3AG3B

Bovine heart cytochrome c oxidase in the nitric oxide-bound fully reduced state at 100 k
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag3B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag3B02
4YL4A 1NDTA 4GY4A 4E9TA 2UXVA 4CSZA 3V9EA 2PP9A 2DY2A 2VW6A 3H56A 4BXVA 1I53A 1NWOA 2PP8A 4HHGA 5TK2A 3X1GA 4BWUA 1J9RA 1AZNA 3X1EA 1FFTB 2Q9OA 3V9CA 1NIEA 1AAJA 3TA4D 1ZIBA 3GYRA 3SQRA 2FQEA 2H3XC 4BDVB 3ASOB 4MFHA 9PCYA 5B1BB 3NJNA 2EINB 3QJQB 4DP5X 4E9SA 1JZEA 1AZRA 4YSQA 1B3IA 1NTDA 3CVCA 3NSFA 5B1JA 2XVBA 5B7FA 2IH9A 2AANA 4G7RB 4AX3A 5I6NA 1IBZA 5I5IA 1JXGA 1M56B 2B08A 1CURA 2Y1AA 1RZQA 3BQVA 2RACA 2AZUA 4DP6X 1AACA 4X4KA 5TK4A 5I5JA 2FT8A 1NPJA 2AVFA 1KCWA 5ANHA 1NPNA 1PNDA 2J55A 2HX8A 3FS9A 1AR1B 1AS6A 2H5UA 4GXFA 3TBBA 4A68A 3CVDA 4L0PB 1BXVA 1ETJA 3QJUB 1XB6A 1DZ0A 2VN3A 1AG0A 3IN0A 1OV8A 2BP0A 1F56A 2IWFA 2YAFA 4BWTA 1JZIA 4KO9A 3JTBA 1CUOA 1DYZA 4YSEA 1J9SA 2GC4C 1SHWA 3AG4B 3U25A 4A67A 3CZUB 1E5ZA 4YSSA 1J9TA 1V54B 1PLCA 2FQFA 1AOZA 3EH4B 3FQYA 3ASNB 3UADA 3MX0B 2DWSA 1SDDA 2W8CA 5I26A 1OCOB 4G71B 4F2EA 1BEXA 1AQ8A 1BXAA 2GIMA 1RCYA 1CC3A 2PLTA 3HEIB 3MBWB 3NSYA 1MDAA 4PCYA 3GXUB 2P80A 1OOWA 5PAZA 1BQKA 1JVOA 4KO6A 3FPXA 1CYWA 3QJTB 2EIJB 5IY5B 2YAQA 4AKQA 1PAZA 1GSKA 2OJ1A 2JFCA 2VM3A 3FU9A 3S3DB 2CJ3A 2IDTA 3IN2A 3S3BB 4KO5A 1NICA 5A7EA 1GS7A 4DP4X 1WAEA 2BWDA 4YSOA 2VSKB 3NP4A 4DP8X 4YSPA 4BK5C 3AY2A 2PPCA 4P5SA 3FPYA 1AZBA 2VM4A 2XLLA 2Q5BA 1A8ZA 1VLXA 2VW7A 2EIMB 3KW7A 1ZV2A 1AZUA 2UX7A 2DWTA 3OMNB 1XB8A 2YAEA 4DPBX 1JERA 1V55B 1SJMA 3FU8A 5F7AA 4YSUA 4E9WA 2GC7C 1AZCA 4ENZA 2IH8A 3QJVB 4UF7C 1A4BA 2GBAA 1OCCB 1UATA 2IWEA 5I6OA 1AANA 1PMYA 4A2GA 4QLWA 3QJSB 1NIFA 1KDJA 3NJFA 5AKRA 1BYPA 4AKPA 3CVBA 1M57B 1SFHA 1WA0X 1JZJA 1JXFA 1BQRA 4GP4B 1IKOP 2YXWA 1SFDA 4QKTA 4AI7A 1SHXA 1L9QA 4GYBA 4JHUA 4HALA 3WKQA 3DIVA 4AZUA 4PAZA 1WS7A 2MRYA 2CUAA 4DP1X 1J5DA 2BP8A 1PF3A 2PCFA 3AZUA 3PAUA 4AKOA 4YSCA 2LLNA 4E9YA 1T5KA 1SF5A 3SBPA 1URIA 3S3CB 2BW4A 2XWZA 1NIBA 2YAHA 2HXAA 2FWLB 3AG2B 4KNUA 1JZFA 1ET5A 4E9RA 1PLAA 2XV3A 3PXLA 3NJMA 1BQ5A 2CAKA 1RKRA 3T9WA 4EF3A 2BWIA 3H4FA 2UXTA 4YSRA 1MZZA 3PLYA 3TU6A 3DKHA 2ZXWB 3D12B 3ABGA 1OE2A 4WTQA 1OF0A 2H47C 4TXVB 5B1AB 3T6ZA 1N70A 2PCYA 3AW5A 4GP8B 1GY1A 3X1BA 1NZRA 1AIZA 3UAAA 1OCRB 1A4AA 1OCZB 2GSMB 1PNCA 1OE3A 3EF4A 3WNIA 1L9TA 1AS7A 4WKXA 1W6LA 2YEVB 2CCWA 2FQDA 4HAKA 2BP0B 1GS6X 1JOIA 2XV0A 5B7EA 2PPDA 1R1CA 2QPDB 3EH5B 3UACA 2JXMA 3IEAA 3CG8A 3NJJA 1EZLA 1NINA 1SNRA 2FTAA 4KNTA 4M3HA 4NB7A 1E30A 1KCBA 5B3SB 3TASA 2NRDA 2QPEB 3T6WA 3WNJA 4P5RA 6PCYA 4Q8BA 1ASPA 2BO0A 3X2QB 1IUZA 4A2HA 1SDDB 3T71A 1ZIAA 3EHBB 4HCIA 8PAZA 3NSDA 2OCCB 1HFUA 4ZK8A 3UGEA 4A2FA 4YVUA 3OQRA 1V10A 1ILUA 2N0MA 2IWKA 3FU7A 1J9QA 4Q89A 2FNWA 2X87A 2PP7A 1HAUA 2CBPA 4E9XA 1KV7A 4NERA 2QDVA 3QPKA 2I7SA 4UAHA 3WKPA 2J56A 5I6LA 2J5WA 2BZ7A 2P80D 4BXSV 2YAPA 2XXGA 5B1JC 2WSDA 4DP7X 5I28A 4G7SB 4F2FA 2DYSB 4F7KA 2E86A 4KOBA 4N4YB 5I6MA 1QNIA 4DP2X 1E65A 1ASOA 2HRHA 3OM3B 1BXUA 1KDIA 3NYKA 3T6VA 3CDZA 2MTAA 2FT6A 3FQ2A 2I7OA 1A65A 3TBCA 1BAWA 1L9RA 2YARA 3RYMA 4A66A 1PCSA 4HIPA 1M9WA 5AFAA 2FJSA 2TSBA 1FA4A 5B7MA 5D4IA 1GY2A 2ZONA 4HCFA 3UAEA 1KYAA 3AG3B 3PAVA 2QT6A 1AS8A 3SBRA 3ABKB 1ASQA 3NP3A 1A3ZA 5B1KA 1L9SA 2QDWA 2WO3B 2YQBA 4JKNA 1JZHA 4W1TA 2AZAA 2UXGA 2WO2B 4YVNA 2R7EA 3NJLA 3JT2A 1W8EA 2PPEA 4BWWA 3WG7B 2HLEB 2BP8B 1CYXA 1KBWA 3N55A 3ZBMA 3OMAB 2BZCA 3FT0A 2YXVA 1TU2A 4KOCA 4G70B 1GW0A 1ZDSA 2UX6A 1TEGA 1FWXA 1BYOA 4G72B 2R7EB 4HCGA 3T6XA 3G5WA 5I6PA 4BDVA 2IDUA 4KO7A 2VSMB 2YAMA 1L9OA 1XMEB 1GS8A 5I5MA 3FYEB 2HRGA 4JHVA 3EH3B 7PAZA 2VMJA 3HB3B 1N68A 3IBOA 3L45A 3NSCA 2IDSA 3S8GB 1QLEB 2EIKB 1WS8A 3UABA 4NAJA 1ET8A 1MG3C 3DTUB 1X9RA 3OMIB 1MG2C 2HX9A 5F7BA 2XXFA 1E5YA 3OD3A 2PPAA 3QQXA 4YSTA 2XUWA 1MZYA 1IBYA 4FAAB 6PAZA 3H4HA 3GDCA 3NJGA 1GYCA 4DPCX 3X1NA 4M4RB 1NIDA 1TEFA 2XX1A 4GP5B 3ABMB 4W9ZA 3ZX1A 1KGYE 2ZOOA 1W6WA 3IE9A 2X88A 3ZDWA 2EILB 4A2EA 5LDUA 2IDQA 5D4HA 4DPAX 3FSWA 3FYIB 5I6KA 2XV2A 2Y69B 2GHZA 2IAAC 1PZCA 1NWPA 3N2JA 2OV0A 1ID2A 1EHKB 3ABLB 3QJRB 1ZPUA 2AFNA 2YAOA 3AG1B 4UANA 1NIAA 2VW4A 1XB3A 1E67A 3WIAA 1IC0A 2FT7A 5FC9A 4E9QA 1PLBA 2W88A 4FA7B 4YSAA 1ZDQA 3KW8A 1L9PA 1JVLA 3FU7B 3PCYA 3S8FB 2GI0A 1GR7A 4CSPA 4YSDA 4DP0X 3FQ1A 4A2DA 2GB2A 4K9JA 2ZWNA 2J57A 3NJIA 2DV6A 7PCYA 1QHQA 5D4JA 1PY0A 1JZGA 4HZ1A 5EHFA 1PZAA 2PPFA 2HZHA 2TSAA 2FQGA 2XX0A 1A4CA 3NT0A 2DYRB 3X1FA 5AZUA 1KBVA 2UXFA 1TKWA 3BVDB 3WI9A 4HHWA 1ILSA 3ZIYA 1HAWA 1ET7A 4KNSA 2A3TA 2BHFA 2BW5A 2JKWA 1ADWA 1WA2X 3FSVA 5PCYA 2HX7A 2I85A 3C75A 4N8UA 3PPSA 3PAZA 1SF3A 2B3IA 2XYBA 5E9NA 3CDZB 3ERXA 3NJHA 2XU9A 1WA1X 1J5CA 1OE1A 3NJKA 2CALA 4G7QB 3SBQA 4E9VA 1AG6A 1JXDA 3FSZA 1YLBB 4DP9X 1X9UA 4RH4A 1PZBA 2IDFA 3FSAA 1RZPA
chains in the Genus database with same CATH superfamily
