1KKDA

Solution structure of the calmodulin binding domain (cambd) of small conductance ca2+-activated potassium channels (sk2)
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
92
structure length
92
Chain Sequence
RKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Small conductance calcium-activated potassium channel protei
publication title A helical region in the C terminus of small-conductance Ca2+-activated K+ channels controls assembly with apo-calmodulin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 4
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kkdA00
1QLEC 3OUSA 3WG7C 3K04A 4I9WA 2DYSC 4MTGA 4R7CA 4GX2A 2A9HA 3SYQA 3VOUA 5CBFA 1OCCC 4PA4A 4PDVA 4MTFA 3E8GA 5J9PC 4PA9A 4JTDB 2P7TC 4J9ZB 4MW8A 4WFHA 5B1AC 3ASNC 3SPIA 3SPGA 1K4CC 3SYOA 1XL6A 3LDEA 2X6AA 1P7BA 3RW0A 3SYAA 2AHYA 4PDLA 4MVMA 3SJQC 2HFEC 5BZBA 2DWDC 4RUFA 3IFXA 4MVOA 3HPLC 4X88A 5CBHA 3F7VC 4MVQA 5EC1C 2WLJA 5E1AC 4F4LA 2WLKA 3BEHA 2YEVA 4R50A 2QTOA 4RUEA 4HYOA 4X8AA 3ZRSA 2AHZA 2Q67A 3STZC 2WLHA 1ORQC 5EBLC 2JK5C 3OR6C 1S5HC 4RO2A 1JVMA 4EKWA 3STLC 4G27B 4JTCB 4PA3A 1G4YB 3FB8C 4KFMA 4J9YB 3IGAC 3K0DA 3LDCA 4MS2A 5CBGA 4TWKA 3FB6C 4GX5A 2A79B 4XDLA 3OUFA 2EIMC 3OGCC 2HG5C 3T4ZA 4XDKA 2Q69A 4MW3A 2H8PC 3F7YC 4GX1A 2WLNA 3E89A 3SPCA 2Q68A 3AG3C 4LBEC 1R3JC 4PDRA 4ZBMA 3LDDA 1KKDA 4QE9A 3JYCA 3E8FA 4MSWC 1J95A 3UKMA 3KG2A 5KUKA 2HVKC 4HZ3A 4X89A 3TCUA 3ABMC 4H37A 3K06A 3E86A 4P9OA 2IH1C 5B3SC 4QNHB 4BW5A 2X6CA 3OR7C 3LNMB 1M57C 2ATKC 3FB7C 5IY5C 3E8BA 1XL4A 1M56C 2NLJC 4WFFA 3T4DA 2ITDC 3SYPA 4OXSA 4DXWA 5EBMC 4MTOA 4WFEA 3T1CA 4H33A 3ZJZA 2DYRC 2HVJC 3R65A 2QKSA 4WFGA 4P9PA 2HJFC 5EC2C 4LCUC 3RBZA 3X2QC 4MVSA 4CBCA 4R8CA 3T2MA 2EIJC 3EFFK 2ZXWC 3ABLC 5KUMA 2R9RB 3UM7A 4PDMA 4JTAB 4MVRA 4PA7A 1R3IC 3AG4C 3RVZA 2OCCC 2KB1A 4P30A 2WLIA 4P2ZA 2BOCC 2EIKC 3GB7C 1R3KC 4UUJC 2IH3C 1ZWIC 3RVYA 2EILC 4LP8A 2ITCC 2W0FC 3K03A 4GX0A 3K08A 5EBWC 2BOBC 1K4DC 2WLLA 3LUTB 3TETA 5EK0A 1R3LC 4MVZA 3F5WC 3SPHA 4XDJA 1BL8A 2Q6AA 2X6BA 3ABKC 2Y69C 3ASOC 3E8HA 2WLIB 3E83A 3AG2C 1V54C 2A0LA 1V55C 1OCOC 2DWEC 1OCRC 3PJSK 2WLLB 2EINC 3FB5C 3K0GA 1LNQA 2WLMA 4QE7A 4MVUA 4RAIA 4R6ZA 3SPJA 1OCZC 3SYCA 2ZD9A 3AG1C 4PA6A 5B1BC 2K1EA 4G28B
chains in the Genus database with same CATH superfamily
4IHJB 2QA4V 4R7CA 5LOVB 4DR5B 5CBFA 5C8YB 3L74H 4J10A 3SPIA 4DV3B 3JARA 2YIDA 3RW0A 3SYAA 3E22B 1YDXA 4UCSA 2DOSA 4GLXA 5H6RA 2QEXV 3K3WA 3W7UA 1A32A 4Z2WA 4FFBA 1HW7A 3D36A 1Q6IA 3L71H 2O57A 4JYBA 4BIOA 1AR5A 2E5LB 1PNMA 1SF9A 2UU9B 1Y74A 5FNVB 1YHQV 1KP3A 5BXZA 2YXLA 3ZRWB 1NTMH 4PELA 4UVCA 3EVKA 4OGQB 1MA1A 2EIJB 2B1IA 3TJTA 2N05A 2F4VO 2XAJA 3OR7C 4LF8B 4DXWA 1H2MA 3ZHSA 1PD3A 2ADQB 5BMVB 1S77D 3RYCB 3CRCA 2Q5ZA 1Z2GA 1PPJH 4JGSA 4DV7O 1DF4A 1SS3A 4LF4O 4ICGA 4FFKA 4JV5O 4LFBO 1HNWO 2EILC 2W6JG 5JCOA 5EIBD 1TAEA 4DV5O 3F5WC 1O9HA 1P84F 3VBBA 1AJNA 4DV2B 4X1YA 4DK1A 2IBZH 4JI2B 5KA6A 4ZHQB 3K5OA 1N34B 4K0KB 1Y4MA 4DUZB 1JQ0A 1T5EA 3DXRA 4O2AA 2ZM6O 2P5OA 2AXTZ 1QLEC 3FKSG 4CH6A 2W0XA 2ZIMA 3O9OA 4UVBA 4FJCC 3H1JH 4YY3O 4JTDB 1AROP 4TT3G 1MSDA 2FMLA 4FM2A 1VQMV 1VQ5V 2JEXA 5JJJB 4GZRB 3UO2A 3BAAA 3F7VC 4DR5O 3B8MA 4D6TH 2VQFB 3AG3B 4WFAV 1YZBA 3JD3A 2QWOB 4X1KB 1RSOA 1NZ6A 3S3XA 1XHXA 5LA6A 4A5UB 4UV8A 4FLZA 4KXRA 2UXDB 1GRJA 2F66C 2WSSG 2YEVB 3OMNB 4DR2O 4IIJA 2HEPA 4JYYA 1AI4A 4TUYA 2JGUA 2LGWA 4FLVA 3SPCA 1B06A 3LDDA 1I94B 1M90W 1H2LA 3B2EE 2ZDIC 4I0XB 3ABLB 2F23A 2IH1C 3S3WA 4WFBV 3EXAA 1Q82W 3UO3A 1RM1C 1XOUA 2P4VA 1D5AA 2OCCB 1R73A 1M56C 4FPPA 1I5YA 1GAXA 3R65A 3CCLV 4MVSA 4LF8O 3EFFK 2F43G 2IU0A 4DV4O 2F93B 4NVPA 2MW2B 3CYOA 1NS1A 3LNNA 1HNZB 1MZFA 5JJEB 2RDCA 2OYQA 3K08A 2UUBB 3FAVA 2H94A 3BABA 5D5PA 1YITV 2DQ0A 1M93A 4FM0A 5HFMA 1QQCA 4JI8B 1P7GA 1SZTA 5LXTB 3IAYA 4BR6A 3KKYA 4HNAB 1NI8A 2DMXA 3WG7C 5CA3A 4GYCB 4DV2O 4DV1B 4JI2O 4BIZA 2QJ1A 1JFFB 1N34O 2GV9A 5EZYB 4O2BA 1MOFA 3IFXA 1FFTB 1DK1A 2FTKA 3BEHA 3CMAV 5KHHA 1VARA 1SC5B 5LGUA 1ORQC 1IBLB 4LNUA 5JVDB 2B1GA 1PM9A 4JTCB 4KFMA 1SQXH 5LMUB 1GO3F 2HG5C 3JAWB 1N4CA 4GX1A 4W4LA 3UKMA 3KG2A 4DR1O 5BR8O 2UXDO 4DR7O 3SJAC 1NJIW 2ZR3A 4UXNA 5IY5C 4TV8A 1VMGA 2ETNA 2YI9A 1I94O 2F95B 3C90A 4JF3A 3A2FA 1VQ8V 5EC2C 4B3TO 4UCUA 2BCCH 3OFNG 5C8YA 2LO1A 3F5TA 1VF5B 1FXKC 4JI5B 3CHXA 4H13B 3E22A 3AG1B 1FXHA 4B3MB 5IYZA 3JASB 3CJHA 1XHZA 1BL8A 1N0JA 2EULA 1IBMB 2QWNB 1SERA 3TK1A 4JAAA 2A0LA 3UT5B 1HNZO 1CPYA 1SA0B 3FB5C 1M9NA 2UUBO 2WAMA 3QTCA 2QSAA 1RPRA 4YIOA 3HB3B 4G28B 1GM8A 2YXHA 5JJNB 3SYQA 1OCCC 1PL4A 4X20B 3BY6A 2CGOA 3WFVA 4FM1A 2CH7B 1EFRG 4DV1O 1D5NA 4RUEA 2UXCB 1KU9A 4HYOA 2Q67A 1E79G 3GWOA 4KHPB 1G1XB 1GK9A 2QWQB 1NBMG 5F2VO 5IDJA 4F6RB 4X62B 3BCCH 3IGAC 1YTFD 3ZMZA 1VQNV 1W59A 3FD9A 1O9GA 4X66B 2WLNA 3X2QB 4O4IA 3P3NA 3K5LA 1FS0G 3MD0A 1WPXA 1ZUQA 4X1IA 2QM8A 5ITZA 4NXNB 4GUNA 1B04A 2YIBD 4NTWA 1XDCA 1IBKO 1N33B 4GKJB 4BIUA 1K5QA 1E1QG 3OE7G 4LFCB 1KC8W 1LR1A 1WA8B 4O4JA 4JI4B 2K9PA 3D36C 4QJFB 5LBQA 2YICA 3P3PA 5LHIA 2XAGA 1V55B 1ZX3A 3A0RA 4DRXB 1KYOF 3IJ4A 4PA7A 5DM6V 3JD4A 2EIKC 2FL4A 3QO8A 4LP8A 3KZIZ 1W2BU 2BTQA 3ABUA 2D3OW 3VQXA 2ADPA 1HWYA 3ABKC 3H1LH 2AZ0A 1S0VA 1JMKC 4JI5O 2C2AA 4B3MO 5LMNB 1V54B 1Q90D 3B8NA 2EINB 2PGGA 3RWRD 2XHBA 4J7KA 1OZ0A 2BE3A 4YJ3A 3BPZA 2A9HA 2JRIA 2PZSA 3AG7A 3BFRA 3JAKA 4N23A 4PA9A 1JA8A 4J9ZB 3ASNC 3SPGA 2ZT9B 2CGNA 3RYHB 5CBHA 1AP5A 2ODMA 3OD4A 2WLJA 4HAMA 4X8AA 2CAZC 1GKFA 2CDYA 3ML0A 2AGAA 4UB8Z 3E2EA 3T1HB 1YI2V 1MSWD 5CBGA 4U3JA 5EYPB 1WP7A 2EIMC 3TXSA 2DN9A 2RMKB 1YVWA 2XAQA 3JATB 4LC1A 5KUKA 2Q7HA 3CXHF 3K06A 3B40A 3N27A 3QVNA 5LP6B 1XREA 2AW9A 3E8BA 4X66O 1US6A 5B3SB 1EN5A 2F4VB 3RGBA 1D2DA 2HJFC 3GWKC 4NTYA 1Q3EA 2BSKB 4NXNO 1FXKA 3CRMA 3CSXA 3E35A 4FLTA 4LFCO 1FFXA 