1THZA

Crystal structure of avian aicar transformylase in complex with a novel inhibitor identified by virtual ligand screening
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Crystal structure of avian aminoimidazole-4-carboxamide ribonucleotide transformylase in complex with a novel non-folate inhibitor identified by virtual ligand screening.
pubmed doi rcsb
source organism Gallus gallus
total genus 217
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1thzA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1thzA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1thzA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1thzA02
1OZ0A 1M6VA 1KEEA 5H3LA 1IK4A 1S89A 1M9NA 2X8WA 1CS0A 1P4RA 1C3OA 3ZZMA 2XW6A 4EHIA 1C30A 1PKXA 1VMDA 2YVQA 1A9XA 2IU3A 1PL0A 1ZCZA 1JDBB 1G8MA 1BXRA 1S8AA 1EGHA 1THZA 1T36A 2IU0A 2B1IA 1WO8A 4A1OA 2B1GA 1B93A 1CE8A
chains in the Genus database with same CATH superfamily
4HNVA 3SPIA 1TTPB 4G3XA 3LX6A 4RL6A 4UQOA 3M6FA 3N7UA 2ZE7A 5IF3A 5KSOA 4CF4A 3G6WA 3KJZA 4EKIA 2YBEA 3THOA 4FWBA 4JBGA 1OB5A 4RORA 4TT3D 1V3UA 2WYVA 4X84A 3OOEA 4MNTA 4F5EA 2R72A 4YROA 5BPFA 1YBVA 4URZR 1X15A 1DIHA 2D4AA 4PC3A 2QXTA 1THGA 4BXOB 4S0ZA 5B7GA 2BTQA 2DRIA 3B40A 1P33A 4TT3A 3R9KA 2UXDB 4XE5A 4XUDA 2N1BA 4PYIA 1HOXA 1A69A 3GYBA 5I9MA 2E4WA 3CW2A 2R60A 4LE2A 3P2OA 4NCKA 2RBEA 3FWNA 2I6QA 3M4XA 1EP2B 2CHUA 2CEAA 1KK0A 3EZYA 3IQXA 3IBYA 4XX0A 3WK5A 5JSQA 4R3UC 4OBEA 2B5VA 1XVAA 3EZ6A 2C5LA 4G4JA 3NQ41 2QRMA 2XVYA 4KN9S 3SDSA 4ISCA 1YS9A 1KVQA 1QHHB 4R83A 1TTTA 3KQTA 2W4LA 3VNSA 3JWHA 3CEJA 4AJOA 3ROXA 1Y80A 4Q4CA 3UG7A 1L5YA 1S3IA 3NIWA 1SPBS 3R7BA 1XZGA 2R00C 4IWYA 3AUTA 3RG8A 4JYZA 1Z5VA 4W63A 5JFOA 2VYFA 1Y1PA 2GILA 4YCSA 3NKFA 1VGQA 2FZ4A 3EFOA 2F7SA 5E9QA 4Z3KA 1X1QA 1PZXA 5KMGB 3A0RB 3EMVA 5LZ2A 1PQYA 4BKPA 4RZHA 4RTMA 3OJ0A 3QIAA 4GFDA 2WD7A 1X13A 5GTHZ 3BCCH 3ICXA 1NBIA 4HRYA 3WGOA 3OZVA 4JLPA 2C2HA 3BMQB 2L0XA 3U5TA 5I9NA 1OX6A 2BUCA 4PBSA 3E7XA 3QO7A 4J0IA 1PN3A 5AM2A 2XUPA 1URPA 4QULA 5LZ5A 2BCEA 4ZO8A 3E3MA 2JIZG 2D2IA 1G2IA 1WLSA 5U4QA 3MD9A 1PLKA 1FX1A 2I71A 3H0CA 1AGYA 1V5IA 1FPOA 1DP4A 1T2CA 1XXHB 2R47A 2O52A 2VPXA 2EX1A 3C1UA 3HBFA 1G4UR 4JLSA 1N2CA 2WIAA 4COKA 4X95A 3DWEX 3GMDA 3QOYA 4KR0A 1Z45A 4MRAA 2EIXA 3WLSA 2ZRCA 3IQEA 1ZAKA 1G1MA 3APQA 4WN9A 1K3TA 4AIIA 1W36C 3MELA 3Q3HA 3CPEA 3EH2A 3T99A 1MP0A 1HDCA 3WGIA 1XCLA 3SDZA 2Q9BA 3I9FA 2VRZA 2AFVA 4GI7A 3UCSC 3HUTA 2J9XB 4OYYA 2Q7OE 3RFVA 3CVYA 3MHHC 5MGBA 1QHYA 3ZV6A 4RESA 2H1WA 2DKOA 3TD9A 3AKCA 2Q1YA 2V59A 4DCSA 3M70A 3UO2A 5B30A 5LUAA 4WZ6A 5EE9A 1RJGA 3MRTA 1G7CA 5M3BA 4TTJA 3RV3A 3IKLA 2X19A 1GTVA 2BP7B 1BC5A 5BSUA 1YQXA 1XJWA 3LUFA 1PNRA 1PR6A 3S1LA 5EJ7A 1GN8A 4WIFA 1USUA 4R0NA 4ZGGA 4OP2A 4GDFA 4B76A 4NB5A 4M99A 3ZEAA 1Y7TA 4KAJA 4P4GA 3QP9A 2G0NA 1Z74A 5EJGA 3N3BC 3WGZA 1NSTA 3VR0A 4XVQA 2WT9A 2X15A 2O1XA 4G25A 1DF4A 4OHCA 2VSXA 4NE7A 2PY6A 4LFBO 4NH0A 1I0HA 4HQLA 4DLBA 3LW8A 1LS6A 2ZZMA 1SQBH 3GF4A 1H2SB 4XVCA 2PS3A 2ZWOA 2V5AA 5FXMA 2HDWA 4JYMA 2MMCA 3OPYB 3HBMA 3ABIA 5LU9A 1NBMD 1XJQA 4KW7A 3GCGA 3BTVA 4Z54A 2FEXA 4CGYA 3OQBA 4L0CA 1VDMA 1WWRA 3PKZA 4DYHA 3UT5A 1LCIA 4FK8A 1M6WA 1JDPA 1EI9A 2VA8A 1TIBA 1KY5A 1N2CE 3Q40A 1NBMA 2CHFA 1X8LA 3EGOA 4YRZA 1N0WA 1H4VB 4FPXA 3B36A 4WGGA 1R15A 5IKEA 4NF2A 3FGOA 3NHMA 5B1YA 1VL0A 4JJ4A 3L0DA 4J7UA 1NVWQ 1A7JA 3DFIA 5IT0A 3NLLA 4UHHA 2PKCA 3ZIUA 4X7MA 1MVOA 5TX7A 1ZXXA 5JUWA 2QD3A 4ALLA 1ZAYA 2HJDA 2VZ0A 3GRFA 4Q05A 3NNSA 4M1TA 4YN3A 4L16A 1JSCA 3IKMB 4EB6A 1ZEJA 3UXMA 3F3YA 3E5HA 3LLMA 3B6IA 1V54C 1G5TA 4IY1A 4GOMD 5DGDA 1O6ZA 1RLOA 4KFTA 5EXPA 1KOGA 2FWRA 2HDOA 2G77B 4ENWA 4EABA 2HJSA 1TU3A 1E6EA 5IW8A 2UVPB 5AI0A 4BVEA 5EQFA 1GFSA 2ZI9A 3W7BA 1JG4A 1JYFA 1T8RA 3FZGA 2Z3HA 3HRHA 4BBZA 5DNWA 3VH3A 2E0IA 2I6UA 2ZJAA 1IU9A 4RKEA 2VBGA 4CF5A 1A97A 2GN4A 4NYJR 5HCNA 1UXOA 1X38A 4YRKA 1DQZA 1T24A 4OK3A 1BE0A 4NDZA 1VSUA 3ZZ0A 4QT4A 4C7VA 2GRUA 2FW1A 3A14A 3U61B 3AR7A 5ED4A 3VQXA 3ZS8C 1DT5A 2X77A 5DK4A 2XNKA 2FSSA 3PNBA 3JSLA 2AOTB 4GDMA 3K04A 2BJHA 2X23A 3NAQA 4OFBA 4YV7A 2VNHA 3OMAB 4YS6A 3D9QX 3AIOA 2QLMA 1P6OA 2F66C 4MVRA 3RLFA 4IT5A 2LIVA 4IDPA 1AC5A 1NBME 3D2AA 4R2JA 1W0KD 3R7WA 5H68A 1XMXA 3T1NA 4OJMX 2C61A 3DSRA 3BAFA 1JH9A 1QYCA 4I7ZB 2J0QA 2BR4A 1VQ5V 1Y7IA 1SERA 4WXPA 4PG5A 1DTSA 4AG6A 2EFJA 2QUJA 2BFPA 2GETA 5AI5A 1NUSA 3EFFK 1D2NA 3WIEA 1KEEB 3LGXA 2WAAA 4LVOA 4YR7A 3DE4X 5B3KA 3NVDA 3TLZA 1IURA 2R9AA 3FNIA 5B3JA 5JVDB 2JCGA 3A3OA 4OI0A 1EUCA 1A7UA 3D8UA 2V55B 4OQQA 3DDUA 4BGDA 4JIGA 4URWR 4J9YB 1Z5ZA 3QVUA 1GPAA 3F7YC 2WJZB 4LJ6A 1N36B 5LWQA 1C9NA 5JNSA 1U5CA 3CLVA 2Y69C 1USVA 2EKPA 4N3AA 5K3EA 2WAXA 1YE3A 1M6HA 1BKYA 1EB9A 4MVJM 2V3CC 1G8PA 1Y74B 3RWMB 2DPGA 4BB6A 3ZV4A 3QFCA 4H35A 1L5WA 2EGGA 4F9EA 3M3HA 2AUTA 3UB4A 2VJMB 3FBGA 3MBIA 3U0VA 3W7SA 1D2MA 4OXYA 1JR9A 5LKAA 5TVKA 3WGGA 1XILA 1IVSA 1UAGA 2OM6A 4ILKA 4F1KA 3NHAA 4ZGBA 3IQFA 1XRJA 2ANBA 2P2YA 1QIFA 2A0YA 3AKZA 1WETA 5EJFA 5DMHA 3WOHA 5KA6A 4Q9AA 2PKRA 3D3WA 3T1YB 4XQ0A 1H1DA 3CF2A 2A88A 1FSFA 1WVGA 5EZSA 1ZMBA 2CBXA 1A0OA 3T6KA 3W7XA 