3SJCC

Crystal structure of s.cerevisiae get3 in the semi-open state in complex with get1 cytosolic domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
54
structure length
54
Chain Sequence
LSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
total genus 21
structure length 54
sequence length 54
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2011-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sjcC00
3B2EE 3QF7A 2JS5A 2P22C 3SJCC 1X4TA 3QG5A 1SKVA 3CSXA 2CAZC 3SJAC 3SJBC 3THOA 3ICXA 1NT2B 3ZS8C 2F66C
chains in the Genus database with same CATH superfamily
3B2EE 3VQVA 2A9HA 2WLKA 3CCEV 4F6RA 2VRZA 1N36O 3G6EV 1ZLZA 1WA8A 4LNUA 5JQGA 2QWQB 4JI7O 3E86A 2B1GA 3IC9A 1ZL8A 5IYCO 3K5OA 1DTOA 1VF7A 1KU9A 2Q5ZA 4JYYA 3CWBH 1TUBB 2JJ1G 4GKJB 3ABKC 4GUNA 2ZD9A 2YEVA 4O4JB 2IW5A 1R3KC 3EFFK 1GN6A 4RAIA 4FMTA 4DUZB 4TUYB 2H3OA 4BW9A 1J95A 3RVYA 1M57C 1AI4A 2IH3C 2HHHB 2GSMB 1DF4A 5KHKA 3ZX6A 5TISZ 4O2BA 4BIUA 1KMIZ 3K04A 2WA3A 3UT5B 1S72V 2FMLA 3SPGA 1TVKA 4L87A 5HFMA 3JATA 5EBLC 2HJDA 2BCCH 2M7WA 4QE9A 1K73W 4PDMA 3E22A 1QQCA 5CA1A 1MG1A 5BR8B 2W6IG 4AHCA 5IYDO 1XEQA 3KCXA 3HPLC 4ASUG 3L70H 4TV8B 4IHJB 5C93A 1AJPA 1HNWB 2R70A 1R3LC 2Y0PA 2AHZA 1NVPB 3EXAA 4B3SB 2H94A 2FYUH 1X59A 2PI4A 2FTKA 4LF9O 1HNZO 3P32A 5BMVA 4RWUA 3RWRD 2BTQA 4JAUA 3OEHG 2QTOA 3F5WC 4K0KB 3U0ZA 4I5SA 1AJQA 4TQDA 5LA6B 4OX9O 2HVKC 1HP8A 3AG3C 1TUBA 1W59A 5DECA 1UJWB 3AG2B 1K9MW 3B40A 4U7NA 4GX0A 4G2KA 3H9VA 4YIOA 5JJNB 3AG3B 3K59A 3STLC 1G8MA 3JAKA 1P7GA 4UCRA 3LSUA 5LMNO 3KZIZ 4U3JA 1GMGA 4J7KA 1Q81W 3JAMN 5L3BA 2UU9B 3L72H 4I9WA 4B7EA 4PA9A 1JFFB 4LBEC 4TOIA 5L3CA 3FAVB 2ADPA 2HG5C 4O4IB 1Q6UA 5ITZB 1XQ8A 2DE0X 1Q6HA 4Q20A 4P2ZA 2PGGA 2ZDIA 3HKDA 2IJIA 1SQGA 1RPRA 2ZE8A 4JZ2A 4UB8Z 3JSNA 1IURA 2DJVA 1Y74A 1WPBA 1NBMG 1OCRB 4LH6A 1S77D 3P3PA 4YY3B 3LSQA 3UO2A 5B5EZ 3JD2A 3VOUA 2QWRB 1MOFA 4AI8A 4MVMA 4JYBA 1VQNV 2UXCO 4DR6B 4JASA 3RYFA 4HZ3A 5IWAB 5CMUA 5J2UB 1MZFA 3DGEA 1JJ2U 1SETA 1KYOF 3CS5A 5B1NA 1VEWA 2P06A 1NR1A 4D7SA 5E1AC 3ZHQA 1Y74B 2B5UA 1SERA 1HDJA 5L3GA 4C7UA 3DSQA 2YIAA 3X2QC 2JS3A 3H1IH 4TT3G 4LF7B 1Q5OA 2CH7A 1YTFB 1S3JA 3L9DA 4D6TH 1L8DA 2Z3YA 3SPCA 2JIZG 4QPJA 2FL4A 5JJJB 5KX5A 4GX2A 3SPHA 3T1YO 2ATKC 4WFFA 3E35A 5BZBA 1FYJA 4X9QA 1JMKC 4WFHA 3TETA 4MS2A 5B3SC 1YF2A 2EIMB 3TJTA 3ZMZA 4EFBA 2ITDC 2G38A 1VQ5V 1KP3A 4JI1B 4HYOA 2Z5UA 1BSMA 4CS2A 3RYHA 4NXMB 1K4DC 4UVAA 1V55B 5A9GA 4R50A 1BT8A 2CGOA 3CCUV 1SQBH 2ZM6O 4O2AA 4CC6A 1GTOA 3ZS8C 2RN9A 1AI7A 3T1HO 5GTIZ 3E8BA 1M4UA 3CC7V 1YI2V 4JF3A 4DYLA 5A2QN 4I0XB 3IGAC 4GCZA 3K06A 3D3IA 1SZXA 2Q9LA 4FLUA 4Z2WA 5CBGA 4W4LA 1AI5A 1Z5WA 4E4EA 5K1XA 4MT8A 4J11A 2AW9A 1KP2A 1XHXA 4X1IB 4QJFB 5BXZA 2LGQA 4UB6Z 1XMOB 2QR4A 2WWWA 3AG4C 4JGSA 1IBMO 2VWJA 1FJGO 3RYIA 5LMUB 4LF5B 3OTOO 1MSDA 3B09A 2WAMA 1G4YB 5L3FA 2EIJC 1NZ6A 2F4VB 2QE7G 4RQEA 4JI4B 1IZ3A 4WBNA 5BY1A 5FLXN 3MAQA 1HR0B 3QO7A 3QNEA 2B9ZA 1K3EA 3OUSA 3ZRSA 1SA0B 2BSKB 2PTMA 2GV9A 3APOA 1IDSA 3ZHUA 4JI4O 4PDLA 4JAVA 2QKCA 2W0FC 2O57A 3EVKA 3JSLA 3J81N 1AR5A 4KHPB 4YJ3B 1VQLV 4XDLA 3TXSA 3F7VC 3OR6C 1EZJA 3GVMA 2ZNIA 3CHXA 4FPPA 2PI5A 1AVMA 3N2GB 2GTAA 4CZZA 3WB2A 1PD3A 5CBFA 1S0VA 1VQ8V 1KUQA 1Q3EA 2CUGA 1QLNA 4EB6B 2E3CA 3ML0A 4B7KA 1AI6A 4I55B 2MW2B 4GKKB 3I56V 4MSWC 4EEQA 4UCUA 2D3OW 4JZGA 3ICXA 2QKAA 4BIZA 5LHHA 2XAJA 1XNQB 5JQGB 2OT5A 1ZSPA 4B3RO 2R9IA 1NH2B 3VQXA 4X20B 1IXMA 4FM0A 3B77A 3U10A 4YJ3A 1R6TA 2VQEO 4LF7O 5DM6V 3E8GA 4DV3O 3SJCC 4U3JB 5LXTA 4DUYO 2ZE6A 3W7XA 3MHHC 4BWAA 2PYJA 2CK3G 5EC2C 3CCJV 4J80A 3E89A 3T1YB 2WLLA 3CP1A 3QVNA 4OGQB 2HR3A 1SZTA 4WBNB 5LMNB 1RPOA 5JJEB 1GO3F 4QGPA 2EIJB 5LP6C 3G80A 4PA6A 1NU1H 2CDYA 4FLZA 3B8MA 5LA6A 1M1KW 2DQ3A 1NVPD 5H2FZ 5EC1C 3OMIB 4BAYA 3RT3C 4YY3O 3E8FA 5H9CA 4YHHO 1Y4MA 4NXNB 3H1JH 4J7JA 4DXWA 4J41A 1JX9A 4O2BB 5CN0A 4NTXA 4JI3O 2EZOA 1XI1A 1VP7A 3HKBB 1YZBA 2EBOA 4IHJA 3THOA 4DK1A 5F2VO 1R1BA 2WPDG 2VQEB 5CA1B 1IXBA 4DR5O 2P67A 4R6ZA 3ZN0A 4B08A 3SYQA 3GWOA 1EFRG 2IJJA 2QWNB 5LP6B 2QM7A 1PP9H 3TGUH 3HB3B 4IL6Z 4IYIA 3E8HA 1K8AW 4Q6GA 2EJRA 1QLEC 3FYIB 2DOSA 5FPOA 3ABMC 2D2CB 4LNUB 3L74H 3ZHVA 5LOVA 5FL7G 1CP9A 1XILA 4GKKO 1H8HG 2QEXV 4OPAA 3BA9A 3H1LH 1N32B 3NXSA 1E79G 5HFLA 1YCIA 1CXZB 1XOUA 3K58A 1WB7A 4PV1B 3OGIB 4FZ1A 3G4SV 2RMKB 2UXCB 1YIJV 4TSFG 4DUZO 2CH7B 4CC5A 1AR4A 3ABLC 1MZEA 2IJHA 1P4RA 5FNVA 1N33O 2UUBB 3D36A 1NTZH 1M90W 4K8ZA 1F7YA 4HNAA 1RFYA 3OT7A 5IJ0B 4H0LB 4DRXB 2F66C 3PN1A 5K1PA 1NH2D 1DLBA 4NTYA 4UVCA 4LF9B 3RGBA 5BMVB 1VIBA 3OUFA 4DV2O 4UUJC 3JARB 2XAQA 2E5LB 5CB4A 4CBCA 1L0LH 2Q69A 1HW7A 1VF5B 4ABMA 1AR1B 1XNRO 1NTMH 4X62O 5BR8O 1Q86W 1I94B 1H2SB 4O4HA 4IT5A 3BHPA 5B1BB 2LFSA 3AG1C 3Q4HB 2UXDO 1XL4A 1JA8A 3CRCA 2UU9O 4DV4O 1FAFA 