1KKDA

Solution structure of the calmodulin binding domain (cambd) of small conductance ca2+-activated potassium channels (sk2)
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
92
structure length
92
Chain Sequence
RKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small conductance calcium-activated potassium channel protei
publication title A helical region in the C terminus of small-conductance Ca2+-activated K+ channels controls assembly with apo-calmodulin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 4
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kkdA00
3SYCA 2ITCC 1XL6A 2EIKC 4MVRA 5B3SC 3LDCA 1M57C 2Q69A 4OXSA 2H8PC 3ZJZA 4MVQA 3AG4C 3T2MA 2WLHA 5J9PC 3ASNC 4BW5A 3BEHA 1ZWIC 4UUJC 2X6BA 4PDVA 2AHZA 5KUMA 4H33A 2P7TC 1OCOC 4QE7A 1V55C 4R6ZA 4WFHA 2WLIB 1J95A 4LBEC 3E89A 2X6CA 3FB6C 3LDEA 2Q67A 2KB1A 3E8HA 1K4DC 4PDMA 4MW3A 4XDJA 3RVZA 3LDDA 3SPIA 1OCRC 2WLLB 2BOCC 3LNMB 3F5WC 4CBCA 3OR7C 4G27B 4R8CA 3TETA 4KFMA 1M56C 2WLJA 2YEVA 2K1EA 4GX5A 3K04A 3ASOC 3E83A 1JVMA 3K0GA 2Q68A 4JTAB 4LP8A 3SYQA 4PDLA 3IFXA 2A79B 5B1BC 3F7YC 2HFEC 4JTDB 4LCUC 3K06A 4RO2A 4H37A 3UKMA 2W0FC 3E8BA 3IGAC 2HVKC 3E8GA 5CBFA 4P2ZA 1R3KC 4I9WA 4MW8A 3T1CA 2BOBC 5IY5C 2WLMA 2JK5C 2DYRC 3E8FA 1QLEC 3JYCA 2EINC 2HG5C 1P7BA 2WLIA 3OGCC 3SYAA 5BZBA 5KUKA 3FB7C 3GB7C 4PA6A 2QKSA 4MVMA 4GX0A 4RAIA 3AG2C 3K08A 4TWKA 5B1AC 3K03A 4MVZA 2ITDC 3SYOA 4QE9A 2NLJC 5EBWC 2ZD9A 4MVSA 2EILC 4PA4A 4PA9A 4PA7A 4WFEA 5EC1C 4RUFA 4ZBMA 3SPGA 5EC2C 4P30A 4MSWC 4P9PA 4R7CA 1OCCC 4JTCB 3OUSA 2DWDC 2A0LA 3FB8C 3KG2A 3SPHA 2OCCC 1ORQC 2Q6AA 3AG3C 3HPLC 2IH3C 3FB5C 3SPCA 4RUEA 4XDLA 2EIJC 1R3JC 4MTOA 4X89A 2X6AA 2A9HA 4J9YB 1R3LC 3R65A 1BL8A 4XDKA 5CBHA 4F4LA 4MVUA 1K4CC 3E86A 1G4YB 1OCZC 4MTFA 4PDRA 2R9RB 3X2QC 3OR6C 4HZ3A 3UM7A 3T4ZA 1XL4A 2DYSC 4EKWA 4PA3A 5CBGA 2QTOA 3OUFA 4X8AA 4WFGA 4X88A 5EBMC 1KKDA 2HVJC 2DWEC 2IH1C 3K0DA 3ZRSA 4J9ZB 3TCUA 4HYOA 2WLLA 3PJSK 1S5HC 3RW0A 3STLC 1V54C 3STZC 2Y69C 4MS2A 4GX1A 3VOUA 4GX2A 4QNHB 1LNQA 5EBLC 2ZXWC 4P9OA 4MVOA 5E1AC 3AG1C 4MTGA 2EIMC 3RBZA 4WFFA 2ATKC 3SJQC 3LUTB 4R50A 1R3IC 3ABKC 3EFFK 2WLKA 3RVYA 4G28B 3SPJA 4DXWA 3ABMC 3F7VC 2WLNA 5EK0A 3WG7C 3ABLC 2AHYA 2HJFC 3SYPA 3T4DA
chains in the Genus database with same CATH superfamily
2RDCA 5IYBO 3LDCA 2QWPB 1HR0B 1JQ0A 1XREA 3OMNB 2YUAA 5J9PC 1W0JG 3ASNC 3IJ4A 4TV9A 1NT2B 3RYIA 2FL4A 1FD9A 2ZDIA 2PTMA 2Q67A 5LGTA 4GKJB 4NVPA 5KAFZ 4J7JA 3H1IH 1JCHA 3T1YB 1VF7A 1YJ9V 1PNLA 4FVMA 5LA6B 5K1XA 3SJCC 4G27B 1NKDA 2BTOA 4U3FH 1DF5A 3VQWA 2F93B 1BMFG 3GWKC 2G38A 1VQKV 2JIZG 5CBFA 2LGQA 4MW8A 5LXTA 5C8YA 2P4KA 3CWBH 2QEXV 5J2TB 3CCVV 2HG5C 1P7BA 3OE7G 4Z1MG 4DR3B 2OTJV 4ZI7A 1HDJA 4WFAV 1BQ0A 5KLVH 4PA7A 3VQVA 2V1DA 2YICA 3JASB 1K73W 1JJOA 5IT9N 2VQFO 3CRMA 2QKCA 1YXBA 3MHSC 5BXZA 4DO2A 4X20A 2FKXA 2UU9B 2FMLA 4FLZA 3UM7A 5L3BA 4FM1A 1TUBA 4JF3A 5HFMA 3SJAC 1G8MA 3TCUA 2E75B 4AILC 4DW1A 2RJZA 1SF9A 1XNRO 3JAKA 2ZIMA 2M7WA 2M6YA 1VMGA 3EFFK 4ZHQA 2CTQA 4LF7O 1AR1B 3T4DA 5IYZA 4TV8A 4QIWF 2L6LA 3N2GA 5IYDO 4IT5A 5GTIZ 3ICXA 2CUGA 4NTWA 3J80N 1XI1A 2DW4A 2N04A 1VQOV 4DV0O 4JASA 2VQFB 2CGOA 2YC0A 1YVWA 4U7OA 4XDJA 3RVZA 5CA1A 3RT3C 1R6TA 1N0NA 1OCRC 1PNKA 3OEHG 5BMVB 5GTHZ 2E5LO 3AK1A 1MSWD 1S0VA 1HW7A 4DV2O 3IFXA 2AW9A 3GVMA 4FFBA 4KL1A 3L74H 4X20B 3HB3B 2Q8VA 1QR9A 1XNRB 1Z5WA 4I9WA 4TOIA 5IJ0A 2HP8A 1PL4A 4JPRA 2B5UA 1SRYA 4RWUA 3FB7C 3C90A 1K8AW 4LF7B 1N8RW 1DF4A 1AP5A 1JPXA 2EZPA 3G80A 3P30A 3MAQA 4MSWC 4NB5A 5LL6Y 3OUSA 4ZHQB 3ABUA 2PYJA 1Q82W 1YITV 2Q6AA 2CAZC 3AG3C 5IYZB 3W7XA 4DV0B 2B1IA 4F6EA 1Q6UA 4TV8B 4YXWG 2YIDA 2JEXA 5B5EZ 4LFAO 3EXAA 1DGSA 2EIKB 4I4TA 1HNWO 1L0NH 2E5LB 2Q7GA 4OGQB 5CA1B 4DV2B 4FZ1A 3VOUA 1BHBA 2UXNA 2EX3A 4WFFA 5EYPA 2DMXA 2WLKA 4G28B 3SPJA 1SQQH 3BAAA 1AILA 3D36A 2JS5A 4FFBB 4FZ0A 1J5EB 3RWRD 2YXLA 5L3EA 1K5QA 1ZWIC 2CDYA 1VQLV 3ZMTA 1QQCA 4QE7A 1V55C 2VRZA 4IYIA 2HHHB 2CH7B 1YTFD 1JA8A 4CZZA 5ITZA 3E8HA 1I5XA 5LBQA 2BE3A 1Q6IA 4N23A 2QKAA 4LFAB 1GK9A 2K1EA 4K0KO 2Z5UA 3D8CA 3P3PA 3DXRA 4D7SA 1L0LH 1HNWB 2HJDA 1YF2A 1HWYA 1GTOA 4LCUC 4UCRA 4MTXA 5EIBD 1URFA 1WB7A 3HKBB 2JGUA 4I4TB 4LFBO 5LOVA 5D5PA 2RNBA 2ZE7A 3K5MA 1KP3A 3HKEA 2ZD9A 2DYSB 3DGEA 3M7MX 1Y66A 2Y4UA 4R7CA 1OCCC 4JTCB 3KG2A 2X7RB 5LGNA 2FYUH 3G6BA 4UCUA 3G67A 4E4EA 2F23A 1SZXA 1WPXA 2B9ZA 4PA3A 2QTOA 1M57B 1N33O 4DV5B 4K0KB 4X1IA 5ITZB 4J9ZB 4Q20A 4HYOA 3PJSK 1YDXA 2IW5A 2AZ2A 4JZGA 2VS0A 1R3IC 3N27A 3OTOO 3DXRB 4DXWA 4LFBB 4TWKA 2EULA 3A0RA 1KC8W 1BS3A 1W59A 2P06A 4Z1VA 2WLHA 5DEDA 4JAUA 2Q4PA 2IU0A 1NI8A 5GW7A 5LOVB 1VQNV 2CGNA 1MNGA 3SR2C 1MMMA 1M9NA 4AQYB 2DYRB 1AJPA 1AI4A 2WLLB 1SERA 3LNMB 1IXMA 3K04A 2IBZH 1GO3F 1RSOA 4H44B 4B7KA 1N33B 3LNNA 1Q5OA 1NR7A 1JR9A 3M8AA 3F7YC 1PM9A 2ZINA 3THOA 3BVOA 4J41A 4NXMB 3D3QA 1ZAUA 5IY5C 3E35A 3OTOB 3ZS8C 5B1AC 2UUCO 3CJHA 4JZ2A 3FD9A 3UO2A 1BQZA 4O2AA 4CH6A 1MA1A 3FX7A 1XEQA 3ZX6A 4K8ZA 2CTPA 3CX5F 1ORQC 4JI0O 2PI4A 4X66B 3BPZA 3R65A 1EZJA 1H2MA 3OR6C 5C93A 1YIJV 4E2LA 2QJ1A 5EBMC 1YCIA 1ZX3A 1B04A 3ZHSA 2D3OW 3STZC 1AB3A 1K5SA 3I5DA 1BCCH 4CH5A 3ZRWA 3OTFA 2EIMC 4JI7O 2NNUA 1H38A 4CC6A 4FLYA 1RSOB 1NBMG 3DC6A 3WG7C 1Y74A 4X9QA 1T5EA 2BSKA 1I94O 3S3XA 2UUCB 4CH4A 4OXSA 4B3SO 4MVQA 3T2MA 1RFYA 1BE3H 1NS1A 4WBNA 3ABTA 1VQ6V 1DK1A 3VQYA 1N0JA 2X6CA 2H3OA 3HKDA 4PDMA 4JI0B 3CJHB 4NTYA 3KKYA 3L72H 4O2AB 2B1GA 2KSDA 4UXNA 4R8CA 4G2KA 2P22C 4KP4A 3BY6A 1M4UA 4DV1O 3JALA 3ZHQA 3SJBC 4JTAB 1FPOA 3B8NA 3CMEV 4DW0A 4PD4F 1Z2GA 2A06H 3CRCA 1X59A 2ARHA 2PZSA 1WP7A 1S76D 2OIGA 3B09A 4MVZA 5FPRA 3CC7V 1ZTEA 1I94B 4JI3O 4ZOLA 1A32A 4B3SB 1XBLA 1GAXA 5EC2C 1KUQA 4JV5O 3WFVA 3N2KB 4H0LB 1XMOO 2OCCC 3B77A 3SPCA 2DQ0A 2A9HA 2RCVA 1Q81W 4YHHO 4WBNB 