1THZA

Crystal structure of avian aicar transformylase in complex with a novel inhibitor identified by virtual ligand screening
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Crystal structure of avian aminoimidazole-4-carboxamide ribonucleotide transformylase in complex with a novel non-folate inhibitor identified by virtual ligand screening.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 217
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1thzA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1thzA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1thzA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1thzA02
1B93A 2X8WA 1M6VA 2B1IA 2XW6A 1WO8A 1CE8A 1PKXA 1C30A 1G8MA 1M9NA 2YVQA 2IU3A 1KEEA 2IU0A 1A9XA 1T36A 1EGHA 1S89A 4A1OA 1C3OA 1THZA 3ZZMA 5H3LA 1ZCZA 4EHIA 1JDBB 2B1GA 1OZ0A 1P4RA 1BXRA 1IK4A 1CS0A 1S8AA 1VMDA 1PL0A
chains in the Genus database with same CATH superfamily
2NMVA 3LCJA 4A10A 1ZA1A 1OQAA 5EP4A 4IMRA 3H6HA 2K9PA 1ULZA 4RFSB 2VCYA 1U4NA 5IUKC 4CUJA 5F51A 2F1IA 2VJKA 1HNZB 3IQFA 4ID3A 2Y9PB 4HNQA 4IUYA 5ENDA 4G0VA 1G63A 2FPIB 1VJDA 3SYLA 1BMFG 5EG5A 5EHIA 3QY9A 3D3JA 4HG2A 4JQZA 2QRUA 2OLKA 3VTAA 3WB9A 1QZTA 3CCUV 1G2QA 4QQNA 4ALJA 5JDIA 1QOZA 2C7VA 2OIGA 1PNOA 3SPCA 5ILQA 1NUTA 3I4LA 1U1CA 2DYRC 4ZVQA 1CDOA 4B33A 1IYZA 1C7RA 4QOEA 1PL8A 1OTXA 1SVNA 1KERA 3NXKA 2ZWIA 2ERCA 4A5SA 2A7QA 1Z6AA 2BEWA 4G4GA 2IYZA 3DYIA 4RJ2A 2BGTA 1KS2A 1V11B 3AYZB 3JWJA 5A03A 2O4UX 5JRZA 4MULA 4A0FA 5JAIA 2XNDG 1TLLA 1N33B 2P27A 3OFNA 4MYSA 4X8HA 2ZUTA 1LDBA 2C99A 4D4LA 2A9QA 1SUWA 1DVRA 3EXAA 1TCUA 1VPWA 3O82A 1NBOA 1XEFA 4OQDA 3QO7A 3N2ZB 1E9EA 3PN1A 2ZK7A 5FA6A 1EP1B 4HAOA 5JSYA 1Y8RB 3MMPA 3QMMA 3ZEIA 2ERXA 5HGJA 4FMCB 4ENWA 3AR3A 2VLIA 1EFHA 3ODGA 1XMSA 3OFND 2EZPA 1KGDA 3LZ6A 4IZ6A 3PNQA 5F1OA 3BEOA 3CV3A 1QQCA 3LYAA 1XQWA 3T3GA 2Q4RA 3TO5A 5I7VA 5FWXB 4BFSA 1QH8A 2AFVA 2VQFB 3TSOA 4HN4B 1AXGA 5DGDA 4BHTA 1K5DA 2DUWA 2D00A 4UZSA 1PJ3A 1PQYA 2ZR3A 4WFJA 5BQ3A 5EPEA 4L74A 2QF7A 2DN9A 3C74A 2IEBA 1FUKA 3RTCA 2PXHA 2ZRNA 2JZCA 5J5VA 1E7QA 4NOLA 1KUQA 3OJ6A 2RHDA 3OMIB 1JALA 3PVSA 5T6MA 5KNLA 4IP0A 1POXA 2PZLA 4MR7A 1TAHA 2BM1A 3QU2A 1H2WA 3I64A 3Q72A 4D44A 1Y8QA 2X5OA 1L8DA 1CXZA 3TQOA 3W5AA 3NKVA 3B85A 3UM9A 3H2HA 2NM0A 5H81A 3T0FA 3NBUA 3IIKA 1OPRA 1HTTA 2V0GA 3LRPA 4TVOA 4E11A 4DZTA 2Y0DA 1SF9A 1E1CB 1HE8B 2HRCA 2GPAA 5GAJA 2XITA 4K3UA 5HUJA 1VRVA 2E4VA 3ZN1A 2XVMA 4DK0A 1EVIA 1DBQA 3QBDA 1XJQA 4MIEA 1XVLA 2WWHA 4I6EA 3R7WB 1R5JA 1H3EA 3KTOA 2EDCA 1XAHA 2AI3A 4W5JA 4C2AA 5B30A 2H4ZA 4C88A 3USCS 1MX1A 3VKFA 3LDCA 2B37A 4XDGA 5JNTA 2FGKA 2GSDA 1F38A 1VLMA 2AHZA 4DWWA 4HL6A 1JSZA 2FVXA 1HK7A 3QIAA 4MW8A 3RW9A 3PJRA 1DV2A 2R8RA 1XCPA 3H9UA 1YQ9A 1CUCA 3GFVA 4CS2A 3K0EA 4JA2A 2G72A 1T0PA 2PKRA 5COBA 1CQIA 3QXXA 1T3GA 5ICCA 3CLRD 2G07A 5KNCA 4Y9RA 3VMMA 3CR3C 3HJCA 1YHQV 1WD5A 1FUYB 2CE4A 2BZGA 3AW8A 1FTYA 3FZYA 2IUUA 1Q82W 3ZJYA 3L7DA 1ZUNB 2J9RA 3M8KA 1HA3A 1Z7YA 1J8MF 4Q7KA 3ND7A 1E98A 3NDRA 4DC9A 1PZFA 4E0BA 4GP9A 1FNNA 2HWKA 2L82A 2D2EA 1LFDB 1K3UB 2F3TA 1ZMXA 4HTAA 1MVLA 1UBTS 3HUTA 3FPSA 2YICA 2HZ7A 1TZKA 1NI4B 4PSAA 3U7IA 1ESCA 3E4CA 2OCDA 2W6JG 2IYFA 1KH2A 2C4WA 3H5NA 4YX9A 3DYBA 3P27A 3ZV7A 2X6RA 3ZW7A 1CLEA 2QLBA 4B45A 5IDVA 1OI3A 2YVAA 1T43A 4FUTA 3SY8A 2A5LA 2WJJA 3COSA 3RSOA 5J2TB 3L74H 2C1EA 3QFFA 4CMIB 2JJ1G 2O06A 3QZUA 3AX6A 4MVZA 3I5YA 4MRNA 2GM4A 3WGTA 4YJHB 1JPUA 4GRDA 1THTA 2FPRA 4KR3A 2ZIFA 1OXVA 3VQXA 2DJ5A 3ILSA 4NH4A 3WV5A 2ORED 3INYA 4YTEA 5LMUO 3D4IA 3ZGVA 1YR1A 3ZN0A 3GFFA 2ADFA 1YDMA 2JFYA 3I01A 5AI4A 2B5WA 2BGJA 4W6ZA 3BWDD 3VQTA 1WVIA 1N36B 3EMKA 5TLSA 1N7GA 3WGHA 2X0JA 5TEWA 4XJTA 1EAMA 3KKZA 2D0DA 3WG9A 4RXTA 1CUUA 5GOTA 2VDVE 2VZ0A 4I5EA 2KBFA 5ER9A 3NEYA 1ZJYA 3ZJ4A 1XTKA 1RXYA 1E79D 2A14A 1OLOA 4NL4H 5EBWC 3QELA 5C4IA 3KZNA 2RAUA 3TQFA 1VPVA 1N9KA 3KTDA 3IAAA 1KYYA 3TCUA 1DQPA 4ITUA 1TVEA 2Q21A 2GMWA 1YTLA 5LMZA 2PTMA 2X13A 2H4HA 2BFCA 3UJPA 5EINA 5CH3A 4BVAA 4KIWA 2V7GA 1WWKA 1Z8NA 1M6VA 1FMCA 4G0PA 2WT8A 2FSHA 2D4HA 2JIPA 1P6XA 1SC9A 1U2SA 2X1VA 2RGGA 3HSKA 1KP9A 2FPLA 3P0RA 5BORA 4P0QB 4FLEA 1KY5A 3RS8A 3DXRA 2QTMA 1P5HA 4EFNA 4L51A 2PWPA 3CKKA 3QVSA 2I1WA 3SQXA 1SAYA 2O8VA 4G1BA 1OASA 4MKHA 1L4LA 3Q9NA 1LDMA 3ASVA 4NPAA 4GLLA 3IT2A 4OUDB 4LF6B 1S2DA 1PG0A 3BORA 3LMKA 2Z9BA 3W7VA 2R00C 3RB8A 1Z3IX 1V54C 3QJYA 2AHOA 1DBPA 4BNHA 4CQJA 2EATA 3U4DA 3TXSA 1KEEB 1ENOA 3UMMA 4ZRMA 1I1HA 4L9SA 3BMOA 3N58A 4FFVA 2UU9B 1RWPA 1Y1SA 3PFIA 4BQSA 3C3JA 2VSQA 4FFDA 1G0NA 3UNXA 1XMOO 1UKCA 2AYYA 2Z43A 1JKMA 4A03A 5E95A 4CQLA 4PD4F 1CUGA 1W73A 2PUBA 4ZCMA 1RWQA 3NIWA 3ZWXA 3MCZA 3QE3A 4RW0A 1KMIY 5EE5B 2E6UX 2Q1TA 1C5KA 4YONB 3E1UA 1F4VA 1VJGA 2H51A 5EXEA 2GBLA 4C0KA 5IYZB 