1THZA

Crystal structure of avian aicar transformylase in complex with a novel inhibitor identified by virtual ligand screening
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of avian aminoimidazole-4-carboxamide ribonucleotide transformylase in complex with a novel non-folate inhibitor identified by virtual ligand screening.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 217
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1thzA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1thzA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1thzA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1thzA02
1WO8A 1IK4A 5H3LA 1KEEA 1C3OA 1CE8A 4A1OA 2B1IA 1S89A 1A9XA 1PL0A 1OZ0A 1G8MA 1B93A 2B1GA 1JDBB 1ZCZA 1CS0A 1S8AA 1C30A 1THZA 2XW6A 2X8WA 3ZZMA 1VMDA 1T36A 1M6VA 1EGHA 1M9NA 2IU0A 2IU3A 1PKXA 1P4RA 4EHIA 1BXRA 2YVQA
chains in the Genus database with same CATH superfamily
6CHYA 4C7VA 3C87A 4D3DA 3G2HA 3NB0A 5CT5A 1E96A 4AI6A 3B53X 3CX4A 3H6HA 4L8GA 5IT0A 3G89A 2WHEA 4DBLE 2J33A 2EKQA 2ZCVA 3DL7A 1PL0A 4XPZA 1YDMA 4RABA 3QI2A 4JI4O 1BH2A 1OT5A 1ZYUA 2VJKA 5CURA 4S3MA 3TMAA 4JT4A 3A0UA 1W0KG 2VQ6A 1U8FO 3V8NA 3ZU4A 2WUVA 5DEIA 4O4LB 2BONA 3R5JA 5TT0A 3WNVA 4F4FA 2G6VA 1FYFA 4W7HA 1ZH0A 1CBUA 1NJ5A 3RVMA 2YJNA 4OHFA 1KZHA 1SY7A 1U5CA 3FNIA 3MAAC 4KN6A 1UOPA 1EXNA 2VN8A 4CNQA 1NRIA 2VDNB 4PLZA 5T4BA 1O5OA 2Q0OC 2OGZA 4V0NA 2AT1A 5EUBA 2FWIA 1GTZA 1NV9A 5IC5A 2PGIA 3A1WA 3A0HZ 3ZGYA 1MT3A 3TK1A 1T8YA 4ZC8A 1OTXA 3AMVA 1UM9A 2HQOA 3LWDA 5BY2A 4GMGA 3W3AA 5JXWA 4UB6Z 1MN6A 5H59A 3QE0A 1R0KA 5TX7A 3CXCU 4TVBA 4CLEA 1DIBA 2C1ZA 2OSBA 1VBMA 4LYDA 1JIIA 2EZOA 4LWSA 3GGDA 1I6LA 5H5JA 3CGWA 3H9GA 2FP4A 2XVAA 3BAAA 3H1LH 3GA5A 1AKUA 3F9IA 3QK7A 4ZODA 5DB4A 1LD3A 2CJFA 5TARA 1AHHA 2Q0AA 2G0NA 4PC1A 2O59A 2Q5JA 2H4YA 4LY3A 1TQ2A 3GFFA 4QIHA 4XUEA 1M5TA 3B2EE 1G6OA 3IFSA 2UU9O 5TR9A 5GMOA 5LYJF 3DBIA 2PWAA 4Q16A 1H4TA 3R2NA 2DY0A 3UJNA 1EX1A 4Q48A 4ZVSA 2PZFA 2SKDA 1EFRD 1FUEA 4Y1FA 1QU2A 2EIJC 4URHA 1L3CA 4GKBA 4DSUA 1R3JC 4XUCA 3AEIA 4UVEA 2OQVA 2I3DA 3BRSA 2ET6A 1BYUA 3HJHA 5BN4A 5J40A 2HB6A 5KYNA 1VE3A 3DT6A 3VMMA 2OHJA 3MTBA 4MWGA 1E7YA 2HMAA 3NYWA 3PC2A 4XLTA 4CLXA 1GZHB 2PV0A 2I7VA 4P9EA 3EFHA 4PFQA 4QZVA 4G4GA 4Q19A 4II7A 5TRTA 3MN1A 3LQ4A 2NT3A 1M2FA 3CW8X 2WY2D 3K9FC 1C29B 3TZCA 2VCYA 4KOAA 3O65A 1SXJD 2Q0XA 3DE0X 3LUFA 4P5EA 2PPLA 1ZRHA 4U2EA 4GGPA 1DBPA 1F17A 4WCEV 3B6ZA 2VWGA 2WFLB 3A1NA 5H3CA 5B1HA 2P1RA 1DOAA 5AI8A 1E7RA 1AR5A 3IJ4A 4KFRA 4AO7A 5JARA 1LS6A 4YRIA 5JTUA 3HB5X 1T3GA 4IIGA 1R3UA 3EMDA 3VKWA 5L3QB 1C0EA 1M2KA 1MMMA 4P7GA 2E75B 1PLKA 2OB1A 1J56A 2XT0A 3TSYA 3F6YA 3PEUA 4EPRA 4BGDA 3LCVB 1FQJA 6PFKA 5KVQA 4DQ0A 4RZIA 3TQSA 3KL2A 4FK8A 2Z5VA 1D8AA 2WG0A 1BS2A 2OQ2A 3STHA 3PD0A 3BQ9A 3CE6A 4ZDJA 4KPEC 5G40A 3VHXA 3MC1A 1AQNA 2VHJA 3TCUA 4QHYA 4AYTA 5CN0A 1QYWA 2J6HA 2PWPA 2VCHA 3ND6A 5EZYF 5KHJA 3E9RA 3GAAA 3RVSA 1M7HA 1E2MA 3C97A 3QW2A 3BM5A 3KXLA 1HDOA 2AG6A 3T3EA 4D8YA 3OQMA 1Z4JA 2HEGA 5A7FA 1P44A 2PMCA 2B2CA 2XAQA 3PEWA 1ZJWA 1UC4B 1XQ9A 2Q4TA 2Q9BA 4LDAA 4P82A 4CM7A 5FR2A 3CX3A 4B71A 4K0KO 5DNYB 4LNHA 4DOMA 3FMIA 4MVXA 3ZTWA 2O9JA 3OPNA 4GR9A 4U2FA 1OFGA 1P4SA 5BZBA 4A6PA 1EYZA 4EGJA 7REQA 3PDIA 3T7JA 1QQAA 3ORHA 2VHUA 4GI3A 3FHLA 2J9XB 2YC4C 3EGOA 4CMCA 1OVMA 1LI7A 2C77A 3PHGA 4KMSA 5FYDA 1LC3A 3X2QC 3EBOA 1CLEA 1T5HX 1G291 1H5NA 2BKXA 2C3PA 1X7GA 1ZS9A 2ZSJA 1ZR4A 2A1UA 5CB4B 2AK2A 1GNTA 2FN9A 1SQVH 5H4HA 1G8AA 3RVQA 3UAYA 1X7XB 3ULKA 3DV9A 3WLLA 4MYTA 1P4HA 1T4DA 2F3SA 2OLEA 2ZRPA 1E2JA 5KYXB 2GAOA 3CQ9A 3EODA 3PX3A 4NZPA 2OHGA 1YDXA 4E88A 2CBGA 4K3UA 3TFWA 1YJCA 2I2DA 4KL1A 2R1TA 1FJGO 4IQ8A 1KI2A 1PZMA 1GM9A 4ZVRA 3THYB 1T2DA 1TA4A 4MW6A 4BS9A 1NDQA 1Y67A 4PG8A 2O4CA 3INGA 3ID6C 2JCXA 3AKYA 4ME6A 4REOA 1H93A 4H6PA 3WYAA 5JIBA 1XNJA 1VIDA 2JZCA 2P6JA 1SKBA 2OGUA 3MGKA 4G3XA 1KI1A 1LNSA 1Z6PA 4QUGA 3CR8A 1KOFA 1G1XB 3H2JA 2VUSA 3CZPA 5HXAA 3BE6A 3RJ9A 5IDWA 1XL1A 1Q57A 1MCZA 1FRNA 2C84A 2ZIUB 3IDQA 1SHZA 2QTMA 3M6UA 3OZEA 3G4SV 4I9QA 1XU4A 1ZM3A 2X3UA 2DPGA 3A28A 1W4AA 5IW8A 3LU1A 5TF4A 4W5TA 1TLTA 3HG7A 5JJ5A 1OXMA 4Q7MB 1L8LA 1VP9A 1M34A 3P5BA 3RW9A 2V7UA 5KKCA 1STOA 3AM3A 4DV4O 3ELDA 3H17A 1FLDA 4N5IX 1E62A 3BTVA 3Q9LA 3ELUA 5CU7A 5AXCA 1KEKA 2LUOA 2XBLA 1R0RE 3Q7EA 4OSOA 2ZSDA 2O5CA 1SBTA 1V0JA 1U28C 1EGAA 2PXXA 1IAVA 1PGNA 1PQWA 2LV8A 3NHWA 1HLPA 4WCFA 4C43A 5JNTA 1PNRA 4TLCA 3CIFA 3I2IA 1IC6A 5EIWA 1KTVA 3L8CA 5CNKA 4AWXA 4EYQA 3ZE1B 5H8WA 1PFYA 4JGSA 1ZUWA 3IJRA 1V7QA 3HKEB 1VF6A 3K9BA 2XNCA 2XUJA 1WULS 4I8IA 3NVMB 1ZNXA 1LLCA 2P9HA 5GAJA 1DQZA 1V26A 2AG8A 4EA6A 1XA4A 2QLCA 3KJZA 5SZJA 3W6OA 3E22B 3V55A 4AJ2A 1NN5A 2A1TS 2BFEA 3HPQA 1GQ2A 2RN9A 4L1KA 5CYPA 4NABA 3TQHA 3O4HA 3GP8A 2EEZA 3LCUA 1K92A 3LT2A 4P33A 3LZDA 2HIMA 1MO3A 1QPZA 1SOUA 3HU3A 1E0DA 1YASA 4HWRA 4PG7A 1W5BA 3U5TA 4DANA 2HF7A 3PXGA 3D54D 4GMXA 4IGKA 1ONPA 4NCAA 2P62A 5IYCO 2N05A 1QG0A 5ELMA 1JU9A 4J7JA 1Q7RA 3BKWA 4FSDA 4M37A 1JHVA 1D6SA 3S44A 3GFPA 4P2ZA 5F64A 1BS3A 1I8TA 3PTAA 1UJ2A 4I8DA 1YF3A 4WN9A 1M76A 1FRQA 1RKQA 1P4JA 3H8VA 3UN1A 