3AG3B

Bovine heart cytochrome c oxidase in the nitric oxide-bound fully reduced state at 100 k
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag3B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag3B02
3H4FA 1KGYE 4DP2X 3NJKA 2FNWA 5I5MA 1JXFA 2E86A 4KOBA 5I6NA 4HAKA 3EH3B 1ASQA 2EINB 1J9QA 1E65A 5B7FA 3IE9A 2PP8A 1HAUA 4A2FA 4YSUA 3QJUB 1A3ZA 1ID2A 2DYSB 2TSBA 2YAPA 3EH4B 3IBOA 2VMJA 4NERA 1AZCA 1IC0A 2H47C 1M56B 3PAVA 4L0PB 4KO9A 5I6OA 1NWPA 4UANA 1FA4A 1MG2C 1NIBA 1L9RA 1JVOA 2BWDA 5B1AB 1AZUA 3T71A 4P5RA 2XVBA 2J57A 1AQ8A 3TASA 4KNSA 1KCBA 2BP0B 4P5SA 2BHFA 5E9NA 4YSOA 1VLXA 2AFNA 4F2FA 8PAZA 4PCYA 2WO2B 2FT8A 2EIKB 2Y1AA 4AKQA 1HAWA 4E9YA 5I6LA 3AW5A 2XX1A 2IAAC 2QDVA 3G5WA 1XB3A 3FT0A 1KBWA 4KO5A 3FSVA 1J5DA 2CJ3A 1SNRA 2HRHA 2PP7A 5B7EA 5FC9A 3AZUA 1SDDA 2ZOOA 1ADWA 4DP5X 2HXAA 2X88A 3ABKB 2H3XC 1SF3A 2JXMA 3GXUB 4DPCX 1QHQA 3DIVA 3CVCA 2YXVA 4G72B 1FWXA 3FSWA 1ETJA 4YSTA 5D4IA 5B1KA 2YAHA 1JVLA 3AG3B 4G70B 4N4YB 1JOIA 3SBPA 5B1BB 1YLBB 2XXFA 3PCYA 3ABGA 3TBCA 5PAZA 2I85A 2B3IA 3HEIB 3ZDWA 2DYRB 5I26A 3SBQA 5AFAA 1PCSA 1CUOA 1RZQA 2LLNA 2YAFA 1SHXA 2VM3A 1KCWA 4KNUA 3FSAA 3NP3A 1AR1B 4F2EA 5ANHA 4GP5B 2A3TA 1NZRA 1E67A 1QNIA 1NTDA 1L9QA 1A4BA 1AS7A 2CALA 2I7SA 2XLLA 1W6WA 2XWZA 3NSFA 2XV2A 4GY4A 4UF7C 3JTBA 3UACA 5I28A 3ASNB 1FFTB 1UATA 3UABA 2HX8A 2YAQA 4M4RB 1HFUA 5PCYA 1OCCB 5TK2A 1OCRB 3NJMA 2OV0A 3QJTB 3NJGA 1AIZA 1BYOA 1SHWA 3T9WA 3NJFA 7PCYA 3FQ2A 4CSPA 2IDUA 3S3BB 5A7EA 3X1BA 4E9SA 4A68A 1TKWA 2X87A 5I5JA 4TXVB 1KDIA 2P80D 2UXFA 3MBWB 1ET7A 4HCGA 4YSPA 1JZFA 1NDTA 1GY1A 1JZGA 1MDAA 1OE2A 1SFDA 5AKRA 1TEGA 1GSKA 1L9TA 3S3DB 4FAAB 2GB2A 3GDCA 2HZHA 2IDFA 3CZUB 3NSYA 3OMAB 3ASOB 1JZHA 2IDQA 4K9JA 4DP4X 2HX9A 2AZUA 2UX6A 4WTQA 3AG1B 3SQRA 1ZDSA 2JKWA 3PAZA 4AX3A 3WNIA 2BO0A 3WKQA 4DP8X 2VSKB 4PAZA 2QT6A 3NJJA 1M9WA 2CAKA 5B3SB 2UXTA 1ASPA 1M57B 4JKNA 2FT6A 2VW6A 2IWFA 1OCOB 4W1TA 5I6MA 2BW4A 3QQXA 2YAOA 3PXLA 1NIDA 1N70A 2MTAA 1ZIBA 1OE3A 2UXGA 3X1NA 5I5IA 1GS8A 3DKHA 1QLEB 3UAAA 3T6ZA 1BXAA 3FU7B 4AI7A 1X9UA 1JERA 1NIEA 4Q8BA 4YVNA 1E5ZA 3FU7A 1EHKB 2YAMA 4DPBX 4BXSV 3QJSB 9PCYA 4RH4A 1EZLA 1GR7A 2R7EA 2HRGA 4BXVA 4MFHA 1GY2A 1F56A 2GC4C 2CCWA 2YARA 1A8ZA 1J9TA 1NICA 3ERXA 3EH5B 4HHWA 2XV0A 1ILUA 1V54B 1N68A 4HHGA 2FT7A 3FS9A 2GC7C 2W8CA 3AG2B 3WNJA 1B3IA 3CVDA 4E9QA 3X1EA 6PAZA 1OE1A 2IWKA 2DV6A 4BDVA 1PZCA 2HLEB 2DWTA 1AS6A 1KV7A 1AZNA 3PPSA 2JFCA 4G7SB 4HCIA 4YL4A 4YSDA 2AANA 2ZWNA 1ASOA 4A2EA 2PCFA 2VM4A 1PNCA 2FQDA 2HX7A 2PLTA 3FPYA 3WKPA 2VW7A 4KNTA 1CYXA 2EILB 3UAEA 1GS6X 3KW7A 1ZPUA 2H5UA 3FYEB 1RCYA 1WA2X 3QPKA 1R1CA 3TA4D 2AVFA 3UADA 2GBAA 1TEFA 1NINA 1OCZB 1CC3A 2EIJB 1RKRA 2J55A 4BK5C 4ZK8A 1IUZA 3GYRA 3S3CB 2GI0A 4YSRA 2FQEA 1JXDA 1WA0X 2FWLB 1L9SA 2ZXWB 2QPDB 1NWOA 4E9WA 2CBPA 4DP7X 3QJQB 5D4JA 4DP0X 2IDTA 1BXUA 3FU9A 3FYIB 1SF5A 2VW4A 3WIAA 1J5CA 1SJMA 2J56A 3FSZA 2YEVB 1PZBA 2XV3A 2XX0A 1CURA 2RACA 1W8EA 1V55B 2WO3B 3FU8A 5IY5B 2PPCA 1AG6A 4E9TA 4JHUA 2EIMB 4G71B 4KOCA 1AZBA 4Q89A 4AKOA 2QDWA 3S8FB 1XB6A 5AZUA 3UGEA 1JZEA 1OOWA 1CYWA 4G7RB 3CDZA 1NPNA 2R7EB 3FQYA 2XYBA 1BQKA 4A2GA 4FA7B 1KYAA 1IBYA 2XXGA 1GW0A 1OF0A 1WA1X 1DZ0A 2OJ1A 1E30A 5TK4A 1BAWA 1SFHA 3CG8A 4E9XA 3N2JA 5B1JC 3BQVA 1PZAA 1MZYA 1W6LA 3NT0A 4QLWA 4N8UA 3X1FA 3X2QB 1X9RA 1J9SA 4DP1X 3TU6A 3QJVB 3BVDB 2IDSA 2UX7A 1IKOP 3IN0A 4GP4B 1E5YA 2BZ7A 3IN2A 1PLBA 2XUWA 3CVBA 4DPAX 7PAZA 1RZPA 4JHVA 4M3HA 3ZX1A 3OMIB 3NJNA 3T6XA 2VN3A 1L9PA 2GHZA 1ET8A 1ILSA 2UXVA 1TU2A 4YSCA 1BQ5A 4YSAA 3NP4A 2NRDA 4HALA 2BZCA 4HIPA 1A4AA 2PPEA 2BP8B 1ET5A 4GP8B 2Q9OA 2IH8A 3FQ1A 3OQRA 3NSCA 4F7KA 4KO7A 4EF3A 2AZAA 2GSMB 4HZ1A 2YAEA 1PF3A 1PLAA 3N55A 1WS8A 3RYMA 3WI9A 4BWWA 4A2DA 2IWEA 2FJSA 3ZIYA 1PY0A 4YSQA 4WKXA 3D12B 1J9RA 3DTUB 4NAJA 1JXGA 3PLYA 4CSZA 1T5KA 4W9ZA 5F7BA 2XU9A 1AAJA 1BXVA 1JZIA 2YQBA 2DY2A 3FPXA 1NIFA 1AS8A 1URIA 1KBVA 2BWIA 3AG4B 3TBBA 3V9CA 3NJHA 1PNDA 4DP9X 3HB3B 2PPFA 1MG3C 5LDUA 2MRYA 4YSSA 3IEAA 4E9RA 1KDJA 2BP8A 2B08A 4AZUA 1AANA 2PCYA 1MZZA 1SDDB 1L9OA 1BYPA 3NSDA 3OM3B 3WG7B 3OD3A 3U25A 5I6PA 2TSAA 3PAUA 2N0MA 4BDVB 1GYCA 2Q5BA 1AOZA 3EF4A 4YSEA 2BW5A 1XMEB 3T6WA 4X4KA 4A2HA 2YXWA 1GS7A 2J5WA 4DP6X 1AG0A 5B7MA 4QKTA 3OMNB 1IBZA 3V9EA 2CUAA 3X1GA 4G7QB 4GXFA 1BEXA 3ABMB 1ZV2A 2GIMA 2VSMB 3H4HA 2Y69B 4GYBA 3SBRA 2WSDA 4E9VA 2DWSA 3T6VA 4HCFA 3KW8A 5I6KA 5EHFA 1I53A 4YVUA 1WAEA 2IH9A 3NYKA 4ENZA 2P80A 3AY2A 3CDZB 4KO6A 3NJIA 3L45A 3C75A 3JT2A 3ZBMA 3QJRB 2BP0A 3NJLA 1NIAA 3ABLB 1ZIAA 1NPJA 2FTAA 1PLCA 2ZONA 2OCCB 4BWTA 3H56A 4UAHA 4AKPA 4A67A 2PP9A 5F7AA 1ZDQA 2PPDA 2QPEB 1A65A 1JZJA 3S8GB 2FQGA 4NB7A 6PCYA 1PAZA 1V10A 1AZRA 1OV8A 2I7OA 1WS7A 2PPAA 5D4HA 4BWUA 2FQFA 3EHBB 1XB8A 1DYZA 1A4CA 1BQRA 4A66A 1AACA 1PMYA 5B1JA 3MX0B 2W88A
chains in the Genus database with same CATH superfamily
