1THZA

Crystal structure of avian aicar transformylase in complex with a novel inhibitor identified by virtual ligand screening
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of avian aminoimidazole-4-carboxamide ribonucleotide transformylase in complex with a novel non-folate inhibitor identified by virtual ligand screening.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 217
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1thzA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1thzA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1thzA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1thzA02
1KEEA 1BXRA 1G8MA 1CE8A 1A9XA 1B93A 2XW6A 1CS0A 1S89A 1C3OA 1IK4A 1EGHA 5H3LA 3ZZMA 1VMDA 1PL0A 1S8AA 2B1IA 1JDBB 1PKXA 1M6VA 1T36A 1ZCZA 4EHIA 4A1OA 1P4RA 1M9NA 1THZA 2IU3A 2IU0A 1WO8A 2YVQA 2X8WA 2B1GA 1OZ0A 1C30A
chains in the Genus database with same CATH superfamily
2WJHA 3NGLA 5HR5A 3FGPA 5FF9A 1QBGA 1QIIA 3REQA 4Z1OA 2ADQB 3VKUA 1O96B 4HC4A 4WAUA 1QUFA 1EBBA 3CMAV 4V24A 5DNYB 4AICA 3MDSA 1GN9A 2AI3A 1JAIA 2EEPA 2X5XA 4MRAA 3T0IA 5EINA 3R66A 1ESCA 2ZSHA 2BH9A 4GLLA 1R64A 4CPDA 2XD4A 1IAQA 1KQ3A 4IFTA 3H4TA 3O4IA 2SICE 4EBBA 1SZPA 3APQA 3GJQA 4O1MA 3F6CA 3PHHA 3UXYA 4Z0HO 1AF2A 5KB3A 1SULA 3FJOA 4B3MB 4ZYYA 5TVKA 1WB9A 3D6JA 2UVQA 4WN9A 4PCUA 3AUKA 2CMGA 3L41A 1C30A 2FJPA 4P3OA 5ISMA 1YH3A 1R10A 4FNAA 4RXMA 1V7CA 5JASA 3VHXB 2IS1A 2ANCA 3PQ4A 2IYNA 1DO8A 1ZOOA 1W9MA 2XECA 4GC5A 4FLZA 1YR1A 4MUBA 2YVUA 3PTAA 1X1EA 1NBIA 4N0QA 1FJGO 2XQJA 5I7AA 1EGQA 2JIZG 4AJLA 3PJEA 4ZFTA 1U8ZA 1CJTC 1LLQA 2Y1DA 5LQAA 4Y1GA 4PIPA 1XMOO 4BOYA 3CY6A 4J1NA 5IKEA 3BAZA 4KUMA 4ZVQA 5BSTA 3UWMA 5IF3A 1PD1A 1SBIA 2HVVA 3SNHA 1A3CA 4AI6A 1S2NA 4ZYUA 3UEOA 1N7IA 1XEWY 1XGKA 3BS4A 2O3SA 2YWJA 3L06A 4H7PA 1V8ZA 3W8NA 4ESEA 2AZDA 1SG0A 1V2HE 1W47A 2Q9BA 4Q4HB 3HEBA 4AJOA 3N9IA 3RUEA 3E35A 3BRWD 3IOBA 2BFBB 1YITV 1F38A 2RKBA 3P8ZA 4M37A 5F3RA 4AO7A 5DWQA 5JXIA 5A0TA 5BW5A 1JE0A 2PH3A 5TY0A 3FGNA 4MH0R 2PZMA 2NO7A 5SY9A 4DNXA 2JCSA 3F8SA 4I08A 2MSEB 3IXLA 4MHOA 4OFXA 1ZSNA 3L1HA 1MQ0A 1PW7A 1MAVA 4X6UA 1O0BA 4AUKA 4AAYA 1DVRA 4HL6A 2W2OA 4MMYB 4RBNA 4MHTA 1SXPA 1Q50A 1T9GR 1N1EA 1VSVA 2ZPUA 3K04A 3OIGA 4QVGA 4N9QA 3IJEB 1XALA 3C1UA 1BKSB 3NDRA 3B13B 1TVKB 4F5YA 5CFRA 2O14A 3DDWA 3ZE0B 4DUYB 2VUTA 4YJHB 1SB9A 4FR2A 4QLBA 1RPNA 1AHPA 1PV0A 4KO4S 4NTWA 3EF0A 2HCRA 5GWXA 1OGYA 2CVZA 1C1YA 3AR6A 2NU8B 3KXKA 4HEJA 2GETA 1PGJA 1JMYA 5LR6A 3DVQX 2QM3A 1RZRD 1QVAA 5LDGA 4M89A 2QNIA 4YI5A 4IMRA 2WPDA 1HE8B 2YIDA 3PNSA 4ZCSA 4L1KA 2AJDA 4DCGA 4E30A 4RTKA 4Q1CA 4JVSB 2LCFA 2WAXA 3GVHA 3R3YA 5EKSA 1Y67A 3M6XA 2OYSA 5AT1A 4E3ZA 5HOEA 2BTQB 2HSDA 1Z4JA 2G63A 2NTYC 3GGJA 4NOKA 4HEA6 1P1CA 2PDAA 4DNOA 4OK5A 3GFVA 3TOSA 2BTOA 1GQSA 3OI7A 1DK1A 3ZEAA 2FFJA 3RSQA 4MGZR 2G1UA 4ZHQA 1RM1C 1GQFA 2RAPA 3FYIB 2CEKA 3KETA 3RW9A 1EX6A 2G08A 3KR1A 5F12A 1L1QA 4B33A 4E5KA 3UJDA 2EYQA 5IHXA 4QYTA 3L0PA 1BL8A 4PA3A 1QG2A 3QOFA 1QP7A 3GUVA 3DULA 4RTJA 4BX9A 4S04A 3W5HA 5E3JA 5B57C 2PL5A 2TECE 1Z12A 4M38A 2ZTLA 4Q3BA 1CZHA 2PUCA 5I7WA 5FFNA 4IDOA 4WI1A 2JGLA 4YYEA 4FDVA 1DX6A 3F96A 2CB0A 3CX3A 1UBFA 1T2AA 2H3EA 3GZTB 5TQ2A 4D81A 4HBZA 3OCXA 4YWJA 2GM3A 2JI4A 2NQ2C 1NDHA 1DC3A 1C3LA 1DTOA 1E1MA 1LU9A 2ROQA 3QIAA 3LGAA 5AOBA 4BRWA 2Y0CA 4RZ2A 1PGQA 3UYLA 1M56B 1ELOA 1QFJA 1PJ3A 1XDWA 3M7IA 2Q2WA 1HZZC 4NU8X 4TWZA 1G0OA 5CCDA 5JARA 2KCQA 1L9KA 3KBOA 3RBVA 4OJKA 3F6PA 1LJLA 3OEHA 4CC6A 3GRPA 4WMLA 3T7RA 2QD2A 3UQ8A 3K3PA 4OHCA 3C6MA 4M55A 3AEUA 2J3IA 4G28B 4HGPA 5BPFA 1PR3A 3G5LA 4FMDF 4BHTA 2V7UA 2JLVA 1YGPA 1QC5A 5FBVB 4LC5A 2WU1A 3C45A 4REOA 3T38A 4CC5A 2UUAO 1U7UA 4YASA 1ZIOA 1FE8A 4AC9A 4LN1A 4B3IA 4HAXA 3PNKA 2J5BA 2X2EA 1G20B 2L2QA 3IILA 3R24A 4FFLA 4A9AA 3D9QX 4RLSA 1FYFA 3AK3A 3S2ZA 4RHXA 3LO5A 4JH0A 5F7XA 2IDJA 4O2BB 3EGVA 4QO8A 5BYBA 4EBFA 2DQ0A 2QWRB 5D5PA 3BMQA 3VPAA 5CFQA 2QVXX 3KVOA 5JH7A 2VK8A 1JHDA 2IZ5A 5I8PA 1DDIA 1PT7A 1X1CA 1T5EA 1ISJA 1EK6A 1W2WB 2YMMA 3AESA 3O8QA 1NXSA 5EZQA 5J5AA 2R00A 4GI2A 4CNQA 5I7SA 4ZZ0A 1LA2A 1XBLA 1GNSA 1C5KA 2FK7A 3PDCA 2ZFUA 1AP6A 4FYMA 1YL6A 4PICA 2C7GA 4D82A 3L72H 2B8TA 3H2IA 1VA4A 3EULA 5EZ6B 2C4UA 5G1PA 4I81A 4KIUA 2ZCEA 1F7VA 3P26A 3I0NA 2GBPA 3B70A 1YIJV 3QVJA 1YZKA 1F8UA 2N46A 4HB3A 2SBTA 1XQWA 2P22C 5CK4A 4DR6O 1N2ZA 3GRRA 4INJA 4OU4A 3OEHG 2CV1A 1ZMBA 4AYXA 2AW5A 3WO1A 3HCWA 2JFUA 2O2DA 1P61B 2XB9A 1LY1A 2C2XA 3DDCA 3ROQA 2ZYUX 4FK8A 4P4TA 1QH9A 3O7MA 1F1BA 1D2MA 4S3MA 1MG0A 3SY8A 3WLSA 1RQ2A 4MS7A 5MN4A 2JARA 3I37X 1K9MW 4NFLA 2EJ7A 1N3LA 1B76A 3A32A 1T2EA 4RWEA 1QIEA 4D8XA 1ORDA 3ONFA 1AUPA 3RJMA 1SA0A 4BP1A 3UJ6A 1EVJA 2IY7A 2XMGA 5AJZA 3WOVA 4HY3A 3B1VA 1ZICA 3LF2A 5A0FA 4KE9A 3RANA 3PQEA 1MVNA 5BV0A 4I4LA 4GR9A 4X1OA 4PYIA 3N2LA 4R16A 4HZ3A 4V0ME 3BEHA 1YULA 1T9AA 3QEMA 2QRGA 3VUEA 2Q3BA 4H6XA 3TW8B 4Q05A 3V48A 1AGRA 4FOTA 4NBUA 2IW1A 5AW1A 1ENVA 3P9QA 3QPWA 1E66A 1I3NA 2JFBA 2R6AA 4MARA 3OZTA 5ALIA 2FXVA 2Q4BA 4QEZA 3TBFA 5AKXA 4JJGA 2QK4A 2AOXA 4DW1A 2IM9A 1RHKA 1GG5A 2F8LA 2FW0A 3C85A 3SIPA 1LVHA 1T4CA 2Q6KA 3HDGA 2CEAA 