1Z5VA 3JASA 1DK1A 4PDVA 4DR1O 4FLXA 3JASB 5IWAO 2ETNA 1NS1A 2A79B 1WJZA 2PF4E 3LDDA 1SQVH 1KKDA 1NKDA 4O4HB 2R72A 3UKMA 4JI0B 1R3JC 5LBQA 3CSXA 2WLNA 3FD9A 2DW4A 2Z0AA 4FLTA 2XAFA 1IX9A 4X1KB 1R73A 3QTCA 2LJ2A 1KQSU 1YEWA 2DWDC 3U11A 1X4TA 3QO8A 4I7ZB 4I4TA 1SQQH 4UCVA 2H8PC 1B6QA 2JEXA 2M6YA 2EILC 1IBLO 2WLIA 2ARHA 3F5TA 2YI9A 2DYSB 1AP6A 3SJBC 3A2FA 2R9AA 3L75H 5KHIA 3CCLV 1CEZA 2QTSA 1N34O 1G1XB 2Y48A 5GW7A 4DO2A 2EIKC 1BQZA 3CXHF 3WG7C 2IU0A 3JAWB 4AQYO 1AJNA 2WSSG 1SQXH 3ZMVA 3DTUB 2X7RB 2Q73A 4DR5B 3ABTA 4ZKIA 1N36B 4LF8B 2V7QG 2BTOA 4GT1A 3OD4A 5KAFZ 3ETDA 5B3SB 3KKYA 4TQFA 3WB1A 2X0LA 3ZRVA 2CTPA 5LP6A 5CA0A 5E79Z 4MVRA 2VQFB 4MVOA 3AG1B 4DR6O 5IE9A 1VQ7V 2VS0A 5B1BC 1WAZA 3AG7A 2RNBA 3KCYA 3JD4A 1FPOA 2VWKA 4JV5O 4J42A 1N0JA 3BRCA 2FKXA 3QG5A 1LR1A 1THZA 3AG2C 2F95B 3HKBA 3T4DA 3UT5A 3M8AA 2V1DA 4JI3B 3JARA 4D7TA 1H2NA 1URFA 2Y4TA 1KB9F 2ZXWB 2P4KA 1TAEA 1IVSA 1K92A 1XUQA 1Q43A 2HFEC 2NN4A 1LNQA 2E74B 2CGNA 4FK5C 2OIEA 5H5NA 4DR7B 3M7MX 2XT9A 1PNLA 3CRAA 5LMUO 2BOBC 1VF6C 4LC1A 3CJHB 5EBMC 4H44B 4PA4A 1BQ0A 4WCEV 5H6QA 4PDRA 3K57A 4JTDB 3C3TA 3RYIB 1QHTA 1FFXA 2XUMA 3FFQA 1RM1B 1BHBA 4K0KO 3CD6V 1BMFG 4CH6A 2QJ1A 1FKAO 2GDSA 2Q0AA 2N74A 1FXKA 4LWSB 2LO1A 5KUKA 3OMAB 3T1HB 1QLEB 1F4NA 3SR2C 5EYPA 2YIBA 3FX7A 4TV9A 5B66Z 1V9PA 1IBLB 2MK3A 1EN6A 4JI8O 2IBZH 3B8NA 2VQFO 1MABG 4O2AB 1BCCH 4YIPA 4X64O 5KA6A 4CH3A 1GM9A 1V55C 3ZBHA 3ZEDA 4ZBMA 1QBZA 3OEEG 3HKEA 3OMNB 2L6LA 4DV6O 2V4DA 2K9PA 2EJ7A 1K5QA 1GN3A 2JEUA 1NTKH 4ZI7B 2PYLA 4FM2A 2UXBB 4J9YB 4K35A 2NLJC 3SYOA 1RSOA 3AK3A 2UXDB 3DXRA 4KFMA 4FIPC 4KHPO 5KX5B 1HR0O 1GN2A 2OIGA 2ZDIC 3CCMV 2DMXA 1M56C 4KL1A 2Q68A 3WFVA 3J7AU 4DV5O 4YJ2B 1JOYA 2GTSA 1H2MA 4I50A 3QO5A 1N0NA 3TK1A 4FLYA 2QWOB 2WLLB 4O4LA 3ZCCA 4JI7B 2HHHO 2IH1C 3LNNA 3CE2A 1JCHA 1F23A 2Y0IA 1AB3A 3Q4HA 1NQTA 3CYOA 1TA8A 2W0XA 3H1HH 4RO2A 5C8YB 5EIBC 2OTLV 4LFAO 3SGIA 1L1FA 2GUZB 3CRQA 5CA0B 4MVUA 1S76D 4NYKA 3F7YC 2P4VA 3FAVA 5KAIZ 5LYJB 2AZ0A 1GM7A 4UXNA 4F6EA 4ZI7A 1XDCA 4DR4B 4DV7O 4DV1B 3ABMB 3ASNC 3N2KA 2JGUA 5LHGA 3AK1A 1M57B 2LW1A 4E2LA 3H01A 4TUYA 4OPHA 1M56B 3FB6C 4MW3A 1YJWV 5B1AB 2YEVB 3ZMTA 4R8CA 2N05A 1XL6A 3ZN1A 2P5OA 4JI6B 3AEIA 3GWKC 3A0RA 4DR7O 1E1QG 1WP8A 4JPRA 3A8TA 1YSCA 4DR1B 3O9OA 5IY5C 3CJHA 1JFFA 1PM9A 2KG7A 1ZL8B 1H38A 3SJAC 2LFRA 2HEPA 2KB1A 3R65A 1JR9A 3BVOA 5EK0A 4DUYB 1OZ0A 2ODMA 5LGUA 1WNSA 3BA8A 1ZWIC 1WPXA 1QR8A 1MNGA 2B1IA 1PL4A 2PY5A 2BE3A 5B1AC 1I5YA 2JS5A 2GHYA 4TV8A 3RYCA 2YDEA 1H8EG 1V54B 4UFZA 3DC6A 2Q4PA 3L71H 2HJFC 2XASA 5B1OA 3K9SA 4X65O 4O4LB 2ZIOA 1F4MA 4I50B 5LGNA 1J5EO 3PJSK 2YXYA 4YJ2A 4BIOA 1XHZA 2AGAA 2EZPA 3K3WA 3FB8C 4DR3O 2YC0A 3G71V 4B3MB 3RYFB 2F43G 1W0KG 1H2GA 1PNKA 2ZNJA 3AK2A 2C2AA 4O4IA 5ITZA 4QNHB 3UCSC 3IFXA 4TWKA 3ABUA 5CB4B 4H13B 1XBLA 2UXXA 4GX1A 2K1EA 5KHGA 1QVGU 1AP5A 4N21A 1K34A 5LHIA 3MHSC 4ZOLA 4WFAV 1OCCB 2X6BA 3W7SA 1P7BA 3ASOC 4LH7A 3JATB 4FJCC 1PPJH 4B3RB 3HKDB 1EM1A 1YHQV 3CPWU 4X1YA 4LF8O 5KUMA 4DR3B 2F1MA 3K9AA 2Q7EA 2Q7HA 2F93B 4DV5B 4L8JA 2BOCC 1Z2GA 3OM3B 3H1KH 4TV9B 1GH6A 4X8AA 1JQ0A 2ZQMA 1SQPH 1D2DA 4U7OA 1K7DA 4DV0O 4PD4F 4CH5A 4UCTA 4X20A 4AILC 1N32O 4EKWA 5GONA 2ITCC 4ZHQB 3ASOB 5JWPA 2QDOA 2HLDG 1Q7YW 1VQ6V 4NKGB 1MA1A 5DEDA 1JVMA 3J80N 4LR3A 2XHBA 3K5LA 2P7TC 4ZIBA 3QF7A 1K97A 4I55A 1ZUQA 1GAXA 3BY6A 4LP8A 2LGWA 4Z1VA 3MDSA 3SPIA 4EFEA 2DN9A 4ZOLB 3T2MA 5GTHZ 2YSUB 1OCZB 4DV2B 4LFBO 1VQPV 4J10A 1K4CC 3X2QB 2QA4V 4JI6O 1H2KA 1VARA 2WLMA 4OXSA 3P3NA 4JI1O 1OCRC 2CTWA 3L73H 1KKCA 2UUCB 1BE3H 1ROPA 2JJ2G 1Q90D 3SYPA 1UPGA 1L0NH 4PA3A 3VBBA 1GM8A 2JRIA 4PHZA 2KQXA 2W6JG 1WP7A 5KA5A 1Y66A 4B3TO 1EZVH 2A0LA 4J7ZA 4Z1MG 1TVKB 3W7WA 4MTGA 2PZSA 4LFCB 1KECA 1XREA 4UV9A 3AG4B 1SC5B 1GRJA 3EHBB 1SESA 2KKWA 3OE7G 4DV7B 5J2TB 3ZHTA 3G6BA 3K5MA 1Q8IA 2YIBD 3CMEV 3BFRA 3JAKB 4CS4A 3CC4V 2HKOA 3S3WA 2YXLA 3ASNB 3BEHA 4A5UB 2UUBO 4LFAB 1B3QA 5L3DA 1HWYA 3A0HZ 2P22C 1YJNV 5JH7A 2ZIMA 3R66A 5JVDA 4LF5O 5JH7B 4QIWF 2E75B 2GBOA 2ZKOA 1US6A 1O9HA 4GX5A 4X1YB 2RJZA 1VQMV 2IJKA 3CRMA 2X6CA 4X88A 1QCEA 5EZYA 4YHHB 3ETQA 4CH4A 2BTQB 2WLIB 4EB6A 2R9RB 1D5NA 5LOVB 2DQ0A 2ZCEA 3NR7A 1KC8W 1ZAUA 4WF9V 1B06A 1YJ9V 3OAAG 1PV0A 4I9QA 3CXCU 1H2LA 1XMQO 4R7CA 1TUEB 1P84F 5LYJA 3SJQC 1Y6XA 3ZMUA 1KD1W 3CB2A 4X64B 3ZMSA 4FZ0A 1BL8A 3W7UA 1XMQB 1SRYA 3O65A 3LDEA 2AHYA 2ZT9B 4DV6B 4NXMO 2JK5C 3KG2A 3OTOB 1K33A 2LQTA 4RQFA 3BABA 1VQOV 4JYAO 4JI5O 1RM1C 3T1CA 1O9GA 3UM7A 1PKXA 3OR7C 4YXWG 2ILMA 1QR9A 3K03A 4LFBB 5LXTB 1I0HA 1K5SA 1VQ9V 2ZR3A 4PI0A 1F51A 1YTFD 1NJIW 2EIKB 3UO3A 4FLVA 2QM8A 1BS3A 5KMGB 1R6NA 2XAHA 4BW5A 3CCQV 1JPXA 1D5AA 4JAAA 3VQYA 4FFBA 1N8RW 1PL0A 4X1IA 1ORQC 3IC7A 2X6AA 1UFIA 5IJ0A 3FB7C 1OHHG 3ZRWA 1I08A 3RFRA 4PJ0Z 