1Z5VA 1KB9F 1SS3A 3K59A 4DV1B 3T1HO 3K0DA 3OW2U 3L75H 1DTOA 5LA6A 2KQXA 1S5HC 3HKDB 4JAAA 2YS8A 4QNHB 1HNXO 2BTQB 3ZN0A 2Q7HA 4MTGA 1OJHA 3SJQC 3JALB 1Q6HA 2QM4A 1DLBA 3ABMC 4GYCB 3ABLC 1OCRB 1ROPA 5FPOA 3BCCH 3SYCA 1XMQO 1AJQA 4K35A 3O9OA 4CS2A 1JOYA 3AG4C 5J2TA 4JI3B 3ZRVA 1NQTA 4UUJC 4JV5B 4CC5A 1FKAO 2UXCO 4WFHA 3FB6C 1XMOB 3CD6V 5EZYA 1N36O 1FYJA 1G1XB 4Z2WA 2N05A 4MW3A 1S72V 4ZOLB 3JASA 2F1MA 2ZE6A 4YHHB 5KHIA 4GKKO 2QWRB 3KCXA 3T1HB 5KX5B 2PUSA 4CS3A 4I9QA 2NR5A 3MHHC 2W0XA 3W7SA 2R9AA 1HNXB 3AG3B 4U7NA 4GUNA 2F95B 3BA9A 1KD1W 3CXCU 5B1NA 1PKXA 3OGCC 2IM9A 2AGAA 1IBMO 4MVMA 2OWOA 2LW7A 1BHAA 1XMQB 1YHQV 1XOUA 2E74B 1GM7A 3UCSC 3CS5A 2W6JG 4OPHA 2JRIA 4PJ0Z 2GHYA 3WB1A 2UXCB 3HPLC 3L71H 4J42A 4J9YB 1N36B 1KYOF 4IL6Z 1NVPD 1G4YB 1OCZC 1VF6A 2EZOA 4DR4O 3JCUZ 3R66A 4GKKB 4X88A 1Q7YW 3ZHVA 3QO5A 5EZYB 2GV9A 3STLC 2LP7A 4MS2A 5BMVA 1F7YA 1V55B 5EBLC 2ZXWC 4P9OA 4UVAA 3W7WA 4ZKIA 2ZIOA 4A5UB 2MW2B 1IBMB 5B3SC 5CA3A 3SGIA 1ZL8A 1GKFA 4QGPA 3WB0A 3U0ZA 1K34A 1LUVA 3K5NA 2LO1A 4GT1A 1FXKC 2W6IG 5LYJA 3LDDA 2IJKA 2WAMA 2PF4E 5IE9A 2EJRA 1M56C 3NR7A 3ZMUA 4DR4B 3CCJV 4ICGA 3JSNA 4JTDB 1OCCB 1Q86W 4TUYB 2R9IA 5CA0A 4FM2A 3E8BA 3AEIA 3T1CA 4QJFB 3SYAA 2QM8A 3GB7C 2QKSA 2YI9A 4J7KA 3K08A 2ITDC 2OTLV 4QE9A 4BW9A 3W7TA 1WP8A 3ZMZA 4EEQA 1H2SB 1EN4A 5JJNB 4I5SA 2WA3A 5BR8O 1NH2B 2E3CA 2A0LA 3OT7A 3FB8C 1R6NA 1JFFB 3SPHA 3G4SV 3FB5C 3S3WA 2GTAA 1ZL8B 2F4VO 1PL0A 1PNMA 2RN9A 3E86A 2CH7A 1Y76A 3RN4A 4LR3A 4QPJA 2CTRA 4EKWA 1AROP 3H1HH 2VQEO 1FXVA 3RW0A 3TXSA 1V54C 5LYJB 4GX1A 1B3QA 5JJJB 2ZNJA 3I55V 5FNVA 2Q5ZA 3L9DA 4JI2O 3ML0A 3ETDA 3NXSA 5B1OA 1VQMV 5KHGA 3HKBA 5CA0B 2GSMB 3BFRA 3BRCA 3CCQV 2X6BA 2ZE5A 3ZMVA 5BR8B 4UV8A 4KHPO 4I55A 2ZR3A 5IY5B 2GUZA 2F4VB 2ZT9B 2WPDG 3OR7C 1P49A 4KFMA 3RYCA 2WLJA 2YEVA 5B1AB 3K0GA 4PDLA 2XTAA 3QNEA 2VQEB 4JI4O 3WB2A 1AP6A 4X65O 1D5AA 3UKMA 1IZ3A 1Y76B 5A9GA 3DTUB 2HVKC 1VQ8V 2H94A 5KHHA 5LP6C 2F43G 4HNAA 4JI2B 1FFTB 3OAAG 3K03A 1E1QG 3SYOA 3JAWA 3FYIB 5FNVB 3CCUV 4LF6O 3OGIB 1PPJH 4DUYO 3CCMV 5JQGB 2XAJA 4GCZA 2GDSA 1YJWV 1FS0G 5H5NA 2IU3A 4KHPB 1GM9A 2Z0AA 1GM8A 1R6KA 2EIMB 3B8MA 4B3TO 2RMKB 5CBHA 1RP3B 3CB2A 4NKGB 3WG7B 2UXXA 3X2QC 3CC4V 1IBKO 3CCLV 1KKDA 2PGGA 4WFGA 2F66C 3H1JH 1SQBH 2DWEC 4I55B 3JD2A 4QPKA 2WLLA 2Y48A 1P84F 3L70H 3VBBA 3QO8A 1Q3EA 2GUZB 4JGSA 1AR4A 4X65B 3RYCB 1GRJA 4PI0A 2YEVB 4YY3O 1GMGA 4IHJB 3EVKA 2ADQB 3CRQA 1VQ5V 1GN6A 2AHYA 4TQDA 5L3GA 2Z3YA 4IIJA 1XL6A 2YDEA 2YIBA 1NTKH 3A8TA 1H2LA 4BW5A 4AI8A 4LF6B 4DUYB 4H33A 4HNAB 4RQFA 3DC5A 1YI2V 3JAWB 2UUAO 1TUEB 4B3TB 5L3CA 2IJHA 4GX5A 1EZVH 5E79Z 3ZRXA 4W4LA 3TXQA 4GLXA 1AI6A 3B4SA 4UB6Z 4RO2A 2W0FC 2OCCB 2ZQMA 3E8FA 2RQ6A 1VQPV 3WU2Z 5A2QN 1IXBA 2OT5A 1UFIA 1L8DA 3B40A 5AG2A 5CN0A 3SPGA 2JJ2G 5EIBC 1TAEA 3CRAA 1XHXA 2Y0PA 1IURA 4IIJB 2N74A 4B7EA 4N21A 4ZIBA 3ABMB 3ABLB 2NN4A 3H1KH 3OM3B 4X8AA 2V7QG 3FAVA 4DYLA 2XASA 3AG4B 3ETEA 5JVDA 3BHPA 4PHZA 1SA0B 4LWSB 1QCEA 5E1AC 2WA4A 1LR1A 4BAYA 3GWOA 2HLDG 2QDOA 2P5OA 2EINB 1NZ6A 1XDCA 3QO7A 1FAFA 1ZUQA 4FM0A 2QR4A 3PN1A 4PDVA 1WA8B 2P7TC 1J95A 2XHBA 1H2NA 2DE0X 1JX9A 2QA4V 3K79A 3N2KA 2JDIG 1XNQO 2D2CB 3F5WC 3LSUA 1N34O 4DV6O 3ZHTA 1WB8A 1W2BU 1KBHA 1K7DA 3ASOC 1MOFA 1FXKA 3APQA 5KHKA 5KHJA 1EN6A 4J80A 1SETA 1N4CA 2Q0OC 4H37A 5H6RA 1R3KC 5HFLA 2BOBC 3FAVB 5JVDB 1QR8A 2P90A 4YIPA 3AG2C 1OCZB 2LFRA 2BTQA 2Q7EA 1RM1C 4DV4O 5DM6V 2R70A 1EBOA 2YXHA 2EILC 4BIZA 4ZBMA 4RUFA 2QTSA 4P9PA 4DR2O 3C3SA 1S5LZ 1RPRA 4IGGA 2ZXWB 2P4VA 1R3LC 3LSSA 2FB5A 4JI7B 1H2GA 4F4LA 4MVUA 2GTSA 4U3JA 3A0HZ 1VQ9V 1N34B 3OUFA 5B3SB 2ETNA 4LNUA 1AJNA 1NTMH 2CTWA 4B3RO 1Y6XA 1SQXH 5JWPA 1O9GA 4DK0A 2R72A 2Q0AA 3JATA 1CEZA 3AG1C 3JD3A 2YIAA 5KX5A 4R50A 1FXKB 2QSAA 3RVYA 1E79G 5LHGA 2ZM6O 5FLXN 2HJFC 3SYPA 1RPOA 1GN3A 4FMTA 4MVRA 1M56B 4GZRB 3B2EE 4TT3G 4DV4B 1K92A 1TGOA 3LSQA 5CMUA 1XHZA 4NXNO 4LF8O 1OCOC 4WCEV 4DR2B 1I5YA 4LF5O 1CPYA 2VWJA 4L87A 1IX9A 3CCRV 3CYOA 2DN9A 2BOCC 4F6RA 2ZR2A 1D5NA 3HR0A 3E83A 2WSSG 3QF7A 1H8EG 3CXHF 5B1BC 4GKJO 2GBOA 4B3RB 1H2KA 4U3JB 1OV9A 5DN6G 4UCSA 3IGAC 3JD1A 5LMUO 5IYCO 3JYCA 2EINC 4LNUB 2WLIA 5LHHA 2ZM6B 4RAIA 4GX0A 2UXDO 5EBWC 2Y4TA 3D3IA 5LMNO 3JATB 1S3JA 4P30A 4TQFA 3RGBA 1V54B 4NXNB 4LF8B 2Y0IA 4WF9V 4FLWA 2X6AA 3F5TA 2ZE8A 1YEWA 1YSCA 4NYKA 2ZKOA 4PDRA 4LF4O 1MABG 2R9RB 1XL4A 2ILMA 2HVJC 2XAFA 1ZLZA 1I7FA 2Y69C 1KP2A 4FFKA 1B6QA 3MD0A 1CP9A 4F6RB 4RQEA 1Q8IA 2CE4A 3LUTB 1AI7A 1CXZB 2LJ2A 5LMUB 2UU9O 4OX9O 2QM7A 4TUYA 5IJ9B 1GN2A 4WFBV 1EN5A 3K58A 2UXDB 3ZEDA 5LMNB 1VQ7V 3H9VA 1KECA 3FFQA 1OHHG 1NU1H 1QVFU 2WLIB 3TJTA 3ETGA 3QTCA 4O4HB 4UFZA 1U97A 1K4DC 3I56V 2QWOB 5LP6B 4JYBA 2UUBO 1JFFA 4FPPA 2ODMA 3K5OA 4LF4B 3CPWU 3SYQA 4FJCC 2PYLA 4NTXA 2HFEC 4LF9O 1V9PA 3K06A 3G71V 4W4KA 4JYCA 3AK2A 1QLEC 4FK5C 1SC5B 5JH7A 5KA6A 1OZ0A 4PA6A 4OX9B 4TV9B 2QE7G 1M93A 2IJJA 3RYIB 5B66Z 4J7ZA 3X2QB 1IVSA 1QLNA 4D7TA 3TK1A 5L3FA 1SQPH 2HR3A 5BY1A 1KKCA 4FLTA 1KMIZ 3RYHA 4MT8A 4CS4A 2JVDA 4DUZO 2EIJC 4MTOA 4X89A 5L3DA 1K4CC 4JAVA 1IBLO 3E2EA 2UUBB 5CB4A 2LW1A 3BA8A 1I0HA 2IH1C 5IWAO 5LXTB 5C8YB 4PV1B 1QU7A 4L8JA 3CSXA 2O57A 4GX2A 2V4DA 1WAZA 4EFEA 4ZI7B 3ZN1A 4LF9B 1F4NA 1PV0A 4I50A 4JI6O 5LHIA 1BGYH 3ABKC 1KQSU 4LP8A 2CK3G 2PY5A 2XAQA 4HAMA 4PI2A 1N32O 4C7UA 3JARA 4DR7O 1YTFB 1IDSA 2JS3A 5JH7B 2VWKA 3LDEA 2KB1A 1K33A 3JD4A 1TUBB 1XILA 2EBOA 5JCOC 1H8HG 4DUZB 5JQGA 1J5EO 5H6QA 1SQGA 3ZBHA 3C3TA 1IBLB 5DECA 3JAKB 3RYHB 5IWAB 2HHHO 2A79B 1R1BA 4NR1A 4FLUA 1R73A 5CB4B 2P6JA 3E8GA 4LFCO 1VP7A 3APOA 3N2GB 4JI6B 2QWQB 1QNMA 3KCYA 4FLVA 4FLXA 1SESA 2NLJC 2LQTA 3CCEV 3J7AU 4FIPC 4MVSA 4PA4A 4BIOA 2XUMA 4KXRA 4WFEA 4IHJA 1N32B 4I50B 1W0KG 4AHCA 3UT5A 4DR7B 5J2UA 4J10A 2DWDC 3MDSA 3ZHUA 1Y67A 2JGDA 1NH2D 1GN4A 1TVKA 