3AG3B

Bovine heart cytochrome c oxidase in the nitric oxide-bound fully reduced state at 100 k
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag3B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag3B02
2DWTA 4WTQA 1L9SA 4G7SB 4E9YA 4RH4A 1OCOB 1A3ZA 1AZRA 1JXGA 3EF4A 4HCIA 4AZUA 2IDFA 4G7QB 2ZONA 2OJ1A 3KW7A 3CDZA 3D12B 3WNJA 2AVFA 1J9QA 2OV0A 5B7FA 1XMEB 4NERA 2P80D 1AOZA 1KV7A 1AIZA 1I53A 1ASQA 1PLAA 2FQGA 4BWUA 2ZOOA 5PAZA 1RZQA 1XB3A 2XU9A 7PCYA 4P5SA 1PZBA 1W6LA 3NJNA 3QPKA 1EHKB 2TSAA 1NICA 5B1JC 4GP4B 2WO2B 4E9SA 1OCCB 1GR7A 3ZX1A 2JFCA 3PPSA 5I5MA 2BZ7A 2DY2A 4A2DA 1ZDSA 2VM4A 2IH9A 1NIAA 2FT6A 1AG6A 4KO7A 1JZIA 5ANHA 2JKWA 2GSMB 4DPBX 3S3DB 2FT8A 5D4HA 3QJTB 2HX7A 1RCYA 1SF3A 2BWIA 2IDQA 1JZHA 2I85A 2R7EA 3DIVA 4G71B 1IKOP 1SHWA 2YXWA 1KCWA 1YLBB 3IN2A 4GXFA 1HAWA 1AANA 5D4JA 3NYKA 2BP0A 4FA7B 2IH8A 1IUZA 4KOCA 2FWLB 1AACA 2YAPA 2CBPA 4YL4A 5B1KA 4G7RB 2XX0A 2BP8A 3WKQA 1JOIA 3MBWB 3AG2B 3X1GA 4YSEA 1TU2A 2NRDA 5B1JA 1NDTA 3T9WA 1BXUA 1TEFA 2UXGA 4HAKA 4F2FA 1BYOA 3GYRA 2DV6A 4AI7A 1IBYA 1CYWA 4E9TA 2XV3A 1OE3A 2PLTA 1A65A 3WI9A 3NJFA 2DYRB 2QT6A 3WKPA 1OE1A 1M9WA 2XYBA 9PCYA 4YSAA 3WNIA 1OF0A 3UGEA 1JERA 3SBPA 2H3XC 3NP4A 2XXGA 1JXFA 2P80A 3ASNB 3ABGA 1QNIA 1E5ZA 1NPJA 3TASA 2HZHA 5TK4A 1PCSA 3FQYA 3OM3B 1GS8A 2FQFA 1OCZB 1SDDA 1OE2A 3JTBA 4N4YB 3AG1B 5B7MA 1JZGA 2DYSB 3EH3B 4FAAB 2BWDA 2FT7A 4HHGA 2YEVB 1GS6X 1HFUA 4E9WA 2GC7C 1BEXA 3AG3B 2ZWNA 4YSSA 1CURA 4L0PB 1QLEB 2XX1A 1KGYE 3QQXA 4E9RA 7PAZA 3FSAA 4DP9X 1SF5A 3N2JA 3NJKA 1MDAA 4PCYA 1NIEA 2J57A 1J9SA 2YAMA 2PP8A 1FFTB 3ZBMA 1AAJA 4DP1X 1GY2A 1SFHA 1ADWA 1AS8A 4BK5C 3ZIYA 3S3BB 3EH4B 1L9QA 4Q8BA 2BW4A 1E67A 4M3HA 2VW4A 3HEIB 4DP4X 1XB6A 1KDJA 5EHFA 3PCYA 2PP7A 1NIDA 1L9PA 4W1TA 2GIMA 3OMNB 4A68A 3SBQA 3OMAB 1MZZA 3SQRA 3X1NA 1TEGA 5LDUA 1JZJA 4WKXA 4YSOA 2HX9A 2H47C 5IY5B 3T6ZA 3NSYA 1NZRA 1NINA 3TA4D 5I26A 1WS8A 3V9CA 4AX3A 1CYXA 3OD3A 1ID2A 5I6LA 4JHVA 5AKRA 1SDDB 3NSCA 1JXDA 2X88A 4E9XA 5I6PA 5B1AB 1BQRA 4G70B 1E65A 4YSCA 5I6MA 1SNRA 3ZDWA 6PCYA 1PLBA 4YSQA 1NTDA 1JZFA 1BQ5A 3QJUB 1T5KA 2UXFA 4GY4A 1GW0A 1ZV2A 2Q5BA 1AQ8A 2HRHA 4M4RB 2BHFA 4UAHA 2TSBA 4DP6X 3X1BA 3FU7A 2FNWA 2YAEA 4YSUA 5B1BB 1ZPUA 5E9NA 1PF3A 2JXMA 1DYZA 2H5UA 4HALA 4MFHA 3BQVA 3BVDB 2IDTA 3DKHA 2BP8B 3OQRA 4HHWA 4KNUA 2CJ3A 2EINB 3NJGA 3UAEA 5I28A 4NB7A 4QKTA 3CVDA 2MTAA 3NJHA 2PPCA 2I7OA 1BYPA 3TBCA 1PNCA 2HRGA 1BAWA 2R7EB 4HIPA 3GXUB 4QLWA 2YXVA 3FS9A 1NPNA 2BP0B 2W88A 2AFNA 3T6XA 1KBVA 4KOBA 4DP5X 4UANA 2X87A 2GC4C 3C75A 4A2HA 1IC0A 2GI0A 1ET7A 6PAZA 1UATA 2CALA 4KO5A 1WA0X 4W9ZA 1A4AA 3JT2A 2YAHA 3EH5B 2PPEA 4BWWA 4E9QA 4CSZA 2YARA 2FQEA 2VMJA 3T6WA 1BXAA 3ABMB 3FSVA 4HZ1A 3V9EA 1FA4A 2XWZA 3CVBA 2ZXWB 4K9JA 4E9VA 2VW7A 2FQDA 1AZBA 2XV0A 1AS6A 3NJJA 1ASOA 1JVOA 1PLCA 3S8GB 3U25A 2LLNA 2UX6A 3AW5A 1OV8A 3FU9A 3NJLA 3UABA 1HAUA 2QDVA 1X9UA 4KO6A 3WG7B 1ET5A 3PAZA 3QJSB 4YVNA 2IAAC 2B3IA 3CVCA 2BO0A 3IBOA 4F2EA 1NIFA 1ZDQA 1OOWA 1KCBA 1J5DA 4TXVB 3T6VA 2N0MA 2DWSA 2QPEB 2XV2A 3UACA 2HLEB 2EIJB 1M57B 1KYAA 1IBZA 4UF7C 1NWPA 2PCYA 1PAZA 2GB2A 5I6KA 1KBWA 3NSDA 4YSRA 4BXSV 4KO9A 3EHBB 2VSMB 3IN0A 1E30A 4F7KA 3X1EA 4BDVA 4A66A 1OCRB 3TBBA 3NJMA 3FYEB 3L45A 1SFDA 2HX8A 4X4KA 2J56A 5FC9A 3QJRB 1GS7A 1GSKA 4NAJA 2PCFA 4EF3A 2QPDB 1RKRA 3SBRA 1AR1B 4BWTA 3WIAA 1M56B 2CCWA 8PAZA 2IDUA 4HCFA 5I6OA 2EIKB 1PNDA 3UAAA 5B7EA 4AKPA 2XXFA 1AG0A 2B08A 3KW8A 1WA2X 3DTUB 2IDSA 3PLYA 5PCYA 4ZK8A 3OMIB 3X1FA 2XUWA 2PP9A 1FWXA 1W8EA 1PY0A 3FPXA 3FU8A 3UADA 1BXVA 4YVUA 5TK2A 4GP8B 3NJIA 4DPCX 2UXVA 1CUOA 4A2EA 2VN3A 5F7AA 1ZIBA 5AFAA 3PAVA 2GBAA 1X9RA 3G5WA 4BDVB 1AZCA 3AG4B 5A7EA 2IWKA 2Q9OA 1AZNA 1WS7A 1TKWA 1AS7A 3H4HA 2GHZA 3S8FB 2XLLA 2CUAA 4Q89A 2AZUA 1ILSA 4BXVA 2UXTA 2YQBA 3NT0A 5AZUA 4DP8X 1E5YA 1J5CA 1V10A 3ABKB 4JHUA 1L9OA 3FSWA 1B3IA 1J9RA 3NP3A 3PXLA 4ENZA 2YAOA 4A2GA 2Y1AA 1RZPA 1BQKA 3ASOB 1ZIAA 1MZYA 5D4IA 4YSDA 3X2QB 1WA1X 4P5RA 4CSPA 3AZUA 3N55A 2EILB 1ETJA 1NIBA 2WSDA 4JKNA 3FQ2A 1NWOA 3PAUA 5I5JA 3HB3B 3IEAA 1A4CA 2WO3B 1A8ZA 2I7SA 4DP0X 2FTAA 1DZ0A 2PPAA 4DP2X 2RACA 3FT0A 1EZLA 1PZCA 4HCGA 2EIMB 1V55B 5I5IA 3CG8A 3NSFA 2Y69B 3IE9A 3CZUB 1AZUA 1JVLA 1KDIA 2PPFA 3FYIB 3GDCA 2QDWA 2J5WA 4G72B 2IWEA 4AKQA 2MRYA 2HXAA 4A67A 2YAFA 2YAQA 2W8CA 2E86A 1L9RA 1PMYA 1VLXA 2VSKB 2VW6A 4PAZA 2PPDA 5B3SB 1ET8A 4N8UA 3S3CB 3T71A 3TU6A 1N70A 3MX0B 1GY1A 3FSZA 4GP5B 2CAKA 1A4BA 3QJQB 3CDZB 1XB8A 3FPYA 4AKOA 2J55A 4GYBA 1JZEA 2UX7A 1QHQA 3FQ1A 4DP7X 1GYCA 1SHXA 4A2FA 1ASPA 1F56A 3H4FA 1MG2C 2A3TA 4YSPA 1CC3A 2AZAA 2IWFA 3AY2A 1L9TA 1V54B 3FU7B 1WAEA 4YSTA 1SJMA 1J9TA 3QJVB 2AANA 1MG3C 1ILUA 2OCCB 3RYMA 2VM3A 1R1CA 1W6WA 4KNTA 3H56A 1N68A 2BW5A 5I6NA 5F7BA 1URIA 3ERXA 2FJSA 2BZCA 1PZAA 3ABLB 2XVBA 4KNSA 4DPAX
chains in the Genus database with same CATH superfamily
