1THZA

Crystal structure of avian aicar transformylase in complex with a novel inhibitor identified by virtual ligand screening
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Crystal structure of avian aminoimidazole-4-carboxamide ribonucleotide transformylase in complex with a novel non-folate inhibitor identified by virtual ligand screening.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 217
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1thzA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1thzA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1thzA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1thzA02
1PL0A 1B93A 1C3OA 1A9XA 1EGHA 1THZA 1S8AA 4A1OA 2X8WA 1T36A 1CE8A 1C30A 1WO8A 2YVQA 1G8MA 1S89A 1IK4A 2B1GA 1M6VA 1KEEA 3ZZMA 1P4RA 1M9NA 1OZ0A 1ZCZA 2XW6A 1JDBB 2B1IA 2IU3A 1BXRA 4EHIA 1VMDA 1PKXA 5H3LA 1CS0A 2IU0A
chains in the Genus database with same CATH superfamily
4KB5A 4INZA 4BX3A 3QA9A 3BM5A 1T0HB 3IIKA 4QGGA 3NV7A 1QGYA 1RJEA 3AR8A 1PK9A 1U2GC 1ICEA 5J3JA 3IIIA 5AW7A 3LPAA 1TW3A 3H4TA 5ES3A 1OIVA 1LK5A 1ZEJA 3QSYA 3RF7A 1GKYA 2VK2A 5A0VA 3H2SA 2XOKD 4HLUC 3PX2A 1BQ3A 2D5NA 4KR0A 5U1PA 3DEKA 4IQFA 1WCIB 1Y48E 5HUHA 3DCNA 1RKUA 1LVUA 2OLEA 2ZGVA 4QD3A 4IWNA 3R7FA 4KEAA 4TMWA 3D1JA 5FEUA 3FSGD 1NVKA 4G1MB 1Z6PA 2LXNA 1S1CA 4B3CA 3ETCA 2YICA 3JWEA 4QWWA 5JCOA 2HA5A 4OHXA 1Q7YW 4OCLB 4UV9A 2W6CX 3OTGA 5E7MA 5CFQA 2RHWA 3TVYA 4AZSA 3V8VA 3JAMA 1UFKA 4DB4A 5ALSA 2KWIA 2I34A 5L53A 1V9CA 5CEFA 3IP7A 4U3JB 2W2KB 1XTVA 3F7YC 1H9AA 5CT4A 1FL9A 2YUTA 3LG2A 1CQJB 1I13A 3IKLA 4MHSA 1MT3A 1Z2CA 5GVRA 4EB3A 3MYRA 1K7YA 4G1BA 4JAAA 4Z9YA 4KXNA 5AR1A 4TRRA 4P34A 3MQ2A 4IFIA 5BSKA 1II9A 1TO2E 5AM5A 3SF0A 2XD4A 5BNFA 3QKTA 2OR3A 1PZMA 2QW8A 3T7KA 7GPBA 3G7UA 1J56A 2ZYSA 3TJRA 2FN3A 3H1PA 4Q9JA 1FTWA 4PRYA 1Y1TA 4A4DA 2G6TA 1IPFA 2GEUA 4FM9A 3FDZA 4H9GA 3F8SA 1GL7A 1NNLA 1TU3A 3WQBA 2WDPA 3OPMA 3KDPA 4AY3A 1AUVA 5FLXN 3NEYA 3U4QB 3QRWA 4I4NA 4JR2A 2JAOA 2QY9A 4JI1O 4DV3B 4OEHA 2AVDA 2RCVA 3I1FA 1SZPA 4WKNA 2GESA 4PU0A 4NABA 2LIPA 4YYEA 3HVUA 4AURA 4B47A 4EHAA 3UNXA 3SU8A 3I9V6 4YIPA 3IE1A 5CBFA 3DWFA 4URWR 4RHUA 3PIDA 4GZ6A 4K1RA 2P2DA 3T8YA 2YIVX 4YJ3F 4TSFG 4K86A 4UHFA 4V0KA 2ODPA 1PUIA 3EY9A 3ZNOA 1RP3B 3L8DA 1J2JA 1K0FA 4TKVB 2AX3A 3OQMA 3TLMA 5LP6B 1TTHA 2YDXA 1ZWIC 1Q1QA 1YOVB 4RLSA 3IMCA 3DBRA 1GV1A 4ID3A 5JI3E 4Z8YA 2RGAA 1XZIA 3UB2A 5FBRB 2WD7A 2GUGA 1UM8A 1N57A 2E4ZA 2P6PA 4V3CA 5JSYA 4DXDA 1NXTA 4ZAWA 2Y6UA 5FUYA 3HEBA 1W2GA 2XE7A 3ISTA 2JAQA 1M83A 2HFEC 4R68A 1ZSNA 4J3JA 4ND6A 1RWVA 4D0NA 421PA 5DHAA 2AMYA 3P71T 3OU2A 3LGSA 5IVPA 1D2MA 1P4AA 1QPGA 5CBPA 1E2JA 2I33A 4PA9A 4GT1A 1MOFA 4NAVA 3V9PA 4DSUA 2XVXA 3JVVA 1T2AA 2Z58A 4W5TA 1JQ0A 2MYUA 2JGKA 2XV1A 3TR6A 3GRVA 1S8NA 4X62O 2QN2A 4I4IA 3I92A 4ZTUB 4YCMA 4EDFA 3FCOA 2AZ2A 3WV5A 1PT9A 1XZHA 1S1MA 4HWOA 3OKCA 5A04A 5AVYA 1P33A 1E5TA 3TLCA 1I5EA 3PDIA 2BKEA 1GXSA 3D5TA 1PJ8A 4WACA 3DTYA 4OI2A 4XUDA 3RKRA 1XPRA 1FSSA 1JEYB 2QN8A 3PEVA 3DKRA 4FILA 4PZ9A 2CJYA 2CNWD 4MUKA 3I5XA 1AA6A 1GY8A 1HYQA 3JAMN 2ZBGA 4OPMA 1FU7A 3TL6A 1VHDA 2LVBA 5DWQA 1XP8A 3DW1X 1OI7A 1UC8A 2VH5R 3AT1A 4BDSA 1CQIA 2QRUA 2CB0A 1ROPA 4BW5A 3AYZB 5KI6A 5KHHA 3FIUA 5DF1A 4R9RA 2Q1SA 1JQKA 4EUEA 4HATA 4MQBA 1ZBQA 1P44A 2CLSA 1UR5A 3AUUA 1G64A 2UKDA 3OZCA 4X64O 1E3SA 3GN2A 2FW7A 2R44A 1DZIA 1RI2A 4CHTA 2PZGA 5LSAA 4YRBA 1M5UA 1NG1A 4FFRA 5HA5A 1LBQA 4DA4A 1QRAA 3C6YA 4ESHA 2QD4A 2R7NA 4LJKA 4MS7A 1SZXA 1KYQA 2EJCA 2YYSA 3MWDA 3NVDA 3FLEA 2DFLA 2C03A 3VH1A 2P2GA 4C7JA 5F77A 3L0CA 3ST7A 1GZUA 1PAUA 4UBKA 3UJ8A 4BMYA 4IXNA 3S8EA 2VUHB 2GTHA 4ZO8A 1B6RA 4LHWA 4P5EA 1OBCA 3G6WA 4XQCA 3THRA 1GJRA 2LR0A 1MQAA 2AN3A 1JFSA 2H51A 3QHQA 2Q07A 3SDSA 2PHZA 2VYFA 3TI9A 1U9JA 4RTMA 2I6QA 5KWJA 3A3KA 1GG5A 4NI5A 1UJBA 1Z2PX 4TVSA 1X8LA 1NYRA 2XITA 5JSKA 5J47A 3MUOA 1NOJA 2QVLA 3FPCA 4S0XA 5IF9A 2DUNA 5CD1A 1KPGA 4G9GA 2AUNA 5TR9A 1Y82A 1J8MF 4JI7O 2N9UA 2OORC 2W2PA 2G63A 3AP1A 4GKJO 1HYGA 1KJJA 3BVOA 2Q1UA 5C3UA 3IQXA 1MSWD 2GARA 3F74A 2A78A 4TTVA 1W2BU 1J33A 2RGNC 4CU2A 1YA6A 1YH3A 2CDAA 2FJ0A 2X76A 3OMLA 4NDAA 1PUJA 3QNMA 4MOWA 1RLOA 1D2DA 1XMPA 3GCDA 1QQ5A 3OUUA 1IZ3A 4P4LA 2GZAA 2C2HA 3ZU5A 2YQZA 1TJPB 1AVTA 2A7XA 4TXNA 2JAUA 4QQ8A 5DX0A 3WHIA 1XQ6A 2G9RA 4FFPA 1ZI9A 1GTOA 4GI7A 2B1GA 2W42A 5C9ZA 2GVNA 1P5ZB 2GZMA 1KBQA 1JHXA 2ATIA 3E9QA 3NHZA 2XNKA 2C5HA 3CUKA 1E1RG 3AB7A 3W3ZB 2GLUA 1NYTA 4Y2JA 1A76A 4F9EA 1DDOA 1YI1A 3HKEA 1ZITA 4QOGA 4LJ5A 4UZFA 2OAP1 2CJWB 3UG6A 4N54A 1XDUA 1XHEA 2JBAB 4TXJA 1G18A 3HFJA 2IBSA 3M6LA 2VHVA 5FIUA 3PDJA 2C7OA 4KE6A 2LCFA 5IJ9A 1TCVA 2PCJA 4FGUA 3KEFA 2EIJC 4X95A 2WLIB 5JR3A 3JQQA 2CMDA 3UUGA 1U81A 4LVNA 2OG4A 4HD8A 1ZUQA 3E8SA 5K8CA 4R2JA 1VGRA 2J08A 4Q37A 3GJ3A 4UDYX 3DD5A 4O4LF 3RW9A 1NF3A 1C81A 1NWCA 1CP3A 2ZTUA 1E2UA 4A2WA 2AFIE 3RYIA 2W2OA 3O8QA 5CU7A 2VYND 3ZZTA 2PUJA 2C5BA 1ZI6A 1J5XA 5JZMA 1QR2A 4BB9A 1QVWA 3BA1A 3BILA 2CE4A 4I9NA 4AZ3B 4MRSA 3OJLA 4B33A 3AM3A 4F6LA 1XMJA 4IDNA 3VUEA 2XGGA 2JGDB 4YIKA 3QYFA 1E9DA 1J5PA 2AC2A 2JBHA 1QC5A 1T5LA 1HP8A 1ZS9A 2PTGA 