3RVYA 2IH3C 5GONB 2E74B 1UJWB 1HP8A 4NR1A 1AP6A 1K34A 3C3TA 3N2GB 3HKCA 4LF4B 3ZMVA 1N36B 5LHGA 5CMUA 4LFBB 4QGPA 1OCOC 1HNWB 1MABG 4B3SB 5H2FZ 1QVGU 1Q43A 4AI8A 4DV5B 4JI6B 2RCVA 3JSNA 4PI0A 1EN6A 1R1BA 1W0JG 4MTGA 1YTFB 3MHHC 1BHBA 3TGUH 5B1AC 2ZM6B 1K97A 4I7ZB 1DGSA 5DEDA 1TUBA 1AI6A 1GN3A 4IT5A 1VQ6V 4LFAO 4L8JA 1QVFU 4YY3B 2WLKA 4R50A 2QTOA 2Y4TA 1VP7A 1S5HC 4FZ1A 4NXMO 2XNDG 4K8XA 2N04A 1EN4A 3CWBH 3K0DA 1L0LH 2VRZA 2OIGA 1N0NA 4CC5A 2X7RB 2Q68A 4KL1A 1KKDA 2P90A 1H8HG 4DR2B 4AQYO 3T1HO 3ZCCA 1IXBA 2JS3A 3H9VA 1F51A 1NR1A 4P9OA 3M8AA 2QKCA 2M7WA 4BW5A 1SZXA 1SKVA 4LWSA 3FB7C 4I50B 2NLJC 4ABMA 3OTFA 4JASA 2HKOA 2CTWA 2JDIG 4ZI7B 3T1CA 3ZJZA 2DYRC 2YSUB 1FPOA 4K3AA 4OX9B 3UM7A 3FYIB 1TVKB 3AG4C 4P30A 2WLIA 4P2ZA 3RFRA 1J5EO 4JI1B 1WP8A 5FL7G 2B9ZA 2BOBC 1K4DC 3LUTB 3L70H 4DV4B 1QLEB 2WWWA 5B1OA 2DJVA 1K3EA 1BZKA 4W4KA 3ASOC 2GTSA 3AG2C 2PI4A 2PI5A 2XASA 2DWEC 1LNQA 1M4UA 4QE7A 4UCTA 2JGDA 4MVUA 3JALA 5FLXN 1N36O 2K1EA 1OJHA 3OW2U 1SETA 1SQVH 2V1DA 4B3SO 4Q6GA 4PJ0Z 5L3EA 5CA1A 2ZKOA 2GSMB 4DYLA 5IJ0B 1K8AW 4JI6O 3SYOA 3B09A 3SJQC 3APQA 4JZ2A 2DWDC 4RUFA 3M7MX 1K73W 3CE2A 5E1AC 4RQEA 3ZRSA 3U10A 5KAIZ 3Q4HA 4XBFA 4PA3A 1GN4A 2W6IG 3N2KA 1R6TA 1RM1B 4L87A 4DRXA 2ZQMA 1WPBA 4XDLA 2Q69A 5K1PA 3ZN0A 1UPGA 4UCRA 4FLYA 2D2CB 2P6JA 3LSSA 4DW0A 3NXSA 3CS5A 4LF5B 5LHHA 3H01A 1M57C 3CRAA 3WB0A 3CCMV 5JH7A 4DR1B 1VEWA 5BR8B 5H9CA 5J2TB 4DR7B 2FYUH 5BY1A 3SJCC 4WFGA 1DTOA 3CD6V 2KQXA 4K8ZA 5KMGB 2KG7B 4R8CA 5LYJA 1JPXA 2XUMA 5KUMA 3CC4V 2XAFA 5J2UB 4I4TA 4YIPA 3P32A 1NVPD 2BOCC 3CRQA 3GB7C 1Q6HA 4YJ2B 3CCQV 4B3TB 3KCYA 3A0HZ 4FMTA 2QE7G 4MVZA 4OX9O 3B4SA 5DN6G 2WA4A 1WB7A 4KP4A 3E8HA 1XEQA 2WLLB 2GUZA 5C93A 4JI1O 3RYIB 4R6ZA 1XQ8A 3SYCA 4NKGB 1PV0A 2NN4A 5CB4B 4I9WA 2DYSC 2NNUA 1EM1A 5KHKA 4I55A 1YJWV 1HNXO 4ZIBA 2JIZG 3I5DA 4J11A 2IJKA 5KHIA 1B6QA 5LGTA 2HFEC 3O65A 4WBNB 1PKXA 2YIAA 1KKCA 2ZINA 2EX3A 3FYEB 1TUEB 1B3QA 5IJ9B 4CH5A 1KBHA 3OR6C 3I55V 1V9PA 1XMOB 2KKWA 3BRCA 4LR3A 4O4HB 3ZHRA 1CEZA 1L8DA 4MW3A 4DR3O 1JJ2U 1WJZA 4X9QA 5K1XA 4EB6B 3ZEDA 5JQGB 2UUAB 3ETQA 3ABMC 4OPAA 4PD4F 2ZNIA 3C3SA 3K59A 2Q73A 3W7TA 2EJ7A 4WFFA 3T4DA 2UXBB 1BQ0A 1KQSU 2A7WA 1ZSPA 1XBLA 5E79Z 3K5MA 3ZMTA 3DC6A 3K9AA 5CA0B 4JYAO 4LF5O 4TV9A 1IBKB 2EZOA 2JVDA 1ZL8B 2ZXWC 4K35A 3ZBHA 1WN7A 4LF9B 3ZS8C 3G6BA 1QR8A 2H3OA 1R3KC 3HKEB 2OTLV 4F6EA 3VQYA 3HKDB 3HKBB 1U97A 2X6BA 2Q9LA 4DR4O 4ASUG 5KX5B 4CZZA 1YCIA 3OEEG 1IVSA 4IHJA 4DV6B 2Y69B 5LOVA 3BA8A 2E76B 4IL6Z 2P67A 1BE3H 4U3FH 4LF6B 3ZMSA 2LP7A 1Y76B 3JD2A 3SDLA 2UXXA 3E8GA 4O4LB 1HDJA 2QDOA 3ICXA 3CC7V 1XL6A 2AHYA 4MVMA 2VWKA 1NR7A 4MVOA 2UUCO 3JARB 3J81N 3STZC 3G4SV 2CTPA 4EKWA 3WU2Z 5FNVA 1S3JA 3ZRWA 3OUFA 2H8PC 1XMOO 3L75H 4FFBB 4RWUA 4MSWC 2Q7EA 4EEQA 2YS8A 5EIBC 1NVPB 3OAAG 3WB2A 4DK0A 4DR6B 1L0NH 3MAQA 5BMVA 1Y6XA 2R70A 3RYCA 3ZHTA 1Y74B 4TQFA 2EIKB 4OXSA 4MTOA 1YIJV 2UUAO 3J7AU 3JSLA 4U7NA 4UFZA 1Q5OA 3RN4A 1JJOA 2UXBO 1WNSA 2ZE5A 4NYKA 2FKXA 1PNKA 5H5NA 1VQPV 4EFEA 1BHAA 3K03A 2ZE7A 5IYBO 1OHHG 4ZHQA 1BCCH 1ZTEA 4FZ0A 4LF9O 4QPKA 3L9DA 3OMIB 4DUYO 2GHYA 1SRYA 4RAIA 3OTOB 5LL6Y 5KAFZ 1LUWA 2Q7GA 3AK2A 4X1YB 3L73H 1H38A 3D8CA 4MTFA 4DV6O 3H1IH 4UCOA 1JX9A 1VQ9V 4LF6O 4X64B 3ZHQA 1KMIZ 1H2KA 4PDLA 4X1KA 5GW7A 2EIMB 2X0LA 4G2KA 2JS5A 2YEVA 5JWPA 1Q6UA 2WLHA 2VWJA 4LFAB 3G67A 2IW5A 4TWKA 1XILA 4GX5A 4FLXA 3BA9A 4I0XA 2DE0X 1RSOB 3LSQA 1W0KG 4NXMB 5LA6B 3JD0A 1KB9F 4IIJB 1K92A 4LF7O 2HVKC 4JAVA 2LW1A 4JYCA 4B3RB 4TUYB 1SQQH 4QNHB 2X6CA 3LNMB 2Y0IA 4J80A 4IYIA 1M5IA 2Y0PA 2ITDC 4AQYB 5EBMC 2XOKG 1I08A 3ZN1A 4WFEA 3JD1A 4DR6O 3W7WA 1Q86W 3NR7A 1R6NA 1OCOB 1GM9A 1JCHA 1R3IC 1ZWIC 3CCJV 1K5SA 2QGNA 1XNQB 2EJRA 5LXTA 2GBOA 2PYLA 1V54C 1J5EB 4HNAA 5B1AB 4CS3A 5D5QA 2EINC 4PV1B 3FAVB 2CTQA 3FX7A 2WLMA 1VF6A 1Y66A 3SR2C 1JFFA 1GH6A 1OCZC 1OCRB 2ZD9A 2QWRB 4E4EA 5EZYA 4Q20A 2PUSA 2Y4UA 2CUGA 4PHZA 1NQTA 4GX2A 5B1BB 4CC6A 3G6EV 3ETDA 4IGGA 2P7TC 3OTOO 2Q0OC 5DECA 5L3FA 4CH3A 3LDEA 1P7BA 1FAFA 3CMEV 3CXCU 1VQKV 5JVDA 1AR1B 3JCUZ 3HPLC 3K9SA 3ABTA 3TXQA 2IJIA 1F7YA 1FJGB 4O2BB 1AILA 3JAWA 5CN0A 5KA5A 2R9AA 3CCSV 4AILC 4X64O 2A79B 3DSQA 3UQ8A 4LNUB 1BSMA 4LBEC 2IU3A 1GN2A 5IE9A 3HKBA 5LP6C 4B08A 4H37A 3ZHVA 2M6YA 2Q8VA 5B3SC 1MNGA 1XL4A 3GVMA 4YHHO 2V7QG 4H33A 1MMMA 3CPWU 3RBZA 4B3RO 2XTAA 1GM7A 2HR3A 4TV8B 3ASOB 1JR9A 3JASA 2E75B 1XUQA 2ITCC 3UT5A 1Q7YW 4C7UA 4CH4A 1S5JA 1SA0A 1SQFA 3UCSC 2YI8A 4JI3B 2EILB 5GTHZ 1EZJA 2ZE8A 3SJBC 5LGNA 3THOA 3VQVA 5IYZB 1VQ4V 3CJHB 4X20A 2Q0AA 1XNQO 5B66Z 2R9IA 3KCXA 1H2SB 1RPOA 2CH7A 4WFHA 2WPDG 2DW4A 4TOIA 2OCHA 2QM4A 3BHPA 1S5LZ 2NR5A 1ZAUA 5A9GA 4F6RA 1I7FA 1HNXB 2JJ2G 5EBLC 3CEIA 2PTMA 2OWOA 1RP3B 1M57B 1X4TA 4MS2A 3ZHUA 1THZA 2Z3YA 1BS3A 3A0BZ 3T4ZA 2CTRA 1FJGO 3F7YC 1G8MA 3E89A 2YDEA 1YEWA 3AEIA 3MDSA 1VQOV 1Q81W 5AG2A 4X89A 3CC2V 5HFLA 1GN6A 1VF7A 3E86A 2UXNA 1WA8A 2DQ3A 4DR3B 2A3QA 2XAHA 5B5EZ 4O4IB 3P30A 4JI0B 4RQFA 2EZPA 1M56B 3LSUA 3QG5A 1K9MW 1IZ3A 4X1IB 5ITZB 1AR4A 3ZIAG 2EBOA 2EIJC 2R9RB 2MK3A 3BVOA 4D7TA 4MVRA 2KSDA 1NU1H 1AI7A 4O4JB 5FPOA 1XMQO 2QWPB 4JYAB 3L72H 5EBWC 1QCEA 4J7ZA 1MG1A 5IYCO 2DYSB 2RNBA 4DW1A 1S72V 1QU7A 4H0LB 2Y48A 3R66A 2BTQB 3W7SA 3K5NA 4TQDA 4FLUA 3K79A 1ENVA 3U0ZA 3DGEA 2WA3A 4JI3O 4DV3O 4DR4B 3K57A 2LJ2A 1SESA 2JJ1G 3CP1A 3RYHA 3MHSC 3WG7B 1AVMA 1K4CC 3D3IA 3ZRXA 4YJ3B 3JAKB 4MVQA 5EC1C 3RYFB 4F4LA 1NKDA 4QIWF 2QKAA 2L35A 2AHZA 5EYPA 3JAMN 2JK5C 2OIEA 3ABMB 2CK3G 2HP8A 2RQ6A 2E5LO 1G4YB 4J7JA 2P06A 2UU9O 2UUCB 4J9YB 3JATA 1QHTA 2HJDA 1ZLZA 5LP6A 1NH2D 3AG3C 1R3JC 2RN9A 3E8FA 4GCZA 4HZ3A 4U3JB 1URFA 2ZXWB 1R6KA 1Q8IA 5TISZ 1X59A 2BSKA 2Q4PA 3FFQA 4DV0B 5IY5B 3QO5A 2IJHA 2HVJC 2QKSA 1DLBA 4B7EA 4JPRA 5GONA 3ABLC 3N2GA 2PF4E 4PDMA 1U96A 5FPRA 4JI0O 1G6UA 