3G0CA 4BFXA 2F93B 2CHEA 4L8LA 1NP3A 1XD8A 2C4VA 1MABB 4HSGA 1NYRA 1EFPA 2TS1A 3SDBA 1NI3A 4C6RA 3K9FC 2ZI7A 1JXQA 1U5CA 2PMCA 2OBBA 1ZD2P 1Z2EA 3KSZO 5EJIA 2QT0A 2ZYRA 2B9ZA 4IF6A 4IIHA 3QA3E 4LVCA 4NZOA 2A06H 4DMFA 3G5MA 2ETVA 1QJCA 4EDHA 2LCIA 1JWBB 3JQEA 5CDUA 3SYRA 3WJ1A 3BXZA 3KB2A 2LCQA 4ITVA 4DG9A 1YMQA 3FYEB 1RLTA 1ZNQO 2REBA 3C3JA 4QFMA 4YUAA 3Q12A 4FYXA 4YAIA 4JT8A 1E1LA 2BJHA 2NAFA 4FSDA 2GN6A 1PVOA 1C7IA 2FWRA 3PI7A 1HA3A 1QGDA 2OGZA 3RTCA 5BWMA 4QFBA 2H17A 2JGAA 1E6CA 3EVKA 1JKJA 4RVSA 1Z15A 5J4YA 2O7QA 3G2PA 3GAMA 2VT3A 4KDFA 2C1XA 2HTFA 4HG2A 1IXYA 3OCYA 2YOHA 5A2QN 2J9FA 2A9PA 2P4EA 1DKLA 1V3TA 2QAJA 3ETJA 4H6VA 4J0EA 1O1YA 4MIYA 4BAGA 2PT5A 5JLAA 3KPWA 3VQTA 4E88A 4JAVC 1NN3A 1ZJ6A 2OAQ1 2P1RA 2Z9BA 4PZUA 4GP7A 3MB5A 3NT2A 2XE8A 3B89A 1SS3A 1U9YA 4OXNA 1V5FA 1WD7A 3FWPA 3WLOA 1SQGA 2BN4A 4PG4A 4Z4CA 1ZNZA 2ZTUA 4DG8A 1G5IA 3P45A 4LY9A 4UTVA 5IK2D 1NPDA 4ZU1X 1HG0A 2B4YA 3G79A 1UXIA 4MUAA 2X0FA 1YFLA 4BZXA 3NVKI 2W2NA 3MNFA 2IH2A 2DBRA 5KNDD 5KNDA 4PQFA 2ZU6A 1XNQB 3IPLA 1KJJA 1GPH1 1M8KA 5KHOC 5AK5A 4JA0A 2OHVA 4UTPA 2QL5A 5AG2A 5CFLA 4F3TA 1XVAA 1UZUA 3IE2A 4BDSA 4PLYA 4Y1RA 1E2FA 4MGIR 4WPGA 2R1VA 3RT9A 4K0RA 1RSZA 1PFYA 2C4WA 1OR8A 2H92A 3G2OA 1Q1NA 2ENWA 3PNMA 4RLQA 1KRHA 3M49A 3KLOA 1H2FA 1BMQA 1T0PA 4P8RA 4PPYA 4YRZA 4U3JB 3ZDAA 4G5XA 1V1RB 1HDXA 4GCZA 4E5YA 2PXAA 2IYEA 1FP4A 1LFDB 1R4MB 1KORA 4IDPA 4MVJI 5HIMA 4LHVA 4D42A 2NNWB 5A1JA 2YXNA 5D7NA 4C7XA 1ACLA 4R2HA 4OXQA 3IQDB 1L0NH 2Y4OA 3A0RA 3OMIB 1IOLA 2X7HA 1KP9A 1W88A 2VDKB 3JQCA 2H29A 3O4JA 4AL4A 1EG7A 2ZJ8A 1OCOC 3OTQA 3DMTC 3DWGA 4P82A 1OZAA 4F46A 3HWWA 5HF5A 1RWOA 3MT9A 4BE9A 4ICIA 1P9LA 1BE3H 1IBKO 1IEWA 4OI0A 4OBEA 4MUGA 2WE8A 3PQCA 1CUUA 3TCKA 3A2KA 4ARBA 3ZHZA 3LXMA 2OYRA 3U37A 1A8SA 2WD8A 4I1VA 1G1XB 5DBFA 2RGWA 1BGYH 4LMRA 5JQGF 3CA8A 4K8XA 2H08A 5K01A 5DM2A 3WIOA 4CHGA 3NWPA 2FE1A 2PH1A 4IIXA 4C5CA 4N1AA 2ZR2A 2ZJZA 3SC3A 4CYMA 2V6BA 2WFLB 3FH0A 4GR5A 3ZCXA 1L1RA 2FUCA 4LFAB 4AM8A 1U97A 3AINA 3BCRA 1CXZB 3QF4B 2C78A 2PUHA 1YDFA 4MQEB 5KYYA 3G2MA 3SQMA 1L5WA 4K8OA 4D56A 5KA6A 2UU9B 2LUOA 3SYMA 3BSWA 1KIAA 2ECOA 4WOBA 2R85A 1ZAUA 3ER9A 2Q1WA 1V4NA 1MC8A 2CXNA 4JBWA 2Q0QA 2QM7A 5HP4A 3BDVA 1YFKA 2JF0A 4M0UA 2YXLA 1IRIA 3EOZA 3AK1A 4K6MA 4LJ7A 3FN4A 5BSRA 3VFDA 1EZJA 4E6EA 2AS0A 1UFQA 1AO3A 1H8HA 4E51A 5ALXA 3ESRA 4DV5B 1R27A 1ZFNA 1ZSPA 2OLKA 4TYPA 4N4AA 3ELUA 4B7EA 2EIMC 2COEA 2PGXA 4MW7A 4R8RA 1CVLA 3F73A 1Q81W 4JKYA 1F8XA 4S12A 4AF6A 4EFLA 4LC0A 3D0KA 4G0OA 3U56A 2WPNA 2ZRMA 1TC1A 1QRAA 1QDEA 3QVGA 1PEAA 2NUBA 4BDTA 3GRFA 4UE6A 1QR9A 3I9NA 3HL4A 1CIVA 1JIQA 5E9JA 1I08A 1R0ZA 3U0BA 1J0XO 5CFOA 3TD2A 4DWVA 2GRJA 1NN1A 1T9KA 1KJYA 2Z43A 1SRQA 1VJ1A 1T0JB 1TKRA 4Y0AA 2CFOA 2A0WA 3HV0A 1QYCA 3GCGA 4NMMA 3WQBA 4AN1A 2A3QA 1XL1A 4EUHA 3RVPA 3HU3A 3UENA 4UE3S 4CV0A 3SZ3A 5E6SA 3Q88A 5CGZA 3ZGNA 1ABBA 2YJNA 4XGRA 1XN4A 4V0RA 3BL5A 1CUEA 1OZ0A 1XMIA 2C5HA 3OM9A 1HYQA 2VJNA 1W2BU 3KPUA 5GZ3A 5GV7A 1NN5A 4MVZA 1QOZA 2NO6A 2JVKA 5L6MB 5IJAA 2VJOA 4I5SA 1EVKA 4HQ6A 5CB0A 1CQIB 2F3TA 5I48A 3OR7C 1QNFA 1XC7A 5CLGA 1EFRA 2BM9A 2RJOA 4EI9A 4G0WA 2XOKD 3IV9A 2XMSA 1Y3IA 3ROZA 3NYIA 2ZKLA 2IV7A 3L7DA 1DTWB 4LG1A 4Q19A 2IH4A 2RGRA 4JZKA 4MQBA 3E7FA 4MS1A 4XRRA 3D7KA 4RTPA 1MC4A 4KREA 5KTTA 2M6YA 1VMDA 2C4KA 2GXSA 3QYPA 3CC7V 4IY1A 2OTJV 4PIVA 4DM7A 3P2EA 1QQAA 2ZYIA 4M0MA 4DAOA 1ZMXA 5LOVF 3ZPGA 2RI6A 1PHRA 2AJTA 5CBFA 4RJLA 3F6BX 3HJNA 1GQYA 1R16A 5EIBC 1PQYA 3WYCA 3JD2A 3IT1A 3MJFA 2QIPA 3NU1A 2QYOA 3QBTA 2GRAA 2AGAA 5HKKA 1I2AA 3SQNA 3VPDA 1Z2AA 3DQPA 3RZUA 4V2UA 4BYMA 1GD1O 1TA0A 4G2NA 5DTEA 1GLVA 3VR6A 4J0QA 5HFJA 5CBHA 2GBLA 3DF7A 3U31A 3LKBA 3F1LA 1EM8A 1WA5A 2I99A 1Z6YA 5BYKA 5ER9A 2A6PA 3OBBA 2W58A 2F43A 2R44A 3GFRA 3K15A 1PF7E 2OBFA 3Q6MA 3BF8A 1A82A 2YJGA 4G8CA 4XDYA 2OYCA 1FTGA 1QVZA 4HNSA 5KUKA 2WI8A 1BZYA 4XJVA 4Z4QA 3L46A 2QG4A 5SY4A 3R7DA 3EVAA 3HVJA 1PL6A 1GFWA 1U65A 2QU8A 2X1MA 1YASA 2J8ZA 3CNOA 4IO0A 1BWSA 3K1AB 4IUCS 5CNJA 4ZVPA 3PRHA 1LB1B 2X7JA 4J0CA 2EP8A 1N2CE 2GNOA 3ZD8A 1GG2A 3PC3A 1WY7A 3TPZA 1RC1A 4A16A 5CLJA 4ZD4A 1GK9A 2DFTA 2ERYA 2X3YA 1J90A 2BHSA 5TE9A 1XVTA 3NALA 2VDWB 3IEMA 4MQ5A 3PKJA 3EAQA 1ZIDA 4P5PA 3VOBA 3IA2A 5KLVH 1ZZGA 3FTFA 1FBTA 3KLPX 2APJA 1G2OA 1NW9B 1SZJG 4L5JA 4BTLA 3ZHVA 1T8TA 5H6RA 2R1TB 3K09A 5EHIA 3QPAA 5KEIA 3TMKA 4C76A 2GZDA 1GN4A 3KEOA 3JCUZ 4UV8A 1P1BA 4DILA 5AI8A 1Q19A 1GUBA 2A9VA 2G7MC 3AY0A 4CT4B 1BO6A 3H5OA 5TVGA 1V11A 5L45A 2WSMA 1MXFA 3NDJA 3O2JA 4D9KA 2XLCA 2GD1O 1F4VA 3PD1A 3C7DB 1AB5A 5SZIA 3OCQA 4WXHA 2X42A 4OFWA 1U63A 4M0CA 4K28A 2OFXA 1H2KA 4WGGA 1JLRA 1LC0A 1XRJA 1GN3A 1ICIA 2ONYA 3C8MA 3HUTA 3P2OA 3TB6A 1MR3F 3HVUA 5BXQC 4OCLA 3E89A 1UPAA 4CH4A 2OCHA 1L7QA 5LQCA 4BXOB 3RK4A 4V0KA 1EAMA 1LDBA 1IUOA 5FPOA 4ZKIA 1SKAA 4KFUA 2N04A 3EVNA 1YR9A 3SX0A 3EIFA 3QX9A 1L5LA 5I9NA 5K2OA 5AVXA 2IRWA 4OQPA 4EK9A 1FMJA 4IX1A 4LI0A 5IFKA 4LDQA 5KOIA 2VYVA 5IDVA 2QL7A 5BV2P 4BKUA 4X61A 4ZVVA 1IWOA 1Y3FE 1BN7A 2I4TA 2Y1GA 1RHUA 2VG8A 4LMPA 5BQOA 2FTKE 5EL0A 1JECA 3F7MA 3PUWA 4KLAA 3KKMA 5EN4A 4NCAA 3LCCA 5LQMA 4F7OA 