3SJCC

Crystal structure of s.cerevisiae get3 in the semi-open state in complex with get1 cytosolic domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
54
structure length
54
Chain Sequence
LSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
publication title Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 21
structure length 54
sequence length 54
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2011-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3sjcC00
1X4TA 1SKVA 3CSXA 2F66C 3ICXA 2CAZC 3SJAC 1NT2B 3THOA 3B2EE 2P22C 3SJBC 3SJCC 2JS5A 3ZS8C 3QG5A 3QF7A
chains in the Genus database with same CATH superfamily
4NYKA 1N34O 3QO8A 1ZLZA 2ZQMA 3F7VC 4E2LA 1X4TA 3KCXA 3CCEV 3J81N 1KKDA 4AILC 5B1BC 1MG1A 1THZA 4JTDB 5CMUA 1NQTA 4D7SA 1IBMB 4U3JB 1SZTA 1GRJA 5LHIA 3ETDA 2PZSA 2UUBO 3H1IH 2ZM6O 4YHHB 1OJHA 1VQ5V 2QR4A 2BTOA 1Y67A 5LL6Y 2E5LO 2EINC 1PNKA 2ZDIA 1VQMV 2EBOA 4JYCA 1M9NA 1JQ0A 3N2KA 4U3FH 2Q67A 1F23A 1BSMA 1Q43A 5H2FZ 3UM7A 1YITV 4JI7B 4FMTA 2NLJC 2WA4A 4FLVA 3OMAB 2WWWA 1Q82W 2PUSA 1VQ7V 1V55C 2F43G 1H2GA 2EJ7A 2Y48A 1SQFA 1EFRG 5CA3A 4DV2B 4WCEV 3IAYA 1LR1A 4X1KB 3SYOA 3B8NA 1AI6A 2ITDC 4F4LA 1YCIA 5HFLA 3ASOB 3CCMV 2ZE6A 2G38A 3CE2A 1PL4A 4JTCB 1LNQA 1AJQA 3JSNA 4UCRA 5J2TA 1JPXA 3OTFA 2PI5A 1SQPH 1COWG 3HKCB 2ZKOA 3LDDA 3EXAA 2XUMA 2ZE5A 3QO5A 3N27A 3FB5C 2GBOA 3MHSC 3TXQA 2DYSC 3M99B 4Q20A 3JARA 1YJNV 3ZN1A 4O4JA 4MVUA 4TUYB 3ABMB 1H2NA 1QQCA 4DV3B 1JOYA 3ETGA 2ARHA 5EYPB 1VF6A 3AG1B 2FKXA 4XBFA 4H0LB 1IXBA 3WG7C 1VARA 4CC5A 1NT2B 4FK5C 4K8ZA 1Q7YW 1FD9A 4JI6B 2X6AA 4A5UB 4LH6A 2CGNA 2FMLA 1VF6C 4YY3O 1ENVA 5JCOC 3RWRD 2GV9A 1GN6A 3W7SA 2JS3A 1UJWB 1NBMG 2JJ2G 5L3CA 2Q0AA 1YI2V 4BAYA 4FLXA 4JYAB 1EM1A 4UV8A 1D2DA 4O2BA 4CS3A 3H9VA 1FKAO 3X2QC 3CCJV 4TV9A 1Q6IA 4H44B 5LA6A 2Q69A 1G4YB 4TV8A 3OUFA 5IY5B 1QNMA 4NXMB 1QR8A 2IU3A 2WLLA 1YVWA 1NR1A 1NJIW 5ITZB 3VQVA 4PD4F 1IBMO 2FYUH 3RYIB 4MTGA 5B1NA 3RW0A 3B09A 1MABG 1TUBA 2VWKA 4YHHO 1M5IA 4MTOA 3W7UA 1NKDA 1XEQA 1R6TA 2A9HA 1SA0A 3APQA 3GWKC 3L74H 4IHJA 1M56B 2N74A 4FFBA 4JI7O 1AB3A 1ZAUA 3ASNC 4HNAB 1VIBA 1QVGU 2IW5A 4B08A 4JPRA 4DUZB 1Y76A 2WAMA 3DC5A 2DMXA 1S77D 1SQQH 1OCCB 3HR0A 1F4NA 4G2KA 2Q73A 1R3LC 1XREA 2DQ3A 3J80N 4CH3A 4TOIA 4LF4B 3ABLC 4DV2O 4CC6A 1B04A 1OCOB 4L87A 4UB8Z 1N36O 4BIUA 1P84F 2CE4A 3VQXA 1RM1C 4P9OA 4H33A 4I55B 1EBOA 5LHGA 3R65A 4JGSA 3R66A 1AP5A 1K4CC 4LWSA 1RFYA 4DK1A 5LGNA 2XAJA 1GN4A 1TUEB 4J80A 1ZX3A 2BSKB 1FXVA 4DO2A 2XAHA 1VF5B 1U97A 1ZTEA 3TGUH 4I0XA 3C90A 2PF4E 2ADPA 2YXYA 4WFBV 4JYBA 1FAFA 1VQ4V 5HFMA 4DV3O 4PA9A 4EB6A 2Q9LA 1ZSPA 4JYYA 1R73A 1EZJA 4KUMA 2CAZC 3CPWU 2WLHA 4UCUA 3OEEG 5C8YB 4QPKA 5JQGB 1N0NA 3MHHC 1O9GA 4FVMA 4UV9A 4PDVA 4PA6A 4MTFA 4JI6O 4FLWA 2IJJA 1RSOB 3ZBHA 2GHYA 2W6JG 5CBFA 3IJ4A 3UO2A 2D3OW 5LXTB 3QG5A 4JYAO 4DV5B 1I5YA 1WPXA 5FPRA 3BAAA 2QSAA 2R70A 5D5QA 4LF5B 2XAQA 1ZWIC 3AG2C 5LYJB 2DWDC 2ZNJA 3S3XA 4RO2A 4F6RA 1IVSA 1Q5OA 5LBQA 4I9QA 4NXMO 4KP4A 4BIZA 2UUCB 3N2GA 1M57C 1P7GA 3OGIB 2YIBA 4MVOA 1Y4MA 3SGIA 3WB1A 4XDJA 2OIEA 5IJ9B 5CA1A 4PV1B 2EIMC 4WBNB 5LGTA 2DWEC 3CCSV 4DR3B 3TK1A 5BMVA 1VMGA 2Z5UA 2IH1C 2ZXWB 2ETNA 3E8BA 5EIBC 4ZBMA 4DR4B 2E74B 3F7YC 3SJCC 1MSDA 1PNLA 4DUZO 1N4CA 1H2KA 5KMGB 5KLVH 3OR6C 2ZCEA 1TVKB 3BVOA 2UXCB 1CP9A 1KKCA 1TA8A 4LF4O 3STZC 4CH6A 3LNMB 2WLKA 1SRYA 1GM7A 2EULA 3H1KH 1RPOA 2GUZB 3UQ8A 4IIJA 5KX5A 3B2EE 4X20B 1M1KW 4QE9A 3T1YB 2ZE7A 3ABKC 4U7NA 4B3RB 3RYFA 2K1EA 3OE7G 2L35A 2OYQA 2E3CA 4X9QA 3TXSA 2HJDA 2DYRC 4O4IA 1RPRA 4OXSA 3CX5F 3FD9A 3JAWB 4XDKA 1V54C 4W4KA 5L3DA 2EIKB 2A06H 1G6UA 2YI8A 4GYCB 1Q8IA 2ATKC 5EC1C 1YDXA 1QLNA 2BTQB 1SF9A 2LGWA 2AZ0A 3L75H 2CTQA 5KA5A 2WLIA 2EILB 1EN6A 5B1OA 3TCUA 2PI4A 1AJNA 4DV5O 4NTXA 3K59A 1HW7A 1KYOF 1Z5VA 4B3SB 4LF5O 2RN9A 2WLMA 4ZHQA 5KHKA 4X64B 4BW9A 4DR7B 1N33B 2DOSA 5IWAB 4I5SA 1MZEA 4IYIA 1Q6UA 1NVPB 4JV5B 2F66C 4KFMA 3JAMN 1CPYA 1GM9A 3JD1A 5IJ0B 4GX1A 2Z0AA 4I4TB 3U0ZA 4PA7A 2UUCO 3CEIA 3M8AA 4GZRB 4LF8B 1JFFA 1PV0A 1GTOA 1TGOA 5J2UA 4ZI7B 4GX5A 1VQLV 5BZBA 4GLXA 3CD6V 4DR3O 4JI4B 1SQGA 3FAVA 3SYPA 1MMMA 2RMKB 4LFAB 3J7AU 4I9WA 1Y66A 2P67A 1HNWB 4DR4O 1AR5A 5A2QN 4MT8A 2O57A 1NTMH 5C93A 4H37A 3STLC 2BOCC 3ABUA 3HKEB 3ASOC 2UXCO 3JAKA 1ZL8B 5KA6A 2F95B 1HNXB 4X1IB 3RYCA 1QVFU 3ZMVA 1BE3H 3BA9A 4RUFA 4DRXB 3ZRWA 2Y4TA 3DGEA 5JVDB 2CH7A 2ODMA 2LFSA 1NTZH 1N32B 2QM4A 2F23A 4PELA 4Z1MG 4WFGA 2CGOA 4J9YB 3T1YO 1G8MA 2HVKC 4B3RO 1K92A 3ABMC 1V9PA 4P30A 2FB5A 1WB8A 5JJJB 2ZNIA 4OPHA 1P7BA 4FIPC 3CCVV 4RAIA 1DTOA 1H8HG 2JEXA 4LBEC 2WLNA 5LOVB 4LNUB 2M6YA 2NR5A 2V1DA 2OWOA 1SC5B 3CMEV 1PD3A 3FKSG 3HB3B 1RP3B 4UFZA 2A7WA 1YHQV 2HVJC 2QM7A 1JX9A 3H1HH 3CWBH 5B66Z 2BE3A 4G27B 3L72H 3P3PA 1FJGB 2Q68A 4ASUG 