3SJCC

Crystal structure of s.cerevisiae get3 in the semi-open state in complex with get1 cytosolic domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
54
structure length
54
Chain Sequence
LSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 21
structure length 54
sequence length 54
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2011-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sjcC00
3B2EE 1X4TA 3SJCC 3CSXA 3SJBC 3SJAC 3ZS8C 2JS5A 1NT2B 2P22C 2F66C 3QF7A 3THOA 1SKVA 3QG5A 2CAZC 3ICXA
chains in the Genus database with same CATH superfamily
1EN4A 2KG7A 4MW3A 4DR2O 5BMVB 1NR1A 1JMKC 1JFFA 1KB9F 1OCOC 4GYCB 1MABG 2WA3A 4DUYO 4NXMO 1EN6A 4DR4B 5IDJA 2QKAA 1CEZA 2Z0AA 4JZ2A 4LF5B 5H5NA 2AZ0A 2P4VA 2P22C 4ABMA 3A0BZ 2PYLA 3EFFK 4JI6O 4F6RA 4O2AA 4TWKA 4GKKO 3LDCA 1S5LZ 2R9AA 3HKCA 5CA1A 4FLVA 3RVYA 4A5UB 3AG2B 1FS0G 4FFBB 1D2DA 3UO3A 2ZM6O 4DV2O 2WLIB 2ZE5A 1KBHA 4MS2A 4I9WA 2YIBA 4FFBA 2KSDA 1SRYA 3JCUZ 1SC5B 4LNUB 4LH6A 4FZ0A 1D5AA 3THOA 2YI9A 4DW1A 3UM7A 3HR0A 3E89A 4DYLA 1SA0B 1ORQC 3JSLA 2O57A 4EEQA 1NQTA 4UCTA 4ZHQA 2Q0OC 2BSKB 1WA8A 4AHCA 2UUAB 3RN4A 3LSQA 3AEIA 2WLMA 1Y66A 2UUBB 1B06A 3MHSC 1JQ0A 4DO2A 1OCRC 3STLC 2A06H 4UB8Z 2PTMA 3C3SA 4X66B 3SPHA 1M1KW 4ZI7A 3CCRV 1R3LC 1AI6A 2LQTA 2W6IG 1I94O 2LGWA 2FYUH 2HFEC 3AK2A 3VQVA 1VEWA 3K08A 1BMFG 1UJWB 3MDSA 1HNZO 2YUAA 1WJZA 3T1HO 2E5LO 4KHPB 2XAHA 5EC1C 3T4ZA 4DXWA 4U3JB 3CCLV 2GBOA 4IIJB 5CA3A 2MW2B 4JI3B 1EBOA 5BY1A 5KUMA 2N05A 2XASA 3BHPA 4NR1A 4X88A 1Q6UA 4U3JA 3HPLC 3J81N 4IIJA 4ASUG 1YVWA 2DYRB 4R7CA 3ZMUA 1J5EO 3B8NA 2Q8VA 3GWKC 4W4LA 1XMQO 4TQFA 1DF4A 2JEUA 4XDJA 3ZHTA 1IXBA 4J10A 5LL6Y 1HWYA 3T1CA 4J7ZA 5KUKA 2R9RB 1PM9A 5GONA 3B77A 1MA1A 1I5XA 4H37A 5L3GA 3IGAC 5KA5A 4CH5A 4LFCO 4OX9B 1SESA 3CCUV 4JYCA 2VWJA 4I55A 3ZEDA 1F23A 1YJWV 1OHHG 1H2SB 2E3CA 2Y0PA 2ZDIC 3B09A 3W7SA 1SQVH 4MTOA 4J9ZB 1VQ5V 1JX9A 5J2UA 5GW7A 1I7FA 1NJIW 4JF3A 3BY6A 1YDXA 3JAWA 3H1IH 1I5YA 4WFAV 1FFXA 4B3SO 5KHIA 1YJNV 4B08A 5D5PA 1AJQA 4LF9O 4NXNO 4DV6O 1XHZA 3E8BA 3E2EA 2LW1A 3WB1A 1UPGA 3J7AU 5JCOC 5CBHA 3CJHA 3FFQA 1FD9A 1G1XB 1R73A 1K7DA 4TV8A 4WCEV 4BAYA 4JV5B 4TUYA 1IBLO 4QPJA 3I56V 3OEEG 4DR7B 4UVBA 1GN3A 3KG2A 1XNQO 4K3AA 4O4LB 1G8MA 3LSSA 5HFMA 1WNSA 3ZHQA 4E4EA 4BIUA 5F2VO 4PI2A 2W6JG 4UVAA 1AJPA 5B3SC 2E74B 4HNAA 2KB1A 4DRXA 5B1BC 3Q4HB 1N32O 2HJDA 1Q86W 4I4TA 1NR7A 2PGGA 4U7OA 1HNXO 1K3EA 2V7QG 3CMEV 3C3TA 3K5NA 1SQGA 1OZ0A 3JD3A 4NB5A 3KZIZ 4GKJO 4IYIA 1H8HG 2UU9O 1KKCA 3TGUH 1PL4A 3JD2A 4JYAO 3CCMV 4ZKIA 5B3SB 3K03A 2Z3YA 5EC2C 1KECA 1V55C 2DQ0A 2EZPA 2QSAA 1ROPA 5B1BB 3L72H 3JATB 5KMGB 1N36O 3SJAC 4WBNB 2W0XA 4H33A 1JCHA 3OR6C 2OTLV 3JATA 2EX3A 1A32A 2X7RB 5KMGA 4DV0B 2QKCA 4J9YB 5CBGA 4YJ2B 4DR4O 4LF5O 2JRIA 4I0XA 2ZE8A 1NT2B 1ZTEA 2GHYA 2JJ1G 5IY5C 3OEHG 1N34B 3H1LH 2DE0X 4X65B 3QO5A 4X1KB 4QPKA 1URFA 4X9QA 2WLKA 2GUZA 4B3TB 4MTXA 1EM1A 1TUEB 3ABKC 2ZT9B 3EVKA 3JAKA 4O4IA 1FXKA 1YTFB 1ZAUA 3BA9A 2WPDG 3WFVA 2YXHA 3UO2A 1S5HC 3TJTA 3ZN1A 3ML0A 2EJ7A 5H6RA 5FPOA 1SKVA 3D36C 4WFGA 5A2QN 1GN6A 4FFKA 3W7TA 4EB6A 4JI5B 4K8ZA 4CS3A 3K59A 2QWOB 2F95B 2YDEA 4PJ0Z 4B3RB 1IURA 5E79Z 3CCJV 2UUAO 3OUFA 3M8AA 3AG3C 2UUBO 1N0JA 1VQPV 1ZSPA 1VQNV 3M7MX 1BSMA 1GTOA 4X64B 5D5QA 1K33A 1TA8A 3ZHRA 4OPAA 4FJCC 4RQEA 4FZ1A 2P4KA 4X66O 2CH7B 4FM0A 1QLNA 4N23A 1DLBA 5EZYB 3N2GA 1OCCB 3P30A 1YZBA 3K9AA 5IWAB 4ZIBA 4JI2O 2QTOA 1W0JG 3RYHA 3RW0A 1MNGA 1AR4A 2RMKB 3G6BA 4LF8B 2VQFB 2PZSA 4KHPO 3E22A 4IYHA 4O4JA 4UVCA 3AG3B 4IHJB 1R1BA 1QLEC 3B40A 3SPCA 2GDSA 4JI3O 5LOVB 3ZS8C 1S77D 2NNUA 1Q5OA 1GKFA 4O4HA 5DN6G 1R6NA 5J2TA 1BZKA 1JPXA 3CB2A 4FIPC 1Y74B 3T1YB 1X59A 1NTKH 2E75B 4X8AA 4WFEA 4RAIA 1Z5VA 4XDKA 4UV8A 2QE7G 2A79B 4FLZA 3BVOA 1Y74A 1E1RG 3HKBA 1QLEB 3SPIA 3SJBC 5JH7A 1FXVA 5IE9A 1KU9A 5JVDB 1LNQA 1VMGA 2D2CB 2QKSA 2G38A 5IYZB 1RFYA 4X1YB 3CS5A 4OX9O 1M5IA 1Y4MA 3LUTB 2HVJC 2XUMA 3RWRD 1GN2A 1M56C 1GM8A 2BTQB 2Q67A 4MVOA 1QVGU 3E86A 5L3CA 4DV4B 2BTQA 2HJFC 5LGNA 2P67A 1XHXA 2XOKG 4YY3B 4J41A 3DXRA 5IJ9B 1MZFA 4H0LB 2P5OA 4J7JA 1BHBA 3F7VC 1VF5B 2DJVA 3RBZA 2RQ6A 1AI7A 4JPRA 5IJ9A 3QNEA 4RWUA 2KG7B 1JFFB 4DV1B 2IJKA 1K5QA 2UXXA 4JV5O 1SF9A 1JVMA 2N74A 4AQYB 3BCCH 4DR7O 3U11A 1Y67A 2QA4V 3OGCC 4UB6Z 1XOUA 3AG2C 1Q6IA 2OIEA 5L3BA 3GWOA 2W0FC 4F6RB 2IBZH 2QTSA 4O2AB 5LA6A 5GTIZ 5B66Z 2JS3A 1Q81W 1GM9A 2UUCB 3K57A 3HKCB 3RYIB 5CA1B 2CUGA 1RPRA 3FB8C 2LFSA 2NN4A 4BIOA 4PA4A 2IJHA 1NZ6A 3RYIA 3HKDA 1WB7A 1FJGO 1FXHA 3AK1A 2PUSA 3H9VA 2QEXV 1PNMA 1QR9A 1WP7A 3VOUA 3TETA 3JASA 2WSSG 4AILC 1H2NA 1WPXA 2UXNA 2B9ZA 4OPHA 4ZHQB 3GVMA 1YTFD 1K4DC 1PP9H 1WA8B 3DGEA 2XHBA 3AG1C 3U10A 2A9HA 4MSWC 2HLDG 3FKSG 4WFHA 2CAZC 2WAMA 3PJSK 1UFIA 4P9PA 4TT3G 1BQ0A 2WLJA 3ETQA 