3MV8E 3VVVA 4N2CA 3VDAA 5I0YA 3TN0D 4QD2E 1N3NA 5I16B 1UENA 5E2VL 1C16B 4U6YA 4WWKA 2WZPA 1JXGA 4U2YA 1IC5H 1OSZA 4FLZA 1MHPL 3WFBH 4W6YB 5DFTA 5EC2B 3SDDA 5CXPA 2YD1A 2GTZB 1QRNB 2E7DA 1T03L 1OCWH 1U8OB 3RU8L 1SPDA 5DLMH 3CFEA 1M7IA 3M17A 4XCYB 3BVVA 1KYUA 1IIKA 4ZOBA 4ZS7L 4N3UA 3BKCH 4RIRB 3KDMB 1MCJA 3OGCC 4U6HB 4ZRGA 4EDXB 4MASA 4N5EC 5H94A 1IBLB 3IFLL 1PEWA 3STZA 5GS2D 3CV5A 3SDXF 3WBDA 5JOFA 2YC0A 1TR7A 2LJ2A 3K5NA 3CVIL 3MYJA 3Q8AA 4FFVD 4GP4B 5HHMB 4B9YA 2BHZA 4LPXA 1KJVB 4TQDA 2O5XL 3VWJA 5LWYL 3LSOA 5B4MD 1J88A 3ARUA 4L05A 4AL8H 1NFDA 4G43B 2WBJD 3O9WC 4NUGH 4ZUTA 2WOYA 1AMYA 1BGYH 3NPSC 2NXYD 3LPWA 4QGYA 4KRPB 5L7XH 2X89A 5FCSH 4LPUA 4ZUWB 3IDJA 3T0XA 5FYLL 2OXHA 1Q94A 4XC1H 3ZE2E 4ZFFA 2I85A 3IJYA 2CK2A 1A6AA 2R7EA 5DD3L 5KSAC 4H8QA 5DFAA 3N41F 1CTNA 4PJEF 4X6CB 2JNZA 4MZ3A 2F8VA 4FF9A 3S3DB 1OF2B 2VITA 2EDRA 4ZZFA 5IW6A 1AJ7L 5G4NA 2E9WA 4FKEA 1HXYA 5B1KA 3OGCA 3LKPB 4GMSH 4QRSB 4TL5A 2XTLA 4AEEA 5D7LB 3B9VA 3ZLQC 3ARVA 1EJ8A 3TEUA 3MRHB 2QSAA 2FX9H 4HH8A 3C5ZB 5AEAA 1AI1H 5DFWH 1S3RA 3L2NA 4UDUB 4LBAA 2P43B 3SDAA 3F5WB 3L4WA 3WB2A 1M2VB 4Q56A 1OAYH 1BYOA 1E28B 4J42A 2DV6A 2ORBL 2NYYC 4OIBA 1KFGA 5DJZB 1A65A 3NIDF 4MXVE 3MJ9A 2XN9B 5D7JA 4GKJO 1WICA 1M9WA 3VXOB 1CDIA 1H0DA 3ZIAG 4MD0A 3RY6A 1U6AL 3TV3H 3GUTA 1JXFA 5EBWC 1HDMB 2J6WA 4Y2LA 5KVFL 4NKMB 4DV0O 3CN3A 2WN3A 4EB6A 1F4XL 1FNSH 1GS8A 1P7QB 4NS0A 4WFGD 3MOQA 4U7SA 2YI9A 4PREB 3IJ4A 3IC7A 2CDFB 3LEXB 3IB4A 3EH3B 4OD3H 5BY1A 2HFGL 2K3HA 3L9EA 1FS0G 3TBYB 5I8CB 2JKTM 2ZOLA 3KM2A 3MOAL 1Q0EA 1QBAA 1HDMA 5CJQH 2ILMA 3IFPB 2L3BA 3IMSA 1WIOA 4LB8A 4NZFA 3DLQR 4KITB 5FPIA 1LE5A 4DERA 3AG3B 3CFBA 1ZT4B 3ULUC 2HA1A 5TDNA 1IXMA 3BFOA 3N44B 4G42A 3RL2B 3WNLA 1QABA 3P0GB 3Q2VA 4APQD 1D6EA 4GX1A 4DR6O 2D3NA 2J57A 3L70H 3H53A 3O2DL 5KWYC 4YE4L 4UU9B 1H5BB 4N1EA 3WFEL 2PYLA 3KPPB 3KPLA 1EAQA 1CFNB 5LNDA 3NCWA 1FORH 1F3DJ 3LTVA 3VWKA 4ELDA 3DSNA 3CCVV 1GY2A 1SFHA 4M4RA 4MCYA 4P48A 2ROXA 2E9BA 3ARXA 4ZHQB 4JZOA 1KIUB 1AJPA 3K59A 4QTIL 3EH4B 5TJWK 3S3BB 4F7TB 3W7TA 5JPNC 2BW4A 1JN6A 1WBYB 2V3EA 2Q8AL 3V4UH 2EH7L 1ZHNA 3RG1C 4CA4A 4F7PA 4LH6A 5KVEL 1MZFA 2Q6WB 2D7TH 4XVSL 3FX7A 2X2JA 3MLSH 5I1CH 3SPIA 1PD1A 2PW2B 4W1TA 4Y16C 5C3LD 3VDCA 1FG2A 3FUEA 3CFQA 4I0CC 1XF4A 1A9VA 5LBSL 2ALWA 3ZX6A 2F54D 1V3MA 3HS0C 5HYJB 1M7DB 3MRRB 1PG7X 3AAZB 1LUVA 1CL7H 3NSYA 4LKXA 5FYJD 3QS2A 2OZNA 3E8UL 5CBAA 4YAQB 4KHPB 2GUOA 5TF1L 4LHJB 1LE5B 5FGCB 2KKWA 3NSCA 4ZXBD 3DURB 5KG9A 3CHXA 4DW0A 3R8QA 4BEIA 1Q5OA 3O4OB 1N59A 4MA7L 3RNKA 1WP7A 1I82A 1Q0YH 4G70B 4BIKA 3ZDWA 1ROCA 2V17L 4FFKA 1GYVA 1WTGT 2VH5H 4GLRH 3QO8A 5F7NC 5C07E 1ZOXA 3CN0A 1CFNA 1N34O 1RUML 1T6BX 1F4AA 4BGLA 1BGXH 3QRGL 1GW0A 1JHLL 1Y0LB 4EOWL 1T89A 3KE0A 3LS4L 4JRFA 5DJ6B 2RQEA 1SQGA 1AXSB 2QGBA 1INQB 3OE7G 2ZKWA 1WZMA 2KERA 3DGEA 5DUPL 2GSGB 3KPRE 1NBMG 1PF3A 4ZFOL 2OJEB 4YHNA 4EN3D 3GMOB 4Y9GA 4FOMA 4Z7VB 2NYKA 2AS5M 4DXWA 2V33A 4UTBL 3F5WA 1YNLH 1AP2B 2BP8B 3MA9H 4B3MO 2BCKB 3RZWA 3O2DA 5E2JA 3WEXB 4IGBA 4TSAL 5FAAA 4TSAH 4C54A 4ETQA 3JD1A 1DBKH 2JRIA 1N3NB 3JALB 2FBRA 2P7TB 1B4RA 1K85A 4RGND 4QKTA 4I85A 3KPRA 3ZKMC 4EN3C 2NYZA 1NKRA 2GJ6E 1KB5B 4HIPA 3H85A 4NWTL 3IXAB 3LDDA 4ILDA 5EU6A 1URZA 1NKOA 1ZT1B 1RAMA 4M3JA 1XNRB 2XKNA 1LK2A 3ZDYB 5GW7A 4MJ6A 1A6AB 4L23A 5DGQA 3MSPA 5JW3L 1YNKL 3P9MA 1DP0A 2ADYA 3X12A 5E2WH 3DBSA 1RZJH 1NJIW 4TNFA 4ES9A 3TPUA 3T4DA 1ZT7B 4GXVL 4XAWH 3FO1B 4KH2A 2NY1D 4M1DH 1E3FA 2R0KH 2P22C 1NT2B 4JFED 4ZMVA 5GXBB 2P67A 2K70A 3ZKXB 1Z66A 4BJLA 1MCPH 1HTYA 1NLBH 1EERB 2OQJA 3CFCH 5CEZD 4HC1A 3D3VB 1OF2A 3VXQA 2X4NA 4XP9L 3AW5A 3FU9A 3BVOA 4FQ1L 2UUAB 1INDH 2J12B 4AK2A 4LVOC 3B9DA 4DCQA 4ZFFB 5IJ0B 3V5DA 1M7IB 3OX8B 4B9IA 4HOZA 3AXIA 1U8OA 1I75A 2XI9A 3FTYA 3T4ZA 3MLVL 1J5DA 3MRIA 1HJBC 4AC2A 1CEZA 3CPWU 2GT9A 5F21B 5IB3B 2NY7H 4QXTA 5E5LA 1YUHB 1GGBL 1OP4A 3JATA 3SGKC 1M6UA 1Q1JL 4NTYA 1TJMA 1N2RA 1OAXH 3LSOB 1TTFA 1N5AB 3VWJB 4U6YB 1JMKC 1A2YA 4DR7O 4F7KA 1RZKH 1IAIL 4GBXB 2X7LB 3TVMB 4BIZA 3GEFA 1ZHNB 1SVBA 3FCSA 2DQDL 4NIYE 3CDCA 3KYOB 1AZZC 4F7PB 2J43A 3EBGA 5EEVA 1XNQO 3JYBA 2JV6A 3FUFA 3FBKA 5J9PB 4JI7B 3X13B 2X4PA 1QNZH 3DSNB 5DHEA 1V3KA 2V8MA 2VLMD 3QJRB 4TS6A 1RVFL 3WKML 2A6DB 2B39A 3T8XB 3MODL 3CSYA 2GTZA 5I0DA 4XNAA 3WXWH 1KBKA 4NENB 3J7AU 5CA1B 3HFFA 1IAKB 4WFGE 2K6ZA 4PIRF 4NFCA 4P46D 4DVBA 4Y9CA 3UTSB 5I6OA 1R34A 1FBIL 2XWXA 2ZCKH 4GG8A 3L3DA 1AH1A 3CSXA 3LNGA 4MKMA 3DRTA 4NQQA 1V7MH 3QEQA 4X80L 4NRXB 4BKTC 1IAIH 3N50A 5FKPB 5GSVA 3VI3A 1QP1A 2F54E 4ODVH 1SXBA 4BYHA 1XCQB 4EZJA 2WNKA 1JI1A 2VXQH 4G6MH 4IBTA 2YEQA 5LUMA 1XDTT 2EX3A 3NSXA 4BQ8A 5HGDB 3F7LA 4FTDA 1I8LC 5L0QC 4ETYA 4P05A 2YUAA 1R0AL 3MMEB 1XGUB 1QVFU 2IBBA 5IFJA 3PJSA 1YQ2A 2J5LB 5EO9A 5L2JA 1N6QH 2C8NA 5DD1H 3AADB 4JY6B 1Z9MA 3W7UA 5CEXA 2GBUA 3HKZA 2YN5A 4WEUD 1UUSA 3NJVA 4BDVB 1A14L 2AEWA 1B6DA 4K73A 2DN9A 3JD2A 1YVLA 3C08L 3VU2A 1JPXA 3D85B 4ICGA 1FO0L 5C0RH 4AIZB 1E2VA 1N64H 3PABA 4HGWB 3LNHA 1BVZA 4IJTA 2LTQC 2VQFB 4WUUE 5GS0C 4NQCD 2YGNA 2JGDA 2OMVB 5I17B 2LGWA 3EG9A 4IGGA 1FZMA 1I7UA 2J5LC 3HG4A 3REWA 5HBBA 1S9WA 1V10A 1XGQB 3CDFA 4GRWH 4YN3A 2QR0A 3BKJH 3OEEG 1A7NH 3RWIB 5ACZA 4DV1O 3O8XA 2G60L 4MNGA 3O9OA 5CZXC 3BUBA 5F93C 1UGNA 1I8LA 3QUYB 2GUZB 1F3DH 4BUQA 4GKKO 2AHIA 