2OCCC 1I5XA 1YJNV 4UUJC 3A8TA 1WAZA 1IURA 2W0FC 4GX0A 3PN1A 3TETA 1FXKB 4K0KO 5L3GA 4DUZO 2Z5UA 1FFXB 1DF5A 1VQ7V 2IM9A 1FKAO 2LFRA 1Z5VA 1JOYA 1F4MA 3K0GA 3HKCB 4J41A 2XT9A 3ETGA 3RT3C 3W7XA 3CX5F 1AB3A 2AZ2A 2P22C 1KD1W 1PNLA 3ZMUA 4DUYB 2LGQA 1FXVA 2QR4A 3VOUA 1Z5WA 2QTSA 5J9PC 2VQFO 1OCCB 2YIBA 4TSFG 4ZOLB 3AK3A 2OT5A 5BZBA 1QNMA 4EFBA 2GTAA 4OPHA 4NB5A 1P4RA 3ZRVA 2CE4A 1TUBB 1VF6C 3T1YB 1MZEA 4G27B 3STLC 3CCRV 3CCVV 1OV9A 3LDCA 1KUQA 3CRRA 2HHHB 1SQGA 1N32B 4FLWA 2LW7A 4JI7B 1K7DA 4PDRA 3OEHG 4I50A 4ZBMA 4QE9A 4UCVA 3JYCA 1J95A 4J42A 3IC7A 1N8RW 4ZI7A 3OMAB 1S76D 3CB2A 2HLDG 3DTUB 3H1HH 1TGOA 5H6QA 4LF7B 2JEUA 4U7OA 5IWAB 1EZVH 1TVKA 4FK5C 4LWSB 4P9PA 3QO7A 4CBCA 1NTKH 2A06H 2P4KA 1WB8A 3OM3B 2ZE6A 4DV0O 4GKKB 1SQPH 2KB1A 3CCUV 2ZR2A 4CS4A 4JI8O 4BWAA 5EK0A 4I9QA 4FVMA 1L1FA 3ZX6A 2ZIOA 2Y69C 2YUAA 2WLIB 3E83A 4JZGA 1BT8A 3PJSK 3QF7A 4HBNA 5IT9N 3ABKB 3M99B 1EBOA 4NTXA 1QBZA 4GT1A 2VQEB 1YSCA 3HR0A 3AG1C 1YF2A 1F23A 5KHJA 5IJ0A 3OGIB 1CXZB 1H2NA 2N74A 4QPJA 4DO2A 3OUSA 3CCEV 3K04A 2JGDB 1GTOA 4B7KA 3JALB 5KLVH 2V4DA 1NH2B 1IBLO 1VIBA 2X6AA 1BGYH 4WF9V 2ZDIA 4I5SA 3ASNB 4UVAA 5CA1B 5L3BA 3K58A 4MT8A 1IDSA 5LMUO 4RO2A 1JVMA 1ROPA 2IJJA 3VQWA 1AJPA 1HR0B 3FB8C 4BW9A 3QNEA 1RFYA 4H44B 3Q4HB 4ZKIA 3DXRB 4O2AB 4XDKA 1VQLV 2YXYA 5IYDO 4D7SA 3N2KB 2ZNJA 4X65B 3T1YO 1TA8A 4IYHA 1SQBH 1YXBA 1UFIA 5J2TA 2HHHO 1WLEA 2ATKC 1N32O 2R72A 1FD9A 4JI7O 5KMGA 2KG7A 1H2GA 5J2UA 2L6LA 3U11A 4Z1VA 2G38A 3X2QC 3H1KH 4YJ2A 4YXWG 3D3QA 3T2MA 5JH7B 2RJZA 1XNRB 2BTOA 4Z1MG 4YHHB 1I0HA 4E2LA 3APOA 1IBMO 5IWAO 1OCZB 4AHCA 4KUMA 5B1NA 5LYJB 2WLLA 4UV9A 3RYFA 4I4TB 3WB1A 5JCOC 3RYIA 3I56V 3AK1A 4XDJA 2Q6AA 1BQZA 5KHGA 2ZCEA 4GKKO 1V55C 5CB4A 1F4NA 4LH6A 2ILMA 2QM7A 1NTZH 4PA6A 3IC9A 2GUZB 2Z0AA 1IXMA 4WBNA 1AI5A 4PA4A 4PDVA 1QLNA 5L3DA 4PI2A 3G71V 4MW8A 3OT7A 2UXCO 5GTIZ 1K33A 2VQEO 2B5UA 4UB6Z 4KHPO 5IJ9A 4FIPC 5A2QN 1AJQA 4X88A 4I55B 5L3CA 4X62O 4N21A 4CS2A 4MTXA 4O4HA 2ARHA 2OTJV 3ETEA 3G80A 1KECA 1E1RG 1Y67A 4EB6A 3FB6C 5JQGA 2GDSA 3OGCC 2F1MA 3DC5A 4BAYA 1GMGA 1COWG 1HR0O 1N33O 4GKJO 1M1KW 3TCUA 1KP2A 1H8EG 1PL0A 4JI4O 4DV7B 5CA0A 1NT2B 2PYJA 2YC0A 3SYPA 4X65O 1ZL8A 2E3CA 4JV5B 2LFSA 1XI1A 3SGIA 4LCUC 1FYJA 4JAUA 3HKEA 2VS0A 3EHBB 3J80N 2DYRB 3HKDA 1P49A 4JTAB 3JCZA 1LUVA 3RVZA 4TV9B 4ZOLA 5KX5A 3AG4B 1CP9A 1R3LC 5LMNO 3B77A 3SPHA 4WCEV 1XNRO 1XMQB 2LQTA 1IX9A 1YJ9V 1OCRC 4LH7A 1Y76A 3AG2B 1BMFG 2PY5A 3SPJA 1PP9H 5B1BC 4O4LA 1QR9A 2FB5A
chains in the Genus database with same CATH topology
2QA4V 1SESA 2JJ1G 4R7CA 3JD2A 3CP1A 2A9HA 3MHSC 5CBFA 2UXXA 4N23A 3E8GA 4PA9A 3WG7B 4J9ZB 3SPIA 3ASNC 3SPGA 1K4CC 3D3IA 3ZRXA 1XL6A 3CC7V 3RW0A 3SYAA 2AHYA 4MVMA 1NR7A 4MVOA 5CBHA 4MVQA 5EC1C 2WLJA 4F4LA 1NKDA 4QIWF 4HAMA 4X8AA 1GKFA 2AHZA 3STZC 3G4SV 2JK5C 3ML0A 5H6RA 4EKWA 3ABMB 2QEXV 2CK3G 3K3WA 3E2EA 3W7UA 1G4YB 1YI2V 4J9YB 1MSWD 5CBGA 1S3JA 3D36A 3ZRWA 3OUFA 2EIMC 2H8PC 4JYBA 1NH2D 3AG3C 1PNMA 1R3JC 2XAQA 4LC1A 3E8FA 4MSWC 1KP3A 1YHQV 4GCZA 5KUKA 3ZRWB 4HZ3A 1NVPB 3OAAG 4PELA 4UVCA 2EIJB 2B1IA 3K06A 2ZXWB 1R6KA 2XAJA 3OR7C 3E8BA 5B3SB 2EIKB 4OXSA 4DXWA 4MTOA 1YIJV 5IY5B 1PD3A 3QO5A 1S77D 2IJHA 2HVJC 2QKSA 2HJFC 4U7NA 1DLBA 4JPRA 4JGSA 3ABLC 1DF4A 1FXKA 4PDMA 3E35A 2OCCC 1I5XA 1PNKA 1YJNV 4UUJC 1VQPV 3RVYA 2IH3C 2EILC 1BHAA 3K03A 2W0FC 2W6JG 5IYBO 4GX0A 1UJWB 1OHHG 1K34A 3TETA 1FXKB 3F5WC 3ZMVA 5LHGA 5L3GA 2Z5UA 1DF5A 3VBBA 5CMUA 1AJNA 1VQ7V 4QPKA 1OCOC 2LFRA 1JOYA 1MABG 1QVGU 1F4MA 3OMIB 2GHYA 3K0GA 5KA6A 1SRYA 3ETGA 4RAIA 1Y4MA 3W7XA 1JQ0A 1QLEC 3FKSG 1KD1W 1W0JG 1PNLA 4MTGA 3ZMUA 1H38A 1YTFB 1FXVA 3VOUA 4MTFA 4UVBA 3MHHC 4FJCC 5J9PC 1BHBA 4JTDB 1AROP 4TT3G 5B1AC 1JX9A 1K97A 1VQ9V 1OCCB 4PDLA 4TSFG 1AI6A 5GW7A 1VQMV 5BZBA 2OT5A 1VQ5V 1VQ6V 2EIMB 2JEXA 2X0LA 1QVFU 3F7VC 3B8MA 4G2KA 2WLKA 1P4RA 2YEVA 3AG3B 2QTOA 4R50A 3ZRVA 4WFAV 2WLHA 3JD3A 1S5HC 2XNDG 3STLC 4G27B 2IW5A 4UV8A 3CCRV 3CCVV 3LDCA 3K0DA 2YEVB 2WSSG 3OMNB 4TWKA 4GX5A 1AI4A 3LSQA 1W0KG 3JD0A 2X7RB 3SPCA 2Q68A 1K7DA 1KKDA 4PDRA 3OEHG 4ZBMA 3LDDA 4QE9A 3JYCA 1M90W 2P90A 1J95A 1H8HG 1K92A 2HVKC 3ZCCA 4JAVA 1F51A 2ZDIC 1NR1A 3IC7A 4JYCA 1N8RW 3ABLB 4P9OA 4WFBV 2IH1C 1Q82W 3OMAB 1S76D 2M7WA 4QNHB 4BW5A 2X6CA 2HLDG 3DTUB 3LNMB 3FB7C 1RM1C 2OCCB 4FPPA 1R73A 1M56C 2NLJC 5H6QA 2ITDC 4JASA 1I5YA 2JEUA 5EBMC 2HKOA 2XOKG 4U7OA 2JDIG 3ZN1A 4WFEA 3T1CA 3ZJZA 2DYRC 3JD1A 3R65A 2YSUB 3CCLV 4FK5C 4P9PA 3W7WA 1Q86W 4MVSA 3QO7A 4CBCA 1R6NA 3EFFK 2F43G 1OCOB 3OM3B 2IU0A 3UM7A 3FYIB 1GM9A 1JCHA 1R3IC 3AG4C 3CYOA 2KB1A 4P30A 2WLIA 4P2ZA 1ZWIC 5FL7G 3CCUV 2ZR2A 3K08A 3CCJV 2BOBC 1K4DC 3LUTB 2H94A 5EK0A 1QLEB 2WWWA 5B1OA 1K5SA 1L1FA 1K3EA 2EJRA 1YITV 2Y69C 3ASOC 2DQ0A 2WLIB 3E83A 3AG2C 2PI4A 1V54C 5HFMA 2PI5A 2XASA 2DWEC 5B1AB 3PJSK 2EINC 3ABKB 1LNQA 2WLMA 1EBOA 3M99B 4QE7A 4MVUA 1QBZA 4GT1A 1SZTA 1Y66A 1YSCA 1OCZC 1OCRB 2ZD9A 3AG1C 1F23A 2K1EA 4Q20A 4DO2A 4QPJA 3OW2U 3OUSA 1SETA 3K04A 3WG7C 5CA3A 3CCEV 1NQTA 2V1DA 4GX2A 5B1BB 3G6EV 1GTOA 3ETDA 5L3EA 4BIZA 2P7TC 2GSMB 1K8AW 5L3FA 3SYOA 1NH2B 3LDEA 2X6AA 1P7BA 3SJQC 1MOFA 3CMEV 2DWDC 4RUFA 3IFXA 2ZDIA 4I5SA 3ASNB 4UVAA 4WF9V 1AR1B 3CXCU 1VQKV 3HPLC 1K73W 3ABTA 1FFTB 2IJIA 5L3BA 5E1AC 4RQEA 2FTKA 3BEHA 3CMAV 3ZRSA 4MT8A 5LGUA 1ORQC 4RO2A 3CCSV 5CN0A 1JVMA 5KA5A 1ROPA 2IJJA 2B1GA 4XBFA 1AJPA 4JTCB 4PA3A 2W6IG 3FB8C 4KFMA 3QNEA 1RM1B 4L87A 2ZQMA 2A79B 4XDLA 4ZKIA 1GO3F 2HG5C 4XDKA 2Q69A 1VQLV 4GX1A 3ZN0A 5IYDO 4LBEC 2IU3A 3UKMA 3KG2A 2P6JA 3LSSA 4H37A 3NXSA 1NJIW 1WLEA 5B3SC 2ZR3A 4UXNA 5LHHA 3H01A 1M57C 2ATKC 5IY5C 1XL4A 3CCMV 1H2GA 5H9CA 4JF3A 2V7QG 4H33A 3CPWU 1VQ8V 4WFGA 3RBZA 5EC2C 3X2QC 1DTOA 3CD6V 1GM7A 2HR3A 4YXWG 3ASOB 4R8CA 3T2MA 3OFNG 1JPXA 5KUMA 3CC4V 2XAFA 4Z1MG 