2YEVA 5JH7B 2NN4A 2ZIMA 2L6LA 2QM8A 1YJ9V 4FLZA 1CXZB 2JGDA 5FPOA 1FFXB 3ML0A 4N23A 2QA4V 1WP7A 5IY5C 2R9IA 2PGGA 1HR0B 3JYCA 1KMIZ 4B3SO 4HYOA 4X64O 5KAIZ 2YIAA 2CTRA 2YXLA 1N33O 4QGPA 5CB4A 5IWAO 3CB2A 2YSUB 4JV5O 4HZ3A 4J42A 3CJHB 3ZMTA 3FX7A 2P6JA 2P7TC 4F6EA 4MSWC 3JASA 4MW3A 5CA0B 1M56C 1PPJH 4LF8O 3T2MA 3DXRA 4UVAA 2UXBB 4JF3A 1PM9A 5IYBO 4NVPA 4JI5B 1FXHA 3I5DA 2PTMA 3JD3A 1K97A 2QJ1A 3M7MX 4MVSA 5FLXN 3QVNA 1OCCC 4WFEA 1XBLA 2JGUA 5JCOA 5GONB 3C3SA 2PYLA 3F5WC 4JZ2A 1GAXA 4JI4O 3RYHA 4LFAO 3BA8A 1HNWO 1AI4A 3FB7C 2OCHA 2JVDA 2VS0A 2AXTZ 1OCOC 4PDMA 3JD2A 1W0KG 1HNXO 1OCRB 1XNQB 4JI1B 2MK3A 3CXCU 2VRZA 1XL4A 3SPGA 5FL7G 2KG7B 2Y4UA 1X59A 2JEUA 2P22C 1YTFB 1N32O 3K0GA 3HKDB 1Q3EA 5JQGA 1BHBA 3N2KB 1VQ8V 5B3SB 1F7YA 1FXKB 2EZPA 4QPJA 2XOKG 2BOBC 1PP9H 2R9RB 2CTWA 2F93B 2QTOA 4UUJC 4B3MB 5F2VO 1P49A 4O4HA 3CC2V 3CCLV 1JJOA 4H13B 3OMIB 4UCTA 3H01A 4X8AA 4B7EA 2XNDG 4MVMA 1URFA 4UXNA 3KG2A 4PA4A 3G67A 5EBMC 1KU9A 3ZRXA 2IH3C 3E83A 3B77A 4UCSA 4AQYB 2E76B 2HP8A 1S72V 2XTAA 3CRMA 5DN6G 4WF9V 3IC7A 1A32A 1H8EG 3OM3B 5KUKA 1BMFG 4GUNA 4YJ3A 1ORQC 1FJGO 3CSXA 3HKBA 1WA8A 4MVZA 1BHAA 4DV0B 4DR6B 2YIBD 3CC7V 2W0FC 3O65A 3JATA 4FPPA 4LR3A 2IM9A 1WNSA 4I50A 1HR0O 3PJSK 3WG7B 4N21A 2UXXA 1W0JG 2ITCC 2YXHA 1AVMA 4O4JB 1MA1A 4DR1B 1NVPD 1SQXH 3ZIAG 4U7OA 4GX0A 1SESA 2ILMA 3ZHVA 2FL4A 5DECA 2RCVA 3JCUZ 2GSMB 5KHGA 2HEPA 4KHPB 2YIDA 2GTAA 1AI7A 1K5QA 2KB1A 5H6QA 5GTHZ 1TVKA 5EC2C 1XQ8A 2NNUA 3P30A 1J5EB 2VWJA 2UXBO 1Q6HA 3K08A 4YJ2A 3P3NA 4RWUA 2B9ZA 4JI5O 3PN1A 3AG4B 3CRRA 1Z5WA 1IZ3A 1F4MA 5KHHA 4DK0A 2GUZA 3UT5A 3SYQA 1BQZA 4O2BB 2GTSA 4O4LA 1VQ9V 4QE7A 1GN3A 4TV9B 3CXHF 4LCUC 5LA6B 3SPJA 3ZRSA 4CS2A 5E79Z 2HHHB 3D3QA 1AJPA 1K73W 1S5HC 2DE0X 3DC6A 3H1JH 5GTIZ 1UFIA 1XNQO 2WLLB 2YUAA 4JI1O 1HNZB 3ZX6A 2OTJV 1AR4A 3QNEA 1BCCH 3RGBA 3S3WA 3LSQA 2EJRA 1TUBB 5IYZA 4YXWG 1SS3A 5B1AB 4Q6GA 1SA0B 2XHBA 4YIOA 2KSDA 1FS0G 3L9DA 4D7TA 4FJCC 4IHJB 1YJWV 4FFBB 3QF7A 4J11A 2JIZG 3E2EA 2EIKC 3JALA 3G80A 5LP6B 3CCUV 2B1IA 3VQWA 1YZBA 1Y76B 3ABTA 3SYCA 5GW7A 2MW2B 4IL6Z 2QWOB 3D36C 3IGAC 4B3MO 1SQVH 4GCZA 3LDCA 3SR2C 1K8AW 1I5XA 2IJKA 3EVKA 4ZIBA 2OCCB 1EN5A 1R3KC 4UVCA 1Z2GA 5EZYA 4LFBB 3MAQA 3KKYA 2FTKA 4AQYO 4QNHB 3AEIA 3T1HB 2LP7A 3Q4HA 3IC9A 1XI1A 3DSQA 2P5OA 2WLJA 4GT1A 4LWSB 4BW5A 1VQPV 2N05A 4P9PA 3THOA 1WB7A 3K57A 1BL8A 1S0VA 3B4SA 4DV0O 4E4EA 3VQYA 1GH6A 4L8JA 4DR6O 5JWPA 2HR3A 1SKVA 4K3AA 4K35A 2DQ0A 3E86A 3FYEB 4I0XB 4FM2A 4CBCA 4I7ZB 4PHZA 1QCEA 4DR1O 2H3OA 2E75B 4EB6B 2ZR2A 4GKKB 4NKGB 1OCZB 2DW4A 4DR2B 2ZIOA 2LQTA 2RJZA 3CHXA 4IYHA 4B7KA 4ZOLA 1YF2A 2Q0OC 1W2BU 4KHPO 3CRAA 3K5MA 1J5EO 5LMNB 1IXMA 1ZL8A 2Z3YA 1VQOV 1NH2D 3K06A 3AK1A 4FM1A 3AG2B 3TETA 4DRXA 3E8HA 2VQFB 3E35A 4GKJB 2EIJB 2RNBA 2YC0A 3WB0A 4X65B 3B8MA 1BT8A 1NR7A 4DR5B 4LC1A 2HHHO 1XMOB 4F6RB 4U3JA 3L70H 2EIMB 4JAVA 4TWKA 4EKWA 2ZT9B 1UPGA 4JZGA 4MW8A 3N2GB 3BFRA 1HNZO 1GMGA 1I08A 3OTOB 1QHTA 1QLEB 1YTFD 5KHJA 3SJAC 5CA1B 3CRCA 1M93A 1AR1B 5A9GA 1N0JA 3E22B 3CS5A 1BGYH 4CH4A 1JA8A 3OT7A 5BXZA 1DLBA 1QR9A 2H8PC 4EFEA 3BY6A 5DM6V 3ZHRA 5AG2A 3D8CA 3U11A 2OTLV 3SYAA 1HP8A 1FFTB 2Q6AA 1R3JC 4X1KA 2Q5ZA 4X62B 1L1FA 1MZFA 1NTKH 3OR7C 2KQXA 2X7RB 2LO1A 2HG5C 4LFBO 2QE7G 2WA3A 2LGQA 1N8RW 5KX5B 3GWOA 4NTWA 3T1HO 5IT9N 2ZE8A 3BABA 2N04A 3HKCA 4WFHA 3O9OA 2LJ2A 1EZVH 2Q7HA 1V54B 3OAAG 1XUQA 5J9PC 4JASA 1R3IC 2RDCA 1AILA 4TUYA 3K5LA 2Y69B 4LH7A 1Y74B 2RQ6A 5EYPA 3ZMSA 4DXWA 2JRIA 3ZHQA 1IX9A 1FPOA 3CCRV 5KAFZ 4MS2A 2YS8A 4X1YB 5BY1A 4GKKO 5DEDA 2LFRA 3TJTA 1K33A 1R1BA 4DR2O 3RVYA 2R9AA 3D3IA 5JJNB 3AG1C 3RVZA 1Y6XA 4LF6B 1S76D 3E8FA 2LW7A 3AK2A 1B06A 5LMNO 5D5PA 3OEHG 1JR9A 4FM0A 2WLIB 1L0LH 3ZJZA 5TISZ 3BRCA 1L0NH 4PJ0Z 4BWAA 2Q8VA 2VQFO 3ZN0A 1XILA 2KG7A 2W0XA 2A79B 3DTUB 4GKJO 1XNRB 4ABMA 3K5NA 3A0RA 4QJFB 1OCRC 5LMUB 4MTXA 1FYJA 4D6TH 4ZHQB 4X65O 3HKDA 3ZRVA 1IBKB 5IDJA 4DR5O 5FNVB 1FXKA 5ITZA 4R50A 3BCCH 1XMOO 2DJVA 2PYJA 3RYIA 1D5AA 2ZDIC 2HFEC 3AG3B 1F51A 2BCCH 1T5EA 3JCZA 4DUYB 5B3SC 1JFFB 3BPZA 4K0KB 3OTOO 1FXKC 4J7JA 5J2UB 3VOUA 1S3JA 2D2CB 4TSFG 1XOUA 1P4RA 4DR7O 3A8TA 4X66B 4HNAA 1N36B 3CRQA 3JD4A 4JI2B 2B5UA 1K4DC 3OUSA 4WFAV 5JJEB 1DF4A 2JK5C 2QKAA 4CH5A 2QDOA 3FAVB 4TT3G 1BS3A 2HKOA 2AHYA 2IJHA 4MVQA 2P06A 4FLTA 2HLDG 4O2AB 5CBHA 1SETA 1NH2B 3H1LH 1EN4A 4PI0A 3JAKB 4X62O 4J41A 1G1XB 4DW1A 3RYCB 2QGNA 1OZ0A 1QBZA 2XAFA 3NXSA 4I55A 3ZRWB 1XMQB 3ZS8C 2P4KA 3JD0A 5B1BB 1E79G 2CH7B 3FB8C 5KUMA 5K1XA 3WFVA 3K79A 3CC4V 2ZR3A 1H2MA 3OFNG 2R72A 4C7UA 2BSKA 1IDSA 4LFCB 2EINB 2JDIG 4Z1VA 3K3WA 3SPIA 4X89A 4CZZA 2AGAA 1OHHG 5L3EA 1KP3A 3ETEA 4X88A 3FFQA 2YICA 1GKFA 3E89A 4OGQB 1DF5A 3P32A 2OT5A 5C8YA 2UUAB 3OMNB 1I7FA 2C2AA 2H94A 1V55B 4OX9B 4FFKA 4R6ZA 1PL0A 4CS4A 