2P6UA 4V1CI 1MQ0A 1DP4A 2VP9A 3AK1A 4MJXA 1ST2A 5AESA 5EZSA 5L3GA 2QU8A 3EARA 3K1YA 2GK4A 2FR6A 3G0IA 3OQOA 2WC1A 3E58A 1I7QB 4D44A 1EX6A 2HMTA 1T43A 1XDSA 1SC6A 3IXMA 2M6YA 1F9AA 2QM8A 1E1CB 2RB5A 4NMLA 1FDOA 1MX1A 3N2KA 1Y4AE 2QM4A 3QPCA 3SK0A 2FJUA 1TO6A 2Y1EA 3Q9UA 3VPBA 1VA4A 4PZLA 1N6HA 1J22A 3DHWC 4ZAFA 3PDJA 3PIDA 2B8NA 2AX3A 5TS3A 3OT1B 3LP5A 2ONKA 2NWQA 4GUAA 2C78A 2V54A 4JT9A 4KQHA 4RKRA 4ZYYA 2A59A 2GXUA 3UGJA 3WAJA 2QTFA 2J6CA 1EZ4A 1IOLA 3F4LA 2QAGC 4I1RA 1FU4A 1Y3FE 1L7DA 3JWJA 4JBIA 4PCVA 4TV8F 4XIYA 3ZTTA 1SC1A 4KUHA 4PZAA 1YZTA 4MRVA 2R4QA 4BNVA 2ICAA 1JKIA 1D7AA 4GXNA 5B4VA 3G6KA 2PXAA 3A04A 1O94A 4H9GA 1M6WA 2OCPA 3WDSA 4E5KA 4Y98A 4TVKA 3UF0A 2QJRA 4DJFC 1ZUQA 4IZHA 2O2IA 2G6BA 1U6KA 4WGFA 1E5QA 2C9MA 4LS3A 4OGKA 1XXLA 1X7WA 3JV7A 2C2OA 2PGLA 1LWNA 2CH7A 5CB4A 1D2EA 1E60A 2VH2A 3EZLA 1KMCA 4QXAA 3SPHA 3OE7A 3ZBUA 1HEUA 1SQ0A 4LVOA 5J4YA 3L0SA 1HXHA 2QRJA 3ETDA 2KB1A 2UV8A 4DMLA 1NN3A 1DKPA 1KXZA 1XXHB 4W6QA 4Y3UA 3RS7A 2BSKB 2XOKG 2V55B 4FZ5A 1AMOA 4FGWA 3TBFA 3A2FA 1VLLA 1NVGA 2XMPA 3GGSA 3PGJA 4XAQA 1TCBA 1PGJA 1JQEA 1M66A 4NFLA 4BYGA 4NTXA 5J59A 4YLYA 2OVFA 1SZJG 3V4OA 5CBPA 3CH6A 3K2EA 3C3XA 3UWPA 4OBXA 4GLOA 1FNSA 3DEHA 5CT8A 4YAOA 5K6AA 6ABPA 4JXZA 4WBNA 2WIKA 3D3EA 3L18A 1B1CA 4G0YA 4JJ7A 1ZMOA 4ZI7A 3WV5A 1DF5A 4YDQA 2HWKA 3F90A 4JYCA 2VPXA 5H70A 3JRWA 5CDYA 2PU5A 3TB6A 5ESWA 1LSOA 5KQLA 2BUBA 4ZCPA 4BX0A 3KO8A 4LJRA 1DKMA 2NTJA 4HGQA 4ETNA 1OAOC 1TYAE 2RJOA 2CNDA 2J30A 5EWMB 4AF7A 3VNQA 1WPXA 1AURA 3FUVA 5J2UF 5EWJA 1BHAA 1PZEA 4Q1DA 2KSDA 2Y1OA 3QVGB 3ZJ5A 4DL9A 3SYKA 1THMA 1TK9A 3W1VA 2VBFA 3RRNA 2I7CA 1BGVA 4KAXA 2FLKA 2II6A 5K4AA 4X0EA 3TPCA 3VSAA 4DJEC 1GUZA 1P3Y1 3IMCA 1NUSA 2P3QA 5BOSA 2C5EA 3JU3A 3KKMA 2OUIA 1M6VB 1SBIA 2VDVE 3LYAA 4ND7A 4D4IA 1TIBA 3EVEA 1TD9A 4C2AA 1ESMA 1PFVA 3RT9A 4ZYTA 1CE8A 1S7GA 2F64A 4KMMA 4CXMA 2XAFA 4MH0R 2FN4A 5TMEA 4B3MO 3OQ6A 3NALA 1BSMA 1AXEA 1K7CA 2CDAA 4EJ0A 1TEHA 3QITA 2F62A 4RGBA 1QO0D 2P0EA 3LLUA 2VHQA 1SD2A 3BK2A 3DDCA 3Q9NA 4Z2YA 1WTAA 3L72H 1YTFD 2EBFX 1EWTA 2FH5B 2R4TA 4IO0A 5CW1A 3SHQA 2JFYA 3JW8A 4TWIA 1CUBA 1RRKA 3MHPA 5C37A 1C30A 1E2FA 4EA9A 2QR5A 1S5PA 1ND6A 1PWZA 4L6CA 4LEIA 4D8VA 1XCOA 1XF9A 4GS5A 2WQ7A 5JJLA 2YIJA 4RKYA 2BI7A 3V8BA 2X7JA 3NI2A 2JFBA 4FSXA 3X2EA 2I6UA 4AMBA 4G5QA 3FMPB 4DZZA 4POAA 3NP7A 4M9QA 3N2IA 1RM3A 3RK1A 2DQYA 4IWNA 3LUKA 3IH5A 3G2OA 2UUCO 5K99A 3L9XA 1HDRA 2YEVA 3OJ0A 5BYJA 4ZVOA 4ZVUA 5AK4A 1TJ3A 3A9UA 5DHSA 1XALA 1U6JA 4HADA 5BNTA 1PEAA 4HYOA 4I4TB 1U0TA 2JHFA 2Q5EA 3NHZA 3FMVA 3VO9A 3PFCA 2Q6AA 1H2AS 2X8LA 4XBFA 5FTNA 3VPXA 4CPDA 2F9LA 2OTLV 4XPIB 5HKAA 2AJLI 3H5AA 1DKLA 1DUVG 3N8KA 2JIPA 1EM1A 3HI6A 3KHTA 4DR6O 3OUZA 1E79A 4EKIA 1M1YB 3NEAA 1ST3A 2V7PA 1XPJA 4AS2A 4URFA 3EQ9A 3FTNA 3WB2A 4UVIA 4DVJA 4W9RA 5AHOA 4X64B 1PWXA 3LT1A 4KX3A 3KFVA 1NVVR 3A7EA 2YXHA 4U7GA 1BOOA 1O6GA 4IX9A 4E3WA 3MF4A 2XYGA 3N86A 2EZPA 3E81A 2UUAO 4UVDA 3LC0A 4CIDA 1WX1A 4OFWA 4CN9A 4W4LA 2GDSA 1YCHA 2P06A 3IESA 1T5BA 4Q37A 3K0EA 1EM8A 3TTUA 5U4XA 4R1OA 5JMOA 4O1HA 3KOZA 2QTHA 3ILSA 3S1AB 4KZKA 3VH3A 4KR9A 3WQRA 1VIYA 1YZKA 4P6VF 4EAQA 3ADOA 2EINB 4OUDA 4WADA 1UPGA 3BSSA 4ACAA 4D81A 1FMJA 4BLOA 4LQCA 4L72A 1P33A 1XZPA 1V9LA 3V1UA 4C22A 1KR5A 3D4OA 3GK3A 3IELA 4H3KB 1NXVA 4J6EA 4QPKA 1KQPA 2BR4A 1QC5B 2P0AA 3OAAA 2C1XA 2GD6A 2PD3A 3DTVD 4N9WA 5DX0A 3W5AA 2B5WA 1N6NA 1CX9B 2OBFA 3LSYA 4CQLA 4KQCA 1CNMA 3NWOA 1IPEA 3T5AA 2Q62A 3HK2A 1GQQA 5DDIP 1Z0FA 3IC7A 4HAIA 2C4KA 4RL4A 5ANRB 2VJQA 3IB3A 4OMDA 4CKEB 2NVOA 3JATB 5FA5A 2EW1A 2KM1A 3ESQA 4NJMA 4DAOA 5JV5A 2GI4A 3OC6A 5IS2A 1HYBA 3LCMA 5ALMA 3W2TA 2EIKB 3N0WA 4OMCA 2JGNA 1DBRA 3KOMA 1T91A 1CIPA 1WV0A 3X43A 3RKRA 1WXEA 5E6SB 2HXSA 4X1IA 3DDHA 1J0EA 1XTSA 2Z2IA 4JGBA 3QFTA 4JD5A 4BKUA 4IVPA 3OCQA 1JS1X 3BTUA 1VJ5A 2G83A 3ROTA 2ZRLA 1CUYA 3IS3A 1M75A 2Y77A 2N04A 4OB7A 4Z99A 4QJ4A 5JCXA 5B36A 3S1SA 2BFNA 3EULA 3PWKA 1XKQA 2A84A 3NVDA 4MO9A 4MTCA 4U7WA 5FKJA 2XUKA 3DPSA 2ZS8A 4FPPA 4YPFA 1SKYB 4G25A 1FQWA 1P1BA 1FP7A 1F1JA 2OV6A 2XUPA 4XXHA 5GJBA 2G80A 4NAHA 3JSAA 4ZT3A 1UP7A 2IOHA 3UJ6A 1U2TA 1WXIA 2I78A 3A1DA 3KQQA 5KQGA 3HZRA 1E4EB 3BXFA 2E7ZA 2EP7A 2Q2WA 1HDEA 4NDZA 4OHRA 2XCSB 4BJ1A 2TMYA 1BJRE 3GWGA 2GR9A 4HR7A 4BTEA 1VIBA 4M9CA 2O8DA 2YVLA 4LW8A 1E2IA 1CZKA 2H11A 4KUMA 1IXRC 1JFRA 1SC9A 4YIHA 4Z8YA 3RWRD 1QV9A 1U28A 4G1MB 2NMVA 5BP7A 1VHDA 1GKIA 1CC1S 1G5QA 1KF0A 4FMTA 1MT0A 2GPJA 2HAEA 2XE6A 2R7MA 4I0WB 2ZUFA 3G2PA 5AJHA 2VZ0A 4YN3A 3C4QA 4ACBA 5HSGA 1Z5ZA 3K9CA 4AY4A 1AS0A 4P3KA 4MLPA 4U9IS 5BOSB 2AFHE 1QH8A 4P5PA 1DAKA 2HF9A 2CMKA 1N6OA 4F1JA 1FP4B 1G8SA 2JGLA 2WP0A 4KXVA 3A3NA 3LS2A 2GZAA 3TJZA 2JIOA 1IX9A 1MNGA 4K6FA 5LP6B 4CKXA 4BMXA 2Q8QA 4GPAA 3E48A 4AJKA 1W4LA 4CS2A 1Y5NA 3MS4A 6REQA 4X64O 2PG3A 1DVRA 2V4MA 2WLLB 5JS1A 1XEWX 1XA0A 2WNSA 2Z3VA 1XKLA 1K4KA 3FCAA 4H4EA 5HIIA 3KUXA 1P1RA 3WTBA 1XZQA 4JEIA 5FI3A 3M7IA 5FUVA 2Y0EA 1R8QA 4V39A 1V4NA 2ZQ5A 1POXA 3HGTA 5KJ6A 3WRXA 2ORVA 2O0MA 2VDOB 3I9V6 3VOBA 5DHFA 3WWOA 3DMNA 1WSBA 4QVKA 1IJFA 3GELA 4MVCA 1TOAA 4TGLA 1Z2NX 2Z3IA 2Z1MA 2QX6A 1FEZA 