1P7GA 4RUEA 1MZFA 4XDLA 1NR1A 1WLEA 4OPAA 1FFXA 2DOSA 3JARB 2OYQA 3FYEB 4O4IA 3U11A 3CCSV 4HZ3A 3T4ZA 4O4JA 1ENVA 2AXTZ 1E1RG 3FKSG 3ZCCA 3ZRSA 1FXHA 5IJ0B 4DRXA 5IDJA 3JCZA 1LNQA 1HP8A 4MVOA 1EFRG 4LFCB 5GONA 4JI5O 3OFNG 3ZHRA 5JJEB 3ZMSA 1COWG 4DV5O 4I7ZB 2Q69A 2ZDIC 3ASOB 3OMAB 3ZJZA 4DK1A 4EB6A 4JI1O 3JD0A 1M1KW 2OIEA 4JYAO 2AHZA 1K97A 1VEWA 3E89A 4LBEC 1THZA 4JI4B 1FJGO 1K9MW 3BABA 3P32A 2XOKG 1BSMA 4ASUG 4PELA 3UT5B 4DR1O 3AG2B 5J2UB 2UXBO 3AG7A 3K3WA 1RM1B 1JVMA 2JGDB 2Q9LA 2EILB 1TVKB 5EYPB 2ZNIA 4K3AA 1XUQA 1FFXB 1VF6C 4O4IB 4CH3A 1Q43A 4AQYO 4P2ZA 3TGUH 4O4JB 4B3MO 1F23A 4YJ3A 4K8XA 4JI5B 1SA0A 1WPBA 2A3QA 3UQ8A 3O65A 4LWSA 4DRXB 4DV7O 1O9HA 4I0XA 1UJWB 4X62O 4PA9A 4LH6A 5EC1C 1IBKB 3ZIAG 1HNZO 4JI1B 5GONB 4JYAB 1ZSPA 4NXMO 2OCHA 3IC9A 3DSQA 2XAHA 1FJGB 3AG1B 1R3JC 2YI8A 4EB6B 4YY3B 1WA8A 3CHXA 4O4LA 4MTFA 3M99B 4DR1B 1I08A 2UXBB 1KU9A 4X64O 1SQVH 2XAGA 1UPGA 2XNDG 1L1FA 1OCOB 2PI5A 4X66O 3CRRA 4O2BA 1F4MA 1X4TA 3HKEB 3RBZA 5D5QA 2ATKC 4ABMA 3CE2A 1Y4MA 4UV9A 1US6A 4X1KA 5EK0A 3F7VC 4B3MB 2DJVA 2UUAB 4X1YA 1YJNV 2EIKC 3OD4A 4DV7B 4JYYA 2H8PC 3JSLA 4UVBA 1TA8A 3CC2V 4X62B 3RYFA 3K57A 3CP1A 2HKOA 4IYHA 5B1BB 2YXYA 2ZCEA 3H1LH 4R6ZA 4BIUA 1HNZB 4YJ3B 4I0XB 3CMAV 4X1IB 3EHBB 4B08A 1AR5A 2QWNB 2X0LA 4CBCA 3TETA 1QVGU 2EJ7A 2YSUB 3L73H 1LUWA 2Q68A 2MK3A 1BZKA 4YJ2A 2DQ3A 3A0BZ 1WN7A 4X64B 4JI8O 1P4RA 4O4LB 1SKVA 2A7WA 2WLMA 2JK5C 1MZEA 1MG1A 4UCOA 2FTKA 5KUKA 4UVCA 2Q73A 1QBZA 1S5JA 2E76B 3Q4HA 4O2BB 4HBNA 4H13B 2LGWA 3ASNB 1GH6A 2Y69B 4X1KB 3J81N 4UB8Z 3G6EV 1AVMA 1G6UA 1VQ4V 4X1YB 2ADPA 1S77D 2JJ1G 2YIBD 1AI5A 3RYFB 2C2AA 4DR5O 3OEEG 4YIOA 3IC7A 2DYSC 5CBGA 5TISZ 3UO3A 3W7UA 4XBFA 4KUMA 4LC1A 1K3EA 4D6TH 4JI8B 2WWWA 3D36C 3P3NA 1VARA 4DR6O 3IAYA 2WLNA 3HKCA 1SZTA 4YJ2B 2ITCC 3QVNA 1XNQB 1WJZA 5KMGA 3U10A 1M57C 2LFSA 4DV6B 1Q90D 3BEHA 5KUMA 3RFRA 4Q6GA 1F51A 2BCCH 5K1PA 1MSDA 4J11A 3Q4HB 1QLEB 3SPIA 1VF5B 3H01A 4TSFG 5FL7G 4DV3O 3SDLA 2KG7A 4DR5B 3ZRWB 1NJIW 5JCOA 3E22A 2IJIA 3CEIA 1PD3A 1B06A 1EM1A 2KKWA 3QG5A 1M90W 1Y74B 3KZIZ 2BSKB 1YZBA 1JJ2U 2K9PA 1PP9H 1U96A 2EIJB 4DR6B 2DYRC 4BWAA 3OMIB 5BZBA 1QHTA 1HR0O 5H2FZ 5KA5A 3A2FA 3AK3A 1VIBA 5LGUA 2QGNA 3K5LA 2AZ0A 2HEPA 5IJ9A 3HKCB 4UCTA 5H9CA 1SQFA 2IH3C 3T1YO 5KMGB 1WNSA 3ETQA 1NVPB 1BL8A 3ABKB 4XDKA 1D2DA 4O4HA 5F2VO 1JMKC 1NTZH 3K9SA 4DV3B 5LP6A 5KAIZ 1XQ8A 3K9AA 1M5IA 4LH7A 2P67A 4EFBA 2KG7B 2L35A 3JAMN 2XT9A 4LF5B 3E22B 4BR6A 4DR3O 4UCVA 3VQXA 1BT8A 2JEUA
chains in the Genus database with same CATH topology
2Z3YA 2XAQA 1XL6A 5IYBO 4HAMA 3LDCA 4OXSA 1JQ0A 3OMNB 4MVQA 3T2MA 5J9PC 1W0JG 3ASNC 4BW5A 4H33A 1YTFB 3ABTA 1VQ6V 4RQFA 2X6CA 3LDEA 2ZDIA 2Q67A 2KB1A 1K33A 3JD4A 5LGTA 1YI2V 2EBOA 4PDMA 1H8HG 1JCHA 1TUEB 1YJ9V 1PNLA 2B1GA 5H6QA 5L3CA 4UXNA 2IJHA 4G27B 4R8CA 1NKDA 4G2KA 4KP4A 3BY6A 4GX5A 3ZRXA 4JTAB 1AI6A 3B8NA 3CMEV 1DF5A 1BMFG 2A79B 1VQKV 4RO2A 2JIZG 2W0FC 1R73A 2OCCB 2P6JA 3E8GA 5CBFA 2ZQMA 4MW8A 3E8FA 1S76D 1VQPV 2QEXV 3CCVV 2HG5C 1P7BA 3OE7G 4Z1MG 2OTJV 2OT5A 4WFAV 5CN0A 4MVZA 3CC7V 1SESA 2NLJC 3CCEV 4FIPC 4MVSA 4PA4A 4PA7A 4WFEA 3SPGA 2V1DA 5EC2C 1W0KG 2JJ2G 3WFVA 1K73W 2DWDC 1NH2D 2OCCC 3B77A 3SPCA 4RUEA 2AHYA 4XDLA 1NR1A 2DQ0A 2A9HA 3MHSC 4DO2A 1WLEA 1Q81W 4N21A 3FYEB 3ABMB 3ABLB 3CCSV 4HZ3A 3UM7A 5L3BA 3T4ZA 4JF3A 1ENVA 3OM3B 4X8AA 1E1RG 2V7QG 5HFMA 3FKSG 3ZCCA 3K0DA 2XASA 3AG4B 1FXHA 3ETEA 3ZRSA 3OW2U 1DTOA 1G8MA 3TCUA 1S5HC 5IDJA 3JCZA 4QNHB 1LNQA 4MVOA 3ZN0A 1QCEA 5E1AC 4MTGA 1EFRG 2M7WA 3SJQC 4BAYA 3GWOA 2HLDG 3EFFK 1DLBA 2EINB 3OFNG 3ABMC 3ABLC 3ZMSA 1COWG 1OCRB 1ROPA 3T4DA 1AR1B 3SYCA 3QO7A 1AJQA 2Q69A 2ZDIC 3ASOB 4QIWF 3OMAB 3ZJZA 1JOYA 3AG4C 5IYDO 3ZRVA 1NQTA 3JD0A 4UUJC 1M1KW 4PDVA 2AHZA 1K97A 2P7TC 4WFHA 1J95A 2DW4A 3E89A 4LBEC 1VQOV 3FB6C 1THZA 4JASA 3CD6V 1K9MW 1JX9A 2QA4V 3P32A 4MW3A 4U7OA 2XOKG 4XDJA 3RVZA 1S72V 3K79A 4ASUG 2JDIG 1OCRC 4PELA 1PNKA 3F5WC 3OEHG 3AG2B 1W2BU 1K7DA 3K3WA 3ASOC 1RM1B 1JVMA 1FXKA 1MOFA 1MSWD 1S0VA 2EILB 3IFXA 1SETA 3MHHC 3W7SA 3HB3B 1QR9A 4H37A 5H6RA 3AG3B 1R3KC 4P2ZA 5HFLA 4U7NA 4I9WA 2BOBC 1KD1W 3CXCU 4JPRA 5B1NA 1F23A 1PKXA 1SRYA 2B5UA 3OGCC 1QR8A 2P90A 3FB7C 4MVMA 1K8AW 3AG2C 1OCZB 1BHAA 2LFRA 1N8RW 1DF4A 1RM1C 1UJWB 5DM6V 1JPXA 1YHQV 2EZPA 1EBOA 2EILC 4PA9A 1GM7A 4BIZA 3P30A 5EC1C 4RUFA 4ZBMA 2W6JG 3ZIAG 4MSWC 4P9PA 2GHYA 3OUSA 3ABUA 1RPRA 1Q82W 1YITV 2XAHA 2ZXWB 2Q6AA 3AG3C 3HPLC 3W7XA 2B1IA 3AG1B 1R3JC 4YXWG 2JEXA 4J9YB 1R3LC 3LSSA 1H2GA 4F4LA 1NVPD 4MVUA 1G4YB 1OCZC 4MTFA 2EZOA 3M99B 1VQ9V 2EIKB 3OUFA 4X88A 5B3SB 1Q7YW 3QO5A 2XAGA 1AJNA 3STLC 2LP7A 4MS2A 2XNDG 1L1FA 3VOUA 1OCOB 1V55B 2UXNA 5EBLC 2PI5A 2ZXWC 4P9OA 4UVAA 3W7WA 1BHBA 1F4MA 1CEZA 3AG1C 3JD3A 3RBZA 4ZKIA 4WFFA 2ATKC 4R50A 1FXKB 1Y4MA 4UV9A 3RVYA 2WLKA 1E79G 4G28B 3SPJA 5LHGA 5EK0A 3F7VC 2HJFC 3SYPA 3D36A 1RPOA 1YJNV 2EIKC 4FMTA 4MVRA 1M56B 5B3SC 5CA3A 4TT3G 2H8PC 1K92A 4UVBA 3CC2V 3LSQA 5L3EA 1GKFA 1K5QA 1ZWIC 1VQLV 3CP1A 5CMUA 2HKOA 3ZMTA 5B1BB 1OCOC 4QE7A 1V55C 4R6ZA 1K34A 4BIUA 4WCEV 1YTFD 1I5YA 4CZZA 1CPYA 3E8HA 4GT1A 1I5XA 1FXKC 4L87A 3CMAV 2W6IG 3EHBB 3LDDA 5LBQA 3CCRV 2IJKA 3CYOA 2WAMA 2X0LA 2BOCC 2EJRA 4N23A 4CBCA 2ZR2A 3TETA 1QVGU 1GK9A 1M56C 3ZMUA 2K1EA 2YSUB 3E83A 2Z5UA 2Q68A 3CCJV 2WSSG 2MK3A 1H8EG 1HWYA 1GTOA 2DQ3A 5B1BC 4LCUC 4JTDB 1OCCB 1Q86W 4MTXA 1P4RA 2R9IA 3E8BA 5DN6G 3IGAC 3AEIA 3JD1A 3T1CA 4QJFB 2WLMA 5IYCO 2JK5C 1MG1A 3JYCA 2EINC 5LHHA 2WLIA 2FTKA 3SYAA 2QM8A 5KUKA 3GB7C 2QKSA 4RAIA 4GX0A 3K08A 4UVCA 1KP3A 2ITDC 2OTLV 4QE9A 5EBWC 2ZD9A 1QBZA 2DYSB 3D3IA 3W7TA 3ZMZA 3DGEA 1S3JA 3ASNB 4P30A 1Y66A 4I5SA 4R7CA 1NH2B 1V54B 1OCCC 2Y69B 4JTCB 2A0LA 3G6EV 3FB8C 1R6NA 3KG2A 3SPHA 3G4SV 4WF9V 2X7RB 1VQ4V 3FB5C 5LGNA 2X6AA 1S77D 2JJ1G 