3AG3B

Bovine heart cytochrome c oxidase in the nitric oxide-bound fully reduced state at 100 k
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag3B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag3B02
3FYIB 2XV0A 3T9WA 3UADA 4DP9X 3CZUB 5A7EA 2MTAA 2FQDA 4G7RB 1NDTA 2B08A 3WKQA 4A2GA 1ADWA 1GY1A 3ABMB 2BP0B 2W8CA 6PAZA 2YQBA 1ILUA 2OJ1A 2PP9A 2ZWNA 4N4YB 3FU7A 4HIPA 3QJUB 1BXUA 3EH4B 4Q89A 3OD3A 4BWTA 2EIMB 3QJTB 5I5MA 1AS6A 3C75A 2BZCA 1CUOA 3IN0A 2IDSA 1PF3A 2DYRB 3DKHA 1IC0A 4BWUA 1PLBA 4GXFA 2VSKB 3X1BA 2PCYA 1ASQA 2WO2B 3HB3B 8PAZA 2HZHA 2I7OA 4WKXA 3ABKB 3QJVB 2XV2A 4HCGA 1L9OA 2UX6A 2X88A 4AKQA 2EILB 3NJIA 1QNIA 3WNJA 2J5WA 2YXWA 4P5SA 4HCFA 1ET7A 5AZUA 4YSCA 1DYZA 2R7EA 5AKRA 1OE2A 4YSQA 1BYPA 2IH9A 2E86A 1DZ0A 5TK2A 1SFDA 4WTQA 2H3XC 4N8UA 1SHXA 1OCZB 4E9RA 4QLWA 1SDDA 5I6PA 1A65A 5IY5B 2B3IA 5E9NA 5B3SB 4MFHA 2IWFA 4PCYA 7PAZA 3OMNB 1GW0A 2PPEA 3S3DB 1AZBA 2HX9A 2NRDA 2J57A 2Q9OA 1E5YA 4W1TA 1X9RA 1F56A 2AANA 3D12B 4PAZA 1ZIBA 2QPEB 5B7MA 9PCYA 2XUWA 1AS8A 3SBQA 1IKOP 3ZX1A 1I53A 1HAUA 3IN2A 1B3IA 1SF3A 2PPFA 4JHVA 4UF7C 3GYRA 1RZQA 2DWTA 2J55A 2TSBA 3X2QB 2EIKB 3ZIYA 2YAEA 1M9WA 3GXUB 4YSRA 4YSAA 1J9TA 3WNIA 1IBZA 1W8EA 1XB3A 2BP8A 3NP3A 5I6NA 4DP6X 3FU7B 4AZUA 4RH4A 2VN3A 4M3HA 2YAMA 4BXVA 5I6MA 6PCYA 1N70A 1NTDA 3AG2B 3ASOB 3ZDWA 1WS7A 2CALA 1PCSA 1CC3A 2XX0A 1AAJA 2YEVB 3CVBA 1A4CA 4HCIA 4G70B 2VW6A 4KO7A 2FWLB 1R1CA 3NJMA 3DTUB 2I85A 1OCCB 3X1GA 3MX0B 4DPCX 3PAUA 1GS8A 2BZ7A 4E9QA 1J5CA 3ERXA 5B1JA 1OE3A 4G7QB 1JZGA 3IE9A 4X4KA 2AFNA 3CDZA 1AZUA 2Y1AA 3NYKA 4ZK8A 5I6LA 1PY0A 4A67A 4BK5C 1AOZA 2VMJA 3V9CA 4GP8B 5B1KA 3EHBB 4CSZA 3FQ2A 4YSOA 1QLEB 1WA0X 3S8FB 1ID2A 3FT0A 3UAEA 2GSMB 3AY2A 2FT8A 1AZNA 1YLBB 4E9VA 4TXVB 2GHZA 2H5UA 3OMAB 3SQRA 4YSTA 7PCYA 2RACA 5I6OA 4YSSA 4YL4A 3CVCA 3T71A 5PAZA 4A2EA 1AG0A 1BYOA 3H4FA 1JZFA 1ASOA 2J56A 2XX1A 1W6LA 3AG4B 1SJMA 3TBBA 2OCCB 1L9QA 1V10A 2YAPA 5EHFA 2P80D 1SFHA 1OCRB 4A68A 3NSYA 2LLNA 3T6ZA 3NJKA 1V55B 2PPCA 2CAKA 4YSPA 3G5WA 2JKWA 3PAZA 4DP4X 1J9QA 1KBWA 1TU2A 3QPKA 2X87A 1NIEA 4HALA 4KO9A 4AKPA 2XXGA 3KW8A 2HLEB 3PPSA 1NPNA 1KYAA 3N2JA 1BQRA 2IDTA 1KCWA 4GP4B 1MG3C 3ABLB 1KGYE 1KDJA 1VLXA 1J9SA 4HAKA 1PAZA 1RKRA 3PXLA 2QPDB 1A4AA 3PAVA 3WI9A 3NP4A 1PLAA 2GB2A 2YAQA 2P80A 5TK4A 1OV8A 3NJNA 3NJHA 2YAHA 1L9SA 1AS7A 4UAHA 1PLCA 3FU9A 4AX3A 2YAFA 1MZZA 3PLYA 1BXVA 1SHWA 1NIDA 3L45A 1E30A 2PPAA 4NAJA 1WA2X 3WKPA 2JFCA 3KW7A 2ZOOA 2XV3A 3QJRB 1AIZA 1GSKA 1IUZA 3X1EA 2HXAA 3GDCA 1NWOA 2Y69B 2VSMB 4K9JA 3N55A 1OF0A 2EINB 1OE1A 4JHUA 1PNDA 1A3ZA 1NZRA 2XLLA 2EIJB 1MDAA 1AR1B 1TEGA 5PCYA 4DP5X 2VM3A 3BQVA 1ZDSA 1OOWA 3QJQB 3FYEB 2UX7A 2YARA 1JOIA 2FQGA 2BW4A 2FT7A 2CUAA 3FSAA 3FU8A 1ET5A 2QT6A 3TASA 5B7FA 3CDZB 2XYBA 2GIMA 4KNSA 1ZIAA 1JERA 2GC4C 3AG3B 5I28A 3EH3B 1ZPUA 4E9WA 3UGEA 2BHFA 2IWEA 4YVUA 2I7SA 5I5IA 2W88A 3CVDA 1CYXA 3FS9A 3MBWB 3FQ1A 4A2DA 1MZYA 2MRYA 3QQXA 1AZRA 2BWDA 1QHQA 5I26A 3UABA 4HHGA 3FPYA 3QJSB 1XMEB 4M4RB 1GYCA 2PLTA 1CURA 1ASPA 1RZPA 3SBRA 2AZAA 2XU9A 1E65A 1L9RA 4KOBA 4BDVA 2VW4A 2PCFA 1IBYA 4E9TA 4G71B 2FQEA 1ZDQA 3ABGA 3X1NA 5I5JA 4DPBX 1J5DA 1JZHA 2BP8B 1GS6X 3T6XA 5FC9A 3ASNB 2HRHA 1E67A 3FQYA 2WSDA 1BEXA 2UXFA 4F2FA 3V9EA 3UAAA 3FSWA 1TEFA 1WS8A 1KCBA 3CG8A 5D4JA 5LDUA 3NJLA 4AI7A 1AZCA 1GR7A 3OMIB 2ZXWB 1V54B 1PZBA 1URIA 2DV6A 1FWXA 4KNTA 2R7EB 4JKNA 1KV7A 4G72B 4GY4A 2VM4A 1BAWA 1J9RA 1JVLA 2IWKA 1ILSA 3SBPA 4DP2X 2N0MA 4F7KA 4EF3A 2CJ3A 1KDIA 1SDDB 2JXMA 3DIVA 1PNCA 1XB8A 1WA1X 2XWZA 1NICA 3NSCA 3IEAA 1TKWA 5AFAA 1T5KA 2IDFA 2IH8A 3AW5A 4GYBA 3ZBMA 4NERA 1JZJA 1JXGA 2H47C 3FSZA 2PP8A 1ET8A 4FAAB 3FPXA 2FTAA 2IAAC 1L9TA 2YAOA 3EH5B 3JT2A 4L0PB 3RYMA 1PZCA 2GC7C 2WO3B 3NSDA 1GY2A 2TSAA 3PCYA 2BW5A 4DP0X 4CSPA 2FNWA 2UXTA 3HEIB 1KBVA 4E9YA 5B7EA 3BVDB 4UANA 3H56A 4YSEA 3H4HA 3NT0A 4ENZA 3AG1B 1FFTB 2PPDA 1FA4A 1X9UA 2IDUA 2UXGA 3TU6A 2A3TA 5I6KA 4G7SB 2PP7A 1E5ZA 2IDQA 1BQKA 4QKTA 2XVBA 1AG6A 3NJJA 1HFUA 4YSDA 2YXVA 3TBCA 3U25A 5ANHA 4BDVB 2BP0A 2DYSB 2FT6A 3FSVA 4KO6A 3WIAA 4DP7X 4P5RA 4Q8BA 1ZV2A 1BXAA 1PMYA 2DY2A 5D4IA 4GP5B 1NIFA 3WG7B 2DWSA 4FA7B 1NINA 4BWWA 4DP8X 2HX8A 3TA4D 1PZAA 4YSUA 1JXDA 1L9PA 3S3CB 1SNRA 2VW7A 4W9ZA 5F7BA 2UXVA 4BXSV 1AANA 4DPAX 2QDVA 1BQ5A 1W6WA 5B1JC 1HAWA 3AZUA 1GS7A 1JZIA 3NJGA 1JVOA 4KOCA 1AQ8A 3EF4A 4HZ1A 2BO0A 3IBOA 1EZLA 2ZONA 4AKOA 4KO5A 5D4HA 3OM3B 3NSFA 1A8ZA 4NB7A 1CYWA 1M56B 3JTBA 2BWIA 3T6VA 1AACA 2OV0A 4A2FA 1OCOB 5F7AA 4HHWA 1MG2C 1RCYA 3S8GB 2QDWA 2Q5BA 3S3BB 2AZUA 1XB6A 3T6WA 1A4BA 2FQFA 2GBAA 1NPJA 4F2EA 1ETJA 3UACA 5B1AB 1NWPA 1UATA 4A66A 2GI0A 1NIBA 2CBPA 3NJFA 4YVNA 3X1FA 2AVFA 1NIAA 1WAEA 2CCWA 4A2HA 2XXFA 3OQRA 5B1BB 1EHKB 1SF5A 4KNUA 4E9SA 1M57B 1JZEA 2HX7A 1JXFA 4E9XA 1N68A 4DP1X 2HRGA 2FJSA
chains in the Genus database with same CATH superfamily
