3SJCC

Crystal structure of s.cerevisiae get3 in the semi-open state in complex with get1 cytosolic domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
54
structure length
54
Chain Sequence
LSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 21
structure length 54
sequence length 54
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2011-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sjcC00
3QG5A 3SJCC 2P22C 1SKVA 1NT2B 2F66C 3QF7A 3SJBC 3THOA 3B2EE 3SJAC 2CAZC 3CSXA 3ZS8C 3ICXA 2JS5A 1X4TA
chains in the Genus database with same CATH superfamily
3HKDB 4DR3B 3ZHQA 2GSMB 1RPRA 4DV3B 2QM7A 4GKJO 3OUSA 4P30A 3OM3B 2P22C 4UFZA 1P7BA 4L8JA 3D3QA 1K5SA 3ZRXA 4ZHQA 1JQ0A 2RCVA 5IJ9B 1KB9F 4NVPA 1N0NA 2Y4TA 2HVJC 5B3SB 2WA3A 3MD0A 2ADQB 4Z1MG 3ZS8C 2VQEO 5KHKA 3UQ8A 1YI2V 1OZ0A 3FB5C 1YHQV 4X1IA 1B06A 4MW8A 4AQYB 2QWPB 5A2QN 2OCHA 3FFQA 3H1LH 2PI4A 3OW2U 3T1HB 4RUFA 1IZ3A 1BMFG 3M8AA 1GK9A 4TV8A 1KECA 3STLC 3RFRA 4FFBA 2P7TC 4HBNA 3L9DA 1OCOC 3ETGA 4TSFG 4JTCB 3TCUA 5IYCO 1BCCH 4CC5A 4K0KO 1WN7A 1US6A 3CCRV 4I50B 1FD9A 2QKCA 3W7TA 4ZIBA 2P4KA 4FLYA 1ZUQA 1G4YB 3RYIA 4TOIA 4YHHO 4DV6O 2UXBB 3LDEA 1BS3A 4JYAO 3IAYA 4CH5A 1TVKB 2QR4A 4DUZO 4MVZA 4YY3O 3BA8A 4JI2O 2UUCO 1NH2D 5IJ9A 1NTKH 2IH1C 3EFFK 4GLXA 5BR8B 2OT5A 1KP2A 5IY5B 2X6CA 3E83A 1MZEA 4R50A 2EULA 5KHIA 1GO3F 5BZBA 2ZXWC 1K4DC 3TXSA 4UUJC 2F93B 2Q7HA 4BIUA 3T4DA 2QA4V 4RWUA 4BIOA 4DR5O 4FK5C 4JI0O 3ETDA 4J42A 1JVMA 2HJFC 2Y4UA 2JGUA 1XI1A 3JASB 4QGPA 2ATKC 3AG3B 1YTFB 1OCZC 4I50A 2LW1A 1S5HC 3OAAG 4WCEV 3BEHA 3AK2A 1I94O 3K0GA 2HFEC 4R8CA 3P3NA 4G28B 1VIBA 1B04A 4X66O 1OCRC 3Q4HB 3OR7C 4CH3A 1I7FA 1SZTA 2B5UA 1HP8A 2YI8A 3KCXA 1TVKA 1Z5WA 1NS1A 4UB6Z 4LFBB 4JI4B 1M1KW 1M4UA 2Q5ZA 3IFXA 1PL4A 2ZNJA 2NLJC 4EKWA 3MDSA 4UVCA 1N36O 3JAKB 2DN9A 1VF6A 1R73A 3HKEA 4NTXA 2OWOA 2BOBC 3FAVB 1N32B 2R9AA 3G80A 3AEIA 4NXMB 1R6KA 4PDLA 2HP8A 1AP6A 1EN6A 3VQWA 4D7SA 3L70H 4I4TB 4B7KA 1NVPB 2RNBA 3GWKC 1FYJA 3MAQA 2NN4A 1Q6IA 1B3QA 5FNVA 2ZXWB 4LH6A 1Q82W 4TUYA 1P4RA 5LHIA 4JI1B 2Q0AA 1WPXA 1RM1C 3JSNA 4RQFA 2HR3A 3J80N 2WLMA 3JASA 1XUQA 5DECA 1VQ4V 4LF5B 3RVYA 2IM9A 3A8TA 1HNZO 4B3RB 4JTDB 2R72A 3K5LA 1IBKO 3N2GA 3Q4HA 5FLXN 3AG2C 3E8GA 2EIJB 1BHBA 4X8AA 1NQTA 2CTPA 3PJSK 3RYCB 4CBCA 4TQFA 2JVDA 5GW7A 1CEZA 3JAKA 2FL4A 2P90A 3I5DA 3FAVA 2LFRA 2LP7A 1SKVA 1R3JC 2YXLA 2OCCC 1VQ8V 3CC2V 4B3SB 1O9HA 3VQYA 3FYIB 2Y0IA 4JYCA 4I4TA 3SGIA 3CXHF 4LF7O 1AI7A 3GWOA 1AJNA 1GM7A 2QM4A 1QHTA 3CMEV 1OHHG 2JEXA 4WFHA 1V9PA 1VQNV 1NU1H 4J41A 2FB5A 3CD6V 1XL4A 3FKSG 3ZMSA 4DXWA 2ZKOA 2EILC 3M7MX 3QG5A 3CWBH 5B1OA 3C3SA 1IBLO 3ABLC 2EIKC 1GN4A 2YIAA 3ZRVA 4QIWF 3RYCA 2BTOA 1AI4A 1KP3A 3MHSC 1VF7A 4DV4B 1D2DA 2F66C 1XHXA 4ASUG 2EJRA 1KU9A 2WLIB 4OXSA 1WAZA 5H6QA 5BMVB 4DV1B 3ZEDA 2JEUA 2Y69C 3F5TA 5D5QA 1MABG 2UXXA 4EFEA 2P4VA 2JRIA 1SF9A 2QWOB 1H2MA 4X65O 2AHYA 4H13B 2OCCB 4GT1A 3AG4C 3HKBB 3X2QC 2D2CB 4X64O 2WWWA 3ASOC 3ZBHA 1AR1B 2VQFB 4KFMA 3DTUB 3RBZA 1PNMA 2QWRB 2Y48A 2YS8A 2ZQMA 2ZCEA 3E35A 1SC5B 3FB7C 5B66Z 5LOVB 4WBNB 1SQQH 2E74B 2YXHA 2WPDG 4LH7A 2ZINA 1SQVH 4TWKA 2A3QA 1XMOO 2ZR2A 4DV5B 4A5UB 5LHGA 2RQ6A 4KHPB 2XTAA 1MSDA 2X6AA 3NR7A 4J9YB 2DOSA 3J81N 1R1BA 2GTSA 1BL8A 1F23A 1ZTEA 3AG1B 5JH7B 1FXHA 4KL1A 3R65A 4JV5B 5K1XA 3CYOA 1W59A 4HYOA 3K5NA 3CCJV 2EIKB 2A0LA 2WLIA 4H44B 3FB8C 2Q0OC 1W2BU 2B1IA 2EZPA 4DUYB 4MT8A 2Q6AA 1KKDA 3BVOA 4B3TO 1B6QA 4LF6B 1SZXA 1WPBA 4PD4F 1X59A 5JCOC 3THOA 4U3FH 2VWJA 5KUKA 5IWAB 1VQ9V 1BZKA 3E2EA 3G6EV 3HKBA 2FKXA 4OGQB 2ZDIA 1L0NH 1I5XA 1Y6XA 4I5SA 4O2BB 3F7YC 2P5OA 3EHBB 1L1FA 3BCCH 2OTJV 5LOVA 1FS0G 3AG4B 3P32A 4AI8A 4IIJB 3MHHC 2IH3C 1D5AA 4HNAB 1Q43A 4WFFA 2GUZB 5KHGA 2O57A 2HHHB 2ZT9B 5LP6B 2ADPA 4JI6O 2IU3A 4Q6GA 2IU0A 2A79B 3UT5B 2BSKB 3L74H 2UUBB 5JH7A 4EFBA 1GN2A 4K8ZA 1URFA 1PNLA 1AB3A 3ETEA 3H1JH 3ML0A 1LNQA 5EK0A 4GZRB 2PUSA 3ICXA 4QNHB 5GTHZ 3T1CA 3ZHVA 1ZWIC 4LFAB 5LMUO 4DRXB 5CBHA 3K3WA 5L3FA 1I0HA 4JTAB 2F4VB 2ZE8A 3CCLV 4I0XB 3ABTA 3SYPA 1SETA 1F51A 4O2BA 1YDXA 3WG7B 1PL0A 4ZI7B 4Q20A 3UO3A 5B1BC 2MK3A 2OTLV 3LNNA 5J9PC 5DEDA 2K1EA 3K59A 4IIJA 3SJCC 5CBFA 5BR8O 2WLHA 4HNAA 1K8AW 4K3AA 2G38A 4AHCA 5LP6A 3WB2A 4OX9B 1IX9A 5KHHA 1HWYA 3JD2A 5CA1B 3UT5A 2BSKA 2LGWA 3ZX6A 1Z2GA 1F4MA 4R7CA 3T4ZA 5JVDA 2X0LA 3ZRSA 1KKCA 5IYDO 4DR1O 4P9OA 2PYJA 2JJ1G 1VQOV 3RYFB 2AGAA 1MNGA 4MTFA 2GBOA 5IYZB 3SPCA 1LUVA 1IXBA 4XBFA 3DGEA 1K34A 4PDRA 3JARB 4JZ2A 2KQXA 3D36A 1XMQO 4DRXA 1YITV 1GM9A 4B3MB 5BXZA 2ZM6B 1QCEA 4GKKO 3ABKC 5L3GA 5IJ0B 3CRCA 4UCUA 1N34B 4PA3A 5F2VO 4I0XA 4LC1A 3CCSV 1H2KA 4JYBA 4CS2A 5LMNB 4ZI7A 3JD4A 3APOA 4NXNB 3JD1A 1FFTB 2JGDA 5ITZB 1CXZB 2QEXV 4D7TA 3NXSA 4D6TH 1HNWO 2LFSA 3VBBA 2D3OW 2HVKC 1M57C 4JI7O 4QJFB 