3AG3B

Bovine heart cytochrome c oxidase in the nitric oxide-bound fully reduced state at 100 k
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag3B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag3B02
1AZBA 2HRGA 3ZX1A 2FTAA 2E86A 4BWUA 1CURA 1NINA 1BQKA 1W6WA 2DWTA 3FU8A 2TSBA 3WNJA 4A68A 1M57B 1JXDA 1KDJA 2XVBA 3IN0A 1AZCA 1PLCA 3PAVA 3PPSA 1E5ZA 5I6NA 2XUWA 5B7FA 5I5JA 5PCYA 4HCGA 4YSUA 3AG1B 4E9RA 2PLTA 2EIMB 2R7EA 1VLXA 4X4KA 3L45A 4AI7A 5A7EA 2CUAA 2FT7A 4K9JA 1SF5A 3NJFA 1JZJA 2AFNA 1L9QA 2VN3A 1OE1A 1F56A 3AG4B 4KNTA 4A67A 2PP7A 1A4CA 3ABMB 2WO3B 3QPKA 2BP0A 1J9TA 5D4HA 4DP1X 4M3HA 1BEXA 1L9PA 3NJGA 5E9NA 3U25A 1AQ8A 2AANA 2ZXWB 1CYXA 3TBCA 3DIVA 1W6LA 1ZV2A 3NYKA 3NJJA 1SFDA 3T6WA 1JZIA 1JXGA 1AR1B 4AZUA 2JFCA 2XX1A 2Q9OA 3UACA 4A2HA 6PCYA 2VW4A 3S3DB 4A66A 4GP5B 1NWOA 1AS7A 2BW4A 1AS8A 2J55A 1ZDSA 5FC9A 2PCFA 2PCYA 4HALA 1AIZA 3FSWA 4E9WA 1NPJA 2YAOA 2HXAA 1E65A 1JZFA 2HX8A 5B7EA 4FA7B 2UX7A 4HCIA 4HZ1A 2FQGA 2UXGA 1M9WA 3QJRB 4NAJA 1GY1A 1IBZA 4BK5C 2PPFA 3FU7B 3N2JA 4TXVB 5IY5B 3T9WA 1AZRA 2J57A 2MTAA 4WTQA 2YAQA 4DP7X 3FYIB 3BQVA 1GS8A 3EH3B 2YAFA 1PAZA 3FSVA 5I5MA 4G7RB 1MDAA 2I85A 4YSDA 1DYZA 2VM3A 5B1KA 3NJIA 5D4JA 4KO6A 4Q89A 2A3TA 1X9UA 3AY2A 3FPYA 3CDZB 1ASOA 4YSOA 5AKRA 2VSKB 5ANHA 2IWFA 1XB6A 5B1JA 2CAKA 4CSPA 2Y69B 4FAAB 3OD3A 2CCWA 1MG2C 1XMEB 2B08A 1NPNA 4DP5X 4BXVA 1CUOA 3ASOB 2QDWA 1AANA 2P80D 4P5RA 3OM3B 5PAZA 3WI9A 3UABA 1L9SA 2PP8A 1WAEA 7PAZA 2YAHA 4DPAX 1GSKA 1EZLA 5I6MA 3JT2A 5D4IA 1BXUA 2OJ1A 1OCCB 2LLNA 4F2EA 3NP3A 3FSAA 4F2FA 4HHGA 1ASQA 1L9OA 1GW0A 5I5IA 2BHFA 2PPEA 4HHWA 1J9SA 1GY2A 3JTBA 2XLLA 1IBYA 1TEFA 3NSDA 2HLEB 4UAHA 2R7EB 1AG0A 1RKRA 3CG8A 1GS7A 2VW6A 2YAMA 2P80A 5I6KA 1JXFA 5B1AB 4A2FA 5B7MA 2BP0B 3SBRA 4G7QB 1KYAA 3T71A 4M4RB 4DP8X 2Y1AA 2ZOOA 5B1JC 1OCOB 3X1GA 2QPDB 2I7SA 2YAEA 1RZQA 1E67A 4YVUA 2X88A 6PAZA 1E5YA 1EHKB 2BZ7A 2BW5A 2IWKA 3TU6A 1NDTA 4UANA 4CSZA 3KW8A 4ZK8A 1X9RA 1WA1X 1ET7A 2PP9A 3FS9A 2VW7A 1AS6A 1J9QA 1OE3A 2YEVB 3FQYA 4GP8B 3X1NA 4HCFA 4AX3A 1XB8A 3SQRA 2UX6A 5TK4A 3V9CA 3EH4B 3ABGA 4N4YB 4NB7A 3QJUB 2N0MA 2TSAA 2AVFA 4BDVA 4P5SA 3V9EA 1PNCA 3WIAA 2GSMB 2BO0A 2UXVA 3H56A 4PCYA 2H5UA 1OF0A 2IDQA 4KO9A 4DP9X 4A2GA 2OV0A 1SHWA 1URIA 3FQ1A 2IH8A 1JERA 4YSQA 3GYRA 3ZIYA 1L9TA 1NWPA 1BAWA 2H47C 3NT0A 3OQRA 3PCYA 1I53A 2DYSB 1SFHA 2BWDA 2J5WA 4G71B 4KOCA 3HEIB 3EH5B 1AAJA 4HIPA 4DP4X 4WKXA 1V55B 1A8ZA 4KO7A 3X1EA 1FWXA 2CALA 1UATA 1HFUA 1SJMA 3X1FA 1M56B 1ETJA 1AACA 2Q5BA 2FT8A 3IN2A 2XXFA 4E9QA 3FYEB 3N55A 4PAZA 4W9ZA 3AG3B 4QLWA 1QHQA 1NICA 2BP8A 3AZUA 2DWSA 4YSRA 3T6VA 4AKPA 4KNUA 2PPDA 2UXTA 3SBPA 2GB2A 2MRYA 2VMJA 8PAZA 2JXMA 1AOZA 1A4AA 4Q8BA 1CC3A 5AFAA 3FSZA 1SF3A 3EF4A 5F7BA 4E9TA 1FFTB 2HX9A 2IH9A 4L0PB 2FQDA 3QQXA 4KOBA 3QJQB 3OMIB 1ASPA 4MFHA 1XB3A 4YSSA 2B3IA 3EHBB 3NSCA 4HAKA 4GXFA 1TU2A 3WG7B 1ZDQA 1JVLA 3ERXA 2YARA 1ZIBA 3FT0A 3T6XA 1KCWA 4BWTA 4AKQA 2WO2B 1IUZA 4DP2X 1RZPA 1ILSA 1W8EA 5I6LA 4RH4A 3MBWB 4A2EA 2IDSA 2DYRB 1ADWA 4W1TA 3G5WA 3SBQA 2GC7C 3QJVB 2QPEB 1BYPA 3OMNB 1NIBA 2XU9A 5B1BB 1WS7A 2BWIA 2J56A 1NIFA 2I7OA 3NJKA 4KO5A 4ENZA 2VM4A 1IKOP 3DTUB 1SDDA 3HB3B 3MX0B 2EILB 5B3SB 1N70A 1OV8A 2HZHA 1NIAA 4N8UA 5F7AA 3TBBA 4BWWA 1A3ZA 5LDUA 2IDUA 4E9SA 3S3CB 4YSTA 1PF3A 2IAAC 5AZUA 1PLAA 1SNRA 2HRHA 1PCSA 4YSPA 3T6ZA 4BDVB 5EHFA 1J5DA 3NP4A 1AZNA 1SHXA 4JHVA 2GHZA 4YVNA 2CBPA 4DP6X 1WA2X 4G70B 3UADA 2ZWNA 2YXWA 3CZUB 4YSAA 2JKWA 3NSFA 3FQ2A 3ABLB 3PAZA 3S3BB 1BXAA 1J5CA 1A65A 2GC4C 5I6PA 5I28A 4F7KA 1ZIAA 3C75A 1BXVA 1TEGA 3S8FB 1MZZA 1JOIA 2DV6A 1BQRA 1J9RA 1GYCA 4E9VA 2IDTA 1PNDA 2OCCB 1NTDA 2IDFA 4AKOA 2QT6A 1KBWA 3D12B 2PPAA 4GP4B 1V10A 2FJSA 2VSMB 3TASA 5I6OA 1MG3C 4KNSA 1HAUA 1JZGA 2NRDA 3PAUA 3X1BA 1KGYE 2RACA 2X87A 1PZBA 2XWZA 3RYMA 1B3IA 3ASNB 3FPXA 1PLBA 1A4BA 3CVBA 3UAEA 3IBOA 7PCYA 2BP8B 4DP0X 4E9XA 1RCYA 3CVCA 1GS6X 4UF7C 1NIEA 2FNWA 3KW7A 1AG6A 1PMYA 2FWLB 1CYWA 1ILUA 3QJSB 3UAAA 1PZAA 2ZONA 2GBAA 4EF3A 3WKQA 2WSDA 2AZUA 3BVDB 3NJMA 2EINB 3IEAA 1HAWA 4YL4A 2FT6A 1BYOA 1OE2A 4E9YA 3PXLA 3ABKB 1QLEB 2EIJB 2FQEA 1JZHA 2BZCA 3NJNA 4BXSV 2XXGA 2EIKB 2QDVA 1KV7A 4G72B 3FU9A 4QKTA 5I26A 2XV0A 1PZCA 1OOWA 3ZDWA 2DY2A 1DZ0A 1ID2A 3CVDA 5TK2A 3FU7A 3S8GB 2YXVA 2YQBA 1L9RA 1OCZB 2XV3A 3OMAB 3PLYA 4YSCA 1MZYA 1AZUA 3AW5A 1KDIA 1OCRB 1JVOA 2CJ3A 2IWEA 1T5KA 1E30A 2H3XC 2YAPA 2AZAA 3H4FA 1FA4A 3NJHA 1SDDB 4YSEA 1JZEA 4JKNA 1NIDA 1KBVA 3CDZA 3NSYA 3ZBMA 4JHUA 4GY4A 3WNIA 3GXUB 3WKPA 4DPCX 9PCYA 1NZRA 1R1CA 2GIMA 2PPCA 2FQFA 3NJLA 2UXFA 1ZPUA 3QJTB 1ET8A 1QNIA 2HX7A 4DPBX 3X2QB 1BQ5A 1GR7A 1KCBA 3AG2B 2XV2A 1N68A 3TA4D 2XX0A 1V54B 3DKHA 4A2DA 2W8CA 2XYBA 3UGEA 3GDCA 3IE9A 1WA0X 4GYBA 2GI0A 1IC0A 3H4HA 1YLBB 4G7SB 1PY0A 2W88A 1TKWA 1WS8A 1ET5A 4NERA
chains in the Genus database with same CATH superfamily