3I3BA 4Y4HB 1UM5H 5CHNA 1I31A 3H9SB 5E2WL 3CZUB 4HT1L 3T0EC 4OQTL 2W07A 5IMMB 2ZX5A 3BQUB 4XNYL 2QKIA 1ZAUA 3EDKA 5C0DB 1F3DJ 3M99B 1XNQO 5AKTA 4EIBA 3VAEA 5E4EC 2Q76A 3BIKB 6PAZA 3ZE2B 1RUQH 2F23A 2BVEA 1ILUA 2OJ1A 1MI5B 3BW9A 3C5JA 4LVOC 4PPTA 4RIRB 3LQZB 4ZUUB 4ELME 1JCKA 2HWZH 2H41A 3BZDA 3EJRA 4UU9A 1Z5WA 4GXVL 3GMMB 4K94C 5KZCD 1L0YA 3GKWH 1O7DE 3OD3A 4CL7A 3QJTB 1LO3H 4CS2A 3W11C 5B66Z 3WAKA 2HTLC 1MH5A 3DSFL 4HFUH 4U6YB 4B5ZA 2XN9B 3Q2WA 4W9EC 2FH8A 3QDMD 3HBQA 5JQ6L 1OP4A 3D51A 1TVDA 4IRSB 3L3KA 5J11B 1KIRB 2BWQA 4POUB 1S46A 1CIDA 1RMFL 3B2UD 3LS4L 4O2EB 3WMPA 3S3CB 2ZZUT 2IPUK 4WFFE 2I7OA 5C07B 2YEZB 1RJLA 4JQXC 5IBUB 1MNUH 4U0RC 2XIBA 3ECWA 2RQ6A 1TJGL 1W8OA 4MVOA 2WB1A 3QWNA 2IV8A 3V6OC 5GS1A 3VTMA 1MWAH 1XHXA 1LE9B 3VH8G 4NO3B 3RFZB 5BVJA 1BGYH 4LOVA 1DYZA 2PWGA 1ZA3B 3VW3L 2D3NA 2WZAA 4CGUB 1WK0A 4TLUA 5TK2A 1XD0A 1FZJA 3CFMA 1K6QL 2J4WH 4ZDHB 1XBDA 4JQVC 4HH8A 5C0GA 4UCVA 4CSSA 4OGYH 1T1XA 2H3XC 1Y6MR 1L6XA 1DLHB 4ODVH 1UOWA 4OV5B 1U58B 3HLKA 3MXVL 5KYUA 4JI7B 3IF1A 2GJ6E 2Y6SD 4P57A 4BKLB 5JQIB 2RMKB 3P3NA 5FCUH 2IQAB 4PCYA 4FI7A 4HW6A 4JHZA 3EO9L 1OZTG 5DJCA 5FK9A 4EUPB 1DP0A 1MLBA 1X4YA 2YUVA 4ZG1A 2KYIA 4AQYB 5DVPA 4DO5A 2OMZB 2NRDA 2CGYA 1VQMV 2RDCA 3LKRA 5HHOE 3WTTA 4I18A 4N0FA 5FFGA 1FQ9C 2BLFA 5DJ2B 3TCXA 4MWFA 4AYDC 1BVNP 3D25A 1AGDA 3DUUB 4HMEA 1JDAA 2YK1L 3OJMB 2OZNA 2O6DA 2WBJB 2AK4E 1MCKA 3OB0K 3QQ9D 5EF3A 1I3VA 5L7XL 2VISB 3BAWA 3T4AB 3D87B 3GXUB 1A9BA 4YSAA 1EDQA 1E28A 1FFQA 1U8LB 3JUYA 4X83A 3WNIA 5IT2H 1JHKH 5LGHL 3EAKA 1IGIH 4RVBA 4TVPH 2ADQB 1XMOB 3GQFA 3BVNB 1DDHB 2CJSA 4JY5L 2BCCH 2NY0C 4XXCC 3G9VA 3II1A 3OAZK 4L48A 4M8RA 4AQ8A 3UAJD 1K5SA 3QBTB 3EOTH 1TMQA 1Q3EA 3EJYD 1WFTA 3L5IA 4ABUA 4YHML 1HS6A 5D7LA 3ESOA 4KX9A 3G6JE 2C3WA 3LD8C 5F7DB 4I3GA 3K46A 1JPFB 4FHJA 4TUOB 4KO7A 1UT2A 4HFWB 4JZNB 3F7QA 5CSZB 4YJZL 1BEYH 4JASA 3FMGL 3OKEB 4I1NB 4P5KA 4IGGA 2UXDO 1E6OH 3BSGA 1OGTB 3HI1A 3KCXA 1UB6A 2BMKB 2CG9X 5GS0C 3O8XC 5IESL 2AS5M 2PWEA 2JGDB 3ARFA 3NOIA 4E0RB 2D2CB 1SA0B 3CCHB 5GISL 4ONGH 1JK8B 1AZUA 5CNHA 3BAYA 3DO7B 4A67A 2BDNL 3KBHE 4J4PD 4JMNA 5DJ0A 4Q2ZA 3VCLB 1BPLB 1A6TA 4U1HA 4Q97A 5BNXD 1KACB 3TNNA 1QLEB 4PDMA 3ZL1A 2Y6SC 2W95A 4IU3A 2EZPA 4M93B 2Y3AA 4F6RB 3PXJA 3GUFA 3K72A 5F6HI 5I8KL 1W0VB 2AK4D 3PWJA 3TVMC 3PGDB 4JDTL 2X89D 4BK5A 3OKMA 1RUPL 3DTXA 4WI2A 1VGEL 4WWNA 2WM0A 4F24A 5JHDA 5PAZA 1F18A 3GBMH 1MXGA 1VAHA 3IGAA 3L75H 4LFHG 1RZ8B 3HBZA 5D2LB 3RX9A 1DVFD 4GQQA 5IKCB 5JW5A 4PJ8B 2JIXD 3U7WH 2DN7A 5I73C 2NYYD 3VFVA 2K0RA 4MAYD 1NFDE 4XOBA 5HBBA 1XCQB 2Z8WC 2P80D 4N5UA 5DK0A 3F6IA 1OGAA 4JI0O 3VMPA 3T6ZA 2J8HA 1ADQH 1T6VN 3LZNA 1YUKB 4MDJA 1P7QD 5HDWA 4MCMA 4Y7OC 1GYAA 2OMUB 1MXDA 4Y4HC 5JIDA 2R2BA 3MRQA 3VXSD 1OWRM 1A1OB 3KW8A 1AGBA 2ZXWC 2HVKA 3NIGE 1VFUA 5E4EB 1KCWA 2WP3T 1N19A 4PG2A 1D2OA 3CMGA 4R2GC 3V7AG 3MV8D 4F27A 2ZE5A 1UGKA 4N2DA 4BCZA 1U6AL 3L3OC 3FOMA 5IOKA 1MAJA 2YKKA 5L4IA 1U93B 4AK2A 1UKTA 3GEFA 5DO8A 4N1EA 3BVXA 4UAHA 4ZUVB 3V7MA 4J6RH 1WCQA 3EOBA 5CIPA 1ANUA 4FNLL 4MTGA 4I0PC 4OCLC 1JF1B 4E36A 3D2UA 5AYTA 3FCGA 3BZEB 3H9HA 5JW3H 4RA3A 3FN3A 3R4RA 1DLHA 3WKPA 3L9EA 3MRIB 3QIUB 2Q8VA 3HR0A 2P7TB 1SQFA 1BX2A 3M17A 1HHIA 3K5MA 1A14H 4N9GA 2AVGA 1EZSA 3MCG1 5C07D 3IC7A 2Z4QA 3P0YH 3JD2A 1MFNA 4POZD 1BZKA 1FLRH 2R0ZL 5F1KC 3TZVC 4J39A 2ZG1A 1O5PA 1IKNC 1M53A 3O65A 3BGFB 5C2UB 2NCEA 2XLLA 2CTPA 3MLSH 4AQZA 3FU0A 4LDLB 1HJBC 3CD6V 2E75C 4KJYB 5TE4H 1MFDL 5E08L 5KX5B 2YD4A 3LB6C 5HHXL 2E6QA 2VM3A 1NLDL 2CDFB 5JHLH 4CVXB 1FO0H 1WE5A 4JGNA 4X7DC 4H5SB 5AWNH 3SDAA 1Q0XL 1JP5A 2ZXDA 3WMSA 4B27A 2FT7A 2MCAA 3BQUD 5CN2A 3R8QA 2WCPA 4Y5VB 3HC0B 2QTSA 1MLCA 2NXZC 5I28A 2CUGA 2FYYB 3EOAB 4Y1SA 3HKFA 3IJ4A 3MVSA 3KXFD 2IGLA 1J05A 4N2MA 3QCVH 1YN6A 4YLBA 3C08H 2DF3A 1QVFU 1TZGL 3SPVB 4B95C 4A2DA 2WAHA 2N1KA 1A9VA 1WQVT 4M1GL 3WJLA 4CC4A 2C9QA 4BGLA 3UO1L 2B1HL 4JFXA 1ZD6A 3VFTA 2Z65C 3AM8A 4QRPA 4UTBA 3DSNB 3HC3H 1K5QA 2QGBA 4HP5A 3ZYIA 1IBYA 3NFSL 3T3MF 1BQLL 3L8QA 3DHJA 3LZRA 3CHPA 5E5MB 1H3PL 2A6DA 2X1QA 2P5WE 3MN8A 3MRKA 3FBQA 5GRJL 3A6OA 1JYWA 1XEUA 4QRBA 3HG1A 4UOQA 1T4WA 3BGMA 1RURL 4BQ6A 1U8PB 2OTPA 3QZBA 3OAWA 3I50L 5CP7B 5DJAB 3ZDXB 4GSDH 4TKWA 5BXFA 4DR2B 1Q1JL 3BN3B 1V7ML 1B0GA 3F12B 4U6XB 2ESVE 3RX8A 2A6IB 4LF8B 4DKEL 1QFHA 3TFKC 1YNLL 3COOA 3WLWD 4LHJB 4Z7NB 2WN3A 4F7TA 2QHLA 4WUUE 5IJCC 4OBSA 3MAQA 4NKMB 2OYMA 3QPXH 2MCPH 3BD4A 3QT2A 3SQBA 3DIVA 1XB8A 1KF9B 1WA1X 4JKPL 3MNMA 3CLEH 1FL6B 1KN2H 5DRNA 1OARH 5F7HA 4PGEA 1UXLA 1Z5YD 4LRIC 4KTGA 4O9HL 4FAAB 3ATAA 3LRKA 2ENYA 3OAUH 4NQTA 5IR1B 1HWGB 2YKLH 3JT2A 5IM7B 4LEBA 1ACYH 1M7UA 5EZYA 4PBWD 1DBJH 4D7BA 1M5IA 1IM3B 2QFPA 3HE7B 4FLSA 2JKXA 1PM9A 1F1GA 4PJHE 3NZHL 2J71A 3O6FB 1CU4L 4QRQB 1XZWA 3O11A 4R90H 2Q4PA 2WZ5A 3VQYA 5I1GH 4E9YA 4NZRL 2UZYA 3LKSB 2EH7H 5C70A 3P9MB 1M7DA 3KJ4C 2LFRA 4KROC 4WVRA 3N44F 1TJIH 5E0FA 1YY8A 2CM5A 3OPZL 3VO0A 5TF1H 3B7TA 2YIDA 4YR6B 5H8DA 1DHKA 5CEZE 1XCXA 3DHPA 5AVYB 1XIWD 3C12A 1QU7A 1D5ZB 2LGQA 2O5XH 3K9AA 4G82A 5LQBH 5FO2A 4GG8A 1XWVA 4MDIB 3UM7A 3RYCB 4JFVA 4H8WC 3CMOL 1IAOB 2NW2A 4FMKA 5JIIA 3THMH 4PJBE 3WIAA 4CVZB 1F4YH 4D9QD 3RWDB 5BZBA 3NCYP 3IETA 3RNQB 2HP4A 1TVHA 4MBOA 4XPHH 4ONHA 4WI9A 3APMA 1U8PA 5J89A 1YG9A 4APXA 4ELKA 2AMGA 3F7YA 