1KKDA

Solution structure of the calmodulin binding domain (cambd) of small conductance ca2+-activated potassium channels (sk2)
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
92
structure length
92
Chain Sequence
RKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A helical region in the C terminus of small-conductance Ca2+-activated K+ channels controls assembly with apo-calmodulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Small conductance calcium-activated potassium channel protei
total genus 4
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kkdA00
1S5HC 1XL6A 3ABKC 5EBWC 2OCCC 4PDVA 5CBGA 2BOBC 2ATKC 3OUFA 4XDKA 3AG3C 4PA6A 4HZ3A 3OGCC 2ITCC 4PDRA 1P7BA 4LP8A 2K1EA 3T1CA 3E8FA 3K06A 2WLNA 3ABMC 4KFMA 4GX1A 4MTGA 3FB8C 4R8CA 2EIKC 4WFEA 1XL4A 4MVOA 2Y69C 3BEHA 4RUEA 5EC1C 2Q68A 4DXWA 3IGAC 3PJSK 4P9PA 1JVMA 4F4LA 2DWDC 1OCZC 3FB6C 4LCUC 1K4CC 2HVJC 2A0LA 3SPJA 1V55C 4PA9A 2Q67A 4PA3A 2NLJC 2IH3C 2AHYA 3E89A 3AG4C 3ZRSA 5B3SC 4PDLA 3LUTB 2WLHA 4RO2A 2ZD9A 3FB7C 4JTCB 3SYQA 5CBHA 5KUKA 2WLLA 3SPCA 2DYSC 2IH1C 4GX2A 4P9OA 3UKMA 2Q6AA 3OUSA 1KKDA 3RBZA 3TETA 3RW0A 3T4ZA 3SYAA 3ZJZA 4X88A 2QKSA 3OR7C 3E8HA 3SPHA 2AHZA 3F7VC 2HFEC 4H33A 3T4DA 5EK0A 3AG1C 2X6BA 4JTAB 5E1AC 4EKWA 3STLC 5J9PC 3ASOC 3LDEA 1QLEC 4G28B 3HPLC 2EIJC 4I9WA 3OR6C 4MVUA 1BL8A 3VOUA 3E8GA 3WG7C 2WLLB 5BZBA 2A79B 1R3IC 2YEVA 3GB7C 3STZC 2Q69A 4XDLA 3RVZA 2KB1A 3R65A 3UM7A 4RAIA 4BW5A 3ABLC 1V54C 1M56C 5KUMA 4MTFA 3F7YC 3E83A 1ZWIC 2H8PC 1OCOC 1OCRC 4WFHA 2WLIA 3SPIA 3ASNC 4HYOA 4R7CA 2HVKC 2WLKA 2R9RB 3LNMB 4QE9A 3LDCA 3SYPA 4MVZA 3FB5C 4P30A 5B1AC 2HG5C 4QE7A 4MVRA 4JTDB 4P2ZA 3SYCA 4QNHB 2BOCC 3IFXA 5EBLC 3AG2C 3SJQC 5B1BC 4ZBMA 4MS2A 4OXSA 2WLJA 5EC2C 1OCCC 1G4YB 4R6ZA 4X8AA 3KG2A 4PDMA 3LDDA 1ORQC 3K03A 4J9ZB 4WFFA 3SPGA 4LBEC 3K0GA 3E8BA 2X6CA 3TCUA 1J95A 2DWEC 4MTOA 4MVSA 2HJFC 2QTOA 3RVYA 3JYCA 4UUJC 4XDJA 1R3KC 1R3JC 3K04A 4PA4A 1LNQA 2X6AA 4MW8A 5EBMC 3X2QC 1R3LC 4GX0A 4CBCA 3K0DA 3EFFK 4MVMA 4R50A 4MSWC 5IY5C 2EINC 4MVQA 4MW3A 2ITDC 1M57C 4J9YB 2P7TC 3E86A 4GX5A 2WLIB 4RUFA 2EILC 3K08A 2ZXWC 4WFGA 2A9HA 2JK5C 2WLMA 3F5WC 4G27B 5CBFA 3T2MA 2EIMC 2W0FC 3SYOA 4PA7A 4TWKA 1K4DC 2DYRC 4H37A 4X89A
chains in the Genus database with same CATH superfamily
2Q9LA 3BAAA 2Q7GA 2AZ2A 1G6UA 5B1BB 1CXZB 4U3FH 3U10A 5LP6C 1X59A 1D2DA 1AROP 1FXKC 1Q8IA 2WAMA 1ZTEA 4HAMA 2WLNA 3RYFA 1VQMV 3ASNB 3EXAA 3L74H 4ZHQB 5JQGA 1ZL8B 1AJQA 4OPAA 1N0JA 4H44B 1NVPB 4O2BA 3L71H 2UXXA 2F93B 2VWJA 1K34A 2RMKB 1BT8A 3B8MA 2ZT9B 2EIJC 4WFAV 1BMFG 4DR6B 1R3IC 3Q4HA 3E35A 3U0ZA 2KB1A 3R65A 2JS3A 2OT5A 1I7FA 1F7YA 2PF4E 4JI7O 1YXBA 1AI5A 4GUNA 4J80A 4CH4A 1GN6A 5BR8O 1HW7A 4J7JA 4R6ZA 2EILB 4LBEC 2V4DA 3MHHC 1WN7A 2Q4PA 3FKSG 1GN2A 3H9VA 3MD0A 1NI8A 3CX5F 1M90W 2ETNA 1Q81W 3CWBH 2QWPB 4R50A 2ITDC 2KQXA 3J80N 4KL1A 3IC7A 4TUYB 1TUBA 1PP9H 3OEHG 4O4JA 1BZKA 3A0HZ 2H94A 5LGTA 2OCCC 5KHHA 2P6JA 5IJ0A 3G71V 4LF5B 3RYIB 3OUFA 1YIJV 4FIPC 4DR2B 1THZA 4NTXA 2KSDA 1YJWV 2XHBA 2XT9A 4LP8A 5L3BA 3RYHA 4R8CA 1VQ6V 3K79A 3BEHA 1BCCH 1SQVH 4FLVA 4OGQB 1MA1A 3ZHSA 2FTKA 2AHYA 3HR0A 2ZXWB 4O2AA 4DV1O 1FJGO 4KHPB 4DR1O 1RP3B 3AK3A 4J42A 4RO2A 5A9GA 3CCSV 4ZI7A 3ZHUA 4Z1MG 2IH1C 2DN9A 5KHGA 2DQ0A 3CCLV 1FPOA 1UPGA 1IBKO 4X88A 1M93A 3QO8A 4GCZA 4L8JA 2UU9B 2IM9A 2IU0A 1I94B 3ABMB 4JI3B 4DRXB 5CMUA 2A79B 3FAVA 2Q69A 4XDLA 2WWWA 2UXCB 2N05A 1XEQA 1HR0B 3C90A 1SKVA 2NNUA 1IBLO 1CEZA 3KKYA 3IJ4A 1WP7A 4ASUG 5LBQA 1F23A 2XAQA 3AG2C 3SJQC 4OXSA 1E1QG 3CP1A 3K03A 1WB8A 2NR5A 4BR6A 1TVKB 2ZNIA 2DWEC 5KA5A 3NXSA 4AQYO 2DMXA 5E79Z 5ITZB 5H6QA 1P4RA 3EFFK 1N32O 4MVQA 2WLIB 4ZKIA 4FFBA 2AXTZ 4X66B 3RN4A 1FS0G 2JGUA 4X64O 1K4DC 2L35A 4LFBO 4A5UB 5EBWC 4JAUA 4JZGA 2DE0X 2ZR3A 2V1DA 1ROPA 5H2FZ 4KHPO 2VS0A 2QWNB 1LUWA 5D5QA 4N23A 1K8AW 2QEXV 4MTGA 2E75B 4DR7B 2B1IA 4OPHA 1VMGA 4X64B 4FLYA 2LGQA 2JJ2G 4B3SB 5IYCO 3C3TA 2EINB 2HJDA 5EIBD 5DEDA 4BIOA 2WLHA 5L3FA 4JYAB 3FB7C 1KU9A 2XAFA 2WLLA 4J7ZA 2HEPA 1EZVH 2Q0AA 2JVDA 3D8CA 4GYCB 5J9PC 4H0LB 3HPLC 4I9WA 2XOKG 2HHHO 3EHBB 1Z5WA 2WLLB 3CMAV 1NH2B 3A8TA 2F1MA 2P22C 2UUAO 2IU3A 2A3QA 4FFBB 4I5SA 3DC5A 1NH2D 1H2NA 1JR9A 2EIMB 3GWKC 2WLIA 1Q3EA 5J2TA 2E74B 2EJRA 2R9RB 3LNMB 4Z1VA 3SYPA 1S77D 2X0LA 5B5EZ 1GAXA 1QVFU 4PELA 2YS8A 4DYLA 5IWAO 1R6KA 2QWRB 2WLJA 3CHXA 1OCCC 1RM1B 4X1IA 5FNVA 3VQVA 1QR8A 4FLUA 4F6RA 3CCEV 3IC9A 3JCZA 3W7XA 2RN9A 2QE7G 2X6AA 3CRRA 1DTOA 4FLWA 1QLNA 2CGOA 3ZCCA 1XQ8A 3E86A 4CS2A 1EN5A 2JK5C 2WLMA 4B08A 2YC0A 1FXKA 2ZM6O 3H1KH 2F43G 3QG5A 4DV5O 2XASA 2BOBC 4LFCO 4UVBA 4LF5O 3BCCH 3FB8C 2EIKC 2Y69C 4DXWA 4JI8O 2QDOA 4UCVA 3G6EV 1M56B 4WBNB 3OEEG 1V55C 3AK1A 1SA0B 1H38A 3E89A 2CGNA 4WFBV 4NXMO 3AEIA 3L9DA 3WB2A 1NT2B 5CBHA 5KUKA 4TV8B 1O9GA 3UKMA 1VQPV 1GM7A 3ETDA 3JATA 3TETA 1JCHA 4I50B 2Z5UA 5DM6V 4CS3A 2OWOA 5AG2A 3I5DA 4CH6A 2R9AA 1AB3A 4JI8B 5E1AC 3OMAB 1Q43A 1J5EB 5HFLA 3T1YB 1VQ8V 3RYIA 1N33O 5BZBA 4X20A 1NBMG 4O2AB 1VF7A 1ZUQA 5KUMA 1V54C 4LH6A 3I55V 4DW0A 2BSKA 3UCSC 1XUQA 3CPWU 4NTYA 1QU7A 3BVOA 1YTFB 4JTDB 4DR7O 4B3RB 2QGNA 5B1BC 2GUZB 2JIZG 1XBLA 2CK3G 5LHHA 3T1YO 4PDMA 1NTMH 2RNBA 3KCYA 2QKCA 4MTOA 1VQNV 1WA8A 5LP6A 2P7TC 3CRQA 3BHPA 2EX3A 1I5XA 2W0FC 2HP8A 1GK9A 2WA3A 4FJCC 2GV9A 4DR3B 5LL6Y 5K1PA 3CS5A 3O9OA 4PA6A 1I94O 4CC5A 2C2AA 4PDRA 1KKCA 2QM7A 3MAQA 4DV6O 2X7RB 4YY3O 3PJSK 4I7ZB 2W0XA 2A0LA 3AG2B 2Q67A 5B1OA 2EULA 3ABUA 1JJOA 4GZRB 5KAFZ 1YZBA 2CH7B 4CZZA 3CCRV 5CB4A 2FL4A 5HFMA 1XMOO 2XAHA 1BHAA 4G28B 1WP8A 4JGSA 1VF6A 4TQFA 1EM1A 2CH7A 3ZRVA 4LFAB 2QTSA 4EFBA 1B6QA 1URFA 1FJGB 4O4LB 4PD4F 5JQGB 1AJNA 4LF7O 4DV3O 1NJIW 3LSUA 1N0NA 2Z0AA 1LUVA 1B04A 3THOA 1QVGU 2UUCB 4HNAB 4W4KA 3CXCU 2Q73A 2B5UA 4YJ3B 2X6CA 2FB5A 