3G6EV 3UKMA 2JS5A 3WB2A 3AG4C 1MOFA 4JI8B 3OGCC 1RSOA 3BHPA 1YXBA 3BEHA 3L73H 4LF6O 1HWYA 4NB5A 2AW9A 1GO3F 2YI9A 4TQDA 5LXTA 3SPHA 2UU9B 2YEVB 1KB9F 4JAAA 4UB6Z 3SJBC 4W4LA 1K9MW 2JGDB 4LF9B 4NXNB 5EBLC 5LYJA 4UVBA 5E1AC 4HBNA 1XNRO 1Q81W 4BR6A 3K9SA 5LMUO 3AG7A 1ZUQA 3A0BZ 3K04A 3K58A 2CUGA 1GM8A 2IU0A 2DYSB 3KCYA 4JI0B 5CB4B 2VQEB 4LF7B 1IBKO 3WU2Z 5KHIA 5J2TB 4DV4B 5LP6A 4DV1B 1K3EA 2JJ1G 5B1AC 1SERA 1MNGA 2A0LA 3NR7A 2KKWA 3I56V 1R6NA 3E8GA 5CN0A 5IJ9A 4DV6B 3JASB 1ROPA 3ZHTA 1Q90D 4WBNA 3DXRB 5EIBD 3JARB 4DUYO 1H2LA 1WP8A 4K0KO 3ZHUA 1E1QG 5LP6C 3A2FA 2ZD9A 5H6RA 1VP7A 2QWRB 4X66O 1KBHA 1K5SA 4JI2O 1DGSA 3KZIZ 2WPDG 2Q7GA 2X6BA 5KMGA 3ZEDA 3UCSC 1WPBA 4LP8A 3RYHB 4J10A 2OCCC 1H38A 1J95A 3FB6C 2M7WA 1B6QA 2QKSA 2V7QG 2ZXWC 1SQBH 3X2QB 1S5JA 1H2SB 4PI2A 2QTSA 1GN2A 4FZ1A 5H5NA 4PDLA 3OW2U 3G71V 2IJIA 4DV7B 1KC8W 1M90W 4UCVA 1XMQO 3G4SV 4JTAB 4X20A 3C3TA 4J7KA 4HAMA 4J9ZB 2LW1A 3T1CA 1NU1H 3SDLA 4TV8B 4GX2A 3ETQA 1PKXA 4EEQA 4JAUA 3ZHSA 4LFCO 2AHZA 4B3TB 2K9PA 1YSCA 2F1MA 3QTCA 4IT5A 1U96A 2F4VB 5LHHA 4WFFA 3JAWA 3VBBA 2UXDB 2Q4PA 1OCZC 3ASNB 3QO7A 1XL6A 4O4HB 2QWPB 3K0DA 1BQ0A 1KECA 3UO3A 3ICXA 3SJQC 4ZKIA 3D36A 2UUAO 1JJ2U 2UXNA 4R8CA 4FLUA 1VQKV 2BTQA 4OX9O 4AI8A 1E1RG 3LUTB 4KL1A 3ABLB 2EX3A 2PY5A 1WN7A 4JI8O 4JI3B 1DK1A 1TAEA 2EIJC 1KQSU 3SPCA 1RM1B 1VQ6V 4YJ3B 2X6CA 4MVRA 3GB7C 2QWNB 4DW0A 2UU9O 3HKBB 1MSWD 2XT9A 2Y0IA 1WA8B 1AROP 3FYIB 1YEWA 3RN4A 3T4ZA 3K9AA 2EILC 4LF9O 2P4VA 3W7WA 4NXNO 3JATB 4NR1A 4I50B 1M4UA 4OPAA 4ICGA 4PDRA 2XAGA 3E22A 1BZKA 1VF7A 5IJ0A 1IBLB 4JI0O 2VQEO 4I4TA 4PA3A 4LF7O 1QLEC 1US6A 1D5NA 3ZMUA 4DV4O 4DV1O 2X0LA 5EBWC 2HJFC 4ZI7A 3I55V 4DV6O 3EHBB 5IE9A 5BR8B 1I94B 1I0HA 1K34A 4YJ2B 1VEWA 1NI8A 3K5OA 5IYDO 2A3QA 1N34B 1W59A 4UCOA 3UT5B 5EK0A 1L8DA 3CYOA 4R7CA 3LSSA 4P2ZA 4O4LB 3HKEA 5L3GA 2B1GA 1LUVA 2IBZH 4X1IA 4G28B 1K7DA 4AHCA 2QEXV 3CP1A 2W6IG 2ADQB 2UUBB 5JVDA 2ZM6B 3K03A 3G6BA 4DV7O 1O9HA 1WJZA 2YDEA 1JMKC 2E5LB 1Y74A 1R6KA 3CCQV 3AK3A 1JVMA 5LGUA 1M57B 2DN9A 3B40A 5IYZB 4X1YA 1KP2A 3CMAV 1CEZA 5L3BA 3IFXA 2Y69C 5H9CA 4RUEA 1YIJV 4YIPA 1AI5A 3A0HZ 4B3TO 3JALB 1XHXA 1JCHA 2V4DA 3RFRA 2F4VO 2UXDO 2XASA 1HDJA 5LOVA 4LNUA 1VQNV 3F5TA 4DYLA 1WLEA 2EZOA 1GK9A 5B5EZ 5BMVB 1AP6A 5EZYB 4XDLA 1XHZA 2QKCA 4J7ZA 4BIOA 3ZMZA 4EFBA 4JI3O 3Q4HB 1KD1W 2ZINA 5FNVA 5JH7A 2OIGA 3LDEA 2P90A 2CK3G 4QIWF 1FFXA 3LSUA 4FZ0A 3ABKB 4Z2WA 1OV9A 3RBZA 2CDYA 4IIJB 3MD0A 4IGGA 3APOA 3LNNA 1NS1A 3W7TA 2CTPA 1PNMA 2WSSG 2Y0PA 1Q86W 1IURA 3ZCCA 1LUWA 3AG3C 1KUQA 2DYRB 3CJHA 3JSLA 1IBLO 1NZ6A 4FLYA 5CA0A 3RT3C 3RYFB 3MDSA 4KXRA 1XDCA 4ZOLB 3EFFK 4TQFA 4YY3B 4NTYA 5IYCO 5K1PA 5L3FA 4RQEA 1WAZA 4O2AA 5CBGA 4RQFA 2AZ2A 4O4IB 4K8XA 1B3QA 3GVMA 1QU7A 1S5LZ 3HPLC 3W7XA 2QWQB 3T4DA 5BR8O 1I94O 3U10A 3L71H 3OD4A 5GONA 2GDSA 2Q7EA 1SZXA
chains in the Genus database with same CATH topology
3UT5A 2OYQA 2E3CA 4O2BB 4O4IA 4O4LA 4TV9B 3JAWB 5LA6B 1X4TA 3FFQA 4CS2A 2HHHB 4AILC 1G6UA 2YI8A 4GYCB 5C8YA 2UUAB 1Q8IA 1I7FA 4D7SA 4OX9B 1IBMB 4U3JB 2PZSA 4CS4A 1HNZB 2BTQB 2JS5A 3WB2A 4YHHB 4JI8B 1RSOA 3BHPA 3RGBA 2BTOA 1TUBB 5IYZA 4Q6GA 1SA0B 2XHBA 2YI9A 4TQDA 3N2KA 4JI7B 1Q43A 5LXTA 2UU9B 4D7TA 4IHJB 3SJBC 4FFBB 4FLVA 3QF7A 4LF9B 3K59A 3JALA 5LP6B 4NXNB 1HW7A 5LYJA 2PUSA 1Z5VA 3VQWA 4B3SB 4HBNA 4ZHQA 5KHKA 4X64B 4BW9A 4DR7B 1N33B 1SQFA 5IWAB 4DV2B 3K58A 3SR2C 4JV5B 3IAYA 4ZIBA 4JI0B 5CB4B 2F66C 2VQEB 4LF7B 4X1KB 5EZYA 5IJ0B 5KHIA 5J2TB 4DV4B 4LFBB 5LP6A 4DV1B 4I4TB 3U0ZA 3MAQA 2KKWA 4LF8B 5IJ9A 4DV6B 3JASB 1JFFA 1TGOA 5J2UA 4WBNA 4ZI7B 3T1HB 1XI1A 5EIBD 3JARB 3DSQA 2P5OA 5LP6C 3A2FA 4GLXA 3JSNA 4UCRA 5J2TA 3OTFA 3THOA 3HKCB 3K57A 4JI4B 1SQGA 1DGSA 3VQYA 4LFAB 2Q7GA 4L8JA 1HNWB 5KMGA 3ZEDA 1WPBA 3RYHB 1SKVA 3JARA 4O4JA 4FM2A 4TUYB 3HKEB 4DV3B 1QQCA 5EYPB 1S5JA 3JAKA 4PHZA 1H2SB 4PI2A 2F95B 1HNXB 4EB6B 4X1IB 3RYCA 4GKKB 3BA9A 4CC5A 4DRXB 4DR2B 2ZIOA 1NT2B 2RJZA 3CHXA 4K8ZA 4ZOLA 4DV7B 5JVDB 4JI6B 4UCVA 4LH6A 4X20A 3K5MA 1N32B 5LMNB 2QM4A 5JCOC 3RWRD 2GV9A 4FM1A 4TV8B 2Q0AA 4DRXA 4FLXA 3ETQA 4JYAB 4EEQA 2VQFB 4O2BA 4GKJB 4CS3A 4B3TB 1V9PA 2F1MA 4TV9A 3QTCA 2F4VB 5JJJB 2ZNIA 3JAWA 5LA6A 3WB0A 4X65B 2UXDB 4TV8A 4O4HB 4DR5B 5LOVB 4LNUB 4NXMB 3ICXA 1XMOB 4F6RB 4U3JA 2OWOA 5ITZB 4FLUA 2BTQA 3VQVA 4UFZA 3N2GB 3RYIB 4KL1A 2EX3A 1TUBA 2PY5A 1WN7A 2VWKA 3OTOB 1M5IA 1QHTA 4JI3B 1SA0A 5KHJA 3SJAC 5CA1B 1TAEA 1M93A 1FJGB 4IHJA 4YJ3B 5JH7B 2ZIMA 4FFBA 3E22B 3HKBB 1ZAUA 4FLZA 4HNAB 4CH4A 4B08A 5FPOA 1FFXB 1YEWA 4DUZB 2PGGA 4EFEA 1HR0B 3JATB 1KMIZ 3U11A 4I50B 1M4UA 2YIAA 2YXLA 4CH3A 4TOIA 4LF4B 5CB4A 3E22A 4X1KA 3CB2A 4X62B 1VF7A 5IJ0A 1IBLB 4CC6A 4I4TA 1B04A 3VQXA 3JASA 5CA0B 4I55B 4ZI7A 2UXBB 5KX5B 4NVPA 4JI5B 5BR8B 1I94B 2PTMA 3BABA 4YJ2B 