1CFNA 3U82B 3PF2A 4BYHA 3TJTA 1UOWA 1LNQA 1FAIH 1A9BA 1IEBB 3N85H 4M5YL 4K3JH 2BVOB 1E5BA 3VWKB 1ETZA 3O2DA 3B43A 4K3DH 4PJXF 4ZNCD 3U11A 5DVKA 1SLUA 3D06A 3IAGC 5TE7H 2JQZA 3OKNA 3EO0A 4UCOA 3VXPA 3BSZA 1Y0LA 4JFVA 2X6MA 2WLIB 4LGPB 4O51A 2IJHA 5F9WC 1KB5B 3V0FA 1KTDA 3UMTA 4ZTOH 4RISH 4EXPX 4N25A 2VE6B 5KBNC 4FEMA 1U8KB 1YN6A 5D1XE 2OBGA 2ZNIA 4PRBB 3WUWB 5D1ZA 1JVOA 1KENL 3CHQA 2BSSA 2QPSA 2A0LA 1WBXB 1NQBA 3P11L 5HFLA 1QYGH 2VDLH 1H15B 3PJSB 3FB5A 3ULAB 2OYPA 4DV1B 3QRLA 3QTCA 4MAYA 1Y74A 5KX5B 1NCTA 1W0KG 1UEMA 1CQKA 4RMRA 5EH1A 2ENYA 3O3EA 4WBNB 4OCYH 5C97A 1SXBA 4TUYA 5HI4D 3LNIA 3F5WB 5ID1B 3GMOA 4UILL 4BD4A 5DJCB 4XMLL 2AFNA 2IAMC 2XRAL 3AUWB 4M6NL 5AB1A 4D94A 4Z3EA 2WO2B 2EIKB 1AGBA 4AKQA 3KBHE 1XMOO 1P0SE 2WXIA 4O4IB 3IMTA 3RWGA 3RU8H 1M7XA 1OAQH 1HTYA 1JTTA 2ZAHA 4GEIA 1SEQH 5EOQH 3SE4A 3IJ8A 5CEZE 5JW3L 2PP7A 3MO1B 3RVWC 4ZW8A 1NLDH 3GJFK 4OVVA 3FOLA 3RL2B 3ML0A 3RVVD 4B0MB 3GXUB 3LTVA 3ZDXE 2WAHA 4IYIA 2WYHA 1TQCB 4XVUC 1ML0A 5GGRY 3ESOA 4MVOA 4ODWB 1TTUA 2GJZA 1AQKH 2R70A 2XPZA 4KKBC 1NC2B 1GN2A 4HIIB 4ES9A 5BS0B 1U8LB 4IHJB 3UMNA 2BK8A 1YVLA 3EZJB 2NUTA 3HEIB 2HFEC 4FZEH 1FP5A 3I74A 4Q9BA 1EIBA 4JK0D 4ODUB 3ZE0F 2C7FA 1MHCB 1RK1B 2G2RA 1EBAA 3CXHJ 5DJ2B 4O2BB 1K6QL 4WCEV 1KBGL 4FFZL 3W37A 5J3HD 4QGTA 3KHQA 2FHFA 2WGXA 1MAML 4LVHB 4MTFA 2D2CB 4XC1L 1UM4H 4QR7A 1IE4A 3NFSH 4AZ8B 2BHYA 3MOBH 4LRIA 5IGXL 5L88L 3EJUA 4CSSA 3X13A 3W7WA 5FPRA 3LOWA 3P0YL 4FLQA 3R4RA 1WZLA 4WWKA 4AUUA 4GUOA 1JK8B 2ZIOA 1UATA 5DFAA 4ALAL 3MGOB 1A6UH 5D1ZI 5D5MF 2VQEO 4ZMAT 2BSKB 3QDHA 2OV0A 3QIWB 5KBKA 3P2TA 5E2VL 4YDZA 1UZ6F 1HC1A 2R29L 1SHWA 3SDDA 5IK3A 3CFNA 5FHAL 1B06A 1HH6A 4Q0XH 4K71C 4YJ2A 3U7YL 1URLA 5DJ2A 4O2AB 2OJEA 5HJBA 1OAXH 4WI3A 2F7QA 5GGSA 4KUZL 3RNQA 1P9MC 5HVWA 4KK8C 4LLDB 2ZUSA 1RMFL 5I23A 4O4HA 4P2OC 3WGUB 2Y5EA 1RQ5A 2KQXA 1YPZF 4BIKA 2YK1H 3O8XB 2E9GA 4FJYA 1UM4L 2V37A 4NJAH 4NB5A 5L4FA 5A7BA 4U7MA 3D25B 1L9TA 5IY5C 2A73A 4FAAB 3SKOA 4N90D 1P7GA 4K9JA 3L95B 2IH1B 2X6AA 1NAML 4OM1H 4CS2A 1AOHA 2J1YA 4X6BB 5IOPB 3CE1A 3MCKA 3BPLB 5I16B 2ZP9A 4Y16C 1M7UA 4D7SA 1N36B 4JO5A 5CN1A 1RJLA 3F58H 1OOAA 1CD8A 1M57B 4JKNA 4P4RA 4X6DA 3SB3A 5I1IL 2LGNA 3JALB 4FLXA 1QLEC 2CR0A 1NMCC 2NXYB 4PHXA 3UO3A 1C12A 2Y7LA 2Z7YA 3DLQR 3WFBL 2E76C 3VA2C 3QA3A 4PVNA 4LNRA 2D7TH 1YECL 3KZ8A 1DTOA 3K6SB 2NY2C 2R0WH 4FCHA 4DPBX 2JGDA 2HG0A 2AJ3A 4EZLA 4GAYA 5A2BA 2BHZA 4OGXH 3O81A 4D9LL 2VN5A 5D7JC 5K9QI 3HG1D 4F33A 1MKFA 3HNSH 4PJFE 1E28A 5DA0B 1XILA 1ZS8A 2HRGA 4Z7VF 3EDFA 3S3JA 4IKJA 3HE7B 2F23A 1AD0A 1QSEA 4LHUA 2ZOKA 4NRZB 1L4IA 3HS8A 2C3VB 3QZMA 1A8ZA 5JR1L 1IO4C 5I17B 1KLUB 4TVUA 2TRYA 1G7IA 3GIVB 4ONFL 2FGWL 4F6RA 2CLZB 4YPJA 1XVSA 3RZCB 2HJLA 1NJIW 3MLXL 4DR1B 1N68A 4FD0A 2FT7A 2XVGA 1M7DB 2CNYA 3MV7D 3DHMA 1KIUB 1CFNB 4M93C 4XP6L 2CLRA 1OO2A 5L8KB 5BQ7A 2FEEL 3LSOB 4PJ6A 4HCIA 2E9JA 3LNGA 3HBPA 5E03A 2EIKC 4QHNB 6TAAA 3AB0C 1E9QB 4R97C 4CGUB 4JJHA 4PD4K 3EJJX 1R3KB 1XTMA 4NJ9H 1A4KA 5J1TC 2JVUA 4Q0XL 1LWRA 1N5AB 3OZ9L 4LXFA 3IETA 1FL6A 4G6KH 5DCCA 4EJ1C 4DVRH 5A40E 5FDWA 3T0EA 2NT1A 3FN9A 3TN0A 3J27A 1Q5OA 5I1CH 4NKMA 4PRBA 4DEPC 2OMXB 2ZXAA 4PV9A 3FAVA 2AJZA 3GTVA 4HC1L 3H42H 2IGTA 5IHZA 3L3JA 3PHQA 3VSTA 3BO8B 4Y9EA 4Y4FB 1XGQB 1J5EO 5JHDE 3S3CB 2RJZA 5IV2A 4NO2A 4KTGA 3MV8D 4FYTA 2FBJL 1HZHH 3ULUL 1L9SA 1CFMA 3QULB 1R3KA 5EZJB 2AQSA 1S9VB 5KOVC 3IT8D 4E9WA 2YD2A 2XN0A 3CCHA 4LF6O 3CBRA 3SPJA 1H3GA 1HYRC 4DP7X 4PREA 2F0CA 1OM3L 4JFEE 1JK9A 1IBDA 3CN0A 3DOSB 4X66O 3O4LB 3ZMUA 1DK1A 3QQ3A 3SY0B 1FXHA 4HH9B 3NEOA 2IBZX 4QRFA 3TO2A 1LEGB 4NO0A 5LLIC 4U6HA 4LCWA 3E9UA 1L3NA 1ZTXH 1NT2B 1GJWA 2W9DL 1NUGA 3ARFC 1DR9A 1VFAA 4S0HA 1JPSL 4XRCA 5IY5B 1T21A 2PTTB 1JGEA 3LKSB 2VJ8A 4JL1A 5B8CB 2W80C 3IWUA 2DQDH 4TQHA 3S48A 5T3ZL 4PR5A 3QUKA 3O8XC 4I3GA 1JZEA 4H5SA 4M43L 4MMZC 3S4SB 2AXTZ 4U1LB 1OF2B 5BRQA 2GEQA 4TWKA 4L8BB 2X4OB 3C6LB 5I9QC 2DQEL 2OW7A 4YHPB 4YUEL 5F8QC 1LP9B 4TUOA 5DT1L 5E2WH 5BZBA 3TN0C 2YD5A 1NFDF 4NPJA 2XYBA 1MCSA 4WWKC 5CR8A 1JZ6A 2PR9A 2APSA 1R5VA 5EUOE 3V0EA 3MRLA 4LVOC 2VDMB 3KBEA 1ZWIC 1E30A 4HWUA 3JV4B 4M6OL 2QM7A 3PHOA 3EOBA 3VSUA 4OR1A 4LDEB 5CGMA 1ZXKA 3A4EA 4JQIL 2Z4QB 3JAKB 1OAKL 5FW8A 2NY6D 1MFCH 4PJAB 1QW8A 3NAAL 3MUY1 4K8RH 4NKIH 4P46C 3HZYB 2WJ5A 3JATB 1V7NH 2IDSA 5FYKL 3J2PA 5DS1A 4JI4B 4OQ1A 4GUPA 4YNYB 1EN4A 3ILPA 3KWWA 5F7EH 3C8HA 3KG5A 1S3JA 1S9XA 3CFBB 3P4OA 1XD0A 4R7VA 2H1PL 4YSCA 1DQDH 3O41B 1SHMA 2FJUB 1E0OB 2NRDA 3BDYL 4OUUB 1BYNA 4OGQC 1XUQA 1EFQA 1LL1A 2ADQB 3LNDA 3RWCA 3WKNA 5GS0L 1EZUA 1J8RA 3SZ6A 1TZGH 5DD1L 4DUVA 4B60A 4WW2A 1WQVT 5E8NA 2X9WA 1T3FB 3PXJA 1Q0XL 5J8OA 3ARFB 5JW5A 2APBA 1A6WH 1PLGL 4XVJL 1PLAA 4GEJA 3CC5B 4D0DB 4HFWB 4MJIA 1T5EA 4GG8A 4JHAL 5D1QC 3DO7A 5E8PB 3D0AA 1J9RA 3DX8A 1CF8H 3TFKD 3NCMA 3LVTA 3HE6B 4X62B 4G2AA 4JY4A 3UC0L 2XN9D 2HRPL 4LCYA 4Z77B 2DD8L 3MDSA 2IIJA 3JALA 3RBZA 2EACA 2HP8A 3FCTB 1URIA 1CPYA 1NAMB 1YY8A 5GZND 5BQDA 3K2MC 2BSED 2BSTB 4AV0A 3IJEA 4GQPH 2MRYA 1KF9B 4GW1A 3V4VB 3N2KA 3F7RA 2CNZA 2KC0A 4HU8A 4P8QA 4PRAB 1PM9A 2ZJSL 4PB9H 4DEPB 4WFED 3STZA 1N8RW 1AGDA 1CGSL 2XG4A 4TNWK 1QLFA 2V17L 1L0NH 4ONOA 5MENE 1NL0H 2DTSA 1RZKL 4BDVB 4HZLA 4NP9A 4DOHB 2QGDA 1T6BX 2MOGA 1I8IB 3U1SL 2DQ0A 1IGFL 5JA9A 5BRPA 2FLBT 1FAKT 