4ZI7B 5HFLA 4LFAB 3ICXA 4GZRB 4EFEA 2H8PC 4GX5A 4DV0O 2QM8A 3H1JH 3LDEA 1WAZA 4X62B 1XMOB 5LHGA 3U0ZA 3UCSC 2JK5C 1M4UA 5IJ0B 3AG1B 3E8HA 1N34O 3DSQA 2P06A 2Q0AA 4X65O 5C93A 2LP7A 2DYRC 4R6ZA 1YHQV 2AXTZ 3QVNA 5H9CA 1X4TA 4L87A 4H13B 5IJ0A 4B3TO 1WB8A 2QDOA 3S3XA 4I50A 4I5SA 1H38A 3RYCA 2Q68A 1CPYA 2ZXWC 3RT3C 1EN5A 4D6TH 5JWPA 3CD6V 3SJQC 4DK1A 3ZMZA 5B1OA 3OE7G 1OCZC 3UKMA 4CS4A 3TK1A 1SQXH 1K34A 5IT9N 3JD0A 1KD1W 4JI4O 1WN7A 2CTRA 2XT9A 3ZBHA 5GONB 4JI5O 4JYYA 3ASOC 4B3RO 4AI8A 1EFRG 1K92A 3ASNC 4PA3A 1VQKV 4CZZA 2ZXWB 1R3JC 3CX5F 3CCEV 1AROP 4X64O 3CWBH 1OCZB 4I55B 4J42A 1F7YA 1XL6A 1Z2GA 4U7NA 1BHAA 5IWAO 3MD0A 3E35A 4NTXA 5J2UB 1P7BA 3K0GA 1I08A 2FKXA 4DW0A 3ASOB 4DV7B 1E1QG 4LF8O 2VQFO 3BAAA 3BEHA 3ZRWA 2H94A 4MT8A 3JAWB 3ASNB 2JGUA 3ZJZA 2UXCB 1FFXB 1P7GA 3D3IA 1ZL8A 2LW7A 3FYEB 1N4CA 2OYQA 3VQYA 4OXSA 2P7TC 1GH6A 3SJCC 3H01A 4YJ3A 2CGOA 4LF6B 3AG7A 3WB2A 1VP7A 5K1XA 1JJOA 3PN1A 1S72V 3JAMN 3P3PA 4Q6GA 1SETA 3T1YO 4FVMA 2AZ2A 3CJHB 3T4DA 4PV1B 4HZ3A 4B7EA 5FL7G 1R6TA 4TV8B 4DUZB 3VBBA 1XBLA 2MK3A 4TUYB 2PYJA 2LGQA 1Q3EA 4GX1A 5DECA 3B8MA 1NKDA 1BCCH 4UXNA 4YHHB 2X6CA 1VIBA 4LF7B 4Z1VA 1BT8A 3ZRSA 2Q69A 4DR5B 2K9PA 2ZR2A 3OGIB 1FKAO 4JI8B 2IJIA 4J7KA 5TISZ 2IJJA 4XBFA 4UCUA 3OMNB 1COWG 1HP8A 3K3WA 2UXDB 4HNAB 3SYPA 1VQMV 2FL4A 1M93A 4DRXB 3MHHC 2EZOA 2ATKC 1LR1A 4I4TB 3E83A 2QM4A 4QJFB 4ZBMA 4DR1B 2HP8A 1QU7A 2AGAA 1XUQA 3CYOA 4KP4A 3CCQV 1VQ4V 4DUYB 1Y76B 1O9HA 4JASA 4DV4O 1CP9A 2BE3A 2DWEC 1JA8A 2P90A 2YSUB 4PHZA 4O2BB 4YY3O 3P32A 5E1AC 2IW5A 2OCHA 4MTFA 5LMUB 2HHHB 1XL4A 1Y76A 3G6EV 2FMLA 3ZMSA 5LYJA 1VQ8V 4O2BA 5CB4A 4RQFA 1TGOA 1GAXA 2ZE7A 1TVKA 1S5JA 2YIBD 1AILA 1NTMH 1S0VA 1MG1A 4MW8A 4CC6A 4DV1O 3OM3B 1FXKC 4I9QA 3ZCCA 2DYSC 2RJZA 1JJ2U 4FLTA 3OUSA 2X6BA 5IYBO 1R6KA 1XNRB 4JAVA 4LBEC 4AQYO 1HW7A 4I0XB 3EXAA 1VQOV 1B3QA 3ETDA 3D8CA 1Q7YW 3CMAV 3K79A 1SQPH 1Y6XA 1OV9A 3ETGA 4GX0A 1HNWB 1Q43A 1ENVA 3TXQA 1KMIZ 2GUZB 2UUCO 3ZHUA 4QE7A 2HG5C 3G71V 3JAKB 2Q7GA 4O4IB 3ZX6A 2CDYA 3A0RA 4GUNA 1FXKB 2DYSB 2EINC 3F5TA 5B1NA 1BE3H 3LNMB 1WLEA 4NTYA 3L73H 3ZRXA 2P6JA 1DGSA 1L0NH 3S3WA 3KCXA 3UQ8A 1IBMB 5DM6V 3K04A 1N0NA 3CC4V 4EB6B 2E5LB 4WFBV 5LMNB 3QTCA 4PA7A 4TQDA 5GTHZ 1OCCC 3JALB 2Q7HA 4MTGA 2IU0A 1AI5A 2ITDC 3CCVV 2EINB 1TUBB 3CC7V 1DF5A 4FLUA 1L1FA 1Q90D 1IZ3A 5J9PC 2PI4A 2Y48A 2PY5A 2EBOA 4K0KB 1NS1A 2EILC 3KKYA 4Q20A 2YICA 1KYOF 4TV9A 3JALA 3RGBA 5EYPA 4LFAO 1TUBA 3N2GB 1ZUQA 2QJ1A 4JTDB 1PKXA 5LP6A 4X62O 3RYHB 2RN9A 4J80A 1XMOO 3MAQA 3JARB 3SPJA 4X89A 4DV3B 1CXZB 3E22B 3QO8A 4O4JB 4WFFA 3STZC 1XILA 2BTOA 4BIZA 5KHJA 1THZA 4BW9A 3CPWU 1NU1H 1GO3F 3SR2C 2EILB 3K5LA 3OFNG 3JARA 3FB6C 1FYJA 4O4HB 1F4NA 2ILMA 4J11A 4FK5C 5J2TB 3ZMVA 3CRRA 3L71H 2FB5A 4QNHB 1VQ7V 2Q4PA 2ZINA 4LH7A 3G80A 1SERA 5H6QA 2PF4E 2X6AA 3CXCU 1AI4A 4YIOA 1YIJV 4RO2A 2OCCC 4MVUA 1H2MA 3HKBB 3X2QC 5BR8B 1MMMA 3L75H 2XAFA 2DOSA 5JH7B 2EIJC 4MVMA 1AVMA 5JJEB 1YSCA 2JIZG 1YCIA 4FLYA 4KUMA 2XNDG 1RPOA 2OCCB 2CK3G 3APOA 5KAIZ 3X2QB 2Z5UA 4DV5B 3E8FA 2F93B 2ARHA 3CRAA 2ZNIA 3SYOA 2RNBA 4JYBA 1AJNA 4DV7O 2EIJB 3BPZA 4JGSA 1R3IC 4X20A 2UXCO 2ZR3A 3DXRB 1YXBA 5LGTA 4ZOLA 4XDLA 3FAVA 1KC8W 2Q5ZA 2XAGA 2JVDA 1MZEA 1LUWA 2AW9A 1VF6C 4K8XA 1AR5A 1SQQH 4LF6O 1N33B 2Y4TA 2EIMC 3A2FA 3D3QA 4JTCB 4PA6A 2A3QA 2UXBB 1H2LA 1NH2B 2ZIOA 1IBKB 1VQLV 4LF4B 1YI2V 3H1KH 4PI0A 5H2FZ 4DUZO 1HNXB 1IX9A 2NR5A 4UV9A 5JQGA 1K5SA 2LO1A 4D7SA 3L74H 5CA0B 5JJJB 4YHHO 4LF7O 5B5EZ 2WLHA 4DR5O 4YIPA 5KX5B 2KQXA 2EIMB 4LWSB 1K73W 4JI8O 5LA6B 5CA0A 5K1PA 2JGDA 2DWDC 3GB7C 2HKOA 1K4CC 4QGPA 2ITCC 1VF6A 2H3OA 1YJ9V 2UXDO 2A0LA 1QR8A 3JCZA 5KX5A 3C90A 1SQBH 4LWSA 4UCOA 2N04A 2YIDA 4DR1O 5FLXN 4QIWF 1BL8A 3HKDB 2CTPA 1SZTA 3SGIA 5LHHA 1B04A 3N27A 3K58A 4CC5A 1NVPB 3JASB 3FYIB 3UT5B 3M99B 1JR9A 4FMTA 5BMVA 4BR6A 3A0HZ 5LMUO 2HHHO 5L3DA 4G28B 3UT5A 2AHZA 4G2KA 1P4RA 4PDMA 2PI5A 1XREA 5EIBC 4KXRA 1H2KA 1F51A 3WU2Z 1OJHA 2RDCA 1OCOB 2R72A 2GSMB 2ODMA 1M9NA 5KLVH 1PNLA 2QWPB 1BS3A 1N8RW 4DR3B 1XNRO 2B1IA 3W7UA 4GX2A 4N21A 4FM2A 4GT1A 5EK0A 5CBFA 5KA6A 4P2ZA 3CC2V 1EZVH 3QF7A 2WLIA 4CH4A 2ZE6A 1HNWO 3NXSA 4JI1B 1GMGA 2Y4UA 2EIKC 4EFBA 4I50B 4LNUA 1WP8A 1IVSA 3RYCB 4FLXA 1KQSU 3CHXA 3E8GA 1SA0A 3N2KB 3RVZA 1QBZA 2BSKA 5KHKA 3CCSV 3N2KA 1KP3A 4JI2B 1GM7A 3CEIA 1HR0B 2XTAA 3W7XA 4F6EA 1B6QA 4LFBB 1IBMO 2OIGA 2OWOA 2EIKB 3F7YC 4C7UA 1MSDA 5LMNO 5LXTB 1DK1A 2WLNA 2E76B 1OCRB 4B7KA 2JEXA 5L3FA 3CP1A 5DEDA 1H2GA 4K0KO 3OTOB 2EJRA 4LR3A 5FNVB 3JYCA 2ADQB 3R65A 2X0LA 1PPJH 2ZCEA 2CE4A 4NVPA 5LXTA 1BQZA 2ETNA 2Q7EA 4LCUC 4BWAA 1U97A 1IDSA 4GLXA 2IM9A 3KCYA 4MVSA 3TXSA 2R70A 3ZIAG 4JI7B 5FNVA 3QG5A 2DQ3A 3I55V 2L35A 1VQ6V 3NR7A 4JZGA 4KFMA 4W4KA 1Z5WA 3ZRWB 3ABUA 4DV3O 4QE9A 2YI8A 