2QJ1A 3HKCA 3K5OA 3M7MX 4DK1A 2JGUA 5JCOA 1N34B 2Q7HA 5GONB 2PYLA 4UCOA 3RYHA 3UT5B 3BA8A 1L8DA 2JVDA 4TUYA 4O4LB 3HKEA 3K5LA 4LH7A 2RQ6A 5EYPA 4EB6A 4X1IA 2CAZC 4X1YB 4AHCA 4UCUA 5C8YB 1XNQB 5JQGB 2UUBB 4JI1B 1O9GA 5JVDA 4FVMA 2ZM6B 2R9AA 1O9HA 5JJNB 1JMKC 2E5LB 4LF6B 2P22C 4FLWA 5D5PA 5IYZB 4X1YA 4FM0A 3HKDB 1Q3EA 5JQGA 3N2KB 3BRCA 5LXTB 3QG5A 4DV5B 4BWAA 5FPRA 3BAAA 2R70A 5D5QA 4LF5B 1XNRB 3JALB 3K5NA 1XHXA 3RFRA 2V4DA 5LYJB 2F93B 5LMUB 4B3MB 1P49A 4ZHQB 2ZNJA 4O4HA 1JJOA 3HKDA 4UCTA 5LOVA 4LNUA 4F6RA 1IBKB 5FNVB 1Q5OA 4I9QA 5ITZA 2UUCB 5BMVB 2PYJA 3N2GA 3RYIA 1KU9A 2YIBA 5EZYB 1D5AA 1XHZA 4UCSA 3SGIA 3WB1A 4AQYB 1T5EA 4DUYB 5IJ9B 5CA1A 1JFFB 3BPZA 4K0KB 4EFBA 5J2UB 4WBNB 4YJ3A 2ZINA 5FNVA 5JH7A 4DR3B 3CSXA 3HKBA 5BMVA 4X66B 4HNAA 1N36B 4JI2B 4DV0B 1FFXA 5JJEB 5EIBC 4DR4B 4CH5A 4DR6B 2YIBD 3SJCC 3JATA 4LR3A 5KMGB 2IM9A 1WNSA 2ZCEA 4I50A 1TVKB 4IIJB 3LNNA 2UXCB 4O4JB 4FLTA 4O2AB 4DR1B 1TA8A 4PI0A 3JAKB 4CH6A 3JSLA 3RYCB 4FLYA 5CA0A 5KHGA 2HEPA 4I55A 3RYFB 1XMQB 3ZS8C 4KHPB 1TVKA 4ZOLB 4TQFA 1XQ8A 3UQ8A 4IIJA 4YY3B 1J5EB 5KX5A 2VWJA 3B2EE 5K1PA 4O2AA 4O4IB 4X20B 4K8XA 5K1XA 4YJ2A 2R72A 3T1YB 3U10A 3PN1A 1Z5WA 5GONA 2Q7EA 4B3RB 5KHHA 4DK0A 4LFCB 3RYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4T A;  1SKV A;  3CSX A;  2F66 C;  3ICX A;  2CAZ C;  3SJA C;  1NT2 B;  3THO A;  3B2E E;  2P22 C;  3SJB C;  3SJC C;  2JS5 A;  3ZS8 C;  3QG5 A;  3QF7 A; 
#chains in the Genus database with same CATH topology
 4NYK A;  1N34 O;  3QO8 A;  1ZLZ A;  2ZQM A;  3F7V C;  4E2L A;  1X4T A;  3KCX A;  3CCE V;  3J81 N;  1KKD A;  4AIL C;  5B1B C;  1MG1 A;  1THZ A;  4JTD B;  5CMU A;  1NQT A;  4D7S A;  1IBM B;  4U3J B;  1SZT A;  1GRJ A;  5LHI A;  3ETD A;  2PZS A;  2UUB O;  3H1I H;  2ZM6 O;  4YHH B;  1OJH A;  1VQ5 V;  2QR4 A;  2BTO A;  1Y67 A;  5LL6 Y;  2E5L O;  2EIN C;  1PNK A;  2ZDI A;  1VQM V;  2EBO A;  4JYC A;  1M9N A;  1JQ0 A;  3N2K A;  4U3F H;  2Q67 A;  1F23 A;  1BSM A;  1Q43 A;  5H2F Z;  3UM7 A;  1YIT V;  4JI7 B;  4FMT A;  2NLJ C;  2WA4 A;  4FLV A;  3OMA B;  2WWW A;  1Q82 W;  2PUS A;  1VQ7 V;  1V55 C;  2F43 G;  1H2G A;  2EJ7 A;  2Y48 A;  1SQF A;  1EFR G;  5CA3 A;  4DV2 B;  4WCE V;  3IAY A;  1LR1 A;  4X1K B;  3SYO A;  3B8N A;  1AI6 A;  2ITD C;  4F4L A;  1YCI A;  5HFL A;  3ASO B;  3CCM V;  2ZE6 A;  2G38 A;  3CE2 A;  1PL4 A;  4JTC B;  1LNQ A;  1AJQ A;  3JSN A;  4UCR A;  5J2T A;  1JPX A;  3OTF A;  2PI5 A;  1SQP H;  1COW G;  3HKC B;  2ZKO A;  3LDD A;  3EXA A;  2XUM A;  2ZE5 A;  3QO5 A;  3N27 A;  3FB5 C;  2GBO A;  3MHS C;  3TXQ A;  2DYS C;  3M99 B;  4Q20 A;  3JAR A;  1YJN V;  3ZN1 A;  4O4J A;  4MVU A;  4TUY B;  3ABM B;  1H2N A;  1QQC A;  4DV3 B;  1JOY A;  3ETG A;  2ARH A;  5EYP B;  1VF6 A;  3AG1 B;  2FKX A;  4XBF A;  4H0L B;  1IXB A;  3WG7 C;  1VAR A;  4CC5 A;  1NT2 B;  4FK5 C;  4K8Z A;  1Q7Y W;  1FD9 A;  4JI6 B;  2X6A A;  4A5U B;  4LH6 A;  2CGN A;  2FML A;  1VF6 C;  4YY3 O;  1ENV A;  5JCO C;  3RWR D;  2GV9 A;  1GN6 A;  3W7S A;  2JS3 A;  1UJW B;  1NBM G;  2JJ2 G;  5L3C A;  2Q0A A;  1YI2 V;  4BAY A;  4FLX A;  4JYA B;  1EM1 A;  4UV8 A;  1D2D A;  4O2B A;  4CS3 A;  3H9V A;  1FKA O;  3X2Q C;  3CCJ V;  4TV9 A;  1Q6I A;  4H44 B;  5LA6 A;  2Q69 A;  1G4Y B;  4TV8 A;  3OUF A;  5IY5 B;  1QNM A;  4NXM B;  1QR8 A;  2IU3 A;  2WLL A;  1YVW A;  1NR1 A;  1NJI W;  5ITZ B;  3VQV A;  4PD4 F;  1IBM O;  2FYU H;  3RYI B;  4MTG A;  5B1N A;  3RW0 A;  3B09 A;  1MAB G;  1TUB A;  2VWK A;  4YHH O;  1M5I A;  4MTO A;  3W7U A;  1NKD A;  1XEQ A;  1R6T A;  2A9H A;  1SA0 A;  3APQ A;  3GWK C;  3L74 H;  4IHJ A;  1M56 B;  2N74 A;  4FFB A;  4JI7 O;  1AB3 A;  1ZAU A;  3ASN C;  4HNA B;  1VIB A;  1QVG U;  2IW5 A;  4B08 A;  4JPR A;  4DUZ B;  1Y76 A;  2WAM A;  3DC5 A;  2DMX A;  1S77 D;  1SQQ H;  1OCC B;  3HR0 A;  1F4N A;  4G2K A;  2Q73 A;  1R3L C;  1XRE A;  2DQ3 A;  3J80 N;  4CH3 A;  4TOI A;  4LF4 B;  3ABL C;  4DV2 O;  4CC6 A;  1B04 A;  1OCO B;  4L87 A;  4UB8 Z;  1N36 O;  4BIU A;  1P84 F;  2CE4 A;  3VQX A;  1RM1 C;  4P9O A;  4H33 A;  4I55 B;  1EBO A;  5LHG A;  3R65 A;  4JGS A;  3R66 A;  1AP5 A;  1K4C C;  4LWS A;  1RFY A;  4DK1 A;  5LGN A;  2XAJ A;  1GN4 A;  1TUE B;  4J80 A;  1ZX3 A;  2BSK B;  1FXV A;  4DO2 A;  2XAH A;  1VF5 B;  1U97 A;  1ZTE A;  3TGU H;  4I0X A;  3C90 A;  2PF4 E;  2ADP A;  2YXY A;  4WFB V;  4JYB A;  1FAF A;  1VQ4 V;  5HFM A;  4DV3 O;  4PA9 A;  4EB6 A;  2Q9L A;  1ZSP A;  4JYY A;  1R73 A;  1EZJ A;  4KUM A;  2CAZ C;  3CPW U;  2WLH A;  4UCU A;  3OEE G;  5C8Y B;  4QPK A;  5JQG B;  1N0N A;  3MHH C;  1O9G A;  4FVM A;  4UV9 A;  4PDV A;  4PA6 A;  4MTF A;  4JI6 O;  4FLW A;  2IJJ A;  1RSO B;  3ZBH A;  2GHY A;  2W6J G;  5CBF A;  3IJ4 A;  3UO2 A;  2D3O W;  5LXT B;  3QG5 