2ZSVA 1MCRA 3B37A 2YSUB 4ICWA 3C5JA 4QOKB 2XZQH 3OV6A 3UBHA 4FA6A 4ABUA 4XMPL 3O6FD 3TNNB 3RWHA 1YCIA 1UXWA 3APCA 5EU5A 3ULUE 4JY5L 1A8JH 1RU9L 3L13A 1AR4A 1IGCH 4LF3A 5F89A 4K23L 1IC5L 5JH7A 2CGYA 2JB6B 2DOCA 5D2NB 1IM9D 1WH0A 2DWSA 4HKXA 1EH9A 3OAWA 3MGOA 4J5VA 5A6LA 1RUMH 1YMMB 2UV3A 1MFMA 4L1LA 4PA6A 4ZS7L 4Z5RA 4WWKB 5ETUB 2YJQA 4L3EA 3CHRA 4J7ZA 3AABA 4GUNA 1RERA 1XMWA 3ATFA 2HHHO 3BZDA 3GMPB 4HT1L 4RQQA 5DRXB 1HCYA 3FRUB 5F7EL 3VA6A 1Y76A 2ZWSA 4DR7B 2Y9RT 2X7LA 3D34A 1S6NA 2A9DA 5DHYB 2Y5TB 4J3SA 4ONGL 2XAJA 2YQ3A 3QAZC 4LSVH 4LGRB 2OMXA 4PV9B 1KNOA 5FK9A 3CC4V 5IBLC 1KMIZ 3E22B 4ZTEA 3ZOAA 2FQGA 3GXNA 5B3SC 4OFQA 4JY6B 4ODBD 4CW1A 5KVEH 4FEIA 4D0CA 4GSUA 1SGKA 1MSDA 2N04A 2BHUA 3BFWA 3PHQB 1X44A 2P1YA 1PYWA 5F0PB 1GJUA 1OPGL 1QZNA 2W94A 3PNRB 2VLJB 4AGLA 4IBQA 1PMYA 3T09A 3J07A 1CFQA 3QPQD 4FJ6A 5J3HC 4AE1A 1J8HA 1NTKH 2XN1A 4NKDB 3S6CA 4DP2X 3VG9C 2IFFL 3GMPA 5DRXA 4YPGB 4ODVH 2FH8A 5KS9F 4LDOB 2E3CA 3OSVA 3HZVA 4NKQB 1BBJA 4OGQB 3ES6A 3T4AC 1NBYA 3QT2A 5HGBB 3T2NL 2HRPH 4H8UA 5GW7A 3V4PA 2DYSB 3NCYS 3VG0L 3HPJB 3E8UH 4JM0A 3AITA 4NERA 3W9EB 3LXAA 1DDHA 5BS0E 1NCBH 5FYLE 5EZIL 3VGAC 5JJEB 4WAFA 1F90L 1LD9A 4GINA 2D3VA 2IANE 3GD1C 3H9VA 1ZHKA 4KZDH 4X20A 5AEAA 3KCWA 2YKLL 3L3DA 2LT9A 3CCSV 4MMZB 4Y1AB 2PYLA 5KVDE 1MOEA 5JA8B 2CO4A 1JI2A 3JD0A 3BZFA 2XG5B 2VZOA 4HIHB 4O58L 3DGEA 2QA4V 2WZPD 4PV1B 1KCBA 3WNPA 3ZU8A 2BIMA 3MACH 3MRFB 3PGFL 1CI3M 4N21A 4P5SA 4KMQA 1SYSA 4HEPG 2NXZD 4PJ8B 3VFMB 2CLVB 3F12B 3RX8A 3KWXA 5JQ6L 2R39A 2VDNH 3WIFB 4DEUA 4N86A 2EDOA 2AW2A 1M7IB 2RQ8A 5KYUA 3DSQA 3QDGE 3WLWC 4PA9A 1BVKA 3K3QA 3K9AA 1CDHA 1N8ZB 1CJYA 1CICD 2COVD 2WWNA 2ZKHL 3BEVB 1KB5H 1QSZA 1SC5B 2DQCL 3BCDA 2V3EA 4GW1B 5DS2A 5J13B 4GJTB 1RIUH 2ADFL 3KGRA 3Q1EA 3OXRB 4ZS6C 1NR1A 2GITB 3VSVA 1KGIA 1TFPA 4JKPH 2UUBO 3BYTA 3OKOA 1QP1A 1S7SA 4BUQA 3BZ4A 1R4XA 3RL1A 2IG2L 4KUMA 1XWVA 3QWRA 4L37B 5IOKA 4I1RA 4JFZL 3SBPA 4OB5L 3TV3H 3VI4A 3UH8A 4DO4A 4K3DL 3ZDWA 2JEUA 2YA1A 3VU2A 5IMLA 2R2HB 3HLAB 3VGBA 3KWUA 5D7IF 4ZMWA 3ULVC 1Q9KA 1HWGB 1S5HC 4QRPD 5SWSE 4WO0A 3P02A 1D9KB 2F1MA 2DLEA 3DUHA 3NK4A 1FIEA 3ZGHA 3CZJA 3NDZE 5LYJB 2VUOA 3DV6A 4KI5D 1KXVA 3BMVA 3FHEA 4EZJA 2P8MA 4LHJB 5GTHZ 3VXQB 5HYQB 2P5EB 1INEH 2XV2A 4UF7C 4OJAA 2ZKHH 2BE3A 5JIQA 1JZ8A 1SJHB 2AVGA 2ARHA 3F7QA 4LLQA 3FW6A 1A6ZA 5LHGA 2WD0A 4NQDE 4DR2B 1S5IL 3ZQWA 5K1JA 3ZHVA 4LE8A 5C0GB 4MQTB 4KVNH 4X88A 1YEHH 5JUEL 2ZUXA 3TPUB 1IM9A 4XMVA 3P54A 1OHQA 2WANA 4N0YH 4HF5L 2UZXA 4UYPA 2V3DA 4WWKD 1DQMH 2IAMD 1FG9C 2HJKB 4E9SA 4H44B 3BPNB 5LMUB 4L29B 4L8SA 2XWJA 3RA7H 4BQCA 2ZCKL 4NZTL 1G87A 1ZA6A 3S37H 5D5MA 3GO1H 2JJWA 4FNQA 4XPAL 4EIUA 4G7YL 4AQAA 5KYXA 2NZIA 3DHJA 3L9EA 1HCZA 4YHYB 4HJ0D 1E1QG 1OPOA 2TAAA 1AQKL 4TUYB 5E0FA 4GIAA 4N87A 2EIMC 4H26B 1CEZA 5J6HA 4PB0L 2D3NA 4F7MB 4P2ZA 3MRJA 5EU3A 1IB5A 4XN2A 4PBVC 5I0ZA 3VGAB 3IFPB 2KT6A 1N3NA 1FXKC 1ND0B 3QO7A 2HYMA 5IK3B 3H01A 4MMYA 5BZZA 5LXTA 1H3TA 4GKSA 1T0MB 4OT1H 2UXTA 2O5NA 1PL0A 2E7HA 5TDPA 1OCOB 2CR6A 2DQMA 1U3HA 3ZHUA 2AP2A 3BH8B 1B2WH 2JCWA 1BWWA 2AJZB 2YZ1A 3EFFA 4I2XE 1F86A 3SOTA 1N4CA 3D51A 1S5HB 1L7IH 4NQXA 1GYWA 2B9BA 3PWVB 1W2KT 4G59C 1CL7I 1RZFH 5DQ9A 3VXTA 2X0UA 2P4VA 1BXAA 5E2UH 4HBQA 2A4CA 2OSLB 5JXEC 2M2DA 2DW5A 2KERA 4PP1C 4LAQL 2VXQA 2VQTA 4I0PD 4AVHA 1W0VA 1I1AA 2N3JA 2EDJA 3FAXA 2F08A 4AYBA 1B0GA 3ZRXA 4PDRA 1GGCL 3AT8A 2CTPA 3GFUA 1KFGA 3PJNA 4FN0A 4KI1A 4DN4L 2XACC 2O5YL 2NUTB 3ZRCC 1P4UA 1Q9WB 4YDMA 5EN2B 5KAQF 4JYBA 32C2A 4GXUN 3MUUA 3D08A 4IBYA 2WC7A 3IJ4A 5J13C 2UWEA 1YN7B 4PJ8C 5J06A 2R1WB 3PL6A 4UMGA 1WE5A 5BNXD 3B2UC 4P0DA 5LBQA 1IAOA 1BFVL 3FDWA 2EH7H 2VC2L 1X7SA 4NUJB 4XO9A 5I8EA 3WNJA 3ETGA 3E8BA 5H5NA 1U2CA 3I2CL 4QF1B 2X2JA 4W9CC 5LO7A 3MOAH 5AUMA 4OZGE 1AS6A 4JO3H 3GHEL 3DYOA 1Q0YH 1USZA 1BJ1H 4WFEE 4G9DB 5DVMA 1IT9L 2ZUQB 4H8HA 4AYFB 25C8H 1WFOA 5IG7B 3Q05A 3BJ91 4FFKA 4BZYA 2PCFA 4F33B 3L7EA 3BRCA 5GS2H 3TGXA 3Q4HB 3RILA 4UI2A 4HEMA 3QCTL 1H38A 4BFNA 2HMID 5F1KC 1MF2H 1QNZL 1AI6A 4B9GA 3QYMA 2CAZC 3C6SB 1WA2X 1Z5VA 4KKLD 4IRJD 4NC2B 4TV8B 4XBEH 3ZN1A 1TEFA 1R6TA 3ETBJ 5I1DB 4RRPA 4YFDB 4FG6C 5TPWL 1MLCB 2B9AA 3AK3A 2VSCA 4S1RL 4AL8L 1BHGA 4CZZA 5IEKB 3BT2H 1VF5C 3BC9A 3BMWA 2OQJB 2Y69C 3TEXA 1F4WH 2AK4E 4AYFA 1FC1A 3MOAL 3WDIA 4EMZA 3DVFA 3MCKB 4RMUA 3NZHL 1L6PA 1XX9C 4LSSL 5BZWA 2QR0B 4Z7OF 4JI7B 4N0CD 5C0IA 5HVGB 3WEBA 3O6KL 1UZ8B 2H3OA 2JCCE 3S0PA 1E4KA 2GCYA 2Q8AH 5A2IH 2IANA 2QL1A 2YPLD 1QUNA 2W0FA 2WLZA 2I5YH 4HIJA 3GBMH 4PJDB 3UG3A 2YK1L 3B5GA 3EBIA 4XI5C 1CGYA 2XN2A 1XBDA 1MWAA 1WHOA 1A21A 3FB7A 3L3GA 1PZ2A 4G82A 2F5BL 3RKPA 3GMNB 1VFUA 3F7YB 4NWUH 1B9KA 1I1FB 2R23B 1XF3B 3QUMA 4I88A 5C0BE 3QEQB 3R0NA 2BVOA 3CUPB 3NH7H 2CDEA 3KDMB 1NLDL 1TQVA 4N2OA 5B4MD 5D1XA 2XT1B 1SQVH 2VXVH 1BZ7A 3EYOB 4HSQA 1LK2A 4JDEA 1NPNA 3TA3D 1UACL 4XNQA 2NX5A 4NJ9L 3CCQV 2A38A 1QRND 2XKNA 5FGBC 2BS8A 1DJWA 2ESVE 5GGSY 2EABA 1IGMH 1AD0B 1QSEB 4LHUB 3B6SB 4JDZB 1P5UC 2O6CA 2QQKL 4RMWA 3ZT7A 4CKVX 5JOFA 4YE0A 1QFPA 1WA1X 4X6CF 4H88L 3WY2A 3P11H 3BUIA 1BAWA 