1YTUA 4DV3B 1V26A 3X1WA 1G42A 1XZNA 4JX9A 3EXHB 3HZOA 1SMKA 1G18A 4Q3CA 2RKBA 3STYA 3A10A 2V6IA 3ZHXA 1Y0BA 3MHTA 4OCMA 3O2NA 5BV0A 3RWOA 1X1QA 1Y8CA 3I5DA 3SEAA 1SA0B 5KX5A 3UMRA 1Z5WA 3SQMA 1X6VA 4BP3A 2YC0A 1M2EA 1DIGA 2BCEA 2ZQYA 4G8DA 1LQTA 3KWLA 4CLDA 3C0KA 5KOHA 1VMDA 2DC1A 3F73A 4NZMA 4YAKA 3COVA 1PV2A 3NIGB 3QWFA 4Q00A 4AJ1A 3NV9A 2PL9A 1IZ7A 1XD2A 2IS2A 3FRHA 1M0SA 1IONA 4LBZA 2GXQA 5CLQA 5DNEA 3ZW9A 3Q6MA 4MCIA 2C7OA 2OYSA 3LT2A 4EK9A 3QLVA 2OHIA 3W5SA 5I01A 3RAPR 2GGSA 2GZDA 3AR2A 2GM9A 5FRDA 2D2FA 3J7AC 3EBLA 3QU7A 4OSOA 1QTQA 3CXUA 2ENUA 2JBHA 1T9AA 3DE7X 4Y2SA 1A8UA 3UQYS 2JKZA 3OGCC 3P0IA 1R0XA 4XUEA 3OGIB 2CNOA 2FCRA 2DTDA 2FU5C 3BM5A 5D3KA 4W63A 2OP0A 2ZRKA 4D7AA 3MCTA 4PQEA 2F00A 2E37A 2ZPUA 3A70A 2J09A 3ANYB 5JNSA 2RH8A 1QKIA 1FFTB 5JEEA 3ZWBA 3OQPA 4MNTA 2RC5A 1G5RA 3FPKA 1I7NA 4YDHB 4LVNA 5B3SB 2ZTHA 4BEJA 5LMNO 2CNNA 1Q90D 2FUEA 4UUAA 1OBFO 4W5NA 4WBNB 1RD4A 4RVHA 1GUBA 1AN0A 2B2CA 2KM1A 3T0GA 5HF5A 4YN3A 2CK3G 1WS6A 4PO8A 3X1YA 3C4JA 4E4TA 1TNDA 4Q03A 3SS7X 2XOKG 3KEMA 1Z17A 5HKBA 4MWSA 1Z4KA 2R8OA 2F1JA 3Q4GA 1ADGA 3ZXXA 2A78A 4L50A 4TT3D 2IYUA 1B43A 2ZIGA 4XM0A 4YUWA 3KBOA 1XMVA 5I8ZA 2Q1WA 1MOQA 4C4ZA 3EGOA 1GQQA 1QFYA 4B6RA 1KRWA 3RVOA 5M2QA 4KRXA 5DH9A 4R0NA 1C3JA 4Z3OA 1V35A 3DHVA 1C2TA 1FYEA 4OSEA 1RWKA 1GTRA 1PNLA 1UBLS 4DQUA 4Z4HA 2IH4A 2MYUA 4HVCA 3P2EA 3T1YB 4HS4A 3C3KA 3RC9A 3O2QB 2O6HA 2NLJC 2WSIA 2JGEA 1SUAA 1Q0RA 4E03A 4OLAA 2X4DA 3PNOA 2C3YA 1J49A 3K2IA 1CEXA 4BBJA 1WP8A 2Y1OA 3GAMA 2ZULA 3D4NA 1T3TA 1GYRA 1H4VB 3CN9A 4J8PA 1ABBA 2Y1GA 2Q8QA 5SYNA 1U0JA 3NIDB 4NYJR 3Q87B 5DHRA 1U04A 4WFGA 1AKRA 2G5TA 2YV3A 5AT1A 5C4MA 4DM4A 1HI9A 1VE6A 1B2RA 3DAYA 4A4DA 5IDYA 3I76A 3FOAA 4B34A 3PJGA 3I9LA 1YRWA 1DWPA 2W4LA 5LD2B 4FZ5A 1E0JA 4C2TA 4XD2A 5JSZB 1H2SB 2BFFA 4EFDA 2DKOA 3OUZA 1P1IA 4JVOA 2FMLA 2BE9A 3O8BA 5T8KA 2JIZD 3PD7A 1XF9A 5B3JA 1G20B 4MQ6A 3IVCA 1NXOA 3ASOC 2J3IA 1M1ZA 1PVVA 4IV5A 4UU1A 5LZ7A 3IC9A 3L82B 1UJNA 4O6VA 4HRQA 3ND8A 4J9ZB 2O5EA 3F5WC 1QYDA 3EEBA 4IDCA 4EATA 1JUDA 1DP4A 2GS9A 2C7GA 4JBHA 1BTOA 3MOIA 1BW9B 2IDZA 5BZBA 4F84A 3PXGA 3R20A 1A9RA 1G4YB 3N2GA 3IQXA 5LQJA 4MVJE 2ZYDA 2OCAA 3IPRA 4V03A 4B6OA 3FRJA 2EKBA 1RIFA 5WRFA 2LE0A 3D64A 3ZBPA 4KIGA 1IN4A 3OHPA 5PGMA 5JADA 1E62A 1I5RA 5CU7A 4KO3S 3LLMA 1OWOA 1COWA 3RZVA 4NCIA 3H1IH 3JQ9A 1DG3A 1OA0A 1IOZA 3PR1A 4KRYA 3Q9SA 4D8VA 3THYB 3O73A 4TRJA 3TAXA 5I5EA 2CL5A 1KTIA 1PT9A 3FM9A 3I34X 2JGDA 5DHPA 1KO8A 4QE9A 5F77A 4X1KB 1F2UA 2QJFA 2ZB2A 2FR8C 2AOWA 5FUQA 4ZIRA 4ANFA 1IN6A 3SIXA 3X0DA 4Q66C 1F2TB 4AY3A 2IHTA 1H3NA 3HYRA 4EDFA 3RS0A 3RAJA 1COWD 4R1UA 1JHVA 1V37A 1QV9A 1SKYB 3AF2A 3NWOA 1V7QA 5FTLA 1QF7A 3ZH9B 4UHEA 5KYKA 4YUZA 3IO3A 4Y0NA 2VAMA 1BE6A 4KO8A 1JJOA 1IM8A 3PUVA 1NJ2A 3QTCA 1Q5PA 5LQCA 2HREA 4IVQA 1NU1H 5JZBA 1ZJJA 4D9HA 2ZROA 4X44A 2MMGA 4DMHA 2PEYA 2CTPA 2F23A 4L9AA 3K8QA 1KBOA 1TZBA 4Y2QA 1Z28A 2ZBEA 4PFQA 1NJSA 4KE7A 2AH5A 5IHXA 2H94A 3CH6A 2YMMA 4MS1B 1CKEA 2CHFA 4YAFA 7REQA 4K05A 1YBAA 4EFMA 1M2OA 1TO2E 1ZH0A 3KV3O 521PA 1DX9A 1XRLA 2NPOA 3BS4A 3JYCA 4YXWA 2VSYA 1KU6A 3ZDXB 1FTSA 2YDXA 1KRXA 3GCDA 2X8WA 1FP2A 1UJ5A 3S3WA 4E12A 1XNJA 1W9MA 4ZI3A 2CEAA 1IMJA 1YVEI 4FU0A 4W5QA 3BMCA 3K0FA 1YDFA 2HJGA 1P1RA 4BTLA 2ETXA 2ZJAA 1ACJA 1E9SA 2ZJZA 1I3CA 4LBEC 1CBUA 5DI9A 1AQ6A 1Z29A 1XQXA 1SGWA 2IEAA 3OEEA 5H1YA 4YLYA 1QH1B 3KZOA 5CVUA 1H2YA 3HK2A 4Q4HB 2VBIA 4D9NA 1A95A 5EN4A 4DNQA 3ONFA 1G6OA 4AKIA 3GVIA 1QGED 4OWPA 2PZAA 3CONA 1II8B 3BE6A 4RO0A 2PV7A 5A2QA 1Z74A 2A33A 4C87A 4W8GA 3IPXA 2HG5C 4HLUC 1GQOA 1VQPV 1N5KA 2IS6A 4AFNA 1N5DA 2NO1A 3D5TA 1ZHOA 2FWAA 3QKTA 1BFDA 3PQ5A 5KHOC 2V3CC 4YA6A 1GN6A 4BC0A 3DFUA 3DEYX 3QKUA 1O4WA 4Z4IA 3VH4A 3VISA 2NZVG 2CAZC 1MENA 4H0CA 3MIZA 1E77A 4F3WA 5I48A 4JYYA 2AX4A 3I0ZA 4GMFA 1IULA 1L5GB 2XKAA 4QLBA 3T61A 1B15A 1GNLA 4CT0A 3M1YA 5ECGC 3TK1A 3FB5C 3SLGA 3LX8A 5C3UA 5CTAA 4QBHA 4EA6A 5JJJB 3T5MA 1VMEA 2VBGA 4BAUA 2JD2A 3F7YC 3ZK7A 2QRLA 4F11A 5EJFA 1EFLA 3C8DA 1M8KA 1MAVA 1GYQA 3GGGA 4ZO7A 4GCZA 4AWBA 3NPMA 3OEHA 3VJRA 3BFVA 2BY4A 5H16A 1XEWX 5FOXA 3WGYA 2NYTA 4OB8A 4KN9S 4PYOA 5LKRA 4ZCLA 1NHGA 5F9FA 3LPDA 3PQ7A 4K40A 4D3DA 1B8UA 3PK0A 5ALNA 3LPCA 2VPTA 1KY3A 4R2MA 1C0LA 2ZWVA 4DSNA 2DERA 2OXEA 4U7FA 1Z25A 2P4SA 4MV4A 1MOFA 4FYXA 2V03A 2MOKA 5CD1A 3JATA 1E3JA 2Z6VA 4DIKA 4ZFTA 3G67A 2HB6A 3TDMA 2GFHA 2HTFA 3C3PA 5A0FA 3GZTB 5LXTA 4MINA 4HGQA 5LQKA 2CMFA 3WMWA 4HB3A 2VHUA 1F2DA 1HKUA 3RBXA 2GAIA 3HB4X 5IM4A 1U6IA 4EW2A 1AQUA 3JX9A 1QHFA 2JLVA 1X3SA 4O4HB 4M8LA 3F97A 3TQQA 3DZKA 1E1MA 4TYWA 4NYMR 1GNTA 1U0OC 2B35A 2C00A 3HCRA 5F3WB 1OF1A 3T1NA 3B3JA 4QDXA 3H5IA 2P79A 3AV3A 3QO5A 4ZAXA 2G5GX 4D9BA 1EX1A 2AQ8A 2ONJA 1GGJA 2C96A 2ZBVA 2VWQA 1NTRA 2HH9A 4HZUA 1VCHA 2FTKE 