1EJBA 5J23A 3ML1A 2Q3FA 2RMKA 5BV2P 3RSHA 3PLAE 1X1AA 1NJ1A 2WP8J 4PSKA 1IAVA 2C2MA 3IJ5A 1CQPA 3OBBA 1G4HA 2EGGA 3NM5A 1EFKA 1GN9A 2AKEA 4YAIA 3FTCA 4N82A 4DC1A 1QDEA 1M5IA 3HLTA 1RQNA 2BVNA 2UZ3A 1KFKB 1UBEA 4D8VA 2E4YA 1SPBS 2GO1A 2ZI3A 3Q15C 5BY1A 1O5OA 4Q7LA 3P9SA 3WI7A 2V45A 3FB1A 1T5EA 4M88A 5DHFA 4CTJA 1W5BA 4MUYA 3TFOA 3RS7A 1PBNA 1EXVA 2BGJA 2YV2A 3A3NA 1FXSA 2J5BA 1QV6A 1MU0A 1HNXO 1N32O 3OQ1A 2CXTA 4FVMA 2ZTLA 5ERGB 4PWZA 1IM5A 4Y2UA 1Y6RA 4Q48A 3V9AA 2XAJA 4LWSB 3G9TA 3I6ZA 3ZBHA 2PXHA 2OHFA 1KZ4A 4DWJA 4LXTA 3I04A 3C1TA 5C80A 1DG1G 1E3TA 1N1DA 1Z25A 4IP0A 1M34B 1F0PA 3QKUA 1GKFA 3CGWA 4FM0A 1VGVA 5KTTA 1TT7A 3VOTA 2X2OA 1JIIA 3IKTA 4RBNA 5A2GA 4FHZA 2XTMA 1DP4A 1JECA 2OQ2A 5THKA 4II3A 3W5JA 5DP1A 4LGMA 4MRRA 1FMCA 1L5VA 3A4IA 2HRCA 3GJ7A 3FWYA 4BE9A 5LUAA 2WHEA 4E2YA 4BQSA 5EP2A 1TO6A 1U8EA 3K9HA 4YP7A 4R81A 4IDPA 5FA8A 1L3BA 3CINA 1A8IA 5L95A 4U2EA 2UUPA 4U7FA 3AFHA 5IBQA 3F6EX 2FMXA 1SF9A 5C5IA 5AOBA 3HDTA 4KXLA 4A8JB 2ZJAA 1PR5A 1NC1A 5HW0A 1WVIA 3BD9A 2NLOA 1A5SB 3MTBA 1J25A 1FSGA 1IY2A 1G8MA 3D7MA 1N8NA 2HSZA 2OBNA 4G5FA 1M74A 1G6UA 3K1JA 5GWXA 4DK1A 1ZWKA 3G0CA 2WF7A 3EXHA 1E2GA 4CF6A 5K0SA 3NATA 1VHWA 4R16A 4G4JA 2AJTA 4WW0A 3JSAA 3GUZA 4KQJA 2WHPB 2V8OA 2YMMA 3NPAA 1P2DA 3BHJA 5CB0A 1RZVA 4J0HA 3PUWA 1VIDA 4W1RA 3RU9A 4IEEA 3WB9A 1QO0A 4RVSA 4JS0A 4X1KA 4RE5A 1Y1LA 1W0JA 2VZ8A 2OCCB 3F2IA 1LJUA 5H8WA 3SX0A 3BXZA 1XHFA 2OB1A 2YHUA 3APOA 1V1RA 1HT0A 2WA1A 3ZD8A 4D4HA 2IW5A 3TAHA 2JFFA 3Q7RA 4CS2A 4XGNA 4OHWA 1P0IA 4O2LA 3OIYA 2HJWA 1W85A 5TMEA 2C95A 1E96A 1EM8B 3KV3O 4B3SB 5D3KA 4ZQGA 4PA6A 1W25A 3NGLA 4HUQB 4RWEA 5KKAA 3T38A 4EW6A 2IJJA 4UTPA 3B5EA 4C7BA 3ZMZA 4MTOA 1N6HA 4EATA 4X66O 1KYIA 5JSUA 1MMFB 3PQDA 3G5UA 5SICE 4C4OA 2XASA 4J0CA 1AKMA 3DOJA 1CX9B 1HGXA 2XGJA 2IV7A 1VE1A 5LA6F 1LK0A 1AK1A 1R3IC 3CFYA 1W36D 3C16C 1SQPH 1SCNE 3T4DA 3GVXA 4U4AA 3BRWD 2XUAA 1QE3A 5KNDD 1M72A 1LW7A 3K9NA 1DC7A 2ZI6A 3HB9A 4I9FA 2WKWA 3STHA 3TLJA 4ARVA 4HNAA 3UBMA 2IUTA 3AERB 1VYHA 1WLYA 4BNZA 5FOXA 1RIIA 3UGKA 1QF7A 3NHPA 4RPJA 1TIKA 3PUKA 1A4RA 1JXQA 4QPCA 4PO9A 3PGXA 1COWG 5AVVA 5FV4A 2X2EA 1OLUA 4Y0AA 1D2RA 5IAEA 1TA9A 1Y3HA 1I9CA 1U2DA 3CURA 1R37A 1HZZA 1P9OA 4KN5A 2DM6A 3THXA 1F5SA 5EBLC 1WF6A 3EOAI 2WR8A 3WGUA 4DMRA 3SYNA 3WFVA 5J5VA 2HRQA 3SOPA 2QN9A 2VRCD 2JIZG 3WLEA 2WM2A 3EIFA 1D8AA 2R8OA 4J16C 4FR0A 4JA2A 5E8JA 4NTXA 4FI3C 4NFYA 1ACLA 2IHJA 1EP2B 2Y1WA 5ENZA 3ZS8C 1W1WA 3A1UA 3FWKA 1Z82A 3CN7A 3U7GA 2GUZA 1O6GA 2NT4A 5J4YA 3ZE1B 2QG6A 1TMOA 1E3WA 2AZXA 1MH9A 1OILA 3DQPA 3K09C 3TSOA 4X93A 1HNZB 3GEIA 1QANA 2I87A 4BLPA 1SKYE 2FWAA 3GAFA 3MERA 4QFBA 1IRXA 2A33A 1XMQB 2ZAYA 3TW6A 1VL0A 1M1XB 3JXEA 4DR2O 2BFMA 1ID8A 4EFKA 3FETA 1KVSA 4CEHA 2C9YA 3UHOA 2OBLA 2FEPA 5BWLA 2QT0A 1LX6A 3KCQA 1NHGA 1LPNA 1EFLA 2ORWA 1M6HA 3DFFA 2FRXA 3IAAA 1PR6A 3IILA 4BGUA 3STLC 2H4ZA 3ZLJA 1DAIA 1NFRA 3NQ41 3KKMA 4K40A 1KI1A 1NPTO 4GWKA 4GMHA 1LQUA 3WGHA 4DAOA 3C5VA 2B30A 3RH0A 1THTA 2N42A 4XD7D 3OZIA 1VBFA 3I64A 4TRNA 3UJHA 3L73H 5FR1A 3W5SA 1Q81W 3GWKC 2L69A 3S4YA 1Z73A 3DM9B 1EWYA 2OV6A 5EWLB 4EB8A 2GOYA 1CIJA 1YB2A 4Q3LA 2IUYA 2V7VA 3SHWA 3IAEA 2GK3A 4US0R 4XSVA 1JLMA 4Z4FA 1ZJ5A 1CUIA 1G3QA 4IYRA 3TLXA 2FNAA 1RYYA 5LP6C 1L7MA 4MYSA 2H3EA 2XB9A 2GLXA 1DBQA 5T3YA 3Q7EA 3J80A 5B1EA 1JG6A 4WCFC 2HLDA 3C6MA 3PCTA 4DNOA 2J0VA 2X0JA 5JPCA 2H8PC 2VHXA 5I7EA 3T1HB 2ZBUA 5A4KA 1YGYA 1CP9A 4QZVA 3QXJA 4XDHA 3I61A 4HQOA 2FSHA 5I3CA 3DL7A 4I50A 2POQX 3IT3A 3RSOA 3TTWA 5IHPA 5AUQA 4HLNA 2XT9A 3SYRA 2QMYA 2Q29A 4OY3A 2RAPA 4ID9A 2PS0A 4P3NA 4EI7A 3TQIA 3GGPA 2PMEA 4L4RA 3W7UA 2PWAA 3M49A 2FEWB 5G02A 4D99A 2UUCB 4IMIB 4LFCO 2V0CA 1GR0A 3UUWA 1Z0FA 2EHDA 1MQ0A 3PXBA 5L4NA 1RYBA 4HMOA 3KAPA 3AB3A 5AHXA 4BFXA 3W7VA 3D3IA 1L7DA 1T2CA 1E1QA 3AGPA 1J06A 3NTXA 3KUXA 5C1IA 2PW9A 3ZWVA 2JLAA 1L7AA 4AL4A 1W5FA 3CPEA 3E5HA 3F6SA 2D7JA 4FSHA 5A9RA 2VTBB 2PE5A 2W2XA 4GE3A 4PM4A 1ADFA 1HT1E 1W9MA 3FDXA 1RLTA 2H5IA 3ZBUA 4PGHA 3JWHA 3P9XA 4MR9B 5JE8A 2V3CC 4IKOA 4CZZA 1V55B 2VQFB 4Q24A 4D3ZA 5L3ZA 1QQTA 3TZQA 1NWHA 3ZJZA 2NV0A 1CUFA 4PDMA 3WK7A 1KTIA 3PE3A 3DNMA 4H7EA 2Q0OC 4LJ6A 4ZI2A 4XQ9A 3FB4A 5AKLA 5FH9A 1EUDB 4P2BA 1C9NA 4I19A 4DJ5X 1A69A 2LZ0A 3BWDD 1KIAA 2CK3A 4K7JA 3GBVA 1T29A 3DVRX 3SIWA 2G9UA 1OLXA 4FYYA 1HEIA 1UBMS 3MT7A 5KYYB 2PUTA 1MPTA 5C81A 1M5RA 1CIPA 4DMUB 1EDOA 1YDWA 3LGXA 5C53B 4OX9O 2W8BA 3LCJA 1LDGA 4M7PA 3T3PB 2Z98A 5KX5B 4C6SA 1US8B 2P0YA 3W2GA 1GTRA 1KJWA 4QTUB 3UG7A 3PFHA 3S2IA 3TX2A 4ENRA 4HNVA 4OHCA 5B64A 4CTMA 4RW0A 5E6UB 2BD0A 4PE5B 2P90A 2P0EA 4KO4S 2QTVB 4PG5A 4PLTA 1QRRA 3QLUA 4UDOA 1X7DA 1TJYA 3CN9A 1S4MA 2ZB2A 4B48A 2B1QA 2FU5C 4PQTA 3EDOA 1MW9X 2R6DA 2HHCA 3CPJB 1XNHA 2R48A 1EGHA 2B69A 4QPZA 1B2LA 3ZVKA 1E6EA 3FLMA 3VC7A 3PWKA 2I7XA 2IIBA 1MRZA 2HQRA 2WJAA 3HA5A 2IH5A 2AQKA 1BMFG 4OP3A 1G7TA 2Y0DA 2J8ZA 3C74A 1GZ4A 1BQZA 4TS1A 2DWDC 1VK9A 4KGZA 3ZYCA 1ECBA 1W87A 2NTEA 3MUFA 4MR8B 3ND9A 4A0SA 5BORA 1DAPA 2PUFA 5GM1A 5CMLA 3SXUA 3HJHA 3J80N 4QEDA 4B6PA 4HRWA 4RIGA 2PNFA 1F6BA 4J90A 4QKQA 1MENA 3R6LA 4OSOA 1RMQA 3PRJA 3Q0IA 1F6WA 4G4SP 4G4SO 