5DZNA 1R24B 1FRGH 2W0FB 1CURA 2DWTA 1BQLH 1WN7A 1A66A 2ZCZA 3CTTA 4PYGA 4PUBH 1SJXA 5BMFH 5E4EB 3PAVA 4BK5A 4DKAA 2XUWA 3FF8A 1G9MC 3NDYE 2YDEA 4NRZA 4NYLB 3THOA 4UV8A 2A77H 2XNDG 5D1QC 3FT2A 1FLTX 2Z9TA 1CL7H 1UACH 4ODTH 2O5YL 4PJ5D 4YDIH 1EBOA 1KXVA 2FZ3B 3DIDA 3FHAA 4R5VA 4PVNA 3N1FC 1J9TA 1LEKA 2YUXA 4QTHB 3C8KB 4MNGA 4F6RA 4J3WA 3IJEA 3IJ9A 3H1HH 4LF3A 1XF1A 5MI0C 2DM4A 3CFTA 3GMQB 3D08A 2IIJA 3IDJA 5E8NB 4NQVA 2AHZA 4JM2D 1N0XH 4G2KA 4LCCA 4XZUB 4S0HA 3B56A 1IEHA 3BVNA 4J3OH 2JIXA 1UA7A 4GKZA 4P2QE 3RYIA 4OGXH 4P2QB 4HALA 1QD0A 1YEFH 3MRMB 3ZRWA 1AIZA 3FSWA 3GLEA 3QFJB 2YAOA 3ARGA 3EDJA 1SEQL 4AQ1C 2FEDD 1AIFB 3D3VE 4HXBL 2Z93B 3B9AA 3D3VB 3QJRB 4PRAB 4M29A 5LXGL 3VD1A 2E5LO 4NNYA 4F58L 4PW3A 2IJHA 2B39A 3AFLA 3OMZA 2IJJA 3VXMD 2PPFA 5JZ7C 4Q9RH 4XOBA 5LMUB 1A1NA 3IMUA 1OL0A 3EYSL 1WLEA 2L04A 5DJ2A 2XPZA 3Q6GL 5DUJA 4YXHH 2KS0A 2ESVD 3DETD 1KPUA 4H0IA 3KYNB 2GW5A 5ETUB 1MDAA 3ECVA 3WN6A 4PW9A 2ODHA 2F19H 1S4IA 1UADC 4N1EA 4AQOA 2A3TA 1QO3A 5AWNH 4DCQB 2RQEA 3JALB 2N1KA 3QZWA 2IWFA 5AOKA 3QRGL 3BIKA 3SGKC 4AWJC 1BMFG 3AUVA 1U2CA 4ZBJA 3ZEDA 3EUUA 1NKOA 2B08A 2ARJA 3LPPA 3ZDZF 3JTSA 4ZFGL 1ZT7A 4E5XA 4NJ9L 5DK3A 3ARDD 3GSVB 1G1OA 1Z1WA 4QGTA 3T3MF 2YAHA 1G9HA 5FO8B 2H3NA 5BR8B 4YJ3A 4NQDE 4OLWH 4NQDB 3VFTB 2UWEF 4WEMB 2CJUH 2E8ZA 2JTDA 3KH4A 1MNUL 2A73B 1KT2B 3E1F1 4DUVA 3QAZB 1WAAA 4HHGA 3V0IA 4Z1MG 1WD9A 3CN3A 3VWJB 4O4HA 1DSWA 1I7TB 1LNUB 1U8KA 5KZCB 3SOBL 5I2IB 2AZ0A 1BJ1J 1I7UA 2I07A 3NSDA 4FRWA 4HIEA 3T77B 3DX3A 4H4NA 2Y5EA 3QEUB 4UAHA 1G6RH 4LSSH 2BSCA 5GS1C 1NGZA 1RMFH 2C9XA 2Q8BH 2ZX8A 4OUOA 1D9KC 4Z7NE 4MJJA 5JLZB 4ZUTA 4XB7A 4X42A 1BDYA 4QXUL 1YYCA 1CL7I 3MRNB 1AP2A 2JGUA 4LF9B 4G7QB 4O2FA 5T5FA 4PEEA 2IGFH 3QZOA 3GIZL 5I1EH 1MCHA 2QR0A 3MACH 2DYSC 2JIXD 4DP8X 3O6FA 5EOQH 2CBQA 1XGYL 1LWHA 3CCSV 3QZPA 1MHHB 3X12A 1TUBA 1HDJA 4WWKA 2R2EA 3DX8A 3OG6B 1NC2A 3MHHC 1MCRA 5HHNB 3S34L 3SGJA 1KTLA 5LKNA 2OR9H 3TU6A 4PJDE 1LHZA 3M1OA 3SGDH 3PE9A 4ABWA 4S1RL 2Y3NA 4OFVA 3PYCA 4LAJH 5E2WH 5EB9A 3QC5X 4N90D 2WA3A 4XGZB 1CTMA 5EZPA 2DQUH 2VXQH 2FBOJ 1IEBB 1M6OA 3PL6C 4UCOA 3SYAA 2P4KA 1Q4NX 5H37G 4CRPA 2A0LD 1A64A 2KC0A 3FU0A 4YE4H 2BY3A 5F9OL 2PCPB 4DNLA 3IDNB 4KHPO 3MCKA 5L4IA 1QQCA 3TO2A 5G4MA 2CHDA 4DR5B 2EIZA 1RURH 3FUNA 3GXDA 4LVHC 4NN7C 2XWDA 4BDVA 1R3JA 4Y1SA 1YNTA 3ORJA 5JIDA 5KVFE 4JDTL 4IKNA 1I0HA 5CWSA 1Q3EA 3MNZB 3SE9L 5TISZ 4MJ2A 3C6LC 2VDNH 2ITFA 2YMOA 4FXKA 4JI1O 1WJ3A 2NX5E 2NZ1A 1Q9WA 2Z0BA 2NX5B 2XZZA 3G7TA 3D18B 4LDCA 5H2BA 1JERA 4NJAL 4U4IA 2BHZA 4J4PC 5ISZB 4DV4B 1P5UA 3E80A 3TPKA 1MNGA 3L5WB 4POUB 5D1QE 5GISH 3RWFB 3S2CA 1T5WB 4OZFH 4JY5H 3VCLB 1X5JA 5G55A 3X17A 4LLDB 2IOMA 2FCBA 1KTKE 3QQNA 1UT9A 1D5ZB 4QF1A 2HJLA 4WK0B 2YN3A 4BH8A 5AAPA 3EH2A 3IN2A 2G30A 2OMXB 2OMWA 2VKWA 2X0UA 2D3NA 3KPNB 3P0YH 4MWFA 4PBDA 4WQOA 1E9OA 4NT6B 4WK4B 43CAB 2O57A 3L4CA 4JO4H 2CK0H 3REVB 2V4LA 1VQNV 4LLVB 1NEZA 4AM0A 5CBFA 1Q1JL 3GKZA 4RZCB 4F7PA 1JZ7A 2DWSA 4O9HL 4AKPA 2D7OA 1IGCL 2I60L 2DWEB 4LQ1A 1KCSL 3K08A 3ZMVA 4PRNA 5MI0B 3TFKC 3W39B 4XCYA 2E7MA 4WCYL 3UTSA 2Y7MA 1NLBL 5B3SC 5GSVA 1M4UA 1C12A 4JAUA 4W93A 3EF4A 5L3GA 3LZLA 4OLZH 4TPRL 4S0SD 1NM4A 4ZS7L 5IQLA 3ZHVA 4RIRA 2IVFC 3T0BA 4E9TA 1SM3H 5EUOF 2ZXEB 1GJUA 4OZHA 1S78C 1MF2H 2VMCA 4DH2A 3LSSA 4UYPA 3KM2A 3O6FD 4P23A 2MHAA 4XN4A 4L4VE 4BFJA 1ZSDB 1NTKH 4U1GB 2DQDL 4WWKD 4P57B 5IMKB 4GX2A 1HQ4B 1NC2D 3ABUA 5LMNO 4PV1B 1ZDQA 3ERXA 3PJLA 1W72A 2ICEC 4DF9A 4UNTA 3QG6A 2CCLA 3KCXA 1RJZB 2G4GA 4I77L 5L7XL 4QRUA 2YGOA 1A6WL 4JVWA 4IBVA 4IGBB 2XTLA 3ULVH 3CC7V 2O26U 5IB3A 2EC9U 4AHCA 4XH2A 5FYJU 3F3HA 4PELA 1ADWA 3BLPX 3QI9C 1C7TA 1KPVA 2LABA 2P3YA 1LYQA 1GHFH 1B4RA 3CC5B 5E4IA 3M45A 4N2BA 1BFSA 4R5XA 1M9SA 2Y7QA 2CIIB 3ASNC 2WTOA 3SGDI 4CNIA 3JWNH 4PGJA 5L88L 1FO0H 3VFUB 4D7SA 4EKWA 2DLTA 1BIHA 2AV1B 3QNXA 4PCSA 3HB3B 2OMNA 3CSYB 2CUMA 3U46B 1DF5A 2DQTL 5TTRA 5F7AA 2HZHA 5HDLA 4LNUB 1X7SA 4FJZA 1YA5A 3MRGB 3LYRA 4GT7A 4A7UA 1LP9E 1PF3A 3GTNA 3WTVA 3ARED 1E6JH 4GKSB 2MQCA 3T6ZA 3T0EE 1DVXA 1SBBA 3OKEA 4I3SH 3T0EB 1J5DA 2BMKB 5IR1A 1TIUA 4UAOB 1LK2B 1OAXL 3TGUH 1IGFH 3VSVA 3FTSA 4OD1H 4B3RB 2PO6D 3B9DA 3VXRE 4FVMA 3HAEH 3A6OA 3HE6D 5FUZL 4FQCH 3VXRB 3FQ2A 1CS6A 3O9WC 2QGCA 4QY8A 1XMWA 4OLUL 1R24A 4Y16C 3E2EA 1GGYA 2F5AH 2O5XL 2W0FA 3P11H 3F6IA 3RTQC 1BG9A 4ANUA 1GCYA 3UMNA 4RA3A 5HDQL 1YZZA 3TZVC 3RNQB 1J0JA 3JD0A 4QCIB 4R8WL 5CJBA 1ZLVH 1S9VB 2OCJA 1L4IA 4FZ8L 2BIHA 2WAHA 1D9KB 5J6SA 4K15A 4KRMB 2IANB 1PVHA 2AZ2A 3TASA 2V7HB 1BCCH 1NMCC 4NYLA 4CH6A 5I82A 4L18A 1ZLWK 4WENB 3P02A 3QWNA 3HBQA 2J8UF 3LPFA 3TYFB 4FHJA 4M8VA 2KMWA 4AVIA 2FZ3A 4PLOB 1ZANH 2VZOA 3IAGC 2EVIA 2NXYC 4QTHA 3C8KA 3I9IA 4P23D 1GC1C 3IDMB 5D2LF 2A9ML 2VL5B 5L4FA 2EE2A 4WFAV 4PWJA 2CZNA 3I56V 2YPVA 4QRPB 4K7PL 4RMTA 4W9DC 1GGCL 1AJNA 1SZTA 4YHHB 1R3IL 3P69A 2ENPA 4UB0H 3GMQA 1SUJA 3GZKA 4EI5C 4F2ME 2CKBL 3DX6B 1U4EA 3U0WL 3VGBA 3GLDA 4XZUA 1UG9A 2WXIA 1XZWA 1I8MB 4B41A 2QLYA 9CGTA 2VZTA 1TU2B 4YX2L 1FAIL 3ULAB 3EXJA 3O11B 3O6MH 3FRUB 1KEMH 3EO9H 1FFNB 4P2QA 2F5BH 2WANA 1Z2KA 3MRMA 1YXBA 3A67H 3AADB 3B3IB 4P9PA 3T0XA 1HJCA 5LOVB 3QFJA 3GD1C 5TQ0L 4QD2E 2ZWKA 1FG2B 4ZI7B 4V1DA 1AIFA 4TQIA 2GV9A 1D7DA 2VN6A 2Z93A 3D3VA 4IDJH 1IX2A 4JREC 3BAAA 3G80A 4PRAA 