5CPBA 2UUCO 5HFAA 4WFFA 3AZPA 3JYHA 3VR5D 2REOA 2LGWA 4JTAB 3A14A 5BW4A 3KEQA 3L6EA 4S1VA 1I4DD 3KL2A 3OOSA 4CJXA 2FEAA 4FOTA 4MPTA 4NZPA 2GLTA 1WWRA 4F6EA 2LD4A 4ZK2A 1MV8A 2WM2A 2ODMA 4DLUA 3CC7V 1FC0A 3S28A 1ZNZA 4ZXFA 2B4TO 3ELUA 3I73A 1X13A 1NN3A 2Z1MA 5ALTA 1NQOA 2FZGA 4X20A 4PYNA 3ABLB 2FETA 4ADSG 2V8OA 3HN6A 3GXBA 3RBVA 1QOPB 3VSDA 3TW8A 1V7ZA 4AJ4A 3L7IA 1H2RS 1NGSA 2QR4A 2BKLA 1LX6A 4B4KA 3W1WA 5JT1A 4BBZA 6Q21A 3GLHE 2WLJA 2TMDA 1S7GA 3NJ8A 2YFHA 3K9HA 3COYA 3FGOA 5I8WA 4F1JA 1Y89A 5H3CA 1V3QE 1W4ZA 1WQ1R 3DD5A 2XZDA 1UAQA 1VJTA 1L7XA 2Y4TA 5EFOA 1XRJA 4REQB 3W8RA 2GEDA 4HPJB 3GD7A 3IOMA 4M0UA 3V1MA 3AT1A 3E05A 1UX1A 3NKLA 1GEGA 1AZSC 4BV3A 1NA5A 5CA3A 1X15A 5E0OA 1IDOA 3FNEA 4B4DA 1SESA 5CA0F 4B3DA 3B1VA 3IR7A 3NEJA 2Q2QA 3GL9A 2YVUA 5KYUA 1CYEA 1QR9A 1DCFA 4KTVE 1PVOA 2C2GA 2P9JA 1Y5NA 3QSYA 2ZBGA 3E2IA 4U9HS 5KS2A 4TL6A 1YJXA 2CJXA 3WMGA 2W7TA 4KGDA 5HKAA 2P4HX 3GPCA 1PFKA 4FHEA 1DFHA 3LG2A 4R1OA 3GFBA 5LC1A 3SYKA 2QI9F 3REFA 4D0LB 5EZYB 1A2QA 1ONNA 3W5BA 3NP7A 1QCZA 3R3ZA 4RWZA 3SZRA 1W48A 1AVTA 1JIQA 3FWHA 3UJ6A 1N78A 4F4LA 3L7NA 1UBRS 3HCFA 4U6QA 1H8EG 3E5HA 4D25A 2QENA 1CVLA 4RJJA 1H4SA 4X95A 2XHZA 1AGYA 2NXWA 4LF4B 4B43A 4DA9A 1G64A 4YJGB 1UL1X 1OAKA 4XVCA 2XY4A 3QEMB 4FZRA 4KWIA 4R1NA 2AD1A 3B9BA 1WIWA 3CN7A 4URWR 4W8HA 3RVDA 4FKBA 2FPXA 4JYAB 5IY5B 4MB0A 3OA2A 4AZWA 5I7HA 1DQSA 4EARA 2H1OA 1VQ4V 3OUSA 2HLHA 3RRMA 3U44B 4BE9A 3JQ7B 1Y33E 5DLYA 1A8HA 1JAHA 4D92A 1DUVG 1PZXA 2C3UA 4WTOA 1NUSA 4IY1A 4BZZA 2W6ID 3H86A 3MT7A 1RHQA 4WECA 4Y6OA 3MUEA 2C0CA 5ITZA 4DO2A 1TT5A 2WPDG 5E4FA 2WINI 1Z83A 2IXGA 3FHTA 4QPNA 4Z4GA 3UPUA 4MQLA 4QYMA 4D8XA 2QUBA 2R8EA 5DF1A 3ABZA 4YJ3B 2FWRA 1T1EA 3ZPCA 6AT1A 4E1BA 1TQ2A 1B1CA 1SVOA 3IFSA 3LSTA 5JZVA 2YV4A 3OTGA 4KVGA 3KLPX 2JHGA 1ZH4A 1VQ7V 3MT0A 4G65A 4PBSA 3TGWA 2J3EA 4F2HA 2WW8A 3OOWA 4DRZA 3K15A 3RRNA 1PJAA 3Q0TA 2WJ3A 2J3KA 2VNSA 2V7XA 2IJJA 1BE0A 5DZSA 2GVZC 5AM5A 2JAHA 3OKAA 2Q1UA 4PC7A 3UPDA 3UJAA 5JAUA 1DOZA 4EFEA 4E70A 3JYLA 2XNKA 4KLCA 1VHLA 2RI0A 3AERB 3PNKA 3DE0X 5FOWA 3AP3A 2NAFA 1P84F 4DA6A 2R1VA 1EM8B 3N28A 4BNXA 1FOEB 4DR1O 4D0GA 2VPWA 3M33A 3GGOA 4L0DA 4EPTA 4I9WA 2IC5A 1ZX1A 1X70A 1CQXA 4DBLC 4KQJA 1XTRA 2CHGA 1L5KA 1P77A 1T6XA 2OVFA 4DLVA 2WM9B 4LSMA 5ALRA 3GLKA 2ZSKA 1YC5A 3RQIA 4G37A 5KC8A 4FW9A 2H6EA 3MUOA 5AHXA 4HT3B 1X77A 3FWYA 2G1PA 1NG9A 4ASUD 2C31A 4K9RA 5KNBA 2X6QA 4F7OA 3JARB 2JVJA 5ISMA 3GEBA 1I36A 4KITB 2VH5R 3LQKA 3D59A 3D5EA 4MRSA 2DUNA 4PIMA 3ML1A 2FP4B 2FZWA 2L42A 3PR3A 4QYXA 5KTSA 5L3FA 3QVWA 5CBFA 2R7NA 2W8ZA 1ODSA 4CV1A 4KPUA 5DSZA 1GILA 5CH5A 4QGPA 5CBHA 3B52X 4IQFA 3ENQA 3HA5A 2AUTA 4ON9A 4I3FA 4X88A 3SHWA 5BWLA 3QUAA 3F7OA 5KREA 4Z4EA 3F74A 3PEUA 3COPA 4LZOA 3W5HA 3JALB 1N5IA 2VPXA 4K6OA 4ZQFA 3DVSX 2I4LA 2KQXA 1DAPA 4JI6O 2BDUA 3M9WA 2F7SA 5D1NA 4RTOA 5DCLA 1IRIA 2CB0A 2ZGVA 3WVNA 4QIHA 4JI3O 1USUA 3U9SA 4HJXA 3BN3A 2XVXA 1JILA 1JLLA 4B7KA 4PFJA 1YK0A 4AC9A 4RKRA 3QPDA 3R44A 2ODTX 3HU2A 2VK2A 2WAXA 3KHSA 4RAQA 2P9TA 4XYBA 3TAUA 3ZBHA 4CLRA 3K5WA 3IFXA 2ZCJA 2ZVQX 1PTJA 4UM9D 3HUDA 4N03A 1AQJA 2B0JA 2ECKA 1JSLA 1JEYA 1WBDA 3EQZA 5LUAA 2BDEA 3I04A 1FP4B 5DHSA 2V98A 1XMPA 3WL8A 2XECA 2Y1FA 3BRWD 3M1LA 1UFVA 3TEMA 2WZQA 3LQYA 4EHFA 5JECA 4TQAA 1C7FA 3HLTA 5CYOA 4JXJA 1ZJ5A 3P5BA 5CAEB 2VBCA 1J8QA 1TEVA 3IAFA 3P2YA 4ZOLB 3VYTB 1IWPB 4ZEMA 3T5AA 2O2CA 4RTSA 1QP4A 3QBJA 3SMQA 4ZTZB 4NMLA 4O2RA 4PG6A 4BKMA 5D6NA 1AQNA 4NR1A 2I2WA 2DHEA 3ZDAA 3DAGA 3RCBA 2Q6KA 2OZLB 3CLTC 4INOA 3HKDB 4K0KO 2H5EA 3OOEA 1Q7GA 1M73E 2EZ9A 1U65A 4ZI7A 1Z8FA 3E27A 4BQFA 3L2OB 4G56A 2ISCA 1JEQB 2EFJA 3IQGX 1H6DA 1C0KA 5D3ZA 1AC5A 5BW8A 3C15C 2QR5A 4O2AB 2AXEA 3WYCA 4WA7A 3NW9A 4GOKA 3K0CC 2Q0XA 5BWOA 1MQAA 3S99A 5J43A 2ZUWA 1ZIXA 2PANA 2Q5HA 1O97C 3EZNA 2OYRA 4QQFA 1PVDA 3P9KA 3QW4B 2NVBA 1XPOA 2WA3A 1IUPA 3E53A 2LJ2A 1ZMBA 1JDZA 2UVQA 4QYSA 1IZ0A 1F8UA 3CB2A 5C0OE 3FTQA 5KYGA 4L4SA 3MTBA 3LBHA 4JI2O 2VF2A 4XYEA 2VT2A 1T8PA 4OJNA 4PI2A 3L72H 3C7CB 1OMOA 2CE2X 2ZG6A 3IHKA 1N33O 2W6MA 1RPRA 1SKBA 1ZNWA 5LQUA 4IYJA 4DJAA 2AZ0A 2I7CA 5A6VA 2GDSA 3C85A 4BCBA 2I1VB 2VNJA 1T9ZA 1UJWB 4LMRA 4D9MA 3RU9A 4XVQA 1WX1A 5M34A 3AL0C 2XRYA 1EFCA 3WICA 4DXWA 3SPXA 5LZ9A 1RE0A 2I8AA 3PC8C 3MTQA 2HQBA 2FPGA 4PLCA 4AZTA 3AG4B 1C9NA 4XCQA 3X1DA 2DHCA 3H1FA 4BNMA 3OZRA 4AY2A 2A9KA 2Q5ZA 5IZCA 3RN4A 1EFPB 1U5BB 5JQGF 1NVTA 4TN1A 3MS7A 2BH2A 4G84A 1E1RG 4DKXA 2BBTA 2VQFO 1XEQA 3INRA 3KJQA 4GC5A 3E7DA 4BQRA 3DMRA 2NUPB 4O4HF 1M33A 1SR8A 5CB8A 2DECA 1GGKA 1IY0A 4OMCA 1W85A 1J25A 1NP6A 5BYJA 3CZ5A 1R6AA 4D8TA 4C04A 4LJSA 2ZSHA 3KC2A 1RXCA 3L9XA 4QUDA 1KIAA 4IHJB 4RQTA 3IAXA 3UO8B 4BIMA 4FJ0A 5DB4A 1PDOA 2WTBA 1VSUA 4V0ME 5BP7A 2PUGA 1K7DA 2XBLA 1TF7A 3EH2A 3U16A 2IH2A 4UE6A 2P1ZA 