4IJUA 2PBRA 3HXOA 5A5DA 1P84F 5BN5A 2LNDA 3EF1A 3Q72A 5JZSA 4X3PA 3TK1A 1IHDA 3P9RA 1TFRA 4LRWA 2G6VA 1DJOA 4AS1A 1N9GB 2I4MA 1GT91 2QSYA 1TYEB 4G2NA 1S0UA 4DR4B 3K70D 1FZQA 2RHBA 4IRUB 1P0FA 1CBUA 4FDTA 2JEUA 3DAOA 5B30A 3B1ZA 4LNUA 1SU4A 3A1CA 3IODA 4LDJA 4WESB 2CVOA 3CF2A 2WJWA 1KK3A 4MMXB 4R1PA 1ZD1A 2H7CA 4QOEA 3SI7A 1ZH6A 1A27A 1LBSA 5KKCA 3TOSA 1N6IA 1EE9A 2CW5A 1MOQA 2IPXA 4TM7A 1V1MB 3BB1A 5IYZA 2HIGA 4GPD1 4RS3A 3NUGA 3VR4H 3A11A 1UADA 3PYXA 1B0PA 3LGAA 5LU8A 4O08A 4JV5O 1E9EA 1KO5A 2E4VA 2RHMA 4NFSA 5HIMA 2B3ZA 4EBFA 2OXCA 2PM8A 2M98A 1B8NA 2GD1O 3T99A 4CEJB 1T4CB 1FXUA 3BQ9A 4DKJA 2YJZA 1L6RA 3Q3GE 2HHAA 1IH8A 3REGA 3V4VB 2BSAA 3QX8A 4N48A 5EHNA 5KVQA 4WQMA 3UW1A 4KTTE 3ER9A 1W94A 2DGDA 1IEVA 3LUTB 1JTEA 3P0FA 2BBWA 3BGVA 2ZWIA 2OPBA 5C4GB 1DBRA 1EVZA 4DHEA 3DUWA 1WSWA 1LC0A 1K66A 4QUIA 3PJGA 2JJMA 2Y1LA 3AVOA 3L1IA 3ZY4A 1U28A 1BMQA 2YJ3A 2G83A 3JYPA 3NGXA 1AO3A 5C8VA 2VHQA 1SC9A 4PNPA 4TL9A 4XVUA 4E4YA 4LR3A 3QVKA 5B57C 5EEGA 1L4FA 4ZVMA 4MUJA 2IF2A 3AG4B 3LHSA 3QQPA 2Y77A 1JX9A 1NTKH 5H83A 1UX1A 4LHSA 4JI4B 1ESNA 1R0ZA 2BEKA 3CCVV 5EK0A 4DA7A 4RY9A 2GTSA 1ZNWA 4BMXA 5JSFA 2JFGA 4NYIQ 4YAKA 3FPGA 2AVNA 4HDNB 5BR1A 2MSKA 3PQ2A 1VSQA 1AQIA 1YF3A 2OQRA 3HDGA 2A94A 1TJ5A 9LDTA 4D4IA 4MK4A 2FQ1A 1UT8A 2V1UA 5K4AA 3AM5A 4FJ1A 4NDZA 2QV0A 2Q6TA 4H27A 2B92A 5KAMA 1C9EA 4TSFA 1EZ4A 1I1OA 2EJUA 1PJ2A 4Y1RB 4RFSA 4KO1S 1Z2OX 4BAGA 1N2XA 5FJJA 2XSZA 3GI1A 3CPSA 3ZW8A 1S2NA 5C7LO 1YQTA 4UE6A 3EK2A 1JG1A 3O84A 4PIPA 3HU5A 1PW5A 5GONA 4L6IA 1OTXA 3PN1A 2ZRLA 4MGKR 5IRCD 1QB8A 1XEXA 2X4IA 2EKDA 3A0HZ 4QOIA 3SSNA 2OCYC 1UPUA 4ZCTA 3GP8A 1F8FA 5K0TA 1L8LA 3AEQA 5K3FA 5IWAO 4TMKA 2PH1A 1VIYA 3R1IA 1EJ0A 2B3JA 1U3WA 2DY1A 3CRRA 1H8ED 2O8DB 3OE7D 1QOPB 4X00A 3HPLC 2AFHA 1HYBA 3L2OB 3ZY6A 3BDAA 1MDBA 2FJUA 3IUMA 1KIFA 4Y9SA 4KWHA 5JJLA 4G0YA 2EILC 1AGPA 2IHKA 4OXRA 2EJ7A 4ARUA 5KA6A 1CS0B 3ZHRA 1PJSA 2JCGA 5HBGA 5C5CA 3D36C 1H93A 1NURA 2QPAA 4D8TA 4TQ9A 4BJ6A 1EFUA 3OFND 2Y4TA 1U2TA 2IYNA 2WBLC 4UUQA 1JIJA 5JSHA 4A8JC 4O29A 4GP9A 5EXPA 2WJYA 2VJLA 2VJBA 4X8MA 2BF4A 2C3UA 2PSEA 2H2DA 4MW1A 2NU7A 1YTUA 2AUMA 1TB4A 1N2ZA 2H57A 1V6SA 4XJVA 2OCPA 3R4CA 3K0FA 1WKQA 3ACDA 1HUQA 1RI3A 4LXUA 2JDIA 3KDAA 1OZHA 3CCJV 4BGIA 2PRYA 1B4DA 1SHZA 1HRKA 4ZDKA 3WIEA 4BZXA 3HV0A 5AI9A 4XXHA 5CTJA 2O5EA 3SICE 2C7PA 2IU0A 4K6OA 3P9KA 4DCPA 3HJNA 4EK9A 2OCCC 4UHHA 1H2NA 4TV9B 5CJ2A 2XAFA 4H2DA 3U39A 1VF6C 2WJHA 1MVOA 1CR2A 2OCBA 1GZSA 2HXVA 1O9HA 3MJ4A 2L2QA 4W5QA 1YRQA 2CL7X 2AJLI 1M6EX 4UDXX 1EVIA 4LDAA 1YI0A 1HYEA 1K2VN 1WP9A 121PA 4AIRA 1W581 2ZTHA 1RAFA 1M1NA 4H60A 4C0HA 1U8TA 1SD1A 1G7RA 1K1EA 1TM2A 3GPLA 1PKXA 4FFOA 2ZJ2A 5HKBA 1X94A 1WHTA 1N0HA 2XNSA 3HVJA 2QEXV 3UAXA 2GB4A 3PXCX 2ACWA 2ZE5A 4Q12A 3ZHYA 4TLMB 3DAGA 1IONA 5TQ0A 4C9BA 1ORHA 5EAIA 2HH9A 4YACA 5JNTA 5A9SA 1RXIA 3C43A 4FK5C 1YULA 2C31A 3ROTA 2ISCA 4PC1A 2SCUB 3PQ4A 4EJFA 3BXXA 1WPBA 2HNKA 5K03A 1YO6A 1R8XA 4BN0A 2M6LA 1DPGA 4WKOA 4L16A 1NVBA 3IQWA 1UQRA 2VXBA 1KJZA 4NU6A 3I4CA 1EGVB 2PN1A 3WB0A 1DFHA 1WXDA 4B08A 4DIMA 3H8VA 4HEA1 1NQVA 4FMCF 1ZMXA 3FPAA 5I9IA 2FQQA 3CCUV 2B94A 4AY6A 3S81A 3ZDAA 4K6KA 4HJRA 5EY5B 2OBXA 1P72A 3VV2A 1L1FA 5DLDA 4D9GA 4F2GA 3S2YA 2WAOA 4I66A 5KZMB 3GWOA 4B7AA 4K03A 1FRFS 4CUKA 5MGNA 3TXXA 5BNIA 4F4JA 4G5RA 3RQIA 4IIVA 1Q15A 2RFLA 1B76A 3FI0A 4WK4B 3ZE8A 2HJRA 3AG5A 2GSWA 4DLKA 2XMQA 2YNMA 5LDHA 4EW3A 4DXAA 4BWYA 4X8OA 4C7OA 3CPHA 2W2MA 3MB8A 2F1OA 4J7UA 4LYGA 1RHUA 4EA7A 2VDOB 4OXYA 5LDGA 1QIHA 3TLEA 2QD3A 1J0EA 3HUDA 3FR7A 4EFBA 4K6GA 3GWGA 4LCEA 5I7OA 4MQLA 2PT5A 3U3ZA 2QD1A 2HBRA 3LJKA 1AV7A 2JBWA 1PD1A 1E1RA 3MXTA 5FLXA 1NVVQ 4QVIA 3RWMB 3N7AA 4PGMA 4JMLA 1W73A 1NDUA 5EEHA 1GR1A 1T10A 2XMZA 3HI4A 1CF9A 3ZZNA 3HO1A 2QQGA 3WLQA 1FLVA 4UE3S 3W5UA 1Z7EA 1IZ8A 2E37A 3ZXIA 4LV6A 3LC7O 1DIBA 3EMDA 3S1AA 3EZLA 4DLVA 3M3HA 3NP7A 5CDFA 4AJ9A 4DLZA 1QIMA 3VR6D 2FMFA 1WF3A 1DDIA 5DULA 3RVSA 3KL4A 4A9AA 1KMIY 5F9HA 1IVNA 3ZLVA 1QIJA 1DF5A 1XNQB 2OCGA 1M1YA 1WCV1 1ULZA 2CUKA 2QR5A 3R0QA 5A6VA 3H2HA 4K6HA 5LMNB 3OQHA 4QODA 3QYJA 1WMEA 4B6SA 1I7NA 4DV3O 2BFDB 5CHEA 3CEJA 2HRDA 4M1YA 4MO2A 1ZOLA 2J59A 4K87A 5KHLB 3JD0A 4NHEA 2CY0A 2P3SA 2H4XA 3S1SA 1Y66A 2WWTA 4BOYA 1U6JA 5G0TA 4ACAA 1EM6A 4BNDB 1DJQA 4I81A 3RG8A 3GRRA 4CODB 3JRNA 4C2AA 4PX5A 1LBEA 3GJSA 1TUBB 4P5PA 1HTTA 1W35A 3CONA 4RSRA 5B7GA 4QUHA 2BN4A 1OKKA 4EY7A 4MHTA 4DDVA 2CXXA 1YVRA 2YOFA 5T4BA 1XTPA 1JTKA 1RWOA 2YUAA 5TQ2A 2PSHA 2PRKA 1M10A 3H4VA 1XN1A 3RREA 5AVSA 1MABB 2BFNA 2PGDA 4J9YB 3V1KA 4UHKA 3HVKA 3FAZA 5L3CA 4CL3A 5EJ4A 3G4SV 2QR2A 4XGRA 4R83A 1O5IA 4HN4B 3Q4HB 4QIHA 2VPIA 3JVUA 4XSGA 4EA8A 5CDUA 1H4TA 1GKKA 2YWDA 3ADDA 3LW7A 1AF7A 2RG7A 3WRXC 4OWPB 3ANYB 4V0RA 2FE4A 3S68A 3SN6A 4BB0A 2KMLA 4P81A 4W7IA 4CMAA 1UP7A 1E1CB 4CNBA 2YCBA 3IGAC 4V2IA 3TECE 2INGX 1MJGA 1XC7A 3FOFC 1PO7A 1C5KA 1YDMA 5DX8A 5DM60 1G3MA 2FLWA 3U7QB 3WVNA 4GVXA 5FTLA 1V55C 5FBWB 3WMWA 2CSUA 2A06H 5T4FA 1Z0DA 4KAAA 1I7LA 1NJ5A 1XB2A 3HL4A 5IASA 2P6UA 1TM7E 4F3WA 5I9SA 4LH6A 2NAPA 1R7RA 621PA 1Z62A 4B6FA 4XDKA 2AQHA 1SXJA 2VQ3A 1KGSA 1XZEA 