2PX3A 2B5VA 5IAJA 4MMXB 1AF4A 4QPNA 2F8MA 5C8VA 4JQOA 5B6JA 1O9BA 3TLYA 4EY8A 1U98A 4X88A 3M8AA 3DHVA 3PC6A 2KW5A 5AVKA 3VX3A 4UM9B 1X7WA 3W7WA 2Q4TA 4NB5A 1H2WA 3DDNA 1D6NA 3NHBA 3GWKC 4Z1MA 5UKDA 4J2TA 3NRCA 4S1NA 2QUJA 1KJ9A 1LNZA 2IXDA 2FR0A 1XB2A 3B2EE 1YRLA 2YC2C 4RKWA 4EA7A 1JKMA 2OBYA 1HZZA 4MR9B 5LHGA 1INLA 2C31A 4I5EA 3LPNA 4O4JA 4BJHB 3IEUA 2Q67A 4B7ZA 4DRZA 2EZOA 1D7OA 1M6NA 4UVHA 1P1HA 4PF1A 2PWZA 4PSKA 4ZVRA 4YMUA 5BY1A 2D8AA 1QH8A 3HXKA 3QNEA 2IHVA 5KNBD 2VP3A 1RKBA 5LBQA 3KPVA 1V7QA 2HQBA 2V7VA 3KT6A 2CFSA 3X44A 1R1DA 2HJSA 3O0TA 4ZI3A 3WHLA 1CUVA 2JL1A 3WXBA 4DGSA 3QLEA 3EE6A 4V0NA 1QZXA 2P9CA 1R9MA 2NVWA 3E9YA 1LSOA 1J0AA 1JR9A 1EEHA 2E3JA 5IDJA 2FFHA 2PLFA 4WADA 4BLQA 4JI4O 1NPYA 1G42A 1K8AW 2ZTVA 5E38A 5E4TA 5A71A 3ZHUA 1U5BA 1YS9A 3FTCA 3IKVA 4UBKA 1FFYA 1P17A 3O9ZA 1EWKA 2ZITA 1TIYA 2R00C 4B6FA 3FMFA 3N6RA 2VDMB 3T7JA 1USVA 4BQFA 4G3MA 4BCDA 1D04A 1QV7A 2BGJA 3SYQA 3AVOA 1TTPB 1GAJA 4JN6B 4POAA 2OZLB 4L02A 1MB9A 3V2GA 3TM5A 3HRKA 5CW1A 2VWGA 3EGEA 3QHQA 3FFAA 5DRTA 3RFUA 3PBKA 3WKAA 4G41A 1Q44A 4BTEA 4HLDA 4DABA 3EQ9A 1QLNA 1B6SA 1VIYA 2CNKA 4AS3A 1PX2A 2OCBA 3SJCA 1GTVA 1HORA 1OU4A 5HTKA 1EXWA 1H3FA 1X0VA 1SCDA 5EMNA 1GNQA 5JFOA 2KM1A 2JK0A 1BC5A 2I2BA 1JYEA 4MJ7A 4ZU6X 1PD3A 2X13A 2X0DA 2BEWB 4JHLA 4NK5A 5CCXA 3EISA 2IHYA 1F8YA 3A1NA 2OORC 1RM0A 1ODTC 4BMSA 2CJPA 4EARA 4CEJA 3GFTA 1YE3A 3MXOA 2CLDX 5KDOA 4KQ9A 1SOVA 1M76A 3PJGA 1RRFA 2RGYA 2Z8YA 2JFNA 2HIHA 1J95A 3P5SA 2G7ZA 2R7MA 5HIIA 2ZRIA 3HGTA 3K9NA 4MYDA 3TSCA 3U0VA 3EWNA 4INOA 4JJZA 5H5NA 1TZBA 2XTMA 3AH8A 2FJ0A 4LWPA 4J4BA 3ZW9A 3SF8B 1BWPA 3ETNA 2X8JB 4O2LA 5CURA 2AC2A 2PEYA 2EKBA 3WGYA 4CMCA 4LF7B 2VZ9A 1O57A 2G28A 2WTBA 2E48A 1XAIA 2WT8A 1UPGA 3K06A 1UBEA 4IMPA 1T35A 1ULTA 2VPQA 3EBPA 1MFPA 2E55A 2C54A 2HDWA 1FS6A 3NQ41 4O1HA 4NU5A 2DJIA 1FU8A 4FYHA 4DV5O 3K7EA 4X1KB 2BFEA 2ZW9A 4C4OA 2PRJA 4ZQIA 5EC2C 3RWMB 4XX0B 4TT3G 1WP7A 1R73A 3QJYA 5BNZA 1ZMRA 4BQEA 2OMKA 3I5AA 3L6UA 4C2TA 1I36A 5LA6A 2KHZA 2NADA 2ZI4A 3DXZA 1BFDA 2C58A 1PNQA 1CJVC 4INZA 4ZEOA 4E09A 3PWTA 3DBOB 2XNDA 1Z2OX 1G1AA 4U9IS 4QPJA 5AJXA 3OHSX 1XPRA 1OJLA 5CXSA 3LYHA 4LDNA 4QASA 4TTAA 5I7FA 5KYXA 3OZSA 2JASA 4MIKA 4F3YA 4LP8A 2AOTB 1HP8A 4M1QA 4F4DA 1OILA 1Z2CA 2YXHA 5JADA 4P2ZA 3ZHYA 1T3SA 1I9GA 1VJ0A 2ZPTX 4V0MA 4H13B 5DLPA 4ZHQF 3RK1A 2VP0A 4H77A 3MTAA 4S24A 5KHHA 3E3MA 3W7TA 1E3SA 4QULA 1R0SA 2VS0A 2KQUA 4LEIA 4MPTA 2FZCA 4R31A 1TF5A 1VTKA 3PC7A 5LQRA 2DLCX 2IS2A 3MTQA 4OKNA 5JNUA 2NTVA 1YR2A 3A1DA 4UHFA 3Q8LA 2Z1DA 4BAYA 4X62O 1ORTA 1Y48E 2M1XA 1CDOA 1ECGA 2P0EA 4FBMA 4I46A 2GCEA 5E7QA 3DMDA 1VI5A 1L7EA 1AVMA 2VCHA 4RX1A 1HFKA 4JAAA 1C9NA 3WFVA 3AHIA 3ESYA 3RCBA 4M1YA 3A14A 4RDHA 4BNDB 5J2TB 1UUFA 3DC6A 2BKVA 3G5UA 2WJZB 1CP3A 4J41A 3UJCA 3M2PA 5EXXA 3R9KA 1PS9A 4ER6A 3ROKA 3ICEA 5AW6A 1MEOA 3AZOA 1JJVA 4M1KA 4TRJA 5D3ZA 4XYGA 1IHDA 4UAUA 2F48A 4DIBA 3BD8A 3DEJA 4D8TA 1NSFA 3OTGA 3CISA 4R98A 4XE5A 1AI6A 1HMYA 4E2ZA 1DLBA 2V7XA 3TKLA 3U5TA 1P6XA 1YZ3A 2GBCA 3B2NA 4C3ZA 5H81A 1KSGA 3HM9A 3ER8A 2J0UA 2A92A 2PMKA 1GZUA 4R84A 5EHQA 4I4IA 4K6GA 5CA0B 3UM7A 4X3OA 3UC5A 4HRQA 1WP4A 1ZK0A 1Q14A 2W6QA 2AKYA 1TPYA 4TL6A 3EC7A 2QE7G 4HLUA 4RY2A 1AJQA 1CJKC 2PZFA 4ZA2A 2D5BA 2F95B 4KSCA 2ST1A 1C81A 2EIKB 4B82A 3RTBA 1YR7A 2FFBA 1V5EA 1COZA 2A7XA 1EGAA 3OAAD 4YJ3B 4Q24A 3CSUA 1S2MA 3SHWA 1OAOA 1KYQA 2X41A 2QWNB 5BQPA 3O47A 2Q7GA 1YVUA 1M7BA 1O0SA 2HXVA 2IE8A 4GF5A 3D3WA 1GPLA 3D36A 3JQGA 1HNZB 2D0IA 2C29D 2E21A 4WBNB 4HWGA 1YQGA 1YXMA 4Y2UA 1G8YA 2ZAOA 2G88A 1XIVA 2HOQA 4PW0A 3JRNA 1DWUA 1P9RA 4HDSB 1SESA 4FYPA 4BGVA 1XTVA 3T9CA 3CBGA 4RCZA 5HJ5A 1E96A 4IFBA 1AQLA 1WCIB 3BZWA 2O2EA 1GHTA 2X9GA 3H1LH 3DPUA 4HH4A 4PCLA 4Q7QA 5BSGA 2A5FA 1VHLA 4F9EA 4JT9A 3OLQA 1BE1A 2QZ9A 4ZDKA 2GBOA 2YYAA 3RARA 1J8MF 3MCWA 1JR6A 4ZHSA 3BN3A 3PXAA 5AOAA 3V8PA 3N8HA 3LHIA 4L50A 4QXMA 1MMFB 4GL4A 4DSUA 4H4CA 4O8XA 2J41A 3CUTA 2WZCA 3MW8A 3EXIA 3OOJA 4YP9A 1E9BA 1THGA 4G25A 4RPHA 1XEFA 2WAAA 4CS2A 1K0UA 1OJHA 1N3IA 2F3PA 4MA4A 1NVWQ 2CD7A 4Q3OA 4WJZA 1POWA 5L3VA 5L51A 4F5ZA 3A9SA 2ZRLA 4BB5A 1BSMA 4MAAA 2ZRPA 3ZWAA 5KTOA 5KVVA 1N2GA 1JB1A 2RCNA 4IWNA 4PAWA 4ZEMA 1Q0TA 1T8UA 1OX4B 4US0R 3DBLB 5AI6A 3AP1A 2ACEA 1VL0A 5C31A 1XHZA 2CLEB 4ZI7A 4QODA 1RBYA 2DX7A 3EFOB 4B7UA 1EA7A 2NT4A 4BGUA 2AK3A 3QMWA 4ER0A 2O8BA 1TD9A 4RKEA 1MEEA 2A2ZA 4C30A 2B4QA 4W1QA 3WL3A 2PMFA 3ZDXB 3BIWA 1ND6A 3JWIA 4AP9A 5H3HA 1P74A 1IN1A 4WFFA 3H9GA 4URHA 4P2GA 2ZRDA 1T3TA 4V1CI 3B77A 1Q0LA 3GJTA 3MM4A 1V8PA 2IYZA 3A2NA 3RPEA 2OD7A 1IPEA 3E2PA 3L6BA 2EIKC 3PS9A 2ETNA 1QJ4A 2UYGA 3EZYA 4JLNA 2C7QA 2JATA 4YO8A 4IZIA 4YAWA 2Y0PA 1T4MA 5D3MB 3W7UA 1G5PA 1GA1A 1Y8RA 3C98A 4IDGA 4WOKA 3GT4A 5DI9A 3AYZB 3DEAA 2NU6B 2AMVA 2OHHA 4RELA 3A25A 4A6DA 4DIDA 3ITEA 1WXHA 1TL7C 3HK2A 2FR8C 1Z6AA 1D9XA 3BFVA 1T36A 1GPJA 2XRMA 1HW7A 3OPMA 1XOIA 2DFKB 2EZ8A 2H4WA 2HRZA 3A2MA 3IP1A 2JK1A 1TX4B 1P8JA 4PRZA 3TI9A 2UXBB 4D44A 4OIMA 1SQVH 5G1OA 2EX1A 5I47A 2XWQA 1GNRA 4XCQA 1QZUA 2EW2A 3EDCA 4QOEA 4Z8XA 4B83A 5IASA 5GINE 1GARA 4JJEA 1WN6A 2ONZA 4XVCA 2IYSA 1PWXA 2I2FA 