3U10A

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
202
structure length
202
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 61
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u10A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u10A02
2CV6A 1XRUA 2BNNA 1ZX5A 4WBBA 3BPZA 1GQGA 5E16A 5K8SA 3WW2A 2QCSB 2Z69A 3U0ZA 4XF3A 5FPZA 3SCHA 2ET1A 1CAVB 3NJZA 4MGZE 3HQXA 4IEUA 4QXKA 4Q0UA 3OD0A 4LTAA 4HMZA 1J1LA 4IERA 4E2SA 1VJ2A 5J48A 1QXJA 3D82A 3H7YA 3I59B 3SCFA 1UIKA 5LEKA 1G6NA 1RL3A 5D1IA 2EAAA 5BUVA 1HW5A 4ZU4A 4F7ZA 4J1WA 1UW8A 3H1YA 3KCCA 2KXLA 2IC1A 4Q29A 1ZZ6A 5LEJA 3NL1A 2IXKA 2I45A 5I0SA 5FQ0A 1YFWA 1SQ4A 2PHDA 3NW4A 4I01A 4I2OA 3NKTA 4Z82A 1O3SA 1I6XA 1NE6A 3H7JA 1OFNA 5FLJA 4AQ6A 3CEWA 3LAGA 4YYOA 3S7EA 3E5XA 3S0MA 1WA4A 3VHRA 4HN0A 5I8SA 4D7SA 1O3RA 1H1MA 3LOIA 1EP0A 3CLPA 1YUDA 1V70A 1WLTA 4ONUA 1OI6A 1LR5A 5KBFA 4XFCA 3S7IA 4YARA 3I7DA 5J7MA 1QY4A 4XF9A 2UYBA 4KWLA 5C8WA 1RUOA 1ZZBA 3PNAA 1ZRFA 4WZCA 4X6RB 3H8UA 4EROA 3NSTA 4HN1A 4R52A 3ELNA 3RYPA 5HI0A 2OA2A 1ZZCA 4I02A 3KGZA 4ZU5A 4HBNA 3DL3A 2OPKA 1YHFA 3ZDSA 3MPBA 2PYTA 3MYXA 2PHLA 4LEJA 4MX3A 4XF1A 5I8TA 3I54A 4Q0QA 1CAUA 4HSLA 4XF4A 3L2HA 3WW4A 3SCGA 1O3QA 3DV8A 3UKTA 2F4PA 4P9GA 4MGKE 2O8QA 2E9QA 2PQQA 3OCPA 4HLTA 1YFUA 4MUVA 4META 3CL1A 2UYAA 3H50A 1IPJA 1CAXA 2C0ZA 2VPVA 4ORFA 2GU9A 1CGPA 3WW3A 2PAMA 4EWAA 5JSRA 3FFQA 4I0AA 4PJYA 5CVRA 2GAUA 2HKXA 4IEXA 4NVPA 3QACA 2WC2A 4JTNA 1YLLA 4AQ2A 4BYYA 4XF0A 2IXLA 3BB6A 4IEPA 4JVAA 5FQ0B 4MV2A 5JSOA 1ZNPA 3IBMA 2MNGA 4LULA 3M70A 4MGIE 3E6BA 1UD1A 1EY2A 1SFNA 3LA3A 2XLGA 3ST7A 3RYRA 5J3UA 2O1QA 1Y3TA 3TNPB 3TNQA 2XKOA 1UPIA 3O14A 5E1RA 5BXXA 3SXWA 4IETA 1FT9A 4QX5A 1TQ5A 4CYDA 1DZRA 4AVCA 3SHRA 2UY8A 3ETQA 2EVXA 4HVRA 1VR3A 5I0RA 4X6QB 3D0SA 3USSA 1U12A 4ZU7A 2IXCA 5CU1A 5FDBA 4LUMA 2ATFA 3ES4A 5BPXA 5BY5A 4H7LA 3BCWA 3B02A 4QMAA 3FJSA 4N9HA 3RDIA 3ROUA 2H6CA 3MDPA 5FCCA 4I09A 5KHKA 4EV0A 2PTMA 2H6BA 1WGPA 1ZZ7A 2N7GA 3U10A 1CAUB 4F8AA 1O5LA 1O3TA 3OGJA 2MPFA 1J59A 1CAWA 1ZZ9A 1FI2A 4QM8A 4XFGA 2GC0A 1Q43A 3DKWA 4QGMA 1ZVFA 3D0JA 4Q0SA 5KHJA 4HVOA 4XFBA 2XGXA 3NVCA 3G7DA 4YSFA 2VECA 1CAXB 3LZZA 3SMHA 2XKPA 3IIAA 2CGPA 4UBGA 1XE7A 3DN7A 4PIXA 4EWDA 3UKVA 1OMIA 2WFPA 2GC2A 4IESA 4K8FA 5I0TA 1EYBA 3RYKA 3IWZA 1H1IA 4LA2A 5EFUA 3M3IA 4GULA 5T3NA 2GC3A 2UY9A 2D5HA 1RC6A 1IPKA 4QM9A 1ZRRA 2XHKA 3WW1A 1ZZ8A 4TLFA 3RZZA 1ZRCA 2IXIA 2ETEA 3EQEA 4IEZA 1Q5OA 4L2NA 2Q0AA 2K9ZA 4IEVA 2OYZA 1YWKA 3MZHA 4J1XA 4FAHA 3ES1A 4PIYA 3BALA 5FPXA 3H1WA 1PM7A 2BNOA 1QXRA 1J3PA 4XFFA 4YRDA 4KL1A 4LUKA 3KSCA 4AXOA 4L11A 4Z07A 4OLLA 5LRRA 1XE8A 4JV4A 3CJXA 2PFWA 1QWRA 4BHPA 4XETA 2H0VA 3E6CC 3CO2A 4DINB 4LA3A 1X7NA 2Y0OA 1X82A 3RPQA 1Y9QA 2B5HA 3HIFA 1PMIA 4O9GA 4OFGA 2PAKA 1LRHA 2BGCA 5JSPA 4D7TA 2Q4SA 2Q30A 1JUHA 3FE5A 4IEWA 4FAGA 1GQHA 5KHHA 4QGLA 3E5UA 2Z2SB 3EJKA 3H3ZA 2FQPA 3ACLA 3QOPA 4Q0VA 5KHIA 4WVZA 4QGNA 5C6CA 2PAEA 2QNKA 4KU7A 3EO6A 3E97A 3H9AA 2GH2A 5FLHA 1I5ZA 2IXJA 2B9UA 3OF1A 4KU8A 1Q3EA 2EA7A 2IXHA 2QJVA 4KWKA 4Q0PA 5I8YA 3LA2A 4EWEA 4MZUA 1O5UA 5JR7B 2QDRA 4KWJA 2VQAA 4XFIA 1X8MA 1CAVA 1LKNA 3HT1A 3FZ3A 3GYDA 3IDCB 4HVQA 2XLAA 1CAWB 3BU7A 3IDBB 2K0GA 1CX4A 2GZWA 3LWCA 2CAUA 4I3PA 4YNIA 4E2QA 4N9IA 1J3RA 2V09A 1ZREA 4B29A 3FX3A 1X8EA 2CAVA 3FWEA 4XEZA 1NYWA 3GBFA 2XL9A 3E6DA 3I59A 4E2GA 2PA7A 4HZFA 3KGLA 2XLFA 2FMYA 3E5QA 5F1RA 1RUNA 3HT2A 1VP6A 2P17A 4HSJA 3R6SA 5FLIA 1EPZA 2GC1A 5LRSA 2ZCWA 2OZJA 2DCTA 4JTOA 1DGWA 1FXZA 4IEOA 4R8HA 4AVAA 1OD5A 5EZWA 4BH9A 3EHKA 4FBFA 4AVBA 3OTFA 3C3VA 1NXMA 1SEFA 1YFYA 3LA7A 4XFHA 2D5FA 3RNSA 2ZKLA 2D93A 3CF6E 4IEYA 5JAXA 2D40A 2Q1ZB 4MH0E 4I0BA 5CADA 3H3UA 4UXAA 5I91A 4FT8A 3EBRA 3PLQA 4BIFA 1J3QA 4PIZA 1DGRA 3UKNA 1RTVA 1O7FA 3FHIB 4LLOA 3H1MA 3JZVA 1O4TA 2HJIA 2MHFA 5AVPA 4A2UA 3N4MA 5BV6A 4UBHA 5I0UA 2BEOA 4MGYE 2OZ6A 3KMHA 4XFAA 2BYVE 5I93A 1ZRDA 2XL7A 4O9EA 4RD7A 1RGSA 1DZTA 1NE4A 1UIJA 2BNMA 2ET7A 1LB2A 2QVSB 2B8MA 5JCTA 4IEQA 1J58A 5KHGA 3U11A 1L3JA 1UCXA 1NZCA 1YFXA 3PVBB
chains in the Genus database with same CATH superfamily
4FVVA 5JIAA 4WFAV 4WBBA 1TME2 1MSDA 5E16A 5K8SA 2WYSA 4DRXB 2QSAA 5H9CA 4XF3A 3IB3A 2VGDA 4XPVA 1RJ7A 1AI5A 3Q8BA 1WCKA 4HMZA 4L0PA 4A45A 3HKBB 5L9RA 5J48A 5F37A 4C90A 3DYMA 4QX3A 1RL3A 2GALA 1WW7A 5APAA 4ZU4A 2HWC2 1MZ5A 1EM1A 3ETEA 2VZOA 1GV9A 5CZKA 4FFIA 4XJWA 4N7IA 3VQVA 4AQYO 3CCSV 1YFWA 3IAYA 4QXHA 2YIAA 4BB3A 3T2OA 4JGSA 3WDWA 2PLV2 3T1YO 2IJIA 5FTTC 4B4RA 3CEWA 4AK3A 1DU3D 4PA9A 1I9RA 2DQ0A 3JAMN 2YROA 4D8MA 1UWWA 1QJY2 5B2GB 3GCWA 2ZGKA 2Q68A 1LR5A 3CWBH 1SQVH 1IBKO 4RGGA 1TA8A 3THOA 3I7DA 2P6CA 1QJFA 4CVUA 3ML0A 2QM7A 3NV3A 3OJBA 2E3CA 3OY8A 4U3FH 4QKNA 3E22A 3OGCC 1SQFA 1YVWA 2Q7GA 3AVRA 3LSQA 2DE0X 1DGLA 5LMUB 2QQWA 2F23A 4LO5B 2PYTA 3LUTB 1HNWO 4ZS3A 4XF4A 5SV8A 3WW4A 4XZPA 2X6CA 4NHYA 1R1A3 2YIBD 5IYBO 2O8QA 4QHBA 1WD3A 5LWBA 1FJGB 4HLTA 3CL1A 3VBOA 2CY6A 5FREA 3AJZA 1NY71 2A06H 4CXWA 4CP9A 1JMKC 2EAKA 3NAPC 3H8OA 3P1IA 2HKXA 1H9WA 4O4HA 4MTGA 2ZABA 3O1TA 3I2FA 3WNKA 5FLXN 4DPNA 1OURA 1B35B 2AW9A 2XR4A 