3CRRA 1B04A 4K8XA 1DGSA 5FNVB 1WA8B 4ZHQA 2EIMC 4I0XA 5JVDB 3RVZA 2UUCO 4DV0B 2XOKG 3OFNG 2NNUA 1OCZC 3UQ8A 4QPKA 1GK9A 2HVJC 2Q7GA 4GKJO 1OJHA 3ABLB 4WFEA 4LF6B 2ZM6B 2AZ2A 5LL6Y 1XNRB 5J2TA 1P49A 3RW0A 1S5JA 4MVZA 1WB8A 1M93A 5KLVH 1VQKV 1FXKB 4LWSA 4UV8A 2A06H 2NR5A 4HAMA 3RN4A 1SKVA 3CCRV 1JJOA 1GKFA 3JD3A 3I55V 4QE7A 1WN7A 1Y76B 3K79A 5DN6G 1FXHA 3MD0A 3DC5A 2P6JA 5CA3A 1BGYH 5C8YA 1FXVA 5IJ9B 5L3EA 1ZX3A 4B3SO 2JGDB 1FS0G 2XAGA 1R3IC 4GLXA 1LUVA 1R6KA 3TCUA 1Q6IA 1G6UA 3ZIAG 5EBWC 2FB5A 2CAZC 1NT2B 4P30A 2ZXWC 3HKCB 1VQ4V 2A7WA 1YITV 1WLEA 3SYCA 3CCSV 3ETGA 4PELA 4IIJA 1SS3A 4NR1A 4H33A 2XTAA 1HNXO 1FXKC 2BSKA 4N23A 1E1RG 4DR2B 2P90A 4FVMA 3B4SA 2F4VO 1GN4A 2WA4A 3RYCB 4DW0A 2F23A 2RDCA 3JALB 3ZRXA 1S5HC 2QM4A 2YIDA 1N34B 1FJGB 1ENVA 4X89A 1S5LZ 3CEIA 2YXHA 3FB5C 1BZKA 1I5XA 1I7FA 3N27A 2WLJA 4MVSA 3BCCH 3BPZA 5KHJA 3HKEB 2EINC 2OCCB 4JTCB 4IIJB 4UVBA 2QSAA 4JI0O 2LW7A 5AG2A 5IDJA 4NTWA 4P9OA 1VF6A 3C3SA 5H6RA 4NXNO 4LF6O 4KUMA 3BAAA 2JDIG 2QGNA 4X65B 4FM1A 2EULA 2EX3A 1IBMB 2Q67A 5IJ9A 3K0GA 1BHAA 3OGCC 2WLHA 1OCOB 3JD0A 3ETEA 4X66B 3CC2V 2KSDA 4MTXA 2UUAB 2UXBO 5CBHA 1MSWD 5EZYB 3VQWA 2RCVA 2OYQA 4H37A 4X66O 1J5EB 1FFXB 5JCOC 2LP7A 2DWEC 3CCVV 3N2GA 4X62B 1IBKB 2ZE5A 4LF4O 5J2UA 2HP8A 5D5QA 4CS3A 1I94O 5EIBD 1W0JG 3E83A 3K08A 4G27B 3E2EA 3K5NA 1EN4A 2GUZA 2E5LO 1N33B 3IAYA 1MMMA 1QVFU 1QNMA 4PA7A 3I5DA 4IYHA 2ADQB 4MW8A 3FYEB 2AXTZ 3WB0A 4MTOA 1CPYA 4ICGA 4K3AA 1XNQO 2YI8A 4G28B 1LUWA 4UCOA 1SA0A 1FD9A 2IU3A 3HKCA 3CX5F 1OV9A 1HNXB 1N4CA 1PNMA 5FPRA 4JI2O 2PUSA 2Y69B 1AILA 4PI2A 1FFTB 3RBZA 2OCHA 4JYAB 4RUEA 1U96A 2DYSC 3JALA 3SYAA 1V54C 4UCSA 1EN5A 1DF5A 3LSSA 4DR4O 3ABKB 2Q6AA 4W4KA 3STZC 1ZTEA 3DXRB 1NR7A 1RSOB 3APQA 1AROP 2IM9A 5J9PC 3JD1A 4XBFA 3LDCA 2Y4UA 3K0DA 5KHHA 4JTAB 2KG7B 4KXRA 5IY5B 3GB7C 4DV1O 2YUAA 3S3XA 2YS8A 5IT9N 1SQFA 2ZE7A 2JGDA 3SPJA 4XDKA 1OCOC 4KP4A 2A3QA 3LUTB 2CTRA 4JI8B 2UXNA 3JCZA 3T4ZA 4HBNA 3ZHSA 4F4LA 2OTJV 3OTFA 3RYHB 3D8CA 4RUFA 3ZJZA 5EYPB 1HNZB 1Y67A 3G67A 2RQ6A 4JYCA 3N2KB 3JYCA 5GONB 1HNWO 2XNDG 4FFBB 1YVWA 2UUAO 4F6RB 4LCUC 2EINB 2OCCC 3JAWA 3WG7B 2DYRC 1EBOA 3OW2U 1XMOO 2CTQA 4DV3B 4B3TB 1U97A 4LF4B 1A32A 5LGTA 1YXBA 3SDLA 2OWOA 4AQYB 4OX9B 2Y69C 4WFBV 2JVDA 4FFKA 3ZRWB 4B3MO 2E76B 4BR6A 4U3FH 1NI8A 3JCUZ 1YDXA 4LFCO 4WFGA 5IYZA 4P9PA 3TXQA 2EILB 2QWPB 3W7TA 4GZRB 5KMGA 3IJ4A 1OCCC 4FLWA 4IGGA 4MVQA 4JI2B 4I4TB 5JCOA 3A0BZ 4JI5B 2L35A 2YICA 4X1KA 1Q82W 1W2BU 4JV5B 1RP3B 3CMAV 1TGOA 1COWG 1QU7A 4NB5A 2Q8VA 1T5EA 3M99B 2DYRB 3D36C 3E22B 3C90A 2ZINA 1Y76A 3LNMB 4GYCB 4XDJA 4DW1A 5IYZB 3HR0A 3P30A 3WU2Z 2Q0OC 4DK0A 5D5PA 1IBKO 5IYBO 4DRXA 1KBHA 2N04A 4NVPA 4HNAB 2ZR2A 1SF9A 1M5IA 4J9ZB 1M9NA 2CE4A 4MTFA 2QKSA 4DV4B 3FKSG 4O4JA 3ZHRA 4DR2O 3D3QA 1VMGA
chains in the Genus database with same CATH topology
3B2EE 4FLVA 5KMGB 3SJCC 4U3JB 3VQVA 5LXTA 4F6RA 1D5AA 3VQYA 4FFBA 4KL1A 4BWAA 2PYJA 4X1IA 4YJ2B 4LNUA 5JQGA 4I50A 5IJ0A 4FLYA 3RFRA 3T1YB 4O4LA 4JI7B 1B04A 3K5OA 4K8XA 1DGSA 5FNVB 4WBNB 3LNNA 4ZHQA 5LMNB 5JJEB 5JVDB 5LP6C 1VF7A 1KU9A 4DV0B 4FLZA 1TUBB 1TA8A 4GKJB 5C8YB 5LA6A 3UQ8A 5EIBC 3SGIA 2Q7GA 4O4JB 4LF6B 2ZM6B 5CA0B 1XNRB 5J2TA 5LYJB 1P49A 4TUYB 4DUZB 4NXNB 1S5JA 4BW9A 4ZI7A 4DR4B 4O2BB 4DV1B 2HHHB 1M93A 5KHKA 3N2KA 2JGUA 4O2BA 1XI1A 1KMIZ 3UT5B 4TUYA 1TVKA 3HKBB 1SKVA 4IHJA 3THOA 4DK1A 3JATA 1JJOA 1WN7A 2VQEB 3E22A 1QQCA 5CA1A 5CA1B 5BR8B 5C8YA 5IJ9B 4B08A 2P5OA 4JI6B 4AHCA 5LP6B 4GLXA 4TV8B 4IHJB 1HNWB 1G6UA 2R70A 4DR1B 1JFFA 4Q6GA 2CAZC 4B3SB 1NT2B 3HKCB 5FPOA 3SJAC 5BMVA 4LNUB 5LOVA 3RWRD 2BTQA 2HEPA 4IIJA 4DUYB 4K0KB 3U0ZA 3BA9A 1N32B 3K58A 1WNSA 3BA8A 4DR2B 4TQDA 5LA6B 2UXCB 4FVMA 2PY5A 1TUBA 2JS5A 4TV8A 3RYCB 3RYCA 4CC5A 3JALB 4UFZA 2QM4A 1N34B 5FNVA 1FJGB 5JJNB 2UUBB 3K59A 4O4LB 4K8ZA 4HNAA 1I7FA 2ZIOA 3JAKA 4I50B 5IJ0B 3BPZA 5KHJA 3HKEB 4DRXB 2F66C 4YJ2A 3PN1A 4IIJB 1XHZA 4UCRA 5K1PA 4U3JA 4LF9B 3RGBA 4B3MB 5BMVB 3RYFB 2UU9B 3JARB 2E5LB 1JFFB 5CB4A 4TOIA 2ZNJA 4O4IA 5ITZA 1HW7A 4O4IB 5ITZB 1XQ8A 3BAAA 5CB4B 4FM1A 4X65B 1I94B 1H2SB 4O4HA 2EX3A 1IBMB 5KHGA 3BHPA 5IJ9A 2PGGA 4ZOLA 4X66B 1Z5VA 3HKDA 3JASA 4LH7A 3JATB 1SQGA 2UUAB 4FLXA 5EZYB 3VQWA 4B3RB 3HKDB 3JASB 3JSNA 2OYQA 1WPBA 1J5EB 1FFXB 4X1YA 5JCOC 4DR3B 2F1MA 4LH6A 4O4HB 2Q7EA 2R72A 4JI0B 2Q7HA 2F93B 4DV5B 3CSXA 3N2GA 4L8JA 4YY3B 4X62B 1IBKB 5J2UA 5D5QA 4CS3A 5EIBD 4FLTA 4TV9B 4X1KB 3QTCA 3K5NA 1YEWA 1N33B 3U11A 1X4TA 3IAYA 4I4TA 4DR6B 4UCVA 3RYFA 3WB0A 5IWAB 4CH5A 4UCTA 4X20A 4AILC 5J2UB 2YI9A 5GONA 2YI8A 4ZHQB 3SJBC 4UCOA 1SA0A 3A2FA 3HKCA 2R9AA 4LR3A 1HNXB 5KHIA 5FPRA 4D7SA 2XHBA 2PUSA 3K5LA 4ZIBA 3QF7A 4PI2A 3DSQA 2YIAA 4JYAB 4I55A 3JALA 4UCSA 4LF7B 1Q5OA 4EFEA 1L8DA 4ZOLB 3JAWB 5JJJB 5KX5A 