2OAGA 4NS4A 3WISA 2K87A 5IZCC 1YDHA 1TM3E 4TWAA 4PJ0Z 1P39A 2PF4E 5GGYA 1WXGA 3KCNA 4L4SA 3ITNA 3PSAA 5IARA 4URFA 1D6SA 2X0KA 3K31A 2HJFC 5EJMA 4QXAA 2EJBA 3AG7A 2P9CA 3PLNA 4E1AA 2IZ1A 1OV4A 4EGQA 2ZYTX 3H1JH 5ARDA 1RQPA 5JSZA 2EL9A 3KKEA 3R65A 1IOVA 3K96A 3BRSA 4WUVA 3K9SA 1SBTA 1ISJA 4A27A 4NBRA 3P20A 3HTXA 7ADHA 4KWCA 5NLLA 3K8QA 2XAQA 1TKRA 2QL9A 3KB6A 4OHRA 2QDOA 4BFVA 2JLRA 5BQ3A 2BP7A 3TNLA 3OY7A 2GJ8A 2O3SA 5F4ZA 1BDIA 3IC7A 4WCFB 1C1HA 4V1CI 2CH7B 2IV2X 4M9UA 1ZXXA 2ODMA 3PJRA 4PBTA 1FTGA 3N2YA 3NHAA 3IFXA 2HDWA 1ZH2A 4MTXA 3AOGA 1MB0A 1XQWA 1EAYA 3COVA 3PVZA 1JEAA 4KIJA 4EW2A 4I50F 3K59A 2W83A 2JI8A 4AJ1A 3SJAC 5AK0A 3RODA 4DA8A 4EJSA 2QNIA 3A9RA 3N5KA 2OYRA 2ZCUA 1GFZA 4DV5B 3K20A 1NVFA 2B1JA 3OD5A 2A5LA 2YIMA 2ZDGA 1DELA 5BSEA 3CZQA 3LY5A 1X15A 2PGIA 1K89A 2VHTA 4PR0A 3WDKA 1N25A 2Z6QA 4FJCC 1JF8A 1J2EA 4AJNA 3L7OA 1U9IC 5CEEA 4IXMA 3P26A 3EPRA 2FA9A 2QRPA 2ZYWX 3L8EA 2JHGA 4KPYA 4DLYA 1HFJA 3ZEAA 3S3XA 5F64A 2GEVA 3QJ5A 1OTYA 4B8ZA 3CLVA 5DMXA 1COWA 2B9EA 1P7VA 4B84A 4MRNA 2PWYA 1VIMA 3I5DA 3RK0A 4LVCA 5JJBA 4YP9A 4IIHA 3VTFA 1Q86W 2GNPA 4KODA 5AVXA 4WE3A 2UZIR 4HUJA 1Q7CA 1IWOA 4NBNA 2P11A 4N5DA 2B34A 1Z37A 4FFNA 3MT9A 1F12A 1FNCA 2HA2A 2Q3HA 4RPCA 2JIZA 5T8KC 2XA1A 4KBGA 2XXJA 4OMFG 1T4DA 1O5TA 1IBLO 3LKZA 3VNAA 5CR9A 1X9IA 5C0OE 3PUIA 2VPYA 4EO7A 2J3QA 5H6RA 3I1YA 4GO1A 1TPZA 3IBFA 3IUPA 3LSTA 1YV9A 2VN8A 2C78A 4EGJA 2VDKB 2QVZX 2HR1A 1LWNA 1SBNE 3NIWA 4OH7A 3NALA 3FHTA 1PWYE 1OX4B 4UTOA 2ILMA 2M6YA 5GJWC 2ZRGA 1K4MA 4PQEA 5KNBH 4TSRA 4X92A 4BVFA 4QOJA 1XDDA 5K99A 4E5MA 3D59A 3D6UA 4UUPA 1XRRA 4F11A 1VSBA 3Q0TA 1V48A 4XD2A 5FP0A 1P2SA 4L95C 1DWQA 1ULUA 2Q2OA 1HLPA 4JEMA 4Q20A 4B81A 2OILA 1UBHS 3CCSV 4GF5A 1MRSA 4LDRA 2R97A 3BH6A 2BTEA 4QUEA 1K6JA 3ZYZA 4RVDA 5K1XA 2BKLA 2IHBA 3NAZA 3AG4C 1BMDA 3AEYA 1JGTA 2LW7A 2PPLA 1Y1PA 4BMSA 4GWGA 2DW4A 3HZHA 4D96A 1S0VA 1PZFA 1WSAA 4KXUA 4KTVE 4DTCA 4F1JA 4JR1A 1GL3A 4GYCB 3WGQA 2IYYA 1N0IA 5LMUB 4Q7MB 4QDKA 1WNTA 3D8UA 2X14A 5K05A 1AZSC 3QKRA 1UAYA 1XQ1A 2CV1A 1COZA 3AI2A 4XGQA 1P4HA 2P5UA 5EN4A 4YDQA 4OGGA 3WP1B 1EBFA 3IAM1 4AKTA 2EP5A 5E3HA 2A5YB 1LPSA 1XNJA 1MLDA 3ZBTA 5B7NA 3GRUA 1UKCA 4DIKA 1VXRA 5ED0A 3ZEDA 3H0EA 5I3ZA 3OOJA 4MWDA 2ZYHA 4NU5A 1BXKA 1I0IA 1XBTA 5DV9A 2YYZA 4EYSA 2H5LA 3DDHA 3DC6A 1MKYA 1ZJ4A 1NXPA 1K33A 3ANXA 3TQFA 2O7QA 2IWHA 3E5NA 4ER0A 2NXJA 2PMBA 2Y0BA 2IXFA 1E9SA 3ZKAA 1FIUA 2GPNA 4F6EA 3GJ4A 3ORYA 3QUSA 2YUIA 4F2HA 4IWYA 3L79A 4IR7A 4NKGB 5ALFA 3MJTA 3GAAA 4RHTA 4XCQA 3RDPA 3K9WA 4RKFA 2ZT7A 4HEQA 5F7JA 4QFTA 2QS9A 1RZ3A 1SAYA 3TVDA 4CI9A 4I55A 3RRNA 4Z0TA 1R15A 4MGZR 3DOFA 4J7XA 1RAAA 1NUHA 1K9SA 3IV6A 3CTMA 5EJFA 4ZFRA 4TGLA 3L9XA 5H70A 2WV9A 2JLUA 5DXFA 1RXEA 5A7GA 5DHPA 5AI6A 4F2DA 3TG8A 3EEIA 3LQRA 4L8WB 5AVJA 3QVJA 1F51E 1UZNA 2FH5B 5D51S 5IYZF 4DTIA 1P8AA 3T3HA 1PGQA 5EIXA 4OHYA 1CP2A 5IUNC 1UEIA 4YJGA 3M2TA 1TLLA 2IGTA 4IRMA 3D3WB 2PYDA 1AVMA 3M6AA 4KBYA 2ZXUA 1B0UA 4WY5A 4KN8A 3WMXA 3NHLA 4RNDB 1K5PA 1O0SA 3UH1A 3BERA 2D4HA 2WWYA 1PD3A 2XCUA 1AZTA 3RNOA 2ITDC 4WCEV 3N2NA 2J6CA 2XD9A 1KYOF 1KS9A 5KOHA 5L7TA 8MHTA 4KYVA 2AX4A 5CVTA 2CNOA 4OAOA 5ALLA 3ZIUA 2PUAA 5E6SB 2AXPA 5DRTA 4MW3A 3T4EA 1U1IA 4O4HA 3PFWO 3IEVA 2PS9A 4YX9A 3HZRA 5GINE 2Q1YA 1ACMA 3PDCA 2KB1A 4R1LA 3RT3C 3IPCA 4BP8A 3KZVA 2YRXA 1R5OA 2VI5A 1F2UB 5AXBA 5EJ6A 3I5YA 1H2XA 4GRIA 5KSYA 2QSUA 4JBHA 4HDKA 3EIQA 4R6WA 1M56B 3H9VA 4WXEA 1HLDA 1NIPA 2KE5A 4FYWA 3GROA 1O6CA 4OI0A 4V0QA 4MVMA 4RJKA 5DM1A 2QVCA 3GLGA 3DXFA 2BSQA 3AF3A 3GZNB 1N2GA 1SHKA 5KTPA 3W8DA 3TSCA 3L04A 1W5SA 2XADA 3OIFA 2D2FA 1I10A 4DLRA 1F8GA 2AL7A 4B2YA 1A5ZA 2SKCA 5AVQA 4R6ZA 3QKSA 3Q5GA 4PPYA 4J0IA 1G6Q1 1YBVA 2XWJI 3AHDA 4LTNA 4EJ0A 1K8RA 2L6LA 3ICQB 4XB2A 4N5NA 3B2EA 5HFLA 5EC1C 2Y3IA 3VR0A 4X84A 1AZLA 4B3SO 5ALZA 1NJ6A 3UTDA 5CB4B 4Z9XA 2W90A 3NANA 8GPBA 2VRZA 1V25A 1ZR4A 4PYOA 4UVHA 3K6SA 3LUHA 1A4UA 1HQCA 3E8GA 2FPLA 1BXGB 1U5CA 4LI0A 2QRLA 2PVPA 4JLDA 5DBHX 1S2MA 3OX1A 3Q9NA 5ECGC 3JVDA 4Q66C 2W6JD 5GONF 3PK0A 1I32A 16PKA 3OGIB 1KE2A 2YDYA 2MCFA 4CMEA 3VPGA 1VG1A 4CKZA 1CUEA 3LYHA 2E4UA 1L1RA 4NCXA 5EQJB 3C3BA 3KX2A 1NBIA 4B46A 4FDMA 4LJ7A 2QRVA 4HDMB 4QSMA 1ZCZA 1AQNA 4TUYB 3KE9A 3DTUB 3BMOA 5EMJA 3OJXA 4AP5A 2Q0SA 1LSUA 1YBFA 5AKEA 1NVPD 1E1KA 2ZBPA 4EQ6A 3B7GA 2PBLA 2EILB 1BX1A 4BEWA 4H18A 1BJTA 4RGYA 4MB6A 2BH9A 3OCYA 5EJEA 4YMUA 4C30A 4R8KA 3OLVA 3JYOA 4URVR 4V24A 2QKYA 2IYQA 4BMDA 1I80A 4QXRA 4EYEA 1VSUA 1FTYA 3EODA 3JYQA 5EPOA 5K8UA 4LIPD 3Q5DA 3DOEA 2XA2A 1MIOA 2Z8YA 4BE4A 4WFBV 3MMNA 3UHJA 4K0KB 4KKXB 3AB8A 2WM3A 3UXMA 4LPSA 2GTPA 2ZT5A 4GRDA 1AN9A 1G1AA 4HTFA 4GH5A 2BZ1A 2WZCA 3GP3A 2O3UA 5EJAA 3DE2X 2QZ9A 2VA9A 1IBMB 1HNZO 1U63A 1PVVA 5ALIA 5CVEA 2O5CA 4M0LA 1K8ZB 4E0BA 5I7HA 1ULBA 1U6IA 1QH1B 1XMQO 2ATKC 2JIMA 1R4NA 2WG2A 3MAAC 1N0NA 3NBXX 5M2QA 2GERA 3NBAA 1YJ8A 2IDKA 3FHJA 4AC9A 2SBTA 1VECA 1JAYA 4QLBA 4Z9BA 3FUXA 4QTXA 1AF4A 3H8JA 1FDSA 5J40A 3RIGA 4NY1A 3C5EA 4RGVA 1VIAA 2WF9A 1TADA 1W0JD 4WCDA 3N6XA 4R3NA 1MX5A 4HDRB 4RV4A 3BEDA 4FLTA 1ECFA 3U4DA 3T0IA 3GLVA 4U3FH 4F4CA 2LKCA 3WYGA 4DIBA 3LRPA 