2W91A 4E2LA 3ST7A 3PVOA 1ENSA 4CC6A 3LDEA 1RHI3 3ZKYA 3J7NA 4P9YA 1VRH2 1PO22 3IM0A 1U0AA 2UUBB 4CSWA 3K9SA 1IBLO 1J83A 1FT9A 1JJ2U 4CYDA 5LA2A 4HVRA 3QH6A 3SJBC 1STMA 2QE7G 2J1SA 5JZGB 5LOVA 1A8DA 1YRZA 1NU1H 4B3NA 1HR0B 5FOJB 5LA0A 1REDA 1UYXA 3ZFEC 1BGYH 4QX2A 3ZXEA 2P37A 5A6XA 4P5YA 1RXFA 1Y66A 1PVC3 3N2GB 4Q4V1 5JJJB 1OJHA 4CDUA 3LEKA 5L3GA 1O5LA 3P6BA 5GTIZ 1G9BA 3LOBA 5C33A 2R9RB 4CDXC 4Q0SA 5F3IA 5B1BB 2OIGA 1IS3A 2E51A 2WINB 4IV1B 3G7DA 1M93A 1NLRA 1CAXB 3RZMA 3ZRSA 2JDIG 4K8XA 3ZSLA 4E4HA 5DXDA 4NHKA 5H9PA 4GULA 5IK8A 3CXCU 3ZMUA 3ZHUA 5LK7B 1V6LA 3WW1A 2P5BA 1SQXH 2E5LO 1ORQC 3EQEA 4CEYA 4DR1B 4FI9A 2OYZA 4R4ZA 5JPNB 2Z5WA 4DV7O 3K4DA 5DABA 4LUKA 3H8RA 3KSCA 3VZOA 1P84F 3ZMTA 2OIEA 4AFDA 1RUJ1 4JV4A 3FL7A 3MIHA 2EULA 4OUEA 1WA8A 5CEHA 4QGPA 1F4MA 2O0OA 1SBFA 3HIFA 3PMEA 3ABMC 1AR62 2Q7HA 1LRHA 4XTMA 1LHWA 2ZGTA 4KQ7A 1OVPA 3ACLA 4EN0A 3GZAA 4ZONA 5C6CA 5A3LA 1IXMA 1SESA 3AP4A 1NTZH 2MEV2 3GWKC 1S0CA 4Q0PA 3LA2A 4MZUA 2FBEA 4X8NA 2VQAA 2W5FA 1JZ2A 1GFF2 3HEIA 3AXEA 4X62B 1BMFG 3HAGA 1UYYA 2WSVA 2WJSA 2WO3A 4YNIA 1MS8A 3QF7A 1UKGA 1WNSA 4XEZA 5CA1B 1G8WA 2F17A 4XQWA 1M06G 4AQSA 4ZXEA 4K0KB 1COV2 1JU4A 1PZ8A 4Y33A 3WG3A 2EILB 2XASA 5F6KA 2AC1A 3Q8FA 3VKOA 1GR3A 1XMOO 3ZPYA 3C3SA 1LOAA 5FLIA 5LRSA 4BQ1A 2LALA 4LF4B 3K5NA 1P49A 4X65B 1FXZA 3ME2A 3J7HA 3POJA 4BH9A 1K8AW 3OTFA 5IDJA 2YC4A 2ZBJA 1YFYA 4XDKA 2ZR3A 4BK5A 3POSA 5FZLA 1LOFC 5C9AC 4MS2A 4A7YA 1FPN2 4R9BA 3EBRA 1RUC3 4Y1ZA 4A6SA 4AGVA 2HWE1 4LO8A 2WO1A 3W7WA 1XILA 3RYIA 2G19A 1YJWV 1SHWB 4BW9A 4ASMB 4Z92B 1SPPA 1FYJA 3I3DA 3QD6A 3NWKA 1PK6A 2JS3A 3FBMA 1VBB3 4NJ4A 1GRJA 2ET1A 1D5AA 1VBA2 4DV2O 1DQ5A 2ZGSA 5CFDC 4BIUA 1PGL1 2ZCEA 1PKXA 2DYRC 2CK3G 3HB3B 4IHJB 4ITCA 2VW1A 5BUVA 3A7QA 5A1AA 1YJ9V 1NVPB 2AR6A 2VAUA 3T3YA 1V6KA 2WT1A 3W5MA 2R72A 4UVCA 4JI2O 3SYPA 2E74B 2DJVA 3CC7V 2CE4A 4LP8A 1AJQA 2YGLA 4N53A 2WLIA 1I6XA 1OFNA 4FMTA 5KA6A 3S0MA 4RQPA 3H1HH 1YJKA 4IIJA 1PZ7A 4FZ1A 1O3RA 3ZIAG 2XJVA 1NCRB 3VBHA 4XBFA 3ZMNA 4MHRA 1MS3A 1IHMA 5KBFA 3TK1A 3FN9A 3L9JT 4DV4O 3TRSB 1K97A 3RI9A 4KWLA 1N1SA 3RWNA 1RYYA 1W2BU 4YM3A 1VQ5V 3HOBA 3N9PA 2Z3YA 2GUZB 3UM7A 3FFZA 1WB7A 1WLEA 3DC5A 4UF0A 4O4JA 2HKOA 1IXBA 2OA2A 2ZMKA 3LNNA 3BKZA 1RUJ3 1C8M3 3GBWA 4JDNA 1JHNA 2VVDA 1PO13 3I49A 1O3QA 4K8RB 1DF5A 1C3HA 2EXHA 3OCPA 4YZ1A 2NQYA 4MUVA 3PUSA 1OA2A 2UYAA 1XNCA 4TV9A 5IY5B 5KWRA 2CNAA 4RFT0 2TNFA 2JEUA 1JZ4A 3CEIA 1N3PA 3N9QA 3ZMZA 1IOAA 2QWPB 2WABA 2CTRA 3THPA 4B7EA 1PIV1 3S5AA 4XF0A 5CBGA 5LASA 3ZFGC 3QH7A 2GHYA 4DR7B 3B09A 2MNGA 3IKWA 4IV3A 5IE9A 4JRLA 4XE9A 2B45X 1VBD2 3K04A 4PDLA 1Y3TA 3TN91 1POV0 2WQZC 1ND3B 4P9OA 2Q5TA 4MVUA 1MNGA 3J7LA 4AEJA 2YFUA 3SHRA 2NPIA 1VR3A 4TV8A 2XONA 2ATFA 4YM2A 1WMEA 4OVEA 4JCKA 3O1UA 1H4GA 4FVMA 1S0GA 1N8RW 1G9CA 1JYIA 4H55A 3ASOC 4QMAA 1K45A 1VMGA 3RS6A 2VO5A 3M7AA 4J80A 2CWMA 1DP0A 1WCSA 3IJ4A 1WGPA 5GONB 1GWKA 4WM7C 1KU9A 2JXAA 2RE9A 4PDWC 3ACHA 2P3IA 2GSYA 2RJZA 1ZVFA 4IE5A 3SMHA 4J10A 4PIXA 3UKVA 1OMIA 2YC0A 4IESA 3RYKA 1SC5B 4CA9A 5J96B 1SETA 1D2SA 4BWAA 1YQ6A 4P14A 4XAAA 4XJAA 2R072 4PDRA 4H37A 5K0UC 4L92A 5HV0A 5GZEA 1C1FA 1XMQO 2A7AA 4TYSA 1KITA 1DYOA 1AR1B 1I1EA 3KF3A 5FY4A 1SA0A 1UO9A 4DR6B 1DQ6A 4E4ZA 2W3JA 2RR13 1HNZB 2C1FA 4ZS2A 1UMHA 4R9AA 3KHCA 2BCCH 5JDBA 1DHKB 2Q1FA 2XWBB 5FZIA 5LBBA 4Y1YA 1MS9A 1GMGA 2EXJA 1W90A 3UETA 3W5NA 3RYCB 5LW9A 1A8MA 3QOPA 4XHXA 2YG0A 3Q4HA 4IE7A 2FDKA 1UX6A 3JALA 4BQYA 1US2A 4XACA 3E89A 1LJ7A 5F3CA 3NMBA 5ACA1 5EP9A 4EWEA 4A7KA 3GXUA 1D4M1 1UXXX 5EYYA 1N32B 3IDCB 3ZSMA 5F32A 1X8EA 3KT4A 5EZYA 2Y48A 3K2OA 5F1RA 5C8YA 4H44B 2UUAB 3AG3B 4TXWA 1PHMA 2QKDA 1VP6A 1XYNA 2VUCA 1ULOA 4Y26A 2ZCWA 3O7OA 3MIGA 4LFBB 4LK6A 3B4SA 2DUQA 4R8HA 5EZWA 4AVAA 2CTWA 4FBFA 5DMYA 3OUIA 2FCTA 3AYCA 2D93A 4GT1A 1ULPA 4NAMA 3OPWA 1YIPA 2BU9A 3SPGA 4FLYA 3QCWA 5SV5A 2CGOA 2A3YA 1YDXA 5L3BA 3R0RA 1ZBA2 1OC1A 4XUNA 2Q6AA 1R091 3BN6A 5JCTA 1GZCA 1YNAA 2R041 4UFHA 1ZM1A 1QOSA 1RMU1 1UU6A 3RRDA 2NLRA 4KGGA 3LCPA 4JV5O 4J41A 4Y20A 2VCCA 5FPZA 5C7GA 4O2AA 2ZEZA 1MZ6A 2FDGA 2NYYA 4PDVA 2WL1A 1ZBE3 1YQ2A 2OS2A 4AFCA 2R063 4L99A 3UGGA 1CONA 2UXCB 2FCVA 1VQMV 3NQHA 4F7ZA 3IAPA 5JMCA 2Q4PA 5CYYA 2N04A 1TZOA 1UU5A 4DR5O 2YS8A 3HD8B 5J2UA 4DO0A 4M4PA 2QKSA 2UXDB 4MGQA 4IQPA 4I2OA 3NKTA 1UY4A 4QPYA 1JYNA 3H7JA 3FX7A 3FC0A 2WFF3 1GNYA 2I74A 5IJ9A 2WSUA 4OI1A 1UZWA 1F5FA 5FPRA 4IGGA 3KQRA 2IW5A 4RL7A 2V5YA 5D8AB 4AF9A 3OD4A 3VQXA 1R64A 3CC2V 4BQ2A 5F3GA 2IVIB 4EN7B 2BUKA 4WFFA 1V6OA 3ENRA 1YTFD 4JI7B 2DU0A 4AOCA 1MEC1 2OWOA 1U5IA 2D6PA 2PHLA 3N2KA 1M56C 2HWF2 1QJX2 5DQ0A 5I8TA 2QJ1A 3Q8CA 5E6HA 1QBZA 5A3TA 1K4DC 1FAFA 3HKDB 5BMVB 3QO5A 5FZ6A 4DIQA 3CMEV 3ON7A 2ENRA 3TAYA 4QKBA 2Z42A 3JB8A 1JOBA 3OUJA 1WCDJ 1ST8A 1YYNA 5FPLA 5T50A 4NXNB 1K5MC 4AQ2A 4BYYA 4B3TB 1D4M3 5ITZA 5AC92 4MV2A 3B2EE 3T4VA 3IBMA 4B08A 4OMCA 4BQWA 3OBTA 3E6BA 4W4KA 5JXGA 2OKXA 1Q8PA 4PLMA 4LKEA 5LBEA 2JG8C 4KBBA 3WDUA 2ZDIA 2KG7B 1W59A 3POIA 3RYHA 1E5RA 1R1BA 4K9SA 5I0RA 5FMBA 3LDRA 2GP3A 4V1PA 5E8AA 2WLQA 5LY2A 3CU7A 1SZTA 1HB1A 5IHRA 1LHVA 