4TTDD 4P59L 2UXVA 1I94O 3V4UH 4K7PX 2TRYA 2JCCE 4NPYA 3WKML 1DDTA 5KBMA 4S10A 4AG4H 4WWPA 3MNZB 3H56A 2F1BA 2EE0A 1Z9SB 4L0ZA 2YUWA 3DUUB 3KJ4B 2PY5A 4R0LA 1QRNE 5TK2A 3SCMA 1NFKA 3WFDH 3MLTA 5JQGA 2BCMA 2YBGA 5EUKA 4U3XA 3ZZQA 4ES9A 5DVPA 2OZ4A 5HYFA 1ZSDB 2JTYA 3PABA 4OCYH 3GMLB 4YIQA 3TH4T 3WJLA 1MFBL 4X9HA 5ACLA 1VEWA 2JJTC 3E8UH 4NGHH 3GMRB 4PV9B 5L2KD 5LQBL 1T22B 5HY9A 1RVFH 3ELAT 3WEAA 4N0YH 4NQVA 4JS7A 4POZC 3U0TB 1X6NA 3HUJB 5DUBB 5B1JA 2CDEA 2DI9A 4XP6H 2APXA 1O6VA 4MJIA 4XNXL 1N67A 3V95A 3BWZA 5F9WB 3FH5A 1IC5L 1RLBA 1GYUA 3L4UA 1OK0A 1S5HA 3WKYA 1TNMA 4MQTB 4EOWH 3HI1B 2OTPA 5IESL 1ZVYA 3KLDA 2HVBA 2ICWI 1ZAUA 3EKCA 4H8WL 5EBLA 4Y16D 3RWEA 1A9BB 3KWWA 3MRCA 3FS9A 2VDNB 3PHOB 1LE5B 4RISL 2VWKA 3O9OA 3AQYA 5JOPE 4XVSH 1RURL 2ZYIA 4RQQB 5C93A 1N3NB 4LE8A 4LSSH 3ZTNL 1H15B 3VJ6B 4BWTA 4J28A 3MXWH 3NEOA 3OG4B 4XB8A 4GRLD 4U6TA 3GRWL 1UWEH 4IBSA 1UOKA 2GC4C 2V9RA 4GG8B 1N0JA 5F7KC 5HD8C 4KI5C 4U4IA 1HXYB 4NT6A 4MZIA 1I9EA 1R24A 2Z31C 1WJZA 3CC4V 4YSSA 1S78D 2IXQA 1XTMA 4PREB 4E9LA 2V33A 1E4WH 1AOZA 1MWAA 4CNIA 2RAMA 4E5XB 1OCOB 3D36A 4WO4B 3TIDA 4URKA 2GIMA 1EAPA 2QWQB 2EH8H 3EJRA 2IANE 2W0KA 3F2LA 1JNJA 1WPCA 4R8WH 1KYUA 5CMUA 3SE3A 3BPOC 2HMID 5CBGA 1DJXA 3DVFA 4GX1A 4QHLA 4LIQH 4ZMXA 3RI5F 3T4DA 3I6GA 4OBRA 1OY3B 4IHOA 3DXAB 5ALBH 5IY5B 3L3JA 1VSCA 4QY8A 5DS1A 4UTBL 2EVJA 2F4VB 5FUZH 4MCZB 3V5HA 3CIQA 3GK8L 3EXJA 1P5VB 4G28B 2PTVA 4WHDA 2ZD9A 2ZCKH 1T21A 3SYPA 2Q7YB 4GYCB 1QZNA 4WO0A 2ZNXA 4J9YB 4WQOA 1GS7A 3ZE1E 4WI3A 4B5ZA 3SKOA 4B3TO 2F19H 2L7UA 1BSMA 3HG2A 4Y2NA 1GXEA 2L7QA 3ZKXB 1JWUB 3BP7A 4P5SA 4OFKA 2X41A 4G6FD 2ZXEB 2O6PA 3QJXA 2AJUL 1J5HA 3P30L 1PZ2A 5CU9A 5JCOA 3GM0A 1ZV2A 4RMBA 3OTFA 1AZUA 3BDXA 5I8EA 2RNBA 1GK9A 3MTRA 3NABL 1XB8A 5IVXB 2ED7A 3SD2A 2A79B 1X5LA 3L1GA 1RUQH 3O6FB 4JF3A 4OF7A 1TTBA 4EI5D 3OL2A 5ESAB 4LEXL 5G4MA 1Q9KB 1YJ9V 3QJVB 4PJDE 3FTYA 3VXNB 3GBNH 4PSRA 1HYSD 2DMBA 4KJQC 3UBXI 4DGWC 3VW3L 1MCIA 2PXYC 2BVQB 4C56E 1A7OH 3ALPA 4JANB 3C5ZC 3MN8A 4A38A 1SM3H 5FKPB 2L7EA 2K78A 2C4FT 2YPKB 5LP6A 2ZPKH 3BWUF 1I7RB 1JZJA 2MQ3A 4ODXB 4RGNB 4OZHE 4XC1L 5HGHA 3VWKA 2OT5A 5JW4R 2YXWA 3GZPA 5DJZA 1L9QA 1NCBH 3IDUA 4HALA 4IOFD 4RMQA 3UTZB 4F7MA 5ICYA 3A3YB 3LEXB 2F5BL 2ADPA 4JEGB 3WUWB 3W7WA 1B4LA 4OCSH 5AEAA 3TYGH 5GGQL 1FIGH 4KY1L 4Y9BA 2VJXA 3U36A 3HFML 2WCGA 2C9AA 3LRSB 3EDJA 1OW0C 1HOEA 3ARQA 4M48H 2VXQL 2WXJA 3LXBA 4P9PA 3NA9L 4RMVA 4OAWA 2PCFB 2IBZH 5CN0A 2WWOA 3LCYA 3MYZA 5CA0A 1NAMH 1QFOA 3PXLA 4HV8B 5B39A 1XCQA 4XCCL 4G6MH 1HZHL 3VGHA 5IV2A 4OCRH 3P4NA 1GGBL 1TENA 3ZE2B 1YVWA 2FE0A 1KELH 4OX9B 1FXKC 2VC2L 5K1XA 1K4CB 1MFAL 4WTQA 4RUEA 1N0LA 3CCSV 1MEXH 1NUFA 4NN7B 3REWB 3S4SB 3REVA 3G6JB 4G8FB 3L5HA 1IVSA 5I23A 2HLFD 4G3YH 1N70A 3WIHA 2XKUA 2NLJB 1DLFL 4PLJD 5GJTH 2VH5L 3BOVA 3WB0A 1XMQO 5E70A 5CLWA 4NUGH 1F51A 2UWEF 1WAPA 3SJBC 4LCUA 3X17A 3B2UC 4KKBD 3CCUV 4LESA 4G6JL 3G9AB 1W6LA 2CCWA 3LMJH 3C6SB 2CRYA 2X7RB 5J2TA 1URLA 1VQOV 1GS6X 1MCOH 1AP6A 1S7RB 3P3TA 4G11A 4WFED 1KLGA 3EIFA 1LQBC 3UO1L 3L71H 3FKUS 1AC6A 1Y76B 3IPBA 3OPZH 5C6TL 3KBPA 2JKIS 4HC1L 4HIQA 4S11A 4UM9B 1WLHA 1ZHNB 1Q3EA 2YI8A 3TASA 1Y74B 1MJUL 2EDYA 1P2CB 1NJIW 2JKRM 5KSUB 1MI5D 1T2QH 1DZBA 4UQIM 1UXWB 4M7JH 3W81A 4XMKL 5IMLA 2F1MA 2H0FA 3I6LE 4ZS7H 1DVTA 4RGMB 3Q6FA 3JVGC 3CFNA 3H54A 3U7YL 2M8XA 1D9KD 4JFOB 1I4FA 3GSRB 2YICA 4U3SB 5I0DA 5CN1A 1VARA 3D4CA 4H25B 5DWPA 2YEZB 3SDCD 3NCCB 2EKSA 3TNMA 1AR4A 3OEEG 1J0ZA 4N9OB 3UTSD 5TDNB 1G7PA 3KYKH 1O75A 3Q3GA 4JDEA 3M45A 3Q8FA 3SO3B 3P4MA 3RIFF 3IAQA 3ULVE 1BM3H 1S7XA 3UDWC 2W0FC 3JTSA 1C8QA 4HPOL 3SDXF 2J5WA 4DFIA 4LFAB 3CSPA 2P80D 2A74A 3L4ZA 1KJ2L 1MHHA 3AXHA 4J80A 2ZWKA 4PGBB 4TN9A 3RU8L 1J0HA 2WQUA 4YUEL 4D3CH 3QJHA 3QO5A 4NQXB 1J88A 3WD5H 2Z0AA 3X3FL 2YPLA 4X20A 1F4XL 3HHSA 3LVEA 4TQHA 5T5FL 4FA6A 5KYYA 3WTWA 1X9QA 5E8NA 1GZHA 3PQYE 2Q68A 4FQXD 5I6MA 5H2BA 4U0QB 4QRQB 1WJ3A 3EYVA 3O0RL 4GKNA 5AYTA 3TT3L 2QFRA 3TETA 1PX3A 1SQPH 1MHPL 1CICA 1NVPB 1CLOL 1H8NA 2OTUB 1OTUD 1WITA 3O3BB 4KTDL 3S3SA 4DUYB 1UOVA 1R3IH 4P4KA 3S88H 5GS1B 4MZ3A 1THZA 1T7XA 1BCIA 5BR8O 2QSTA 3ZT5A 3B4NA 2X0VA 1TVHA 4KK9D 3H2WA 4NWUL 4HUNB 4OCYL 4P2OD 3B9KD 3OLGA 4ZTEA 1EZJA 1M1XA 2RALA 3NP3A 4RIRA 3QNYB 4NQDA 4I0PB 5CUSH 4NGHL 3U1SH 4XNMB 4R2GB 1OSYA 2QSCL 5IYZA 3X11B 4TQEH 2ZAGA 3BUIA 5BPPA 5L9DL 2Z8VC 3H9SA 2CM6A 2CHWA 3BQUB 2J6EA 3IKCB 4K0OA 4G42B 4PJAF 1M4UA 5FHAH 4UOZA 2Q76B 1SYVA 2WIMA 4Q9RH 4WI7A 1TZHB 4JZOA 4XWOD 1TU2A 3BDYL 3S3WA 4YXHL 4QOKD 4EEQA 1S7SB 1IAIM 3MJ7B 3SPVB 5ECGA 1T1YA 5I8CA 3L75H 5D7IB 1PEZA 2WUBH 4DKDC 4W6XB 3QZBA 3U46A 2KPWA 1QW9A 4CILA 4WY7L 2XZQH 3NSJA 3OAZK 5FK9A 2ITCA 3DV6B 1BF8A 4OZIE 1OAQL 5EN3A 4HWEH 4NAJA 4OLYL 5JQ6H 3F5WA 3B56A 3K04A 5KVEE 2P47B 3R06A 5LN4A 3F7PC 5F7BA 1WO2A 1IFHH 1KJMA 2XI9A 3PGDB 5BR8B 2GFBA 3CXFA 4AL8C 1SS3A 1KN4H 5DUML 4HP5A 4OU3A 2R59A 5DJ0A 4NENA 4FQQB 2E9WA 4N8VB 4XBMA 1JV5B 5DR5L 2GK0A 5DC0A 3X1NA 1CLZH 3SE4C 1AQDA 5B5EZ 1UYWL 4GP5B 4DV1O 1GGYA 4PIRF 1ES0A 1CF8H 4FG6D 3DX7A 3LEYH 3ULAB 3FUNA 4KUZL 4R9HA 1M7XA 4QXUL 3QISA 4RAHA 1NDMB 2ZG2A 1ZLVK 2B1OA 3BZ5A 3V9FA 5JW3L 4YO0A 2R69A 3BZEA 4WDIB 4ZNEE 4JFXB 3ZKMC 4GT1A 4KRLB 4KI5E 5C09B 5J4MA 2EH8L 3HG1D 5KA6A 3FHEA 1GMEA 1JGDB 4P04A 3NTCL 1CLYH 