3D8RA 3RUIA 3PUKA 1LV7A 3K5OA 3U6BA 1QOZA 1M74A 2ZBDA 2P0EA 3F9RA 3JYQA 4AKTA 5I3CA 3C3XA 4E7OA 3I8SA 4HUQB 4OFXA 1OH8A 5AJVB 3FB6C 2HV8A 3T4PA 3MMXA 1KKDA 1WB7A 3UWKA 3SBOA 3UAVA 1VRWA 3C7KA 2I03A 2P1RA 4FD3A 1NTZH 1N2BA 2ZRPA 3GUUA 4KVAA 1UKEA 3FYCA 2NVOA 3NANA 1NF8A 4P3NA 1C2YA 3M1LA 4U3JA 3C98A 1Z4QA 1ZQ9A 5DM2A 3UQYS 2RJOA 4DJFC 2NU8A 2OIEA 1ZA1A 3RVDA 3ESXA 4JXEA 4X6UA 3WZLA 3GHYA 1ODJA 2FFQA 1KC8W 3W0LB 1QH1A 1XA4A 1SCAA 2C95A 3U1BA 2V65A 2VEOA 4AJLA 5IC6A 1UC5B 2AXEA 3L92A 1ZD8A 2HMSA 4BCDA 2W0SA 1Y6RA 1TQDA 1NQ5A 1WDMA 4QOSA 1YTFB 4RC9A 4LMAA 4QOEA 3U4QB 1DRWA 4EHLA 3U3OA 1JR2A 4JTDB 2J45A 4KKXB 1ATIA 4B71A 3IHLA 2VPZA 3IQZA 4ER3A 1ABEA 2QRGA 2PANA 4GZ5A 2AQHA 2FQQA 3F97A 3VGJA 4KXMA 1WG8A 4MVQA 4GPBA 2DG2A 1SHKA 3CW8X 1VJ0A 3EXAA 2YIJA 5HJ5A 4UTXA 1P4AA 4AP6A 5JRDS 1Y3BE 1MQAA 2CGEA 1XRRA 4MYUA 5GONF 1GKKA 5BV0A 1E2JA 4RTOA 1C0KA 1CS0A 2RHCA 1NV8A 1G5QA 1O77A 5IKOA 1RHRA 3ZEFB 4FFKA 1QO7A 2PSJA 3NETA 1UXGA 2HMTA 3T7DA 3LPNA 3W9UA 4KFUA 2REQA 4CQLA 3G49A 3DLBA 2XE4A 4HV4A 1RM3A 5AW0A 1T2EA 4UEOA 1M0EA 1UWZA 1EQ2A 1Q1EA 1ORTA 5CVCA 4JI6B 1PR5A 1XTRA 1DG9A 2P3QA 4LPSA 3IJPA 5KTNA 5JNLA 4DQLA 4YRNA 3EIWA 3ECCA 1E7MA 4G1CA 5BVGB 3RYHB 4Q19A 3EPKA 2XXJA 1VJRA 3EUAA 2JA2A 1I51A 1MPTA 4PYLA 4CN8A 4C2AA 1OJLA 2P0AA 2GCPA 4G2KA 1NW7A 1KQNA 4EUSA 2H1IA 2QWOB 2BFBB 1WKQA 2Q9LA 2LGWA 2FLVA 1H2EA 5LOVA 3RPEA 5AQEA 2AUMA 3HDTA 4ZXPA 1U0RA 3PDUA 1A76A 4D45A 4ZCTA 2OV1A 3T4XA 3ZTTA 4OX9B 4YMTA 4R8CA 4RIHA 1ZJ5A 2ESRA 3NBYC 1VE7A 1FJGB 1XUOA 3G2OA 3C6MA 5CVDA 2G07A 1DTWA 2YWGA 2WW8A 3IB3A 4M87A 1JQLB 3JD1A 1W5EA 2XGMA 4DW1A 4XM0A 4MJLA 2B4KA 1YZBA 1M8JA 2QJ1A 1AY0A 4RGYA 2QTVB 3U49A 5EUBA 1O0BA 1I36A 4EHJA 1GNRA 4YMIA 1JPUA 5KHKA 2G6VA 3THXA 5TT0A 1Y1KE 3CNQS 1Q0PA 3VKGA 3FAZA 3S40A 4AG5A 1UODA 3KOXA 4KYTA 3R7NA 1VBNA 5BXYA 4MCJA 4NS1A 3RYFB 3ILXA 2YFYA 1ML3A 1UJ5A 4ZPXA 1IJKA 4YRIA 2JG3A 4GP9A 1TA4A 2NT4A 1M5RA 5AHOA 1OLSB 2NO6A 4AY4A 3QKWA 1YHQV 4B3XA 3FOAA 3F5TA 4XVHA 4J3FA 5EESA 1O96B 1KWKA 4XJVA 5SYMA 5AJZA 1R0SA 2YYSA 1VI2A 3S1SA 3I2KA 2Q67A 1D2GA 4UDXX 3SF8B 3CSSA 1NDUA 1W73A 1P2DA 3U7QA 2FW7A 4QXOA 4E1VA 1J39A 5HUJA 1UPAA 3ABRB 1SXHA 3VNRA 1GQ2A 2BGLA 5AJXA 4DV6B 2UUAO 4O4IB 4RVFA 5FQNA 2D1RA 4BGVA 1VG8A 3VNVA 1XMSA 1L4KA 1Z6XA 3ICEA 3EDQA 2VQ3A 1Y81A 5IXYA 1D4AA 2ZE5A 5B57C 4JXKA 4K81B 2IYAA 4IO0A 1MH9A 5DISB 3NIDB 4BECA 3W6ZA 4TQUS 2O8FA 4PZ9A 4KQ2A 2F90A 4U2BA 2VR1A 3LECA 3W05A 3I9OA 1RZ3A 1Z4PX 2OO7A 4PBTA 4ZVQA 4ZCLA 2VIIA 1JFLA 1K63A 4RIGA 3LI2A 2ILVA 3W6OA 4UV8A 4MTGA 5HVNA 3CUSA 3AG6A 2GPAA 3DZHA 1JDBB 4E07A 1KZ1A 4KWEA 3JVEA 4W5WA 1A9TA 5EPEA 2J0SA 4DCCA 3KQPA 4RQEA 2OXEA 5FAXA 4JUFA 1M2HA 4QM7A 1KP3A 3HXKA 2VT2A 1RYDA 5G0TA 2XYQA 1DXYA 4LIPD 4FEYA 1ZCAA 4L22A 3PP8A 5DTIA 4PFQA 1KYZA 3BHIA 2DY1A 1ALNA 4Q37A 2N3ZA 2VAMA 3NWOA 2LWIA 3KEGA 3KZ1E 5I9BA 3E2EA 4TLLB 1YBAA 1JE0A 5MFZA 5C8YB 5HHTA 3RIHA 3AF3A 3TRDA 5IH3A 2HVKC 1NUPA 4QPJA 1JX9A 1WVMA 4MVUA 5KDOA 3NUQA 3ZN1A 1FFWA 3G89A 3TQSA 4WJLA 2QBYA 3KE8A 4WBXC 5E6RB 2HVJC 3KD2A 4NNPA 5FLEX 5CLJA 5KOJB 4PAGA 3KKYA 1JAZA 5AXAA 3BC1A 1LTQA 4QTXA 4HYEA 4RQTA 1JF8A 2F1KA 4XB1A 3PUHA 1VL2A 3LKZA 3O7MA 2PRYA 4WY8A 4OHYA 5L4LA 2QWQB 4D3DA 1OZAA 2FSVC 2ZJYA 2AQKA 4X91A 4FEGA 3ODGA 2R9VA 4ZV7A 3LL7A 4LF7O 2QE7D 5DYYA 2W2KB 3T0GA 4DT1A 2INGX 2JBWA 4QD3A 4TUYF 1KI4A 5HFMA 4J7XA 4B3SB 4TXLA 1E58A 3SM3A 2YXHA 4L0DA 1OWNA 2G3YA 3EASA 1NF2A 3ROKA 1WHTB 2V6IA 1R0LA 4EKNB 1KU9A 2FETA 2BM1A 4DUGD 2QE7A 3COZA 5T41A 2DPHA 2LP7A 1J2YA 4DLYA 4D98A 4H0NA 1GUAA 2RH5A 5F78A 3ONDA 3MAAC 3WY9A 4XWYA 1B41A 1VJDA 2AN5A 4K26A 3P97A 1GG9A 4DUGA 1ZP6A 1QXSA 5TMEA 4IJQA 3IHTA 4CG0A 5JFTA 3L4KA 5KWIA 1DC6A 3HFJA 1BQ4A 1XT6A 3CSUA 1EDZA 2YJGA 5ITWA 2PRIA 1MG1A 3I5AA 1IG0A 4H3VA 1YB4A 2WSYB 2FWBA 1EH5A 2Q41A 4D0NA 1PBNA 1OVGA 4PM4A 3PGVA 4JH0A 4NAHA 4CI9A 3CR3C 3N2GB 2X6AA 1JVSA 3PQ8A 1AZLA 5EL0A 3E8SA 1O4WA 4S1NA 1Z0IA 3K6RA 3L82B 4NYJQ 1N8KA 1NIJA 3F4BA 1SQXH 3K06A 4ZDJA 3CWZA 3RWRD 4H3SA 4G0NA 2PCLA 1OI4A 2B61A 1SF9A 3W06A 4HSEA 4I08A 1HLFA 4YAEA 4K03A 4G85A 3GMSA 1P7VA 2GK3A 3H19A 1RYYA 5HMMA 2VSOA 3OCYA 4UHDA 3MMZA 3GCWA 2C4WA 2NWQA 3OLVA 4WCDA 3QI7A 1WKCA 3KUKA 4MMXB 2BFOA 2WZBA 3OJEA 4LHYA 1U8CB 2HADA 4G0WA 5K3CA 1TIYA 4Q12A 5KWVA 2IXBA 3DE2X 4GM0A 3IP7A 3E1KA 1HQKA 3ANTA 2VH1A 2PVSA 3PEWA 1UJWB 3A6DA 4O25A 2IUUA 3WYDA 1Q6YA 1QHSA 3NDPA 4LCBA 1NKSA 2OBYA 4Z1MD 2PUVA 1GRVA 2HMWA 2YHIB 2Q7HA 5LP6A 4C7XA 2FPGA 1JJIA 1K8QA 3BFPA 4ZYYA 5JQGB 3JQGB 4BNVA 3FSJX 2DFVA 4DY6A 1ZGCA 4U7GA 3GFOA 4LXGA 1XLVA 4KK4A 2Q28A 1CEZA 4P2BA 4LNUB 2CVZA 1BFDA 3P7MA 4Z1MA 3TIXB 3IEUA 1CERA 3ZVNA 3NG1A 3CINA 5FEUA 3VYRB 3WGJA 4ZEOA 2OZPA 2EBFX 3SXPA 1Q91A 3I6YA 2EIKB 2JGIA 4Y2QA 2HN9A 5F76A 3AZQA 2ZBPA 1NVDA 4QDTA 2XYPA 1U8UA 3PEFA 4JX9A 2RD2A 3OFNG 3TTSA 2QVGA 4YHHO 1PNQA 5G1PA 4MULA 4UEWA 5CMLA 3ME5A 4CIYA 3ETNA 1IWPB 1T8SA 2VYVD 3LOPA 5JD6A 4QVKA 5DGHA 4EY4A 1UMCA 2FWPA 1Y0BA 4X6YA 1QZZA 2XV1A 2HCBA 1SWWA 1RMYA 1SRQA 1KBOA 3OCXA 1JQKA 3F5DA 3FKQA 3IL2A 1DC5A 3SYOA 1MB9A 1KC3A 2YHAA 1YDEA 1Z2GA 2MDTA 4IOMA 1J8YF 3LPAA 4ZRNA 3QVKA 1VCHA 