1V54C 1O9GA 3P3NA 1ZL8B 3K9SA 3QO7A 1I0HA 1FPOA 4YJ3B 3ZHSA 3HB3B 1Q6HA 2F1MA 5B1AC 4CBCA 3FB5C 4JAAA 2LFRA 4DR6B 1YITV 3HKEB 4DK0A 3VQWA 3FD9A 2Y69C 1T5EA 1G4YB 3F5WC 4G27B 1V54B 5KHGA 2WWWA 4PD4F 5BR8O 3HKEA 1QQCA 4L8JA 4UCRA 3CRCA 1NI8A 1NH2D 1NBMG 3RYFB 2F4VB 5B1AB 2EULA 2CTQA 1KP2A 1MOFA 4I7ZB 2GTAA 1PL0A 4FM1A 5L3EA 2Y69B 3RYFA 3FX7A 4JI0B 2Q6AA 4UCSA 3SYCA 4B3MB 4F4LA 4DV5O 1F4MA 2ZD9A 3R66A 2K1EA 4UFZA 2Q9LA 2V1DA 3B2EE 2OT5A 2ZDIA 4MVRA 2WLLB 2VQEB 1US6A 3TCUA 1IXMA 1XDCA 1Q8IA 5CN0A 4DR2B 5EBMC 3ABTA 5LBQA 1H8EG 3G4SV 4NXMB 1KUQA 5BZBA 2B5UA 2WLLA 1RP3B 2QWNB 5LYJB 3BFRA 2NLJC 2ZNJA 3CSXA 5CB4B 1N33O 2XAQA 2QM7A 2UXBO 2AHYA 1IBKO 1TVKB 4O4LA 1J95A 1D5NA 4JI6B 2F66C 3JD4A 4LF4O 2JDIG 1AP6A 3SYAA 1NVPD 3LSUA 3OD4A 4GKKB 2M7WA 3BABA 2YXYA 1AR1B 5JCOA 1HDJA 3O9OA 1LUVA 2B1GA 3OT7A 1R3KC 1FJGB 4FLWA 1GN4A 3Q4HA 3LNNA 1XI1A 4LP8A 4UCVA 1L0LH 4NTWA 2ZM6B 2CTWA 5LHIA 4R8CA 3VQXA 3OW2U 4DV2B 2V4DA 1PV0A 3AK3A 1W2BU 3SDLA 3CRMA 2HR3A 5KAFZ 1YF2A 3DTUB 2Y0IA 2XAJA 3CXHF 4X1IB 1VARA 4TOIA 1S76D 5EBLC 1QVFU 1U96A 3JSNA 1W59A 2GV9A 4LC1A 4ICGA 2YIAA 4IL6Z 4X1IA 4MVZA 1FAFA 3B4SA 4FPPA 5EIBD 1RSOB 2HVKC 3AG4C 3CRQA 4WBNA 3BA8A 3K5MA 1AB3A 1NTZH 1V55B 2GTSA 2ZKOA 4GCZA 5LP6C 5JJNB 1ZLZA 3A8TA 1I94B 1E79G 1RSOA 3JD1A 5AG2A 4YJ2A 3LDDA 3APQA 4JAUA 3ZMTA 1Q82W 1HNZB 2L6LA 1GK9A 3ABLC 3IJ4A 3T1HB 4JTAB 2OTJV 4TV9B 1K97A 5EYPB 4X1KA 3K06A 4HAMA 3AG4B 2R9IA 2BOBC 4DR3O 3BRCA 4RUFA 1V9PA 5LP6B 2ADPA 5CMUA 1K9MW 5IY5B 3WG7C 1WPBA 1P84F 3IC9A 2DN9A 4JI4B 3ABLB 4UUJC 1VF7A 2IH1C 2QWRB 3O65A 1J5EB 3H1HH 4KL1A 2F43G 1XMQB 4JI1O 3ABKB 4P9OA 2HEPA 1M90W 3FB7C 2DMXA 2IU3A 2WA4A 4D7TA 3RFRA 5EBWC 3WG7B 4PDVA 1L8DA 3L70H 4LFCB 1HR0O 1G6UA 4HYOA 4CH6A 4LFBO 1RM1C 4P30A 1SZXA 2CH7A 5A9GA 5LGUA 5EZYA 3D36A 1QHTA 1S3JA 3OTFA 3IFXA 4CS2A 5KHHA 4NKGB 2QR4A 3G67A 5IYCO 2VS0A 4TSFG 1P49A 1XQ8A 3L9DA 5IYDO 2YEVB 4HBNA 3DC5A 3OTOO 4MVQA 4IT5A 4PELA 4Z1MG 2C2AA 4B3SB 4IHJA 4E2LA 2A7WA 2ZIMA 2YS8A 4NXNB 1SS3A 1VQ9V 4LF9B 4DV6B 5C8YB 5LOVA 2YEVA 3WB0A 4EKWA 1RM1B 3K5OA 2VRZA 3SPGA 4JI7O 1AP5A 2M6YA 1W0KG 3CE2A 3T2MA 3ETEA 3ZN0A 4OGQB 4PDRA 5C8YA 2QGNA 2CGNA 4X20B 1QNMA 4R50A 4YXWG 3ZHVA 4U3FH 4ZOLB 3FAVB 3I5DA 3K0DA 1IBLB 1XEQA 1KKDA 2LJ2A 1M57C 1XNQB 2Q73A 3ABMC 2YXLA 1TAEA 3OAAG 4DR6O 1GRJA 3SYQA 2IH3C 5JVDA 3DC6A 4WF9V 4RUEA 2QWQB 1MSWD 4H44B 2KKWA 4IGGA 4PA9A 5IYZA 5JQGB 1JOYA 4X1YA 1ZWIC 1BGYH 1YEWA 1N32B 1FFTB 1PD3A 1ZX3A 1QCEA 5ITZB 1M57B 1EZJA 2JS5A 4NYKA 4GKJB 4Z2WA 3OMIB 2F4VO 2JGDB 5BXZA 3ABMB 2UU9B 2VWKA 3OR7C 5ITZA 2JJ2G 4JYAB 2BOCC 2FTKA 1SQFA 1M56B 3IAYA 2DW4A 4JI0O 3W7WA 4B3MO 2D3OW 3OMAB 3EHBB 1PNKA 4CH3A 5FPRA 3IC7A 3ZRVA 2F23A 2ZQMA 1K8AW 2RCVA 1N36B 2YC0A 4PDLA 3J80N 4BW5A 1DTOA 2VQEO 2BCCH 4K35A
chains in the Genus database with same CATH topology
4O2BA 5CB4A 2PZSA 4GLXA 5BMVB 2IM9A 1JMKC 1JFFA 3E22A 1TGOA 2R70A 4GYCB 4O4JA 4JI7B 5FNVA 3QG5A 4IHJB 1TVKA 1S5JA 2YIBD 4DR4B 4LF5B 1Z5WA 5LOVB 4CC6A 3ZS8C 2P22C 2YI8A 4I9QA 1Q5OA 2PYLA 1O9GA 2RJZA 4FLTA 4O4HA 1XNRB 4F6RA 5J2TA 1HW7A 3CB2A 4O2AA 3T1YB 4YJ3B 1Z5VA 2R9AA 3HKCA 4FLZA 2F1MA 5CA1A 4FLVA 1HNWB 1Q43A 4DR6B 4FFBB 3HKBA 1KMIZ 3HKEB 4DK0A 3VQWA 3SJBC 1T5EA 3JAKB 2Q7GA 4O4IB 5JH7A 5KHGA 2YIBA 1KU9A 4FFBA 5JVDB 3HKEA 1QQCA 4L8JA 4LH6A 4LNUB 4UCRA 1D5AA 3THOA 2YI9A 5IYZB 4X1YB 1SA0B 1M5IA 3JSLA 1DGSA 4EEQA 3RYFB 4UCTA 4ZHQA 2F4VB 2UUAB 4AHCA 3RWRD 2BTQB 3UQ8A 1IBMB 4FM1A 2UUBB 4EB6B 2E5LB 5LMNB 3QTCA 3RYFA 4TQDA 2PTMA 3JALB 2Q7HA 4JI0B 4UCSA 4X66B 4DV4B 1TUBB 2BTQA 4ZI7A 4B3MB 4FLUA 1XHXA 2PY5A 4YY3B 4K0KB 4UFZA 3VQVA 4TV9A 3B2EE 3JALA 5IJ9B 3RGBA 5EYPA 2VQEB 1TUBA 3N2GB 2P5OA 2QJ1A 1Q8IA 4DR2B 4KHPB 2RQ6A 4NXMB 5IJ9A 5LP6A 3RYHB 4U3JB 3MAQA 4IIJB 3JARB 5LYJB 5CB4B 2ZNJA 3CSXA 4JI3B 4DV3B 3E22B 1JFFB 4O4JB 4DV1B 2BTOA 5KHJA 1TVKB 4O4LA 4BW9A 3BHPA 4JI6B 2F66C 3K5LA 3SR2C 4U3JA 4AQYB 3U11A 4IIJA 3JARA 4GKKB 3BABA 5JCOA 4O4HB 4F6RB 5J2TB 1FJGB 4O2AB 5LA6A 4FLWA 4TQFA 2ZINA 4LH7A 3LNNA 1XI1A 2UUCB 4UCVA 2ZM6B 3K57A 3HKCB 3VQXA 3RYIB 4DV2B 5CA1B 5GONA 2V4DA 3HKBB 5BR8B 4LF8B 4X1IB 4TOIA 4CH5A 3RYIA 3HKDA 5JH7B 3JSNA 2PUSA 4OX9B 2GV9A 2VWJA 2YIAA 4I55A 5JJEB 3ZEDA 3JASA 4X1IA 1H2SB 4AILC 2E3CA 4FLYA 5EIBD 4ZHQB 5J2UA 1I7FA 2XHBA 4WBNA 3BA8A 3K5MA 3U10A 5LP6C 5JJNB 4DV5B 3JAWA 2F93B 1FFXA 1I94B 2ZNIA 5KHIA 1RSOA 2CAZC 4YJ2A 4B08A 3ETQA 5D5PA 4ZI7B 4LFAB 1HNZB 3ICXA 3BPZA 4EFEA 1XHZA 3T1HB 4X20A 4ZOLA 4TV9B 3WB1A 4X62B 2JVDA 5EYPB 4X1KA 1XMOB 5JCOC 4K8XA 3U0ZA 1M4UA 1N33B 5IJ0B 3FFQA 3A2FA 2UXBB 3BRCA 1V9PA 3DSQA 2ZIOA 4TV8A 2Q0AA 1IBKB 5LP6B 4JV5B 4LF4B 4TUYA 4PI0A 1WPBA 4DR7B 1X4TA 5IJ0A 4I50A 4JI4B 1VF7A 1J5EB 4O4LB 1HNXB 3RYCA 4KL1A 5JQGA 1WNSA 1XMQB 4D7SA 5CA0B 2HEPA 