1LGYA 1W0KD 2GEFA 2X7XA 4KN9S 3RG8A 3VNBA 5EIEA 3X44A 1MOFA 8ATCA 4BNUA 1SC3A 3IX7A 3BMCB 4PZPA 5D3QA 4HTFB 5EC8A 2CY0A 1HT1E 1ZCFA 1B15A 1QZZA 2XPCA 4Q9KA 4R1UA 3IPXA 1MKYA 2P9CA 3N7TA 1GTRA 1XTUA 2REBA 2WMYA 2XD4A 4LE1A 4DR2B 4UBMA 4PC2A 4UU7A 3IOMA 2NU6A 3ZI7A 2IEYA 4AIIA 1G2QA 2H94A 1PCXA 2ZXUA 1PEYA 3TL6A 5P8WA 4FHCA 1KJQA 4BMYA 4TZ6A 3R3HA 3G68A 3T0IA 5AMXA 3RC7A 4JVMA 1JA9A 2AOTB 5EHXA 2VRCA 3WOHA 3MCAA 1VL8A 1JAYA 2QQ0A 4MWDA 4DVGA 2VJCA 1AXGA 4ILKA 1WXFA 4H1WA 4HXYA 4Q3LA 3WG9A 1UBEA 1AK1A 2CUTA 4HGZA 2R9IA 2F9FA 3HDGA 1RADA 1OY1A 4LOKA 2PT7A 4DN6A 4XJVA 2BBTA 2H1IA 4BQEA 4DO2A 5JH7B 1DO0A 4BR6A 1QRDA 3PUXA 2QRKA 4HNGA 4M9RA 5CCEA 4X65O 3OSZA 4A2WA 4TWKA 4DR2O 3DCJA 2P27A 2F67A 3ROGA 4F56A 3JD2A 4JASA 2V1UA 2NN4A 1WY7A 2IHJA 3JD3A 2VF5X 3ENVA 4F9FA 1USKA 2W83A 2BFFB 5JLJA 4IJWA 1FUKA 4Z5XA 3M6WA 2DKOA 2WTNA 3O4JA 3C1UA 4KQ2A 4I66A 2CDCA 3FFTA 4RM2A 5FPTA 5TJHA 1B76A 4BNYA 4B85A 2GM4A 1SCJA 1NP7A 1IJBA 1PS0A 2J3JA 3K3WA 1QOPB 2J87A 2DWDC 2G72A 4UFNA 4M60A 2B4RO 1YQXA 5JBNA 4B5KA 2HPVA 3A6HA 3OOHA 3Q8WA 1KYOF 3UAZA 2C0PA 3MDSA 1W93A 1X86B 5DN6D 2IUYA 1P5JA 1ISIA 3P0FA 4J9UE 3LW7A 1C7RA 4PQEA 3RNOA 5BORA 1ZM7A 2EZUA 1W5EA 3P9QA 2JGRA 1KHTA 4AUMA 3ZVMA 4JBWA 4CS3A 3WDLA 4KXUA 3ZWKA 4IYIA 1CUAA 2Y2VA 1CZOA 2C9ZA 2G5TA 3D81A 4P4NA 1K89A 1WHTA 2H4WA 1XEQA 1Z34A 3PC3A 4AKIA 3HR0A 5LMUB 3ZHVA 4EH1A 2WINI 3K58A 1I6KA 1BWPA 3KOXA 2G40A 4MUEA 4BVBA 4C76A 1ISRA 4CL0A 1Z6TA 3DOUA 2Z0MA 4D8UA 1XJWA 4EI7A 1Z0JA 4MVJH 2EBUA 1IXMA 1SULA 2ZYWX 4JCCA 4D3ZA 1CG6A 1WN6A 3M9WA 4MV0A 4B6FA 3I92A 4QGFA 4BC1A 1WS6A 3W7WA 2Q73A 1BQ0A 1A98A 2IXFA 3HP4A 3L7IA 4NCIA 4PAQA 4V0OA 5A4MS 4OCNA 5KYKA 4FZ1A 1V11A 1WXWA 2OHIA 4UDNA 2HJ9A 4C78A 1E79G 4KI7A 3K9NA 1MX5A 1WJGA 2WU1A 3GZJA 3BD7A 3DBHA 1PKXA 4TUYB 5IYZB 3O3CA 4LSWA 4HWPA 4F91B 2N42A 4QIWF 4JP3A 1J1IA 2X2PA 4LHYA 5CA1F 1Y76B 3H1AA 3SJ7A 4Q20A 1KJ9A 4P22A 1CEQA 3KEMA 3P20A 4UZFA 4ALKA 5HIAA 4B3DA 3QJ5A 4BNXA 2QP9X 3WJ2A 1H8ED 1S2IA 4D25A 4M0UA 4X8LA 4O2AA 1X1TA 2UUBB 5LNK1 3E83A 1GCIA 1FP2A 1U11A 4O1IA 2WA3A 1XYYA 4D4HA 5B1YA 3AKEA 2XNDA 4UZSA 2INGX 2E4ZA 1NKTA 1VPEA 4FEGA 2WZBA 1S8OA 3RHTA 3H05A 1VXRA 2XBMA 3OHPA 2VWHA 3UT5A 1VYTA 1XZFA 1ODFA 4QDXA 1KO8A 4WEOA 4YJHB 5HKOA 3HYSA 5GWXA 4N39A 2XQFA 2DF8A 2Q9LA 1V45E 4URWR 3ZGNA 3S6JA 4AUEA 1YRBA 1OYWA 2J31A 2RJNA 3AETB 3DE5X 4UNNA 4FLZA 4C06A 4DXDA 5A9SB 1QGYA 2D3WA 1P75A 1UDRA 4Z1VA 2PUTA 2C20A 4JEMA 1Z25A 3L0CA 5AP9A 4BGUA 1Q0LA 1Y9DA 2OESA 4DT1A 2JFWA 3QNUA 2BZSA 2H2WA 4J0EA 4KNWA 3VR1A 2ZS9A 5HS4A 2ZCJA 5DHTA 5IAKA 4Z1MD 1JNYA 4YIKA 2ZSBA 3PDUA 4HK4A 4JI7O 2FR5A 3V2HA 2ZREA 3LLCA 1CCWA 4ZAWA 4IGIA 1JI3A 3ZU6A 2R8XA 4WNAB 5AICA 1DHRA 1RRGA 1VBFA 1M0EA 4CT4B 1E61A 1FX1A 3DMRA 4UNIA 4PDMA 1ZG3A 4V0MA 5JCJA 1AZLA 4LY9A 2ZRDA 3KSAC 1ZK4A 1XAJA 2OHOA 3LCJA 3WWZA 1RJEA 2P4HX 1ZNQO 2Q3JA 4TKUA 3RLIA 1DXYA 4OBBA 5TJ9A 2QG4A 1WHSA 3KAJA 2Z6AA 4TV9A 1S77D 1MIOA 3I76A 4LMRA 4QOSA 3T7TA 4MQ5A 1HLDA 1CUFA 3E18A 2W0MA 4X92A 1O9HA 2AOTA 2F66C 1HG1A 2XMQA 5C81A 4OM8A 1J39A 3DVAB 4E5DA 2YXDA 1SM4A 1M1XB 2D54A 3CURA 2OFXA 4ZQCB 2IYRA 3AYZB 1UBCA 5FUQA 4UTOA 1AUQA 1SEVA 2OV8A 4J0FA 1VQ4V 4PVDA 2QKCA 1FSGA 2O06A 5I9MA 1KFBB 3AP2A 2G84A 1AR4A 1B4DA 2I1VB 1EBUA 2YS6A 2ZATA 3FM9A 3OESA 4BAZA 4E1VA 4O4HA 4EW1A 5JRDS 1JLLB 2EYUA 2HLNA 1FOEB 4U2CA 3RHSA 2NU9A 1RLUA 2BHSA 1HV8A 1P0CA 5DOVA 1HI9A 4MIKA 4Q6BA 1ZM4A 1CZRA 4LMPA 4OFBA 2GFHA 2Q5OA 4LGMA 2GBPA 4M0MA 1ZI8A 5HIJA 4ZKEA 3OMIB 1Z2PX 4ZP1A 3ZH2A 3APOA 2OYSA 1Z45A 1I4WA 2CFRA 4Z7JA 2G71A 1TW2A 1DLIA 1ZK0A 2GEDA 2QUZA 1WMAA 4IIUA 4MEAA 3CPJB 2BT4A 3RFFA 1X92A 3AJRA 2QMZA 3C70A 1JECA 3K6JA 3TQQA 3IXQA 2RGAA 1RM1C 4IP0A 1LJLA 1H2RS 1Q5PA 3E1UA 5LHHA 2PKWA 1Q77A 4OL0A 2H1RA 1CZHA 4UBLA 4YACA 5IK2A 4D99A 4B7EA 5JHGB 4D7SA 1CSEE 1E1RA 4ETWA 5E1AC 2RJZA 1IHDA 3K0HA 4NOLA 1V8BA 3JRXA 4PS0A 4FGSA 1D07A 3IR7A 4EJSB 5EJ7A 5CW2A 4G4IA 3HYRA 1GNSA 4PAWA 3UXHA 3DW1X 2FVYA 1Q1ZA 3FHOA 3ZV5A 1R5TA 2BI4A 4QPJA 5EWLA 1A72A 2H29A 4JMLA 1AQJA 1T5EA 1F8XA 3FG9A 4EITA 4KXYA 4BQPA 5JHHB 1RLOA 2FRDA 2W42A 3QXXA 1EQUA 1G18A 2QRLA 2PKQO 1R8YA 3DXZA 3WYDA 1RQNA 2EZ8A 3AHHA 1GFIA 3LQRA 3NT4A 3UUGA 5A5DA 2IZOA 1POWA 4DCTA 1SCIA 1U2RA 4G1EB 4PYNA 1KMNA 3U81A 2FFBA 3KVNA 4DMRA 1BDIA 4DV6O 1ZK3A 1G55A 3DV2A 1G17A 1VDMA 3OBIA 4FXPA 2HWWA 3EJ6A 3SXUB 3K94A 3W5VA 4AF8A 3TG2A 1U9YA 2DCMA 4A91A 1BCRB 5JPDA 4TYNA 4KJXA 4DSZA 1IEVA 1N33O 1GPNA 3EXAA 2FB5A 1P2TA 1TTHA 2JAHA 2W4IA 2C2HA 2GOYA 3MMZA 3RUHA 2AA3A 4YP6A 3VOTA 2XIJA 3OEYA 1FYVA 1ROPA 4I1SA 3VPSA 3TSZA 5TQ2A 1BXKA 4QUJA 2BF4A 4AILC 4KO3S 4DLLA 2X5OA 1E5LA 1XP5A 5LXTA 1LBHA 5CT4A 2H7YA 2XR1A 4GI5A 2O0LA 2B3JA 1QAQA 3RZUA 3JS5A 3ZQ6A 3A1SA 1DC8A 3FLMA 4NPAA 4TN1A 5BSUA 4L75A 4L4XA 2HF8A 5KNBA 2HHHB 2ADMA 1PYOA 1N6KA 3DWFA 4ZAZA 1SHTX 3KKLA 3RTAA 4RH1A 2EKBA 4I50B 2O2EA 1N9GB 1G20A 2OUKA 3LI2A 3ORRA 1K7XB 3UHPA 4E2WA 2FUCA 2FUG1 2H08A 1A8QA 1BX3A 3HUFA 3KVOA 3N8IA 3CWBH 3S8MA 1AB6A 5KAFZ 1UODA 2MT9A 2YWJA 3EEIA 4MS4A 3WFVA 1KEPA 4DWWA 1Z13A 2E76B 2OCBA 4HBGA 4QM6A 3N53A 4YX9A 2I8AA 1PNLA 3KQMA 1UDAA 1C3XA 