4FQLL 4I55B 1HCYA 43CAA 5IJBC 1C9SA 2ZNXA 2NNUA 3GBDA 4Z1VA 1C08A 3N40F 1U91B 2GUOA 3V2AR 1B0GB 3F12A 1L9PA 1WC7A 4OJAA 1I7ZA 4IYIA 5DMIL 2A6KA 5F7BA 1XGYH 2CDGA 4KTEH 5IY5C 2VDKH 2IAMD 1XL6A 4IRSA 3EGSB 4G8GB 4GFTB 4JFED 4OGXH 2AGJL 3AZUA 4XP5L 5CEZH 3AWGA 1ZUQA 3AS1A 5GHWL 1B9ZA 4HIXH 4HGWB 3WFHB 4NC2B 5I0WA 4OJFH 5IEKA 3EBIA 1ZA3A 5F9DC 2BO0A 5HI3D 1T2QH 4P23B 4XRCB 2VMCA 3NSFA 5DYOB 1NUNB 2XOKG 2O6FA 3FRPB 2XNDG 3W81A 3ULSB 1DCLA 3IRPX 1OCOB 3FTXA 5DS1A 1AZVA 2OI9B 3RP1A 2YI9A 2A9NL 3ES6A 4NYLB 2ORBL 1CLYL 1G7LB 1T7YA 2K78A 3S3BB 5BOPA 3AK3A 2IAMA 3T6WA 3BA9A 4FZ1A 1Q4NX 1FXKA 1ETJA 2I60H 3UACA 5J6HB 4CBCA 4UQAA 4R7NB 1QBML 1IM9D 4EDXA 4DAGL 1GYVA 1ZLZA 1UD3A 2XIDA 3LRGA 4ISVB 1J0YA 3JTTA 3W2DH 4L29A 1RERA 1ID5I 2F74B 2P5WA 3D07A 3GPEA 5MEQA 4GNKB 3HN8A 4HZLB 1I7TB 5EO9B 2EH8H 5EZLB 5AB2A 4P46D 1R3IH 3IJHA 4J3XA 3VXNB 2P8MB 3MLUL 2C1PA 4WSGA 2DWDB 1FH5L 2Y7QA 4QRPE 4JPRA 3GSQB 4IW4C 3LKPA 1XQ8A 1SBSL 1IAOA 5AVXB 3MR9A 1FZKA 4G7YH 1DDHA 1KB5H 2ZUVA 4HCRA 4OUOA 3ARED 3VWKB 3HKZA 4GEJA 4GKNB 5L2JA 5BXZA 5CCHE 4CJ0A 3MKGA 2APSA 4MXQC 3DX0A 3O8XB 3C9NB 4H8HA 3ZHRA 1W72B 1CICA 2NY0D 4ZPVA 3CU7A 1WFNA 3N0PB 2FZ3A 4MTFA 3NEOA 1XNRO 4PRBB 4UM9A 3NH7L 1NCIA 4GRLA 4ONFL 5L2KD 4AYBA 4P4RA 5A3IC 5J1AB 1SXNA 1UB6B 2BMKA 2WLLB 2Y7NA 1FNGA 1TVKA 1T5XA 5EN3A 2ZKYA 3AADB 4QYOB 5I74C 2EYRA 5EU4A 3L81A 4N8CL 5I1KH 1Y76B 1KTDB 1S5HB 2AQ1A 2OCJA 4ZX3A 7CGTA 1G7IA 1ZS8A 2CIIB 1D5IH 3K79A 2YXWA 4DQOL 4LCIL 3HVNA 3OHXB 5I8EB 1KJ2B 5AZUA 3QORC 1H8LA 4JM2D 4DV3B 2WSPA 4AYEC 1JMZA 2JKJA 2BIPA 2BHYA 3MBXH 4Z7NE 4JJ5B 4WTQA 1CT8B 4ETQB 1DJZA 2ERJC 1WF5A 1LK3H 3ZE1E 5E56A 3PNRB 3LMJL 1D6EA 4LVOB 1HSAA 2DMBA 3I2CH 2ICEA 3SE9H 4BRJA 1BD2E 4ZFZA 4IBWA 5F7FA 1EZJA 5JHDB 1PZ2A 2LFGA 2VQTA 1J0HA 1LO2H 1AJQA 4XO4A 2BFGA 3MZTA 5IESH 3PGDA 1WA8B 1XGPA 1FVCB 2UUDK 4ONGL 3V4VA 1KULA 4KFMA 5GS0H 1AI4A 3TZVD 3D3VA 2ADJB 3ZX1A 5DRWA 3QXDB 2A83A 3OF6D 3J8F7 1BAFL 4MAUH 3AG7A 1TPXB 5GS1C 5HXMA 1UWEL 2PPFA 4OPHA 1PP9H 4P9HC 5HHME 4ACTA 3IETB 2J55A 2LV4A 4LLDB 4BFOA 1UWXH 1GA2A 2YAEA 4M6NH 2YLHA 4UQBA 2ZD0A 4PRHD 1U8IA 4X6BB 1VKXB 1W8EA 3P77B 4KUCF 3T2OA 1MFCL 2B59A 3QIWA 1N8RW 1B2WL 4WCYL 3KPLA 4DV2B 2ZKOA 3H53A 5HDQH 1IBGH 2JMRA 3ZK0A 5E8DL 4GIOA 3RVUD 2YD2A 4CZZA 3EO1A 3CHRA 4LZKA 4WEEA 4ZAKD 2VAJA 4D8OA 4YWGH 2RCVA 2F43G 1A4CA 1S7UA 4HCIA 3APCA 3BAXA 4FLUA 3IDIA 4LP4A 6FABH 1JN6A 1VIWA 5D7JD 3E80A 4AT6B 1TVKB 1T5XB 4WI6A 4CMHC 3X1GA 4UCFA 4LHUD 1M1SA 3BWZA 3QUZA 1G5AA 2VITA 1BBDL 1XVSA 2N74A 1ZA6A 1ZTMA 4FXGB 4UB0H 4YDIL 5DJYB 4QWWD 2Z0AA 5B1JA 4F58H 3VJ6B 4GAYB 3KPQB 3KH4A 3SKOA 3CFDB 4AOFA 1PY0A 4BK5C 4J8RA 3RVZA 1SVBA 3RL2B 3IDXH 3NK3A 3ZL4H 4F8PA 2VDOL 3C6EA 4HV8A 4FNTA 1G6RB 3B8YA 5HHPB 2Q7YB 1CLZL 3Q44A 2YJQA 1ZLVH 5TDOB 4LH7A 2NY5H 3P73A 2BOBA 4ERSH 5BS0D 4HUXB 5KX5A 1N0LB 2X42A 4MMZC 5D1ZI 5KHJA 1M9NA 4TXVB 2X09A 4IM8A 1MFAL 3GJEA 3T3PE 3OKDB 3O6KL 4M9PA 3UBXA 5K9OA 2JSFA 3GT6A 3TV8A 2YPKA 5F0MB 4YQXL 2YSTA 5DCCA 2OS7A 1IVSA 3ETBF 4OCNC 3L7FB 1A14L 4Z7OF 2KH2B 2W38A 5EEYA 3FU6A 4UVCA 3RGHA 3J7AU 3IC9A 4HIIA 1FIGH 1U3YA 1U8QA 1QCEA 2RJMA 5CKGA 1HHKB 3GSXB 3JWDL 5F8QC 5DD3H 1S76D 1OTUD 3AWEA 4G6ML 2A73A 2I26N 3PAZA 3L2MA 4HWZB 4U6TA 4YJ2A 5INDA 1L0QA 2EIMC 3RBSA 1GAFL 4MVBD 2N56A 2KQXA 3JARA 1NLDH 5FO9B 2HRPL 1N8ZA 5C6TH 4HS6A 1JIBA 3BWUC 1KBGH 3KPOB 4Z3HA 4JREB 2HPTA 2YEZA 4G5AA 1MG3C 2DB8A 2VJ0A 4QRPB 2Q7HA 3T2MA 1V3KA 4JFEE 4L3ED 4GFXA 4MNGE 1LK2B 2WNGA 4XC3L 4CSTA 2JK5B 1YI2V 2YPLA 1OLLA 2WWMC 3NJNA 4MX7A 1JWMB 2CGZA 4YO0B 1NJ9B 2VLKE 4PIRF 3GS4A 4RMSA 3CN1A 5FYJU 4DOHB 3DROA 3QCVL 2XZCH 2G5BA 3C08L 4MZRA 5FF6B 3H9VA 2NT0A 4X4MA 2F61A 2DWXA 4Q20A 1CLOL 2PPAA 5DMYA 2ZOOA 3QQDB 3ZTJH 5FWRA 3LHPL 4MNQA 1O6SB 2SEBA 3TIEB 1SBBA 4I9XA 4NFBA 4JO1L 4MQ7A 4P5TA 2YSUB 2Q3AA 2Y06L 3QUYA 4HUMB 4APQA 4B9ZA 1ZCRA 2CLRA 4D0DA 2F1EA 4A2MA 4AIXA 2N05A 4Y5XA 5TQ2H 3U0PB 5LDSA 1NMCC 1OF0A 2HN7B 2FLBT 3TN0B 3B77A 4PJFE 2QLYA 3VMNA 4LCCC 1AR1B 1T89C 5GRJH 5AOJA 3ATDA 2VLKA 3BAEH 4UT9L 5ITFA 1YPZB 4P3DB 1FL6A 3KXFE 1HESA 3BI9X 4ZI7B 4LBEB 4KXRA 2E5LB 1HCZA 1QBAA 2JJSC 2XPYA 1SLVA 4R6UA 4WRLA 3CN4A 5HDRA 4CU7A 4R4BA 3MBEB 4Y1TA 2VJ8A 2AJUL 3UBXG 1NCBH 3VWJB 7FABL 4X9FA 3QYMA 1DQQA 2DJ4A 4QE7A 5LP6B 1AMXA 2W9LA 2WXKA 4GO6B 4ZSOB 1NJIW 1UXMA 2DQGH 2B14A 3L4TA 4LDCA 2OTUB 4F9PC 5TDNB 1W0WA 1IGMH 2UUAO 1TZIB 2FX7L 5EBLA 5GGVY 3WLBA 3VDCA 3G6DL 5I5IA 1KGWA 1NEUA 2W88A 2XQBH 3CVDA 3OJ2C 2B4CH 4YLQT 2VR5A 2YUWA 3UTTE 3FB6A 3V0GA 5D7LB 2BWDA 2KZWA 1I5XA 5DQJA 3ECBB 3JARB 5H4ZA 2WMPA 3FT4A 2X1OA 4HOWA 5CJ8A 4ZYKA 2LGWA 5I24A 4HAFA 5IMOB 1XMEB 2FB5A 1E3ZA 3K0DA 4UOW0 4Y1AB 4GAGH 3BGFC 1MI5E 4J80A 4HS8L 1F1DA 5D72H 5FYJD 2E7LC 4MCYB 1OCRC 2WW8A 2XJLA 1ZT4A 2FECI 2BOCA 3QO7A 4AV0A 2EE9A 4ENED 1X3DA 3GKZA 1WZAA 1RU9H 2GCYA 4NHCL 4WEBH 1ESOA 2NYYC 1TYRA 2MNJB 4FFWD 4BIOA 4KQ3L 2H2PC 2FR4B 1KCBA 2Y23A 1R1BA 5D1XB 5D4JA 3DECA 3KGTA 3EGXB 4OU3A 2A0LA 3E7JA 3W9EA 3OMIB 4POZC 4HZAA 4J3SA 3DIFA 3PP3K 4YHZL 3DVNB 2A9ML 1KMIZ 2XRAL 3HHMA 4XMTA 2YA0A 2VC2B 