1BQZA 3E22A 1QLEB 1GH6A 1TA8A 1R6NA 4JAVA 1N32O 1LUWA 3KKYA 3U10A 1SQPH 3ZHRA 5LL6Y 1KYOF 2YUAA 2WLLB 3LSUA 2V7QG 5CA1A 1MA1A 3OTOO 3A0RA 1N8RW 1OJHA 1K33A 3HKDA 4LNUB 4JF3A 1Y76B 1QR9A 1EZJA 1K5QA 3RYFA 4FLXA 2QWNB 3ZN0A 2YIBD 1J5EB 2DE0X 1GN6A 3K08A 3RW0A 5IYZA 1Q7YW 3L72H 2UUAO 3DSQA 5EZYB 5EYPB 3JARA 4PA9A 2W0XA 5GTIZ 3E8HA 3UO2A 4JI5B 2CUGA 4X89A 5FPRA 5KUMA 1JA8A 1EBOA 5IJ0A 1MSWD 1SQXH 1SA0B 1HDJA 2VRZA 4DR4O 5LGTA 1H2GA 5JQGB 1XOUA 4LP8A 1FJGO 1Y74B 4YIPA 3RN4A 1K7DA 1RP3B 2H94A 2E76B 2DW4A 4JI8B 5ITZA 5KAIZ 1WB7A 1ZL8B 4P2ZA 3I55V 2EX3A 3JD0A 2P67A 2AZ2A 2M7WA 5HFLA 2ZE7A 3LDDA 1IVSA 3K06A 4FM0A 1TUBB 1XNQB 2N04A 3M99B 1QVFU 4DR2B 3B8NA 2YEVB 4PDVA 4U7NA 4B3SO 5CB4B 3JD3A 4GKJB 1M5IA 2X7RB 1X4TA 3L75H 5JJEB 4X62O 4RUEA 1NH2B 3VQVA 1M93A 4DR6O 1OCOB 2DJVA 1WJZA 5KA5A 1DGSA 2DYRC 4J9ZB 3CRQA 1COWG 1NVPD 5GONB 5EZYA 5EYPA 2Q4PA 3OMAB 2VQEB 1FKAO 3AK1A 2YXYA 1K4CC 3A2FA 1M56C 1S72V 2L6LA 1YCIA 1BT8A 1SA0A 2ITDC 4I55B 5EBLC 5JQGA 3SYCA 1JJ2U 4LF4O 1Y74A 1K9MW 3SJQC 1Q86W 2R70A 3JALB 4IT5A 1WP8A 1SQBH 4PDMA 3DXRB 4KP4A 4O4JB 1ZL8A 2JDIG 5CA0B 2AZ0A 2XHBA 1OCCC 4IL6Z 4K0KB 4DV4O 2ZD9A 2ZR3A 4LFCO 2ITCC 4BW9A 4NTWA 1EN4A 1HW7A 2YEVA 1VMGA 4JI3O 1GKFA 4YHHB 2QJ1A 5CB4A 5KX5B 4X1YB 1QR8A 3G6BA 4J10A 2UXCO 3ZHSA 4YY3B 1AJPA 1IBMO 1OCZB 4JI2B 2UUCB 4J11A 3DC5A 1EFRG 2RJZA 5GONA 4CZZA 1H38A 4UCRA 2HKOA 1HNXO 3OR6C 1OCRB 3H1KH 5B1AC 1YZBA 1P7GA 5L3BA 4DK1A 1GN3A 3EVKA 2EINC 2DYRB 1KMIZ 3RWRD 5DM6V 5CN0A 4I55A 2EZOA 4Z2WA 4IHJB 4JI0B 4LR3A 4MW3A 4P9PA 3E8FA 2N05A 2AW9A 2UU9O 3CPWU 2CGNA 3DXRA 3RT3C 3L73H 2K9PA 4O4JA 5CA0A 4JV5O 1TUEB 3IJ4A 2WAMA 3QO7A 4O2AB 4CH4A 3WU2Z 1W0KG 2CTQA 1MOFA 2F43G 4HAMA 1CPYA 4DV2B 4X66B 2YSUB 3FX7A 1OCCB 4PI0A 4X1YA 5KX5A 2R9RB 1BQ0A 5EIBD 3ABMC 3CXCU 3JCZA 2HEPA 1RM1B 1G1XB 5IWAO 3HPLC 5K1PA 5JJJB 1NKDA 4TV9B 2LQTA 3SYOA 3TK1A 1JMKC 1FXKC 2Q67A 1PD3A 1S5JA 1N36B 3WB0A 3ZJZA 3AG2B 1YIJV 4FIPC 2YC0A 5LXTB 3UCSC 1VF5B 5L3CA 4IHJA 4DV7O 1HR0O 1PPJH 4UB8Z 2MW2B 3K0DA 2EINB 4DYLA 4LF9O 1TAEA 4EB6B 2F1MA 4H33A 3OT7A 2AXTZ 1G8MA 4PA7A 4DR7O 1NR1A 1NI8A 2XAJA 4O2AA 4GX2A 3N2KB 4IYIA 4UXNA 1JFFB 1XNRB 2L35A 1HNZB 3P3PA 2Z3YA 1J95A 1IBKB 2CH7B 1XREA 1IURA 4LFAO 3LSSA 1BSMA 4X20B 3T1YO 3AG7A 4ZBMA 2W6IG 2CDYA 2ETNA 1N33O 4TV9A 2EILB 3DC6A 2F4VO 1H2NA 4J7KA 3JCUZ 2LW7A 3CMAV 1WA8B 3ABMB 4X1KB 4MTXA 3SPIA 5KMGB 5JWPA 1UPGA 2Q8VA 3RGBA 3CRAA 3ZHTA 2YICA 4NB5A 3RVZA 3ABLB 5TISZ 4DV0O 3ZMUA 5E1AC 4H0LB 2B9ZA 5LXTA 4QPJA 5BMVA 4LF8O 2YDEA 2FTKA 4FZ1A 4OPHA 4K8XA 4IGGA 1VARA 4OX9O 2WA4A 5BY1A 2E5LO 2PYLA 2UXDO 5H2FZ 4EB6A 1XHZA 2DQ0A 2PZSA 3QF7A 2Y69B 4DR3O 5AG2A 4WFAV 4DV3O 3O65A 4LWSB 1KUQA 1Y67A 3N2KA 3QTCA 1YF2A 2BE3A 1JFFA 1WB8A 2Q68A 2OIEA 4GX5A 2CH7A 2R9IA 1XBLA 4WBNA 3X2QB 4I9QA 1SERA 3H1IH 1IBLB 4GCZA 5H6RA 1KQSU 3ASOB 1R3LC 1UJWB 2CTRA 3SR2C 4CC6A 2ZM6O 4I9WA 4W4LA 4NYKA 2UXNA 3N27A 1N34O 1N4CA 4F4LA 4TT3G 2QGNA 3JATB 3CX5F 1WA8A 4RAIA 5IYBO 4X1KA 2P06A 5FPOA 4GX0A 1YJWV 1VP7A 1ZAUA 4RQEA 2LJ2A 4X9QA 5J2UB 4NXNO 4AQYO 2GTAA 2Y0PA 4F6EA 3APQA 4FLZA 1L8DA 3T1HO 5LGUA 5B1NA 4MTOA 3OFNG 1EZVH 3JYCA 5H5NA 2GV9A 4FZ0A 2Q69A 4DW0A 4FM1A 3S3WA 4X65B 5EC1C 4FLUA 4FMTA 2EJ7A 2DYSC 1AI5A 3D3IA 3F5WC 3QNEA 1S77D 1FAFA 1RFYA 1PV0A 3BHPA 4DK0A 3H01A 1M90W 2UXBO 4LWSA 1VQPV 5KAFZ 1JX9A 2P6JA 4PA6A 5LA6B 3OTFA 1L0LH 1AP5A 4YJ2B 1QLNA 5L3DA 1PNKA 1R3IC 3VQXA 2QWQB 3ASNC 3U11A 3G71V 1VEWA 2GUZA 1BGYH 3IC9A 2AHZA 3ZMZA 4X1IB 1P49A 3FB6C 4QPKA 3UKMA 1KC8W 4KUMA 2CAZC 4ABMA 5J2TB 3CP1A 2QSAA 5J2UA 4TV8B 4JI8O 1GRJA 2CK3G 1VQ7V 1BE3H 1H8HG 4B3TB 5EC2C 2Q73A 4JGSA 3SPJA 4FVMA 3ABUA 2LGQA 4U7OA 1GM8A 1U97A 3RYIB 1AILA 3FYEB 4LBEC 3OEHG 2PI5A 4H37A 3OGIB 2JS3A 4EEQA 5IY5C 1Q5OA 3BRCA 4E2LA 1VF6C 1MMMA 4IYHA 1VQMV 2XASA 2IJHA 1XQ8A 1K3EA 4BIZA 5JCOA 3ETQA 4HZ3A 2DYSB 2XT9A 1XEQA 3E86A 2JK5C 4YJ3B 5LA6A 1NTMH 4YJ2A 4LFBO 4LCUC 4JI4O 3K5MA 5KA6A 2ZE5A 2KSDA 3W7XA 1EM1A 4JI6B 2H3OA 1PP9H 1WP7A 4FLWA 2WSSG 3RYHB 5B1BB 3F7VC 3ASNB 1QU7A 3AG3C 1W0JG 4NXMO 4UVAA 3SPHA 4PV1B 4CS4A 2PY5A 5J2TA 3OMIB 2IW5A 3I56V 3QVNA 2VWKA 4G27B 2DWDC 1AR5A 4GUNA 3ZN1A 1K92A 1Y4MA 1E79G 2A9HA 2WLJA 2XAFA 4O4LB 5LMUB 3E8BA 2CE4A 3W7WA 4JI1O 5D5PA 2A06H 1JJOA 1Z5VA 5CMUA 2Q7EA 5CA3A 4LF5O 2JJ2G 4WFBV 4FPPA 1V54C 2E3CA 3CCEV 1CP9A 1YTFD 4B3RO 4BR6A 1JR9A 2NR5A 3BFRA 5CBGA 4J7JA 2HJDA 4YJ3A 3ABKB 3OMNB 1XILA 1QQCA 2W6JG 4I7ZB 5IE9A 1VQ6V 3S3XA 3HKEB 1TGOA 2HG5C 4CH6A 2QKAA 3B77A 2QM8A 5LBQA 2V1DA 3RYHA 5C8YB 2ILMA 1IXMA 2CTWA 2JS5A 2W0FC 3ZMVA 1E1QG 2ARHA 2Q7GA 4DR1B 5KHJA 3SJAC 2WLLA 3WB1A 3B40A 5FNVB 1M57B 4TUYB 1KD1W 2LO1A 4QE9A 4LNUA 1Y76A 3WFVA 1NJIW 1XDCA 3GVMA 4O4LA 3CEIA 1VQLV 1Q6HA 4OPAA 1XMQB 3CCUV 1WLEA 1XL6A 4BW5A 3CS5A 2EIJC 