4DV2B 1JMKC 2IM9A 4DR5B 1N36B 4EFBA 4LF8B 2BTOA 2UUCB 5KHHA 4JI1B 4CS2A 4TQFA 3RYHA 3WB1A 4NXMB 5LP6A 5CA0A 1SQFA 4PHZA 2VQFB 4O2AA 4CC6A 4JI8B 3ZS8C 4HBNA 2VWKA 3BRCA 1M4UA 3QG5A 3OTFA 3RYHB 1TVKB 2F95B 3HKBA 2PZSA 3UT5A 4LFCB 4FLUA 4JI3B 5EYPB 1HNZB 2RQ6A 3JARA 4D7TA 3N2KB 1Z5WA 5K1XA 1TAEA 1Q43A 1XHXA 4X1IB 5GONB 4FFBB 2KKWA 4DV7B 4F6RB 5J2TB 3K5MA 1Q8IA 4DR7B 3M7MX 2YIBD 1XMOB 3JAKB 4CS4A 3JAWA 2YXLA 2VWJA 3RYIA 4LFAB 5LMUB 4LF5B 2P22C 5JH7A 2ZIMA 4DV3B 5JVDA 4B3TB 5JH7B 3K57A 2F4VB 4LF4B 2OWOA 4JI4B 4WBNA 3MAQA 3RYIB 1HR0B 1QHTA 1O9HA 4AQYB 4OX9B 1FFXA 4X1YB 2JVDA 2RJZA 1SA0B 3FFQA 2PTMA 5EZYA 4CH6A 2GV9A 4YHHB 2QJ1A 3ETQA 4CH4A 2BTQB 4EB6A 5IYZA 5LOVB 2ZCEA 1ZAUA 2Q0AA 5KMGA 4FLWA 4JI2B 4I4TB 3JSLA 5JCOA 3T1HB 4JI5B 4KHPB 4YJ3B 4I9QA 3SR2C 5EYPA 2YIBA 4X1KA 4TV9A 5LYJA 2ZNIA 3CHXA 4JV5B 1V9PA 1TGOA 3CB2A 4X64B 1IBLB 3N2GB 1T5EA 3WB2A 1XMQB 3E22B 4O2AB 1Q3EA 2ZINA 4DV6B 4CH3A 4GYCB 3ZEDA 4EB6B 5IYZB 3OTOB 2E3CA 4I55B 4GKKB 4DK0A 5D5PA 3BABA 3HKEA 4DRXA 4NVPA 2V4DA 4HNAB 1O9GA 4EEQA 4UCUA 1M5IA 3ICXA 1XNQB 5JQGB 4ZI7B 2PYLA 4FM2A 2UXBB 3VQXA 4X20B 4LFBB 5LXTB 4DV4B 1RSOA 4FM0A 2UXDB 3U10A 4O4JA 4YJ3A 5KX5B 4PI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2E E;  3QF7 A;  2JS5 A;  2P22 C;  3SJC C;  1X4T A;  3QG5 A;  1SKV A;  3CSX A;  2CAZ C;  3SJA C;  3SJB C;  3THO A;  3ICX A;  1NT2 B;  3ZS8 C;  2F66 C; 
#chains in the Genus database with same CATH topology
 3B2E E;  3VQV A;  2A9H A;  2WLK A;  3CCE V;  4F6R A;  2VRZ A;  1N36 O;  3G6E V;  1ZLZ A;  1WA8 A;  4LNU A;  5JQG A;  2QWQ B;  4JI7 O;  3E86 A;  2B1G A;  3IC9 A;  1ZL8 A;  5IYC O;  3K5O A;  1DTO A;  1VF7 A;  1KU9 A;  2Q5Z A;  4JYY A;  3CWB H;  1TUB B;  2JJ1 G;  4GKJ B;  3ABK C;  4GUN A;  2ZD9 A;  2YEV A;  4O4J B;  2IW5 A;  1R3K C;  3EFF K;  1GN6 A;  4RAI A;  4FMT A;  4DUZ B;  4TUY B;  2H3O A;  4BW9 A;  1J95 A;  3RVY A;  1M57 C;  1AI4 A;  2IH3 C;  2HHH B;  2GSM B;  1DF4 A;  5KHK A;  3ZX6 A;  5TIS Z;  4O2B A;  4BIU A;  1KMI Z;  3K04 A;  2WA3 A;  3UT5 B;  1S72 V;  2FML A;  3SPG A;  1TVK A;  4L87 A;  5HFM A;  3JAT A;  5EBL C;  2HJD A;  2BCC H;  2M7W A;  4QE9 A;  1K73 W;  4PDM A;  3E22 A;  1QQC A;  5CA1 A;  1MG1 A;  5BR8 B;  2W6I G;  4AHC A;  5IYD O;  1XEQ A;  3KCX A;  3HPL C;  4ASU G;  3L70 H;  4TV8 B;  4IHJ B;  5C93 A;  1AJP A;  1HNW B;  2R70 A;  1R3L C;  2Y0P A;  2AHZ A;  1NVP B;  3EXA A;  4B3S B;  2H94 A;  2FYU H;  1X59 A;  2PI4 A;  2FTK A;  4LF9 O;  1HNZ O;  3P32 A;  5BMV A;  4RWU A;  3RWR D;  2BTQ A;  4JAU A;  3OEH G;  2QTO A;  3F5W C;  4K0K B;  3U0Z A;  4I5S A;  1AJQ A;  4TQD A;  5LA6 B;  4OX9 O;  2HVK C;  1HP8 A;  3AG3 C;  1TUB A;  1W59 A;  5DEC A;  1UJW B;  3AG2 B;  1K9M W;  3B40 A;  4U7N A;  4GX0 A;  4G2K A;  3H9V A;  4YIO A;  5JJN B;  3AG3 B;  3K59 A;  3STL C;  1G8M A;  3JAK A;  1P7G A;  4UCR A;  3LSU A;  5LMN O;  3KZI Z;  4U3J A;  1GMG A;  4J7K A;  1Q81 W;  3JAM N;  5L3B A;  2UU9 B;  3L72 H;  4I9W A;  4B7E A;  4PA9 A;  1JFF B;  4LBE C;  4TOI A;  5L3C A;  3FAV B;  2ADP A;  2HG5 C;  4O4I B;  1Q6U A;  5ITZ B;  1XQ8 A;  2DE0 X;  1Q6H A;  4Q20 A;  4P2Z A;  2PGG A;  2ZDI A;  3HKD A;  2IJI A;  1SQG A;  1RPR A;  2ZE8 A;  4JZ2 A;  4UB8 Z;  3JSN A;  1IUR A;  2DJV A;  1Y74 A;  1WPB A;  1NBM G;  1OCR B;  4LH6 A;  1S77 D;  3P3P A;  4YY3 B;  3LSQ A;  3UO2 A;  5B5E Z;  3JD2 A;  3VOU A;  2QWR B;  1MOF A;  4AI8 A;  4MVM A;  4JYB A;  1VQN V;  2UXC O;  4DR6 B;  4JAS A;  3RYF A;  4HZ3 A;  5IWA B;  5CMU A;  5J2U B;  1MZF A;  3DGE A;  1JJ2 U;  1SET A;  1KYO F;  3CS5 A;  5B1N A;  1VEW A;  2P06 A;  1NR1 A;  4D7S A;  5E1A C;  3ZHQ A;  1Y74 B;  2B5U A;  1SER A;  1HDJ A;  5L3G A;  4C7U A;  3DSQ A;  2YIA A;  3X2Q C;  2JS3 A;  3H1I H;  4TT3 G;  4LF7 B;  1Q5O A;  2CH7 A;  1YTF B;  1S3J A;  3L9D A;  4D6T H;  1L8D A;  2Z3Y A;  3SPC A;  2JIZ G;  4QPJ A;  2FL4 A;  5JJJ B;  5KX5 A;  4GX2 A;  3SPH A;  3T1Y O;  2ATK C;  4WFF A;  3E35 A;  5BZB A;  1FYJ A;  4X9Q A;  1JMK C;  4WFH A;  3TET A;  4MS2 A;  5B3S C;  1YF2 A;  2EIM B;  3TJT A;  3ZMZ A;  4EFB A;  2ITD C;  2G38 A;  1VQ5 V;  1KP3 A;  4JI1 B;  4HYO A;  2Z5U A;  1BSM A;  4CS2 A;  3RYH A;  4NXM B;  1K4D C;  4UVA A;  1V55 B;  5A9G A;  4R50 A;  1BT8 A;  2CGO A;  3CCU V;  1SQB H;  2ZM6 O;  4O2A A;  4CC6 A;  1GTO A;  3ZS8 C;  2RN9 A;  1AI7 A;  3T1H O;  5GTI Z;  3E8B A;  1M4U A;  3CC7 V;  1YI2 V;  4JF3 A;  4DYL A;  5A2Q N;  4I0X B;  3IGA C;  4GCZ A;  3K06 A;  3D3I A;  1SZX A;  2Q9L A;  4FLU A;  4Z2W A;  5CBG A;  4W4L A;  1AI5 A;  1Z5W A;  4E4E A;  5K1X A;  4MT8 A;  4J11 A;  2AW9 A;  1KP2 A;  1XHX A;  4X1I B;  4QJF B;  5BXZ A;  2LGQ A;  4UB6 Z;  1XMO B;  2QR4 A;  2WWW A;  3AG4 C;  4JGS A;  1IBM O;  2VWJ A;  1FJG O;  3RYI A;  