1NOLA 2CDFA 2VDQB 4L48A 4UV4H 3PXJA 1OGAB 4PU2A 5B1CA 2X38A 4QT5A 4APQA 3RFZA 3O4LB 1FZKA 4G27B 1ZPUA 1D2PA 1HCFX 4KJYB 4Z7NF 3IGAB 1N19A 3LPFA 4MNHA 3D3QA 4M5TA 5FLXN 4CC0A 2WZ5A 4N0CC 2P8LB 3C60A 3APCA 3B1UA 2ZCKL 1LP9B 4LWSA 2VDML 5G4NA 5ABZA 5I76A 4PQXA 3JUYA 4NR1A 1BQLH 2W5PA 1UADC 2XFGB 2F19L 3T08A 1RH8A 2DJ4A 4JGUA 4UUJC 4XVJL 4FFBA 1ZTXH 4A2DA 2EEDA 3MDJA 1FL3A 2PF6A 3I5DA 2R4SH 1JPEA 2GJ6E 2ZXDA 1PNKA 3MBEC 1PY0A 1Z5LB 1TYRA 2J1XA 1B3JA 1JPSH 2N3JA 2YXFA 3CDGA 3GBLA 2F7IA 1QI4A 1K4DA 3EFOB 2HZHA 1BBDL 2XG4A 4DWHA 1TUBB 2ZUQB 4U1HA 4R26H 4ZRGA 5EIBC 2YIBD 3HB3C 1AD0B 2DYRB 1R5WA 1N4CA 1RJZA 4N2CA 2YDEA 2VN4A 5C6PB 4FLYA 1XGZA 3HZYB 3ZTJH 3O81A 4AT6B 4D0BB 1EANA 1LD9B 3LUTB 3QUYD 1A7OL 1MF2L 3CU1A 3LH8A 4YK4C 3ROLA 2B5IB 1NLDH 1FE8H 1Z9LA 2BW5A 1DUYA 1UGNA 2D3JA 4KMLB 3FSVA 5IMKB 5A9GA 2ZPKL 5AW1B 4Z3EA 1TJIH 2JKNA 1TCRA 1MVUA 3NIFF 4S1RL 3DRTA 4YDIH 1GAFH 4HU2A 4RVBA 3TIEB 4O51B 1IGCL 1MCNA 5MI0B 1DVFD 5C1MB 5J5EA 4Y4KC 2AJVL 4G7QB 4E9VA 2ENYA 4NCDA 1AG6A 2DYPA 4F58L 3KR3L 2OMZA 3AS2A 3R1GH 4ADGA 2P8PA 3U0ZA 1LO4L 3UP6A 2K9PA 4LSPL 1TQVA 5FYJD 4WI4A 4OLZH 2OAAA 3EJTA 1YXBA 4UQAA 1U8HB 4CSZA 3VXOB 1NFIB 1E90A 4Q4IA 3G3LA 3G9VA 4U6VH 4JRFA 4D8PA 5KBDA 3S37H 1MHCB 1UFGA 4U2YA 1AZNA 3QI9D 4BGLA 1NKDA 3X1EA 2ZKXA 4NQEB 4R97C 5DEDA 1U3YA 4TKWA 5FV1L 2UU9O 2F7QA 3POHA 4KK6D 4MJ6A 5IROC 3TA4D 5ADOH 1MUJA 4XBGB 3RHWF 4OZ4A 4JN2B 4R5VA 4X42A 1S9WB 3WBDA 1HHKB 4LL9A 2XQBL 1BP3B 5HHME 4LP4A 3A6CH 5FYJU 4LEOA 5A2JH 4JX0A 4HD9A 5KVGH 1M7DA 2Y3NA 4UYPA 4LT7A 1JXGA 5DD1H 4JV5O 1X5HA 1EHLL 3VDBA 2KBGA 4R90H 4ZOCA 5IHUL 2Y72A 4JY4B 3GMNA 4ZUSA 2V2TB 2DICA 2FATH 5I5JA 2BX5A 1Z9OA 1ZE3H 2K8MA 3DJRA 4P2QE 1XHZA 4Q6IB 5IK3B 1IURA 5EZIL 5HHPB 2H26A 4PRHE 1JZDC 2P3YA 2XHNA 5C08D 4RUFA 4OQ1A 1AKJB 3OPZL 3PDGA 1NMCB 3GLEA 1T6BX 1JTTA 1T6WA 3TNNA 2XN9D 2QADC 3B3IA 4M00A 3C8DA 4YBLB 4PB9H 1RJYA 3TXAA 3BRFA 3SGDI 2VDOB 2ICWA 2Z64C 3JTBA 4N26A 5C8YA 3PDDA 5MEPB 2XWEA 4X5RA 3EDDA 5C0AA 4GG6A 4TTDC 4S0TD 5BO0D 5I1DB 1SVCP 4PS4L 4Z8FH 4YXKH 1X5XA 3F65A 1N6QL 2DTML 2IM9A 4MT8A 2CPUA 2CIKA 43CAA 1YSCA 2VDRB 4LRNH 4QR7A 2PNDA 3IYLW 4GAYB 1G6RB 2OMNA 2A1WL 4JREB 3GMQB 2VLMD 3CFUA 3T0VA 2R2CA 5LNGA 3JSNA 1UJ3A 5EU6D 1V7NL 1EUTA 5BZBA 2GI7A 2B4CH 4JQVA 5D1ZD 5DZPA 3C6LD 5E6IB 3U0PB 3UPCA 3RLSA 3N41F 4YHYB 1OOWA 5PAZA 1BM3L 5KSVB 2F53D 3AREA 5DEJA 2YR3A 4NJ9H 2GVYA 2PTUA 3RRQA 3U2SA 1D5MA 2VXVH 4GW1B 1JYWA 3FQXB 4G8IB 4RNRA 3V5KB 3O8XC 4R7LA 1PKQB 1QYGL 2J5LB 3PFUA 4I77H 2YD1A 1AMYA 3OKLA 3HN8A 4MA8H 4WO4D 1RLWA 5F6HI 3PPEA 2R70A 2OP4L 3UZEA 4XXDB 2AHIA 1QLFB 3CJHB 2UYLB 3VU2A 4NQSA 4OCMC 4E36A 2GSGB 3ZU8A 4N9GB 5FYLE 4KH9A 1T0MA 4JPIB 5KYUB 5B1BC 3BYTA 2PWDA 1XEUA 2DLIA 1YMMA 4Y16C 1KMIZ 4E42A 3QIBB 3OGCA 1D5XA 3KPMB 4TUOB 2L04A 2KSDA 4HQQL 1JPFA 2BNRE 1GOGA 1ZKAA 3CMEV 2DM7A 3IETA 4JTAB 1R3IL 2WCPA 3QDMD 1M7IB 3ZDXB 3CLFH 5CJ5A 4JTDB 4L05A 1UFUA 2EEXA 4FQIL 2LLGA 4ENZA 3SBWC 4NVPA 3FB7A 2CR0A 5HYSA 3U6XS 2GQHA 1I0HA 3ILPA 1S78C 1ZWIA 1DQLL 3U1SL 5L3FA 5CUSL 2E9IA 1VGEL 1LR1A 5B3JF 2CXGA 3GSNH 1MFNA 2NY3D 2AZ0A 2A9ML 4XCCH 3FOLA 5FL7G 4X5WB 4LFBO 2W59A 2OWOA 2OCJA 2WZ0A 1KCKA 3V0JA 3ZS8C 3KPRE 5F7NC 3D0LB 3QNXB 1IBLO 2C3WA 1FVEB 4X98A 2HCZX 1BYNA 2HMIC 1MFEL 1MFDL 2K7QA 2J1KA 4PWJA 3MV11 5TFSL 1LO0H 3QIUD 4Z0BL 4DP1X 1I3VA 3DRQA 3NAAH 1BZ8A 3G6BA 1FNHA 4Y9EA 3E22A 3UTTB 4AKOA 1WIPA 1MDTA 1XGTB 4MRCA 5DMGD 2XIBA 1S7TA 2BY2A 4AZ8A 1XIWA 1CZ8L 2NCEA 4YWGL 1Z2KA 3DV4B 2PTMA 4LAQL 4RSYA 3UIYA 3VXQA 4LDLB 2PZSA 5EOQL 2K0RA 3FFCE 4MVZA 1CFTA 2JVUA 3QHFH 2G60L 3FT2A 3PWPE 2BVYA 2OTJV 1SOQA 2NYYD 2EAEA 1NMBL 1JNHA 5DJCB 3L5WB 2OSWA 2QKAA 1OF0A 1CGUA 3FQTA 4PJ8A 3AC0A 3D85A 3RGHA 1CFSB 4HH9B 4NO5A 4XPFH 3KXFE 4AQAB 1A7BA 4NRZB 4EI5C 2BINA 1DQJB 3MV7A 2CBQA 2IH3A 3UAAA 1KB9J 4XTRD 3VXUE 1IBLB 3BPCB 4O4LB 1JWSA 1RI8A 1ANUA 2XA3A 4H1LH 5E00B 3QDGA 4MCNA 3RVXC 2QGNA 3QQNA 4PWGA 2Z93B 1T2XA 2XKNA 1I3RA 4K71C 1H3WM 3DSNA 3KHOA 4RMSA 2AQ2A 3OR7C 4O4JB 2GKIA 3D25A 3EH5B 5K1JA 1BMZA 2JXMA 2HJKA 3NJJA 1P1VA 3MUY1 3MLYL 4ZFZB 4GSDH 4IOFC 4DHLA 1VQ7V 4JM4H 3SJQC 1T89C 2VWEC 5DJ8B 3WFHA 1JF1B 1GIGH 3AACA 2ZCZA 5FO7A 5TF0A 2X42A 4HBCL 3SGEH 1GC1C 1U2HA 3KPPB 1SXZA 1FZJA 1M05A 1ZAGA 2IOIA 4HIJA 5JYLA 2IH1C 1KT2A 3RJOA 2R29H 1SDDB 2CHZA 1E4JA 1UA6H 1VDGA 2VDPL 1BVLA 3BJ91 3HN5A 4Z0XB 3RVTD 2ZUWA 1XF1A 4X6DF 3KYNB 1NA8A 1RZGA 3DX6B 4I1RA 4AYBA 3EG9B 5C7ZA 5FFLA 1CVSC 3IXTB 4DVBA 3HPLC 1OOAA 2P7TB 2V37A 3CS5A 5K9JH 4WJ5B 15C8L 4EPSA 2IJHA 2H8PA 3JD2A 2ALWA 5C07E 4Y1AA 4JYAO 2JQZA 4DV4B 4FQ2H 4OM1H 4HYOA 1RPKA 2ZF9A 2EO9A 3VFWB 3FT4A 1E3XA 3SE8H 1JX9A 1QR8A 3GIZL 1FPTL 4BAYA 1MCQA 3HZMA 1I8KA 2OCHA 2HLFC 3EJPA 5TQ2H 1BWWA 1FE8L 3MRFB 1BAFL 4WWOA 5DYOA 4PLJC 4F7EA 3QSKB 4NM8L 3O3DA 2F15A 3BISA 4Y2DC 3TA3C 1E5UI 1JI1A 3MLRL 4PJEA 4KKBC 4X1KA 3C90A 1WT5A 3B9AA 3ARVA 1U36A 4G7SB 4HS8L 5FOBB 2DYSB 4PJHB 4Q9BA 1X5ZA 1AROP 1U8CB 4K7FA 3NZ8B 4JRWA 2OL3A 5ANMA 4NX0A 4E0RA 1DANT 5DGRA 3EFFB 2VLLA 4WUKL 3S9DB 2R83A 2CA3A 1GKFA 3R1GL 2EYTB 5DZAA 3RTLA 2V2XA 