A;  4JYA O;  4DV5 B;  1I5Y A;  1WPX A;  5FPR A;  3BAA A;  2QSA A;  2R70 A;  5D5Q A;  4LF5 B;  2XAQ A;  1ZWI C;  3AG2 C;  5LYJ B;  2DWD C;  2ZNJ A;  3S3X A;  4RO2 A;  4F6R A;  1IVS A;  1Q5O A;  5LBQ A;  4I9Q A;  4NXM O;  4KP4 A;  4BIZ A;  2UUC B;  3N2G A;  1M57 C;  1P7G A;  3OGI B;  2YIB A;  4MVO A;  1Y4M A;  3SGI A;  3WB1 A;  4XDJ A;  2OIE A;  5IJ9 B;  5CA1 A;  4PV1 B;  2EIM C;  4WBN B;  5LGT A;  2DWE C;  3CCS V;  4DR3 B;  3TK1 A;  5BMV A;  1VMG A;  2Z5U A;  2IH1 C;  2ZXW B;  2ETN A;  3E8B A;  5EIB C;  4ZBM A;  4DR4 B;  2E74 B;  3F7Y C;  3SJC C;  1MSD A;  1PNL A;  4DUZ O;  1N4C A;  1H2K A;  5KMG B;  5KLV H;  3OR6 C;  2ZCE A;  1TVK B;  3BVO A;  2UXC B;  1CP9 A;  1KKC A;  1TA8 A;  4LF4 O;  3STZ C;  4CH6 A;  3LNM B;  2WLK A;  1SRY A;  1GM7 A;  2EUL A;  3H1K H;  1RPO A;  2GUZ B;  3UQ8 A;  4IIJ A;  5KX5 A;  3B2E E;  4X20 B;  1M1K W;  4QE9 A;  3T1Y B;  2ZE7 A;  3ABK C;  4U7N A;  4B3R B;  3RYF A;  2K1E A;  3OE7 G;  2L35 A;  2OYQ A;  2E3C A;  4X9Q A;  3TXS A;  2HJD A;  2DYR C;  4O4I A;  1RPR A;  4OXS A;  3CX5 F;  3FD9 A;  3JAW B;  4XDK A;  1V54 C;  4W4K A;  5L3D A;  2EIK B;  2A06 H;  1G6U A;  2YI8 A;  4GYC B;  1Q8I A;  2ATK C;  5EC1 C;  1YDX A;  1QLN A;  2BTQ B;  1SF9 A;  2LGW A;  2AZ0 A;  3L75 H;  2CTQ A;  5KA5 A;  2WLI A;  2EIL B;  1EN6 A;  5B1O A;  3TCU A;  2PI4 A;  1AJN A;  4DV5 O;  4NTX A;  3K59 A;  1HW7 A;  1KYO F;  1Z5V A;  4B3S B;  4LF5 O;  2RN9 A;  2WLM A;  4ZHQ A;  5KHK A;  4X64 B;  4BW9 A;  4DR7 B;  1N33 B;  2DOS A;  5IWA B;  4I5S A;  1MZE A;  4IYI A;  1Q6U A;  1NVP B;  4JV5 B;  2F66 C;  4KFM A;  3JAM N;  1CPY A;  1GM9 A;  3JD1 A;  5IJ0 B;  4GX1 A;  2Z0A A;  4I4T B;  3U0Z A;  4PA7 A;  2UUC O;  3CEI A;  3M8A A;  4GZR B;  4LF8 B;  1JFF A;  1PV0 A;  1GTO A;  1TGO A;  5J2U A;  4ZI7 B;  4GX5 A;  1VQL V;  5BZB A;  4GLX A;  3CD6 V;  4DR3 O;  4JI4 B;  1SQG A;  3FAV A;  3SYP A;  1MMM A;  2RMK B;  4LFA B;  3J7A U;  4I9W A;  1Y66 A;  2P67 A;  1HNW B;  4DR4 O;  1AR5 A;  5A2Q N;  4MT8 A;  2O57 A;  1NTM H;  5C93 A;  4H37 A;  3STL C;  2BOC C;  3ABU A;  3HKE B;  3ASO C;  2UXC O;  3JAK A;  1ZL8 B;  5KA6 A;  2F95 B;  1HNX B;  4X1I B;  3RYC A;  1QVF U;  3ZMV A;  1BE3 H;  3BA9 A;  4RUF A;  4DRX B;  3ZRW A;  2Y4T A;  3DGE A;  5JVD B;  2CH7 A;  2ODM A;  2LFS A;  1NTZ H;  1N32 B;  2QM4 A;  2F23 A;  4PEL A;  4Z1M G;  4WFG A;  2CGO A;  4J9Y B;  3T1Y O;  1G8M A;  2HVK C;  4B3R O;  1K92 A;  3ABM C;  1V9P A;  4P30 A;  2FB5 A;  1WB8 A;  5JJJ B;  2ZNI A;  4OPH A;  1P7B A;  4FIP C;  3CCV V;  4RAI A;  1DTO A;  1H8H G;  2JEX A;  4LBE C;  2WLN A;  5LOV B;  4LNU B;  2M6Y A;  2NR5 A;  2V1D A;  2OWO A;  1SC5 B;  3CME V;  1PD3 A;  3FKS G;  3HB3 B;  1RP3 B;  4UFZ A;  2A7W A;  1YHQ V;  2HVJ C;  2QM7 A;  1JX9 A;  3H1H H;  3CWB H;  5B66 Z;  2BE3 A;  4G27 B;  3L72 H;  3P3P A;  1FJG B;  2Q68 A;  4ASU G;  2YEV A;  5JH7 B;  2NN4 A;  2ZIM A;  2L6L A;  2QM8 A;  1YJ9 V;  4FLZ A;  1CXZ B;  2JGD A;  5FPO A;  1FFX B;  3ML0 A;  4N23 A;  2QA4 V;  1WP7 A;  5IY5 C;  2R9I A;  2PGG A;  1HR0 B;  3JYC A;  1KMI Z;  4B3S O;  4HYO A;  4X64 O;  5KAI Z;  2YIA A;  2CTR A;  2YXL A;  1N33 O;  4QGP A;  5CB4 A;  5IWA O;  3CB2 A;  2YSU B;  4JV5 O;  4HZ3 A;  4J42 A;  3CJH B;  3ZMT A;  3FX7 A;  2P6J A;  2P7T C;  4F6E A;  4MSW C;  3JAS A;  4MW3 A;  5CA0 B;  1M56 C;  1PPJ H;  4LF8 O;  3T2M A;  3DXR A;  4UVA A;  2UXB B;  4JF3 A;  1PM9 A;  5IYB O;  4NVP A;  4JI5 B;  1FXH A;  3I5D A;  2PTM A;  3JD3 A;  1K97 A;  2QJ1 A;  3M7M X;  4MVS A;  5FLX N;  3QVN A;  1OCC C;  4WFE A;  1XBL A;  2JGU A;  5JCO A;  5GON B;  3C3S A;  2PYL A;  3F5W C;  4JZ2 A;  1GAX A;  4JI4 O;  3RYH A;  4LFA O;  3BA8 A;  1HNW O;  1AI4 A;  3FB7 C;  2OCH A;  2JVD A;  2VS0 A;  2AXT Z;  1OCO C;  4PDM A;  3JD2 A;  1W0K G;  1HNX O;  1OCR B;  1XNQ B;  4JI1 B;  2MK3 A;  3CXC U;  2VRZ A;  1XL4 A;  3SPG A;  5FL7 G;  2KG7 B;  2Y4U A;  1X59 A;  2JEU A;  2P22 C;  1YTF B;  1N32 O;  3K0G A;  3HKD B;  1Q3E A;  5JQG A;  1BHB A;  3N2K B;  1VQ8 V;  5B3S B;  1F7Y A;  1FXK B;  2EZP A;  4QPJ A;  2XOK G;  2BOB C;  1PP9 H;  2R9R B;  2CTW A;  2F93 B;  2QTO A;  4UUJ C;  4B3M B;  5F2V O;  1P49 A;  4O4H A;  3CC2 V;  3CCL V;  1JJO A;  4H13 B;  3OMI B;  4UCT A;  3H01 A;  4X8A A;  4B7E A;  2XND G;  4MVM A;  1URF A;  4UXN A;  3KG2 A;  4PA4 A;  3G67 A;  5EBM C;  1KU9 A;  3ZRX A;  2IH3 C;  3E83 A;  3B77 A;  4UCS A;  4AQY B;  2E76 B;  2HP8 A;  1S72 V;  2XTA A;  3CRM A;  5DN6 G;  4WF9 V;  3IC7 A;  1A32 A;  1H8E G;  3OM3 B;  5KUK A;  1BMF G;  4GUN A;  4YJ3 A;  1ORQ C;  1FJG O;  3CSX A;  3HKB A;  1WA8 A;  4MVZ A;  1BHA A;  4DV0 B;  4DR6 B;  2YIB D;  3CC7 V;  2W0F C;  3O65 A;  3JAT A;  4FPP A;  4LR3 A;  2IM9 A;  1WNS A;  4I50 A;  1HR0 O;  3PJS K;  3WG7 B;  