2CG9X 4CRPA 2PUSA 1ZHLA 3NGBC 4QE7A 3IDIB 3K2KA 3ISYA 2AV7B 5DVLA 4BKSC 2DQTL 3E22A 4FFZH 4DP1X 2YPLB 4OCXH 3T4YA 1NCWL 4OLXH 5KSVA 2UX7A 3DSNB 3WHXB 3ULVE 3IN0A 1I9EA 3MV9E 3FT4B 3ROOB 1HIML 2K7PA 1PPIA 4GIOA 4JO3L 4F7CB 4E9LA 2ED6A 4F2MA 2FBJH 4N20A 5F96H 1WFIA 4GBXA 3TXAA 4KJWC 2P4AB 3T6XA 5E2TH 4NXNO 3E1ZA 4JDTL 1B04A 4WO4D 2IF7A 3L5WA 3GUFA 3V6BR 1PQZB 1HSBA 4HALA 2BZCA 5M94B 2VDQH 1UT2A 4JV5B 2VZ1A 2B15A 2CHXA 3O4LE 4G8FB 1ZTXL 1QCEA 2W07B 1ET5A 3NEEA 2WGNB 4V1DD 4KKZA 3NIDB 1CXHA 2B4CL 5FGCB 4UVAA 5IB1B 5CD5D 5EU5B 4F7KA 5JPMC 1KB9F 3PN1A 3I50H 2L7EA 2XQBH 3PNWA 3ZIMA 1T0NA 4I55B 1S3RA 1TTRA 2XFXA 3N55A 3BQUD 5T3ZH 4F7MA 1FBIL 3T1HO 3K72A 2VB5A 2XNDG 4MTXA 3SE3A 2ZM6O 4H20L 1UPGA 5AB0A 2DLGA 1BWMA 1HIMH 3RVVC 4HIIA 4PUBL 5GHWL 4ZFZB 3UBGA 5DHVB 1E27A 4L3EB 4L5FL 4NZ8A 2ICCA 5T5NF 4I48A 1TT6A 4KXRA 2A99A 4C83B 1QFUH 5KSBB 3QNEA 1O9WA 1NAMH 1XI1A 1TZHA 1FS0G 1F18A 4N24A 4JI3O 1AP6A 2UY7B 4O02H 2ADPA 3I84A 4OUUA 3WMQA 4LARL 2MHAB 4ACPA 3UAJD 2QQLH 2XBDA 2DMHA 1MLBB 1KDJA 4YGAB 3M46A 5AW5B 3DX1A 1OKEA 3V5DA 3PDGA 2XOKG 1UFUA 5FYKU 5IJKA 3RWFB 2PCYA 3KPMA 3MJ7A 5IJ9B 3V0DA 5CN0A 3Q2VA 3WJLC 1D7CA 3ZDYE 2R29H 1I31A 2XQBL 3CX2A 3NSDA 3MJ8A 1GGIL 4ZW7A 2ZE8A 2OMYB 3RURA 4DUYB 3S35H 1QD0A 1G6VK 3I6KA 2CHDA 5KEZA 3BCFA 1I3RA 2H6PA 5KVGE 3PV6A 4EOWH 5KVDL 5AAPA 5EWIL 1CIDA 1GGYA 4DKFH 2KKQA 4P2QE 3VTMA 1U9KA 3MRLB 4MJ6A 1Z1WA 2WQRA 1GZHC 3RFZA 2IBBA 2FBOJ 4NEHB 4PJ5D 3HI5L 4YBLC 3V9EA 2KKWA 3KCYA 4OZGF 1BZ9A 2D9CA 3OB8A 5KBLA 1S3KH 3QG7H 1Q9KB 1ADQL 2BIQA 4CH6A 4KAQH 4GO6B 4FQXC 1OM3H 1KEGH 2QWNB 1ED3B 1YEFH 5EU6D 2C26A 3S37X 5A2AA 2EICA 2F95B 4R8CA 1KXTB 5DUBA 4NI6A 5AUMB 1Y18A 2WP3T 1XGRA 3WIIH 1NKRA 5E5MB 4LSVL 1RHFA 4OD3H 1VQ4V 3TZVD 5F21B 4CILA 3VXUA 2HG5C 2Q7EA 4X98A 2MEJB 2KS0A 3KWWB 2AHIA 5AVRB 1U2HA 3Q8EA 3ZBMA 4QCIA 2YIBA 3LQMA 3C6SA 4PV1C 5D8JH 5L4MA 4L8CA 2BP0A 2PYFB 2HN7B 5GISH 1MDTA 2FTAA 4POZC 3FBKA 3V52L 2NUPB 5IYDO 1R3LB 1R3KC 2X4UB 3N41B 4M6OH 5EU6A 5T5NG 2Y07H 4Z3IA 5I1KL 5C0EB 1OB0A 2QWQB 2QSTA 4EIZC 1KU9A 1ZL8B 2DRUA 2Q3ZA 1MFCL 2Y22A 5G2NA 3QVNA 2ARWA 3SGDI 4B5ZA 3BPNC 5INCB 5IFAL 4M7LT 2E4TA 4NXSA 4OGXL 1A4CA 1GAFL 1AI5A 1NCAH 1IKFL 5J7CC 3SDYH 1N33B 4KROB 2X2IA 4LKXB 3V95A 3H9HB 1G6RH 3L2LA 3W5MA 3QJHA 5DQJA 1QR4A 4OV6F 3B4NA 1CLOL 2FNWA 1QPXA 3KLLA 4KKCD 5EUOA 3KYMB 4KOBA 3DWTA 4JI1B 4BHUI 4DV7O 5CWSA 4XDLA 1Z0MA 3F62A 3LKPB 4PS4L 3GSNA 3LXCA 2I32A 3FBQA 1I7FA 3IE9A 1C5CH 3PHAA 4UV7L 4BZ1H 3UZVB 5I8KH 4MD4B 3FXIC 1OW0C 3IBOA 4P2RD 5EOTA 1EAJA 4JFHD 1C5DB 5K9OA 3EKCA 4TQEH 1N3NB 4B7EA 1YYLH 1GSMA 1MFNA 3KPRD 3MXWH 4J6RH 2VLJE 2MQ0A 4LNUA 3KGTA 4KKPA 5EEXA 1KJ3L 2CTRA 2G5BB 2OXGB 2Y7MA 2ZE6A 4S2SB 4YBLB 1MY5A 1A7RL 3NCCB 1KJ2H 2MOQA 1IZ3A 1XDCA 3GWOA 3QCVL 4RRPG 5I30H 1ZLDA 2IBZY 4WW2F 1C8QA 4CVXA 3HAEH 4OFDA 1K3EA 3Q2CA 4AOFA 3ECQA 1PX3A 2O61B 1TTCA 1WGVA 4ZXBA 4KKNA 2RIKA 3T0BA 1PD0A 1K72A 2K6ZA 1TCRA 1AH1A 2PW1B 5EYPA 4ZUSA 4YE4L 3EFFK 1ZK5A 1TTFA 3GKZA 4KRMB 5ERWA 3OR6C 4JKPL 1KEML 3ZRFC 5JHBA 4F8PA 1UJWB 2GUOB 3UT5B 5FKAA 1N6QL 4CNIB 2D3JA 2Q7AA 4BQBA 4QRPA 3FAVB 2OSYA 3MODL 2JGUA 4Q56A 1UWEL 3ABKB 2H3XC 1X5KA 4FG6D 5MI0C 4FXTA 2W0LA 4DPCX 4U1IA 3DIVA 1L0LH 4AQAB 5ETUA 4HG4K 3ARDA 3I02B 3SYAA 2X42A 4HJIA 2WTOA 4GW5A 3UAJA 2C34A 4HJ1A 5EYPB 4ZUSB 4M48L 1DUYA 3MVSA 5DZAA 3QUHA 3U6XS 1MFAH 3I6KB 4XNUH 1AI1L 1PY4A 4QXWA 2DYRB 2YPKB 4GT0A 3TO4D 2WLJA 3ULSA 2LLNA 4XCNA 2YAFA 2VR4A 4LH6A 2BRRL 2WLLB 2AJYL 3EG9A 1F90H 1IGCL 3DX7B 2OTPA 3RGVB 1T1ZA 3V4PL 4XI5D 4HNAA 1PYWB 4J42A 4IIJB 4JAVA 5CJXA 4IBZA 1FUNA 1LWJA 4JI0B 1FZOA 3CK0L 4GY4A 4PWGA 4QTHA 4LF9O 1SY6L 5F2VO 2EDFA 3AREC 4Z7QF 2AI0H 2BVQB 2V5RA 1MAJA 4GO9A 1GZQB 2A2QT 2XNAA 2ZXWC 3MKGA 4M4RB 4XP4L 4XTRD 4FQHB 5CMAB 3CFDA 3BAIA 1FGNL 1ZUQA 1R75A 1JGVH 4HGWB 4WU5B 1HDMA 4MDIA 4N2BA 3WMPA 5FWRA 1YHPA 5F1IA 3CZEA 1A1MA 1NUDA 3GPSA 3MV9A 3KEHA 3N2GB 2X87A 3UTSD 2HJFB 5F70A 4UQAA 1ZLVH 3ARGA 5DK3A 2WLYA 1EHLL 4F8LA 1VQLV 2K70A 4J9ZB 1A14L 3EF7A 4DW2H 1NOAA 2EDNA 1F8TH 5HGHB 4TTGA 1B90A 5KSAC 3WG7C 1JZGA 3HMXH 5FAAA 3QC6X 3GZOA 2EC9T 1CYGA 3LV3A 5ILTH 3VH8G 3M1CA 2HT3D 3AXLB 4XP5L 3MMEB 2OX5B 2EE9A 4ODVL 4UM9D 2ESVA 1JZHA 4FNSA 3KGSA 3KL0A 5EO0B 4ZT1A 4ZNEE 1WZMA 3AG1B 2CUHA 1I1AD 4JYYA 5IJ0B 2XI9A 1I1YB 2GTWA 3MLYL 1FVCA 1U95A 3GSUB 4TSBL 4UCTA 3WKML 4YEEA 2VSKB 4Y5XA 4G27B 1LWHA 4PSPA 2CJSA 4B9YA 2JS3A 1GN4A 5E1AA 3EYFB 1MJJB 4ZODA 4KX8A 1JPGA 1YPZE 3B9KC 2VDKL 4BIOA 4WI0B 4OGAC 1N70A 3NSXA 3T6QC 1MIML 4LSUH 3U46B 4XMXA 3ZUCA 5GJSH 5KYWA 2EZPA 5FYJE 5F1SA 4HFUH 2AQQA 2E27H 1I7RB 4N0UA 3MBXH 1MCEA 4PJEA 2QKIB 4U3FH 1WFTA 4BSVB 1E5ZA 4PRHA 3ZZSA 4HMDA 3HHSB 2JQMA 1TJIL 2JCCA 4MDJA 4NN5C 1ZT7A 2EE0A 2O61A 1T89A 5EZOL 4U1HA 4MNQD 3F7VB 4Q2ZB 3IS1X 3LAFA 1S7WB 4AQOA 4Z77A 3T2PA 2YD6A 3JUZA 3WEXB 5EF2A 4KDWA 1UM6L 3W56A 3WN5C 3P4LA 4TN9A 4XZUB 2GEEA 5GRXG 5I6XB 1S9VA 4AILC 3FB8B 3JSSA 2MNUA 3RDTC 1AR2A 4QXTA 1WO2A 3RG1C 4MASA 3MRDB 3FQUA 2OMWA 4D0BB 5DM6V 4W9DC 2SEBB 1JZ2A 3O9WD 3B77A 4OFPA 2NYZA 4JRXB 3TBTA 2C4FT 2HEPA 5AW7B 