3C09B 4B5EA 5SWSB 2R2BB 3HMWH 1PZSA 4PA3A 2DWXA 3ES6A 3STLA 2X10A 4FP8H 2I26N 2NY1B 1M9WA 3ARGD 2VJ8A 3VI4E 3S37L 1T5EA 4QO1A 4M8QB 1U3HA 4RBPH 4WV1A 3KPNA 2WOBA 4X0NA 2X4SA 1VF6A 5GHWH 4LCWB 4JYAB 5KHGA 3P9MA 5SWQA 1IZ3A 4LSUH 4JFDA 1AO7E 1SEBA 5B1NA 1BAGA 2A9AA 2F43G 1XWVA 3ETBF 3P32A 4NRYB 1D9KC 5EU5B 3MREA 4X4ZA 5KHHA 4DYLA 4DRXB 4AGOA 5IHZB 4GXUN 3H6AA 2HFGH 4OFPA 1NCIA 2DEXX 3A6CL 4IRZL 3K0GA 4KOCA 4G80B 4PJGB 5DD1L 1FWXA 3MAQA 3LKRA 4A6YB 2ZXCA 3DBXA 5C9KA 5DQJA 4LSVH 5BJTA 2W9DH 2VSMB 5AOZA 1YYLH 4R2GD 1KFGA 4TV8A 4PGCB 4P5KB 2NZ9D 4KTYA 4FADA 2H0EA 2W6JG 5I1AA 1X5IA 3JAKB 3IBOA 4LHUG 3QVNA 4FOMA 4ZO6A 3QGVA 4MYPA 5CLZA 4ELDA 3GXDA 2CUHA 3N6YA 5F7EH 3M8OL 3HS0C 4J3OF 4Y5YA 5CSZB 2Z91B 4WNQB 2H9GB 3ARBB 5F9OL 2VDNL 1MCFA 1NEZG 3GSXA 3LOWA 5GGVH 4CU7A 2C9VA 3GF8A 5DQ9A 2X3AA 3MV9B 4DJMA 4CA4A 1VQ4V 3NJGA 3QQ3A 4JYYA 2VMEA 2ZXBA 1LTXA 4WUUB 4HWBH 4Z8FL 5D70H 4YXKL 2QQQA 5SV3A 4W9ZA 1DLHB 2GUZB 1YEJL 2FGWH 1Y1UA 4O2AA 4LRNL 5GGTH 3E9UA 1AMXA 3ALWA 3K71A 2KZ1B 3N50A 2UWEB 3E3QC 2R51A 4YHLH 2N01B 3MUZ1 1X3DA 2JCCA 3QORA 3B9KC 4HPYH 5C0FB 4OFIA 3I74A 4LF9B 1NKRA 2QTOA 2ZNJA 1IFGA 2WP3T 2XV2A 3SPIA 4WWKB 1QRNA 2AEQH 2PTTA 3GDBA 4I3SH 1MH5A 3GXFA 3CC5B 3EGDB 5TTRA 2IV9A 1G7MB 3QR1A 4UB8Z 1X5KA 3LSQA 2C5DC 4BCYA 4KKLD 1ZSPA 4XWOC 5DS8A 5J11C 3KCPB 2JELL 2RH0A 4WI5A 1XB3A 4IRSC 1R73A 4I77L 1TSHA 2AABL 1F4MA 4MA8L 4JMNA 5JPNA 3TCXA 1GCYA 1G7HB 2VN6A 3MFFB 4HJIA 3GJFH 4PJXB 5E5MA 3T2NH 4Z5RB 3FK3A 3QXAB 2R1WA 5IEHA 2DI8A 3HLAA 5DD0H 4QRRB 3FB5C 3NFPA 4IL6Z 1OGAD 1YPZF 3LN5A 8FABB 4DP0X 2OPCA 4L1HA 5JIIA 3IJ8A 3TGXA 4JFFE 2ZG1A 5IWLC 4ZODA 3ZRSA 4QXTA 1M6OA 1KXVA 1H9DA 4UBDD 3TJPA 1Q1JH 1U8IB 3VRIA 1JHTB 1BIIB 1VQ6V 1HCZA 2JF1A 4HZ1A 3QUGA 4JPKL 3U48A 3V6FA 2BFVL 1BPLB 3ULSB 4MD5B 3QEGH 5TDOB 2Z5UA 1EXUB 3IWVA 4KKNA 3V7MA 3G7TA 4LPXA 2BDNL 4OD3H 4XGZA 3AITA 1TKWA 3T65A 4JHZA 1N64H 1QRKA 2XZCL 3BH4A 1WFUA 2R0WH 3KDMA 3L3OA 3PRZA 4N3UA 4FG6C 4Q14A 1UWFA 3RGVA 1B04A 2BVPA 2A3TA 1MJ7H 1T6VN 5DMKA 3GSNL 1PV0A 1B2YA 2MCG1 4WCEV 2CM5A 4YR6A 1SXNA 1TETL 3C5XA 2EDDA 1I1YA 3H3PH 3E2HC 5JPMA 1UUSA 5FECA 1CXLA 4P3CL 1SMOA 1EDQA 4UV7L 5E7BA 2YGNA 4O02A 1IGMH 3ERXA 5DHEA 3O6KH 4JRYB 1ID5I 5KMGA 3DX1A 3RDTB 4BZ2A 3ULVL 1JUFB 1YEGL 2OMWB 2C7UB 5JMRA 1AD9B 2EILC 4JAUA 2IANA 3QH3B 3IS1X 3BW9B 3RL2A 3GSQA 3GUFA 3BGMB 1YYMH 3M8AA 4BBWA 2DY2A 2NUPB 3E8GA 4NPKA 4BXVA 2ODMA 1M4KA 5E9AA 3VFGL 4HX1A 2HPOA 2PO6A 4U6HA 2EH7H 2Q9OA 3FT3A 3KPSB 1NIEA 5I71B 1A6AA 2AJZA 1RZ7L 2ADIA 3N0PB 1OM9A 4G6KH 4DUZO 4KRPB 4PV1C 1MQKH 2VZTA 2P26A 1DQVA 1IM3B 1ED3A 4R0LB 3SQRA 2IADB 4Z7VE 4AIZB 5IQMA 5BRZB 1S46A 3ASOB 2FH8A 1E6OL 2P44B 4MSWA 4PJAB 1AZRA 3IDJB 3C87A 2P43B 4GMSH 5DFTA 2PWFA 4P5TD 5C0BE 3F8UB 4XPFL 2WCSA 3Q0HA 4H4NA 3PP4L 3DVIA 3Q01A 4AX3A 2O61A 3OR6C 1AFVL 5BXZA 2ZNWA 1UACH 2NSQA 5JO5A 1YN6B 4IBYA 1CURA 2VR4A 3LX9A 3QUYC 5A2FA 2GY5A 5T3XH 4GNKB 4K7PY 1A7QL 3RWRD 1KCVL 4PJDA 4X6BA 4ATTA 4MMXB 2WXLA 1Y67A 3T4AC 3FO9B 1G7IA 2GUOA 4B0MB 4BFKA 1IE4A 2AF2A 4C56A 1R75A 4DR4O 1IL1A 3ZTJG 3DDGA 5CJXC 5I15H 3DJZA 4XX5A 3T77A 1AI6A 3WN5C 4OZFB 3LQAH 3TVMB 5ITFA 4J3UA 1VKXA 4OZHA 1QR9A 4LGPB 4LPCA 5I6XC 1DO6A 1CUOA 4DW2H 3IGUA 1ZXKA 1T4WA 2AV7A 2R29L 4GSUA 4M1GH 2N05A 2QQKH 1H8SA 1UA6L 3P73A 3U79A 1WAAE 4PDMA 2VWEE 1MCRA 4J3TA 4X5XA 1HXMB 4LARL 1WSST 3EH4B 4WW2F 3QI9C 3DPBB 4U1NA 3WMQA 4EN3D 1H19A 3IRZA 4IKNA 5I26A 2WN2A 1MLCA 3IVKA 1RM1C 2EIZB 3FTWA 1IQWL 3DGGB 4LVNB 1KEMH 2ATKA 4U0RC 1NCHA 1FCCA 4XODA 3QR2A 1BLNB 2XTAA 1HKLH 4GPVA 4K3JL 5E2UL 4Z7NB 1A0QL 1HHIA 3ZQ9A 1HH9A 1EAPB 5TQ2L 3KJ4C 4IU2A 2YAQA 2D9QB 1NCNA 5I2IB 3SJCC 1HHJB 4GI8A 3TBTA 3PWJA 4HK3N 2NXZB 3ZCCA 1XOUA 2J88L 1OCWH 1S0VA 1GM7A 4L3EB 3ZYIA 1YTFD 2V4DA 1RK0A 2LAAA 4QY8B 5C70A 1I8MA 2R9IA 4I2XE 4J1UB 4WJG3 3IAYA 2Y36L 3S5LA 1P7KA 3RWGB 5I75B 4YDLC 1KIUB 1CFQA 1MCEA 3WL9B 4GKSB 2Q8VA 4PUBL 5F9WC 4DZ8A 2VM4A 3TJEL 3DK2A 1FNEB 4FG2A 4JVWA 2FEEL 1NUNB 3PE9A 3HMWL 2DQFB 4IJ3B 4O4YL 1KULA 2D0FA 1BQSA 2YI9A 2FUTA 3FD9A 3VQMA 1GMGA 4X66O 1SXSA 1OAYL 3MVSA 5F7AA 4JQIL 3DGDA 4JFTA 5CEYA 3BZ4A 32C2B 5AUMA 1LO3H 1QVFU 2BE3A 1EEYB 2IWEA 1X5AA 4TSBH 2OYPA 5ABDE 3CVHA 4QLWA 3QEUA 1JFHA 3SQBB 3CQFA 1QA9B 2HFGL 1WP7A 1KB3A 1P7QA 4LCYB 3UCQA 3WJJA 4OIAA 3SY6A 3I2CH 4JHUA 4I85A 5INDB 4JY5H 4I18B 5LMUO 2YD2A 2W9DL 4PAZA 5IM7A 3KE0A 2QHLA 2MRYA 2PMZA 4OD2B 4JFHD 3BIBX 3EGSA 4EIZC 2W07A 1V8HA 1YN7A 1L9NA 1LYQA 2GSIB 2ICEA 1OCOC 3J27A 2VZVA 5C3IA 4F9PA 1WTLA 4WO4C 1MKFA 1QABA 2C9RA 2EEAA 1H0DA 3TO2B 3HE6A 2IPKB 4TVUA 2XASA 5F7MC 2GW5A 4P9OA 1FNSH 3G5YA 4PVNA 2ITDA 3QB7C 4QHUB 1BQ5A 1MJ8L 1T5XA 1UKQA 5FLVA 5IY5C 1CR9H 3ZE0F 1CB4A 2JJSC 2CLVB 3UTTD 4LDCA 1HR0B 4P46A 3DKHA 3U4AA 2WLZA 1CGXA 3PQYA 1OARH 5GRJH 4MZ2A 2QQNH 5D70L 5B1AB 2FEJA 5HHNB 4H5SA 1JMZA 4F8QA 1T03H 4UDTA 1T0NB 2FGWL 4FZ1A 3VXRE 5HGAB 1A2YB 4DKEH 4G6AD 4PB0H 4RDQF 1L0NH 1FL6A 4CJ0A 1X5GA 5J6GB 4F7TA 4LF6B 1SZXA 3D2UA 2CR3A 3IU4H 4RAVA 5LMUB 4X4ME 1FLRL 4HGKC 5FGBC 2AEQL 5CEZD 3BAAA 3AROA 2NY3C 1Y4MA 5HYEA 1BVZA 3DI3B 