5KX5B 1HNXO 4EEQA 2OIGA 3JYCA 1R3KC 1R3JC 3APQA 5H9CA 1XILA 4JI2B 1R3LC 4MVMA 3JD0A 4JYAO 1L1FA 2F23A 2ZXWC 2ZE5A 2A9HA 4G27B 2PI4A 3K5LA 4BIUA 4DV5B 4X89A 1HNXB 4JYYA 4JI0O 2YEVB 1AI4A 2ZCEA 2P67A 2B1GA 1K9MW 1SF9A 3K06A 4X9QA 4AILC 4F6RB 3NR7A 1KECA 3WB1A 2N74A 1CPYA 3K5OA 2BSKB 2R9IA 3SR2C 5B3SC 1VQ9V 2RJZA 2ZE7A 4F6EA 1Y74B 5CA0B 3JCUZ 2DYSC 5FL7G 4DO2A 2UXDO 2CTRA 1K33A 5IYZA 2Y48A 4CH5A 4W4LA 2DW4A 3ZMTA 1L8DA 1MMMA 2AHZA 5EK0A 3AG1C 1SZTA 3DSQA 3JD2A 1T5EA 1SQPH 1XDCA 4MVUA 3VOUA 5JH7B 4RWUA 3M8AA 3OW2U 3R66A 4LF8B 5IY5B 3QTCA 2EJ7A 1V55B 4DV0O 1N34O 2IJHA 1ZWIC 3ASNC 1PM9A 3G4SV 4IIJA 4B3RO 3QO5A 2BOCC 3JARB 4UCSA 3E22A 4RQEA 4E4EA 1I5YA 4OX9O 5FNVB 2W6JG 4D6TH 1J95A 1HNWB 1SRYA 5CN0A 5LHGA 1SZXA 4DR5B 4TSFG 5BR8B 4IHJA 3K08A 4X20B 1B3QA 1WPXA 1BS3A 4GT1A 3BABA 4GKJO 3UT5A 3JAKA 4JYBA 4YHHO 3QO7A 2IJIA 4JI1B 3AK2A 1UFIA 4YJ2A 1E79G 1YEWA 2IW5A 3HKEA 4I9QA 2PYLA 1QBZA 1V54B 4NXMB 2K1EA 1TVKA 2VQEO 4RQFA 4RUEA 4P9PA 2JGDB 3JSLA 2P90A 2HHHB 4PDLA 1S5JA 2PYJA 2OTJV 1K5SA 4JTCB 4KXRA 1R6NA 5BXZA 2PGGA 4JYCA 3A2FA 4P9OA 1F4MA 1M57B 4LF6B 1AP6A 2WSSG 1GN3A 1N34B 4PHZA 4K0KO 3B09A 3TXQA 2LW7A 2YSUB 3ETEA 4TV9A 1FFXA 5J2UA 4JI6O 1PL0A 1BQ0A 1M5IA 1NU1H 5EZYA 2OTLV 1L0LH 3ABLC 1KMIZ 1W2BU 4B7KA 5L3EA 2BTQB 3RWRD 1JMKC 1FXVA 4UFZA 5KAIZ 2ZINA 1PD3A 3OMNB 4P2ZA 4QNHB 5ITZA 1KP3A 2RQ6A 3AG3B 4ABMA 1U97A 4C7UA 2BCCH 4IGGA 3P3PA 1YJNV 5J2TB 1N36O 1H2MA 1SQXH 4I55A 3S3WA 4UV9A 4DV4B 4FLXA 4J10A 4CBCA 5LMUO 1YVWA 3ETQA 1Y76B 1M57C 3OAAG 4BWAA 1EN4A 2EIMC 4HBNA 5KHKA 1VQ5V 3B40A 2XAGA 2BE3A 3FAVB 1IXBA 4XDKA 3ZN0A 1OJHA 2QR4A 3LSQA 1XHXA 1RPOA 4JPRA 3K58A 3D36A 1XL4A 1XNRB 4B3SO 1H2KA 4QPKA 1Q82W 2YICA 4B3TB 1OCZC 2R72A 3QNEA 1S3JA 4IL6Z 1SC5B 5IYBO 2VQEB 2UUCO 2E3CA 3AG4C 5GTIZ 4KP4A 3DGEA 3GVMA 4UCTA 1AVMA 2IJJA 3SYQA 5KMGB 4DV7B 3HKBA 4UVAA 3QVNA 3ZJZA 3Q4HB 2EZPA 1VQKV 2EIJB 4LR3A 4JI4B 5IWAB 1JX9A 4ZIBA 3W7SA 3OR6C 1E1RG 4IT5A 1ZAUA 1MSWD 3STZC 3N2GA 5JWPA 1LR1A 4UV8A 4ZOLA 4WF9V 4DV2B 2H8PC 1QLEB 4LF6O 3SPIA 4HYOA 2CUGA 1YTFD 1U96A 3H1LH 3B77A 2UXBB 3JASA 4QE7A 4MVRA 2UUBB 3CCMV 2DQ3A 3E22B 4ZHQA 2QWQB 1G4YB 5LMNB 3KG2A 4U7OA 3ZHRA 3SJAC 4DR3O 1NTKH 2HJFC 1Q6IA 3DTUB 2Q5ZA 4O4JB 1LNQA 2UUBO 4YIOA 4NKGB 1TUBB 4DR4B 4U3JA 2EILC 3D36C 4D7SA 3JD1A 4I4TA 4AQYB 5EYPA 3K9AA 1VF5B 4EB6B 5KX5A 1R73A 1MSDA 1KP2A 3UQ8A 3HKCA 3JAWA 1WA8B 3DXRA 4LNUB 3B8NA 1Q6UA 3A0RA 3CYOA 5B1AB 4FLTA 1Y74A 4GKKO 2LQTA 4MVOA 4F4LA 2PI5A 4K8XA 5LGNA 1W0KG 3AG7A 5LA6B 1HR0O 2IH3C 1MOFA 3RT3C 1NQTA 3OUSA 2P06A 1XNRO 3K5MA 1GN4A 5IDJA 2Q7HA 1IX9A 1WJZA 1O9HA 3LDEA 3ZHTA 1QLEC 4DV6B 4NR1A 5KLVH 3HKDB 4I50A 1Y6XA 4FM2A 4O4HA 3F5TA 4I4TB 3CD6V 1AR5A 2P4KA 4FFKA 5LA6A 1ZX3A 4D7TA 3H01A 4U3JB 1KQSU 1S0VA 1SA0A 2Y4UA 2UUAB 3SYCA 3H1IH 2ZKOA 3VQWA 4BAYA 1SQGA 1X4TA 2WPDG 3D3IA 3K0GA 3QF7A 4FZ0A 1GTOA 2M7WA 1COWG 3ML0A 4MW3A 3HKDA 3F5WC 3T2MA 3OGIB 2QKAA 1GMGA 1FXKB 2LGWA 3SYOA 1NR7A 3ZEDA 1MG1A 4JI6B 1AI6A 4N21A 5JJJB 1AR1B 5JCOC 1DF4A 1KYOF 3JSNA 2XTAA 1N33B 2D2CB 3E8FA 2H3OA 4L87A 2GUZA 3HB3B 5LXTB 4GX1A 4WFEA 1OCRB 1VP7A 2Q68A 4X1IB 2AZ0A 2P4VA 3L72H 4FPPA 4TV8A 4LF8O 3ZS8C 4PA3A 2YXYA 4X65B 4JI2O 4FMTA 5C8YB 2O57A 3RYFB 1N32B 5L3DA 2BTQA 5L3GA 5EZYB 4O4IA 1VQOV 3OFNG 3OMIB 3ETGA 3F7VC 4MTXA 5JCOA 3STLC 5IE9A 4B3MB 3G6BA 3JALA 4LFAO 4BIZA 1GM8A 1TUEB 4X65O 1VEWA 3J81N 1GM9A 4UVCA 3FD9A 1OCZB 3CC4V 2Y0IA 5KHIA 3H1HH 3B2EE 3E83A 1OCOC 5GTHZ 2B9ZA 3P32A 1SS3A 4R7CA 4TOIA 1ZLZA 3CRCA 1H8HG 4AHCA 2DYSB 1Q7YW 1H2SB 4ZBMA 2ZQMA 1JFFB 3M99B 4MT8A 3APOA 4J9ZB 4YHHB 4MVSA 4LF9O 3RVYA 4DUYB 4UUJC 1IZ3A 1G1XB 4YJ2B 3X2QC 5GONA 3CRAA 1VQ4V 4MSWC 4WFGA 1TAEA 2P5OA 4PA7A 2ILMA 4I55B 1QCEA 3ZMVA 1S76D 1S5HC 1IURA 3P3NA 4PDVA 2YIAA 4YXWG 5GONB 3CCQV 3CRMA 4ICGA 1PNLA 4FM1A 1Y4MA 2CTQA 2ITCC 4DW1A 1RPRA 5JVDA 1D5NA 1XHZA 3FYIB 2IJKA 3KZIZ 1M1KW 5TISZ 1JVMA 2UXDB 1K4CC 2MW2B 3JARA 1GO3F 1QQCA 2FKXA 3SPJA 4DV0B 3ZRXA 1D5AA 2KG7A 3ZRWA 3U11A 2L6LA 1PKXA 2Z3YA 3LUTB 2CAZC 2Y69B 5J2UB 1FFXB 3SPCA 2JDIG 2PY5A 3P30A 4LF4O 2F4VO 3OTOO 4X1YB 4LF4B 5BMVB 3T4DA 1EFRG 4YIPA 2YXLA 1OCOB 3HKEB 1F51A 3TXSA 2YI8A 3H1JH 3WG7C 4NXNB 3EVKA 4LWSB 1Y76A 3UM7A 4LC1A 3ZRWB 4K3AA 4J41A 2RDCA 4U7NA 4WFHA 4IYIA 1SQQH 1DGSA 4QE9A 5B1AC 4LH7A 1AJPA 3GWOA 1FAFA 5JVDB 1YF2A 3O65A 1P84F 1K5QA 4WCEV 2E76B 3ZN1A 1XNQO 2YXHA 3ZMUA 2QTOA 1W59A 2DYRB 3K04A 1EZJA 1ZSPA 1Y66A 4GX0A 2LFRA 3AG1B 5KHJA 1S72V 4FK5C 3G80A 1JQ0A 4JI7B 4LF9B 4JF3A 3CB2A 2AGAA 2ZM6B 5BMVA 5H5NA 1XNQB 5JH7A 1IXMA 3AG3C 4FLZA 4HZ3A 3ASOB 3T1CA 4YJ3A 3BPZA 5LOVA 4O4IB 3IGAC 2KG7B 4LF7B 4JI1O 1GKFA 3ZHQA 2WA4A 2K9PA 2PUSA 5C8YA 2NLJC 2ZDIC 2A7WA 2ZD9A 4B3MO 4NXNO 4JI4O 4UCRA 5B66Z 3SJBC 3UO3A 2M6YA 4DR5O 3PN1A 4O4LA 3RBZA 4UCUA 4DUYO 4O4HB 5JJNB 5C93A 2CTWA 4EKWA 3ZIAG 3JAKB 2F4VB 1AI7A 3J7AU 1BQZA 2LJ2A 1OZ0A 5DECA 3GB7C 3SGIA 4O2BB 3CXHF 1FXHA 1OCCB 1N4CA 3VBBA 1RM1C 1Q6HA 2JRIA 2N04A 5LMNO 4FM0A 4MVZA 1H8EG 1JOYA 4JAVA 1WB7A 3IFXA 3RYHB 1H2LA 1DF5A 3ABTA 1XMOB 3JAMN 4LFCB 5K1XA 5L3CA 1K97A 5CA1B 3LDDA 3E8BA 3K57A 1AP5A 4K35A 2GDSA 5EBMC 2E5LB 3I56V 3N2KB 4JI3O 1HWYA 2YI9A 3CMEV 1RFYA 1FFTB 3K59A 3D3QA 1OHHG 2F95B 1P7GA 3RGBA 2QSAA 4TWKA 4LFBB 4IYHA 1HDJA 1HNZO 3ABLB 3ZBHA 1I08A 4DUZO 3K3WA 2Q8VA 2OYQA 2YIDA 1L0NH 1P7BA 5CA0A 2E5LO 1F4NA 4CH3A 1K7DA 2CDYA 1HNWO 2XUMA 1MNGA 4GLXA 2DWDC 3FB6C 4CS4A 5EIBC 3T1HB 4OX9B 4PV1B 2Y0PA 3IAYA 3S3XA 3L70H 1XREA 2GSMB 3BA8A 5LXTA 4FVMA 1NZ6A 2ZIOA 5LGUA 4GX2A 3CSXA 3B4SA 3L73H 4K0KB 5DN6G 1YHQV 1KKDA 2FYUH 1JPXA 3MDSA 3RW0A 3OR7C 3E8HA 4JI5B 3SPHA 1XOUA 5IJ9A 5IJ9B 3CC7V 1IVSA 1UJWB 5CB4B 3OT7A 1KUQA 1BL8A 3HKCB 3JAWB 1RSOB 1B06A 2LFSA 1PNKA 3OTFA 1DK1A 3SJCC 1N36B 2HLDG 2OCHA 5FPRA 1WAZA 2EZOA 2HVKC 4GKJB 2LP7A 