4RO2A 4PI2A 4GKKB 1AROP 2KKWA 2IJIA 2PF4E 1RPOA 2ZE6A 4N23A 3UM7A 5LGNA 4DV2O 3N2GB 3B2EE 2XAQA 2KB1A 3EXAA 4TQDA 3K9AA 1S5LZ 4C7UA 1FXVA 1VQKV 1AJQA 4KXRA 3B4SA 4XDJA 1HNWB 3A0HZ 1NTZH 3CCVV 1V54B 4JYYA 2IJKA 4JI7B 1PM9A 4E4EA 3IGAC 2F23A 2V4DA 5KLVH 1EN5A 3HKCB 2XNDG 4O4IB 5C8YA 3OTOB 1YJNV 1TUBA 3R66A 2YIBA 1H2SB 4U3JB 4UCTA 4DV1O 2Q9LA 1ZX3A 3JAMN 4DV6B 2CGOA 1SESA 4JYAB 4MSWC 2FYUH 3KZIZ 3G4SV 2RMKB 4DUZB 2UUAB 3BY6A 1ORQC 1QNMA 4MS2A 4Z1VA 2ZNIA 4FJCC 1OV9A 1U96A 2IBZH 4O4HB 1DF5A 4J80A 3H1HH 2VQFO 4WF9V 1XNRO 3VOUA 5LHHA 3OUFA 4DR4B 3ZCCA 3K04A 2B1GA 1FJGB 4NKGB 5H9CA 1DF4A 5EIBC 1MG1A 4MVUA 1S76D 4DV5O 4DR5B 4KHPO 3A0BZ 1M56B 2OIGA 4PJ0Z 5IDJA 3JALA 3O9OA 1NZ6A 1NT2B 2ZIOA 2HLDG 1H2LA 2Z0AA 5B5EZ 3ZMTA 1F4NA 3LNMB 4X88A 3J7AU 1A32A 4MVOA 2RN9A 3HKCA 4O4IA 2ODMA 2ZDIC 1I94B 4X62B 3C90A 1YXBA 2N74A 3TXQA 3LSQA 2A7WA 4B7EA 4DUYO 4DR6B 4YXWG 4U3JA 4N21A 4LF6O 3CC7V 4BWAA 4MVMA 3KCYA 5IT9N 1JCHA 3HR0A 3CCMV 1RSOB 3SYAA 1THZA 5HFMA 2NNUA 1I08A 4MTGA 2EIMC 3E89A 4O4HA 1H8EG 1I5YA 4ZKIA 3SJBC 1K73W 5JJNB 2EBOA 3AG1C 4JZGA 4JPRA 4LF4B 1QVGU 4FLTA 1Q3EA 1DLBA 3CJHB 3H9VA 5L3EA 2H8PC 2WLKA 5B1AB 2HHHO 3HB3B 4XDLA 1JOYA 1WNSA 1ZSPA 3OGCC 4LFCB 2UUBO 3LUTB 3CB2A 1FPOA 3K5OA 1S3JA 1YEWA 3CE2A 4JI3B 1SQFA 4UCVA 1LR1A 3ZHUA 5LYJB 5DN6G 2UXCB 1IBMB 3CC4V 3W7UA 3U0ZA 3CRMA 2F95B 4UV9A 1RSOA 2IJJA 3BABA 3STZC 4XDKA 4MVQA 4QE7A 1HNXB 4R6ZA 4DO2A 4GX1A 2PGGA 1M9NA 4UVBA 5LP6C 1GAXA 2XUMA 4WFGA 2OYQA 2VS0A 2GHYA 2YI9A 1FXKB 1BHAA 2EIMB 1V55C 4NTYA 3G67A 1QBZA 2M6YA 1ZLZA 3P30A 4G2KA 3ZRWB 1D5NA 2XAHA 2UU9B 2XAGA 3CJHA 3CCQV 4LF7B 1MZFA 2KG7B 1NBMG 2C2AA 3D36C 1ROPA 2YIDA 1O9GA 4BAYA 3BAAA 4PA4A 4YIOA 1E1RG 1JPXA 3K03A 3JSLA 4DW1A 4PHZA 3FD9A 2QDOA 3ZIAG 3WG7C 5LYJA 2GDSA 2BTQB 3CRRA 3JAWB 5EBWC 3TETA 4X20A 3OEEG 2DWEC 2ZIMA 5E79Z 5FL7G 4CS3A 1FFXB 4ZOLB 1GMGA 4B3MO 3L71H 3SDLA 2BCCH 1SQGA 1G6UA 3TJTA 4PELA 3PN1A 1T5EA 2X6BA 5KMGA 3LDCA 1SS3A 5LMNO 4WFEA 4GYCB 4F6RB 4JAUA 1FXKA 4UV8A 1Y66A 2QTSA 4JAAA 3D8CA 3C3TA 4DV7B 2Z5UA 4K35A 1HR0B 1UFIA 3ZRWA 3B09A 1PKXA 3IC7A 3QO8A 4UCSA 4LF9B 4NR1A 4FM2A 4FLVA 5JVDB 4DR7B 3OD4A 1ENVA 2KG7A 1IDSA 3K9SA 1V55B 4X64B 2PTMA 1AI6A 5B3SC 4UCOA 5EBMC 2QTOA 2E75B 3CHXA 3SYQA 1P84F 1YVWA 2DMXA 2RDCA 2QE7G 3K79A 1R6TA 4ZHQB 4ICGA 3T1YB 1J5EO 1AVMA 4FFKA 1Q8IA 2JIZG 4JASA 1XMOB 4B08A 2BTQA 1YSCA 1S0VA 1VQ5V 3W7SA 1N33B 3JAWA 5C93A 1NR7A 1GTOA 3AK3A 1F7YA 3B8MA 4JI5O 2BOCC 1FFXA 4MVSA 3OE7G 4ZOLA 3BA9A 3T2MA 1DTOA 2FMLA 3KG2A 3TGUH 3JATA 2DQ3A 1QLEC 4DV0B 2JGDB 4J7ZA 3QO5A 4AILC 1DK1A 1Q6UA 1SRYA 1YJ9V 3GB7C 5A9GA 1AR4A 3K57A 4F6RA 4LF8B 3SPGA 4FFBB 1Q90D 3E22B 4L87A 4MVRA 4W4KA 2XOKG 3K58A 1Q81W 1KBHA 1K97A 2WLNA 2E5LB 1R3KC 2UXDB 2QKSA 3CSXA 1XNQO 3BPZA 1N0JA 4DR2O
chains in the Genus database with same CATH topology
1WPBA 3HKDB 4DR3B 5JCOC 4DV3B 3THOA 2VWJA 4O4LA 5IWAB 2P22C 1XMQB 4UFZA 4DV2B 4X66B 4L8JA 5KX5A 4PI0A 4X1YA 5EIBD 4PI2A 3HKBA 4GKKB 2HEPA 2KKWA 4ZHQA 4O2BB 5IJ9B 5K1PA 5JJJB 4NVPA 4TV9B 2P5OA 3N2GB 3B2EE 1JMKC 5LOVA 3ZS8C 1S5JA 4TQDA 3WB0A 1N36B 5KHKA 3UQ8A 4IIJB 1D5AA 4HNAB 1Q43A 1HNWB 5KHGA 4X1IA 2HHHB 4AQYB 5LP6B 4JI7B 5LXTB 3FFQA 4Q6GA 3T1HB 3UT5B 2UUBB 5JH7A 4EFBA 4IHJA 2V4DA 4K8ZA 3HKCB 4TV8A 4O4IB 5C8YA 3RFRA 4FFBA 3OTOB 4HBNA 1TUBA 2YIBA 1TAEA 4EB6B 1H2SB 2F1MA 2PUSA 3ICXA 4U3JB 4UCTA 4CC5A 4DV6B 1WN7A 4I50B 4JYAB 4O2AA 4ZIBA 4LFAB 3N2KB 4FLYA 4DUZB 2UUAB 1JFFB 3RYIA 4TOIA 4DRXB 1XNRB 2UXBB 1HNZB 2ZNIA 1IBKB 3IAYA 4O4HB 4CH5A 1TVKB 2F4VB 4X20B 3BA8A 4DR4B 4O2BA 5IJ9A 4TV9A 4GLXA 5BR8B 4ZI7B 1FJGB 3LNNA 4X1KB 5EIBC 5KHIA 5KMGB 3K59A 4DR5B 4IIJA 3SJCC 3RGBA 4HNAA 2F93B 3JALA 2Q7HA 1NT2B 2ZIOA 4AHCA 5LP6A 3WB2A 4OX9B 5LXTA 5BMVA 5KHHA 5CA1B 3UT5A 2JGUA 4K8XA 3HKCA 5JVDA 4O4IA 1XI1A 1I94B 4X62B 3JASB 2PYJA 2PYLA 4DR6B 3RYFB 4EB6A 4U3JA 1XHZA 5IYZB 2PZSA 4I50A 4BWAA 3QF7A 3JARB 3N2KA 3QTCA 1JFFA 1B04A 4DRXA 4B3MB 2ZM6B 4CH3A 1I7FA 4O4HA 5IJ0B 4WBNA 4UCUA 2YI8A 1N34B 4I9QA 1IBLB 1TVKA 1Z5WA 4LFBB 4JI4B 3SJBC 1M4UA 3SR2C 4CC6A 5JJNB 2ZNJA 4CS2A 5LMNB 4ZI7A 4NXNB 3JAKB 4LF4B 3JATB 3HKEA 4FLTA 5ITZB 1Q3EA 4X1KA 2OWOA 4D7TA 5FPOA 1N32B 2R9AA 1ZAUA 4NXMB 5J2UB 1WNSA 3E22A 4FLZA 1L8DA 1TA8A 3VQWA 4D7SA 4LFCB 4I4TB 3U10A 3MAQA 3CB2A 5FNVA 5CA1A 2GV9A 4LH6A 4TUYA 3K5OA 1YEWA 4JI3B 4JI1B 4FM1A 1SQFA 4X65B 2Q0AA 3HKDA 4FLUA 4LNUB 3JSNA 4UCVA 3JASA 5LYJB 3RYFA 4FLXA 2YIBD 1J5EB 2UXCB 5IYZA 4LF5B 1IBMB 3U0ZA 3DSQA 5EZYB 2F95B 3BHPA 5EYPB 2IM9A 4DK0A 3JARA 4B3RB 1RSOA 2R72A 3K5LA 3N2GA 5LA6B 3BABA 4JI5B 3OTFA 1HNXB 4YJ2B 5FPRA 2PGGA 3VQXA 5IJ0A 5LP6C 3U11A 1SA0B 5JQGB 2OYQA 3RYCB 2YI9A 4TQFA 4X1IB 2JVDA 1P49A 3JAKA 4JI8B 5ITZA 2CAZC 2UU9B 5J2TB 2EX3A 1SKVA 4LF7B 2YXLA 4B3SB 1O9HA 