2CHXA 4I2XB 4ODTH 3L4YA 4NHUA 2PTTB 4MNGA 5F6IB 3W7UA 4RDBA 3CZNA 5IEKB 3IJ8A 4HBCH 2K7QA 4YIQA 1OCWL 3P0VL 4PJ5A 4PP2B 3VD4A 4I0PD 4YHNA 1M42A 4YHPA 3CMOH 5IQLA 3SBPA 3U1QA 3GI9L 2W0FA 2EJ7A 4OZHF 5DN6G 4IBVA 3GLZA 3QO1B 4WGWB 1ND0A 1WT5A 1TCMA 4QHMB 5D4QA 5DD1L 4TWKA 3D4ZA 3ULAB 2DWEC 4KKBC 1LQBC 2Y1YA 4FYQA 1BFOB 4OR1A 1SJVA 3SDYL 1XH1A 3L95A 2IH8A 1RJLB 4PVLA 3IAQA 5GGRA 1EEUA 1NSNH 4DR3B 1I1AA 1HIML 3NA9H 2FTAA 2IANA 3ESNA 1FNFA 3SKMA 3O9WB 2Z8SA 5EIIG 4AMWA 3MHZA 2R2BB 3NACH 5I8CB 4JGJA 4ZSOA 4TNWF 3T1HO 4OD2B 1UH2A 4PREA 4YDKL 2E74C 4RUEA 4FZEL 2YQ3A 3MJGX 3PJSB 1LO0H 2DOCA 5D1QA 4RWYL 4DHLA 1RAMA 3RWCA 4MJIB 3U30C 1MCLA 1XH3A 3H9SD 4P59L 2AQRA 1T2QL 4XVUC 2BCKA 1XCTB 4D0BA 1NGZA 4KY1H 2NW3B 5AVZB 4HZLA 4LFCO 2Q1EA 4CN1A 1FA4A 2VERN 1S8DA 1KUQA 5GPRA 2WKOF 3ZE2E 2DQEL 4HJ0D 2CGRH 1HL9A 3C5SB 2IJJA 1Z9SA 5JXEC 3QDGA 4D8PB 4G8FB 5D2NC 3NJJA 2ZIDA 3S5ZA 5ANHA 4BW9A 1CGUA 2VDNH 4UBDD 5DJ2A 1F4WL 2YN3A 3FSVA 4MLIA 1EJ8A 1F8TH 4PY7B 3SY0A 4OUUA 2AW9A 5I74B 4WBNB 3ICXA 3DRTA 1FNHA 3KL5A 1QBMH 4ZXBA 5ALBL 4PJCE 2DZEA 1MNGA 4XPFH 5LL6Y 4YHYC 2IPTL 5GZOC 2Z92B 1MIEL 3SE8L 3N9GL 5J13B 3HZMB 1YJWV 3FFCE 1TZHB 3D0VA 5HGHA 1BVZA 1OGSA 2BTOA 3ESPA 4KJQD 1Q8MA 1VFBB 3NCJL 4JFFE 2QPUA 2HG5B 2CDFA 4G1EB 3LHAA 3FBKA 4PB9L 3VD9A 3GTNA 1JE6A 3TXQA 4ALAC 1HEHC 4XTRC 3T3ME 3U0WL 5HGBB 5F1OB 2ZONA 4WDIB 4IJ3B 1A8ZA 3BKML 4HXAH 1NFIB 1JI2A 3GWJA 3PP4L 4FTVB 5J8OA 1QD0A 5EPMB 3AUVA 2JLPA 3L95B 2XTJC 5IJKA 4A2FA 3QDAA 1H3VA 5EBLB 4GZRB 2QFRA 3IXTB 1I9JH 4DR2O 1JF5A 1PG7W 2AEIT 5FAAA 1QASA 2LU4A 4KHXH 3BHBB 1NCCL 3B34A 4CA4A 4NI3A 2IQ9H 2Q8BL 1I7FA 3UIZA 4NP4H 4MGXA 5DJCB 4XXCA 2ICEB 4L18A 5FPOA 5EIIA 4OX9O 3X17A 1M71B 2XAQA 5JJJB 2F4VB 3BDYL 2JVUA 3GHBH 5KJRL 4Q9QH 2YWZA 1QW8A 4DO4A 1IQDA 3Q9PA 4FQCL 4EAEA 1E6JH 1MVFA 1NGWB 2P6JA 4RFEB 4XMXA 1BD2A 1GHFH 1R24A 1R3LB 3DETD 4Y2DB 3UG5A 3VDBA 3P32A 3SPJA 5MENA 1DE4A 3KPRE 5GZNA 4LLDA 1TOXA 1FG2A 2GUZA 4MB5A 2DLGA 1RZ7L 3B7SA 3EYUH 3G04B 4KX8A 2XFGB 1DGSA 1A32A 5IP4A 2GJJA 3N41F 5KYXA 1X5LA 5T1MB 3MI6A 1YEJH 4YUEH 1WD9A 1CXFA 4JHAL 5HHNA 1WBXB 3DVGB 3EYVB 1ADWA 1ZKAA 4YAQB 2VRKA 5K9QG 2YQBA 4IL6Z 1Q86W 2EC8A 3BVNA 2RTTA 1KGIA 2LFEA 3KPPA 5KUMA 1JFQL 5ISZD 4XMZA 1XZ0A 5E1HB 3O0RH 4MD0B 4Q0XH 4RQQB 2CHZA 1QG3A 1UCBL 4UTBH 4MDJB 3D09A 2AJVL 1MOFA 4PWEA 3W7WA 4HMCA 3IN0A 3IDIB 1Z5HA 3GPSA 3H42L 4N3TA 3RU8H 2W9DH 2OR7A 4JKLA 4GXFA 3F58H 4Y16C 3EDJA 5AW4B 1XF5B 1R3KA 3Q5TA 3BP4A 3MTXA 1S5JA 4G11A 2WUCL 1GGBH 4ZOCA 4Y4KD 2X4SA 3CTTA 1D2PA 3GSNB 3NAAH 3QJVB 4UCOA 3LDBB 3MV7B 3K4ZA 4AT6A 2EYTA 4JY4A 4WU7B 4AQAB 2OMVA 2P4KA 1OD9A 2Y0PA 4X99B 4HWNA 5DZ9A 5CJOL 2J8UB 1NEZB 1X9LA 2IANB 2RQ8A 4NM4H 3VG0H 5EIBD 2C9PA 5EOQH 3A3YB 5JH7B 4LF8O 1J5EB 3I9PA 4JFWA 4Q2ZB 4NQCD 5DVNA 4DR1O 4H0LB 4WO4B 2GUYA 4QHLA 3L5JA 1SFDA 4LSPL 3CCMV 2WSSG 4JRYD 1XGQA 1H2KA 4GBXA 4L3EB 3A67H 3BLBA 4GW4A 4LIQH 1T0NA 2IV9A 2X4PA 3GMNB 4XBEL 5B3SB 3LDEA 1KTCA 5LHIA 1J8HE 3MFGB 2FX9H 2BSED 4NNYB 3TA3A 3WSQH 1GW0A 3CCSV 4YXLH 1Q7YW 3L3GA 1RFYA 2UZIH 1WAPA 5CAYB 1JV2B 5CZXC 4UB0L 5FKAA 1EAPA 2GSIB 4W1TA 4I85A 1F41A 1X9RA 3D12B 4XE5B 3MBWA 2CJTA 2FJHB 2D31B 3UAFA 4I13B 4LRNH 2NW2B 3PGFH 5E99H 3QW9A 2VQ1B 3RPKA 3FDWA 1BQUA 1S5HC 3NK4A 3GSOA 5IVZB 2LU3A 4DFIA 1F45A 1KXHA 4PJ8D 5AW9B 3C2SA 3MRJB 4Y5XC 5HYFA 5D6DC 2XA8H 4JI8O 1HOCA 3CH1B 4AIEA 3H7LA 3M1OA 1EN4A 2YN5A 2FLMA 3L3HA 1GSMA 3CFJA 4O4LA 3F7KA 1LMIA 4Q6GA 1VFBA 2XHNA 1K9MW 4WY7H 4NOFA 4LCUA 5HFMA 1EVUA 1L3WA 3OMZA 1E1RG 3V95A 1UA6L 1F4MA 3ASOB 4I9QA 1H2LA 5I1JH 2QQKH 2A06H 3W1ZA 4YBQC 3WS3B 2VWJA 5B22A 2Q8AH 1F11A 2YEVB 5FFLA 1YNKH 4Y9EA 2H3KA 5E9DE 5FYKU 4MXVF 1D3CA 5GRVL 1CJYA 2X7LB 1FIGL 4D0CA 1Y66A 1MCOL 2BP5M 3ULSA 5KVDE 1JGLH 2E0PA 2F18A 3FFCB 1HWYA 4C4KT 3H9HB 4X5QA 5EBMA 3NGBB 3MMEB 3L72H 2B0SH 4FMFA 3G6EV 2G2PA 3SJVB 3V4LA 4GEIA 3JVFC 1JNHA 3CVHA 4X6CA 2X3BA 2XTJE 2XQ0A 4TPRL 4Y4KA 4IK6A 3WUZA 2YSSB 3DGGA 4HH9A 4L4TA 3W7XA 2ZOWA 1A0QL 4LNRB 4OCRL 3TN0A 1IFHL 3O6LH 1RK1B 1DF5A 3EHBB 1KXQA 3OZKA 1U8HB 2IDCA 1SQBH 1NGXB 4IOFD 2VLKB 5ITFB 3B5TA 1WFOA 5DJDA 3QFJA 2NR6D 1UXWB 2WVTA 4WWID 5IVXE 4BFBD 2AJ3B 1VA9A 3MUZ1 3OR6C 4JAVA 1CFTB 3E9TA 5H6QA 2XZCL 5EF1A 4OQ1A 5DWUH 3IJHB 3VXNA 4AGOA 4BUGA 4B9YA 1IC1A 1AXTL 3MV8B 5KS9F 1S77D 4KKNA 1OOAA 2AERT 2P5OA 2AJZA 4EB6B 4G6AC 4X62B 1NFDF 2GJ6B 5K9KB 1ZS2A 4HA1A 1RZIA 1OSEA 5CEXB 3ARGD 3KVQA 4WUKL 5CEYA 1KTLA 4B96A 3T6QC 3CS5A 2WCSA 1ORQB 4XNXH 5E8PA 1S7WB 3INOA 1INDH 3T4YA 1RIVH 1C5CL 4FLOA 3D0LA 3ISRA 5E1AB 4A7UA 1CYGA 2X4NA 1FPOA 4MAZA 3WJJA 1NIEA 5DLLA 1KJ2H 4MAYB 3PV7A 4L8SB 4PJ9A 5CLZA 1L9MA 1RZKL 2YXHA 4XP1H 2Q87A 1IAKA 1K2DB 4HQQL 1DK1A 3NPZB 4R5XA 5CD3A 3LRMA 3D48R 3MA9H 1Y0LA 1E6OL 2NTFA 5CBAA 4CGTA 5E5MA 1NKGA 4PDVA 2ZSVB 1PLAA 2AJXH 1EXHA 4NQDD 3JZ7A 5AYUL 3OTTA 3VXMA 1L9SA 1XXDC 1LUVA 2XY1A 1KJMB 5C09D 5BW7A 4AX3A 4OT1L 5BY1A 4G43B 2UXCB 5F9OL 3QQ4B 1CTMA 1FL3B 2B4CL 2WTPA 4YPGA 3DVNA 4NAJA 1PX4A 1G9NH 5L4MA 3FULA 3OXRB 2Y0IA 3UMNA 3W39A 3U10A 1O7SA 3M6DA 4FQHB 4XVJH 4XCNB 3RG1C 2VXQL 3WFCL 