1AI5A 1PL0A 1PNMA 3E86A 2C2AA 1YSCA 3OEEG 4PDRA 1MABG 2R9RB 3IC7A 4QPJA 1WPXA 1XL4A 2DYSC 4EKWA 4PA3A 5CBGA 2QTOA 1M57B 2HVJC 1AROP 3W7UA 4J9ZB 4XBFA 2XAFA 4Q20A 4HYOA 1FXVA 3PJSK 4KUMA 4LC1A 3RW0A 1K3EA 1V54C 2Y69C 1KP2A 2IW5A 4GX1A 1B6QA 3I55V 2WWWA 3MD0A 1CP9A 4RQEA 3LUTB 1AI7A 1R3IC 3ML0A 3ETDA 4DXWA 2WLNA 4TWKA 2QM7A 3NXSA 5B1OA 1SZTA 1VQMV 3A0RA 2ITCC 1KC8W 4WFBV 1M57C 2LFSA 2GSMB 2WLHA 1VQ7V 1KECA 4JAUA 3BEHA 3CCQV 1OHHG 2X6BA 5KUMA 3ZMVA 2IU0A 1QVFU 2WLIB 3ETGA 4UV8A 5GW7A 1VQNV 1F51A 1M9NA 2ZR3A 1K4DC 3I56V 5IY5B 4JYBA 2DYRB 1AJPA 1AI4A 1QLEB 3SPIA 2WLLB 1SERA 3LNMB 3H01A 4TSFG 5FL7G 1IXMA 3OR7C 2WPDG 4FPPA 4KFMA 2WLJA 2YEVA 5B1AB 3ZRWB 3K04A 3CPWU 1NJIW 1GO3F 3K0GA 3SYQA 2IJIA 1PD3A 4PDLA 4FJCC 1NR7A 3QNEA 3F7YC 2HFEC 1M90W 3G71V 3K06A 3UKMA 1JJ2U 3DTUB 2HVKC 1VQ8V 2H94A 4JYCA 5IY5C 2EIJB 2DYRC 3E35A 3OMIB 1QLEC 2F43G 4FK5C 5BZBA 5KA6A 1OZ0A 4PA6A 1FFTB 2QE7G 3OAAG 2IJJA 3K03A 1E1QG 5B1AC 3X2QB 1QLNA 3SYOA 3TK1A 3FYIB 5KA5A 5L3FA 3CCUV 2HR3A 5LGUA 3CCMV 2XAJA 4GCZA 1YJWV 1FS0G 1ORQC 5H9CA 2IU3A 2IH3C 4MT8A 1GM9A 2PI4A 1GM8A 1R6KA 2EIJC 4MTOA 2EIMB 3B8MA 4X89A 1NVPB 3R65A 1BL8A 3ABKB 4XDKA 5L3DA 5CBHA 1K4CC 4JAVA 3E2EA 3WG7B 2UXXA 3X2QC 1EZJA 3OR6C 5C93A 3CC4V 1YIJV 4E2LA 3CCLV 1KKDA 5EBMC 4WFGA 2DWEC 2IH1C 2D3OW 3JD2A 4QPKA 2WLLA 2Y48A 3K9AA 3STZC 3VBBA 1K5SA 2P67A 3QO8A 4GX2A 4JGSA 3ZRWA 3ZN1A 1F4NA 2EIMC 2YEVB 5LHIA 2NNUA 1H38A 1GMGA 1NBMG 3ABKC 1KQSU 1VQ5V 3WG7C 4LP8A 2CK3G 5L3GA 2JEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYC A;  2ITC C;  1XL6 A;  2EIK C;  4MVR A;  5B3S C;  3LDC A;  1M57 C;  2Q69 A;  4OXS A;  2H8P C;  3ZJZ A;  4MVQ A;  3AG4 C;  3T2M A;  2WLH A;  5J9P C;  3ASN C;  4BW5 A;  3BEH A;  1ZWI C;  4UUJ C;  2X6B A;  4PDV A;  2AHZ A;  5KUM A;  4H33 A;  2P7T C;  1OCO C;  4QE7 A;  1V55 C;  4R6Z A;  4WFH A;  2WLI B;  1J95 A;  4LBE C;  3E89 A;  2X6C A;  3FB6 C;  3LDE A;  2Q67 A;  2KB1 A;  3E8H A;  1K4D C;  4PDM A;  4MW3 A;  4XDJ A;  3RVZ A;  3LDD A;  3SPI A;  1OCR C;  2WLL B;  2BOC C;  3LNM B;  3F5W C;  4CBC A;  3OR7 C;  4G27 B;  4R8C A;  3TET A;  4KFM A;  1M56 C;  2WLJ A;  2YEV A;  2K1E A;  4GX5 A;  3K04 A;  3ASO C;  3E83 A;  1JVM A;  3K0G A;  2Q68 A;  4JTA B;  4LP8 A;  3SYQ A;  4PDL A;  3IFX A;  2A79 B;  5B1B C;  3F7Y C;  2HFE C;  4JTD B;  4LCU C;  3K06 A;  4RO2 A;  4H37 A;  3UKM A;  2W0F C;  3E8B A;  3IGA C;  2HVK C;  3E8G A;  5CBF A;  4P2Z A;  1R3K C;  4I9W A;  4MW8 A;  3T1C A;  2BOB C;  5IY5 C;  2WLM A;  2JK5 C;  2DYR C;  3E8F A;  1QLE C;  3JYC A;  2EIN C;  2HG5 C;  1P7B A;  2WLI A;  3OGC C;  3SYA A;  5BZB A;  5KUK A;  3FB7 C;  3GB7 C;  4PA6 A;  2QKS A;  4MVM A;  4GX0 A;  4RAI A;  3AG2 C;  3K08 A;  4TWK A;  5B1A C;  3K03 A;  4MVZ A;  2ITD C;  3SYO A;  4QE9 A;  2NLJ C;  5EBW C;  2ZD9 A;  4MVS A;  2EIL C;  4PA4 A;  4PA9 A;  4PA7 A;  4WFE A;  5EC1 C;  4RUF A;  4ZBM A;  3SPG A;  5EC2 C;  4P30 A;  4MSW C;  4P9P A;  4R7C A;  1OCC C;  4JTC B;  3OUS A;  2DWD C;  2A0L A;  3FB8 C;  3KG2 A;  3SPH A;  2OCC C;  1ORQ C;  2Q6A A;  3AG3 C;  3HPL C;  2IH3 C;  3FB5 C;  3SPC A;  4RUE A;  4XDL A;  2EIJ C;  1R3J C;  4MTO A;  4X89 A;  2X6A A;  2A9H A;  4J9Y B;  1R3L C;  3R65 A;  1BL8 A;  4XDK A;  5CBH A;  4F4L A;  4MVU A;  1K4C C;  3E86 A;  1G4Y B;  1OCZ C;  4MTF A;  4PDR A;  2R9R B;  3X2Q C;  3OR6 C;  4HZ3 A;  3UM7 A;  3T4Z A;  1XL4 A;  2DYS C;  4EKW A;  4PA3 A;  5CBG A;  2QTO A;  3OUF A;  4X8A A;  4WFG A;  4X88 A;  5EBM C;  1KKD A;  2HVJ C;  2DWE C;  2IH1 C;  3K0D A;  3ZRS A;  4J9Z B;  3TCU A;  4HYO A;  2WLL A;  3PJS K;  1S5H C;  3RW0 A;  3STL C;  1V54 C;  3STZ C;  2Y69 C;  4MS2 A;  4GX1 A;  3VOU A;  4GX2 A;  4QNH B;  1LNQ A;  5EBL C;  2ZXW C;  4P9O A;  4MVO A;  5E1A C;  3AG1 C;  4MTG A;  2EIM C;  3RBZ A;  4WFF A;  2ATK C;  3SJQ C;  3LUT B;  4R50 A;  1R3I C;  3ABK C;  3EFF K;  2WLK A;  3RVY A;  4G28 B;  3SPJ A;  4DXW A;  3ABM C;  3F7V C;  2WLN A;  5EK0 A;  3WG7 C;  3ABL C;  2AHY A;  2HJF C;  3SYP A;  3T4D A; 
#chains in the Genus database with same CATH topology
 2RDC A;  5IYB O;  3LDC A;  2QWP B;  1HR0 B;  1JQ0 A;  1XRE A;  3OMN B;  2YUA A;  5J9P C;  1W0J G;  3ASN C;  3IJ4 A;  4TV9 A;  1NT2 B;  3RYI A;  2FL4 A;  1FD9 A;  2ZDI A;  2PTM A;  2Q67 A;  5LGT A;  4GKJ B;  4NVP A;  5KAF Z;  4J7J A;  3H1I H;  1JCH A;  3T1Y B;  1VF7 A;  1YJ9 V;  1PNL A;  4FVM A;  5LA6 B;  5K1X A;  3SJC C;  4G27 B;  1NKD A;  2BTO A;  4U3F H;  1DF5 A;  3VQW A;  2F93 B;  1BMF G;  3GWK C;  2G38 A;  1VQK V;  2JIZ G;  5CBF A;  2LGQ A;  4MW8 A;  5LXT A;  5C8Y A;  2P4K A;  3CWB H;  2QEX V;  5J2T B;  3CCV V;  2HG5 C;  1P7B A;  3OE7 G;  4Z1M G;  4DR3 B;  2OTJ V;  4ZI7 A;  1HDJ A;  4WFA V;  1BQ0 A;  5KLV H;  4PA7 A;  3VQV A;  2V1D A;  2YIC A;  3JAS B;  1K73 W;  1JJO A;  5IT9 N;  2VQF O;  3CRM A;  2QKC A;  1YXB A;  3MHS C;  5BXZ A;  4DO2 A;  4X20 A;  2FKX A;  2UU9 B;  2FML A;  4FLZ A;  3UM7 A;  5L3B A;  4FM1 A;  1TUB A;  4JF3 A;  5HFM A;  3SJA C;  1G8M A;  3TCU A;  2E75 B;  4AIL C;  4DW1 A;  2RJZ A;  1SF9 A;  1XNR O;  3JAK A;  2ZIM A;  2M7W A;  2M6Y A;  1VMG A;  3EFF K;  4ZHQ A;  2CTQ A;  4LF7 O;  1AR1 B;  3T4D A;  5IYZ A;  4TV8 A;  4QIW F;  2L6L A;  3N2G A;  5IYD O;  4IT5 A;  5GTI Z;  3ICX A;  2CUG A;  4NTW A;  3J80 N;  1XI1 A;  2DW4 A;  2N04 A;  1VQO V;  4DV0 O;  4JAS A;  2VQF B;  2CGO A;  2YC0 A;  1YVW A;  4U7O A;  4XDJ A;  3RVZ A;  5CA1 A;  3RT3 C;  1R6T A;  1N0N A;  1OCR C;  1PNK A;  3OEH G;  5BMV B;  5GTH Z;  2E5L O;  3AK1 A;  1MSW D;  1S0V A;  1HW7 A;  4DV2 O;  3IFX A;  2AW9 A;  3GVM A;  4FFB A;  4KL1 A;  3L74 H;  4X20 B;  3HB3 B;  2Q8V A;  1QR9 A;  1XNR B;  1Z5W A;  4I9W A;  4TOI A;  5IJ0 A;  2HP8 A;  1PL4 A;  4JPR A;  2B5U A;  1SRY A;  4RWU A;  