4QRRD 1LDPH 4ZS6D 5JOPE 2ODIA 1S6NA 1F1AA 4N85A 3WU2Z 5C07E 2E7LC 4UZSA 3WFEL 5C07B 3W11C 3ARSA 1JX9A 1E50A 1JVOA 5D4QA 5B39B 4GUQA 3KYNA 5ETUA 2IJKA 1JI1A 1NKGA 3H4FA 1XTLA 4NGHH 3WELA 1URZA 3S37H 4A6YH 2N74A 1XBLA 3BHPA 3FO1B 3K6IA 4DCQA 3UBXI 3JALA 4OCRL 4AMWA 2O93L 4WEBL 1BVNT 5GGVH 9PCYA 3IFLH 4JI7O 1JGDB 2HH0H 3RYCB 1PGRB 1KWKA 4B7IA 2AJYH 2ZCEA 1BFVH 4AMXA 3HTLX 3H1JH 3CVHH 4XVUD 1RUML 1NVPB 4JJOA 1IM9B 3GSVA 4WTWA 4YLQT 4D8PB 4JE4B 4MQ7B 4L5FE 3D69B 3U9UB 3K2MC 5FO8A 3GB7C 1E2ZA 1VHPA 4JO1H 1U2HA 3L4WA 3U48A 3R65A 4NQDA 3VFTA 2CSPA 3N0PB 1PPIA 3EBAA 3MOQA 3D33A 3QNYB 1PZDA 2JKSA 4FQXB 2A73A 3GJFH 4JN1H 4AC4A 4ZFFB 2UXDB 2NCEA 1IQWL 1XIWC 3A47A 3L3JB 4A68A 2WLKA 4TT3G 3ULVF 2XVBA 1MW3A 3VWJA 2QQLH 1FFQA 1I7TA 3ZMNA 1LNUA 2IAMB 3K6DA 5AEAA 5JOEA 5I2IA 2D8KA 2GVYA 1CFNB 3V0GA 1ZXKA 12E8H 3T77A 2BVPB 2N7SA 3QEUA 4RETB 5TF0A 5GZNC 2CR3A 4Q74A 1NL0L 4YK4B 5K9KB 1MQ8A 3DV6B 2W59A 1L9QA 1YDXA 2VN3A 1U3HC 5GGRY 4OIIL 5JLZA 4A67A 5BV7L 2PP7A 3MJGX 3DOIA 3HZMB 3TN0B 3MRNA 4L0YA 4H20H 2WNXA 3UTSB 3L5JA 1MCSA 4JMXA 3CXHK 1H8OA 2ALAA 3LN4B 3PXHA 5FUOH 1PX8A 1MHHA 5LCVA 1KYOF 3ALWA 2Q3ZA 3QFJD 3IFNL 2O5YH 1TA8A 5HHNA 3UACA 2BDNL 4V1DD 1QU7A 1VP7A 4ELMB 4OZGB 3LN9A 1G0DA 4XOCA 2XG5B 4NAQA 4LFBO 2QWQB 3OWEA 3QR0A 4XGZA 2X0LA 1YECL 3ULUD 1IEBA 4S1DD 1QI5A 5DHDA 3FQXB 4X66O 1VQ5V 5JXEC 3SBWA 1OHHG 4BA0A 4FM0A 2MH4A 5DO8A 2PCPA 4YLBA 3IDNA 1S9YA 1IC1A 5SWZE 5FL7G 4H0HB 4CS4A 1QYGH 2FB5A 4CC6A 1D5MB 2HMID 2X3CA 3MQIA 4Y8AA 4GS7C 5IY5B 4GSUA 1AZRA 4JZNB 3W2DL 2P8LB 3O9WB 3B2UC 1JD9A 2CJTA 3MAWA 3MNZA 3BISA 5JHLL 4N8CL 4M48L 2BCMA 1GYUA 4HZLB 1WBYB 2YMXL 1YTFD 1GL4B 5GGSY 3K2UL 1OAQL 3D18A 1RZGB 1UCTA 3WB2A 2DD8L 2WTRB 2XWRA 3CZKA 4HXBH 1XL6A 5B1AC 1N64L 3B09A 1S76D 3JWDL 4EUPH 5LXGH 5ISZA 1KC5L 3U0TB 5B1BC 1QFHA 4ZX3A 5HBBA 4G1MB 4W9FC 1NMCB 1RZIB 5F96L 5B1JA 3S98A 2A5UA 5DHYB 3RWFA 1T5WA 3ZK0A 3EYSH 5E2TL 5AOJA 3Q6GH 3VCLA 2LV4A 2Z8VC 1OCOC 1N0NA 2K6WA 3N85L 4LLDA 4UOZA 4IBSA 3VFVB 1UFGA 5L9DL 1D5ZA 2WLJA 3VXPB 4JRXD 3ZBHA 1IKFL 2KZ1B 2NXYB 1T2QL 3VWJD 1J8SA 2OMXA 4JCLA 2YOCA 2K3TA 3KPNA 3IVKB 1U8LA 4NT6A 43CAA 4J23A 1TZIA 3REVA 2VGLM 4LLVA 3KR3H 3T1CA 1CK0L 1G7LB 3P2TA 1JSYA 3ICXA 3NCYS 4GIPD 4RZCA 4WFEE 1CYGA 3AACA 2DWEA 4CDHA 4PDLA 3W39A 1GGUA 4UDTB 4EI5B 5JJJB 5KYYB 5M94B 5GGTA 4X4MA 2CRZA 2D03L 4ZFGH 3G6JF 2YKLL 3HKDB 5KEZA 4NJ9H 4HFUH 2Q7EA 3K59A 1Y67A 5A2AA 5ABZA 1KCKA 3JVGC 2P4VA 5DFWH 5D6CB 4UZGA 3CIAA 3SKMB 4KC3B 5F6IB 2W07B 4AENB 3AY4C 3WTWA 1PKQE 1ZSDA 1MNUH 3T0WA 2E0PA 4UV7H 3CE2A 4I8DA 2P80A 4XO9A 4XNDA 4P57A 5IMKA 1HQ4A 3WJJC 2LGWA 2PZSA 4Z2WA 3MCLH 2XT1B 1DANT 3RA7L 4HWEH 1T4WA 1KYFA 1AO7E 1K73W 1JG9A 4JZJB 4G6AD 4NWTL 5AAWA 1KGCD 1VIBA 2DH2A 1RJZA 1GK9A 3SOBH 1CXKA 5AAMC 1T6WA 1VENA 4I1RA 5B39G 3KMDA 1DQQB 2YS4A 4IGBA 4M4RB 2JJTC 1WHPA 1S7WB 1UD5A 4K94C 3RPIB 3WUWG 3ZE2B 2C3HA 2YRLA 4APXB 3FAXA 3NUKA 2Q2EB 1DJSA 2XG4B 2NY4C 4F3FB 3P9LB 6PAZA 1JQ0A 3W3BA 4X88A 2DYPB 3EH1A 1S7TB 3CC5A 4BCXA 2EXTA 3K5LA 1U8JB 4K35A 2CIIA 1IGYB 3GIZH 1Y66A 1S5LZ 1FVCB 4G6JL 3HG1B 3VFUA 4GRLB 4R4ND 2AV1A 3P3TA 1XGYH 2WLZA 4N23A 3CSYA 5FYJL 3U46A 4X9BA 2BERA 3NEXA 1OP3H 2VLKE 5FEBA 4DR6B 4Q9QL 4LNUA 2VLKB 3MRGA 2E9JA 4G9DB 3S34H 3UJTL 4EO5A 4GKSA 5HHPB 4PIBA 4AYDC 4S1RH 5ISZD 3T0EA 5KJ7E 2BMKA 3C5JB 1LK2A 2IU3A 1NCWL 3T08A 4BSWB 3ZQ9A 3OR6C 4DGUA 2EH8L 5J5EA 5TF1H 5JPNB 5E23A 3KPSB 2V17L 3VXRA 1BZ8A 1WEJL 2EDYA 2YD1A 3JZ7A 2RAMA 2J2ZB 1OCZC 5F9OH 2QPUA 1C7SA 1ZTEA 1TQBC 5EU4B 3JBG7 3V6BR 3ARDC 1T3FB 3QW9A 1QRKA 3RNQA 1NQTA 4UQAA 2V9RA 4NBYB 5BOPA 4QCIA 3FFDB 2FKXA 1JGVL 1S9VA 2X09A 4JDTH 4JRYD 2C9VA 1AI4A 1V55B 4HWUA 3SE9H 2GEEA 1D9KA 2IANA 4GW5B 2N04A 1RI8A 4I2XB 2QHRH 2V7HA 1KZYA 3OHXC 2DYRC 1ETJA 3IGUA 1X5YA 3HI6L 3L17A 4FYTA 1C9SA 1KB5L 2CE6A 1B6QA 4NJAH 1CU4L 3CCEV 5HHME 5C0FB 2BVEA 5CNHA 1JMZA 2ZIMA 3TYFA 5F70A 1I3UA 3L9YA 3S37X 4QTIL 2J12B 3MLXL 1MDTA 2F18A 1DEDA 3IC9A 2JQMA 1XSOA 4YSRA 4JPVL 4XZ4A 4ZMXA 5AL8A 1YYLH 3B7RL 4I88A 1O7SA 3K0GA 5ERWB 3IDMA 1AOZA 2VL5A 3MV8E 3P2BA 5KLVH 3MV8B 4FN0A 3ZKSD 1NFDE 4QRPA 3F7LA 5F7BA 3RZWA 4AYGA 2A74B 4P3CL 3PQYB 2F43G 2O6PA 4YJZL 3MBEC 2EXSA 3DX6A 3QJQB 4PJEF 3F01A 4IGBD 4WGWB 1Q1JH 2FX7L 1AFVH 3MCYA 1WBXB 4O9HH 3IWVA 1IGCH 4R8CA 2I60H 3ARPA 1KCSH 3I6LD 4XI5C 3WN5C 1I8MA 4U1HB 1TU2A 4R2GB 3MV7E 3O11A 4WCYH 1H3TA 4J41A 1NLBH 3FRUA 3LCYA 4UFZA 1FFNA 2PGGA 4MAYD 2ETNA 1XGTB 4JV5B 3B3IA 5F9JB 1S5HB 4TPRH 5LOVA 4W81A 4ZS7H 4D0BB 1K4DC 2OTUB 5IREA 4ZI7A 5BXFB 3DJZA 2XXMB 1QWNA 2RTTA 2IQAB 2RFXB 3H9SD 3P32A 3HB3D 2JK5C 3U7AA 2DQDH 2VUKA 1F11B 2Z31B 3VVVA 3VNYA 5CA1B 4M7LH 5C07A 1E40A 3EOTL 2W0LA 5B1BB 4W6XB 5L8KB 5B39A 4Z3HA 4P2RB 1NIFA 3QEQE 4I77H 1K92A 5C09E 5L7XH 1QFOA 1A6WH 3ZYIA 4PBVC 5K59E 2HP4A 3FO1A 3RWDB 2L7UA 1F1GA 4N86A 1X5MA 1N70A 1Z9NA 1YJDL 2Q3XA 4LCWE 4E9SA 3OHMB 3OD4A 4MGXA 4ZO6A 5KAQG 1JGDA 3M8OL 4LCWB 3RYCA 3LNEA 1O9VA 5CP3H 5E51A 3TJHC 4AQZA 4QTFA 2FGWL 1PCSA 4B9GA 4EIZC 5F0PB 3LS4L 3OAZK 1IM9A 4PIRF 1A6UL 4D8PA 1I9JL 4Y9EA 4MQ7A 4ZNEE 1WA2X 5L88H 