3R0MA 4YHNB 3HAEB 3TXQA 5K9QG 4PELA 3WB1A 2OTWB 3E3QE 3CX2A 3O6FC 4IRJA 1E4XH 1Q6UA 2ZX5A 2HEPA 2AAAA 5IG7B 3FAWA 4U0RB 1NINA 1QR4A 5J2TB 2E4FA 1BQHA 4GUPB 1ZSHA 4M3HA 1R3LB 1UZ8B 3ILQC 3G6AA 3ESPA 1N10A 1KLGB 4PJBF 2WK2A 3KCXA 3T2NL 3VFRB 1DTUA 1NFDE 1UT9A 2LOEA 5BQ7A 2WIIA 5DD0L 1QI5A 4A2HA 2ZUTA 3EFDH 4XNAA 3U4EB 1VQMV 3EHBB 3CHSA 3MRBA 2F93B 4RX4D 3K5NA 2Y1ZA 3BESR 3BZDA 3ULVC 3GD1C 1FXHA 1JTPA 2NNRA 2JKLA 1TJHH 4PLKC 4HLZH 5F89B 1ILUA 4WVRA 1LDSA 1INDH 4W70A 3DURB 2NN4A 3VUAA 4I4TB 1HTYA 4RCAA 2O1AA 4OZIA 2NQ3A 3SDDD 1YNTF 3L5IA 5CJQL 1S9XA 4DK1A 1T1ZA 2BY0A 2NYYC 1JXJA 2KPNA 2Z34A 5AVSB 4JKPL 3JASA 4ZBMA 2DIJA 3K74B 3N41B 5EORH 3D48R 2JWYA 3K2IA 3DK0A 3QRBA 3DIFA 4JM2F 4YY3B 4JKMA 3CSGA 2R0WL 4LASH 4LKCA 5DQDL 1RSOA 2A4EA 1X7TA 3BVNA 4Z7QF 4YH6A 5GGUA 4A2LA 1SLXA 2LQTA 3PGFH 4JDEB 4FCHA 1KACB 4XTRC 1DUZB 3ZDZB 4K15A 1BLIA 1L0PA 3KMDA 3RWHA 4BFIA 1WYJA 4Z76A 2J8OA 1SA0A 2VZSA 1IU1A 4JO2L 4UOJA 3TPUB 4F2FA 1BE3H 2AITA 3LPGA 4UNIA 1IGML 1KP3A 1M42A 5C9JA 3KH4A 1B0RA 2GJZA 3W82A 5DRXA 2IU3A 4NN7C 5I1GL 3QDJD 2DQCH 4FZ8L 4ZNEA 4KX9A 3QIWD 3CZLA 4KJWD 1BSIA 4ZMOA 5A2BA 4EBQH 2Z31A 3VQYA 1MHEA 4XP5L 5EF3A 5DZLA 1A32A 2G9HA 4H1LG 2QLVB 2OR7A 3A4FA 1YYML 2B1HL 1KJ3H 1RUPH 2N1TE 5GPRA 3V52L 5DM6V 5ISZD 1SETA 1EWHA 1OPGH 2WWKO 5I1CL 2XAHA 3WO3B 3E8FA 2X70A 4PRDA 5TE7H 4HCFA 3KGTA 5F7UA 3SIKA 4KROD 1SUHA 1R3KB 4I48B 1XEDA 4R8CA 2NYZA 3RVTC 1NI8A 2HKAA 2EIBA 3B9DA 2C9UA 2JIZG 4LOUD 4UB0L 1Z2GA 5E8OA 5BMFH 3SKMA 1IBFA 4XCNA 1D7CA 5J8OA 2VUYA 4BW5A 3HS8A 4DVRH 1I1AA 1G6UA 4JO3L 3FQUA 1G1KA 2GJ6A 5KVDH 1BFOA 3WELA 4G72B 2WLMA 2R0LH 1DVSA 4F7CA 4YLBA 3G5WA 4G1EA 4RBPK 4WTXA 3BCCH 4B3EA 3H1KH 3CX5K 1WBZA 3MJ6A 2Y48A 3VFUA 3OWEA 4Z77A 5IKCB 1LEIA 2MOVA 3QWOA 3N04A 1B0GB 2Z4TA 1N59B 2WM0A 4KH2A 4Y8AA 1Z32X 5DJAB 1DE4A 4F15C 4DKAA 4FNSA 4KVCH 3D69A 3WTUA 2XOKG 1ET8A 5I15L 1TQCC 1QPKA 4XNYH 4LLAA 1E5YA 3SO3C 2F7RA 3O2WL 3LQAL 2M83A 3FONB 4L9DA 1YUHA 4CVUA 5E5RB 1ETZA 3D3VD 4YGVB 1ODAA 1NGWA 1OQOA 1WCBB 1PYWB 3DUHA 4TQPA 5EC1B 2PXYA 4JFYB 3DLQR 1A5FH 2VDOL 1T4KA 1T1XB 3GXTA 4GQ9H 2WYZA 3UG3A 3WO4B 5AKSA 3ARGC 1E6JL 4YFDB 1ZL8B 1C12B 5DJ0B 4NENB 3V0FA 3OJVC 4BFOA 4G8EB 3EO9H 3BFRA 2QTVA 1N32B 5CSBA 4XH2A 4ZFGH 2IIJA 2Q2EB 2VDRL 4Y2OB 3AGWA 3MLUL 1ES0B 4FJ6A 4G7YL 3MV9D 1SHMA 5CBEB 2CSPA 2WTOA 1G6RL 3P3NA 1T20B 4PRBA 4WUUD 4NXMO 4JI6B 4Y7MA 5GS1C 1OALA 3CK0L 3IFPA 1TQSA 4EIGB 3NCYP 4AJYV 5EZLA 1SEQL 5D9SB 1OW0A 2W0PA 1RJLA 4WF7A 1CDCA 4Q0XH 2W60A 4UANA 4PRNA 2D3LA 3WIAA 2DQUH 5KSAB 5LWYL 3ZL2A 1VEMA 2BIPA 2XTJB 1Z3RA 4I0PC 4ABQA 3UC2A 5IB3A 5JORB 2EDTA 2N74A 1GGUA 1RJCA 4R2GC 4YFEA 3GINA 3KWXA 2NZ9C 2HT3D 3OZ9H 5IF0B 3ZN0A 1B9ZA 2YGOA 4YSDA 3VFSB 4FJCC 5DRNB 4LWSB 3L74H 1FXKA 3F58H 4QTHB 4LVEA 3D0AA 1UD4A 5EH1A 4HETA 2X6BA 2WC7A 4PI2A 2O6EA 4LKXB 4P2QA 2PCPA 3W7TA 2H6PA 4ZX6A 1TVKB 2IOOA 1WA8A 4PRHA 3U10A 4AJ0A 3HUJE 4YE4L 4QRRD 1JHLH 3GMPA 4XVUC 1AGEB 1NCGA 3CDGB 1LO3L 2BRRL 5AZUA 1Y07A 4NXMB 7TAAA 4LLDA 4G9FD 3A4DA 1F6FB 3MRMB 1S5LZ 1BZEA 2CGRL 3PWLA 4U1HB 4FXLA 3C5SA 4XMUA 2R0ZH 3CRAA 4BCXA 2ESVB 2GIYA 2K7PA 5PCYA 2O5ZH 3V7AG 2AK4D 5KAIZ 1B3QA 3NRQA 4ZPTA 1SF3A 4W9FC 3BVWA 4DV0O 1JPTL 1MFVA 5DXWA 5HYIA 3OB0K 4N8CH 3GM8A 3GBML 1E2WA 4M8UA 1TXKA 2WBWB 4KKLC 2DLFH 1IIKA 1GZQB 2F7OA 2VLME 3JVGA 1VQ9V 3N9GH 3P9LA 4RRPA 3RWFB 4MB4A 4P9HC 5T1LA 4KHTL 4H7VA 5I8OH 5JOEA 4ZPVB 4P06A 4GI6A 2GHWB 3TLRA 3MRPA 3J2PA 4TNWK 4ALAL 2F8IA 3T1WA 4XHJD 5KHJA 3WLBB 2E27L 1FNSL 1LMKA 3X1GA 1IE5A 5FHBH 3PDOB 1UTDA 2HJDA 1E4KC 3BEVB 3FQWA 1QX1A 5DYFA 2Q8AH 3QBTB 2MEJB 5H37A 2IMNA 4ENED 1EN4A 2WBJA 3PL6D 3UDWA 2NXYB 2W0FA 4F6RB 1BM7A 5GRJL 5MEND 2CRMA 3L54A 3LDDA 3MQIA 4MTGA 1JZEA 4DR6O 1B3IA 1KGXA 4JHBA 4M7ZB 1E9QA 2BNRA 2Y7SA 3KYOA 4YFLF 1HDMB 4LNRB 2RFXA 4OZ4B 2OZ4H 3DXAE 4GH7B 5IT2L 4NN5B 3CD6V 1XT5A 4KRPD 4UNUA 3IMVA 5AVQB 3JVFC 4WENB 4DV0B 2CAZC 1FVDB 3PUCA 4NP9A 1R5IA 1ZMYA 4AEHL 3PHSA 2AZUA 2PYFB 1JQ0A 4M03A 5M94B 2E7BA 4PGZA 2YD8A 4JHWL 4ODHL 4PS7A 1ZANH 2ZUQC 2MW2B 3PXHA 4U1LB 4V1DD 2Y6TE 3HZVA 2DYRC 1B9KA 3QZOA 4A68A 4JDVB 3P4LA 1BJ1H 1XB6A 1L6ZA 2EO1A 2WPGA 5F97E 1JS4A 1LO5A 1OAXH 4RFEA 4C83B 1AYOA 2BVTA 3E1ZA 4RO2A 3KPRA 1MN4A 2B5IC 4ODWA 5CWSB 2G38A 5IVXE 5IIEA 4N25A 5C0GB 4M29A 4YSEA 3KDPB 2ZT9B 1K8DB 3CXDH 3GRWA 1S7UA 3MRQA 4WNSA 5EO1B 1VCAA 4R96A 5H4ZA 3EDFA 4ABUA 1N0NA 3MJ8A 4LH6A 4LDOB 1PD0A 4OGZA 1FL5B 5C0AB 5MI0C 4QYOB 4ACPA 4J4PC 4XXCC 4FQCL 3VD1A 2HVKB 4H0LB 4OR1A 1NDGA 1R6KA 3L72H 4X6EB 1PG7H 3ESNA 4RGNE 5BVJA 2W65B 1DBKL 2A6DA 3X3GH 4JI2O 3Q5TA 2R39A 5EORL 1GOHA 3S35L 1MDAA 1G1CA 2VMDA 5K1PA 3AMKA 4D7PA 3FFCA 2VKXA 1Q9WB 5D1XD 3H3KA 1MWAH 3PWPA 4P5TC 4KO6A 2EC8A 4KJPD 1UJ3B 4B41A 2HVJB 3QDAA 1VGKA 3LQZB 2FZ3B 1VF7A 3PGFL 3HRPA 2H2PD 1Y1DA 1J1PL 2XXCB 3BSGA 4U7MA 4UTBA 5DZ9A 2IDTA 1WZ1L 5D93B 5LAPA 3KXFA 3WFVA 1TZ8A 1WAEA 1YPZB 2BWDA 3FT9A 3N44F 4N0UB 4RNRB 3DO3A 4W6YB 4YDJA 4DP8X 3VXUA 1YECL 2DQCL 4J2XA 4Q97A 5FDWA 3SE4A 4D7TA 5KYNA 4JY6A 2MTPA 4MZRA 4EBQL 4J2QA 5KVMC 1CGWA 3BN9D 2NXZD 4QNPF 1OSPH 5LB1A 