4N21 A;  2UXX A;  1W0J G;  2ITC C;  2YXH A;  1AVM A;  4O4J B;  1MA1 A;  4DR1 B;  1NVP D;  1SQX H;  3ZIA G;  4U7O A;  4GX0 A;  1SES A;  2ILM A;  3ZHV A;  2FL4 A;  5DEC A;  2RCV A;  3JCU Z;  2GSM B;  5KHG A;  2HEP A;  4KHP B;  2YID A;  2GTA A;  1AI7 A;  1K5Q A;  2KB1 A;  5H6Q A;  5GTH Z;  1TVK A;  5EC2 C;  1XQ8 A;  2NNU A;  3P30 A;  1J5E B;  2VWJ A;  2UXB O;  1Q6H A;  3K08 A;  4YJ2 A;  3P3N A;  4RWU A;  2B9Z A;  4JI5 O;  3PN1 A;  3AG4 B;  3CRR A;  1Z5W A;  1IZ3 A;  1F4M A;  5KHH A;  4DK0 A;  2GUZ A;  3UT5 A;  3SYQ A;  1BQZ A;  4O2B B;  2GTS A;  4O4L A;  1VQ9 V;  4QE7 A;  1GN3 A;  4TV9 B;  3CXH F;  4LCU C;  5LA6 B;  3SPJ A;  3ZRS A;  4CS2 A;  5E79 Z;  2HHH B;  3D3Q A;  1AJP A;  1K73 W;  1S5H C;  2DE0 X;  3DC6 A;  3H1J H;  5GTI Z;  1UFI A;  1XNQ O;  2WLL B;  2YUA A;  4JI1 O;  1HNZ B;  3ZX6 A;  2OTJ V;  1AR4 A;  3QNE A;  1BCC H;  3RGB A;  3S3W A;  3LSQ A;  2EJR A;  1TUB B;  5IYZ A;  4YXW G;  1SS3 A;  5B1A B;  4Q6G A;  1SA0 B;  2XHB A;  4YIO A;  2KSD A;  1FS0 G;  3L9D A;  4D7T A;  4FJC C;  4IHJ B;  1YJW V;  4FFB B;  3QF7 A;  4J11 A;  2JIZ G;  3E2E A;  2EIK C;  3JAL A;  3G80 A;  5LP6 B;  3CCU V;  2B1I A;  3VQW A;  1YZB A;  1Y76 B;  3ABT A;  3SYC A;  5GW7 A;  2MW2 B;  4IL6 Z;  2QWO B;  3D36 C;  3IGA C;  4B3M O;  1SQV H;  4GCZ A;  3LDC A;  3SR2 C;  1K8A W;  1I5X A;  2IJK A;  3EVK A;  4ZIB A;  2OCC B;  1EN5 A;  1R3K C;  4UVC A;  1Z2G A;  5EZY A;  4LFB B;  3MAQ A;  3KKY A;  2FTK A;  4AQY O;  4QNH B;  3AEI A;  3T1H B;  2LP7 A;  3Q4H A;  3IC9 A;  1XI1 A;  3DSQ A;  2P5O A;  2WLJ A;  4GT1 A;  4LWS B;  4BW5 A;  1VQP V;  2N05 A;  4P9P A;  3THO A;  1WB7 A;  3K57 A;  1BL8 A;  1S0V A;  3B4S A;  4DV0 O;  4E4E A;  3VQY A;  1GH6 A;  4L8J A;  4DR6 O;  5JWP A;  2HR3 A;  1SKV A;  4K3A A;  4K35 A;  2DQ0 A;  3E86 A;  3FYE B;  4I0X B;  4FM2 A;  4CBC A;  4I7Z B;  4PHZ A;  1QCE A;  4DR1 O;  2H3O A;  2E75 B;  4EB6 B;  2ZR2 A;  4GKK B;  4NKG B;  1OCZ B;  2DW4 A;  4DR2 B;  2ZIO A;  2LQT A;  2RJZ A;  3CHX A;  4IYH A;  4B7K A;  4ZOL A;  1YF2 A;  2Q0O C;  1W2B U;  4KHP O;  3CRA A;  3K5M A;  1J5E O;  5LMN B;  1IXM A;  1ZL8 A;  2Z3Y A;  1VQO V;  1NH2 D;  3K06 A;  3AK1 A;  4FM1 A;  3AG2 B;  3TET A;  4DRX A;  3E8H A;  2VQF B;  3E35 A;  4GKJ B;  2EIJ B;  2RNB A;  2YC0 A;  3WB0 A;  4X65 B;  3B8M A;  1BT8 A;  1NR7 A;  4DR5 B;  4LC1 A;  2HHH O;  1XMO B;  4F6R B;  4U3J A;  3L70 H;  2EIM B;  4JAV A;  4TWK A;  4EKW A;  2ZT9 B;  1UPG A;  4JZG A;  4MW8 A;  3N2G B;  3BFR A;  1HNZ O;  1GMG A;  1I08 A;  3OTO B;  1QHT A;  1QLE B;  1YTF D;  5KHJ A;  3SJA C;  5CA1 B;  3CRC A;  1M93 A;  1AR1 B;  5A9G A;  1N0J A;  3E22 B;  3CS5 A;  1BGY H;  4CH4 A;  1JA8 A;  3OT7 A;  5BXZ A;  1DLB A;  1QR9 A;  2H8P C;  4EFE A;  3BY6 A;  5DM6 V;  3ZHR A;  5AG2 A;  3D8C A;  3U11 A;  2OTL V;  3SYA A;  1HP8 A;  1FFT B;  2Q6A A;  1R3J C;  4X1K A;  2Q5Z A;  4X62 B;  1L1F A;  1MZF A;  1NTK H;  3OR7 C;  2KQX A;  2X7R B;  2LO1 A;  2HG5 C;  4LFB O;  2QE7 G;  2WA3 A;  2LGQ A;  1N8R W;  5KX5 B;  3GWO A;  4NTW A;  3T1H O;  5IT9 N;  2ZE8 A;  3BAB A;  2N04 A;  3HKC A;  4WFH A;  3O9O A;  2LJ2 A;  1EZV H;  2Q7H A;  1V54 B;  3OAA G;  1XUQ A;  5J9P C;  4JAS A;  1R3I C;  2RDC A;  1AIL A;  4TUY A;  3K5L A;  2Y69 B;  4LH7 A;  1Y74 B;  2RQ6 A;  5EYP A;  3ZMS A;  4DXW A;  2JRI A;  3ZHQ A;  1IX9 A;  1FPO A;  3CCR V;  5KAF Z;  4MS2 A;  2YS8 A;  4X1Y B;  5BY1 A;  4GKK O;  5DED A;  2LFR A;  3TJT A;  1K33 A;  1R1B A;  4DR2 O;  3RVY A;  2R9A A;  3D3I A;  5JJN B;  3AG1 C;  3RVZ A;  1Y6X A;  4LF6 B;  1S76 D;  3E8F A;  2LW7 A;  3AK2 A;  1B06 A;  5LMN O;  5D5P A;  3OEH G;  1JR9 A;  4FM0 A;  2WLI B;  1L0L H;  3ZJZ A;  5TIS Z;  3BRC A;  1L0N H;  4PJ0 Z;  4BWA A;  2Q8V A;  2VQF O;  3ZN0 A;  1XIL A;  2KG7 A;  2W0X A;  2A79 B;  3DTU B;  4GKJ O;  1XNR B;  4ABM A;  3K5N A;  3A0R A;  4QJF B;  1OCR C;  5LMU B;  4MTX A;  1FYJ A;  4D6T H;  4ZHQ B;  4X65 O;  3HKD A;  3ZRV A;  1IBK B;  5IDJ A;  4DR5 O;  5FNV B;  1FXK A;  5ITZ A;  4R50 A;  3BCC H;  1XMO O;  2DJV A;  2PYJ A;  3RYI A;  1D5A A;  2ZDI C;  2HFE C;  3AG3 B;  1F51 A;  2BCC H;  1T5E A;  3JCZ A;  4DUY B;  5B3S C;  1JFF B;  3BPZ A;  4K0K B;  3OTO O;  1FXK C;  4J7J A;  5J2U B;  3VOU A;  1S3J A;  2D2C B;  4TSF G;  1XOU A;  1P4R A;  4DR7 O;  3A8T A;  4X66 B;  4HNA A;  1N36 B;  3CRQ A;  3JD4 A;  4JI2 B;  2B5U A;  1K4D C;  3OUS A;  4WFA V;  5JJE B;  1DF4 A;  2JK5 C;  2QKA A;  4CH5 A;  2QDO A;  3FAV B;  4TT3 G;  1BS3 A;  2HKO A;  2AHY A;  2IJH A;  4MVQ A;  2P06 A;  4FLT A;  2HLD G;  4O2A B;  5CBH A;  1SET A;  1NH2 B;  3H1L H;  1EN4 A;  4PI0 A;  3JAK B;  4X62 O;  4J41 A;  1G1X B;  4DW1 A;  3RYC B;  2QGN A;  1OZ0 A;  1QBZ A;  2XAF A;  3NXS A;  4I55 A;  3ZRW B;  1XMQ B;  3ZS8 C;  