4E2LA 1FXKC 3P32A 1NVPD 2BOCC 3GB7C 3CCQV 1OCZB 2ITCC 3AG1B 1FXHA 4KUMA 5B1NA 1Q7YW 2WLLA 4FMTA 4UV9A 2QE7G 4MVZA 3I56V 5DN6G 2EILB 4XDJA 1BL8A 2Q6AA 1EZJA 1SERA 4KP4A 3E8HA 3TK1A 5LGNA 2A0LA 1V55C 1CPYA 2WLLB 1F4NA 5C93A 3FB5C 1VQ4V 2QM7A 1M9NA 4R6ZA 2WAMA 3SYCA 4PA6A 1RPRA 2R9IA 3HB3B 4G28B 1GM8A 4I9WA 2DYSC 1IXMA 2NNUA 3SYQA 1AI5A 1OCCC 4PA4A 4PDVA 1RPOA 1QLNA 1YJWV 3BY6A 5L3DA 4WFHA 3G71V 2WPDG 4MW8A 2DW4A 2JIZG 1K33A 2IJKA 2B5UA 1B6QA 4FIPC 5LGTA 1AJQA 2HFEC 1PKXA 3WFVA 4X88A 5L3CA 3FYEB 4N21A 1EFRG 1TUEB 4RUEA 4HYOA 2Q67A 1E79G 3GWOA 4MTXA 2JJ2G 5EBLC 2OTJV 3OR6C 1GK9A 3I55V 3ETEA 1NBMG 5IDJA 1KECA 1M57B 3IGAC 1E1RG 4MS2A 1YTFD 3FB6C 1THZA 2Z3YA 3ZMZA 3OGCC 1VQNV 3T4ZA 1CEZA 4MW3A 3F7YC 1G8MA 2WLNA 3E89A 4BAYA 1GMGA 3AEIA 1JJ2U 1VQOV 1COWG 1Q81W 3X2QB 1M1KW 4X89A 3TCUA 3ABMC 3CC2V 1KP2A 1H8EG 1PL0A 5HFLA 3E86A 1FS0G 2UXNA 3MD0A 1WPXA 2DQ3A 2QM8A 2XAHA 3W7TA 4WFFA 3T4DA 3P30A 3SYPA 1KQSU 4BIUA 1K5QA 1E1QG 4RQFA 2EZPA 3OE7G 3ZMTA 1KC8W 1M56B 2LFSA 1K9MW 3K9AA 4LCUC 4QJFB 3ZIAG 4JAUA 5LBQA 3EHBB 2EBOA 2EIJC 2EZOA 5LHIA 2ZXWC 2XAGA 1V55B 2DYRB 2R9RB 3A0RA 2MK3A 4JTAB 3JCZA 4MVRA 4PA7A 5DM6V 1AI7A 1QR8A 3JD4A 3RVZA 2EIKC 1R3KC 3QO8A 4LP8A 2OTLV 5EBWC 3AG4B 1QCEA 1CP9A 1MG1A 1W2BU 3ABUA 1R3LC 5IYCO 3B77A 3SPHA 2D3OW 2DYSB 4WCEV 2X6BA 1HWYA 3ABKC 1S72V 1S0VA 4ASUG 2Y48A 4CZZA 2C2AA 1YJ9V 1OCRC 3OEEG 3W7SA 2Y69B 3AG2B 3K79A 1V54B 1BMFG 1ENVA 3DGEA 2P67A 3SPJA 3B8NA 5B1BC 2EINB 1QR9A 3ZMSA 1OZ0A 2LP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLE C;  3OUS A;  3WG7 C;  3K04 A;  4I9W A;  2DYS C;  4MTG A;  4R7C A;  4GX2 A;  2A9H A;  3SYQ A;  3VOU A;  5CBF A;  1OCC C;  4PA4 A;  4PDV A;  4MTF A;  3E8G A;  5J9P C;  4PA9 A;  4JTD B;  2P7T C;  4J9Z B;  4MW8 A;  4WFH A;  5B1A C;  3ASN C;  3SPI A;  3SPG A;  1K4C C;  3SYO A;  1XL6 A;  3LDE A;  2X6A A;  1P7B A;  3RW0 A;  3SYA A;  2AHY A;  4PDL A;  4MVM A;  3SJQ C;  2HFE C;  5BZB A;  2DWD C;  4RUF A;  3IFX A;  4MVO A;  3HPL C;  4X88 A;  5CBH A;  3F7V C;  4MVQ A;  5EC1 C;  2WLJ A;  5E1A C;  4F4L A;  2WLK A;  3BEH A;  2YEV A;  4R50 A;  2QTO A;  4RUE A;  4HYO A;  4X8A A;  3ZRS A;  2AHZ A;  2Q67 A;  3STZ C;  2WLH A;  1ORQ C;  5EBL C;  2JK5 C;  3OR6 C;  1S5H C;  4RO2 A;  1JVM A;  4EKW A;  3STL C;  4G27 B;  4JTC B;  4PA3 A;  1G4Y B;  3FB8 C;  4KFM A;  4J9Y B;  3IGA C;  3K0D A;  3LDC A;  4MS2 A;  5CBG A;  4TWK A;  3FB6 C;  4GX5 A;  2A79 B;  4XDL A;  3OUF A;  2EIM C;  3OGC C;  2HG5 C;  3T4Z A;  4XDK A;  2Q69 A;  4MW3 A;  2H8P C;  3F7Y C;  4GX1 A;  2WLN A;  3E89 A;  3SPC A;  2Q68 A;  3AG3 C;  4LBE C;  1R3J C;  4PDR A;  4ZBM A;  3LDD A;  1KKD A;  4QE9 A;  3JYC A;  3E8F A;  4MSW C;  1J95 A;  3UKM A;  3KG2 A;  5KUK A;  2HVK C;  4HZ3 A;  4X89 A;  3TCU A;  3ABM C;  4H37 A;  3K06 A;  3E86 A;  4P9O A;  2IH1 C;  5B3S C;  4QNH B;  4BW5 A;  2X6C A;  3OR7 C;  3LNM B;  1M57 C;  2ATK C;  3FB7 C;  5IY5 C;  3E8B A;  1XL4 A;  1M56 C;  2NLJ C;  4WFF A;  3T4D A;  2ITD C;  3SYP A;  4OXS A;  4DXW A;  5EBM C;  4MTO A;  4WFE A;  3T1C A;  4H33 A;  3ZJZ A;  2DYR C;  2HVJ C;  3R65 A;  2QKS A;  4WFG A;  4P9P A;  2HJF C;  5EC2 C;  4LCU C;  3RBZ A;  3X2Q C;  4MVS A;  4CBC A;  4R8C A;  3T2M A;  2EIJ C;  3EFF K;  2ZXW C;  3ABL C;  5KUM A;  2R9R B;  3UM7 A;  4PDM A;  4JTA B;  4MVR A;  4PA7 A;  1R3I C;  3AG4 C;  3RVZ A;  2OCC C;  2KB1 A;  4P30 A;  2WLI A;  4P2Z A;  2BOC C;  2EIK C;  3GB7 C;  1R3K C;  4UUJ C;  2IH3 C;  1ZWI C;  3RVY A;  2EIL C;  4LP8 A;  2ITC C;  2W0F C;  3K03 A;  4GX0 A;  3K08 A;  5EBW C;  2BOB C;  1K4D C;  2WLL A;  3LUT B;  3TET A;  5EK0 A;  1R3L C;  4MVZ A;  3F5W C;  3SPH A;  4XDJ A;  1BL8 A;  2Q6A A;  2X6B A;  3ABK C;  2Y69 C;  3ASO C;  3E8H A;  2WLI B;  3E83 A;  3AG2 C;  1V54 C;  2A0L A;  1V55 C;  1OCO C;  2DWE C;  1OCR C;  3PJS K;  2WLL B;  2EIN C;  3FB5 C;  3K0G A;  1LNQ A;  2WLM A;  4QE7 A;  4MVU A;  4RAI A;  4R6Z A;  3SPJ A;  1OCZ C;  3SYC A;  2ZD9 A;  3AG1 C;  4PA6 A;  5B1B C;  2K1E A;  4G28 B; 
#chains in the Genus database with same CATH topology
 4IHJ B;  2QA4 V;  4R7C A;  5LOV B;  4DR5 B;  5CBF A;  5C8Y B;  3L74 H;  4J10 A;  3SPI A;  4DV3 B;  3JAR A;  2YID A;  3RW0 A;  3SYA A;  3E22 B;  1YDX A;  4UCS A;  2DOS A;  4GLX A;  5H6R A;  2QEX V;  3K3W A;  3W7U A;  1A32 A;  4Z2W A;  4FFB A;  1HW7 A;  3D36 A;  1Q6I A;  3L71 H;  2O57 A;  4JYB A;  4BIO A;  1AR5 A;  2E5L B;  1PNM A;  1SF9 A;  2UU9 B;  1Y74 A;  5FNV B;  1YHQ V;  1KP3 A;  5BXZ A;  2YXL A;  3ZRW B;  1NTM H;  4PEL A;  4UVC A;  3EVK A;  4OGQ B;  1MA1 A;  2EIJ B;  2B1I A;  3TJT A;  2N05 A;  2F4V O;  2XAJ A;  3OR7 C;  4LF8 B;  4DXW A;  1H2M A;  3ZHS A;  1PD3 A;  2ADQ B;  5BMV B;  1S77 D;  3RYC B;  3CRC A;  2Q5Z A;  1Z2G A;  1PPJ H;  4JGS A;  4DV7 O;  1DF4 A;  1SS3 A;  4LF4 O;  4ICG A;  4FFK A;  4JV5 O;  4LFB O;  1HNW O;  2EIL C;  2W6J G;  5JCO A;  5EIB D;  1TAE A;  4DV5 O;  3F5W C;  1O9H A;  1P84 F;  3VBB A;  1AJN A;  4DV2 B;  4X1Y A;  4DK1 A;  2IBZ H;  4JI2 B;  5KA6 A;  4ZHQ B;  3K5O A;  1N34 B;  4K0K B;  1Y4M A;  4DUZ B;  1JQ0 A;  1T5E A;  3DXR A;  4O2A A;  2ZM6 O;  2P5O A;  2AXT Z;  1QLE C;  3FKS G;  4CH6 A;  2W0X A;  2ZIM A;  3O9O A;  4UVB A;  4FJC C;  3H1J H;  4YY3 O;  4JTD B;  1ARO P;  4TT3 G;  1MSD A;  2FML A;  4FM2 A;  1VQM V;  1VQ5 V;  2JEX A;  5JJJ B;  4GZR B;  3UO2 A;  3BAA A;  3F7V C;  4DR5 O;  3B8M A;  4D6T H;  2VQF B;  3AG3 B;  4WFA V;  1YZB A;  3JD3 A;  2QWO B;  4X1K B;  1RSO A;  1NZ6 A;  3S3X A;  1XHX A;  5LA6 A;  4A5U B;  4UV8 A;  4FLZ A;  4KXR A;  2UXD B;  1GRJ A;  2F66 C;  2WSS G;  2YEV B;  3OMN B;  4DR2 O;  4IIJ A;  2HEP A;  4JYY A;  1AI4 A;  4TUY A;  2JGU A;  2LGW A;  4FLV A;  3SPC A;  1B06 A;  3LDD A;  1I94 B;  1M90 W;  1H2L A;  