4FT4A 4UCUA 1TYDE 1Y1RA 2D2CB 3FYUC 4F5YA 1KMHA 4HN9A 2JJ8A 3ORYA 2J1LA 3KXKA 4OA5A 4G01B 3IQIX 4DPMA 4TKVA 5IT5A 3F71A 5C1IA 1K7SN 2J85A 4W99A 1B0AA 1WMFA 5CLFA 5EJIA 3OOJA 4RK4A 3SZUA 4L6CA 2DSTA 2FSGA 4B3MB 2FPOA 1G98A 4HN2A 1E1DA 1C4KA 2HF8A 1EP9A 1IHDA 2BJVA 1V3VA 4YRMA 4H16A 3HKCB 4FFBB 5B37A 5GPBA 2QU7A 2GN0A 3C3MA 1SZXA 3ZVRA 1EUCA 4YRAA 2G17A 2A8NA 3TLYA 3H2GA 4AZSA 3BGSA 1LTKA 3TMAA 2GAAA 1KZ7B 1XELA 1PGPA 3JQEA 1J8FA 1SQSA 4NZNA 5K0CA 1NV8A 1U81A 3AIKA 5L3ZA 1H2FA 1L5NA 1J90A 3FAVA 1I2MA 1XAJA 2AOUA 3RLIA 3KETA 1Q7YW 1MH9A 4YT2A 5EMKA 4HQFA 4DM7A 3TI7A 3OZTA 1YSCA 2VHZA 3WGUA 3C1OA 4LZZA 1D8AA 3HKBB 4YGXB 4H31A 2HJVA 1Z15A 5HK9A 4Q9HA 1N25A 2P4EA 4K2AA 4LHVA 4MRMB 3O3NB 4U7PB 1L4MA 4ALIA 2YFQA 4BL5A 3IXLA 3EIFA 1E0SA 2VP6A 2EW1A 2OCYC 3K59A 5JWRA 4IVNA 5DHUA 4R9SA 2CD9A 1BFKA 2QRGA 3L01A 2W4QA 1BX1A 2PO7A 5G0WA 3M49A 1H2GA 1OC2A 2ECOA 1AP5A 4ZVRA 1UPGA 1E6MA 2XD4A 3TTYA 3PQ3A 3D81A 4FZ0A 3A05A 3ZD6A 2WD7B 1PG5A 2C4NA 1S3GA 3V8RA 3DDZX 4UV9A 2DYSC 2OK8A 3U7EB 3RADC 2C2OA 4C43A 1Z2GA 2QT9A 5ALPA 5JSFA 1T3LA 2YRWA 1D2RA 1ZRSA 5BUZA 3B1JA 1M67A 1MEJA 1Z47A 4R6WA 2F3SA 1O94C 3R3XA 1RI3A 4N0MA 2YY6A 1NWHA 5JJIA 3BWXA 4WDQA 5HJ5A 1AT1A 2N9UA 2DFNA 1G17A 2QLFA 1E2FA 1XTTA 2XQJA 3EZGA 2CMDA 3D4OA 2GA8A 4G25A 3MCVA 4UOEA 1T9GR 2J48A 3CRQA 4RKEA 2RJOA 4ONEA 2WHPB 3EUFA 1FFBA 2QA5A 2WSBA 1TZCA 1ACMA 2JS5A 3WGNA 4N5MA 4QVIA 3IUPA 4D98A 1UIMA 4ZT4A 4M1KA 4JL5A 4YECA 5IU6A 1VL6A 2PZBA 4S05A 3RFUA 2RGDA 3H1LH 4JA0A 4PA3A 4L9WA 3ZDQA 1RPJA 2KLBA 4Q19A 5DX1A 1BFUA 3PPVA 1VQ8V 4QWWA 1MZFA 1Y48E 5L3BA 3PI6A 3PV0A 3PLAE 4PZPA 4QPDA 1J07A 1LRLA 1HFKA 3G5TA 3K9WA 3DT6A 1H5QA 4JV5B 2O9JA 2M6RA 3WSWA 4YDQA 1ORHA 1EA7A 1AK1A 4YCBA 2X23A 1T2CA 1GPBA 3IDZA 2F62A 1E6CA 5AOAA 4TS4A 1NAHA 4KVAA 4AN4A 4OY3A 5EWLB 1IXKA 4GZ5A 4NBTA 3PR2B 4K5QA 4R2LA 3W2FA 3APOA 3NYQA 2H4JA 3L7AA 3B38A 1G8JA 5EA2A 5ER6A 1I2CA 1U0BB 4MW0A 3L05A 3V34A 4EKYA 5HQJA 3P9ZA 2DWPA 1QZUA 4YLGA 4TV8A 2HQSA 3PHBE 5JATA 1YR3A 1YJAA 2V6JA 3TNDA 2ZYAA 1BEUB 2CVZA 3GLTA 4RQUA 3UXEA 2EFGA 3QU4A 2V7PA 3FVTA 2VDUE 2SICE 3MD0A 1XRRA 1QK4A 4J16C 3SYTA 2XCOA 4ZDKA 4OCLB 4LF6O 1LJLA 2DR0A 2J0UB 3WISA 1EZVH 3N2KB 1W0JD 2WYIA 4M0KA 1T4BA 2JIMA 4MQEB 1PYOA 2D1QA 1YI2V 4M87A 4O4JA 3T35A 2V9CA 1VQOV 1KJWA 1OXMA 1I1QB 3TL2A 3WNQA 3O3CA 1IXSB 4EGAA 2O0KA 2EZ4A 3AUXA 3Q41A 3T15A 1NVEA 2NUTA 3G68A 4CR7A 2UU9O 3VPAA 3OBIA 3WYBA 3TQSA 5FX2A 2ZVDA 1XJCA 3RVBA 4R6ZA 5ICFA 4D8YA 4EY3A 3TR0A 3SEFA 5CB0A 3ET4A 2Z5LA 3CA8A 2JI7A 1ZAKA 3W6UA 2XUDA 3JQAB 2DPLA 2GPBA 2YH2A 1GP2A 3G2MA 2I8LA 2PMCA 5KB3A 2KI5A 1RWNA 1V6SA 5FFFA 2NW6A 4FC7A 4L95C 5ICGA 1W35A 4PPNA 2CDAA 1T9DA 3BG5A 4EKIA 5C46F 4DT1B 3BTOA 3I1IA 3CF2A 3DUFA 4G2NA 2QL5A 4B74A 2G4VA 1VKOA 2OE2A 3O4IA 2PKYX 5K4AA 3QYPA 1PWYE 1L5QA 2PT9A 4ZKIA 3F6EX 2QRPA 3DEFA 1E79A 5I51A 3SX2A 4PG5A 4O29A 3BIFA 4KGVA 3AILA 2W0FC 1N2GA 1PBTA 3P94A 1E8DA 2WHYA 2RCYA 2HW8A 5CD9A 1KDZA 1HDJA 4QOIA 4MO2A 4TUYF 5F1KA 3J7TA 2GQ0A 3DEHA 3ASYA 3C39A 1ZUWA 3D6FA 4INAA 2IEZA 2X5KO 1PNTA 3VR1A 1A2OA 1P1HA 2HSDA 4IEFB 2O7VA 3HTXA 4I36A 2WLSA 1EJBA 2XWBF 2O8BA 4CMAA 4G1UC 2ZTUA 3VMFA 3AR5A 1Y3IA 1LVGA 4EY8A 5CFZA 3PHIA 3V2GA 4L2IB 2HQOA 2QKSA 4IS2A 5AVJA 1JEDA 1NXWA 1SRQA 4JAVC 1MABG 1YQXA 1TZJA 5U4XA 3CNEA 4MDEA 5C7IO 3O84A 1DJNA 4N76A 2PR7A 3P0FA 3HVUA 5F3DA 1I4TD 4X60A 2AHRA 3GUHA 4QBIA 1N2BA 2B4KA 1D2NA 3FOCA 5BSKA 2ZBRA 4RJKA 4J2OA 1ZCBA 3AEQA 3ASUA 1Y74B 4IJVA 4P4SB 2AW3A 4X54A 4AI8A 1QGAA 2B30A 3RSSA 4A6XA 1LFAA 1SXJE 2UZ1A 5JVDB 5A04A 4LOHA 4KOEC 3KS9A 1U2EA 3RBZA 3N75A 3S68A 3WAJA 3JSLA 1KJJA 3L8DA 4XPZA 1PJZA 5C32A 4LF7B 4RF3A 5FNVB 3Q10A 4Q20A 1RKBA 4OB7A 2YL2A 4FILA 2J33A 4IOMA 4R16A 1SH7A 2NQ8A 2Q3BA 2VF4X 1U8ZA 1CZHA 4R0MA 4M98A 4YJDA 3ES9A 4EJSC 1CJBA 2ZYIA 5DWVA 2X8BA 3NHAA 4RPHA 1W36B 2R1UA 3RVNA 3I52A 1FXVA 3REGA 3T38A 1O9BA 4F5WA 4EELA 5LZ8A 2AFHB 3DTTA 4WLVA 5K0JA 3KFXA 3B09A 1YC2A 5REQA 5L6LB 4DEXA 4MCAA 3EXFA 1IHYA 3SGLA 3MBOA 1T34A 5DLDA 2PZFA 1UFKA 5IC5A 3VPSA 5SYAA 1VOTA 1E60A 1MZEA 3L06A 2O8FB 3T3PB 3R7FA 3HVRA 2OC9A 2XMDA 3UUWA 3JZFA 5ELXA 1NFFA 5KJEA 4CF5A 2XTJA 4Q7JB 4KJXA 1FUUA 2HQRA 3I28A 1YKSA 4NU6A 4AJEA 4CFZA 3HXKA 4JASA 1PNRA 4ILKA 5FHRA 5IBQA 3TSCA 1Q21A 1P2UA 1YSBA 4EG4A 4ESOA 1OYYA 2GB4A 1GUZA 4HGNA 1V55C 2O96A 2G25A 2DJVA 2WD9A 3FX7A 3MBIA 3PHJA 1VBMA 5IKOA 2ZUSA 2RAFA 4JEMA 4U2GA 1U7WA 2QXTA 3BSFA 3HJBA 3X1JA 4E4EA 2UYOA 2DKNA 4HVLA 1P3DA 1WD7A 4DMKA 1ZTEA 2C61A 3L6CA 4TXHA 3WB1A 4BO4A 1ESMA 1ND6A 2FPMA 2QG9A 3T8YA 4RMNA 3H3JA 1D2DA 2R6CA 4GQAA 4ZQEA 1N0VC 1UAYA 3H87A 3AEUA 1THZA 2DOSA 1WJGA 4OQNA 3S3TA 4L8YA 1BDIA 4PIPA 3B9PA 1NS1A 4CMKA 3D4BA 4E2LA 3RIHA 1Y5LA 5JXIA 2K1EA 1Q15A 1RC8A 1OVMA 4GX1A 4G07A 4DQ0A 2ZZNA 5HPYB 