2P4K A;  3JD0 A;  5B1B B;  1E79 G;  2CH7 B;  3FB8 C;  5KUM A;  5K1X A;  3WFV A;  3K79 A;  3CC4 V;  2ZR3 A;  1H2M A;  3OFN G;  2R72 A;  4C7U A;  2BSK A;  1IDS A;  4LFC B;  2EIN B;  2JDI G;  4Z1V A;  3K3W A;  3SPI A;  4X89 A;  4CZZ A;  2AGA A;  1OHH G;  5L3E A;  1KP3 A;  3ETE A;  4X88 A;  3FFQ A;  2YIC A;  1GKF A;  3E89 A;  4OGQ B;  1DF5 A;  3P32 A;  2OT5 A;  5C8Y A;  2UUA B;  3OMN B;  1I7F A;  2C2A A;  2H94 A;  1V55 B;  4OX9 B;  4FFK A;  4R6Z A;  1PL0 A;  4CS4 A;  3G6E V;  3UKM A;  2JS5 A;  3WB2 A;  3AG4 C;  1MOF A;  4JI8 B;  3OGC C;  1RSO A;  3BHP A;  1YXB A;  3BEH A;  3L73 H;  4LF6 O;  1HWY A;  4NB5 A;  2AW9 A;  1GO3 F;  2YI9 A;  4TQD A;  5LXT A;  3SPH A;  2UU9 B;  2YEV B;  1KB9 F;  4JAA A;  4UB6 Z;  3SJB C;  4W4L A;  1K9M W;  2JGD B;  4LF9 B;  4NXN B;  5EBL C;  5LYJ A;  4UVB A;  5E1A C;  4HBN A;  1XNR O;  1Q81 W;  4BR6 A;  3K9S A;  5LMU O;  3AG7 A;  1ZUQ A;  3A0B Z;  3K04 A;  3K58 A;  2CUG A;  1GM8 A;  2IU0 A;  2DYS B;  3KCY A;  4JI0 B;  5CB4 B;  2VQE B;  4LF7 B;  1IBK O;  3WU2 Z;  5KHI A;  5J2T B;  4DV4 B;  5LP6 A;  4DV1 B;  1K3E A;  2JJ1 G;  5B1A C;  1SER A;  1MNG A;  2A0L A;  3NR7 A;  2KKW A;  3I56 V;  1R6N A;  3E8G A;  5CN0 A;  5IJ9 A;  4DV6 B;  3JAS B;  1ROP A;  3ZHT A;  1Q90 D;  4WBN A;  3DXR B;  5EIB D;  3JAR B;  4DUY O;  1H2L A;  1WP8 A;  4K0K O;  3ZHU A;  1E1Q G;  5LP6 C;  3A2F A;  2ZD9 A;  5H6R A;  1VP7 A;  2QWR B;  4X66 O;  1KBH A;  1K5S A;  4JI2 O;  1DGS A;  3KZI Z;  2WPD G;  2Q7G A;  2X6B A;  5KMG A;  3ZED A;  3UCS C;  1WPB A;  4LP8 A;  3RYH B;  4J10 A;  2OCC C;  1H38 A;  1J95 A;  3FB6 C;  2M7W A;  1B6Q A;  2QKS A;  2V7Q G;  2ZXW C;  1SQB H;  3X2Q B;  1S5J A;  1H2S B;  4PI2 A;  2QTS A;  1GN2 A;  4FZ1 A;  5H5N A;  4PDL A;  3OW2 U;  3G71 V;  2IJI A;  4DV7 B;  1KC8 W;  1M90 W;  4UCV A;  1XMQ O;  3G4S V;  4JTA B;  4X20 A;  3C3T A;  4J7K A;  4HAM A;  4J9Z B;  2LW1 A;  3T1C A;  1NU1 H;  3SDL A;  4TV8 B;  4GX2 A;  3ETQ A;  1PKX A;  4EEQ A;  4JAU A;  3ZHS A;  4LFC O;  2AHZ A;  4B3T B;  2K9P A;  1YSC A;  2F1M A;  3QTC A;  4IT5 A;  1U96 A;  2F4V B;  5LHH A;  4WFF A;  3JAW A;  3VBB A;  2UXD B;  2Q4P A;  1OCZ C;  3ASN B;  3QO7 A;  1XL6 A;  4O4H B;  2QWP B;  3K0D A;  1BQ0 A;  1KEC A;  3UO3 A;  3ICX A;  3SJQ C;  4ZKI A;  3D36 A;  2UUA O;  1JJ2 U;  2UXN A;  4R8C A;  4FLU A;  1VQK V;  2BTQ A;  4OX9 O;  4AI8 A;  1E1R G;  3LUT B;  4KL1 A;  3ABL B;  2EX3 A;  2PY5 A;  1WN7 A;  4JI8 O;  4JI3 B;  1DK1 A;  1TAE A;  2EIJ C;  1KQS U;  3SPC A;  1RM1 B;  1VQ6 V;  4YJ3 B;  2X6C A;  4MVR A;  3GB7 C;  2QWN B;  4DW0 A;  2UU9 O;  3HKB B;  1MSW D;  2XT9 A;  2Y0I A;  1WA8 B;  1ARO P;  3FYI B;  1YEW A;  3RN4 A;  3T4Z A;  3K9A A;  2EIL C;  4LF9 O;  2P4V A;  3W7W A;  4NXN O;  3JAT B;  4NR1 A;  4I50 B;  1M4U A;  4OPA A;  4ICG A;  4PDR A;  2XAG A;  3E22 A;  1BZK A;  1VF7 A;  5IJ0 A;  1IBL B;  4JI0 O;  2VQE O;  4I4T A;  4PA3 A;  4LF7 O;  1QLE C;  1US6 A;  1D5N A;  3ZMU A;  4DV4 O;  4DV1 O;  2X0L A;  5EBW C;  2HJF C;  4ZI7 A;  3I55 V;  4DV6 O;  3EHB B;  5IE9 A;  5BR8 B;  1I94 B;  1I0H A;  1K34 A;  4YJ2 B;  1VEW A;  1NI8 A;  3K5O A;  5IYD O;  2A3Q A;  1N34 B;  1W59 A;  4UCO A;  3UT5 B;  5EK0 A;  1L8D A;  3CYO A;  4R7C A;  3LSS A;  4P2Z A;  4O4L B;  3HKE A;  5L3G A;  2B1G A;  1LUV A;  2IBZ H;  4X1I A;  4G28 B;  1K7D A;  4AHC A;  2QEX V;  3CP1 A;  2W6I G;  2ADQ B;  2UUB B;  5JVD A;  2ZM6 B;  3K03 A;  3G6B A;  4DV7 O;  1O9H A;  1WJZ A;  2YDE A;  1JMK C;  2E5L B;  1Y74 A;  1R6K A;  3CCQ V;  3AK3 A;  1JVM A;  5LGU A;  1M57 B;  2DN9 A;  3B40 A;  5IYZ B;  4X1Y A;  1KP2 A;  3CMA V;  1CEZ A;  5L3B A;  3IFX A;  2Y69 C;  5H9C A;  4RUE A;  1YIJ V;  4YIP A;  1AI5 A;  3A0H Z;  4B3T O;  3JAL B;  1XHX A;  1JCH A;  2V4D A;  3RFR A;  2F4V O;  2UXD O;  2XAS A;  1HDJ A;  5LOV A;  4LNU A;  1VQN V;  3F5T A;  4DYL A;  1WLE A;  2EZO A;  1GK9 A;  5B5E Z;  5BMV B;  1AP6 A;  5EZY B;  4XDL A;  1XHZ A;  2QKC A;  4J7Z A;  4BIO A;  3ZMZ A;  4EFB A;  4JI3 O;  3Q4H B;  1KD1 W;  2ZIN A;  5FNV A;  5JH7 A;  2OIG A;  3LDE A;  2P90 A;  2CK3 G;  4QIW F;  1FFX A;  3LSU A;  4FZ0 A;  3ABK B;  4Z2W A;  1OV9 A;  3RBZ A;  2CDY A;  4IIJ B;  3MD0 A;  4IGG A;  3APO A;  3LNN A;  1NS1 A;  3W7T A;  2CTP A;  1PNM A;  2WSS G;  2Y0P A;  1Q86 W;  1IUR A;  3ZCC A;  1LUW A;  3AG3 C;  1KUQ A;  2DYR B;  3CJH A;  3JSL A;  1IBL O;  1NZ6 A;  4FLY A;  5CA0 A;  3RT3 C;  3RYF B;  3MDS A;  4KXR A;  1XDC A;  4ZOL B;  3EFF K;  4TQF A;  4YY3 B;  4NTY A;  5IYC O;  5K1P A;  5L3F A;  4RQE A;  1WAZ A;  4O2A A;  5CBG A;  4RQF A;  2AZ2 A;  4O4I B;  4K8X A;  1B3Q A;  3GVM A;  1QU7 A;  1S5L Z;  3HPL C;  3W7X A;  2QWQ B;  3T4D A;  5BR8 O;  1I94 O;  3U10 A;  3L71 H;  3OD4 A;  5GON A;  2GDS A;  2Q7E A;  1SZX A; 