4MV9A 5IT4A 3ZHZA 1C3LA 4M1MA 4QU9A 3AY7A 1DL5A 4FCTA 2GUZB 3ZVMA 1XQYA 1P0MA 4K9DA 4B87A 2G04A 1ZINA 1SUCA 1GK9A 2Z2JA 5EE0A 4D9NA 4IH9A 3QUAA 2H00A 2CF6A 2Q0QA 4C06A 4MWZA 1N0NA 1P1JA 2Y0PA 3G6EV 1EGHA 4CTNA 2CXHA 1Z9BA 1HUQA 1SVSA 1KAGA 3N0TA 2OG4A 4CMBA 4XUGB 2XCSB 4KGVA 3CF4A 4OCLA 4I4IA 2CHEA 2QTCA 1CZLA 5KYYA 4EEZA 1Y6GA 4CMIA 3ZCQA 2XJ4A 4UU7A 4HEA1 1ICEA 2ZM6O 5BW4A 1URFA 1X7ZA 4PZAA 3ZGVA 1U97A 2DQ3A 2O0KA 3M6IA 4PFKA 3KTFA 3AIKA 5GJWC 1Z7WA 3VJLA 1P4RA 3UWMA 3BDIA 4U8HA 1II0A 4EENA 1G6UA 4AJJA 2ZYUX 5FOUA 3BSFA 2D0IA 1RSOB 3A6FA 4RELA 4YWHA 4II7A 2JLAA 1R4ZA 3GNSA 3AJ9A 3M4NA 3OE1A 2C5SA 3FVTA 1CR2A 1GG2A 3LWBA 2GKGA 2H2WA 5DWDA 2Y67A 2ZWAA 1Y4DE 2H1LA 2M2IA 1RW4A 1M2OB 1DC8A 4UASA 4WT7A 4TSFD 3U3KA 1Z5OA 3QWFA 2GR9A 5M29A 1OTHA 3PT5A 1QNMA 5BN5B 1OGIA 1TMYA 3PGXA 1C7IA 3A04A 1IHDA 2X2EA 3MERA 1HV8A 1YQGA 2HQRA 3JAWB 1H0RA 4TSFA 1S2OA 1DI0A 2B3DA 4LYHA 4XRRA 4WLUA 4LF5O 2BL4A 3S1AA 4NK4A 1RPZA 1M2VB 2ZRKA 4JGGA 1PSWA 1L4YA 4BP9A 5LQUA 1PG0A 4CTJA 3HPRA 1YHYA 3USZA 1OXUA 1RKBA 2Y2UA 3A10A 1HG1A 5TC4A 3W8EA 4XCQA 4WI1A 3OEYA 2KLHA 3QWAA 2BM0A 3LLUA 1D4FA 5L40A 1FCJA 2PX4A 1WABA 4Q7KA 5M34A 1FLNA 4MDYA 3NHSA 4OMCA 4CS4A 1ANKA 1VKHA 1NYQA 5BQ5A 3WBFA 3PUZA 3RD5A 2ZVPX 4RZSA 2IEBA 4MW7A 2DKNA 4LHWA 5KX5B 1R37A 5GPBA 3F6SA 1SRRA 4Q66C 2GFQA 1IY2A 3BQMB 3TFQA 1CUEA 1L5KA 4DJDC 1JDBC 2DJVA 4KACA 4PANA 3UUGA 3OIUA 3V7FA 1SCUA 1R3JC 2ZNVA 1KVUA 4NIMA 3FYUA 1J0XO 5G0SA 2VRBA 5HIIA 2EZTA 1H8HG 3HCNA 3HB9A 4HWSA 2DT8A 4BV3A 3H2ZA 4UMFA 3AY3A 1Z2PX 3U9TA 1S9HA 4E2WA 1XQXA 1MMFB 3AI1A 3UK1A 4HH0A 4H33A 1V35A 3ANSA 3D4BA 3W04A 2HKIA 1EFLA 1NNUA 1ENVA 2ZRJA 3P5BA 4B43A 3ZN2A 1Z07A 4X94A 3BX1A 2RQ6A 3KQMA 2AR7A 4GOLD 4B4KA 4UU1A 4ZYVA 1BMQA 1M1ZA 1KTIA 4K5QA 1U0LA 4MV6A 1ZOOA 1VB3A 1FIUA 1AHNA 2XECA 3MUNA 2Q1UA 4R2LA 2W0XA 3NIGB 3WRVA 4OHKA 3EK2A 4ZJPA 4ZZ0A 4ONEA 2C8JA 3EVDA 1JHMA 4FBLA 4Q4AB 4NJMA 5FPYA 2V1UA 4X90A 2A59A 3MCZA 1A9SA 3U9LA 2BKEA 4X00A 4PFJA 4M0CA 3O3NB 4TTIA 5M59B 5AVRA 3JVIA 4J16A 4NBUA 4DMRA 5FULA 3FPCA 4NBVA 3MOSA 3R3VA 1ZH2A 1M1UA 1NOKA 1ESZA 3W1EA 4JB3A 4WD3A 4QHYA 1GZ4A 3QELB 4MSMA 4B17A 2PZLA 4DV2B 3V2IA 2CLLB 4ZI5A 1F06A 3LLCA 3PXEA 2ZLBA 4EJSA 1SVWA 4RE5A 4LWSA 2VP2A 3UFBA 4GI1A 2EBOA 3TVTA 2YWDA 4EGFA 3LCJA 5FOWA 3K30A 3LT1A 5K8CA 3EZLA 2P6RA 1YZNA 4LYEA 4KPEC 1MORA 4N0EA 5IKXA 3I45A 1TAGA 1DNPA 5J63A 1QBGA 5F9HA 2HSWA 1PQPA 3UB3A 4PAOA 3I83A 5G40A 4MUAA 1LTKA 1CG6A 3F90A 3R0QA 1YQWA 2GTSA 1XZFA 1OYWA 5JBIA 2QUZA 4DB2A 2HD4A 1N0JA 3L72H 3UW1A 1JQBA 4BO9A 5FV4A 1ZHFA 2PEYA 2YZ2A 3BXXA 3DAPA 3MTAA 3SY8A 1GTJ1 2VCEA 1FE8A 3P9XA 3HB0A 3ET5A 4PC1A 1Z4LA 2XDQA 2HXYA 2IP4A 4HPWA 2IPLA 2VL7A 4KR7A 1VYUA 4U1RA 2JK5C 3AR8A 1K7FB 5C4MA 2H59A 3JRWA 4Z0NA 2EF1A 2OZEA 3L46A 1J70A 3G2IA 2XLBA 5BZBA 1EP9A 1NKVA 1HT1E 1RXSA 3TXYA 3W9YA 1KBHA 3UWSA 4P4NA 1PNLA 4R50A 1N7IA 4RKFA 2GVZC 4MS4B 1BJRE 1VECA 3PSAA 1CIPA 3R6WA 2P4UA 4X5OA 1N1MA 1IN1A 5CGQB 3TZLA 3FSRA 1ZM7A 2D5IA 2LR0A 3FPGA 3UMVA 3THYB 2QVBA 4JGIA 4IVRA 3ZZ1A 1H0KA 3K3WA 5AVTA 3LVRE 5ECGC 3EIQA 4Z4EA 2PZFA 3RTDA 5M5BA 5E4JA 3ZD9A 3FFBA 1YI1A 1NVFA 3R44A 3VFDA 1WPXA 2F62A 2DMXA 3EJ6A 3T7RA 2D0OB 3W5AA 4N5HX 3A32A 1Y7LA 3MILA 4B08A 3CYOA 3MGAA 3P52A 1RR6A 3QY0A 5KCZA 5KSWB 2A7XA 3VUEA 1U0NA 1GO2A 4MR8A 3ZHYA 1V6AA 1T0BA 5KPDA 3K35A 2DFDA 1W2WB 3DWIA 5LNK1 2G9RA 3AHIA 4YJ2B 3AEKA 5H70A 4E12A 1TMGE 2QPLA 4ZK2A 1SUFA 2HY7A 3HXLA 1KI9A 4QTYA 2OEPA 1WN7A 1X1TA 2B3TA 1B8UA 3OPVA 2WTAA 1JQDA 1FFBA 2OVBA 4TYNA 5TEWA 4JMLA 2ORYA 1XTBA 4CN9A 4NU8X 2PZGA 4P30A 2EIMB 1UKCA 2O3RA 4CLOA 5DJ5A 1DIAA 2Z1MA 3SIPA 3QVGB 3W7VA 3F5SA 4XIYA 3KXPA 1JIUA 3U81A 4PCUA 2B8NA 3CVVA 4ZA2A 2ZTSA 3H1LH 3N3AC 3GLVA 2I6XA 2R6HA 3TOZA 1KETA 4UNRA 2MR5A 2EIKC 5DI3A 4B0PA 5F7OA 2CXQA 4EEQA 1EX7A 3IIMA 5AHKA 2J07A 1NVTA 4RDHA 2PYJA 3I6IA 3N1UA 3QLUA 4M7OA 3PRHA 1AKRA 2COEA 1S8NA 5A4FS 1I3NA 2WJ6A 3OE4A 3I2GA 1YB5A 3K0FB 4FMTA 1U9IA 1RYHA 1BOOA 2PTMA 2BGJA 3I04A 4R1NA 8MHTA 1YU6A 1W49A 4TL6A 2LO1A 4HXFB 1B00A 3R09A 1CUCA 1UFRA 4MICA 2BM8A 1ZSVA 2J9GA 4ENQA 3EZGA 5TF4A 3LVQE 1X86B 2ZRFA 1MV5A 1ZMOA 2XMDA 5LQKA 1ZICA 2W98A 1SS3A 1LBQA 5K6AC 3ROZA 4Y6RA 4E4TA 1U96A 1UM9B 1W4BA 3KRTA 1JXQA 1VSTA 3ZWAA 3TZCA 2ODQA 3HKEB 1NIPA 3OETA 4CU2A 1YS4A 1GN3A 4UVEA 3RRMA 3KOOA 8ABPA 4J7CA 3MIIA 2J1LA 4MPDA 2OFPA 4QDOA 4G01B 2V0CA 4PA9A 2QI9C 5HILA 2JCXA 4RXMA 5FNZA 4BAZA 3PHLA 2ZKIA 4MQBA 2DCMA 5L45A 4ER7A 5A5EA 4N3CA 4KN6A 1GRJA 5ES4B 2Z2KA 1I7DA 1OI7A 1D4OA 4UHEA 7REQB 3UANA 2W2LD 1Q84A 4OOFA 3VJMA 2VQEB 4JAVA 1NAIA 2IM9A 2R7NA 3GBSA 4I9FA 4QVIA 1PD0A 1RWWA 4ZEMA 2R85A 1NBEA 3LJKA 3ZN0A 2W2LA 3N8KA 1LPAB 2IPMA 2Z58A 1DLIA 1CLEA 4UBKA 3TZHA 3FDXA 4F4UA 1L9XA 2JAWA 3HDYA 3CJHA 1P6XA 3CGWA 1RAFA 4DDUA 4B3MO 3GJ8A 3U7RA 4OKIA 5ALGA 4TXHA 4EFBA 3KCYA 1ODTC 1E2MA 4YCDA 5LHHA 4CCYB 3PLAE 4BBPA 3GG9A 3SXJA 4UUJC 1ZD1A 1WUJS 1AV7A 1PHRA 2CXOA 4XR9A 3H04A 2Q7EA 3EXG1 2O8EB 3BTUA 1BEZA 3EMDA 5AOVA 1W6RA 3U19A 1H66A 2PPLA 1P4SA 2IP2A 1W2BU 5DM70 3RJTA 3KB8A 4PLYA 2BIFA 2EGUA 1HORA 1OZFA 3DC6A 2X5KO 2W2TA 3FMIA 4NABA 2EERA 2G5PA 1OASA 1I94B 