5LMU B;  4LF5 B;  3OTO O;  1MSD A;  3B09 A;  2WAM A;  1G4Y B;  5L3F A;  2EIJ C;  1NZ6 A;  2F4V B;  2QE7 G;  4RQE A;  4JI4 B;  1IZ3 A;  4WBN A;  5BY1 A;  5FLX N;  3MAQ A;  1HR0 B;  3QO7 A;  3QNE A;  2B9Z A;  1K3E A;  3OUS A;  3ZRS A;  1SA0 B;  2BSK B;  2PTM A;  2GV9 A;  3APO A;  1IDS A;  3ZHU A;  4JI4 O;  4PDL A;  4JAV A;  2QKC A;  2W0F C;  2O57 A;  3EVK A;  3JSL A;  3J81 N;  1AR5 A;  4KHP B;  4YJ3 B;  1VQL V;  4XDL A;  3TXS A;  3F7V C;  3OR6 C;  1EZJ A;  3GVM A;  2ZNI A;  3CHX A;  4FPP A;  2PI5 A;  1AVM A;  3N2G B;  2GTA A;  4CZZ A;  3WB2 A;  1PD3 A;  5CBF A;  1S0V A;  1VQ8 V;  1KUQ A;  1Q3E A;  2CUG A;  1QLN A;  4EB6 B;  2E3C A;  3ML0 A;  4B7K A;  1AI6 A;  4I55 B;  2MW2 B;  4GKK B;  3I56 V;  4MSW C;  4EEQ A;  4UCU A;  2D3O W;  4JZG A;  3ICX A;  2QKA A;  4BIZ A;  5LHH A;  2XAJ A;  1XNQ B;  5JQG B;  2OT5 A;  1ZSP A;  4B3R O;  2R9I A;  1NH2 B;  3VQX A;  4X20 B;  1IXM A;  4FM0 A;  3B77 A;  3U10 A;  4YJ3 A;  1R6T A;  2VQE O;  4LF7 O;  5DM6 V;  3E8G A;  4DV3 O;  3SJC C;  4U3J B;  5LXT A;  4DUY O;  2ZE6 A;  3W7X A;  3MHH C;  4BWA A;  2PYJ A;  2CK3 G;  5EC2 C;  3CCJ V;  4J80 A;  3E89 A;  3T1Y B;  2WLL A;  3CP1 A;  3QVN A;  4OGQ B;  2HR3 A;  1SZT A;  4WBN B;  5LMN B;  1RPO A;  5JJE B;  1GO3 F;  4QGP A;  2EIJ B;  5LP6 C;  3G80 A;  4PA6 A;  1NU1 H;  2CDY A;  4FLZ A;  3B8M A;  5LA6 A;  1M1K W;  2DQ3 A;  1NVP D;  5H2F Z;  5EC1 C;  3OMI B;  4BAY A;  3RT3 C;  4YY3 O;  3E8F A;  5H9C A;  4YHH O;  1Y4M A;  4NXN B;  3H1J H;  4J7J A;  4DXW A;  4J41 A;  1JX9 A;  4O2B B;  5CN0 A;  4NTX A;  4JI3 O;  2EZO A;  1XI1 A;  1VP7 A;  3HKB B;  1YZB A;  2EBO A;  4IHJ A;  3THO A;  4DK1 A;  5F2V O;  1R1B A;  2WPD G;  2VQE B;  5CA1 B;  1IXB A;  4DR5 O;  2P67 A;  4R6Z A;  3ZN0 A;  4B08 A;  3SYQ A;  3GWO A;  1EFR G;  2IJJ A;  2QWN B;  5LP6 B;  2QM7 A;  1PP9 H;  3TGU H;  3HB3 B;  4IL6 Z;  4IYI A;  3E8H A;  1K8A W;  4Q6G A;  2EJR A;  1QLE C;  3FYI B;  2DOS A;  5FPO A;  3ABM C;  2D2C B;  4LNU B;  3L74 H;  3ZHV A;  5LOV A;  5FL7 G;  1CP9 A;  1XIL A;  4GKK O;  1H8H G;  2QEX V;  4OPA A;  3BA9 A;  3H1L H;  1N32 B;  3NXS A;  1E79 G;  5HFL A;  1YCI A;  1CXZ B;  1XOU A;  3K58 A;  1WB7 A;  4PV1 B;  3OGI B;  4FZ1 A;  3G4S V;  2RMK B;  2UXC B;  1YIJ V;  4TSF G;  4DUZ O;  2CH7 B;  4CC5 A;  1AR4 A;  3ABL C;  1MZE A;  2IJH A;  1P4R A;  5FNV A;  1N33 O;  2UUB B;  3D36 A;  1NTZ H;  1M90 W;  4K8Z A;  1F7Y A;  4HNA A;  1RFY A;  3OT7 A;  5IJ0 B;  4H0L B;  4DRX B;  2F66 C;  3PN1 A;  5K1P A;  1NH2 D;  1DLB A;  4NTY A;  4UVC A;  4LF9 B;  3RGB A;  5BMV B;  1VIB A;  3OUF A;  4DV2 O;  4UUJ C;  3JAR B;  2XAQ A;  2E5L B;  5CB4 A;  4CBC A;  1L0L H;  2Q69 A;  1HW7 A;  1VF5 B;  4ABM A;  1AR1 B;  1XNR O;  1NTM H;  4X62 O;  5BR8 O;  1Q86 W;  1I94 B;  1H2S B;  4O4H A;  4IT5 A;  3BHP A;  5B1B B;  2LFS A;  3AG1 C;  3Q4H B;  2UXD O;  1XL4 A;  1JA8 A;  3CRC A;  2UU9 O;  4DV4 O;  1FAF A;  1Z5V A;  3JAS A;  1DK1 A;  4PDV A;  4DR1 O;  4FLX A;  3JAS B;  5IWA O;  2ETN A;  1NS1 A;  2A79 B;  1WJZ A;  2PF4 E;  3LDD A;  1SQV H;  1KKD A;  1NKD A;  4O4H B;  2R72 A;  3UKM A;  4JI0 B;  1R3J C;  5LBQ A;  3CSX A;  2WLN A;  3FD9 A;  2DW4 A;  2Z0A A;  4FLT A;  2XAF A;  1IX9 A;  4X1K B;  1R73 A;  3QTC A;  2LJ2 A;  1KQS U;  1YEW A;  2DWD C;  3U11 A;  1X4T A;  3QO8 A;  4I7Z B;  4I4T A;  1SQQ H;  4UCV A;  2H8P C;  1B6Q A;  2JEX A;  2M6Y A;  2EIL C;  1IBL O;  2WLI A;  2ARH A;  3F5T A;  2YI9 A;  2DYS B;  1AP6 A;  3SJB C;  3A2F A;  2R9A A;  3L75 H;  5KHI A;  3CCL V;  1CEZ A;  2QTS A;  1N34 O;  1G1X B;  2Y48 A;  5GW7 A;  4DO2 A;  2EIK C;  1BQZ A;  3CXH F;  3WG7 C;  2IU0 A;  3JAW B;  4AQY O;  1AJN A;  2WSS G;  1SQX H;  3ZMV A;  3DTU B;  2X7R B;  2Q73 A;  4DR5 B;  3ABT A;  4ZKI A;  1N36 B;  4LF8 B;  2V7Q G;  2BTO A;  4GT1 A;  3OD4 A;  5KAF Z;  3ETD A;  5B3S B;  3KKY A;  4TQF A;  3WB1 A;  2X0L A;  3ZRV A;  2CTP A;  5LP6 A;  5CA0 A;  5E79 Z;  4MVR A;  2VQF B;  4MVO A;  3AG1 B;  4DR6 O;  5IE9 A;  1VQ7 V;  2VS0 A;  5B1B C;  1WAZ A;  3AG7 A;  2RNB A;  3KCY A;  3JD4 A;  1FPO A;  2VWK A;  4JV5 O;  4J42 A;  1N0J A;  3BRC A;  2FKX A;  3QG5 A;  1LR1 A;  1THZ A;  3AG2 C;  2F95 B;  3HKB A;  3T4D A;  3UT5 A;  3M8A A;  2V1D A;  4JI3 B;  3JAR A;  4D7T A;  1H2N A;  1URF A;  2Y4T A;  1KB9 F;  2ZXW B;  2P4K A;  1TAE A;  1IVS A;  1K92 A;  1XUQ A;  1Q43 A;  2HFE C;  2NN4 A;  1LNQ A;  2E74 B;  2CGN A;  4FK5 C;  2OIE A;  5H5N A;  4DR7 B;  3M7M X;  2XT9 A;  1PNL A;  3CRA A;  5LMU O;  2BOB C;  1VF6 C;  4LC1 A;  3CJH B;  5EBM C;  4H44 B;  4PA4 A;  1BQ0 A;  4WCE V;  5H6Q A;  4PDR A;  3K57 A;  4JTD B;  3C3T A;  3RYI B;  1QHT A;  1FFX A;  2XUM A;  3FFQ A;  1RM1 B;  1BHB A;  4K0K O;  3CD6 V;  1BMF G;  4CH6 A;  2QJ1 A;  1FKA O;  2GDS