3D69A 3NCMA 3U9UA 3BPLB 4EZLA 5LJYH 2WP3T 3QDGE 5E95B 3HC0B 2DQTH 2IAND 3QDGB 3V0VA 3DJRA 5EIBC 4XP9L 2OK0L 4M03A 1BD2D 3QNYA 3WO4C 4AGPA 2Y2WA 1KCRL 4FQXA 1OAKH 5D5MF 5BZZA 5KSBE 4ZFFA 1KWGA 1Q9LB 3C75A 5KSBB 3L3JA 1TEGA 4TNWK 1U97A 4LDLB 4UTBH 4TVPE 2GTZB 2IAMA 1P9MC 5DJ8B 1Q0XL 1CFNA 2ZOUA 5DVNA 3ETBJ 4Q6YA 5FUZH 4S0TD 3V95A 2SEBB 3RL1B 2BVPA 2CRMA 4KDTA 3X1BA 3OB0K 2GG1A 1YSCA 3UBHA 4OLUH 5C0DB 5T3ZD 1AKPA 4QRPD 5K9KA 1B3IA 2O5XH 3DV6A 2C4FT 5GRJL 1A6TB 4FG2A 4RFEB 5HDQH 3VFWA 4Y2DB 3HZMA 1F00I 3TN0A 2B1IA 4APQD 5HI4D 4AV5A 4ZYKB 3E86A 2NY4B 3BEVB 5D96B 5AKTA 4GAGL 3PNWB 1FNEB 3U4EB 2RNBA 4HKJB 3TLRA 2Y7SA 4NPJA 5EF3A 5KG9B 2OMYB 4CN1A 1N3NB 1H8LA 2M1KA 3RX5A 2D7MA 4ELMA 4MA3B 4OZGA 3DUUB 4HUMB 1HAWA 3VWKC 2XG5A 2OM5A 1JUFB 3UCSC 3UIZA 1DO6A 3HPLB 4Z7UF 2A9MH 4P99A 4RX4A 1G6UA 5E7FA 3OAAG 5EO1B 3FQXA 4K7PH 3HZVB 1GGCH 2ZUVA 4BXSV 2H1XA 3C08L 1IIKA 5C1MB 1R3IH 3IXAA 3BVVA 3BPZA 4OCXH 4LCUB 4WWID 3QFGA 4C7UA 1D5MA 2CKBH 1OGAE 4XBEL 3IF1B 5B1NA 1DZ0A 4TNVK 4FQLL 1OGAB 4PS3A 3U0WH 3SODB 1AGBB 4JZNA 4R97B 1P1VA 2D0GA 3V8OA 2P8LA 3O9WA 1OCZB 1HINH 1FAIH 3C12A 4YX2H 2HVJC 4Y4HC 3DA0A 2VERN 5FM4A 2PWFA 4FJYA 3AREC 2CLRB 5KUMA 4HZLA 1GAFH 2P8PB 5TQ0H 3BCCH 1OB0A 3ARUA 3QUZC 2H3XC 4OGYL 3WV0A 4P2ZA 1RZGA 5CBHA 1NVPD 2WTRA 3C60B 1A6AB 3MNVB 1NFKA 4JKNA 5FYLL 3U0TA 1E3XA 2PO6C 1CFQB 1RZIA 1M4KA 3OHXB 4G1MA 2Q7GA 1XCXA 1X6NA 2NXZB 3MI6A 2JTYA 5DHYA 3S35L 4I50B 5E5LA 4PPTA 4TVSa 4XMTA 5I0YA 4WTXA 5KZCD 3WL9B 3AG2B 4BFNA 3TBYB 3WFEH 4FQXD 3VFVA 5A6MA 1IC5L 1ZE3C 2H4EA 3VXPA 3VI4E 5K93A 3VX1A 1JZ8A 3VI4B 1SY6L 4PJFE 5C0NC 1FQ9C 1FSKB 2GI0A 5IBTL 1G43A 3BI9X 3EJUA 3GXIA 4MA1B 4PJFB 2WWOA 3IVKA 2PF4E 3T1HB 4OUUB 1PY0A 4IBZA 4OCRH 4TUKL 1G7LA 1MKFA 3IPFA 3IDYC 3B5HA 4H2CA 4WFEA 4PQXA 3QWRA 4KH9A 4OI8A 2VLRE 3SE8L 1NJ9B 1CP9A 1M1XB 4CVUA 5EIIG 2VLRB 3MR9B 4UDTA 3CH1B 4EI5A 4LK4A 3Q8CA 3HKDA 1RUMH 3INUL 4K73A 4B60A 3TN0D 2AI0L 1KBBA 4UQEA 2WQXA 1Q6UA 3WN5B 2A6JB 3GXMA 1QSFB 3JV4B 1U8IB 3ZJZA 4M7LT 4QRSB 4BHUA 1IGTB 3CCHB 3D39B 5D6CA 5C7XH 5DJ0B 3SKMA 1JPGB 3F62A 4N2GA 2W07A 3L45A 4RMUA 4AENA 4K9JA 4F27A 2UYLA 2PYJA 1LQSR 1UUNA 2Z65C 2ZYIA 4J1UB 3WIFB 5F2FA 2CH8A 3ZT5A 4X5WB 1IQWH 4WF9V 2XWBB 5FPRA 2WO3B 5L3DA 3FUJA 5IFAL 3ES6B 1AQ8A 3HS0B 4JZJA 4NHUB 4RRPG 1XH3B 4LLAA 1DQQA 4LCVA 4M4RA 1W6LA 3LEXB 4RX4D 3SYPA 3QQ9C 5F1NB 3RPIA 5MP6L 1PZ2A 4APXA 3SDXE 5HHXL 5IJ9B 1NL0H 4IDLA 2XG4A 1YITV 1HL5A 3NRFA 4F3FA 3CXFA 3P9LA 1VFAB 1S3JA 4OIIH 5JCOC 3RWJB 2DYPA 1HL8A 4ZMYA 3L1FA 1S7TA 4R7NB 1BJ1H 1FH2A 2YPVL 3PAYA 5BV7H 4N8VB 1M7DB 3UZEC 1XSKA 3OLGA 1XOUA 4GP5B 1H2LA 4YS4A 1U8JA 1IGYA 4JY4A 2IH3B 1SZNA 3FB6B 1RK1B 1FVCA 1ZV9A 4IOFD 3HG1A 3KPLB 1TJGL 3MPCA 2PN5A 1Q6HA 1N32O 4GRLA 1IXMA 4ZS6C 2X1WL 4X7DC 5IGXL 1BMGA 1A9BB 1AR4A 5FECB 1SQPH 4X2UA 3EHBC 4RNRB 4J7RA 1D6EB 2HX8A 2VLKA 4Y5XA 3IFNH 3SE6A 3V55A 5L3FA 4G9DA 1OALA 1L7TL 1JZ6A 4NAJA 5HHPA 4MB3A 4KRNA 2F8VA 3B6SB 3K81A 2G5RA 1OPOA 3C5JA 4OX9O 1YECH 3VFSB 3CFNA 3GWKC 2VXTL 5HDWA 4BSWA 1R3LB 2GDSA 5DWUL 3WIIL 5JPNA 4RBPH 1DDHB 3KPSA 4OCYL 3H85A 2J2ZA 3JATB 2ZCHL 3NIGE 3BRGC 5C0BE 2Q67A 5EU4A 4IK6A 1NKRA 5K69A 5C0BB 4R7DB 1QLEL 2VR5A 1T3FA 4PS4L 1PSKL 4K8RD 2E27H 3DX7B 3W2DH 3TPUB 3FFDA 3I6KB 1HCYA 1MG2C 5JHLH 3MKKA 1FKAO 3QWRD 4MD5B 2Y7LA 2VR4A 1I3VA 4GW5A 4I2XA 4M48H 4N8CH 4GEJA 3NJVA 2XAQA 2NY1B 1XGZA 2DQ0A 2ICWB 4P5RA 4XX1G 5B38B 2PP8A 2YSTA 3K2UH 4UBDD 1LWRA 43C9B 2DD8H 4KTDH 3QYNA 3JWDH 2JKJA 4D9LH 1JFFB 1ECYA 1KC5H 4KZ0A 5F96H 5EEUA 2CG9X 2NZIA 3N5AA 5E2TH 4CS2A 1YJWV 1BXUA 1T83C 5ERWA 1MREL 5GRUL 3ECWA 3N85H 1C8PA 2CK2A 3RHWF 2GJRA 5L9DH 3RT3C 3E89A 4NKGB 3MV8A 4FYQA 4LFCO 3CU7A 1UYWL 2BHFA 1IKFH 2A74A 4B9IA 1T2QH 3PQYA 3VWKB 3WFDL 1G9NC 1GY2A 3BFQG 1WITA 4L8BB 3K3QA 3II2A 3W1ZA 1SC5B 2ZCLH 1CK0H 4P04A 1MH5B 2ZR2A 1WBXA 3ZKMC 3B8MA 1TFPA 2Y1YA 4LSVL 4O4JB 3QQ4B 3MO1B 4M5SA 3BPOC 4BCYA 1HSBB 2YAMA 1ZWIC 4U1HA 3D8MA 3R7QA 1H6TA 4I9WD 3O3DB 5FHAH 2D03H 1XGTA 2YKLH 2WLMA 1NS1A 4PJCE 5F9JA 1S5HA 4D0BA 2WXRA 2LAAA 4HAFA 2OTUA 2VDLB 3T71A 2Z1PA 1NCDL 4IBLT 1DVFB 5BXFA 3TTSA 1J8HD 3ZHUA 2HVJB 3HG1D 4Y4HB 4GX5A 3X1GA 4GRLD 4HUKB 2IQAA 3QHFH 1FFRA 3FF7A 4NHCL 2BW5A 5AB2A 1F11A 2Z31A 4CMMB 3B8NA 2KL6A 1F4NA 1ZUQA 4MNHB 5CA1A 3HNSL 2UUDK 4NWTH 2V5RA 4EEQA 5JTWA 2HMIC 3U6RB 4P2RA 1J95A 3K5MA 1U92B 2FIKB 3QIUB 5T1LB 2X6AA 1MCDA 1MXDA 2EDFA 3RWDA 4G42B 4HDIB 5GZOD 3KPSD 4HCFA 3CCUV 1Q86W 3WDJA 3QBTB 4WFFA 3PJSB 3T3PE 2G3ZA 4ACPA 1FJGO 1CD1B 2NY2B 3O0LA 4LCWA 4BK4A 4X65O 1EDYA 1R6KA 2WMPB 4B9PA 3O3AB 4TSBL 2AVFA 4J2XA 5IFHL 3HR0A 1BSMA 1AJ7L 1NCTA 3R66A 1XL4A 4ICGA 1BFTA 2GSMB 1YEHL 2ZP0T 2H0EA 4X7EC 1IAOB 1OHZA 5TPWL 2IDQA 3OGIB 3WENA 5I24A 4QHMB 5GPRA 1NUGA 2HKOA 1OW0A 1U93B 5FYJH 3LHPL 5A16B 3UERA 3HC0A 1URIA 5AD0B 3QDGA 4GKKB 1RZJC 3FQ1A 4K7PX 4Q9QH 1XNRB 1QBML 4YSQA 5KVFL 1UWXK 2BTQB 3UJTH 2H47C 1HOCB 1FIEA 4E42B 2Y07L 2BWDA 1Q9LA 3JVGA 4JG5A 5KSBA 5G4OA 2GUYA 4KJQC 3HEIB 4WW2C 3ZL4L 1A21A 1OP4A 4YDKL 2Y48A 1AP5A 1KY7A 3BN3B 1NCWH 2GTZA 3SDDC 2ZYSA 1HWGB 5DJ8A 