5BUAA 2DKSA 3HB3C 1RK7A 1BVOA 2DIEA 1VFBB 5B3JF 4XN1A 2IG2H 1B3IA 4P2YA 4F80A 5CWSB 2XN9B 5T5FA 4G7SB 2JFCA 1NJ9B 4MB5A 4NM8H 5E6SB 1KTBA 4AGNA 4WVRA 4F8NA 1SVBA 3FO0H 4N2NA 4PR5B 1D5XB 1MRDH 3MA9L 1FNLA 4Y5YC 1MNUH 1IIKA 4ZFZA 4A6YA 1U30A 1XH3B 3EJPA 1P4RA 3UZVA 4R96A 1TSRA 3K08A 3GUTB 4W9HC 3RPIB 1JGDA 2VW7A 4TUOB 2BFVH 5EULV 5LQBH 4Z9KB 2CM6A 4J3OD 1XGZA 1CE1L 4QTIH 2DW4A 2EDRA 1E3XA 5E4EC 5B5EZ 1AI7A 4BGDA 3QDGA 5K9QG 5ELIA 2DQGH 5D5QA 2IXQA 5DQDH 2HLFD 1KJ2B 3W7XA 2VR5A 3BH9A 3K58A 4X8CA 4LSQH 3VFUA 3CLWA 3K8MA 1B6UA 2ZUUA 3LIUA 3LMJL 3NK3A 3ZT5A 4B3TB 2DLIA 4QRUB 3K5SA 2HKOA 1CTNA 3WN5A 5CD3A 1GMGA 2WKOA 1KWKA 4OLVH 3FUFA 3E6FB 1XMOB 1DQQB 4QXGL 2UWEF 4Z3TA 1JK9B 3DOSA 5C6TH 4JFDE 4DN4H 1HT6A 5DVOA 4CH5A 1EQWA 1SYVA 3DPBA 1EAOA 5EOCH 3FQXA 1QRNA 4JB9H 3KPSB 4KVCH 3RB7A 4MVSA 4JR9L 2Q7YA 3JAWB 4L18A 3AQYA 4ZTOL 2CJUH 5IB3A 4U6YA 1IZKA 4R2GB 3ZTEA 1DGSA 2VQUA 3GKWH 5B8CA 3DVNA 4JG9A 1UACH 3H9YA 4MVMA 2AXFA 5IQ9A 2IU0A 4CSTA 1I9IH 3QO5A 1GMEA 4YDKL 4XMKH 5EORL 3UCSC 1S76D 1ROPA 4L8JA 3H9ZA 4DSYA 1T3FA 2GW5A 3NN8B 4FVMA 1Z9OA 4K5NA 4GAYB 5I1LB 3LEVL 2HFGH 4BV1A 4OAWB 2F7OA 3MGTB 3AREA 5KHIA 3FH7A 2HVBA 1OD9A 1SF9A 4BH7B 1JMXA 1YEGL 3D0VB 3RVTC 2IANB 4GX5A 1EN6A 3V6OA 5C0EA 4WDIA 4IKNA 1DF4A 1XGUB 5I17A 2WCGA 4KTYA 1KCUL 1XGQA 5EEUA 3X1EA 3I56V 1PZAA 3HZMA 3P30L 5DU7A 5E8OB 3S7GA 4OBSA 2J1XA 3JWOL 3WY4A 4DK6A 3FB6B 5IF0B 1SQBH 2DJVA 1IKOP 4I18C 1FNSL 1FCGA 3HZYA 5F71A 4HWBA 4MQSB 3JD3A 4AJVA 5H35A 4OLUL 5F7WC 3MRRB 1MW0A 4KHPB 5DS8B 4LQFH 3D25A 1Z9MA 1XDTT 2Q0OC 1MFVA 3JTTA 4K7PY 1ET8A 4KGJA 4HJJH 3CX5K 3V0JA 4K8RD 3VX0A 3X3FH 3BPOB 4DR2O 3PP4H 1BZ9B 4PN6A 3C8KB 2B77A 1DVXA 1BS3A 2F53B 3QS2A 5ESAA 3D85A 5DJ0A 1GHFH 3CPLA 1ZD6A 2XXCB 1F1AA 3GS4A 4GP8B 4R4NC 4F91B 4UTAH 4O2CB 4Y16D 3HS0C 4KRPC 5LG6A 2GUZB 1OM9A 2DWYA 1I94O 2F7PA 2OX5A 2EVJA 3RIAK 1BM3L 5ALBH 3T2OA 3O9WB 3CSPA 3LV3B 1H6TA 5LJYH 4CL7A 3SDAB 5FB8B 3VXUB 5K9JL 2DMXA 2IWEA 5CCGE 1UYWH 2R0WL 3NIFE 1IARB 1ONQB 2QV2A 4CSZA 5L3FA 4PP2A 3JASA 1CR9H 2DY2A 2Y7QA 3D85D 2ZP0T 4F7TA 5D7LD 3LN5A 1ORQB 5DFVD 1I3UA 1E28B 5CN3A 1RJYB 3T4DA 1W2BU 5EBWB 1RSYA 5EOCL 5HHOB 1UOKA 1IC4H 3G71V 1BVLA 3VWJA 2B1GA 5K1PA 4NO5B 1XH0A 1J8HD 4UM8A 3CSTA 1YO4A 4JI6B 1RMFH 3PRZA 3TZVB 1TPXC 5DYOB 4QHLA 1KYOJ 4FQIH 5B38B 1ZT4A 1AANA 2NCEA 3TWYA 4NN5B 5IB1A 4U1NA 2DMKA 3II3A 3M17A 3C5SA 2DN9A 4TF4A 4XN4A 1TLKA 3UKMA 4YUEH 3VH8A 2YXHA 3EYOA 3LS4H 3HI1A 2DS4A 1Z2KA 5D1XB 2DWDA 3IVKB 3RYIA 4BGLA 4R5TA 2Y7QB 1JN6B 1KT2A 1SBSH 1WF5A 3DTDA 4G8GA 1KJVB 1ECYA 3TM6A 3WELA 1ODAA 4KHTL 2HFGL 2LVCA 3ZDYF 4DGUA 4UQ3B 1UQSB 3EUDA 3VXMA 1T6VN 1KJMA 4NZTH 3ETBF 3IFLL 4HAFA 2Q8BH 1QW9A 5L0QB 1WB8A 2HT3C 3E2HB 1QKZL 1WUNT 2NNRA 3DOIA 4L3CA 5D2NC 1H3VA 2VMDA 4TVSa 5SX4H 3L73H 2AEPL 1TQBB 4KGLA 2A9HA 1KYOF 1M57C 2WHVA 4YR6B 2YPLA 3T4YB 2XICA 2DEXX 2Q8AL 2ED8A 2UUDK 5KBPA 2AJUH 5KANI 3A4FA 1M05B 4ODHL 3F7PC 3TEUA 3VH8B 1TENA 3MI6A 1T0PB 4DGVL 3V8OA 1WDAA 3ZE1E 4ENED 5L2KD 4NQQA 3ZRWA 2KLTA 1WBYA 4WY7L 1AC0A 4HWBH 3BN9C 4I87A 5IHZB 5CEZL 1SOXA 3MLZH 4JW3A 4HKZA 4A7QA 3T0DA 4P4KC 1TVHA 3SDAC 5I1JH 2YD9A 1N0JA 3IU4H 3MRJB 3EO0B 2BNRD 1QATA 3RHWF 4ETQA 1BQHG 3KM2A 3JTSB 1WC7B 5IREA 2P49B 2B1HH 3FONA 2OCCB 3ZR5A 3T3ME 2GHYA 3MJ9A 2HVKA 4UAHA 2WWMC 4J8RA 3T08A 5CP3H 3X2QC 5F7AA 1QBMH 4LWSB 2QVFB 3TL5A 6PCYA 5GSRB 4RSYA 1E9PB 4XBPB 1JVMA 4KROC 3VM5A 1PNMA 5FO8B 5F2FA 4DR6B 1FRGL 4BRJA 1UD2A 4R7CA 4LLWB 1MREH 6CGTA 2FEDD 1I0HA 2P28B 4WBNA 4MMXB 5CNHA 3MV7E 4WJ5B 1XFPA 4R2GD 1J05B 5IJDC 1X6NA 2A6JB 3N91A 2TRHA 4FMFA 4NNXA 3SKMB 3QJXA 4XWGH 2XZCL 2BIIA 4R4BA 4GO8A 4EZMA 4TNVK 2BS71 4JLRB 4ZOBA 3UTTA 3GLAA 1D6EA 3KL5A 4XPHL 3BWAA 4QGPA 3PGCB 1U8NB 4Y8AA 1IAOB 1IC0A 3OZ9H 5B1NA 4GQRA 1G7JA 4KY2A 5LB1A 4AQ8A 4LL4A 3MR9A 3OG6B 1CGWA 1NIBA 3I2CH 4M5SA 3IK2A 1GZPA 3BPOC 4LF7B 5CJBA 1CLVA 5T33H 1WRFA 3BLKA 3N42B 3OT7A 5ACLA 2A4EA 5KS9A 4L9LA 5B1AB 2BVQA 4NM4L 4EBQH 1VIWA 4FFZA 4NUJA 3C3SA 4MYWB 3QYNA 2IJJA 2JTYA 4MX7B 1X3DA 2EYTB 3ZL4H 2YLHA 1DO5A 2LFRA 1JCVA 8CGTA 1VF7A 3AREB 2X7LB 2ENSA 4MLIA 5JIDA 1RK0B 1VLXA 4YSOA 1YEDB 4MVQA 2WUBL 5C8YA 3CC2V 1U41A 1IAII 4AENA 4EI6B 2EUZA 4WDIB 4I9WA 1SBBA 5DK2A 5E9DB 5KYUB 1S7VA 2VQ1A 4H1LB 4E5XA 2BNQB 1A6VL 4ZMQA 1ORSB 2X41A 1NVPB 4BK5A 3EFFB 5C2BH 3W7UA 3LKQA 1F3RB 4YO0A 1J5DA 2IQAA 2EDQA 3MV8A 4WI7A 1M2VB 2ZT9B 1JHTB 3OPZL 3FO9A 4PG9B 3Q3GA 5IFAH 1PKQA 4G1EA 4H0IA 5HGGS 2X6VA 2Q10A 5T1KB 2NY3B 5DUBB 2D0HA 3W9DA 1OCZC 2YXVA 4LLYB 1II4E 1OARH 2BCMA 2CIKA 4R5VA 4JANB 1L9MA 3EOYG 1V7ML 3WEAA 4EVNA 1N0NA 2AMUA 3OKNB 3QGVA 2QBWA 4HS6A 2EUWA 4BZ1L 3ZHSA 2QPFA 2R8SL 2B3IA 1JD9A 2HKHL 3E2HC 3DJ9A 3FHQA 3QYCA 2JELL 1TUBB 4FXGA 2BC4B 5JW4N 3FSAA 4HU2A 4IKLA 4Y1AA 3JBG7 3DHPA 4LQ1A 5SV4A 4NZDA 5CFAA 2E5EA 3DXAA 4LCUB 3VUAA 3OGCB 5JW4R 3K3WA 1PP9H 1HR0O 1IBFA 3V4VA 1FFTB 1S5HA 1L0XA 5D7SH 2YAQA 2R29A 4NXMB 1H5BA 4ERSH 1QABA 5CCKH 2ZCEA 2HG5A 1SZTA 3V5HA 2QSCL 2YGOA 4X7FC 5BUGA 2UXXA 1FG2B 4P5TA 4WNQA 4UB6Z 3IPFA 1H8NA 2GTAA 1OCCC 4X65O 1UT1A 1PEWA 5DHXB 4XAWL 1HNFA 