1PW3A 5J6HA 5L3CA 2F53D 1XAKA 1NIBA 3QXDB 5I76B 3ZMUA 4BFGA 3RB7A 3MUGB 2XWJA 4C59B 1A6UL 5JUEL 3R19A 5ILTL 1J0YA 3CVIH 4BKLB 2PXYB 4KTDL 5KOVC 3MA7B 2K78A 2F53E 3EFFB 1TVDA 4JPIB 4V2CB 5L88L 4X8CA 2QHRL 4G43A 4ZUTB 3EO1A 3SE3C 1NTKH 3GJEA 1CZ8L 1MJ8L 4KHXH 1NCGA 1UEYA 4JRXD 2MSPA 3SBWA 1JNHA 4X99B 1BZ7B 4NQXA 4ACTA 2UWEE 3V0AC 4JK0D 3MJWA 3SN6N 4MX7B 2NY2D 1OIOA 2PPDA 3GGWA 3T71A 2WCPA 3T2MA 1HI6B 1OTSD 4KTYA 2VO8A 2EDFA 4N0CC 1NMBL 4GP5B 2YXFA 1D7DA 4N1HB 4NRXA 1BHAA 4F8TA 4LPTA 2YMTA 3WLBA 5JIDA 1VGEH 2O5XH 1ED3B 5DC9B 1QPKA 1I31A 1F1DA 1P1ZA 2I5YH 2WIIA 1QW9A 3V0DA 3IDIA 1GC1C 1BM3H 1FFQA 1YDPB 5CGYD 3UAJA 1BX2A 3IC9A 5F1IA 1NAML 3AY2A 1QVGU 4H2CA 1IM3A 5H35B 2YXYA 3SIKA 1JF5A 3NN8B 1YJDC 4F20A 3K04A 2X4PB 3ARBB 3TXSA 2XTJC 3GKZA 3OLEA 2IFGA 4OF0A 2K9FB 2XA3A 3RU8H 1MVYA 1QRKA 4ZMXA 1QLFA 3MRDB 4Y4FC 5SWQA 2X9WA 2QMKA 2VZTA 5HVWA 2ATAA 2VM3A 2Y5QA 1S72V 1TTUA 4Z7OF 3H56A 3BH8B 4G9FA 5IR1A 5DEFA 2EDDA 1JRHL 2W6JG 3CMAV 3DV4B 4Y19D 4J2XA 2BZCA 4F3FB 3FDWA 4U1MB 1WFTA 5E2VH 1YEKH 2B3RA 5KJRL 5L4JA 3HHMA 1Z7JA 3JV6A 4JYAO 5E8OA 2DWDA 4XO3A 4YXWG 4KI5D 4RH4A 3LNDA 4V1DD 2IBZY 1XF2B 1RPOA 3FQWB 5T1DL 4B6ZA 2JTYA 3UJTH 4NZRL 3UYPA 4NXSA 2OMWA 4FFVC 3MRBB 3ZL1A 3KW7A 5HHNA 4FRWA 2NX5D 3UBXG 4PCSA 1COWG 4DK0A 2OV0A 1TNMA 3QIUC 3RVTD 4ICXA 4NKGB 5TFSH 2W0LA 2ZZUT 2Y7NA 1KB9F 3DMMA 1E6OH 2AABL 4LASL 1O9WA 1ASQA 3MCKA 1SOKA 3WKYA 3TWCL 1HNFA 2F0CA 4MXVF 5AOLA 1U8IA 2XU9A 4X66B 2Q20A 3AACA 2GFBB 7PCYA 3HZMA 3MRPB 4OLEA 3QRBA 1OP9A 5J1SC 3QPKA 1IM9A 3QNFA 2ADQB 3D3IA 4IIZA 4ZQKA 2WCSA 3K5RA 1BFOB 4H88L 3BWUC 3PJNA 5BRZE 4L8SB 4APXB 4QRRD 5BMVA 3HKBB 2E8ZA 5D5MF 3JTTB 4ANUA 5AW1B 1ZCRA 1TJIH 5I8OL 4CC6A 1AR1D 4M9PA 3GXDA 3AB0B 3ALPA 3QZBA 4LQ1A 5TGBB 5EZYA 5TDOB 4Y8AA 3Q8CA 5D4HA 3VW3H 2EDTA 3UPAA 1F6AA 3QEQD 2RQ8A 5DMIL 3S34L 1I7ZA 3UAFA 1E4JA 1SHWA 4YDMA 1E40A 2Z5UA 3K6IA 5D2LB 1FO0A 4I3RH 3OVUB 3ILDA 3TO4A 1TLMA 3IAQA 5I1EH 2F08A 3WFHA 3DMMC 3P0VL 4HJ0D 4HFUH 1ZJBA 4OW6A 2Y0PA 4JBSA 3OR6B 1FP5A 1X4XA 1HL8A 4GUPA 2YAPA 4ETQB 5HGBB 5DF0A 1HQRB 2DQUH 3CFDB 3DV6B 1FJ1B 4I4WB 3FONB 4CU7A 1JWUB 3G04B 1BOGB 1KJ3L 2W6IG 5D5ME 1RJYA 1TU2A 1ZA3A 4E2OA 4LL9A 4RWYL 3ZL2A 3MBEA 4PLKC 2N04A 1FPOA 1F58L 2WXLA 4LCYB 3BKML 2MCMA 4NP9A 1RURL 4XMUA 1VKXA 3ZE0B 5LAXA 1HXMA 4PA6A 4YPGA 1OE3A 1A7BA 3UXFA 1NGZB 2DM2A 5BS0E 4OFYA 4R96B 5F9WC 4I5BA 2AC0A 4YDZA 4B3SB 4LMQI 1GMIA 1NOAA 3SBPA 2DI8A 4BK5A 2JI2A 5JA8B 2NW2A 2RJMA 5C86A 5BW7A 4L8CB 5CO1A 6FABL 3BUQA 3OM3B 4ZIBA 1QHPA 5IMLA 2BNQB 1MFVA 1OW0C 3MV7B 4EI6B 4I0XB 1QFUL 2EO9A 2J8UF 4I9WD 4K15A 3RYCA 4LEXL 4NNXA 5B39G 1BJ1H 4N6RB 1CXHA 3AT9A 1HIMH 1ZVSA 1BEYL 3BRGC 3JZYA 3D3VD 2HMID 4OD1H 2VWKA 1XGTA 4YDVB 3CPLB 2FATH 4OZHA 2VERA 4FQ2H 4R7DA 1KP2A 1DFBH 4LVHC 5IB4A 3GSWB 3LN5B 1YQVH 2W59A 4C83B 4E9WA 4P23D 4EQ3A 4I1RA 4YUEH 4FHBD 2V5MA 3GTTA 2P48B 2B5UA 3JD4A 5JQ6H 3MLPA 4K8RH 2NDFA 1GN3A 4WK2B 4I9WE 2E4FA 4HAFA 1WNSA 2WB1A 4MAYD 2ISDA 2UUCB 3HG1B 4X4MA 5HGAB 1N32B 3WMSA 3GIVB 1XGRA 1QLEH 1T5XB 4AM0B 5AOKA 2XWDA 2ICWA 2JQZA 2BIIA 2Q1EA 3D2UD 1HHJA 5FUZH 5IREA 3BZFA 1Q9WA 2V5YA 4JDVA 4OFPA 3LIZH 2MQ3A 4J39A 1T5XA 4CSSA 1C1EH 2C9SA 4D94A 3T8VA 2ZWLT 4JFYB 1XGPB 2WJ7A 1MF2L 5A2BA 4JG1H 4PTUA 4Z78A 3D39D 1L9PA 1P7KA 2APVA 3N43B 1DE4A 5BV7C 2L4OA 4NKQB 3TEWA 4HJJL 1S77D 3O6ML 4OAWA 1EDQA 3HB3D 1TMQA 5LYJB 3T2NL 2W0PA 5KYNA 4S0HA 5TE7L 3V9CA 3BISA 4PJXF 2CPUA 5HTSA 3IFXA 2OMZB 3D33A 2PY5A 4KQ4H 2ITCC 1KB5L 5IYZB 3RVZA 1YC8A 4K9EL 5F1KC 2BSRB 5B4MC 4K3HA 5TQ2H 2D7NA 5AVSB 5HI3C 3IMBA 5DRNB 2H3OA 2D7QA 2C1PA 1DDTA 3DC6A 2VISA 4XNXL 5E5RB 4JLRB 1KTJA 2GHWB 4MD0B 4D7TA 2WANA 4L2YA 4ODSH 4XVOA 4O4LA 4R96A 4CN6A 3PWPD 5D7JB 4JQVC 4RRPM 4BA8A 3I75B 4DKTA 2UXFA 2V7NB 2XETA 2Z7UA 5ADPH 4KK9D 4KZDH 2IH1B 3QYCA 4LRIA 2AVGA 1MCOH 3IS0X 4Z7QE 4UAHA 1U8KB 1UQSB 1J1PH 3VXTA 1QA9B 4NGHH 3WFVA 3SPVA 1ZA3B 4Z77B 4HBCH 4OF6A 4JI5O 5KW9L 3O4LB 4LF9B 2VIRA 4FFYH 4L4VB 3VNZA 3P3SA 3J81N 1FHGA 1AY1H 1QX1A 5E00A 3LZQA 3JAKB 2ZJSH 3I55V 1MW1A 3BLPX 5E94B 3QC5X 4NB7A 1I7FA 1WAAA 2MTAA 2FX8H 4WW2F 3RUGA 3CD6V 4ZW3A 2HH0H 3TBCA 3OL2A 2EXYC 1ZPLA 2DS4A 4BA0A 1DN0B 5C7XH 3ARGA 3DROB 4YWGH 2OXHB 3ZN1A 3T6XA 2Z1PA 4AMXA 5CLYA 2DI9A 1CDBA 3WY3A 1IM9D 4L9LB 5F6HI 4LKCA 1MIEL 5LJYH 2J1KA 4LBEB 3C75A 3RYHA 2DQFA 4XWGL 3ZL4H 3HC3H 2V7HA 4D7SA 3V0JA 4PY7B 5CSBA 2YAHA 5E6UB 1CICA 5F89B 5C0JA 4ORGA 3TT3H 5CZVL 5IVXA 5AB1A 1XEQA 4Z7IA 1A6TA 2I07A 3POCA 2CO6B 2J21A 4HBNA 5FUOH 1NCOA 2HJDA 1SZXA 4WTZG 3STZB 5ETUB 1J0IA 1N9PA 2E9JA 5IBUB 3NCBB 3ZDZE 1UOVA 4Z76A 1AZBA 1DLHB 3BAKA 2VDOH 4FQXA 3S48A 1ACYH 5BQ7A 3V52H 4S0SD 3BPOB 5C9KA 4JI6O 3IGUA 2OR9H 8FABA 1A7PL 4GSDH 4QHUA 4AITA 1NKGA 3FTVA 3VXRA 3QK0A 2XAJA 4BK4A 1HZLA 2F1AA 3CZFB 4Z7WA 1SLVA 3NZ8A 4Y7OC 5E9DD 5GZOA 4FNQA 4LCUC 2EXTA 3D52A 3L3OC 3OAYK 3Q13A 1S3JA 4N87A 5EUOF 5CEYA 3H0TB 1Z5LB 2EC8A 4A37A 1SN2A 2W1NA 3QXUA 3S8WA 1JGLH 2DMHA 1L4IA 1EN4A 2N0MA 4L8JA 5CF3A 3MBED 5J5EA 4HK3N 2B1IA 1KTKE 3BUPA 3RWDB 3SOBL 1SXSA 5MEQB 1AYOA 1MELA 5DHVA 2CGRL 3HKDA 