1G9ML 2EH8H 2IEPA 1N33B 3CHPA 1K72A 4WUUD 2PY5A 4B3TB 1Z9LA 2V17H 5HJDA 3D25B 2SEBA 3MROB 3RL1A 5J57B 4EN3B 1OAUL 2F54B 5C0DA 1MAML 1E3FA 3PQYD 3HKBB 2KLTA 1A6TA 3DVFA 4RFEA 4K3EL 4XO4A 3N1PC 2QEXV 4PVMA 4IJ3B 3MLRL 4Y2DA 2AITA 2MQGA 1JGVH 4NPYB 1AGEB 1L0PA 3NIDF 5CIPH 2XWTB 5HHOE 3KLLA 2D7TL 3CPLB 4ZYKA 8PAZA 1MCOH 4E0RB 1BF8A 3BEVA 3RVUC 4CGTA 4OZIB 4A63A 3PNWA 2FH6A 4FQPA 4X64B 1FNEA 4HEME 2XWEA 3U4EA 1KB5H 1H0DB 4HKJA 1FFTB 1DFBH 4OF8A 1LGVA 1T1ZB 5IQ7H 1CU4H 1FL6B 1MFUA 2Q7YB 5KG9A 1XMOB 2OMYA 1N3NA 1EHNA 4QTIH 3BFWA 4C57C 2AF2A 2RA1A 2H2PC 3MLXH 4MA3A 3PY9A 5DJZB 5JMRA 1JZ2A 1WH0A 1S5IL 1ZS2A 1CI3M 1JUFA 3VTAA 3EHBB 3DTDA 3HPLA 4ZMTA 4PD4J 2Z7YA 4GXFA 3RIFF 1FZJB 4OTXL 3F05A 5EO1A 4I9XA 4LT7A 4YZWA 5F7MC 2MOQA 3HZVA 3LQAC 3T6XA 1MCQA 4P3CH 2WO2B 3MLTB 3QUYC 4P2RD 1IBLB 2GFBB 4LCUA 3BDYL 4EQ3A 2MQ0A 3IF1A 4IGGA 1OGAA 2FX7H 1XO8A 3QRBA 3KVDD 3QSKB 1E79G 4EZKA 1AGBA 1QA9B 3FBKA 4FKKA 4ALAC 3D50A 3L1OH 1P49A 1CI5A 4PJ0Z 3FX7A 4WFFD 3BD5A 4PWEA 4U0RB 1XV8A 3MRDB 3LMJL 1EXGA 2YPLB 5ACMA 1K97A 2P8PA 4GG6B 4MTOA 4BWAA 2PWHA 1MCNA 1IKOP 3C60A 4M6NL 1A6AA 3MNVA 3QZMA 5B38G 3L1GA 4HJ0C 4LHJB 2QELA 4BIKA 1OM3L 1T5EA 1CFQA 3GHPA 4LLUB 4ONFL 5CCHE 1CZ8L 3T4AB 3IRCA 5DD0L 5D5PA 4AT6B 4YSTA 4I50A 1EMTL 1KIQB 1DN0B 2ZYHA 4WFBV 3CDFA 1P7HL 1SNRA 3WL9A 1U8PB 1MSDA 3TBYA 3EOTH 4KKRA 4PLKD 1EO5A 2EXYD 4JHVA 3VI4A 4KQ0A 1ZS8B 5EU5B 3D7PA 4KU1A 1UD6A 3K6FA 5JR1L 3ARWA 1FGNL 4OUUA 3NSFA 3L9RB 3ABLB 1YJDH 2F2HA 3PAZA 4MQSB 3BE1L 4NQTA 3RI5F 4A2MA 5MENB 2R0LL 1VADB 3HMWH 3M8OH 4V2BA 3IKCA 2JKRM 1L0QA 2Q20A 1NJ9A 5A7BA 2FGWH 3BAEL 1M1XA 1WSST 4WGKA 4QE9A 2VLRA 3MR9A 5J3HD 2DV6A 3CH1A 1SUHA 4BAYA 3IMVA 2R29A 3KYKH 3LS4H 4YPJA 1EN6A 1A6UH 4R7LA 4KJPD 1I9JH 4Y2DD 1NOFA 2MCMA 1MNNA 4G80B 1JFHA 3BPOB 2A6JA 1AZVA 1QSFA 3JV4A 5TDOB 1U8IA 1ZWIB 4QRSA 2AAVA 2WCPA 2F4VB 1IGTA 2HFFB 3CCHA 3D39A 5AW1B 4JO5A 4XBFA 2Y3AA 3HHRB 4K07A 4XP9H 5DJ0A 1JPGA 2X87A 3RYMA 3S48A 4XNZB 1PLGH 1Q8IA 4J1UA 3WIFA 5AOZA 3ZIMA 2H32H 1P7BA 4LF6O 1AQKL 4X5WA 3VGAC 4WWOA 2XWBA 4RGMC 1JGEB 2AXGB 4N3UA 1D5XA 3ES6A 1ROWA 3HS0A 2MQ3A 2QGDA 2MSPA 5CHNB 1OK0A 2ZUXA 4N5ED 4NHUA 1Q0XH 1XH3A 2WXQA 3A5VA 5D7SH 3UH8A 5ICYB 3LEXA 5HP5A 5F1NA 5DO2D 4HG4K 5IJ9A 4MAYC 1AXTL 4J11A 3UTTE 3GS4A 2FWSA 2EC9T 4KGLA 2H3OA 4YJ2B 5GRJH 1VFAA 5EZOL 3RWJA 1KJ2B 3VXUD 4R7NA 1KTCA 3I50L 4KTYA 2EKJA 4R6UA 4N8VA 1M7DA 5CD5D 3IYLW 4PP1C 5GS2H 3CMOL 3BVTA 3R4RA 4U3CA 3VA2C 2FT6A 3NCWA 1H19A 2IH3A 3FB6A 3ABKB 1RK1A 4AJYV 2YA1A 4DR7O 3KPLA 3O9OA 5CJOL 2J88L 2KUTA 1Y18B 4KUCF 1A9BA 5FECA 2FHCA 1HC1A 2QDVA 4RNRA 5D1ZC 1D6EA 1E4HA 1KB3A 3H9HB 1KGXA 4LH7A 1YN6B 3C60D 4ISVB 1UCBL 4YHML 1EUTA 1K8IA 1O6SB 2P49B 1J5EB 1BWMA 3B6SA 5ADOL 1P69B 1Y6XA 3VFSA 1NTMH 2NXZD 2VUOA 3N1GC 3QIBD 1R3LA 2XWJB 5I1GL 2EIMC 3ZHQA 1DDHA 1BQSA 4MZ2A 2XZCL 1T1YB 1GMEA 3C08H 1N7ML 3CBJB 3JATA 1H3UA 3HE7C 4KJYB 1EH9A 1TG8A 4H1LG 5I5RA 4YDZA 3RDTB 3SDDB 4XBEH 1H3XA 5C0BA 1P9MA 2VO5A 3FUEA 4R7DA 4FQLH 1QHOA 4W9LC 4N6QA 4TSCH 5D7LB 1UA6L 2EO9A 3QHTC 3DX7A 3UEZA 3TPUA 1G7PB 3I6KA 5CU9A 1B2YA 3PS6A 1I94O 2D7QA 3X2QB 2ZWLT 1MCLA 4ONOA 4PU2A 4RO2A 3IJYB 4MD5A 5IT2L 3F85A 3DKHA 4WI9A 1KLUB 2ICWA 3Q43A 2I26N 4W9JC 1RSYA 3UGEA 5B38A 5HXMA 2VLJB 3ECBA 4KHTL 4OGYH 1E4XL 4XCEB 43C9A 7FABH 3E1ZA 4JW3A 1F7YA 1JFFA 5FYLH 2UVEA 1QSFD 3GSOB 2XPGB 4HBCL 4OF6A 1AR2A 3D39D 4IU3B 3Q1SL 4NLAA 3F5TA 3S35H 5C08B 3FU8A 4L5FL 1QFPA 4TTDC 4YXKL 1IC5H 3Q13A 2LU3A 1WAAF 4GMTL 4WF7A 1NH2D 1HKFA 2SODB 4NDMB 1SY6H 2X4TB 3VWKA 5IBTH 5B7FA 2EO7A 4MZ3A 3LRSB 2NY3C 3F7PC 3PXJA 4L8BA 5F0JB 2XTSA 4FNRA 2E76C 3VXSB 5F89B 3V5DB 1SETA 4TUKH 1VZHA 1EFQA 5DCCA 5H37H 1EGJA 1KP3A 4ZZFA 1UTDA 1MH5A 2CTWA 4O4JA 1JR9A 3DO4A 2R2CA 3MO1A 3QQ4A 3H1IH 1OE1A 2OI9C 3CDGB 1KU9A 1YVWA 1HSBA 4CSTA 4DZBB 1Z5WA 3RJDA 3MLZL 5HPMB 3G4SV 5F2VO 3F83A 2UXNA 1T0MB 3O3DA 4G7VL 5D7JC 2MNUA 3T2OA 3INUH 1BT8A 4GKJB 3T2QA 2OXHB 4LL4A 4JDEB 1X5ZA 2MPVA 1LDSA 4UU9B 1K4CB 1PPJH 2WXMA 3VD0A 2CO3A 1S0VA 4WO4D 1DVFA 3TBCA 4HJEA 1KY6A 1U3NA 1YY8B 4MYWB 1SFDA 4XOEA 2ITDA 5LG1A 3V4VB 1V3MA 2EYTB 4CUCA 1BYNA 2BHYA 1LK3L 1T89C 4UYQA 2QQNL 5E70A 3BAIA 1HTYA 3WUZA 4HT1L 2XXCB 4MNHA 5IFAH 3QDHA 3BOVA 3CIQA 1EK3A 5LO7A 3F7KA 3U6RA 3EJCA 1DDTA 3BKML 4Q6GA 1U92A 2XETA 2FIKA 3QIUA 2DJVA 1A25A 2J1YA 2AJXL 4I0CC 5AW2B 5T1LA 1E8YA 1MELA 5MP6H 4G42A 4HDIA 5HHXH 4EDXB 5JQ6L 1EM1A 3PJSA 1CD1A 5T5NG 4HCIA 2WMPA 2CRIA 2YRPA 3O8XD 3O3AA 1G7MB 4M6OL 3GTTA 2JLPA 5DJCB 2I9LB 1UWYA 3CSGA 2R9HD 3D2UD 2JELH 3U6XA 4TQPA 1I9EA 1IAOA 3RBZA 1TJGH 3DIFB 5SX4I 5IGXH 4ILDA 4QHMA 2YAFA 2E3CA 1U93A 2E74C 4MB5A 5A16A 5AD0A 1I9IL 1B4JL 4MBOA 2AQQA 2QADC 1MFMA 5FXCH 3WMSA 2NY1D 8FABB 1HXYB 1HP8A 4J5VA 4K8ZA 2BTQA 1CDUA 1HOCA 1L7TH 3E8VA 4HJIA 4E42A 3L95B 3CSPA 4U1LB 2UU9B 2JE8A 2VZUA 3B7YA 1T4KB 3QJHB 2BWQA 4L87A 1L0NH 4LF8B 2VXTH 4L9DA 2DWDC 5DWUH 4TQEH 3WIIH 2YICA 3FW6A 2BCKB 5F9WC 5HYIA 5AB9A 3ARFD 3KLKA 3MKGA 1AANA 3CPUA 4NP9A 3D25A 4OCYH 4XXWA 3MROA 2CPCA 4I85A 1L9SA 1UKSA 2ZCHH 3BHBB 1CDHA 4EN3A 1CDIA 2F54A 4DPAX 