2YIDA 3EEFA 4ZVKA 4O08A 4B7UA 3AOGA 1MGPA 2WU0A 2Y0BA 5BMVB 1CRPA 1D1QA 2BYTA 2LW7A 1QFZA 3MNFA 1IMJA 1XRSB 4Q3OA 4UXHA 5E1OA 4YT2A 3R76A 2Q7EA 3IV7A 1TF2A 1Y82A 1GGEA 1U7OA 4WY2A 4KKVA 5SZIA 3BCCH 1N8NA 3VU9A 5CH3A 2HMWA 3T41A 2OECA 2FPXA 1Z74A 2YJ5A 2HSDA 3DC2A 1CQIA 4X1IB 2IU0A 1QFJA 2WAXA 3DH0A 4FBLA 4LV8B 5AW5A 3VDQA 4DLZA 5JCJD 4BNHA 3HHPA 3DZCA 3VAZA 1MAAA 2UVPA 5JSKA 1RM1B 1F2UB 3VGPA 4DG9A 5JNUA 1QCDA 2BTQA 4K9MA 4UUNA 1CDDA 3OTWA 4ES6A 5HCNA 1AO3A 3OTIA 3OZ7A 3VYVA 2Y92A 2ARKA 2R48A 2XWPA 4R16A 5BSKA 1U0HC 3SJQC 3ZIAG 4N8EA 4MVRA 2FPRA 3A0RA 3PI7A 1XL0A 3L4BC 3RT1A 5L7TA 4Y6LA 2QSAA 1QP0A 3TEJA 3IP7A 3QXHA 4A26A 1GM5A 2P9GA 5B64A 2ANBA 1TM1E 3WGHA 4HS4A 4LRQA 4BO1A 4I4TA 3REOA 1U7HA 3SPGA 3I5MA 3EDRA 2WLIA 4D6TH 3AO0B 4FDUA 4JTDB 1Z0AA 2HFEC 3MHHC 3GRFA 2XNDD 5EGSA 3UPDA 1PPJH 2Y6VA 4O2AB 5C7LO 4UHFA 4QUIA 1PQYA 4KH1A 4F4HA 4NCBA 1M67A 1GCUA 3NHUA 2J5BA 1S4MA 3IAHA 4WK0B 1PZHA 2B78A 4GW3A 4KQMA 1EDOA 3FUCA 4FVMA 3TLZA 3TTXA 3UWSA 2RGYA 5EUMA 3LPAA 3T7RA 1RM5A 1KYQA 2NIPA 1Z5OA 2EKDA 5K3BA 1N33B 4YA6A 4Y7CA 5KVSA 3PUHA 3WY9A 4QXPA 3A6FA 4BLQA 3N2GB 1OCOC 1E1NA 1M10A 1MPXA 4WCFC 1KGSA 2HRDA 2FSIA 5HQ3A 2ZRHA 1NNEA 3CCJV 4CG2A 5KX5F 5MFPA 4BIOA 2PMDA 2Q2NA 2R84A 2WE8A 2REXB 2HY7A 1TAUA 2QTSA 1NUAA 1Z28A 2J3IA 5TE9A 5BYAA 4C7XA 4FOSA 1LRLA 3N2NA 3LSUA 1E3EA 1T2UA 2J3QA 3VZRA 1A76A 5IE9A 1MSDA 1Z2GA 2IA5A 1X9HA 2VJDA 3KKOA 1Z2EA 3AHDA 3P2YA 2OO3A 4FQ8A 4PGFA 2CUNA 2I33A 3OPYB 3QEOA 2CEKA 5IAJA 3VSEA 4J29A 3AVOA 1YS1X 1I7PA 5M59B 1IXSB 4I9UA 2OZLA 2PL9A 1LPPA 3BA6A 4A16A 2EAUA 4YXWD 5C51B 2QMEA 1Z8HA 3DS8A 2CLHB 1ZO8A 3AG2B 4RZ3A 2WYVA 121PA 3UG7A 4EMUA 4K88A 4ND1A 1C9EA 4R7ZA 4K8XA 1R0YA 2C0QA 4XFJA 1DUIA 4HDKB 3GUYA 4QECA 3LG2A 3G8AA 4J16A 2YS7A 3NQ41 2KQUA 2AXPA 3ILHA 1BW9A 4RV5A 3DFZA 4JZKA 5IG2A 3R9XA 4MUMA 5H2FZ 2O1EA 1FMTA 4YRQA 5CCXA 4PSVA 3RREA 1G98A 3PNPA 5KYYB 3KDPA 1M6YA 3TNJA 5MGBA 2UZ3A 3J81k 4NBRA 1SF9A 1GFWA 3ENWA 3HFSA 4NWIA 4AF6A 2G6TA 1QGED 1VMEA 4DK1A 2OGWA 3LGSA 4QYIB 1M2OB 5BSGA 3TW6A 4GR5A 3EYAA 4JV5O 4JT2A 1FVXA 1Y3CE 3HFJA 5FLYA 4BW9A 1JLLA 3ASVA 5BO5A 1UEXC 3G79A 2NV0A 1RIIA 2V74B 3K3PA 1GN2A 5EKDA 1PJ3A 3G23A 2BFMA 3GJ0A 4I81A 4J4BA 3S1LA 1HPLA 3PBKA 3T94A 3AVUA 1TIYA 3ABOB 1O3YA 4XFKA 3ROFA 5LQNA 5BV8A 1ORIA 1WZCA 3JWHA 4L8JA 2AK3A 3M3HA 3QVOA 4IKOA 4KGZA 1F9EA 5BQXA 2Z98A 2QNRA 5CDTA 3AKCA 5HZHA 4K86A 5K2MA 5JW6A 5KTOA 1PT7A 4B82A 1ZGHA 1ZGJA 1H1LB 2WIJA 2BMEA 4EK9A 5H6QA 1MSWD 1A4XA 2OPBA 3TUJC 3V00A 4L5CA 5EEGA 5FD8A 5I4IA 4IDAA 4GD3Q 1X13A 3B6MA 1Z36A 3SJCA 1YZLA 4JJ4A 2PQMA 3B52X 1G0NA 4LWSB 3LY7A 3RFUA 1GD1O 2ZAGA 1HNWB 1VG9B 4M83A 4QARA 3TCNA 1FU8A 1NHGA 4S1TA 4OG2A 1TQDA 3ZRXA 1WN7A 1QH8B 3RFTA 8ADHA 3IGAC 1JEYA 1QS0A 4YCDA 4PHHA 1Q0RA 3OKAA 4LVUA 4U00A 3UCEA 1AX9A 2GCOA 4R0NA 1RPNA 2YOFA 4DV1O 5D5QA 1ZD2P 3OQIB 4IJQA 4YMWA 3RR2A 2JZOA 4ZOAA 3ICQB 1MX3A 5H4GA 3OCJA 5IKMA 1MABA 2XRYA 4MWZA 3CVUA 2WOOA 5EIBC 3H86A 5DBOA 2JAXA 1TEXA 2NZXA 3FIJA 4JWTA 3U7QB 4DMMA 1U3DA 1NRWA 1OIWA 1PEDA 4FMBB 4HZUB 5HKKA 1AG9A 1JG2A 3JZIA 4UHKA 4RD2A 1GSAA 2AB0A 2DLDA 1A77A 4KWIA 4CR6A 1M34E 2VDJA 1E5XA 4M6WA 1MH1A 3GLRA 3BFXA 1FXVA 3UCSC 1CFZA 1Z6ZA 3QPVA 2BGWA 2Q3DA 3VZSA 4JQOA 4FB4A 3IIKA 2D2XA 1DWOA 5CIQA 1SBHA 4DLNA 3CG0A 2B37A 3ENQA 3NHKA 5K0EA 1E63A 1IE3A 4UTNA 1N92A 3LT5A 1C0LA 4LZNA 1F8UA 8LDHA 3TLEA 4Q9IA 4W9MC 4YJDA 1KFKB 4EJFA 3GFSA 1KA9H 2Y48A 2C9BA 1ENYA 2O2SA 3GDHA 1NXXA 3F78A 3HCNA 5AKHA 3UAGA 1NAHA 2LR0A 1AD2A 1V9CA 4IRUB 4BEVA 5K3EA 4B17A 2PSJA 1VL5A 4MKGA 3OEHA 2V9PA 3A14A 2PXHA 3IB6A 1MEJA 2FKAA 1H2XA 1UINA 4JBYA 1FXUA 4WXMA 3TTWA 5F23A 1P7BA 1XNRO 1WW3A 3BULA 3G6WA 3KD2A 2JLQA 4GEKA 4CETA 4NK4A 4JI8B 3K16A 1OJ7A 2ZJYA 3N2LA 4H7DA 4LNUA 2XYPA 3AWIA 1O54A 1GGVA 3EASA 4RYLA 4UUBA 4X45A 4W5QA 4DXWA 4TROA 4IJMA 1ZL0A 4XARA 3RSLA 3U09A 3LKVA 1ID8A 1ZJJA 4D6XA 1NIPA 2W90A 4AMVA 4ESOA 4OREX 4AIRA 3AU9A 3UAVA 3F7YC 3T99A 4DLYA 1A7JA 1EIZA 1ZW6A 4RZ2A 4TTRA 4X8OA 2VHZA 2OTJV 4YVFA 5F1PA 4B47A 4CU2A 4CM1A 3H1BA 4ASUD 1ZUNA 4GBED 3BZUA 1BMQA 1TVKB 1PZGA 4IEFB 4RAOA 4XJTA 1S0UA 4N47A 1L8XA 3E8XA 3PITA 4JJEA 4Q9HA 5CFOA 3UYKA 1YFLA 3ROMA 1BVYF 3QE2A 4FC6A 4N54A 1PSDA 3B5IA 3U37A 1E69A 2GZHA 2JGEA 3VU9B 5K3FB 1PR0A 2Q27A 4AZWA 1MDBA 2C96A 1P2SA 1JR9A 2Z08A 3IQEA 3ND9A 9ATCA 1NVXQ 4XDJA 2A1UB 2GZDA 1XN4A 2BMAA 3KQHA 3NX4A 3I0ZA 2X6BA 4TWJA 4E6PA 1AKVA 1EUCB 2HCJB 2VWPA 2R25B 3BTOA 3CLUD 2H3EA 3LUJA 3V33A 4NXNO 1Y1RA 2TMKA 5BWNA 4QUDA 4EG2A 1H66A 4PAGA 1LDGA 1DWPA 4J9VA 3GNSA 4QU8A 3ZWQA 5J4KA 1XLUA 3R41A 3SIXA 1B0AA 1PSZA 5AW8A 2I9KA 1TLFA 1QHTA 2GWHA 1U2SA 4IJVA 1RDFA 1TVCA 4C0AC 4EB6A 5CITA 2RI1A 2X86A 1AUXA 2L19A 3G5TA 5FXMA 3ZOZA 4BLUA 4J43A 4MQEA 4BO8A 1D9ZA 4R1PA 3E1SA 5KYTA 1XZ8A 3L41A 3R0ZA 1IY2A 3JWIA 3NBFA 2E0IA 4NONA 3VR2D 4NZZA 1K5HA 1FS0G 2QVXX 3DVAA 3M82A 1BHSA 3BZBA 3LA6A 3JVIA 1RYEA 4NG4A 5TF0A 4OB8A 4ZEOA 2ZS7A 1U9ZA 4F2WA 3R7AA 4EATA 2XGGA 5K20A 1XTJA 3GJZA 2H4ZA 1NURA 2QW8A 3E84A 4Z4CA 2OOKA 1TUBA 2XUQA 4Q66C 5K4HA 2BN4A 1BTOA 3IYLW 3QXCA 1B6QA 2G5CA 3L6DA 2ATKC 2PK3A 1WN5A 1RM0A 2CFTA 2OVBA 3C5EA 