2UZXB 4LBEC 4U1HB 1FYTE 3RZCD 2J1ZA 4P9MH 3E0GA 1NU1H 1T0OA 5CZXC 1JGIA 5HYSB 5MENA 3F5TA 1MCIA 1G7QB 5D71H 5ISZA 4Y89A 2R9AA 2UXFA 2DQJL 4LSPL 4LVOB 5D1QE 5E4AA 4YSPA 5KTEL 4PVMA 5B38A 3LS5L 4MJ5A 2HVJC 4HZ3A 1TEGA 1GSKA 3Q8FA 1ZT1B 3CZUB 2DQFB 3OMAB 1P53A 1F3DJ 5D2NA 5DD6A 1LILA 5IWLC 4WKZA 2UX6A 2W0PA 4WTQA 4X9FA 3B2DC 4C56A 1BVNP 2HMIC 2JKWA 2VDOB 2Z6FA 4P9OA 1XCTA 3IF1B 1Z32X 3FSOA 3O6MH 4FQCH 3ARXA 5FO9A 5DEJA 2DQIH 1T4KB 2WLIA 1LQBC 4BQ8A 3BH8A 4JO4H 1X5HA 5ACZB 2NZ9C 5HHNB 4POZD 3SCMD 2OWOA 4CBCA 2H32H 3UO8B 3VXOB 4QPEA 4AQZA 1OTTC 3D0VA 1SJHA 2B59B 5T1LA 3EYQD 2CK3G 4R4FL 3G67A 5FOBB 3UAAA 1QLEB 4NWTL 4WWNA 5DSCA 3MCLL 5AQ0A 1FFXB 1CP9A 4WUKL 3I02A 3RBSA 2NW3B 3MU3A 1OT4A 4MXWH 5I76A 4Q7DA 4Y4KA 3K5LA 1EJ6A 4HUUA 4OIFA 4UDUB 4K94H 4DGIH 2XA3A 4JE4B 4NSKA 5FXCH 4L4JA 5LBSA 1J86A 3BDXA 4DAGH 3UIYA 2WQ8A 1K8IA 5KSBF 3Q6FA 4AIZA 2A6KB 4JJOA 3VU1A 4XX5A 4RQEA 2WYIA 1C08B 1HDJA 3VXOA 4KZEL 1Y6MR 5FYKE 3PJLA 4G28B 4NQSA 2K0RA 3CRCA 2FJGB 4ZPVA 1CXZB 1Q7YW 1A14H 4IDJH 3RDJA 4L4VD 3N50A 4PI0A 4PGDB 5HHOD 3T2LA 3T8VA 5TQ0L 5IUSA 3MJ7B 3HMXL 4OLZH 2ZCHL 4M7LL 4NAMA 1UZ6E 3SDDC 2DWTA 1KV7A 1I7RA 3N06B 1H2NA 4X8AA 1JGLL 1UJ3C 2F8XC 4BE6A 3LY6A 3KAAA 3MLPA 2FIKA 4YSDA 1JFHA 3HZKA 4G8IB 3CCHB 2NXZC 2NPLX 3DBSA 4LNVA 3R7QA 3K6OA 4XBGB 4AIEA 4XMWA 3M7OA 2Q0AA 2HX7A 4QRAA 5DQDL 3QDAA 1G5AA 3K4DA 2QKAA 3POHA 3ZZQA 2VL5B 3PAYA 4BFIA 2P5WE 5LVEA 1I8KB 4OAWA 1Q6IA 4RDQG 5EG6C 4BEIA 1BQHA 6FABH 1T22B 1DSWA 5AYQA 5KS9B 1AGCB 1ZVYA 4MW3A 2O6PA 3U9UB 3P2DA 2VXTL 3M7MX 5J57B 3WIFA 2HLAB 2GBAA 5L4IA 1JL8A 4LL9A 1RKRA 2WXLA 3T65A 1E4XH 2DE0X 4A38A 1D5MA 1NC2D 5AWNL 4X5XB 4QOKE 3I9GL 1KCSL 1XREA 4CJ1A 5IB5B 1IFHH 1J1PH 1AJ7L 3SPGA 3LN4A 4IU2B 2C1PA 4YXLH 5FECA 4OPAA 4K71B 5GISL 2WWMD 4M7ZC 2ZINA 3OKOB 2ZXWB 1MIEH 4Z7NB 3N40P 4JV5O 1XR8A 2EIZA 3KLHD 4PRIE 2BVPA 3QIUA 4XNXL 3HKBA 3HIZA 2M8XA 3ETTA 2WZ5A 3T2NH 4RGNE 2H2PC 3H85A 2R9RB 5IW1B 1JE6A 5CBEA 3FYIB 3VYPA 1HVXA 1E2WA 4JFSA 5HDQL 5SWSA 3QUYD 4PJXE 1FDLL 2WBWB 2YUZA 1K8DB 2QJ1A 1HHKB 3II2A 1XT5A 3JUYA 5E2UL 5E6IC 5HYJE 4V2BA 5EDSA 4DO2A 2IAND 1IC1A 4P23D 1S9WB 5J0BA 1F3JB 1L0QA 2QMJA 5KMGB 3ZKMD 4AQ1B 5GGVL 4N1CA 2QVIA 1ZLUH 1SQMA 2WYTA 1R0AL 1HJCA 3ROLA 4IGBC 1NUFA 4LSRL 2R4SL 3F7YC 3T8XA 4PJDF 1TVHB 3SIKA 2UUCO 4NPYB 3LZQA 1S5IH 2IWGA 3HG3A 1VARA 4WFEA 4URKA 4P59H 1MWOA 1AHWB 2EDTA 1VEMA 2BERA 1LO4L 3BH4A 4ELKA 4Z7OB 3GT6A 3TBTB 1X9LA 1N5AA 2C1OA 4TLTA 3ZDZE 3TA3A 3CBJB 4G6JH 4J2XA 2OXHB 3BP5B 3QCVH 5GJSL 3TT3H 3KYKL 2HWZH 3ZRVA 1MWAL 4X99A 1KTKE 2G5BA 2J2ZA 2X44D 1YYCA 1TXKA 3BVVA 3ZTJH 4I2XB 4ZUTB 1VKXA 1VFBA 4JUSA 1EEQA 3HBQA 1AGEB 4X2UA 1JPTH 3B5HA 4OJCA 5EIVA 4KHXH 3BKMH 3C90A 4PELA 2BZ7A 3DO7B 3FU0A 1KZYA 4M3HA 4GKLA 1KJVA 1YMMA 1T66D 5DHDA 3P9WB 1KGCE 2JKTM 3SE8H 1ZTMA 3UT5A 1SXAA 2RFXA 3NZ8A 5FKAB 4JG5A 4OJDH 4GKSB 4V33A 1SLWA 3MROA 5D7LA 1UEYA 4LOUC 3LH8A 2NY3D 2CJUL 3A6OA 4N0UE 3RAJL 2G9HA 4RZKA 3K0GA 1H0DB 5IHUL 1U58B 2X5PA 3VWJD 2C7UA 1NCDL 2MIZA 2DDQL 3QH3B 4KUCF 3K04A 4DW0A 1HZLA 4HZ1A 3FKSG 1G5GA 3GBEA 2YWZA 2YAEA 2Z34A 1OAQL 2CA4A 3CD4A 2RGSA 4GXVL 1A3QA 3WI9A 3RYMA 4BW5A 1JDAA 3BZ5A 1FPTL 3FO0L 3GPEA 5FA4A 3UBXA 1DVTA 5C9JA 2FX9H 3OAYH 4HIXL 1OJHA 2HKFL 3PWLB 4Z76B 4R7LA 3LDCA 3RWJA 1GRJA 5DURB 2HRLA 4EUPA 2R56H 3IBEA 4UB0L 3GB7B 5C3IA 4HIEA 4XP5H 2YC1B 3QIWA 1KN4L 3K79A 3GBML 1TDQA 3MREA 3X3GH 1MNGA 2ZG3A 2A74B 2Y2TA 4TRPL 3TNNA 4BWAA 2PYFA 3FH8A 4PJDE 2ICEB 1INQB 2VXQL 4KXZH 2VMFA 3CVIL 2GBUA 3V5DB 1UB5B 4LSQL 5DJ0B 1SJEA 5HJ3A 4KH2A 3U9UA 1AQHA 5BVJB 4Y1SA 4XC3H 4MKTA 2CCVA 3OJMB 4ZRGA 4FLUA 1DN0B 3CN4A 4UDUA 4F2MB 1NH2B 3UPAA 3H6JA 3N3EA 2EH8H 1J5IA 1OB1A 2X4RA 4MWFA 4PLJC 4QRQB 4U05A 4P46B 3OD3A 4UWQB 1YEIH 5GRUH 4DGWC 4GB9A 1MI5D 3MRFA 2RJMA 5LMNB 4KVPA 3PPEA 4C55A 4Y1AE 5SX4I 1KYDA 2VAAA 2WXRA 2CR3A 4LGSB 2BNRA 1AG0A 5B7MA 3LPPA 2JSFA 5HVHC 1M9SA 2NTSP 4WFGD 1WFMA 4CNIA 4U6HB 4L5FE 5B8CC 2EXWD 5ILTL 5LGTA 1F4XL 5FHAH 3WIHL 4YDVB 4NPKA 1A1OA 1E5UI 5T3XH 1AKPA 3NZUA 4UTAL 4YDLB 4E9VA 5ADPH 1FO0A 3RI5F 1JGEB 3X14B 5H4ZA 1EHXA 2E3VA 4HPOL 4MBOA 4G83A 2CIIA 2HTKD 3MRPA 3N44B 3RP1A 3T1YB 1MCLA 1OSEA 2IAMB 4W70A 4YHIA 1IQWH 4WI4A 4KXDA 1SERA 5GGQL 3B7TA 3HI1B 3L3OA 2VLRA 4MB3A 3H53A 4H8WL 1WT5C 4WEBL 5TQ2L 1I9JH 3WSQH 1I5XA 2YR3A 3W39B 3NJLA 4O9HH 5GGSB 3TVMD 2DEYX 3PJSK 2CRZA 4BWTA 1JWSB 3BUDA 3IGKA 4KZCA 5E95B 5BPPA 3TBVB 3K80A 4K2UL 1I1AC 2PPDA 1RH8A 4J3TA 4NB7A 4J6IA 3GTTA 2BP5M 3APMA 4AITA 5D1ZB 4XWGL 4HULB 1TJIH 2KB1A 1QLEH 1FBIH 2KLSA 3HRZB 2F54B 3CMGA 4A66A 3U1QA 4QRPB 1AACA 2C9VA 4U2ZA 1GM9A 2H0FA 4XAKE 3UDWC 5BVPL 3L1OL 4RLDA 5I5MA 1WZ1H 1ZLWK 1RSOA 4B9FA 1BAFH 3P69A 4HAKA 4EUPH 2NY4B 4ZAKB 1UD8A 4DERA 2EADA 1AILA 5D7IB 4ODXA 1XNQO 1HAUA 3VCLB 1JRHI 1FN4A 4H8WH 4WUUE 1DUYB 4LFAO 2BM3A 1K8DA 1AZCA 4PJGF 4WGVB 3SDXA 4NQCB 2WBJD 12E8L 1L3WA 4JCWA 5F89B 5FPOA 3V6ZB 3SR2C 3OGCA 2BOBC 3L7FA 1I8MB 5ITZA 5E08H 3FTZA 4DFIA 5CB4B 3L3JB 4FXKB 1ACZA 1KPVA 2AJUL 2MNWA 3RZCC 1TQTA 4R2GC 3UJIL 2BTQB 2XVBA 5FNVA 2OCJA 2O72A 2IVFC 3GI8L 