2FX2A 4WJZA 5HCUA 7ABPA 1M57B 2C94A 2DHCA 4RZ3A 3ELBA 5FO0A 5F9FA 2ODQA 2ORYA 3K2QA 1UJWB 1TZJA 1M6NA 2VP4A 2IU3A 3HCAA 3ITDA 3E9MA 1SNYA 2Q9AA 1F9AA 3CNBA 1JXAA 4YDHB 1T8YA 1AUQA 4BEVA 5JG7A 1G8PA 1PDVA 3HFGA 2WMOB 3GH1A 4IVQA 1QHNA 4Q3OA 3EW7A 1A1VA 1OFUX 4WECA 4UBMA 1Y80A 4NJEA 4AYWA 2Z57A 4OJTA 1H2MA 4NVPA 2H3OA 3X2SA 2A9VA 3T1HO 5JD3A 3INRA 5B4TA 4DDTA 1RWWA 3MC1A 1WXHA 5JYBA 3R8FA 2BFCB 2NU9B 4NPCA 3TIIA 4BMNA 1BXZA 3EZ6A 3ER6A 1TVKA 1QZZA 3C7AA 3Q1KA 4IPTA 1OLSA 1RJ9B 4FZ0A 2X0EA 3VO9A 3WBKA 2IGBA 2XTAA 3BD8A 1GK9A 4X8HA 1OVGA 3FPHA 3RARA 5ESDA 2FF7A 2JLYA 2Q1WA 3HM2A 2F93B 3CH4B 2RN9A 4BY9E 2MK3A 4ZYZA 2P8JA 4FPPA 3TLBA 3KALA 2QAGC 3EQ9A 1QVVA 2IHZA 3H2ZA 1CW2B 2BM0A 3UOAB 3FKJA 3SC3A 2VQDA 1DU4A 5ICGA 5EBMC 4A6DA 1LWOA 5IYBO 1GU7A 4O59O 1CEZA 1ZD2P 3IPXA 3F5DA 3V00A 2KI5A 4KHZA 2BJVA 2DKOA 1JIKA 1NXWA 4YPOA 2YWEA 3RE1A 3UKDA 4YCJA 5IM4A 5CDHA 4JC4A 4NG5A 5EINA 1SHUX 4UEJA 2ZCVA 3Q7QA 3GOHA 1T2FA 4JP1A 4FOOA 2VQFO 4J49A 2GAOA 3L6RA 3STXA 1BDMA 1H2KA 4LFBB 4DW1A 5FNZA 3CCMV 4OI4A 4R1OA 1P4RA 3CLSD 1RM5A 4KACA 2AMLA 1MA0A 1YR6A 5TF4A 3FHOA 2ZOSA 2R7MA 2JFWA 1OB5A 1Z74A 1LVHA 2RC5A 3AKYA 2ZFUA 2V7UA 1NE7A 2YXLA 4RD1A 1GYPA 2P7HA 2Z1MA 1JIUA 1VQ7V 4LBWA 4N8EA 4PI2A 1PJLA 4ZD6A 3NRBA 1UBSB 4G01B 4HNUA 2YMQA 3WKDA 4K28A 2JI6A 3NHWA 3EX7C 4QGBA 3F6BX 4L76A 5M52C 1QAMA 3D1LA 1V11B 1VHTA 2GILA 3D8TA 3SPGA 3D4BA 4FSDA 4PCAA 1SUDA 2BGRA 4IX1A 1RM1B 3TVTA 1ZK4A 1PRYA 4CM5A 2HLNA 3V1MA 1W1IA 2X6TA 3UT6A 1RQGA 1KEVA 2H11A 1JN0A 1XOIA 2IQ5A 1YL7A 3KQVA 1Z4NA 4JI8B 1WKBA 3HJRA 4AK9A 1SKVA 1A71A 5ECWA 3KP1A 2R62A 3OWOA 1XALA 4FMDF 4DG5A 2I4IA 1G19A 1VYUA 4M0KA 3H5RA 2XE6A 2HPVA 2HF9A 2HU5A 4RE6A 3WNZA 4X65B 3UJ3X 2CBZA 1BFDA 1T0UA 4BUZA 1JLLB 1UBOS 1YRLA 2HLDD 3PD7A 4ITVA 3GQBA 2AJDA 4PC2A 4EHHA 1GPNA 1T1EA 2PKRA 3OFSA 3AR3A 2YVAA 3HB4X 1KYWA 1LX7A 4B7KA 4I6JA 5JPDA 1L8AA 3WLAA 3RUFA 2HJSA 5LZ7A 4RZUA 2RGRA 3G2QA 1F20A 3OTHA 4IV8A 1QFXA 5IF3A 1D2EA 3K5IA 3QELB 5EZSA 5FBZA 4WX2B 1G21B 3NEPX 4MVZA 2QQFA 3ETLA 1S6YA 5C46F 3KEMA 2Z6UA 1QYDA 1AP5A 1Z22A 3NBZC 5FQOA 3KLNA 2G82A 1A2QA 4IV5A 2NACA 1R73A 4FLMA 1K3FA 1MHTA 2W0XA 1JHVA 3H1HH 1PJ3A 2IQIA 4FYHA 4TVKA 3AHIA 3ZCRA 2F48A 4LCPA 2J5QA 3UK7A 4DR4O 4JSRA 1L5HA 1VMAA 4DMHA 1PS9A 3R3YA 1SFRA 4EG5A 1E1QD 3ZGZA 3KT3A 4QO7A 4EO4A 3UANA 3ZHBA 3FJOA 3ZWDA 1XZNA 3LV8A 2WT4A 5KYNA 3U49A 4JODA 5EHGA 5JLAA 2CLHB 2E3JA 2GN1A 1T1IA 1QHTA 4ZKIA 3OEWA 1SBCA 3H8WA 4B09A 3D8CA 4DCUA 4EGFA 1W30A 4UZEA 4C0JA 2YSUB 4AQYB 3EVTA 4REOA 5IG2A 4TQGA 2KJQA 1RKBA 4CN8A 1KP3A 3JQ9A 4J1TA 1EWTA 3DXRB 2FQXA 1ZC4A 1G7SA 3RYHB 3F90A 1K86A 2W2NA 1V1JA 4DDWA 4N01A 5KS2A 4KLCA 4ICIA 2ZRBA 1EFPB 3WLNA 2QTTA 2Z2YA 1U2PA 4KHPB 2IPAB 3CF6R 3H11A 3VVCA 3TPFA 3FFWA 3MEQA 2ATCA 1LFDB 1QVGU 3KQSA 3C7CB 1VQOV 2H65A 1I4TD 2ODEA 1JXOA 3IJ4A 5I4BA 1ONOA 3AWDA 3PR1A 5ADWA 3I62A 2HRZA 5DNDA 4CG2A 4PHGA 3GLHE 4IVNA 2I3GA 4N3NA 3ABKB 2Z6AA 1H65A 3GLRA 3QZUA 3CJHA 3LLUA 2I1WA 1CUJA 4NOKA 5KC9A 3FRIA 5FPHA 3H1IH 3V8PA 4F92B 1I94B 2I62A 1VKNA 2C5EA 1YZTA 1U2QA 4BNFA 4X85A 2Q99A 1EBUA 3L8HA 3LF2A 4CW7A 4WFJA 3VC3A 2QPOA 2BFPA 5EWMB 2KCQA 1H66A 4PW0A 4HS4A 3GUCA 4JJ4A 2IIQA 3DMNA 3LBNA 3WK6A 4DCVA 2QI9C 2G08A 4JNKA 4JI4O 4JYPA 3LUJA 4OI1A 3KUUA 2AZDA 2VKQA 3TR0A 3E7WA 4F5WA 1C50A 4I9HA 2MWMA 3HCDA 2VDUE 4M8IA 1I1NA 4OHFA 1E3DA 3ESDA 1H4SA 3BB4A 1N4DA 1WVGA 4CQMA 3BJIC 2AI1A 2RAVA 1Y9ZA 4NNPA 2IJHA 4HMQA 3HJGA 1LZKA 4CEIA 2UXDB 2BOVA 4WK0B 2FF5A 1G5TA 3X2EA 2LP7A 4U2BA 1N2CE 2IXBA 2HA7A 4LQ4A 1PG2A 1I6LA 5KJ1A 3DSRA 3X44A 2R8XA 4LJ4A 1ACJA 2EFCB 1WMSA 4FS8A 5TGTA 5A2QN 4HRAA 1RBYA 3ILSA 3NB0A 4P30A 1GM7A 5BMVB 3QEBZ 2O8CB 2ZQZA 1N3YA 2ZXWB 4PG8A 3DQQA 3I6QA 2ZUWA 1QUFA 1FNNA 3NDBB 2HXGA 4DZZA 2OZEA 5JU6A 1V8BA 4F96A 2YWFA 4IGFA 2XNDD 1ZKMA 1ZW1A 2JVDA 4D3XA 1VB5A 4WK6A 3VYVA 3TCNA 3ND5A 3H1KH 3GVIA 1DXHA 4MLCA 1Y33E 3TZBA 4FGZA 5DYWA 5BVHB 3QIAA 3Q85A 4P3XA 1BWPA 4UM9D 3ABRB 3Q7IA 3GT0A 4YGYA 1CZKA 1WOMA 1J24A 3C70A 2O07A 1R6TA 3VKGA 3MUEA 4GG1A 2DYRB 4ISBA 2Q9BA 3DBLA 2HPAA 4FQ5A 3DEAA 3BH7A 2QZPA 1TAUA 5KTOA 4HQ6A 4UNIA 4BKOA 3CH7A 1T3ZA 3EY4A 4Q4HA 4K9SA 1EHIA 3DOHA 2HDOA 1QVZA 3H1BA 5B3AA 4L02A 2FE1A 4Q00A 5BY2A 3GFOA 2P69A 3H16A 3H75A 3DKKA 5I9LA 3LPLA 2UUAO 1MAVA 3FZEA 3NIBA 3ZC3A 2ZAMA 3EIUA 3FKSG 3KBBA 3QWHA 3RBVA 2C97A 4YGXB 3WNDA 2XUJA 4BP9A 2HU8A 4YV2A 2A79B 1KI3A 3CRCA 4K26A 1NP6A 2KSDA 1M56C 1E2IA 4IXDA 2AW3A 4WZAE 2DWUA 3RUEA 3KJIA 3GP5A 1YBAA 3E9RA 4ROSA 1UAAA 2RONA 3AFIA 3L9WA 1WKCA 4KYIB 4DC0A 4QBIA 1OPRA 1KY5A 4Q1BA 2V5AA 4GXQA 3GT3A 4TMFA 4KPGA 1SKMA 1XZMA 1YOBA 3DZGA 4CT5A 2BE9A 1UL1X 3UV6A 3KJEA 1C8VB 5GV7A 3ZXUB 1TQ4A 5G41A 2AN4A 4AULA 4H3SA 3PC7A 5KAPA 1G3RA 3I0MA 3VYUB 2PUEA 1WWKA 3B8HA 5D01A 3UJDA 1XEWY 3UMCA 1VLMA 1FDRA 2FWIA 2FEMA 1K98A 4O2BA 4FR5A 3JD2A 3DFMA 1YRWA 4OQDA 1CJUC 4JEIA 4ZQFA 3KWFA 3F6YA 4CFYA 4P9OA 3MWEA 1KQFA 2PUCA 2Z0MA 1L7VC 4TSFD 3NOVA 1U8FO 2E48A 2DBQA 4FCWA 1PV1A 3VNRA 4OKNA 4FLUA 4G0QA 1IHOA 1E7RA 3HP1A 1KDRA 4R50A 4OP2A 3BY6A 5AHRA 4L3VA 5JNUA 3OIGA 3CR8A 3L4JA 2VAWA 3WNBA 1RQXA 4I55F 1EUZA 2OAQ1 2RHDA 4U9UA 