4WCEV 4LOUD 3DC5A 1Z9LA 2OZ4L 5EOTB 5E8NB 2H41A 3D8CA 4D9RE 1E30A 3AG4C 1JGVH 1PZSA 2VDKL 2Q8VA 3JD0A 3K2IA 3OUSA 2PW1A 4DO5A 1MHPH 5B1NA 3MGAA 3FW6A 2YUVA 4TQEL 2X7RB 1CS6A 4G59C 1GOFA 3MBXL 3ETSA 3BAEL 3NCJL 1SJHB 4ERSL 2XDHA 2VDRH 1U58A 2ESVE 2G38A 3VXSE 4OCYL 1L7IL 5IHUL 4BWTA 5E1AB 2X2UA 1CXZB 1UXSB 4W68A 4HVBA 1SF9A 1UM5L 4UQ9A 1S76D 3JQOB 3CB2A 5EF0A 4UOW1 4RFNC 3G9AB 3PRZA 2JE8A 1XBDA 2NXZD 5I23A 1LO0L 1T04B 1UZ8A 2OYKA 4MD4A 1WO2A 3LB6D 5LMNB 4MXQC 5K9OB 2N59A 5E8EB 2FE0A 4FN0A 5EUOE 5H4YA 1FNGA 4JFOB 4N8CH 3ZE1E 1YN7B 3S3WA 1XCTA 3BKJL 3FPXA 4RFEA 1OAKH 5HGGS 1X5HA 4TSBL 5KVFE 1PL4A 2ZXQA 15C8H 4PJCB 1P1VA 5C0BB 1W91A 1D7BA 4DGVL 2ZE8A 2EQDA 5AYUH 4MGXA 5JR1L 1QFWL 2D4FA 3VSUA 4Q6YA 2EDKA 4NM8H 2ZNXA 3L95B 2AXGB 4U1LB 4XTRC 4UB8Z 4HDIA 1UFUA 3DHMA 5B5EZ 2ICEA 2IWKA 4LOVA 1OEZW 4KGLA 4X8XA 3BPNC 1NC4D 5IFAH 1VQNV 1AS7A 4MLSA 3L7FB 2VLRE 4GXUN 3U83A 2VNCA 3H1ZA 3MREB 4YJ3A 2YK1H 5SWSA 2BY1A 4HUUA 4PUBL 4DV7O 1BAGA 2NY3D 5CD5D 5DK2A 3ZT7A 4Y19A 4KXCA 3QEUB 3JUYA 3P1VA 2XV6B 1N8OE 4L9LC 5EN2B 4AEFA 3QXDA 3ZRXA 1MA1A 3WCYA 1UJ3B 1R0AH 3QZPA 4KVNH 3GUFA 1F3RB 4YX2L 4ZUUB 4QNPE 4U3SA 1OGTA 4I77L 1IIIA 1SJXA 5C0CB 3GD1C 3GS0A 4E41A 1CDCA 1E27B 1HWWA 2EIBA 1TVKB 2IG2L 1BD2B 1C5CL 1N8ZB 2ICWI 1FL3A 2YMXH 3GJFB 5F9OH 3QZWG 1PV0A 3FCGA 5FECB 4UIMB 4K71B 5E5UB 4JHZA 1RZGA 3BO8B 4J3WA 2ZP8A 3L5WA 4PJDF 5IMOA 4LLYA 3RZCB 4FQCL 1WFMA 1RY7B 3EYVA 4HKXA 4F7CB 2ZIOA 2WWOA 5FA3B 1M2OA 3EYUL 4IYKA 5DQDH 1IBDA 3PWUB 4Y88A 3NSFA 4U3HA 2HHHO 4E36A 1SLUA 1E2ZA 1OSPH 2EECA 3K6OA 5L2KA 3B40A 5JO5A 2AGJH 3WN6A 3AGVA 3W7XA 4X64B 3H1HH 5D1QA 3ZUNC 1DQLH 3I02B 3GXTA 3TFKD 3NIGE 5DWPA 3HCVB 1CR9H 4GFXA 2E47A 3VQLA 5C0DB 5EIIG 4HX1B 2MTPA 3FH8A 2BSTB 5CJOL 1E9OA 1BA9A 4N90E 4KV5E 2YS4A 5K39A 1N34B 1ET8A 3BP6A 1L5GA 2VWEC 5LXGH 2ITDB 3MX0B 2DIJA 5IMKA 2VYRE 5EZIL 1XCTB 1YN7A 4RFEB 2IH3B 4BUHA 1DBJH 4B96A 3VI4B 4CADA 5K9OA 5AKTA 5C0IB 3O11A 5E1QA 4TV8A 1SEBB 4QYOB 1HP8A 4MTFA 2WTOA 1N6VA 1HH9B 5GS1C 4Y2NA 4DR3O 3ZZQA 2UXBB 2A3TA 5BS0B 5IQOA 1CC3A 4WO4C 1UXSA 4O4IB 3TN0A 4IRSA 3OKNA 4GUNA 3FU7B 1X6LA 2HUEA 2P5PA 2K8QA 4R97B 3M1OA 2OXGB 1TKWB 1NSNL 3B8MA 4BSWB 3CK0H 3MU3A 2FECI 1UZ6F 1SJHA 1D5ZA 1CFSA 5J1TC 4PVMA 1MH5B 4XNQB 3T0EA 5DK0B 5IB5B 1JD7A 4GBXA 5TF0A 1RZ8A 4L4TD 2AQTA 3RL1A 2QKIB 4FM0A 4KZ0A 3E3QC 1AVMA 2VAAA 4ZTOH 3LPPA 4TV9A 3MRJA 4K3DL 3S3XA 1HL5A 2B16A 2WQWA 1LE9A 1MFCL 4PJXA 4FG0A 4W9EC 1SM3L 3KPSA 4LF3B 2FATL 4WFBV 1G6RH 4KROC 1YY9D 5EORH 1BEYH 3RPBA 3OUFA 3QHZH 2G9HA 5AOIA 1BIHA 3U7YH 2MEJB 4OH2A 4PW9A 2OYQA 2A1WH 1U92A 1S9XA 3MLRH 4LSDA 1KXTB 4QOKA 2P80D 5CZXD 1E3XA 1ES0B 3DO7B 1XNRO 1FVCB 1K5NB 1YEFL 5IYCO 4FNRA 4TNVF 2FQGA 1QUPA 4BR6A 1MJ7H 3BIKA 3RGHA 4XMTA 1G94A 1EZVX 4LU5L 3VXNA 1AGBB 2YXLA 1NL0H 4N26A 1BG9A 4J1UB 4DK3A 1F11B 2AJYH 3VGBA 5I1LA 4IHBA 4YJ2B 2DKSA 1TNNA 1UVQB 1UCBL 3TA3C 1UWEL 1FSKB 2APSA 4DUZO 3A67L 4Y4HD 2UYLA 2J1ZA 2ITCB 3QRGH 4A2DA 4FQQA 3UPRA 1NIAA 1DVFA 2O6FA 2OR9L 1NOFA 1WPXA 4XWOD 4IJ3C 3L9YA 1IFHL 1BQHG 3B56A 2XZCH 1T21B 3O6FB 1VADA 2AV1A 3QZWA 2CJUH 4Q9BA 5D8JL 5LYJA 4MYWB 1JZHA 4MS8C 4U1IA 4LBEA 2YMOA 3G5ZA 4FQLL 1AQDA 4FNPA 2Q10A 3FZUD 3N1PC 2M7WA 1AD9A 4Y5YA 4FA7B 1IQDA 3NMEA 4LWSB 1CD0A 1ZTXE 4IKJA 4ZXBB 2AKRA 4YR6A 4DR4O 1NCCL 2B1HL 3MCLH 2BP8A 3M7FB 4XNUL 1LYQA 5JIPA 5IESH 4CN4A 3L3IA 3OAUL 2IU3A 4TUOA 4IMLB 4QRRA 1IO4C 3W0WB 3N42B 1PLGH 2R2HA 2VUYA 3G6DL 4HMCA 5FWQA 4YXHL 3S2AA 1CLCA 3X11A 4AQ1B 4PWFA 3RQ3A 2ILLA 4U3CA 1P4LA 4AI7A 2DWEC 3UERA 5DUBA 3W9EA 5ID1A 4E9TA 2AQRA 4YIPA 1XIWA 2ICCA 1R4XA 2QKSA 3O0RH 4F57H 4JI5B 1BZDA 4WSKA 3KCPB 5AW9B 3CP1A 4BELD 4A6YA 2CBTA 2YWZA 4Z5RB 4CNIB 2OL3H 3NP4A 3U11A 4ZKIA 4GG6B 4LBEC 4OZHB 3QR1A 4HKZA 2JKJA 5JHLH 4FFWC 4TULH 5DRXA 3EJUA 1COBA 2DLEA 2CO2A 1KUQA 3CC7V 3FFCB 1YYML 3BSZH 4XAKE 5E6ZA 4G3YH 1FFPB 4ZAKD 5CR1A 1JZGA 4YXLH 1MDTA 3IDXL 5E8EA 4WK0B 3RVWC 3JWOL 3GTVA 3VFTB 1PLGL 2FTKA 3QB7C 3CVHH 3QIUB 4P9HL 4K5LA 3ZMSA 1LNUB 5ADPL 1XMOB 1XL4A 4XCNA 4OIIH 2CBMA 3CQPA 3K8MA 2GBTA 2Y7LA 3LNIA 4PN6A 2WSSG 2AQ2A 3T0ED 5BO1L 1A0QL 1HILB 3BE1L 1WUZA 1V3JA 3ARGD 4DN3H 3UJJH 1U58B 1NQBA 5IVOA 5KLVH 3CE1A 4L4TE 5E0QA 4J9ZB 4QXUH 4TM9A 4OFDA 3RDTB 1IMHC 3DJ9A 1FFTB 1FV1A 1JZ3A 4G6KL 1PJWA 2ZPKH 4CW1A 4S2SA 4K55A 4J27A 3ZHFA 2XQBH 4M1CC 4YXKH 5HI4D 1RIVL 4BFEA 1D6EB 1W72B 3HUJF 2H0PA 2ZOKA 3LS5L 4ZXBA 1KDJA 2EABA 3KL0A 1AQDB 4U1HB 3GHBL 1K4CB 2Z35A 3AM8A 3A21A 3X1NA 1ZGLA 4LLAA 4UQEA 4FXGA 4ANKA 3BHPA 1NCWH 2H47C 2X2YA 2I9TB 2ZOLB 2H94A 5IQ7L 1JUFB 1O9VA 1LL1A 1U91B 4JFPA 3MV8B 1AR1C 3UPRB 3VYNA 3EUDA 1FSKC 1NPUA 1JXDA 3EGSB 3MO1A 4OZGE 4EN3A 5HSFA 5J3HD 4Q9RH 2QVTA 4JQXA 3C09B 5B1AB 1QMUA 1BQRA 1A47A 2OZ4H 4I18A 4XP6L 5D7KE 4Z95L 1R46A 5I1LB 4AT6A 1QASA 4X1IB 1AO7E 5CINL 5BOZG 4LLWA 4MAYB 2GAZA 4U7KA 4EIUA 3LHPH 3C8KB 4L8DB 4HJ0C 2KLRA 4H44B 3HC4H 4MVBC 3WV0A 4HJIA 2FSDA 4N23A 3EW3B 4DP6X 1O7VA 5D7KD 4HIIA 3BABA 2AAVA 2QPFA 1RIUL 4NT6B 4B3EA 4NRZA 3K3WA 3KBEA 2VDNB 1QR8A 3K08A 4HALA 1G6VK 3FAVA 2P24B 4HIJA 4G7YH 1H3UA 4MFHA 4PJBF 