4EN9B 4FPOB 4AEDA 3A8TA 4S2FA 1OHFA 2W1UA 1AP6A 1JFFA 4L9BA 3J7MA 3H9VA 3G6EV 1E1RG 3QG5A 4JI5O 2ZX2A 1R093 3LZZA 5B1AC 4YFWA 5JPMB 1SDDB 1H2LA 2JGDA 1KUQA 2IU0A 3CCLV 1FXKC 2P6JA 3VZKA 1H8EG 5L73A 2Y4TA 1DYPA 3JCUZ 5FPAA 2G1MA 1ZA4A 4ZI7A 5F8PA 2DCZA 1SQBH 4XQDA 2WWJA 1G6UA 1REEA 1JA8A 1RUH1 5JI7A 4J11A 2YU2A 1AYM1 2A6WA 1XE8A 4OHZA 4LE4A 5DEDA 1CZVA 2UUCB 4FIPC 2WLHA 4WCEV 4RYDA 3VD4A 1X82A 4FZ0A 4FLWA 4QD2A 3ALQA 4A5UB 2VM9A 5FZBA 1Y9MA 1JUHA 2JDUA 2RMU3 2Z2SB 3WF0A 5KX5B 3OW2U 1R6KA 1M9NA 5IK4A 2W1SA 3IMMA 3CJHA 1PGW2 3B94A 4CU7A 2IXHA 1JOJA 2FD8A 4LLFA 1IKPA 1LKNA 2LGQA 2XLAA 4YVSA 2VWKA 4FQZA 5L7OB 2XH6A 4F83A 4G27B 1AJKA 3RZKA 5JOXA 1G9FA 3U37A 1VBC3 3VL8A 1IS6A 5FIXA 4UFZA 4B3RB 1H6XA 3ZYBA 5F9TA 4JASA 1LGNA 2EIEA 4DV6B 5FO8B 4ZHQA 1NH2D 5A3MA 1DQ1A 1TUBB 1QH6A 2ZXWB 3A4UA 2ZGUA 2CAZC 4ZXKA 4I7ZB 4EJRA 4AHZA 2XWJB 3LA7A 3WG7B 4XFHA 2ADQB 4P02B 4Y22B 1AR93 1OQ1A 5A9GA 3OPZA 4GXLA 4ASUG 4FT8A 3MIFA 3PLQA 3WF2A 4CS4A 5E1AC 1CEZA 2R32A 4NIIA 2MHFA 2ETNA 3G6JB 1KYOF 2P5OA 2KR2A 1Q8OA 1RUD2 4FM0A 5IW0A 2Y4UA 5BNPB 1LB2A 4DR4O 4Y1UA 3W59A 2PHTA 1GZTA 1RUG2 5FZMA 4BQ4A 2QQLA 3VQYA 4CPBA 4Y4YA 2FTKA 1DQ0A 3B01A 3ZN4A 4UCUA 5FPBA 1IG0A 3ZMVA 4LF8B 2LS6A 5D1IA 4ARXA 1T6GC 1ENQA 3STZC 5L3DA 3WB1A 3IPVA 2ITCC 2Z79A 4R7CA 4IE0A 1APNA 2I45A 1KS4A 4I01A 4V2WA 4IE6A 1XNRO 1RVF1 3AJYA 1ZLZA 3FLRA 4WFEA 4LBQD 3JD73 4QDSA 4YY3B 3TEWA 2B42B 2XBO1 1AZDA 4RHV3 1VQ6V 2UXBB 5I8SA 1UF2C 4CDWB 5C70A 3DKQA 1SLAA 2WO2A 1W6OB 5IYZB 4M3CB 4NN0A 3IC7A 4OCTA 1TG7A 2BGOA 5J7MA 1QY4A 1Q6HA 3A0HZ 2UYBA 1OF4A 2XUMA 4LO6B 4MW3A 2CWSA 4BXSV 1HRI1 2QGNA 1LTEA 1RUH3 4YW4A 3ZO0B 1AYM3 4LF6B 2ZHMA 3RJRA 1YCIA 5HI0A 2ZEYA 4FJCC 1GBGA 1NCRA 3F7YC 4QU1A 5LP6C 3LEIA 4MOAA 1J5EO 3F7VC 3VBUA 1N1VA 3EMRA 3UKTA 1DFQA 3K5MA 1NY72 1YFUA 4LC1A 1UOFA 4TOIA 2JECA 3CMGA 2YXYA 4JI0O 3CRCA 1R081 3A0NA 1YLLA 2GH8A 2P4EA 1VQOV 5KMGA 4NXMB 4M3CF 1M1KW 2J1VA 5FNVB 2I2SA 4COZA 3PIGA 2QUOA 2OUHA 4ZZ5A 1BEV1 3AK1A 3MV11 3AKSA 3ABKB 1NQTA 1W8OA 1QOTA 3H8XA 1GZ9A 4MTOA 3BYWA 3O5SA 4OX9O 1KFXL 2C5DA 2K2SA 3JASB 4FFBA 1C57A 4LIUA 2FDFA 3EB7A 5L36A 2IWGB 1NA1A 1HRV1 1AI6A 2TUNA 4JGZA 3K06A 4I30A 3I3QA 3PIJA 1H8TA 2C2AA 1GKBA 3UO2A 2QE3A 3ZKUA 1V54B 1ND3A 4N8MA 2JVDA 1L0LH 4KUMA 1HWYA 2AH2A 4Q4V2 3S3XA 4EV0A 2H6BA 5EQUA 2N7GA 3DUIA 4E4DX 2GNDA 3ZYPA 2ZGRA 3TYJA 1JI6A 4QPKA 1MMMA 5EJZB 1VBE1 3KB5A 2BVVA 3FKSG 2F43G 1QOOA 4YVWB 4I0XB 5KHJA 2KA3A 4LBMA 4HVOA 2CH7B 4UBGA 3L73H 3FLTA 1FX5A 3IWZA 5KR7A 4Q20A 5EFUA 4DK1A 4X89A 1GLHA 5CFCC 4QM9A 5EBLC 1ZZ8A 5JUVA 4QIWF 2O14A 2P90A 2ZD9A 1W6NA 4XFFA 1NX9A 4G4FA 2NN4A 5FMOS 3ZIXA 1AXYA 1H1AA 3UT5A 3WDYA 2RM21 2GMEA 2XJTA 4LA3A 5FYSA 4TLGA 5CA3A 1I08A 3VDDC 1RVF3 4AGRA 1VARA 3VBSA 4UUJC 5JXJA 2E7AA 1BJQA 3Q8EA 3ZSEA 3DPRA 2GSMB 1MABG 2JWPA 4Q8KA 2RJKA 3B5LB 4ZKTB 5FY7A 4AGGA 4PLNA 3IGAC 3J8F3 3EO6A 1RUI1 1N33B 5FLHA 2ZEXA 2RN9A 2DUOA 3GWOA 5HCBA 4D69A 4DW1A 3JYCA 2JIJA 3NV4A 2G9GA 4JAVA 1ZYBA 4I55B 5I8YA 4OUMA 3S6PA 1CAVA 3RYCA 2V72A 3GZEA 2K0GA 3L9DA 3NV1A 3T2PA 1ZREA 1IS4A 2ZXQA 2JG9B 4GX2A 4YW3A 3ZHVA 4B3SB 3BODA 3K03A 4OHWA 3E5QA 3BUCA 2UXNA 2XJSA 1YIJV 1XHZA 2F6BA 5AFEA 2GP5A 5D2AA 2BDRA 3R6SA 4BPZA 2IVJA 4S2HA 3E83A 5EK0A 2DCTA 3M3QA 2AXTZ 1DGWA 2QTOA 2V73A 5K4LA 1HXS1 1LNQA 3C3VA 1NUKA 1D0HA 2R7EB 1S55A 4IEYA 2HWE2 1R083 1I94B 1AR73 4P9XA 4CEWC 3CHXA 4CU9A 2X5IB 2KSDA 1F9KA 3MF6A 1KDKA 1O7FA 4H3WA 1KD1W 3RW0A 3N3HA 1X4TA 4TN7A 4RD7A 1NE4A 3BVCA 2ET7A 3ZMSA 2Y6KA 5C9AB 5DM6V 1B35C 4NOTA 5GZFA 1NZCA 2ZZJA 4QQHA 4XJUA 2BNNA 4N43C 4EFBA 1GQGA 2QQKA 3KCXA 1PGL2 1HRV3 1L8DA 4DV1O 3HQXA 4IEUA 2YICA 2F66C 3C7OA 4NPMA 5LMNB 1QXJA 5FYHA 4HONA 2LW8A 5JZGC 3POWA 2DF7A 4Z2AA 2HWB3 2KXLA 3AG4B 4DRRA 3H1KH 2XDVA 1SQ4A 4MXWB 5A32B 5CFDB 4LOTA 2Z5UA 5FLJA 2DYRB 2W92A 4AQ6A 2E7QA 2FZ2A 3QBQA 4UW3A 3DGTA 3OGRA 4JYAB 4JTCB 2ZHLA 2BTQB 5B1BC 2VS0A 1WLTA 1K73W 3BA8A 3PJQA 2VOTA 1UN1A 4OI2A 3THTA 2VULA 3JATB 1XNAA 2C26A 4WV8A 5F39A 2VQEB 4UCSA 2OX0A 2UU9O 1C5IA 4QX8A 2Y6LA 1IX9A 4RWUA 4I02A 1V9PA 1EUTA 3JCIA 1OQDA 2JE8A 4M0HA 1UQXA 2OVUA 3HBKA 1CAUA 3AMMA 1PMJX 2PQQA 4JAAA 4XURA 2UWAA 1IPJA 3MUY1 1PIV2 1R3JC 5AG2A 1AX1A 4WBNA 5CVRA 2ORZA 3CKHA 2CUGA 2WC2A 3W9AA 1N36B 5BMVA 2WA4A 2LROA 5FQ0B 5ABJB 5T55A 4QPIB 2XAHA 1UMIA 3TN92 2RCVA 4BLIA 2F95B 3RYRA 3VB9A 1S5HC 1R3LC 3JSNA 3ZMOA 2VQFB 1NI8A 4NTWA 4YZ4A 3D5OA 1W0PA 4QHOA 3M7MX 4X66B 2UY8A 3ETQA 2XHBA 5EJ3A 3MLLA 1QJY3 2EILC 5BPXA 4BMEA 3KS7A 1LU1A 4GD4A 1W8TA 4RS5B 3BCWA 3L71H 1DBNA 3VBOC 1DGWX 4DV3B 3Q9OA 1VMJA 2RDSA 1ND2A 2E53A 5FZ8A 4M01A 5A3OA 2AENA 1CD3G 3LSSA 5KLVH 1F4NA 1LOGA 3OGJA 3ZFFB 3CCRV 4ISRA 3RZLA 4NRPA 4BM8A 4QGMA 3PN1A 1OLMA 1GN3A 3NVCA 1SLTA 1H2KA 3U75A 4BIZA 2DCYA 3QO7A 2GC2A 1Y74B 2F4VB 5A7WA 3GBGA 5T3NA 1V6NA 1JZ8A 3K48A 4TLFA 5KXCA 1NXD1 4EEQA 2W95A 4IXLA 4L2NA 1SQPH 2XQXA 3VBRA 3H1WA 5CN0A 2JE7A 4KL1A 1WPXA 4X1YA 3I2IA 1PL0A 4LO4B 5LRRA 4GB31 4ZBMA 4BQXA 2ZEWA 2DDUA 5K0UB 4PDMA 4EZ4A 1W6QB 3RYFB 4CCKA 4DEVA 4DV5O 2QZ2A 2Y33A 2FKXA 1AXKA 5E88A 4XXAA 5JMOA 5A1LA 1VRH3 1PM9A 