5CCEA 4E4RA 1RFYA 1MMMA 2GSMB 3MW8A 5LDDC 3M6IA 3OFVA 5IVIA 3FTQA 3E89A 3M4ZA 2OCIA 2DOKA 2UXBB 4LDNA 1ZLXA 5K0FA 4LOAA 5EJ5A 1PIWA 3R5SA 1KHTA 1GHTA 1XMVA 2IZ0A 2WKQA 3VNBA 3SQWA 4XM1A 2F2TA 2GKOA 1QRUA 4FGWA 4RK7A 3ANLA 4JASA 3PA6A 4Q3AA 4OCMB 2QLMA 1I7DA 4CIAA 3A25A 1UAGA 2PFKA 2DPYA 2VHZA 3FPFA 4EOGA 4V38A 4V2UA 3OCUA 4N41A 1MRNA 3EASA 5LHIA 1XDWA 5JS8A 1WNFA 1MDFA 3O38A 2H16A 3EOZA 5KYVA 3TTSA 4EKDA 1R6VA 4BUJA 5GZ3A 2CLCX 3WYNA 4O4HF 5EGSA 3COZA 4G56A 2JDID 3UMSA 3ZR4B 2IYZA 3Q5EA 4OMCA 3S8MA 2QYHA 4H1UA 3T7TA 1VQ5V 3IQHX 4R0MA 3FY4A 4PGAA 1HORA 3EUAA 1QRDA 3VI4B 3M5DA 4B76A 1E2LA 1OWPA 1DX6A 2ZUBA 2HUPA 4WOJA 2HJVA 4X44A 3QTCA 3PIRA 1EINA 2EJRA 1L5WA 1UJ5A 3HUUA 1H9BA 1ENZA 5FA5A 3JALB 4NBSA 1U0OC 4JWKA 2VJCA 1Q43A 3RV4A 2O2SA 3UJPA 4EB0A 4DUYB 3AJ8A 4YHHB 3ZN2A 3B6MA 2XBMA 1YZLA 2V6JA 4INAA 1C8LA 3E8XA 4PAGA 1OH5A 3I01M 3MWLA 5FFNA 4K6MA 4XB1A 1M57C 2PV0A 2IBMA 2QWOB 1DK1A 3FNFA 3LDEA 1FQOA 4QWMA 2R11A 2CTQA 4CG1A 5I7RA 2ZB3A 4DMMA 1P3DA 1TGOA 5LMNO 3M9XA 3U3OA 3SNKA 2G38A 2FYUH 5CVCA 4QJ5A 1O95C 4PFSA 5FL7G 2ZBDA 3EFEA 4OGWA 4FLWA 3I05A 2H17A 4OFXA 2CDCA 2FDCA 4JUBA 5GIOE 3KLMX 1R3LC 1QG6A 3WIBA 5JDIC 1UKZA 2L17A 3W7TA 2PVSA 4GMFA 3UMYA 1ZO8A 3BIJA 5CITA 1KY2A 5JNVA 1HW7A 5CP8A 1QTNA 4HS9A 3ZDXB 5CXXA 3LYLA 2VWQA 5JAUA 3DHYA 2FQWA 4YRGA 4TRMA 5K0BA 1O6ZA 1BQ0A 3DBHB 3KM0A 4DV0B 5DCLA 2EFGA 3PG5A 1M6YA 2YWCA 4M49A 2X6RA 1KETA 2ZSEA 3MG9A 1O96A 1KP2A 3HUEA 7MDHA 5FI5A 4M9ZA 2X8LA 3GLTA 2C7VA 3V34A 1KQGA 4D6XA 2BY4A 2BONA 3CCFA 1NM5A 2PY5A 2XEDA 4MUIA 4BNJA 3LBIA 3R6TA 4YV0A 4EKNB 4DV4B 3E70C 1Y42X 2VFAA 1M54A 4DB2A 2YIDA 1M0EA 4FHGA 4NEHB 3H84A 4QGSA 4NF2A 1EHYA 1I3OA 3RS4A 2Q3MA 2X7XA 3F3KA 4RA9B 3TX6A 4A82A 3FA2A 3GT4A 3OLZA 3PUZA 1W93A 4B3TB 4I4CA 3ZPGA 3WIOA 5KYGA 1H38A 1Q0HA 1XCOA 3BL8A 4RF3A 3T3GA 3HNRA 4LZJA 1E2NA 5HZGA 1KOGA 4PONA 1C4WA 3HNOA 3I76A 4WFKA 2AG6A 3U17A 1Y7IA 1VA4A 2VG8A 4IJMA 1D04A 1FFEA 4CF5A 3MBOA 2CBXA 2OSVA 2XQKA 5M7EA 2H1FA 4A2QA 2BR5A 4AY2A 3G1WA 4RZXA 3VYSB 2D5IA 4MVJP 4KR7A 5BXZA 1SCIA 1JVNA 4W8GA 4PYNA 1MP0A 1KOJA 3FX7A 4NS1A 3VHXB 3I9V1 3V48A 3ESYA 1IM2A 4ANFA 1TK3A 3A37A 2JK0A 3JSLA 1YT5A 1MZFA 4HTAA 2QX7A 1YRBA 2D59A 4ZEXA 4J3FA 3ZV5A 5H9CA 2NAFA 5LZ8A 1VPWA 4EHFA 2X1MA 2Y0CA 2UVDA 4JMPA 1UDWA 2GCEA 3RS5A 1UXJA 1VJCA 3BCCH 1AKRA 3CLTD 3GG2A 1RM1C 4M1QA 3QNUA 4LCNA 4JVLA 2MJLA 1GLGA 4XGIA 5LQNA 4LKRA 3QLJA 1K0UA 1G5FA 3NH9A 4ND4A 1GU1A 2JCVA 5L9AA 5EZYA 2CFCA 1W36B 3BGOS 2H92A 5D5PA 1AHHA 2JIBA 1M5TA 3RRBA 2BR3A 1KRWA 1BA2A 2ZZNA 2Q9CA 1U90A 2BL4A 4D4LA 1R1BA 3O1HB 4B3IA 3PNSA 5BUSA 1CJBA 4EX7A 3ANTA 4CBVA 3PTLA 3VU3A 1LTHR 4REQB 5EHIA 4NR0A 1Y6ZA 1AMUA 2H59A 2XDQA 3B4SA 3CY6A 5MDHA 1EVYA 2R7AA 3L0YA 2B8EA 2VWHA 4N0EA 1WPRA 2E74B 1JDJA 1SOAA 2ZNRA 3ZE9A 1RJFA 3GY0A 4W7HA 1OKKD 1YNSA 1MEJA 2GCOB 1W1UA 2DERA 1QFYA 4RSMA 1YA8A 1P5JA 4AKHA 2WWWA 3PD0A 4HQLA 3RFFA 1X14A 1QG0A 3I0NA 4DABA 1K6MA 1VMIA 4B73A 4EFEA 1W59A 3DDCA 1UBUS 3DPSA 4UKDA 5HIKA 3STWA 4AY4A 3LM8A 2V5VA 2O0JA 2EW8A 1Z2GA 4AX8A 1JIXA 3EUEA 5J1TB 2RNBA 4IJ5A 2DPLA 2E6KA 4J6EA 1EFVA 5LOVA 1OA1A 1TYCA 5FL3A 3TSWA 4NCIA 3HXTA 1EFDN 4AWXA 5AD1A 7REQB 4DV5O 4WNAB 3RGGA 3JQGA 2HW8A 4KRYA 1H94A 3BWCA 5C1OA 4JSYA 1E5QA 1Y7TA 4LF4B 2W22A 4RUKA 4Q6GA 2ADOA 4UUNA 4Y6QA 2QAGB 5JCPA 1MH1A 1JR4A 1ECPA 4JJZA 1HMYA 1K4KA 5D5HA 2C3YA 3A6DA 1YR9A 2AGVA 2C99A 2RGYA 3W5IA 1M75A 2L42A 3FGZA 4BIMA 3VU8A 1OXBB 5IM4F 2ZJOA 2QPTA 1EXNA 5LBTA 1JKMA 4MSUA 4WXPA 3I45A 1BSMA 2VRNA 3OQOA 4MV6A 2JG3A 2FPPB 3PFNA 4Q1VA 4DSZA 3TTTA 1JLHA 1QYIA 3NKFA 4IHJA 1EP3B 2ZVDA 2ILTA 3R9XA 3NNDA 2CBGA 4GQAA 2C20A 4JOCA 3ORSA 3QPDA 4RUEA 1AIPA 4J7ZA 4PYQA 5LZ5A 1RCUA 4Q9LA 4JDPA 2WFMA 2M7WA 4EI2A 3CCRV 2DPGA 4TTRA 5HFAA 1QOQB 4EPVA 3C3CA 3OHPA 2B8JA 1FPOA 5KHKA 1FYEA 3HVIA 3MQFA 4TWBA 5AK4A 2QJWA 1OBHA 3PNLA 3ITEA 1QORA 1E0DA 2GFQA 4QHTA 2IY9A 3ABKC 4X41A 1UEJA 1WZIA 4CM4B 4FIDA 4JK3A 1SO8A 1BGXT 2ZK7A 2NNWB 4ASUG 1SJ9A 2EZ9A 4TT8A 3R3SA 3AEKB 4CL8A 3TRKA 1PR3A 1KFBB 1L5NA 1IWPB 2HAEA 2DQ3A 1PTKA 2IZ5A 1QLWA 2DH5A 1UBRS 2P1RA 3TMYA 3K0DA 3RIYA 1T5HX 3KQNA 2F4VB 4FOLA 1HG1A 4ALIA 3F3YA 3HL0A 1ANKA 5BW6B 1V7CA 3LOPA 4K9DA 2CNKA 4TYQA 3KQHA 4YLYA 1TTPB 5L3SA 1ZRSA 1GZ3A 3H05A 3KDSE 2D3TA 4BNYA 2NZUG 5LMUO 1YCDA 3EPJA 2GCPA 4HWSA 4HC4A 3OCJA 4IF6A 2CXSA 4BYGA 1XVTA 4Z1VA 1QR8A 4G8CA 1WA8A 2GZDA 4GX1A 5IWCA 3L4BC 1PV4A 4GZMA 2VDWA 4EHIA 2XGSA 3KZCA 2GT1A 5CBGA 4YMTA 1KZ7B 4KO8A 3B8MA 2OGWA 4NAHA 2IOFK 2G1PA 2FN9A 2NZ2A 3R41A 5HUQA 2WM8A 4S12A 1B15A 4CGYA 1NDQA 4P84A 1GM5A 2YFYA 1S8FA 2ZXWC 4ZI5A 2SNIE 3B6JA 3F2VA 2O23A 5EPUA 3ZQUA 4YJHA 3WLFA 3LVQE 3DHEA 5FPPA 4DV6B 4LJLA 3RFVA 4GW3A 5J43A 4CMIB 4LRQA 1JQBA 4X3OA 3R7LA 3FCSB 3GB7C 2PKQP 2PKQO 5F7OA 1XXLA 1RWPA 4ZMSA 4J10A 6PFKA 4NG4A 1TOAA 1P91A 2Y1OA 2B98A 1TUGA 3O95A 9LDBA 3OA0A 4RK4A 3ODGA 2XOEA 2GASA 4FYPA 1ST2A 1BQ4A 1OIWA 1COWD 1K7CA 3NAMA 4YQFA 1SESA 2I0FA 4UNNA 4A36A 1Q7BA 3CX6A 3TH5A 1DOAA 5KQSA 2DYRC 3OTOB 3T5DA 4EB6B 1CY2A 1Y8CA 3P9ZA 5B6PA 1Z5OA 4FE3A 1GCIA 3FSJX 3QMWA 4PN7A 3JQ8A 1SWWA 1YB4A 3H0KA 3QTLA 3D6MA 2OHJA 3GX1A 