3UBMA 2HXGA 5FBQB 1NVBA 3FCOA 4LXHA 1EXMA 1KFJB 4RFSA 3RIXA 2AI2A 1Q15A 1VJCA 5F9FA 1U0EA 4WGGA 3W7SA 2AL7A 2A58A 1BN6A 1E1QD 1MR3F 4FFKA 4DRXB 3PTLA 4I6GA 4M55A 4MVJI 5KYVA 3K6SA 3LNCA 3CB4A 2JFPA 2NXNA 5B2FA 3FIUA 5IAAA 4RVCA 2X4DA 1L7RA 2FEKA 2X77A 4LBVA 4MI1A 1FFXA 2O52A 5FV7A 2XCIA 1A9ZA 3K2BA 4QODA 3ZVRA 3ERCA 4HPXB 4UCXA 1G8FA 2IYAA 3DPUA 4X1YB 5JDIA 1FZTA 3NTOA 1F1BA 3LUTB 1AA9A 1Y5LA 2QB5A 3DD1A 2X6QA 1VFNA 3PXEA 2YHAA 1BA3A 4NJMB 4RK6A 4KGXA 2EKPA 1TJ5A 3VC2A 3RSSA 2FN8A 2HNBA 2O2XA 2EIKC 1E9SA 4LISA 2O23A 4GAEA 3OFNG 3UT5B 4OQDA 2R47A 4YJHA 4DFDA 1MABB 4G3MA 5IWAB 1YZ3A 3BBLA 3TLJA 4X1OA 1T3TA 2O3RA 4MV9A 3ZN0A 2QWRB 1EFPA 4W99A 4DJ5X 4OFZA 1JEQB 5LWQA 1U63A 1VYUA 3GQBB 2JB9A 2M9MA 4XGNA 4C0QC 4ANFA 4MSUA 3IPAA 4I9FA 1L4KA 1W4ZA 3EXEA 1FRVA 3H5NA 2EIMC 1DBVO 1M57B 1R4NB 3Q7SA 4MR7B 1S2LA 4QUKA 2Z5FA 3AFGA 3AV0B 2BFBB 3D4LA 3EZ7A 4N5NA 3AZPA 4MVQA 2YJ3A 3B4SA 5F76A 3UHAA 1FXKB 4ZAXA 2Q4EA 3QV2A 1P19A 4HYQA 1FX0A 3DKKA 1GU7A 2PJUA 3MUFA 4I4CA 2QROA 2YUIA 2HA2A 1R37A 2I6XA 4J94A 5F2EA 1I32A 4AY6A 2CV2A 2P65A 3QX8A 1BH6A 4OXKA 3O8OB 3UMJA 1NQAO 4PX5A 3J7AC 1F8FA 2YWGA 3ICPA 5TQ0A 3K5HA 4K8RB 4QE7A 3ZHRA 1L5WA 4L5YA 4ODIA 4ZOLF 1CQJA 2F1HA 2GJ4A 3AG4C 5A4FS 5KKAA 2NO0A 1PJBA 4K0KB 1CR0A 5FFMA 1F4MA 4RTLA 1EFRA 4EF5A 1D2DA 4MTXA 3UQ8A 2FDXA 3H5LA 2FZ5A 4FJ1A 5LUBA 3MJDA 5K45A 3SMQA 1SVSA 1ID1A 3OCZA 3VR4H 5EJ9A 4GBJA 2NAFA 3E9ZA 4WKBA 4DADA 4F5ZA 5DRTA 4MSWC 4YUAA 1KERA 3BG5A 2FMHA 1SVKA 2CXHA 3R3SA 2DQ0A 1U94A 4X7MA 3OFNA 5KJEA 3W90A 2RGGA 1M2GA 5F7JA 5IANA 5JJNB 1RAGA 2WLSA 1WCIB 1N0VC 2GEBA 3BYZA 2MIIA 2FWPA 2QZZA 1JQJC 3DM9B 3KE8A 4N8SA 3H1IH 5BRAA 1BQ4A 3ZPXA 3IJEB 2RBGA 2UXCO 1L9XA 4MRSA 4ZARA 1DQSA 3N58A 4OAQA 1NVMB 1GDHA 1M1NA 3P2OA 1Z5PA 1C8LA 3MMSA 4G0UA 1U96A 3CONA 2NR5A 1Y7HA 2XJ9A 2QZSA 3L43A 1VZ2A 3IQZA 4IRMA 4FB5A 3SPXA 2FPGB 2JLVA 2XUZA 3CZMA 1DRUA 3SXJA 4JLVA 2A30A 1IHYA 4X61A 2OCAA 2ZIXA 4AB1A 1HDIA 2QWPB 1C8KA 4G41A 5EHNA 1US8B 2ZWAA 5LDHA 2Q69A 2PI4A 1JDTA 1QQTA 2D0PB 1Q1GA 2PYIA 3GJ7A 1N2BA 4MA0A 5FI5A 3DAHA 3TE7A 5H16A 4F11A 1QIFA 1F51E 3CLRD 4NQZA 5JPIA 3RLFA 4HF7A 1MG1A 1YXMA 4RNDB 4UUOA 1P1KA 2G76A 3H0CA 3BTSA 1XL6A 2G0AA 2ZQYA 3TTSA 3K1ZA 4B3XA 2C5HA 1R0LA 2F6RA 3CTMA 3QBVA 1R9MA 1V39A 3D6HA 4CUKA 3RODA 2AJBA 4D9IA 1BVUA 1ZNZA 2TYSB 3KSDO 5DPMA 2BTOA 1X1SA 2CKMA 1LWOA 3CKMA 3AM4A 2FWMX 3DR5A 1X3LA 3MZ0A 3OLWA 4IZOA 3WYFA 5JSHA 1T5LA 1XLTC 2J3DA 1JR3D 3ZZ1A 5KOIA 4LKRA 1IMOA 4UNQA 4ZMRA 1EB9A 1X6VA 1L5HA 1IQUA 3H01A 2JJ2G 1GPWB 2Q29A 3IVXA 3TQFA 5FV4A 2CTWA 3D9QX 3EGDA 2QTAA 5LLTA 2QL5A 1XNHA 3JPWA 3OKFA 3UH0A 1Q0QA 2YY7A 4EFLA 3T1TA 2EX4A 3UKMA 3G82C 4G24A 2XMRA 3PT5A 2VAVA 3SC3A 1N5LA 5KYYA 2SNIE 3LO5A 3UWKA 3WTCA 4DSNA 2CCKA 4EGSA 5KNCA 1H94A 2UYGA 4RPLA 5HOEA 5IM5A 1ADGA 1RJDA 2ODAA 3P9SA 4EARA 4EG3A 2OBXA 3DB1A 4AXBA 1LW7A 1UKCA 1NBOA 3I6BA 4Y6GB 4I6EA 4WNCA 4MHSA 3SDBA 1KWGA 3RQIA 3C90A 1B00A 2V6GA 5EYPB 2R8BA 3DMTC 4BC0A 2BEKA 4B8ZA 4H77A 1YJNV 1AKTA 2WYUA 4ZCQA 3ZXXA 1I4EB 3GVMA 2BP7A 5A4IS 4CM4A 1TZBA 1MXFA 2C2AA 4CU5A 4BE7B 1UJ5A 2HREA 3UTDA 4YUZA 4DB4A 2MINB 1NYLA 1ECGA 1RI2A 2QT0A 4GVLA 4B48A 4MSQA 1PDWA 3FVRA 4E5PA 3QYAA 1UC8A 1NLFA 3OZBA 5DM6V 4DUZB 2OFOA 3OEED 3QVGA 4HCJA 2WJZB 2ZVQX 4DNXA 3P9XA 1U7WA 3RGWS 3VHXB 1E7SA 3NYQA 2NUPB 2HHJA 2P3LA 2WV7A 1KQSU 2CXQA 4FE3A 4GLBA 4PYIA 5DO9A 2R79A 3FNBA 1K88A 2H8KA 3MJHA 3L6BA 2RGRA 2JBHA 2XOKA 1H8EG 2DFNA 3I9KA 3JCUZ 2OPHA 4WBXC 2DPLA 5DGIA 1CP9A 3CT4A 1QH9A 3PUWA 1K7FB 1C2TA 2PS1A 4TXLA 2JNWA 4UV9A 1P7ZA 2VFAA 4MW5A 4BNTA 4DR4B 4DUPA 4NR0A 1USUA 5BMVA 2FI1A 3ZPCA 3GLKA 1YMVA 2P69A 4I3FA 1UWKA 1SU8A 1I2DA 3U7IA 4JH0A 1G6Q1 2HFKA 3KOOA 4K35A 2G04A 5FNVB 2I66A 3OLQA 4TWAA 3WS7A 3OKPA 1M73E 4LN1A 4TKLA 1WSAA 1P80A 2VQEO 2HJDA 5JCPA 1C9YA 2W6ZA 1KH1A 2PT5A 4AZTA 3WI7A 3P1JA 4FM1A 3JQAA 1VXOA 1QO7A 3EUAA 4KTVE 5HFAA 4XWKA 3Q7TA 1F2UA 3SYQA 3IQGX 2UXDB 3O8LA 4HQ6A 3AHFA 1VLJA 3T7KA 4CMJA 3V2UA 2OV3A 2N75A 2UAGA 1T4MA 4MX8A 3DZKA 3K31A 3N76A 1WV1A 3V4FA 2ATXA 3FY4A 5LB2A 4TV8B 3SZLA 1K0FA 5AKKA 3VBCA 2HEPA 1N8SA 2WWIA 2J0UB 3EWIA 4GPIB 1QANA 1AJNA 1SH7A 2VDPB 1K7SN 4KQXA 5KB3A 1Y1LA 5T4EA 4EWLA 2P91A 5L6MB 1JEDA 4JJ8A 1TXGA 3EY4A 3CHYA 1XDGA 2QUAA 2WICA 3G17A 4X84A 1K98A 1Q6UA 1GITA 5A9GA 2VP6A 4DR3B 4FNGA 4PYRA 4RA9B 1G64A 4F3NA 5LQAA 1L5GB 4RCYA 2WLIB 4YRFA 4E32A 5HGJA 4EY4A 4Q39A 1RE0A 2WABA 4JOQA 4NYMQ 5JMPA 1H8EA 4BNNA 4ZN6A 5C8YA 4PICA 5E4YA 3RRZA 3MT0A 3B85A 1NDHA 4RCZA 3O1JC 1GAJA 5C8DA 1JDNA 5FBHA 3D4NA 3EB9A 4J16C 1QTNA 1XHLA 5KTMA 5MN6A 4B74A 1Z2AA 1N2SA 2Z2XA 3AFOA 1Q1AA 4S24A 2D4HA 5B37A 1THZA 2DUWA 1IOWA 1B2RA 4F6RA 3K5LA 1WG8A 1OLUB 1QZXA 4P80A 1DIAA 1WBJB 1FBTA 2G4CA 3NTRA 3KLNA 3T3OA 1SK8A 2X9LA 1N32B 3SNHA 3KBBA 1I7SB 1RBQA 4RENA 5KOHB 3GRKA 2D5AA 1F60A 1HQYE 1XMXA 5FB3A 5B7NA 3G85A 2XEDA 2G4LA 2AE1A 2A3QA 1GWNA 1QCCA 2R6CA 3O31A 2Y66A 1W6UA 1CEZA 2IXTA 1OX7A 2VVTA 5AW7A 4BW5A 3AEUB 1EUCA 1RZRA 1EVKA 3IRUA 5JVDA 1S2DA 4QDUA 3NHJA 3AERB 4CM3A 2PPVA 3UKDA 1WD5A 3A9SA 4D57A 4C4PA 1HOXA 3ASYA 3GJ8A 3QBTA 1JJ7A 2B5UA 1ONSA 3RAJA 1U3UA 1VKJA 