4CDUC 2WN3A 1PO23 4H33A 1W3XA 4D7TA 4LFCO 2A3QA 2RNBA 5F2VO 3BVOA 1DF4A 4QGNA 4SBVA 1WMXA 1BL8A 5ACA2 5DDJ1 1D4M2 2IJJA 1LOEA 3KZ4C 4YGBA 4FTBA 4KWKA 1UZVA 3AB0A 3QVNA 5JR7B 3VHNA 2QDRA 3HT1A 3K08A 1NAEA 4LBNA 2YXHA 2SLIA 4FTSA 1H6YA 4AAXA 4AG4A 2GZWA 2PN5A 4KHPO 3FUQA 2ATKC 4O4IA 3I59A 1S0EA 4C0BA 2WAMA 3FYIB 1CN1A 2PHXA 4HZFA 2R0FA 1MQTA 1FFXB 5EBMC 1XYPA 3HT2A 5JVDB 2A7WA 3K58A 2JDNA 2GC1A 4DR2O 3OAAG 1N34O 2WWSA 4OPAA 2GBOA 3EHKA 3OSDA 4BQ3A 1SMVA 1ENXA 1OCRC 2HWD1 2D5FA 3CF6E 2A71A 2D40A 4MH0E 5LXTB 5CADA 5IY5C 3ZYGA 4BIFA 2R6QA 2Y6GA 4HYOA 3HN1A 4FO9A 4CCCA 4DB5A 3VD3A 1R092 3LSEA 2EBOA 4FOWA 4XFAA 5J2TA 2R042 3NNJA 4GZRB 2VXRA 2F4LA 2QFEA 4WVMA 1RMU2 1FKAO 1F4HA 2XTAA 2E75B 5IWAB 1O59A 2XMLA 3PVBB 5LA6A 2QBXA 1GN2A 3JD3A 4CDQC 1CZTA 4XCAA 4UFLA 4TUYA 2QCSB 2Z4FA 1TVKA 4QAWA 1KJLA 5DAWA 1BHAA 2YI9A 2W46A 1ONAA 1SERA 2R30A 2MEV3 3LD8A 1CXZB 4RGKA 1EZVH 3MHZA 4Y24A 1QDCA 3RVHA 3FHQA 1XJAA 3K0DA 5IJ0B 4OQ8A 5LEKA 1H30A 1VRBA 1G6NA 4AI3A 1A3KA 1D0GA 2P6HA 3H1YA 1BQ0A 1ZZ6A 3NL1A 1DLLA 1ZX3A 4IYIA 1JXNA 4Q2FA 3WLUA 5I0SA 1OKOA 2PHDA 1QNWA 1VQLV 2BV4A 1K4CC 1H2SB 1FNYA 2DYCA 1COV3 5C3SA 4AHXA 1GWMA 4IUGA 2JX9A 1NR1A 4JI4O 1HQLA 4D7SA 5FKCA 3DXRA 3R4SA 4OYUA 1S0JA 1OI6A 2GTSA 4QPGB 2AEYA 1US3A 1KECA 4LF9O 4Y3OA 4NMIA 3PNAA 1ZRFA 1MEC2 5H6RA 1UPSA 3ZVXA 5IFPA 2PYJA 3VDBA 2A75A 1ZZCA 3W7SA 2R70A 4GYCB 5FUIA 2HP8A 4LF7O 3P3NA 1O8PA 4B3MO 4JC1A 4Q0QA 3OG2A 2B5UA 3DV8A 5HFLA 1L7RA 1JJOA 4EE2A 4M3CE 5IVFA 2CTPA 3NNFA 2C0ZA 4MVTA 2GU9A 1M56B 1C28A 1RPOA 3OBRA 4JTNA 3OOXA 5LGTA 5FOBB 2BWAA 4I3GA 3ILFA 4JHZA 4LULA 5FP7A 2YEVB 4AWDA 1YXBA 3T1HB 1JU3A 5IATA 5H9SA 1GOGA 3T30A 2WYFA 4JZRA 1OXCA 3I8TA 4AI1A 5FNVA 1O8SA 3PL0A 3W58A 2RG4A 1JYTA 1F51A 1WPBA 2QEXV 2J1UA 5F5QA 1M90W 4YJ3A 1U12A 2Q8CA 3IC9A 3AG3C 5A7QA 2QWRB 3O1RA 4Z1VA 4GMP0 2HG5C 3NAPA 1WW4A 4R8CA 4L8JA 1VQ4V 3FJSA 4X9QA 3N35A 2VE1A 3OR6C 3HN3A 4I09A 3D4KA 2JJ1G 5TSWA 1HNXO 4FP3A 3AG7A 4ES9A 4YJ2B 4ZIBA 3T2TA 1FI2A 2WLKA 1XBLA 1Z0HA 3WNMA 3W7XA 4Q4X1 2P06A 3DN7A 1UXZA 1XI1A 1QVGU 3B8NA 4Q26A 1UZZA 2FMDA 2WS91 3ZX6A 3WDXA 4YW5A 4I0XA 3FB8C 4CUBA 1EUUA 4IEZA 2CH7A 1HN0A 3ZFEA 3ZXJA 1JR9A 5B1AB 2ARXA 2ZTNA 4B1LA 1ZWIC 4KG8A 4Q4Y1 4QB1A 1FXKB 3A0KA 4L11A 2JENA 4U3JA 4CDXA 1VBD3 2B5HA 3AVSA 3KKYA 2AGSA 2Y38A 2QA4V 3OGGA 1K92A 3FE5A 1RUF1 5IYDO 5KHIA 1YTFB 2RS11 1XREA 2B9VA 4UV9A 1XQNA 1DQ4A 4ZKIA 3B3QE 2JDPA 4MVQA 4DYLA 3BTZA 1A34A 4LNUA 1Q8SA 3ZHQA 1JVMA 2IH3C 1QH7A 1LECA 1CX4A 5D8AC 4I3PA 2HEPA 4EB6A 1J3RA 1DZQA 4I9QA 4DOUA 5GLTA 3NV2A 3FAVA 3JQXA 3T4HB 2Q9LA 2G9FA 1NQDA 3FB7C 2D6OX 2E33A 4JGYC 2WIIB 3RMXA 1Y43B 5FZ3A 2R073 4NTXA 3E8FA 3M99B 4HFSA 4HNAA 5FXVA 4AFAA 5LHGA 1PNLA 1SFYA 4N7UA 3MHHC 3BRCA 4I0BA 3LQCA 3V0BA 1JW6A 1DGRA 4H14A 4XJ9A 5IVVA 5LYJB 3W7UA 4BR6A 1UY2A 1RGSA 1W6MA 2BNMA 3SKVA 1F15A 1K5QA 3X2QB 1GZWB 4P00B 2DBNA 2UURA 4FLTA 3JAKA 1B06A 4QE9A 4YM1A 5EWSA 2O8OA 1WUVA 4DXWA 1F23A 4K1YA 4FLXA 1M5IA 4N90A 3T4DA 3JAWA 2ZINA 2HBUA 5DZGA 3F5TA 1LOFA 5C9AA 3MLJA 1UZYA 2EINB 1QLEC 1PV0A 2OIIA 1VQPV 2VU9A 1IVSA 5BNNB 1GP4A 2EAAA 1FYUA 5HBAA 4BZ4A 1IBMB 1PPJH 1RVF2 2BVBA 5A3PA 1ENRA 3VZMA 3RVZA 1N1TA 2Q1MA 4TZDA 2XBO2 1Q90D 1NQJA 3HNBM 5CBFA 4XAEA 4DO2A 4MVSA 5EBWC 1KKDA 1ULFA 3G80A 4XW3A 3CLPA 2EJRA 4MYEA 3TEXA 4FFKA 4MXWA 4W4LA 3M3OA 4AYUA 1HRI2 2SBAA 4YARA 3V0AB 1IGOA 1WW6A 3DYOA 5FUNA 1P7GA 2VBPA 4AVSA 5IK5A 5C8CB 4EROA 3CCUV 2A9HA 3AYDA 4HN1A 4MHUA 3I5DA 1GO3F 4Q4Y3 3RYPA 1I3HA 1QEXA 1JN2P 3SISA 4HBNA 4N21A 1XQ8A 4UW5A 4XVHA 1OLQA 1ZL8A 3ZDVA 4XF1A 5CNAA 3CC4V 1EBOA 1ZBA3 5CA0A 5FO9B 2ORXA 2D2CB 2P3YA 4G28B 3T4ZA 5FYUA 5IVCA 4META 2ZM6O 3IN9A 1OSGA 1R082 4HZ3A 2WNUA 3AL5A 1W9FA 4OMDA 1RIRA 1ODMA 4PI2A 5C71A 4OI0A 2ZNIA 3HPNA 4BXFA 1HB3A 1NH2B 4G2KA 3NJVA 4NPRA 4FLVA 1W0NA 3NRUA 3G4SV 1RB8G 1HLCA 1BEV2 3C7FA 3AK0A 4JI3O 3HKEA 4ZOLB 1J95A 2VXJA 4MGIE 1KGYA 4W4ZA 2X8KA 1UD1A 1KDMA 5DAPA 5J3UA 4JQRA 5L7OC 2BOIA 3K0GA 5JOYA 2RS51 4X8AA 3STLC 1MS1A 4LQRA 3EFFK 4LFAO 4LUMA 4JI6O 3GJAA 3BTXA 3QNEA 5FY0A 4JI1O 2GN7A 3GNEA 3ZFGA 4QB2A 3EXAA 2YMZA 1VBE2 1FMD1 3WG7C 2VZQA 2QM4A 4DXSA 2D98A 1JZ5A 1Z7S1 1QJX3 4HT1T 5JI9A 3WY6A 3MO4A 4XFBA 5JQGA 1I5YA 4CCLA 2EJ7A 4WVVA 1CP9A 5BNPC 4MSWC 5IWFA 5GM0A 4PA6A 1G1XB 2UY9A 5FZOB 4WM8C 4AQYB 2ZHKA 2CDYA 3B9IA 2DCKA 1DYKA 2B1IA 3T1YB 2Q0AA 1BVVA 1XL4A 4E4SA 4XDJA 4PIYA 3PDQA 3WP3A 1Y74A 2DWEC 1W3VA 1RSOA 5AC93 2RM22 4WM7A 5FBZA 3UNPA 4X1IB 4PDWA 4MXVA 5CFCB 4NWWA 3JCZA 1GU3A 2VZVA 1GANA 1IBKB 5IT9N 2PY5A 3OEHG 1F31A 1RUI2 2ZMNA 3AFGA 2XAQA 4W6WA 3FB5C 1LHNA 3AG1B 1RUG1 4FOVA 3LDBA 1S0BA 3WG1A 1G86A 3E8BA 3ZN6B 1W6QA 2GH2A 1W8ZA 3MAQA 4DUYO 4LT5A 2B9UA 1YI7A 1XYOA 4PBPA 3IMNA 3N9OA 3RSJA 1HNWB 1MVEA 3VDDB 3BPSA 1Z2GA 4XABA 5GZDA 4CDWC 1G9AA 4CPBD 4KBZA 4XILA 3POFA 4L8QA 4JAUA 5T52A 1NLSA 3PUHA 1JX9A 2HHHO 4GX5A 3J7AU 3SPIA 1HB2A 4I4TB 3WFVA 3WT3A 1O91A 3ZIWA 1JH5A 2A73B 1JPXA 3W7TA 1HXS2 1N47A 1VP7A 2Q8OA 3RBZA 1IQDC 3AMHA 1ENVA 1S72V 1Y76B 2ZIMA 2KB1A 3OYWB 2AZ5A 3CNAA 4QPWA 4YW7A 3ZRWA 1WWYA 1IBLB 5EYPA 5C5UA 1WBLA 2BZDA 