5JJJB 4PI2A 4DK1A 5KX5B 4CS4A 4HNAA 5LA6B 4D7TA 3RFRA 4DRXA 5CA0A 5K1PA 4I4TA 2PGGA 1WN7A 3K5NA 1SQGA 5KX5A 1L8DA 5GONB 4UCOA 4LFCB 1G6UA 4CH6A 5EZYA 3HKDB 1QHTA 3OTFA 3SGIA 4CS2A 1B04A 5KHHA 3K58A 4CC5A 4I55B 3JASB 3UT5B 1P49A 1XQ8A 3JATB 4HBNA 5BMVA 5KMGB 4B3SB 4IHJA 5J2UB 3SJAC 4WBNB 4DV7B 2ZIMA 3UT5A 3BAAA 4NXNB 4LF9B 4DV6B 5C8YB 5LOVA 3WB0A 3JAWB 3JATA 2JGUA 3K5OA 5EIBC 2EX3A 5KMGA 1FFXB 2UXCB 4DV0B 4YJ2B 2OYQA 2R72A 3VQYA 3SJCC 4YJ3A 5C8YA 4LF6B 1NT2B 4X20B 3WB2A 5K1XA 4DR3B 1JJOA 4ZOLB 1N34B 3PN1A 4X65B 4FM2A 4X1KB 1IBLB 4Q6GA 4FVMA 4B3TB 1XNQB 4TV8B 4DUZB 3QF7A 4CH4A 3JAKA 4O4IA 2PYJA 2YXLA 4TUYB 1Q3EA 1TAEA 1ZAUA 4JI1B 3BA9A 5JVDA 4EFBA 4YHHB 4I50B 4LNUA 4LF7B 3RYCB 4DR5B 2KKWA 5IYZA 5JQGB 4FLXA 4X1YA 3CHXA 3N2KB 1SA0A 4JI8B 5FPOA 1YEWA 1SKVA 1N32B 4UCUA 5ITZB 2UXDB 5KHKA 4EB6A 4JI5B 4HNAB 1M93A 4K8ZA 3N2KA 4DRXB 2JS5A 2F95B 4CS3A 3K59A 4GKJB 4B3RB 4JI2B 1HR0B 4I4TB 2UU9B 2VWKA 4LFBB 2QM4A 5ITZA 4DR1B 2OWOA 4JYAB 3M7MX 1SQFA 3IAYA 4X64B 5D5QA 4DUYB 1TA8A 5LXTB 1O9HA 4FM0A 4PHZA 5EZYB 3N2GA 4CH3A 5FPRA 4O2BB 3OTOB 4LR3A 5IWAB 4ZIBA 5FNVB 1N36B 5LMUB 2HHHB 2ZCEA 4NVPA 3RYHA 5LXTA 2Q7EA 4BWAA 2VQFB 5LYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2E E;  1X4T A;  3SJC C;  3CSX A;  3SJB C;  3SJA C;  3ZS8 C;  2JS5 A;  1NT2 B;  2P22 C;  2F66 C;  3QF7 A;  3THO A;  1SKV A;  3QG5 A;  2CAZ C;  3ICX A; 
#chains in the Genus database with same CATH topology
 1EN4 A;  2KG7 A;  4MW3 A;  4DR2 O;  5BMV B;  1NR1 A;  1JMK C;  1JFF A;  1KB9 F;  1OCO C;  4GYC B;  1MAB G;  2WA3 A;  4DUY O;  4NXM O;  1EN6 A;  4DR4 B;  5IDJ A;  2QKA A;  1CEZ A;  2Z0A A;  4JZ2 A;  4LF5 B;  5H5N A;  2AZ0 A;  2P4V A;  2P22 C;  4ABM A;  3A0B Z;  2PYL A;  3EFF K;  4JI6 O;  4F6R A;  4O2A A;  4TWK A;  4GKK O;  3LDC A;  1S5L Z;  2R9A A;  3HKC A;  5CA1 A;  4FLV A;  3RVY A;  4A5U B;  3AG2 B;  1FS0 G;  4FFB B;  1D2D A;  3UO3 A;  2ZM6 O;  4DV2 O;  2WLI B;  2ZE5 A;  1KBH A;  4MS2 A;  4I9W A;  2YIB A;  4FFB A;  2KSD A;  1SRY A;  3JCU Z;  1SC5 B;  4LNU B;  4LH6 A;  4FZ0 A;  1D5A A;  3THO A;  2YI9 A;  4DW1 A;  3UM7 A;  3HR0 A;  3E89 A;  4DYL A;  1SA0 B;  1ORQ C;  3JSL A;  2O57 A;  4EEQ A;  1NQT A;  4UCT A;  4ZHQ A;  2Q0O C;  2BSK B;  1WA8 A;  4AHC A;  2UUA B;  3RN4 A;  3LSQ A;  3AEI A;  2WLM A;  1Y66 A;  2UUB B;  1B06 A;  3MHS C;  1JQ0 A;  4DO2 A;  1OCR C;  3STL C;  2A06 H;  4UB8 Z;  2PTM A;  3C3S A;  4X66 B;  3SPH A;  1M1K W;  4ZI7 A;  3CCR V;  1R3L C;  1AI6 A;  2LQT A;  2W6I G;  1I94 O;  2LGW A;  2FYU H;  2HFE C;  3AK2 A;  3VQV A;  1VEW A;  3K08 A;  1BMF G;  1UJW B;  3MDS A;  1HNZ O;  2YUA A;  1WJZ A;  3T1H O;  2E5L O;  4KHP B;  2XAH A;  5EC1 C;  3T4Z A;  4DXW A;  4U3J B;  3CCL V;  2GBO A;  4IIJ B;  5CA3 A;  2MW2 B;  4JI3 B;  1EBO A;  5BY1 A;  5KUM A;  2N05 A;  2XAS A;  3BHP A;  4NR1 A;  4X88 A;  1Q6U A;  4U3J A;  3HPL C;  3J81 N;  4IIJ A;  4ASU G;  1YVW A;  2DYR B;  4R7C A;  3ZMU A;  1J5E O;  3B8N A;  2Q8V A;  3GWK C;  4W4L A;  1XMQ O;  4TQF A;  1DF4 A;  2JEU A;  4XDJ A;  3ZHT A;  1IXB A;  4J10 A;  5LL6 Y;  1HWY A;  3T1C A;  4J7Z A;  5KUK A;  2R9R B;  1PM9 A;  5GON A;  3B77 A;  1MA1 A;  1I5X A;  4H37 A;  5L3G A;  3IGA C;  5KA5 A;  4CH5 A;  4LFC O;  4OX9 B;  1SES A;  3CCU V;  4JYC A;  2VWJ A;  4I55 A;  3ZED A;  1F23 A;  1YJW V;  1OHH G;  1H2S B;  2E3C A;  2Y0P A;  2ZDI C;  3B09 A;  3W7S A;  1SQV H;  4MTO A;  4J9Z B;  1VQ5 V;  1JX9 A;  5J2U A;  5GW7 A;  1I7F A;  1NJI W;  4JF3 A;  3BY6 A;  1YDX A;  3JAW A;  3H1I H;  1I5Y A;  4WFA V;  1FFX A;  4B3S O;  5KHI A;  1YJN V;  4B08 A;  5D5P A;  1AJQ A;  4LF9 O;  4NXN O;  4DV6 O;  1XHZ A;  3E8B A;  3E2E A;  2LW1 A;  3WB1 A;  1UPG A;  3J7A U;  5JCO C;  5CBH A;  3CJH A;  3FFQ A;  1FD9 A;  1G1X B;  1R73 A;  1K7D A;  4TV8 A;  4WCE V;  4BAY A;  4JV5 B;  4TUY A;  1IBL O;  4QPJ A;  3I56 V;  3OEE G;  4DR7 B;  4UVB A;  1GN3 A;  3KG2 A;  1XNQ O;  4K3A A;  4O4L B;  1G8M A;  3LSS A;  5HFM A;  1WNS A;  3ZHQ A;  4E4E A;  4BIU A;  5F2V O;  4PI2 A;  2W6J G;  4UVA A;  1AJP A;  5B3S C;  2E74 B;  4HNA A;  2KB1 A;  4DRX A;  5B1B C;  3Q4H B;  1N32 O;  2HJD A;  1Q86 W;  4I4T A;  1NR7 A;  2PGG A;  4U7O A;  1HNX O;  1K3E A;  2V7Q G;  3CME V;  3C3T A;  3K5N A;  1SQG A;  1OZ0 A;  3JD3 A;  4NB5 A;  3KZI Z;  4GKJ O;  4IYI A;  1H8H G;  2UU9 O;  1KKC A;  3TGU H;  1PL4 A;  3JD2 A;  4JYA O;  3CCM V;  4ZKI A;  5B3S B;  3K03 A;  2Z3Y A;  5EC2 C;  1KEC A;  1V55 C;  2DQ0 A;  2EZP A;  2QSA A;  1ROP A;  5B1B B;  3L72 H;  3JAT B;  5KMG B;  1N36 O;  3SJA C;  4WBN B;  2W0X A;  4H33 A;  1JCH A;  3OR6 C;  2OTL V;  3JAT A;  2EX3 A;  1A32 A;  2X7R B;  5KMG A;  4DV0 B;  2QKC A;  4J9Y B;  5CBG A;  4YJ2 B;  4DR4 O;  4LF5 O;  2JRI A;  4I0X A;  2ZE8 