3VQYA 1K7YA 3QXCA 4Z8XA 4ALNA 1E92A 4RVDA 1KKMA 3U1VA 2D6FA 3DOCA 5KTYA 3AUUA 1OCCC 4RZSA 1RVV1 5CBGA 1R9NA 3F0TA 3EEOA 1U0GA 4BN0A 2X2EA 1RDFA 4QOFA 5MHTA 2JW5A 1I0LA 4GKBA 4YYZA 1Q44A 4U3FH 3E9CA 2Q27A 4FEGA 3HJFA 4GLXA 1LR1A 3TTTA 1CDDA 3CLSC 1VL2A 4TT3A 2B34A 1XRNA 3BQ9A 2AW5A 3BJMA 4KDEA 4JGIA 4BGDA 1HP8A 1ZUIA 4UTRA 4CN9A 3DP9A 5IG2A 1OBOA 3Q1KA 1D1TA 4JLOA 4BUJA 4FGWA 2VYCA 5IZ4A 7ABPA 1SQFA 4K1LA 3TR5A 4A9AA 5AM1A 1BVYF 3ZE9A 1N9GB 3MWEA 3LQ2A 5DISB 1GN3A 2YR0A 3UJHA 4PZ9A 3DMYA 4EI8A 1GA1A 3WLTA 3CUYA 4O5OA 2EARA 2GBGA 4RAOA 1ISJA 3QOYA 2XTMA 4BFCA 4TUYA 5AKXA 4OX9O 3AHDA 5FI3A 3M6XA 4JJEA 2XXAA 3JY6A 2PE5A 1T5SA 4FJCC 1H69A 2HVWA 4G4SP 1DXYA 2YASA 4F38A 3WBBA 3D6NB 3JTEA 4P3XA 1ZK0A 4ER7A 1NKDA 1IZZA 1XLWA 5KTRA 4V2UA 4DLBA 4ARVA 2ZM6B 3RTDA 4D4IA 2NT3A 4OI0A 1RYMA 2H4XA 4POOA 3OEWA 3ORFA 4Q01A 4IDDA 4MV5A 4BP8A 1ECBA 2P40A 2WVGA 4QPZA 4J3NA 4CU5A 2CJYA 2OV8A 4TL9A 4ZT2A 1JWLA 3R65A 5LFAA 2G80A 4MR9B 3ZCXA 2EV9A 1MIHA 4UVCA 3TTVA 3LP6A 3K0AA 4CKEA 4DIOA 2C2HA 1KYIA 1TX4B 3AU8A 4MRRA 3U48A 1D4FA 2JIZA 5K4HA 3LLCA 2PMKA 4AUEA 1RXUA 4J3FA 1QHEA 5AKZA 4EJ0A 4B83A 2WF8A 4YRBA 4C2UA 2N74A 3DZBA 5A9GA 4ZJYA 1MSDA 1H2EA 1R12A 2QRJA 2FMKA 1SBTA 3JAWA 1DGQA 3RIXA 2CZGA 3PTLA 1CETA 5EJMA 3WOHA 1LDYA 4LC9A 2JCGA 1Q3TA 1HE4A 4YXFA 4CG1A 3BFPA 2O2ZA 3K09C 4HUJA 3U4IA 3HO6A 2GETA 4I9FA 1NJ1A 1YFLA 4QUAA 3KTAA 1ORWA 4N47A 2OK7A 4D6PA 5EZQA 3FW1A 1P4AA 2I33A 4FMCF 5LQAA 4GR9A 2BMWA 5EJ2A 1IPHA 1UDXA 2O2JA 4QU8A 2IOQA 3FMGA 4XX1A 1AK9A 5K7SA 4EG7A 4IGFA 5ALMA 1W88A 1VSTA 1L5SA 2V58A 4MWDA 3WIBA 4MQFB 4JOCA 4LJ6A 2X7HA 5C7YA 1OE0A 3ZDFA 3OX1A 1QWOA 4P36A 5CGQB 2QN9A 1L5LA 1GL3A 2NGRA 4PTZA 2Z8YA 1KPIA 1PZEA 2OT5A 2RHHA 4NONA 2VOEA 3FGZA 4LF5O 1P80A 4V0QA 1KFCB 3FOBA 2WYWA 4KUEA 2IXFA 4JVSB 4F5ZA 4XDYA 2OFXA 1U0TA 5FPQA 3QVKA 4K3AA 3HO1A 4IG4A 1FF9A 5KPJA 3V2UA 4E09A 1ZBDA 4N8EA 5AW8A 3H11A 3OQBA 2QP9X 4JT4A 4A8JA 3B8MA 4GZLA 1K34A 4FQ8A 3PQEA 4EGFA 5HZHA 3IE2A 2YOFA 1JR2A 1DAKA 1W7AA 3A9RA 5E1OA 1XMQB 1MTOA 3PYMA 5CCBA 3HE3A 4PFKA 4PN7A 1R6BX 2HJ9A 4EHKA 3PDCA 3FB8C 2LCQA 4ENVA 5BRAA 3BHPA 3EYAA 5T41A 4GMHA 2GYUA 3T0IA 2QQFA 1E2MA 2EX3A 3ZE0B 5DCWA 3SX4A 221PA 1ZOOA 4L8FA 4GRIA 1K8RA 4DL9A 3ZZ1A 4DV2O 3CZ9A 1K7EB 2GTAA 4L8VA 4YAJA 2H3HA 3ZD8A 2CBZA 1XNHA 2WICA 3K9CA 3FD8A 4A16A 4I4NA 4NK4A 2P90A 1LDGA 3QYJA 1PAUA 1QS0A 5JCPA 1ES9A 4Q4DA 2QMUA 1G4AE 2PUDA 1C8KA 2ZQ5A 4NG5A 1W0KD 1Z5GA 3M4NA 2ZI6A 2JGKA 1QX3A 1KK0A 2GVNA 2EYQA 3LTNC 3WK7A 4CL8A 1N2CA 1FFWA 4WT7A 5EQTA 2WHEA 4UVHA 4WJZA 3DC5A 2OB1A 3LQ4A 1A8IA 3T5DA 4JYMA 5BSMA 3N7TA 3R3VA 3FZGA 3ILVA 2C2BA 1JTEA 3NOXA 3QG1A 3KAQA 4M9RA 2YN4A 4UEKA 6LDHA 2RHOA 1KYTA 4MPJA 4YQYA 4YJFB 1LZKA 4NQZA 5BN1A 4GPAA 2I99A 3FKSG 4PZYA 5T67A 1JZSA 3UHFA 4HGOA 1ZL2A 3B6JA 5LYJB 3W1VA 3ZU2A 4OCZA 4DV4B 1ZI8A 4HXFB 1DIRA 5I9NA 4E13A 2ODQA 4DRXB 4X65B 4AG5A 4CCWA 1VHQA 3MXOA 3DB2A 3MZ0A 1FSZA 2HFEC 5MGNA 4BFYA 5C5IA 5EERA 3SX0A 2OSBA 2DHRA 4GYCB 1EGQA 2X14A 2ZJ3A 3KYCB 3NOQA 3QXSA 4JU8A 4I8IA 1QQ5A 4HDCA 3RV4A 5J2TF 2JDIA 1P2GA 1SC3A 2V6FA 3A6JA 2CFIA 4C76A 1YR8A 1ZWIC 5JJEB 3PQ2A 3HGMA 1AR5A 4AO6A 3CXCU 1ZD8A 3F9IA 1U5AA 5KI6A 3KDPA 1ZI6A 4OL0A 1M8FA 2IK8A 2PU5A 4CC6A 1RKUA 2Q73A 5ADHA 2ZWMA 3N8IA 1KJYA 4LXGA 2NO4A 4ZYLA 2I87A 3AY7A 3NXSA 3SM3A 3CUKA 3OCXA 4IWNA 3OZFA 5E79Z 2W2OA 1A8QA 4GWGA 1BDHA 2QTFA 4X8LA 1P73A 2EHDA 1PHPA 4N5NA 4NZZA 1ZGAA 1V11A 3K9AA 4OQXA 2JDID 1SUPA 1DTEA 1I7DA 3H16A 3A26A 2IBTA 2IGBA 2WWWA 5KAPA 4YP0A 1GPUA 1C9KA 4YB8A 1DEKA 1RWXA 1XBLA 1XO1A 4I5SA 1MA0A 3C6ZA 5HILA 4ESVA 2NSDA 3BKWA 4U9IS 1OH5A 2ZJ2A 3RRJA 3TUJC 1D4OA 4I1VA 2XJ4A 2GM5A 4AJIA 2H1WA 4UNSA 3K1AA 2BEVA 1U2TA 4RTMA 4BLOA 2IZZA 5C1OA 2RONA 1EXNA 1MZVA 4ME6A 5KO2A 5EJ5A 4L9RA 4MI1A 1R5XA 3ZLUA 1H9AA 2O59A 3A27A 1IXMA 2OT3B 2Y27A 3O75A 1XZBA 4UVDA 4TKMA 2R6HA 1T9BA 4R9RA 5JYDA 1A7AA 4UCQA 3SC6A 4DIBA 2I5PO 1ELOA 1QHIA 3HCNA 2BE7A 2HY7A 4ECEA 2W48A 2H48A 3AKCA 2ODBA 2XA9A 4KO2S 3TJMA 5HKOA 5BNTA 1Q6HA 1WE2A 3NATA 3R3JA 1KKUA 4UBNA 3Q4HB 1JNXX 3ENVA 1KQ3A 3IUQA 3HB1A 4JLUA 2ZDQA 1JQLB 3ZNQA 2LNDA 3ZEAA 4B76A 1JFTA 2GCIA 4WJLA 4IUDS 5LL6Y 2OHJA 4UHKA 3R8FA 1UDWA 4QEDA 4LF4O 3UF0A 3HV2A 3VR5A 5JAQA 2F43G 4PINA 3PFBA 4BLPA 1S9HA 3SFVA 2HT1A 4IT5A 3RYHB 4CEJB 3ZDEA 1ZMOA 5CXXA 3NFRA 4EEKA 1M5IA 3FB6C 4EFKA 1KYWA 1FXHA 2VHVA 4O4IB 2QN6A 3H83A 3T3OA 2O1EA 2Z6AA 4L4RA 3O9VA 4RIEA 2R70A 2YJNA 5IKPA 3OJCA 2TMYA 3AVTA 2YEVA 1B8OA 4ZKDA 1TEXA 1BCRA 4E2FA 4NYIQ 4KR9A 3A32A 3ER9A 1I6LA 3ZX5A 4MUXA 3WYAA 2WLLB 2SNIE 5CX1B 2GK3A 4WOKA 1WMEA 1RHMA 5IYZF 3PB3A 1G1AA 2YYAA 2H31A 4OHKA 3ZY4A 1HE2A 4D4KA 4ENUA 1R4AA 3CFYA 3TE6A 4LF8B 1IY1A 1ZGJA 2O3TA 5K6RA 4J7CA 3BCUA 1R6UA 4QGSA 1DTSA 4PYQA 3O8CA 2DWQA 3VHXB 1HDRA 5CMUA 2FFQA 