4G5XA 1I2DA 3MFQA 1IEWA 4HNTA 4R98A 4R2LA 1VSTA 4TLLB 3JQ7B 1IBRA 1V37A 5FNVA 5C8DA 2JZNA 3THSA 2G84A 4TS4A 4TN5A 3F5SA 4YP0A 1E4OA 5E1AC 5FOSA 5I6DA 3EF0A 4M9RA 5ENVA 1BX3A 3BQMB 3O2SB 2P4QA 3A1NA 1UC9A 4PX9A 4Q4AB 4UB6Z 2YV5A 5G3YA 2QTNA 1MQ9A 4MTLA 1VKOA 3AJEA 3V1TC 2PJDA 4E70A 2FUKA 2D13A 3OC0A 3RN4A 2JS5A 2Y99A 4W9NA 2QZZA 5EUQB 1HE8B 3I39X 1X80A 2ZETA 2QVYX 2WUFA 3PUVA 3MHTA 4ZA2A 2P6JA 5F2KA 3PFGA 3H8SA 5LBIA 2JRLA 1N5DA 3ZQJA 4EX6A 4MULA 5DEOA 1LPPA 2FMIA 2FK8A 3FH0A 2UV8A 4FKMA 4DF3A 2ZIFA 3I2JA 1XFAA 2XKAA 1VJ5A 5BWBA 4L08A 1K6IA 1WZNA 4ESOA 4JXEA 4ER5A 4CMGA 3DZHA 1JG4A 4MVJM 1HETA 3OOWA 2OHIA 1P1KA 3QGMA 1T2EA 2VWKA 2X3UA 4C2BA 2PQ6A 4KH0A 4YUZA 4IRXA 1R6XA 1AKWA 2X9GA 3EVAA 3HDJA 1DX9A 2PQ0A 3H04A 3QX9A 4EA6A 1KH1A 1RRFA 2REQB 3D02A 3MBIA 2JIRA 4S24A 1DKMA 5B1AB 5HKAA 2Q6KA 2FFQA 1D7AA 4P4UA 1TK9A 3NHKA 4JSTA 4O5OA 4WZ6A 3DV2A 2HTFA 2ALJA 5BYJA 1RPTA 4UVEA 1VE9A 3OT5A 2WSIA 4Z0HO 3ILXA 5FORA 2J5XA 3PNQA 1C8KA 3ZDFA 4C7UA 2AFVA 3RW0A 4BO0A 5E9AA 1XREA 3DZFA 1B93A 5FTWA 2AEMA 4NEQA 2ZSFA 1PP4A 2O8BA 2JASA 4GM1A 4MTFA 4E2FA 1LDBA 5L3VA 4E30A 3ZK7A 2ZRAA 1B3BA 1SUAA 4PV7A 5DHQA 1A2BA 5DM2A 1GDTA 4OGLA 2VPZA 4QPJA 4ZHQB 1B00A 1Z6GA 3FMOB 3DDSA 1FQJA 4MUBA 3IKMB 1GPYA 3DTVB 2GPSA 2RGGA 2GVZC 1EFAA 3IUYA 3QPWA 1WUTA 4HFMA 2FAXA 2O2JA 2FW8A 4RKRA 5BQOA 3BMCB 2IEDA 2YHBA 5C1DA 5GOTA 1FUYB 2ZI9A 4N49A 5L3QA 2UYYA 1ZCBA 4ZYVA 3BS4A 4HN2A 4UTNA 1SQ6A 3WL6A 3X1DA 1B73A 4ZV7A 2RH9B 2F1HA 5BR8B 1ICIA 1ISHA 4ZICA 1GPJA 4YP6A 4KK3A 1DJMA 2J9XB 3PB3A 1E7YA 1MR3F 2PKCA 4KQWA 4A03A 2NPFA 1ZCFA 2OO7A 5FOQA 4EAAA 2XRMA 4TL6A 1JDZA 2PKWA 3CX8A 1XOUA 2C92A 1A8SA 5A4FS 2YZNA 4YCCA 1OYYA 5TT0A 1CUYA 4ZFNA 3DR5A 2D7DA 5CX1B 4PHZA 2VBGA 3GT7A 5HX7A 2ZZMA 1XE3A 3U81A 3MWYW 3HU3A 3K9QO 3R3ZA 4GPZA 3VQYA 2WZBA 4QPKA 4CHGA 5HIAA 1SEPA 4UDNA 4EAQA 4K0KO 2QK4A 2FR8C 2JAWA 4CM1A 3TPCA 4TZ0A 5F2NA 2EEZA 2IOYA 1N2IA 5CGZA 3NVKI 2ECOA 1FFYA 3F5TA 3OZXA 1N7IA 3VR4A 1LSSA 1ETUA 3GRYA 4MQFA 1IBMO 1YZ3A 3ICOA 4BIOA 4R8LA 4MA4A 2Y1DA 1Q95A 4P33A 1GILA 1JAIA 1BEEA 1UEXC 4Z6KA 5KYUA 3ZV7A 1OJ7A 2QX8A 3VDNB 4K88A 1KEKA 1PP9H 4BLOA 2IHVA 3QVUA 3ESQA 3EAFA 4DLUA 5LZ4A 1LPBB 1SRYA 5DDIP 5AHOA 4KOEC 1TKAA 3E1GA 4ZV9A 1GP2A 2WSLA 1PGOA 3WWDA 3D2BA 4HVAA 4OCNB 3VO2A 4OO3A 4YRPA 2PYZA 4E2ZA 1O4VA 2PD3A 3FG9A 3SZLA 1HE1C 1RAEA 2F8TA 5FX2A 3CU5A 4HRXA 4BJHB 1HDXA 2H1LA 3GRFA 3DLTA 4WY2A 3QFRA 4WZBE 5F33A 4ERXA 1Z5VA 2IF0A 1BMFA 9ATCA 2NYRA 4RVUA 3VR5H 1UDAA 3BSYA 2EIXA 2VRWA 1YK0A 4YAUA 1E5DA 3W5VA 2O54A 4RQEA 1EK1A 3HM9A 3BCHA 1CVIA 3UOWA 3N2EA 3JVEA 3HCEA 5FAKA 4TQFA 2CTPA 2G76A 1J0XO 2G1UA 2Y4OA 3ZKWA 4DV2B 2G5TA 2H2WA 1MCZA 4D9MA 4E46A 4GOND 3E8MA 2V98A 1X9GA 4KNVA 4RZ2A 4YXFA 1R4MA 3E2MA 1VLQA 1TK2A 4G85A 5CYOA 3UO8B 4YI3A 2RH8A 4PDVA 1G9SA 2ADPA 4P0QB 2G5CA 3E8FA 2WF6A 2ZT8A 5BSMA 3MJRA 4FNMA 3FHLA 1XDCA 3SQMA 3ZJ4A 5UKDA 1DS6A 5EE1A 3V4RA 4JCCA 2ENUA 3CW2A 1V5WA 4BWVA 4ZO7A 3VZPA 3D7KA 2Q21A 4Q02A 1ORIA 2DMRA 3IJFX 2I8CA 4QXOA 4HZUB 1T8TA 1LUWA 2Y67A 1JLRA 3CC4V 2UYQA 4BQEA 4WKBA 1NPYA 4Q1CA 1NQ5A 1E0KA 2JCSA 3SYPA 4AS3A 3ZH2A 2A57A 3ZTWA 4DYDA 4QRIA 2JJ2G 4CH4A 5TEWA 4H16A 4DBLC 3FGNA 2V8BA 3K35A 1EUCA 3RRFA 3EZ2A 1WSBA 3ENQA 2OM6A 1LI4A 1ODLA 4LFBO 4EG8A 4RC9A 4OF4A 1P7PA 2QW1A 1Z6TA 4TMTA 2N74A 1IXKA 2BFAA 3TM5A 4BFZA 3EOBI 4AHCA 4WF9V 2PUSA 1CUAA 3UWOA 1ULSA 1QO0D 4IIJA 1SBIA 1NOKA 5JROA 4O4IA 4DV1B 1A2KC 2DXIA 1I2CA 1RQ2A 2P62A 3FKSA 3KKNA 3PXDA 3O8OA 4O1HA 3SHTA 1W36C 2AWOA 1DMSA 4ZT3A 3K1TA 4NU0A 2I1QA 2I6SA 3OO1A 3EQ6A 4Q4JA 2W4IA 2F1MA 2XJ4A 3CRVA 4JF3A 2YIBA 2P22C 4IZ6A 4BNMA 2EG5A 3H7AA 1NVAA 1IXSB 4QTTB 1Z33A 3MTGA 1Q12A 1RQLA 4C04A 2R6FA 3G17A 3L0PA 3QUQA 3CZMA 4I5EA 2QTHA 3HHEA 4DT1B 4PQGA 2V9ZA 4LWOA 4D9EA 1EK5A 3ZE0B 2QJ1A 1OMOA 3DZIA 3L93A 3A2FA 2VDJA 1YVUA 2EEPA 4WXMA 3FVRA 1AJQA 3FM9A 4JI8O 4KNWA 4Q3CA 3DDNA 1W4RA 3JTEA 3SFVA 3T7JA 5FLYA 3I9FA 3A2LA 4BKQA 1OWLA 1YB7A 3HEAA 2HP8A 3UAZA 1B8PA 3Q8KA 3C6BA 4X65O 1TIPA 3ZCPA 2A92A 1U1DA 1YI8A 3TQRA 1X7YB 3JV7A 3AL0C 1NTRA 5DNUA 1KOLA 3BFPA 1T9GR 3GJRA 1AHNA 1SELA 1V4BA 1U8ZA 5TNXA 2B4KA 4QJ3A 2D5LA 2Y1CA 4UFNA 3L8GA 4YT8A 3G0DA 4JTCB 4BQOA 5HMLA 1DZ3A 3ZVLA 2BEVB 1KSFX 1YSCA 1R1DA 4H44B 1W0CA 4H7DA 4ISCA 1TRHA 1HT3A 3IP5A 1H0RA 2UUCO 2IL1A 3M5WA 2AOTB 1GN8A 3DZKA 1Y3AA 2LGJA 3R74A 5BN3A 2YL2A 4FYVA 3K0BA 2HA0A 3GCWA 2W71A 5AVZA 3F5MA 1H1LB 4PA4A 3N2KB 4ZK6A 2HPHA 3RC8A 3G02A 4AN0A 1KEEA 1NSFA 5SYMA 4FOPA 2D1FA 3LA8A 1OXVA 4PRLA 1Z36A 4P92A 1YKFA 1JYFA 1F4NA 4P7FA 1PS8A 3OE5A 1RLJA 4E13A 1KC8W 2Q2WA 1XTTA 4QVKA 3EZGA 1GQYA 4N3AA 3TXSA 2C04A 3KYJB 4MCHA 4NZ9A 4WA8A 3SJCC 3RYTC 5CLFA 1L4MA 1TJNA 2ZVQX 3OURA 4TROA 4O8XA 1AG9A 4HDSA 1AE1A 2E21A 1NVUQ 2ENWA 3VDMA 3CVXA 1T2NA 4AQYO 2R72A 4YJFB 4KMMA 5HOQA 3SSOA 4CBCA 4JOSA 1T5IA 2XGOA 1XKXA 1PJZA 4PLGA 4U9HS 2QZ4A 3A4TA 1M6VA 4BZZA 4NBKA 4CQNA 1EX1A 2FR1A 3RYCB 5I01A 4D3SA 1DT5A 5ALHA 5ESWA 1CETA 1Y81A 4FXOA 4WINA 3N3BC 5GJCA 1R8JA 1G41A 4KHPO 3VMMA 3W1VA 1ZINA 5DI3B 3C3EA 2QG4A 2ZYUX 2EW1A 2QTLA 2ROQA 1LBTA 3KV1A 4H7JA 1OI2A 5EZYF 1X38A 1YWGO 4CF4A 5BOSA 2I8AA 3T9CA 