A;  1NT2 B;  1ZTE A;  2GHY A;  2JJ1 G;  5IY5 C;  3OEH G;  1N34 B;  3H1L H;  2DE0 X;  4X65 B;  3QO5 A;  4X1K B;  4QPK A;  1URF A;  4X9Q A;  2WLK A;  2GUZ A;  4B3T B;  4MTX A;  1EM1 A;  1TUE B;  3ABK C;  2ZT9 B;  3EVK A;  3JAK A;  4O4I A;  1FXK A;  1YTF B;  1ZAU A;  3BA9 A;  2WPD G;  3WFV A;  2YXH A;  3UO2 A;  1S5H C;  3TJT A;  3ZN1 A;  3ML0 A;  2EJ7 A;  5H6R A;  5FPO A;  1SKV A;  3D36 C;  4WFG A;  5A2Q N;  1GN6 A;  4FFK A;  3W7T A;  4EB6 A;  4JI5 B;  4K8Z A;  4CS3 A;  3K59 A;  2QWO B;  2F95 B;  2YDE A;  4PJ0 Z;  4B3R B;  1IUR A;  5E79 Z;  3CCJ V;  2UUA O;  3OUF A;  3M8A A;  3AG3 C;  2UUB O;  1N0J A;  1VQP V;  1ZSP A;  1VQN V;  3M7M X;  1BSM A;  1GTO A;  4X64 B;  5D5Q A;  1K33 A;  1TA8 A;  3ZHR A;  4OPA A;  4FJC C;  4RQE A;  4FZ1 A;  2P4K A;  4X66 O;  2CH7 B;  4FM0 A;  1QLN A;  4N23 A;  1DLB A;  5EZY B;  3N2G A;  1OCC B;  3P30 A;  1YZB A;  3K9A A;  5IWA B;  4ZIB A;  4JI2 O;  2QTO A;  1W0J G;  3RYH A;  3RW0 A;  1MNG A;  1AR4 A;  2RMK B;  3G6B A;  4LF8 B;  2VQF B;  2PZS A;  4KHP O;  3E22 A;  4IYH A;  4O4J A;  4UVC A;  3AG3 B;  4IHJ B;  1R1B A;  1QLE C;  3B40 A;  3SPC A;  2GDS A;  4JI3 O;  5LOV B;  3ZS8 C;  1S77 D;  2NNU A;  1Q5O A;  1GKF A;  4O4H A;  5DN6 G;  1R6N A;  5J2T A;  1BZK A;  1JPX A;  3CB2 A;  4FIP C;  1Y74 B;  3T1Y B;  1X59 A;  1NTK H;  2E75 B;  4X8A A;  4WFE A;  4RAI A;  1Z5V A;  4XDK A;  4UV8 A;  2QE7 G;  2A79 B;  4FLZ A;  3BVO A;  1Y74 A;  1E1R G;  3HKB A;  1QLE B;  3SPI A;  3SJB C;  5JH7 A;  1FXV A;  5IE9 A;  1KU9 A;  5JVD B;  1LNQ A;  1VMG A;  2D2C B;  2QKS A;  2G38 A;  5IYZ B;  1RFY A;  4X1Y B;  3CS5 A;  4OX9 O;  1M5I A;  1Y4M A;  3LUT B;  2HVJ C;  2XUM A;  3RWR D;  1GN2 A;  1M56 C;  1GM8 A;  2BTQ B;  2Q67 A;  4MVO A;  1QVG U;  3E86 A;  5L3C A;  4DV4 B;  2BTQ A;  2HJF C;  5LGN A;  2P67 A;  1XHX A;  2XOK G;  4YY3 B;  4J41 A;  3DXR A;  5IJ9 B;  1MZF A;  4H0L B;  2P5O A;  4J7J A;  1BHB A;  3F7V C;  1VF5 B;  2DJV A;  3RBZ A;  2RQ6 A;  1AI7 A;  4JPR A;  5IJ9 A;  3QNE A;  4RWU A;  2KG7 B;  1JFF B;  4DV1 B;  2IJK A;  1K5Q A;  2UXX A;  4JV5 O;  1SF9 A;  1JVM A;  2N74 A;  4AQY B;  3BCC H;  4DR7 O;  3U11 A;  1Y67 A;  2QA4 V;  3OGC C;  4UB6 Z;  1XOU A;  3AG2 C;  1Q6I A;  2OIE A;  5L3B A;  3GWO A;  2W0F C;  4F6R B;  2IBZ H;  2QTS A;  4O2A B;  5LA6 A;  5GTI Z;  5B66 Z;  2JS3 A;  1Q81 W;  1GM9 A;  2UUC B;  3K57 A;  3HKC B;  3RYI B;  5CA1 B;  2CUG A;  1RPR A;  3FB8 C;  2LFS A;  2NN4 A;  4BIO A;  4PA4 A;  2IJH A;  1NZ6 A;  3RYI A;  3HKD A;  1WB7 A;  1FJG O;  1FXH A;  3AK1 A;  2PUS A;  3H9V A;  2QEX V;  1PNM A;  1QR9 A;  1WP7 A;  3VOU A;  3TET A;  3JAS A;  2WSS G;  4AIL C;  1H2N A;  1WPX A;  2UXN A;  2B9Z A;  4OPH A;  4ZHQ B;  3GVM A;  1YTF D;  1K4D C;  1PP9 H;  1WA8 B;  3DGE A;  2XHB A;  3AG1 C;  3U10 A;  2A9H A;  4MSW C;  2HLD G;  3FKS G;  4WFH A;  2CAZ C;  2WAM A;  3PJS K;  1UFI A;  4P9P A;  4TT3 G;  1BQ0 A;  2WLJ A;  3ETQ A;  4ZI7 B;  5HFL A;  4LFA B;  3ICX A;  4GZR B;  4EFE A;  2H8P C;  4GX5 A;  4DV0 O;  2QM8 A;  3H1J H;  3LDE A;  1WAZ A;  4X62 B;  1XMO B;  5LHG A;  3U0Z A;  3UCS C;  2JK5 C;  1M4U A;  5IJ0 B;  3AG1 B;  3E8H A;  1N34 O;  3DSQ A;  2P06 A;  2Q0A A;  4X65 O;  5C93 A;  2LP7 A;  2DYR C;  4R6Z A;  1YHQ V;  2AXT Z;  3QVN A;  5H9C A;  1X4T A;  4L87 A;  4H13 B;  5IJ0 A;  4B3T O;  1WB8 A;  2QDO A;  3S3X A;  4I50 A;  4I5S A;  1H38 A;  3RYC A;  2Q68 A;  1CPY A;  2ZXW C;  3RT3 C;  1EN5 A;  4D6T H;  5JWP A;  3CD6 V;  3SJQ C;  4DK1 A;  3ZMZ A;  5B1O A;  3OE7 G;  1OCZ C;  3UKM A;  4CS4 A;  3TK1 A;  1SQX H;  1K34 A;  5IT9 N;  3JD0 A;  1KD1 W;  4JI4 O;  1WN7 A;  2CTR A;  2XT9 A;  3ZBH A;  5GON B;  4JI5 O;  4JYY A;  3ASO C;  4B3R O;  4AI8 A;  1EFR G;  1K92 A;  3ASN C;  4PA3 A;  1VQK V;  4CZZ A;  2ZXW B;  1R3J C;  3CX5 F;  3CCE V;  1ARO P;  4X64 O;  3CWB H;  1OCZ B;  4I55 B;  4J42 A;  1F7Y A;  1XL6 A;  1Z2G A;  4U7N A;  1BHA A;  5IWA O;  3MD0 A;  3E35 A;  4NTX A;  5J2U B;  1P7B A;  3K0G A;  1I08 A;  2FKX A;  4DW0 A;  3ASO B;  4DV7 B;  1E1Q G;  4LF8 O;  2VQF O;  3BAA A;  3BEH A;  3ZRW A;  2H94 A;  4MT8 A;  3JAW B;  3ASN B;  2JGU A;  3ZJZ A;  2UXC B;  1FFX B;  1P7G A;  3D3I A;  1ZL8 A;  2LW7 A;  3FYE B;  1N4C A;  2OYQ A;  3VQY A;  4OXS A;  2P7T C;  1GH6 A;  3SJC C;  3H01 A;  4YJ3 A;  2CGO A;  4LF6 B;  3AG7 A;  3WB2 A;  1VP7 A;  5K1X A;  1JJO A;  3PN1 A;  1S72 V;  3JAM N;  3P3P A;  4Q6G A;  1SET A;  3T1Y O;  4FVM A;  2AZ2 A;  3CJH B;  3T4D A;  4PV1 B;  4HZ3 A;  4B7E A;  5FL7 G;  1R6T A;  4TV8 B;  4DUZ B;  3VBB A;  1XBL A;  2MK3 A;  4TUY B;  2PYJ A;  2LGQ A;  1Q3E A;  4GX1 A;  5DEC A;  3B8M A;  1NKD A;  1BCC H;  4UXN A;  4YHH B;  2X6C A;  1VIB A;  4LF7 B;  4Z1V A;  1BT8 A;  3ZRS A;  2Q69 A;  4DR5 B;  2K9P A;  