3ZE2E 4GAGH 2WUCL 1K2DB 1TYEB 2ZE6A 1Q5OA 1YCSA 1OPGL 3OAYH 3J7AU 4DPBX 3P30A 3GI8L 2YIDA 3G6JE 3UTQA 4D9LL 2P06A 3N2KB 2BOBB 1S7QA 5ADPH 3VH8B 2FJUB 3TFBA 5I66B 3SQOL 4Q6IC 1HOCA 3Q8EA 5E0FA 2AEIT 5J3HC 4JI2B 4AITA 2WLIB 4GO6B 1BVKB 2ZAIA 4PJIF 3KPOA 2CTWA 5I17B 1NMCC 4IYHA 3MODH 5FCUH 2NUTB 2W80C 1NCDL 5KOMC 4A7SA 3PWVA 2P28B 4UM8B 4YBLC 2FTKA 1FAIL 4CH4A 4M3KB 3TZVB 1E4HA 3AAZA 4GOSA 3BPZA 3ILPB 4X8JB 1ZT7A 3ABTA 3D18B 4K3GA 4O2EA 1SFDA 4ZUVB 2BHZA 3JD1A 4ELKA 4QRPD 1ZT1A 3ZO0A 4P57B 2BH0A 3L7EA 4BFRA 4U7OA 1EUUA 2B8OT 1C08B 4PGDA 4UUJA 5C07A 1X44A 2NW3B 5KYXB 3UBXB 1CBVL 1T5KA 4JREC 4E68A 1WF5A 1RPUA 3H9ZA 4QLRA 4LHQB 3CWGA 3MBEA 5K9KA 1J05A 1V3MA 4FI6A 3ISYA 1PEWA 3FFOA 2WOYA 3DPDA 1H2KA 4XNYL 4ADJA 3BIKA 3UZQB 2V5SA 3AG2B 2VXQA 4XNUH 3A0HZ 1OWWA 4YHYC 3OSVA 4Z3GA 2Z35A 1I7ZB 4FTVB 3GQFA 5AKTA 4NM4L 2DOCA 2X4OA 1OQXA 5DRZA 2APSA 3WY1A 2X7LB 2J5LC 4J3WA 3VQ1C 2IGFL 4ZFOB 2X0WA 1MPAH 2LE9A 4N21A 4F8LA 4GQ9L 2A5UA 3W39A 1PZ5B 1CFTB 3CLEH 3FT2B 2FO4B 2R23B 3MAWA 5AW4B 3EO9L 1MRCL 2X89A 1FFOB 1CI3M 5HYJB 3DO4A 4X5PA 4HIIA 3QIBC 4ZFGL 3LPPA 2YJLA 3VI4A 4FLOA 3EF4A 4HK0B 5FO2A 2APVA 1ZV9A 4Y4KA 3MV7B 2A38A 3IMUA 2NR6D 1AZZC 4UTAL 3I56V 3FUKA 4WW1A 3WIHH 1AO7A 1X59A 4QUOA 3I3EA 2CLZB 5E95B 2LFGA 5F3BA 1YEKL 2A73A 1KCBA 2Y07H 3B7SA 3RB7A 3T6WA 5BXFB 5C8JA 2CO2A 3P77A 3UAFA 5H6QA 4HC1A 4X83A 4WTZG 4ZTPH 3X2QB 1I8IA 4BUQA 1A1OA 1MA1A 1D6EA 2BXYA 5IROA 5L4JA 1JA8A 4QPEA 1M71A 1ROWA 1KENH 3HHRB 4N0FB 3T3MF 1WZMA 5J0BA 3DTDA 3TEYA 3KGSA 3IJ7A 3L1EA 1KNOA 1N9PA 1TO5A 2GJJA 1MCWW 2DM2A 4TOYH 3BP5A 3EO1B 1EXHA 2R72A 3W2DH 5CLTA 4LNUB 3STBA 1J9QA 4GAAA 5DDHA 4DR2O 1JDCA 4F80A 1A7PL 2ZXGA 2W95A 4BH8B 5I1EH 2PP7A 4CW1A 4JZNB 1K3EA 4MQXC 4LSTL 4YHPB 4TVPH 4A39A 4ALAC 2COQA 2XVGA 2ICCA 4U1JA 1G4RA 3OHXA 1QFHA 5EN2B 3KBEA 2V4LA 4YHZH 2B1AL 2QWRB 2J56A 7CGTA 1R0AH 1JRHH 1YHQV 4G6AC 2H94A 5D7IE 2ZYHA 1H5BA 1FLTX 2R0ZL 5BRPA 4BKLB 4I9XA 1HE7A 3RKDD 3DX4A 4GT0A 3JWDH 5DHVA 2QQLL 4BYHA 5IVOA 1W59A 3IDXH 3LNFA 3FQRA 4HDIA 1MCLA 1XGRA 1ND0B 2L8AA 2Z6FA 4CRPA 1DBJH 2UXCB 4J3VA 1AHKA 1XD1A 4KOBA 3OKNA 4N8CL 3DHMA 1FXVA 1OT4A 4BWAA 4OLVH 3ULUF 1MZFA 4XOBA 4WU5A 3F00A 5AZ2H 3N9GL 2XETA 2WVVB 4BIOA 3WTVA 1GAXA 2XY1A 1J0YA 3FQ2A 4TPRL 2NY5H 4PP2B 1QBML 4R4BA 2L3BA 1CE1L 4BRJA 4FK5C 4DR2B 4HIPA 2BNQD 5AFAA 2FJSA 2JGDB 4E41D 2Z92A 2V2XB 5GSVA 3ZJAA 5JVDA 1UB6A 3QNZB 1KYAA 2CU9A 2BLFA 3LKSA 1PQZA 4CC4A 3MRHA 3S96B 5IW6B 3G5XA 3RYCA 3MRNA 3N40F 3JSSA 1K7DA 1ZPLA 2IFGA 5KANG 3ZMTA 4NJAL 5C09E 4LF3B 1KYOJ 5DD6A 2WO2B 2O6CA 3O8XA 4JFFA 2E5LO 4G5AA 1DBBL 3JV0A 5IDJA 4YHKL 1OGAE 3SDDC 3M1OA 1DBML 3E6FA 3O4LE 1KBWA 4I5SA 4JR9H 2BZCA 4PJ5D 4NZRL 3S48A 3CN0A 3LNNA 4L4TD 3U1QA 3S34H 3VXMB 4HLZG 5E8DL 5DRWB 4AMKH 4KZEL 1LP9E 3PG2A 5DGQA 1MCBA 5EIIA 1ITBB 2B2XH 2DLEA 2J6EH 3LKRB 4I9WE 3UZVA 2IO5A 4D9RD 2QKIC 3MLWH 2VDKB 1NGQH 2G3XA 3NSCA 2FNBA 4GRMB 4M61B 5A6MA 2X5PA 1Q0YH 2D9CA 3RNQA 1FFPA 2XWBB 3HG5A 1KGIA 2BIOA 1W15A 3MLVH 3RWDA 1FPOA 1FGVH 4BH7B 1MY5A 4HMCA 5KYWB 3ZE0B 2ZWLT 5JUEH 1MZYA 4D7SA 3BDBA 1OAXL 4DV6B 4FNQA 3SBWA 1Q43A 1HHHB 1UA7A 3KVQA 4KJWC 4OSUL 4YDKH 1XGUA 3MRRB 5EOCH 2Q2LA 1F02I 1UWXH 2CHDA 3L7FA 5D1ZI 1A6UH 5H8DA 3FXIC 1HJCA 2JS3A 4N2AA 4XN4A 1S3JA 2AV1A 1CXEA 2VDLH 1E28B 2XX1A 3QZWB 2NQDA 1XR9A 3L4VA 4J3BA 5HGBB 1HNXB 1W6WA 3VRJA 4KROC 4N90D 5DLML 5IFAH 2LU7A 3PUUA 5LDUA 2AJXL 5F7YC 5KW9H 3FU0A 3FYIB 4L5FL 5INCA 3VI3B 1L5GB 3EJZC 3H1ZA 4LOUC 5AVXB 3X3GL 5L8LB 3D4ZA 1JJ2U 2HFEB 5L8JB 4U05A 2Z1KA 4B7IA 2MHAB 3TURA 5ITBL 4AGMA 4DO2A 2E7MA 3EBGA 4HCRA 4Z7VA 1Q90D 5J13B 3B2DC 2R69H 4QEGA 2Z8SA 3WHXA 1PLGH 4PJBB 3GHBH 5I24A 2OMXB 2PYEB 5KAQF 5JDSA 4DCQA 1H6EA 2QVTA 2BCCH 5C0BA 3RDTC 1WP6A 1H3XA 4LPTA 3BD3A 2V2WA 3BWUC 1I7FA 3ECUA 3FU7B 2CK3G 3B3BA 2UXDO 4IKJA 4HJUA 4FERA 5JW4N 1NCCL 2YFNA 4AYDC 4QHNA 1EX0A 4JPRA 4NQEE 4UZSA 4YJ3A 1JCVA 1DSFL 4X7TA 4KVNH 3NJIA 3ZL1A 3K6SA 1BBJA 1OSPL 3BPNB 3QZNA 4NZUH 4BSWA 4J11A 3BH8B 2XRAH 1YNTB 1T7ZA 1UVQB 2XTJD 3QFDB 3AABA 2X44D 4X9IA 3HKEA 1FYJA 2NZ1A 3DJ9A 3PF2A 1HP8A 1CL7I 3HKCB 1USZA 4JM2B 2BP5M 4NKIL 3T0ED 4APXA 2NW2A 5F44A 4ZBJA 3EYOB 5EFIB 1FFQA 1PX4A 1ILSA 3WI9A 4Z7QB 5KOVC 2ILMA 1SXAA 1G9NL 1BIHA 3MODL 4XPBL 3OR7A 5FCUL 3T4ZA 1QEWA 2IAMB 1UM6H 3ARBC 1KG0A 3NIGF 3RL1A 5HPMA 4O5LL 3UT5B 4GW4A 4UB6Z 4BGDA 2EC9U 2Z0UA 5GXBB 3IDYC 5LXVA 4PJCF 1WAAA 1K5SA 3PPSA 5AVVB 5EZYB 3WFBH 3RGVB 3MLZL 3AXLA 4OBSA 3W5MA 3HNSH 1FVCA 3MR9B 4FPPA 1O5PA 4DO5A 4QRTB 1JNNH 1E27B 1D5BA 2RMNA 2IH1A 2YC1A 3HC3L 5FGSA 3B2PA 4JAMB 4KXAA 4JYBA 4ZAKB 5I74C 3U6RA 4F6EA 1JXDA 2XDHA 3O6LH 2D7TL 4D6TH 1DCEA 3QCVL 5LAXA 1EGJL 4LCCC 2Q86B 2D7PA 4MS8D 3RIFK 3P11H 3AU1A 3TF4A 4X62O 1DVZA 3HPLA 2PP9A 3M7OA 1K73W 3N85L 4WWKC 3K8LA 4H40A 3TONA 3KKYA 4UNTA 5T3ZL 2YZ8A 4FQ1L 3V2AR 3HPJB 3F04A 2VISB 1IAKB 1CLVA 1PS3A 1NBVH 2AZ2A 3MCKB 5IBTL 1A6TA 4I2XA 4GKZB 1JPXA 3QQ9C 4HGMA 3BP4A 2ADIB 4GXVL 3LIZL 1EBAA 1TT6A 4YXLH 1JGUL 1UA3A 1FN4A 3CVCA 5L88H 4Y2DA 3TA3A 1OGSA 1JCKA 1B4RA 4PWIA 1WPBA 5C0EB 4PR5A 1PKQE 4JG1H 2HG5B 