4YY3B 1SGKA 5JCOA 4TQFA 4YFEA 3SN6N 3V4UL 2DMCA 1R5IB 1P7BA 2NY3C 4IOFC 4K94L 4Y89A 3Q01A 1L6ZA 2DM4A 3TBTB 1NCAH 2EIJB 3ABMC 1W9XA 4UV4H 3QB7C 4JM2F 4MTXA 4QO1B 4WU5B 4X4XB 4JLRB 5I66B 3DDGA 1T66D 1FO0B 5IT9N 4ES9A 1Z0MA 3UQ8A 4HKZA 2ICWI 2FBRA 4KJPD 3SKMB 4YGAB 3S3JA 1FE8L 2B7DT 1A1MA 3EYOB 1OVZA 2HJKB 1I85C 2BC4B 4YC2C 1HINL 4DR3O 3ZDZF 1Z5VA 3W37A 1HYRC 3RRQA 35C8L 5TJWK 1G94A 1R19A 3CDZB 1AE6H 1LTXA 2H45A 1PBYA 2WPDG 1ZIAA 3IDGA 3S3SA 25C8H 3S9DB 4UVAA 4FF9A 5D1QB 5JORB 2FIKA 3MREA 3PY9A 4FP8L 3CCRV 3MV8E 3UOAB 5GS3A 4PHZA 2GBUA 2GJ6D 4DV5B 2I07A 2HP8A 1NMAL 5TGBB 2ZCLH 1E9OB 1AO7B 2VXSL 3VFSB 5LBSA 3KPRD 4NYLA 3BUDA 5CWSB 4GKLA 4KPHH 2BERA 3MCLL 3QJSB 4PM1A 4JL1A 1D5XA 1RJYB 3SOBH 1R3IC 3N85L 3ARYA 4MA8L 5HYEA 1BE3H 3FU3A 1QACA 2Z35B 4FEMA 5FHBL 4Z1PA 4MA3A 4ZMOA 2J1KA 1AR1C 4H2CA 1QTYT 1UWYA 5AVSB 1P1ZA 4N0RA 4DPBX 4ADJA 2LHAA 4A6YA 4NPYA 2GFBB 1WBYA 4MA1C 4YXHL 4DJMA 4KXZI 4Z7OE 5IJ0B 4PWIA 2Z31C 4AGPA 4HKBB 43CAB 3L54A 4Y9CA 2ZOTA 5H2FZ 3OWRA 3LH9A 5L3BA 3CG8A 4Z77A 4LSTL 4KY1L 1A25A 1O7VA 5T3ZE 2F54D 5SWSA 4BUQA 3UTSE 3TF7C 1YEEL 2QZQA 2KQMA 3QFJB 5TE4L 3R7RA 2N4IA 4AQ8C 3ARDA 5AZEH 3CNKA 2ZDIA 4R5VA 5E6ZA 1TQCB 4G72B 3B9DA 4LKXA 2A0LD 4Q56A 1DVTA 4RGNB 5L0QC 4RLDA 2IPUG 4PY8J 1TNNA 2X0UA 3JYBA 5CD5C 5JOFB 2DQJL 4EEEA 3OE7G 5K1XA 4X6EB 5I66A 1E50A 5ALBH 2BHZA 5CEYB 5FV2A 1WG3A 5C09B 5I1AA 3I9AA 1JWUA 5F2FA 2DQMA 5EOTA 4Z7WF 3A8TA 4Y0GA 4PV9B 3FPXA 2QHRL 4DV4B 4X1YB 1HWWA 3IFXA 1L9TA 3CSBA 2DD8H 4QKXB 4X0KB 5HJ3A 4I48B 3RY6C 4FZ0A 2ARJB 2GC7C 4MMYA 3D36C 1TU2B 2OP4L 4QRUB 3CPWU 2EDYA 3GXDA 4J3BA 4NZJA 4Z7UB 4Z7VF 3ZKND 2XNAA 4V33A 3EJZC 2OMTA 4RFEA 1FJ1B 4Y4HD 4A38A 4ZO7A 1MOEA 3TC9A 4B3MB 3R65A 3PQYD 4JPKH 4YSEA 3H4HA 4KK5D 3AEIA 4K15A 5FK9B 4G2KA 1CK0H 2YBGA 3L3OB 4H2AA 3HZVB 4I5BA 4KKCD 2FB4L 3RGVC 1XF2B 4L23A 4FK5C 1RPQA 1YJDC 4JZJA 4ONOA 2VE6A 3RWGB 4ZFGL 4ATWA 2P8MA 3S2CA 3ZRCC 2X4OB 5D7JC 3LH2L 1I9JL 4ONHB 2F68X 2PYED 4X4ZA 4J8QA 4KHXL 1ZT1A 3KKYA 2DLHA 2UWEA 3PIQA 1J8HB 1YNTA 3D34A 4N0UB 1ZLSL 1OM3H 4A6YH 4BH7B 5L4FA 2PN5A 1K3ZA 1NTZH 4Y9FA 4X80L 1Q9OB 4Z6AT 2GUOB 2RR3A 4AW7A 2QDOA 2HAZA 4OF6A 3TNMB 4ZMVA 1JG9A 5I0YA 4JKKA 1YNLH 5F1NA 1VQ5V 1E28B 3VE0B 4JV5O 1NCDH 3AC0A 4KK5C 3IU4H 1MFEL 3O2DH 1QOKA 4KVPA 2A9CA 5F9JB 4NM8L 4PRDB 3N91A 2CHNA 2B59B 4MTOA 1V3LA 1BQ5A 1XF5A 2NY5C 2VLRD 4UCRA 3OV6A 4P5TD 2XZQH 1NOFA 2QTEA 3EFOA 3CFEA 1OPGH 2YR3A 4QYAA 3ZMZA 1A6WH 4L5FL 5KW9L 4G9FD 5AZ2H 3MCKA 4KRMB 4F8LA 2ENQA 1YAIA 2EO9A 5I8EA 1L6PA 1JGEA 4NO3A 3RFZA 3QEQD 4IDJH 1DJWA 3ES6B 4HJSA 1N2RA 5J3HD 2IH3A 4PCTA 1OHZA 2K8MA 1SYVB 3JTBA 3P4OA 5DJXA 1J8SA 2LVCA 2BNUA 1PZ3A 3ULVH 1UASA 3I3DA 4QAWA 5H9CA 4YDLC 4LFAB 2PR4L 1AFVL 2BP3A 1RCYA 1NGYB 2H32A 2W9DL 3LVEA 4GAJL 4GBXB 4JFOB 4L3EA 3UFIA 1S7XB 5C9JB 1NA8A 3U9WA 3VCLA 3GS7A 1A4BA 4EKJA 3S37H 2JJVA 1NAKH 4F8TA 1TJIL 3K9SA 1H3TA 3NIDE 4HPOL 1UATA 4KZCA 5AVQB 5JVDA 3OXSB 3OD4A 2FSEA 3NRFA 5ICYA 3H1ZA 3FB5A 2VXQA 4MCYA 1IT9L 1WAEA 4J12A 1A7OH 3VRIB 3ATEA 5D5QA 1CFVL 3A22A 5AOLA 1TJHH 2DKSA 5EA0L 4EFEA 4FFZL 3Q8FA 1KGXA 1BYNA 2TRHA 1BQHG 3DPDA 4ZQKA 5T3ZH 3STLA 2I9TB 4NBZB 2DEYX 5EORL 2X4OA 4XPHL 3WN5A 1MIMH 1E9QA 3QJZA 4DP9X 4A7GA 3VFNA 2MTAA 3QG5A 1H38A 3HE7C 5LAXA 4N28A 4ZXBC 1M6OA 3AY4C 4A2GA 1Q9OA 4K3AA 1OP9A 3F7RA 2D3OW 2NY6B 2BP0B 2ZTBA 1I94O 2W8CA 4F7EA 4OLZH 1KYOF 3CC4V 3O9WD 2YGPA 4G5ZH 5BRZA 1K9TA 3NGBC 4YHHB 3PWPE 4Q89A 5TH2A 2HVJC 5F1SA 3WD5H 5HPMA 3H3PL 4FTVE 3FHAA 1OHQA 3GUTB 5GHWH 1CG9B 4JO3H 2ZUYA 5D96B 5KS9A 3EGDA 1SQ2N 3KYMA 4NQCE 4BEIA 4O5LL 3IK2A 3MO1A 3U4AA 1T5EA 3RW0A 4DKFH 3K6IA 5HDBE 3ZGIA 5ADOH 1SM3H 4IRZH 1YEFH 4D9LH 2X88A 1ZXKA 4GT7A 4AKQA 3ZYZA 1BVOA 1U93A 3NN8A 1NFKA 3PDOB 3HRZB 6CGTA 3HB3D 3MV7D 3CHOA 3QHZH 5IVXA 3L9DA 2V9QA 1GZQB 2PKDA 3F5TA 1KC5H 1NJ9A 2YMTA 4S1QH 3KLSA 4PJ9D 3NCWA 3PDGA 4PJCF 5ECJE 4N20A 1SERA 4HNAB 4ZBJA 4L4TE 2XACC 4ZMLA 1Y4MA 4N0YL 3NESA 1REIA 5H2BB 4PGCA 2VRZA 1OKEA 1KIUB 1ODUA 3Q8AA 3QXWA 1AJ7L 4U1NA 4W9FC 1OP3K 43C9A 4L3CB 4DVRH 1N18A 5IW6B 2YMXH 2C7UB 2DBLH 3OKMB 2J21A 2Q68A 3LPPA 4BZ1H 2L7EA 1WJZA 1QSEA 1E5YA 1QR8A 3FB8B 1F56A 4LCWA 4LK4A 1LQSR 4BZ2A 1YTFB 5IMLB 4W9IC 2C3HA 3GSWB 1SBSH 3SJQC 1WGOA 1B3IA 4JRLA 1P49A 1OAKH 2EE3A 1O9GA 4NPJA 4Q9RH 2EIKC 4OZIB 3LVTA 5ENWB 1U8NA 2NR6A 3OKLA 1WCBA 2WVVA 1VFMA 4FX5A 3TH2T 4U49A 1J9TA 3TTSA 3V5KA 2ZUTA 1AXSB 1PSKL 2FWUA 1I82A 1IEBB 4AYFA 1A9EB 2H7WA 5DRZA 2HG5A 1V05A 1VQ7V 1AKJD 4WHTB 3TS8A 1SZTA 3ILPA 4HEME 2VN3A 4P2RA 1Y0LB 5CBAB 2H8PC 1OGTA 4BXVA 3CN0A 3SDDA 5EWIL 2WWWA 4ZOAA 1TTUA 1HSBA 3GUTA 4FABL 4JFHE 2RD0A 4R2GD 1MCRA 4NLAA 2XX0A 3ZW3A 3FOMB 1D5IL 3CVBA 1V7NL 3B2UC 3FQRA 3W0WB 2VLMD 4MQXC 5GSVB 5EYPA 4X5PA 1RIVL 3E3QC 1MDTA 5EEXA 1KCVH 3K5SA 2HTLD 1KCKA 1MFDH 5E08H 4PLKD 3VXRA 4XC1L 1EXUB 2BZ7A 2WGNB 4ORGA 3RPBA 4E9QA 5I1IH 5D1XD 5E6ID 3NZSA 1FJGO 2Q7YA 2EXYD 4JANA 5HHPA 3IS0X 4NEHB 4JO2L 4KXZH 3UJJL 1WRFA 2ZNJA 4FCAA 1RFDH 3RYFB 3UCSC 3K03A 4DR7B 1IZKA 2O4EA 2YUXA 4OIAA 2ZOUA 1RPUA 5CN3A 4Y2NA 3I85A 3HFMH 1SJEA 2UUCO 4PGBA 3DTXB 