3ADOA 4IDHA 4LWQA 4TV8F 1XPOA 1BJTA 2FKNA 2Q21A 3L77A 1EXNA 4JGIA 2OWEA 4M22A 4WZAE 4MVMA 2HMWA 3E2MA 4LTDA 1RC0A 4Q0MA 5F7OA 2C5EA 5KSZA 1G7CA 2QAGA 3HBAA 4XYBA 3GFBA 2BGGA 3ENNA 4FBGA 4G2TA 4I43B 2W4LA 3E1SA 4RHTA 3I2GA 5HZKA 3G85A 5AIBA 3K0KA 4M1EA 1UOOA 3WIUA 4QLAA 5HUQA 4RZUA 4RABA 2OO5A 2IKQA 2DPYA 1KBHA 2C3YA 1FIUA 3NBMA 4XJXA 1Z47A 4CGZA 4KYTA 3MD9A 3ZGLA 5HQTA 3FSGA 1GUYA 3ZRVA 3ESCA 2QD5A 3PU6A 1GT91 2XITA 5EFZA 5HK9A 2H2DA 1PJZA 1Q77A 1RRCA 4X1YA 2LFRA 2PSFA 3T5MA 4RTMA 4HQRA 4WFBV 3LKDA 5AUQA 5CXQA 5AJHA 3ZXUB 4MAFA 1CUWA 1MC1A 4FJCC 2M1ZA 2F9FA 2PPLA 1N34B 4FQ5A 4ARZB 5DYGA 1MF7A 3PKIA 4DADA 3NDBB 2G5TA 4D57A 4Z86A 1E63A 4YRLA 4W9MC 3G6BA 2X5JO 2QN7A 4UFNA 5AOVA 4MA0A 4AUNA 3AW9A 4OP3A 4M1SA 1DRUA 4MRVA 5BMVF 3D8RA 1JFTA 1CETA 1OHHD 2NN4A 2I4IA 3FB1A 2P41A 1ESMA 1RTKA 3FPSA 1AI4A 3I23A 4MP8A 3ZH9B 3KQSA 1WDTA 1VQMV 1K3TA 1Y89A 3V1LA 2BW0A 2FLWA 2PA0A 4DV6B 1IHXA 3MOIA 4GMKA 4EPRA 4YXWD 5GJBA 3FR8A 3ZGVA 4AQ7A 3JQ8B 3WK8A 5D5QA 5AM2A 1CFJA 1GMGA 4CIYA 4Z99A 3RS0A 4DUPA 4B71A 4GZLA 2PMDA 4NH0A 5LHHA 4FQ7A 3H84A 3PUVA 3DMOA 1DJOA 2CLOB 3Q0IA 3BERA 3PIRA 4D3DA 2FH5B 4OYHA 5IC6A 3QMVA 3D2BA 2QTHA 4MR8B 1BGVA 3EA5A 3GPBA 3TAHA 1CUIA 3H9BA 4LSMA 3T5TA 4AD8A 4BE7B 4UV9A 4CS3A 4WBNA 2WU3A 3NAQA 1WIWA 3DTUB 2X7XA 3E8SA 2EU8A 2JBHA 4TSRA 1FJGB 2IA5A 3F97A 2O07A 3WTCA 2XMBA 4LJRA 1BQEA 4C7UA 2GJKA 2VWKA 3E2EA 1E9RA 1Y8ZA 5T64A 4P34A 4ZO4A 4C87A 1AX9A 1SZTA 1EFRG 3L70H 2Y48A 2D0DA 4P31A 2A7WA 4P3KA 4AWAA 4IM7A 3FYDA 2A9OA 4IKPA 4A8HA 3I9MA 1WY5A 4TSFA 1L3IA 2IHUA 2YJ3A 1DIHA 3CGWA 4D1YA 2VK1A 1M1ZA 1X1DA 2D7DA 3IOCA 2P9TA 1BQ4A 2VTBB 1OAAA 2Q29A 3KHUA 1GTRA 4EYEA 3MS7A 3AJ8A 4M0EA 5K0NA 3ZU5A 5AW2A 4C4RA 2NXWA 4EJ0A 3QE2A 2PT7A 1E5QA 4HDRB 4N5MA 2EL9A 5J43A 3DKPA 4UTOA 3QF4A 3KZOA 4I36A 2G40A 2QUAA 3FCOA 4P4UA 2V6MA 3RS3A 1ORRA 5JISA 1IG0A 4OSEA 4MGEA 4X20B 3ILVA 4TS9A 3S99A 3WYFA 2GJ9A 1AN0A 1QQ5A 1HURA 4AG6A 1MX1A 3HFJA 3DGEC 4DL9A 4ATNA 4F9TA 1ABFA 1BX0A 2Q45A 1RPAA 4FM1A 2ECQA 1RI2A 1FXKC 1CY6A 1K7EB 4TMZA 2JI9A 4L8WB 2RHBA 4RMJA 3A6DA 3S5UA 5CFZA 5AH0A 3PENA 4QFTA 3UAXA 3V4VB 1NR7A 1LLUA 2E89A 5EUMA 3VJLA 1X8KA 4B79A 1N1GA 2HR1A 1TTTA 2WM3A 3JSNA 3JD4A 1LPOA 1XVIA 4ZD6A 1YJQA 4KPGA 4DV0O 4B80A 1YS2X 3DBIA 1E9SA 1F3LA 2Z9DA 3CR3C 5BPHA 4BNXA 2BFOA 3QVVA 3FETA 4IV5A 5BW4A 4L72A 5AVTA 1J5XA 4KL8S 1M73E 3GRUA 1XZNA 2NZJA 3UC9A 3OFNA 3RE1A 4BP8A 1IH8A 4GT1A 3PSAA 4NH4A 4D97A 3WLHA 2W42A 1CF2O 4E3WA 5C8XA 4F93B 3R7WB 1P2DA 2H1HA 5CW6A 2OGWA 1EK1A 4EYGA 4ZVTA 3M99B 1U3VA 1MO6A 4KXFB 1YZHA 2DYRB 3K5NA 3L7OA 1ZM3A 1HXHA 3KJFA 1UK9A 4UEKA 4EG5A 5BT8A 1AQUA 3PX3A 4A6PA 4HVAA 5K5EA 1U3DA 2YY6A 4Y1RB 2H85A 1Z0SA 2VAWA 4D26A 1WULS 3T3DA 5JS2A 2Q5HA 3FB7C 5CVVA 2EZ9A 3M5PA 4FUTA 4EUFA 1QRDA 4LAFA 4C4ZA 4CCAA 5HS6A 3MHTA 3DS8A 4Y1FA 4CIWA 4QUIA 2UVPA 3TZBA 3DMTA 4FYJA 2Z3IA 1WB4A 2DP4E 2C8JA 1QHSA 2X4IA 3PR3A 4MVJH 3BTVA 4PC6A 4RHYA 1Z8HA 2IGBA 1I1OA 4OK3A 3DO6A 3QELB 5JLJA 2YY7A 2H4ZA 1II9A 3PC8C 3FHCB 4F6RB 2JH3A 3GQVA 2DR0A 3G2LA 4LJ6A 5J5VA 4CCYA 1OB5A 2GT1A 2Z1MA 3BWVA 1G6HA 5K45A 2AEMA 4B81A 1H05A 4R8LA 1W1UA 4PLTA 2J59A 3L1UA 4DIMA 2GX6A 5F21A 2NZYA 1XNRB 2PTGA 1R37A 1SCAA 1TCCA 4IUBS 1YNSA 3AG6A 2G0NA 3NUZA 4YCSA 3GGGA 4G5FA 2ALJA 3COJA 4OREX 3RV4A 3B7WA 5ALLA 5C7YA 3Q10A 3ZMTA 1WZIA 1M2OB 3NC4A 2I8CA 4LZWA 3WAKA 3GGOA 3JQ7B 3O4VA 1M83A 4CDRA 4PO8A 2AG6A 5K7SA 1XDBA 1EFRD 5K1XA 2MSKA 4BR6A 5HFMA 1UFVA 4RSMA 1W5AA 1YNOA 4DHWA 4E7OA 4JBNA 1DXHA 4Y67A 5ARCA 2B3JA 3ZPXA 2XA2A 3KTAB 2AZ4A 3B7PA 3CVYA 4WXYB 3U7HB 1W0KG 3NBXX 2R7LA 4GBGA 1EWQA 1JEDA 4RCYA 2DR3A 2H54A 1BH2A 3HEAA 1B04A 3P97A 4XI9A 5EEGA 4PQRA 4XB2A 3QYJA 3K2BA 1A32A 1N5KA 2FU5C 5TS3A 3HUUA 4PFSA 2HVWA 1NJ2A 2PU7A 3D6HA 4JYCA 2CDAA 3DUFA 3ZLUA 1OCZC 1V8DA 2MSNA 5CR9A 1NTOA 2YZ2A 5E2AA 5TJHA 3QTCA 4CIVA 3ZN2A 2ZXWC 4DUZO 2CLMB 3OIUA 5FFFA 4BLUA 1N8NA 1Y9ZA 1AR5A 1RLIA 2REOA 1TAGA 2W2TA 4GH5A 3MA0A 4X0EA 2OP0A 4IVRA 4Y3UA 13PKA 4KITC 1YQUA 4NYKA 2W2XA 3ZC3A 3TSYA 3H9VA 2V7EA 2JEUA 4ZC8A 1SUIA 1YF3A 3LWBA 5JWOA 4KOAA 4I50F 3IPYA 3QO5A 1IFXA 1KAMA 5AUPB 4OYLA 3SYNA 3L0ZA 2EF1A 2HK7A 3KEGA 3GL9A 1J39A 3MT7A 3A37A 4M0PA 5AVZA 4GOLD 1M8GA 2CZQA 1WXGA 1U9ZA 1V39A 4PHFA 3OP1A 2HDNB 3KKKA 3G9XA 3UWOA 3EW9A 4DMHA 1T24A 2A3RA 2PGIA 2QMQA 1DAHA 2D74A 2ZI5A 4HDSA 3QQPA 2IX3A 4N5HX 4MCAA 2ZVPX 4UHJA 3TJRA 4AZ0A 3TQSA 4OKSA 1GZDA 4FR5A 1RAFA 2UYOA 2ZGVA 5F51A 1JPNA 2BISA 2ET6A 2GNPA 3PTLA 4GLBA 3UG6A 1AY0A 4HVLA 1HTWA 3A11A 4DCSA 3E18A 4M9CA 1WP9A 2FN4A 2OXCA 3VOAA 1XK6A 1TJPB 1DC8A 1WMAA 3OOEA 3SOZA 1NWCA 5DCLA 3V6LA 3WJ7A 4PO3X 1A9ZA 3AXTA 1MIOB 1NG9A 3G8QA 3B60A 5F33A 3EDOA 3ZWXA 3TZQA 2JJQA 2VCEA 4JQZA 2GAAA 5GADl 4MUNA 1JNXX 4NCNA 5CA3A 3LPMA 3ZPCA 2A0YA 4L07A 4DJTA 2XDYA 5EHNA 2Y6VA 4LHEA 3GRKA 4AF8A 3RR2A 1ZTEA 1YDWA 2J08A 2XCLA 4G65A 3D5EA 1LQ2A 2FPSA 1Z83A 1QAQA 4U7NA 4Y1EA 3O2SB 3U3RA 2FDRA 3P4YA 1C7JA 4WV3A 2VP4A 3IC7A 3U48A 1XZHA 3R7LA 5LGNA 4XYEA 1PJLA 1NFQA 3H0KA 4CQMD 4A36A 1A2KC 5CDGA 1V55B 4O8ZA 4H0LB 2VJPA 4LISA 4BNVA 2P75A 1G3MA 4ZC1A 1S5JA 3ETGA 3ZZTA 3OT4A 2AMLA 3QK7A 3TDKA 1CR0A 