3ZSJA 3AP6A 2HJIA 3KM5A 1GM9A 5C3RA 2WNVA 3TJTA 3CP1A 4QU2A 5I0UA 5FYYA 1QNMA 2OZ6A 1S2EA 4LBKA 1ULEA 3R66A 2QZ3A 3WU2Z 3WUDA 4XBLA 5KAIZ 4J7JA 5KHGA 4CEWB 1DGSA 2WT2A 2VMGA 1ZX5A 2AEZA 1D2QA 2RS53 3ABKC 2ZGNA 5JCOA 4JRAA 4CXYA 3UV9A 4Q6GA 2GV9A 3H01A 1O6UA 3I2OA 4K21A 1LULA 3W21A 1R73A 4EN8B 4TSFG 2BPA2 3C7HA 2M6YA 4N43B 4XUQA 2EIDA 2IC1A 4XQ4A 1V54C 5LEJA 1LGCA 4IL6Z 1EZJA 3RQ0A 4CCDA 4Y5SA 1I5PA 2E5LB 1S77D 4TT3G 4UVBA 1Z7S3 2DBIA 4DV7B 5FPVA 4COUA 5DN6G 4QX0A 1NT2B 3ZEDA 2ARBA 4YVWC 2Q7EA 4AE2A 2JEXA 1YUDA 5BNOC 3PTRB 4GH4C 3NXSA 5A3NA 4NIGA 3O0WA 3PTYA 4RR3B 5FZFA 3CX5F 3MF9A 1SCRA 4X64O 5FZGA 1AR4A 4PHZA 4QKFA 2ARHA 4YG0A 4GWNA 1H2NA 3CCJV 3I2GA 1G7YA 3ZX7A 5GLUA 5A6YA 4LXLA 3VBFB 2EIKB 4MW8A 2HVJC 1LHOA 5JJEB 3TETA 1RUD3 2WZR1 1FOD1 4DV0O 3OEBA 4L87A 2DWRA 3I54A 3L2HA 1WLWA 1P8JA 2HEVF 4P9LA 3THCA 2RS31 4BLJA 3JD2A 1URXA 3HWJA 3A0RA 1EAH1 1RUG3 3THDA 5BR8O 4FXKB 3LDDA 3U4XA 1W28A 3D8CA 1JTZX 2JRIA 5A70A 3K75B 5EPAA 1J1TA 5LHHA 1R3KC 4PJYA 3ZN1A 3NKGA 4DUZO 3QACA 2WRAA 1VQ7V 2PHWA 1XOYA 1LUVA 1XMOB 1D5NA 2B9ZA 5JSOA 5CAZA 2LP7A 1OT5A 5FWEA 2VZSA 4O65A 1A78A 3W20A 2Y6HA 2O1QA 1XU1A 3IAQA 2HFEC 4OHVA 2OTJV 4C7UA 2JG9C 3GVMA 1XNQO 4XMAA 3CCVV 2C9KA 1Y7BA 4COWA 2V4AA 1N4CA 4EFEA 3ZYRA 3D0SA 4ZU7A 4BISA 5FDBA 4QHZA 4K20A 3OY8B 2G38A 3E22B 5FZ7A 1K5MA 2PMWB 3B02A 3OPTA 3WB0A 2GTAA 1GQPA 2RDCA 2DTYA 3BGAA 3RDIA 2H6CA 4KFMA 3H0OA 3E35A 5FP3A 2D44A 5K7PA 3SH5A 1UL9A 2WQ4A 4AHWA 1NCQC 4YIPA 4DV2B 4BA6A 4UI9L 1MOFA 2X5IC 4Z8BA 2JG8A 3VBOB 2D3RA 3IIAA 2DCJA 3ZLIA 4EWDA 3HKCA 3JU9A 3CCMV 3GZUC 3OTOO 3POYA 4O4HB 4XOGA 1EN5A 4JI2B 2PHFA 1ZRCA 1W8UA 2ZA9A 2D3SA 5IAXA 3VDAA 1W6PA 4IEVA 3SLIA 1IKQA 1BBT1 4GB32 5FPXA 1W8FA 3ES1A 4JTDB 4JGZC 1TE1B 5DG2A 1RUE1 2VG9A 4GJZA 2QTWB 4LNVA 2HYKA 1SCSA 5FPOA 3VD5A 4XETA 5J09A 3K9AA 1OLRA 5GALA 4DV4B 2Y0OA 1DLCA 4JI8O 1Y9QA 3PVEA 1PMIA 4O9GA 4XCBA 4FM2A 3AG4C 4BCUA 1FXKA 5LOVB 2OCHA 3CQOA 4PQQA 5DDJ2 4QGLA 2NM1A 4Q0VA 4GKJO 5LBCA 3AZVA 5DN2A 4QNHB 3MIBA 4Q4W1 2YBKA 1X50A 4I5SA 4ASKA 2ARCA 3R4UA 4CDUB 4KWJA 2L35A 4Q4V3 1X8MA 3ZHRA 3VKMA 2QR4A 5EC2C 1CX1A 4HOOA 3ASIA 3WP5A 3N9LA 1YIFA 3JBG1 3F2ZA 4ABMA 4RFRB 2GNMA 4E2GA 2JIGA 4CCJA 2ZGQA 2MK3A 2RS33 2BSKA 1NOVA 4LF5O 4JTOA 4CEYB 2HWD2 3C7EA 1YEWA 1SEFA 3CB2A 4JQTA 1KRIA 1REFA 5JAXA 4QXCA 5CG9A 1WAZA 1ASJ1 1OCOC 2VMIA 4P9WA 1SFPA 3NNGA 1WA8B 4LLOA 1PX3A 2YBSA 1KQRA 2E6VA 5ISLA 1U5YA 2XNDG 4WVWA 1UKRA 1ZRDA 2BP6A 1GM7A 4CP0A 1OCRB 4GX1A 4O2BA 5ABJC 4DXTA 4QPIC 4B4QA 1X59A 3RZGA 1GTOA 3RWKX 4IEQA 2TEPA 4FPHA 2FB5A 2FCUA 1L3JA 4R9DA 2LGWA 5G04L 2CV6A 3UQ8A 1EN4A 2EICA 5FBJA 1DIWA 3N7JA 3U0ZA 2ID4A 3S5QA 2Q8DA 1BKZA 1DG6A 3K46A 1SLIA 5TISZ 4H7MA 4BK4A 1YI2V 1A6CA 3AMNA 1SLLA 4URTA 5FZ0A 5HXMA 4HPKA 4CDQB 2X7RB 3MW2A 4LE3A 4RS5C 1XE0A 2D6KA 1SLCA 1UU4A 1KB9F 2P4KA 1XMQB 4YW6A 1CPMA 3NW4A 3MHSC 4XIOA 2A79B 5FXXA 4Z82A 3SPJA 3OBZA 1CPYA 4UXNA 1DK1A 5IVYA 4LKFA 3ZFFC 2JKBA 5IK7A 2Q73A 4A42A 1OVSA 2CHHA 2WLLA 3JARA 3AKPA 1JYCA 4UW4A 3S7IA 2P2KA 3SYQA 1VB4A 2N05A 2YV8A 1O9GA 2WPDG 4JPRA 4WZCA 2HWE3 4X6RB 3WQBA 3RYIB 1RM1B 2D97A 5B5EZ 5GZGA 5IUQA 4ZU5A 2HJFC 3GALA 1EPWA 3CZJA 4RUEA 3EHBB 3OE7G 1PK6B 1Q6UA 5BNQA 1TMF1 3SCGA 1OOPA 4O4LA 3N9NA 4DZGA 2VTFA 2VZUA 5EV7A 2YU1A 2QDNA 2R49A 3AP7A 3IDAA 2XQRA 1NBMG 4NKGB 1HQNA 2IXLA 1HN1A 1GP5A 1GUIA 3CJIA 2WLPA 4N53B 2WLIB 5LP6A 1AL21 2XLGA 4YG6A 1AJOA 4X1KA 4CUGA 3CRMA 1VEWA 2Q5ZA 4RQPB 4PD4F 4IIJB 3O14A 4E9KA 4I50A 3DYPA 3VBHB 2A6XA 5T5LA 2EZOA 4MVZA 2D3PA 2HH9A 1WMDA 2ZE6A 2JDHA 1MG1A 1AVBA 3LSUA 2ZAAA 4K7JA 5CU1A 3MW4A 1W2AX 2ZGMA 3WSOA 3AG2C 1JZ6A 3RMYA 1YI9A 1CVNA 4UF0B 4CCOA 4O4JB 4PF5A 4OUSA 4QQOA 4OHXA 2DV9A 1UAIA 3MDPA 1XOUA 4JV5B 2CL2A 2D43A 4Q1PA 5FZAA 1WP8A 3VUOA 1CAWA 4Q4X2 3VV1A 2JKXA 4QM8A 2RVAA 5C4WA 2YSUB 2EIGA 5LZ6A 5ERLA 5LBFA 5CKMA 2WS92 1BS3A 2OUJA 3VQWA 1KC8W 3CPWU 1SKVA 4DR5B 4CZZA 1WD4A 1PIV3 3WINE 4UCTA 1N0JA 1XXNA 2VUAA 3WUCA 3B9CA 4Q4Y2 2X05A 3ZPOA 5JVVA 1Q5OA 2K9ZA 4IV3B 1YWKA 3KV6A 4FAHA 3T2MA 4JZ2A 1N0NA 5EHDA 1H38A 4OLLA 4RGAA 1OCZB 3GF6A 5FMCA 3TN93 4DW0A 2A6YA 2VQTA 3U78A 1W0KG 1LOCA 1RUF2 3JD1A 3SPHA 2RS12 2VMEA 4TV8B 1JMUB 4PCRA 2ZE8A 3LGRA 5JSPA 2NP0A 5KHHA 2Y0IA 4LWSA 1V6JA 4LKDA 4KU7A 4F6RA 1OQEA 2QQPA 4DR3O 1L7LA 4ZHNA 1Q3EA 2VZPA 3C7GA 4CCMA 2QQNA 4DRXA 3MBWA 1X9PA 4W8JA 5FYBA 4AW7A 1PL4A 2QTSA 4QPGC 2CAUA 3OGIB 4ES8A 2VCAA 3HKBA 2V09A 5FP9A 4YXWG 1NYWA 3K5OA 4BDVB 1UY3A 3VDDA 1P7BA 1MZEA 3OBAA 5GLVA 1H0BA 2XG3A 1GSLA 3G6BA 1TMF3 1UPGA 5FYCA 1S5JA 4LJHA 2D6MA 5DECA 3AM2A 2VY0A 5H2FZ 4HSJA 3UGFA 3LKJA 1SQGA 1IZ3A 5CISA 3GJBA 1GN4A 4DY3A 1SA0B 4QXBA 2XB6C 4I4TA 1KD7A 2JDKA 3RNSA 2C9AA 3ACIA 3VHOA 2VWJA 2BGPA 1KJRA 5I91A 1YQ8A 4JGYB 1QR8A 2BE3A 4JYBA 3APQA 4A2UA 3KT1A 4PF1A 3TWIA 1BE3H 3WG4A 2BEOA 2R16A 5HCAA 4LHNA 2D6LX 3B40A 2B8MA 2X0LA 4J42A 4J9ZB 3JALB 1OKQA 3LIGA 4JZGA 3SYCA 3BPZA 1W9TA 1R1A1 1UY0A 3I4IA 4KH9A 5ACA3 4GKKO 5JH7B 3I3BA 4JI5B 2WT0A 3RJ2X 4CEWA 3AYAA 1V6IA 5CA6A 3URFA 5EZYB 1K3IA 1Q8QA 4AVVA 5C8YB 4IL7A 3WF4A 1QJZA 2W68A 1D2DA 4ATEA 2VR4A 