4X42A 4AJYV 3QDJD 2Z8VC 4FZ0A 1ZLSH 4Y16A 1CD9B 2VKWA 4QRRE 1RP3B 1F41A 3ARGD 5CBFA 4B6ZA 5IV2B 2WBJA 2JI3A 2E75C 5A2QN 4MKMA 3CH1A 1KNOB 1HX0A 2GABA 3QDME 4OFYA 3NRPA 2Q76B 5K9JH 3QZOA 1WEJL 1IZJA 3G5WA 3HHMA 4NIYE 5FYJU 2AAVA 4LRNL 2WBXA 3MRNB 3FSVA 1KPUA 4V2CB 2BXYA 4ZXBC 4AEHH 3NCFB 3DETC 1UXSA 3ISWA 3G5YB 4HK3N 4HV8A 5EC2A 1DBAH 1QEXA 2MMXA 1UOLA 4MQ7A 4NN6B 1G7PB 3UJJL 2IDCA 1X5AA 1N0XH 3FQNB 2WWKT 3D36A 2CO6A 4IBVA 3FFDA 3D39D 5CLTA 2X38A 1UH4A 3F7VA 4KHTH 2A6IA 2AEIT 4JFDB 3ZYIA 4D8OA 4L2YA 2QTOA 3ATDA 4QHMB 1NGZB 4FQLH 3S36L 4JPQA 2Q76A 3W0WD 1E3ZA 2KQNA 1HXMB 3GMQB 3QIBD 4OLYL 4XNZB 1E4JA 1J1XH 3MFGB 2BVYA 4QCIB 1QFOA 2VRAA 3SBQA 4C7UA 1DBBH 1MJ7L 3CQFA 3ZGIA 3TN0B 4ADJA 3MSPA 1MVUB 1AGCA 2VLJD 4PCSA 1MN4A 4PRNA 3WTSA 2MHAA 5LMNO 3DX0A 5HDLA 1G1YA 5ANHA 1MSWD 2YUXA 1GAFH 4JFHE 4MQXC 1NTDA 3MV8B 4NRYA 1L9QA 1AS7A 2VKXA 4K5MA 4RGMB 5I26A 4YHML 4I0XA 4S1QL 4CC4A 1UJ3A 1JNLH 2Q7GA 3JTBA 3DO4A 3EGDA 3O8XA 2OS7A 3MV11 2JJ1G 5CEZH 4QHUA 3IFOB 1CE6A 5BMVB 4NSKB 3C9NB 2C9XA 2WOYA 2ZG1A 3F7KA 1N0XL 4N2CA 4NZUL 5CSGA 1ZHBB 3QUZB 5HGAB 3THML 4P2QA 4ABQA 1LHZA 3CFEA 1BM3H 4YNYA 2QHRH 1UURA 1UWXH 4QPKA 2BVPB 2WUBH 3FX7A 3L5HA 3NJFA 3QIUB 2HT4D 5H9CA 3WS3A 4H13B 3CCVV 2B5IB 1A4JB 3F85A 2DM7A 4EXKA 4D7PA 3EBHA 1U8CB 1X4XA 2VDQL 3AS2A 2R2EA 1E40A 1QFHA 4LHQB 3WDHA 4ALAH 2ZF9A 5LXVA 1C08A 3VVWA 5L2KE 4FFVC 2O26U 5MEPB 1KJ2L 3MBWB 3IJHB 3J7HA 5D6CA 1MH5A 2D7MA 1IQDB 3QI9A 3IJ7A 3D07A 3LZFH 2NLJC 3ESUF 2ENJA 1RZJL 4EI5B 2AK4B 4JBSA 4HX1A 3Q43A 1HEZB 1XEUA 3AS3A 3QHZH 5IQ7H 1IBLO 2P48B 3GDCA 1I4FB 1TJGH 1OARL 1U3JA 3ZE1B 5FV2A 4M8UA 3BN9D 4OD3L 4XPHH 1AHKA 1DLHB 2VL5A 2W6IG 2YPLE 5F1NA 5IMKA 4L5FH 2E0PA 1PV0A 4WEUD 4I4TA 1NGQL 2JF1A 4O5LL 3C5ZC 5J9PC 1BX2A 3GSRA 3TZVC 2FT6A 4XT1C 4XVTH 1B4LA 1U33A 4LF5O 5I8OH 2AK1H 3PXLA 4MD0A 1IL1B 4MCYA 4PJ9B 4BIZA 1CDYA 1Q0XH 4H25A 4MT8A 2O5XH 4WSKA 3X1NA 5E4EB 3U48A 3V7MA 4IGBA 4TQIA 5HDOA 5FLVA 2Z64C 4L4VA 5L6YH 2JEXA 3C87A 5FB8A 5JORA 1QWUA 2IH1A 4RRPM 1FFQA 1NCAL 1EHKB 4QYOB 1D5BB 3VXSE 1PDKA 3P3NA 3E83A 1HEHC 3ORJA 5L7XH 3MRBA 2RDCA 5TISZ 3ARRA 4NQED 1G4RA 5DJ8A 1BVLB 1WFJA 2VZSA 4MFHA 4WI2A 3VWJB 1BVKB 4OLYH 1DQIA 5JCOC 1R3IL 1ZJAA 3BGMB 2KYIA 3G9VA 1B4TA 3EIFA 4GT7A 4N0RA 4X6DE 3TBVA 1BSIA 1UVQB 2APXA 3U2SA 5F0LB 1G1KA 2KZ1B 5AENA 4KAQL 2ZX7A 4HKJA 4AV5A 1HOCB 3E3QC 1PZCA 1F3JA 2BXZA 4NQEA 4P5TB 1BP3B 4OTXH 5K39A 2P5PA 3MRMA 1DBJH 4H7VA 1F6AB 1RUAH 4B3SO 4G7VL 3WFEL 1BOGB 4ODWA 3GZQA 2E6QA 4UAOB 1KT2B 1AHWC 5JPNA 4BFEA 3ZS8C 2P90A 1F42A 1MCCA 2NSQA 2I26N 2GIXA 1RUQH 1QWNA 2QQNL 1YYML 4EN3A 1QSFE 2OP4H 4F1SA 1DL7L 1CYXA 1MZFA 2VQFO 2DQHH 1IBKB 2NY1D 2Q67A 4LT7A 1IAIL 4NZFA 2Y07L 4XXCA 4AXWA 3HC4H 1U8QA 2YWYA 2HJFA 2ZM6B 4UUJA 3G6BA 4WFGE 1JHLL 3ZE1F 2QWOB 2E5LB 1OGTA 4B3TO 3BYYA 4BK5C 1A6ZB 1XV8A 2FJHA 2VLKE 3LZFL 4P57A 3KEDA 3MFFA 4X6EA 3IU4L 5JO5B 3QR1A 4U3HA 4MVUA 4NFDA 2WY3B 1BEYH 4PJAE 1JZDC 2PR4L 1KMGA 3EOAA 3WKMH 1IGIL 4LLVB 1DE4A 3WD5H 3IXAB 4MS8D 1KGJA 1NWOA 2WBJB 3GNML 1LE5A 4P23B 5BW7C 2O93L 1U4EA 1BQUA 2R59A 3QAQA 1FL6B 4DP0X 4JO8A 2ZCLL 2Q7YB 1PKOA 3H42L 3QQ9D 4XMUA 4F57H 2F8VA 3TVMC 1BSMA 3Q8CA 2QMKA 4MLSA 3V6OE 3WIAA 4CJ0A 1DUZA 1YAZA 1BFOA 2CGRL 2YN5A 2Q3XA 3HMWH 4HLZH 3FSZA 2YEVB 2Y6SC 4TQEL 1MA1A 1LMIA 2DD8H 3TFBA 4Z7NF 1JZ3A 2ZG2A 5KTEH 2X89A 5AVXB 5EEZA 1V55B 4FKKA 4X1KA 3MBXL 2I69A 4K07A 3F65A 3WFHB 1J0HA 3ARWA 4C54A 2LLGA 3UTSB 2EIMB 1QSED 4LHUD 1PZDA 43C9B 4P59L 1EM1A 3CRRA 4KZ0A 4YDLC 3P2BA 1DLBA 3DVGB 4FMKA 2ADJA 2XTAA 4M29A 2ED9A 4G7RB 4WFBV 1ANUA 4TVPL 3QXWA 5FA4B 4NUGH 3WJJC 2YRBA 3EJYD 3IGAB 3SPIA 2LGWA 1E90A 2R7EB 3KPRA 4K7FA 1JGVL 5L4JA 1KB9K 3WD5L 1UWYA 2WB7A 2WXMA 1XXFC 4NQUA 2N01B 1GW0A 1MUJA 2P5WB 4PM1A 4OZFH 3TEWA 4I0XB 1HXKA 1N4XL 1AP2A 4JQVC 2ZZUT 5E6UB 1SXCA 4R90H 2F43G 3BQVA 3K91A 2YFNA 2WM0A 2CCLA 5CD3B 1E6OH 3DURA 3WFVA 3D69A 3QCUL 3AAZB 1R5IB 2WVTA 4P2CG 4X5WB 5J1AA 5AAMC 5DYOA 4CMMA 4AGPA 1EO8H 4OZIF 2K78A 3IN2A 1PLBA 2XUWA 1W0VB 3ZO0A 2I27N 4HS3B 3NRQA 4JHVA 5A6MA 4YLQT 3I6GA 3ES6B 5LGHL 1S7VB 3BWZA 4UQCA 4OX9O 3EDKA 4QE9A 3ULVH 5L9DH 1DJXA 1DJZA 4X66B 2DDQH 1TU2A 5AVZB 5A43C 4X9IA 4HOXA 1Y6KR 2GFBB 3CWGA 4GKKO 4HA1A 4HIPA 5DEGB 1TF4A 3QIWD 3N6YA 5EZYA 3TJEH 3ARDC 2OULB 5D7KD 3IJYB 3BKCH 3KPNB 2Y23A 3RDTA 2VDKH 3O9WA 4HK3J 5TDOA 1FL3A 4GPVA 1H8EG 4NBZB 1JGLH 3CFKB 4GZRB 1AXSB 4K3EH 3CXHF 3IFNH 3ZQ9A 7FABL 1R0AH 1P5VB 2EVIA 5KVEL 5IBLD 4F9LC 3GEFA 2YD8A 4DQOH 5EPMA 1O75A 1D6EB 2CXGA 2MQ3A 4QWWD 3ILQC 3OZLA 4MNGB 4RA3A 1KB3A 1EFXD 3ZJZA 5I2IB 5ESQA 4JR9H 4PJGB 3JASB 3LHAA 1JWSA 4KUCD 3FB8A 4LDCA 2KDYA 3SBWA 5KSUB 3IMVA 2EIBA 5E4OA 4YXKL 3ZCCA 4NC1E 4G6JL 3AQXA 5SWSB 4IOIA 5AG8A 3EXAA 3QWQB 3I85A 2XKUA 2OCFD 3LRMA 4JO1H 2N7SA 3A23A 3EOTH 5EZIH 2X0LA 5EO1B 3IGFA 2ARJA 5GSRA 4FFWC 1J1PL 1MZZA 5B3NA 3TCTA 3P4NB 2X1XR 5T1MA 3VFTA 3TYFB 3AG1C 5H4YA 1YI2V 4KQ3L 1D5NA 4X98B 1WCQA 5KUMA 4MAYC 9CGTA 2E5LO 3TH3T 1D5XA 4FI7A 1M1SA 2DM3A 4WCYH 4FYRA 4N0YL 1PZSA 3C2AH 1T1XB 3RWJB 4LASL 5IYZB 3DC0A 5CEZD 1MRDL 2G3XA 2V4LA 5KSAA 