3B2E E;  2ZDI C;  4I0X B;  3ABL B;  2F23 A;  2IH1 C;  3S3W A;  4WFB V;  3EXA A;  1Q82 W;  3UO3 A;  1RM1 C;  1XOU A;  2P4V A;  1D5A A;  2OCC B;  1R73 A;  1M56 C;  4FPP A;  1I5Y A;  1GAX A;  3R65 A;  3CCL V;  4MVS A;  4LF8 O;  3EFF K;  2F43 G;  2IU0 A;  4DV4 O;  2F93 B;  4NVP A;  2MW2 B;  3CYO A;  1NS1 A;  3LNN A;  1HNZ B;  1MZF A;  5JJE B;  2RDC A;  2OYQ A;  3K08 A;  2UUB B;  3FAV A;  2H94 A;  3BAB A;  5D5P A;  1YIT V;  2DQ0 A;  1M93 A;  4FM0 A;  5HFM A;  1QQC A;  4JI8 B;  1P7G A;  1SZT A;  5LXT B;  3IAY A;  4BR6 A;  3KKY A;  4HNA B;  1NI8 A;  2DMX A;  3WG7 C;  5CA3 A;  4GYC B;  4DV2 O;  4DV1 B;  4JI2 O;  4BIZ A;  2QJ1 A;  1JFF B;  1N34 O;  2GV9 A;  5EZY B;  4O2B A;  1MOF A;  3IFX A;  1FFT B;  1DK1 A;  2FTK A;  3BEH A;  3CMA V;  5KHH A;  1VAR A;  1SC5 B;  5LGU A;  1ORQ C;  1IBL B;  4LNU A;  5JVD B;  2B1G A;  1PM9 A;  4JTC B;  4KFM A;  1SQX H;  5LMU B;  1GO3 F;  2HG5 C;  3JAW B;  1N4C A;  4GX1 A;  4W4L A;  3UKM A;  3KG2 A;  4DR1 O;  5BR8 O;  2UXD O;  4DR7 O;  3SJA C;  1NJI W;  2ZR3 A;  4UXN A;  5IY5 C;  4TV8 A;  1VMG A;  2ETN A;  2YI9 A;  1I94 O;  2F95 B;  3C90 A;  4JF3 A;  3A2F A;  1VQ8 V;  5EC2 C;  4B3T O;  4UCU A;  2BCC H;  3OFN G;  5C8Y A;  2LO1 A;  3F5T A;  1VF5 B;  1FXK C;  4JI5 B;  3CHX A;  4H13 B;  3E22 A;  3AG1 B;  1FXH A;  4B3M B;  5IYZ A;  3JAS B;  3CJH A;  1XHZ A;  1BL8 A;  1N0J A;  2EUL A;  1IBM B;  2QWN B;  1SER A;  3TK1 A;  4JAA A;  2A0L A;  3UT5 B;  1HNZ O;  1CPY A;  1SA0 B;  3FB5 C;  1M9N A;  2UUB O;  2WAM A;  3QTC A;  2QSA A;  1RPR A;  4YIO A;  3HB3 B;  4G28 B;  1GM8 A;  2YXH A;  5JJN B;  3SYQ A;  1OCC C;  1PL4 A;  4X20 B;  3BY6 A;  2CGO A;  3WFV A;  4FM1 A;  2CH7 B;  1EFR G;  4DV1 O;  1D5N A;  4RUE A;  2UXC B;  1KU9 A;  4HYO A;  2Q67 A;  1E79 G;  3GWO A;  4KHP B;  1G1X B;  1GK9 A;  2QWQ B;  1NBM G;  5F2V O;  5IDJ A;  4F6R B;  4X62 B;  3BCC H;  3IGA C;  1YTF D;  3ZMZ A;  1VQN V;  1W59 A;  3FD9 A;  1O9G A;  4X66 B;  2WLN A;  3X2Q B;  4O4I A;  3P3N A;  3K5L A;  1FS0 G;  3MD0 A;  1WPX A;  1ZUQ A;  4X1I A;  2QM8 A;  5ITZ A;  4NXN B;  4GUN A;  1B04 A;  2YIB D;  4NTW A;  1XDC A;  1IBK O;  1N33 B;  4GKJ B;  4BIU A;  1K5Q A;  1E1Q G;  3OE7 G;  4LFC B;  1KC8 W;  1LR1 A;  1WA8 B;  4O4J A;  4JI4 B;  2K9P A;  3D36 C;  4QJF B;  5LBQ A;  2YIC A;  3P3P A;  5LHI A;  2XAG A;  1V55 B;  1ZX3 A;  3A0R A;  4DRX B;  1KYO F;  3IJ4 A;  4PA7 A;  5DM6 V;  3JD4 A;  2EIK C;  2FL4 A;  3QO8 A;  4LP8 A;  3KZI Z;  1W2B U;  2BTQ A;  3ABU A;  2D3O W;  3VQX A;  2ADP A;  1HWY A;  3ABK C;  3H1L H;  2AZ0 A;  1S0V A;  1JMK C;  4JI5 O;  2C2A A;  4B3M O;  5LMN B;  1V54 B;  1Q90 D;  3B8N A;  2EIN B;  2PGG A;  3RWR D;  2XHB A;  4J7K A;  1OZ0 A;  2BE3 A;  4YJ3 A;  3BPZ A;  2A9H A;  2JRI A;  2PZS A;  3AG7 A;  3BFR A;  3JAK A;  4N23 A;  4PA9 A;  1JA8 A;  4J9Z B;  3ASN C;  3SPG A;  2ZT9 B;  2CGN A;  3RYH B;  5CBH A;  1AP5 A;  2ODM A;  3OD4 A;  2WLJ A;  4HAM A;  4X8A A;  2CAZ C;  1GKF A;  2CDY A;  3ML0 A;  2AGA A;  4UB8 Z;  3E2E A;  3T1H B;  1YI2 V;  1MSW D;  5CBG A;  4U3J A;  5EYP B;  1WP7 A;  2EIM C;  3TXS A;  2DN9 A;  2RMK B;  1YVW A;  2XAQ A;  3JAT B;  4LC1 A;  5KUK A;  2Q7H A;  3CXH F;  3K06 A;  3B40 A;  3N27 A;  3QVN A;  5LP6 B;  1XRE A;  2AW9 A;  3E8B A;  4X66 O;  1US6 A;  5B3S B;  1EN5 A;  2F4V B;  3RGB A;  1D2D A;  2HJF C;  3GWK C;  4NTY A;  1Q3E A;  2BSK B;  4NXN O;  1FXK A;  3CRM A;  3CSX A;  3E35 A;  4FLT A;  4LFC O;  1FFX A;  3RVY A;  2IH3 C;  5GON B;  2E74 B;  1UJW B;  1HP8 A;  4NR1 A;  1AP6 A;  1K34 A;  3C3T A;  3N2G B;  3HKC A;  4LF4 B;  3ZMV A;  1N36 B;  5LHG A;  5CMU A;  4LFB B;  4QGP A;  1OCO C;  1HNW B;  1MAB G;  4B3S B;  5H2F Z;  1QVG U;  1Q43 A;  4AI8 A;  4DV5 B;  4JI6 B;  2RCV A;  3JSN A;  4PI0 A;  1EN6 A;  1R1B A;  1W0J G;  4MTG A;  1YTF B;  3MHH C;  1BHB A;  3TGU H;  5B1A C;  2ZM6 B;  1K97 A;  4I7Z B;  1DGS A;  5DED A;  1TUB A;  1AI6 A;  1GN3 A;  4IT5 A;  1VQ6 V;  4LFA O;  4L8J A;  1QVF U;  4YY3 B;  2WLK A;  4R50 A;  2QTO A;  2Y4T A;  1VP7 A;  1S5H C;  4FZ1 A;  4NXM O;  2XND G;  4K8X A;  2N04 A;  1EN4 A;  3CWB H;  3K0D A;  1L0L H;  2VRZ A;  2OIG A;  1N0N A;  4CC5 A;  2X7R B;  2Q68 A;  4KL1 A;  1KKD A;  2P90 A;  1H8H G;  4DR2 B;  4AQY O;  3T1H O;  3ZCC A;  1IXB A;  2JS3 A;  3H9V A;  1F51 A;  1NR1 A;  4P9O A;  3M8A A;  2QKC A;  2M7W A;  4BW5 A;  1SZX A;  1SKV A;  4LWS A;  3FB7 C;  4I50 B;  2NLJ C;  4ABM A;  3OTF A;  4JAS A;  2HKO A;  2CTW A;  2JDI G;  4ZI7 B;  3T1C A;  3ZJZ A;  2DYR C;  2YSU B;  1FPO A;  4K3A A;  4OX9 B;  3UM7 A;  3FYI B;  1TVK B;  3AG4 C;  4P30 A;  2WLI A;  4P2Z A;  3RFR A;  1J5E O;  4JI1 B;  1WP8 A;  5FL7 G;  2B9Z A;  2BOB C;  1K4D C;  3LUT B;  3L70 H;  4DV4 B;  1QLE B;  2WWW A;  5B1O A;  2DJV A;  1K3E A;  1BZK A;  4W4K A;  3ASO C;  2GTS A;  3AG2 C;  2PI4 A;  2PI5 A;  2XAS A;  2DWE C;  1LNQ A;  1M4U A;  4QE7 A;  4UCT A;  2JGD A;  4MVU A;  3JAL A;  5FLX N;  1N36 O;  2K1E A;  1OJH A;  3OW2 U;  1SET A;  1SQV H;  2V1D A;  4B3S O;  4Q6G A;  4PJ0 Z;  5L3E A;  5CA1 A;  2ZKO A;  2GSM B;  4DYL A;  5IJ0 B;  1K8A W;  4JI6 O;  3SYO A;  3B09 A;  3SJQ C;  3APQ A;  4JZ2 A;  2DWD C;  4RUF A;  3M7M X;  1K73 W;  3CE2 A;  5E1A C;  4RQE A;  3ZRS A;  3U10 A;  5KAI Z;  3Q4H A;  4XBF A;  4PA3 A;  1GN4 A;  2W6I G;  3N2K A;  1R6T A;  1RM1 B;  4L87 A;  4DRX A;  2ZQM A;  1WPB A;  4XDL A;  2Q69 A;  5K1P A;  3ZN0 A;  1UPG A;  4UCR A;  4FLY A;  2D2C B;  2P6J A;  3LSS A;  4DW0 A;  3NXS A;  3CS5 A;  4LF5 B;  5LHH A;  3H01 A;  1M57 C;  3CRA A;  3WB0 A;  3CCM V;  5JH7 A;  4DR1 B;  1VEW A;  5BR8 B;  5H9C A;  5J2T B;  4DR7 B;  2FYU H;  5BY1 A;  3SJC C;  4WFG A;  1DTO A;  3CD6 V;  2KQX A;  4K8Z A;  5KMG B;  2KG7 B;  4R8C A;  5LYJ A;  1JPX A;  2XUM A;  5KUM