3FB7 C;  3C90 A;  1K8A W;  4LF7 B;  1N8R W;  1DF4 A;  1AP5 A;  1JPX A;  2EZP A;  3G80 A;  3P30 A;  3MAQ A;  4MSW C;  4NB5 A;  5LL6 Y;  3OUS A;  4ZHQ B;  3ABU A;  2PYJ A;  1Q82 W;  1YIT V;  2Q6A A;  2CAZ C;  3AG3 C;  5IYZ B;  3W7X A;  4DV0 B;  2B1I A;  4F6E A;  1Q6U A;  4TV8 B;  4YXW G;  2YID A;  2JEX A;  5B5E Z;  4LFA O;  3EXA A;  1DGS A;  2EIK B;  4I4T A;  1HNW O;  1L0N H;  2E5L B;  2Q7G A;  4OGQ B;  5CA1 B;  4DV2 B;  4FZ1 A;  3VOU A;  1BHB A;  2UXN A;  2EX3 A;  4WFF A;  5EYP A;  2DMX A;  2WLK A;  4G28 B;  3SPJ A;  1SQQ H;  3BAA A;  1AIL A;  3D36 A;  2JS5 A;  4FFB B;  4FZ0 A;  1J5E B;  3RWR D;  2YXL A;  5L3E A;  1K5Q A;  1ZWI C;  2CDY A;  1VQL V;  3ZMT A;  1QQC A;  4QE7 A;  1V55 C;  2VRZ A;  4IYI A;  2HHH B;  2CH7 B;  1YTF D;  1JA8 A;  4CZZ A;  5ITZ A;  3E8H A;  1I5X A;  5LBQ A;  2BE3 A;  1Q6I A;  4N23 A;  2QKA A;  4LFA B;  1GK9 A;  2K1E A;  4K0K O;  2Z5U A;  3D8C A;  3P3P A;  3DXR A;  4D7S A;  1L0L H;  1HNW B;  2HJD A;  1YF2 A;  1HWY A;  1GTO A;  4LCU C;  4UCR A;  4MTX A;  5EIB D;  1URF A;  1WB7 A;  3HKB B;  2JGU A;  4I4T B;  4LFB O;  5LOV A;  5D5P A;  2RNB A;  2ZE7 A;  3K5M A;  1KP3 A;  3HKE A;  2ZD9 A;  2DYS B;  3DGE A;  3M7M X;  1Y66 A;  2Y4U A;  4R7C A;  1OCC C;  4JTC B;  3KG2 A;  2X7R B;  5LGN A;  2FYU H;  3G6B A;  4UCU A;  3G67 A;  4E4E A;  2F23 A;  1SZX A;  1WPX A;  2B9Z A;  4PA3 A;  2QTO A;  1M57 B;  1N33 O;  4DV5 B;  4K0K B;  4X1I A;  5ITZ B;  4J9Z B;  4Q20 A;  4HYO A;  3PJS K;  1YDX A;  2IW5 A;  2AZ2 A;  4JZG A;  2VS0 A;  1R3I C;  3N27 A;  3OTO O;  3DXR B;  4DXW A;  4LFB B;  4TWK A;  2EUL A;  3A0R A;  1KC8 W;  1BS3 A;  1W59 A;  2P06 A;  4Z1V A;  2WLH A;  5DED A;  4JAU A;  2Q4P A;  2IU0 A;  1NI8 A;  5GW7 A;  5LOV B;  1VQN V;  2CGN A;  1MNG A;  3SR2 C;  1MMM A;  1M9N A;  4AQY B;  2DYR B;  1AJP A;  1AI4 A;  2WLL B;  1SER A;  3LNM B;  1IXM A;  3K04 A;  2IBZ H;  1GO3 F;  1RSO A;  4H44 B;  4B7K A;  1N33 B;  3LNN A;  1Q5O A;  1NR7 A;  1JR9 A;  3M8A A;  3F7Y C;  1PM9 A;  2ZIN A;  3THO A;  3BVO A;  4J41 A;  4NXM B;  3D3Q A;  1ZAU A;  5IY5 C;  3E35 A;  3OTO B;  3ZS8 C;  5B1A C;  2UUC O;  3CJH A;  4JZ2 A;  3FD9 A;  3UO2 A;  1BQZ A;  4O2A A;  4CH6 A;  1MA1 A;  3FX7 A;  1XEQ A;  3ZX6 A;  4K8Z A;  2CTP A;  3CX5 F;  1ORQ C;  4JI0 O;  2PI4 A;  4X66 B;  3BPZ A;  3R65 A;  1EZJ A;  1H2M A;  3OR6 C;  5C93 A;  1YIJ V;  4E2L A;  2QJ1 A;  5EBM C;  1YCI A;  1ZX3 A;  1B04 A;  3ZHS A;  2D3O W;  3STZ C;  1AB3 A;  1K5S A;  3I5D A;  1BCC H;  4CH5 A;  3ZRW A;  3OTF A;  2EIM C;  4JI7 O;  2NNU A;  1H38 A;  4CC6 A;  4FLY A;  1RSO B;  1NBM G;  3DC6 A;  3WG7 C;  1Y74 A;  4X9Q A;  1T5E A;  2BSK A;  1I94 O;  3S3X A;  2UUC B;  4CH4 A;  4OXS A;  4B3S O;  4MVQ A;  3T2M A;  1RFY A;  1BE3 H;  1NS1 A;  4WBN A;  3ABT A;  1VQ6 V;  1DK1 A;  3VQY A;  1N0J A;  2X6C A;  2H3O A;  3HKD A;  4PDM A;  4JI0 B;  3CJH B;  4NTY A;  3KKY A;  3L72 H;  4O2A B;  2B1G A;  2KSD A;  4UXN A;  4R8C A;  4G2K A;  2P22 C;  4KP4 A;  3BY6 A;  1M4U A;  4DV1 O;  3JAL A;  3ZHQ A;  3SJB C;  4JTA B;  1FPO A;  3B8N A;  3CME V;  4DW0 A;  4PD4 F;  1Z2G A;  2A06 H;  3CRC A;  1X59 A;  2ARH A;  2PZS A;  1WP7 A;  1S76 D;  2OIG A;  3B09 A;  4MVZ A;  5FPR A;  3CC7 V;  1ZTE A;  1I94 B;  4JI3 O;  4ZOL A;  1A32 A;  4B3S B;  1XBL A;  1GAX A;  5EC2 C;  1KUQ A;  4JV5 O;  3WFV A;  3N2K B;  4H0L B;  1XMO O;  2OCC C;  3B77 A;  3SPC A;  2DQ0 A;  2A9H A;  2RCV A;  1Q81 W;  4YHH O;  4WBN B;  1Z5V A;  1KB9 F;  1SS3 A;  3K59 A;  4DV1 B;  3T1H O;  3K0D A;  3OW2 U;  3L75 H;  1DTO A;  5LA6 A;  2KQX A;  1S5H C;  3HKD B;  4JAA A;  2YS8 A;  4QNH B;  1HNX O;  2BTQ B;  3ZN0 A;  2Q7H A;  4MTG A;  1OJH A;  3SJQ C;  3JAL B;  1Q6H A;  2QM4 A;  1DLB A;  3ABM C;  4GYC B;  3ABL C;  1OCR B;  1ROP A;  5FPO A;  3BCC H;  3SYC A;  1XMQ O;  1AJQ A;  4K35 A;  3O9O A;  4CS2 A;  1JOY A;  3AG4 C;  5J2T A;  4JI3 B;  3ZRV A;  1NQT A;  4UUJ C;  4JV5 B;  4CC5 A;  1FKA O;  2UXC O;  4WFH A;  3FB6 C;  1XMO B;  3CD6 V;  5EZY A;  1N36 O;  1FYJ A;  1G1X B;  4Z2W A;  2N05 A;  4MW3 A;  1S72 V;  4ZOL B;  3JAS A;  2F1M A;  2ZE6 A;  4YHH B;  5KHI A;  4GKK O;  2QWR B;  3KCX A;  3T1H B;  5KX5 B;  2PUS A;  4CS3 A;  4I9Q A;  2NR5 A;  3MHH C;  2W0X A;  3W7S A;  2R9A A;  1HNX B;  3AG3 B;  4U7N A;  4GUN A;  2F95 B;  3BA9 A;  1KD1 W;  3CXC U;  5B1N A;  1PKX A;  3OGC C;  2IM9 A;  2AGA A;  1IBM O;  4MVM A;  2OWO A;  2LW7 A;  1BHA A;  1XMQ B;  1YHQ V;  1XOU A;  2E74 B;  1GM7 A;  3UCS C;  3CS5 A;  2W6J G;  4OPH A;  2JRI A;  4PJ0 Z;  2GHY A;  3WB1 A;  2UXC B;  3HPL C;  3L71 H;  4J42 A;  4J9Y B;  1N36 B;  1KYO F;  4IL6 Z;  1NVP D;  1G4Y B;  1OCZ C;  1VF6 A;  2EZO A;  4DR4 O;  3JCU Z;  3R66 A;  4GKK B;  4X88 A;  1Q7Y W;  3ZHV A;  3QO5 A;  5EZY B;  2GV9 A;  3STL C;  2LP7 A;  4MS2 A;  5BMV A;  1F7Y A;  1V55 B;  5EBL C;  2ZXW C;  4P9O A;  4UVA A;  3W7W A;  4ZKI A;  2ZIO A;  4A5U B;  2MW2 B;  1IBM B;  5B3S C;  5CA3 A;  3SGI A;  1ZL8 A;  1GKF A;  4QGP A;  3WB0 A;  3U0Z A;  1K34 A;  1LUV A;  3K5N A;  2LO1 A;  4GT1 A;  1FXK C;  2W6I G;  5LYJ A;  3LDD A;  2IJK A;  2WAM A;  2PF4 E;  5IE9 A;  2EJR A;  1M56 C;  3NR7 A;  3ZMU A;  4DR4 B;  3CCJ V;  4ICG A;  3JSN A;  4JTD B;  1OCC B;  1Q86 W;  4TUY B;  2R9I A;  5CA0 A;  4FM2 A;  3E8B A;  3AEI A;  3T1C A;  4QJF B;  3SYA A;  2QM8 A;  3GB7 C;  2QKS A;  2YI9 A;  4J7K A;  3K08 A;  2ITD C;  2OTL V;  4QE9 A;  4BW9 A;  3W7T A;  1WP8 A;  3ZMZ A;  4EEQ A;  1H2S B;  1EN4 A;  5JJN B;  4I5S A;  2WA3 A;  5BR8 O;  1NH2 B;  2E3C A;  2A0L A;  3OT7 A;  3FB8 C;  1R6N A;  1JFF B;  3SPH A;  3G4S V;  3FB5 C;  3S3W A;  2GTA A;  1ZL8 B;  2F4V O;  1PL0 A;  1PNM A;  2RN9 A;  3E86 A;  2CH7 A;  1Y76 A;  3RN4 A;  4LR3 A;  4QPJ A;  2CTR A;  4EKW A;  1ARO P;  3H1H