1VF7A 4FLXA 3ORRA 2J45A 4FR0A 1Q20A 4RWZA 2BZGA 4DVJA 5TLSA 1CQPA 3EQ8A 4CMJA 3WFIA 4JYPA 3I34X 4QNRA 5FL7A 1ZZEA 3R3XA 2ZB8A 2BGIA 2A59A 1NXPA 1T6BY 2ZSFA 3DO8A 4Q47A 4BV3A 1S4MA 2HC9A 4YRPA 4KVFA 3D59A 5T3UA 2X0EA 4LCUC 3ZWVA 2Z5VA 3KTOA 2IIVA 3ETCA 3DFKA 5CD1A 4F3WA 3NM5A 4GIBA 1ODFA 2QKYA 5HF9A 2WLIB 2X8BA 4M99A 4IYHA 2FR8A 5D51S 5EGSA 1OLXA 1QCCA 1VE1A 2YWFA 3NKFA 4UVGA 1NLZA 2IIBA 1TGVA 1LTKA 3HLKA 3I1FA 4LXGA 1M1KW 1A9QA 3SPHA 3AXSA 5EUBA 3A31A 4AJ2A 2WZDA 4WESB 1PWZA 1NF8A 1LTHR 4N40A 3CRNA 3K08A 4QGBA 1M74A 3F5FA 3W1VA 3BWYA 2X9QA 4O4IF 5F35A 2NUAB 4B6OA 1NC3A 1GADO 4L9RA 3ABMB 3NG1A 4TT3D 2FAXA 3C7KA 5CXXA 4TUYA 2ITDC 2I8AA 4TQUS 3RTEA 1Z6XA 2IEZA 3AR3A 3KOOA 2BBOA 1TGOA 5JZ9A 2MIIA 2J6HA 2QAIA 5ALFA 4Y9SA 1F17A 1ZK4A 2YINC 4JASB 5EJ9A 4PONA 1OE0A 2P5SA 1P7WA 1YRYE 3T9DA 2OFWA 2CUGA 4Y2RA 3WNBA 5HNKA 1OXSC 3PR1A 4O5AA 1X7DA 2F43B 4P7BA 3K9SA 5CB6A 2GSWA 3D54D 4RK6A 4HAUA 2OO5C 2UXDO 4HBGA 2CGNA 4ZYXA 2OAEA 2QY6A 3QPBA 4OFZA 3K9BA 3EG9A 1GL7A 1EWRA 3T7KA 1UJ4A 2CLIB 3N8GA 4IVQA 5LC1A 3U1BA 3GARA 3OF5A 4MJ3A 4FYKA 5B6IA 2GK7A 2PZLA 4HTFA 1OFVA 3Q7EA 4OA8A 1L5KA 1EDOA 1GKLA 4LW8A 3E8FA 3CZCA 4U7WA 4M4SA 3FLEA 1PYGA 3IUPA 5CK5A 4JYZA 1KO7A 5B53A 3BD7A 2QUIA 3NBYC 5J63A 5HFLA 4DA8A 1LRLA 3HDHA 5CN0A 4K87A 2HPAA 4P4SB 4KQMA 5IDWA 5BMVA 4O02B 1NONA 2QXYA 2KB0A 2Y9MB 1XA0A 3BG5A 2QSYA 3M1IA 1XJ5A 4GOXA 3K20A 5HCUA 5KNDH 3DLBA 4DDVA 4JYMA 2DQKA 2L17A 3JQBC 4O63O 3QI7A 1ZGHA 4LCPA 1UIRA 3Q11A 1I6KA 2KBFA 2B7CA 3NFYA 4G4GA 2VYND 2HPVA 4R6ZA 3VOUA 2C0PA 2FP3A 2XDQB 2YN2A 5FBRB 2HF7A 2Q5FA 2PQ0A 4HQOA 4CV3A 3U6BA 1UBJS 3LDUA 4DDUA 1MPTA 2RMKB 1J5EO 3T9FA 2O19A 4XPIA 2XPCA 3JASA 3GRAA 3QXJA 6CHYA 2ZRNA 4Q82A 3LYLA 2H2HA 3WU2Z 2G9NA 1VSQA 3C3DA 1GZ4A 3ZRWB 1USUA 2EG9A 2EINB 3KU1A 3M4ZA 5F78A 3U62A 1NUAA 2ATVA 2FF5A 4W63A 4WVLA 2D0OB 2VOJA 3X1KA 3X3HA 4XDJA 2XGSA 3K0CA 4IX9A 1X86B 1YI1A 4JNKA 4BJ1A 3CJHB 2GHQA 3CF0A 3I45A 3UANA 2VNHA 1OCRC 1H1LA 2PX5A 4XDHA 4IJQA 2BKUA 2DFLA 3ZDZB 1FUKA 2RH9B 4GAEA 4QQNA 5E6UB 3GXOA 4JI6O 2FG6C 3LT5A 1HRDA 1USWA 2BR3A 1SKYE 3DV2A 3D3KA 1S5PA 5DXFA 3C1OA 2D7CA 2XV1A 5EWMA 5K3EA 3IAXA 2XYHA 3QM1A 3IEVA 3DEKA 3ZMVA 1R8YA 4ZALA 3MCUA 3KIPA 3K0HA 4GEGA 3WGQA 3AVPA 1IXSB 1FP2A 2D3TA 2TMGA 4FMBB 2ZB2A 4MW2A 1R7RA 4UUAA 5FPYA 3O9VA 4CR8A 4DQXA 3OQVA 5HZHA 3RUAA 5H2FZ 5CT5A 4K6CA 1H8EG 3S2IA 4ZOLF 4BMZA 3VC3A 2EGHA 4MYCA 1JI3A 3P19A 4PTZA 3NEAA 1N32B 4REQB 3OUSA 1A95A 5HZGA 2OFOA 4UHEA 1P81A 5BVHB 3PEWA 1SXJD 5IBRA 5IVKA 3WB0A 1ECBA 1JLKA 1JF8A 4S2EA 4C1BA 3RAFC 1E2HA 4RCVA 2C95A 4N01A 2GCPA 1D09A 2R84A 3C5HA 3P3NA 4LOIA 5IBQA 2DECA 2DULA 1CR1A 4O4HB 3E15A 3QUSA 4II2A 4YJGB 4BNUA 2QB5A 3AM5A 1NP7A 4OSOA 4A5SA 4N48A 1RTTA 3C6QA 3NETA 4Q7JB 2OCKA 1WXIA 3MWLA 5ER6A 1UZLA 5TPZA 3INRA 3QUTA 1IRXA 2QTVA 4HD8A 4URWR 1E5VA 1IN8A 1V5IA 3DVAA 3SHTA 1AB6A 3S29A 2O5VA 3VBCA 1T5BA 4WNIA 4KWHA 3A3KA 3N8KA 2Q5IA 4BIIA 1RYDA 2I54A 4ZFNA 2AYYA 1N2BA 3UJ7A 3BB1A 5B5EZ 4KNVA 3DUFB 4AJIA 2OQ2A 1OAKA 3A70A 4WECA 1WB6A 3E8GA 3RS2A 2O8DA 1PLJA 4TYQA 4CL3A 4GDFA 3JV7A 3QTLA 2PO5A 2F1MA 1ITZA 2YYYA 3V2UA 3WS7A 2IC5A 3UKMA 2YWCA 3JATA 3O1IC 4G6ZA 4NEQA 4RFVA 1K27A 1A4RA 2IEGA 3SC2B 2FUG1 5DM4A 1K4DC 2ZE8A 1CRZA 1AJPA 2DKFA 1I4OA 1WNFA 4DW8A 1VF6C 1W30A 3ELBA 3V8RA 2H94A 5FRDA 1KI6A 3RC3A 3TPCA 4F5DA 5IDQA 2VTEA 5DZSA 3M3DA 4B9EA 3R5XA 3K2EA 3FOEC 4RIFA 2Z98A 4E5UA 3TUZC 4ZPXA 1S0UA 2HIAA 1VG9B 3I92A 2O8FA 2PM8A 5LJIA 3QKWA 3IESA 3ZCSA 2XB2A 3OEHD 3T1OA 4OCMA 3RJZA 2H1CA 2O7VA 4DMLA 3U3ZA 5H82A 1NZFA 1VHTA 4M7RA 5KNBA 2BKAA 5JHHB 3BA8A 1LBQA 2HHJA 2DJ5A 1KY5A 1EDZA 1EP2B 2PLAA 1YBVA 8ATCA 4GOJA 2AZTA 3QRWA 4L5AA 4KQGA 2WJVA 3BFXA 3RSSA 3ANYB 3MAGA 2HF2A 4IH1A 4ISCA 3PFKA 4Z7JA 2G4CA 3LDGA 1D5NA 1OTHA 4X8MA 1WUJS 2PV0A 5CMLA 1WZUA 4EHIA 4LCOA 1U8UA 2CTQA 2W43A 5E3IA 5JRDS 3WGOA 1M5RA 2JJ2A 2GN8A 4TWAA 4GEKA 4Q4JA 3HCAA 3TNDA 2HK6A 3AJRA 1E9CA 3LQFA 5DVZA 2WKWA 5TX7A 3EQZA 1JDBC 5BP7A 2W11A 1RJWA 2IQIA 3A9TA 1XZBA 3W3AH 3KKPA 3B1FA 1AJEA 1P5RA 2V1UA 3T35A 1UKAA 1EUYA 3NR7A 4OHXA 3WB1A 4JI7B 4RA6B 3L43A 4YC7A 1E6KA 1LLDA 3IKJA 3BB3A 4HDKB 1KY3A 3PPYA 4IIBA 4U4AA 5FLYA 3T54A 2H9IA 5KCMA 2O3KA 1L4HA 2ATEA 5I9IA 4IHJA 1NE2A 1R4NB 3PSHA 1FVOA 2YDYA 4NG4A 4QJBA 5FI0B 4DLLA 2FMHA 2RHDA 2V54A 2L35A 3C8UA 4FOSA 1JRLA 2QZJA 4GUDA 1N5MA 2FL4A 1Q83A 2CNNA 3U17A 5B12A 1XLUA 3TQHA 1BDBA 5HZMA 4EW3A 1PNRA 2IKSA 1P6QA 1KS2A 4YUVA 1JDUA 3I5DA 1TM1E 4Z4FA 4K9LA 5ES3A 2XOKG 1Q15A 2YWGA 5B1EA 2FYUH 2QGNA 1AGYA 2VLBA 1UBGA 4KTVE 3UN1A 3ABKB 5INTA 5IUJC 3OE1A 2NG1A 3A6EA 4HWPA 1NULA 1JEJA 3C6BA 3DBLA 5AI0A 4IS3A 1RXCA 2P67A 5L3FA 1YJ8A 2AMFA 4AJ9A 3DQQA 4NE9A 3V4FA 2IYOA 3ABKC 4FINA 4KU4A 2ORVA 4NMHA 3W1EA 3KQOA 3LC0A 3WKBA 1YS6A 1XI1A 3WE7A 4OFBA 1VHDA 5KHJA 3GG9A 1HWYA 2CKDA 5IEBA 3K9QO 4UPVA 2ZT9B 4NKGB 3SX2A 3B6KA 2X3FA 5TNXA 2JLRA 3GRYA 1K4MA 4OBXA 3A58B 4OATA 1K5PA 4EO7A 2Y76A 1EVEA 1GZSA 1MC5A 1XA4A 5IAEA 2Y93A 3F71A 1Z45A 5DSTA 3TGWA 1YVRA 1KMQA 4HXFB 1DC6A 4OGKA 1BSVA 1CUJA 1XJWA 4KAFA 4Y0VA 3ZY2A 1Z08A 1Z2GA 2FPPA 4Q39A 4G84A 3T5GA 4DMUB 1OB2A 2FP4A 2Q9CA 