1NANI 2GAZA 2IXQB 5C0CB 2HFEC 2WQVA 2EXWD 2VNCA 4OLEA 4XWOD 4WJG3 1C7TA 3MGOB 3DYOA 1AZNA 5KVMC 1ZSDA 2WYHA 4M6OL 1LR1A 3KHOA 4XNZB 5AOIA 3PL6C 4OT1H 1U3JA 4OLWL 1S5IL 5HD8D 2DRUA 1ZWIA 3P11H 4BSWB 5GSRB 1D5RA 1F4XL 2QSVA 3QDJE 3L3DB 4MQTB 1QO3B 4QXTA 4LCWD 1MMMA 1MCWM 3QHTC 4QY8B 1LEIB 3GSXA 4NQUA 3QORB 5EUOE 5DJZB 3HJEA 1I9EA 4KXCA 4W6XB 1Z3GH 3L1OL 1BQLH 1V10A 1ND0B 2KT6A 3QUXD 3IDUA 3RYHB 2QKSA 3J80N 1S7QA 1SFHA 4PD4F 1A8JH 1Z6JT 3C60A 3G6AA 3T8VA 5IFJB 5D93C 1AD0B 2AXGB 2Z5UA 3KLLA 4H25A 4FYTA 1V55B 1CFMA 2BY1A 1OQOA 2PPCA 4MMXA 5HI4C 2WVVB 4RFOL 5GS0D 1I4FB 1ZLWK 5I0VA 4O2FB 1MAMH 1JPGB 3QPKA 5E1QA 3BPNC 3RVWC 3K2UH 4JO5A 4HC1H 3E35A 3FT4B 4ZYKB 1NMBH 3AACA 4OZIF 2XDHA 1MWAB 1FDLH 3KJ6H 4Z7WE 2WIIB 2Z35A 1ZHLB 3GS0A 3RYIB 4NCC2 3MV7A 3RUGA 3GRWL 5IROD 1CL7I 1JYNA 3U1SL 2OSWA 3EFFB 4DH2A 35C8H 4XPTL 4JVPA 4PDLA 4PS8A 3EW3B 1E8XA 5DLMH 3H2WA 3DUSB 5TK4A 4UAOC 4KK6D 1UM5L 2YAHA 4P3CL 5FA4A 1URLA 4EOWH 5AALA 5IVXB 1IGTA 5EBWB 3BP7A 1U0QA 2AABL 5ETUB 4X9QA 2OL3H 1BXVA 1NMAH 4GSUA 4AZ8B 5KSBE 2VXSH 3I6KA 4ZJ9A 2ZYHA 3VACA 2ESVD 3BFOA 3K1KC 4RMRA 4FLWA 1XO8A 4AVJA 3TEZA 4H44B 3SOBL 1UH3A 2VRAA 1LO3L 3GWKC 3F7YB 2F7QA 2FVNA 4OFKA 2MNUA 3EUUA 4BCYA 1JV2A 4OZ4B 3DX2A 4JGMA 4QDGA 5IWAB 4CW1B 4N2IA 1PNDA 1YEDB 5C8YA 1KIPB 4G9FB 4P9OA 3LN5B 4RRPG 2A3QA 5L2KE 2LP7A 1DLFL 3ZHLA 4YXHH 4EN3B 4HPYH 2H3OA 2LLLA 3BQUC 3KGRA 1DCEA 2E7LA 3AXIA 3DK2A 4JRXA 3ROOB 1JRHL 3BH9B 3UH8A 4TSAL 5MHSD 4NQDA 3L4UA 4WW2B 4O2BA 2GABA 2YARA 4FQ1H 1BF5A 4JAUA 1EMTL 1XGTA 1ETB1 1ZHKB 2IAMC 2Y2YA 4OLYH 5TF1L 4ZX4A 4QY8A 4LF4B 3FSAA 1SYSA 4FE9A 1SA0A 4GX0A 3CCHA 2GBVA 4HUCA 3ZIMA 1JK8A 1YYCA 1V5JA 4X8GA 3L13A 3MRBB 3TV3H 1X5FA 1UC6A 2E27L 1NM9A 2ATPB 4QGYA 4NO0B 2ZCEA 4XWGL 5E2TH 1A6AB 3U82B 4F15B 4LT7A 4YIOA 2C9XA 1HR0O 3GIZH 4OLVH 4UQDA 4BFKA 4CADA 4S0HA 1L1FA 5D1QD 3RTQD 1J10A 4XCFL 3DMMC 4XNUH 3DRQB 4U6HB 5IJDC 2DTML 4M4RB 2N04A 1XREA 2OCCC 1I1YA 3GZKA 3SBWC 4E5XB 1RZPA 4N2HA 2LU7A 2DQ3A 4XMWA 2P43B 3GHPA 5AENA 4E9TA 3ZSTA 4G71B 3AQXA 5ADPH 1BOYA 1EXUA 2JTDA 3CZFA 3NIDB 2OJZH 4V11A 1KB5B 4UT7H 1WPBA 4PTUB 2KKQA 5DZOA 2HRHA 4UQIM 3GO1L 3SDXE 4NQSB 2X4UA 4YMPA 4H8VA 4KJWD 4PQXA 1RJZB 4PS4L 3W38A 5DK0B 1I7RA 5D5ME 2Y06H 4LDOB 4NUGH 1P2CA 4MNGB 4H88H 1WS8A 1FZMB 3F85A 1ZANH 4NZTL 3ABTA 5C0JA 3S88H 4B3RO 3WKML 1GR7A 5HGHB 5L2JB 5KVFH 2FSDA 1DBBL 4UT9H 4LWSB 5LMNB 1RUAL 2R7EB 2IANE 4GKOA 4JO4H 2Z8VC 4XPAL 5IBUG 1TA8A 2YMOA 2OYLA 2JDIG 1VERA 1GCYA 1PD3A 4HJ1A 3HKEB 2JK5C 2A77L 4HGWA 3HG0A 1SOQA 1ILSA 2EZOA 1FCGA 4OCSL 3L3DA 4FHKA 4X80H 5E23A 5KVEH 3T4AC 2HT2C 4IHOA 5GW7A 5ACZB 1Z1WA 2ZKMX 5LGNA 3AT0A 3UPRA 5C3IA 4GQ9H 1NICA 3L5WA 3R0MA 4AJVA 3AQYA 4FKEA 4IIJA 5AW8B 3IGLA 4NERA 1IC5H 1JBJA 2UWEF 1MFEH 1FL5A 2CO1A 3FN0L 3PPEA 4X6DB 3FT2A 3P4MB 4TSCL 4A55A 1R75A 1F3DH 2NDFA 4M5TA 3DXRA 5ESQA 4WI4A 5FKPA 3VGEA 2XWTA 4TL5A 5I16A 4Q7DA 2JJ1G 4HJJH 4LP5A 4U3XA 5FA3B 3BCCH 2NNAA 2RALA 1R5WB 4GG6B 1ZHLA 4LU5H 4KZEL 2NY6C 3CBRA 4PRPD 1N6QH 1X4XA 2J2ZB 3QXAA 1X5AA 1MEXL 4ODHL 2X44D 3BKJH 4ZS7H 5K9QI 3GBML 5LXVA 2F74A 3BWSA 4PA3A 1IU1A 5CHNB 1RIHL 2QPFA 3G67A 4QRTB 2XVBA 1RU9L 1JD7A 4DR7O 1T5WB 2M6YA 2O26U 3K80A 3QP3A 4P49A 1IFGA 5D8JH 3HKCA 4XXWC 1DUZA 1HFUA 2J1XA 4M7JL 2WAMA 5KANG 1D9KB 4UTAA 5E8NB 2QSCL 1QLEC 3DVGA 3KM1A 1SN2A 4M9OA 1GYWA 1T0PB 2W07B 4XI5C 3VNZA 5IMMA 5DVMA 4OFIA 1NAMB 1TDQA 3SCMC 3R66A 2DTSA 1NEPA 4IRJB 1MW3A 4LCIH 4PR5B 3U7AA 1P2CB 1PMYA 4PVMA 5D4IA 5K33A 3OUSA 1Q72L 1VQKV 1S5LZ 1BWWA 2NZ9D 2OBGA 3P0VH 3QWRA 5ESVA 2W0XA 4KVNH 5IEHB 5T3ZL 4W9ZA 1VIBA 1G9NC 4BXSV 1K3IA 1IGYA 4LXFA 4G8EA 1KY6A 3OKKB 1GXEA 2XN2A 3FQUB 2ILMA 3T0XA 1MIML 4KOCA 5EPMA 2CRYA 1E2VA 4TVPE 3FF7A 1LVEA 3U83A 3JALB 3ARVA 3V6ZB 2V2TA 1T4KA 2H26A 2RCSH 3CXDH 1CGSH 3VD5A 2XETA 3NN8B 2H4EA 1ZT7A 4FGMA 2IWGA 4G5ZL 3GNMH 4IIJB 1FFNB 1HNWB 4RMUA 4X8XA 4KUMA 3T1FA 4ISVA 1G6RH 4K8RL 5HHOB 2YD6A 2GDSA 2V1DA 1XB6A 4QPEA 4X5LA 2XKNA 1YC7A 5MEQB 2R4RL 5IJVA 2FWOA 2QQNL 3VFMA 3N5AA 4YZFE 1KNOB 1HNYA 5C86A 2D3VA 4F8NA 2WQWA 4K71B 5JQGB 3OR7B 5IFAL 1QVOA 1X44A 3APFA 5HHXH 1YNTF 4B6ZA 5BR8B 5BMVB 3KNBB 3OQRA 5EDXA 3DHUA 4DFHA 1IDSA 5DS2A 2QKIB 2CCLA 1ZLUH 2X1WL 4ZHQB 1Q0XH 4URKA 3LJ3A 3ARBA 2APFA 3KPNB 2HX7A 1OB0A 2V3EA 4FQXD 5DVOA 3QUXA 3ZHDA 1JXFA 5A2BA 1BD2D 1JPEA 2HTKC 1ZSPA 4MJIE 1TQSA 4FQQA 3DC6A 1CZ8H 2PCPB 2EXYC 4IIQC 1CDGA 3W9DB 3OEEG 1FV1A 3EFFK 1XIWC 2AKRA 2C4XA 3CP1A 2QWPB 1BBDH 4QNPF 4Z7VA 5DD5H 3DJRA 3U7YL 3FN9A 3VI4E 2ZWNA 1LEGA 3JVGC 4RZKA 4V1DA 3T0AA 1Z5LB 4RESB 1YRKA 3QJUB 5CKAA 4HPHA 2XTLA 3QJOA 4KV5F 5JO5B 3IAYA 2NZ1A 3CXHK 1XDTT 3UO1H 2FDBP 4JG0L 4BSVA 4JGUA 3QS3A 5IW1A 1A2YB 1EA9C 1IB5A 4BWUA 3G80A 4Y2OA 1LE9A 1D5NA 2JH2A 2VDPB 4G8GD 4J3WA 1ZTXL 1X4TA 3HOGA 3QUHA 4ZTPL 2XWRA 2WO2B 1N0JA 1PL4A 1YMHB 1G7QB 1B4LA 4J4PA 3CZSA 1IKFL 3VNYA 4IBYA 3TVMD 1VARA 2YPLD 1OGPA 2EUWA 1CFSB 1NC4A 3IDMA 3L5WB 2PABA 5JQ6H 3N43B 2YPLB 4P5MB 2ZT9C 1HI6A 3CUPB 4IOIA 1T4KB 5JHBA 5B38B 5E6RB 4HCFA 1MRCL 4YQXH 3FT2B 1NCCH 2YSSA 3DGGB 3ZIAG 2X38A 2VWEC 1NH2D 