1FP7A 1N2SA 2HFJA 4WKGA 4B79A 5A3RA 2IYSA 3E9MA 2PL1A 3EDCA 4G24A 4XUGB 2OV1A 2CUNA 3VTKA 1XTIA 3LHDA 3PFWO 5IVDA 4B6FA 4Z0HO 3TZKA 4B2YA 4PAGA 3TOSA 1A9OA 3QMPA 1M8GA 3PU6A 1JA9A 4Z51A 3T1HB 1V4NA 4N9WA 2OV6A 2R6DA 3G0OA 2QD1A 4QJ4A 2QG4A 3AHFA 1ZJZA 4K3VA 3DWGA 1JZQA 1YZYA 1T1JA 1T3HA 1FSSA 3I9KA 5B7GA 3C3XA 1U97A 1T8YA 1T2EA 3F3YA 2QLTA 3CIOA 3E03A 2ZFUA 5LCXA 2NU7B 4R8LA 4BATA 2CDYA 2OLEA 5B1BC 4MVJG 4FSXA 3HJNA 2E76B 3KYDB 2FLKA 1EJ0A 4HBZA 1Y7LA 1VYUA 4FHCA 1VPTA 3TXQA 3N27A 1XLUA 3QQPA 3IPYA 1GPJA 1ZH8A 5EJAA 1S2NA 1U99A 2AJTA 2ZITA 5JC8A 5TMBA 1J22A 1E5DA 4JR1A 2W6CX 1EWKA 4UHBA 4E5NA 1JHAA 2Q8NA 3IAM6 1SXGA 5KKAA 2PGIA 1SUSA 3HCCA 1NI8A 1N34B 4MGEA 3V1YA 2QB5A 4TTRA 4DEVA 2HRZA 3D3WB 4DHWA 4WBNF 1JB9A 3VJMA 4NENB 4LXQA 4CMIA 5F33A 1JG2A 2BGIA 3FDJA 1R9JA 4J0DA 5F7OA 5KQLA 4F97A 4OPAA 5DNVA 1CUFA 2ZRMA 2DR3A 5FI1B 4B31A 3UMJA 4EKNB 1CC1S 2VJOA 7MDHA 2AG5A 2VPIA 2BI4A 4PE5B 3FFXA 1CB0A 5U1PA 2CMKA 4S2EA 4F3TA 1FLAA 1JJVA 1KC3A 3IPCA 3PRHA 1MQ8B 3LU1A 1RZVA 2W6IA 3QW2A 2CSUA 2FZ4A 2IZ1A 2Q45A 1G1XB 4I46A 1Z18A 4QG3A 4QM7A 2PBLA 5DWDA 1KZGB 3NGXA 1KYXA 3TTUA 2I0FA 4YBRA 2EINB 1PP4A 1QANA 1J70A 2W2NA 2LVBA 4XD7A 4QOHA 3HDJA 3EGDA 5DM60 5CYFA 1X1CA 4N01A 4H27A 2ZNVA 1AR1B 1WXGA 1P4GA 3TIFA 2EX0A 3OIUA 3TOCA 1B74A 3B48A 3L1KA 5CNKA 1K97A 2QW8A 1N4CA 1M2FA 4ZVKA 1N0NA 1MA3A 4UUPA 1VQKV 4ZN6A 3P32A 1UFOA 4JZKA 1GAJA 1C1HA 1D4AA 4WCFB 2QYOA 4C3ZA 4H9GA 2YWEA 5ALFA 2HUNA 5BR7A 5JYBA 4CTJA 4DUZO 1CY6A 3DAPA 4YI3A 1P2BA 4WH0A 4XD7D 3Q8MA 5JS7A 4R1LA 3T9CA 2WKRA 4N7BA 3ST7A 3T5GA 4WK2B 1DKQA 4WKBA 4YMVA 3CH4B 4WXEA 4NTYA 2REXB 5HXAA 2VRWA 1FBTA 3WK4A 1S5LZ 4ZTUB 1LBEA 4OUDA 3EA0A 2FP3A 1PR6A 5L3EA 4QU9A 2KHZA 1KFBB 2PUCA 5K3AA 3OA0A 1O6FA 3UN1A 2Q5QA 2OBFA 3WZ2A 2BKVA 4MCHA 2B20A 4WE3A 3U3RA 1QVFU 3EMBA 3DZCA 4G0ZA 2YYSA 5FF9A 5JFGA 4KHZA 1KEEA 2OGZA 2W22A 5B55A 3BZUA 1NW5A 2XA2A 3ZCPA 1W1WA 4HOYA 1JQKA 5F2OA 2Q68A 4ASUA 4I2NA 4XWWA 3GCZA 1HYQA 1M3SA 1VP7A 5KHKA 5HVNA 3A1SA 1FVXA 1L0LH 2I2BA 5J3JA 2XB6A 2NXCA 2AS0A 2V3WA 4BAYA 4E51A 1U31A 4BO7A 2B3JA 3GVPA 3PRKE 4C7UA 5K03A 4LKOA 2ZSDA 4J03A 4ES6A 2XWQA 1IHUA 3NAMA 3EXHA 1CERA 3AB3A 2X4LA 3HZZA 2EIJB 2LTAA 2ACVA 2L6LA 1PDWA 2KW5A 2DMXA 2F9LA 3CNQS 1MH1A 1Y82A 3AH8A 4BNWA 3DA8A 1N75A 4LWQA 4PO3X 4EKEA 1NOJA 1K4DC 4HK4A 2Z57A 2CHVA 1WETA 2PW9A 4ZVUA 1ZKDA 1RP7A 4CL3A 3QOFA 4KCGA 1Y4SA 4YRTA 2OYQA 4YRCA 5BSVA 4ACBA 1IY8A 2CJWA 3Q6IA 3ZOZA 2IYXA 4PHTA 4FCTA 4NXMB 5B1DA 2Q69A 2Q1YA 3B6EA 3PSAA 3QXHA 4GI7A 2OQ2A 3QTLA 3HFGA 4ZC1A 1LTQA 5IXJA 1T1RA 1ECCA 2GZMA 1BAPA 4FSHA 4GAEA 4ND7A 2EILC 1C7EA 1LRJA 4BGUA 4URHA 5G4LA 3RF7A 3HJRA 5AVSA 4LRTB 2YMLA 3EEQA 4HNVA 2QZPA 1UBEA 3V7YA 4IX9A 2QXUA 3EZXA 3ZS8A 4NTXA 5KC9A 3A6KA 4KFMA 4C4PA 2P5TB 5FUVA 3BRWA 4Q9KA 2YVKA 3MIIA 2XR1A 3PXAA 3TGUH 4Z53A 2GTSA 1PEKE 4Q4LA 4U8HA 3CF6R 5HX7A 5EESA 1YFKA 4BR6A 2MW2B 4G1CA 5CA0A 1ZINA 1RRCA 4TQ9A 2A1UA 3OD5A 1WP9A 1DWOA 1K89A 1JMYA 3IXMA 4IJQA 3QE9Y 2PSFA 4P8RA 2ZBPA 5DYTA 2A7WA 2WNHA 3MCWA 4BNJA 1OU4A 2B82A 2FOXA 2VWPA 5LQMA 3TDKA 4GX2A 1NLUA 3IILA 5EP3A 4QUBA 1X8KA 2FN7A 2AR9A 4ZVNA 1S3SA 4KHPB 4ZZ2A 4UHHA 3MJFA 3UXHA 3S81A 4IFEA 2Z6QA 4R8CA 1X8LA 5T64A 3LUFA 1JIVA 3K4HA 5HEKA 4PYLA 5IAAA 3N8HA 1O54A 4PBRA 3CX8A 5FLEX 2WPNA 1ECGA 1L6IA 1OLUB 3HCBA 2ZIXA 2PG3A 4B3MO 3LT0A 2C97A 2JCVA 1XDUA 1V7CA 1VI2A 3DOOA 3VDMA 2R9IA 3GUCA 3H2YA 1ORIA 4M0EA 3MGKA 4PLPA 2IBSA 2WV9A 3GR6A 1DE0A 4C7KA 1PGNA 4IQ4A 1R6KA 2HMTA 3WL4A 1AV6A 3SNHA 4H2DA 3A7EA 1UCFA 1Z7EA 5KWIA 3MJ4A 3PS9A 2SCUB 5BPFA 4WA8A 3OTHA 3IJPA 4RDXA 2HP8A 1TQ8A 4ESEA 1HNZO 4EG3A 3KZ1E 1SD2A 2O8NA 4FGLA 3K9LA 2PSJA 2F1OA 5LZ4A 1KGSA 2QVBA 2X3FA 1UZLA 4C7OB 3JQ8B 1W76A 3DBLB 2JBAB 3RSLA 3OZUA 3PTZA 3CWQA 1XA4A 3CINA 3R75A 1FNCA 5L3QA 4RLFA 2VDQB 1GXSA 2R8PA 2COEA 3UV6A 4DE5A 5I9MA 5FPPA 3TLJA 4KAJA 2EIXA 1BCSA 4X6UA 4KEAA 1A9SA 3TJRA 5CLIA 3KR0A 1SD5A 1JKXA 3LA6A 1NXSA 1XVIA 3WKDA 4R3WA 2A3QA 3C6BA 1G16A 3HO8A 4DR6B 1DAHA 5TRTA 4LMPA 4XWYA 1Z56C 1TM7E 2J5KA 1U98A 4N3NA 4B4OA 3SZOA 1XEAA 3U10A 3ULKA 4WACA 1KOJA 4FX5A 4R8MA 3HPQA 2G04A 1RBQA 1G20A 3MJEA 3ESDA 3QNWA 2IEIA 1L9XA 1R7RA 1P7PA 4ABTA 4JLWA 3LXRA 3LL4A 2G40A 3CEMA 1YQTA 3L92A 5ALWA 4MV0A 2F2TA 3ZWNA 4I9NA 4JI5B 1F20A 4MSDA 1L1EA 1DKLA 1TAEA 1KO7A 3LUKA 4P5DA 5DT9A 1KP2A 5EYPA 5EUCA 3I9V6 3G9QA 3UEOA 3ZY2A 2B4RO 2V7QD 3AF3A 1HL3A 1IAQA 4J9UE 1V6CA 3IDFA 3G9XA 3AIOA 1JIUA 4PYIA 1F7UA 2VAXA 3EIXA 1PW7A 1YL7A 4K1XA 2W4MA 4QECA 3PKZA 5AM0A 1QQ7A 5IYDO 3PT9A 4MA4A 3ZI0A 3CRW1 1C50A 4GPIB 4OQPA 3KJGA 4G5HA 4Q3LA 1EFRD 3OZVA 1X1RA 2GBCA 4CH6A 4ZWNA 3ZQKA 2CNKA 4IWYA 5H5JA 4Q21A 4X1KA 4RZ2A 3DH0A 3QBTA 4R6XA 5DRTA 3I5UA 2EP5A 1BEEA 1IOWA 1DEXA 2WNSA 1HF3A 3G59A 3HCOA 4KU4A 4JV5O 2GRUA 2P9EA 3VOSA 