A;  3CC4 V;  2XAF A;  5J2U B;  4I4T A;  4YIP A;  3P32 A;  1NVP D;  2BOC C;  3CRQ A;  3GB7 C;  1Q6H A;  4YJ2 B;  3CCQ V;  4B3T B;  3KCY A;  3A0H Z;  4FMT A;  2QE7 G;  4MVZ A;  4OX9 O;  3B4S A;  5DN6 G;  2WA4 A;  1WB7 A;  4KP4 A;  3E8H A;  1XEQ A;  2WLL B;  2GUZ A;  5C93 A;  4JI1 O;  3RYI B;  4R6Z A;  1XQ8 A;  3SYC A;  4NKG B;  1PV0 A;  2NN4 A;  5CB4 B;  4I9W A;  2DYS C;  2NNU A;  1EM1 A;  5KHK A;  4I55 A;  1YJW V;  1HNX O;  4ZIB A;  2JIZ G;  3I5D A;  4J11 A;  2IJK A;  5KHI A;  1B6Q A;  5LGT A;  2HFE C;  3O65 A;  4WBN B;  1PKX A;  2YIA A;  1KKC A;  2ZIN A;  2EX3 A;  3FYE B;  1TUE B;  1B3Q A;  5IJ9 B;  4CH5 A;  1KBH A;  3OR6 C;  3I55 V;  1V9P A;  1XMO B;  2KKW A;  3BRC A;  4LR3 A;  4O4H B;  3ZHR A;  1CEZ A;  1L8D A;  4MW3 A;  4DR3 O;  1JJ2 U;  1WJZ A;  4X9Q A;  5K1X A;  4EB6 B;  3ZED A;  5JQG B;  2UUA B;  3ETQ A;  3ABM C;  4OPA A;  4PD4 F;  2ZNI A;  3C3S A;  3K59 A;  2Q73 A;  3W7T A;  2EJ7 A;  4WFF A;  3T4D A;  2UXB B;  1BQ0 A;  1KQS U;  2A7W A;  1ZSP A;  1XBL A;  5E79 Z;  3K5M A;  3ZMT A;  3DC6 A;  3K9A A;  5CA0 B;  4JYA O;  4LF5 O;  4TV9 A;  1IBK B;  2EZO A;  2JVD A;  1ZL8 B;  2ZXW C;  4K35 A;  3ZBH A;  1WN7 A;  4LF9 B;  3ZS8 C;  3G6B A;  1QR8 A;  2H3O A;  1R3K C;  3HKE B;  2OTL V;  4F6E A;  3VQY A;  3HKD B;  3HKB B;  1U97 A;  2X6B A;  2Q9L A;  4DR4 O;  4ASU G;  5KX5 B;  4CZZ A;  1YCI A;  3OEE G;  1IVS A;  4IHJ A;  4DV6 B;  2Y69 B;  5LOV A;  3BA8 A;  2E76 B;  4IL6 Z;  2P67 A;  1BE3 H;  4U3F H;  4LF6 B;  3ZMS A;  2LP7 A;  1Y76 B;  3JD2 A;  3SDL A;  2UXX A;  3E8G A;  4O4L B;  1HDJ A;  2QDO A;  3ICX A;  3CC7 V;  1XL6 A;  2AHY A;  4MVM A;  2VWK A;  1NR7 A;  4MVO A;  2UUC O;  3JAR B;  3J81 N;  3STZ C;  3G4S V;  2CTP A;  4EKW A;  3WU2 Z;  5FNV A;  1S3J A;  3ZRW A;  3OUF A;  2H8P C;  1XMO O;  3L75 H;  4FFB B;  4RWU A;  4MSW C;  2Q7E A;  4EEQ A;  2YS8 A;  5EIB C;  1NVP B;  3OAA G;  3WB2 A;  4DK0 A;  4DR6 B;  1L0N H;  3MAQ A;  5BMV A;  1Y6X A;  2R70 A;  3RYC A;  3ZHT A;  1Y74 B;  4TQF A;  2EIK B;  4OXS A;  4MTO A;  1YIJ V;  2UUA O;  3J7A U;  3JSL A;  4U7N A;  4UFZ A;  1Q5O A;  3RN4 A;  1JJO A;  2UXB O;  1WNS A;  2ZE5 A;  4NYK A;  2FKX A;  1PNK A;  5H5N A;  1VQP V;  4EFE A;  1BHA A;  3K03 A;  2ZE7 A;  5IYB O;  1OHH G;  4ZHQ A;  1BCC H;  1ZTE A;  4FZ0 A;  4LF9 O;  4QPK A;  3L9D A;  3OMI B;  4DUY O;  2GHY A;  1SRY A;  4RAI A;  3OTO B;  5LL6 Y;  5KAF Z;  1LUW A;  2Q7G A;  3AK2 A;  4X1Y B;  3L73 H;  1H38 A;  3D8C A;  4MTF A;  4DV6 O;  3H1I H;  4UCO A;  1JX9 A;  1VQ9 V;  4LF6 O;  4X64 B;  3ZHQ A;  1KMI Z;  1H2K A;  4PDL A;  4X1K A;  5GW7 A;  2EIM B;  2X0L A;  4G2K A;  2JS5 A;  2YEV A;  5JWP A;  1Q6U A;  2WLH A;  2VWJ A;  4LFA B;  3G67 A;  2IW5 A;  4TWK A;  1XIL A;  4GX5 A;  4FLX A;  3BA9 A;  4I0X A;  2DE0 X;  1RSO B;  3LSQ A;  1W0K G;  4NXM B;  5LA6 B;  3JD0 A;  1KB9 F;  4IIJ B;  1K92 A;  4LF7 O;  2HVK C;  4JAV A;  2LW1 A;  4JYC A;  4B3R B;  4TUY B;  1SQQ H;  4QNH B;  2X6C A;  3LNM B;  2Y0I A;  4J80 A;  4IYI A;  1M5I A;  2Y0P A;  2ITD C;  4AQY B;  5EBM C;  2XOK G;  1I08 A;  3ZN1 A;  4WFE A;  3JD1 A;  4DR6 O;  3W7W A;  1Q86 W;  3NR7 A;  1R6N A;  1OCO B;  1GM9 A;  1JCH A;  1R3I C;  1ZWI C;  3CCJ V;  1K5S A;  2QGN A;  1XNQ B;  2EJR A;  5LXT A;  2GBO A;  2PYL A;  1V54 C;  1J5E B;  4HNA A;  5B1A B;  4CS3 A;  5D5Q A;  2EIN C;  4PV1 B;  3FAV B;  2CTQ A;  3FX7 A;  2WLM A;  1VF6 A;  1Y66 A;  3SR2 C;  1JFF A;  1GH6 A;  1OCZ C;  1OCR B;  2ZD9 A;  2QWR B;  4E4E A;  5EZY A;  4Q20 A;  2PUS A;  2Y4U A;  2CUG A;  4PHZ A;  1NQT A;  4GX2 A;  5B1B B;  4CC6 A;  3G6E V;  3ETD A;  4IGG A;  2P7T C;  3OTO O;  2Q0O C;  5DEC A;  5L3F A;  4CH3 A;  3LDE A;  1P7B A;  1FAF A;  3CME V;  3CXC U;  1VQK V;  5JVD A;  1AR1 B;  3JCU Z;  3HPL C;  3K9S A;  3ABT A;  3TXQ A;  2IJI A;  1F7Y A;  1FJG B;  4O2B B;  1AIL A;  3JAW A;  5CN0 A;  5KA5 A;  2R9A A;  3CCS V;  4AIL C;  4X64 O;  2A79 B;  3DSQ A;  3UQ8 A;  4LNU B;  1BSM A;  4LBE C;  2IU3 A;  1GN2 A;  5IE9 A;  3HKB A;  5LP6 C;  4B08 A;  4H37 A;  3ZHV A;  2M6Y A;  2Q8V A;  5B3S C;  1MNG A;  1XL4 A;  3GVM A;  4YHH O;  2V7Q G;  4H33 A;  1MMM A;  3CPW U;  3RBZ A;  4B3R O;  2XTA A;  1GM7 A;  2HR3 A;  4TV8 B;  3ASO B;  1JR9 A;  3JAS A;  2E75 B;  1XUQ A;  2ITC C;  3UT5 A;  1Q7Y W;  4C7U A;  4CH4 A;  1S5J A;  1SA0 A;  1SQF A;  3UCS C;  2YI8 A;  4JI3 B;  2EIL B;  5GTH Z;  1EZJ A;  2ZE8 A;  3SJB C;  5LGN A;  3THO A;  3VQV A;  5IYZ B;  1VQ4 V;  3CJH B;  4X20 A;  2Q0A A;  1XNQ O;  5B66 Z;  2R9I A;  3KCX A;  1H2S B;  1RPO A;  2CH7 A;  4WFH A;  2WPD G;  2DW4 A;  4TOI A;  2OCH A;  2QM4 A;  3BHP A;  1S5L Z;  2NR5 A;  1ZAU A;  5A9G A;  4F6R A;  1I7F A;  1HNX B;  2JJ2 G;  5EBL C;  3CEI A;  2PTM A;  2OWO A;  1RP3 B;  1M57 B;  1X4T A;  4MS2 A;  3ZHU A;  1THZ A;  2Z3Y A;  1BS3 A;  3A0B Z;  3T4Z A;  2CTR A;  1FJG O;  3F7Y C;  1G8M A;  3E89 A;  2YDE A;  1YEW A;  3AEI A;  3MDS A;  1VQO V;  1Q81 W;  5AG2 A;  4X89 A;  3CC2 V;  5HFL A;  1GN6 A;  1VF7 A;  3E86 A;  2UXN A;  1WA8 A;  2DQ3 A;  4DR3 B;  2A3Q A;  2XAH A;  5B5E Z;  4O4I B;  3P30 A;  4JI0 B;  4RQF A;  2EZP A;  1M56 B;  3LSU A;  3QG5 A;  1K9M W;  1IZ3 A;  4X1I B;  5ITZ B;  1AR4 A;  3ZIA G;  2EBO A;  2EIJ C;  2R9R B;  2MK3 A;  3BVO A;  4D7T A;  4MVR A;  2KSD A;  1NU1 H;  1AI7 A;  4O4J B;  5FPO A;  1XMQ O;  2QWP B;  4JYA B;  3L72 H;  5EBW C;  1QCE A;  4J7Z A;  1MG1 A;  5IYC O;  2DYS B;  2RNB A;  4DW1 A;  1S72 V;  1QU7 A;  4H0L B;  2Y48 A;  3R66 A;  2BTQ B;  3W7S A;  3K5N A;  4TQD A;  4FLU A;  3K79 A;  1ENV A;  3U0Z A;  3DGE A;  2WA3 A;  4JI3 O;  4DV3 O;  4DR4 B;  3K57 A;  2LJ2 A;  1SES A;  2JJ1 G;  3CP1 A;  3RYH A;  3MHS C;  3WG7 B;  1AVM A;  1K4C C;  3D3I A;  3ZRX A;  4YJ3 B;  3JAK B;  4MVQ A;  5EC1 C;  