H;  2VQE O;  1FXV A;  3RW0 A;  3TXS A;  1V54 C;  5LYJ B;  4GX1 A;  1B3Q A;  5JJJ B;  2ZNJ A;  3I55 V;  5FNV A;  2Q5Z A;  3L9D A;  4JI2 O;  3ML0 A;  3ETD A;  3NXS A;  5B1O A;  1VQM V;  5KHG A;  3HKB A;  5CA0 B;  2GSM B;  3BFR A;  3BRC A;  3CCQ V;  2X6B A;  2ZE5 A;  3ZMV A;  5BR8 B;  4UV8 A;  4KHP O;  4I55 A;  2ZR3 A;  5IY5 B;  2GUZ A;  2F4V B;  2ZT9 B;  2WPD G;  3OR7 C;  1P49 A;  4KFM A;  3RYC A;  2WLJ A;  2YEV A;  5B1A B;  3K0G A;  4PDL A;  2XTA A;  3QNE A;  2VQE B;  4JI4 O;  3WB2 A;  1AP6 A;  4X65 O;  1D5A A;  3UKM A;  1IZ3 A;  1Y76 B;  5A9G A;  3DTU B;  2HVK C;  1VQ8 V;  2H94 A;  5KHH A;  5LP6 C;  2F43 G;  4HNA A;  4JI2 B;  1FFT B;  3OAA G;  3K03 A;  1E1Q G;  3SYO A;  3JAW A;  3FYI B;  5FNV B;  3CCU V;  4LF6 O;  3OGI B;  1PPJ H;  4DUY O;  3CCM V;  5JQG B;  2XAJ A;  4GCZ A;  2GDS A;  1YJW V;  1FS0 G;  5H5N A;  2IU3 A;  4KHP B;  1GM9 A;  2Z0A A;  1GM8 A;  1R6K A;  2EIM B;  3B8M A;  4B3T O;  2RMK B;  5CBH A;  1RP3 B;  3CB2 A;  4NKG B;  3WG7 B;  2UXX A;  3X2Q C;  3CC4 V;  1IBK O;  3CCL V;  1KKD A;  2PGG A;  4WFG A;  2F66 C;  3H1J H;  1SQB H;  2DWE C;  4I55 B;  3JD2 A;  4QPK A;  2WLL A;  2Y48 A;  1P84 F;  3L70 H;  3VBB A;  3QO8 A;  1Q3E A;  2GUZ B;  4JGS A;  1AR4 A;  4X65 B;  3RYC B;  1GRJ A;  4PI0 A;  2YEV B;  4YY3 O;  1GMG A;  4IHJ B;  3EVK A;  2ADQ B;  3CRQ A;  1VQ5 V;  1GN6 A;  2AHY A;  4TQD A;  5L3G A;  2Z3Y A;  4IIJ A;  1XL6 A;  2YDE A;  2YIB A;  1NTK H;  3A8T A;  1H2L A;  4BW5 A;  4AI8 A;  4LF6 B;  4DUY B;  4H33 A;  4HNA B;  4RQF A;  3DC5 A;  1YI2 V;  3JAW B;  2UUA O;  1TUE B;  4B3T B;  5L3C A;  2IJH A;  4GX5 A;  1EZV H;  5E79 Z;  3ZRX A;  4W4L A;  3TXQ A;  4GLX A;  1AI6 A;  3B4S A;  4UB6 Z;  4RO2 A;  2W0F C;  2OCC B;  2ZQM A;  3E8F A;  2RQ6 A;  1VQP V;  3WU2 Z;  5A2Q N;  1IXB A;  2OT5 A;  1UFI A;  1L8D A;  3B40 A;  5AG2 A;  5CN0 A;  3SPG A;  2JJ2 G;  5EIB C;  1TAE A;  3CRA A;  1XHX A;  2Y0P A;  1IUR A;  4IIJ B;  2N74 A;  4B7E A;  4N21 A;  4ZIB A;  3ABM B;  3ABL B;  2NN4 A;  3H1K H;  3OM3 B;  4X8A A;  2V7Q G;  3FAV A;  4DYL A;  2XAS A;  3AG4 B;  3ETE A;  5JVD A;  3BHP A;  4PHZ A;  1SA0 B;  4LWS B;  1QCE A;  5E1A C;  2WA4 A;  1LR1 A;  4BAY A;  3GWO A;  2HLD G;  2QDO A;  2P5O A;  2EIN B;  1NZ6 A;  1XDC A;  3QO7 A;  1FAF A;  1ZUQ A;  4FM0 A;  2QR4 A;  3PN1 A;  4PDV A;  1WA8 B;  2P7T C;  1J95 A;  2XHB A;  1H2N A;  2DE0 X;  1JX9 A;  2QA4 V;  3K79 A;  3N2K A;  2JDI G;  1XNQ O;  2D2C B;  3F5W C;  3LSU A;  1N34 O;  4DV6 O;  3ZHT A;  1WB8 A;  1W2B U;  1KBH A;  1K7D A;  3ASO C;  1MOF A;  1FXK A;  3APQ A;  5KHK A;  5KHJ A;  1EN6 A;  4J80 A;  1SET A;  1N4C A;  2Q0O C;  4H37 A;  5H6R A;  1R3K C;  5HFL A;  2BOB C;  3FAV B;  5JVD B;  1QR8 A;  2P90 A;  4YIP A;  3AG2 C;  1OCZ B;  2LFR A;  2BTQ A;  2Q7E A;  1RM1 C;  4DV4 O;  5DM6 V;  2R70 A;  1EBO A;  2YXH A;  2EIL C;  4BIZ A;  4ZBM A;  4RUF A;  2QTS A;  4P9P A;  4DR2 O;  3C3S A;  1S5L Z;  1RPR A;  4IGG A;  2ZXW B;  2P4V A;  1R3L C;  3LSS A;  2FB5 A;  4JI7 B;  1H2G A;  4F4L A;  4MVU A;  2GTS A;  4U3J A;  3A0H Z;  1VQ9 V;  1N34 B;  3OUF A;  5B3S B;  2ETN A;  4LNU A;  1AJN A;  1NTM H;  2CTW A;  4B3R O;  1Y6X A;  1SQX H;  5JWP A;  1O9G A;  4DK0 A;  2R72 A;  2Q0A A;  3JAT A;  1CEZ A;  3AG1 C;  3JD3 A;  2YIA A;  5KX5 A;  4R50 A;  1FXK B;  2QSA A;  3RVY A;  1E79 G;  5LHG A;  2ZM6 O;  5FLX N;  2HJF C;  3SYP A;  1RPO A;  1GN3 A;  4FMT A;  4MVR A;  1M56 B;  4GZR B;  3B2E E;  4TT3 G;  4DV4 B;  1K92 A;  1TGO A;  3LSQ A;  5CMU A;  1XHZ A;  4NXN O;  4LF8 O;  1OCO C;  4WCE V;  4DR2 B;  1I5Y A;  4LF5 O;  1CPY A;  2VWJ A;  4L87 A;  1IX9 A;  3CCR V;  3CYO A;  2DN9 A;  2BOC C;  4F6R A;  2ZR2 A;  1D5N A;  3HR0 A;  3E83 A;  2WSS G;  3QF7 A;  1H8E G;  3CXH F;  5B1B C;  4GKJ O;  2GBO A;  4B3R B;  1H2K A;  4U3J B;  1OV9 A;  5DN6 G;  4UCS A;  3IGA C;  3JD1 A;  5LMU O;  5IYC O;  3JYC A;  2EIN C;  4LNU B;  2WLI A;  5LHH A;  2ZM6 B;  4RAI A;  4GX0 A;  2UXD O;  5EBW C;  2Y4T A;  3D3I A;  5LMN O;  3JAT B;  1S3J A;  4P30 A;  4TQF A;  3RGB A;  1V54 B;  4NXN B;  4LF8 B;  2Y0I A;  4WF9 V;  4FLW A;  2X6A A;  3F5T A;  2ZE8 A;  1YEW A;  1YSC A;  4NYK A;  2ZKO A;  4PDR A;  4LF4 O;  1MAB G;  2R9R B;  1XL4 A;  2ILM A;  2HVJ C;  2XAF A;  1ZLZ A;  1I7F A;  2Y69 C;  1KP2 A;  4FFK A;  1B6Q A;  3MD0 A;  1CP9 A;  4F6R B;  4RQE A;  1Q8I A;  2CE4 A;  3LUT B;  1AI7 A;  1CXZ B;  2LJ2 A;  5LMU B;  2UU9 O;  4OX9 O;  2QM7 A;  4TUY A;  5IJ9 B;  1GN2 A;  4WFB V;  1EN5 A;  3K58 A;  2UXD B;  3ZED A;  5LMN B;  1VQ7 V;  3H9V A;  1KEC A;  3FFQ A;  1OHH G;  1NU1 H;  1QVF U;  2WLI B;  3TJT A;  3ETG A;  3QTC A;  4O4H B;  4UFZ A;  1U97 A;  1K4D C;  3I56 V;  2QWO B;  5LP6 B;  4JYB A;  2UUB O;  1JFF A;  4FPP A;  2ODM A;  3K5O A;  4LF4 B;  3CPW U;  3SYQ A;  4FJC C;  2PYL A;  4NTX A;  2HFE C;  4LF9 O;  1V9P A;  3K06 A;  3G71 V;  4W4K A;  4JYC A;  3AK2 A;  1QLE C;  4FK5 C;  1SC5 B;  5JH7 A;  5KA6 A;  1OZ0 A;  4PA6 A;  4OX9 B;  4TV9 B;  2QE7 G;  1M93 A;  2IJJ A;  3RYI B;  5B66 Z;  4J7Z A;  3X2Q B;  1IVS A;  1QLN A;  4D7T A;  3TK1 A;  5L3F A;  1SQP H;  2HR3 A;  5BY1 A;  1KKC A;  4FLT A;  1KMI Z;  3RYH A;  4MT8 A;  4CS4 A;  2JVD A;  4DUZ O;  2EIJ C;  4MTO A;  4X89 A;  5L3D A;  1K4C C;  4JAV A;  1IBL O;  3E2E A;  2UUB B;  5CB4 A;  2LW1 A;  3BA8 A;  1I0H A;  2IH1 C;  5IWA O;  5LXT B;  5C8Y B;  4PV1 B;  1QU7 A;  4L8J A;  3CSX A;  2O57 A;  4GX2 A;  2V4D A;  1WAZ A;  4EFE A;  4ZI7 B;  3ZN1 A;  4LF9 B;  1F4N A;  1PV0 A;  4I50 A;  4JI6 O;  5LHI A;  1BGY H;  3ABK C;  1KQS U;  4LP8 A;  2CK3 G;  2PY5 A;  2XAQ A;  4HAM A;  4PI2 A;  1N32 O;  4C7U A;  3JAR A;  4DR7 O;  1YTF B;  1IDS A;  2JS3 A;  5JH7 B;  2VWK A;  3LDE A;  2KB1 A;  1K33 A;  3JD4 A;  1TUB B;  1XIL A;  2EBO A;  