2IW1A 2IHBA 4ZYYA 3KJHA 1FXKA 4QHTA 4EA8A 3CS5A 3CR7A 1DRJA 5DX0A 3H5RA 1JLRA 3WWEA 2CZQA 4OQMA 1KAHA 3HXQA 4BO9A 3CRAA 4A8PA 2VRBA 5JCJA 2IJIA 4LN1A 5CDSA 2DHQA 4HAYA 1E9CA 2XASA 4GE0A 2QKAA 4JP8A 5DCUA 4F9TA 3TFOA 3M4XA 1YGPA 5CDUA 4LWSA 3P4YA 4YP5A 3TQTA 3FYTA 2WM8A 2LP4Y 4BC1A 3PQFA 1LK5A 1PQ4A 1V16B 1QPZA 1N1MA 1K4MA 3OQHA 1CQJA 5ERYA 2HYDA 4E30A 5TMPA 3BXFA 3GQVA 3WJ1A 1D2EA 2ATEA 2JB9A 5BYAA 1WBBA 4DCGA 1S7CA 2PY6A 3H1AA 4J2HA 4DSAA 1A4RA 4R69A 5JCJD 5KQRA 2J3LA 2HHAA 1QU2A 4X3CA 4Z0NA 4MKXA 4DGQA 1DS6A 4CMEA 4FCVA 3DB1A 4JLKA 1MEEA 3BYZA 1DB3A 2TRSB 2IYRA 1OCOB 1F3OA 4I99A 4G4SO 2XEXA 3MAJA 4X63A 5ILGA 4DA7A 5EBLC 4YR7A 1WHTB 4G6ZA 3ZXSA 2GYYA 1L4YA 3MJVA 3E7PA 5EC1C 3AJDA 1W75A 4X45A 4GDMA 1CQWA 3L4SO 5FUYA 1QH1A 4P38A 3KQKA 4X7BA 4C20A 1Z6QA 4U63A 4YRFA 9ABPA 4MMXB 3OECA 3P9PA 3ZDCA 1L5MA 5FTNA 4XQEA 1Q7RA 4BN5A 3TLMA 2QJ1A 4TX1A 3CTMA 4LDJA 3OLVA 5EZYF 3KXLA 4MV3A 3HU5A 3A25A 4KAXA 1OGJA 2EULA 1ZN9A 3AI3A 3K5MA 4TM7A 2IS4A 4Q7LA 4IXNA 5E3HA 1ZS9A 3W4IA 1NC1A 3MGGA 1G3IA 1NUPA 1C0EA 4NJEB 4S12A 3CLVA 1P6UA 3GN2A 4HHEA 1Q50A 3A3PA 4M0PA 3HM9A 2PYIA 4ZVMA 3L71H 1NG1A 3R2NA 4GYWA 3TUZC 3EHBB 4FD2A 1F0PA 3HZHA 5JASA 3P2OA 3SJBC 5JXGA 1X3LA 1SHLA 2V5UA 5AI9A 1D5NA 4PRLA 5A7HA 5ALVA 1V4VA 3ZDRA 4FFLA 3V2HA 1J5EB 2QAGA 3KU1A 1N6OA 1NNSA 4FYIA 4RVSA 2UUOA 1OB5A 2Z0MA 3F4LA 1N36O 3EVDA 2QR3A 2AEEA 1KEVA 1W1IA 3H9GA 1H38A 4Q47A 1PZHA 4YT4A 2OY0A 4YRKA 2OM6A 1IQPA 4DCCA 2F8SA 2R68A 2ES4A 2RGEA 3S44A 4DV6B 1CR6A 1E3SA 2G70A 3EGXB 3LSUA 2PKWA 3E61A 4F3CA 2NUAB 3RH0A 2X8LA 5JW6A 2OMEA 3ROZA 1XZJA 5D2CA 2QJTA 4WLFA 4NNJA 3PFKA 4YJ3F 3AJ8A 3SJCA 2Z5GA 3KVNA 3MHPA 1TUBA 5HFNA 1G9XA 3MTIA 3RF6A 1KSJA 1JKJB 3TL3A 3NZEA 4AJPA 2IIPA 1W0JA 4A82A 3ABKC 1Z0ZA 2BP7B 1SOMA 1C7IA 4OHXA 4MS4A 1TTPB 3E5MA 3OO1A 3G13A 3GRZA 3IBFA 1EFDN 5JJNB 3MS2A 1JX6A 4L3VA 1EQUA 1BGVA 1O5TA 4DMGA 1A76A 5JQGA 2LUOA 1YI0A 3WTCA 1V25A 1HLDA 4MW2A 2EGUA 3E6AA 1WLSA 1M56B 1CNEA 4W9RA 3R3SA 3TOVA 4HF7A 4UREA 4WD3A 2YVLA 1K8AW 4K8OA 4LF7O 1W5FA 7YASA 2Z2IA 5CDGA 1T5EA 1VF5B 2C2WA 3LTEA 4F4UA 4O4HA 1T9HA 4IH1A 3ZIUA 2O7PA 2W2KB 4JWKA 1DBSA 3R3WA 1NQXA 4YCDA 2JAXA 3Q12A 2WTXA 4PC1A 3KSBC 2QDXA 3WWYA 2YYZA 2NSJA 2FZCA 4D9JA 5HM6A 1K5HA 3PUHA 5BNZA 3ND5A 3BPSA 2HBQA 5FXMA 1KORA 4IL5A 2BFDB 4JYBA 2BFWA 3L8EA 3MLBA 3WHPA 1GZUA 1VCIA 4TLCA 3I0NA 3VZQA 4WY2A 4ISCA 2A7XA 4WOCA 4RHUA 3OIGA 4QRIA 3T1OA 3IAHA 4CZ2A 1WMAA 2C8JA 4AS2A 2GEKA 4IGAA 1Y80A 4H18A 4RUKA 3Q3GE 3BXZA 3SFTA 3OPXA 4PCLA 2R11A 4FMDB 5AW4A 4DV3O 4KQXA 3K0HA 1NYTA 1OX5A 3FUTA 4XR4A 4HNTA 2HNBA 1XTVA 4FLZA 4KI7A 1TMGE 3KOOA 2EF1A 2ISQA 2R7AA 1NNEA 4W5TA 1ZSYA 4B3SB 1DXHA 3A4YA 4BLQA 4G5XA 1OR8A 3GH3A 5DEOA 1B93A 1GL6A 1O0BA 3FYDA 3A6HA 3VQVA 3W3AA 3R66A 1Z5NA 3TLBA 4Z8YA 4DSTA 1MT0A 4MCJA 4HWOA 2GRJA 3FPCA 4REQA 4U2BA 2FHSA 5JS8A 3OTWA 4QPCA 3V46A 3C3TA 3OIVA 4V0LA 3BB3A 2Q07A 5JMPA 3A2KA 3E1SA 1I4OA 4ABMA 1BH6A 3OTIA 3WZLA 2HPVA 1EWTA 4H33A 2JLCA 4DMFA 2IIVA 5BSRA 5K8JB 1LPNA 5D3MA 1AUPA 5JD4A 2PUEA 4BZWA 1RB7A 3KFLA 2ZS9A 4JGGA 4EQ6B 1KYOF 3CW9A 5K8IA 2OCCC 2ZP1A 2Q6IA 2Y6VA 1DF5A 3T54A 2PVCA 1PQPA 4BN4A 3W3AD 1XIVA 4A7PA 2YY7A 2ZRCA 2X6AA 2B3ZA 5AHOA 2C82A 1I7SB 3GLSA 3LF2A 4N21A 4C4AA 3A6LA 3EC2A 1YJNV 1RPZA 4UPDA 2DWUA 4Q9IA 4NFHA 4CM8B 1MA1A 5KWJA 4UQOA 1TMKA 2ZU0C 3C6MA 3SJAC 4TZTA 3ETGA 2PLNA 2QN2A 2B0CA 4XIGS 4LNHA 2J9FA 4ZOLF 5JCXA 1SS3A 1GWNA 3GJRA 1LGYA 1WBJB 4NYKA 1EN6A 4G5GA 3L0BA 5M5BA 1RJ9A 1MNGA 3ILHA 4XOUA 3ZGXA 4EECA 3A9SA 4C0BA 4HEA6 1AKYA 1PEYA 2IW3A 5K0EA 4NV3A 2XNHA 1EVKA 3MAAC 3RV3A 2EF0A 1X7XB 5BR1A 4XGRA 4X92A 4WNIA 1S3IA 5FPYA 4DCUA 2FKAA 3UXYA 5FBKA 3ZU4A 5CMLA 4TSFA 3JQ7A 4EZBA 5ERXA 2WABA 2CBGA 3WSTA 1KJZA 2NU6B 2I67A 4O2AF 3DGFC 3R23A 1YZLA 1W52X 4KRFA 1ODCA 1YU9A 2H65A 4MW5A 5BR4A 3L07A 3IOYA 4WF9V 5FUMA 3HYTA 1NFQA 4G0MA 4CI9A 1J1IA 1F7VA 3KSUA 3EG5A 3IAS6 4MH0R 2A6PA 3T1YO 1JFRA 4JBXA 2EC5A 2YIDA 1Z6ZA 2P8RA 4TSFD 2YJ3A 2CDNA 2I4OA 3NVDA 2ZXUA 4RQAA 3DKPA 3BAZA 2RBEA 3RPEA 2F48A 4V1CA 3PUWA 2X3UA 4F3KA 2YWCA 4TQGA 3G2JA 4Q12A 2PTGA 5K0LA 4LGYA 4OVKA 4B3IA 4JBLA 1JJ2U 2AEMA 2V6BA 4IX1A 1G2PA 2CNLA 2ZM5A 1NL3A 3G9ZA 4KLZA 4KQ6A 5I9LA 4WCDA 4U6NA 3ZQ4A 5LP1A 3NCTA 2BSAA 5BNFA 1MXFA 3PEEA 1K0FA 2PR2A 3AERA 3N5KA 4J6FA 4GM0A 3DAHA 3F6CA 3RBAA 3GLIA 5BOVA 1U6JA 2JHCA 1E99A 2XHBA 4ZOQI 3ET5A 1ZU5A 3WFZA 3KO8A 4V39A 4TTTS 4YNBA 3U39A 4PI0A 4HGYA 1FDUA 1L8AA 4FLYA 3TECE 1FE8A 2QUIA 5AHRA 1K86A 1OSNA 1M10A 3RG2A 2OGUA 3S27A 2GEFA 1IN5A 4IUBS 1KPHA 4MA0A 4GL4A 5CVCA 2KMLA 2QVGA 3R5FA 1MO3A 1OAAA 4YO7A 1XDGA 2JA2A 1MFZA 1A2BA 1U90A 4RF4A 4LFAB 2ALJA 1E5QA 2BF4A 4IHJF 1F8YA 1KOFA 3UICA 2ZSUA 1TVCA 1PWZA 4PO1A 4IIEA 4TPKA 5B2EA 1XB2A 2ZJ8A 1YI1A 2FP4A 3O93A 2HDOA 2PH3A 2PFKA 2OPBA 