1OB1B 2BNQE 5T1KD 4CS2A 3IK2A 1JZDC 3DUUA 3T1FB 5IBLD 2YPLA 4W6XB 2QTOA 4OZIE 3LXUX 2OSYA 4FVMA 3KPMB 3K0DA 3JV6B 5DS8A 3SDAD 4X6CA 1DN2A 1T5WA 2E8YA 3ELAT 2AAAA 4XE5B 3OR6A 2R7EB 3ZHKA 5I19H 1DGSA 4PDRA 2WVSA 3LRSB 2VDOB 4ZUWA 4X65O 4XNYL 1F1GA 3BXNB 1R3HB 2ZICA 4K23L 3VXUA 4X9GA 3KLHC 4CC1A 4ZTEA 1B3QA 3UTPE 4NIKB 1DDHA 3LKQA 3NK3A 5EWIL 1MWAB 1BHBA 5FO8B 3W2DH 1NAMB 2J8HA 2YXHA 3D9AL 3CMEV 2XVLA 4GT7A 3QIBB 1WH0A 5DJ8B 5GJSH 1D2OA 4QRQB 2UXCB 4NTXA 2DKUA 4TV8B 2YZ1A 2ZXWB 3IDIB 3F5WC 5ICXA 3US9A 4U6HA 1QHTA 1J0ZA 2VDPH 4KMTH 2IF7A 3PJSK 3C5ZC 1UACL 4UIKH 5AVWB 5DDHA 1QRNA 1THAA 1S4IA 3KLKA 2JJ2G 4PJ8D 2TRYA 5AW5B 1VFMA 1KYOJ 5HFMA 1X9UA 3R06A 1YEHL 2YOCA 5DHYA 2OMZA 4YVNA 5DHXB 4BCZA 5C0GB 1KC5L 4XAKD 1QO3A 5JA9A 3WEAA 2K7QA 2KQXA 2VQ1B 2SEBA 1IILE 4LHUG 2NSQA 4E41D 2H2SD 1VSCA 1J1XL 2ZIMA 2WTRA 4OT1L 2YEVA 3AMLA 1C5DB 4F37F 4B5EA 1FCGA 4FCAA 1K4CA 1P7KB 1FXHA 4FCHA 2IH3C 4FXLA 3SJCC 3TL5A 4N2LA 3ZMZA 3K4AA 1XL6A 1HH6B 2QBWA 3D2UB 3JARA 4NJAH 2D3JA 2EIZA 5F7EH 4Z0XA 4IRZH 3KJ4C 4UYPA 1OAYL 1M7XA 3FYEB 4GI9A 4D7PA 4LF8O 3BVTA 3U4EB 1UWGL 2K9PA 2GITA 2J56A 5E8DL 5EYPA 3BZEB 1MXDA 4HLJA 4UIMA 2K1MA 4K2UL 2AP2A 1FVEA 3LH2H 4NN5B 4WI4A 3TBWA 1TVKA 1NU1H 2KPWA 3MLVH 4XN8A 4LARL 4YBHA 1QLRA 4TSCH 1EHLH 4PV1B 4LGRB 4P8QA 4PB9L 2WQVA 4ELME 3OHXA 5I1IL 2NY1C 2V4DA 5D7IF 4Q6KA 2LU5A 1QD0A 3QDGB 3KW8A 4BCXA 3F84A 2IDSA 4WTZA 2DAVA 1KMIZ 4N8CL 3RZCC 4O2FB 3WGVB 1ED3A 3VFTA 4MJ2A 2DQMA 1EGJL 4X6DA 1IAOA 4I48B 5IJCC 1PY0A 1KPVA 1ICTA 4PRPD 4QRAA 4YVUA 3L95A 4NAQA 4U1LA 1MWAH 4YHIB 5EYPB 1IGFL 5DTFB 1AP5A 3C6LD 5CEXB 3TM6A 2C7UA 4MX7A 5F7AA 1MCKA 1Q81W 2PMZA 5DZPA 5IVXF 3QI9B 4NKDA 3V0WL 1IGMH 2C34A 2ZNWA 5KUMA 4X7SH 2DE0X 3UX9B 2HYMA 1FZKA 3H42L 4Y2DB 2Y36H 4L5FH 3A4DA 1KPRB 5EBMA 2F4VO 5EZJB 1YEDB 4WDIA 3MYZA 4Q89A 1EZVY 1B4JH 2CUAA 2PCPB 3KPRD 3OGOE 3ZTEA 3BRFA 1ODUA 1U3JA 2K9UA 2QA4V 3PV6A 3O3DA 1UXMA 3QNYA 4XZUB 1P7GA 4X9YA 5EBLA 4K5NA 4EUPG 2WXFA 1CWVA 3QG6B 4UM8A 1MJ8H 2Y1AA 4KHXL 4XB7A 5I18L 4X9BA 2FB4L 4EI5B 2O6DA 3BPNB 2VLJD 1U8NB 2R29H 3HS9A 4JANB 4WJ5A 1XGYH 4JO1L 3IDMA 3AZUA 2EILB 1ETJA 5HVFB 3N27A 4WEBL 1DJSA 1HE8A 2V8LA 3IDYB 4X8JB 4XPGH 3HB3B 4W4KA 1JNLH 4QT5A 5SX5K 2WO3B 2I7SA 4JQIL 5EO0A 4KY1H 2Y1ZA 5KAQF 1G7HA 2B4CL 4QKXB 4DYLA 3QIBA 2FJUB 4EIBA 1G6UA 2ZE7A 1NBYB 3AXHA 1A2YB 5BMFH 3DHJA 3IE9A 4HS3A 3NFPB 2VXVH 4WV1A 1UVQA 2VQTA 1RSOA 4YDJB 3QQNA 3VD5A 1OZ0A 2VGLM 3JAWB 2W92A 5DHDA 1QPXA 3VG0H 4AKQA 2DDQH 4LESA 1LEKA 5KBLA 2K7PA 4UT7H 1KNOA 5EBLC 4H5SA 1QSFD 1KJ2L 2N56A 4HEME 4XMWA 2IAMA 5FLXN 3DX9B 1D9KB 3P9LB 4FQJL 4CC4C 4XPTL 3CSTA 1L9RA 1OLLA 5C0IA 1K33A 1IAOB 4EI5C 4PG9B 2FL5A 2X38A 4XXDA 1UKQA 2O57A 4FZEL 4UT6H 4JKPH 2EILC 5IFJB 2A6IB 2Y24A 3HVDA 3L3HB 4M7ZC 4UILL 4O2BA 5B1OA 1VZHA 4QXVA 5HGDA 5CN0A 2HG0A 3DTXB 4N2EA 5IESL 1XB8A 3OBAA 1NCCH 4GI8A 3KPOB 3DX8B 4KMTL 1TZOA 5A2FA 3BSZL 5E1AC 5K5YA 3QO0A 3IS1X 4H8WL 2G3XA 4X5PA 3O6KH 2VLLB 1F1AA 4WI5A 1KKDA 2PO6D 4MNHB 4FL4C 2AZAA 1T4KA 2BMKB 1EWHA 4KUCD 1Y18B 4ZPTA 3BZEA 3IJ8A 3PU7A 1V54B 4WV1C 2NR6D 4CVZB 1CGSL 3I2CH 2VSDA 1RJCA 4YSTA 3Q9PA 2B59A 2WQUA 3L74H 3DJRA 4B08A 3PL6C 4H13C 2BC4A 3DSQA 1MCEA 2Z93A 4HISA 4JUSA 3T2NH 3BH8A 3WXVL 5A43C 1G9NC 2LE9A 1I3GL 3ZE0F 3MXVH 1JSYA 1S7WB 4Z0XB 1JCVA 2QFPA 4P57B 3IXAA 1QLFB 1LEKB 3G7TA 3MRDA 1ZLWK 3ZY7A 4FKKA 4KY1L 4AIOA 1KB5A 3GI9H 1US6A 3MRMA 4N90D 3RIAK 1KXQE 1ONQB 3FHEA 4O4IA 2CJSA 2VZOA 3M8OL 1UA7A 4AXWB 4KZEL 5SV4A 1P4IL 4LFBO 2A6KB 2VMCA 2WVTA 1JYXA 1YXBA 5C7ZA 2OLDA 3BDYL 4JKKA 2YN3A 4WI6A 2P3YA 5D2LE 2EH8L 5CGMA 1NFIA 4K0KO 3EOTL 4JRLA 4KY2A 4JPQA 1JNNH 1J9QA 4WFED 1SJVA 3SCMA 1BQ0A 1QA9A 1S7SB 1VQOV 2A2QT 2YD5A 4NQEB 2F5AH 5HYJD 2GSIB 3BUTA 1JZ2A 4YBLB 3WSQH 1W72A 4X89A 3MV8D 5D70L 1QR4A 4NCDA 1U97A 2WLMA 1N5YL 3N91A 2CUGA 3GSNH 2X4NB 3HJ0A 1XF3A 1RU9H 3OLGA 1U8HA 5D1QD 1JNHB 4X99A 4S2SB 1IZKA 4Z18A 4XE0A 4JGUA 3QDGD 2O5ZL 3W3BA 4MRCA 2DW5A 5I5MA 5KAIZ 4PV9B 1VIWA 1Q72L 3MNWA 3MVSA 4NN5C 4XP9H 2XRAH 1R3LB 2ERJC 5GS0L 3T3PF 3SDCD 4WI8A 3H8NA 3TS8A 1F97A 1SEQL 2YA0A 3MACH 5J06A 2AW9A 5GONB 4XNYH 3SO5A 4Q6IA 2EVGA 1R5VA 2JSFA 1TDQA 1GL4B 3FRUB 5CJXC 1ZANH 2HX7A 2C7UB 5GRJH 3MRRA 4NQCE 4DEUA 5DJYA 3M86A 1AKPA 5BW7C 3QIUA 4GXFA 5AZ2L 4ZX5A 4XNMA 1OW0A 2XFXA 5FYJL 4XVUC 2NN4A 3GJFA 2I60L 4MNGB 2ZKYA 4OXSA 4MB5A 4KX8A 2GV9A 1XBLA 4IT5A 4LR3A 2ZUUA 1VIBA 2HT3C 4G7RB 4XODA 3WKQA 4QJ5B 2XICA 2EYTA 3JALA 1RLBA 1SQBH 4MZRA 4YDKL 1FZMB 3MKGA 2YUXA 4Z5RA 5KVDL 2HFTA 3APCA 3DOSA 3RBSA 3F3HA 5BRQA 2HJFC 5AUMB 1MCBA 1UFGA 2H0EA 5IQLA 4LLMA 2VXTH 2XV3A 2YKLH 4UT9A 2YQ2A 2GSGA 1A0QH 3KD4A 4OFVA 4KJYB 2WZAA 3EJQA 4JAVA 5GQBA 4OGAD 4UWQB 2NUTB 5ALCL 3A0BZ 3S4SB 5CJXA 2ZP9A 4UV7L 1JERA 3MRQB 4XBEH 3FB8C 1E5CA 1JF1B 1UOWA 5FGBC 4OT1H 3ARBD 2O6CA 2Z65C 1CCZA 2HZHA 4K71C 1PCSA 1ZXKA 3TASA 4P46B 3WFCL 1K6QL 5IF0B 3BH9B 3JTBA 3L9RA 3JWOH 4NNXB 2CUMA 3FCBA 1N4XH 4QXWA 2FT7A 4KKZA 2P8MB 2VLJE 3QNZA 1X5AA 1NCUA 4P4RB 5KS9B 2NW2B 1OHHG 3E6FA 3JCUZ 3HKEA 3OT7A 4FNLL 2M8XA 2ZWNA 3A6CH 4IOFD 2ADPA 2BVQB 2EO1A 