4J80A 4MTGA 4MW0A 4XRRA 3EYAA 1T3HA 5JBIA 3EXIA 4BTLA 1GPBA 1X19A 5LPNA 2FSPA 2C0QA 1Z12A 3GRPA 1XQ8A 3D2CA 4ARCA 2GDSA 1AGRA 3ZRWB 2VT3A 4OQMA 1R8SA 1I94O 3ROFA 1FVOA 2R8PA 3EG5A 3T5AA 1BDBA 1JQEA 5SY4A 3KSUA 2C83A 3KHSA 4TMVA 1IIBA 2RBEA 2GCIA 3A6HA 3Q3HA 1DQYA 1DAFA 2GN2A 4OJMX 5A2QA 3EXG2 3VX8A 4IFBA 3QE9Y 3AONB 5TGDA 4RTSA 2IOQA 4KREA 3CKLA 3CB4A 3DP7A 5EXTA 2R2GA 2ZVJA 1EPUA 1S2IA 2HEPA 1G9XA 5DTJA 4EGAA 1QYCA 4Z4HA 2CN1A 1JCHA 1P9NA 2HU7A 1F4MA 5FL7A 3OT7A 4H4CA 3ZRSA 3HV2A 5CA1B 1C1YA 1E59A 3U44B 4D9KA 5LBQA 1NN0A 4ZEVA 2HG5C 3BE6A 1XD9A 3A1EA 4OVKA 3ZIAG 4ZAXA 3O9OA 1Z35A 3M4JA 5LOVF 2O7NA 1ULHA 2ZDIC 1QYVA 2UXDO 3TN7A 2C7QA 1CY6A 2JCYA 2AJBA 3T5PA 3ZWQA 2A9OA 2W8ZA 4Q3BA 1MQSA 3IUBA 5BR7A 3R3WA 3W3AH 2Q8QA 5DSTA 1HL7A 3E2EA 3O9ZA 3BFXA 3WLPA 1YB1A 3FCAA 5JC8A 1NQXA 4HAIA 4LOHA 3LNMB 4OX9Y 1KKLA 1KEZA 4Q4DA 2WAMA 4MR7A 2K7FA 2G72A 1XU7A 4DEVA 4RMHA 1E58A 1GPAA 1X1EA 1F51A 4TYMA 1EIWA 1RXUA 1U02A 1JEQB 4Z1MG 1N33B 2PGGA 3RSSA 1A9TA 5IFLA 3CYOA 1HLGA 4D46A 4ZI7B 2Q49A 4Y2TA 2C96A 5AI8A 4RTKA 5EQFA 1Q7EA 1GM9A 1K5SA 4MP8A 3JZAA 2HCFA 1HDOA 1EMDA 4IHJF 3W8RA 3AOEC 1PJBA 3C24A 1JSCA 5HUJA 1D9XA 1D8TA 3NS7A 4B9EA 1JIQA 2PUHA 4NH0A 4Y2PA 2C4UA 2CK3D 3HSSA 4MGIR 1U99A 2X15A 3QP9A 4PFQA 4Z0PA 5IDJA 4E33A 1JR3E 1P9WA 2C9CA 1Q82W 4JLNA 5E4FA 2NSLA 4PZZA 3VVBA 4KI0A 4J7JA 1Q6IA 2VH1A 3G2IA 3MRTA 4J7AA 2NTJA 1P62B 5IJ0A 1DCMA 5THQA 1G5QA 4P3PA 5LKRA 2EKLA 3HSKA 3PLRA 4MKXA 3BWMA 4HWKA 2CL0X 4MIEA 1SXHA 4RK1A 1N1MA 3OT1A 5F3DA 2X5NA 4PZEA 2AFIA 3ZOKA 2WA2A 1IN5A 1NRJB 3QUCA 4MW7A 2PMDA 4G4IA 4EYGA 2OKGA 1RM4A 1VFPA 1Q91A 1CRZA 2CXUA 1Y1RA 1NW4A 2LFSA 1QH9A 2RK4A 4JLSA 2FG5A 3FPLA 4BYMA 1MFPA 1LBIA 1KY4A 5LMCA 1W52X 3LVFO 1Y8RB 3H9GA 1VLJA 3AY6A 4XVHA 4PPNA 1QIDA 2WW8A 3WFIA 1RFGE 4HXFB 1W44A 4PNZA 4DDKA 3OIVA 5JAMA 4GOXA 4JZ2A 1DWPA 5B1AC 3E03A 2C9DA 1F60A 3B12A 1MGOA 3L71H 4V0OA 1LEHA 5REQB 3E3NA 3N53A 4RVCA 3HB3B 3TSZA 4BLTA 5JUWA 1A04A 1STOA 4R0VA 1C3VA 3L0DA 2EZPA 3EGIA 3ENKA 4I8DA 1QP4A 2VLIA 2M6RA 1YE8A 1CUGA 3JU3A 3BJEA 4YV1A 2QWXA 1S2LA 2J3LA 4UNPA 3JARB 4EI9A 2CC2A 5AM3A 1GUFA 3C90A 1V8OA 3U48A 1AR1B 4ZZ1A 4WKPA 2FVXA 3R9IA 4BVGA 2Y4UA 3GDFA 3UWDA 5ADVA 1PSDA 1XV5A 2P5TB 4DLXA 2FFJA 4BPBA 3C3WA 2G0TA 4UMEA 4NCAA 4U1RA 1PL4A 1PJ4A 2EKPA 1CB0A 3ZWWA 4Z5XA 3S5JA 1J23A 1ZGBA 3ZN0A 5GZ6A 3SJZA 1VDMA 2VYQA 1P31A 1CRWG 4PRZA 4I1OA 1P1HA 5B36A 3RCBA 4TMZA 3GVMA 2DJ5A 3K1AA 2O1EA 3OCQA 4K9PA 3RNLA 3UT5A 5FAXA 4WGGA 3OJEA 1C7ZA 1ZC3A 4LW8A 5KOYA 4IINA 4KIFA 4BMOB 3CC2V 3N70A 1NLYA 1P81A 2XCSB 3SHVA 3U0ZA 1A8HA 4LZLA 2JLWA 2JEZA 2NXWA 2Q5HA 5DTIA 3ROXA 2OENG 4FYXA 5DJ5A 3V33A 4ZYLA 1NP7A 4OTZA 3TFQA 1JQJC 1NR5A 4Q15A 5FNVF 4QVGA 4UNRA 1AS0A 3REQA 4CIWA 4YUYA 1XU9A 1T36B 2RGBA 2WQ6A 1C4KA 2VNJA 2VJYA 3LZDA 2E75B 2JH8A 4B3RB 4OOEA 2W6NA 2ISQA 4BNTA 4YECA 1SHJA 4OCZA 3BL6A 2GEDA 4KNYA 3HYCA 4CG3A 2ZIWB 4W6QA 1NZJA 4R1NA 2QYSA 3EGXB 4N40A 2COKA 2FUEA 1E7MA 1U0NA 3LFUA 3ZZ0A 1YZNA 3PITA 4EF6A 4XDZA 4CV1A 5K3OA 3WWCA 5HJ5A 3PGA1 2Q3LA 1Q44A 3LDCA 1CUBA 2OE2A 3OUFA 1TMKA 1U8CB 4KVZA 1KO7A 3IULA 1AN0A 3MTAA 4P3YA 1DI0A 1UXHA 2AD5A 2AMJA 3AUYA 2LKDA 2MTBA 5KNBA 4EKIA 4Z0NA 1LDEA 2ATXA 1CB7A 2C5LA 4AN4A 4DJDC 4EO9A 2C2WA 2XTZA 2JZCA 3PEWA 4JELA 1WCYA 2D0PB 5I8PA 2WLJA 1CUZA 4XLLA 1Z6AA 2QLFA 4DUYO 3NR7A 1BDHA 4YHHO 1K8QA 1Z8NA 1R0SA 4OOFA 4Q4LA 4AM8A 5IKXA 2JGUA 4URZR 2O96A 3IAYA 1F06A 3HY6A 1O2DA 4JN6B 4JJKA 2O2DA 1QDLB 2NR5A 3L1UA 1GUZA 3B53X 3BABA 2CWWA 4F6RB 1N6OA 1QRTA 1D5AA 3P9PA 2J3MA 2XSZD 1XDZA 4UHEA 5T67A 3RF6A 1IPHA 2IFTA 5BN1A 2HU2A 5DTRA 5AWFC 2RBGA 3DE3X 3NHBA 4U2GA 3AV3A 2F59A 2BZ0A 2X22A 2HXSA 2CTWA 3OIWA 3EVFA 4IAOA 3H17A 2RHTA 4HBNA 1D2HA 2P40A 3QH4A 5KSPA 5B6IA 4LOLA 4ITUA 1XLUA 3UCSC 4O6VA 3HXLA 3TI7A 2TMYA 1OXXK 4CVNA 3G8BA 1L5SA 2W6OA 1NL3A 2QJFA 4EZBA 1K34A 4L7VA 4ENQA 4PSUA 3UY4A 4RVFA 4EGCB 1UWLA 3QE4A 3NWEA 3R5XA 5LQKA 4IMJB 1HX7A 5EP4A 1G8YA 1Z5ZA 4CS3A 3FOEC 3RJZA 2DF8A 1GG8A 3SR3A 1R9GA 1UK6A 4PZCA 2PX2A 3T54A 4FLZA 2ZIGA 4DV4O 3LK7A 4I2VA 3NBKA 3SBXA 4BX9A 1CV2A 2PUDA 4GLJA 4PQFA 2AN9A 3I0ZA 4ARSA 4HDOB 5KWIA 4KX3A 3VU0A 3J81A 1OCZB 2GZRA 3I9KA 4O8ZA 2QJTA 3MOSA 3G0OA 2VDRB 3ETDA 4P93A 4B3TO 4KQCA 1S9HA 2OGUA 1D6MA 4KXMA 3JATA 3COWA 2IYAA 3F3SA 3MN1A 2ZRDA 1WHSB 2IUSA 3RD5A 3BCSA 1KZYC 3OHSX 1UDXA 3GNLA 1VHJA 5FOVA 4LF5B 2ZU6A 1ZD4A 3QJGA 5LZ9A 3MWFA 2OTLV 3A27A 4IY1A 3K4QA 3GQVA 3JR7A 2QTAA 4DNQA 1T1RA 1F7YA 2GHRA 4RCVA 2VXCA 1Q1EA 3D5EA 1NLZA 2GWRA 2NO0A 1TQDA 1S77D 4ZT5A 2OYQA 5DN9A 4UCQA 5HDBB 1Z5PA 3MJFA 3RVZA 2ZRNA 3DUFA 2NO1A 1P1CA 4I43B 1ZSVA 5E3JA 2SHKA 3VQXA 3MS4A 4G8BA 4H0CA 4AJKA 2PMFA 2OSBA 1R0BA 3AP2A 3APQA 3QF4B 1NN1A 5JAQA 4TV8B 2IYFA 5B1OA 4FFBB 4J3NA 4BRWA 1KMHB 3CX7A 1URPA 4OV6B 1H2WA 1VP9A 3PR2B 3KLBA 2JFXA 1SQFA 1U3DA 5FWYB 2FSVC 4FEGA 1P2FA 1U3TA 1VPEA 3ERCA 9MHTA 3QE0A 2BOBC 3G71V 5T5QA 1XNQO 4Z86A 2V0NA 3I73A 4TKUA 2FZ4A 4JT4A 3FCXA 4ZMBA 1MX3A 5ALKA 1NW6A 1NXOA 3QITA 1VQPV 1NMEA 2B7BA 3M81A 1PQWA 2V9CA 3MXOA 1UWZA 1XYYA 4LJ9A 4OMDA 4R41A 3Q6NA 1SBQA 4YREA 2BSXA 1K7SN 3HXQA 3FPKA 4NDNE 2V4MA 3M5PA 4L0CA