1XAJA 3CJQA 1VP9A 2BEWB 1RYFA 3WDKA 4NBNA 2VJKA 4J0KA 4IYIA 2CLDX 4HN9A 5HIMA 4J0QA 3TRHA 4BDSA 4C0JA 1ND5A 1FFAA 3SPCA 3TI7A 3JXEA 3HB5X 1R3IC 1YNSA 1N2JA 4MEJA 5JY1A 3MBKA 4EJFA 3OPYI 4YAWA 3ZHQA 2HPAA 3MRVA 2QUIA 3FCXA 5CM8B 5CJ2A 3ZGZA 2Q7DA 3CNOA 4NESA 5IAEA 5DCYA 1VF7A 4FLYA 5SZHB 1NN1A 3B85A 4KFSA 3CCUV 5B2ZA 3ZY5A 4W5TA 2R1TB 2VT7A 4UM8B 1ISJA 2UUBB 4RFSA 4RWZA 5ITSA 3G85A 3EY9A 2M1XA 5CH5A 1QDLB 4WPGA 3CP1A 5AHWA 1SG6A 2NO4A 2X6TA 3AGQA 1UDWA 5REQA 4YALA 5ELXA 2ATEA 1RQLA 3GWGA 1V6SA 4IS3A 2CK3D 2XAHA 5EJ6A 2V6JA 3IGAC 2FPUA 3RARA 1NW8A 1UXHA 3U44B 2ZU0C 3ST7A 3ICOA 2VPQA 3L7JA 3H97A 4UBNA 1JGTA 2XZDA 1SQGA 4Q4DA 3E9RA 1J9GA 2DLDA 4RKYA 1NM5C 2NLJC 1DS6A 1F0PA 3BT7A 5BNWA 4ENVA 2CK3A 1JMVA 4HL6A 4BP1A 4R98A 3QMMA 2I8LA 3TZ6A 2GJ9A 4PNHA 4QLBA 3VH1A 3MJVA 3V7YA 3MWLA 5LWHA 2AIRA 3OY7A 4Q9NA 2EJRA 3E9MA 3FNQA 4CUJA 1CJBA 3B8HA 2O5CA 3P2YA 3ABMB 2B94A 5B4TA 5SICE 2VDUE 1YJ8A 1SVLA 4U9IS 3QNUA 1Q7BA 1Z2DA 4KE7A 2WM9B 2WVGA 4G23A 4O1MA 4XQEA 2G08A 2O06A 1RB7A 2XY4A 4R7GA 2HJVA 4JVOA 3CZPA 2VJOA 1C3OB 4UM7A 4S1TA 4H37A 2DHCA 2FN3A 4RMIA 2XXBA 2XUIA 3FD9A 3CLTD 4JXJA 1W4LA 1CJMA 2R8XA 1W0JG 1C8KA 1P39A 4DRYA 1M6VA 4J4TA 2H54A 4C5AA 3DE6X 1W52X 3K0BA 5CX1B 4NBKA 4N9WA 5ALNA 4MW4A 4ZALA 3AONB 1RRPA 5T7BA 5COBA 4H60A 2PCJA 3R9WA 4GOND 1H8EG 1T34A 3B9RA 2PGIA 3IUPA 4KXNA 2PE5A 1SC5B 4G8DA 2I62A 4H4EA 5DXJA 2XUGA 3JWJA 2C77A 2I7CA 4HCJA 5CA1B 3V48A 1WJGA 1QR8A 1JECA 1GZUA 4L2IA 3TL6A 3WL6A 4P3YA 3LWZA 1I7SB 2NR5A 1AMOA 3MWEB 4MDEA 1Z6ZA 3LBFA 4Q9DA 2FWMX 3RM3A 2X0KA 4EYOA 1NX9A 3NV7A 1GEGA 2YWCA 4LYJA 4GU5A 1YB2A 1FW8A 3BGSA 2DY0A 5KHHA 1A9RA 3HDGA 1ZD3A 2QN3A 3GOQA 2XIJA 1UBNA 1DKOA 4W4LA 3DOUA 3MOGA 4YB8A 2VS0A 1OVMA 4X97A 1M10A 2VCYA 1Q0RA 5L95A 1AT1A 5F9MA 5IDWA 1CU1A 3B6MA 3PRKE 1JKXA 4QXPA 2UZ3A 1BS9A 2AZTA 2QOEA 1NTRA 1EMDA 4WKNA 4I50B 1KD1W 4MO9A 2B8TA 1WCYA 4CDRA 3MLBA 1GM8A 1G20A 5E6UB 5EMNA 4EKYA 1X80B 2YYAA 4ZOLB 2GJAA 4G3MA 4XRGA 4PDVA 1J0EA 1YRYE 3NHYA 3F7NA 3VX8A 3JCZA 1JUDA 2VYCA 5IJ9A 2IH4A 2FXIA 4BC0A 4DWWA 3E82A 1DDIA 4RVUA 3VQYA 3OECA 2LZ0A 2ECOA 2V4UA 1A82A 1YC5A 3UO8B 4J0CA 4PINA 1YIAA 3TM4A 2AFHA 2A8NA 3PDHA 2DWQA 4FCCA 2K1EA 5A9TA 4GMGA 1GL3A 4V1CA 3S8YA 3FVVA 3QPDA 4L5AA 4QBTA 3NT2A 4RIIA 3CLSC 4Y0NA 1JPNA 1QVAA 4ESEA 3TYXA 3ZU4A 4HDQB 2W48A 4XYGA 2D7CA 2V7QG 3MXOA 2H0AA 2ZWVA 1X8XA 2EL9A 2I99A 4NU5A 1HNXB 1AI5A 3QUQA 4I2VA 3HVKA 4JVSB 1F2VA 2NN3C 5AK6A 2XMZA 3G8QA 4KDFA 4I9QA 1OD6A 1M73E 5JASA 1MR3F 5AK5A 4CL3A 5AT1A 4NE9A 3AVVA 3SAJA 4LN1A 4MGKR 2WM3A 4MP8A 3AEQB 4MMZB 1LY1A 3UYKA 5EZYB 4B6OA 4RGBA 4OHWA 2EIMC 4CS3A 4MAMA 1PWZA 3BH0A 3IAS1 2H1CA 3U80A 3PDIA 1B6QA 4YRJA 4DV5B 3UNXA 4FQ8A 4AZ3B 5EJEA 3PTAA 2NG1A 3LBHA 5GW7A 5D3MB 3DBHA 4LF8B 1KDRA 1XZIA 4RJLA 2ONYA 3D3NA 5KKNB 4QTTB 4B6PA 5HRCA 4OBBA 3QMVA 4ZT2A 5BQOA 1IH8A 4MWTA 4QPZA 4EVQA 3DL4A 1X9IA 1G20E 1CFZA 2OTCA 3L7KA 4I6JA 2DUUA 2QU7A 1KIMA 5K0BA 3S2IA 3NT5A 4L95C 3QH4A 4LI0A 3S2GA 2YJZA 5CBHA 1YF3A 2O07A 1DAMA 4P7GA 4FTWA 3NAZA 4P22A 3ZIAD 3WK8A 4PX9A 2XTZA 4BLQA 3RNLA 5HKOA 5KDDA 1YULA 1NI4B 4Q3LA 1DBQA 4KBYA 1TUBA 1FYVA 3KXLA 4IEEA 3N2LA 1XCPA 2AJ8A 2AFHE 3OQ6A 3ZS9A 4LG1A 1D5CA 1F51A 3GEBA 5B3AA 3ZIAA 4CM4A 4F92B 2D7JA 3HJRA 4HQFA 1Z0SA 4J6FA 1DPFA 2ID7A 3SSMA 1CVRA 2O2YA 3HXMA 2E3CA 3D0KA 2O7SA 1RBYA 1DXOA 2C5HA 4JI8B 1XSEA 2XOXA 4L74A 5EYPB 5EMLA 2NV6A 3SBXA 2PUWA 1Q2UA 5KYUA 1VIDA 4N03A 4Z9YA 1QB7A 4NCNA 2C9YA 1J90A 1MG0A 5H59A 1Z8DA 1YQDA 2YN2A 4PTZA 3NJRA 3TW0A 3K9LA 2C1XA 3OJWA 4KYVA 4WLOA 4QDJA 3SSOA 4DCGA 1T29A 3CIOA 4Z1OA 1SQ6A 1IHUA 2ZR8A 4IZHA 2H0QA 2YHSA 1JS1X 3JQBC 2NYTA 1IM2A 2PUHA 1NT2A 2IHKA 1KFJB 4MR7A 3FX7A 2ECQA 4TL9A 5THQA 4V03A 3QVWA 2OVFA 4LXHA 4H0FA 4C3UA 3PI7A 1Z4MA 3Q0TA 5BSKA 2E1RA 4BV8A 4QGSA 1YXMA 1T1RA 2HIAA 2J3KA 2A92A 2XZPA 1YOVA 1BYIA 3GLUA 1J2EA 1KEPA 2RJNA 2AJLI 1KMQA 1ZN9A 2QIPA 2AF4C 4L1KA 2C9DA 1HEIA 2ASVA 3SR0A 1RYEA 1ZIYA 2CE2X 3AM3A 3IBFA 4K9PA 5JMTA 3LOQA 2YY6A 3L49A 4R31A 2IBTA 3NYWA 4C7JA 2B20A 4PLCA 4GE3A 1T0IA 3HACA 4RWUA 5CXUA 1Y1LA 2W6JG 5CYPA 5FTLA 2Q3JA 1E1QG 1CTQA 4WINA 4X1YB 1I0IA 4G4GA 2WFLB 1NMSA 3DQQA 2WTEA 1ZABA 1MV8A 1UT6A 1ZRMA 3PNQA 1NP7A 5KYXB 3PZRA 1SULA 3ZX5A 3ZX6A 1F51E 1EVIA 5FV7A 4DA8A 1KOJA 3R5FA 1THMA 3B8NA 2QK4A 4JEHA 1N6PA 4NH4A 1GR0A 1MT0A 2CW5A 1E99A 3KJQA 5JSKA 1DLBA 2C3PA 5G3YA 2WSSA 3CEAA 2UAGA 1E8MA 3CUTA 5TB5A 5BWCA 1YRHA 3UPDA 1JR4A 1MN6A 4MO2A 4E1AA 3VVCA 2FRDC 4G5XA 1U02A 2OM2A 4XDZA 4HB0A 2H3HA 5I5EA 2A9VA 2NXCA 4INZA 4RPHA 3WNVA 1CTTA 3PUWA 3BGWA 3UVEA 4YYZA 3N2ZB 3GVHA 1LPPA 1VJGA 3HPLC 3WB0A 2HRRA 2ZI7A 4RENA 4Q4JA 4Y98A 3WGTA 1AB6A 4IDQA 4W1SA 2O8BA 4UCVA 3QOWA 3TW8A 1N6HA 2P5YA 2VXCA 4LXXA 2O2GA 1B3QA 3F5QA 2DFPA 5B5EZ 1P84F 2QEXV 1UAQA 5HJEA 2J6HA 2XNJA 4HAYA 1PLLA 5HF8A 3ZGOA 4GRDA 3R3JA 2CXXA 1YR9A 4W9NA 2XUQA 4JGSA 2O7QA 1X7HA 4TMTA 1X8KA 3A2KA 4MB2A 2ZI5A 1NP6A 3WLIA 2HSEA 1CB0A 3K0AA 1QJ4A 1ID8A 4Q93A 1M2EA 3ABMC 2ADMA 1S2MA 4AIRA 4UOQA 1FYXA 1MZFA 1DKNA 1GSHA 1JZSA 3SJ7A 3EHEA 4QOGA 2QM0A 1P4HA 4JZGA 3DFUA 2CVPA 3IBGA 3QEJA 1PCXA 4MUJA 1Y5RA 4LY3A 5JOQA 1UL1X 1WSWA 