#chains in the Genus database with same CATH homology
 3UT5 A;  2OYQ A;  2E3C A;  4O2B B;  4O4I A;  4O4L A;  4TV9 B;  3JAW B;  5LA6 B;  1X4T A;  3FFQ A;  4CS2 A;  2HHH B;  4AIL C;  1G6U A;  2YI8 A;  4GYC B;  5C8Y A;  2UUA B;  1Q8I A;  1I7F A;  4D7S A;  4OX9 B;  1IBM B;  4U3J B;  2PZS A;  4CS4 A;  1HNZ B;  2BTQ B;  2JS5 A;  3WB2 A;  4YHH B;  4JI8 B;  1RSO A;  3BHP A;  3RGB A;  2BTO A;  1TUB B;  5IYZ A;  4Q6G A;  1SA0 B;  2XHB A;  2YI9 A;  4TQD A;  3N2K A;  4JI7 B;  1Q43 A;  5LXT A;  2UU9 B;  4D7T A;  4IHJ B;  3SJB C;  4FFB B;  4FLV A;  3QF7 A;  4LF9 B;  3K59 A;  3JAL A;  5LP6 B;  4NXN B;  1HW7 A;  5LYJ A;  2PUS A;  1Z5V A;  3VQW A;  4B3S B;  4HBN A;  4ZHQ A;  5KHK A;  4X64 B;  4BW9 A;  4DR7 B;  1N33 B;  1SQF A;  5IWA B;  4DV2 B;  3K58 A;  3SR2 C;  4JV5 B;  3IAY A;  4ZIB A;  4JI0 B;  5CB4 B;  2F66 C;  2VQE B;  4LF7 B;  4X1K B;  5EZY A;  5IJ0 B;  5KHI A;  5J2T B;  4DV4 B;  4LFB B;  5LP6 A;  4DV1 B;  4I4T B;  3U0Z A;  3MAQ A;  2KKW A;  4LF8 B;  5IJ9 A;  4DV6 B;  3JAS B;  1JFF A;  1TGO A;  5J2U A;  4WBN A;  4ZI7 B;  3T1H B;  1XI1 A;  5EIB D;  3JAR B;  3DSQ A;  2P5O A;  5LP6 C;  3A2F A;  4GLX A;  3JSN A;  4UCR A;  5J2T A;  3OTF A;  3THO A;  3HKC B;  3K57 A;  4JI4 B;  1SQG A;  1DGS A;  3VQY A;  4LFA B;  2Q7G A;  4L8J A;  1HNW B;  5KMG A;  3ZED A;  1WPB A;  3RYH B;  1SKV A;  3JAR A;  4O4J A;  4FM2 A;  4TUY B;  3HKE B;  4DV3 B;  1QQC A;  5EYP B;  1S5J A;  3JAK A;  4PHZ A;  1H2S B;  4PI2 A;  2F95 B;  1HNX B;  4EB6 B;  4X1I B;  3RYC A;  4GKK B;  3BA9 A;  4CC5 A;  4DRX B;  4DR2 B;  2ZIO A;  1NT2 B;  2RJZ A;  3CHX A;  4K8Z A;  4ZOL A;  4DV7 B;  5JVD B;  4JI6 B;  4UCV A;  4LH6 A;  4X20 A;  3K5M A;  1N32 B;  5LMN B;  2QM4 A;  5JCO C;  3RWR D;  2GV9 A;  4FM1 A;  4TV8 B;  2Q0A A;  4DRX A;  4FLX A;  3ETQ A;  4JYA B;  4EEQ A;  2VQF B;  4O2B A;  4GKJ B;  4CS3 A;  4B3T B;  1V9P A;  2F1M A;  4TV9 A;  3QTC A;  2F4V B;  5JJJ B;  2ZNI A;  3JAW A;  5LA6 A;  3WB0 A;  4X65 B;  2UXD B;  4TV8 A;  4O4H B;  4DR5 B;  5LOV B;  4LNU B;  4NXM B;  3ICX A;  1XMO B;  4F6R B;  4U3J A;  2OWO A;  5ITZ B;  4FLU A;  2BTQ A;  3VQV A;  4UFZ A;  3N2G B;  3RYI B;  4KL1 A;  2EX3 A;  1TUB A;  2PY5 A;  1WN7 A;  2VWK A;  3OTO B;  1M5I A;  1QHT A;  4JI3 B;  1SA0 A;  5KHJ A;  3SJA C;  5CA1 B;  1TAE A;  1M93 A;  1FJG B;  4IHJ A;  4YJ3 B;  5JH7 B;  2ZIM A;  4FFB A;  3E22 B;  3HKB B;  1ZAU A;  4FLZ A;  4HNA B;  4CH4 A;  4B08 A;  5FPO A;  1FFX B;  1YEW A;  4DUZ B;  2PGG A;  4EFE A;  1HR0 B;  3JAT B;  1KMI Z;  3U11 A;  4I50 B;  1M4U A;  2YIA A;  2YXL A;  4CH3 A;  4TOI A;  4LF4 B;  5CB4 A;  3E22 A;  4X1K A;  3CB2 A;  4X62 B;  1VF7 A;  5IJ0 A;  1IBL B;  4CC6 A;  4I4T A;  1B04 A;  3VQX A;  3JAS A;  5CA0 B;  4I55 B;  4ZI7 A;  2UXB B;  5KX5 B;  4NVP A;  4JI5 B;  5BR8 B;  1I94 B;  2PTM A;  3BAB A;  4YJ2 B;  2QJ1 A;  3HKC A;  3K5O A;  3M7M X;  4DK1 A;  2JGU A;  5JCO A;  1N34 B;  2Q7H A;  5GON B;  2PYL A;  4UCO A;  3RYH A;  3UT5 B;  3BA8 A;  1L8D A;  2JVD A;  4TUY A;  4O4L B;  3HKE A;  3K5L A;  4LH7 A;  2RQ6 A;  5EYP A;  4EB6 A;  4X1I A;  2CAZ C;  4X1Y B;  4AHC A;  4UCU A;  5C8Y B;  1XNQ B;  5JQG B;  2UUB B;  4JI1 B;  1O9G A;  5JVD A;  4FVM A;  2ZM6 B;  2R9A A;  1O9H A;  5JJN B;  1JMK C;  2E5L B;  4LF6 B;  2P22 C;  4FLW A;  5D5P A;  5IYZ B;  4X1Y A;  4FM0 A;  3HKD B;  1Q3E A;  5JQG A;  3N2K B;  3BRC A;  5LXT B;  3QG5 A;  4DV5 B;  4BWA A;  5FPR A;  3BAA A;  2R70 A;  5D5Q A;  4LF5 B;  1XNR B;  3JAL B;  3K5N A;  1XHX A;  3RFR A;  2V4D A;  5LYJ B;  2F93 B;  5LMU B;  4B3M B;  1P49 A;  4ZHQ B;  2ZNJ A;  4O4H A;  1JJO A;  3HKD A;  4UCT A;  5LOV A;  4LNU A;  4F6R A;  1IBK B;  5FNV B;  1Q5O A;  4I9Q A;  5ITZ A;  2UUC B;  5BMV B;  2PYJ A;  3N2G A;  3RYI A;  1KU9 A;  2YIB A;  5EZY B;  1D5A A;  1XHZ A;  4UCS A;  3SGI A;  3WB1 A;  4AQY B;  1T5E A;  4DUY B;  5IJ9 B;  5CA1 A;  1JFF B;  3BPZ A;  4K0K B;  4EFB A;  5J2U B;  4WBN B;  4YJ3 A;  2ZIN A;  5FNV A;  5JH7 A;  4DR3 B;  3CSX A;  3HKB A;  5BMV A;  4X66 B;  4HNA A;  1N36 B;  4JI2 B;  4DV0 B;  1FFX A;  5JJE B;  5EIB C;  4DR4 B;  4CH5 A;  4DR6 B;  2YIB D;  3SJC C;  3JAT A;  4LR3 A;  5KMG B;  2IM9 A;  1WNS A;  2ZCE A;  4I50 A;  1TVK B;  4IIJ B;  3LNN A;  2UXC B;  4O4J B;  4FLT A;  4O2A B;  4DR1 B;  1TA8 A;  4PI0 A;  3JAK B;  4CH6 A;  3JSL A;  3RYC B;  4FLY A;  5CA0 A;  5KHG A;  2HEP A;  4I55 A;  3RYF B;  1XMQ B;  3ZS8 C;  4KHP B;  1TVK A;  4ZOL B;  4TQF A;  1XQ8 A;  3UQ8 A;  4IIJ A;  4YY3 B;  1J5E B;  5KX5 A;  2VWJ A;  3B2E E;  5K1P A;  4O2A A;  4O4I B;  4X20 B;  4K8X A;  5K1X A;  4YJ2 A;  2R72 A;  3T1Y B;  3U10 A;  3PN1 A;  1Z5W A;  5GON A;  2Q7E A;  4B3R B;  5KHH A;  4DK0 A;  4LFC B;  3RYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...