2CLIB 2QW0X 3OEWA 5EMNA 2ZIOA 5FPQA 3AR3A 1DJQA 2XZDA 1P2FA 3WO0A 1C7ZA 1M2HA 4LNAA 2QWQB 2UUOA 1WOMA 1HM5A 3B2QA 5BW6B 2YYAA 3UICA 3ASNC 4XSHA 2Y0IA 3V46A 3T3DA 1IEXA 3BJRA 5GADl 1FYDA 1Z26A 5C5DA 3VJMA 5BNIA 4DBVO 5A5GA 1HKUA 5KJCA 2WUGA 2Y69B 4AZ3B 1RQ2A 1QKIA 1PT8A 1J0XO 3B09A 1MNAA 2WJGA 3E5RA 1DDIA 5BR8O 3RFCA 4N4AA 3SS7X 4DIKA 5BMOA 4LOJA 5F7ZA 4NU8X 1W36C 1EUYA 3AG7A 4MRPA 3LUHA 4I2VA 3U49A 5IUKC 5I7VA 3LX5A 4BTVA 3GJXC 2NU7B 3FJ1A 1IN7A 3U1BA 2VT6A 3MQ4A 2ZQZA 3KB1A 4EIWA 2GNOA 2XX3A 5J63A 3OFSA 3OD4A 4G6ZA 4MV5A 3I34X 3A05A 1JLKA 1BYIA 3D2BA 2ZCUA 3GLIB 5LP6A 1ZA2A 3WX0A 1C1XB 1VB5A 1TYCA 2BMFA 2XKBA 3VTAA 4BZXA 4D3SA 2ZAIA 2H3HA 3L4BA 3H5IA 5EJ4A 4CCAA 5LDDC 1VG8A 1UZAA 1Z38A 1UFVA 4MS2A 1RR6A 4Q5IA 5JDCC 2NUPA 4BB9A 4WJLA 5JISA 3FYDA 1C5KA 2EATA 1U3TA 3TLMA 1PVVA 2JH8A 4NRDA 1GAQA 4YJGA 1XD8A 3BK7A 1U31A 1O03A 3G67A 1UFQA 1W5AA 4NXMB 2NOAA 4RJTA 4G5RA 1O9GA 2G77B 3I2KA 3NONA 5E8RA 4E46A 2JEUA 2GN0A 3DVLA 3QKSB 5A02A 3R5FA 4HMPA 4DPKA 2KKSA 4ZQEA 2WI8A 2C7BA 3PWSA 3R5KA 1RWVA 3LECA 1TCUA 4MSMA 4IUBS 5LMCA 3CV3A 4H2DA 3RC9A 2CMDA 4EY8A 3P71T 1E8MA 1NFQA 4RFVA 5K0JA 2P8RA 4RD6A 4UUPA 2NZVG 4UVHA 1H1TA 3QE9Y 5L9AA 1XELA 2CXPA 5KMGA 5JECA 2E3CA 4EB3A 4CVNA 2R8YA 1GA4A 1OX6A 4QUEA 5AOCA 3TLYA 3ZNNA 4D9MA 4ALNA 4I0XB 1RHKA 2FTKA 2I1QA 4LJ9A 2LFSA 1FFBA 1U0GA 2BGIA 2CLDX 1RJWA 2H2AA 1W94A 3PRHA 3N2EA 1IBKB 4MQFB 5EZYA 1C9MA 1USIA 1UDCA 4X3PA 3X3HA 5LZ7A 1NX6A 3LVFO 4PYKA 5DIZA 3C3MA 3SR0A 2DQZA 2QPLA 3CEAA 3TTTA 1J5PA 5IYZA 4Q02A 1N2JA 3F5MA 2CMFA 2ZUWA 3U56A 1CY6A 3BCUA 4BMCA 2Q1WA 5LGUA 3T4EA 4YY3B 4PGMA 4I1OA 4D80A 4QBGB 2VLBA 2ZI4A 4BN5A 3TX2A 4P7BA 4IJUA 4Y2PA 4J1TA 1L1FA 2FZCA 3BQMB 1KIFA 3EGXA 3L40A 1B6RA 1LK7A 3LC2O 4H3HB 4PU0A 1KOGA 3K6SB 1HURA 4R6ZA 4MUFA 2IXEA 4K9NA 3JQBA 1GGMA 1LX7A 2QRQA 4YJ2F 3RU9A 1YI2V 4J2HA 4HNQA 4WOJA 3E89A 1RCTE 1ZVJA 1TMYA 3DGEC 4Z8XA 3WJAA 2PUEA 4C4AA 3GLUA 3I8XA 2FPIA 2R86A 1K63A 4X8HA 2CJWA 3L9DA 2YZGA 3MOSA 3SBDA 1I3CA 3A2MA 5DNAA 1YC2A 1DIOB 2IY9A 1VQ2A 4MCHA 4YP0A 1XBTA 3IEIA 4QELA 1NF8A 4ZVTA 3ZRSA 2RKWA 2Z04A 3NKFA 5COQA 1RXVA 4F8YA 1N75A 4XR9A 5IVIA 2WIBA 1CY4A 1Q43A 5GTHZ 3H7AA 4CL2A 2RGXA 3B3AA 5LZ4A 1E1DA 4LCJA 4P7JA 3OT4A 1NXTA 4Z4QA 1BX1A 2RCYA 3ZGXA 2AC2A 2IHZA 4V0QA 2BCGY 2NXWA 2VJOA 1XI2A 4AU1A 3IT1A 3R3VA 3TMYA 2ZIMA 1WIWA 4L5IA 4A7PA 4ZI2A 4D9EA 1EWVA 3JYQA 5BPFA 1TF7A 3VBBA 3MT7A 5DTIA 1KJYA 1JI0A 2WJ4A 2WJHA 2PZKA 3LC7O 4UE2A 1K6IA 4TMXA 3JR7A 1T1RA 3AF3A 1BHJA 3JALA 2ZVDA 3J7AU 1DZ3A 3TWOA 1SEPA 4PLGA 1E2HA 2DTEA 3UOGA 1F5SA 1PYGA 1S89A 3NAGA 3DMOA 3PL1A 3UJHA 4Z51A 3KKZA 4ZV4A 1KB9F 5E6RA 2W0FC 3QLUC 3WLOA 2GJKA 2OOSA 5EZ5A 1OCEA 3V7FA 1MU0A 5I4CA 4GGOA 3CR3C 5IUJC 1JVSA 3PNLA 4JYAB 1BVRA 1Y4UA 2HSZA 3AFHA 4LHXA 1LUAA 4XD2A 2O6LA 2GHQA 3RSQA 1IAQA 5DE3A 1RSZA 3U3OA 3HVJA 1XMOB 1Q17A 1Z3IX 2YJGA 1PBNA 4NG5A 4U7HA 2C29D 3M83A 5FJJA 4Y7DA 5TPWA 1YTFB 1S3IA 4DV3B 1X14A 3HPRA 3Q4GA 4QJIA 4YAUA 5HJEA 5JRZA 1GGHA 3OX4A 2R8PA 3QHPA 4DNPA 4TV9F 2JW5A 4ZVPA 1XE3A 2IKQA 1CJUC 2MU1A 3GRAA 3AZOA 4C5CA 4RULA 4ONEA 3BSWA 1RB7A 4PW0A 4DIFA 3VNAA 2AXEA 3L4KA 2I91A 1BL8A 2XUHA 4MPPA 3AR7A 4OJNA 3SU8A 3LDCA 4ZI3A 2PLFA 4INJA 4IO1A 5CGZA 3CRCA 4DILA 4QQ8A 1OH7A 4F6RB 1SPXA 1QGDA 1P7VA 1SUWA 2DM6A 1FNCA 2Q41A 2WNIA 2X2OA 4IIHA 1WNTA 1C3EA 5E0OA 5BV1A 2C8JA 2ERCA 2ON6A 3D5TA 3LQFA 3R6LA 1M2NA 2ZBPA 3T9FA 3WADA 4CNBA 4LIPD 2E5LO 3OHSX 1JL3A 3WLQA 4ARUA 1N34O 4CV3A 4HV4A 1WW8A 1UBMS 1QH0A 2WKPA 4FYHA 4LRWA 3HYLA 3KWMA 5H1YA 1P8AA 2QTZA 4AJIA 1DLJA 1H3NA 3HC7A 4EZIA 1LFDB 2PX8A 3CJTA 4CH3A 1CZUA 4M2LA 3TW8B 4F4LA 3HCRA 3TZBA 3IAM6 4G5SA 4JQSA 2YUAA 5LQRA 2FLWA 5DX1A 1E6UA 1LPSA 3R0QA 2HVVA 1J06A 3FVWA 2FE1A 5KUMA 4UM5A 4WOKA 5ALIA 5F51A 2OXEA 3VU0A 5C35A 3AERA 4OQYA 4YK7A 4EKNB 5KZMB 2RDMA 5K0TA 1I4LD 4EZBA 1U2ZA 1ZHHA 3LZ6A 3UH1A 2X76A 4XVUA 1DRVA 2CMHA 3AG6A 3F7MA 3FROA 3HACA 3LPNA 3M4NA 4HGRA 4KP4A 1E3WB 1JRLA 2EF1A 4YAJA 2NG1A 3GLGB 3IHKA 1MV5A 1JMYA 1B3RA 5HFNA 4JMPA 4E31A 4P34A 1PVOA 3TRHA 2C95A 3AESA 4MEBA 1Q2XA 2WT9A 5E79Z 4P9CA 1G3QA 3VSBA 3SPCA 2GMWA 2X5KO 3WQSB 1PQPA 3IP6A 1B3BA 1BXGA 3L04A 3L7DA 1EBBA 4C3ZA 3NC4A 5FX2A 2FKNA 3A4LA 4BRZA 2C82A 1P61B 5YASA 1W36B 5TQVA 3CP1A 3B77A 1M7GA 2JIZD 4WLNA 2RMKA 1E9BA 4JYMA 2QBYB 3H5RA 4JGIA 3Q4HA 5DISB 3QLVA 4JJFA 1NVPB 4QU5A 4CRWB 3SCZA 1SG6A 5LD2B 5EZQA 3U13A 2ILTA 1VQPV 3ZCCA 2J9RA 2PZ8A 4FC7A 5JCOC 4HS9A 4KFSA 2EFHB 1JWLA 4KIJA 1MZEA 2BWJA 3OTQA 5FWXA 2HUPA 1A2KC 2PM8A 3NEJA 2MOKA 4ZU6X 4EHDA 4ZAYA 2OFPA 4UEWA 4CQMB 4EHNA 3EDYA 3V6MA 1PZNA 3H18A 3AT1A 3I1IA 3Q40A 5DNVA 1AV7A 1QHNA 4EHJA 1XTVA 5KYUA 1E2QA 3V9AA 4YASA 3GLIA 3AF2A 3A4NA 4WHMA 4IIJB 2QN3A 5EIBD 4ZO6A 5ERYA 1ZVMA 2J8ZA 3TGUH 5FYQA 3R3UA 1CDOA 4FHDA 1F4NA 1XWIA 3NIFB 4G37A 4QOIA 3ROXA 2CF6A 5B5SA 1EK6A 4FFPA 1E4VA 3ENZA 4F1WA 2ECQA 5COBA 4M0LA 5I47A 3O73A 1GYRA 4OPHA 3ZHOA 4AUNA 3IP9A 1TM7E 2VDRB 3SEFA 2XZOA 5AD1A 4TMTA 4I5IA 4LK2A 5D6OA 4RY9A 4XX1A 1TPYA 2WJPA 3TZKA 3O38A 5A5EA 3V8EA 5CJJA 3JY6A 2H0QA 3MB8A 4U2BA 3WGNA 3K5IA 5B58C 2PJZA 3EYWA 1XEAA 1ZK1A 5EOVA 3UXMA 4PPFA 2ZTSA 