2QWOB 3N2KA 4P30A 4UB8Z 2OCCB 1WNSA 3FFQA 1WPBA 3K9SA 1IBMB 2GHYA 4WBNA 2IBZH 3ZMSA 4FZ1A 4X8AA 1PV0A 2CE4A 1IBKB 3BY6A 2YUAA 3OD4A 4QIWF 1Y67A 4WFFA 5LOVB 1P49A 2HR3A 4X66O 5CA1A 3TCUA 2VRZA 2LO1A 2QA4V 4EB6A 4XDJA 4X1KB 1YSCA 4MW8A 3K0DA 4J9YB 3JD4A 5CBFA 5LHIA 2GTAA 3CEIA 4ZOLB 1AILA 1QR9A 1Q5OA 5H6RA 1XL6A 4QGPA 2ADPA 1ENVA 1VARA 4UB6Z 1KD1W 4GKKB 4J7KA 1PNMA 2YDEA 3N27A 1VF6C 4BW9A 3FYEB 3JASB 3CCJV 2EBOA 3WU2Z 2Y4TA 1NKDA 5FPOA 3K5NA 4PA9A 3OE7G 1R1BA 3ZRSA 3BA9A 1NTZH 4DV4O 3T1HO 4EFEA 2ZR2A 3ICXA 1YI2V 3DXRB 4LNUA 2QKSA 3M7MX 4H33A 1SERA 2KKWA 2X6BA 2QJ1A 5EYPB 3ASOC 3LSSA 4TQDA 5B1NA 1V9PA 4DR6O 4DV1B 2PZSA 4I0XB 2NN4A 5KMGA 2YIBD 3X2QB 2LW1A 5LP6B 3WB0A 4B3TO 2BTOA 1N8RW 3F7YC 5F2VO 4JI0B 1SQBH 2ZDIA 4QJFB 3LDCA 3CJHB 5LYJB 2ZIMA 1NR1A 1M9NA 4JI5O 4AI8A 1I0HA 3SPGA 1XMQO 1CP9A 5BY1A 3RFRA 3UO2A 1Z5VA 1NS1A 1VIBA 1BE3H 3N2GB 4X62O 4G2KA 1FKAO 1TGOA 4NTWA 1QHTA 1IBLB 4NVPA 3UT5B 3RYCA 4Q20A 4NB5A 3JD3A 4JV5B 1YJ9V 2MK3A 2EIKB 1OV9A 1BHBA 1R6TA 3ABKC 2CTPA 4JV5O 3OM3B 4J11A 5CBGA 2ATKC 4QPJA 1JA8A 4TV9B 3W7TA 3C3SA 3JATB 3MHSC 4PI2A 4X62B 2AW9A 3OGCC 2UU9O 3HKBB 4DV3B 1M4UA 3G67A 5IYDO 5EC1C 1JFFA 2GTSA 2UXBO 4K8ZA 4DV7O 3A0BZ 3CC2V 4DR1B 3E2EA 2UXCO 1PL4A 1K73W 2GBOA 2Q0OC 2V7QG 3KCXA 5D5PA 1KBHA 2DJVA 2JGDA 2ODMA 1SESA 2Q6AA 3SYAA 2QM4A 2HFEC 3BRCA 1H2GA 4JTAB 3ZMZA 1A32A 4X1YA 3JALB 1QNMA 5FLXN 3TK1A 2JJ1G 3L75H 2PTMA 1IBMO 2FMLA 3ABKB 4RAIA 4BW5A 5IYZB 1TA8A 2RCVA 4JAAA 3ZHVA 1OCRC 5IT9N 4H13B 2WLKA 2ZE6A 1FD9A 4JASA 3FB5C 4DK1A 2HG5C 2OIEA 4UXNA 1DLBA 1US6A 3W7UA 1YITV 2ADQB 4JZ2A 1Q90D 2G38A 1XMQB 2YIBA 4PA4A 3WG7B 2JEXA 5KA6A 4E2LA 5LYJA 4XBFA 3RYCB 4IIJB 4NYKA 1SQFA 5IJ0B 2ZE8A 4IHJB 4GX5A 4LWSA 4RUFA 3VQYA 5LMUB 3ZX6A 2ZNJA 4TUYA 4H37A 1W0JG 1MABG 2R70A 1AR4A 1EBOA 4KUMA 3DC6A 3VQXA 4DRXA 1K3EA 2A06H 4X1KA 4DR2O 3LNNA 1FYJA 1YDXA 3ABMC 4KFMA 1J5EO 4LCUC 4ZI7B 3CCUV 1VQ7V 2HVJC 4UCOA 1Q86W 2XAJA 1BSMA 2VWKA 1YCIA 3TJTA 1S5LZ 5GW7A 1MZEA 3BFRA 4DR4O 1Z2GA 1HP8A 4Q6GA 5CA3A 5A2QN 3T4ZA 4DK0A 3CCVV 2JS5A 1RSOA 2D3OW 3OTOB 1JJ2U 3E8GA 2YEVA 1XI1A 3RVZA 1SETA 1M56C 4MTFA 3CE2A 4DV2O 4PJ0Z 2W6IG 1ZL8A 5EBLC 4TT3G 2JEUA 4MS2A 3FX7A 2QM8A 5EC2C 2F66C 2XNDG 1K92A 1VQLV 2ARHA 1ORQC 3CJHA 3TGUH 4HNAA 3AG4B 4B7EA 2HKOA 4Z2WA 5B3SB 1HNZB 2Q7EA 1PPJH 1GH6A 4CC6A 3WFVA 2VQFO 1IDSA 3SDLA 5IY5C 2EINC 1G8MA 5JJEB 1KC8W 2UXNA 3W7WA 1WLEA 1NVPD 4PI0A 2VQFB 4DUZB 4I0XA 2DOSA 1KB9F 1MZFA 4YY3B 1BGYH 1EN6A 2DYRC 1GRJA
chains in the Genus database with same CATH topology
1R73A 3ABLB 1KP2A 5B1BB 4PA6A 3K3WA 3B8NA 2C2AA 4PDRA 1AROP 1P7BA 3A0RA 1FXKC 2QM7A 3CYOA 2WAMA 4HAMA 5B1AB 2WLNA 1F4NA 1VQMV 2X7RB 4MVOA 3ASNB 1K7DA 3PJSK 4F4LA 2DWDC 2PI5A 3FB6C 2A0LA 5LGNA 3AG2B 1W0KG 2Q67A 5B1OA 2IH3C 1MOFA 3ABUA 1AJQA 2GSMB 1NQTA 4CZZA 5LGUA 4GX2A 1NVPB 5DN6G 3OUSA 3CCRV 1YHQV 1KKDA 2UXXA 1JPXA 3RW0A 1K34A 5IDJA 3OR7C 3E8HA 3SPHA 3CC7V 5HFMA 3B8MA 1UJWB 2XAHA 3LDEA 1QLEC 4G28B 1BHAA 4JGSA 2EIJC 1BL8A 4WFAV 2LFSA 1BMFG 3ZRVA 1PNKA 1R3IC 3E35A 1B6QA 2KB1A 3R65A 2OT5A 2HLDG 3CD6V 3H01A 2EZOA 2HVKC 1KQSU 1AJNA 2LP7A 1S0VA 4P30A 1AI5A 1NJIW 2OCCB 2GHYA 3SYCA 4BAYA 4R6ZA 3ZMSA 2WPDG 3D3IA 1QVGU 4X8AA 3BY6A 4QIWF 2EILB 4WFFA 3CXCU 4LBEC 3K0GA 2HR3A 2B5UA 2X6CA 3TCUA 3MHHC 2QA4V 1GTOA 3JYCA 3FKSG 2M7WA 4XDJA 1R3KC 1R3JC 3MD0A 5H9CA 1M90W 1YSCA 4MW8A 1Q81W 1R3LC 3K0DA 4MVMA 4R50A 1COWG 3ML0A 2ITDC 3JD0A 4J9YB 4MW3A 3JD4A 2ZXWC 3IC7A 1L1FA 2A9HA 5CBFA 4G27B 3F5WC 2PI4A 3T2MA 5LHIA 1GMGA 1FXKB 1QR9A 3OEHG 4BIUA 3SYOA 1NR7A 2H94A 5LGTA 1MG1A 4X89A 5H6RA 1XL6A 2OCCC 2YEVB 3G71V 2P6JA 1ENVA 1AI6A 4N21A 1AR1B 1AI4A 3OUFA 1YIJV 4FIPC 1DF4A 1THZA 1KD1W 2P67A 1YJWV 1PNMA 2B1GA 1K9MW 4LP8A 3E8FA 5L3BA 4L87A 3K06A 3HB3B 4GX1A 4R8CA 4WFEA 1VQ6V 1OCRB 3K79A 3BEHA 3FYEB 3CCJV 2Q68A 2EBOA 1KECA 1CPYA 4FPPA 2FTKA 1NKDA 4PA9A 2R9IA 3OE7G 4PA3A 2AHYA 3ZRSA 5B3SC 2ZXWB 1VQ9V 4FMTA 4RO2A 3CCSV 5L3DA 2DYSC 5FL7G 4DO2A 4Z1MG 2IH1C 2DQ0A 2ZR2A 5L3GA 1K33A 3CCLV 1YI2V 1VQOV 2Y48A 3OFNG 2DW4A 3ZMTA 4X88A 3OMIB 3ETGA 3QO8A 2QKSA 4GCZA 2AHZA 3F7VC 4H33A 4MTXA 1SERA 5EK0A 3AG1C 2X6BA 1SZTA 3STLC 3ASOC 3LSSA 3JD2A 2IU0A 5B1NA 4BIZA 3ABMB 4MVUA 3VOUA 1GM8A 1TUEB 5CMUA 2A79B 3X2QB 2Q69A 4XDLA 1GM9A 2WWWA 3OW2U 4UVCA 5IY5B 1OCZB 3CC4V 1N8RW 1V55B 3F7YC 3E83A 2NNUA 2IJHA 1ZWIC 1OCOC 1CEZA 3ASNC 3P32A 4R7CA 2ZDIA 4QJFB 3G4SV 3LDCA 1H8HG 1NR1A 2DYSB 4ASUG 3QO5A 1F23A 5LBQA 2BOCC 2XAQA 1Q7YW 3AG2C 3SJQC 4ZBMA 1M9NA 4OXSA 2ZQMA 1E1QG 4RQEA 3M99B 1I5YA 3CP1A 4MT8A 3K03A 4J9ZB 3SPGA 1CP9A 2W6JG 1J95A 2DWEC 4MVSA 3RVYA 5KA5A 3NXSA 4UUJC 1SRYA 5CN0A 5H6QA 5LHGA 3X2QC 1P4RA 4TSFG 3EFFK 1VQ4V 4MSWC 4MVQA 4G2KA 4WFGA 2WLIB 3K08A 1WPXA 4GT1A 4ZKIA 4Q20A 3JD3A 1FS0G 4JYBA 4PA7A 1YJ9V 2MK3A 1QCEA 2EIKB 1K4DC 3ZMVA 1S76D 1BHBA 1S5HC 3ABKC 4JAUA 5EBWC 4PDVA 4YXWG 3OM3B 2IJIA 3QO7A 5CBGA 2ATKC 4QPJA 3CCQV 3W7TA 2ZR3A 1E79G 1PNLA 3MHSC 2IW5A 2V1DA 1ROPA 1Y4MA 3OGCC 2ITCC 1QBZA 1V54B 1RPRA 4N23A 2K1EA 1K8AW 3FYIB 2QEXV 4MTGA 4RQFA 2B1IA 2IJKA 5IYDO 4RUEA 5EC1C 2JJ2G 1M1KW 4P9PA 1JVMA 1K4CC 5IYCO 1GO3F 3SPJA 2P90A 3CC2V 3ZRXA 2EINB 3ZRWA 3E2EA 1PKXA 2Z3YA 4PDLA 1K73W 2OTJV 3LUTB 1K5SA 2WLHA 2V7QG 2Y69B 3FB7C 4JTCB 5L3FA 2XAFA 1R6NA 2WLLA 3SPCA 4JYCA 2JDIG 1SESA 4P9OA 2Q6AA 3P30A 1F4MA 1M57B 2WSSG 3SYAA 2HFEC 3T4DA 1H2GA 1EFRG 5J9PC 4JTAB 3ZMZA 2YSUB 1OCOB 3HPLC 1F51A 4I9WA 3ETEA 2XOKG 3EHBB 3TK1A 3WG7C 2WLLB 2JJ1G 3CMAV 1NH2B 1PL0A 3UM7A 3ABKB 4RAIA 4BW5A 4LC1A 3ABLC 3ZRWB 1W2BU 2OTLV 2IU3A 4I5SA 5L3EA 4U7NA 1NH2D 2EIMB 1FXVA 1OCRC 2WLIA 4WFHA 2EJRA 2WLKA 2R9RB 3LNMB 4QE9A 4JASA 3SYPA 3FB5C 5B1AC 1PD3A 3OMNB 1S77D 2HG5C 2X0LA 4P2ZA 4QNHB 1AJPA 4PELA 1QVFU 3GWOA 1KP3A 4UXNA 1R6KA 1DLBA 3W7UA 3AG3B 2WLJA 1OCCC 