3RYF B;  4F4L A;  1NKD A;  4QIW F;  2QKA A;  2L35 A;  2AHZ A;  5EYP A;  3JAM N;  2JK5 C;  2OIE A;  3ABM B;  2CK3 G;  2HP8 A;  2RQ6 A;  2E5L O;  1G4Y B;  4J7J A;  2P06 A;  2UU9 O;  2UUC B;  4J9Y B;  3JAT A;  1QHT A;  2HJD A;  1ZLZ A;  5LP6 A;  1NH2 D;  3AG3 C;  1R3J C;  2RN9 A;  3E8F A;  4GCZ A;  4HZ3 A;  4U3J B;  1URF A;  2ZXW B;  1R6K A;  1Q8I A;  5TIS Z;  1X59 A;  2BSK A;  2Q4P A;  3FFQ A;  4DV0 B;  5IY5 B;  3QO5 A;  2IJH A;  2HVJ C;  2QKS A;  1DLB A;  4B7E A;  4JPR A;  5GON A;  3ABL C;  3N2G A;  2PF4 E;  4PDM A;  1U96 A;  5FPR A;  4JI0 O;  1G6U A;  2OCC C;  1I5X A;  1YJN V;  4UUJ C;  3A8T A;  1WAZ A;  1IUR A;  2W0F C;  4GX0 A;  3PN1 A;  3TET A;  1FXK B;  4K0K O;  5L3G A;  4DUZ O;  2Z5U A;  1FFX B;  1DF5 A;  1VQ7 V;  2IM9 A;  1FKA O;  2LFR A;  1Z5V A;  1JOY A;  1F4M A;  3K0G A;  3HKC B;  4J41 A;  2XT9 A;  3ETG A;  3RT3 C;  3W7X A;  3CX5 F;  1AB3 A;  2AZ2 A;  2P22 C;  1KD1 W;  1PNL A;  3ZMU A;  4DUY B;  2LGQ A;  1FXV A;  2QR4 A;  3VOU A;  1Z5W A;  2QTS A;  5J9P C;  2VQF O;  1OCC B;  2YIB A;  4TSF G;  4ZOL B;  3AK3 A;  2OT5 A;  5BZB A;  1QNM A;  4EFB A;  2GTA A;  4OPH A;  4NB5 A;  1P4R A;  3ZRV A;  2CE4 A;  1TUB B;  1VF6 C;  3T1Y B;  1MZE A;  4G27 B;  3STL C;  3CCR V;  3CCV V;  1OV9 A;  3LDC A;  1KUQ A;  3CRR A;  2HHH B;  1SQG A;  1N32 B;  4FLW A;  2LW7 A;  4JI7 B;  1K7D A;  4PDR A;  3OEH G;  4I50 A;  4ZBM A;  4QE9 A;  4UCV A;  3JYC A;  1J95 A;  4J42 A;  3IC7 A;  1N8R W;  4ZI7 A;  3OMA B;  1S76 D;  3CB2 A;  2HLD G;  3DTU B;  3H1H H;  1TGO A;  5H6Q A;  4LF7 B;  2JEU A;  4U7O A;  5IWA B;  1EZV H;  1TVK A;  4FK5 C;  4LWS B;  4P9P A;  3QO7 A;  4CBC A;  1NTK H;  2A06 H;  2P4K A;  1WB8 A;  3OM3 B;  2ZE6 A;  4DV0 O;  4GKK B;  1SQP H;  2KB1 A;  3CCU V;  2ZR2 A;  4CS4 A;  4JI8 O;  4BWA A;  5EK0 A;  4I9Q A;  4FVM A;  1L1F A;  3ZX6 A;  2ZIO A;  2Y69 C;  2YUA A;  2WLI B;  3E83 A;  4JZG A;  1BT8 A;  3PJS K;  3QF7 A;  4HBN A;  5IT9 N;  3ABK B;  3M99 B;  1EBO A;  4NTX A;  1QBZ A;  4GT1 A;  2VQE B;  1YSC A;  3HR0 A;  3AG1 C;  1YF2 A;  1F23 A;  5KHJ A;  5IJ0 A;  3OGI B;  1CXZ B;  1H2N A;  2N74 A;  4QPJ A;  4DO2 A;  3OUS A;  3CCE V;  3K04 A;  2JGD B;  1GTO A;  4B7K A;  3JAL B;  5KLV H;  2V4D A;  1NH2 B;  1IBL O;  1VIB A;  2X6A A;  1BGY H;  4WF9 V;  2ZDI A;  4I5S A;  3ASN B;  4UVA A;  5CA1 B;  5L3B A;  3K58 A;  4MT8 A;  1IDS A;  5LMU O;  4RO2 A;  1JVM A;  1ROP A;  2IJJ A;  3VQW A;  1AJP A;  1HR0 B;  3FB8 C;  4BW9 A;  3QNE A;  1RFY A;  4H44 B;  3Q4H B;  4ZKI A;  3DXR B;  4O2A B;  4XDK A;  1VQL V;  2YXY A;  5IYD O;  4D7S A;  3N2K B;  2ZNJ A;  4X65 B;  3T1Y O;  1TA8 A;  4IYH A;  1SQB H;  1YXB A;  1UFI A;  5J2T A;  2HHH O;  1WLE A;  2ATK C;  1N32 O;  2R72 A;  1FD9 A;  4JI7 O;  5KMG A;  2KG7 A;  1H2G A;  5J2U A;  2L6L A;  3U11 A;  4Z1V A;  2G38 A;  3X2Q C;  3H1K H;  4YJ2 A;  4YXW G;  3D3Q A;  3T2M A;  5JH7 B;  2RJZ A;  1XNR B;  2BTO A;  4Z1M G;  4YHH B;  1I0H A;  4E2L A;  3APO A;  1IBM O;  5IWA O;  1OCZ B;  4AHC A;  4KUM A;  5B1N A;  5LYJ B;  2WLL A;  4UV9 A;  3RYF A;  4I4T B;  3WB1 A;  5JCO C;  3RYI A;  3I56 V;  3AK1 A;  4XDJ A;  2Q6A A;  1BQZ A;  5KHG A;  2ZCE A;  4GKK O;  1V55 C;  5CB4 A;  1F4N A;  4LH6 A;  2ILM A;  2QM7 A;  1NTZ H;  4PA6 A;  3IC9 A;  2GUZ B;  2Z0A A;  1IXM A;  4WBN A;  1AI5 A;  4PA4 A;  4PDV A;  1QLN A;  5L3D A;  4PI2 A;  3G71 V;  4MW8 A;  3OT7 A;  2UXC O;  5GTI Z;  1K33 A;  2VQE O;  2B5U A;  4UB6 Z;  4KHP O;  5IJ9 A;  4FIP C;  5A2Q N;  1AJQ A;  4X88 A;  4I55 B;  5L3C A;  4X62 O;  4N21 A;  4CS2 A;  4MTX A;  4O4H A;  2ARH A;  2OTJ V;  3ETE A;  3G80 A;  1KEC A;  1E1R G;  1Y67 A;  4EB6 A;  3FB6 C;  5JQG A;  2GDS A;  3OGC C;  2F1M A;  3DC5 A;  4BAY A;  1GMG A;  1COW G;  1HR0 O;  1N33 O;  4GKJ O;  1M1K W;  3TCU A;  1KP2 A;  1H8E G;  1PL0 A;  4JI4 O;  4DV7 B;  5CA0 A;  1NT2 B;  2PYJ A;  2YC0 A;  3SYP A;  4X65 O;  1ZL8 A;  2E3C A;  4JV5 B;  2LFS A;  1XI1 A;  3SGI A;  4LCU C;  1FYJ A;  4JAU A;  3HKE A;  2VS0 A;  3EHB B;  3J80 N;  2DYR B;  3HKD A;  1P49 A;  4JTA B;  3JCZ A;  1LUV A;  3RVZ A;  4TV9 B;  4ZOL A;  5KX5 A;  3AG4 B;  1CP9 A;  1R3L C;  5LMN O;  3B77 A;  3SPH A;  4WCE V;  1XNR O;  1XMQ B;  2LQT A;  1IX9 A;  1YJ9 V;  1OCR C;  4LH7 A;  1Y76 A;  3AG2 B;  1BMF G;  2PY5 A;  3SPJ A;  1PP9 H;  5B1B C;  4O4L A;  1QR9 A;  2FB5 A; 
#chains in the Genus database with same CATH homology
 2QA4 V;  1SES A;  2JJ1 G;  4R7C A;  3JD2 A;  3CP1 A;  2A9H A;  3MHS C;  5CBF A;  2UXX A;  4N23 A;  3E8G A;  4PA9 A;  3WG7 B;  4J9Z B;  3SPI A;  3ASN C;  3SPG A;  1K4C C;  3D3I A;  3ZRX A;  1XL6 A;  3CC7 V;  3RW0 A;  3SYA A;  2AHY A;  4MVM A;  1NR7 A;  4MVO A;  5CBH A;  4MVQ A;  5EC1 C;  2WLJ A;  4F4L A;  1NKD A;  4QIW F;  4HAM A;  4X8A A;  1GKF A;  2AHZ A;  3STZ C;  3G4S V;  2JK5 C;  3ML0 A;  5H6R A;  4EKW A;  3ABM B;  2QEX V;  2CK3 G;  3K3W A;  3E2E A;  3W7U A;  1G4Y B;  1YI2 V;  4J9Y B;  1MSW D;  5CBG A;  1S3J A;  3D36 A;  3ZRW A;  3OUF A;  2EIM C;  2H8P C;  4JYB A;  1NH2 D;  3AG3 C;  1PNM A;  1R3J C;  2XAQ A;  4LC1 A;  3E8F A;  4MSW C;  1KP3 A;  1YHQ V;  4GCZ A;  5KUK A;  3ZRW B;  4HZ3 A;  1NVP B;  3OAA G;  4PEL A;  4UVC A;  2EIJ B;  2B1I A;  3K06 A;  2ZXW B;  1R6K A;  2XAJ A;  3OR7 C;  3E8B A;  5B3S B;  2EIK B;  4OXS A;  4DXW A;  4MTO A;  1YIJ V;  5IY5 B;  1PD3 A;  3QO5 A;  1S77 D;  2IJH A;  2HVJ C;  2QKS A;  2HJF C;  4U7N A;  1DLB A;  4JPR A;  4JGS A;  3ABL C;  1DF4 A;  1FXK A;  4PDM A;  3E35 A;  2OCC C;  1I5X A;  1PNK A;  1YJN V;  4UUJ C;  1VQP V;  3RVY A;  2IH3 C;  2EIL C;  1BHA A;  3K03 A;  2W0F C;  2W6J G;  5IYB O;  4GX0 A;  1UJW B;  1OHH G;  1K34 A;  3TET A;  1FXK B;  3F5W C;  3ZMV A;  5LHG A;  5L3G A;  2Z5U A;  1DF5 A;  3VBB A;  5CMU A;  1AJN A;  1VQ7 V;  4QPK A;  1OCO C;  2LFR A;  1JOY A;  1MAB G;  1QVG U;  1F4M A;  3OMI B;  2GHY A;  3K0G A;  5KA6 A;  1SRY A;  3ETG A;  4RAI A;  1Y4M A;  3W7X A;  1JQ0 A;  1QLE C;  3FKS G;  1KD1 W;  1W0J G;  1PNL A;  4MTG A;  3ZMU A;  1H38 A;  1YTF B;  1FXV A;  3VOU A;  4MTF A;  4UVB A;  3MHH C;  4FJC C;  5J9P C;  1BHB A;  4JTD B;  1ARO P;  4TT3 G;  5B1A C;  1JX9 A;  1K97 A;  1VQ9 V;  1OCC B;  4PDL A;  4TSF G;  1AI6 A;  5GW7 A;  1VQM V;  5BZB A;  2OT5 A;  1VQ5 V;  1VQ6 V;  2EIM B;  2JEX A;  2X0L A;  1QVF U;  3F7V C;  3B8M A;  4G2K A;  2WLK A;  1P4R A;  2YEV A;  3AG3 B;  2QTO A;  4R50 A;  3ZRV A;  4WFA V;  2WLH A;  3JD3 A;  1S5H C;  2XND G;  3STL C;  4G27 B;  2IW5 A;  4UV8 A;  3CCR V;  3CCV V;  3LDC A;  3K0D A;  2YEV B;  2WSS G;  3OMN B;  4TWK A;  4GX5 A;  1AI4 A;  3LSQ A;  1W0K G;  3JD0 A;  2X7R B;  3SPC A;  2Q68 A;  1K7D A;  1KKD A;  4PDR A;  3OEH G;  4ZBM A;  3LDD A;  4QE9 A;  3JYC A;  1M90 W;  2P90 A;  1J95 A;  1H8H G;  1K92 A;  2HVK C;  3ZCC A;  4JAV A;  1F51 A;  2ZDI C;  1NR1 A;  3IC7 A;  4JYC A;  1N8R W;  3ABL B;  4P9O A;  4WFB V;  2IH1 C;  1Q82 W;  3OMA B;  1S76 D;  2M7W A;  4QNH B;  4BW5 A;  2X6C A;  2HLD G;  3DTU B;  3LNM B;  3FB7 C;  1RM1 C;  2OCC B;  4FPP A;  1R73 A;  1M56 C;  2NLJ C;  5H6Q A;  2ITD C;  4JAS A;  1I5Y A;  2JEU A;  5EBM C;  2HKO A;  2XOK G;  4U7O A;  2JDI G;  3ZN1 A;  4WFE A;  3T1C A;  3ZJZ A;  2DYR C;  3JD1 A;  3R65 A;  2YSU B;  3CCL V;  4FK5 C;  4P9P A;  3W7W A;  1Q86 W;  4MVS A;  3QO7 A;  4CBC A;  1R6N A;  3EFF K;  2F43 G;  1OCO B;  3OM3 B;  2IU0 A;  3UM7 A;  3FYI B;  1GM9 A;  1JCH A;  1R3I C;  3AG4 C;  3CYO A;  2KB1 A;  4P30 A;  2WLI A;  4P2Z A;  1ZWI C;  5FL7 G;  3CCU V;  2ZR2 A;  3K08 A;  3CCJ V;  2BOB C;  1K4D C;  3LUT B;  2H94 A;  5EK0 A;  1QLE B;  2WWW A;  5B1O A;  1K5S A;  1L1F A;  1K3E A;  2EJR A;  1YIT V;  2Y69 C;  3ASO C;  2DQ0 A;  2WLI B;  3E83 A;  3AG2 C;  2PI4 A;  1V54 C;  5HFM A;  2PI5 A;  2XAS A;  2DWE C;  5B1A B;  3PJS K;  2EIN C;  3ABK B;  1LNQ A;  2WLM A;  1EBO A;  3M99 B;  4QE7 A;  4MVU A;  1QBZ A;  4GT1 A;  1SZT A;  1Y66 A;  1YSC A;  1OCZ C;  1OCR B;  2ZD9 A;  3AG1 C;  1F23 A;  2K1E A;  4Q20 A;  4DO2 A;  4QPJ A;  3OW2 U;  3OUS A;  1SET A;  3K04 A;  3WG7 C;  5CA3 A;  3CCE V;  1NQT A;  2V1D A;  4GX2 A;  5B1B B;  3G6E V;  1GTO A;  3ETD A;  5L3E A;  4BIZ A;  2P7T C;  2GSM B;  1K8A W;  5L3F A;  3SYO A;  1NH2 B;  3LDE A;  2X6A A;  1P7B A;  3SJQ C;  1MOF A;  3CME V;  2DWD C;  4RUF A;  3IFX A;  2ZDI A;  4I5S A;  3ASN B;  4UVA A;  4WF9 V;  1AR1 B;  3CXC U;  1VQK V;  3HPL C;  1K73 W;  3ABT A;  1FFT B;  2IJI A;  5L3B A;  5E1A C;  4RQE A;  2FTK A;  3BEH A;  3CMA V;  3ZRS A;  4MT8 A;  5LGU A;  1ORQ C;  4RO2 A;  3CCS V;  5CN0 A;  1JVM A;  5KA5 A;  1ROP A;  2IJJ A;  2B1G A;  4XBF A;  1AJP A;  4JTC B;  4PA3 A;  2W6I G;  3FB8 C;  4KFM A;  3QNE A;  1RM1 B;  4L87 A;  2ZQM A;  2A79 B;  4XDL A;  4ZKI A;  1GO3 F;  2HG5 C;  4XDK A;  2Q69 A;  1VQL V;  4GX1 A;  3ZN0 A;  5IYD O;  4LBE C;  2IU3 A;  3UKM A;  3KG2 A;  2P6J A;  3LSS A;  4H37 A;  3NXS A;  1NJI W;  1WLE A;  5B3S C;  2ZR3 A;  4UXN A;  5LHH A;  3H01 A;  1M57 C;  2ATK C;  5IY5 C;  1XL4 A;  3CCM V;  1H2G A;  5H9C A;  4JF3 A;  2V7Q G;  4H33 A;  3CPW U;  1VQ8 V;  4WFG A;  3RBZ A;  5EC2 C;  3X2Q C;  1DTO A;  3CD6 V;  1GM7 A;  2HR3 A;  4YXW G;  3ASO B;  4R8C A;  3T2M A;  3OFN G;  1JPX A;  5KUM A;  3CC4 V;  2XAF A;  4Z1M G;  4E2L A;  1FXK C;  3P32 A;  1NVP D;  2BOC C;  3GB7 C;  3CCQ V;  1OCZ B;  2ITC C;  3AG1 B;  1FXH A;  4KUM A;  5B1N A;  1Q7Y W;  2WLL A;  4FMT A;  4UV9 A;  2QE7 G;  4MVZ A;  3I56 V;  5DN6 G;  2EIL B;  4XDJ A;  1BL8 A;  2Q6A A;  1EZJ A;  1SER A;  4KP4 A;  3E8H A;  3TK1 A;  5LGN A;  2A0L A;  1V55 C;  1CPY A;  2WLL B;  1F4N A;  5C93 A;  3FB5 C;  1VQ4 V;  2QM7 A;  1M9N A;  4R6Z A;  2WAM A;  3SYC A;  4PA6 A;  1RPR A;  2R9I A;  3HB3 B;  4G28 B;  1GM8 A;  4I9W A;  2DYS C;  1IXM A;  2NNU A;  3SYQ A;  1AI5 A;  1OCC C;  4PA4 A;  4PDV A;  1RPO A;  1QLN A;  1YJW V;  3BY6 A;  5L3D A;  4WFH A;  3G71 V;  2WPD G;  4MW8 A;  2DW4 A;  2JIZ G;  1K33 A;  2IJK A;  2B5U A;  1B6Q A;  4FIP C;  5LGT A;  1AJQ A;  2HFE C;  1PKX A;  3WFV A;  4X88 A;  5L3C A;  3FYE B;  4N21 A;  1EFR G;  1TUE B;  4RUE A;  4HYO A;  2Q67 A;  1E79 G;  3GWO A;  4MTX A;  2JJ2 G;  5EBL C;  2OTJ V;  3OR6 C;  1GK9 A;  3I55 V;  3ETE A;  1NBM G;  5IDJ A;  1KEC A;  1M57 B;  3IGA C;  1E1R G;  4MS2 A;  1YTF D;  3FB6 C;  1THZ A;  2Z3Y A;  3ZMZ A;  3OGC C;  1VQN V;  3T4Z A;  1CEZ A;  4MW3 A;  3F7Y C;  1G8M A;  2WLN A;  3E89 A;  4BAY A;  1GMG A;  3AEI A;  1JJ2 U;  1VQO V;  1COW G;  1Q81 W;  3X2Q B;  1M1K W;  4X89 A;  3TCU A;  3ABM C;  3CC2 V;  1KP2 A;  1H8E G;  1PL0 A;  5HFL A;  3E86 A;  1FS0 G;  2UXN A;  3MD0 A;  1WPX A;  2DQ3 A;  2QM8 A;  2XAH A;  3W7T A;  4WFF A;  3T4D A;  3P30 A;  3SYP A;  1KQS U;  4BIU A;  1K5Q A;  1E1Q G;  4RQF A;  2EZP A;  3OE7 G;  3ZMT A;  1KC8 W;  1M56 B;  2LFS A;  1K9M W;  3K9A A;  4LCU C;  4QJF B;  3ZIA G;  4JAU A;  5LBQ A;  3EHB B;  2EBO A;  2EIJ C;  2EZO A;  5LHI A;  2ZXW C;  2XAG A;  1V55 B;  2DYR B;  2R9R B;  3A0R A;  2MK3 A;  4JTA B;  3JCZ A;  4MVR A;  4PA7 A;  5DM6 V;  1AI7 A;  1QR8 A;  3JD4 A;  3RVZ A;  2EIK C;  1R3K C;  3QO8 A;  4LP8 A;  2OTL V;  5EBW C;  3AG4 B;  1QCE A;  1CP9 A;  1MG1 A;  1W2B U;  3ABU A;  1R3L C;  5IYC O;  3B77 A;  3SPH A;  2D3O W;  2DYS B;  4WCE V;  2X6B A;  1HWY A;  3ABK C;  1S72 V;  1S0V A;  4ASU G;  2Y48 A;  4CZZ A;  2C2A A;  1YJ9 V;  1OCR C;  3OEE G;  3W7S A;  2Y69 B;  3AG2 B;  3K79 A;  1V54 B;  1BMF G;  1ENV A;  3DGE A;  2P67 A;  3SPJ A;  3B8N A;  5B1B C;  2EIN B;  1QR9 A;  3ZMS A;  1OZ0 A;  2LP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...