4NMXB 1SZXA 2H2HA 3GLTA 4HQFA 5FO0A 5LDGA 2B92A 2MSWA 3B6IA 2RH4A 3FJYA 2I9PA 2H1OA 4Q1EA 4J41A 1T8SA 2KG7B 2AYXA 2I80A 2PHZA 1TU3A 1AVTA 3GG2A 4G9EA 4TSRA 4WLUA 1QVFU 3KZCA 3GZ4A 5H5NA 1CU1A 3IAS1 4MP3A 2BGRA 1DFGA 1S3GA 4DJJA 4PYJA 5CAEA 5KTKA 3MCTA 4D82A 2ORIA 4HZ3A 4I0XA 2W6CX 3A31A 3SICE 3ZXIA 1WY5A 5ALWA 1OIXA 5EKXA 4RTOA 2VH5R 3FX2A 2PH7A 3VQXA 2OENG 5EIFA 2Y67A 3BHJA 4DLUA 4Y0NA 4C04A 2GVZC 1DIGA 1Y9AA 1EUZA 3BRQA 5HK9A 3SXUA 5B1BC 2HMSA 1DC7A 5ALGA 1DT3A 5U9CA 1PFQA 1Y1TA 1O96B 1CB7A 4I2NA 4R8KA 1S5JA 4TS3A 2JIZG 1S76D 2RIRA 4GP7A 3PQFA 5HTKA 3SWWA 4EDFA 3W4JA 3F3YA 2LGJA 4MW0A 4JAVC 1D5AA 2IYUA 2I29A 5ADHA 4EG8A 3UK0A 2LE0A 1JU3A 4BCBA 2DWCA 3G7NA 1L7PA 4L87A 2GK3A 5SY9A 4ECAA 3B3FA 1QF6A 1Q12A 1GNLA 4OO3A 1IEQA 3SS9X 2H2GA 1NW3A 4LXTA 2WG2A 4RMIA 4P0PB 1GN6A 4DIEA 3QSGA 4QPPA 1AROP 5TVKA 1BC5A 2RSLA 4HLUC 3QIVA 1S7CA 3IHWA 2VRCD 1K7YA 2A06H 5EQTA 2D3TA 4RMHA 4HLUA 4ATNA 4DQXA 3PNVA 3O8CA 5LP6C 1UMBB 2GJ8A 2Q9CA 3N27A 2DSNA 2O2YA 3ILVA 2XAHA 5GM2A 2GAAA 4P4LA 4KFUA 4XM1A 4CF3A 1LJ8A 2DJVA 4KVGA 4P32A 4C5AA 2OP0A 2XT6A 1QRUA 3QUTA 4K9RA 3M34A 4KQWA 3NIGB 4FGLA 4MS3A 5F33A 3CCEV 4X5OA 2Z1NA 4YUVA 4A82A 4DV5O 1YE3A 2JD2A 4NMWA 3TVTA 3RSZA 4Q93A 2OXCA 4BMDA 3M2TA 3ZLJA 2CL5A 4S2EA 5CMLA 2AS0A 3NTXA 3N6VA 3AW9A 4A8PA 9MHTA 4D3XA 3RF7A 2B36A 3GW8A 3NKLA 5FL7G 5FOWA 1Q3EA 5FWDA 1ULUA 4F2PA 2PH3A 2BKVA 2IYFA 4FYWA 4HAWA 2RKBA 3RB8A 1XLVA 3TIXB 3RADC 2HXYA 2Q99A 5LMNO 3FZGA 2JJ8A 2QLFA 3MGBA 5IC6A 3USZA 3R0JA 1UJMA 1X1EA 2ZB4A 3BXXA 4QPJC 4L9WA 3JZFA 4ARZA 4D4MA 3L73H 2ZAOA 4G0MA 2HTEA 4HWGA 1I3OA 3QMVA 2JS7A 3OD1A 4AYXA 1Q2UA 4OA5A 4MWSA 4JTCB 1IULA 1QP8A 1W1WA 2AI1A 2FAXA 3Q0IA 2ZRAA 1QDUA 4KK3A 4PYLA 4R2LA 3QUCA 4R1MA 5IKOA 1AN0A 4A3SA 4PX9A 2GAIA 1LUWA 1QHEA 5HMMA 2WMDA 4HRAA 3WGIA 1V7CA 1VGRA 1M3SA 5CLIA 3CZRA 4L7VA 4BX9A 1E1RD 4KAFA 1PJAA 4UEJA 2ZJ6A 4OLAA 4KHPB 2OQRA 3CF6R 3HFGA 3CRAA 1HT2E 4FGJA 3VKUA 2YXYA 1JQLB 1QPBA 1DO8A 2WF6A 3GVPA 3LAWA 2GSWA 3F98A 2MSNA 1JIVA 4MRMA 1OROA 1UM8A 2QN1A 3STVA 1FVFA 2FQXA 1Y98A 1EBOA 3G7UA 4TLEA 3ILYA 4NBVA 3CM0A 3HLKA 2GV9A 4LJ4A 1J49A 4OXIA 2Q1YA 3PCRB 4N3BA 5BV2P 4XLLA 3W2FA 1ICIA 1BDMA 5M3BA 3T5GA 3HEBA 2FQ1A 1V5FA 1GA1A 4IXDA 2NT4A 1VE9A 4PTLA 2X9VA 4XYMA 5D1HA 3TAXA 4ZKDA 4ZI7B 5CA0F 3EIOA 1R5OA 5GVRA 4JI1O 1QWOA 1VJTA 3DCIA 4ZRMA 3B6EA 4JLUA 3GGGA 1UMCA 4YREA 3SIRA 3IOBA 4D0LB 2O4UX 2XUMA 2XYVA 3AJEA 3GO4A 2VWJA 3LBIA 3KQLA 3EVAA 1XCJA 2R7NA 4A5OA 3NUGA 1QQ5A 3T1HO 3GHYA 3RRMA 3V7UA 5L4SA 3HYCA 2DWQA 3EBPA 4YDSA 2JBWA 5B1BB 1ZRSA 1QE5A 1ZCZA 5DRYA 3TYXA 2PT9A 2Y1XA 3PQ5A 4OGLA 5JFGA 2R7LA 1NVEA 3LLSA 4RXTA 4MCIA 3FXAA 5A0TA 2Z2ZA 1VLQA 4PBTA 2JGUA 1J2UA 4CQLB 5DT9A 2ETVA 4YJFB 1CJVC 1M6VA 4YJGB 3MTEA 1P0FA 5DYNA 3U1TA 3QVNA 4DV6B 1QS0B 4YYEA 3E8MA 3UCXA 1RVV1 2CTQA 3SKVA 5FNZA 1NRXA 3BC1A 4TQAA 4US1R 1C7JA 3ZIAA 1NSTA 1DC4A 2FSPA 2JJ1D 3LUPA 3V8QA 1A4UA 3WBJA 1P81A 3NWPA 2YSUB 3LVRE 1JA0A 1QIMA 2W43A 3ACCA 3M4JA 4RK1A 5CM9C 5FI0B 2Z8ZA 3ZI4A 4PN7A 3DFIA 3KLOA 2QRUA 3F2VA 2FWJA 1DXOA 2JFXA 4JCOA 5F78A 1BCSA 2ES4A 2YJZA 4JVLA 3TDKA 1OZFA 2PFKA 3X2QB 1KAOA 2XMDA 4C4YA 4YJ3A 1Z62A 3GX1A 2ZTMA 3N8DA 5EVCA 3ZHCA 1P17A 2SICE 3D6AA 3PYMA 4BUZA 5D7NA 1S1MA 3RABA 5K0ZA 2BR5A 2AZ4A 1HOTA 3CVYA 5AWFC 3I0NA 3FMOB 3VSDA 3A1CA 1DMSA 4FOTA 5HFJA 1VSUA 1Z06A 3KPVA 5C34B 3ZE9A 1L5QA 3L7CA 4CL3A 3NIWA 1YWGO 4V03A 3SHOA 5ITWA 2IJHA 2V4DA 4M87A 2IYSA 3IQXA 4AZSA 3OQNA 3RVRA 2XLCA 4U3JB 1YXBA 4HY3A 4MXDA 3E0XA 4HYEA 4RDCA 4XUGB 4R2HA 2HXVA 4FYMA 1K0UA 1YZUA 2ZR2A 2X3YA 1HL3A 1EXWA 2OT3B 1MJGM 2YJTD 4UXJA 5IBPA 5JWHA 1WCIA 2DULA 2E74B 3CLRC 5AXBA 1L2TA 1ZONA 2HLDD 4W5HA 2VK4A 2HSJA 4X91A 1JA1A 5CK4A 2VK2A 3TSCA 1HNZB 1RRPA 1U97A 4JELA 1O97C 3AG5A 1FFGA 3CBGA 4GPBA 3PTZA 5EBWC 5AHWA 1TMOA 2CLFB 1KC8W 1HORA 1H9CA 3T1YB 4P9PA 1D9XA 5IJ0B 2P4VA 1MOQA 2A33A 2DOKA 2UZ0A 3Q0EA 1EB8A 4XB6B 3V1TC 5LNK6 1DCKA 4PC6A 1MMFB 4Z3OA 2RG7A 1QLWA 2IYNA 1VLHA 2AN5A 2HA6A 3BHNA 1ZOPA 3CCBA 3SOZA 1I13A 1BE6A 2H92A 4K2AA 3KR0A 3W5JA 1RPJA 5HJ2A 1O95D 4JSRA 2FR8C 2W11A 1E5TA 2EOAA 5AHKA 3X1YA 1D2NA 1T10A 4K6HA 2I2CA 1Z4IA 4AURA 2PANA 1XDWA 3EHEA 3KWLA 4ARBA 3CVVA 1FFCA 2WF5A 4J0JA 3DZGA 4L57A 2BDTA 4LVCA 1ORRA 3BH7A 4QFMA 3G5UA 1YOBA 3D43A 3WGKA 5ARBA 3JYLA 1DAGA 4F93B 4I3GA 3N9IA 5AVJA 2VYND 3L6UA 4LYEA 1H6AA 4XRRA 1SXPA 3HSSA 2RGUA 3I28A 1OVGA 1I08A 4HFJA 2RC6A 4W8OA 5DN9A 1ZAYA 2QI9C 2FZKA 3SXPA 3M70A 3I5XA 1ZWKA 2HPAA 3LMKA 1GZ6A 1OLXA 2Q6TA 5JJCA 4CF7A 3STLC 2J07A 1BG6A 4LYJA 1WPBA 4JI5O 3NANA 1U9JA 1REQB 2RAUA 3JSLA 2ZE5A 3NIBA 2YDXA 5E3IA 2WZDA 1MO2A 3JQBC 1QORA 1GVHA 3MAJA 4XVHA 2VATA 3MWGA 5ALSA 5DN6A 2OFWA 2ZUDA 1I4TD 1MAWA 1R6KA 3HJAA 4BY9E 1Y63A 1UOOA 3HR8A 1MAUA 5M52C 1Q3TA 1T8TA 3P5SA 3GRVA 4ETIA 3FZNA 3SX4A 3WL6A 3CXRA 3SC6A 3PNKA 3G5MA 3KAQA 3V80A 3K0KA 4UFOA 5FJIA 1H2GA 1N2CE 1YZGA 5IJ9B 1OFUA 3TI7A 4F2HA 2CGOA 4JFRA 3AQ4A 4UVCA 2WIAA 1Q0PA 2VDWB 4D45A 2NZ2A 4ZZ2A 4KNYA 3ZJUA 5H9CA 4JBLA 4BRSA 4E30A 4Z7OB 4RAQA 4OX9O 1U81A 5G3ZA 2R97A 1BU8A 3IHTA 4JIMA 4R2WA 4RACA 2W22A 4PSUA 2VTEA 2VEDA 2XTNA 3FW1A 4HSEA 5C1PA 5IT5A 