5C0RL 3H1LH 1ED3B 3GXTA 2PUSA 4P9HC 3HKBA 1QLEH 4ANWA 4PS4H 2HTKC 1PSKH 3H2WA 3AS2A 4PJHF 3MAQA 2X7LB 3VJ6B 2QVFB 2B1GA 4NPYA 1AGEA 2XWTA 5CAYB 3CPLA 4JS7A 1GC1L 4C58B 4E0RA 4IBUA 3K5NA 2MIZA 1YN7B 4LAQL 7TAAA 4OZIA 5IW1B 1O9HA 4I7ZC 3CD4A 2ZT9B 2VJXA 3G5ZA 3RZCB 3HI5L 2B1HL 4HEMA 3Q05A 1H0DA 3HG2A 4XCNB 3QDAA 1T1ZA 4U6HB 3LPGA 1FL6A 1FXKB 1EHXA 1WC7B 3SPGA 4B3VA 2Q7YA 1TEFA 3W57A 1UWGL 3P3RA 5KVEE 3ZJAA 3U1QA 2VDOH 5HDBF 5BXZA 4GRWE 1Z0NA 5DJZA 1CXHA 2E7CA 4NZTL 4UTAA 1Q90A 1RERA 2X1XR 2ZOLB 5E1IA 4BZYA 4Z3IA 5GRUH 1MREH 4RQFA 1HVXA 3G5VB 4UM9D 1BJMA 4N3TA 1FZJA 2C9PA 4UNIA 4FLRA 1UYWH 2Y0IA 5F7LB 4A7GF 4Y8DC 1RVFH 3NZHL 1LUVA 3WFDH 3LKNB 1NQBA 3MLTA 4N2OA 2GFBA 3EFOB 3AWGA 1BOYA 2G0LA 3TEXA 4L48A 4JFSA 1XDTT 4ENEC 3QIUD 3BVUA 3R19A 4NTWA 2YAEA 5T1LD 2BVTA 2ZUSA 5HHQA 1KYOK 2OLDA 4LSVH 4XMUA 1QA9A 3L3IB 4EEEA 5HVWA 2ZXAA 4Y4FB 4XVOA 2OULB 5AW8B 2NY2D 3MRDA 3GWJA 2VYRE 2F8OA 1F97A 2YPLA 2N7BA 4X1IB 2OTPA 3MLVH 4GG6A 2Z7ZA 1TZ8A 3CLEL 2WAQA 1NCDH 1AS6A 3EKCA 4YHYC 5JQHC 3TGXA 3E2HB 2HKAA 2LVCA 4FNTA 3OR7C 3OTOB 4GW1B 3T4AA 4LLUA 4NHCH 4AT6A 4N87A 1KC8W 1HCVA 4K0KB 1SGKA 1KN4H 1HNYA 1KIQA 3N3EA 1C08B 1ZLVK 4H40A 1QEWB 3MJ9H 4QPJA 1U8PA 4NWUL 4QOKE 3HNSH 4X9YA 2O4EA 4QOKB 3V9EA 4XXCC 4XR8C 5ABAA 3HMXA 4HOMA 3PWLB 4ABMA 1ZS8A 4K8RC 4WO0A 3OV6A 1A2YB 2UXVA 1QATA 5EU5A 3TEUA 4CZZA 2EULA 1DUYB 2H6PB 3GRWL 2EP6A 3MRPB 3RWHB 1AZZC 4FFZL 3T3MB 3N2KB 3VMNA 3RX7A 2XYCA 3L9RA 4N6RB 3EJYD 5F88B 2UWEE 5MENA 5TD4A 4X62B 2UWEB 1VADA 2VB5A 5LB1A 4EN3D 1FD9A 2F54D 3B37A 3OTFA 2J5WA 4G71B 4OJCA 4QHPA 2I24N 4TSBH 4XHQA 4YFDB 3SKNB 4PRPE 5IFHH 2DI7A 2GSGB 5I1KH 4PRPB 5CFHA 3TFBA 4W4NA 2Y5TB 5JW5B 2WKOF 1YEHH 2ITCC 2NR5A 1YEKL 3MNDA 5TPWH 2C3XA 2E5EA 4G80A 5IHWA 4JG0L 4KMTL 2ICWJ 5TDOA 1ZWIA 2NY5H 1M56B 2HFFA 3LHPH 5E5UB 3S4SG 4FXTA 4NBXB 3SKJL 1BZ9B 3AQXA 5J12B 5GJTL 1QBMH 3ILQC 1P7GA 3BSZA 3W0WE 3FTVA 5KVFH 2V2XB 2IPUK 2VNCA 4KH2A 4PAZA 2Y07H 3TBVB 2LTQC 4JYBA 3KBPA 3R1GH 4I18B 1QHQA 2B9AA 5FGCB 1CN4A 5E94B 1JGEA 1GZHA 1JWSB 4KNUA 2AXGA 1AKJD 4MDRA 4W68A 4YDKH 3HNVH 5CHNA 4DV5O 4LSQL 1Q90D 3ZHTA 1G9MH 3B34A 4BK8A 3GSNL 3NIFF 3T1WA 5ICYA 3RYFB 2DBLL 3K4AA 1NGXB 2V3EA 1OAUH 1MAMH 3ARBD 4PCKA 5FNVB 4YJ2A 3JUYA 5IWAB 1KJ2A 4K3EH 4PJ6A 3JSSA 3MLRH 2R56L 3L5IA 4RDQG 5B21A 2B3IA 3CU1A 1O5PA 2X1PA 2EC8A 3S35X 1IBKB 3HN5A 2Z5UA 4X8AA 1Y18A 1ADQL 2BY2A 5K1JA 3A0HZ 3LZQA 4MVBD 2RH0A 1GM8A 1RAMA 2YPLD 3AG4C 3BAJA 1I5XA 4XWGL 1DK1A 3H9HA 3IBEA 1L3NA 4B3SB 4G8AC 4L1BA 4ISVA 4YHLH 5DJ6B 2EUXA 2YZ8A 4JFYB 4DR4B 3G9AB 2E74B 1O6SA 4EN2A 4GUOA 1S5IH 3FU5A 5GZOC 3APMA 4J12A 1BYPA 4I4WB 1BZEA 2HVBA 4F15B 1DLBA 2XWJA 4OTXH 2DLFL 1Z2GA 1WVZA 4CNIB 3HS8A 4NQEE 4TRPL 1T1YA 1AR1C 1LMIA 5IYDO 1WAPA 1IURA 1MI5E 2JKTM 1FLRL 2XIBA 4KJYA 2VM4A 3GBML 4LCYA 1A7RL 2EAEA 2V37A 4L2YA 3RDTA 3SDDA 5EMYA 3L08A 3COOA 3GJFK 5IW3A 5I6NA 1N8ZB 4BWWA 5D7LA 1ZEAL 4JQIA 4UT6L 4X20B 1G7PA 4HWZB 2IAAC 4N26A 5JDSB 3SZKC 1JCHA 1PLAA 5MEND 4JFEB 2Q10A 3TF4A 2GJZB 3BUPA 3IJYA 3KJ4B 4OF7A 3LMJH 4TQHA 4YVNA 4Y9GA 1ZSHA 1KLUA 2VLJA 4XCEA 2OX5B 3T8XB 4M6NH 1W0YT 2QLVB 1C5BL 1I85A 2COQA 4LFHD 3ZRXA 2VR9A 4LCIL 1OM3H 4I7ZB 2XPGA 3GSOA 4H0LC 4IU3A 4ONFH 1CZ8H 3EOBA 5DD0H 1T22B 1EMTH 1LTXA 3QORD 2X0VA 5C08A 2GC4C 5A40E 5I28A 1TLMA 5JYMA 1O9WA 2Z1KA 1GOGA 4B27A 3P3UA 1WPXA 1BW8A 4J3TA 1W0VB 2HG5B 4NDMA 1V05A 2X4TA 5FGSA 2JI3A 1WWWX 3J07A 3LX9A 5JR1H 2FJSA 3CVIL 3T0AA 3VXSA 5F89A 5EUOE 2YC0A 2NRDA 3PAUA 3V5DA 4PVLA 4HQQH 1OB1B 5EUOB 4GI9A 3BE1H 3U7WL 4KJWD 3I3EA 1GOFA 2O30A 4KXAA 2R0LH 1AHWB 4HUUB 4TVPL 4N21A 3RILA 3CDGA 3CX2A 4AYMC 3CVBA 3BAEH 4KQ3L 4PWHA 4DZBA 4YDLB 5DMYA 3IBOA 5HPMA 2APTA 4KBPA 4Z7NF 4TV8B 1T0MA 4Z18A 3QS3A 3WHE1 3QEHB 3CXCU 3V0HA 3W9DA 4MXVE 1GN6A 2OXHA 3NCJH 4JDEA 2JXMB 4Z77B 3RE0A 3EF7A 1Z3RA 4UU9A 1K4CA 3P30A 3L75H 4MTFA 4CW1B 5EZJB 1YY8A 2FBRA 25C8L 1KXQE 4HUCA 4K94L 3VQMA 2ORBH 1ILUA 3V4VA 2EICA 2EYTA 2VRZA 4GB9A 3WKQA 1WE5A 5JW4M 3KHOA 1AQKH 3UTZB 4YY3O 5HGDB 4L2LA 1F3JB 3MREB 1CB4A 3ARTA 4PJDF 3V0AC 1MOEA 3PXLA 1UZ8B 1SOSA 3HRZC 2EIJB 1JRHL 5L2KB 4P2OB 3BP5B 1NGPL 3NJNA 4OSUL 4ERSL 4EDXA 1KV7A 1EUUA 1AXTH 4Y88A 4BKTC 4JYAB 3H54A 3APNA 5TH2B 5E79Z 4PJ9B 4JI0B 1G94A 1OOWA 5EZOH 1NSNL 2X9ZA 4N2CA 3C6EA 1U8OB 2AK4D 3I50H 3RDTD 3IAYA 1US6A 1HHJB 1G7MA 1OD7A 4JO8A 2JCCE 3CMOH 5DJCA 2I9LA 3U7YL 3ZHLA 3US9A 5KVDE 1UM5L 5D7LD 2XIIA 1H5BB 4HLZG 1LO2L 3DIFA 3AW5A 3K8LA 2J88H 3LPWA 3QWOB 2WLNA 4GAAA 4L9LB 5CJOH 5DWPA 4FMKA 1X9QA 1G6RB 3RGVD 5JHDB 3MV9E 2YAPA 8FABA 1HXYA 4JKMA 4U1MB 4ZMNA 5LBSL 2HVKC 2VLJD 2OTLV 3L2MA 4GH7B 1I08A 4JR9L 1IZJA 3L95A 5BZXA 3M1BB 1UCBH 4YHMH 2FB4L 4U1LA 5CGYD 3LNHA 3S3JA 2KB1A 5ADOH 2FSEB 4EIBA 3QJTB 1T4KA 3QJHA 1QNIA 4WHCA 4Y0GA 5C08D 4X6BA 2V9UA 3D2TA 5I1GH 4EKJA 3O2DL 4PLNC 4HOXA 2XZCH 5IT9N 3BHBA 5J3HC 3RVVD 2QA4V 4ZMLA 1DL7L 3ETBF 3H4HA 1ED3A 5DVMA 2X6CA 2PW2B 2X2YA 5GHWL 1IFGA 4X9FA 2J8UB 2FTAA 1UA6H 4GBXC 1TQCC 2X7LA 4HWNA 4KUZL 3VJ6A 3VXSD 4XC1L 2DH3A 4G2AA 1NCBL 4ZOEA 1YN7A 1Y6KR 2VUYA 1HNWB 2YEZB 5IW1A 3RZCA 4XB8A 5D2LB 1PEZA 2QDOA 3LNDA 4KHTH 4ABQA 4XCNA 1E4XH 3ZGHA 2Z92A 4U6HA 5D9SB 1FXKA 1XGUB 1WC7A 4HCGA 4MA8L 2DOCA 3W5MA 2H1LM 3LRKA 1YMMB 4OGAD 2CBMA 1I75A 2E75B 4FP8L 4HBCH 3IJ7A 5LGTA 2FLMA 3Q1SH 4AI7A 5E4OA 3NJFA 2ZOLA 5DO2C 4DVRL 2GUZB 4KRLB 4GO6B 4GXVL 2DMGA 2XVLA 3G5VA 4L5FH 3AG4B 1FORH 2NYKA 2HLFD 4OI9A 2ZG2A 2BNQE 5DS8B 3B5GA 3JASB 2B4CC 2VDNB 4YXKH 3UFIA 2BNQB 2Y36H 3V0EA 5D4HA 2BFVL 4L05A 3KCWA 3U25A 4NXNO 3CZGA 3RVZA 1MAJA 5HVGB 1SVCP 3LKNA 2CIKB 5CD5C 4BIZA 3KLHD 3T1YO 3IMTA 1X6LA 3EFOA 1RQ5A 2G60L 2OL3L 5E6UB 4OJAA 5F7UA 4KK8C 4ETYA 4AEIH 4A04A 1VGEL 1OQOA 3ZHKA 1AR1B 3L3IA 3NG5A 4OZFB 5E9AA 2E9BA 3ASOC 3EIFA 4Y4FA 2UXCO 4ELDA 4FA8A 4O5LL 3MLZH 1NEUA 2XUMA 5EYPB 4G7VH 2BW4A 1AS7A 1F6LL 4BFRA 1O7VA 4I1PA 4X1IA 4DV6B 1FHNA 1ZDSA 4G1EB 1R3KB 1UFIA 1GGBH 2HCZX 1CXZB 2OW6A 3QIBC 1OARL 2YQ2A 5KA5A 4DKEH 3DX9B 1KULA 4GW1A 4BQ8A 4B9CA 1CDCA 3EYUL 1LK3H 1C08A 2UXGA 4F8LA 1QEWA 1LP9F 1IBZA 4HT1H 3ZYJA 4J3OG 4TXVB 1NUNB 4QOKA 2J57A 2ROXA 3NFSL 3ARYA 3NTCL 3PWLA 3BKMH 5C3LD 2DIAA 5I1LA 1A2YA 1AQHA 4GQRA 2EEDA 1DUYA 2H6PA 3BQVA 1GS8A 1TQVA 2MNWA 3MRPA 3RWHA 1UZ6E 1BSIA 3N2KA 2ERJC 4N6RA 2R69A 3WEOA 2VN4A 1SERA 4LASL 5F88A 5JQ6H 3S88L 2H0JA 4ZMVA 3MVSA 2UWEA 4EJ1C 3ZMZA 5H4ZA 4JGMA 4F1ZA 4AGLA 4WAFA 1HX0A 1ASOA 2EZ0C 1CLOL 4CS3A 4RRPM 4DKTA 1SF9A 4AL8C 1XB6A 4M6OH 3SKNA 3FUMA 2GSGA 2VN7A 1HS6A 2Y5TA 5DZAA 5JW5A 1XMEB 2B7DT 3M17B 1R6VA 1S3KL 1TQWA 3K06A 1TQSA 3PGFH 4JFDB 3GMMB 2M2DA 2WVSA 2A7WA 4HBNA 1H3GA 2BIIA 2EYRB 2IMNA 2KPWA 2P5WE 1I9IH 5DTFB 1B4JH 1BZ9A 2P5WB 3RZCD 2J4WH 2JS5A 4A37A 3BWAB 4JZOB 3NFNB 5ECGA 1U8HB 2V2XA 3BXNB 5AVYB 2XAGA 1NPUA 4LEBA 3TBVA 4P30A 4G9FD 3NCBB 4I18A 4KVNL 4DW1A 2VT0A 3A8TA 2JCWA 4GO9A 3E9TA 4LE8A 5E94A 3VX0A 4EVNB 1JWSA 5HD8D 1OCCB 5MHSE 1FO0B 4HWBL 4L4TE 3BQUC 1B6DA 1QPPA 4DR3B 4L4TB 1P5VB 4J3BA 1N4XL 3RYFA 1BMZA 3K0YA 5GTIZ 1HQRB 4NTXA 1NGXA 3PHOB 3ZTJG 5HVHC 5KBLA 5C0RH 4KXCA 4P5TD 3OC5A 4XBPB 3TNNB 5IW6B 1T03L 1BS3A 2ZNWA 4AVKA 3RTLA 5FNVA 3J2PA 1UXLA 4DV0O 4OU3A 4K3JL 3LY6A 1AG0A 4HNAB 4Q6IB 3PUUA 3GLZA 1GC1H 2UVFA 4P5MB 4Q4EA 1WFIA 5I6KA 4LAQH 4YBHA 3HAEB 4PJXE 4Y4FD 3WE1A 1RJCA 1M3IA 3QJFB 2KHAA 4L1HA 3HI5H 5IK3B 2B1HH 1FFXB 1Q5OA 1T0PB 5KYUB 4E41E 1PNKA 1KYAA 4KQ4L 1T80A 3AC0A 5CN1A 2APXA 3QUML 4O02L 1UWGH 2EECA 4ZO9A 1ORQB 2GEQA 4LPCA 1RZQA 2H0FA 4JFYA 4XDLA 4DKEL 5HYSB 4R84A 4YXWG 5IBLD 4HISA 4LOUD 2IBGA 4I4WA 1A7QL 1IX9A 4LESA 4X1KB 3B77A 4UUJC 2YBRB 1Q72L 2CE4A 1G9EA 3NZHH 3BH8B 1ZAUA 3CJHB 3GXFA 4IS6B 4DV7B 4XMKL 2O61B 4DGYL 3TCUA 4M4PA 3TH2T 1N8ZA 3JSNA 3JQOB 4X20A 4DN4L 1EN4A 1WWBX 2VZSA 4HWZA 3K9SA 1XB8A 5JDSA 3E8HA 2C9SA 2DJSA 3SQRA 4JFEA 4NB7A 2EX3A 2GJZA 3MHZA 3CZNA 5DZ9A 1PNCA 1TQCB 2J7LA 2W94A 3CLEH 2OX5A 3T8XA 5DS1A 5EBWB 3UKMA 2M83A 4F92B 3BKCL 3B40A 1SVZA 1QW9A 2O1AA 4LSRL 2IH8A 3ARFC 4GCZA 1ZX3A 1DP0A 1NCUA 3ZRSA 1T22A 4Z0XA 1TJHL 4UOW1 1XCQB 5C9KA 2H45A 3BP6A 4NWUH 5GONB 2ZWZA 2P47B 3CEIA 3UYOD 4NUMA 3WNMA 3JCUZ 1W0VA 2WXFA 3LHAA 2HG5A 3E8FA 1URLA 3F2LA 2Y6SD 3GRWH 3G6JB 1UATA 1ERNA 1ZMYA 2WUCL 4FTVB 3UPRB 3BAXA 4FFZH 3TNMB 4H44C 6TAAA 3SY6A 3BKYL 1OB1A 4QHKJ 5EUOA 3GI9L 3K72B 2K45A 2HTLD 3U4BL 1NCAL 3WNOA 1AHWA 4O4LB 4HUUA 5FYKD 3KM1A 2RMKB 3DLQR 1QZNA 1M1KW 1VEMA 3RKDD 3MBXL 4TV8A 2YJLA 3QEHA 1EFRG 4U49A 2JXMA 3Q0HA 4Z77A 5A2LH 2KQMA 4G5AA 1X9LA 3RHWK 4A6YB 5EF2A 4JG0H 4KMTH 1OCWL 4CW1A 5EZJA 1SF3A 5J06A 1AD9B 3SKJH 5GJTH 3M88A 1P7QB 1BVOA 4Y9FA 2H2SD 3MUGB 2GBUA 3BWUF 3D4ZA 1NCOA 3IK2A 4F33B 2OAAA 4MFHA 3PWPB 4HHAB 4OR1A 4PA9A 2XT9A 3CVHB 4L1DA 5HGDA 5T1KD 1F3JA 3AQZA 3MREA 3OJDB 1EV2E 2XBZA 4XNMB 3IDUA 4I48B 4LSQH 3T8VA 1SJVA 1XF3B 1UZ8A 3GSNH 4S2SB 3QCVH 5FHBL 5L2KA 4OW6A 2DBLH 5LBVA 4P2OA 3BP5A 3H7BB 3V0DA 4AMKL 3EZJB 5E5MB 4P46D 2JV6A 4GG8B 5C0CE 3GJFB 5TH2A 4PJ9A 3QF7A 1U8OA 1PD3A 3MBWB 4HJTA 1OVZA 4YHPB 1HHJA 2ERJB 2R56H 2KI6A 4HF5H 4KITB 1GH7A 5FGBA 1H5BA 2A9HA 1V3JA 1HNXB 3QWOA 4L9LA 2EE3A 3MUJA 3FCUB 4JFED 1ADQH 4BHUI 1G6RA 5SWSE 5JHDA 3E3QE 3C5SB 4N5UA 5DURB 1EO8H 5AQ0A 4NZFA 3BAWA 5CBGA 4U1MA 3DTUB 5I74C 1EHAA 4QWWD 1MJUL 1UKQA 4JRWA 3M1BA 3RPKA 1MW2A 1OSYA 4FQJL 5F72S 5I73C 2ARWA 2FSEA 2IO5A 4YO0B 4JI8B 2K8QA 5JQIB 3EJYC 5AZUA 3FFQA 3DSNB 1JK8B 2HRHA 3BUDA 4GI8A 4WDIA 4F9LC 2DLFH 1TPXC 4UQIM 5J9PB 3KDMB 4TRPH 1AE6L 2XN0A 3IU4L 1CXFA 1FLRH 3GBMH 4DR7B 1A7RH 4FM2A 4JUSA 4YHZL 2YXWA 4NKMB 5I0VA 3PFQA 4WV1C 2PW2A 4X0NA 5DRZB 1RFYA 2CTRA 5KAQF 4ONGH 1SN2A 2VO8A 2J8UA 3GGWB 5DJDB 4UT6H 4BJLA 1XAKA 4F24A 1CGVA 2VXQA 5I6PA 2X7RB 5KSAC 4IYHA 1QVFU 1HNFA 3MHSC 1I1FB 2GY5A 2YEZA 4N68A 1ACZA 2YGVA 4YBLB 1WISA 5D2LA 2D3JA 2P5OA 5LNGA 4BFGA 1G9NL 4GLXA 3FQWB 5D9SA 2CDGA 1U8QB 1XGUA 2B8OT 5I6OA 2ZG3A 4LCIH 1YMMA 2EDXA 4PDMA 2LW1A 1ZTMA 4FL4C 4GXUM 4PJEB 4JCWA 2GUZA 5E2JA 1EDHA 3C5XA 5DS8A 1XF4B 3ARBC 3JASA 5HYSG 3V52L 2BNQA 4OAWB 4G6FB 5DLLA 3KL0A 2Q8AL 4ZHQB 4PD4F 1UD4A 1NIEA 5DYFA 1JZ3A 2CIKA 4H5SB 5CMAB 4O00A 4EUPB 4LPTA 3CVIH 1UH2A 4HMEA 2J1XA 5L2KD 3KBFA 3ZTNL 3T2LA 1UJ3B 4UUJB 3U7WH 4OZFA 1L8DA 3IWUA 4POZC 4AIEA 3VOUA 4UCUA 