2ZR2 A;  3OGI B;  1FKA O;  4JI8 B;  2IJI A;  4J7K A;  5TIS Z;  2IJJ A;  4XBF A;  4UCU A;  3OMN B;  1COW G;  1HP8 A;  3K3W A;  2UXD B;  4HNA B;  3SYP A;  1VQM V;  2FL4 A;  1M93 A;  4DRX B;  3MHH C;  2EZO A;  2ATK C;  1LR1 A;  4I4T B;  3E83 A;  2QM4 A;  4QJF B;  4ZBM A;  4DR1 B;  2HP8 A;  1QU7 A;  2AGA A;  1XUQ A;  3CYO A;  4KP4 A;  3CCQ V;  1VQ4 V;  4DUY B;  1Y76 B;  1O9H A;  4JAS A;  4DV4 O;  1CP9 A;  2BE3 A;  2DWE C;  1JA8 A;  2P90 A;  2YSU B;  4PHZ A;  4O2B B;  4YY3 O;  3P32 A;  5E1A C;  2IW5 A;  2OCH A;  4MTF A;  5LMU B;  2HHH B;  1XL4 A;  1Y76 A;  3G6E V;  2FML A;  3ZMS A;  5LYJ A;  1VQ8 V;  4O2B A;  5CB4 A;  4RQF A;  1TGO A;  1GAX A;  2ZE7 A;  1TVK A;  1S5J A;  2YIB D;  1AIL A;  1NTM H;  1S0V A;  1MG1 A;  4MW8 A;  4CC6 A;  4DV1 O;  3OM3 B;  1FXK C;  4I9Q A;  3ZCC A;  2DYS C;  2RJZ A;  1JJ2 U;  4FLT A;  3OUS A;  2X6B A;  5IYB O;  1R6K A;  1XNR B;  4JAV A;  4LBE C;  4AQY O;  1HW7 A;  4I0X B;  3EXA A;  1VQO V;  1B3Q A;  3ETD A;  3D8C A;  1Q7Y W;  3CMA V;  3K79 A;  1SQP H;  1Y6X A;  1OV9 A;  3ETG A;  4GX0 A;  1HNW B;  1Q43 A;  1ENV A;  3TXQ A;  1KMI Z;  2GUZ B;  2UUC O;  3ZHU A;  4QE7 A;  2HG5 C;  3G71 V;  3JAK B;  2Q7G A;  4O4I B;  3ZX6 A;  2CDY A;  3A0R A;  4GUN A;  1FXK B;  2DYS B;  2EIN C;  3F5T A;  5B1N A;  1BE3 H;  3LNM B;  1WLE A;  4NTY A;  3L73 H;  3ZRX A;  2P6J A;  1DGS A;  1L0N H;  3S3W A;  3KCX A;  3UQ8 A;  1IBM B;  5DM6 V;  3K04 A;  1N0N A;  3CC4 V;  4EB6 B;  2E5L B;  4WFB V;  5LMN B;  3QTC A;  4PA7 A;  4TQD A;  5GTH Z;  1OCC C;  3JAL B;  2Q7H A;  4MTG A;  2IU0 A;  1AI5 A;  2ITD C;  3CCV V;  2EIN B;  1TUB B;  3CC7 V;  1DF5 A;  4FLU A;  1L1F A;  1Q90 D;  1IZ3 A;  5J9P C;  2PI4 A;  2Y48 A;  2PY5 A;  2EBO A;  4K0K B;  1NS1 A;  2EIL C;  3KKY A;  4Q20 A;  2YIC A;  1KYO F;  4TV9 A;  3JAL A;  3RGB A;  5EYP A;  4LFA O;  1TUB A;  3N2G B;  1ZUQ A;  2QJ1 A;  4JTD B;  1PKX A;  5LP6 A;  4X62 O;  3RYH B;  2RN9 A;  4J80 A;  1XMO O;  3MAQ A;  3JAR B;  3SPJ A;  4X89 A;  4DV3 B;  1CXZ B;  3E22 B;  3QO8 A;  4O4J B;  4WFF A;  3STZ C;  1XIL A;  2BTO A;  4BIZ A;  5KHJ A;  1THZ A;  4BW9 A;  3CPW U;  1NU1 H;  1GO3 F;  3SR2 C;  2EIL B;  3K5L A;  3OFN G;  3JAR A;  3FB6 C;  1FYJ A;  4O4H B;  1F4N A;  2ILM A;  4J11 A;  4FK5 C;  5J2T B;  3ZMV A;  3CRR A;  3L71 H;  2FB5 A;  4QNH B;  1VQ7 V;  2Q4P A;  2ZIN A;  4LH7 A;  3G80 A;  1SER A;  5H6Q A;  2PF4 E;  2X6A A;  3CXC U;  1AI4 A;  4YIO A;  1YIJ V;  4RO2 A;  2OCC C;  4MVU A;  1H2M A;  3HKB B;  3X2Q C;  5BR8 B;  1MMM A;  3L75 H;  2XAF A;  2DOS A;  5JH7 B;  2EIJ C;  4MVM A;  1AVM A;  5JJE B;  1YSC A;  2JIZ G;  1YCI A;  4FLY A;  4KUM A;  2XND G;  1RPO A;  2OCC B;  2CK3 G;  3APO A;  5KAI Z;  3X2Q B;  2Z5U A;  4DV5 B;  3E8F A;  2F93 B;  2ARH A;  3CRA A;  2ZNI A;  3SYO A;  2RNB A;  4JYB A;  1AJN A;  4DV7 O;  2EIJ B;  3BPZ A;  4JGS A;  1R3I C;  4X20 A;  2UXC O;  2ZR3 A;  3DXR B;  1YXB A;  5LGT A;  4ZOL A;  4XDL A;  3FAV A;  1KC8 W;  2Q5Z A;  2XAG A;  2JVD A;  1MZE A;  1LUW A;  2AW9 A;  1VF6 C;  4K8X A;  1AR5 A;  1SQQ H;  4LF6 O;  1N33 B;  2Y4T A;  2EIM C;  3A2F A;  3D3Q A;  4JTC B;  4PA6 A;  2A3Q A;  2UXB B;  1H2L A;  1NH2 B;  2ZIO A;  1IBK B;  1VQL V;  4LF4 B;  1YI2 V;  3H1K H;  4PI0 A;  5H2F Z;  4DUZ O;  1HNX B;  1IX9 A;  2NR5 A;  4UV9 A;  5JQG A;  1K5S A;  2LO1 A;  4D7S A;  3L74 H;  5CA0 B;  5JJJ B;  4YHH O;  4LF7 O;  5B5E Z;  2WLH A;  4DR5 O;  4YIP A;  5KX5 B;  2KQX A;  2EIM B;  4LWS B;  1K73 W;  4JI8 O;  5LA6 B;  5CA0 A;  5K1P A;  2JGD A;  2DWD C;  3GB7 C;  2HKO A;  1K4C C;  4QGP A;  2ITC C;  1VF6 A;  2H3O A;  1YJ9 V;  2UXD O;  2A0L A;  1QR8 A;  3JCZ A;  5KX5 A;  3C90 A;  1SQB H;  4LWS A;  4UCO A;  2N04 A;  2YID A;  4DR1 O;  5FLX N;  4QIW F;  1BL8 A;  3HKD B;  2CTP A;  1SZT A;  3SGI A;  5LHH A;  1B04 A;  3N27 A;  3K58 A;  4CC5 A;  1NVP B;  3JAS B;  3FYI B;  3UT5 B;  3M99 B;  1JR9 A;  4FMT A;  5BMV A;  4BR6 A;  3A0H Z;  5LMU O;  2HHH O;  5L3D A;  4G28 B;  3UT5 A;  2AHZ A;  4G2K A;  1P4R A;  4PDM A;  2PI5 A;  1XRE A;  5EIB C;  4KXR A;  1H2K A;  1F51 A;  3WU2 Z;  1OJH A;  2RDC A;  1OCO B;  2R72 A;  2GSM B;  2ODM A;  1M9N A;  5KLV H;  1PNL A;  2QWP B;  1BS3 A;  1N8R W;  4DR3 B;  1XNR O;  2B1I A;  3W7U A;  4GX2 A;  4N21 A;  4FM2 A;  4GT1 A;  5EK0 A;  5CBF A;  5KA6 A;  4P2Z A;  3CC2 V;  1EZV H;  3QF7 A;  2WLI A;  4CH4 A;  2ZE6 A;  1HNW O;  3NXS A;  4JI1 B;  1GMG A;  2Y4U A;  2EIK C;  4EFB A;  4I50 B;  4LNU A;  1WP8 A;  1IVS A;  3RYC B;  4FLX A;  1KQS U;  3CHX A;  3E8G A;  1SA0 A;  3N2K B;  3RVZ A;  1QBZ A;  2BSK A;  5KHK A;  3CCS V;  3N2K A;  1KP3 A;  4JI2 B;  1GM7 A;  3CEI A;  1HR0 B;  2XTA A;  3W7X A;  4F6E A;  1B6Q A;  4LFB B;  1IBM O;  2OIG A;  2OWO A;  2EIK B;  3F7Y C;  