1RM1B 1K5QA 4WCEV 1YITV 1QR8A 3ZN1A 3CCEV 1YJNV 3JCZA 3W7XA 3ZMUA 2QTOA 2DYRB 4PA4A 3K04A 1EZJA 4UV9A 2QE7G 3WG7B 2JEXA 2X6AA 5KA6A 4CBCA 1Y66A 4GX0A 4XBFA 4E2LA 2LFRA 1DTOA 3AG1B 1QLNA 1S72V 4FK5C 3ZCCA 1JQ0A 1M57C 3E86A 4GX5A 4RUFA 3OAAG 2JK5C 2WLMA 2EIMC 1FXKA 1VQ5V 2XAGA 4JF3A 4H37A 2F43G 1W0JG 2XASA 1MABG 1EBOA 2BOBC 4KUMA 1K3EA 4XDKA 4UVBA 3ZN0A 1IXMA 3AG3C 4HZ3A 3ASOB 3LSQA 3T1CA 3ABMC 4KFMA 1RPOA 3FB8C 2EIKC 4JPRA 3D36A 1XL4A 2Y69C 4DXWA 3IGAC 4QPKA 1Q82W 1GKFA 1OCZC 4LCUC 3CCUV 3G6EV 1M56B 3QNEA 1VQ7V 2HVJC 3OEEG 1V55C 1S3JA 5IYBO 1Q86W 2NLJC 2XAJA 1H38A 3E89A 2ZDIC 3AG4C 4WFBV 4KP4A 3AEIA 3DGEA 5GW7A 5CBHA 2ZD9A 2IJJA 5KUKA 3SYQA 5CA3A 3UKMA 4UVAA 1VQPV 1GM7A 3ETDA 3RBZA 3TETA 3T4ZA 1JCHA 3ZJZA 2Z5UA 5DM6V 3CCVV 5C93A 2EZPA 1VQKV 2D3OW 2EIJB 5E1AC 4EKWA 1JX9A 3OMAB 1JJ2U 3ZIAG 3W7SA 5HFLA 1AI7A 3OR6C 3E8GA 1VQ8V 1E1RG 5BZBA 1NBMG 1OZ0A 2YEVA 3GB7C 1MSWD 3STZC 3RVZA 1SETA 1V54C 1M56C 5KUMA 4MTFA 1FXHA 1OCCB 4UV8A 3VBBA 4WF9V 3I55V 1RM1C 2H8PC 1QLEB 3SPIA 3CPWU 4HYOA 1YTFD 3B77A 4MVZA 1YTFB 1H8EG 2W6IG 4QE7A 1JOYA 4MVRA 4JTDB 4JAVA 3CCMV 3IFXA 4TT3G 2DQ3A 5EBLC 5B1BC 1DF5A 2JEUA 4MS2A 2JIZG 3ABTA 2QM8A 5EC2C 1G4YB 5L3CA 1K97A 2CK3G 2XNDG 5LHHA 3KG2A 4PDMA 4U7OA 1K92A 3LDDA 1VQLV 1ORQC 3E8BA 3AG4B 2HKOA 5B3SB 4MTOA 2HJFC 3DTUB 3WFVA 1VQNV 1LNQA 5EBMC 3I56V 1HWYA 5IY5C 2EINC 1G8MA 3CMEV 1KC8W 2UXNA 3W7WA 1FFTB 1WLEA 2P7TC 1NVPD 2EILC 1OHHG 1I5XA 3JD1A 2W0FC 1GK9A 4TWKA 4FJCC 2DYRC 3K9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5H C;  1XL6 A;  3ABK C;  5EBW C;  2OCC C;  4PDV A;  5CBG A;  2BOB C;  2ATK C;  3OUF A;  4XDK A;  3AG3 C;  4PA6 A;  4HZ3 A;  3OGC C;  2ITC C;  4PDR A;  1P7B A;  4LP8 A;  2K1E A;  3T1C A;  3E8F A;  3K06 A;  2WLN A;  3ABM C;  4KFM A;  4GX1 A;  4MTG A;  3FB8 C;  4R8C A;  2EIK C;  4WFE A;  1XL4 A;  4MVO A;  2Y69 C;  3BEH A;  4RUE A;  5EC1 C;  2Q68 A;  4DXW A;  3IGA C;  3PJS K;  4P9P A;  1JVM A;  4F4L A;  2DWD C;  1OCZ C;  3FB6 C;  4LCU C;  1K4C C;  2HVJ C;  2A0L A;  3SPJ A;  1V55 C;  4PA9 A;  2Q67 A;  4PA3 A;  2NLJ C;  2IH3 C;  2AHY A;  3E89 A;  3AG4 C;  3ZRS A;  5B3S C;  4PDL A;  3LUT B;  2WLH A;  4RO2 A;  2ZD9 A;  3FB7 C;  4JTC B;  3SYQ A;  5CBH A;  5KUK A;  2WLL A;  3SPC A;  2DYS C;  2IH1 C;  4GX2 A;  4P9O A;  3UKM A;  2Q6A A;  3OUS A;  1KKD A;  3RBZ A;  3TET A;  3RW0 A;  3T4Z A;  3SYA A;  3ZJZ A;  4X88 A;  2QKS A;  3OR7 C;  3E8H A;  3SPH A;  2AHZ A;  3F7V C;  2HFE C;  4H33 A;  3T4D A;  5EK0 A;  3AG1 C;  2X6B A;  4JTA B;  5E1A C;  4EKW A;  3STL C;  5J9P C;  3ASO C;  3LDE A;  1QLE C;  4G28 B;  3HPL C;  2EIJ C;  4I9W A;  3OR6 C;  4MVU A;  1BL8 A;  3VOU A;  3E8G A;  3WG7 C;  2WLL B;  5BZB A;  2A79 B;  1R3I C;  2YEV A;  3GB7 C;  3STZ C;  2Q69 A;  4XDL A;  3RVZ A;  2KB1 A;  3R65 A;  3UM7 A;  4RAI A;  4BW5 A;  3ABL C;  1V54 C;  1M56 C;  5KUM A;  4MTF A;  3F7Y C;  3E83 A;  1ZWI C;  2H8P C;  1OCO C;  1OCR C;  4WFH A;  2WLI A;  3SPI A;  3ASN C;  4HYO A;  4R7C A;  2HVK C;  2WLK A;  2R9R B;  3LNM B;  4QE9 A;  3LDC A;  3SYP A;  4MVZ A;  3FB5 C;  4P30 A;  5B1A C;  2HG5 C;  4QE7 A;  4MVR A;  4JTD B;  4P2Z A;  3SYC A;  4QNH B;  2BOC C;  3IFX A;  5EBL C;  3AG2 C;  3SJQ C;  5B1B C;  4ZBM A;  4MS2 A;  4OXS A;  2WLJ A;  5EC2 C;  1OCC C;  1G4Y B;  4R6Z A;  4X8A A;  3KG2 A;  4PDM A;  3LDD A;  1ORQ C;  3K03 A;  4J9Z B;  4WFF A;  3SPG A;  4LBE C;  3K0G A;  3E8B A;  2X6C A;  3TCU A;  1J95 A;  2DWE C;  4MTO A;  4MVS A;  2HJF C;  2QTO A;  3RVY A;  3JYC A;  4UUJ C;  4XDJ A;  1R3K C;  1R3J C;  3K04 A;  4PA4 A;  1LNQ A;  2X6A A;  4MW8 A;  5EBM C;  3X2Q C;  1R3L C;  4GX0 A;  4CBC A;  3K0D A;  3EFF K;  4MVM A;  4R50 A;  4MSW C;  5IY5 C;  2EIN C;  4MVQ A;  4MW3 A;  2ITD C;  1M57 C;  4J9Y B;  2P7T C;  3E86 A;  4GX5 A;  2WLI B;  4RUF A;  2EIL C;  3K08 A;  2ZXW C;  4WFG A;  2A9H A;  2JK5 C;  2WLM A;  3F5W C;  4G27 B;  5CBF A;  3T2M A;  2EIM C;  2W0F C;  3SYO A;  4PA7 A;  4TWK A;  1K4D C;  2DYR C;  4H37 A;  4X89 A; 
#chains in the Genus database with same CATH topology
 2Q9L A;  3BAA A;  2Q7G A;  2AZ2 A;  1G6U A;  5B1B B;  1CXZ B;  4U3F H;  3U10 A;  5LP6 C;  1X59 A;  1D2D A;  1ARO P;  1FXK C;  1Q8I A;  2WAM A;  1ZTE A;  4HAM A;  2WLN A;  3RYF A;  1VQM V;  3ASN B;  3EXA A;  3L74 H;  4ZHQ B;  5JQG A;  1ZL8 B;  1AJQ A;  4OPA A;  1N0J A;  4H44 B;  1NVP B;  4O2B A;  3L71 H;  2UXX A;  2F93 B;  2VWJ A;  1K34 A;  2RMK B;  1BT8 A;  3B8M A;  2ZT9 B;  2EIJ C;  4WFA V;  1BMF G;  4DR6 B;  1R3I C;  3Q4H A;  3E35 A;  3U0Z A;  2KB1 A;  3R65 A;  2JS3 A;  2OT5 A;  1I7F A;  1F7Y A;  2PF4 E;  4JI7 O;  1YXB A;  1AI5 A;  4GUN A;  4J80 A;  4CH4 A;  1GN6 A;  5BR8 O;  1HW7 A;  4J7J A;  4R6Z A;  2EIL B;  4LBE C;  2V4D A;  3MHH C;  1WN7 A;  2Q4P A;  3FKS G;  1GN2 A;  3H9V A;  3MD0 A;  1NI8 A;  3CX5 F;  1M90 W;  2ETN A;  1Q81 W;  3CWB H;  2QWP B;  4R50 A;  2ITD C;  2KQX A;  3J80 N;  4KL1 A;  3IC7 A;  4TUY B;  1TUB A;  1PP9 H;  3OEH G;  4O4J A;  1BZK A;  3A0H Z;  2H94 A;  5LGT A;  2OCC C;  5KHH A;  2P6J A;  5IJ0 A;  3G71 V;  4LF5 B;  3RYI B;  3OUF A;  1YIJ V;  4FIP C;  4DR2 B;  1THZ A;  4NTX A;  2KSD A;  1YJW V;  2XHB A;  2XT9 A;  4LP8 A;  5L3B A;  3RYH A;  4R8C A;  1VQ6 V;  3K79 A;  3BEH A;  1BCC H;  1SQV H;  4FLV A;  4OGQ B;  1MA1 A;  3ZHS A;  2FTK A;  2AHY A;  3HR0 A;  2ZXW B;  4O2A A;  4DV1 O;  1FJG O;  4KHP B;  4DR1 O;  1RP3 B;  3AK3 A;  4J42 A;  4RO2 A;  5A9G A;  3CCS V;  4ZI7 A;  3ZHU A;  4Z1M G;  2IH1 C;  2DN9 A;  5KHG A;  2DQ0 A;  3CCL V;  1FPO A;  1UPG A;  1IBK O;  4X88 A;  1M93 A;  3QO8 A;  4GCZ A;  4L8J A;  2UU9 B;  2IM9 A;  2IU0 A;  1I94 B;  3ABM B;  4JI3 B;  4DRX B;  5CMU A;  2A79 B;  3FAV A;  2Q69 A;  4XDL A;  2WWW A;  2UXC B;  2N05 A;  1XEQ A;  1HR0 B;  3C90 A;  1SKV A;  2NNU A;  1IBL O;  1CEZ A;  3KKY A;  3IJ4 A;  1WP7 A;  4ASU G;  5LBQ A;  1F23 A;  2XAQ A;  3AG2 C;  3SJQ C;  4OXS A;  1E1Q G;  3CP1 A;  3K03 A;  1WB8 A;  2NR5 A;  4BR6 A;  1TVK B;  2ZNI A;  2DWE C;  5KA5 A;  3NXS A;  4AQY O;  2DMX A;  5E79 Z;  5ITZ B;  5H6Q A;  1P4R A;  3EFF K;  1N32 O;  4MVQ A;  2WLI B;  4ZKI A;  4FFB A;  2AXT Z;  4X66 B;  3RN4 A;  1FS0 G;  2JGU A;  4X64 O;  1K4D C;  2L35 A;  4LFB O;  4A5U B;  5EBW C;  4JAU A;  4JZG A;  2DE0 X;  2ZR3 A;  2V1D A;  1ROP A;  5H2F Z;  4KHP O;  2VS0 A;  2QWN B;  1LUW A;  5D5Q A;  4N23 A;  1K8A W;  2QEX V;  4MTG A;  2E75 B;  4DR7 B;  2B1I A;  4OPH A;  1VMG A;  4X64 B;  4FLY A;  2LGQ A;  2JJ2 G;  4B3S B;  5IYC O;  3C3T A;  2EIN B;  2HJD A;  5EIB D;  5DED A;  4BIO A;  2WLH A;  5L3F A;  4JYA B;  3FB7 C;  1KU9 A;  2XAF A;  2WLL A;  4J7Z A;  2HEP A;  1EZV H;  2Q0A A;  2JVD A;  3D8C A;  4GYC B;  5J9P C;  4H0L B;  3HPL C;  4I9W A;  2XOK G;  2HHH O;  3EHB B;  1Z5W A;  2WLL B;  3CMA V;  1NH2 B;  3A8T A;  2F1M A;  2P22 C;  2UUA O;  2IU3 A;  2A3Q A;  4FFB B;  4I5S A;  3DC5 A;  1NH2 D;  1H2N A;  1JR9 A;  2EIM B;  3GWK C;  2WLI A;  1Q3E A;  5J2T A;  2E74 B;  2EJR A;  2R9R B;  3LNM B;  4Z1V A;  3SYP A;  1S77 D;  2X0L A;  5B5E Z;  1GAX A;  1QVF U;  4PEL A;  2YS8 A;  4DYL A;  5IWA O;  1R6K A;  2QWR B;  2WLJ A;  3CHX A;  1OCC C;  1RM1 B;  4X1I A;  5FNV A;  3VQV A;  1QR8 A;  4FLU A;  4F6R A;  3CCE V;  3IC9 A;  3JCZ A;  3W7X A;  2RN9 A;  2QE7 G;  2X6A A;  3CRR A;  1DTO A;  4FLW A;  1QLN A;  2CGO A;  3ZCC A;  1XQ8 A;  3E86 A;  4CS2 A;  1EN5 A;  2JK5 C;  2WLM A;  4B08 A;  2YC0 A;  1FXK A;  2ZM6 O;  3H1K H;  2F43 G;  3QG5 A;  4DV5 O;  2XAS A;  2BOB C;  4LFC O;  4UVB A;  4LF5 O;  3BCC H;  3FB8 C;  2EIK C;  2Y69 C;  4DXW A;  4JI8 O;  2QDO A;  4UCV A;  3G6E V;  1M56 B;  4WBN B;  3OEE G;  1V55 C;  3AK1 A;  1SA0 B;  1H38 A;  3E89 A;  2CGN A;  4WFB V;  4NXM O;  3AEI A;  3L9D A;  3WB2 A;  1NT2 B;  5CBH A;  5KUK A;  4TV8 B;  1O9G A;  3UKM A;  1VQP V;  1GM7 A;  3ETD A;  3JAT A;  3TET A;  1JCH A;  4I50 B;  2Z5U A;  5DM6 V;  4CS3 A;  2OWO A;  5AG2 A;  3I5D A;  4CH6 A;  2R9A A;  1AB3 A;  4JI8 B;  5E1A C;  3OMA B;  1Q43 A;  1J5E B;  5HFL A;  3T1Y B;  1VQ8 V;  3RYI A;  1N33 O;  5BZB A;  4X20 A;  1NBM G;  4O2A B;  1VF7 A;  1ZUQ A;  5KUM A;  1V54 C;  4LH6 A;  3I55 V;  4DW0 A;  2BSK A;  3UCS C;  1XUQ A;  3CPW U;  4NTY A;  1QU7 A;  3BVO A;  1YTF B;  4JTD B;  4DR7 O;  4B3R B;  2QGN A;  5B1B C;  2GUZ B;  2JIZ G;  1XBL A;  2CK3 G;  5LHH A;  3T1Y O;  4PDM A;  1NTM H;  2RNB A;  3KCY A;  2QKC A;  4MTO A;  1VQN V;  1WA8 A;  5LP6 A;  2P7T C;  3CRQ A;  3BHP A;  2EX3 A;  1I5X A;  2W0F C;  2HP8 A;  1GK9 A;  2WA3 A;  4FJC C;  2GV9 A;  4DR3 B;  5LL6 Y;  5K1P A;  3CS5 A;  3O9O A;  4PA6 A;  1I94 O;  4CC5 A;  2C2A A;  4PDR A;  1KKC A;  2QM7 A;  3MAQ A;  4DV6 O;  2X7R B;  4YY3 O;  3PJS K;  4I7Z B;  2W0X A;  2A0L A;  3AG2 B;  2Q67 A;  5B1O A;  2EUL A;  3ABU A;  1JJO A;  4GZR B;  5KAF Z;  1YZB A;  2CH7 B;  4CZZ A;  3CCR V;  5CB4 A;  2FL4 A;  5HFM A;  1XMO O;  2XAH A;  1BHA A;  4G28 B;  1WP8 A;  4JGS A;  1VF6 A;  4TQF A;  1EM1 A;  2CH7 A;  3ZRV A;  4LFA B;  2QTS A;  4EFB A;  1B6Q A;  1URF A;  1FJG B;  4O4L B;  4PD4 F;  5JQG B;  1AJN A;  4LF7 O;  4DV3 O;  1NJI W;  3LSU A;  1N0N A;  2Z0A A;  1LUV A;  1B04 A;  3THO A;  1QVG U;  2UUC B;  4HNA B;  4W4K A;  3CXC U;  2Q73 A;  2B5U A;  4YJ3 B;  2X6C A;  2FB5 A;  5KX5 B;  1HNX O;  4EEQ A;  2OIG A;  3JYC A;  1R3K C;  1R3J C;  3APQ A;  5H9C A;  1XIL A;  4JI2 B;  1R3L C;  4MVM A;  3JD0 A;  4JYA O;  1L1F A;  2F23 A;  2ZXW C;  2ZE5 A;  2A9H A;  4G27 B;  2PI4 A;  3K5L A;  4BIU A;  4DV5 B;  4X89 A;  1HNX B;  4JYY A;  4JI0 O;  2YEV B;  1AI4 A;  2ZCE A;  2P67 A;  2B1G A;  1K9M W;  1SF9 A;  3K06 A;  4X9Q A;  4AIL C;  4F6R B;  3NR7 A;  1KEC A;  3WB1 A;  2N74 A;  1CPY A;  3K5O A;  2BSK B;  2R9I A;  3SR2 C;  5B3S C;  1VQ9 V;  2RJZ A;  2ZE7 A;  4F6E A;  1Y74 B;  5CA0 B;  3JCU Z;  2DYS C;  5FL7 G;  4DO2 A;  2UXD O;  2CTR A;  1K33 A;  5IYZ A;  2Y48 A;  4CH5 A;  4W4L A;  2DW4 A;  3ZMT A;  1L8D A;  1MMM A;  2AHZ A;  5EK0 A;  3AG1 C;  1SZT A;  3DSQ A;  3JD2 A;  1T5E A;  1SQP H;  1XDC A;  4MVU A;  3VOU A;  5JH7 B;  4RWU A;  3M8A A;  3OW2 U;  3R66 A;  4LF8 B;  5IY5 B;  3QTC A;  2EJ7 A;  1V55 B;  4DV0 O;  1N34 O;  2IJH A;  1ZWI C;  3ASN C;  1PM9 A;  3G4S V;  4IIJ A;  4B3R O;  3QO5 A;  2BOC C;  3JAR B;  4UCS A;  3E22 A;  4RQE A;  4E4E A;  1I5Y A;  4OX9 O;  5FNV B;  2W6J G;  4D6T H;  1J95 A;  1HNW B;  1SRY A;  5CN0 A;  5LHG A;  1SZX A;  4DR5 B;  4TSF G;  5BR8 B;  4IHJ A;  3K08 A;  4X20 B;  1B3Q A;  1WPX A;  1BS3 A;  4GT1 A;  3BAB A;  4GKJ O;  3UT5 A;  3JAK A;  4JYB A;  4YHH O;  3QO7 A;  2IJI A;  4JI1 B;  3AK2 A;  1UFI A;  4YJ2 A;  1E79 G;  1YEW A;  2IW5 A;  3HKE A;  4I9Q A;  2PYL A;  1QBZ A;  1V54 B;  4NXM B;  2K1E A;  1TVK A;  2VQE O;  4RQF A;  4RUE A;  4P9P A;  2JGD B;  3JSL A;  2P90 A;  2HHH B;  4PDL A;  1S5J A;  2PYJ A;  2OTJ V;  1K5S A;  4JTC B;  4KXR A;  1R6N A;  5BXZ A;  2PGG A;  4JYC A;  3A2F A;  4P9O A;  1F4M A;  1M57 B;  4LF6 B;  1AP6 A;  2WSS G;  1GN3 A;  1N34 B;  4PHZ A;  4K0K O;  3B09 A;  3TXQ A;  2LW7 A;  2YSU B;  3ETE A;  4TV9 A;  1FFX A;  5J2U A;  4JI6 O;  1PL0 A;  1BQ0 A;  1M5I A;  1NU1 H;  5EZY A;  2OTL V;  1L0L H;  3ABL C;  1KMI Z;  1W2B U;  4B7K A;  5L3E A;  2BTQ B;  3RWR D;  1JMK C;  1FXV A;  4UFZ A;  5KAI Z;  2ZIN A;  1PD3 A;  3OMN B;  4P2Z A;  4QNH B;  5ITZ A;  1KP3 A;  2RQ6 A;  3AG3 B;  4ABM A;  1U97 A;  4C7U A;  2BCC H;  4IGG A;  3P3P A;  1YJN V;  5J2T B;  1N36 O;  1H2M A;  1SQX H;  4I55 A;  3S3W A;  4UV9 A;  4DV4 B;  4FLX A;  4J10 A;  4CBC A;  5LMU O;  1YVW A;  3ETQ A;  1Y76 B;  1M57 C;  3OAA G;  4BWA A;  1EN4 A;  2EIM C;  4HBN A;  5KHK A;  1VQ5 V;  3B40 A;  2XAG A;  2BE3 A;  3FAV B;  1IXB A;  4XDK A;  3ZN0 A;  1OJH A;  2QR4 A;  3LSQ A;  1XHX A;  1RPO A;  4JPR A;  3K58 A;  3D36 A;  1XL4 A;  1XNR B;  4B3S O;  1H2K A;  4QPK A;  1Q82 W;  2YIC A;  4B3T B;  1OCZ C;  2R72 A;  3QNE A;  1S3J A;  4IL6 Z;  1SC5 B;  5IYB O;  2VQE B;  2UUC O;  2E3C A;  3AG4 C;  5GTI Z;  4KP4 A;  3DGE A;  3GVM A;  4UCT A;  1AVM A;  2IJJ A;  3SYQ A;  5KMG B;  4DV7 B;  3HKB A;  4UVA A;  3QVN A;  3ZJZ A;  3Q4H B;  2EZP A;  1VQK V;  2EIJ B;  4LR3 A;  4JI4 B;  5IWA B;  1JX9 A;  4ZIB A;  3W7S A;  3OR6 C;  1E1R G;  4IT5 A;  1ZAU A;  1MSW D;  3STZ C;  3N2G A;  5JWP A;  1LR1 A;  4UV8 A;  4ZOL A;  4WF9 V;  4DV2 B;  2H8P C;  1QLE B;  4LF6 O;  3SPI A;  4HYO A;  2CUG A;  1YTF D;  1U96 A;  3H1L H;  3B77 A;  2UXB B;  3JAS A;  4QE7 A;  4MVR A;  2UUB B;  3CCM V;  2DQ3 A;  3E22 B;  4ZHQ A;  2QWQ B;  1G4Y B;  5LMN B;  3KG2 A;  4U7O A;  3ZHR A;  3SJA C;  4DR3 O;  1NTK H;  2HJF C;  1Q6I A;  3DTU B;  2Q5Z A;  4O4J B;  1LNQ A;  2UUB O;  4YIO A;  4NKG B;  1TUB B;  4DR4 B;  4U3J A;  2EIL C;  3D36 C;  4D7S A;  3JD1 A;  4I4T A;  4AQY B;  5EYP A;  3K9A A;  1VF5 B;  4EB6 B;  5KX5 A;  1R73 A;  1MSD A;  1KP2 A;  3UQ8 A;  3HKC A;  3JAW A;  1WA8 B;  3DXR A;  4LNU B;  3B8N A;  1Q6U A;  3A0R A;  3CYO A;  5B1A B;  4FLT A;  1Y74 A;  4GKK O;  2LQT A;  4MVO A;  4F4L A;  2PI5 A;  4K8X A;  5LGN A;  1W0K G;  3AG7 A;  5LA6 B;  1HR0 O;  2IH3 C;  1MOF A;  3RT3 C;  1NQT A;  3OUS A;  2P06 A;  1XNR O;  3K5M A;  1GN4 A;  5IDJ A;  2Q7H A;  1IX9 A;  1WJZ A;  1O9H A;  3LDE A;  3ZHT A;  1QLE C;  4DV6 B;  4NR1 A;  5KLV H;  3HKD B;  4I50 A;  1Y6X A;  4FM2 A;  4O4H A;  3F5T A;  4I4T B;  3CD6 V;  1AR5 A;  2P4K A;  4FFK A;  5LA6 A;  1ZX3 A;  4D7T A;  3H01 A;  4U3J B;  1KQS U;  1S0V A;  1SA0 A;  2Y4U A;  2UUA B;  3SYC A;  3H1I H;  2ZKO A;  3VQW A;  4BAY A;  1SQG A;  1X4T A;  2WPD G;  3D3I A;  3K0G A;  3QF7 A;  4FZ0 A;  1GTO A;  2M7W A;  1COW G;  3ML0 A;  4MW3 A;  3HKD A;  3F5W C;  3T2M A;  3OGI B;  2QKA A;  1GMG A;  1FXK B;  2LGW A;  3SYO A;  1NR7 A;  3ZED A;  1MG1 A;  4JI6 B;  1AI6 A;  4N21 A;  5JJJ B;  1AR1 B;  5JCO C;  1DF4 A;  1KYO F;  3JSN A;  2XTA A;  1N33 B;  2D2C B;  3E8F A;  2H3O A;  4L87 A;  2GUZ A;  3HB3 B;  5LXT B;  4GX1 A;  4WFE A;  1OCR B;  1VP7 A;  2Q68 A;  4X1I B;  2AZ0 A;  2P4V A;  3L72 H;  4FPP A;  4TV8 A;  4LF8 O;  3ZS8 C;  4PA3 A;  2YXY A;  4X65 B;  4JI2 O;  4FMT A;  5C8Y B;  2O57 A;  3RYF B;  1N32 B;  5L3D A;  2BTQ A;  5L3G A;  5EZY B;  4O4I A;  1VQO V;  3OFN G;  3OMI B;  3ETG A;  3F7V C;  4MTX A;  5JCO A;  3STL C;  5IE9 A;  4B3M B;  3G6B A;  3JAL A;  4LFA O;  4BIZ A;  1GM8 A;  1TUE B;  4X65 O;  1VEW A;  3J81 N;  1GM9 A;  4UVC A;  3FD9 A;  1OCZ B;  3CC4 V;  2Y0I A;  5KHI A;  3H1H H;  3B2E E;  3E83 A;  1OCO C;  5GTH Z;  2B9Z A;  3P32 A;  1SS3 A;  4R7C A;  4TOI A;  1ZLZ A;  3CRC A;  1H8H G;  4AHC A;  2DYS B;  1Q7Y W;  1H2S B;  4ZBM A;  2ZQM A;  1JFF B;  3M99 B;  4MT8 A;  3APO A;  4J9Z B;  4YHH B;  4MVS A;  4LF9 O;  3RVY A;  4DUY B;  4UUJ C;  1IZ3 A;  1G1X B;  4YJ2 B;  3X2Q C;  5GON A;  3CRA A;  1VQ4 V;  4MSW C;  4WFG A;  1TAE A;  2P5O A;  4PA7 A;  2ILM A;  4I55 B;  1QCE A;  3ZMV A;  1S76 D;  1S5H C;  1IUR A;  3P3N A;  4PDV A;  2YIA A;  4YXW G;  5GON B;  3CCQ V;  3CRM A;  4ICG A;  1PNL A;  4FM1 A;  1Y4M A;  2CTQ A;  2ITC C;  4DW1 A;  1RPR A;  5JVD A;  1D5N A;  1XHZ A;  3FYI B;  2IJK A;  3KZI Z;  1M1K W;  5TIS Z;  1JVM A;  2UXD B;  1K4C C;  2MW2 B;  3JAR A;  1GO3 F;  1QQC A;  2FKX A;  3SPJ A;  4DV0 B;  3ZRX A;  1D5A A;  2KG7 A;  3ZRW A;  3U11 A;  2L6L A;  1PKX A;  2Z3Y A;  3LUT B;  2CAZ C;  2Y69 B;  5J2U B;  1FFX B;  3SPC A;  2JDI G;  2PY5 A;  3P30 A;  4LF4 O;  2F4V O;  3OTO O;  4X1Y B;  4LF4 B;  5BMV B;  3T4D A;  1EFR G;  4YIP A;  2YXL A;  1OCO B;  3HKE B;  1F51 A;  3TXS A;  2YI8 A;  3H1J H;  3WG7 C;  4NXN B;  3EVK A;  4LWS B;  1Y76 A;  3UM7 A;  4LC1 A;  3ZRW B;  4K3A A;  4J41 A;  2RDC A;  4U7N A;  4WFH A;  4IYI A;  1SQQ H;  1DGS A;  4QE9 A;  5B1A C;  4LH7 A;  1AJP A;  3GWO A;  1FAF A;  5JVD B;  1YF2 A;  3O65 A;  1P84 F;  1K5Q A;  4WCE V;  2E76 B;  3ZN1 A;  1XNQ O;  2YXH A;  3ZMU A;  2QTO A;  1W59 A;  2DYR B;  3K04 A;  1EZJ A;  1ZSP A;  1Y66 A;  4GX0 A;  2LFR A;  3AG1 B;  5KHJ A;  1S72 V;  4FK5 C;  3G80 A;  1JQ0 A;  4JI7 B;  4LF9 B;  4JF3 A;  3CB2 A;  2AGA A;  2ZM6 B;  5BMV A;  5H5N A;  1XNQ B;  5JH7 A;  1IXM A;  3AG3 C;  4FLZ A;  4HZ3 A;  3ASO B;  3T1C A;  4YJ3 A;  3BPZ A;  5LOV A;  4O4I B;  3IGA C;  2KG7 B;  4LF7 B;  4JI1 O;  1GKF A;  3ZHQ A;  2WA4 A;  2K9P A;  2PUS A;  5C8Y A;  2NLJ C;  2ZDI C;  2A7W A;  2ZD9 A;  4B3M O;  4NXN O;  4JI4 O;  4UCR A;  5B66 Z;  3SJB C;  3UO3 A;  2M6Y A;  4DR5 O;  3PN1 A;  4O4L A;  3RBZ A;  4UCU A;  4DUY O;  4O4H B;  5JJN B;  5C93 A;  2CTW A;  4EKW A;  3ZIA G;  3JAK B;  2F4V B;  1AI7 A;  3J7A U;  1BQZ A;  2LJ2 A;  1OZ0 A;  5DEC A;  3GB7 C;  3SGI A;  4O2B B;  3CXH F;  1FXH A;  1OCC B;  1N4C A;  3VBB A;  1RM1 C;  1Q6H A;  2JRI A;  2N04 A;  5LMN O;  4FM0 A;  4MVZ A;  1H8E G;  1JOY A;  4JAV A;  1WB7 A;  3IFX A;  3RYH B;  1H2L A;  1DF5 A;  3ABT A;  1XMO B;  3JAM N;  4LFC B;  5K1X A;  5L3C A;  1K97 A;  5CA1 B;  3LDD A;  3E8B A;  3K57 A;  1AP5 A;  4K35 A;  2GDS A;  5EBM C;  2E5L B;  3I56 V;  3N2K B;  4JI3 O;  1HWY A;  2YI9 A;  3CME V;  1RFY A;  1FFT B;  3K59 A;  3D3Q A;  1OHH G;  2F95 B;  1P7G A;  3RGB A;  2QSA A;  4TWK A;  4LFB B;  4IYH A;  1HDJ A;  1HNZ O;  3ABL B;  3ZBH A;  1I08 A;  4DUZ O;  3K3W A;  2Q8V A;  2OYQ A;  2YID A;  1L0N H;  1P7B A;  5CA0 A;  2E5L O;  1F4N A;  4CH3 A;  1K7D A;  2CDY A;  1HNW O;  2XUM A;  1MNG A;  4GLX A;  