3OTTA 4RA0C 4B7IA 4LFBB 2BXZA 1EIBA 1L1FA 1LO2L 3HKCA 4G9FD 1HN1A 2XIIA 4ONGH 3APQA 4XMPL 3TC9A 2VLKB 4JFDB 2ITCA 5DO2D 1JZ7A 3L48A 3RHWK 4YJ2A 3P0YL 2XQBL 3A0RA 2DWYA 1MCLA 4GRLA 5D7EA 2DF3A 3BWAB 4BRVA 1L6ZA 3GSVB 2IEPA 3PFQA 4Y1TA 5HHVH 5FGBA 4Z3FA 1JN6B 1WBYA 5D7SH 2ITFA 3GMPA 4HSQA 4FG6D 2L7EA 5D96C 4Y5VA 4PB0H 3FUJA 2J8OA 3LZRA 1FYTE 4X62B 1QSEA 1UZ6E 4L3ED 4X98A 3KPPA 4D3CL 3LQAH 1YEHH 4ZSOB 2E76B 3OMNB 4WW1B 5FHBL 3Q3GA 15C8L 4ZMLA 3HI1B 3PP3H 4ONHA 1MI5B 2R56L 5LA6A 3K1KC 1C8QA 4KFMA 2RHEA 1KQSU 3EJYC 4G42B 5I30L 3U0ZA 4G6JL 5A3IC 5BV7B 2EDXA 3RWJB 2DQJH 2B2XL 5CHNB 3Q05A 1OAZH 3QQ9C 3D4ZA 2Q3XA 1U42A 3K5LA 4HFWA 3B1TA 2R0ZL 5IJBC 4JM0A 1AHWB 3ZHQA 2OTUA 5F3BA 3PDOB 2E56A 1AGDA 4BV1A 1CF8H 2NY3C 5CD5C 1YJDH 2ZSVB 2A83A 2Q3ZA 5HGHB 2LFSA 1Z2GA 5I6PA 3K6SB 3OAZK 1O9GA 4XPHH 5CMAA 2IXQB 3ECWA 3T0EB 3THOA 1WG3A 3MRPA 3RGBA 3KR3H 3QJUB 4OFQA 2GFBA 3MLYL 4PMFA 4ODUA 4UQCA 4FM2A 1FYTB 3HR6A 4B5ZA 4B3TO 2WNGA 5CU5A 3MBXH 2YLKA 3W9EB 4U4BA 3UO2A 3QUZD 1P49A 1Z3GL 3LPOA 2OP4H 4XDLA 4UCTA 2F7RA 3QIUD 4GSQA 4XVJH 5B1BB 3SGJA 4PY7A 2UU9B 1WCBB 2R2HB 2WGXA 5LHGA 2V7HB 3WAJA 1UGKA 5D71L 1QYGL 4I0PC 5IV2B 3EJCA 3ZYZA 1VERA 3RTQC 3MRBA 3BVDB 5CJBA 2FR4B 2GAZB 1G7MA 1MSDA 2IFFL 1KFAL 3VJ6B 3CMOL 3C5JB 1FFXB 1KGCE 3FJTA 4AGPA 2VC2L 4OJFH 4AJWA 4YHZH 1WFOA 4F3FA 3F58H 2HRGA 3EYFA 2C1OA 3BIAX 5DMKB 1VADB 4UANA 2BCKA 1XMQO 4JYCA 1CLVA 1I1AC 4YDIH 1MJJA 3WE6A 3CJHB 1BQSA 5KHJA 3CCMV 3PP3K 3RTQB 2QEJA 3NQKA 2ENJA 3MJGX 1AJQA 4X1YB 5FF6A 2YSTA 4CSZA 3FT9A 4X4YA 3S3SA 3GRWL 3VFSA 4N3TA 3CFUA 4KK6D 1TO5A 3UGUA 3J2PA 1E6JL 2V7NA 2PYJA 2MOQA 1KCUH 4HKXB 4CDGC 1W2KT 3OPZL 5LBGA 4DR2B 1FZJB 3HZVA 1RD6A 2YPVL 2A9DA 5KJ4A 3QUMH 4G83A 3QUML 3ARBC 4JLRA 1PLCA 4QHNA 3QEHB 3RDTA 5IOKA 3T77B 4ANXA 1VFAA 2P5WB 3DURA 5LCVH 3DGGB 5KG9B 3BVNB 5IYZA 3I56V 3M99B 1U92B 2PYEE 2Y2YA 5DUPH 3HZYB 4TPRH 4G8GA 5C0CA 3CFEB 4Q0XH 4U1GB 2VJ0A 3U0WL 3NA4A 5C1MB 2XN0A 3LZFH 3D05A 5HDOA 3MDSA 2NR6C 2JJSA 2E3VA 4RUEA 4K3DH 3MGTB 4WY7H 4AGNA 5FDYA 4RBPK 1BFSA 5C9JA 2RR3A 4KWUA 2QQNH 4AZ8B 1PP9H 4OZ4A 1AVAA 1TQBC 1TYJA 2RBLA 4N68A 5F7YC 1IVLA 4HKJB 4FNUA 4B9CA 4OLYL 3PWJB 2GJZB 2EYRB 3GNMH 4FQXC 4S1SL 2LGQA 4X4ZA 5MENB 4OM1H 3B9KA 3VWKB 5E4IA 4CAGA 3OKNB 5ADOH 3EFFK 3NA9H 2VDQL 1M7UA 2ARJB 5D2NA 5KBMA 2C9QA 1X44A 2ZKOA 1B0GA 5GGRA 2H45A 4PJAE 4JRYE 2CCWA 3W11C 3X11B 2G9KA 1JV2B 4TVSa 1DZBA 4PRHE 3TBSA 2MWCA 1GRWA 1ZXQA 2Z4QA 1I9IH 2JF1A 2ZSWA 3FU5A 3L5XH 2CRYA 4MWFB 1RZFL 1I7RB 1T1XA 4IK6A 4LOUC 5CP7B 5AD0B 3UMNA 2QM7A 4XH2B 4IMLA 3GXPA 4KKNA 2ZUYA 1A3QA 2X70A 2WLLA 2HRPL 2YIAA 4N0UA 1UWXK 4N8PA 4DGIH 3QDHA 4G6ML 4CC0A 1OCCC 1AIFA 2XYCA 3AU0A 4Z7VF 1BZKA 3HG2A 5CCKH 1IBKB 2A9AA 3IBEA 1G9MC 3NFSH 5TK2A 4WU7B 2NY5C 4N0FA 4XCEB 3B9KD 1BQHA 4ABUA 2H6PA 4LLDA 2OYLA 4PJ5A 4ZODA 3TH3T 1U8QA 1G0YR 1H0DB 2PW1B 2ENPA 2Q86B 1RULH 4MMZA 4MVOA 1X9RA 3T1YB 3BUIA 1W0KG 2CK0H 2P47B 4QIRA 4ZOLB 2W65B 5K1JA 4G6AC 4K94C 3II1A 5FA3A 3HPLA 1ZSDB 4N24A 3PE9A 4FQCH 4AQYO 1BF2A 2NZ9D 4JRYD 4XHJD 5C08A 4ELMF 1ILSA 1R24A 5CN2A 1E9QB 1FFRA 4GEJA 4PRPE 2DQDH 4IKKA 1THCA 4YEEA 5AZUA 4RCAA 4X6FA 4QRTA 2Z3YA 3CGTA 3W11D 3ABKB 2A1WL 1JV2A 5CCKL 2MHAA 1CGSH 3I2CL 3KYMB 5D2NE 3FT4B 3BAWA 4UTCA 3E22A 3IPEA 3S3PA 1EO5A 4TQFA 1YAIA 3C3TA 1SQVH 1OGTB 2WWNA 4YSDA 5KSUA 3F5TA 3H3BC 3WJMA 4QEGA 5AB9A 1T83A 1DJWA 4G27B 5IJDC 1YAZA 4FD0A 4OQ1A 2ZE6A 4XMPH 5BQ7B 1E43A 1FC2D 2A5UA 4KK8C 4BINA 2EC9T 3KLLA 5BOPA 3IVKA 4ONFL 2GJZA 1O75A 3AQYA 3KYOA 2LLGA 4NZJA 3ZUCA 5A2LH 2I9LB 3FT0A 2O61A 3K46A 3RJDA 2TAAA 1IRAY 1TQWA 4PJXB 3QH3B 5EG6C 2YBRA 3ABUA 2X9ZA 3MRKA 4N5ED 4HT1H 4JVWA 4ISVB 4L87A 5CZRA 5C0JB 3RVVC 1S7VA 1U8MA 2ZCLL 1GOHA 2QKIA 1NCBH 4UTAH 5JPMB 3KJ6L 3A0HZ 1U2YA 1NM4A 3DX3A 4L9LA 1OAKL 3N06B 4HP5A 3B9AA 4EFBA 3LKOB 1J9CT 1MIML 2F68X 4Y2DD 3WIIL 5C0EA 4BSWA 3VSQA 5IJ0A 1PMYA 3HZYA 3MC0A 2HJLB 3V5DB 3DJTA 4ZOAA 1KIQB 1VDGA 3DMMB 4GRWE 4ELMB 3LRMA 3FSZA 5FLVA 4PLNC 1D5RA 2F8OA 4KTDH 3JWDL 3WJMB 4Y1AB 2CK3G 1XR9B 5LXGL 3U2JA 2G3ZA 1UM5H 3L3JB 3BQUB 3KYMA 4K7PL 4NXNB 4PJ9D 1AXIB 2N05A 1M57C 2LVEA 5CP3H 4WSGA 2VDQB 3O4LA 3VI4A 2ATKC 4X8GA 2WUBL 2KSDA 5D55A 1SJEA 1MG2C 3ZT5A 3KHQA 3LHPL 3SOBH 1I8MB 2Q8BL 3EO9L 3TPUB 4Y4KD 3B5TA 3VFSB 4J3UA 2JJVA 3DDFA 1SDYA 2Q7AA 4TQEH 4AH2A 5G4OA 4M03A 2M83A 2AANA 1MIMH 5F96H 1O5DT 3BN3B 3UJIH 4CGUB 5TH2B 2YD9A 4WFHD 3VGFA 2R4SH 3E7JA 2IPUK 2QVMA 3ZR5A 2X0WA 5HHOD 1T0MA 3B2EE 3VXMD 2BOBB 3VWJC 3BPCB 2F5BL 1H3XA 1MG1A 4LH7A 2HLAA 3D06A 4ZO7A 3GZQA 4LF7O 3W7WA 3RJOA 1F0LA 4YZWA 2ZCEA 2HVBA 3N2KB 1DSFL 4XP5L 4P3DB 1PG7H 3P32A 1TITA 5F44A 4U7NA 3FQRB 5LBSA 4DPRA 4Q52A 2FYYA 4X6CF 5LG1A 3L5WB 4P2YA 5JHDA 3QSKB 4I3GA 5D7IB 4PVNA 2AVFA 1I7RA 3VFRA 4WHTA 2FBJL 3MTXA 3HKFA 1G7PA 3VFWB 2BVPB 8FABB 1NC2B 1NI8A 3GSNB 4NQVB 4L0ZA 2DQJL 1D3CA 5DLLA 4ODHH 1Y0LA 2YFOA 2CCVA 2GW5A 1PDKA 5F0MB 4KXRA 4MTGA 5ETUA 4JRWA 1I85C 3ARQA 1K8IB 2EDMA 2MCG1 4TOYL 4MCMA 4A1RA 2P5OA 4X9HA 1N33B 5F88B 4Z1MG 3UEZA 3VQXA 4X7TA 3G5XB 1Y1DA 1A7OL 3TXQA 1XF1A 4TSBH 3VACA 1EEZB 