1VMHA 1KMIZ 4KXRA 1B35A 1QLEB 2BOCC 4D0QA 5EIYB 2FYUH 4ISQA 1RHI1 4QE7A 3S7EA 2ZX0A 4HN0A 3OMNB 1EP0A 1THZA 4M4RA 4XF9A 3UKMA 3T0BA 5JZGA 2XOKG 3NSTA 1W2OA 3ELNA 4XDPA 4NRQA 2WAOA 1YHFA 1YHQV 4DXZA 5FY5A 2LJ2A 2R043 3CXHF 2J1RA 3N2GA 3NJYA 1C5HA 1RMU3 4Y20B 3I56V 5DZEA 4P9GA 1BT8A 3DCQA 4MGKE 1AHSA 2IJKA 4O2AB 3WNNA 3POGA 4AEKA 2L9LA 2X29A 4IV1A 2YC2A 1CAXA 4DY5A 4ORFA 3SEPA 3KVBA 5C93A 1WW5A 4TWTA 1BK1A 5FY9A 1WCQA 1LEMA 2RJLA 2W52A 3DC6A 4IEPA 1R6NA 4OPHA 5J2UB 3D3QA 3USUB 5HFMA 4JHTA 5DZFA 3P32A 1AILA 1XNTA 4QJFB 4ATFA 3MIDA 1FFTB 4KP4A 4ARYA 4URAA 2RS52 5IJ9B 1GKFA 3U4SA 5FZHA 2CDPA 4YHHO 2VW0A 1U5XA 1DZRA 3O0XA 4D6TH 2IXCA 5B1OA 1Y4MA 4INDA 2XAFA 4J7ZA 1FV2A 2LUWA 1UOBA 4DR4B 1FMD2 3C90A 3GGLA 3P5BA 1FD9A 1VAMA 5LL6Y 5FV3A 5IYCO 1MEC3 5B3SB 2DVDA 1E1QG 4WFBV 1XSRA 2PXJA 3N2KB 1AUYA 2HBTA 5A6QA 3U10A 1Z7S2 4XC9A 5FAXA 1J59A 4XFGA 1ZA7A 4XYXA 3N7MA 1PP9H 3HR9A 5CA1A 3ABLB 4XZUG 1BLZA 2B39A 2CGPA 5J98B 3ZHTA 5FY1A 2DTWA 2VUJA 1EYBA 1XEQA 2ZGLA 5CKNA 3X2QC 2VQUA 5DG1A 3OUFA 2D5HA 5ITZB 1VAKA 1XNRB 3WP4A 3WCRA 2CDOA 4KWUA 3RZZA 4NHMA 2IXIA 5JIUA 1S5LZ 2ETEA 1LHUA 3JXSA 5KXEA 1L0NH 2A1XA 3I3EA 4YG3A 5B1NA 4LHLA 3KG2A 1O4YA 1QXRA 1J3PA 2BNOA 2AACA 2I07B 3C8XA 1MPXA 1F35A 3K59A 1UYPA 3J81N 3SJCC 3CJXA 2EINC 2GNBA 3RFRA 1E5IA 1RUC1 2PFWA 4XUOA 1QWRA 5BZBA 4WM8B 1QQCA 4IGOA 3KWVA 3VD7A 3CE2A 5BNNC 2WKKA 4C8DA 3RYHB 3WF1A 1GQHA 1Q82W 3EJKA 1YSCA 1JZ7A 4CCEA 2QNKA 1JCHA 5LMUO 3BCCH 1VBB1 1J5EB 3AZYA 1E5SA 4UV8A 3BIEA 4AEDB 2XJPA 4UFKA 2M7WA 3AMQA 3L2YA 1JFFB 1I7FA 1FJGO 1K12A 5A33B 4FM1A 4B29A 3E6DA 2VCMA 4IHJA 3CMAV 2P3KA 4JI0B 5C8CC 5JR2A 2JGDB 5FK8A 4AI0A 1N3QA 1CR7A 4HKLA 1NG0A 3VL9A 2ZX4A 4Y5TA 3WEZA 3MV01 3MDSA 4ZI7B 2OZJA 4IEOA 4YFZA 4AHYA 2HEYF 4QQPA 5IT6A 1CESA 1QKQA 3WNLA 4OX9B 3M4FA 2BBVA 2UUBO 2NLJC 3D36C 1SBEA 5EJ1B 2ERFA 4BWOA 3VKLA 3H1JH 1XL6A 5A7OA 2GUZA 3BIWE 3K77A 4LITA 4QDQA 4TQDA 3I3MA 1C8M1 1M57B 1HR0O 1PO11 4UB6Z 4XJZA 2WNEA 1V0AA 4KG0A 5J37A 4EYUA 3CJHB 3DXTA 4U2AA 1E57A 2LW7A 3I2JA 3ZXGA 1AR81 3INAA 3SCHA 3H1LH 4MGZE 2P34A 5DAVA 4YVSB 4CE8A 3ZR6A 3ETPA 4K8ZA 4MVRA 5LA9A 3RN4A 4GIQA 4LBEC 4TTGA 5DPNA 3ORJA 1F2NA 4FPJA 1K5JA 3FHAA 4ZHQB 1PVXA 4O61A 2W1QA 4NB5A 5KXBA 2YY1A 2EXIA 3OEEG 4D6RA 5FL7G 4YZ5A 3ZXAC 3M8AA 1NE6A 4DR1O 4CDQA 3C2UA 5K1PA 2RMKB 1BZKA 2WNOA 3SJAC 3LSDA 1BK0A 3RT3C 4QWNA 2F1MA 1LENA 1FAYA 1S2BA 2DUPA 3ECQA 4RAIA 3WV6A 5JWPA 4F3JA 1RUOA 4QT6A 5GZCA 1WZXA 3H8UA 3FUOA 2DVGA 3PMSA 4LHKA 4Q8LA 2YGMA 2WZR2 1FOD2 5GJ6A 4YPJA 2C24A 5A1FA 4UYBA 5BNOB 3MPBA 4GH4B 2RS32 3D3AA 5GONA 1EAH2 4CTEA 2VBDA 4X62O 5DAXA 2P22C 1PM4A 3NO8A 1W2NA 4LBJA 5CMUA 3H50A 4A3ZA 1S0IA 5AVAA 2PAMA 3AG1C 4X8PA 1T5EA 3IPVB 4NVPA 1QVFU 4K0KO 3JB4C 4AQTA 2AYHA 3VGIA 2EF6A 4HKOA 3ZCCA 3M70A 2WDBA 3K3OA 4LF4O 2YPJA 1H2GA 4Q1RA 2X6AA 4X65O 2RR11 1SS3A 2WAAA 1JOYA 1CIWA 3TNPB 2VMDA 5C3QA 2XBO3 3TNQA 1UPIA 5IVJA 2DN9A 4FXGB 3SKJE 3B77A 2WLNA 4LIVA 4W6XA 2OYQA 4J7KA 2LFSA 3PUIA 2OCCB 1ZSPA 4AI9A 2QQJA 3ETGA 1FV3A 4C1XA 1HRI3 4CUCA 2W0FC 4CH3A 4B4PA 3SNMA 2WNUC 3DSQA 3B7MA 1ZZ7A 3LFIA 4F8AA 4GX0A 3VBUB 1O3TA 4DV1B 2ZIOA 1K9MW 2MPFA 3WOGA 2ODMA 4BQ5A 1XE7A 2NMNA 3VKFC 1SBDA 5I0TA 1KQSU 3MLKA 2R0HA 4LMFA 1BXHA 5IAVA 2WLMA 4CP1A 2P7TC 1AXZA 1AR83 1NCQB 1SG3A 1BBT2 4NO4A 4GKYA 3B69A 5KMGB 3P30A 3AYEA 2LM3A 4X20B 1RUE2 2K9PA 1Q7YW 4M0NA 2VCBA 1KXGA 2W39A 2JEMA 2H8PC 1VIWB 4AXOA 2Z0AA 1BEV3 1Y4WA 1DTOA 1CZSA 2ZMLA 5FUPA 2BTVC 4FK5C 4NTYA 4CH4A 2H0VA 5F3EA 4P2ZA 2VW2A 1FNZA 2A5ZA 4FFBB 2YPDA 4KMQA 1NA1B 2PAKA 3HPLC 2BGCA 4JGZB 2Q4SA 1YQCA 4B7KA 4Q4W2 5L19A 3HQRA 1H8TB 3AKTA 2UU9B 3I2DA 1Q8IA 3V65A 1CPNA 4WVZA 2PAEA 2W94A 3LEGA 1A32A 5C3OA 2QQMA 1QQP2 2Y64A 4YGDA 2LO1A 4HAMA 3ZN5A 1H2MA 1C8NA 1K7DA 3JBG2 4O7XA 1XHXA 4NAOA 3GYDA 1ZBE1 1S3JA 3F95A 3OB8A 3WQ0A 5EIBD 3JQWA 4GAZA 2AREA 2R061 1VBE3 1E79G 4N9IA 2N74A 4RR3C 3FX3A 2IU3A 3GBFA 4D6QA 3SPCA 1AYN1 1SZBA 5G05L 4S2GA 3KGLA 2IFRA 1VF6C 2B46X 1AX2A 1MA1A 3VBFC 2EIKC 2HYXA 3SEEA 4UCOA 1BSMA 5HPOA 3WG2A 5L9VA 2VOWA 4CH5A 2IBZH 2YXLA 4DR7O 2YUAA 2WFF1 1HJFA 1ASJ2 3ITQA 4AVBA 1W6NB 5F2SA 1NXMA 2WQ8A 1S1AA 3BAAA 5FYVA 2FZ1A 3OGVA 3UT5B 1QJU2 2MW2B 4NHLA 5D8AA 4PIZA 1RTVA 2RM23 1TEIA 1W9WA 3OUSA 3HMYA 1W06A 5AVPA 1MSWD 3VBSB 5KA5A 4GALA 3IDEA 3HQUA 3DPRB 1VE0A 1DZTA 4UT5A 5D21A 1KEXA 2H94A 1Z78A 1POV1 3OT7A 1OCOB 5JXHA 1XUQA 3U1XA 4JGYA 3L70H 1RUI3 4R4XA 4YGEA 3IFXA 2JB8A 1ZAUA 3VLBB 2C4XA 2D7FA 1L7QA 1CAVB 4GUNA 1PNFA 3NJZA 3CRAA 3HKDA 1TVGA 4FPKA 2W0XA 4E2SA 3A22A 5E89A 5IFTA 1AB3A 3WHTA 3SCFA 2VMCA 2W6JG 3A0BZ 4XUTA 1UW8A 1ULDA 2EALA 3DF0A 4Q29A 1LOBA 3AK3A 5JH7A 1ULGA 2J7MA 4J6GA 3MW3A 5F5IA 1PX4A 2WNVC 2UXXA 3HNMA 1DQ2A 4DR6O 2DWDC 2OPWA 1OBNA 1HNZO 1HXS3 2ADEA 3LOIA 2KG7A 3ABZA 3BFRA 2GDSA 4DV5B 1ZZBA 5LB6A 1DDLA 1W04A 2ZAHA 5JCOC 4LFCB 1ZRIA 5H9QA 3KCYA 3E1F1 3MICA 5EIBC 3IZOA 4DUVA 3J26N 3KGZA 1H8HG 3H42B 3ZDSA 1HKDA 4Y1XA 1TMF2 4ZY9A 2BJSA 1OUXA 3MYXA 2O57A 1AR5A 2LW1A 1S0DA 2GDFA 1XNKA 3BTAA 4R6ZA 4UB8Z 4MGTA 1N32O 5T5JA 1XC6A 5T5OA 3UYJA 4KHPB 5GLWA 4BW5A 1XB9A 4GKXA 