2DWD C;  3FB6 C;  4CS4 A;  5EIB C;  3T1H B;  4OX9 B;  4PV1 B;  2Y0P A;  3IAY A;  3S3X A;  3L70 H;  1XRE A;  2GSM B;  3BA8 A;  5LXT A;  4FVM A;  1NZ6 A;  2ZIO A;  5LGU A;  4GX2 A;  3CSX A;  3B4S A;  3L73 H;  4K0K B;  5DN6 G;  1YHQ V;  1KKD A;  2FYU H;  1JPX A;  3MDS A;  3RW0 A;  3OR7 C;  3E8H A;  4JI5 B;  3SPH A;  1XOU A;  5IJ9 A;  5IJ9 B;  3CC7 V;  1IVS A;  1UJW B;  5CB4 B;  3OT7 A;  1KUQ A;  1BL8 A;  3HKC B;  3JAW B;  1RSO B;  1B06 A;  2LFS A;  1PNK A;  3OTF A;  1DK1 A;  3SJC C;  1N36 B;  2HLD G;  2OCH A;  5FPR A;  1WAZ A;  2EZO A;  2HVK C;  4GKJ B;  2LP7 A;  2QWO B;  3N2K A;  4P30 A;  4UB8 Z;  2OCC B;  1WNS A;  3FFQ A;  1WPB A;  3K9S A;  1IBM B;  2GHY A;  4WBN A;  2IBZ H;  3ZMS A;  4FZ1 A;  4X8A A;  1PV0 A;  2CE4 A;  1IBK B;  3BY6 A;  2YUA A;  3OD4 A;  4QIW F;  1Y67 A;  4WFF A;  5LOV B;  1P49 A;  2HR3 A;  4X66 O;  5CA1 A;  3TCU A;  2VRZ A;  2LO1 A;  2QA4 V;  4EB6 A;  4XDJ A;  4X1K B;  1YSC A;  4MW8 A;  3K0D A;  4J9Y B;  3JD4 A;  5CBF A;  5LHI A;  2GTA A;  3CEI A;  4ZOL B;  1AIL A;  1QR9 A;  1Q5O A;  5H6R A;  1XL6 A;  4QGP A;  2ADP A;  1ENV A;  1VAR A;  4UB6 Z;  1KD1 W;  4GKK B;  4J7K A;  1PNM A;  2YDE A;  3N27 A;  1VF6 C;  4BW9 A;  3FYE B;  3JAS B;  3CCJ V;  2EBO A;  3WU2 Z;  2Y4T A;  1NKD A;  5FPO A;  3K5N A;  4PA9 A;  3OE7 G;  1R1B A;  3ZRS A;  3BA9 A;  1NTZ H;  4DV4 O;  3T1H O;  4EFE A;  2ZR2 A;  3ICX A;  1YI2 V;  3DXR B;  4LNU A;  2QKS A;  3M7M X;  4H33 A;  1SER A;  2KKW A;  2X6B A;  2QJ1 A;  5EYP B;  3ASO C;  3LSS A;  4TQD A;  5B1N A;  1V9P A;  4DR6 O;  4DV1 B;  2PZS A;  4I0X B;  2NN4 A;  5KMG A;  2YIB D;  3X2Q B;  2LW1 A;  5LP6 B;  3WB0 A;  4B3T O;  2BTO A;  1N8R W;  3F7Y C;  5F2V O;  4JI0 B;  1SQB H;  2ZDI A;  4QJF B;  3LDC A;  3CJH B;  5LYJ B;  2ZIM A;  1NR1 A;  1M9N A;  4JI5 O;  4AI8 A;  1I0H A;  3SPG A;  1XMQ O;  1CP9 A;  5BY1 A;  3RFR A;  3UO2 A;  1Z5V A;  1NS1 A;  1VIB A;  1BE3 H;  3N2G B;  4X62 O;  4G2K A;  1FKA O;  1TGO A;  4NTW A;  1QHT A;  1IBL B;  4NVP A;  3UT5 B;  3RYC A;  4Q20 A;  4NB5 A;  3JD3 A;  4JV5 B;  1YJ9 V;  2MK3 A;  2EIK B;  1OV9 A;  1BHB A;  1R6T A;  3ABK C;  2CTP A;  4JV5 O;  3OM3 B;  4J11 A;  5CBG A;  2ATK C;  4QPJ A;  1JA8 A;  4TV9 B;  3W7T A;  3C3S A;  3JAT B;  3MHS C;  4PI2 A;  4X62 B;  2AW9 A;  3OGC C;  2UU9 O;  3HKB B;  4DV3 B;  1M4U A;  3G67 A;  5IYD O;  5EC1 C;  1JFF A;  2GTS A;  2UXB O;  4K8Z A;  4DV7 O;  3A0B Z;  3CC2 V;  4DR1 B;  3E2E A;  2UXC O;  1PL4 A;  1K73 W;  2GBO A;  2Q0O C;  2V7Q G;  3KCX A;  5D5P A;  1KBH A;  2DJV A;  2JGD A;  2ODM A;  1SES A;  2Q6A A;  3SYA A;  2QM4 A;  2HFE C;  3BRC A;  1H2G A;  4JTA B;  3ZMZ A;  1A32 A;  4X1Y A;  3JAL B;  1QNM A;  5FLX N;  3TK1 A;  2JJ1 G;  3L75 H;  2PTM A;  1IBM O;  2FML A;  3ABK B;  4RAI A;  4BW5 A;  5IYZ B;  1TA8 A;  2RCV A;  4JAA A;  3ZHV A;  1OCR C;  5IT9 N;  4H13 B;  2WLK A;  2ZE6 A;  1FD9 A;  4JAS A;  3FB5 C;  4DK1 A;  2HG5 C;  2OIE A;  4UXN A;  1DLB A;  1US6 A;  3W7U A;  1YIT V;  2ADQ B;  4JZ2 A;  1Q90 D;  2G38 A;  1XMQ B;  2YIB A;  4PA4 A;  3WG7 B;  2JEX A;  5KA6 A;  4E2L A;  5LYJ A;  4XBF A;  3RYC B;  4IIJ B;  4NYK A;  1SQF A;  5IJ0 B;  2ZE8 A;  4IHJ B;  4GX5 A;  4LWS A;  4RUF A;  3VQY A;  5LMU B;  3ZX6 A;  2ZNJ A;  4TUY A;  4H37 A;  1W0J G;  1MAB G;  2R70 A;  1AR4 A;  1EBO A;  4KUM A;  3DC6 A;  3VQX A;  4DRX A;  1K3E A;  2A06 H;  4X1K A;  4DR2 O;  3LNN A;  1FYJ A;  1YDX A;  3ABM C;  4KFM A;  1J5E O;  4LCU C;  4ZI7 B;  3CCU V;  1VQ7 V;  2HVJ C;  4UCO A;  1Q86 W;  2XAJ A;  1BSM A;  2VWK A;  1YCI A;  3TJT A;  1S5L Z;  5GW7 A;  1MZE A;  3BFR A;  4DR4 O;  1Z2G A;  1HP8 A;  4Q6G A;  5CA3 A;  5A2Q N;  3T4Z A;  4DK0 A;  3CCV V;  2JS5 A;  1RSO A;  2D3O W;  3OTO B;  1JJ2 U;  3E8G A;  2YEV A;  1XI1 A;  3RVZ A;  1SET A;  1M56 C;  4MTF A;  3CE2 A;  4DV2 O;  4PJ0 Z;  2W6I G;  1ZL8 A;  5EBL C;  4TT3 G;  2JEU A;  4MS2 A;  3FX7 A;  2QM8 A;  5EC2 C;  2F66 C;  2XND G;  1K92 A;  1VQL V;  2ARH A;  1ORQ C;  3CJH A;  3TGU H;  4HNA A;  3AG4 B;  4B7E A;  2HKO A;  4Z2W A;  5B3S B;  1HNZ B;  2Q7E A;  1PPJ H;  1GH6 A;  4CC6 A;  3WFV A;  2VQF O;  1IDS A;  3SDL A;  5IY5 C;  2EIN C;  1G8M A;  5JJE B;  1KC8 W;  2UXN A;  3W7W A;  1WLE A;  1NVP D;  4PI0 A;  2VQF B;  4DUZ B;  4I0X A;  2DOS A;  1KB9 F;  1MZF A;  4YY3 B;  1BGY H;  1EN6 A;  2DYR C;  1GRJ A; 
#chains in the Genus database with same CATH homology
 1R73 A;  3ABL B;  1KP2 A;  5B1B B;  4PA6 A;  3K3W A;  3B8N A;  2C2A A;  4PDR A;  1ARO P;  1P7B A;  3A0R A;  1FXK C;  2QM7 A;  3CYO A;  2WAM A;  4HAM A;  5B1A B;  2WLN A;  1F4N A;  1VQM V;  2X7R B;  4MVO A;  3ASN B;  1K7D A;  3PJS K;  4F4L A;  2DWD C;  2PI5 A;  3FB6 C;  2A0L A;  5LGN A;  3AG2 B;  1W0K G;  2Q67 A;  5B1O A;  2IH3 C;  1MOF A;  3ABU A;  1AJQ A;  2GSM B;  1NQT A;  4CZZ A;  5LGU A;  4GX2 A;  1NVP B;  5DN6 G;  3OUS A;  3CCR V;  1YHQ V;  1KKD A;  2UXX A;  1JPX A;  3RW0 A;  1K34 A;  5IDJ A;  3OR7 C;  3E8H A;  3SPH A;  3CC7 V;  5HFM A;  3B8M A;  1UJW B;  2XAH A;  3LDE A;  1QLE C;  4G28 B;  1BHA A;  4JGS A;  2EIJ C;  1BL8 A;  4WFA V;  2LFS A;  1BMF G;  3ZRV A;  1PNK A;  1R3I C;  3E35 A;  1B6Q A;  2KB1 A;  3R65 A;  2OT5 A;  2HLD G;  3CD6 V;  3H01 A;  2EZO A;  2HVK C;  1KQS U;  1AJN A;  2LP7 A;  1S0V A;  4P30 A;  1AI5 A;  1NJI W;  2OCC B;  2GHY A;  3SYC A;  4BAY A;  4R6Z A;  3ZMS A;  2WPD G;  3D3I A;  1QVG U;  4X8A A;  3BY6 A;  4QIW F;  2EIL B;  4WFF A;  3CXC U;  4LBE C;  3K0G A;  2HR3 A;  2B5U A;  2X6C A;  3TCU A;  3MHH C;  2QA4 V;  1GTO A;  3JYC A;  3FKS G;  2M7W A;  4XDJ A;  1R3K C;  1R3J C;  3MD0 A;  5H9C A;  1M90 W;  1YSC A;  4MW8 A;  1Q81 W;  1R3L C;  3K0D A;  4MVM A;  4R50 A;  1COW G;  3ML0 A;  2ITD C;  3JD0 A;  4J9Y B;  4MW3 A;  3JD4 A;  2ZXW C;  