3ES6B 1IKNA 1AG6A 4KO7A 4N2DA 4G6FD 3LRKA 2GSMB 3VGGA 3VGEA 1NGQL 2ZYIA 4PLOB 1QWHA 3KNBB 4JX0A 4MVZA 2BWIA 2FECL 2VC2B 3IFNL 3MV9E 4OLVH 4XX1E 3D4GA 1F4MA 4AV5A 1E4KC 3IN2A 4PD4K 5GGSB 1F90L 2XWTB 4LCUB 3VH8B 3T3MF 3RYFA 3D0VB 2C3VA 2FZ3B 3UKMA 1AACA 1P4BL 1SETA 1MFAH 5ENWB 3LYRA 2CIIA 4XP5H 4PS7A 4F7MA 4Z7NE 3J8F7 2Z9TA 5E6ID 1KIRB 4NUQA 3Q6GL 4QHNB 1L0LH 1TUEB 3TWYA 1GM9A 2FWOB 1OKEA 2WO4A 5DI8A 4HSCX 4BIUA 4FQHB 5ERWB 2O72A 1BXUA 4N2IA 3STLA 3BDBA 3CCQV 3PWNA 4WO0A 3G6DH 1ANUA 3L4VA 3D85A 5T1JA 1A4KA 4L3EA 5ECGA 1Y6NR 2KS0A 1JPST 1J5IA 2AW2A 1B04A 3NA9L 1U6AH 2W9LA 1LQBC 3ZTNL 2YFNA 4MMZB 4WHYG 4NC2B 4FQHA 4YK4C 4X1YA 5FF6B 4U6VH 4JY4B 3PGDB 3P0YH 3ULVC 4WU5B 2EDJA 1XEDA 3MV11 4PW3A 5L2JB 3QWOA 5JPNB 4GXVH 4XAWL 5IWAB 4CBZA 4FJCC 4GKNA 3QIWA 4LEXH 4M62L 1AIFB 2CDFA 1UT2A 5GGSA 4JZGA 2Y3NA 2FLBT 2X70B 4N0UB 4H1LA 2QTVA 3WIHH 2X1XR 3E2HB 4YO0A 4YIOA 1DQDL 4IRJD 1OTSC 4XBMA 4XGZA 5K9QI 3QUKA 2ADIB 2PNDA 2V9QA 2KH2B 1A1MB 3STLC 3A6BH 2NY6B 1E8XA 3TO2A 3KYAA 1RMFL 1IZJA 5B3JF 1OCWL 1KYOF 4BSJA 4NBXB 3WENA 1XSOA 3HKBA 5BRZB 1TTAA 4P06A 2PR4L 2VO5A 3HUJB 2VR5A 4N8VB 4GSRA 2SODB 4WKZB 4G28B 4UV4L 1NGWA 4I18C 1P7QD 3DUSB 4NRYB 4ZX3A 4KK9C 3RY6C 3X13A 3B4SA 1DTOA 5ITZA 3CFJA 3HBGA 4Z76B 1E67A 3BD3A 2M1KA 4LSRH 4Q2ZA 5D7LA 4JB9H 2RIKA 3EKCA 3JXAA 2OJZH 3TBVB 4AJ0A 5HYSG 4MD5B 3V6OC 5SWZE 1JDCA 4HC1H 1Q3EA 4LLQA 2ZSVA 4TNWK 4Y5XB 4AEHH 3LS4H 1S6NA 3EBIA 5AWNH 1H2SB 3ASNC 1JZJA 2JELL 4HV8A 4WKXA 4YSOA 2DYPD 4JFEE 3PDDA 1OV9A 3F7VB 1GC1L 1OAQL 3UG5A 4ZW5A 3MRIB 3V0WH 5K9QG 2P4KA 3L9DA 1Y6XA 1NINA 1U3NA 3O6FC 2P5EE 2R23B 4NZUH 3LN4B 1WP8A 4ZUSA 3FFQA 1P2CB 2A99A 3QDJD 4U33A 1YPZF 2BNQA 5KW9H 4JFQA 2C3XA 3WD5H 1DBML 5I1KH 2HN7B 5JDSA 2HJFB 3E38A 2ZINA 1EGJH 4X9QA 2XZAL 3DWTA 1B0WA 1EK3A 3E8GA 3SPCA 1U3ZA 2IALB 3QISA 4OLUL 2VWJA 3BAAA 5IEHB 1PL3A 2K45A 2E7LC 5LBSH 1C7TA 5EOQH 1MPAL 5J57B 1AQ8A 1IGYB 2DZEA 1UQSA 2YAEA 2ZX7A 1L0NH 3BI9X 5IEKA 3D25B 4XHQA 1F3JB 4UB0H 5K93A 3MXVL 3R8BB 4BZ1L 4GAYB 1XUQA 3DIFB 1KB5H 5HHMD 3SJBC 3GRWA 5JVDA 1CFTB 4NQDE 2BVQA 3FCTB 3PHQA 4YBLC 1WUNT 3F7VC 3OQRA 4RAHA 4WO4D 2HRPH 4Y1AA 5DMKA 3ZE2B 5DFVC 4LLUA 3UAEA 3WELA 4AXWA 1ECZA 4HJTA 3MPCA 2ZWKA 2PPCA 2AJ3A 4NKIL 4NO5A 4R26H 5I0VA 1UWEH 3A67H 4C7UA 4JQXC 4ZUSB 5BXFA 3IXTB 2AFNA 3ZHLA 5I19L 3MJ6A 1A7QH 1BVKB 3FAXA 3MODH 2XPYA 1VGKB 3PQYD 3V8OA 3VFPB 1YJ9V 3U7WL 1WCBA 1A4AA 3QDAA 4RMSA 3EH5B 2J72A 4UT6L 1MAML 1UHVA 4LLQB 3EO1B 5EU6D 4NM4L 4H0HB 4LAQH 1HU8A 5CB4B 3R1GH 1G6RB 3EUUA 5JHLL 4ZAKA 4GXUM 1QSED 1N8RW 3DO4A 4HIEB 5LNEA 1LK3L 2Y06H 4BKLA 3E2HC 4GNKB 1UOKA 4XNDA 5A2JH 3HUJE 3MCKB 4PH8A 1V54C 4MW3A 3HBQA 3KPSD 4LE8A 4WKZA 4IM8A 5EEZA 1FL6B 1UPGA 4ODBD 1AGDB 2D2OA 2HT2D 3JWOC 3DX4A 4NNPL 4WAFA 3UABA 4B97A 2ORBH 4KO6A 2X4QA 2J6EH 3CHPA 1OZUA 1WZAA 2BO0A 3JWNH 3VRJA 1CGWA 1RJZB 1ZDQA 3A6CL 3QDGE 4ZX4A 3RWJA 2IAMB 1FIEA 2DEWX 2KT6A 2E9GA 2QPEB 2VABB 3MFGB 4JPRA 3UJIL 3PJLA 4YO0B 4DWHA 1RUQH 1LO5A 4OX9B 1KV3A 2B1HH 3CRCA 1YNTA 2OS7A 3C8HA 3Q3GB 4AQAA 1QTYT 4RBPH 2GB2A 5GGUB 3BGFC 4H25A 2Q7YA 3SB3A 3OG6B 4BSVA 4BXSV 4QAWA 4YLQT 1RH8A 5DVPA 2LGNA 1KBPA 4OLYH 3Q8EA 2QGNA 4HS6B 4RISL 1NUFA 3EADA 2DJMA 3NJMA 5C0BE 3MHHC 5AW3B 1OPGH 4KK6C 4TKWA 3L45A 4H1LH 5GRVK 1RM1B 4X4KA 1WDAA 1HINL 4R4FL 3KPLB 3QJHB 1TVHB 3VGAC 4DUYB 2YKLL 4JANA 4M7ZB 4G80A 2PCFA 2R69L 3UIYA 4PJHF 4DUZB 1VRSA 2ZKXA 2VZUA 2ZX8A 2APTA 3KLDA 1SY6L 4UUJC 5E8PA 4FFBB 4MQTB 4F9LC 4NOBA 2WZ5A 1CL7I 4GX2A 4JO2H 4LSRL 1YPZA 1WA2X 3DRTB 4A2MA 1JWUA 1ZX3A 4WFAV 2DJ4A 2ZXAA 4GAGH 4FLRA 5AYTA 2PCPA 2YA2A 2CR3A 3H3KA 4XI5D 5PCYA 3CMOH 4WUUA 4XN2A 1HHGA 1K4CC 3X1FA 1JGEA 2PO6B 3BDYH 3JASA 3OKLB 5AVUB 2C5DC 3LXAA 2HFFA 2OM5A 2P52A 4OCWH 2JS3A 4MS2A 3RWFB 4EI5D 5DM6V 3ETEA 3QORB 3LDBC 2A9MH 5EIVA 3LXBA 1DQQB 1RPKA 4X65B 2Z7ZA 4JO3H 1DVTA 4MNQE 5TE6L 1Z3GH 5BUPA 3VI3F 1CO1A 3ISYA 1FNFA 1P84F 1UYWL 4OSUL 2OI9C 4ZMYA 5DUMH 2WLJA 2E7MA 1ETZA 1KY6A 1WS7A 4JEGB 3A5VA 1QAWA 1HR0O 5J0BA 1DO5A 5H37A 1FN4A 1P4BH 3F83A 1N2RB 4OJDH 5GIRB 3P0VH 3ME0A 5IVZB 1MQKH 2YD2A 3QPQC 4WBNA 1IJNA 2BLFA 4MQ7A 4NC1C 4J3OD 3VWKD 1KOAA 3LS5H 2UXCO 2CHXA 2DYPA 3SBWC 1W9XA 4MTOA 2FJGB 3G08A 4AQYB 4XP4H 5LGHH 5AENA 3QPXH 2WBXA 4PJGA 4ABQA 5SX5H 1QEWB 1JBJA 4WWOA 3W5MA 1QLRB 4JYAB 1VQ6V 1U3HB 2OTWA 2P5WE 3ASOB 2EZOA 4NN6B 1H8OA 3RWIA 5D4IA 1SLXA 3RRQA 3T2QA 2N01B 4M6OH 5H2BA 2R56H 4FZ8L 3KCWA 3MRLA 3V0HA 4QTFA 2OQJB 3VI4E 5KSAB 4X0NA 1A8ZA 1YIJV 4PG2C 1T7VA 4Q4EA 2CDEB 4GSXA 1RJLB 4HCGA 4ZPVB 1EX0A 1U3HD 3V4UL 2DLIA 2DWDB 3TNMB 4EDWH 1ZTMA 1R6KA 2Y69B 5T1KB 5HHVL 5IBUG 4JFWA 1UG9A 5I2IA 3SE8L 2VMFA 5AYQA 4I1NB 3MYJB 3RVXC 4E0RB 1JK9B 4OGYL 2WHVA 5EO9B 3PJSB 2RJZA 1JL8A 1SGKA 1XGUA 2WC7A 3IJHA 2E86A 1BAFH 3RWGA 5C71A 2UUDK 2R0WH 2VSKB 2HTKD 2VW6A 3W2DL 1DK1A 2QWOB 3M17B 5EWIH 1BYNA 1T66D 5DDHB 3Q1SL 1H3TA 3M1BA 1WF5A 4JJOA 1B0RB 2IJHA 2E75B 1SJEB 3MRFA 4EAEA 4WSJA 2MFNA 2LU7A 1M53A 4IGBB 3FPYA 1MKFA 4OJYA 2RFXA 4YFEA 1HCVA 1GN4A 4GUCA 3WTXA 3C2SA 1IGTA 1IAKA 2XTJE 1EFXD 1ETZB 3Q2WA 3T2PA 2ICES 2OJEA 4M6ML 