4K7PL 4N2DA 4N1CA 4QI3A 3ARDA 2YWZA 3BQVA 4HSAC 2NXYD 1S5IH 1QUNB 2RACA 1WQVT 1BS3A 3T4YB 5IGXH 1IV8A 4UDUA 1WDAA 5JO5B 4LSRL 1TYJA 4LVHB 1EO5A 4KUMA 2EECA 2OJEB 1U58B 2YEQA 3AB0C 3BAYA 3WIHL 1NPNA 5AW0B 2UY7A 2VXSL 4YEEA 4X62B 2QEXV 4GKKO 1AR1B 1PX8A 4LO9A 1ZA6A 3OD4A 1OD9A 3D09A 4DGUA 3T1HO 5F7HA 1QATA 2WLYA 3V0VA 1F56A 2BFGA 3ARFB 3C6EA 3QUKA 1BQ0A 1AP2B 1JZIA 2LFEA 2XSKA 4EN2A 1QR1A 2X4PA 1E2VA 2XPGB 4UT7L 1NU1H 4J8RB 1DYZA 4HULB 3KPQA 1AC0A 4OCWH 1J9SA 4W68A 4H8VA 2AQSA 3FUJA 2YD7A 4BIKA 1HU8A 3LSOB 4OZHB 4J3OD 5DTFB 4L8JA 1ONQB 4EDXA 2AV7B 4F37K 5H2FZ 1J1XH 3RX5A 4NHUB 4JFHE 4DV5O 3KWVA 4K23H 2WGXA 5I1EL 1N0XH 3OAUH 2IPTL 2BSTA 4N5ED 4UQCA 1JVKA 4HH8A 3PL6C 4JN1L 4XB3A 4O4IA 1LLAA 2KS0A 4URTB 3TBSB 4BELD 4DEUA 4U1NB 4PCYA 1T3FA 2YRPA 2A3QA 2P80A 5CAYB 4U1KB 4B7EA 1C9SA 4JTCB 5DEZA 1MJJA 2HP4A 5F3HA 3TJHD 2EIJB 1XF4B 3MCG1 3VWJB 3O9WD 3ZRWB 1EO8L 3S2CA 4GKKB 1PSKH 2JFCA 4KI1A 4KRPC 3LS4L 3UTTE 5HYQA 4AHCA 2DTSA 3HS0A 4XRCA 5B4MC 1K72A 2CJ3A 3WB2A 3VXRA 4KMTL 1OGTA 4NZTH 4XPGL 4W9CC 3RVWC 5E5LA 3ASOC 5GRVL 1DBJL 3GB7C 3LAFA 2Y3AA 1NANH 1S3RA 2WPDG 4IBVA 3CRQA 2BCKB 2JI3A 3KYMA 3FU3A 5EZPA 5K59F 2PPCA 2ZQKA 4X4MA 4B7LA 4ANWA 5FPRA 1E2ZA 1HSAA 1QTYT 5FKAA 5AZ2L 5IJVA 5GGSB 1JFQH 3BCFA 1D6VL 3W11D 5CIPB 4DXWA 4D2NA 1M9NA 1P7KB 2PR4H 5DVNA 5FYKH 1XQ8A 2H32A 1CFQB 1NC2A 2EIDA 1NGPL 1SBSH 4XX1E 1V55B 2Z8RA 3FW6A 3B9KA 4EI0A 2BVOB 1P84J 4DZ8B 1FFXB 2G30A 4MMXC 1UT2A 2GC7C 5EUOF 4P3DB 3MRDA 3FN3A 1RZKL 1XILA 2NNAB 3QZLA 3OKEA 1NFDA 1VFUA 4K3DH 2ZD0A 4PRPD 4O9HH 1PMYA 2LU3A 5CGTA 3LSSA 3JARA 2VRKA 1F4WH 3TVMC 3T8XA 1LGVA 2ZZUT 4WHYH 4IRSA 3CMGA 4MDIB 5D7LB 1NC4D 2X4TB 2Y69C 3K6FA 4KTEL 4JR9L 4QKTA 2YA1A 2GAZB 1A3RH 2VR6A 3QEUB 4TNFA 3V6BR 3KZIZ 1P9MC 2CGYA 3CFEB 2FJHA 2VL5A 5D1XC 1HL8A 3IU3A 3FB5A 1XF2B 2ED6A 2HUEA 2I9TB 2X4NB 3MOBH 3JTTB 1MG1A 4KJPC 4KVPA 5F0PB 3M17B 4HWUA 4LEBA 4LRIC 4ODSL 1AGDA 1EAOA 3QO0B 4RRPM 2B2XL 4P5MA 1CT8A 3HZKA 4XVTH 2VXTL 3TZVD 1KPUB 2ZCEA 2MNWA 2LO1A 4PY8I 4ETYA 2X0LA 2XWZA 4L37B 4LVNC 1OF2A 2ZOKB 1NIBA 1YEIL 2D4FA 2M2DA 3CN2A 5CR1A 2FWLB 2IG2H 4WKZA 2XV3A 4I0KA 2ZCHL 3T9WA 1RKRA 5CINL 4NTYA 1A25A 1NBCA 1R3JA 3FQNA 3H4FA 1MELA 2UXTA 1GM8A 2B9ZA 4WFAV 3AK3A 1MZZA 1J5EO 2DPKA 3F5TA 3BN9C 4MXQD 2CK0H 2NXZC 5ESQA 3ZZ1A 1LE9A 1GRJA 1GPOL 3HC2A 1JYVA 4TXVB 1T5XB 1Z5WA 2OYQA 4UIMA 3U9PH 3A47A 5HVFB 4HJ0D 1FRGH 2P8MA 3TN0A 2YBRA 3QPXL 1OWRM 4OXSA 1QNZL 2WKLA 3HBPA 3UAJD 3PQYB 4EVNB 3JV5A 3VQXA 4NUMA 5I75C 5LBQA 5ICZA 3A8TA 4M8VA 3TESA 1AI1H 1FSKB 4H44C 5KW9L 1KFAH 2EYSA 4WFFE 4HKXB 1OE3A 4N2BA 1GGCH 4AEIH 4Y5XC 3O41A 1JNLH 4Y5VB 2Q7GA 1A1NA 4IKIA 3X12B 3UGUA 2NYKA 4IJ3C 3DXRA 1PFCA 3EJJX 4PJHE 5ETUB 4Z18A 3TH3T 3GUTA 1KN2L 4XBEL 1W72B 2XV0A 3FAXA 1DDHB 5FA3B 5TF1H 1D2DA 4L29B 4S1SH 2O5NA 3IEAA 4YQXH 3EOTH 1GVIA 2X4RA 1MCDA 4QAMB 2R69L 1ZJBA 3GHBL 4AIXA 4I0XA 2OQJA 1U3ZA 5SWZD 2YK1H 4OM0L 1ASPA 3EJUA 2NMSA 5DFVD 3WNPA 4LCWE 3WN6A 5GRYA 1YC7A 3DA0A 4F1SA 1DBAL 2VQ1B 4JI7O 3NSDA 4YAQB 2XWTB 4MDJA 3G6DL 4YVUA 1VHPA 2ID5A 1CQYA 3C8KA 2MFNA 4FQJL 3L3IB 3OR6A 4NQUA 1ITCA 2ZIMA 2WXQA 3WTXA 4KKAD 2MJWA 1H3VA 3QUYA 4NP4H 1WC7B 1TLKA 2I7SA 2FBJL 2YKLH 3QG6B 4PJGE 2GTWA 5ENWB 3MO1B 3RWCA 5B21A 3VFMB 3OBAA 3T4AA 2XZAH 3Q8AA 4PTTB 1S9VB 3AUWB 2OR8A 4HKBA 1QQDA 1U8OB 3OXSA 1G9MH 4CL7A 1PGRB 4AVKA 2CKBB 3AS0A 1LK2A 5DLLA 2I32A 2DQ3A 3N44B 1MRFH 3RPIB 3WN5A 3WFBL 4FCAA 3B2MA 3FO1B 4HS3A 3U30B 3CV5A 3WE1A 3MC0A 5B39G 1C5CL 4EQ2A 2NR6C 1FJGO 4ZHQB 2J8UF 3R19A 4X7SL 2AHYA 4XCEB 4EFEA 5D6DC 4HS6B 4HG4J 4LDEB 2J1ZA 3WTSA 3TYFB 4RZKA 4JI7B 3NYKA 1B0RB 3MV9E 1UJWB 3K6DA 2MTAA 4ZO8A 1KLFA 4WUUE 2VR7A 3HCVA 5FF6B 1NGXB 2HWZH 5ID0A 1NCOA 5J1AB 5DK0A 1N5YH 4OD1H 2OL3H 4X6FB 3VQWA 1QVOB 3QXDB 3NEEA 4PJIB 2UWEE 1KCSL 2NNCA 2OULB 3C5JB 3P2BA 4N8PA 5A1AA 1AJPA 3MNZA 4ODTL 3UTPE 2QDWA 4JLRA 1Z9SA 3HG0A 1R3LC 3DUUA 3LN4B 3Q2VA 1QWHA 5D7JD 5L88L 3DWTA 2D31B 1CYXA 3NJVA 4BCZA 1XF3B 1XL4A 3GMRA 1GW0A 5E4IA 3PS6A 1AR2A 2WB1A 3LYRA 4PV9A 1T22A 3LDCA 4IRZA 1IEBB 2QDOA 1A8JH 4CDHA 2FB5A 1F23A 4QGYA 3BKCH 3U0TA 1ZV5A 3HUJA 1GKEA 5C3TA 4PJXE 1WZLA 4AM0B 4BR6A 2XWJB 3VD7A 1GHFH 4JPWL 1CDGA 4G1MB 3RKDC 4QRRE 4OLWL 5DFWH 2IDSA 1QLEB 5JHDD 4C4BA 4Z6AT 5KBLA 3DTUB 4Z77B 2KG7B 2GJRA 5C7XH 2WGNB 5T3XD 5MEOB 1RUML 3CBJB 1MG2C 3MMEB 4PBDA 3HI1A 4MVUA 1V5JA 2EKJA 2HYMA 3IJSB 2J43A 4TV3A 4FE9A 4DQOH 3KEHA 4BSJA 3LS5L 1KXHA 4JO1L 5KEZA 1A9BA 4UQ3B 1CMOA 3PHOA 3PP3K 3KM2A 1XGYL 3H4HA 3GDCA 5ELIA 6PAZA 5JIQA 5EB9A 1YVLA 4DPCX 4RQQA 4A7GA 5CJOH 2G9KA 3OZLA 1N3NA 1KBHA 3VU1A 2XBDA 2KZWA 4OF8A 2CNYA 1QSFB 4NS0A 5AKVA 1IM9B 2PYLA 1NTKH 3C5ZB 3LV3B 4GG8A 4YXWG 1RV6X 4BHUI 4DPAX 1HXYA 2W9EL 4J27A 3CSBA 4PREA 4J39A 5CBHA 1QOKA 5E9DD 3L3DB 5EO9B 5IJ9B 4IBLT 2R2EB 2AQ3A 4E5XA 1RZKC 3QJOA 3BVUA 4HWZB 4MCYB 4JRYE 4WO4A 1PKOA 3JWNE 1R3KC 1OT1A 3ARRA 4GBXB 4KK8C 3FH8A 2FT7A 3UJIH 2VRAA 1F7YA 3L4YA 3R8QA 2F74B 1IGYA 2DH3A 4HISA 4NAQA 4AC2A 2W88A 1S9KC 1RJLB 4XCYB 4DAGH 3DXAA 2OCFD 1CO1A 3IDNB 2JJSA 1RIVL 4MCZA 1T0OA 2XTSA 3OWRA 1P5VA 