3IC7 A;  1L1F A;  2A9H A;  5CBF A;  4G27 B;  3F5W C;  2PI4 A;  3T2M A;  5LHI A;  1GMG A;  1FXK B;  1QR9 A;  3OEH G;  4BIU A;  3SYO A;  1NR7 A;  2H94 A;  5LGT A;  1MG1 A;  4X89 A;  5H6R A;  1XL6 A;  2OCC C;  2YEV B;  3G71 V;  2P6J A;  1ENV A;  1AI6 A;  4N21 A;  1AR1 B;  1AI4 A;  3OUF A;  1YIJ V;  4FIP C;  1DF4 A;  1THZ A;  1KD1 W;  2P67 A;  1YJW V;  1PNM A;  2B1G A;  1K9M W;  4LP8 A;  3E8F A;  5L3B A;  4L87 A;  3K06 A;  3HB3 B;  4GX1 A;  4R8C A;  4WFE A;  1VQ6 V;  1OCR B;  3K79 A;  3BEH A;  3FYE B;  3CCJ V;  2Q68 A;  2EBO A;  1KEC A;  1CPY A;  4FPP A;  2FTK A;  1NKD A;  4PA9 A;  2R9I A;  3OE7 G;  4PA3 A;  2AHY A;  3ZRS A;  5B3S C;  2ZXW B;  1VQ9 V;  4FMT A;  4RO2 A;  3CCS V;  5L3D A;  2DYS C;  5FL7 G;  4DO2 A;  4Z1M G;  2IH1 C;  2DQ0 A;  2ZR2 A;  5L3G A;  1K33 A;  3CCL V;  1YI2 V;  1VQO V;  2Y48 A;  3OFN G;  2DW4 A;  3ZMT A;  4X88 A;  3OMI B;  3ETG A;  3QO8 A;  2QKS A;  4GCZ A;  2AHZ A;  3F7V C;  4H33 A;  4MTX A;  1SER A;  5EK0 A;  3AG1 C;  2X6B A;  1SZT A;  3STL C;  3ASO C;  3LSS A;  3JD2 A;  2IU0 A;  5B1N A;  4BIZ A;  3ABM B;  4MVU A;  3VOU A;  1GM8 A;  1TUE B;  5CMU A;  2A79 B;  3X2Q B;  2Q69 A;  4XDL A;  1GM9 A;  2WWW A;  3OW2 U;  4UVC A;  5IY5 B;  1OCZ B;  3CC4 V;  1N8R W;  1V55 B;  3F7Y C;  3E83 A;  2NNU A;  2IJH A;  1ZWI C;  1OCO C;  1CEZ A;  3ASN C;  3P32 A;  4R7C A;  2ZDI A;  4QJF B;  3G4S V;  3LDC A;  1H8H G;  1NR1 A;  2DYS B;  4ASU G;  3QO5 A;  1F23 A;  5LBQ A;  2BOC C;  2XAQ A;  1Q7Y W;  3AG2 C;  3SJQ C;  4ZBM A;  1M9N A;  4OXS A;  2ZQM A;  1E1Q G;  4RQE A;  3M99 B;  1I5Y A;  3CP1 A;  4MT8 A;  3K03 A;  4J9Z B;  3SPG A;  1CP9 A;  2W6J G;  1J95 A;  2DWE C;  4MVS A;  3RVY A;  5KA5 A;  3NXS A;  4UUJ C;  1SRY A;  5CN0 A;  5H6Q A;  5LHG A;  3X2Q C;  1P4R A;  4TSF G;  3EFF K;  1VQ4 V;  4MSW C;  4MVQ A;  4G2K A;  4WFG A;  2WLI B;  3K08 A;  1WPX A;  4GT1 A;  4ZKI A;  4Q20 A;  3JD3 A;  1FS0 G;  4JYB A;  4PA7 A;  1YJ9 V;  2MK3 A;  1QCE A;  2EIK B;  1K4D C;  3ZMV A;  1S76 D;  1BHB A;  1S5H C;  3ABK C;  4JAU A;  5EBW C;  4PDV A;  4YXW G;  3OM3 B;  2IJI A;  3QO7 A;  5CBG A;  2ATK C;  4QPJ A;  3CCQ V;  3W7T A;  2ZR3 A;  1E79 G;  1PNL A;  3MHS C;  2IW5 A;  2V1D A;  1ROP A;  1Y4M A;  3OGC C;  2ITC C;  1QBZ A;  1V54 B;  1RPR A;  4N23 A;  2K1E A;  1K8A W;  3FYI B;  2QEX V;  4MTG A;  4RQF A;  2B1I A;  2IJK A;  5IYD O;  4RUE A;  5EC1 C;  2JJ2 G;  1M1K W;  4P9P A;  1JVM A;  1K4C C;  5IYC O;  1GO3 F;  3SPJ A;  2P90 A;  3CC2 V;  3ZRX A;  2EIN B;  3ZRW A;  3E2E A;  1PKX A;  2Z3Y A;  4PDL A;  1K73 W;  2OTJ V;  3LUT B;  1K5S A;  2WLH A;  2V7Q G;  2Y69 B;  3FB7 C;  4JTC B;  5L3F A;  2XAF A;  1R6N A;  2WLL A;  3SPC A;  4JYC A;  2JDI G;  1SES A;  4P9O A;  2Q6A A;  3P30 A;  1F4M A;  1M57 B;  2WSS G;  3SYA A;  2HFE C;  3T4D A;  1H2G A;  1EFR G;  5J9P C;  4JTA B;  3ZMZ A;  2YSU B;  1OCO B;  3HPL C;  1F51 A;  4I9W A;  3ETE A;  2XOK G;  3EHB B;  3TK1 A;  3WG7 C;  2WLL B;  2JJ1 G;  3CMA V;  1NH2 B;  1PL0 A;  3UM7 A;  3ABK B;  4RAI A;  4BW5 A;  4LC1 A;  3ABL C;  3ZRW B;  1W2B U;  2OTL V;  2IU3 A;  4I5S A;  5L3E A;  4U7N A;  1NH2 D;  2EIM B;  1FXV A;  1OCR C;  2WLI A;  4WFH A;  2EJR A;  2WLK A;  2R9R B;  3LNM B;  4QE9 A;  4JAS A;  3SYP A;  3FB5 C;  5B1A C;  1PD3 A;  3OMN B;  1S77 D;  2HG5 C;  2X0L A;  4P2Z A;  4QNH B;  1AJP A;  4PEL A;  1QVF U;  3GWO A;  1KP3 A;  4UXN A;  1R6K A;  1DLB A;  3W7U A;  3AG3 B;  2WLJ A;  1OCC C;  1RM1 B;  1K5Q A;  4WCE V;  1YIT V;  1QR8 A;  3ZN1 A;  3CCE V;  1YJN V;  3JCZ A;  3W7X A;  3ZMU A;  2QTO A;  2DYR B;  4PA4 A;  3K04 A;  1EZJ A;  4UV9 A;  2QE7 G;  3WG7 B;  2JEX A;  2X6A A;  5KA6 A;  4CBC A;  1Y66 A;  4GX0 A;  4XBF A;  4E2L A;  2LFR A;  1DTO A;  3AG1 B;  1QLN A;  1S72 V;  4FK5 C;  3ZCC A;  1JQ0 A;  1M57 C;  3E86 A;  4GX5 A;  4RUF A;  3OAA G;  2JK5 C;  2WLM A;  2EIM C;  1FXK A;  1VQ5 V;  2XAG A;  4JF3 A;  4H37 A;  2F43 G;  1W0J G;  2XAS A;  1MAB G;  1EBO A;  2BOB C;  4KUM A;  1K3E A;  4XDK A;  4UVB A;  3ZN0 A;  1IXM A;  3AG3 C;  4HZ3 A;  3ASO B;  3LSQ A;  3T1C A;  3ABM C;  4KFM A;  1RPO A;  3FB8 C;  2EIK C;  4JPR A;  3D36 A;  1XL4 A;  2Y69 C;  4DXW A;  3IGA C;  4QPK A;  1Q82 W;  1GKF A;  1OCZ C;  4LCU C;  3CCU V;  3G6E V;  1M56 B;  3QNE A;  1VQ7 V;  2HVJ C;  3OEE G;  1V55 C;  1S3J A;  5IYB O;  1Q86 W;  2NLJ C;  2XAJ A;  1H38 A;  3E89 A;  2ZDI C;  3AG4 C;  4WFB V;  4KP4 A;  3AEI A;  3DGE A;  5GW7 A;  5CBH A;  2ZD9 A;  2IJJ A;  5KUK A;  3SYQ A;  5CA3 A;  3UKM A;  4UVA A;  1VQP V;  1GM7 A;  3ETD A;  3RBZ A;  3TET A;  3T4Z A;  1JCH A;  3ZJZ A;  2Z5U A;  5DM6 V;  3CCV V;  5C93 A;  2EZP A;  1VQK V;  2D3O W;  2EIJ B;  5E1A C;  4EKW A;  1JX9 A;  3OMA B;  1JJ2 U;  3ZIA G;  3W7S A;  5HFL A;  1AI7 A;  3OR6 C;  3E8G A;  1VQ8 V;  1E1R G;  5BZB A;  1NBM G;  1OZ0 A;  2YEV A;  3GB7 C;  1MSW D;  3STZ C;  3RVZ A;  1SET A;  1V54 C;  1M56 C;  5KUM A;  4MTF A;  1FXH A;  1OCC B;  4UV8 A;  3VBB A;  4WF9 V;  3I55 V;  1RM1 C;  2H8P C;  1QLE B;  3SPI A;  3CPW U;  4HYO A;  1YTF D;  3B77 A;  4MVZ A;  1YTF B;  1H8E G;  2W6I G;  4QE7 A;  1JOY A;  4MVR A;  4JTD B;  4JAV A;  3CCM V;  3IFX A;  4TT3 G;  2DQ3 A;  5EBL C;  5B1B C;  1DF5 A;  2JEU A;  4MS2 A;  2JIZ G;  3ABT A;  2QM8 A;  5EC2 C;  1G4Y B;  5L3C A;  1K97 A;  2CK3 G;  2XND G;  5LHH A;  3KG2 A;  4PDM A;  4U7O A;  1K92 A;  3LDD A;  1VQL V;  1ORQ C;  3E8B A;  3AG4 B;  2HKO A;  5B3S B;  4MTO A;  2HJF C;  3DTU B;  3WFV A;  1VQN V;  1LNQ A;  5EBM C;  3I56 V;  1HWY A;  5IY5 C;  2EIN C;  1G8M A;  3CME V;  1KC8 W;  2UXN A;  3W7W A;  1FFT B;  1WLE A;  2P7T C;  1NVP D;  2EIL C;  1OHH G;  1I5X A;  3JD1 A;  2W0F C;  1GK9 A;  4TWK A;  4FJC C;  2DYR C;  3K9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...