2GAIA 2H5EA 3UW1A 4WH0A 3PNLA 3ZW7A 3T1HB 1M8PA 3ZHTA 1G1MA 4D4MA 1K8XB 2R65A 4PSUA 5AJWA 3SIXA 3WK7A 1XMOB 1FDRA 3ZIUA 2ECPA 4RTRA 3GP3A 4WXEA 1RKQA 2MSCB 4ZREA 4DLBA 2EJBA 4O2AF 3WR5A 2RIPA 3I2IA 1L5YA 3GT0A 1P1IA 2G4LA 3G9TA 4DO2A 1O7JA 2OT5A 1UOEA 3BJEA 1GPDG 3K1JA 2P68A 3CQ9A 1DEOA 1RABA 3LUHA 3H1GA 1ADBA 1KYIA 3MYYA 2ZSIA 3GELA 3I05A 3QVSA 4UBJA 3ZWDA 2JFGA 3U26A 4CODB 4Z54A 1XTBA 2PS0A 2HT1A 2Z2KA 3WL8A 2NIPA 10MHA 3UJAA 3B9PA 2EZTA 4CG2A 2KKWA 5AK6A 3THYB 1JHQA 4BLTA 4FHFA 1HI9A 4KCGA 1OCOB 2PGDA 4D6XA 1UMCB 2J5QA 2OZVA 2PSHA 2DB3A 1P6UA 2NPOA 4OTZA 4MUXA 4DUYO 1VPTA 1Z74A 4LJAA 2H59A 3K2IA 2VJMA 4MR8A 4MX8A 4Z3DA 3O74A 5IANA 4PA6A 1UXGA 3DP7A 5KNCA 1Z5OA 4BNHA 2RNBA 4QYXA 4AX4A 1KRWA 4XVRA 5A62A 5EZSA 4O2BA 5HM8A 3ZRWA 1XTPA 1HQDA 4M1TA 1TYZA 5TC4A 2X0NA 1KMMA 1UT8A 3VR6H 1ZUWA 4QE3A 3OU7A 3SI7A 3KQKA 2XCSB 1SG6A 3JZAA 3ZBHA 3FSEA 1ADGA 4NJMA 4Y18A 5CIQA 2EBUA 1NF9A 2ZRCA 2J0VA 2G1PA 1QC5B 1T2UA 5FWNA 1E94E 2YICA 1T0BA 3GJ6A 3RC9A 2ZB7A 1OH8A 1E61A 4P0QB 4YK7A 2V3CC 3X43A 5FL7D 5JWHA 3OZXA 1TT7A 2FVXA 2R5FA 2R6GA 4I50B 2WFZA 4EUKA 3I1JA 5JATA 5SICE 2JH9A 3UMCA 5EMMA 5L3SA 3G0OA 1UR5A 2PJDA 4ND5A 1CQJA 1HG1A 1GL9B 3LT2A 1JUDA 4MVXA 1FJXA 1ZN2A 2NYVA 1JR4A 5IJ0B 3D6MA 4P4SA 5ALZA 3ELDA 3VC1A 4AKTA 4DLNA 2Q6OA 3I12A 5TMBA 1F8FA 1PI3A 2EC5A 4YQZA 2OY0A 4NNPA 1RYHA 4GXTA 1ZIPA 4GX1A 3ZI7A 2QA4V 2EBFX 5EKDA 1HRKA 4OG2A 1D1PA 4DUGA 2NU7B 2Q6AA 1CS0B 1Q91A 4MO9A 3KZMA 1JA8A 2J9YB 4MCJA 1G64A 2RKOA 4AQDA 2O2SA 3VZRA 5J3JA 5AHWA 4FHEA 1AOXA 1SUSA 3P9NA 4ZVMA 2R0QC 4WFJA 2OSBA 1Q0UA 4M8NE 1J0CA 3R8CA 5AVUA 1Z0ZA 3PQFA 1BHO1 1NVAA 4ND4A 3R6DA 2ZRAA 3OEYA 1RPTA 4KDCA 3SG0A 2ILVA 3D6UA 1KVSA 3OX4A 5KCZA 4UUMA 4NEHB 2I2XB 1W36D 3DMRA 2JBAB 3FXAA 3MGCA 4V02A 2WQZA 4RWUA 3RYIA 2IPMA 5CNKA 5ALEA 5K6RA 2WWYA 2GV9A 5LZ5A 1M0TA 2ECFA 1NOKA 4DSOA 1MV5A 1C7RA 2BOVA 1ZJJA 1GM8A 5JEEA 3E9EA 3MOSA 4D6TH 2AF3C 1L8XA 3GMSA 1SZDA 4WK6A 1UFRA 1VQ7V 3I8SA 3WDMA 1TAUA 1V26A 5FEMA 4D98A 1QYRA 3A9CA 4UTRA 1W94A 4BZPA 4J7UA 5DNDA 5ILGA 2OFFA 1CW2B 1G5RA 1LVUA 4RIHA 1U2QA 5B3KA 3D6FA 3KZXA 2C2MA 2IH1C 1K3UB 4YXFA 3BGVA 2QF7A 1U7ZA 2BKLA 3BT7A 4J3FA 2YV5A 3DFFA 2I7VA 4ID9A 1I7SB 4AKGA 4XQ0A 2L19A 2UUCB 1LPNA 3O93A 2ODAA 5B1NA 2G38A 4M2LA 5CCBA 1XTIA 4NJEA 1EAYA 1VC2A 3HB3B 2QMHA 2YW9A 3AP3A 3U9TA 2KKSA 2P40A 3W90A 4ZCQA 3BIFA 2A35A 3QTBA 3CX7A 1Z36A 3W2TA 3ZK9A 3W06A 4DMGA 3GP8A 2XUHA 4PANA 1T6ZA 1Y1SA 4TYNA 3ZWPA 5IXYA 4ILGC 4B4UA 2I7DA 3IRVA 5BWOA 3VDXA 1SETA 2EFGA 3FBWA 4OQMA 4RFSA 3BF7A 3RT3C 3AO0B 3W05A 2INGX 4FFBB 4JVMA 2F67A 2FQ1A 4DCCA 5H0IA 1XZEA 1LX6A 3PXEA 1FXWA 1FXUA 1SK8A 3ZK8A 3PWSA 5BOSB 1L7XA 3OZCA 5LVAA 8LDHA 1HFEL 2PGLA 3U6KA 3KFLA 2FPKA 3VO2A 1TM2A 3VA7A 1TW3A 4DUGD 1WP8A 2C7OA 1GFZA 1IXKA 1JG6A 3I53A 4LRWA 1IHOA 1QOQB 2PTHA 3K0DA 2VHQA 3OP4A 1IVSA 3GMIA 3T3EA 4EY4A 1THTA 3W3AD 5LMCA 1M2WA 3ML0A 2AD1A 2FWMX 4AZTA 1V45E 2XE4A 3OZVA 3CCQV 1Y4UA 4F2PA 1Q6YA 1I4TD 2DTEA 2WMOB 5D6OA 4MW5A 4N7JA 1H4TA 4WCEV 3S5JA 2V6JA 1HLPA 2GCOA 4MQ6A 1TYBE 5GY7A 1Y7TA 2CNLA 4L28A 1LDNA 2HXGA 2NO5A 1MLDA 2IYWA 1H42A 1W8DA 3UHOA 3ZEDA 1KY4A 2DZDA 3ONNA 2EJWA 3SBOA 2HHLA 3QUAA 1K33A 1AQYA 4PVDA 4WN9B 3PL5A 4C6TB 2P4VA 4FGJA 4LWZA 4OEHA 2WJ4A 2Z2XA 5JT1A 2HA0A 2WTXA 5GPBA 4D92A 3CE6A 2YHBA 3UAGA 4ZCLA 1M57C 2CK3A 4F3NA 5BN4A 3C3PA 3R0XA 3ZWKA 4BWVA 2B2NA 2RHCA 1K5SA 5SY6A 2ONJA 1Q95A 1RJ9A 1HEUA 4DLWA 1GM5A 3IUJA 3LVFO 4MGHA 3D31A 5IJ9A 2J6IA 4FMCF 2HMTA 3QH4A 5G4KB 3WFJA 1R0YA 1V7ZA 2KMLA 1NM5A 3BEOA 2W6ZA 3QE3A 3IJRA 5HJ7A 1ESZA 4EA9A 3PNYA 1U2RA 1FRNA 2DFDA 2VHZA 3ZY5A 5AVRA 3RHFA 1QMGA 4U5QA 1R00A 1U31A 3ZS9A 3UGTA 4EM6A 2RHLA 2EL7A 4OLBA 2SCUA 1Q0PA 4Q18A 2WWFA 4YCAA 3HCRA 3RKSA 1JDZA 1VQ1A 2WM9B 4OWPB 4QDKA 4C7OA 2R6FA 1KTIA 3CYFA 5ADUS 2WG0A 3HR7A 3PVZA 3QKRB 2P78A 4U63A 3DDHA 2I1LA 3M5CA 5C5CA 2QV0A 1GNPA 1GGFA 3H6HA 1J21A 3K16A 3DCNA 3RKUA 1PKXA 3TEFA 2XQVA 2C9DA 1EP9A 4PAGA 1KU6A 1MN6A 3IGAC 5TS2A 1Z88A 3EQ6A 3ZU4A 4G9BA 3L7JA 3TFQA 1KNXA 1IEVA 5JUWA 1T2NA 1JHPA 4OLAA 1IOWA 4Q4CA 1XP5A 3LPLA 4UVCA 1CV2A 1I13A 2C2KA 2JA2A 2X9NA 3PGJA 4M0KA 4ETIA 4KRXA 1D7AA 4QUEA 1VQPV 1XZPA 4CLOB 3MAAC 2EKDA 1W581 4P84A 3IGFA 4BMVA 4MWSA 3QU7A 5EIEA 2R6ZA 2IYTA 2AHYA 5CB4F 4I5GA 2VAMA 9LDTA 4JCCA 3ZMZA 3DZBA 3P20A 4KVGA 1P2VA 4KTTE 2TMDA 2PBRA 3F98A 4J94A 5DJ5A 4CKWA 4UQLA 4Z9XA 4FWTA 3KV1A 3TDMA 1K3EA 3RQIA 3ZQUA 5I5EA 1GPMA 1U9JA 1JAYA 2YOGA 3LG2A 4JLDA 4QRDA 4U0JA 4C0KA 3W9YA 4FDMA 4X8OA 1W52X 3NXSA 3Q0EA 4AJKA 3C14C 3H1BA 5FD8A 5C5EA 1U7WA 3G17A 4NYJR 2P4HX 4BPBA 2B20A 5JTUA 4IDEA 4GLOA 1JQKA 5BSHA 3IIEA 3TJTA 3AFIA 3N5KA 4UEJA 4QO7A 5TGDA 3AF5A 2YZNA 1N6IA 2GEUA 5IAGA 3CCJV 2JVJA 2JS3A 4D9IA 4CBVA 3QFFA 9LDBA 5LUAA 4N6NA 3M33A 3U09A 3BGOS 3C7AA 2RJ3A 3AFNA 1LFAA 5L3EA 3K1YA 4KO2S 4ZO7A 3B5EA 1Y1KE 1K6JA 3IE1A 5KX5B 1RMYA 3TX6A 5ALKA 1A9TA 4LE1A 2AUTA 2E1RA 2JJ1D 1T3ZA 2WVGA 3GFOA 4GMHA 2YUIA 3M82A 4H35A 4Z2YA 1XRQA 3SU8A 4PYOA 1C4KA 3ZXXA 4BEVA 4EGFA 1KOGA 1WLEA 1H9AA 3JYNA 3E22B 2CLSA 3P96A 5IDYA 2MWMA 1L7DA 2OLEA 3NXKA 1NX6A 1YZNA 2Q5OA 2VN8A 4QT0A 1VQ5V 2C5FA 4GO1A 