5JCO C;  1H8H G;  4DUZ B;  5JQG A;  1J5E O;  5H6Q A;  1SQG A;  3ZBH A;  3C3T A;  1IBL B;  5DEC A;  3JAK B;  3RYH B;  5IWA B;  2HHH O;  2A79 B;  1R1B A;  4NR1 A;  4FLU A;  1R73 A;  5CB4 B;  2P6J A;  3E8G A;  4LFC O;  1VP7 A;  3APO A;  3N2G B;  4JI6 B;  2QWQ B;  1QNM A;  3KCY A;  4FLV A;  4FLX A;  1SES A;  2NLJ C;  2LQT A;  3CCE V;  3J7A U;  4FIP C;  4MVS A;  4PA4 A;  4BIO A;  2XUM A;  4KXR A;  4WFE A;  4IHJ A;  1N32 B;  4I50 B;  1W0K G;  4AHC A;  3UT5 A;  4DR7 B;  5J2U A;  4J10 A;  2DWD C;  3MDS A;  3ZHU A;  1Y67 A;  2JGD A;  1NH2 D;  1GN4 A;  1TVK A;  1P7G A;  4RUE A;  1MZF A;  4XDL A;  1NR1 A;  1WLE A;  4OPA A;  1FFX A;  2DOS A;  3JAR B;  2OYQ A;  3FYE B;  4O4I A;  3U11 A;  3CCS V;  4HZ3 A;  3T4Z A;  4O4J A;  1ENV A;  2AXT Z;  1E1R G;  3FKS G;  3ZCC A;  3ZRS A;  1FXH A;  5IJ0 B;  4DRX A;  5IDJ A;  3JCZ A;  1LNQ A;  1HP8 A;  4MVO A;  1EFR G;  4LFC B;  5GON A;  4JI5 O;  3OFN G;  3ZHR A;  5JJE B;  3ZMS A;  1COW G;  4DV5 O;  4I7Z B;  2Q69 A;  2ZDI C;  3ASO B;  3OMA B;  3ZJZ A;  4DK1 A;  4EB6 A;  4JI1 O;  3JD0 A;  1M1K W;  2OIE A;  4JYA O;  2AHZ A;  1K97 A;  1VEW A;  3E89 A;  4LBE C;  1THZ A;  4JI4 B;  1FJG O;  1K9M W;  3BAB A;  3P32 A;  2XOK G;  1BSM A;  4ASU G;  4PEL A;  3UT5 B;  4DR1 O;  3AG2 B;  5J2U B;  2UXB O;  3AG7 A;  3K3W A;  1RM1 B;  1JVM A;  2JGD B;  2Q9L A;  2EIL B;  1TVK B;  5EYP B;  2ZNI A;  4K3A A;  1XUQ A;  1FFX B;  1VF6 C;  4O4I B;  4CH3 A;  1Q43 A;  4AQY O;  4P2Z A;  3TGU H;  4O4J B;  4B3M O;  1F23 A;  4YJ3 A;  4K8X A;  4JI5 B;  1SA0 A;  1WPB A;  2A3Q A;  3UQ8 A;  3O65 A;  4LWS A;  4DRX B;  4DV7 O;  1O9H A;  4I0X A;  1UJW B;  4X62 O;  4PA9 A;  4LH6 A;  5EC1 C;  1IBK B;  3ZIA G;  1HNZ O;  4JI1 B;  5GON B;  4JYA B;  1ZSP A;  4NXM O;  2OCH A;  3IC9 A;  3DSQ A;  2XAH A;  1FJG B;  3AG1 B;  1R3J C;  2YI8 A;  4EB6 B;  4YY3 B;  1WA8 A;  3CHX A;  4O4L A;  4MTF A;  3M99 B;  4DR1 B;  1I08 A;  2UXB B;  1KU9 A;  4X64 O;  1SQV H;  2XAG A;  1UPG A;  2XND G;  1L1F A;  1OCO B;  2PI5 A;  4X66 O;  3CRR A;  4O2B A;  1F4M A;  1X4T A;  3HKE B;  3RBZ A;  5D5Q A;  2ATK C;  4ABM A;  3CE2 A;  1Y4M A;  4UV9 A;  1US6 A;  4X1K A;  5EK0 A;  3F7V C;  4B3M B;  2DJV A;  2UUA B;  4X1Y A;  1YJN V;  2EIK C;  3OD4 A;  4DV7 B;  4JYY A;  2H8P C;  3JSL A;  4UVB A;  1TA8 A;  3CC2 V;  4X62 B;  3RYF A;  3K57 A;  3CP1 A;  2HKO A;  4IYH A;  5B1B B;  2YXY A;  2ZCE A;  3H1L H;  4R6Z A;  4BIU A;  1HNZ B;  4YJ3 B;  4I0X B;  3CMA V;  4X1I B;  3EHB B;  4B08 A;  1AR5 A;  2QWN B;  2X0L A;  4CBC A;  3TET A;  1QVG U;  2EJ7 A;  2YSU B;  3L73 H;  1LUW A;  2Q68 A;  2MK3 A;  1BZK A;  4YJ2 A;  2DQ3 A;  3A0B Z;  1WN7 A;  4X64 B;  4JI8 O;  1P4R A;  4O4L B;  1SKV A;  2A7W A;  2WLM A;  2JK5 C;  1MZE A;  1MG1 A;  4UCO A;  2FTK A;  5KUK A;  4UVC A;  2Q73 A;  1QBZ A;  1S5J A;  2E76 B;  3Q4H A;  4O2B B;  4HBN A;  4H13 B;  2LGW A;  3ASN B;  1GH6 A;  2Y69 B;  4X1K B;  3J81 N;  4UB8 Z;  3G6E V;  1AVM A;  1G6U A;  1VQ4 V;  4X1Y B;  2ADP A;  1S77 D;  2JJ1 G;  2YIB D;  1AI5 A;  3RYF B;  2C2A A;  4DR5 O;  3OEE G;  4YIO A;  3IC7 A;  2DYS C;  5CBG A;  5TIS Z;  3UO3 A;  3W7U A;  4XBF A;  4KUM A;  4LC1 A;  1K3E A;  4D6T H;  4JI8 B;  2WWW A;  3D36 C;  3P3N A;  1VAR A;  4DR6 O;  3IAY A;  2WLN A;  3HKC A;  1SZT A;  4YJ2 B;  2ITC C;  3QVN A;  1XNQ B;  1WJZ A;  5KMG A;  3U10 A;  1M57 C;  2LFS A;  4DV6 B;  1Q90 D;  3BEH A;  5KUM A;  3RFR A;  4Q6G A;  1F51 A;  2BCC H;  5K1P A;  1MSD A;  4J11 A;  3Q4H B;  1QLE B;  3SPI A;  1VF5 B;  3H01 A;  4TSF G;  5FL7 G;  4DV3 O;  3SDL A;  2KG7 A;  4DR5 B;  3ZRW B;  1NJI W;  5JCO A;  3E22 A;  2IJI A;  3CEI A;  1PD3 A;  1B06 A;  1EM1 A;  2KKW A;  3QG5 A;  1M90 W;  1Y74 B;  3KZI Z;  2BSK B;  1YZB A;  1JJ2 U;  2K9P A;  1PP9 H;  1U96 A;  2EIJ B;  4DR6 B;  2DYR C;  4BWA A;  3OMI B;  5BZB A;  1QHT A;  1HR0 O;  5H2F Z;  5KA5 A;  3A2F A;  3AK3 A;  1VIB A;  5LGU A;  2QGN A;  3K5L A;  2AZ0 A;  2HEP A;  5IJ9 A;  3HKC B;  4UCT A;  5H9C A;  1SQF A;  2IH3 C;  3T1Y O;  5KMG B;  1WNS A;  3ETQ A;  1NVP B;  1BL8 A;  3ABK B;  4XDK A;  1D2D A;  4O4H A;  5F2V O;  1JMK C;  1NTZ H;  3K9S A;  4DV3 B;  5LP6 A;  5KAI Z;  1XQ8 A;  3K9A A;  1M5I A;  4LH7 A;  2P67 A;  4EFB A;  2KG7 B;  2L35 A;  3JAM N;  2XT9 A;  4LF5 B;  3E22 B;  4BR6 A;  4DR3 O;  4UCV A;  3VQX A;  1BT8 A;  2JEU A; 
#chains in the Genus database with same CATH homology
 2Z3Y A;  2XAQ A;  1XL6 A;  5IYB O;  4HAM A;  3LDC A;  4OXS A;  1JQ0 A;  3OMN B;  4MVQ A;  3T2M A;  5J9P C;  1W0J G;  3ASN C;  4BW5 A;  4H33 A;  1YTF B;  3ABT A;  1VQ6 V;  4RQF A;  2X6C A;  3LDE A;  2ZDI A;  2Q67 A;  2KB1 A;  1K33 A;  3JD4 A;  5LGT A;  1YI2 V;  2EBO A;  4PDM A;  1H8H G;  1JCH A;  1TUE B;  1YJ9 V;  1PNL A;  2B1G A;  5H6Q A;  5L3C A;  4UXN A;  2IJH A;  4G27 B;  4R8C A;  1NKD A;  4G2K A;  4KP4 A;  3BY6 A;  4GX5 A;  3ZRX A;  4JTA B;  1AI6 A;  3B8N A;  3CME V;  1DF5 A;  1BMF G;  2A79 B;  1VQK V;  4RO2 A;  2JIZ G;  2W0F C;  1R73 A;  2OCC B;  2P6J A;  3E8G A;  5CBF A;  2ZQM A;  4MW8 A;  3E8F A;  1S76 D;  1VQP V;  2QEX V;  3CCV V;  2HG5 C;  1P7B A;  3OE7 G;  4Z1M G;  2OTJ V;  2OT5 A;  4WFA V;  5CN0 A;  4MVZ A;  3CC7 V;  1SES A;  2NLJ C;  3CCE V;  4FIP C;  4MVS A;  4PA4 A;  4PA7 A;  4WFE A;  3SPG A;  2V1D A;  5EC2 C;  1W0K G;  2JJ2 G;  3WFV A;  1K73 W;  2DWD C;  1NH2 D;  2OCC C;  3B77 A;  3SPC A;  4RUE A;  2AHY A;  4XDL A;  1NR1 A;  2DQ0 A;  2A9H A;  3MHS C;  4DO2 A;  1WLE A;  1Q81 W;  4N21 A;  3FYE B;  3ABM B;  3ABL B;  3CCS V;  4HZ3 A;  3UM7 A;  5L3B A;  3T4Z A;  4JF3 A;  1ENV A;  3OM3 B;  4X8A A;  1E1R G;  2V7Q G;  5HFM A;  3FKS G;  3ZCC A;  3K0D A;  2XAS A;  3AG4 B;  1FXH A;  3ETE A;  3ZRS A;  3OW2 U;  1DTO A;  1G8M A;  3TCU A;  1S5H C;  5IDJ A;  