5I8OL 2PTVA 1JWUA 5EYPA 3L81A 1BBDL 4I0PD 2ZCKL 4RBPK 5DVKA 3ZUCA 3RIFK 3K2KA 1J0YA 1MW1A 3BAYA 4G1EA 3T1FB 1XMQO 1R3KA 5ESVB 4ZOLB 4FEMA 1MG1A 4K94H 5HGGS 2EIKB 3DX9A 1OPGH 3SHSA 4JPIB 1YEEL 2IG2L 3WLWD 5JHDD 3A2FA 1H15B 2W91A 4PGCB 1BG1A 4WWPA 1FN4B 3VDAA 3S8GB 3UAJA 2LW7A 4U6YB 1MZYA 1JRHH 1JHTB 3NN8A 1NGPH 1BA9A 2QSCL 1CGYA 3QDME 4OSUH 4ERSH 1RZJL 1XGQB 2IWEA 2ZNIA 2G75B 2CO6B 4LNRB 4MJIB 3S2AA 3Q3GB 1YNLL 1U36A 1JZEA 1RP3B 3L48A 1NSNH 3LDBC 4DO4A 1SYVB 2BP5M 2BZDA 3GXUB 1F4AA 1DJIA 4PH8A 2YI9A 1NZRA 3U7YH 5D5MB 2EDNA 1SQGA 2N0KA 3AS3A 1UM5H 1XT5A 5J0BA 2OKMA 4L8DB 3M17A 4IRJB 3QO8A 1LO2H 4K9EC 1N68A 1DZBA 1HNGA 4W70A 4JFDA 3GMMA 4KL1A 2CAZC 2EYRA 5DTFA 2B16A 5DI8B 3GDCA 3PHQB 5AW6B 2P5WA 1KELL 2WCGA 4ZAKB 3BWAA 4JZOA 1K3EA 1XSJA 3NFNA 5LBSH 1U8HA 3BXNA 2FATH 4JR9H 2YOAA 3HZKB 1RPOA 2FB4H 3PPEA 4LSUL 2LGNA 2XY2A 5D1XD 1BFOB 1YMMD 3RI5K 4EVNA 2K9UA 1ID5I 1BVNP 1BQKA 3CGTA 1W6WA 3U36B 2GIYA 1FO0A 3GWOA 2FL5B 2BY0A 4L4TA 4EDWL 1GYAA 3O2DH 1P5VA 4AE1A 1K85A 3IN0A 3OGCC 4ATWA 2F8IA 1E5ZA 1HQRA 3PHOA 1NFIB 5GS0C 5HYJB 4P0DA 4XBPA 5IW6A 1DL7H 3TNNA 4JN2B 1A14L 1NFDF 5IHZB 3JV6B 1B4LA 3H9ZA 1AXSB 2F08A 3MGAA 3N42F 4UM8B 2W80C 3POCA 3AG1B 5DQ9B 3BRFA 3D3IA 2PLTA 3BWZA 2DF3A 4PB9L 5GHWH 3OPUA 3SSGA 4KUZH 5B8CB 5DSCB 4HNAA 1FHGA 4Q6IA 4E2LA 3RYHB 2VMFA 4XC1H 1ZJAA 2LLGA 5LHGA 2ZOWA 4P5MA 1NCBH 1B6UA 3HAEA 4B95C 1OT4A 4MLSA 3QJFA 4Z7UB 1NBYB 2AGAA 5IK3A 3LQAL 1FFXA 5KYUA 2CWRA 2AANA 2GSIB 2LE9A 3TWCL 4MA8H 1IT9L 2YXLA 2OYQA 5HFLA 2MKWA 5E6RB 3ABZA 1ORQA 2G2PA 4QRFA 5BRZE 2E7HA 5TGBB 1KG0B 3VM7A 4QAMB 1JXGA 5BRZB 5LDSA 2DIJA 1IVTA 4UQ3B 4AZUA 1AH1A 3DMMC 5HYSA 4ALAL 4DVRH 2G3MA 4GXVH 2Q9OA 5IB2B 2PR4L 3MZTA 3QVNA 5CEXA 2BFVH 1KBHA 4X1KA 2I25N 3GS7A 1O7DC 2YBRA 1KGWA 5DD5L 1TTAA 3BH8A 3ESVF 2LGQA 3CJHA 4YC2C 4BW5A 1FNFA 1EVTC 4IS6A 3UAJD 1N8OE 2PCYA 2O61A 3ESUF 2OL3H 1HE7A 1VGEH 3TO4B 2L8AA 3GDBA 5K59F 3T2MA 1CICD 2UX7A 1L0LH 4O5LH 3DGDA 3FTWA 4YDMA 1U3YA 1DSYA 3CN4A 4DGVL 3MV01 5JJNB 5D7IF 4WTQA 3ZMTA 1AHKA 3AWEA 3I9AA 3U0PB 1N9PA 4GAYB 1PKOA 2R1XA 5EBWA 2E6QA 3BRDA 3SJBC 2DEYX 2AQ1A 5CLWA 3BDXA 5KSAB 3FSVA 4IBYA 3QO7A 2C26A 1S3RA 3ULVD 4UOJA 1OARH 4JGUA 4R26L 1R34A 1KZQA 4JFDD 3VG0L 1ETZB 1KF9B 3EYUH 2F53E 1X9UA 4XN5A 4XN7A 3RVVC 1XCQA 2HT3D 1WWAX 2VSKB 2N05A 4U3JB 5GONA 4ORZC 1MABG 2BSKB 3RVXD 2XAJA 4MX7B 4R9HA 5KSBF 2Y69B 1RP9A 4KROC 3DX1A 5A2FA 4OLVL 2CCWA 4ZNCD 4ZSOB 3LB6C 4FGMA 3EUDA 4FTVA 1MFEL 3G6JA 4TYUA 4HOWA 3UPRA 4ZPTB 2QDWA 3QC6X 5EV7A 3ZKNC 2FHBA 3TNMA 3UABA 4B9FA 3MA9L 4LASH 3S88H 2GHYA 3MLPA 1W2KT 1A3RL 2R27A 3K72A 1GSKA 2E59A 2OQJB 4NIKB 5EZLB 2OMBA 1VPOL 3LD8C 4O4LA 2IM9A 1EZLA 4GLRI 1CLOH 4J80A 3QXDB 3FFCD 4WI0B 4D94A 5CZKA 4QXTB 4Z8FH 1S2EA 4X6CE 5IDJA 3GK8H 1AC0A 3UYRL 1S3KH 3ZMUA 3FSAA 1DQIA 4A6YA 5EORL 2QZQA 4JE0A 4ACTA 2W6JG 3CP1A 1SLUA 4XX5A 4XPHL 2R51A 1AD9A 2HLFC 5K1PA 3AT8A 4FHBD 4GIAA 4MD4B 5DLML 3C5ZD 3O4LD 2ATPB 5E99H 1P7QA 5IB5B 2WNKA 3MUGA 3QPXL 4F33A 4KVNH 1CLYL 4X0KB 1V9PA 3T4ZA 2AABL 3PWPA 3HHSB 3CVHA 4HHAA 5K1VA 5DM6V 5C8JB 5FOBB 3OJDA 4XNMA 4I48A 5LGYA 2AQPA 2CR0A 4HWBH 4AOFA 3VD2A 4MVRA 4A2FA 1XF3A 1J12A 4PJAE 4S2SA 2CA4A 4TLTA 5KVEL 1N4XH 3SBRA 4PJAB 4QGYA 1SXAA 4O4YL 3H7BA 1SQXH 4FLOA 5LGJB 1T03H 1E27B 1WUNT 5HVFB 5E5MA 4QRQB 4GG8A 3ZMSA 3GJFA 4K3JH 2XJLA 1LO5A 2ZSWB 4IHJB 1TQUA 4FI6A 5DHXB 4QKXB 3MBWA 4YWGL 4YHPA 1DR9A 4HPOL 5KUKA 1EHKB 3FB5C 4IRZL 3T0DA 3HJEA 1SDYA 1VFUA 3IGLA 3ETEA 1A4JB 4UQDA 5I23A 4B97A 4NTYA 2HP8A 2EIEA 3WJLA 2CU9A 2JKNA 3CHQA 1RUAL 5CMUA 5FV1L 2YIAA 3C5SA 5ANMB 2J8OA 4XPAL 4KQ4H 2VW7A 4GEIA 3BN9D 1L3WA 3MDSA 3QUMH 4O02H 4OCSL 4R4FL 1CQYA 4B53A 4B5EA 4PJ8B 5IVXE 3RFZB 4FQ2H 2A9AA 5IVXB 1P7KB 2W6IG 4F4LA 3MRFB 4YO0A 4KXZH 3GT6A 3DSNA 1NI8A 1JK8A 3ISYA 1DVSA 4YUEL 1CGWA 2N0MA 3OAYH 4FLHA 5J9PA 3KDMA 5JIHA 3R8BB 1Q72H 2D9QB 3ALPA 1VQ4V 2XN9B 3H56A 1SQMA 4ABVA 4C4UA 2PNDA 2H5UA 4NENB 4XMKH 4NKMA 4CJ1A 4DGYH 2DEXX 1I9RL 3L5HA 1QSEB 2YMTA 2F74B 2OV0A 4FTVD 3CC4V 4GFXA 4NQXB 5DRZA 1Y74B 3GGWA 5DJDA 3D0AA 2KDYA 4DN4H 2MEJB 3Q1EA 3NT0A 4AZ8B 1BEYL 4N2DA 1ZGLB 1I1FA 3NXSA 1EX0A 1ZE3H 2YD7A 2GK2A 1RM1C 2IXQB 4MQXD 3X3GL 1P4RA 1A8ZA 3QG7L 2ZKMX 4YLCA 1FWXA 2CALA 3FQWA 1U8QA 3SDCB 3VXNB 3BKCH 2YRBA 2CKBB 4M7KH 1DCLA 5DFVD 3N44F 3Q6FB 3OWRA 3ZYOA 3ZHSA 2B15A 2FT8A 2BSDA 5EBGA 3UO2A 2ZNXA 2IU0A 2VXSL 5IOPB 3IGAA 4G6KL 3B2PA 1TJHH 4PJEA 3CYOA 4P5TC 3OKDB 1P7QD 1XF4A 2RHEA 4Z7IA 4OAWA 4U6XB 4ZHQA 1MHEB 4HXAL 3SDLA 2UXTA 1QOKA 1SLVA 3EJPA 3PWPD 2PYEE 4Q8BA 3GINA 5CMAA 3PP4L 2WUCH 4H5SA 2PYEB 4EUPA 2KYIA 4JPWL 3CCLV 1O7DE 4Z7WE 3LTVA 2QQQA 3GI9H 1UJ3A 1JI2A 4UUJA 1NCAH 2P7TC 1VCAA 4OJFL 1B9KA 4GQQA 3U4BH 3S3WA 4TLKA 5JDJA 3SDXF 2UUBB 4F1SA 4H1LH 4X5QA 3SE3C 4AE0A 1ASPA 2JEUA 2ZTBA 3U30C 3DGEA 1W15A 3F00A 4LEOB 3DARA 3G6BA 2ICWI 4LZKA 3HOGA 1X7QB 3GUTB 1RUKL 4AIOA 5F9DC 3T1FA 4MVQA 4XBGB 5ESVA 5I30L 4ZOLA 4LOUC 3FT0A 3S5LB 1MXGA 2Q7AA 4GAJH 3HKCB 4XAKD 4JPIA 3DTXB 3KZ8A 3L2LA 3BP4B 3MOBL 1W8EA 2F7IA 3LH2H 3HHMA 1M42A 1VQMV 2CR6A 1H15A 4DQAA 4PGCA 1CXIA