1LVEA 3KPSE 4KAQH 1CTNA 5DEGB 1BG9A 4OV5B 2QPFA 2J57A 2Q7YA 2OMVB 3CZNA 3EJYD 1ECYA 1N12A 2OZNA 3TCUA 5BRZE 4QNHB 2PR4L 3CCLV 3PWNB 3PJSB 4G7VH 4IHBA 4CVWA 3TL5A 2OFQA 4PJAE 2FAUA 1JWUA 2QM8A 4X0KB 3WNNA 3ETQA 5FGBA 2CJUH 1MIMH 3K2UL 4ZD3H 4F33B 1AHWB 1QFWI 5EBWB 3VA2C 2A4CA 4MNQB 2A77H 2G2NA 4DUXA 5IVXA 2IGTA 4AH2B 4WBNB 1EAQA 2CBTA 5BMVB 3O6FA 3O6MH 1F4WL 5ESAA 4DGIL 1Q9KA 5BY1A 4JHAL 3VXNA 5TGBB 4Y9GA 5DC4B 3PAZA 2O57A 2BVQA 1AGFB 4I4WB 4JANA 1A3RL 5F88B 2CG9X 5FKPA 1OAUH 3WO4C 2H7WA 1GSMA 1BMFG 3VRLE 2YPKA 3CVIH 3P0YL 4L8BB 4XBFA 1I7RA 3SBQA 2XFXB 1OB1B 1XCXA 2IAMD 3M86A 4DP9X 1ZCRA 2P48B 2QLYA 1SZTA 1NDTA 4ORZC 1INEL 4YL4A 3UTZA 3LEXA 4XDLA 4O02H 2X3CA 3G80A 3G5ZB 2OSYA 3IB4A 4GRWH 1LWJA 4BZ2H 3O0LA 3H0TB 4HXAL 3N3EA 3LRSA 2DWYA 1FFTB 3KJ6H 1AQKL 4L5FE 3VQ2C 3BPLB 3I50H 3ZIMA 3QG7L 3ZYZA 2WXOA 4FEIA 5KSAC 1XD0A 2H3XC 4AYFB 1ACYH 4TT3G 1N7MH 4PRAB 4UU9B 2XTJC 3LXAA 4HV8A 4YOKA 2DQHH 5JZ7D 3C3SA 3GLAA 3QJFB 1XH0A 3U9UB 2JKSA 4Z7NE 4B9GA 5IW1A 5TPWL 4AGPA 4U1MB 3NRFA 4OCLC 2NY0D 3KH3A 1JK9B 2Q4PA 3LKOB 1KFAL 3QYCA 1JNLL 4L3EE 3G6JA 4G8FA 3S4SA 5FOJA 2LGQA 1AACA 4YL9A 1YEHH 4PD4J 3VRLF 3ZT6A 3ARZA 1W9XA 5AZEH 4G8GD 4FG4A 1FH5L 4BA0A 1UURA 4YQXL 1UM4H 5F0LB 3B8SA 4MKMA 1ETJA 3C6SA 3VB8A 1GN6A 1YQ2A 1KJVB 3IN0A 3ARTA 3UIZA 4EUPB 5LKNA 1IBBA 1S7RA 4FYTA 2YK1L 3A6OA 3CHOA 4MS8C 4KDVA 4X89A 4E2OA 3M1BB 5EEXA 4YX2L 1C5DB 3NCJL 3FRPB 3MX0A 2VQEO 3EF7A 4UM9A 1ZHNA 1AR1D 5CGYD 1Y74A 2DD8L 4QRPE 1P2CA 1K9MW 3T2QA 4HF5H 4Z9KB 5AW2B 5KSUA 1FDLH 3SKUD 5CS7A 3ASNB 1BQZA 1H3TA 2JK5B 1S7UB 3CHQA 2FIKB 2ZIDA 3STZB 2X1XR 2EX3A 1LMIA 2JIXD 3S8FB 4B3RO 2BSDA 4RZCB 3VD4A 4XBPB 4PP1D 4JFOA 3AG7A 2YQGA 3GSRA 4PSPA 1RAMA 2AJSL 2GEEA 2BIMA 4X8AA 1S3KL 3QPQC 4U3SA 1HYRC 2BSEA 3VM7A 2WY3B 4KNQA 3SGDH 1JVOA 1PCXA 2C1OB 2YEZA 4H25A 2A6DB 2C3XA 4L8SB 4OIIL 3K5LA 3N43F 4HKZB 1G9ML 5JNYB 5TDNA 3FU9A 3ATEA 5T3ZE 5T1MB 1J1OH 4JFQB 4I55B 2NXYC 4TQIA 4M1DL 4DP4X 4WCYH 2O72A 2VSKB 4Q9QH 5BNXD 3V0DA 3BSZL 2QR4A 3L81A 4EDWL 2JJUA 4PGBA 2BSCA 4M7ZC 1VQKV 1F4YH 4LZKA 2L0DA 2YRZA 4NQXA 3ARGA 1QBAA 2XT1B 1VLXA 2VW7A 3VXUB 1WTGT 1RPQA 2N59A 3IPFA 2UUCB 3JD4A 3OMNB 4ODBD 4QRQA 4GRWF 4X7FC 3QWRD 1X7SA 2OL3L 3PGCB 2LU4A 4K94C 3FTXA 3I6SA 1VAHA 1U3NA 2OTUA 3O3BA 1P84F 1KBPA 2NNUA 2DQJH 3DX0A 4YPJA 4JQIA 4NO0D 4J3OC 2CHNA 2BTQB 5GS1A 5I19L 1JE6A 2XPZA 3IFLH 2V7QG 1JOYA 4PJCB 4DW1A 2DWEC 3US0A 1BYPA 4JFED 4FLRA 1TJGH 2GBOA 3LZNA 4N5EC 1WBXA 1S7VB 1UKSA 3MV8D 3QNYA 2ZT9C 4I0PA 4XNMA 3AY4C 1SQ2N 3X11A 2A7BA 2G2PA 2E4TA 5D72H 1EPFA 4NWTH 3F01A 3CVHH 1COWG 1TZGH 3BQUA 3IKCA 1AQMA 1JPST 3LIUA 4G42A 2Q76A 3PAUA 1KCUL 4PA6A 2FECI 1TZHA 5KBNC 1GHFL 4H0LC 3ZGHA 1S7SA 4AYGA 5D7LD 5D7KD 1H9VA 5JW5B 3MJ7A 3SPVA 2IPUK 1RMFH 5D7IA 4Z1PA 5IEKB 1Y0LB 2BS8A 2QVFB 2VDKL 3JUZA 4L0YA 4N2KA 5EZOH 3RGBA 2A9NL 2LU5A 5EBMB 3TBYA 43C9A 3O2VH 2E9JA 3T09A 3DV6A 2BWIA 3ZMUA 1YCIA 2B59B 2C9XA 4ONFH 3PYCA 1ORQB 1YHPA 2Y7MA 5AW9B 3B5TA 3W0WB 5IFHL 5AYUH 3W11C 3AJ7A 3ZTDC 3AADB 5FGCE 3PGDA 5AENA 3MBXL 3BUBA 3AFLA 3ZRXA 4Q2ZA 2EEFA 3L1FA 3VXSB 3HMXL 1YY9D 1OP9A 4LSQH 4TRPH 1MREH 4FQQA 3B2EE 1RZJL 4NQCB 4Y9CA 4N8VA 3L9EA 4YK4B 1JV5A 1YZZA 1TG8A 4H20L 4PJFF 3ZDZE 3WEMA 4LCIH 4L8CB 2IJIA 1AS7A 1FS0G 1FBIH 2ZWYA 1ZTMA 4U6YB 4IU3B 2CGOA 3GSVB 2YEVB 2FQDA 2X28A 4MJ5B 4X9GA 3WS6C 4EXPX 1TDQA 5B7EA 2AW2A 1NDMA 5E7FA 2R8SL 3ZMVA 4WDIA 2BOBC 1VACB 2EADA 4JFXA 2XWDA 5C09A 2R56L 1ZHKB 5TQ0H 4KNTA 1BWMA 3BKJL 1QBLL 5C0CB 1JGDA 3DSQA 3L9YA 1OGAA 3L4WA 2IPUG 3ZK0A 3MLPA 3O4LA 4RA0C 4WHYG 4KJYA 1E4KA 2XHBA 4D9QD 5JOFB 1IUZA 2E8ZA 3H6JA 3TZVC 2YC0A 1TTRA 4P23B 5K39B 1ZIAA 3HBGA 2A73B 2P8LA 1KGCD 4H8PA 5HYSG 1RIUH 3ZMRA 4KAQL 3AUVA 4LGRB 1FO0B 1LP9A 5HDLA 3AM8C 4R97B 4Y7OC 5B3JE 2OX5A 1EZVY 3MRLB 2HLDG 3OQRA 4QXGH 4I9WA 3QF7A 5EU7C 2DH2A 5IB2B 1WB8A 5IJDC 4Y19B 2FNWA 3BAXA 4QHMB 1KNOB 4U1GC 1OTTD 4MB3A 4MXQC 5E79Z 4N5UA 1LO2L 3P0VH 4ZI8A 3QC5X 3UG4A 2QDVA 3H1LH 1D5ZB 4LFCB 2WP3O 4ZD3L 1Z5LA 2J2ZB 3FTGB 1CDUA 1SRDA 4MHHI 4MTOA 1U6AL 4BJLA 4CW1B 3EFOA 3UEQA 1AYRA 2EULA 3QFJB 2KHAA 4HJ0C 1TUBA 4NYLB 1NAKL 4F5CE 1AXTL 4K73A 4TSAH 3O6ML 1K5NB 4WFGE 4DN4L 1AD0A 5DJYB 1U8JA 4IS6A 2ZUSA 5KVEH 4UT9L 3HZYA 4AT6A 4D0BA 3QYNA 1LD9A 2VIRA 3CFCH 4M7KL 1AGBB 2DL2A 2H3NB 1OAUL 3FN0H 1FORH 2PWHA 3MHZA 4LPUA 4P9MH 4XPHL 5IBUG 5IMKA 3CVIL 2EO7A 4JGNA 2QADB 4M6ML 2HRHA 2P4KA 1BXUA 3TIEA 3W1ZA 3K91A 2FWUA 2Y5TB 3FO2B 4RGOL 4A66A 1NGYB 4X8CA 4J4PA 1QD0A 5EUOB 4XXCA 2LTQC 1SPDA 4JJ5B 2XC8A 2Y1VA 3AG4C 2OR9H 3RBSA 3DETD 4HMEA 1JZ5A 2HT2D 1A6WH 1AS8A 3HKDB 1U8HA 4QHPA 2UUAB 3VXOA 1NFIA 4XN5A 3CZJA 4P5TA 1MHCA 1N7ML 2Y06L 3OC5A 4U2ZA 2RA1A 2EC9T 1PQZB 3LKSB 5L2KB 2DQHL 1HEJC 4NQEA 1CG9B 12E8L 4KKAC 1BD2B 2E6PA 1H8LA 1XXDC 4XBGA 4JN2A 1AIFB 4L1SA 1S9WA 2D8KA 5I6PA 1HHKA 3E89A 4WW2C 1NCTA 2IDUA 1JF5A 4HOMA 3U11A 3SCMD 5C0RH 2XTJE 2GY7B 4OGYL 1T7WA 3S7GA 1WE5A 2FX9H 2V17H 2ZOWA 4KZDL 3GZOA 5EYPB 5AOJA 4Y16B 5E2WH 5F6IC 4OQTL 1IBKO 4JY4A 4L18A 2V2TA 5HJDA 2VN7A 2R1YB 1TVBB 4K3AA 2WQVA 4Q6IA 4KZ0A 4MJID 5IK3A 1FFPB