4RDQG 1L0PA 3M1BB 5JW5A 1J7VR 1I9RH 3NAAH 2VL4A 4MSWC 1UM6L 5BQDA 4B3RO 3DDGA 3FN3A 4XC1L 4U3JA 5EBMB 1OSEA 5BPPA 4POUB 5JQ6L 3DNKA 3ORJA 4XPTH 1MNUL 1ILUA 2OCCB 3U82B 5AWNL 3FCSB 3AQZA 1R1CA 5DCCA 4OV5B 2H32H 4CC4A 4DUYO 3E9UA 5EUKB 3LRSA 3WS6A 1N68A 1QBZA 3H9SB 4FTVD 1URIA 3CCEV 4JV5B 3D30A 1VGEL 3FTUA 5I1DB 5DMJB 1H5BC 4HHAA 1RHFA 3NIGF 2YI8A 1IGCH 1DSFH 2YSSA 1L9SA 3KS0H 1A9BA 2FYVA 4JM2C 4P9ML 3VRIB 5M94B 3MA7A 1RZJC 4HXAL 3T1HB 1MLCA 1CPYA 1P7BA 2V2XA 3HE6B 2AK4A 5DSCA 3QO5A 4DR1O 4RRPA 1LGVA 4AZUA 4JFXA 5CFHA 2QGEA 5E7FA 2HTLC 3IVKB 1F6FB 1MF2H 1DQIA 1OB1A 3PN1A 4TNGA 4UV9A 1MI5A 3QDGA 3HI1A 3GBMH 4PYHA 4X2UA 1L6PA 4AY0A 3SKJL 4OUOA 3L3GA 1HCFX 2DM4A 2BTQB 1TVHA 2GUZA 1HQ4B 3R65A 3E1ZA 3D48R 3HLAA 1UJWB 4HIXH 4NN6C 2YD3A 2V2TB 1WA8A 1Q9OA 1RZQA 4V1DA 2OCJA 3UBGA 2QR0B 3C8KA 4L8DA 3SDYH 3SOTA 3DX9A 3P9LA 1MFDH 3GMRA 4X6FB 1S9KC 3T2OA 1M6OA 1DBBH 1PZ5B 2KC0A 2OCCC 1WSST 2Y7OA 3OR7B 2WLIB 2V17H 4RO2A 2PYED 1B4JL 1R19A 2A9BA 4F9PA 5FUCE 2P4AB 3QQDA 3WN5A 1H5BA 4RWUA 3PNRB 4GW5A 3CD4A 4MNQD 1HKLL 3NFPA 4YHZL 2XAFA 2JFCA 3HC0A 5LVEA 2DY2A 1ZDSA 2NDGA 3QFJA 4NYLA 1NGYA 1DQLL 3UTTD 2RTTA 3ZZLA 3GMMA 3NIDE 5TDNB 4JL1A 2XZZA 4YFLI 4M5TA 5ICZB 1U8QB 3DVFA 3CFBB 4G9DB 1ADQH 3DPDA 2X3BA 1BIIB 2FJHB 4XMVA 3KPRB 4D9LH 2QL1A 2W38A 5GGRY 3DYPA 4NO2B 1DQTA 3CCSV 3K81A 2WQSA 2R1XB 5GGQH 3MFFB 5L3GA 5E6IB 3VD3A 4APQB 3HRPA 2R2EB 1IC4L 3BH9A 5LGUA 1PD6A 2ZT9C 4P46A 4XP1L 5LBVA 5MEPB 2EH7H 4MB4A 5IYBO 4XH2A 5CA0A 3UTPD 3B37A 2XT9A 3FHAA 1SQMA 1JXJA 2KG7A 2ZUQC 4LO9A 4ODSL 4DAGH 1UEMA 1URFA 1GGUA 1QBLL 5EFIB 1E1QG 1CQKA 1S7XB 3GYRA 1QTPA 4KJQD 2DQ6A 5KA6A 3EJSA 1GTOA 1A6WL 5JQHC 1BBDH 3QQ3B 2VE6B 2MIZA 4CKVX 5KSBA 4G80B 3L81A 5E08L 2LVCA 2WLKA 4KI5E 4L1DA 4V1DE 4QR7A 3UTOA 4URKA 1SYVA 4HJGA 1A3RL 1TQUA 1LDSA 2WKLA 2FWOA 1OF0A 1XFPA 2PXYD 5DI8B 4PTTA 2F15A 3CRQA 5ABDE 3HI5L 4N20A 2OAAA 5DTFA 3ABZA 1EANA 1V7ML 2BVEA 1DANT 5FUOL 3ESUF 5IK3B 4UCRA 3TJTA 2HFGH 3O0LA 4E42B 1QSFA 3BYTA 2G2PA 1HHKB 2Q7YB 4XN1A 4XNMB 5F7UA 3II3A 4B0MB 5F1NA 4EI0A 5HYSB 3FTZA 3F7PC 4FQ1H 2P5EA 5SWSE 4Z7WF 2NY2B 3CN1A 1NCAH 1Q94B 3BSGA 2RQ6A 2GJJA 3B2VH 4L0PB 3E8HA 4Q6IB 2BCMA 3DI2B 3RTQD 4KMLB 1BQLL 4PD4J 1BVLA 2BVYA 3VA2C 4YQXL 3K58A 5IHLB 3ULSB 3S4SG 3IPFA 3GJFH 3FQTB 4QGPA 1EVTC 3GMNA 3IRCA 1S9YA 4OFIA 1JE6A 4QTIH 2EEBA 3TWCH 2XY2A 4PR5B 4DP1X 3VUAA 5KHGA 3PQYA 1Q1JH 1ADWA 4WY7L 1AY1L 5L3EA 3S5LG 4DJMA 3VGHA 1RZ7L 4QRRB 4LSSL 4PJ7A 1YMME 1FH5L 1UA3A 1MVUA 5F1OB 2UXNA 3MV01 4FQ2L 4H8WH 1HH6A 3D2UA 5BJTB 3MUY1 2P44B 1AD9B 2DH2A 4NWTH 5GRWA 4URTB 1NH2B 3NIFB 3Q8BA 5HDBE 5I9QB 5F7WC 4PGDA 5E4AA 5LDUA 3K4DA 2X0UA 5CWSB 2UV3A 3CRMA 1H3WM 3RTQA 1QVOA 2E5LO 2VQ1A 3DI3B 5C92A 4J3BA 1W0YT 2BSEA 1QLEC 3HZKB 2H3NB 3ZTCC 2YD4A 4P2OB 1TSRA 5GGQL 1JRHH 3LVTA 3EYFB 2JQAA 1Q0XL 5I6LA 3LZOA 4PREA 4Z3TA 3FQNA 3WTVA 4LIQE 4PP2A 4PGDB 1MCWW 1UT1A 1H2LA 3FUNA 3N5AA 4JO2L 3V55A 4GJTB 4YHMH 1FFXA 5LWYH 1X5XA 5E6IC 4FG6C 2ODIA 1G1OA 1RUPL 1JZFA 3GSRB 4HS8H 5H9CA 4YDKH 3DUHA 2RCSL 2Z4TA 5EEYA 3VFNA 1S7TB 4X5WB 2X4TA 4HJJH 5AVZB 5FOBB 1ZV2A 4LEOB 3I6LD 5KYXA 1HSBB 1PY4A 3KWXA 4HULB 4CN1A 1BMWA 3GI8H 4YSUA 1TVBB 2XBTA 1BCIA 1IBMO 2EDQA 2EIMC 4P3WA 4LU5H 1AGCB 3AGWA 2FYUH 3DK0A 5IEHA 2BNQD 4TL4A 3TJEH 1HXYB 3L3JA 1FO0H 5C0RL 1TEYA 1GJIA 1UD4A 3ARRA 1FC1A 3D34A 4X20B 3RZCD 4R50A 4GW1B 2G5BA 1TPXC 2B9ZA 4QE7A 1T5WB 2PYEB 4P9HH 4WI0A 4XX1G 3CH1B 3MNZB 3V8CA 4A7TA 2UUCO 4PJ9C 4TF4A 5DEGB 3EYOB 3IMUA 1VFBA 4XB3A 5FYLH 4J3OG 3MLSL 5CHNA 3GSOA 5DZNA 1RZ8B 5DEDA 2IOIA 4NPYB 5IK3A 1YQVL 4LKXB 1ZVNA 5A3ID 4FERA 4JNXA 2NR6A 2Y07L 1XF4B 5D5MB 1T6WA 4H20H 1RSOB 3ULAB 3LZPA 4GO6B 4ZSOA 5GHWH 4E9QA 3JBG7 1G9HA 1AR4A 3T6WA 5I74C 1GH6A 5ERWA 2GTWB 1XIWB 3OR7C 3GINA 4UM9D 3RPIA 5DUBB 1RZIB 4I0PA 1EZUA 1KIRA 3V9EA 4HG4K 1CXFA 3WUWB 4NEHB 2ZUXA 2O6EA 2DICA 2AEQH 4B60A 5C70A 2GIXA 2DQTH 4N85A 2JTDA 4RIRA 4K3JL 4YXHH 3LQMA 4L29A 1RK7A 1A7NL 4I18B 1FF5A 1VARA 1PKOA 3U25A 3SJQC 1I9RL 3C2AH 4OBRA 5J6SA 5IMKB 4ATTA 1S7RB 4N8VA 2XC8A 3DGCR 3NJLA 2Y22A 4M5ZH 4Y2OA 2B15A 3P3UA 1H15B 1WBZB 1RIHL 3WG7B 1ET5A 1YECL 1MCNA 2UWEF 4J8QA 2OPCA 1AO7A 1G1YA 4AGQA 3O6LL 4APQC 2CLZB 1KD1W 2X0LA 3GIZL 4IBZA 1KJMA 4AYFB 3NSJA 5CM1A 3OG4B 5DA4A 1EM1A 1E4WL 5C09B 4Z23A 1OLZA 4TOIA 4CDHA 3I9GL 5EIIA 4OZFH 3LRLA 4M5YH 2O26U 3E6FB 5L2KE 3FB6A 3Q1SH 1G1KA 1AGEA 1TQTA 4FLWA 5EZPA 1T21A 3TA3B 4C58B 3NCFB 3C5ZD 3PIQB 2HKOA 1WFUA 2C9RA 5HD8C 3ZHNA 3STBA 3ZHTA 5HVHC 1LEGB 4OFYD 2ZUQB 5KANG 1K4DC 3H54A 4NYLB 3X1EA 2Y2TA 2NSXA 4QF1A 1YRKA 3E8VA 3Q2NA 4C4UA 1ZAUA 3IKKA 3SJVD 5CILL 4F24A 4JFZL 5L3FA 1UCBH 5B3JE 1Q7YW 3WIFB 4JFFB 3EJZC 3FRPG 1SFDA 5J12C 3IDGB 5IB2B 1FNHA 4N0FB 4MSWB 5T33L 5EOQL 1K73W 2BVPA 2YQGA 2IWGA 2FCBA 3BEVB 4KKCD 4EFEA 1PYWA 3O45A 1DLFL 4M5YL 4FA8A 2LT9A 1OALA 3GSQA 5HP5A 1H9DA 1GIGL 2IBZX 1U96A 2VDLL 1SUHA 2F5BH 3HLKA 3HRZB 1M2VA 5E6YA 3TPKA 2Q76A 3ULVF 3B6SB 4WLCA 4XCFL 3JV5A 3STLB 1PNDA 3EOBB 3BGMA 3DOSB 2AV7B 4YHHB 3MHSC 4ZS6C 4JM2F 4EKWA 4U0RC 5GS1B 3N2KA 5D7SL 2CUHA 5C8JA 1R3KA 5TD4