3ARDC 3RVYA 3TA3C 3R0NA 4ZODA 4RMBA 4YPGB 5CU9A 3L70H 3VXOA 3M8AA 4Q52A 2N7AA 4CNIB 2ADJA 2B3IA 4WTZG 4DOHE 4MFHA 4FXKB 1QA9A 2AQTA 1OM9A 4O4IA 2FWOB 3VFMB 4WFHD 3X14B 5A2KH 4DSYA 1QO3A 3HHSB 3VFRA 1RIUL 3BPCB 4R8WH 3H3BC 3W7TA 2OWOA 3WTWA 4HIEA 2UU9O 1UGNA 5EU7E 3UJJH 2EIBA 3MV9E 4XBFA 1A7RH 1X5HA 1B3JA 3QORA 4X89A 1IKOP 1RULL 4H8QA 4HBQA 4L2YA 1R6NA 1HAUA 3BPZA 2CNYA 4OB5H 3L3HB 3T0EA 4Q14A 4LF9O 1OAYL 1M93A 1ACYL 4OF8A 1AHMA 1HK6A 4EIUA 2K70A 5F3HA 1BT8A 3WIFA 2C9UA 2DWTA 3V0VB 3WTVA 1NCJA 4PJEE 3X2QB 3WFVA 1JGDA 2HJLB 1U8JB 2KC0A 3KXFB 1WYJA 3MRHA 2ICEC 2YK1H 3H9ZA 3NP3A 1CR9H 4PDRA 3FU7B 2N7SA 1SLWA 3SY6A 1CLOH 1LEGB 2BIQA 4JRYE 3UEQA 4WHYG 2P52A 1KTKE 1CBVL 3L08A 4OCXH 2J6EH 1ZVSB 3JWNG 2Q6WA 4AIZB 1TTFA 3OPZH 4Y2DC 2MW2B 2RFXA 3U2IA 1JHKL 4JHBA 2PXYA 1WS7A 3M07A 5I1DB 1HE8A 1CGVA 1GZPA 1I3RB 4HDIA 4JCLA 1AAJA 2JK5A 2MTPA 2AQ3A 2YXMA 3MSPA 3GMOA 2EUVA 4LIQE 5JQHC 1JDDA 4F57H 3O3AA 5FGCB 4KMTL 3L73H 1BJ8A 1NUFA 1XOUA 4RMVA 4DKDC 4LLYB 1PYWA 2Y5QA 1TVBA 3CDCA 4RX4D 4LSPH 4BM7A 2GTWA 2VB5A 1Z9PA 3US9A 5IQNA 4OJCA 3D2UB 2R23B 3BZEA 4GRLC 4PJ7B 5KG9B 1BEYL 1FZKB 4FQLH 2Y1AA 2YJLA 4RAVB 1WZMA 5HJBA 3NIFE 4JDEA 3TBWA 2IGTA 3QIWD 2X3CA 3HI6H 2PTMA 3WSQL 3L3IA 5C2BH 1OD7A 5A2IH 1TAEA 3FQ2A 4A7TA 4UM9D 3ARWA 1FFPA 5GISH 4KTEL 3S35L 4ATTA 3S8FB 3I02B 2PYJA 1QSVA 4OGXL 2BK8A 2FT8A 1TENA 4EBQH 5C07A 1DQTA 1HXYB 4MSWA 1YDPA 2XPGB 4NKOA 4NRZB 4L05A 5L8JB 4GCZA 2ID5A 3MNZA 1DQJA 3L9BA 2VAAA 3ML0A 4HUWB 5IBTL 2RHEA 2YUZA 4LLQB 1SHMA 3CVCA 5B39G 4E9LA 1II4E 3TZVA 3V5DA 2EDEA 2GI7A 4Q9CA 4HJEA 3ZRXA 4U1SA 3WJMB 1K7DA 3AITA 2QEXV 5I8KH 3VXSE 2CDYA 4UV9A 1JGVH 2OKMA 1H5BC 3PL6D 4PRNB 1DEEB 2HT4D 2OCCB 4FKKA 1M4KA 1VF6C 5CCKL 5DT1L 3OVUB 4X6EA 4XDJA 4B08A 4L8SA 4NS0A 4Z7VB 4LF3B 2DIAA 4RGMC 2CMRL 2NNCA 5AVVB 2WLIA 4JJ5A 4K3JL 4AK1A 4Z3FA 3MRCA 1FS0G 5DJ8A 1EPFA 1KJ3L 1JGDB 4X62O 1J9QA 1KBWA 4MW8A 5DQJB 1EJ6A 1ORSB 4RNRA 5I8OH 2ZOLB 2Q8AL 4NR1A 1UZ6F 2HH0H 5CLXA 3HJ0A 3HNSL 4HJGB 5G5DA 4ZFQA 3W2DL 2KB1A 3X12A 3MFFA 4GP4B 3MCYA 4XXDB 1PAZA 3SKNB 3IFLH 2I27N 4HCRL 4WK4B 1J18A 1FSKC 2ARWA 1HXMB 2G5RA 3OZ9L 1SRDA 3MLUH 2VN6A 4PLJD 2ZSWB 1U9KA 1QR9A 1PLCA 5HVHC 4ABQA 2VLJE 4J10A 1NGQL 1VGKB 1FYTB 4LSDA 2AHYA 3HPJA 3LDCA 4OLVL 4U1GC 3IDYC 3LV3A 1X5JA 2EACA 2H6PA 3AU0A 3QHFH 1T3FB 4RBPH 5FDWA 5IOPA 1K4DC 3VXUB 4C56E 5I2IA 5DEJA 1WAZA 2P8LA 4PSRA 5FYJH 1HWHB 2DQCL 5DMKB 1IUZA 4PD4K 2ZD9A 1UPGA 3MV7E 1V55C 1IILE 1Q9KA 5E6IC 1VEWA 3ZTNH 1NWOA 3EKCA 3WG7C 4KAQH 2F15A 5FS5A 2OM5A 3V0FA 1J0KA 4D7TA 3GXMA 4I89A 4K4KA 2EINB 4GW5A 1N5AB 4OFQA 1QR4A 1DL7L 5DWUL 1SN5A 4JI6B 1GOGA 2GSGB 2KS0A 1S9XA 2F5BL 2BC4A 3CMAV 5GRZA 2J7LA 3JWNE 3U36B 3E86A 5LGTA 4NXMO 1AB3A 4P5KB 4CKQA 2ZWLT 1EUTA 4KROB 5TDNA 3V8OA 4PJHF 1F4HA 4R96A 3SQBB 1I94B 1QNZH 3QJQB 1HL4A 4FXKC 3CCEV 1KN4L 2MWCA 5EZIH 4B0MB 3KPMA 1NR1A 4J7KA 4P30A 2CTQA 4DO2A 1OHHG 4XB7A 1CD1B 5F21B 5JCOC 1I1AB 2WUBL 2DQEH 3KPSA 4UAOB 1N34O 2CUAA 3WIFB 2B8OT 5B4MC 5B7FA 3KPQA 5DEDA 1OSZB 3F05A 4RUFA 4X8AA 1RUAH 2D7TH 3UJTH 1LK3L 1FAIL 1M4UA 4OIIL 2VUOA 5FYKL 4FQXB 1RZKH 5D7LD 1QRND 3E9UA 4AXWA 1F4WH 2NY4C 4LLMA 3WTSA 3GMPA 4TV9A 2FTKA 4OCSH 5K1VA 1U4EA 2DAVA 2JKRM 3NR7A 3IMWA 1FNEA 2PY5A 3ULUL 3EYSH 3G5ZA 4RAUB 3FH5A 1XBLA 1T2XA 2AK4B 4PJBB 1P5UA 1PKQA 2PCXA 1WBYB 4Z7QB 4PY8I 2WCGA 3PL6A 1IC5L 3PN1A 3NCJH 4UIKL 1L9RA 2B16A 3DX6A 1MAKA 5J12B 2PYFA 4G6JL 4HWBA 4JRWA 3MUUA 4HAGA 1TYJA 2G75A 3B3IA 3K4DA 2HJFA 3HKCB 1ZDQA 1TVBB 2ERJB 3UT5B 4OX9B 2XQYK 3ULVD 1NBZA 5FW7A 3T2QA 1GRJA 2DYPB 4NN7C 2W5PA 1E67A 4I55A 1B2YA 2D03L 2VH5L 3B7RL 3PGCA 4OCMC 4RAVA 4EN3D 3BKMH 2VLME 3PWLA 3ETGA 1QABA 4M62H 1TVHB 1OTUC 4LU5L 1TEFA 4FULA 1JCVA 2PCFB 2YZ8A 1X59A 4AYGA 5E9DB 4ADIA 3SOTA 3ZRWB 3VQVA 1ZSDB 3TP4A 4J9YB 2HUEA 3BAIA 1CPUA 1QKZL 4HFWA 4ABVA 1RIHH 5JHMA 4DVRL 5B8CC 1QLEH 1LO5A 1XSIA 3EF7A 3QNXA 4LFHD 2Q8BH 4JI1B 3T08A 4NP4L 1AI1L 2C5DC 2DMKA 2Z6FA 2B9BA 2BHUA 1JVLA 4DV5O 1GRWA 1QR1A 1WO2A 5D6CA 2IU3A 4UQ2B 1QEWB 2ADIA 5G4NA 1EEYB 4U3HA 4A5UB 2OW6A 1XIWA 4P2OB 3HAEB 4XX1G 5EEWA 5E79Z 1ACCA 1JF1A 1GHFL 4W68A 3IEAA 4JAAA 1O9ZA 1TKWA 3QUKA 5HHVL 2GHYA 4DUZB 5HGDB 1JUFB 4IU3B 2AV1B 3RKDC 1Y6XA 1U97A 1RZ7H 4U4IA 3QIBD 1M7DB 3HRZA 3ZMEA 1E5AA 4GUPA 5J9PB 5C08A 4MQ7B 5A2JH 3N04A 1P4UA 2K3TA 4CSPA 4UDTB 2Y0SA 2WQUA 3LTVA 4GRWE 2UXTA 1T0NB 3BMVA 5JLZA 3SDXB 1VFOA 2F53D 4ZO6A 1YZBA 1P4LB 1H6UA 4LP8A 1NGWA 2EICA 3MPCA 1EZVH 4YEFA 2JI3A 5HTSA 3CX5J 3QUXB 3NT0A 4KUCD 5INCA 4DV7B 3I75B 4M5ZH 3L5XH 1DE4B 2IDUA 4JN2A 2UXGA 1U2HA 1QPXA 3RU8L 3SDCB 2PP7A 1BQKA 4D9RD 1Q38A 1OGAB 1P7GA 1OW0C 2EH7L 4DN4H 1PKQE 2XBTA 5EO9A 4LFAO 5EZLA 1J48A 3OX8A 2MCMA 1QFWH 4AE1A 1CLVA 1D5MB 2Q0OC 1RZFH 4FA6A 1MREL 1WH0A 4NT6B 3GSQA 3CSPA 5KAFZ 3S34H 3M1CA 1T2JA 4U1JB 4NQCB 3TBSA 4JDZA 4AILC 4BUHA 1AGCA 3IFOB 4QPJA 5F88B 2E3VA 3UZVA 4HK3N 3VG0L 4ANXA 2NSMA 1BXAA 5ITBL 3ISWA 2KI6A 4PG2C 3FTWA 3PWNB 1TQWA 4FA7B 4BHUI 2HX8A 4GINA 4N26A 3TA4D 3ML8A 3RWIB 4MA7H 2QJDA 4PRAA 1T03H 1G7QA 4FTVA 1WIPA 3PWPA 4PJEB 1CXIA 4TULH 2P28B 4FLHA 