5J2UA 3VQYA 4TV8B 4FM0A 1TUBB 4B3TB 1XNQB 4DR2B 4I4TA 1O9GA 3SGIA 5CB4B 3BAAA 4GKJB 2QM4A 1QHTA 4FVMA 1M5IA 1X4TA 5JJEB 3VQVA 1M93A 1V9PA 3JSLA 4PHZA 3RYIB 5LYJA 2BTQB 3M7MX 3QG5A 1DGSA 3JAWB 4EEQA 1Q5OA 3BRCA 4X20A 5GONB 5EZYA 2ZIMA 5EYPA 4CS3A 1XQ8A 1FFXB 5JCOA 2VQEB 3ETQA 4ZOLB 3A2FA 4YJ3B 5LA6A 1SQGA 4YJ2A 1G6UA 2YIAA 3K5MA 1SA0A 3PN1A 1T5EA 5KMGA 4I55B 5JQGA 4GYCB 4F6RB 4JI6B 3RYCA 2BTOA 4FLWA 1VF7A 3RYHB 2R70A 3JALB 4DV4B 4DV7B 2F66C 1HR0B 1XHXA 1KU9A 4O4JB 4CS4A 4UCSA 5BMVB 4LF9B 5CA0B 2PY5A 5J2TA 2XHBA 4DV1B 3ZEDA 4FM2A 2VWKA 4K0KB 5D5QA 4FLVA 5JVDB 4DR7B 4X64B 4BW9A 2PTMA 4O4LB 5LMUB 4EFEA 1HW7A 4UCOA 4YHHB 2QJ1A 5D5PA 5CB4A 5KX5B 4X1YB 1JJOA 3CHXA 3HKBB 1Z5VA 4ZHQB 2VQFB 2Q7EA 3T1YB 1Q8IA 4YY3B 4JI2B 2UUCB 1XMOB 4B08A 2BTQA 2E3CA 2ZCEA 1N33B 3JAWA 5LOVB 4WBNB 2RJZA 5GONA 4LH7A 2ZINA 1FFXA 4UCRA 4ZOLA 3BA9A 4YJ3A 4DV5B 2RQ6A 4DK1A 4KHPB 1QQCA 3JATA 1KMIZ 4DV0B 3HKEB 3RWRD 4AILC 1TGOA 4CH6A 4I55A 5JH7B 3K57A 4IHJB 4F6RA 4JI0B 4KL1A 4LR3A 4LF8B 4JV5B 5K1XA 3RYHA 5C8YB 4FFBB 3K5NA 2JS5A 3E22B 3K58A 2Q7GA 4DR1B 5KHJA 3SJAC 4O4JA 2E5LB 3WB1A 5CA0A 5FNVB 4DUYB 2UXDB 4TUYB 3CSXA 4O2AB 4CH4A 3BPZA 4LF6B 4LNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QG5 A;  3SJC C;  2P22 C;  1SKV A;  1NT2 B;  2F66 C;  3QF7 A;  3SJB C;  3THO A;  3B2E E;  3SJA C;  2CAZ C;  3CSX A;  3ZS8 C;  3ICX A;  2JS5 A;  1X4T A; 
#chains in the Genus database with same CATH topology
 3HKD B;  4DR3 B;  3ZHQ A;  2GSM B;  1RPR A;  4DV3 B;  2QM7 A;  4GKJ O;  3OUS A;  4P30 A;  3OM3 B;  2P22 C;  4UFZ A;  1P7B A;  4L8J A;  3D3Q A;  1K5S A;  3ZRX A;  4ZHQ A;  1JQ0 A;  2RCV A;  5IJ9 B;  1KB9 F;  4NVP A;  1N0N A;  2Y4T A;  2HVJ C;  5B3S B;  2WA3 A;  3MD0 A;  2ADQ B;  4Z1M G;  3ZS8 C;  2VQE O;  5KHK A;  3UQ8 A;  1YI2 V;  1OZ0 A;  3FB5 C;  1YHQ V;  4X1I A;  1B06 A;  4MW8 A;  4AQY B;  2QWP B;  5A2Q N;  2OCH A;  3FFQ A;  3H1L H;  2PI4 A;  3OW2 U;  3T1H B;  4RUF A;  1IZ3 A;  1BMF G;  3M8A A;  1GK9 A;  4TV8 A;  1KEC A;  3STL C;  3RFR A;  4FFB A;  2P7T C;  4HBN A;  3L9D A;  1OCO C;  3ETG A;  4TSF G;  4JTC B;  3TCU A;  5IYC O;  1BCC H;  4CC5 A;  4K0K O;  1WN7 A;  1US6 A;  3CCR V;  4I50 B;  1FD9 A;  2QKC A;  3W7T A;  4ZIB A;  2P4K A;  4FLY A;  1ZUQ A;  1G4Y B;  3RYI A;  4TOI A;  4YHH O;  4DV6 O;  2UXB B;  3LDE A;  1BS3 A;  4JYA O;  3IAY A;  4CH5 A;  1TVK B;  2QR4 A;  4DUZ O;  4MVZ A;  4YY3 O;  3BA8 A;  4JI2 O;  2UUC O;  1NH2 D;  5IJ9 A;  1NTK H;  2IH1 C;  3EFF K;  4GLX A;  5BR8 B;  2OT5 A;  1KP2 A;  5IY5 B;  2X6C A;  3E83 A;  1MZE A;  4R50 A;  2EUL A;  5KHI A;  1GO3 F;  5BZB A;  2ZXW C;  1K4D C;  3TXS A;  4UUJ C;  2F93 B;  2Q7H A;  4BIU A;  3T4D A;  2QA4 V;  4RWU A;  4BIO A;  4DR5 O;  4FK5 C;  4JI0 O;  3ETD A;  4J42 A;  1JVM A;  2HJF C;  2Y4U A;  2JGU A;  1XI1 A;  3JAS B;  4QGP A;  2ATK C;  3AG3 B;  1YTF B;  1OCZ C;  4I50 A;  2LW1 A;  1S5H C;  3OAA G;  4WCE V;  3BEH A;  3AK2 A;  1I94 O;  3K0G A;  2HFE C;  4R8C A;  3P3N A;  4G28 B;  1VIB A;  1B04 A;  4X66 O;  1OCR C;  3Q4H B;  3OR7 C;  4CH3 A;  1I7F A;  1SZT A;  2B5U A;  1HP8 A;  2YI8 A;  3KCX A;  1TVK A;  1Z5W A;  1NS1 A;  4UB6 Z;  4LFB B;  4JI4 B;  1M1K W;  1M4U A;  2Q5Z A;  3IFX A;  1PL4 A;  2ZNJ A;  2NLJ C;  4EKW A;  3MDS A;  4UVC A;  1N36 O;  3JAK B;  2DN9 A;  1VF6 A;  1R73 A;  3HKE A;  4NTX A;  2OWO A;  2BOB C;  3FAV B;  1N32 B;  2R9A A;  3G80 A;  3AEI A;  4NXM B;  1R6K A;  4PDL A;  2HP8 A;  1AP6 A;  1EN6 A;  3VQW A;  4D7S A;  3L70 H;  4I4T B;  4B7K A;  1NVP B;  2RNB A;  3GWK C;  1FYJ A;  3MAQ A;  2NN4 A;  1Q6I A;  1B3Q A;  5FNV A;  2ZXW B;  4LH6 A;  1Q82 W;  4TUY A;  1P4R A;  5LHI A;  4JI1 B;  2Q0A A;  1WPX A;  1RM1 C;  3JSN A;  4RQF A;  2HR3 A;  3J80 N;  2WLM A;  3JAS A;  1XUQ A;  5DEC A;  1VQ4 V;  4LF5 B;  3RVY A;  2IM9 A;  3A8T A;  1HNZ O;  4B3R B;  4JTD B;  2R72 A;  3K5L A;  1IBK O;  3N2G A;  3Q4H A;  5FLX N;  3AG2 C;  3E8G A;  2EIJ B;  1BHB A;  4X8A A;  1NQT A;  2CTP A;  3PJS K;  3RYC B;  4CBC A;  4TQF A;  2JVD A;  5GW7 A;  1CEZ A;  3JAK A;  2FL4 A;  2P90 A;  3I5D A;  3FAV A;  2LFR A;  2LP7 A;  1SKV A;  1R3J C;  2YXL A;  2OCC C;  1VQ8 V;  3CC2 V;  4B3S B;  1O9H A;  3VQY A;  3FYI B;  2Y0I A;  4JYC A;  4I4T A;  3SGI A;  3CXH F;  4LF7 O;  1AI7 A;  3GWO A;  1AJN A;  1GM7 A;  2QM4 A;  1QHT A;  3CME V;  1OHH G;  2JEX A;  4WFH A;  1V9P A;  1VQN V;  1NU1 H;  4J41 A;  2FB5 A;  3CD6 V;  1XL4 A;  3FKS G;  3ZMS A;  4DXW A;  2ZKO A;  2EIL C;  3M7M X;  3QG5 A;  3CWB H;  5B1O A;  3C3S A;  1IBL O;  3ABL C;  2EIK C;  1GN4 A;  2YIA A;  3ZRV A;  4QIW F;  3RYC A;  2BTO A;  1AI4 A;  1KP3 A;  3MHS C;  1VF7 A;  4DV4 B;  1D2D A;  2F66 C;  1XHX A;  4ASU G;  2EJR A;  1KU9 A;  2WLI B;  4OXS A;  1WAZ A;  5H6Q