1YMQA 3UV3A 1LA2A 3MG9A 1AF4A 3SYCA 3L7YA 3O21A 3UAOA 2DJ5A 1R50A 4B3TB 4C78A 1QBKC 4EO7A 1DQNA 1KHHA 5EHIA 1VQPV 1NGSA 3GRPA 4CT5A 3WRYA 1PGQA 3K9AA 1JEEA 2RGBA 3E9EA 4ASUA 4YI5A 4Z4CA 3IVGA 4BB0A 3LVBA 2G8NA 4RNDB 2E4AA 3UKOA 5FLKA 1JPXA 1P9LA 1VSVA 1O6CA 4NC9A 1D0VA 4HDCA 3R7DA 2WVJA 3OX1A 4FR2A 1UBCA 1RHMA 4ABTA 4Q00A 2B1QA 4P80A 4ZKDA 2AOUB 4DVJA 2QZPA 1GAWA 3EEYA 4U7JA 3NM4A 2AC2A 1P5RA 3AY0A 4LE1A 4BNZA 3PE4A 2KMLA 4E3ZA 1HLPA 4FILA 4A5UB 5IUNC 3O4RA 1G7SA 4KIJA 3E8FA 4LVCA 2D1FA 3C3YA 3CONA 1CXZB 4M0EA 1FYFA 3UXYA 4ND4A 4PLHA 1BAPA 2OC9A 4XFDA 3UUFA 3LNTA 4Y7CA 4L8LA 4EX7A 5FOSA 4P3XA 3A9CA 2R9IA 3I4LA 1NJGA 5MN6A 5FBQB 3CEMA 5A9RA 4EKWA 2BKVA 5SY4A 2OD2A 3QKTA 2ZXWB 5KOIA 3GH1A 5F35A 2OILA 4C0BA 5IARA 2WWHA 3ASOB 2WP0A 3DBLB 2EC5A 5BSVA 3AINA 3ZHBA 3A1TA 4TV8A 5AXBA 2XTNA 3I2FA 4QWMA 5EOVA 2YV5A 4IMRA 2NQ8A 4HVCA 1H6DA 3G17A 1NVUQ 1NJ5A 1BD3A 3K31A 3WIVA 2J7KA 3NHKA 3B60A 1ZESA 1VHWA 1FBTA 4LF9O 4J0HA 3CCCA 2ATKC 2OAQ1 2O14A 1CUHA 1D0IA 4DMMA 3Q3JB 4ZOQI 1LBIA 2FPWA 2V7BA 4YDSA 5BQXA 4ZICA 2HRBA 1QK4A 4P92A 2VDWA 3PPVA 2G1PA 3NHLA 2NVUB 1H2NA 4QJBA 2ZUVA 2PV0A 2NX8A 1XCBA 4B4UA 3E4DA 4M0FA 4DR5O 2IS4A 5J4HA 2QGNA 3F73A 3RUPA 5D86A 2VQFB 4LJ7A 3PTZA 1Y5LA 2B8EA 1O5IA 1YBMA 4OL9A 3H84A 4MDFA 1H3NA 4LJAA 2BEJA 1CDEA 2X0EA 1GRNA 1BGXT 3K79A 1GCUA 2R65A 3LY7A 3IR7A 4A1OA 3C1AA 1B93A 1DG1G 4G9BA 3ONNA 1AKNA 2KX7A 4YCBA 4X44A 3HV2A 1B2RA 4YH1A 3HR4A 1L4HA 1GUYA 4CKWB 3ZRVA 1QLHA 1Z4IA 1I7PA 1UBJS 2NUTB 4RVOA 3D2CA 1NFRA 4H1WA 4QT0A 1GNQA 3R6GA 3AESB 4RK5A 4PVCA 3L05A 4B3IA 1JJ2U 4JI2O 1ZW1A 5C51B 1EPUA 1PZHA 1TFRA 3CZAA 4O1IA 1L7XA 4RKWA 4DIFA 1Y48E 2ZCVA 5DBFA 4R54A 2G9QA 2NW6A 4AKSA 1EWRA 1Z28A 2UV8A 4RY8A 5DLDA 3PQFA 5ERGB 1N2IA 2YFHA 3ZHCA 5SYNA 3PFGA 5FA6A 2PX5A 3P9RA 5DM0A 2XUJA 3RT9A 4W5NA 4B44A 1J7JA 4WFJA 1YZKA 2Z2ZA 5ILOA 3KYJB 1TO2E 3KLPX 1RI3A 4MAFA 5IYZB 3UPUA 2DSNA 1SOWA 4UM9B 1SBHA 2J5KA 3X44A 4DC9A 1H2WA 1Y5NA 4PPGA 1KQSU 5CLLA 4EW6A 3WFJA 1QO9A 3FWKA 1X1DA 4GGOA 2HBZA 4KQGA 3VQVA 3H17A 4X8LA 3PIIA 3I72A 1V4VA 3LT5A 3Q1LA 3WFVA 3ZWOA 1MJGM 4MQEB 1DAKA 4NXMB 1EZ4A 2GBLA 1ZJZA 1AZTA 4CMEC 1QG4A 4C22A 1WDKA 2JI9A 3FMFA 3RS7A 2X5XA 3FNGA 3A0BZ 2GCNA 1E32A 3ZHVA 4BNGA 1SGWA 3BHPA 1F0YA 1K7EB 5AUNB 4MKXA 2ONKA 3KXIA 2Z2IA 1IHXA 3N86A 1V5WA 2RB5A 4JI7O 2FUCA 2ZM5A 4A0RA 3O8OB 5K45A 2QGZA 2YIVX 4PZYA 2W58A 1V9CA 3DVQX 3AI3A 2YJ5A 1GVNB 2VP0A 4LBVA 1V6CA 2FEWB 5C8XA 4AMZA 5EIBD 3OZBA 4QTUB 1IHOA 2AA3A 3BWCA 5LOVF 4DQ0A 2KKSA 3DPSA 2HQSA 1VG0B 4P9EA 1FVHA 3FDJA 3UJBA 1SXIA 4MW6A 2EOAA 4U6SA 4ARIA 3NU1A 1V25A 1E66A 4CCWA 4WCEV 2IZ6A 3OTOB 2CDCA 1P62B 1KE1A 3BF7A 3DDSA 1Q14A 2FX3A 4LH6A 2A0FA 5KIAA 4LOLA 4BLWA 2IJHA 1NXXA 4K46A 4KYIB 5TGTA 3I0MA 4CTKA 5IHXA 3KEFA 1P7YA 3HHEA 2X1MA 2B8JA 4B7UA 1EFRD 3OF5A 1Z0DA 1YQ9A 5HZKA 1E3WB 5DSTA 3FFAA 1JDVA 3PITA 3KDAA 1AR5A 3G8DA 3CXUA 4ER5A 1MX9A 3K3PA 5AWFC 5H0IA 1EFRA 2XZLA 5LSAA 2A0KA 4O3FA 2Y1GA 1E5LA 1SHUX 4B34A 4KQ9A 4GX1A 2FPKA 3O47A 1O6BA 2LCQA 2LV8A 2ODTX 1TRHA 4JOSA 1QYIA 2E74B 3PEYA 3D3JA 4AJIA 2GXUA 4G5QA 4QU5A 3OZFA 2J3HA 4XOUA 2MMGA 2KLBA 1QIKA 2PLRA 3I62A 4B5LA 5TARA 1QONA 4PSVA 1E60A 4F96A 4CRWB 2QD2A 2KBFA 4IDDA 4EMSA 1ZK3A 1CK4A 2PJZA 2QXYA 2JIRA 3PWZA 3ZV3A 4GZLA 2Q1TA 5LBIA 3G13A 2GAFA 4I8DA 3IT0A 3RGGA 1XRQA 4BKUA 2HHJA 1QOPB 2DYSB 4F8EA 1Z7GA 1Z8FA 3IQDB 3BVPA 5CFRA 1RYBA 3QIVA 1SKMA 2FB5A 4A5OA 3IEVA 2BZGA 5EN4A 3BXFA 4FGJA 3MGGA 3CG4A 2Q21A 1U80A 1DBWA 4DC1A 3DOOA 4KR6A 1QF9A 3ZBHA 3FZYA 4IUCS 4EY5A 1HT3A 3FE2A 5EJAA 3HY4A 2J9FB 4FGLA 1M1NB 1ZYUA 4B74A 1JWLA 4AMVA 1E4EB 4AZWA 2AQ8A 1K4KA 3OT1A 2YQZA 1JEQB 1JDJA 3K72B 1P1KA 1DPGA 4DANA 1K73W 2BRUC 1MU0A 4HVTA 1GPBA 1BROA 4OD0A 5T3UA 1RE0A 1BXRB 5M04A 3ETGA 3E3OA 3BBPA 2GKOA 1PVVA 4CZZA 3K9GA 1ONOA 5BORA 2DB3A 2R68A 2FWIA 4WHMA 4P4SA 1HZZC 4EOGA 3ML1A 5IMBA 4XQGA 1MFPA 2P9TA 1HF3A 4YLGA 2YV3A 3RW9A 1X7XB 3H2YA 1TL7C 2WF5A 3DL0A 1PGPA 4P9OA 3WFIA 1KYIA 4I43B 4I55B 3CUKA 4M9CA 2Q5FA 4QIHA 1FNSA 3GPIA 4Z9FA 1XE3A 1ISFA 2WF7A 1ZJWA 1C1XB 1NR1A 1KJNA 5TY0A 3WAKA 5L51A 3L84A 2VG8A 5KYGA 4IXWA 2QRVB 1O4VA 2YICA 4JI3B 4D9GA 3A1SA 2JLVA 3EVZA 4H77A 1J49A 1JG7A 4HTFB 3QEMB 1L5RA 2OZKA 3ZK9A 2P87A 1H1LA 4XSHA 5DKFA 2AW5A 1Q44A 2VT3A 3UKJA 1B26A 1T36B 4GR5A 3PUXA 5JDIC 4UVIA 2WFZA 3LSTA 2PS1A 4ILEA 3HJHA 3V6LA 1WXIA 3K09C 1JAIA 1FUKA 1G98A 2Q6IA 1UFVA 3GLSA 5K09A 1Y8CA 1QVZA 2OUIA 2EJBA 1WOYA 2VJNA 1TADA 1DGQA 5EZ6B 5FH9A 2EW8A 3PVSA 1EFVB 3ZXSA 1XRPA 4F3KA 3SSNA 4D5GA 3TDNA 3ZD7A 3VX4A 5D85A 3BZWA 1PV1A 2EBHX 2JJMA 2DETA 5BQ3A 3EUWA 2B3ZA 1J24A 3BS4A 2QQEA 2A86A 2AEMA 5MHTA 1NPTO 2Z6AA 1T2FA 3PR2B 5IT5A 1S8FA 4NFLA 2ZXWC 1V16A 2GPWA 3PF9A 5LUBA 2JGDB 1WMFA 4K9RA 3ASOC 1HYHA 3K53A 3SFVA 4S1OA 2YIDA 2IYVA 2BELA 3VDXA 1RJWA 4ZAZA 2DWEC 1ZVMA 2R84A 7ADHA 3DFKA 4K1RA 1T8TA 2J6CA 3B9BA 3QYJA 3MN1A 4EFDA 1B06A 3M1YA 4W82A 4C2UA 2EXXA 1DAHA 1PL4A 4YMWA 3THWA 1K66A 3L70H 2PWBA 2RHDA 1OC4A 4RA9A 4UREA 1EM8A 1WZUA 3U4CA 1LTHR 4NJOA 1AI4A 4QLOA 5I7RA 2I4NA 1ACJA 1BG6A 1IUKA 2FRXA 4I9GA 3VO9A 3AK3A 3STXA 3G67A 4G0QA 4NU6A 2XVAA 3INNA 2X6QA 3P4XA 