1FXKB 3FWNA 3CB2A 2IYLD 1QCEA 3N3BC 1JW9B 2QQ5A 2WA1A 4LY0A 4QTUB 1Q6ZA 3ZMSA 4UBOA 3ROFA 4BVGA 2WABA 2DCMA 2Z1NA 3KQTA 2OB2A 1VE5A 1ENZA 3EGDA 3FJYA 4MS3A 1SPXA 3AG7A 4DN6A 4KXXA 1N75A 1OFGA 3PC8A 4C0QC 3IPAA 1K3FA 1CEYA 2GN9A 2DYSB 4JPRA 1NSYA 4JOBA 4AQYO 4YO7A 3ROXA 5KYTA 3K9HA 2B0CA 4ZFRA 5COAA 5EXSA 5AVOA 1UQTA 1H8ED 3WKEA 1Y6QA 2O5RA 2I0FA 1PYOA 4FDUA 3MWJA 4PSAA 4EOGA 1M9NA 1BOOA 1PRYA 3Q1KA 1JSZA 4N5DA 2XMQA 3V7UA 3N8DA 4R05A 4B3HA 2O1WA 3PLNA 4EW6A 3H42B 4YYZA 3M4YA 3UJNA 1BWQA 1Z2PX 3LX6A 2B4KA 3PHLA 4IXWA 4LSWA 2F8TA 2Q8VA 3G67A 4OP2A 2B94A 4WACA 4FM9A 2DHEA 2XQGA 3GLQA 3QTTA 1CR6A 1EB9A 1KEZA 2C98A 1KI3A 2GXUA 1NTKH 1P0CA 2WEKA 4CM9D 3E4DA 1LH0A 5IN4A 5LKRA 3O3MB 4OJQA 4E5SA 1JJFA 2WOOA 1CNEA 3Q8XB 4MZXA 5F23A 4EF6A 4NXNB 2OC9A 1A27A 4E1VA 4DA0A 4G0UA 1ZG3A 5LZ2A 2DEUA 3R0JA 3R9XA 2BDEA 5IKOA 3HVIA 4RZ3A 4EVRA 2HCTA 1QF6A 3VKFA 3W04A 4YT2A 1ZKDA 4DR4B 3HWX1 1JI0A 2HF9A 3K1ZA 3K92A 1EIZA 4PC1A 1Z3CA 3K8YA 1AS3A 3ADCA 1OH5A 4RKQA 1QP4A 3JXEA 2EJCA 2GRUA 3PEVA 2ZM6O 4EQZA 1PR0A 4NEGA 4QGAA 5LP1A 1ZI9A 3WBJA 1OIVA 3EYAA 4D4IA 1YACA 2FA9A 3PE6A 1VL8A 1TMOA 2JFHA 2O2XA 2QUKA 2MMGA 2ADOA 2ZTMA 3QVGB 1VLHA 2OMEA 2VRNA 3THSA 4PY2A 3V1TC 3WYDA 1MU0A 4BC0A 1E1KA 3FIUA 3FYTA 1JG3A 2PNFA 3NHZA 3HYLA 1CY2A 2PYLA 5D3KA 3KRTA 4YREA 5JJBA 5FTWA 5JZOA 1A8HA 4H37A 1OA0A 4LWSB 3EJ6A 2YV3A 3GUHA 3K4PA 2VDPB 3IJPA 5JBIA 1MVOA 4TWJA 4FLTA 5J4LA 1XHFA 1V3VA 4A1OA 1E7MA 1G7TA 3SVLA 1T1JA 3RRFA 4ZZ3A 3IVCA 2CVFA 1I7NA 1JVNA 2VI5A 4DV3O 1N2XA 5CT8A 3VKHA 2PVPA 4JYYA 4KZKA 1TO1E 4G1EB 3OKCA 3TGPA 1L5SA 1QKJA 5FLKA 4TWIA 3U4IA 4KN6A 3ET5A 3SC4A 3JQFC 4FS8A 1CZRA 5CX1B 4YP6A 4ZYLA 1S3GA 2ZM6B 2O9JA 1MZVA 2PSJA 2VA8A 3TR6A 5DTIA 5FCDA 2F1OA 3PXBA 1P73A 1ZH8A 3FBGA 4GMXA 2AQHA 3GCDA 4OY3A 1H22A 2X22A 4K9DA 5TQJA 3RLIA 3UH0A 4WBNF 3CD6V 1UQUA 3Q1LA 5H9CA 3FNGA 2JANA 4LE2A 2AB0A 3NDPA 4NCJA 1VG8A 4ZT6A 1XD2A 2JIRA 3Q7QA 2C2AA 2NSDA 3BK2A 1S5HC 1SK9A 4LQDA 4XCVA 1II0A 2GVNA 4L3OA 4YECA 4MEBA 1RXVA 1VG1A 4H4EA 1N1DA 1WN7A 3ESAA 3Q0TA 4QGGA 2V65A 4W9RA 1TEXA 4AY4A 1MRZA 4PYLA 1N6PA 4FHDA 5J9FA 4BIMA 1IZ8A 2I34A 1Q17A 2H5IA 4FKMA 4RK4A 4EY3A 2IPOA 2KG7B 4OGQB 3ORHA 2FPIB 5ABPA 4P0PB 1JIXA 3L84A 3C8HA 3C16C 4MS4B 5DH9A 4DK0A 1JJ2U 1X0XA 2OO3A 3FUVA 4B40A 3AB8A 4XZ3A 3RZVA 2PW9A 2QLMA 3OLZA 3V5NA 1FDWA 4DARA 5D01A 1ZVJA 2AYZA 5HFAA 1ATIA 4H9GA 5JJIA 4L2IA 5K0ZA 1QR2A 4B76A 5B66Z 5BWLA 5HOQA 3KJGA 1W0JA 1WL8A 2CCGA 5GTIZ 2YJZA 2ZEJA 2QRZA 4B85A 5IWAB 1NNSA 2CF6A 2ZYAA 4H3VA 4E33A 3CLHA 4NU6A 5FTJA 2HMUA 3QKRA 2QP4A 3M5WA 4RZIA 4RTSA 3ICOA 1L7BA 4J7ZA 1FNDA 3VZQA 1NMYA 1M6YA 1YDGA 2BFCA 3U44B 1E3DA 2PVCA 2ZLBA 4XM1A 4ALNA 5LPNA 1VL1A 4RVNA 4EENA 4QXRA 2W00A 1YJXA 3S55A 3EARA 3LUCA 2F9LA 1YTFB 4ACAA 1VZ2A 2QW0X 4DOMA 2GVDC 3KX2A 4MSQA 3RVZA 4L4SA 1YOVA 2MT9A 3GEMA 3IAEA 1BHJA 4JITA 1UODA 1R6NA 2PL1A 3L5OA 4YIOA 1LS6A 4YLYA 1JJIA 1KOJA 3SIRA 5KJCA 2GR9A 1VI2A 4H7JA 4AMYA 5K0BA 3HDQA 3LC2O 4L4XA 2RHMA 3IE0A 3E9ZA 1OV6A 2FHSA 3HXPA 2RARA 1IL0A 2Y67A 4QUDA 4URYR 4EHNA 4DR6B 2YS7A 3L8MA 5KPDA 1YBFA 2D1SA 2XNHA 4QBGB 1T36B 1ZN8A 5TPWA 2MHCA 5KA5A 2HRRA 4HFNA 3RT1A 1RADA 4RD6A 3U4GA 1K1EA 2G1AA 1Q0HA 2XUKA 3L8YA 1GG8A 3G9QA 1NKDA 3IA7A 3JYQA 3OKAA 2QTNA 1WDLA 2NQ8A 1PSDA 1EH5A 1V71A 1XXHA 2RB5A 3QV2A 4CDMA 1EM8B 2VHYA 1RT9A 1FYWA 4MZDA 2CXTA 4YXWG 1UDCA 2F3SA 4K9MA 3H9EO 5FWDA 1F2UA 1YK0A 1UH5A 2IOFK 1J1ZA 2Q07A 3HJBA 1QHNA 2EGGA 3O75A 4H60A 3SJUA 4B74A 4CM8B 4E94A 2YMLA 3WGVA 3QUQA 5I7OA 1CRPA 4CN9A 4D9EA 3GDGA 4LJ4A 4O0MA 1RAAA 1I8TA 2CSUA 2EQ5A 4W7IA 3TPFA 4IH4A 2G8LA 1KI2A 1OBFO 3DBHB 4XVUA 1ICEA 2IHKA 4EO9A 1WXEA 2P7IA 3E6AA 5C46F 2ANBA 2VNIA 3R3WA 2PZBA 3ABLB 1K7YA 5AVJA 3OQIB 3FAVA 1UANA 5FUBA 3IT0A 5B1AB 1LQUA 2GKGA 1PX0A 3N8NA 1P9NA 4BB6A 1FS0G 1T5HX 4G1VA 5KTPA 1DAPA 4OLFA 1WKCA 3EOAI 4UE2A 1W59A 3DR3A 3OAAG 4FLFA 2FMFA 1KJWA 3DVRX 4KMMA 1OC2A 4UU8A 5K3FB 2XUJA 4JJKA 4WFQA 3RU2A 4DA9A 3DC7A 2HY7A 3CUEF 3MJCA 2IH3C 1XL4A 5TEWA 5LQUA 2JFQA 3MFQA 5KINB 1RQ7A 4GUAA 2AOWA 2H0RA 4I8XA 3I3OA 3BDIA 3NAZA 5F5XA 2CTWA 1ODCA 3U39A 4E2XA 1BEZA 2AV6A 3WMEA 4EFDA 3RFVA 2EXXA 2YRFA 2YV4A 4F96A 2VA9A 4K9OA 5JAOA 3TTYA 1HY3A 1ZIYA 4OI2A 1CK4A 3H1AA 1UXKA 2QXUA 1VEWA 1KKLA 4JSRA 4QKQA 2Y77A 4X64O 3PEEA 3U81A 2ID7A 4W9NC 3RYFB 2CB9A 4RIGA 1IQPA 1UEIA 3F49S 3BWCA 4LBVA 1PFGA 5FR2A 2NO1A 2P8SA 5HMLA 2ZJYA 1ZL8B 3L7AA 3DDSA 2PRIA 4JUDX 4P2BA 1H2XA 5TQVA 4WNAA 3N2GA 5ITZA 1O6CA 2WTMA 4YT8A 4ZJPA 1HK7A 5LN1A 5CDSA 3OIDA 3NPAA 2DERA 1BMTA 3AWDA 4YRMA 2HGZA 3CEHA 1AKRA 4GX0A 2WR8A 3MF4A 2D5NA 3T6KA 2GUGA 2BFCB 1U11A 1XXLA 3MSXA 1OFTA 2FEKA 4CKBA 2LW7A 4GVPA 5JMWA 2R7KA 1BOFA 5T4BA 3KFVA 4GMGA 5JDCA 2CYCA 1U3WA 1Y3AA 4FDAA 5CPBA 3AETA 3OWOA 3T9EA 3SYPA 1EJBA 3KU4A 3QWBA 2QD3A 2RD2A 4LF7O 2BEUB 4BVHA 2XYVA 2BE9A 4IKOA 4YQYA 1IBLO 4ARIA 2LDBA 2O8FB 2Q3JA 5I01A 3WGLA 3JATB 4I0XA 2WLJA 5C53B 1XUQA 3K5OA 3HZOA 5DK4A 3VDRA 1XNHA 3LHDA 4LV6A 3UK6A 2EILB 2C4HA 2AGVA 3LDHA 3ROMA 5HBGA 4UCWA 4R8KA 2I3DA 1W0KA 5CP8A 3T5DA 4MVCA 3CUYA 1XT6A 4WGFA 5DF1A 4FGZA 1QIMA 1WZ2A 5DOVA 2FPUA 2WMNB 3FI0A 3HJCA 4P7FA 