4C7U A;  1MSD A;  5LMN O;  5LXT B;  1DK1 A;  2WLN A;  2E76 B;  1OCR B;  4B7K A;  2JEX A;  5L3F A;  3CP1 A;  5DED A;  1H2G A;  4K0K O;  3OTO B;  2EJR A;  4LR3 A;  5FNV B;  3JYC A;  2ADQ B;  3R65 A;  2X0L A;  1PPJ H;  2ZCE A;  2CE4 A;  4NVP A;  5LXT A;  1BQZ A;  2ETN A;  2Q7E A;  4LCU C;  4BWA A;  1U97 A;  1IDS A;  4GLX A;  2IM9 A;  3KCY A;  4MVS A;  3TXS A;  2R70 A;  3ZIA G;  4JI7 B;  5FNV A;  3QG5 A;  2DQ3 A;  3I55 V;  2L35 A;  1VQ6 V;  3NR7 A;  4JZG A;  4KFM A;  4W4K A;  1Z5W A;  3ZRW B;  3ABU A;  4DV3 O;  4QE9 A;  2YI8 A;  1V54 C;  1O9G A;  3P3N A;  1ZL8 B;  3K9S A;  3QO7 A;  1I0H A;  1FPO A;  4YJ3 B;  3ZHS A;  3HB3 B;  1Q6H A;  2F1M A;  5B1A C;  4CBC A;  3FB5 C;  4JAA A;  2LFR A;  4DR6 B;  1YIT V;  3HKE B;  4DK0 A;  3VQW A;  3FD9 A;  2Y69 C;  1T5E A;  1G4Y B;  3F5W C;  4G27 B;  1V54 B;  5KHG A;  2WWW A;  4PD4 F;  5BR8 O;  3HKE A;  1QQC A;  4L8J A;  4UCR A;  3CRC A;  1NI8 A;  1NH2 D;  1NBM G;  3RYF B;  2F4V B;  5B1A B;  2EUL A;  2CTQ A;  1KP2 A;  1MOF A;  4I7Z B;  2GTA A;  1PL0 A;  4FM1 A;  5L3E A;  2Y69 B;  3RYF A;  3FX7 A;  4JI0 B;  2Q6A A;  4UCS A;  3SYC A;  4B3M B;  4F4L A;  4DV5 O;  1F4M A;  2ZD9 A;  3R66 A;  2K1E A;  4UFZ A;  2Q9L A;  2V1D A;  3B2E E;  2OT5 A;  2ZDI A;  4MVR A;  2WLL B;  2VQE B;  1US6 A;  3TCU A;  1IXM A;  1XDC A;  1Q8I A;  5CN0 A;  4DR2 B;  5EBM C;  3ABT A;  5LBQ A;  1H8E G;  3G4S V;  4NXM B;  1KUQ A;  5BZB A;  2B5U A;  2WLL A;  1RP3 B;  2QWN B;  5LYJ B;  3BFR A;  2NLJ C;  2ZNJ A;  3CSX A;  5CB4 B;  1N33 O;  2XAQ A;  2QM7 A;  2UXB O;  2AHY A;  1IBK O;  1TVK B;  4O4L A;  1J95 A;  1D5N A;  4JI6 B;  2F66 C;  3JD4 A;  4LF4 O;  2JDI G;  1AP6 A;  3SYA A;  1NVP D;  3LSU A;  3OD4 A;  4GKK B;  2M7W A;  3BAB A;  2YXY A;  1AR1 B;  5JCO A;  1HDJ A;  3O9O A;  1LUV A;  2B1G A;  3OT7 A;  1R3K C;  1FJG B;  4FLW A;  1GN4 A;  3Q4H A;  3LNN A;  1XI1 A;  4LP8 A;  4UCV A;  1L0L H;  4NTW A;  2ZM6 B;  2CTW A;  5LHI A;  4R8C A;  3VQX A;  3OW2 U;  4DV2 B;  2V4D A;  1PV0 A;  3AK3 A;  1W2B U;  3SDL A;  3CRM A;  2HR3 A;  5KAF Z;  1YF2 A;  3DTU B;  2Y0I A;  2XAJ A;  3CXH F;  4X1I B;  1VAR A;  4TOI A;  1S76 D;  5EBL C;  1QVF U;  1U96 A;  3JSN A;  1W59 A;  2GV9 A;  4LC1 A;  4ICG A;  2YIA A;  4IL6 Z;  4X1I A;  4MVZ A;  1FAF A;  3B4S A;  4FPP A;  5EIB D;  1RSO B;  2HVK C;  3AG4 C;  3CRQ A;  4WBN A;  3BA8 A;  3K5M A;  1AB3 A;  1NTZ H;  1V55 B;  2GTS A;  2ZKO A;  4GCZ A;  5LP6 C;  5JJN B;  1ZLZ A;  3A8T A;  1I94 B;  1E79 G;  1RSO A;  3JD1 A;  5AG2 A;  4YJ2 A;  3LDD A;  3APQ A;  4JAU A;  3ZMT A;  1Q82 W;  1HNZ B;  2L6L A;  1GK9 A;  3ABL C;  3IJ4 A;  3T1H B;  4JTA B;  2OTJ V;  4TV9 B;  1K97 A;  5EYP B;  4X1K A;  3K06 A;  4HAM A;  3AG4 B;  2R9I A;  2BOB C;  4DR3 O;  3BRC A;  4RUF A;  1V9P A;  5LP6 B;  2ADP A;  5CMU A;  1K9M W;  5IY5 B;  3WG7 C;  1WPB A;  1P84 F;  3IC9 A;  2DN9 A;  4JI4 B;  3ABL B;  4UUJ C;  1VF7 A;  2IH1 C;  2QWR B;  3O65 A;  1J5E B;  3H1H H;  4KL1 A;  2F43 G;  1XMQ B;  4JI1 O;  3ABK B;  4P9O A;  2HEP A;  1M90 W;  3FB7 C;  2DMX A;  2IU3 A;  2WA4 A;  4D7T A;  3RFR A;  5EBW C;  3WG7 B;  4PDV A;  1L8D A;  3L70 H;  4LFC B;  1HR0 O;  1G6U A;  4HYO A;  4CH6 A;  4LFB O;  1RM1 C;  4P30 A;  1SZX A;  2CH7 A;  5A9G A;  5LGU A;  5EZY A;  3D36 A;  1QHT A;  1S3J A;  3OTF A;  3IFX A;  4CS2 A;  5KHH A;  4NKG B;  2QR4 A;  3G67 A;  5IYC O;  2VS0 A;  4TSF G;  1P49 A;  1XQ8 A;  3L9D A;  5IYD O;  2YEV B;  4HBN A;  3DC5 A;  3OTO O;  4MVQ A;  4IT5 A;  4PEL A;  4Z1M G;  2C2A A;  4B3S B;  4IHJ A;  4E2L A;  2A7W A;  2ZIM A;  2YS8 A;  4NXN B;  1SS3 A;  1VQ9 V;  4LF9 B;  4DV6 B;  5C8Y B;  5LOV A;  2YEV A;  3WB0 A;  4EKW A;  1RM1 B;  3K5O A;  2VRZ A;  3SPG A;  4JI7 O;  1AP5 A;  2M6Y A;  1W0K G;  3CE2 A;  3T2M A;  3ETE A;  3ZN0 A;  4OGQ B;  4PDR A;  5C8Y A;  2QGN A;  2CGN A;  4X20 B;  1QNM A;  4R50 A;  4YXW G;  3ZHV A;  4U3F H;  4ZOL B;  3FAV B;  3I5D A;  3K0D A;  1IBL B;  1XEQ A;  1KKD A;  2LJ2 A;  1M57 C;  1XNQ B;  2Q73 A;  3ABM C;  2YXL A;  1TAE A;  3OAA G;  4DR6 O;  1GRJ A;  3SYQ A;  2IH3 C;  5JVD A;  3DC6 A;  4WF9 V;  4RUE A;  2QWQ B;  1MSW D;  4H44 B;  2KKW A;  4IGG A;  4PA9 A;  5IYZ A;  5JQG B;  1JOY A;  4X1Y A;  1ZWI C;  1BGY H;  1YEW A;  1N32 B;  1FFT B;  1PD3 A;  1ZX3 A;  1QCE A;  5ITZ B;  1M57 B;  1EZJ A;  2JS5 A;  4NYK A;  4GKJ B;  4Z2W A;  3OMI B;  2F4V O;  2JGD B;  5BXZ A;  3ABM B;  2UU9 B;  2VWK A;  3OR7 C;  5ITZ A;  2JJ2 G;  4JYA B;  2BOC C;  2FTK A;  1SQF A;  1M56 B;  3IAY A;  2DW4 A;  4JI0 O;  3W7W A;  4B3M O;  2D3O W;  3OMA B;  3EHB B;  1PNK A;  4CH3 A;  5FPR A;  3IC7 A;  3ZRV A;  2F23 A;  2ZQM A;  1K8A W;  2RCV A;  1N36 B;  2YC0 A;  4PDL A;  3J80 N;  4BW5 A;  1DTO A;  2VQE O;  2BCC H;  4K35 A; 