2ZREA 4D3YA 1PK8A 1VRCA 4KRYA 3IV6A 4B7XA 1JJVA 1TIPA 2AJTA 1GPUA 1NTOA 1UPCA 1JFFB 3GLHB 1C14A 5IAOA 1TT7A 2JCBA 2I3BA 5DNDA 2JIPA 3LFUA 3NBKA 4YY3O 1KDPA 1WNFA 4C89A 3L9XA 4DLVA 4I5DA 1D6MA 4NBLA 3W79A 2UDPA 1E3QA 3QYPA 1TCVA 4ID9A 4PNZA 4MRVA 1EBFA 2OAGA 5GADl 4UTVA 4YIKA 4PY2A 1AKEA 1JP7A 3VHXA 5BY2A 2H8GA 3PJDA 1FFSA 5LP6F 4O3MA 1MRNA 3LHIA 3R3UA 5CHEA 1ZI9A 1JA0A 4RQBA 1TYZA 3R20A 2OXIA 3DXFA 2R8ZA 1LWOA 721PA 3R3XA 1A27A 4WSOA 3QYFA 4PRYA 1K5GA 3H9EO 5HFLA 3G7UA 2MHCA 1OAKA 3SE7A 1AE1A 3GO4A 3OF3A 5FWXA 4MV1A 3RH0A 5FAKA 1MJNA 1Q3TA 4H4CA 4WCFA 3CNNA 4Q3EA 3USES 3C6ZA 1N8NA 1HR0O 3UXHA 1SPXA 4EF4A 3DAFA 4DNOA 1YE5A 3A1VA 2ZWPA 1NT4A 3GXBA 3AC0A 2GCOB 2KI5A 2XA9A 4E0BA 2RI1A 2PT5A 2Q6AA 5FDFA 1GPLA 3ROGA 1KYXA 1XROA 1RP3B 3S7TA 2FOXA 1R6XA 4OO3A 3Q7PA 2JJYA 4R9SA 3IDSA 1Z36A 4FVMA 5FNVA 3O9VA 3G2HA 1ZKMA 1FVXA 4IINA 4PAMA 4WESB 4I5IA 2AFRA 1A5TA 1ZSNA 3JWPA 5UKDA 2OKCA 1QK5A 3FETA 4QG3A 3OKFA 5ENVA 4NDAA 3THRA 1L7DA 3PHGA 5ICCA 1RC1A 4C4AA 5JXWA 4DG8A 2XMCA 2FMXA 4DV7O 3JYHA 1ZNQO 3EPLA 1EHCA 2R87A 1MQSA 2P7IA 4D4JA 4DLXA 4YMUA 2P90A 4QE7A 5EC1C 2YRXA 1ZWIC 1ODIA 1Q8IA 1U90A 4ZI7A 2BFFB 1K6EA 4IL5A 1WNTA 1FRFS 3OR6C 2WLKA 1XB2A 2O1WA 4HX5A 3TEJA 1JEAA 4IR7A 3VR3D 1Y1QA 2IYNA 1I6LA 3DZKA 1H3FA 2ISQA 3K03A 5JAZA 1PS9A 1JWBB 2JH9A 4DQVA 4A0SA 1T1SA 1E6UA 1YR2A 3K92A 3UT0A 3QITA 1S2GA 2UZ1A 3DL7A 2W90A 4JB0A 4YRAA 1GV1A 4ZN6A 3KCNA 4QFBA 4BMOB 2UYYA 2X6CA 3VR3A 3OD5A 4QQNA 3HFSA 1XLTC 3L1KA 1SC6A 1UEJA 3D8TA 4R3WA 3NC1C 4G5SA 5AW2A 3LYUA 4WF9V 2PJDA 2F43B 1DQYA 5L3FA 2DEUA 2Z6UA 3E81A 3PA6A 2D2XA 1K7SN 4UTNA 1YAJA 3LGAA 2Q0XA 3GUHA 3I34X 5IDQA 2B98A 5L3GA 1QO0D 2B78A 4E31A 2J3IA 5C34B 3QVMA 3O4IA 4BUCA 1CR4A 1JSLA 2VC2B 4EGSA 4KVZA 2XT6A 2V7TA 1U0TA 1RIFA 2GD1O 3WK9A 1D4ZA 3BL6A 1FFXB 4G8JA 3AEUB 5LA6B 1M1YB 4K3UA 4W1RA 2CSUA 4AQDA 1ODKA 1QO0A 4KGXA 1Y82A 1L8QA 4FUQA 3BULA 1WAMA 1P18A 4RY9A 2HEIA 1PNTA 2Q6TA 1V9LA 4BMYA 1JHAA 1SHLA 2AVNA 2FOLA 1WA8A 3QU2A 2BFDB 4ZT4A 1AA6A 3GP5A 1DBVO 1TVKB 4MUHA 3R65A 5GVRA 3L18A 1QAQA 3AH8A 3HB7A 2AEJA 1L3CA 2G70A 4UMVA 5AKLA 4PNEA 1CR0A 3AJEA 1ENYA 5BNZA 1FZTA 2CJWB 4RS4A 1U2ZA 2FMTA 4NWIA 3DTVB 4YMLA 2GEKA 1PEDA 1QE0A 1OY1A 3D3IA 1F0NA 3EW7A 4TXMA 5CLGA 2O57A 2VPTA 4MQUA 3UMYA 1VF6C 4MUBA 3QEAZ 1X7YB 2F55A 2ABWA 1A8HA 2GF0A 2DQZA 5EG5A 5IX8A 4R01A 1JFSA 4D99A 3H0EA 2FEMA 1DZIA 2WQ7A 4ZQHA 1O08A 4IHJB 1Z34A 3IE2A 3RTBA 5ULLA 1HPLA 2PUDA 4RLQA 1YRAA 4MZDA 5JANA 4CL2A 2PKYX 3B1FA 1NVVR 1PHPA 3FTDA 5ALHA 2DYSC 3Q7RA 1L1QA 3HKBB 3RKRA 3HYSA 3EXFA 4L57A 3CWCA 4X6LA 4M2LA 1RZUA 1W48A 3KQKA 3NBFA 4FONA 3QF4A 5KC9A 2BI4A 4DHWA 1PYGA 3QBEA 1FSSA 2NU9B 4RK7A 1FUYB 3TKLA 4IV0A 1H2HA 3E0QA 1VPEA 1XO1A 2R5NA 4HRVA 3WQQA 3OO0A 2RGXA 5H81A 1ZU4A 1B14A 1ENPA 3KZCA 4G26A 2G72A 1KAEA 3WO1A 2X7XA 4JD5A 4L27A 3KDPA 4OHXA 4ECAA 1QR2A 1QPZA 4URHA 1TM5E 1D6SA 2H9YA 4GXTA 1SJ9A 2FPRA 1VBMA 4E4RA 4N5NA 3HDJA 4XIGS 2YXEA 1YQUA 4Y2HA 1XD8A 2GAIA 1R9JA 4DLLA 4ZEWA 1Y5MA 3CLUC 2FG6C 1H2YA 2OWDA 1TM1E 5K03A 4FT4A 1JLSA 4PFSA 1UJ4A 2IEGA 4PWZA 5HWSA 2N42A 2MSKA 3IUMA 3T7JA 2RDCA 2I33A 1UWKA 1G3IA 1U6KA 3RAGA 4DPKA 2ZDGA 3X2SA 1EFAA 3LQ4A 1BWQA 3JQAB 1Y8RA 2P2NA 1NNEA 3D6TB 4FLFA 4NMLA 4NULA 1NL3A 4N8SA 5ALFA 1VYVA 3UH0A 2ZIOA 2CUZA 1JYEA 2V3VA 4FYPA 4C3VA 2WAYA 2ZU6A 1NHGA 2ASEA 3SJZA 3NI2A 5JNWA 2I2CA 4WWHA 1IBMO 3C97A 1IZ8A 5K7SA 5HGXA 3A2LA 5F5XA 2WWVD 4QDZA 2VDRB 5TQ2A 2BHSA 3OZIA 5EIXA 1SD1A 3NRJA 2ONCA 3HEMA 3TMYA 3KTDA 1RJDA 3QKSA 3K0DA 1K2VN 4RQUA 5EXTA 3SGIA 1HM5A 4MQFB 4N3NA 2B1JA 2GCIA 4ALKA 3GJ0A 1RCTE 1YONA 4FB5A 3N9IA 4DMKA 2Y6UA 4E2LA 2BLNA 4LV6A 2QLTA 2WSIA 3FOCA 2LXNA 1R8YA 3ETLA 3IPYA 1XQ6A 3BL5A 2YWRA 4YASA 5KKAA 5JNRA 4KFCA 1QCCA 4XLTA 5LQAA 1T0JB 4IOLA 1NLYA 5J2UB 2IH3C 1KS2A 1DBSA 4DCPA 4ZI7F 3A26A 1PWXA 5FF9A 4UE3S 3T94A 2VZEA 1J25A 4CKEB 1B0UA 2F1JA 3R8CA 4EG1A 1XD2B 4ZAGA 4A91A 1YASA 5B64A 4JI1O 5ALKA 5FPQA 3I37X 4R2MA 3KEOA 1UBSB 2O48X 5ANRB 5LLTA 4LFAB 3SD7A 4KRXA 2RGYA 5KWSA 4F38A 3F46A 4B7AA 3SVZA 4TTPA 2C9CA 3EPJA 2QL5A 4EKDA 5DNEA 3M34A 3JATA 1EWVA 2XUOA 3T8YA 4JNCA 3W4IA 4X66O 2X3YA 4WLNA 4G36A 5HK8A 3LQYA 1DJQA 1L5MA 2WVAA 2Q62A 2PJRA 3HKCB 1ABFA 3DMFA 4H44B 1U3FA 5A1JA 3M4ZA 2C0CA 1PWEA 1F8UA 4ECEA 4GBMA 3HA3A 1E9RA 3V8RA 3CCSV 3UJ8A 1FX0B 1SCIA 2OCIA 4GKKO 2FF5A 3SPJA 5I6DA 1Q6ZA 5I3ZA 4NE2A 3PE6A 1N34O 1U7TA 3I01A 4K1LA 3SYPA 1J7KA 2HK9A 5JS1A 3UJ3X 3MMPA 3N28A 4PO9A 1OJ7A 4AJ1A 5BOSB 3C5WP 4HS9A 1JA9A 3SX4A 4QE9A 5KNDH 2NV2B 1Q2XA 3U7IA 1OTXA 4A4DA 1GP2A 3V7UA 2ZVDA 2J3DA 3RASA 1KAMA 2J3EA 1QGDA 4OCMA 4K6CA 1AS3A 1ZA2A 4Z86A 4DLAA 1V8DA 3GGGA 2PUGA 3GCXA 1BVYF 4PIPA 5IUJC 3VSDA 5T67A 2WWIA 1TGOA 4U7PB 5K0GA 1YL5A 2R6DA 3ZPGA 3DT6A 1SC1A 3KFLA 4BWGA 4YRPA 1TJNA 1W8DA 5AUPB 3OM9A 4QICA 4DNPA 1ZIOA 1IEQA 3NC4A 1DC4A 2WOOA 5TGDA 1A8IA 1U99A 4AN0A 1AKTA 2WMDA 4H6XA 3STZC 4RAOA 4JASA 1JEYA 3GMIA 2QV7A 2PZBA 2A6PA 3MLEA 2EATA 4O02B 1T43A 1F4NA 3ABZA 2AXQA 2QRZA 4C7UA 4LWZA 1KZ4A 3ZOKA 4U7OA 3EGWA 5A9SB 3KR0A 1ILEA 3GX1A 1KJ8A 3MOIA 1J8DA 5BUZA 2QLBA 3QX7A 1SBNE 1YS2X 4TKVA 3TLGB 4TKZA 3ZHSA 4H3KB 