2V6FA 2JFOA 4G4SO 1E3EA 5JS8A 1NMXA 3G02A 1K63A 4JI5O 1GPAA 1QTRA 2AXTZ 3DPSA 1XVLA 4ZK6A 3F3KA 3N2KB 1MD9A 1NMZA 1SUEA 1YU6A 2P2DA 2R25B 3WYEA 5JPDA 3KZNA 3TAUA 2O05A 1J23A 5LGTA 2VAXA 3LUJA 3ZV7A 2AFIA 9GPBA 5J47A 4EYOA 4EUNA 1RCFA 2J67A 3JARB 2DWOA 5ALYA 3HWSA 2F66C 3R3VA 3G68A 3DNPA 2CJWB 2HNKA 4RDXA 4FCWA 1AKQA 4PRKA 1Q0RA 1NLFA 3SWWA 4KPYA 2M6SA 1PL4A 2N47A 2IOHA 3M6AA 3LA6A 4P86A 3SC6A 2DLDA 1BN6A 5AKJA 4F12A 2EZPA 1GVHA 1XX6A 4NSNA 4F4IA 3TRJA 3DBRB 1RPJA 3B7GA 4D9GA 1N2EA 1W5BA 1FS4A 3Q6NA 3WAJA 3R5HA 1C3JA 2XB8A 1RYYA 3JAKA 1C2TA 4F3CA 1ZX3A 1KDVA 5JXJA 5JC1A 1RI3A 3STYA 1I4LD 3LSYA 1UOQA 4D3ZA 3QVXA 2QPLA 1G8PA 3M5DA 4HAMA 1DOAA 2XQKA 4DA6A 1U0JA 1M34B 5HA5A 4LWSA 2YNMA 1QQCA 3CWZA 5MGNA 3USES 4MQLA 1H85A 3BFJA 1EDDA 2WIKA 4IMJB 4HNGA 4MSMA 3BRQA 3VH1A 1IY2A 1W93A 4QPJC 4XR4A 3B8FA 2JGKA 2VPPA 1WTCA 2CWDA 3T7EA 1RYFA 3AG3C 4X63A 4DCTA 1SVIA 2VHUA 4KUHA 1E62A 1P2FA 1DLIA 2BFNA 2ZE7A 5H3LA 3M1YA 3UTCA 5BRJA 3ZVKA 1DFGA 3WLFA 1HNWB 3FPCA 1JHXA 2XWJI 3HB5X 1M67A 2WU4A 3A3PA 1O95A 4YHHO 1Q1BA 1RHQA 1C9MA 1WPQA 2AUNA 2MMCA 3MZ0A 3KVVA 3PE4A 1N36B 1B14A 1ZWLA 3I9OA 3W8DA 5K0EA 3WO0A 4FI3C 4MYHA 1JKJB 4JJAA 2WIDA 4Y98A 2X4GA 4HX2A 5AKEA 3H87A 3KOYA 1GV0A 1MENA 3U80A 5I4KA 2RI1A 4WD3A 3DZDA 3SXPA 1Y6ZA 4K6OA 4B7CA 1G8JA 1R3JC 1NI5A 2BV3A 4DBLC 3T9AA 4HVTA 5LLSA 4ZCTA 3KQWA 5C1DA 5F3DA 4OLJA 1PFVA 3NZEA 4K6FA 5CDFA 4NQRA 1TA9A 5A7GA 3HNOA 3RVOA 1HDIA 3E8HA 1ODIA 4HMPA 4Q7MB 5HE9A 4KFTA 3AVWA 5K4HA 2C2WA 3GJZA 4MVJP 1PR1A 1MB0A 4A7PA 4YAUA 3VSCA 4ZT2A 1UKYA 3BWBA 5KIAA 2OECA 2ZIUB 3L7MA 3SE7A 4DZZA 4BCCA 3KWFA 1M75A 3QPCA 4LMBA 5DGHA 6ADHA 3NX4A 1P5JA 3PHJA 1B23P 1C9EA 1DBSA 1TLTA 4DV1O 4P92A 1J07A 4WIAA 3N27A 4QSHA 3D4PA 2OZLA 2BT4A 1LPAB 4Q16A 4ZI2A 3IIIA 1XEQA 4CMIB 3KSUA 4LOAA 5KS2A 4CM8A 1ZD3A 4ZCPA 3TO5A 3FKQA 5C0OE 1XDDA 1SERA 2XW6A 2V7GA 4UASA 3OT7A 1O8CA 4LZOA 4HZIA 4JU9A 3ZQ4A 1IBLB 3PFGA 4K88A 2OHIA 3UAWA 1KC3A 4RJKA 3TIFA 4G8JA 3KQHA 2FZGA 3DC5A 4IEEA 3I4LA 3OX1A 1FTNA 3C24A 1KC1A 3FVRA 1DUVG 521PA 3WQRA 4B4VA 4O8XB 4TSFG 3M1AA 3V2HA 3NBQA 4NULA 1NU6A 3C39A 3DO5A 3DOJA 4KRFA 3MAQA 4Q6WA 1TU0A 4GDMA 4ETWA 3EHBB 3WISA 3G4SV 1V9CA 1NVDA 2OZPA 3NT4A 2XVYA 5DLYA 3ZDCA 1G8HA 2KBEA 2V0CA 2D3WA 2UYYA 2W0XA 3UPDA 3ZCTA 3SZRA 1DP4A 1O54A 1R5BA 3NOQA 4H1WA 3D36C 1KETA 4B5KA 2IXAA 2HFEC 5FX2A 5C4MA 4P9CA 5LZ4A 2ENUA 4IYIA 2GEBA 5CLLA 3OM8A 3SXUA 3QPVA 1VQKV 2Q69A 1UPTA 1KZ1A 4GX2A 1H5NA 2H9AA 2GJ4A 3OPYB 4LV8B 5F5NA 2R751 3AC0A 1G8FA 3F6EX 3JYPA 4LF8O 4CQNA 1K6XA 3QF7A 3FA2A 1I3CA 3N28A 1OBOA 4PXSA 1VBMA 4QU8A 2IZOA 4BNNA 4DF3A 5KSOA 1RYZA 1SBQA 1KK3A 4XPZA 1WKVA 1TM5E 5CH8A 1KU0A 3ANNA 3NV9A 2F59A 2I4RA 3ZIDA 2HIMA 3FRJA 4QX6A 4HYEA 2I29A 2D3OW 1UKZA 3AQIA 3IURA 5AJUA 3GNQA 5JNTA 1Y3HA 4ZAVA 5KYWA 1Y7PA 1N6HA 1S3SA 4WFGA 5TV2A 5IS2A 3H5IA 4LGCA 4MYSA 4ZAGA 4E07A 1U5AA 4HNTA 2DBQA 1HL7A 4KQ6A 2P2NA 1DKRA 1EHCA 2XD9A 2WKQA 4XUGB 4WKCA 3CCCA 2VBCA 3LQ4A 1J22A 3R4CA 4IQ4A 4YLGA 2W2LA 4UPEA 2OXEA 3BAAA 3DTNA 3K5WA 2XXJA 4YRJA 5FBKA 5I7EA 2B8WA 1GWNA 1C4WA 1OU0A 2AK2A 3GBVA 1GKUB 1OYYA 1VRVA 4PZEA 3OFNG 2XKKA 2Y0EA 4OMFG 1NW3A 1CUBA 3BWDD 1F9EA 2CJXA 4YBRA 1U7HA 4G36A 1C7QA 4JL5A 2GWRA 4S0ZA 3AG2B 1JFFA 4A2QA 6PFKA 1Y4MA 3LC7O 1RM1B 1I6LA 1A72A 4FU0A 5IG2A 3EW7A 4K35A 3C4QA 4GNKA 4OQYA 4KITB 2R60A 1EWYA 3BXFA 4YNBA 2JGIA 2JK5C 4LF6O 3L8GA 3Q3IA 5JTTA 1HNXO 3DOOA 4RK0A 3QW4B 2CLKB 2IU4A 3R7BA 1QQ6A 3JQFA 2YVAA 3LIPA 5CVDA 4HWKA 4C7OB 3R23A 1NBMD 4ND3A 2YKGA 1NV9A 3L7NA 3DWEX 4HGYA 2F62A 1LI7A 2PF4E 1EQUA 4JT2A 1C8LA 2QZSA 4RVGA 4A2CA 4CCSA 4PYJA 1YJ9V 2G71A 2GUWA 4TM7A 2AG1A 3WJ2A 2VWQA 4L9AA 1VQ4V 3DHWC 1B41A 3S4YA 4JWTA 2WSSG 1Y6GA 1GG9A 1LDYA 1CKEA 4CETA 1XREA 1MB3A 1W29A 4LRQA 3K6RA 1SF9A 1DT3A 3OPYA 4M9XA 3TH5A 3EXHC 4GUNA 1FX0B 3VU9B 1SHJA 4HVCA 1YTUA 2QKAA 3EA4A 3RC8A 1T3HA 4KB5A 3WYBA 2ON6A 1N5OX 2P5OA 1BCCH 1P0IA 1E8DA 1ZNYA 4GM4A 4OPMA 4WDRA 3ONVA 4Y6LA 4PDMA 5EY5B 4QREA 1J0EA 4GPAA 2IZ0A 3R5JA 3RAJA 4I9HA 4XASA 4EJ6A 5BY2A 4I4CA 4QJ3A 2D2XA 1QS0B 3AUXA 1Q6IA 2QAGC 2QLTA 3W5SA 3I42A 5EWMB 1N9ZA 4JBXA 4F92B 4D46A 4BKQA 2IW3A 1PFWA 3QJ5A 1OHHA 1A7KA 1ZHOA 2QTSA 4EKDA 3DDOA 4CDNA 1X42A 2O2ZA 3QNWA 1E4OA 2AQKA 3U7QB 3P2KA 1G59A 3TDNA 3QOXA 1OIXA 4PG6A 2I7TA 3CZAA 2OXRA 1DDOA 1U0BB 3EY4A 1WCYA 3JVEA 1X59A 1PYDA 1OHHG 2ZIWB 3H5VA 2Q3HA 1LC3A 1P6OA 4C7BA 2HWXA 1H0RA 4BNJA 1R9NA 2FWPA 2FGKA 5DX0A 3EZNA 4J0HA 3I6IA 3R3UA 4W8GA 3P94A 2FEAA 3LRTA 3W8EA 3EY9A 4ARVA 2LPMA 3N7AA 1JA0A 3FPHA 5JS7A 3FZGA 1PL8A 1SY7A 1RZRA 2Y1EA 1NW7A 4XAQA 3G9ZA 3RNOA 3OTWA 3A04A 4EI2A 3FYUC 4INAA 4BCBA 2HA7A 1AGPA 3ET4A 4WDQA 5HEKA 5KJEA 1REQA 5TF4A 4O4JF 2BMFA 5EAIA 4C4AA 4XTCS 1C4OA 1P72A 1RIFA 2ZATA 1KHTA 2ZCVA 3QSGA 1ZGCA 4NV0A 1U2GA 3DT9A 3RROA 2Q2VA 4WNAB 4D43A 3KP1A 1QG6A 1QVVA 5EXTA 4MVWA 3EFEA 2JRIA 1FQOA 3VO1A 3I52A 5C3MA 1VQOV 3PNQA 2Y1CA 4H59A 4HRAA 1FKAO 2AMJA 3L0DA 3FUTA 3G6WA 3DFUA 4DBZA 1AZTA 4GMFA 4KACA 5KYKA 2ZJ3A 1KFEB 3GVXA 3PIIA 1BGWA 1B73A 1JEEA 4J16A 3H0EA 4OXYA 1JWLA 1UBRS 2ZUWA 3HCNA 4C9BA 5CFMA 4U9HS 3VYRB 3G8YA 5KU1A 1QB7A 4YY3B 1H1DA