4CTEA 2JRIA 2X7RB 4KWKA 1ZZCA 2Y33A 3BABA 4NIHA 2AHZA 1R73A 4KWUA 3MW3A 3ETGA 1UKGA 3KZIZ 4DV6B 1GICA 3ZJZA 3DECA 3LCPA 2EIKB 1NH2D 5BUVA 2Q8DA 3ACFA 1HNWB 4ATEA 2WSUA 1ZBE2 4HXCA 1W8ZA 2EULA 1RFYA 1JOPA 3T2MA 4FLWA 3WF1A 1K3EA 1HN1A 4CU7A 3GM8A 4LKSA 3VGIA 3ZBHA 4QAWA 5FBZA 5DN2A 4L2NA 1RUI1 5K0UC 4QXBA 1MEC3 5BNNC