A;  5BMV B;  4DV1 B;  3ZED A;  2JEU A;  2Y69 C;  3F5T A;  5D5Q A;  1MAB G;  2UXX A;  4EFE A;  2P4V A;  2JRI A;  1SF9 A;  2QWO B;  1H2M A;  4X65 O;  2AHY A;  4H13 B;  2OCC B;  4GT1 A;  3AG4 C;  3HKB B;  3X2Q C;  2D2C B;  4X64 O;  2WWW A;  3ASO C;  3ZBH A;  1AR1 B;  2VQF B;  4KFM A;  3DTU B;  3RBZ A;  1PNM A;  2QWR B;  2Y48 A;  2YS8 A;  2ZQM A;  2ZCE A;  3E35 A;  1SC5 B;  3FB7 C;  5B66 Z;  5LOV B;  4WBN B;  1SQQ H;  2E74 B;  2YXH A;  2WPD G;  4LH7 A;  2ZIN A;  1SQV H;  4TWK A;  2A3Q A;  1XMO O;  2ZR2 A;  4DV5 B;  4A5U B;  5LHG A;  2RQ6 A;  4KHP B;  2XTA A;  1MSD A;  2X6A A;  3NR7 A;  4J9Y B;  2DOS A;  3J81 N;  1R1B A;  2GTS A;  1BL8 A;  1F23 A;  1ZTE A;  3AG1 B;  5JH7 B;  1FXH A;  4KL1 A;  3R65 A;  4JV5 B;  5K1X A;  3CYO A;  1W59 A;  4HYO A;  3K5N A;  3CCJ V;  2EIK B;  2A0L A;  2WLI A;  4H44 B;  3FB8 C;  2Q0O C;  1W2B U;  2B1I A;  2EZP A;  4DUY B;  4MT8 A;  2Q6A A;  1KKD A;  3BVO A;  4B3T O;  1B6Q A;  4LF6 B;  1SZX A;  1WPB A;  4PD4 F;  1X59 A;  5JCO C;  3THO A;  4U3F H;  2VWJ A;  5KUK A;  5IWA B;  1VQ9 V;  1BZK A;  3E2E A;  3G6E V;  3HKB A;  2FKX A;  4OGQ B;  2ZDI A;  1L0N H;  1I5X A;  1Y6X A;  4I5S A;  4O2B B;  3F7Y C;  2P5O A;  3EHB B;  1L1F A;  3BCC H;  2OTJ V;  5LOV A;  1FS0 G;  3AG4 B;  3P32 A;  4AI8 A;  4IIJ B;  3MHH C;  2IH3 C;  1D5A A;  4HNA B;  1Q43 A;  4WFF A;  2GUZ B;  5KHG A;  2O57 A;  2HHH B;  2ZT9 B;  5LP6 B;  2ADP A;  4JI6 O;  2IU3 A;  4Q6G A;  2IU0 A;  2A79 B;  3UT5 B;  2BSK B;  3L74 H;  2UUB B;  5JH7 A;  4EFB A;  1GN2 A;  4K8Z A;  1URF A;  1PNL A;  1AB3 A;  3ETE A;  3H1J H;  3ML0 A;  1LNQ A;  5EK0 A;  4GZR B;  2PUS A;  3ICX A;  4QNH B;  5GTH Z;  3T1C A;  3ZHV A;  1ZWI C;  4LFA B;  5LMU O;  4DRX B;  5CBH A;  3K3W A;  5L3F A;  1I0H A;  4JTA B;  2F4V B;  2ZE8 A;  3CCL V;  4I0X B;  3ABT A;  3SYP A;  1SET A;  1F51 A;  4O2B A;  1YDX A;  3WG7 B;  1PL0 A;  4ZI7 B;  4Q20 A;  3UO3 A;  5B1B C;  2MK3 A;  2OTL V;  3LNN A;  5J9P C;  5DED A;  2K1E A;  3K59 A;  4IIJ A;  3SJC C;  5CBF A;  5BR8 O;  2WLH A;  4HNA A;  1K8A W;  4K3A A;  2G38 A;  4AHC A;  5LP6 A;  3WB2 A;  4OX9 B;  1IX9 A;  5KHH A;  1HWY A;  3JD2 A;  5CA1 B;  3UT5 A;  2BSK A;  2LGW A;  3ZX6 A;  1Z2G A;  1F4M A;  4R7C A;  3T4Z A;  5JVD A;  2X0L A;  3ZRS A;  1KKC A;  5IYD O;  4DR1 O;  4P9O A;  2PYJ A;  2JJ1 G;  1VQO V;  3RYF B;  2AGA A;  1MNG A;  4MTF A;  2GBO A;  5IYZ B;  3SPC A;  1LUV A;  1IXB A;  4XBF A;  3DGE A;  1K34 A;  4PDR A;  3JAR B;  4JZ2 A;  2KQX A;  3D36 A;  1XMQ O;  4DRX A;  1YIT V;  1GM9 A;  4B3M B;  5BXZ A;  2ZM6 B;  1QCE A;  4GKK O;  3ABK C;  5L3G A;  5IJ0 B;  3CRC A;  4UCU A;  1N34 B;  4PA3 A;  5F2V O;  4I0X A;  4LC1 A;  3CCS V;  1H2K A;  4JYB A;  4CS2 A;  5LMN B;  4ZI7 A;  3JD4 A;  3APO A;  4NXN B;  3JD1 A;  1FFT B;  2JGD A;  5ITZ B;  1CXZ B;  2QEX V;  4D7T A;  3NXS A;  4D6T H;  1HNW O;  2LFS A;  3VBB A;  2D3O W;  2HVK C;  1M57 C;  4JI7 O;  4QJF B;  1BQZ A;  3E22 A;  1QLE B;  1GH6 A;  1TA8 A;  1R6N A;  4JAV A;  1N32 O;  1LUW A;  3KKY A;  3U10 A;  1SQP H;  3ZHR A;  5LL6 Y;  1KYO F;  2YUA A;  2WLL B;  3LSU A;  2V7Q G;  5CA1 A;  1MA1 A;  3OTO O;  3A0R A;  1N8R W;  1OJH A;  1K33 A;  3HKD A;  4LNU B;  4JF3 A;  1Y76 B;  1QR9 A;  1EZJ A;  1K5Q A;  3RYF A;  4FLX A;  2QWN B;  3ZN0 A;  2YIB D;  1J5E B;  2DE0 X;  1GN6 A;  3K08 A;  3RW0 A;  5IYZ A;  1Q7Y W;  3L72 H;  2UUA O;  3DSQ A;  5EZY B;  5EYP B;  3JAR A;  4PA9 A;  2W0X A;  5GTI Z;  3E8H A;  3UO2 A;  4JI5 B;  2CUG A;  4X89 A;  5FPR A;  5KUM A;  1JA8 A;  1EBO A;  5IJ0 A;  1MSW D;  1SQX H;  1SA0 B;  1HDJ A;  2VRZ A;  4DR4 O;  5LGT A;  1H2G A;  5JQG B;  1XOU A;  4LP8 A;  1FJG O;  1Y74 B;  4YIP A;  3RN4 A;  1K7D A;  1RP3 B;  2H94 A;  2E76 B;  2DW4 A;  4JI8 B;  5ITZ A;  5KAI Z;  1WB7 A;  1ZL8 B;  4P2Z A;  3I55 V;  2EX3 A;  3JD0 A;  2P67 A;  2AZ2 A;  2M7W A;  5HFL A;  2ZE7 A;  3LDD A;  1IVS A;  3K06 A;  4FM0 A;  1TUB B;  1XNQ B;  2N04 A;  3M99 B;  1QVF U;  4DR2 B;  3B8N A;  2YEV B;  4PDV A;  4U7N A;  4B3S O;  5CB4 B;  3JD3 A;  4GKJ B;  1M5I A;  2X7R B;  1X4T A;  3L75 H;  5JJE B;  4X62 O;  4RUE A;  1NH2 B;  3VQV A;  1M93 A;  4DR6 O;  1OCO B;  2DJV A;  1WJZ A;  5KA5 A;  1DGS A;  2DYR C;  4J9Z B;  3CRQ A;  1COW G;  1NVP D;  5GON B;  5EZY A;  5EYP A;  2Q4P A;  3OMA B;  2VQE B;  1FKA O;  3AK1 A;  2YXY A;  1K4C C;  3A2F A;  1M56 C;  1S72 V;  2L6L A;  1YCI A;  1BT8 A;  1SA0 A;  2ITD C;  4I55 B;  5EBL C;  5JQG A;  3SYC A;  1JJ2 U;  4LF4 O;  1Y74 A;  1K9M W;  3SJQ C;  1Q86 W;  2R70 A;  3JAL B;  4IT5 A;  1WP8 A;  1SQB H;  4PDM A;  3DXR B;  4KP4 A;  4O4J B;  1ZL8 A;  2JDI G;  5CA0 B;  2AZ0 A;  2XHB A;  1OCC C;  4IL6 Z;  4K0K B;  4DV4 O;  2ZD9 A;  2ZR3 A;  4LFC O;  2ITC C;  4BW9 A;  4NTW A;  1EN4 A;  