5BN4B 4B6QA 4I0XA 5CR9A 4IYRA 1VXOA 4G63A 2RHOA 3V8MA 3AQ4A 1X1BA 3B38A 3UKDA 2GYYA 1NJFA 4J42A 5K9ZA 2H52A 3D7LA 4UDOA 1NC1A 5LVAA 4IIJB 3CMEV 5JSZA 2EKLA 4G2TA 2MYNA 1L5HA 3D1VA 3EZ9A 3S6JA 1IBSA 2FL4A 2VAVA 4OAOA 2GX6A 4RD2A 1W85B 2YOHA 1E9BA 4QXAA 3AXSA 3ZXYA 3AR6A 2I4TA 3PQ2A 5DWQA 3MSXA 1YZFA 1XZNA 5K2OA 1EFHA 4Y6QA 1XF9A 3WAGA 1Q21A 1JSRA 1UK8A 3KPYA 2OYSA 4NI5A 4LZAA 4NTYA 4PO3X 3DAYA 1FS5A 1FXKA 1NBWB 1YZUA 4MB6A 1CZUA 2EHJA 4B79A 3R5KA 3D6MA 4B0OA 1PV2A 1ZONA 1EE2A 3I9V6 1YDMA 3CF6R 4BP3A 6LDHA 3G1UA 4FCVA 2FN9A 2ID8A 2FRVA 2GEJA 4CUZA 1B16A 1U5BA 4Y2SA 1R0CA 4L9AA 3UN1A 4LSWA 4E33A 4UU0A 4AD8A 1DLJA 2Y77A 4TWAA 5FWYA 4NTZA 4ARUA 5CFQA 4CIAA 3QE9Y 2VOEA 1XN1A 1GPYA 4PYNA 3KFVA 5CT9A 1QVFU 1RBMA 4WOJA 5K5EA 2XB2A 2D5AA 3FKSD 4EFMA 5L3QA 2BR5A 3FPBA 1OLUA 4NBTA 2FGKA 3R5TA 4YC7A 3W5JA 2EJWA 5EWMB 4NEHB 1O7JA 4PX3A 5K0FA 3OZDA 4I99A 2FLKA 3OICA 4I3FA 3WG9A 4JEMA 3FKSA 3TLEA 1AK1A 2G0TA 3MT9A 5DM60 1US8B 1W75A 4OGFA 1SXPA 1J20A 3VVLA 1WX1A 3KCXA 1XCMA 4JJ7A 2IBSA 3O90A 1JHQA 3IDQA 2ZIMA 2WINI 3LBYA 4G86A 3T52A 4NFHA 2JI6A 5F7XA 4BGEA 4ZQGA 4HWRA 3C3SA 1RVV1 3WMXA 2ANCA 2GUGA 3GEGA 4PC7A 1OU4A 4D9JA 3WL8A 4I3GA 4YP1A 3WVNA 3ZYCA 3IR6A 3S3TA 2Z3IA 4AY5A 3O7WA 3AKYA 1TF5A 3GJYA 1GY8A 3RC3A 3AF4A 3KKOA 4INPA 3CCBA 1TB4A 4ZQBA 4YCJA 4OXQA 5J23A 3FTCA 7ABPA 2C94A 4D3FA 1Y42X 1G21A 4MRSA 2E4XA 3SBDA 2NNUA 1ZHOA 2VN8A 1MXFA 3CX5F 2GBIA 2QA4V 3GD7A 1LB1B 1MNAA 1HLDA 3ZI7A 2IW1A 4UFOA 3DDOA 4CM6A 3BK2A 3UJAA 1WMSA 3TSYA 4LHXA 2XMBA 4EF5A 4Q5IA 1Z0FA 1BE3H 4UUOA 2R4QA 2XCLA 3EEBA 2QR4A 1U8TA 1HYEA 3PC3A 2QZ9A 4O4JA 3BGOS 2AEFA 5KNCH 4WASA 4F85A 5C0OE 3LGSA 4G0YA 2GDZA 2AXNA 1PTKA 5ENDA 8OHMA 3X2FA 2OCHA 4YUZA 3OZCA 4HH3C 2RHRA 4BIZA 2FPIB 2V98A 1F6DA 3IP3A 3UOWA 4NNJA 4EYQA 1ZUNB 4JI5O 2EQAA 5KQSA 3NKLA 3LFTA 4X1KB 4F3RA 1II8A 1IJEA 2DHDA 5CAEB 1AUPA 4OK6A 1ULBA 2GN9A 2ZIGA 2C7PA 1QIIA 3EPHA 1CHNA 4GR4A 3TZKA 2YMLA 2O2DA 1HBJA 4D97A 5CB6A 1ZM2A 5IANA 2H94A 5CG1A 1ISPA 4CIBA 3N87A 2XEDA 3PN1A 5LGTA 4DBZA 2CLFB 3ICWA 1D1QA 4LJLA 4DR7O 4ND1A 3L0BA 2C5AA 2WSMA 3X1ZA 3OIVA 4ARAA 1VJTA 1U2PA 3TR5A 1BHBA 3E61A 4HYOA 4LBZA 2ZYSA 3X3HA 1SOUA 2M6SA 1F17A 5L3ZA 3QXCA 5C31A 3H5AA 1S5LZ 4AWAA 1GLGA 1U0BB 2JZOA 1NH2B 1ZMRA 1U1IA 5SZJA 2P9FA 4PLFA 3RVBA 1EWTA 1NKTA 2JIDA 1SZXA 3AO0B 3Q9NA 4FDTA 1G21E 1WAZA 4EYKA 4FD2A 3KYBA 3A1NA 1BWSA 1P45A 2P3LA 2QR3A 3T3OA 4BO3A 2OYCA 4BO6A 3FR7A 1NVVQ 1ICIA 2DGDA 3RHZA 3PNYA 1TOAA 3GRVA 3KB1A 4LGCA 4U39A 4FFPA 5IRCD 4CKBB 4MVSA 5HX7A 1KB9F 3AR3A 4A8JB 3ZWMA 1CJTC 4A0HA 2DTEA 4Q3DA 1CY6A 1BMFG 3LO5A 3E2IA 4EA9A 3T5AA 3MQ2A 1YKGA 5ERYA 1L2TA 3AVWA 3DCJA 1FKAO 3WYEA 1B76A 1KPIA 2JDIG 1KJIA 3LCCA 3Q6MA 4Z4GA 4BPBA 4OP3A 3WSWA 4XKJA 3MGKA 2F43G 3LQFA 2AKEA 1LRLA 1NSYA 1WMAA 3SG0A 3GDGA 3IMCA 3ZMVA 2VWHA 2WF9A 3UMBA 4WA7A 3PX3A 2WSSD 1KU0A 3FI0A 1D2RA 1BS1A 2UXBB 3T3IA 3COSA 4KN5A 2Q8QA 2M98A 3PIDA 4MI3A 2EYQA 1S96A 2CSXA 1HFWA 4UNSA 2WLHA 2UXCB 1OFUA 3EIHA 4EI9A 4HAOA 3INYA 1EAMA 3NDBB 5CDYA 2W2XA 5K0EA 4PA6A 3EGXA 5CCBA 2WDZA 2DHEA 2GEBA 3OZGA 4MPPA 4DZRA 4RK0A 4K8RB 5B1BB 4RH0A 1ZGAA 3SNHA 1XTUA 1SH7A 1SCBA 4B45A 3MTJA 5HF5A 5CA0B 2XD9A 1CHDA 5E9AA 1JJFA 2IFTA 2A30A 4W8GA 4P36A 4I9UA 4I19A 3R5HA 1XMQO 3PWTA 3NBXX 2P2SA 3QQ5A 2HTEA 1W0CA 2BEUA 5CVVA 5BSGA 1E0SA 1NVGA 4AZ0A 2OR3A 4FWIB 4EPWA 1E20A 1KQOA 2ZINA 2Y68A 4LX8A 2OGWA 3V4FA 2AE2A 2QVYX 1CWUA 1X0VA 4JYAO 2CUTA 3FPAA 4AYTA 1EE1A 1PFUA 3EVCA 4Q4HA 4LWQA 2C20A 4JF3A 3OAAG 2SKCA 4KSBA 1OT5A 4LD2A 4C03A 3JAKA 4OI4A 1GFZA 2Z8YA 3O1JC 1JIQA 3RS8A 3I1YA 2EWWA 1ZXBA 2XOKG 1EVKA 3EY4A 5CCXA 3P0FA 1Y7HA 2NTYC 3P9IA 2VDPB 5LDHA 5DECA 2EG5A 2H0RA 4GVLA 4ZVNA 3ZXUB 4ZD4A 3FB4A 2ICAA 3EG9A 2VH5R 3GPDG 1DQSA 3SGLA 4PF1A 1MB3A 3KKKA 2EFCB 2GM4A 3TBKA 1HP8A 2AGAA 3T1TA 4M4SA 2Q4DA 4ASUD 1JDSA 5IM4A 3K0SA 2X8AA 1KEZA 4XGIA 1TUGA 4CXMA 4CZ2A 1AN9A 2AZXA 1UMDB 1HE4A 3OT7A 4PD4F 3D64A 1GZ6A 2C1EA 4V0QA 1Y67A 1FUIA 1A32A 4YP5A 4O8YA 5KNDD 3MYYA 1SIUA 1T13A 3HG7A 3WLRA 4O4JF 2IHYA 1R66A 3DBOB 4NOJA 4IILA 4BVBA 1VPLA 2H85A 2Y4OA 2CNBA 2KG7B 2VT6A 2E75B 5KNDA 1J0AA 2RI6A 5LYJB 4IICA 1Q6IA 5K0NA 2W2PA 4LS3A 2DULA 3SJCA 4LHZA 1SZJG 2HYDA 4KIGA 2UU9O 2CNLA 3GFSA 3DD5A 4NZYA 5JJIA 4HAVA 4IIGA 3MCWA 1O95D 1IZZA 3FHTA 2GB4A 3C6BA 4OL0A 3GLIB 1K6XA 1KYYA 4BVAA 5J2TB 4PGFA 3UV6A 1AI7A 1I7FA 4X93A 3I05A 4XWTA 2IYSA 2O7NA 4JELA 1YJWV 1GUDA 3E27A 3PBKA 1O95A 3CSXA 4IVQA 1GSAA 3OCJA 1ONSA 1OAOA 4U8GA 4Z0PA 2QWNB 1KNXA 4GR9A 5IKMA 3C5EA 1S3FA 3U0BA 3E22A 3DDWA 3PWSA 1EIZA 4WY5A 2PGNA 3D8HA 1MMMA 2W7TA 3K6KA 3DZ8A 4GC5A 4M38A 5CNMA 3B13B 4N7BA 4M0KA 5CPBA 3CHXA 1E7YA 3TNFA 4QSHA 3FKJA 4RY2A 3IC9A 5KJFA 1OB2A 2WK1A 4FIPC 1KFEB 4MH0R 2ZSKA 2O6LA 5J1SB 1NQUA 4EJ2A 1TAQA 5D1NA 1A9YA 1EBUA 3K70B 4I5EA 2XE6A 2XUHA 4C05A 3Q2OA 4M0DA 3D59A 4FFDA 2IJJA 3RRZA 2O7RA 1DF5A 2I34A 4Q47A 2QNRA 1BQZA 3HA2A 3QA3E 4MVCA 5ADHA 2QT1A 2DKFA 3KZNA 5BSFA 1NZFA 3FTNA 4JU8A 4RD6A 1U3UA 3UUWA 4AO6A 3HYNA 4NEGA 3RFXA 3B09A 2PZKA 3EA0A 4E2ZA 1SCJA 1JOYA 3V9AA 3T5MA 3DEAA 3MF4A 4MRNA 4LXYA 1H1TA 3H1BA 4OSOA 1U65A 5B58C 3EXIA 1MA3A 4Z8XA 