1ABBA 1OPXA 2O8EB 3VOUA 4EW3A 1KRXA 4C7UA 2CLOB 3ZK9A 1MJNA 1NJ6A 3IUNA 2YXLA 3PXAA 4RHCA 4TUYF 3T7IA 3L93A 4TWBA 1DSSG 1OC2A 3QWBA 3B9QA 4TKVB 3WMRA 2D74A 3PQ4A 3Q6NA 1Q44A 5DI3A 1GRRA 2OWOA 1X39A 3UWDA 4BV3A 4NOJA 3KCXA 4FBGA 3F7VC 1GRJA 1PWYE 4PHCA 4CM9A 3IURA 3QXJA 5FPPA 1FP4A 1XOIA 1D6MA 3HKBB 1JG1A 3MT8A 3VRHA 2E9SA 1I5RA 4DCPA 2OA0A 2ZT7A 1H1DA 3DOFA 3DUWA 3QWAA 1EESA 1DRJA 4F7DA 5JZOA 1EHIA 3T3PB 1W48A 4HDOB 4RTJA 4WV3A 4FGKA 5B3LA 1DFHA 1WP8A 3DULA 2B7BA 3HO6A 3UG6A 3NASA 4BBJA 5IXSA 1ORHA 2VRZA 2A2ZA 3EMVA 4JLAA 4TRRA 1DQRA 2AMLA 2PKQP 4TL7A 1A1SA 4FNAA 5FRDA 2A0LA 1XX6A 1UKZA 1VSBA 4QICA 1PJ2A 2DPHA 2HRQA 3GH3A 3AYXB 4YFVA 1HL7A 1NS1A 1E7WA 2IPAB 4KUEA 1P4RA 2OD7A 1L5YA 2O2CA 1VDZA 3DOEA 1AU9A 5AK3A 2DY1A 5AOVA 4JTAB 4XM0A 4YJ3B 2Z5GA 4OY3A 2UZAA 1UKAA 3TZHA 2VJMB 1XHZA 3K8ZA 2PGDA 1VJDA 3R24A 3UGQA 4UOZA 3DZ8A 4JYAO 1J0AA 3R2JA 4Q4JA 1LZKA 1X80B 4B6PA 2Z4SA 3OZDA 2CCJA 3TOSA 3PDHA 3ZG6A 2P8JA 4DZTA 1JFFB 2B4YA 3HBAA 3PYLA 3LX4A 2WAOA 4E5MA 4ZPXA 5IEJA 4CQJA 2JCGA 1Y1QA 5JO9A 4C89A 4CKYA 4I4NA 4YTEA 5BWCA 1H2FA 4RESA 1DBIA 5CA1B 1RTTA 3AF0A 1T8WA 3ASZA 5C1BA 4ZD4A 4UAJA 2CK3A 4JQZA 4B6OA 4DCCA 3Q15C 2WM2A 4LP8A 3CE2A 1KFEB 4N65A 4WF9V 3EWAA 5TMBA 5JATA 1MHTA 4YRTA 2CDNA 3X2FA 3QKRA 3N59A 4NVPA 4AQ7A 2JKYA 1YKSA 4U0JA 5H7XA 4E4YA 3QY0A 1QFXA 4AO8A 4BVHA 1B74A 3PGLA 2CHFA 3R7LA 5CEJA 1NQVA 2WF9A 5K4GA 3BXZA 3H65A 2BFPA 6NULA 5FH9A 2JIBA 1QHGA 5JT1A 5IBCA 4DRZA 2PKEA 5AKEA 3GAFA 3IL2A 1GUAA 3BJMA 1YD7A 4P2GA 4GGMX 1FLVA 2QIPA 4BMSA 3G5AA 1VI2A 4WFFA 4H7FA 4HX5A 3GPIA 2AKYA 4XUDA 3S1AA 2F90A 2AEMA 5IJAA 3RAGA 5BSHA 3KXIA 3L82B 4QEDA 3TOCA 4AD8A 2AR0A 1BOFA 1MB4A 3LT0A 1GGFA 1TYEB 1ND5A 2MSLA 1V35A 2QN7A 1VJRA 5JVDB 1VHLA 4DC1A 1V7ZA 2O0KA 4WNAA 1JG6A 1E59A 1MIHA 4TTPA 3G8DA 4YEDA 4ILGC 2QL7A 1DG3A 2RHOA 4K6CA 1OOEA 1BHO1 1YVWA 5CRIA 3VZCA 1XCLA 1C30B 1CT9A 1PLJA 3H19A 3M8KA 2ZRCA 4GOLD 4WZZA 4J7ZA 4OLHA 4HDQB 4P3XA 1WXGA 5LOVA 1VP7A 3B40A 1WQ3A 2AOVA 3JQ8B 4K28A 3I23A 1NMQA 3SHTA 5EJFA 4O4HF 4LXYA 1UZMA 5BN4B 3HO8A 2D2IA 5DYIA 1SKAA 1ESNA 1G42A 3P9RA 3DBVO 4Z86A 1YULA 5JBQA 1AUPA 1JJFA 1RHJA 4UM9D 4U2DA 1T6YA 2GHIA 1CQJB 3LWBA 3T7DA 4MV1A 3FAVA 3ABQB 1OFHA 3CR7A 3QMWA 4EFBA 4GXRA 3HUEA 3KEQA 2IQ5A 5B57C 5CDHA 5LP6F 3L71H 5ED4A 1RXWA 2HM7A 3MRXA 3C3KA 5K3AA 4EFMA 3T5TA 1KSHA 3CC8A 4DV2B 2J08A 4YFYA 3GRPA 1G60A 2X0FA 2WJJA 3HVIA 3IA2A 2B1GA 2ZYDA 3KYDA 1XLTA 5E4TA 3C3YA 3WRYC 3FSGA 3IVCA 1W59A 1RVDA 3T5PA 2B9ZA 2A9QA 2QL6A 4FS3A 4PWYA 2BCCH 3SEZA 3ADBA 2O19A 4FONA 1NI8A 2R6R1 1SNYA 1HK7A 2Q7HA 3S28A 4KIFA 2CVPA 1HRDA 4QNNA 2BOVA 2FCAA 4B35A 5DW0A 2BHNA 4GDFA 2BBOA 1F2TB 4WJZA 3W77A 3CMEV 1RLTA 2XGOA 4P4TA 1R6VA 1Y3IA 2R68A 2PRZA 5FTJA 3UW1A 2HNKA 2NYRA 1R0SA 1U8XX 1RKXA 1K86A 2PLNA 1FMLA 1M83A 1F0KA 3L8GA 3QELB 2JI8A 3DT9A 1N7HA 2BM8A 3T1HB 4MJ3A 3OJ6A 1G2IA 1APBA 1GUBA 5IZCC 4EKDA 5KWVA 4CMAA 1NGSA 1ARZA 5DCAJ 1K6EA 1FIUA 1Z4OA 1BMFG 4JI3O 2PGNA 3L6CA 4LCUC 5TPZA 1E9RA 5CBKA 1U2DA 1W4CA 3ABLB 1NF3A 1L5VA 1VL6A 2DHCA 1ZJ6A 1GN3A 3FDZA 3MWFA 3ZZMA 3UPTA 3IKTA 3EPLA 1D1PA 4R8VA 2IVFA 2DYRC 5L3FA 2R6FA 3F8TA 1R4MA 2HSEA 3LCCA 4UKDA 3FYIB 3JPYA 4HDAA 3DWGA 4OQQA 4RUKA 3ZDZB 2OV1A 2C9OA 3DLPX 3RTDA 1G5TA 4CT5A 4IGEA 5DF1A 1A1VA 4RVOA 4PS1A 4UQLA 4EPTA 5G0UA 2VJMA 1QLEB 4XQGA 2YI8A 2XXBA 4CM9D 2XSZA 1I9GA 2IVZA 3HA7A 3IBGA 4E2FA 1VZ3A 4MV8A 4MKIA 4PRLA 4C29A 3G2NA 1UWZA 1JXQA 2HDHA 4MKZA 2C2XA 1RI3A 1ZIDA 2ZAMA 3IDAA 1SC5B 4KQJA 3UMGA 3PGXA 4CV2A 1B8OA 1H38A 2OO5A 2Q3LA 1X38A 2XECA 4RH0A 3RKSA 1MRSA 4BLTA 4OWPB 3M7MX 2X13A 4EUEA 3I9OA 1XFAA 5JS7A 2NYAA 3EHBB 1PVDA 3AEQB 3ZGZA 5JZVA 1T9DA 1WKCA 1DIHA 1DZIA 1TJYA 5L7YA 1IHPA 4CH4A 3UC9A 4AY5A 2CK3D 1W35A 4JBNA 3HB9A 2VUIB 5F77A 1PNKA 4R1LA 1I2MA 5B5EZ 4TQGA 1FDIA 2X9NA 2C61A 4KU4A 4XQEA 3BCHA 4ZCSA 1VG0B 2P8SA 2R66A 4TSFD 4OFXA 4QOJA 3WKDA 3KAKA 3FPAA 1KDRA 4EYSA 2V58A 4WA8A 3H9CA 3R0IA 5DHAA 4RPGA 2WTBA 2ZWIA 3LRTA 5ALRA 4RVFA 4Z1MG 3WVNA 1R74A 4G8CA 1YQDA 1LLQA 1JIQA 3MGAA 4UEKA 1X87A 2OK8A 3DMPA 1E2NA 3K15A 4CM8B 2IC5A 3IEXA 3QJGA 2GFIA 1L5KA 4L4RA 1G7TA 4FZ3A 4CE6A 1QGAA 1LQTA 3OFND 3QH4A 4FWIB 4BVFA 1PNVA 4N7MA 1SUDA 2HJHA 1YEWA 4ZOBA 4DARA 5JWOA 1EFAA 1GKUB 2ZJZA 2AXQA 4YMHA 4JJAA 2PBLA 1AC5A 5J4LA 2A0YA 3OGCC 1XTPA 2PLAA 3OIYA 4A36A 3S5JA 1SZCA 1M93A 4U8GA 4B7KA 1II0A 1F8GA 1IHOA 2HRCA 2QXUA 2QPTA 2W2TA 3E3MA 4MNTA 1OX4B 4O0LA 4N76A 2JCVA 2CCGA 3Q6IA 4JDPA 5E4FA 1MC8A 2QF7A 4LF8O 3K04A 2NSDA 1NZJA 4ERXA 1SGWA 2IYQA 3WLSA 3VNVA 4LRSB 4PZEA 2XQGA 4MKXA 3OA2A 2DSTA 4PG6A 1NN1A 1YUNA 2FW8A 3KYBA 5HDQA 3L1VA 3O5AA 2BMJA 2OHHA 4HDSA 4CFZA 1EVJA 2JKZA 3AW8A 3I1FA 4I9GA 4TYMA 4X95A 5ICFA 4BFUA 5KO2A 3LOQA 4KIGA 5A1TA 2IS2A 2PAAA 1J2TA 4NESA 4MROA 3G6EV 4O5AA 5KNLA 3EGVA 3RIEA 2NNWB 5HOQA 4UCSA 3M5CA 4OHYA 3HBJA 5GPBA 5FPHA 3G1TA 5KUKA 2Z9CA 2IW3A 3ZWMA 1R16A 2BEVA 3LBHA 3MS2A 3C3TA 3FOEC 4B6GA 1N5RA 5EQFA 1LUVA 5CJPA 4MTFA 3W3AD 5BVHA 3S8EA 3THYA 1NATA 1T2CA 2FEPA 3ECCA 2CJYA 4DV0O 3PZBA 1N8RW 4FM0A 2GWRA 3P0EA 4HGNA 1CVLA 4NLLA 1DOHA 2OORA 2QD3A 3GGPA 3Q98A 3ZY4A 1G8MA 2GX6A 2NO9A 2OD9A