3JCZ A;  4QNH B;  1LNQ A;  4MVO A;  3ZN0 A;  1QCE A;  5E1A C;  4MTG A;  1EFR G;  2M7W A;  3SJQ C;  4BAY A;  3GWO A;  2HLD G;  3EFF K;  1DLB A;  2EIN B;  3OFN G;  3ABM C;  3ABL C;  3ZMS A;  1COW G;  1OCR B;  1ROP A;  3T4D A;  1AR1 B;  3SYC A;  3QO7 A;  1AJQ A;  2Q69 A;  2ZDI C;  3ASO B;  4QIW F;  3OMA B;  3ZJZ A;  1JOY A;  3AG4 C;  5IYD O;  3ZRV A;  1NQT A;  3JD0 A;  4UUJ C;  1M1K W;  4PDV A;  2AHZ A;  1K97 A;  2P7T C;  4WFH A;  1J95 A;  2DW4 A;  3E89 A;  4LBE C;  1VQO V;  3FB6 C;  1THZ A;  4JAS A;  3CD6 V;  1K9M W;  1JX9 A;  2QA4 V;  3P32 A;  4MW3 A;  4U7O A;  2XOK G;  4XDJ A;  3RVZ A;  1S72 V;  3K79 A;  4ASU G;  2JDI G;  1OCR C;  4PEL A;  1PNK A;  3F5W C;  3OEH G;  3AG2 B;  1W2B U;  1K7D A;  3K3W A;  3ASO C;  1RM1 B;  1JVM A;  1FXK A;  1MOF A;  1MSW D;  1S0V A;  2EIL B;  3IFX A;  1SET A;  3MHH C;  3W7S A;  3HB3 B;  1QR9 A;  4H37 A;  5H6R A;  3AG3 B;  1R3K C;  4P2Z A;  5HFL A;  4U7N A;  4I9W A;  2BOB C;  1KD1 W;  3CXC U;  4JPR A;  5B1N A;  1F23 A;  1PKX A;  1SRY A;  2B5U A;  3OGC C;  1QR8 A;  2P90 A;  3FB7 C;  4MVM A;  1K8A W;  3AG2 C;  1OCZ B;  1BHA A;  2LFR A;  1N8R W;  1DF4 A;  1RM1 C;  1UJW B;  5DM6 V;  1JPX A;  1YHQ V;  2EZP A;  1EBO A;  2EIL C;  4PA9 A;  1GM7 A;  4BIZ A;  3P30 A;  5EC1 C;  4RUF A;  4ZBM A;  2W6J G;  3ZIA G;  4MSW C;  4P9P A;  2GHY A;  3OUS A;  3ABU A;  1RPR A;  1Q82 W;  1YIT V;  2XAH A;  2ZXW B;  2Q6A A;  3AG3 C;  3HPL C;  3W7X A;  2B1I A;  3AG1 B;  1R3J C;  4YXW G;  2JEX A;  4J9Y B;  1R3L C;  3LSS A;  1H2G A;  4F4L A;  1NVP D;  4MVU A;  1G4Y B;  1OCZ C;  4MTF A;  2EZO A;  3M99 B;  1VQ9 V;  2EIK B;  3OUF A;  4X88 A;  5B3S B;  1Q7Y W;  3QO5 A;  2XAG A;  1AJN A;  3STL C;  2LP7 A;  4MS2 A;  2XND G;  1L1F A;  3VOU A;  1OCO B;  1V55 B;  2UXN A;  5EBL C;  2PI5 A;  2ZXW C;  4P9O A;  4UVA A;  3W7W A;  1BHB A;  1F4M A;  1CEZ A;  3AG1 C;  3JD3 A;  3RBZ A;  4ZKI A;  4WFF A;  2ATK C;  4R50 A;  1FXK B;  1Y4M A;  4UV9 A;  3RVY A;  2WLK A;  1E79 G;  4G28 B;  3SPJ A;  5LHG A;  5EK0 A;  3F7V C;  2HJF C;  3SYP A;  3D36 A;  1RPO A;  1YJN V;  2EIK C;  4FMT A;  4MVR A;  1M56 B;  5B3S C;  5CA3 A;  4TT3 G;  2H8P C;  1K92 A;  4UVB A;  3CC2 V;  3LSQ A;  5L3E A;  1GKF A;  1K5Q A;  1ZWI C;  1VQL V;  3CP1 A;  5CMU A;  2HKO A;  3ZMT A;  5B1B B;  1OCO C;  4QE7 A;  1V55 C;  4R6Z A;  1K34 A;  4BIU A;  4WCE V;  1YTF D;  1I5Y A;  4CZZ A;  1CPY A;  3E8H A;  4GT1 A;  1I5X A;  1FXK C;  4L87 A;  3CMA V;  2W6I G;  3EHB B;  3LDD A;  5LBQ A;  3CCR V;  2IJK A;  3CYO A;  2WAM A;  2X0L A;  2BOC C;  2EJR A;  4N23 A;  4CBC A;  2ZR2 A;  3TET A;  1QVG U;  1GK9 A;  1M56 C;  3ZMU A;  2K1E A;  2YSU B;  3E83 A;  2Z5U A;  2Q68 A;  3CCJ V;  2WSS G;  2MK3 A;  1H8E G;  1HWY A;  1GTO A;  2DQ3 A;  5B1B C;  4LCU C;  4JTD B;  1OCC B;  1Q86 W;  4MTX A;  1P4R A;  2R9I A;  3E8B A;  5DN6 G;  3IGA C;  3AEI A;  3JD1 A;  3T1C A;  4QJF B;  2WLM A;  5IYC O;  2JK5 C;  1MG1 A;  3JYC A;  2EIN C;  5LHH A;  2WLI A;  2FTK A;  3SYA A;  2QM8 A;  5KUK A;  3GB7 C;  2QKS A;  4RAI A;  4GX0 A;  3K08 A;  4UVC A;  1KP3 A;  2ITD C;  2OTL V;  4QE9 A;  5EBW C;  2ZD9 A;  1QBZ A;  2DYS B;  3D3I A;  3W7T A;  3ZMZ A;  3DGE A;  1S3J A;  3ASN B;  4P30 A;  1Y66 A;  4I5S A;  4R7C A;  1NH2 B;  1V54 B;  1OCC C;  2Y69 B;  4JTC B;  2A0L A;  3G6E V;  3FB8 C;  1R6N A;  3KG2 A;  3SPH A;  3G4S V;  4WF9 V;  2X7R B;  1VQ4 V;  3FB5 C;  5LGN A;  2X6A A;  1S77 D;  2JJ1 G;  1AI5 A;  1PL0 A;  1PNM A;  3E86 A;  2C2A A;  1YSC A;  3OEE G;  4PDR A;  1MAB G;  2R9R B;  3IC7 A;  4QPJ A;  1WPX A;  1XL4 A;  2DYS C;  4EKW A;  4PA3 A;  5CBG A;  2QTO A;  1M57 B;  2HVJ C;  1ARO P;  3W7U A;  4J9Z B;  4XBF A;  2XAF A;  4Q20 A;  4HYO A;  1FXV A;  3PJS K;  4KUM A;  4LC1 A;  3RW0 A;  1K3E A;  1V54 C;  2Y69 C;  1KP2 A;  2IW5 A;  4GX1 A;  1B6Q A;  3I55 V;  2WWW A;  3MD0 A;  1CP9 A;  4RQE A;  3LUT B;  1AI7 A;  1R3I C;  3ML0 A;  3ETD A;  4DXW A;  2WLN A;  4TWK A;  2QM7 A;  3NXS A;  5B1O A;  1SZT A;  1VQM V;  3A0R A;  2ITC C;  1KC8 W;  4WFB V;  1M57 C;  2LFS A;  2GSM B;  2WLH A;  1VQ7 V;  1KEC A;  4JAU A;  3BEH A;  3CCQ V;  1OHH G;  2X6B A;  5KUM A;  3ZMV A;  2IU0 A;  1QVF U;  2WLI B;  3ETG A;  4UV8 A;  5GW7 A;  1VQN V;  1F51 A;  1M9N A;  2ZR3 A;  1K4D C;  3I56 V;  5IY5 B;  4JYB A;  2DYR B;  1AJP A;  1AI4 A;  1QLE B;  3SPI A;  2WLL B;  1SER A;  3LNM B;  3H01 A;  4TSF G;  5FL7 G;  1IXM A;  3OR7 C;  2WPD G;  4FPP A;  4KFM A;  2WLJ A;  2YEV A;  5B1A B;  3ZRW B;  3K04 A;  3CPW U;  1NJI W;  1GO3 F;  3K0G A;  3SYQ A;  2IJI A;  1PD3 A;  4PDL A;  4FJC C;  1NR7 A;  3QNE A;  3F7Y C;  2HFE C;  1M90 W;  3G71 V;  3K06 A;  3UKM A;  1JJ2 U;  3DTU B;  2HVK C;  1VQ8 V;  2H94 A;  4JYC A;  5IY5 C;  2EIJ B;  2DYR C;  3E35 A;  3OMI B;  1QLE C;  2F43 G;  4FK5 C;  5BZB A;  5KA6 A;  1OZ0 A;  4PA6 A;  1FFT B;  2QE7 G;  3OAA G;  2IJJ A;  3K03 A;  1E1Q G;  5B1A C;  3X2Q B;  1QLN A;  3SYO A;  3TK1 A;  3FYI B;  5KA5 A;  5L3F A;  3CCU V;  2HR3 A;  5LGU A;  3CCM V;  2XAJ A;  4GCZ A;  1YJW V;  1FS0 G;  1ORQ C;  5H9C A;  2IU3 A;  2IH3 C;  4MT8 A;  1GM9 A;  2PI4 A;  1GM8 A;  1R6K A;  2EIJ C;  4MTO A;  2EIM B;  3B8M A;  4X89 A;  1NVP B;  3R65 A;  1BL8 A;  3ABK B;  4XDK A;  5L3D A;  5CBH A;  1K4C C;  4JAV A;  3E2E A;  3WG7 B;  2UXX A;  3X2Q C;  1EZJ A;  3OR6 C;  5C93 A;  3CC4 V;  1YIJ V;  4E2L A;  3CCL V;  1KKD A;  5EBM C;  4WFG A;  2DWE C;  2IH1 C;  2D3O W;  3JD2 A;  4QPK A;  2WLL A;  2Y48 A;  3K9A A;  3STZ C;  3VBB A;  1K5S A;  2P67 A;  3QO8 A;  4GX2 A;  4JGS A;  3ZRW A;  3ZN1 A;  1F4N A;  2EIM C;  2YEV B;  5LHI A;  2NNU A;  1H38 A;  1GMG A;  1NBM G;  3ABK C;  1KQS U;  1VQ5 V;  3WG7 C;  4LP8 A;  2CK3 G;  5L3G A;  2JEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...