A;  2Q0A A;  2N74 A;  1FXK A;  4LWS B;  2LO1 A;  5KUK A;  3OMA B;  3T1H B;  1QLE B;  1F4N A;  3SR2 C;  5EYP A;  2YIB A;  3FX7 A;  4TV9 A;  5B66 Z;  1V9P A;  1IBL B;  2MK3 A;  1EN6 A;  4JI8 O;  2IBZ H;  3B8N A;  2VQF O;  1MAB G;  4O2A B;  1BCC H;  4YIP A;  4X64 O;  5KA6 A;  4CH3 A;  1GM9 A;  1V55 C;  3ZBH A;  3ZED A;  4ZBM A;  1QBZ A;  3OEE G;  3HKE A;  3OMN B;  2L6L A;  4DV6 O;  2V4D A;  2K9P A;  2EJ7 A;  1K5Q A;  1GN3 A;  2JEU A;  1NTK H;  4ZI7 B;  2PYL A;  4FM2 A;  2UXB B;  4J9Y B;  4K35 A;  2NLJ C;  3SYO A;  1RSO A;  3AK3 A;  2UXD B;  3DXR A;  4KFM A;  4FIP C;  4KHP O;  5KX5 B;  1HR0 O;  1GN2 A;  2OIG A;  2ZDI C;  3CCM V;  2DMX A;  1M56 C;  4KL1 A;  2Q68 A;  3WFV A;  3J7A U;  4DV5 O;  4YJ2 B;  1JOY A;  2GTS A;  1H2M A;  4I50 A;  3QO5 A;  1N0N A;  3TK1 A;  4FLY A;  2QWO B;  2WLL B;  4O4L A;  3ZCC A;  4JI7 B;  2HHH O;  2IH1 C;  3LNN A;  3CE2 A;  1JCH A;  1F23 A;  2Y0I A;  1AB3 A;  3Q4H A;  1NQT A;  3CYO A;  1TA8 A;  2W0X A;  3H1H H;  4RO2 A;  5C8Y B;  5EIB C;  2OTL V;  4LFA O;  3SGI A;  1L1F A;  2GUZ B;  3CRQ A;  5CA0 B;  4MVU A;  1S76 D;  4NYK A;  3F7Y C;  2P4V A;  3FAV A;  5KAI Z;  5LYJ B;  2AZ0 A;  1GM7 A;  4UXN A;  4F6E A;  4ZI7 A;  1XDC A;  4DR4 B;  4DV7 O;  4DV1 B;  3ABM B;  3ASN C;  3N2K A;  2JGU A;  5LHG A;  3AK1 A;  1M57 B;  2LW1 A;  4E2L A;  3H01 A;  4TUY A;  4OPH A;  1M56 B;  3FB6 C;  4MW3 A;  1YJW V;  5B1A B;  2YEV B;  3ZMT A;  4R8C A;  2N05 A;  1XL6 A;  3ZN1 A;  2P5O A;  4JI6 B;  3AEI A;  3GWK C;  3A0R A;  4DR7 O;  1E1Q G;  1WP8 A;  4JPR A;  3A8T A;  1YSC A;  4DR1 B;  3O9O A;  5IY5 C;  3CJH A;  1JFF A;  1PM9 A;  2KG7 A;  1ZL8 B;  1H38 A;  3SJA C;  2LFR A;  2HEP A;  2KB1 A;  3R65 A;  1JR9 A;  3BVO A;  5EK0 A;  4DUY B;  1OZ0 A;  2ODM A;  5LGU A;  1WNS A;  3BA8 A;  1ZWI C;  1WPX A;  1QR8 A;  1MNG A;  2B1I A;  1PL4 A;  2PY5 A;  2BE3 A;  5B1A C;  1I5Y A;  2JS5 A;  2GHY A;  4TV8 A;  3RYC A;  2YDE A;  1H8E G;  1V54 B;  4UFZ A;  3DC6 A;  2Q4P A;  3L71 H;  2HJF C;  2XAS A;  5B1O A;  3K9S A;  4X65 O;  4O4L B;  2ZIO A;  1F4M A;  4I50 B;  5LGN A;  1J5E O;  3PJS K;  2YXY A;  4YJ2 A;  4BIO A;  1XHZ A;  2AGA A;  2EZP A;  3K3W A;  3FB8 C;  4DR3 O;  2YC0 A;  3G71 V;  4B3M B;  3RYF B;  2F43 G;  1W0K G;  1H2G A;  1PNK A;  2ZNJ A;  3AK2 A;  2C2A A;  4O4I A;  5ITZ A;  4QNH B;  3UCS C;  3IFX A;  4TWK A;  3ABU A;  5CB4 B;  4H13 B;  1XBL A;  2UXX A;  4GX1 A;  2K1E A;  5KHG A;  1QVG U;  1AP5 A;  4N21 A;  1K34 A;  5LHI A;  3MHS C;  4ZOL A;  4WFA V;  1OCC B;  2X6B A;  3W7S A;  1P7B A;  3ASO C;  4LH7 A;  3JAT B;  4FJC C;  1PPJ H;  4B3R B;  3HKD B;  1EM1 A;  1YHQ V;  3CPW U;  4X1Y A;  4LF8 O;  5KUM A;  4DR3 B;  2F1M A;  3K9A A;  2Q7E A;  2Q7H A;  2F93 B;  4DV5 B;  4L8J A;  2BOC C;  1Z2G A;  3OM3 B;  3H1K H;  4TV9 B;  1GH6 A;  4X8A A;  1JQ0 A;  2ZQM A;  1SQP H;  1D2D A;  4U7O A;  1K7D A;  4DV0 O;  4PD4 F;  4CH5 A;  4UCT A;  4X20 A;  4AIL C;  1N32 O;  4EKW A;  5GON A;  2ITC C;  4ZHQ B;  3ASO B;  5JWP A;  2QDO A;  2HLD G;  1Q7Y W;  1VQ6 V;  4NKG B;  1MA1 A;  5DED A;  1JVM A;  3J80 N;  4LR3 A;  2XHB A;  3K5L A;  2P7T C;  4ZIB A;  3QF7 A;  1K97 A;  4I55 A;  1ZUQ A;  1GAX A;  3BY6 A;  4LP8 A;  2LGW A;  4Z1V A;  3MDS A;  3SPI A;  4EFE A;  2DN9 A;  4ZOL B;  3T2M A;  5GTH Z;  2YSU B;  1OCZ B;  4DV2 B;  4LFB O;  1VQP V;  4J10 A;  1K4C C;  3X2Q B;  2QA4 V;  4JI6 O;  1H2K A;  1VAR A;  2WLM A;  4OXS A;  3P3N A;  4JI1 O;  1OCR C;  2CTW A;  3L73 H;  1KKC A;  2UUC B;  1BE3 H;  1ROP A;  2JJ2 G;  1Q90 D;  3SYP A;  1UPG A;  1L0N H;  4PA3 A;  3VBB A;  1GM8 A;  2JRI A;  4PHZ A;  2KQX A;  2W6J G;  1WP7 A;  5KA5 A;  1Y66 A;  4B3T O;  1EZV H;  2A0L A;  4J7Z A;  4Z1M G;  1TVK B;  3W7W A;  4MTG A;  2PZS A;  4LFC B;  1KEC A;  1XRE A;  4UV9 A;  3AG4 B;  1SC5 B;  1GRJ A;  3EHB B;  1SES A;  2KKW A;  3OE7 G;  4DV7 B;  5J2T B;  3ZHT A;  3G6B A;  3K5M A;  1Q8I A;  2YIB D;  3CME V;  3BFR A;  3JAK B;  4CS4 A;  3CC4 V;  2HKO A;  3S3W A;  2YXL A;  3ASN B;  3BEH A;  4A5U B;  2UUB O;  4LFA B;  1B3Q A;  5L3D A;  1HWY A;  3A0H Z;  2P22 C;  1YJN V;  5JH7 A;  2ZIM A;  3R66 A;  5JVD A;  4LF5 O;  5JH7 B;  4QIW F;  2E75 B;  2GBO A;  2ZKO A;  1US6 A;  1O9H A;  4GX5 A;  4X1Y B;  2RJZ A;  1VQM V;  2IJK A;  3CRM A;  2X6C A;  4X88 A;  1QCE A;  5EZY A;  4YHH B;  3ETQ A;  4CH4 A;  2BTQ B;  2WLI B;  4EB6 A;  2R9R B;  1D5N A;  5LOV B;  2DQ0 A;  2ZCE A;  3NR7 A;  1KC8 W;  1ZAU A;  4WF9 V;  1B06 A;  1YJ9 V;  3OAA G;  1PV0 A;  4I9Q A;  3CXC U;  1H2L A;  1XMQ O;  4R7C A;  1TUE B;  1P84 F;  5LYJ A;  3SJQ C;  1Y6X A;  3ZMU A;  1KD1 W;  3CB2 A;  4X64 B;  3ZMS A;  4FZ0 A;  1BL8 A;  3W7U A;  1XMQ B;  1SRY A;  3O65 A;  3LDE A;  2AHY A;  2ZT9 B;  4DV6 B;  4NXM O;  2JK5 C;  3KG2 A;  