1HW7 A;  2YEV A;  1VMG A;  4JI3 O;  1GKF A;  4YHH B;  2QJ1 A;  5CB4 A;  5KX5 B;  4X1Y B;  1QR8 A;  3G6B A;  4J10 A;  2UXC O;  3ZHS A;  4YY3 B;  1AJP A;  1IBM O;  1OCZ B;  4JI2 B;  2UUC B;  4J11 A;  3DC5 A;  1EFR G;  2RJZ A;  5GON A;  4CZZ A;  1H38 A;  4UCR A;  2HKO A;  1HNX O;  3OR6 C;  1OCR B;  3H1K H;  5B1A C;  1YZB A;  1P7G A;  5L3B A;  4DK1 A;  1GN3 A;  3EVK A;  2EIN C;  2DYR B;  1KMI Z;  3RWR D;  5DM6 V;  5CN0 A;  4I55 A;  2EZO A;  4Z2W A;  4IHJ B;  4JI0 B;  4LR3 A;  4MW3 A;  4P9P A;  3E8F A;  2N05 A;  2AW9 A;  2UU9 O;  3CPW U;  2CGN A;  3DXR A;  3RT3 C;  3L73 H;  2K9P A;  4O4J A;  5CA0 A;  4JV5 O;  1TUE B;  3IJ4 A;  2WAM A;  3QO7 A;  4O2A B;  4CH4 A;  3WU2 Z;  1W0K G;  2CTQ A;  1MOF A;  2F43 G;  4HAM A;  1CPY A;  4DV2 B;  4X66 B;  2YSU B;  3FX7 A;  1OCC B;  4PI0 A;  4X1Y A;  5KX5 A;  2R9R B;  1BQ0 A;  5EIB D;  3ABM C;  3CXC U;  3JCZ A;  2HEP A;  1RM1 B;  1G1X B;  5IWA O;  3HPL C;  5K1P A;  5JJJ B;  1NKD A;  4TV9 B;  2LQT A;  3SYO A;  3TK1 A;  1JMK C;  1FXK C;  2Q67 A;  1PD3 A;  1S5J A;  1N36 B;  3WB0 A;  3ZJZ A;  3AG2 B;  1YIJ V;  4FIP C;  2YC0 A;  5LXT B;  3UCS C;  1VF5 B;  5L3C A;  4IHJ A;  4DV7 O;  1HR0 O;  1PPJ H;  4UB8 Z;  2MW2 B;  3K0D A;  2EIN B;  4DYL A;  4LF9 O;  1TAE A;  4EB6 B;  2F1M A;  4H33 A;  3OT7 A;  2AXT Z;  1G8M A;  4PA7 A;  4DR7 O;  1NR1 A;  1NI8 A;  2XAJ A;  4O2A A;  4GX2 A;  3N2K B;  4IYI A;  4UXN A;  1JFF B;  1XNR B;  2L35 A;  1HNZ B;  3P3P A;  2Z3Y A;  1J95 A;  1IBK B;  2CH7 B;  1XRE A;  1IUR A;  4LFA O;  3LSS A;  1BSM A;  4X20 B;  3T1Y O;  3AG7 A;  4ZBM A;  2W6I G;  2CDY A;  2ETN A;  1N33 O;  4TV9 A;  2EIL B;  3DC6 A;  2F4V O;  1H2N A;  4J7K A;  3JCU Z;  2LW7 A;  3CMA V;  1WA8 B;  3ABM B;  4X1K B;  4MTX A;  3SPI A;  5KMG B;  5JWP A;  1UPG A;  2Q8V A;  3RGB A;  3CRA A;  3ZHT A;  2YIC A;  4NB5 A;  3RVZ A;  3ABL B;  5TIS Z;  4DV0 O;  3ZMU A;  5E1A C;  4H0L B;  2B9Z A;  5LXT A;  4QPJ A;  5BMV A;  4LF8 O;  2YDE A;  2FTK A;  4FZ1 A;  4OPH A;  4K8X A;  4IGG A;  1VAR A;  4OX9 O;  2WA4 A;  5BY1 A;  2E5L O;  2PYL A;  2UXD O;  5H2F Z;  4EB6 A;  1XHZ A;  2DQ0 A;  2PZS A;  3QF7 A;  2Y69 B;  4DR3 O;  5AG2 A;  4WFA V;  4DV3 O;  3O65 A;  4LWS B;  1KUQ A;  1Y67 A;  3N2K A;  3QTC A;  1YF2 A;  2BE3 A;  1JFF A;  1WB8 A;  2Q68 A;  2OIE A;  4GX5 A;  2CH7 A;  2R9I A;  1XBL A;  4WBN A;  3X2Q B;  4I9Q A;  1SER A;  3H1I H;  1IBL B;  4GCZ A;  5H6R A;  1KQS U;  3ASO B;  1R3L C;  1UJW B;  2CTR A;  3SR2 C;  4CC6 A;  2ZM6 O;  4I9W A;  4W4L A;  4NYK A;  2UXN A;  3N27 A;  1N34 O;  1N4C A;  4F4L A;  4TT3 G;  2QGN A;  3JAT B;  3CX5 F;  1WA8 A;  4RAI A;  5IYB O;  4X1K A;  2P06 A;  5FPO A;  4GX0 A;  1YJW V;  1VP7 A;  1ZAU A;  4RQE A;  2LJ2 A;  4X9Q A;  5J2U B;  4NXN O;  4AQY O;  2GTA A;  2Y0P A;  4F6E A;  3APQ A;  4FLZ A;  1L8D A;  3T1H O;  5LGU A;  5B1N A;  4MTO A;  3OFN G;  1EZV H;  3JYC A;  5H5N A;  2GV9 A;  4FZ0 A;  2Q69 A;  4DW0 A;  4FM1 A;  3S3W A;  4X65 B;  5EC1 C;  4FLU A;  4FMT A;  2EJ7 A;  2DYS C;  1AI5 A;  3D3I A;  3F5W C;  3QNE A;  1S77 D;  1FAF A;  1RFY A;  1PV0 A;  3BHP A;  4DK0 A;  3H01 A;  1M90 W;  2UXB O;  4LWS A;  1VQP V;  5KAF Z;  1JX9 A;  2P6J A;  4PA6 A;  5LA6 B;  3OTF A;  1L0L H;  1AP5 A;  4YJ2 B;  1QLN A;  5L3D A;  1PNK A;  1R3I C;  3VQX A;  2QWQ B;  3ASN C;  3U11 A;  3G71 V;  1VEW A;  2GUZ A;  1BGY H;  3IC9 A;  2AHZ A;  3ZMZ A;  4X1I B;  1P49 A;  3FB6 C;  4QPK A;  3UKM A;  1KC8 W;  4KUM A;  2CAZ C;  4ABM A;  5J2T B;  3CP1 A;  2QSA A;  5J2U A;  4TV8 B;  4JI8 O;  1GRJ A;  2CK3 G;  1VQ7 V;  1BE3 H;  1H8H G;  4B3T B;  5EC2 C;  2Q73 A;  4JGS A;  3SPJ A;  4FVM A;  3ABU A;  2LGQ A;  4U7O A;  1GM8 A;  1U97 A;  3RYI B;  1AIL A;  3FYE B;  4LBE C;  3OEH G;  2PI5 A;  4H37 A;  3OGI B;  2JS3 A;  4EEQ A;  5IY5 C;  1Q5O A;  3BRC A;  4E2L A;  1VF6 C;  1MMM A;  4IYH A;  1VQM V;  2XAS A;  2IJH A;  1XQ8 A;  1K3E A;  4BIZ A;  5JCO A;  3ETQ A;  4HZ3 A;  2DYS B;  2XT9 A;  1XEQ A;  3E86 A;  2JK5 C;  4YJ3 B;  5LA6 A;  1NTM H;  4YJ2 A;  4LFB O;  4LCU C;  4JI4 O;  3K5M A;  5KA6 A;  2ZE5 A;  2KSD A;  3W7X A;  1EM1 A;  4JI6 B;  2H3O A;  1PP9 H;  1WP7 A;  4FLW A;  2WSS G;  3RYH B;  5B1B B;  3F7V C;  3ASN B;  1QU7 A;  3AG3 C;  1W0J G;  4NXM O;  4UVA A;  3SPH A;  4PV1 B;  4CS4 A;  2PY5 A;  5J2T A;  3OMI B;  2IW5 A;  3I56 V;  3QVN A;  2VWK A;  4G27 B;  2DWD C;  1AR5 A;  4GUN A;  3ZN1 A;  1K92 A;  1Y4M A;  1E79 G;  2A9H A;  2WLJ A;  2XAF A;  4O4L B;  5LMU B;  3E8B A;  2CE4 A;  3W7W A;  4JI1 O;  5D5P A;  2A06 H;  1JJO A;  1Z5V A;  5CMU A;  2Q7E A;  5CA3 A;  4LF5 O;  2JJ2 G;  4WFB V;  4FPP A;  1V54 C;  2E3C A;  3CCE V;  1CP9 A;  1YTF D;  4B3R O;  4BR6 A;  1JR9 A;  2NR5 A;  3BFR A;  5CBG A;  4J7J A;  2HJD A;  4YJ3 A;  