#chains in the Genus database with same CATH homology
 4O2B A;  5CB4 A;  2PZS A;  4GLX A;  5BMV B;  2IM9 A;  1JMK C;  1JFF A;  3E22 A;  1TGO A;  2R70 A;  4GYC B;  4O4J A;  4JI7 B;  5FNV A;  3QG5 A;  4IHJ B;  1TVK A;  1S5J A;  2YIB D;  4DR4 B;  4LF5 B;  1Z5W A;  5LOV B;  4CC6 A;  3ZS8 C;  2P22 C;  2YI8 A;  4I9Q A;  1Q5O A;  2PYL A;  1O9G A;  2RJZ A;  4FLT A;  4O4H A;  1XNR B;  4F6R A;  5J2T A;  1HW7 A;  3CB2 A;  4O2A A;  3T1Y B;  4YJ3 B;  1Z5V A;  2R9A A;  3HKC A;  4FLZ A;  2F1M A;  5CA1 A;  4FLV A;  1HNW B;  1Q43 A;  4DR6 B;  4FFB B;  3HKB A;  1KMI Z;  3HKE B;  4DK0 A;  3VQW A;  3SJB C;  1T5E A;  3JAK B;  2Q7G A;  4O4I B;  5JH7 A;  5KHG A;  2YIB A;  1KU9 A;  4FFB A;  5JVD B;  3HKE A;  1QQC A;  4L8J A;  4LH6 A;  4LNU B;  4UCR A;  1D5A A;  3THO A;  2YI9 A;  5IYZ B;  4X1Y B;  1SA0 B;  1M5I A;  3JSL A;  1DGS A;  4EEQ A;  3RYF B;  4UCT A;  4ZHQ A;  2F4V B;  2UUA B;  4AHC A;  3RWR D;  2BTQ B;  3UQ8 A;  1IBM B;  4FM1 A;  2UUB B;  4EB6 B;  2E5L B;  5LMN B;  3QTC A;  3RYF A;  4TQD A;  2PTM A;  3JAL B;  2Q7H A;  4JI0 B;  4UCS A;  4X66 B;  4DV4 B;  1TUB B;  2BTQ A;  4ZI7 A;  4B3M B;  4FLU A;  1XHX A;  2PY5 A;  4YY3 B;  4K0K B;  4UFZ A;  3VQV A;  4TV9 A;  3B2E E;  3JAL A;  5IJ9 B;  3RGB A;  5EYP A;  2VQE B;  1TUB A;  3N2G B;  2P5O A;  2QJ1 A;  1Q8I A;  4DR2 B;  4KHP B;  2RQ6 A;  4NXM B;  5IJ9 A;  5LP6 A;  3RYH B;  4U3J B;  3MAQ A;  4IIJ B;  3JAR B;  5LYJ B;  5CB4 B;  2ZNJ A;  3CSX A;  4JI3 B;  4DV3 B;  3E22 B;  1JFF B;  4O4J B;  4DV1 B;  2BTO A;  5KHJ A;  1TVK B;  4O4L A;  4BW9 A;  3BHP A;  4JI6 B;  2F66 C;  3K5L A;  3SR2 C;  4U3J A;  4AQY B;  3U11 A;  4IIJ A;  3JAR A;  4GKK B;  3BAB A;  5JCO A;  4O4H B;  4F6R B;  5J2T B;  1FJG B;  4O2A B;  5LA6 A;  4FLW A;  4TQF A;  2ZIN A;  4LH7 A;  3LNN A;  1XI1 A;  2UUC B;  4UCV A;  2ZM6 B;  3K57 A;  3HKC B;  3VQX A;  3RYI B;  4DV2 B;  5CA1 B;  5GON A;  2V4D A;  3HKB B;  5BR8 B;  4LF8 B;  4X1I B;  4TOI A;  4CH5 A;  3RYI A;  3HKD A;  5JH7 B;  3JSN A;  2PUS A;  4OX9 B;  2GV9 A;  2VWJ A;  2YIA A;  4I55 A;  5JJE B;  3ZED A;  3JAS A;  4X1I A;  1H2S B;  4AIL C;  2E3C A;  4FLY A;  5EIB D;  4ZHQ B;  5J2U A;  1I7F A;  2XHB A;  4WBN A;  3BA8 A;  3K5M A;  3U10 A;  5LP6 C;  5JJN B;  4DV5 B;  3JAW A;  2F93 B;  1FFX A;  1I94 B;  2ZNI A;  5KHI A;  1RSO A;  2CAZ C;  4YJ2 A;  4B08 A;  3ETQ A;  5D5P A;  4ZI7 B;  4LFA B;  1HNZ B;  3ICX A;  3BPZ A;  4EFE A;  1XHZ A;  3T1H B;  4X20 A;  4ZOL A;  4TV9 B;  3WB1 A;  4X62 B;  2JVD A;  5EYP B;  4X1K A;  1XMO B;  5JCO C;  4K8X A;  3U0Z A;  1M4U A;  1N33 B;  5IJ0 B;  3FFQ A;  3A2F A;  2UXB B;  3BRC A;  1V9P A;  3DSQ A;  2ZIO A;  4TV8 A;  2Q0A A;  1IBK B;  5LP6 B;  4JV5 B;  4LF4 B;  4TUY A;  4PI0 A;  1WPB A;  4DR7 B;  1X4T A;  5IJ0 A;  4I50 A;  4JI4 B;  1VF7 A;  1J5E B;  4O4L B;  1HNX B;  3RYC A;  4KL1 A;  5JQG A;  1WNS A;  1XMQ B;  4D7S A;  5CA0 B;  2HEP A;  5JJJ B;  4PI2 A;  4DK1 A;  5KX5 B;  4CS4 A;  4HNA A;  5LA6 B;  4D7T A;  3RFR A;  4DRX A;  5CA0 A;  5K1P A;  4I4T A;  2PGG A;  1WN7 A;  3K5N A;  1SQG A;  5KX5 A;  1L8D A;  5GON B;  4UCO A;  4LFC B;  1G6U A;  4CH6 A;  5EZY A;  3HKD B;  1QHT A;  3OTF A;  3SGI A;  4CS2 A;  1B04 A;  5KHH A;  3K58 A;  4CC5 A;  4I55 B;  3JAS B;  3UT5 B;  1P49 A;  1XQ8 A;  3JAT B;  4HBN A;  5BMV A;  5KMG B;  4B3S B;  4IHJ A;  5J2U B;  3SJA C;  4WBN B;  4DV7 B;  2ZIM A;  3UT5 A;  3BAA A;  4NXN B;  4LF9 B;  4DV6 B;  5C8Y B;  5LOV A;  3WB0 A;  3JAW B;  3JAT A;  2JGU A;  3K5O A;  5EIB C;  2EX3 A;  5KMG A;  1FFX B;  2UXC B;  4DV0 B;  4YJ2 B;  2OYQ A;  2R72 A;  3VQY A;  3SJC C;  4YJ3 A;  5C8Y A;  4LF6 B;  1NT2 B;  4X20 B;  3WB2 A;  5K1X A;  4DR3 B;  1JJO A;  4ZOL B;  1N34 B;  3PN1 A;  4X65 B;  4FM2 A;  4X1K B;  1IBL B;  4Q6G A;  4FVM A;  4B3T B;  1XNQ B;  4TV8 B;  4DUZ B;  3QF7 A;  4CH4 A;  3JAK A;  4O4I A;  2PYJ A;  2YXL A;  4TUY B;  1Q3E A;  1TAE A;  1ZAU A;  4JI1 B;  3BA9 A;  5JVD A;  4EFB A;  4YHH B;  4I50 B;  4LNU A;  4LF7 B;  3RYC B;  4DR5 B;  2KKW A;  5IYZ A;  5JQG B;  4FLX A;  4X1Y A;  3CHX A;  3N2K B;  1SA0 A;  4JI8 B;  5FPO A;  1YEW A;  1SKV A;  1N32 B;  4UCU A;  5ITZ B;  2UXD B;  5KHK A;  4EB6 A;  4JI5 B;  4HNA B;  1M93 A;  4K8Z A;  3N2K A;  4DRX B;  2JS5 A;  2F95 B;  4CS3 A;  3K59 A;  4GKJ B;  4B3R B;  4JI2 B;  1HR0 B;  4I4T B;  2UU9 B;  2VWK A;  4LFB B;  2QM4 A;  5ITZ A;  4DR1 B;  2OWO A;  4JYA B;  3M7M X;  1SQF A;  3IAY A;  4X64 B;  5D5Q A;  4DUY B;  1TA8 A;  5LXT B;  1O9H A;  4FM0 A;  4PHZ A;  5EZY B;  3N2G A;  4CH3 A;  5FPR A;  4O2B B;  3OTO B;  4LR3 A;  5IWA B;  4ZIB A;  5FNV B;  1N36 B;  5LMU B;  2HHH B;  2ZCE A;  4NVP A;  3RYH A;  5LXT A;  2Q7E A;  4BWA A;  2VQF B;  5LYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...