3OTO B;  1K33 A;  2LQT A;  4RQF A;  3BAB A;  1VQO V;  4JYA O;  4JI5 O;  1RM1 C;  3T1C A;  1O9G A;  3UM7 A;  1PKX A;  3OR7 C;  4YXW G;  2ILM A;  1QR9 A;  3K03 A;  4LFB B;  5LXT B;  1I0H A;  1K5S A;  1VQ9 V;  2ZR3 A;  4PI0 A;  1F51 A;  1YTF D;  1NJI W;  2EIK B;  3UO3 A;  4FLV A;  2QM8 A;  1BS3 A;  5KMG B;  1R6N A;  2XAH A;  4BW5 A;  3CCQ V;  1JPX A;  1D5A A;  4JAA A;  3VQY A;  4FFB A;  1N8R W;  1PL0 A;  4X1I A;  1ORQ C;  3IC7 A;  2X6A A;  1UFI A;  5IJ0 A;  3FB7 C;  1OHH G;  3ZRW A;  1I08 A;  3RFR A;  4PJ0 Z;  3CRR A;  1B04 A;  4K8X A;  1DGS A;  5FNV B;  1WA8 B;  4ZHQ A;  2EIM C;  4I0X A;  5JVD B;  3RVZ A;  2UUC O;  4DV0 B;  2XOK G;  3OFN G;  2NNU A;  1OCZ C;  3UQ8 A;  4QPK A;  1GK9 A;  2HVJ C;  2Q7G A;  4GKJ O;  1OJH A;  3ABL B;  4WFE A;  4LF6 B;  2ZM6 B;  2AZ2 A;  5LL6 Y;  1XNR B;  5J2T A;  1P49 A;  3RW0 A;  1S5J A;  4MVZ A;  1WB8 A;  1M93 A;  5KLV H;  1VQK V;  1FXK B;  4LWS A;  4UV8 A;  2A06 H;  2NR5 A;  4HAM A;  3RN4 A;  1SKV A;  3CCR V;  1JJO A;  1GKF A;  3JD3 A;  3I55 V;  4QE7 A;  1WN7 A;  1Y76 B;  3K79 A;  5DN6 G;  1FXH A;  3MD0 A;  3DC5 A;  2P6J A;  5CA3 A;  1BGY H;  5C8Y A;  1FXV A;  5IJ9 B;  5L3E A;  1ZX3 A;  4B3S O;  2JGD B;  1FS0 G;  2XAG A;  1R3I C;  4GLX A;  1LUV A;  1R6K A;  3TCU A;  1Q6I A;  1G6U A;  3ZIA G;  5EBW C;  2FB5 A;  2CAZ C;  1NT2 B;  4P30 A;  2ZXW C;  3HKC B;  1VQ4 V;  2A7W A;  1YIT V;  1WLE A;  3SYC A;  3CCS V;  3ETG A;  4PEL A;  4IIJ A;  1SS3 A;  4NR1 A;  4H33 A;  2XTA A;  1HNX O;  1FXK C;  2BSK A;  4N23 A;  1E1R G;  4DR2 B;  2P90 A;  4FVM A;  3B4S A;  2F4V O;  1GN4 A;  2WA4 A;  3RYC B;  4DW0 A;  2F23 A;  2RDC A;  3JAL B;  3ZRX A;  1S5H C;  2QM4 A;  2YID A;  1N34 B;  1FJG B;  1ENV A;  4X89 A;  1S5L Z;  3CEI A;  2YXH A;  3FB5 C;  1BZK A;  1I5X A;  1I7F A;  3N27 A;  2WLJ A;  4MVS A;  3BCC H;  3BPZ A;  5KHJ A;  3HKE B;  2EIN C;  2OCC B;  4JTC B;  4IIJ B;  4UVB A;  2QSA A;  4JI0 O;  2LW7 A;  5AG2 A;  5IDJ A;  4NTW A;  4P9O A;  1VF6 A;  3C3S A;  5H6R A;  4NXN O;  4LF6 O;  4KUM A;  3BAA A;  2JDI G;  2QGN A;  4X65 B;  4FM1 A;  2EUL A;  2EX3 A;  1IBM B;  2Q67 A;  5IJ9 A;  3K0G A;  1BHA A;  3OGC C;  2WLH A;  1OCO B;  3JD0 A;  3ETE A;  4X66 B;  3CC2 V;  2KSD A;  4MTX A;  2UUA B;  2UXB O;  5CBH A;  1MSW D;  5EZY B;  3VQW A;  2RCV A;  2OYQ A;  4H37 A;  4X66 O;  1J5E B;  1FFX B;  5JCO C;  2LP7 A;  2DWE C;  3CCV V;  3N2G A;  4X62 B;  1IBK B;  2ZE5 A;  4LF4 O;  5J2U A;  2HP8 A;  5D5Q A;  4CS3 A;  1I94 O;  5EIB D;  1W0J G;  3E83 A;  3K08 A;  4G27 B;  3E2E A;  3K5N A;  1EN4 A;  2GUZ A;  2E5L O;  1N33 B;  3IAY A;  1MMM A;  1QVF U;  1QNM A;  4PA7 A;  3I5D A;  4IYH A;  2ADQ B;  4MW8 A;  3FYE B;  2AXT Z;  3WB0 A;  4MTO A;  1CPY A;  4ICG A;  4K3A A;  1XNQ O;  2YI8 A;  4G28 B;  1LUW A;  4UCO A;  1SA0 A;  1FD9 A;  2IU3 A;  3HKC A;  3CX5 F;  1OV9 A;  1HNX B;  1N4C A;  1PNM A;  5FPR A;  4JI2 O;  2PUS A;  2Y69 B;  1AIL A;  4PI2 A;  1FFT B;  3RBZ A;  2OCH A;  4JYA B;  4RUE A;  1U96 A;  2DYS C;  3JAL A;  3SYA A;  1V54 C;  4UCS A;  1EN5 A;  1DF5 A;  3LSS A;  4DR4 O;  3ABK B;  2Q6A A;  4W4K A;  3STZ C;  1ZTE A;  3DXR B;  1NR7 A;  1RSO B;  3APQ A;  1ARO P;  2IM9 A;  5J9P C;  3JD1 A;  4XBF A;  3LDC A;  2Y4U A;  3K0D A;  5KHH A;  4JTA B;  2KG7 B;  4KXR A;  5IY5 B;  3GB7 C;  4DV1 O;  2YUA A;  3S3X A;  2YS8 A;  5IT9 N;  1SQF A;  2ZE7 A;  2JGD A;  3SPJ A;  4XDK A;  1OCO C;  4KP4 A;  2A3Q A;  3LUT B;  2CTR A;  4JI8 B;  2UXN A;  3JCZ A;  3T4Z A;  4HBN A;  3ZHS A;  4F4L A;  2OTJ V;  3OTF A;  3RYH B;  3D8C A;  4RUF A;  3ZJZ A;  5EYP B;  1HNZ B;  1Y67 A;  3G67 A;  2RQ6 A;  4JYC A;  3N2K B;  3JYC A;  5GON B;  1HNW O;  2XND G;  4FFB B;  1YVW A;  2UUA O;  4F6R B;  4LCU C;  2EIN B;  2OCC C;  3JAW A;  3WG7 B;  2DYR C;  1EBO A;  3OW2 U;  1XMO O;  2CTQ A;  4DV3 B;  4B3T B;  1U97 A;  4LF4 B;  1A32 A;  5LGT A;  1YXB A;  3SDL A;  2OWO A;  4AQY B;  4OX9 B;  2Y69 C;  4WFB V;  2JVD A;  4FFK A;  3ZRW B;  4B3M O;  2E76 B;  4BR6 A;  4U3F H;  1NI8 A;  3JCU Z;  1YDX A;  4LFC O;  4WFG A;  5IYZ A;  4P9P A;  3TXQ A;  2EIL B;  2QWP B;  3W7T A;  4GZR B;  5KMG A;  3IJ4 A;  1OCC C;  4FLW A;  4IGG A;  4MVQ A;  4JI2 B;  4I4T B;  5JCO A;  3A0B Z;  4JI5 B;  2L35 A;  2YIC A;  4X1K A;  1Q82 W;  1W2B U;  4JV5 B;  1RP3 B;  3CMA V;  1TGO A;  1COW G;  1QU7 A;  4NB5 A;  2Q8V A;  1T5E A;  3M99 B;  2DYR B;  3D36 C;  3E22 B;  3C90 A;  2ZIN A;  1Y76 A;  3LNM B;  4GYC B;  4XDJ A;  4DW1 A;  5IYZ B;  3HR0 A;  3P30 A;  3WU2 Z;  2Q0O C;  4DK0 A;  5D5P A;  1IBK O;  5IYB O;  4DRX A;  1KBH A;  2N04 A;  4NVP A;  4HNA B;  2ZR2 A;  1SF9 A;  1M5I A;  4J9Z B;  1M9N A;  2CE4 A;  4MTF A;  2QKS A;  4DV4 B;  3FKS G;  4O4J A;  3ZHR A;  4DR2 O;  3D3Q A;  1VMG A; 