3UJPA 4N21A 3SC2B 3NOVA 5JW6A 5BRNA 5KAPA 2CKDA 3P0JA 1OYYA 4AHCA 2Y0IA 1RWQA 2KB0A 4GSKA 5JHHB 4D26A 2E82A 3MWGA 1A5AB 2G1KA 4EM6A 1AJNA 4YVFA 2O50A 5AESA 2WKSA 3CLKA 4U0KA 5TEVA 2UVQA 4JHXA 1ZL2A 6REQA 3PFIA 3E03A 4UAVA 4BBJA 1ZOSA 1EXDA 1YFLA 1ORIA 1IDN1 1P91A 4HB2A 1H2XA 3KJIA 4YREA 2IF0A 4II2A 2X5OA 3G7SA 3GLFB 1OF1A 5CT6A 4QAJA 4J6EA 2WHPA 1Q0TA 4LEIA 4HB4A 2QVZX 4H7JA 3NHBA 1H9AA 4X92A 5LGNA 2DZDA 3T4DA 1OKKD 3R75A 3JYOA 5B7NA 4BFWA 4XLLA 3W78A 5TV2A 3TIVA 3KYDB 5MN5A 2FLWA 4EUNA 3G5MA 4BNMA 4C6HA 1KPHA 3IFSA 4C4ZA 2PKEA 3NAGA 2H3OA 3OHPA 1WUHS 1OKKA 5A62A 2C3MA 4KXYA 3ESYA 4FNOA 3ZVRA 1HDYA 1ZXLA 4L3VA 3JZAA 5G4KA 3O26A 2CVOA 5FPTA 5E4YA 1J5PA 1R8QA 4OMUA 2CL0X 4XA8A 1E2DA 5ADWA 2NUPB 2P9ZA 1DWOA 2IXTA 1A5SB 3OIFA 1Z6GA 3JQ8B 1W94A 1F4MA 3C3EA 2OSVA 1IQRA 2BTEA 1Z2EA 1QHXA 4Q21A 5DT2A 3UK7A 1CQXA 2QKAA 3UJ9A 1MBZA 4RPLA 2P4KA 5E9WA 4HOYA 3N58A 2XWBF 3QVNA 4DNFA 3GL9A 2UYHA 1NW5A 1UZMA 2NYAA 4MIYA 2RAFA 4LMRA 4ADSG 4HGRA 1KDZA 1C7FA 1RJ9A 5BSHA 1TUEA 1CZKA 2F23A 3Q10A 4Q6WA 2COKA 3ZDXB 4B1FA 5IWAB 4Q18A 3E2PA 1NNI1 5KNCD 3R23A 4FHFA 3AJ8A 4KXVA 3AK2A 4P5PA 3EC2A 3AHJA 4AWBA 4YCMA 2G9VA 2LD4A 4MHTA 3I56V 3E7PA 4TS3A 4Y6SA 2YHBA 2I3ZA 4HGNA 4A27A 5KNCA 3LDAA 5A2QA 4BUJA 5BO5A 1NYTA 4ZQCB 3IALA 4UAUA 1NPDA 5DHUA 3OMLA 3ADCA 4AULA 1N6LA 4HBZA 1JFTA 1WXFA 4DY4A 1F5SA 4KR9A 3Q7EA 5T8KC 6GPBA 5F2VO 4M88A 3ABUA 4WRRA 3RSFA 3ZQ4A 2DN9A 2OORC 5C1IA 1QS0A 1I5EA 4B48A 5H3LA 5AP9A 1NFQA 3KOMA 4YCLA 3P26A 4A8JC 2H5IA 4FB4A 1OI0A 2YUTA 4CJXA 3M6UA 4ZC8A 1IB6A 2D5BA 5KSZA 4BO0A 2F4VB 1IL0A 4PQRA 4UCUA 1HEYA 2ZYIA 2PMCA 5JAIA 2YMQA 2I4RA 4DL9A 3W7AA 1PR4A 3QMPA 4MYCA 1R4MB 1YDGA 1X7WB 3U7GA 4CMHA 4BFCA 2JGUA 5BQPA 1U0EA 1MTOA 1O6GA 1EYZA 2HVWA 2H4FA 3CGGA 9MHTA 1V48A 1QANA 3LV8A 1XTPA 3WICA 1UC4B 4HWTA 4ZVTA 5EP2A 4XASA 2DMRA 3QEBZ 3QE3A 3UAZA 3DXXA 1FDWA 2LRHA 1S02A 1SWVA 3O75A 1XLWA 2GN1A 3RFUA 3OM1A 5KSYA 3FLEA 3HN2A 4J07A 3AHHA 3KNZA 3TGLA 1H6AA 4ZTBA 4WOBA 5IT9A 5G4LA 4EEXA 3AHCA 3UATA 1E4YA 1K88A 3HEBA 1SUPA 4DM3A 3A3YA 4OQEA 1GZ7A 4ZOCA 4TV8F 4CF7A 2GEUA 1LVHA 3C0KA 4MA4A 4I6GA 1V71A 3LCVB 3C7TA 5B1EA 3O93A 1JNXX 5B1BC 1V8OA 3AETB 1ZOIA 5IC4A 4FYKA 3S55A 1SUDA 3PJFA 4B3JA 1DCTA 1AROP 1K75A 2CV2A 1GARA 3A1CA 3OIGA 3RRXA 3VPBA 3PQ5A 2HLNA 4GPD1 1Q74A 4HDNA 1PL7A 3DM5A 3KV1A 2W6ID 1G63A 4UQLA 2FR0A 2EVWX 4U7HA 4DLRA 1XZLA 2XNHA 1LPOA 4KXQA 4E2YA 1PZFA 2CL6X 3N2NA 1QGYA 1FVFA 1SVMA 1CQJB 3IYLW 1YZYA 4TT8A 2ODMA 4H1TA 2W6IA 1R7RA 2G4LA 1B6GA 3N8GA 5LBUA 3FPKA 1U2DA 3T1CA 1R00A 4NARA 2FB9A 4W4KA 4B4VA 3HR8A 2I2WA 5FT9A 1HQYE 4NPAA 4DZZA 4MSWC 1CV2A 1DXQA 1QGZA 4O2BB 1QQTA 1E3DA 4N01A 3DH0A 3B1JA 4RANA 4XJTA 3GJZA 2C4MA 1UXJA 3WWYA 4ND7A 1DCKA 1OILA 3PRYA 1QVRA 4C1BA 4QBHA 2F8SA 4I4LA 4D4IA 3PYLA 2IWRA 2OBMA 4RLFA 4E7PA 4U2DA 3VR4H 4FYMA 1BMDA 1E79D 3IMGA 2H5EA 2XYGA 1BIFA 4X8HA 3HZOA 3VSCA 1TYAE 4EG7A 1I33A 1MUUA 2QROA 2IK8A 4NEQA 1QQCA 1IEWA 2BFEB 3HWWA 3RBAA 1HDEA 1NQOA 3ADDA 2PF4E 2WY2D 1E79A 1MT3A 1UJNA 3ZTWA 2F3RA 5IASA 1ECCA 2H17A 4RHUA 3TKYA 3U3MA 1QZUA 2G28A 3E3LA 6ABPA 1QLNA 4W5RA 1II9A 4ZO7A 2W2VA 1CZHA 4TKUB 3C4QA 3QLTA 4GHWA 4OHOA 4ZU1X 1VQMV 1NJ2A 3LNNA 2O8CB 4MSQA 2FPXA 5ALVA 4DIDA 3V3KA 5L3CA 4RDXA 5JD3A 3BMNB 3RJMA 5F1KA 4D10F 2L6LA 2BC9A 1JI3A 1ULHA 4G1UC 4LF4B 1AB5A 1WLYA 3M99B 3KVRA 2UUPA 1V1JA 4G27B 4KLNA 4HDRA 4QYIB 3U3DA 3ZDFA 4QXRA 1XHEA 1GT91 1KI6A 2W0FC 2FZGA 4FU0A 4GMFA 4E0QA 4HDKB 2JIOA 3L73H 2JS3A 1XWFA 2VLIA 2IEDA 4RPGA 4LMBA 2G82A 3PUJA 4XX1A 4C1NA 1A3CA 2ODAA 4YTEA 3VKVA 2D06A 4LYYA 2F1HA 5DHTA 1JB1A 3VZRA 3LWNA 1W44A 3IJ4A 2CCGA 4N18A 4YV0A 1KZGB 3Q15C 4JC8A 1HTBA 2ZSJA 2JJ2D 3OCUA 1BHSA 4PGGA 5LL6P 3GLRA 1YI0A 5HJ7A 1UBRS 4CM5A 4TS1A 5KHAA 2D2FA 2CB9A 2GNOA 2VHVA 3KUCA 1EFPA 3HQ4O 5FWNA 1SKUA 2A0UA 2JJ2A 1S6YA 2O20A 3K70C 2PH5A 4B9EA 1CY4A 2J3JA 2WG0A 2WMOB 2H9AA 4QG7A 1DKMA 3GVXA 2XD4A 4YT8A 2MSNA 2M32A 2QLCA 5FBVB 1V1MA 2ZCUA 4MITA 2ZBEA 4Q24A 3MCUA 1Z0JA 4R84A 3W1VA 2FZ5A 3SJBC 3E9QA 4JUCA 4NYIR 1XNQB 1HE5A 5BSTA 3WGLA 3ZTYA 2X58A 1ULSA 4IFTA 4NKGB 3GJ7A 1OHHD 4XCVA 2LJ2A 1KWGA 3A4MA 4HLQB 4EZBA 3WI7A 5E9JA 4MVJG 2Q5CA 2FJPA 5I9SA 2LIPA 4C4PA 2EZ9A 3HL0A 2BHRA 1DBPA 4LMPA 3D1LA 3Q3VA 4YMGA 2JJ1G 4CPDA 1OHHA 1U7ZA 3OJLA 4GS5A 1ECFA 4K8OA 4A2PA 3WHLA 3HB4X 4NU0A 1X2EA 3KYIB 13PKA 3RAPR 1VDZA 4YNBA 4PONA 3AF1A 4A7PA 1KS9A 1W5TA 4MUFA 5DHFA 1LW7A 3I0ZA 4FDLA 2Z3YA 4ZD5A 3OQMA 5A3SA 4PZPA 1NZJA 1T9ZA 4RULA 1E9AA 3PPIA 1VOTA 1K7YA 3F78A 1CYDA 5TRTA 2D13A 2AZ4A 2PMBA 4E2FA 3KSUA 5YASA 4P6VF 4DZTA 1GTL1 1CZOA 1AP6A 2C29D 1YCDA 1SXGA 5FTJA 3CRNA 3OMWA 2GN6A 1U1DA 1YK0A 2DUMA 2CLEB 2YVUA 3CO5A 4CEJA 3OPXA 1TU4A 2JBHA 3G4SV 3WWEA 1RACA 3ZZNA 3N2KA 1XN4A 3IGFA 3K4HA 1XFDA 2X0NA 4FC6A 4C29A 3F67A 5GINE 5D6NA 4K28A 4GWLA 2YVLA 1E64A 3L7OA 3T12A 1JR3D 2CYCA 1XEXA 3EBPA 4QQKA 3A36A 4YUYA 2RE8A 2A9PA 4KE6A 2A5YB 2P68A 5FYQA 3DMTA 5DGCA 3DYIA 3ZBTA 3LUPA 1JR3A 1F23A 3HFRA 3R3ZA 3ADKA 3BHMA 4KV9A 2EIHA 3QU4A 2OV8A 3IH5A 3M3PA 4KR3A 3C3DA 1C2TA 4YHBA 1NYLA 2XVZA 3DWGA 5LU8A 3JQFC 4ETIA 4YT5A 1HL7A 3BJEA 1GXSA 1QF6A 1G291 4D8YA 1Z0ZA<