2YPVL 1UVQA 2CD0A 2QDOA 5DUPL 4U4BA 5D9SA 3MACL 3ALXA 5KN5A 2DWDC 1OAUH 3UEZA 4KFZC 4R3SB 3X1GA 4MDRA 3WTTA 3QQ4B 4GAFB 4LZKA 3RX5A 2FTKA 4JFYA 2EJ1A 1AZVA 4LO9A 5D1XD 1BFVH 4KXAA 3U4EB 1Z6JT 5DD3H 1UJ3B 3DGDA 4HG4J 4QJ4B 2V5MA 3MOBL 1MW2A 2YXMA 3T6VA 1N34B 3LEXB 5HDQH 1JFFB 4O9HL 2IPUK 4P49A 2OYQA 4XNQB 2GJPA 2AXWA 3PABB 4M61B 1P7BA 1UZGA 4PW3A 3ZKNC 2XZQL 4TNFA 3AY2A 4JDEB 1IC7L 1HHIB 1WK0A 1E43A 2WQAA 4YQXH 5HHME 3C75A 1PFCA 3VFNA 3ULVL 5L2KA 2AS5M 1CB4A 1ZIAA 4LBEA 1WUZA 2QEJA 4P3DA 5LBVA 4DETA 3TV3L 4FLWA 4ZQTA 2L3BA 1BQZA 3K06A 3O3DB 3K5NA 4R8WH 5J89A 2VWJA 5CEXA 2C7UB 3RUGB 2P3YA 5DMIL 1V10A 1TR7A 3T1FB 1IBLB 1OV8A 3EOBB 1ZV5A 2FQFA 3WY1A 5E6ID 2MWCA 2WNKA 2I60L 5CS7A 2NT0A 5ACMA 2O1AA 2Y2WA 1A6AB 4M4RA 5IBUG 3JYBA 2AEWA 3FRPG 4DPRA 3VMNA 5C09A 3KL3A 4WTZG 2IC2A 3AFLA 2DQUH 4JREC 3S3PA 4JPKH 1U97A 2VDNL 4X7TB 1B6QA 3CZFB 3GJFA 3EH3B 4WSGA 4I18A 3P9LA 1VQ8V 1ES0B 3O2WL 4XPFH 2NSMA 3WXVL 5EFIB 3UG5A 5EBLB 1MCHA 4LF5B 1PD6A 1WBZB 3FTUA 5FYJH 3QJUB 4DZ8B 2A74A 2YAPA 4M7KL 4HOWA 2VMJA 1K5SA 1MW3A 4G5AA 1OANA 4TOIA 1KGXA 4BCZA 1BHBA 5EO9A 5JQHC 4FQIL 4PJHE 4F37K 1L9RA 3VD2A 1UB5A 2ZUTA 5FUCE 5JIHA 1VZIA 4ADGA 2BWDA 2PETA 2WINB 4OZHE 2BVUA 3MZGB 4R7DA 2UVFA 3LXUX 1CLYH 2VXUH 3MLTB 4JJ5B 3QZWG 1UASA 5CMUA 3WB0A 1XGYL 3ARFA 4PS8A 3RTLA 1V27A 2ITCC 5CHNB 2ZUVA 5A16B 4N9GA 4UNUA 3SE3C 4L4TA 1MAKA 2ZKXA 4B7IA 1H3PL 4LP5A 4UNIA 6FABL 4G11A 1EMTL 3GXMA 3AU1B 4ZO7A 3H9SA 3IDYB 2EYRA 3OLGA 3BXNB 2P44B 4I89A 2XIDA 1REIA 4KVCL 2ZUWA 4X1IB 3VVVA 3X3FL 3HE7A 2YI8A 1D5MB 3SE9L 4K2UH 1VP7A 5HHVH 5TPWH 5CFHA 3MRIB 4KRNA 4E2LA 1QLEL 3OPUA 1AQDA 2YSTA 2MFNA 2OMZA 4TNGA 4Y19E 2E9BA 5DQJB 1CDIA 3MGAA 1M05A 3PWPA 4M56A 3PXHA 2A79B 2OZNA 5DEDA 4AG4L 2F74A 4YDIL 1LO0L 4NHCL 35C8H 3PCYA 5E00A 4P2RE 1HL4A 2FL5A 2Z8RA 1N9PA 2YBRB 4YAQB 4H8VA 3KH3A 2I85A 3CV5A 1ZVSA 4Y2DC 3UTPE 2RCSH 2WSSG 4LEXL 4E68A 2YUAA 2R0KL 3K0DA 1RZQA 2RH0A 1GPOL 1C16B 3K4ZA 4WSJA 1GCYA 4A2LA 3H7BA 3F6IA 2SEBA 2GHWB 2ERJB 3IRPX 4NNYB 4PJ9A 1B88A 3C5JB 4QOKA 4H2CA 3IMBA 3NCJL 1Q0EA 3C5ZB 1AXSA 1JWUA 2YXFA 5EU4B 2X9XA 4JFZH 4ZYKA 3MUHL 3IE4A 4NQDB 3IPEA 3T0EB 5HI4C 3PQYE 2DH2A 5ICZB 3M17B 4HC1H 3D2TA 3ALPA 4XDJA 4I5BB 4LR3A 3BPZA 1ZS2A 4WW2C 1AE6H 2PW1A 3KXFB 4U6VH 3VX1A 4NO0D 2W91A 1YITV 3LQAH 1Y0LB 2GT9B 2BCKB 4O51B 5GSVA 4E41B 1CS6A 5MEOA 5GGTL 3UTTB 5I1EL 2IDUA 4U2YA 1WEJH 4A68A 2FX7H 4LBEB 5BO0D 3JV6A 4H0LB 4TXVB 2BSTA 1T20A 4N8VB 3H9SE 5TDNB 1M7DA 2OMTB 3DUUB 4JGSA 3IDJB 1JFQL 3IWVA 4ZX3A 4UIKL 1BQSA 4MXQC 5I1HL 3MLXH 2W9DH 4OLXL 2Q2EB 3RUGA 2JJTA 2D7PA 2CM5A 2UZYA 5IM7A 4IMKC 1A3RL 1KJ2A 3SDCA 5IB5A 1THCA 5I0YA 4X1KB 2VXUL 5T1MB 3VXRB 1KXQA 1WJ3A 1ZT7B 3GRWH 3SQOH 3B2VL 4JO2H 5DK0B 5C0GA 5LKNA 1EGJA 2B2XH 1DVQA 3UCRA 3LJ3A 3LSQA 4RNRA 2BO0A 2ZXBA 1K5QA 1BXXA 3OUSA 5EF0A 4U1SB 4AGQA 4HIQA 2F5AL 4MJIE 3EZ8A 3NIFB 1KIRA 5L6YL 5BR8B 5ADOH 4ODSH 3M45A 1ADQH 4HUVB 1BMZA 4BFKA 2YD0A 4RGNC 4KQ4L 2EC8A 4O4HB 2CO1A 3MFFB 3TNMA 1P84K 4F15B 5CA1A 3WO3B 4IIJA 1JZ7A 1EAPB 5ICYA 1JMKC 4H20H 4G8GE 2NCMA 1NMAL 4PY7A 4R7DB 5DK0A 3NJXA 3K2IA 1INDH 4NI3A 2NY4C 3QCTH 1BMFG 3HTLX 3VWJC 3IDYC 3BE1L 4MYPA 1EZLA 1GR7A 3UJIH 7CGTA 1DFXA 1ZSPA 3B09A 3I9AA 4Z18A 4BK4A 3L70H 2VLLA 3OTFA 1GL4B 4P23A 3EGSA 3V52H 5LMUO 1DVZA 4HHAA 4PI2A 2A6KA 4OY9A 1J9TA 4XPGL 3S34H 2KH2B 4Z7VB 4X89A 4WTWA 4CVWA 2K9FB 5DWUH 2XV0A 3MUGB 4L0YA 4X9HA 2GDSA 4Q6YA 3T3PE 4L4TD 3BSHA 1N0LA 3GLZA 3BHBB 1JZ4A 1UWFA 5IB4A 3V0VA 4A04A 4GMSH 4FG0A 4XAKD 4ONHA 2DQFA 5FL7G 1RZJH 4GRMB 5AD0B 2AZ2A 2YS8A 2PGGA 2ADIA 2V7NA 1TJXA 4FCAA 6PAZA 5JXAH 4FQJH 5GTIZ 5DJAB 4DGVH 1CLOH 1FL3B 3TN0D 1RIVL 1Q6HA 4JTCB 4FOMA 1KYFA 3SDDB 3PWNA 2YO3A 5IQOA 2IADA 3IXTA 1JHLH 5LGUA 1SN0A 3FQXB 4APXA 3MLWH 5KYYB 5J12B 2OJEB 3E86A 1FJ1A 1T1WB 1ZPUA 5AVTB 2A0LD 4H4NA 3K0YA 3U0PB 2ILMA 5DI8A 5FOBA 1U3HC 5FEBA 4Z7IA 2Z0UA 3BISA 2V2TB 4XCFH 1O6TA 1JHTA 1LDPH 2VQEB 2Z93B 5DRZA 3VQMA 4MMXC 5MHSD 2AZ0A 2IQAB 1YMME 5CJXC 2YIDA 1F5WA 3UO1L 3P4NA 4N2HA 1IBBA 2GI0A 5AW2B 4F15C 4PB9L 1EN5A 4P23C 4YXWG 3FO2B 4FQQB 5JNYB 4P5KB 2PCPA 1C8PA 3BLBA 3VRIA 3IXTB 3VE0B 4EVNB 1YEEH 2AJXH 2XBZA 4WKZB 4WNSA 5LAPA 3I6GB 3QFJE 2CIKB 2DWXA 4I4TB 4UCSA 2J73A 3OKEA 2IMNA 4M5ZH 4LFBB 4RGOH 5JDJA 4CGTA 4XCCH 4M3KB 2IALB 4OF5A 1SQ2N 2HKHH 1R3IH 3WY3A 4NDMA 2VW4A 5IYZA 2ZAGA 4QY8A 1BG1A 2AKRB 1W8EA 1MRFH 3GSQB 1ZHLB 3SDYL 3APDA 3CX5F 4F58H 4KKAD 1BMGA 4AKOA 3MV8E 2QDWA 4JAMA 5IBUB 3B8MA 3HZKB 3TTSA 1R3JC 2QZ5A 4NZRL 2FATH 2JTDA 2K9UA 4WUUB 4YOKA 4F1ZA 1NGYB 2NY6C 4Y2DB 4R5XA 2FSEA 1OD7A 2MNJB 5D7SL 1T83C 1TQCC 3BVUA 3UTPD 5C9KA 5JPNC 43CAA 4O4YH 5KVGH 3D39E 4PIRF 3CSFA 4K7PL 4QI3A 3T2QA 2DQDL 1CT8B 1QVOA 1NLBL 3ZE0B 4ZSOE 1OGAE 4FA7B 2OTUA 4NWUL 3NFNB 1EO5A 4PJ0Z 1KQSU 4RGOL 5D96C 3GIVA 4MNGE 5KVDH 1L6XA 2O5XL 1UADC 4G5ZH 1E5AA 3B2MA 3KR3H 4E9XA 3N2JA 2DJSA 2NQDA 3FN3A 5JIPA 4TLSA 1MI5A 3VQXA 3TX4A 4KHPO 4JAMB 3U4AA 5K9KA 1TMCB 3OKKA 4PGDA 4DV1O 4PJBA 2P8PB 4WU7B 4KK5D 3ARBB 3FFOA 5K39B 1KGUA 3TCXA 2ZT9C 4OIIH 2B1AL 3UYRL 5F7HA 3GSOB 1I85A 3ICXA 4WGW