3ABK B;  3OMN B;  1XIL A;  1QQC A;  2W6J G;  4I7Z B;  5IE9 A;  1VQ6 V;  3S3X A;  3HKE B;  1TGO A;  2HG5 C;  4CH6 A;  2QKA A;  3B77 A;  2QM8 A;  5LBQ A;  2V1D A;  3RYH A;  5C8Y B;  2ILM A;  1IXM A;  2CTW A;  2JS5 A;  2W0F C;  3ZMV A;  1E1Q G;  2ARH A;  2Q7G A;  4DR1 B;  5KHJ A;  3SJA C;  2WLL A;  3WB1 A;  3B40 A;  5FNV B;  1M57 B;  4TUY B;  1KD1 W;  2LO1 A;  4QE9 A;  4LNU A;  1Y76 A;  3WFV A;  1NJI W;  1XDC A;  3GVM A;  4O4L A;  3CEI A;  1VQL V;  1Q6H A;  4OPA A;  1XMQ B;  3CCU V;  1WLE A;  1XL6 A;  4BW5 A;  3CS5 A;  2EIJ C;  4RO2 A;  4PI2 A;  4GKK B;  1ARO P;  2KKW A;  2IJI A;  2PF4 E;  1RPO A;  2ZE6 A;  4N23 A;  3UM7 A;  5LGN A;  4DV2 O;  3N2G B;  3B2E E;  2XAQ A;  2KB1 A;  3EXA A;  4TQD A;  3K9A A;  1S5L Z;  4C7U A;  1FXV A;  1VQK V;  1AJQ A;  4KXR A;  3B4S A;  4XDJ A;  1HNW B;  3A0H Z;  1NTZ H;  3CCV V;  1V54 B;  4JYY A;  2IJK A;  4JI7 B;  1PM9 A;  4E4E A;  3IGA C;  2F23 A;  2V4D A;  5KLV H;  1EN5 A;  3HKC B;  2XND G;  4O4I B;  5C8Y A;  3OTO B;  1YJN V;  1TUB A;  3R66 A;  2YIB A;  1H2S B;  4U3J B;  4UCT A;  4DV1 O;  2Q9L A;  1ZX3 A;  3JAM N;  4DV6 B;  2CGO A;  1SES A;  4JYA B;  4MSW C;  2FYU H;  3KZI Z;  3G4S V;  2RMK B;  4DUZ B;  2UUA B;  3BY6 A;  1ORQ C;  1QNM A;  4MS2 A;  4Z1V A;  2ZNI A;  4FJC C;  1OV9 A;  1U96 A;  2IBZ H;  4O4H B;  1DF5 A;  4J80 A;  3H1H H;  2VQF O;  4WF9 V;  1XNR O;  3VOU A;  5LHH A;  3OUF A;  4DR4 B;  3ZCC A;  3K04 A;  2B1G A;  1FJG B;  4NKG B;  5H9C A;  1DF4 A;  5EIB C;  1MG1 A;  4MVU A;  1S76 D;  4DV5 O;  4DR5 B;  4KHP O;  3A0B Z;  1M56 B;  2OIG A;  4PJ0 Z;  5IDJ A;  3JAL A;  3O9O A;  1NZ6 A;  1NT2 B;  2ZIO A;  2HLD G;  1H2L A;  2Z0A A;  5B5E Z;  3ZMT A;  1F4N A;  3LNM B;  4X88 A;  3J7A U;  1A32 A;  4MVO A;  2RN9 A;  3HKC A;  4O4I A;  2ODM A;  2ZDI C;  1I94 B;  4X62 B;  3C90 A;  1YXB A;  2N74 A;  3TXQ A;  3LSQ A;  2A7W A;  4B7E A;  4DUY O;  4DR6 B;  4YXW G;  4U3J A;  4N21 A;  4LF6 O;  3CC7 V;  4BWA A;  4MVM A;  3KCY A;  5IT9 N;  1JCH A;  3HR0 A;  3CCM V;  1RSO B;  3SYA A;  1THZ A;  5HFM A;  2NNU A;  1I08 A;  4MTG A;  2EIM C;  3E89 A;  4O4H A;  1H8E G;  1I5Y A;  4ZKI A;  3SJB C;  1K73 W;  5JJN B;  2EBO A;  3AG1 C;  4JZG A;  4JPR A;  4LF4 B;  1QVG U;  4FLT A;  1Q3E A;  1DLB A;  3CJH B;  3H9V A;  5L3E A;  2H8P C;  2WLK A;  5B1A B;  2HHH O;  3HB3 B;  4XDL A;  1JOY A;  1WNS A;  1ZSP A;  3OGC C;  4LFC B;  2UUB O;  3LUT B;  3CB2 A;  1FPO A;  3K5O A;  1S3J A;  1YEW A;  3CE2 A;  4JI3 B;  1SQF A;  4UCV A;  1LR1 A;  3ZHU A;  5LYJ B;  5DN6 G;  2UXC B;  1IBM B;  3CC4 V;  3W7U A;  3U0Z A;  3CRM A;  2F95 B;  4UV9 A;  1RSO A;  2IJJ A;  3BAB A;  3STZ C;  4XDK A;  4MVQ A;  4QE7 A;  1HNX B;  4R6Z A;  4DO2 A;  4GX1 A;  2PGG A;  1M9N A;  4UVB A;  5LP6 C;  1GAX A;  2XUM A;  4WFG A;  2OYQ A;  2VS0 A;  2GHY A;  2YI9 A;  1FXK B;  1BHA A;  2EIM B;  1V55 C;  4NTY A;  3G67 A;  1QBZ A;  2M6Y A;  1ZLZ A;  3P30 A;  4G2K A;  3ZRW B;  1D5N A;  2XAH A;  2UU9 B;  2XAG A;  3CJH A;  3CCQ V;  4LF7 B;  1MZF A;  2KG7 B;  1NBM G;  2C2A A;  3D36 C;  1ROP A;  2YID A;  1O9G A;  4BAY A;  3BAA A;  4PA4 A;  4YIO A;  1E1R G;  1JPX A;  3K03 A;  3JSL A;  4DW1 A;  4PHZ A;  3FD9 A;  2QDO A;  3ZIA G;  3WG7 C;  5LYJ A;  2GDS A;  2BTQ B;  3CRR A;  3JAW B;  5EBW C;  3TET A;  4X20 A;  3OEE G;  2DWE C;  2ZIM A;  5E79 Z;  5FL7 G;  4CS3 A;  1FFX B;  4ZOL B;  1GMG A;  4B3M O;  3L71 H;  3SDL A;  2BCC H;  1SQG A;  1G6U A;  3TJT A;  4PEL A;  3PN1 A;  1T5E A;  2X6B A;  5KMG A;  3LDC A;  1SS3 A;  5LMN O;  4WFE A;  4GYC B;  4F6R B;  4JAU A;  1FXK A;  4UV8 A;  1Y66 A;  2QTS A;  4JAA A;  3D8C A;  3C3T A;  4DV7 B;  2Z5U A;  4K35 A;  1HR0 B;  1UFI A;  3ZRW A;  3B09 A;  1PKX A;  3IC7 A;  3QO8 A;  4UCS A;  4LF9 B;  4NR1 A;  4FM2 A;  4FLV A;  5JVD B;  4DR7 B;  3OD4 A;  1ENV A;  2KG7 A;  1IDS A;  3K9S A;  1V55 B;  4X64 B;  2PTM A;  1AI6 A;  5B3S C;  4UCO A;  5EBM C;  2QTO A;  2E75 B;  3CHX A;  3SYQ A;  1P84 F;  1YVW A;  2DMX A;  2RDC A;  2QE7 G;  3K79 A;  1R6T A;  4ZHQ B;  4ICG A;  3T1Y B;  1J5E O;  1AVM A;  4FFK A;  1Q8I A;  2JIZ G;  4JAS A;  1XMO B;  4B08 A;  2BTQ A;  1YSC A;  1S0V A;  1VQ5 V;  3W7S A;  1N33 B;  3JAW A;  5C93 A;  1NR7 A;  1GTO A;  3AK3 A;  1F7Y A;  3B8M A;  4JI5 O;  2BOC C;  1FFX A;  4MVS A;  3OE7 G;  4ZOL A;  3BA9 A;  3T2M A;  1DTO A;  2FML A;  3KG2 A;  3TGU H;  3JAT A;  2DQ3 A;  1QLE C;  4DV0 B;  2JGD B;  4J7Z A;  3QO5 A;  4AIL C;  1DK1 A;  1Q6U A;  1SRY A;  1YJ9 V;  3GB7 C;  5A9G A;  1AR4 A;  3K57 A;  4F6R A;  4LF8 B;  3SPG A;  4FFB B;  1Q90 D;  3E22 B;  4L87 A;  4MVR A;  4W4K A;  2XOK G;  3K58 A;  1Q81 W;  1KBH A;  1K97 A;  2WLN A;  2E5L B;  1R3K C;  2UXD B;  2QKS A;  3CSX A;  1XNQ O;  3BPZ A;  1N0J A;  4DR2 O; 