3RZHA 4TSVA 2VPVA 5ANQA 4YWAA 2VZ1A 3D6EA 5LBQA 1G4YB 4FCAA 2JDYA 2UUAO 1OCCB 4AI2A 1AL22 4JVAA 4A3XA 3SQOA 2RQ6A 4DR2B 1N34B 1H4HA 4LFBO 2JDZA 1EY2A 5KXDA 3H3LA 1LAJA 1YJLA 5FRAA 1AYN3 1XBFA 3O1SA 2BERA 1BCXA 2DVBA 5FYZA 4R50A 2XXZA 1NKGA 3USUA 4UCRA 1BQZA 2VJXA 3OUHA 4CCNA 5FJKA 1OPMA 1JUIA 2RDRA 4IETA 4QX5A 4AVCA 3OMAB 4MLOA 4X6QB 3TXSA 2RMU1 5BY5A 4LR3A 3RI8A 4H7LA 1S76D 1HX6A 2VTXJ 5KX5A 4IDZA 1E5HA 2XPJA 5K9YA 4CEYC 4N9HA 1IS5A 3L74H 4HL0A 3K4ZA 2J1TA 2AZ0A 5L3FA 1CAUB 5LA1A 3O1OA 3SH4A 1QIQA 3S3WA 3AG2B 3X29B 5L7OA 1Q43A 3LF7A 4OXSA 4FOYA 2FL4A 1LEDA 2RV9A 1VBC1 3BTYA 2PYLA 2VECA 3CYOA 1POV3 1V00A 2VUDA 2UXCO 3LE0A 3P3PA 1KP3A 4LA2A 4WBNB 3EVKA 3KF5A 3I97A 1F5JA 1R3IC 1TUBA 4FTEA 4BJ0A 1IPKA 3ABTA 1K34A 2OT7A 2UXDO 3GCXA 3MZHA 4J1XA 3SITA 1O9HA 2BOBC 4YRDA 5GW7A 2G9ZA 4JI4B 4RN5A 1AR91 3NNLA 2WSSG 1MS0A 2HLEA 4Y22A 4WZFA 3M8LA 2ZOEB 3AKQA 2GNTA 1UJWB 4LF9B 3BHPA 4Y4RA 4I9WA 4LBOA 1TGOA 3ACFA 4LR4A 4LH7A 3LEMA 4F4LA 3HR0A 3EYPA 2Y69C 1W8HA 4IEWA 4FAGA 5BNPA 3H3ZA 1JHJA 2R9AA 4TWKA 4LOSA 4PI0A 4H0LB 4JI7O 4RUFA 1NKDA 2QM8A 4WM8A 2ZKNA 3H9AA 3LFMA 3PU8A 4LF7B 3OF1A 4MADA 1RINA 2EIJC 1EFRG 1GNHA 2YIDA 4B3MB 1ND2B 5D5PA 1K5SA 2VBBA 2CTVA 4J9YB 3TEZA 4QDRA 4XFIA 2VOKA 2UWCA 4JX0A 1PNGA 4HVQA 1WBFA 1K3EA 5FWJA 5C5TA 2E7TA 4E2QA 5E79Z 2DYSB 1J84A 2VZTA 2YB7A 1ZTEA 4BMBA 5EYXA 1CWPA 4OZXA 1QR9A 2JJ2G 1VQ8V 1RM1C 1WLCA 3O12A 3ZXFA 5CB4B 4UWDA 4TQFA 3B93A 5A7WB 4LHSA 4U36A 3M2MA 4HK9A 5JLVA 4NXNO 4PA4A 2HVKC 4B3TO 4KNCA 3WQ1A 5A33A 1OA3A 1PK6C 3JD71 3SGIA 2OT5A 2DURA 3VBRB 4RHV1 4X1YB 1HV0A 2A70A 1AJNA 4CDWA 5F5AA 1D7PM 4GB33 3IT8A 1W6OA 5IYZA 1AVMA 4M3CA 4UXAA 3JD4A 4QB6A 3CDZB 4Z1MG 3H1MA 2XVGA 3ZYFA 4UBHA 3KMHA 2OXBA 2ZR2A 4GJYA 1NT0A 1KS5A 1YO8A 1SF9A 2EIMB 4N53C 2Y0PA 1R1A2 1ACCA 1EV11 4GCZA 1XRUA 5DDJ3 5GLZA 1AF9A 1HNXB 4RQPC 2Z69A 3K3NA 3MEPA 4QXKA 2DU1A 1NTMH 3VBHC 4GWIA 3G71V 4MVOA 1IG3A 4O4IB 4A44A 3I59B 2GMMA 3UESA 3GHNA 2OQ7A 1DGRN 1AI7A 1MQTB 4E8DA 3TBDA 4AVTA 3GB7C 1RXGA 1RHI2 1HP8A 2ADPA 1WP7A 1V55C 2EX3A 1IPSA 1O3SA 3K3WA 1PNKA 4YYOA 2WZPP 1UFIA 5F2WA 1Y9GA 1IQAA 1H1MA 2HWD3 4YGCA 2UUCO 3BU0A 4G9SB 2F93B 2W9XA 1F7YA 3JASA 4LK7A 3OFNG 1SLBA 1WN7A 5J2TB 2A6VA 3GHMA 4GQ7A 1PVC2 4WVMB 1POQA 4DRVA 2C6SA 4JTAB 1QCEA 4IV3C 2PHUA 4LEJA 2ZPXA 5LA6B 5F6LB 4YW2A 5LGUA 2QKAA 2WLJA 1RFYA 1LODA 1V9U1 4XHBA 4TUYB 1OCZC 2F4PA 5H9RA 5FYMA 4CP2A 1TVKB 1KFUL 1GMMA 4YVWA 2XJQA 1X36A 5BNOA 4GH4A 3D3IA 4MGSA 4NUBA 5A7NA 2ZT9B 4CC5A 3SR2C 4B3RO 3ZRVA 4F6EA 2GAUA 1T2XA 4IEXA 1Q6IA 4DV6O 3PJYA 3BB6A 1GNZA 1O4ZA 1XNBA 2QQIA 3SYOA 2QWNB 4ZPIA 1MACA 4Q27A 5KUMA 3MPPG 3PURA 2V1DA 4YW1A 4HANA 3MI8A 4CRQA 2YDEA 2HR3A 1GAXA 1UMZA 2BOJA 2QWOB 5E1RA 5FMOL 3DXRB 2ES3A 3N7LA 2K46A 5BXXA 3CSXA 4M00A 1YITV 5K1XA 4LCUC 3ASNC 1EN6A 4RQEA 1OOPC 5FZCA 2QWQB 1MR5A 1S0FA 3J8F1 4AZZA 3R4DB 1ROPA 4CS2A 1BMV1 1ZUQA 4DK0A 2B7YA 3ROUA 4E4EA 2B1GA 1UYZA 4QQ2A 4I55A 5KHKA 2JE9A 2BRTA 3ZR5A 4E27A 4OQ9A 3DEMA 2EZPA 2CTQA 4XTPA 4FSJA 1W9YA 2WO7A 2YIBA 5T5PA 2J1AA 1ZZ9A 2GC0A 1SRYA 1AROP 3DKWA 4JYYA 3U14A 2JG9A 3CJIC 4XMIA 2LRPA 2XKPA 2CYFA 5CKQA 4LF8O 1EV13 4RO2A 4FLUA 1ZRRA 1TUEB 4BE3A 1PD3A 1YJNV 3H1IH 4XIKA 1CIYA 2VOVA 1RUC2 1PM7A 5FY8A 4CBCA 4YY3O 4QX1A 2UXBO 5FXWA 1AR71 1QMJA 3BOPA 2DVFA 1NCQA 3CS5A 1P4RA 1QXPA 3CO2A 5H5NA 2X5IA 1X7NA 3KD4A 2IUWA 4PV1B 4X20A 1MZFA 2Q8EA 3QLQA 1NTKH 4LH6A 4YJ3B 5LK5A 3POEA 1T6BX 1XSQA 3T0AA 3NAPB 4LF6O 1VBB2 4IYHA 1UOJA 3WP6A 5C4WC 3O65A 5BY1A 2AGAA 4UAPA 2LQTA 4P30A 2AZ2A 3ZOIA 1NJIW 5FFOC 2A6ZA 2E32A 3I55V 4QQLA 1W9SA 3FZ3A 1CQ9A 2LTNA 2X53S 1L1FA 1C4RA 3NNMA 2ZM6B 2ZZQA 1TNFA 4EZHA 5A2QN 2GN3A 5A3WA 4Y1VA 3VDCA 2HWB1 4Q4X3 2HEWF 4H13B 5FKBA 2DOSA 1V9U3 3VZLA 3UJQA 1GH6A 1YQ5A 5A32A 5CFDA 3KT7A 2P17A 4NXMO 4JI3B 4AHCA 2WS93 3AP9A 3PUAA 2NN8A 3ZFEB 1G9DA 3VHPA 2VNOA 1JZ3A 2Q1ZB 2BTQA 4FFFA 4GLXA 4H2AA 2ZS6B 3J9SA 4U3JB 4R9CA 1J3QA 4CDXB 5LCWL 4LFAB 3JATA 3UGHA 1RUJ2 5BV6A 1C8M2 4JI6B 1HW7A 2P4VA 1PO12 1OUSA 1UIJA 1GOFA 4JI1B 1RUF3 2RS13 1S2KA 1Q56A 1AR82 1YFXA 2TBVA 4UFJA 1VALA 4LNUB 1YC61 2QQVA 5KC6A 5B4NA 4ICGA 1R1ZA 1TME1 4LTAA 2PHRA 2VQ0A 3GDBA 3KLSA 4EB6B 2VNRA 3VD9A 2VRZA 3FYEB 4CS3A 2CU5A 5FXZA 3D82A 4CU6A 3FAVB 4UVAA 1UIKA 3LDKA 5EXOA 3SDLA 2ZJCA 2L6LA 3ABMB 3AKRA 4BAYA 5JXIA 2BTOA 4J25A 4G3YC 1GP6A 2VVFA 5FQ0A 5B3SC 5ABJA 4QPIA 2HWC1 3FBYA 1SDWA 2LFRA 3N36A 1OA4A 2QDOA 1MVQA 4ZZ8A 4HNAB 2PLV1 3M3CA 2EIBA 1NLQA 4P08A 1V70A 3V0BB 3ABLC 4CZSA 4S2DA 2JGUA 4IT5A 3FLPA 2Y6FA 2KM2A 2Q69A 5C8WA 1QJY1 5HCHA 2W87A 4ET7A 2XAJA 4R52A 1W6MB 4RS5A 1FS0G 1QHDA 2G4IA 3DL3A 4FPEA 4NR1A 1M4UA 4DUYB 1BHBA 1N33O 2VNVA 1GWLA 3JAKB 3PJSK 1XNDA 4P9PA 2K1EA 3R65A 3O0VA 1JOPA 3ATGA 2WWWA 2WA3A 3WF3A 4PBOA 4HETA 3ZFFA 1MS4A 2E9QA 3JAWB 2ZDIC 1OF3A 2J22A 4QX7A 2ITDC 4D6SA 3AC0A 4LPLA 2HHHB 1JODA 4LBQB 3WW3A 1QDOA 1FATA 4JDMA 4B3SO 4E8CA 1BCCH 3VZJA 2R1BA 4RA0A 4XDOA 5FP8A 4JDOA 3HBZA 2OQ6A 3LNMB 2NR5A 2RR12 2CGNA 1ZNPA 2ILMA 3U07A 3APOA 3LA3A 4AEDC 3UO3A 2JS5A 4FPLA 3TOJA 1N1YA 1JYXA 1IDSA 2XKOA 5K0UA 4MSVA 2JICA 1I94O 