The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
65
|
sequence length |
226
|
structure length |
226
|
Chain Sequence |
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
Cytochrome c oxidase subunit 1
|
| publication title |
Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb |
| molecule tags |
Oxidoreductase
|
| total genus |
65
|
| structure length |
226
|
| sequence length |
226
|
| chains with identical sequence |
O
|
| ec nomenclature | |
| pdb deposition date | 2010-03-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF00116 | COX2 | Cytochrome C oxidase subunit II, periplasmic domain |
| B | PF02790 | COX2_TM | Cytochrome C oxidase subunit II, transmembrane domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Helix Hairpins | Helix Hairpins | ||
| Mainly Beta | Sandwich | Immunoglobulin-like | Cupredoxins - blue copper proteins |