3TCLA 2P8PB 3GSRB 5A6IA 3TURA 4CC0A 1HILB 3E38A 1CZ8L 2BNUB 3FW6A 4PCSA 3QULA 5C0CE 4FXLA 2YD3A 5JW4M 1E4HA 4AL8L 2EINC 3WTXA 4HVBA 4U7OA 4KO5A 1NGYA 4JFOA 3WL9B 4IOIB 5CEZL 3BCDA 4XNAA 4GRLD 4MJ5A 1CT8A 4ETQA 2JEUA 3T4ZA 2CLZA 4N68A 5C6PB 1NDGB 3RL1A 5IHUH 3LHPH 1IXMA 4NWUL 2FAUA 3VXOB 2PW2B 5FCSH 1H2NA 4KHTL 4F8OA 4GW4B 3LQAH 5LN4A 4EZKA 2CHDA 4HZ3A 3OAYH 2VDRH 1RPKA 1ZTXH 3GB7A 5LG6A 2KUTA 2UUCB 1PZSA 2FQFA 2OYKA 1N4CA 3RJOA 2B4CC 3V4VL 4ZS6C 5TE6L 5KBLA 3KCPB 5C6WH 5CSGA 5I23A 4HF5L 3ULUC 3IXAA 2AXFA 4R5TA 1N4XH 2C1OB 1JOYA 3MRDA 2ZUUA 1CDCA 5IK3A 1P7QA 1VPOH 2E59A 1BGXL 1THZA 5DRWB 1DEDA 5KYNA 4GUNA 4A6YL 1W91A 1AQDA 4PV8A 5JW4Q 2DQFA 1F42A 3BT0A 3CCLV 3DJZA 3E6HA 2H1XA 3V0VA 3UTQB 4EEQA 3PJLA 1ZWIB 4U2YA 5JHAA 2PYEA 4CS4A 5HJDA 3RLSA 1S4IA 4G7RB 5I1HH 3RQ3A 1XR8B 2NSQA 5I17B 3R06A 4OAWA 1NS1A 4ZW5A 4F20A 2CDEB 2AP2A 5L8LB 1RIUH 4X0NA 3AM8C 5SX4H 1VACB 4ZFOL 1FVEA 4XNQA 2IPKB 5FLXN 1B88A 5EV7A 4BFIA 5BO1L 1KKDA 2AQNA 1AS6A 3FQWA 2PYLA 5AZ2L 1EJFA 2GIYA 3CCVV 3L4XA 4QHKI 4JTCB 1GZPB 4HDIB 1I1RA 3UAJC 1UJWB 1ASQA 3HB3B 4GT1A 3NCEB 2CA3A 3FQNB 1K97A 2IADB 3HI1B 1MCSA 5CJQH 2XUMA 4JI8B 2OLDA 2IAND 4ZDHA 3O3AB 3HKDB 4NN5B 1MCJA 3MJ9H 2ESVB 1DO6A 3NRPA 4P9PA 1CR9L 2VZUA 4AV4A 4PJFB 5GGSB 4GAJH 2WBWB 3Q8EA 2AV1A 4JG1H 4Q4IA 3WGUB 4YSCA 2R27A 3QQ9C 4HYTB 3ARRA 3DVIA 2IQAA 2E86A 2WVUA 4NUPA 1U3ZA 4PG9A 4YHZH 4JFDA 3QDMB 4HUXA 4UM8A 1KEMH 1O5DT 2Z9TA 2A6KB 1AJPA 4LH6A 1EEQA 1FXVA 4N8PA 4FDWA 4MJHA 4NKMA 5K39B 5B3JE 1CFVH 4K5OA 3BFQG 3ZKQD 1F6LL 3DX9A 2H2PD 5FGBA 1QRKA 1OCWH 3MBXL 2YC1A 2NY6D 2D3LA 2D7MA 2XWDA 1G1YA 2XZAH 3KCWA 5BQDA 4B0MM 5ISZB 5C3LD 1P4IL 3F01A 4K23H 3BPOC 1DQJB 1Y74B 2WBJA 4OXSA 1WD8A 1DVFA 3CSXA 2WOBA 5FO8A 4QO1A 4L3FA 9PCYA 4PJ8A 4EI5A 4L87A 4YHOL 1K8IB 3ZQ9A 3R8BB 5LBVA 1AS8A 2G9KA 5D7LE 1HEJC 3RYHA 2MQ0A 1OTSC 2AJYL 2FJGB 3P4NA 4PI0A 4O4YL 3KLQA 1D6VH 5CILL 1E4KC 2HRLA 2ITEA 4YJ2B 4JHVA 3IFOA 5F88A 4PRHB 5LA6A 5INDB 2Q20A 2NUTB 1K8AW 5SX5H 5ESVB 4AG4H 2W92A 4UVBA 1M9WA 3B9AA 3WEBA 4O2CB 1Z32X 5D55A 2Y48A 1CS6A 3VI4F 4Z78A 4S1SL 4L8CA 3VYNA 4YHHO 5I71C 3J81N 3IAPA 4JFPB 4LF9B 3MJWA 4M93C 2F0CA 3IDJA 5EU5A 4ZUTB 2XTSA 4LNUB 4XXDA 2R8SL 3B2VH 4K0KO 4PH8A 4Y19D 3VG9B 1E4XI 6PCYA 4F6EA 1NTDA 1WEJL 4MZIA 3WDJA 2ZX7A 3T0DA 1JQ0A 4DRXA 1K4DB 4NYKA 3CBKB 1FI8C 2VDQH 1HNGA 4K2UL 4JCMA 1SJHA 4K94H 3GTTA 3ARFB 3M46A 3VU2A 2Y36L 5D7JA 5H35A 3RWDA 4YBLB 3Q2CA 5DI8A 1E7UA 1JNLH 3JV4B 5GRVK 2DQUL 2MK3A 3X3GL 4LBEC 1GS8A 4KP4A 3MJ9A 2QELA 3L6FA 3RWEB 1TT6A 4X4KA 1D7BA 1WC7B 1AI6A 1WBXA 1YEIH 3SEPA 2IPTH 5C1MB 1FZOB 1HINH 1MIEH 5FM4A 2JB6A 1GZHC 4ELMF 1QWHA 3JWNC 1N5AA 2QSQA 4IRSC 5IMKA 4G1MA 3AB0B 3UCRA 3MC0A 4CSZA 1CFNA 3T77A 2Y5EA 2XJKA 2ARJQ 4F58L 2PZSA 2OMXB 3IE4A 2C3GA 3OL2A 3D3IA 3UAEA 4F91B 3VTTA 4R2GB 1N7ML 4GQPH 1YLBB 1S9XB 3HG1D 3D50A 4L9DA 1IEAB 1T1YA 3LN4A 5IIEA 1ZGLP 7PCYA 1YYML 1LD9B 3F5WA 1A3RL 4MVQA 1X5KA 4X98A 1J8KA 1CF8H 4KI1A 4UDUA 1GTFA 1Z66A 3O2DA 5IDJA 4F4LA 1XHZA 1BYOA 1H8SA 2UV3A 3HI5H 5MP6L 2QM4A 2PYEE 2E9WA 3IJSB 2JRIA 3OSKA 3WHXA 5FYJL 3LKOA 5I1AB 3O4LD 5JYLA 4BZYA 1N8ZB 3EXJA 2XN9E 5ITZA 2JJSA 3KS0H 2QE7G 3CDGB 4DIXA 1N34B 1UZ8B 4YSPA 2CAKA 2NUTA 4IEFA 1ZWIC 2W6JG 4QLRA 1S9VB 1EDHA 2RIKA 1TU2A 5IYCO 3QA3A 3P3SA 4FABH 3GHEL 4NN7B 4KO9A 1HZHL 4BQCA 2WN2A 1JAEA 5L6YH 4AYSA 3FB7C 4DR4B 3OUFA 1SY6H 1J9SA 2B2XL 4HK0A 2UU9B 2KBGA 3UYPB 4W6YB 3FTUA 2Z64C 2MEJB 3WOVA 3FCTA 4D94A 4PJDA 5AVUB 1GGUA 1VJSA 2VE6B 3HG1B 4I50A 1T04B 1AS7A 1O6SA 2SEBB 3R4DA 1YVWA 3BGAA 4F5CE 1NBZB 1CXKA 4K7PY 5AW1B 3LKQB 2OT5A 2C7FA 4YDJA 4GAFB 3UC0H 2GV9A 3MQIA 2HFFA 2YQ2A 3L6FB 3QIUC 3QNYB 5KSAB 2NXYC 4QNHB 2XBDA 3D85B 3SGKC 5JW5B 1ZLEA 4OSUL 3WEMA 3O9WC 3D69A 2VR8A 1XF4B 2HXAA 3OC5A 4D2NA 3H42H 1EO5A 4PR5A 1A7PL 4BYHA 3RZCC 3K2KA 3D39B 2CH7A 1IJNA 1A3ZA 1G7IB 1ZS8B 2EO1A 3EFDH 2R29H 4H8UA 3BUYA 1UOLA 1NUGA 2WINB 5D1XC 3LZFH 2ADGA 3MHHC 1QZNA 1JD9A 5DVLA 2YIHA 2E4TA 3UG4A 4OF7A 2IJ0C 3FT9A 4TL4A 3TESA 4MS8D 4M62L 3HVDA 1ITCA 1NL0L 2VR6A 4JDVB 4XXWA 3TBYB 4L37B 3RDTA 4NM4L 4I1RA 2AGAA 2W60B 2BW4A 3S5LB 4A1RA 5SWZD 3CPLA 4G7VL 1ET5A 3AGVA 1A6UL 4JPWL 3CVHB 1VENA 4KC3B 3TM6A 3IMRA 4P2QE 5EUKA 5LMNO 2ZUWA 1OM3L 5CZVH 4JFPA 3BUBA 1FDLL 3KPRB 3SPIA 1R5WA 4GG6A 1I1YB 1N0LA 2HT4C 5EB9A 4TRPH 3TPUB 3T2LA 5CSBA 4HX1A 4J5VA 1MZYA 2FO4A 2UZIL 3BP5B 3EBAA 5L3CA 2VXTL 2QV4A 3DI2B 4JFQB 5TFSH 3QQNA 2WXPA 2QWNB 4YR6A 1F0LA 2FATH 4UT6H 4N9GB 1EFXB 3LYRA 5INCB 1ASPA 1J95A 1EERB 5FXCH 1XTMA 3TIDA 3CSTA 4PD4J 4GG8B 2FE0A 3PUCA 5KVDL 3WNPA 2AEOA 3ABGA 4K8XA 5EO1B 3JV6B 1RZIB 3Q3GA 3P3YA 1I8MA 4B3VA 1U8LA 4EQ2A 4JFYB 2OMYB 5D93B 3FQYA 2XA8L 2QJ1A 5KOMC 4X7SL 3T4YB 5IHHA 3V9EA 4W6WB 2I25N 3B3BA 2JKNA 1P4BL 3BKCL 3F62A 4OJYA 4P2YA 3U4EA 3O6FC 3EYQD 3NJLA 3C2AH 2B9ZA 5AD0A 4APQC 4BK8A 3WB0A 1ETZB 1RSFA 1JRHI 3KPOA 4FLRA 3UC2A 3VM7A 4WFHA 2AXHA 2OIEA 2GTZB 3S36L 1WB7A 3K6FA 2YLKA 5FX3A 2V7NB 2BIIA 4GMSL 2M7WA 2R51A 4OIFA 2Q86B 2XQYA 5L4JA 3SZKC 1SEQL 1NAKL 2OMWA 4FQ1L 4Y4KC 3S3WA 1EMTH 3D18B 4HPOH 4BKTC 3CU1A 2H0F