3RYFA 3E2EA 2IFWA 3ZYHA 3J80N 1Y6XA 5JOZA 1VRH1 1PO21 2YI8A 2A3XA 2VOXA 3ES4A 1AI4A 3AXDA 3T08A 4HKWA 2ZX1A 1AX0A 4IV1C 2E76B 1ZL8B 3FMGA 1ALYA 3TXQA 4EKWA 5CA0B 2VMHA 3T1MA 3WB2A 1NZ6A 1VAVA 2UWBA 5F7UA 3T09A 5LMNO 5IVEA 5ANNA 3L72H 2WNUB 2WFPA 3NR7A 2DVAA 1GYKA 3OMIB 2D6NA 1UOGA 1B04A 1FFXA 3ZYJB 2HJDA 1NVPD 1OZ0A 1WLDA 1VF7A 3AEIA 5JVDA 1M57C 2GC3A 3TB0A 3PHMA 2XHKA 2WZEA 1TME3 1GK9A 3MUZ1 3F5WC 3HKEB 4HK8A 2PI5A 4COYA 4FFHA 4MO3M 5DUVA 3AZXA 4Z07A 4JYAO 4YVSC 1FXHA 5LXTA 4BHPA 1W03A 2UU8A 1MS5A 5FZEA 3E6CC 4D94A 4YLZA 5A3UA 1WCUA 3BOWA 2HWC3 3ZSKA 4X64B 3AL6A 2XHNA 3WXPA 4DFSA 3SC7X 3ZHSA 3DTUB 4AAPA 2V4VA 2DQ3A 2VQEO 2FQPA 1AR61 3MIEA 2JB4A 2PLV3 3KV9A 2B4KA 5L3EA 1LESA 2ZACA 3ZFGB 3E8HA 4DV0B 3RG0A 1ZBE2 5HCFA 4BIOA 3KHBA 4BU2A 1HB4A 5J1XA 4MT8A 2R062 1FMD3 2JK5C 2R9IA 1URFA 2MEV1 1ULCA 2RHPA 1AYN2 5FZ1A 1PNMA 5BR8B 2J1EA 2CAVA 5JQGB 5IJ0A 2QQUA 5BYNA 2PA7A 4FPPA 2XLFA 2FMYA 3HVDA 5C3PA 1YXWA 4DUZB 1TNRA 3VOUA 3WD5A 4AL9A 3ZXKA 2P3JA 5LATA 2WFF2 3UJOA 1N36O 4U7OA 2PELA 4NROA 4DUWA 1COV1 1NS1A 1EPZA 3ASOB 3S30A 3VBBA 1M4WA 4SLIA 4XJ8A 4D3WA 4PA7A 4KGQA 1FXVA 4C91A 3MD0A 3I2KA 4Z2WA 2ADDA 4DMIA 5L3CA 5CB4A 5J36A 1RSOB 3V56A 4RSUA 3APBA 4WM7B 2VQFO 3CD6V 4V2VA 4U7NA 1XNQB 4PDWB 3H3UA 3HNYM 1OLME 4QPGA 1Z5VA 4FP2A 4X66O 2E31A 4Q5OA 1FPN1 5CBHA 5DUXA 3UK9A 3N4MA 1IURA 3UT0A 4MGYE 2BBAA 2VZ3A 1DLBA 5I93A 1GICA 4LBLA 3FB6C 3MFCA 2QVSB 1XPWA 2RJ2A 4UFMA 4DV3O 3T1CA 3DGEA 3T2QA 1Q8VA 1PGSA 1W2TA 1S0VA 1YF2A 4AILC 2XJUA 5HXVA 4HG6B 1QNYA 3WDTA 4Q0UA 5FZDA 1U96A 1BZWA 4IERA 5A80A 3VN4A 3H7YA 1OD3A 1VBA1 2OCCC 3BEHA 1HW5A 1W05A 1LGBA 3KQ4B 4J1WA 2F4VO 3OTOB 3CRQA 1WMFA 4K6BA 2Q0OC 3UCSC 3O9OA 3ZRXA 1NCRC 4GZ9A 1K42A 3LIHA 3LB9A 1GOHA 2KD7A 2YEVA 1F8VA 3VBUC 4NWVA 5D5QA 4K3UA 3ICXA 4QKDA 2WBKA 3ZRWB 3G67A 4JI8B 5EYPB 1UZ0A 4FQ4A 2PI4A 3Q8AA 1HQWA 3PU3A 2FHRA 2WNVB 2KQXA 3RWRD 4GKJB 2V5DA 4NPLA 3GM8A 1COWG 2IM9A 3ZYIB 3ZXLA 4OI4A 3SYAA 4AR2A 3AZWA 4MX3A 2W6IG 3AX4A 5BXZA 4NIAA 4CP9B 2JJ6A 4PLOA 4NE9A 5DUUA 4RQFA 1RPRA 1TAEA 2OW4A 4YJ2A 5J9PC 4C1WA 5CB7A 5JJNB 4BOWA 1AR63 4QPJA 3A2FA 1NA1C 4XDLA 5EC1C 1CGPA 2VZRA 3FFQA 4I0AA 1LU2A 1H8TC 2BFUL 3TCUA 1ND3C 2IH1C 1H9PA 2A3WA 4LF5B 1X9TA 5A7PA 2ZKOA 3AZZA 2W2IA 1Q81W 4NIDA 2NMOA 1G8MA 1SFNA 3AK2A 3WZ1A 1WA6X 1AL0G 4K35A 1DF0A 4L97A 3WX5A 1VBD1 2RMU2 3SXWA 2PF4E 1I5XA 3I2HA 3E86A 4ASLA 3MFAA 3R05A 2DFBA 2BWCA 1VB2A 3KV5A 1QQP1 1S4CA 3T0DA 4Y5Z0 3CCEV 2ZQMA 5AFBA 2YYOA 1HIXA 2ZE7A 5IWAO 3OGSA 1HJGA 3OEAA 5FCCA 1VIBA 3M3EA 2PTMA 2WZR3 1FOD3 4UW6A 4K3AA 1FPN3 1NR7A 1VBC2 2FMLA 3B8MA 2Y26A 2VNGA 2V7QG 3FD9A 3D0JA 1EAH3 3PUQA 2XGXA 2PGGA 3VBSC 4KI5M 4PJ0Z 3DPRC 4FPCA 4K8FA 1VPHA 1H1IA 1SACA 3JD0A 3M3IA 1SZXA 1QHTA 1RC6A 1VQ9V 3WCSA 5GTHZ 2R071 1AR92 1B6QA 3HJRA 1QJU1 4C0HA 1W8WA 1VBA3 1AP5A 2VTXA 4OGQB 5FYTA 4IE4A 4AI8A 1HDKA 4N23A 2R1DA 4DINB 5LYJA 2QKCA 2XVKA 1VLNA 1UX7A 2E26A 3OM3B 1SQQH 1JS9A 5FO7B 2FDJA 4JYCA 2Q30A 4A7ZA 3E5UA 2PZSA 4DXRA 1PMHX 1GZWA 3ILNA 5I0DA 5KC5A 1K5MB 2WN2A 1JQ0A 1I5ZA 3B00A 4KU8A 3SH3A 3IIIA 2VL4A 2QJVA 5L9BA 3BI3A 1O5UA 1U5ZA 5JOWA 2EXKA 4MG2A 2Y69B 1W2UA 3BU7A 1RITA 4B8EA 3LWCA 3ZS8C 2YZ4A 4K1ZA 5FYIA 4JKKA 2Q67A 1W99A 1OFSA 3N27A 2JG8B 3N9MA 2VD7A 5FK7A 4FLZA 4YZ2A 5BNNA 1GN6A 2EIJB 5CIRA 3HKCB 4LORA 1H8VA 3AMPA 3BY6A 2DW4A 2JIZG 3C3TA 5CG8A 1RUNA 2X10A 3RVYA 5KAFZ 3JD72 1RP3B 1B3QA 4AFMA 1QGLA 2XVLA 4RHV2 1Z5WA 3WNOA 4GWMA 1W6PB 4P9IA 1QJEA 2ZHNA 1KP2A 1OD5A 2ZGOA 2BFUS 2IZWA 1BBT3 3T1HO 1YZBA 4DUXA 1SPPB 3CRRA 1RUE3 4OULA 1CJPA 4LKSA 1RUH2 4EN6B 1AYM2 2P67A 3V0AA 2W08A 1OPOA 3ZXDA 1F4AA 4FPFA 5C8CA 1OCCC 2BYVE 4FPGA 2XL7A 4O9EA 2VC9A 4P9JA 1EV12 3O1MA 2RDQA 5FJHA 1JBCA 1J58A 1US6A 3U11A 3WNXA 1UCXA 4EQVA 1ZBA1 5FZKA 1LUWA 4Q4W3 1LR1A 1KKCA 5FP4A 3ILRA 1ODNA 4UCVA 3WW2A 4JKLA 1QLNA 2YBPA 4DS0A 4COVA 1QQP3 4GMP1 1OH3A 3A21A 3M1HA 1OH4A 3OD0A 4LO7A 1J1LA 4OHYA 5LGNA 2WWUA 1VJ2A 1X33A 4W65A 5DAQA 3LPGA 3DXUA 3PVNA 4CU8A 3JBG3 4AFBA 2WZ8A 4XBQA 2FDIA 2ZNJA 3D36A 3KCCA 3WNPA 3CBNA 2IXKA 2PUSA 2JD9A 2ZGPA 2BSKB 4ZOLA 2VMFA 3LAGA 5LY1A 3E5XA 3V64A 3VKNA 1WA4A 2ZX3A 3VHRA 2XJRA 4ONUA 1ASJ3 4XFCA 1V6MA 2QQOA 3K57A 1V55B 2ARAA 1LNSA 3ZJZA 1QJU3 2YHJA 3J4UH 3NJXA 4O2BB 3WDVA 4PQ9A 2ZE5A 4D7YA 2OPKA 3E8GA 4NHXA 2WR9A 4DR3B 4TV9B 1V9U2 4UOJA 1QU0A 2RDNA 4K40A 1I0HA 1BVP1 1FPOA 3K51A 4HSLA 2GMPA 4NRMA 1NZIA 2J42A 2HWF1 1QJX1 4PELA 2NZ9A 3JUUA 1RJ8A 4WFGA 2DFCA 5H6QA 3UL2A 2D3OW 4EWAA 5JSRA 3ZN0A 5KUKA 4HPKB 4MTFA 1AJPA 5FR3A 2VH9A 5FZOA 3KVAA 1D4VB 1BYHA 3K4AA 4X88A 2JDAA 4IW3A 1ND2C 2W47A 1HV1A 5FMDA 3T1LA 4LBQA 5CBLA 2H3OA 4MTXA 1Q86W 4B1MA 5AC91 2BW8A 1WJZA 5B66Z 3LPFA 1VQNV 1C1LA 4FPYA 4X1IA 2X6BA 4MVMA 2WLLB 2X09A 3VZNA 3JARB 3ZM8A 5CFCA 2DYSC 4NIHA 4CUAA 2V4DA 3BABA 3K5LA 4WF9V 4AEMA 1TQ5A 3J8F2 4JF3A 2EVXA 3USSA 4XBNA 1K33A 4DNYA 4CH6A 5A6ZA 3KV4A 2YUEA 2XAGA 1U97A 1BMV2 2AHYA 3AP5A 2YXSA 1VF5B 3ZN6A 3OR7C 4IGPA 2HLDG 5A7SA 5HV4A 3VBRC 5LHIA 3WQ7A 4A41A 3QTCA 3KZIZ 4HXCA 1W8NA 3WR0A 3ASNB 3EXUA 3RGBA 1OOPB 1W0JG 2Y8KA 4GKKB 1WB8A 1BQPA 3CCQV 1OHHG