#chains in the Genus database with same CATH homology
 1WPB A;  3HKD B;  4DR3 B;  5JCO C;  4DV3 B;  3THO A;  2VWJ A;  4O4L A;  5IWA B;  2P22 C;  1XMQ B;  4UFZ A;  4DV2 B;  4X66 B;  4L8J A;  5KX5 A;  4PI0 A;  4X1Y A;  5EIB D;  4PI2 A;  3HKB A;  4GKK B;  2HEP A;  2KKW A;  4ZHQ A;  4O2B B;  5IJ9 B;  5K1P A;  5JJJ B;  4NVP A;  4TV9 B;  2P5O A;  3N2G B;  3B2E E;  1JMK C;  5LOV A;  3ZS8 C;  1S5J A;  4TQD A;  3WB0 A;  1N36 B;  5KHK A;  3UQ8 A;  4IIJ B;  1D5A A;  4HNA B;  1Q43 A;  1HNW B;  5KHG A;  4X1I A;  2HHH B;  4AQY B;  5LP6 B;  4JI7 B;  5LXT B;  3FFQ A;  4Q6G A;  3T1H B;  3UT5 B;  2UUB B;  5JH7 A;  4EFB A;  4IHJ A;  2V4D A;  4K8Z A;  3HKC B;  4TV8 A;  4O4I B;  5C8Y A;  3RFR A;  4FFB A;  3OTO B;  4HBN A;  1TUB A;  2YIB A;  1TAE A;  4EB6 B;  1H2S B;  2F1M A;  2PUS A;  3ICX A;  4U3J B;  4UCT A;  4CC5 A;  4DV6 B;  1WN7 A;  4I50 B;  4JYA B;  4O2A A;  4ZIB A;  4LFA B;  3N2K B;  4FLY A;  4DUZ B;  2UUA B;  1JFF B;  3RYI A;  4TOI A;  4DRX B;  1XNR B;  2UXB B;  1HNZ B;  2ZNI A;  1IBK B;  3IAY A;  4O4H B;  4CH5 A;  1TVK B;  2F4V B;  4X20 B;  3BA8 A;  4DR4 B;  4O2B A;  5IJ9 A;  4TV9 A;  4GLX A;  5BR8 B;  4ZI7 B;  1FJG B;  3LNN A;  4X1K B;  5EIB C;  5KHI A;  5KMG B;  3K59 A;  4DR5 B;  4IIJ A;  3SJC C;  3RGB A;  4HNA A;  2F93 B;  3JAL A;  2Q7H A;  1NT2 B;  2ZIO A;  4AHC A;  5LP6 A;  3WB2 A;  4OX9 B;  5LXT A;  5BMV A;  5KHH A;  5CA1 B;  3UT5 A;  2JGU A;  4K8X A;  3HKC A;  5JVD A;  4O4I A;  1XI1 A;  1I94 B;  4X62 B;  3JAS B;  2PYJ A;  2PYL A;  4DR6 B;  3RYF B;  4EB6 A;  4U3J A;  1XHZ A;  5IYZ B;  2PZS A;  4I50 A;  4BWA A;  3QF7 A;  3JAR B;  3N2K A;  3QTC A;  1JFF A;  1B04 A;  4DRX A;  4B3M B;  2ZM6 B;  4CH3 A;  1I7F A;  4O4H A;  5IJ0 B;  4WBN A;  4UCU A;  2YI8 A;  1N34 B;  4I9Q A;  1IBL B;  1TVK A;  1Z5W A;  4LFB B;  4JI4 B;  3SJB C;  1M4U A;  3SR2 C;  4CC6 A;  5JJN B;  2ZNJ A;  4CS2 A;  5LMN B;  4ZI7 A;  4NXN B;  3JAK B;  4LF4 B;  3JAT B;  3HKE A;  4FLT A;  5ITZ B;  1Q3E A;  4X1K A;  2OWO A;  4D7T A;  5FPO A;  1N32 B;  2R9A A;  1ZAU A;  4NXM B;  5J2U B;  1WNS A;  3E22 A;  4FLZ A;  1L8D A;  1TA8 A;  3VQW A;  4D7S A;  4LFC B;  4I4T B;  3U10 A;  3MAQ A;  3CB2 A;  5FNV A;  5CA1 A;  2GV9 A;  4LH6 A;  4TUY A;  3K5O A;  1YEW A;  4JI3 B;  4JI1 B;  4FM1 A;  1SQF A;  4X65 B;  2Q0A A;  3HKD A;  4FLU A;  4LNU B;  3JSN A;  4UCV A;  3JAS A;  5LYJ B;  3RYF A;  4FLX A;  2YIB D;  1J5E B;  2UXC B;  5IYZ A;  4LF5 B;  1IBM B;  3U0Z A;  3DSQ A;  5EZY B;  2F95 B;  3BHP A;  5EYP B;  2IM9 A;  4DK0 A;  3JAR A;  4B3R B;  1RSO A;  2R72 A;  3K5L A;  3N2G A;  5LA6 B;  3BAB A;  4JI5 B;  3OTF A;  1HNX B;  4YJ2 B;  5FPR A;  2PGG A;  3VQX A;  5IJ0 A;  5LP6 C;  3U11 A;  1SA0 B;  5JQG B;  2OYQ A;  3RYC B;  2YI9 A;  4TQF A;  4X1I B;  2JVD A;  1P49 A;  3JAK A;  4JI8 B;  5ITZ A;  2CAZ C;  2UU9 B;  5J2T B;  2EX3 A;  1SKV A;  4LF7 B;  2YXL A;  4B3S B;  1O9H A;  5J2U A;  3VQY A;  4TV8 B;  4FM0 A;  1TUB B;  4B3T B;  1XNQ B;  4DR2 B;  4I4T A;  1O9G A;  3SGI A;  5CB4 B;  3BAA A;  4GKJ B;  2QM4 A;  1QHT A;  4FVM A;  1M5I A;  1X4T A;  5JJE B;  3VQV A;  1M93 A;  1V9P A;  3JSL A;  4PHZ A;  3RYI B;  5LYJ A;  2BTQ B;  3M7M X;  3QG5 A;  1DGS A;  3JAW B;  4EEQ A;  1Q5O A;  3BRC A;  4X20 A;  5GON B;  5EZY A;  2ZIM A;  5EYP A;  4CS3 A;  1XQ8 A;  1FFX B;  5JCO A;  2VQE B;  3ETQ A;  4ZOL B;  3A2F A;  4YJ3 B;  5LA6 A;  1SQG A;  4YJ2 A;  1G6U A;  2YIA A;  3K5M A;  1SA0 A;  3PN1 A;  1T5E A;  5KMG A;  4I55 B;  5JQG A;  4GYC B;  4F6R B;  4JI6 B;  3RYC A;  2BTO A;  4FLW A;  1VF7 A;  3RYH B;  2R70 A;  3JAL B;  4DV4 B;  4DV7 B;  2F66 C;  1HR0 B;  1XHX A;  1KU9 A;  4O4J B;  4CS4 A;  4UCS A;  5BMV B;  4LF9 B;  5CA0 B;  2PY5 A;  5J2T A;  2XHB A;  4DV1 B;  3ZED A;  4FM2 A;  2VWK A;  4K0K B;  5D5Q A;  4FLV A;  5JVD B;  4DR7 B;  4X64 B;  4BW9 A;  2PTM A;  4O4L B;  5LMU B;  4EFE A;  1HW7 A;  4UCO A;  4YHH B;  2QJ1 A;  5D5P A;  5CB4 A;  5KX5 B;  4X1Y B;  1JJO A;  3CHX A;  3HKB B;  1Z5V A;  4ZHQ B;  2VQF B;  2Q7E A;  3T1Y B;  1Q8I A;  4YY3 B;  4JI2 B;  2UUC B;  1XMO B;  4B08 A;  2BTQ A;  2E3C A;  2ZCE A;  1N33 B;  3JAW A;  5LOV B;  4WBN B;  2RJZ A;  5GON A;  4LH7 A;  2ZIN A;  1FFX A;  4UCR A;  4ZOL A;  3BA9 A;  4YJ3 A;  4DV5 B;  2RQ6 A;  4DK1 A;  4KHP B;  1QQC A;  3JAT A;  1KMI Z;  4DV0 B;  3HKE B;  3RWR D;  4AIL C;  1TGO A;  4CH6 A;  4I55 A;  5JH7 B;  3K57 A;  4IHJ B;  4F6R A;  4JI0 B;  4KL1 A;  4LR3 A;  4LF8 B;  4JV5 B;  5K1X A;  3RYH A;  5C8Y B;  4FFB B;  3K5N A;  2JS5 A;  3E22 B;  3K58 A;  2Q7G A;  4DR1 B;  5KHJ A;  3SJA C;  4O4J A;  2E5L B;  3WB1 A;  5CA0 A;  5FNV B;  4DUY B;  2UXD B;  4TUY B;  3CSX A;  4O2A B;  4CH4 A;  3BPZ A;  4LF6 B;  4LNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...