#chains in the Genus database with same CATH homology
 3B2E E;  4FLV A;  5KMG B;  3SJC C;  4U3J B;  3VQV A;  5LXT A;  4F6R A;  1D5A A;  3VQY A;  4FFB A;  4KL1 A;  4BWA A;  2PYJ A;  4X1I A;  4YJ2 B;  4LNU A;  5JQG A;  4I50 A;  5IJ0 A;  4FLY A;  3RFR A;  3T1Y B;  4O4L A;  4JI7 B;  1B04 A;  3K5O A;  4K8X A;  1DGS A;  5FNV B;  4WBN B;  3LNN A;  4ZHQ A;  5LMN B;  5JJE B;  5JVD B;  5LP6 C;  1VF7 A;  1KU9 A;  4DV0 B;  4FLZ A;  1TUB B;  1TA8 A;  4GKJ B;  5C8Y B;  5LA6 A;  3UQ8 A;  5EIB C;  3SGI A;  2Q7G A;  4O4J B;  4LF6 B;  2ZM6 B;  5CA0 B;  1XNR B;  5J2T A;  5LYJ B;  1P49 A;  4TUY B;  4DUZ B;  4NXN B;  1S5J A;  4BW9 A;  4ZI7 A;  4DR4 B;  4O2B B;  4DV1 B;  2HHH B;  1M93 A;  5KHK A;  3N2K A;  2JGU A;  4O2B A;  1XI1 A;  1KMI Z;  3UT5 B;  4TUY A;  1TVK A;  3HKB B;  1SKV A;  4IHJ A;  3THO A;  4DK1 A;  3JAT A;  1JJO A;  1WN7 A;  2VQE B;  3E22 A;  1QQC A;  5CA1 A;  5CA1 B;  5BR8 B;  5C8Y A;  5IJ9 B;  4B08 A;  2P5O A;  4JI6 B;  4AHC A;  5LP6 B;  4GLX A;  4TV8 B;  4IHJ B;  1HNW B;  1G6U A;  2R70 A;  4DR1 B;  1JFF A;  4Q6G A;  2CAZ C;  4B3S B;  1NT2 B;  3HKC B;  5FPO A;  3SJA C;  5BMV A;  4LNU B;  5LOV A;  3RWR D;  2BTQ A;  2HEP A;  4IIJ A;  4DUY B;  4K0K B;  3U0Z A;  3BA9 A;  1N32 B;  3K58 A;  1WNS A;  3BA8 A;  4DR2 B;  4TQD A;  5LA6 B;  2UXC B;  4FVM A;  2PY5 A;  1TUB A;  2JS5 A;  4TV8 A;  3RYC B;  3RYC A;  4CC5 A;  3JAL B;  4UFZ A;  2QM4 A;  1N34 B;  5FNV A;  1FJG B;  5JJN B;  2UUB B;  3K59 A;  4O4L B;  4K8Z A;  4HNA A;  1I7F A;  2ZIO A;  3JAK A;  4I50 B;  5IJ0 B;  3BPZ A;  5KHJ A;  3HKE B;  4DRX B;  2F66 C;  4YJ2 A;  3PN1 A;  4IIJ B;  1XHZ A;  4UCR A;  5K1P A;  4U3J A;  4LF9 B;  3RGB A;  4B3M B;  5BMV B;  3RYF B;  2UU9 B;  3JAR B;  2E5L B;  1JFF B;  5CB4 A;  4TOI A;  2ZNJ A;  4O4I A;  5ITZ A;  1HW7 A;  4O4I B;  5ITZ B;  1XQ8 A;  3BAA A;  5CB4 B;  4FM1 A;  4X65 B;  1I94 B;  1H2S B;  4O4H A;  2EX3 A;  1IBM B;  5KHG A;  3BHP A;  5IJ9 A;  2PGG A;  4ZOL A;  4X66 B;  1Z5V A;  3HKD A;  3JAS A;  4LH7 A;  3JAT B;  1SQG A;  2UUA B;  4FLX A;  5EZY B;  3VQW A;  4B3R B;  3HKD B;  3JAS B;  3JSN A;  2OYQ A;  1WPB A;  1J5E B;  1FFX B;  4X1Y A;  5JCO C;  4DR3 B;  2F1M A;  4LH6 A;  4O4H B;  2Q7E A;  2R72 A;  4JI0 B;  2Q7H A;  2F93 B;  4DV5 B;  3CSX A;  3N2G A;  4L8J A;  4YY3 B;  4X62 B;  1IBK B;  5J2U A;  5D5Q A;  4CS3 A;  5EIB D;  4FLT A;  4TV9 B;  4X1K B;  3QTC A;  3K5N A;  1YEW A;  1N33 B;  3U11 A;  1X4T A;  3IAY A;  4I4T A;  4DR6 B;  4UCV A;  3RYF A;  3WB0 A;  5IWA B;  4CH5 A;  4UCT A;  4X20 A;  4AIL C;  5J2U B;  2YI9 A;  5GON A;  2YI8 A;  4ZHQ B;  3SJB C;  4UCO A;  1SA0 A;  3A2F A;  3HKC A;  2R9A A;  4LR3 A;  1HNX B;  5KHI A;  5FPR A;  4D7S A;  2XHB A;  2PUS A;  3K5L A;  4ZIB A;  3QF7 A;  4PI2 A;  3DSQ A;  2YIA A;  4JYA B;  4I55 A;  3JAL A;  4UCS A;  4LF7 B;  1Q5O A;  4EFE A;  1L8D A;  4ZOL B;  3JAW B;  5JJJ B;  5KX5 A;  4DV2 B;  1JMK C;  2IM9 A;  4DR5 B;  1N36 B;  4EFB A;  4LF8 B;  2BTO A;  2UUC B;  5KHH A;  4JI1 B;  4CS2 A;  4TQF A;  3RYH A;  3WB1 A;  4NXM B;  5LP6 A;  5CA0 A;  1SQF A;  4PHZ A;  2VQF B;  4O2A A;  4CC6 A;  4JI8 B;  3ZS8 C;  4HBN A;  2VWK A;  3BRC A;  1M4U A;  3QG5 A;  3OTF A;  3RYH B;  1TVK B;  2F95 B;  3HKB A;  2PZS A;  3UT5 A;  4LFC B;  4FLU A;  4JI3 B;  5EYP B;  1HNZ B;  2RQ6 A;  3JAR A;  4D7T A;  3N2K B;  1Z5W A;  5K1X A;  1TAE A;  1Q43 A;  1XHX A;  4X1I B;  5GON B;  4FFB B;  2KKW A;  4DV7 B;  4F6R B;  5J2T B;  3K5M A;  1Q8I A;  4DR7 B;  3M7M X;  2YIB D;  1XMO B;  3JAK B;  4CS4 A;  3JAW A;  2YXL A;  2VWJ A;  3RYI A;  4LFA B;  5LMU B;  4LF5 B;  2P22 C;  5JH7 A;  2ZIM A;  4DV3 B;  5JVD A;  4B3T B;  5JH7 B;  3K57 A;  2F4V B;  4LF4 B;  2OWO A;  4JI4 B;  4WBN A;  3MAQ A;  3RYI B;  1HR0 B;  1QHT A;  1O9H A;  4AQY B;  4OX9 B;  1FFX A;  4X1Y B;  2JVD A;  2RJZ A;  1SA0 B;  3FFQ A;  2PTM A;  5EZY A;  4CH6 A;  2GV9 A;  4YHH B;  2QJ1 A;  3ETQ A;  4CH4 A;  2BTQ B;  4EB6 A;  5IYZ A;  5LOV B;  2ZCE A;  1ZAU A;  2Q0A A;  5KMG A;  4FLW A;  4JI2 B;  4I4T B;  3JSL A;  5JCO A;  3T1H B;  4JI5 B;  4KHP B;  4YJ3 B;  4I9Q A;  3SR2 C;  5EYP A;  2YIB A;  4X1K A;  4TV9 A;  5LYJ A;  2ZNI A;  3CHX A;  4JV5 B;  1V9P A;  1TGO A;  3CB2 A;  4X64 B;  1IBL B;  3N2G B;  1T5E A;  3WB2 A;  1XMQ B;  3E22 B;  4O2A B;  1Q3E A;  2ZIN A;  4DV6 B;  4CH3 A;  4GYC B;  3ZED A;  4EB6 B;  5IYZ B;  3OTO B;  2E3C A;  4I55 B;  4GKK B;  4DK0 A;  5D5P A;  3BAB A;  3HKE A;  4DRX A;  4NVP A;  2V4D A;  4HNA B;  1O9G A;  4EEQ A;  4UCU A;  1M5I A;  3ICX A;  1XNQ B;  5JQG B;  4ZI7 B;  2PYL A;  4FM2 A;  2UXB B;  3VQX A;  4X20 B;  4LFB B;  5LXT B;  4DV4 B;  1RSO A;  4FM0 A;  2UXD B;  3U10 A;  4O4J A;  4YJ3 A;  5KX5 B;  4PI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...