3OPYA 2OHVA 5IDWA 4WZBB 1N2IA 4UTOA 4XLTA 1SBHA 1WUJS 4MW9A 5C18A 3OICA 1JE0A 2FE1A 3IERA 3K7EA 3SR3A 1XMQO 4IIUA 1ZABA 3BB4A 4IGGA 5MF6A 1N6LA 2PYLA 4OBEA 4P7FA 3AXSA 4OGWA 1G21A 3RG8A 1NBEA 3C3SA 1SY7A 1OXSC 4I55B 1JDPA 3KKQA 4AHCA 1QIIA 1CY1A 3BZBA 4X1YB 1NT4A 3EMDA 3HPRA 4M21A 3J81N 2QZ9A 1UPTA 1ZL0A 1MX9A 5JANA 4U7TB 3DZGA 5IT0A 2QZJA 3VBEA 1YJ5A 4YVFA 4HFRA 3FCSB 1P75A 1XZIA 1P17A 2G9RA 4YRNA 1RCUA 2QP4A 2WWFA 1O6CA 4B35A 2AJDA 5G0SA 4LZJA 4XEUA 3WBKA 2EJ7A 2G6BA 1CTQA 1IBCA 2RIRA 3UKOA 1NWCA 4HJRA 4IV8A 4GYKA 1ADCA 2RJZA 4BZXA 4ETIA 2OCKA 1OAOA 3OU6A 1RCTE 2QRHA 3LGSA 5AKKA 2F1MA 3QXJA 2G1AA 1P5FA 3UB3A 1GRCA 4CTKA 3TL6A 4QJBA 4JJKA 3QI2A 5KWEA 2FGJA 5CAEA 3WK5A 4RVGA 2C03A 5BVGA 4M1OA 1K33A 4ZOLA 1R0YA 2NSYA 3HVIA 4DR5B 1NE7A 4EAQA 1EZ4A 3K9FC 1RPTA 4UVGA 2AMJA 3FPEA 4X65O 4EF5A 3WGLA 1SM4A 4WERA 1OY1A 4QU5A 2PYZA 4E2ZA 1I94B 2WAYA 3FNBA 1YVPA 2J30A 2CTRA 1J1ZA 4X1IA 4N1AA 3EIQA 3CJQA 4DQKA 4GQBA 4PCAA 1JEQA 3N2YA 3ADDA 3T4DA 1RI1A 4MYTA 4OIFA 4PC3A 1Q0TA 1IBRA 1KAQA 1YS6A 3BGWA 3IVGA 4M0CA 2PS3A 2ZRHA 1SUEA 1UEJA 3MYRA 1E7YA 1PUJA 4WESB 1SWWA 3M4YA 1PJ8A 1VLZA 3V9PA 1VGVA 5DYNA 3R74A 3KE9A 1ECFA 3E86A 4LG1A 1WCXA 1VMKA 3G0IA 4I1UA 3HN7A 2WLMA 2VJNA 1KAMA 4PQRA 3G88A 3GFGA 2JEYA 5D85A 1Q1BA 2WUVA 1ZK3A 2PZKA 3RFXA 3KX2A 3C5VA 3OY2A 3LFTA 4S1TA 2DG2A 3NTLA 3TOZA 3O47A 2C3PA 3M4ZA 1DQZA 2H2HA 4H0FA 4CDMA 1SNYA 4HQRA 1BA2A 3N74A 4Z2WA 3GWGA 1SQGA 1L5HB 2I7XA 1TYZA 3E3AA 2HXSA 3U49A 4OHUA 2OL4A 4D82A 3K73O 3PEYA 5HE8A 3G5LA 1SXJC 2VK8A 4ML3A 5A9SB 1W2WB 5IC6A 4FINA 1W0KA 2WR8A 2B1GA 1QHTA 4WEQA 3MS4A 4FX2A 3FHOA 1Y5MA 4M2LA 1XFDA 1RFYA 1ENPA 2X2OA 2FEMA 2CLOB 1EFPA 3IBTA 4UAUA 4F4CA 4D6XA 3TTWA 4ICIA 4X6XA 1RHUA 4QSMA 2HIGA 4DSOA 5HIJA 2R8BA 1PR4A 3R5TA 5GJVC 3EQ6A 4R2KA 1QGZA 2SKDA 3I8OA 2D7DA 2NUPA 3EWSA 1UFQA 4G0YA 4L6AA 1G4HA 4N4AA 4E88A 3RYFB 2MYPA 3WL5A 2VUHB 3ITDA 5BY1A 1SKQA 1WEKA 2C9BA 4Y9SA 5CT9A 5CDHA 2V3VA 3B4SA 5H8WA 2HIHA 4FYWA 4EPWA 2PRJA 2J6BA 4WZAA 1L1RA 3BA1A 3ZQUA 2XYRA 1Y1TA 3UKMA 5J4YA 1UPCA 1LBQA 2AEJA 5BWNA 1AIPA 1DUSA 1G8HA 1JAXA 5JUWA 2PLWA 3IA2A 1WTCA 3EARA 5C8DA 3A8TA 4L02A 5DGCA 1CQPA 3D02A 4JGSA 4X62B 1U1IA 2C07A 2F3RA 2XMZA 2EWWA 4BPBA 5CB4B 1GTSA 3U37A 1AURA 1PO7A 3DKVA 2CF6A 2A5YB 1UJBA 1T2AA 3IURA 1EBFA 2FN3A 4V0OA 4GEKA 1Z5ZA 2HDHA 3TIGA 4BLSA 4NXNB 1YAHA 1GTVA 3MA0A 4FDTA 4NEHB 2BCGY 1I80A 5IS2A 2ZUUA 1VLVA 3GT3A 3T5TA 3LT5A 4US0R 1XPRA 1SU6A 4NE7A 4AMUA 1OUMA 1G19A 3UWDA 4GI5A 1U4SA 1DRWA 2FYTA 5CIWA 4RFSA 5JMOA 3NRCA 2Q2NA 4Y1FA 2BN4A 4KWHA 3OFSA 2ORIA 1E3DA 2H2DA 3GJ8A 4FR2A 5LNK6 1GCUA 1KFKB 3HSYA 5GINE 5TX7A 5BXQC 1RR6A 1NW4A 1PJSA 2E2WA 5TMEA 3HUFA 2FPIA 4GOMD 1IL0A 3NI2A 1CRLA 1ULAA 1RLTA 2LR0A 3GCWA 4UHJA 3VC7A 1SXHA 3KAKA 4MQUA 3D6MA 4KAAA 3P5SA 4CIAA 3FPBA 1LB1B 3UWMA 2BCJQ 2ZLBA 3G0DA 3LFUA 2IOYA 1QFMA 3TLGB 1D0VA 1JV2B 3T1HO 3KTFA 2XVAA 2IHNA 2D1TA 1UMDB 1I9GA 5TQ2B 1L5ZA 3PC2A 4JYCA 1J9GA 1T5LA 1EE1A 4MV7A 1YIJV 3WS7A 1GV0A 1ULBA 1ZL8B 5A3VA 1KBZA 2GLUA 1R8SA 4Q34A 1WQ4A 2YOHA 1QHYA 1NW8A 1BRMA 3BXEA 5H4GA 2X0DA 3H5TA 4KFSA 4LXYA 2OHGA 2DLNA 1JLSA 1Y3HA 5CFPA 4NY1A 2WD7A 3DO6A 3C5CA 1ZDMA 4ZT7A 1K5GA 3HACA 3FJOA 4BIOA 2N46A 1ZGBA 1WN5A 4PO9A 2I54A 3L04A 5HCUA 3A06A 4O1IA 1Y8RA 1M8JA 3QUBA 4WY5A 3IB3A 3RM3A 1BQZA 1V5EA 1WMSA 3JASB 1GTL1 3SC4A 4L16A 4OLJA 4UNIA 1WZNA 3PGVA 5JVDF 4PLZA 3B40A 3G2HA 4TZ0A 1R0CA 4FC6A 2UYGA 2I3DA 3MWKA 3AHHA 3ZXUB 1QGUB 5FWXA 5FNVF 4U7DA 3R8CA 1EMDA 5FR2A 2GAFA 3MLAA 3KR9A 3COJA 4UNNA 4Z0PA 2O6LA 2AQHA 4EEXA 1GKKA 2E4YA 1GKIA 4HATA 4UUJC 1IQUA 3ZE7A 4HRWA 4EA9A 3A1WA 4ZYTA 3A6GA 1JJAA 1GYPA 1YHYA 1RM0A 4QICA 5JDIC 1ZMRA 1MJHA 1E64A 2HIAA 1TA0A 3KM0A 1QBZA 3URMA 4YAWA 4ZT5A 3PTAA 4TMKA 1IUOA 3RAEC 1YB6A 1UXJA 2C9ZA 5DT2A 1JI0A 4GOLD 1C1DB 1U2ZA 4RIFA 3VPXA 1TCCA 4TS3A 1TQDA 4XQGA 1RM4A 3TW0A 4ZA2A 4JYAO 4G86A 1M2NA 1N5OX 4CDRA 2ZWPA 4AY4A 4ITRC 1HLPA 2YCBA 1S0VA 4GU5A 4X91A 2O7QA 1HH4A 1Y81A 4LY9A 1RAGA 4RSMA 3PRJA 4JP3A 1E1CA 2NO7A 1H0HA 1XZLA 3HJUA 1KAEA 1ZR2A 5DKFA 1S1MA 1NJFA 3LUGA 1ZISA 4TVKA 4CEIB 4C6HA 3VSBA 1PYDA 3OFNG 2E21A 3UT5B 1E3WB 1EESA 3DOHA 3R7WA 1YZQA 1JE1A 3OTQA 4OJKA 3ZHRA 4QUKA 2VP5A 2HDWA 2ZRBA 4CIDA 3V4PB 2PJUA 1Z6YA 3F2IA 4TLBA 3NG1A 1NQAO 2E4XA 3OBBA 3RK1A 4L8GA 2R97A 1JS1X 2O19A 4HH1A 3SHTA 4BY9E 4PYKA 3SBDA 2OWEA 4G8JA 4B7XA 3R9XB 3P20A 3EPKA 4Q0MA 2NG1A 3GLIE 4OCLA 1VL1A 1YF2A 3N2KA 3FR7A 4L0CA 3M6LA 4HLQB 1F4LA 2D30A 4MP3A 1U0EA 3UO2A 4JBYA 1MQ9A 3CCSV 2YW2A 4GGPA 1WN7A 3A3OA 1BJKA 3IBSA 3VZBA 2D0PB 4BWGA 1PGJA 5DTIA 4L22A 2P2GA 4NBNA 5F4ZA 2RHJA 1U11A 2ECFA 2IU6A 1AG9A 1HOXA 1PG2A 3I92A 2W00A 1ZUNA 1IMOA 1WP4A 2I55A 2W6NA 3KE8A 2Q28A 2GYVA 4NAVA 4QXQA 1B42A 2RQ6A 2HPZA 2B98A 2QX4A 2Q9LA 2C2KA 3JQAA 1GPYA 3AFHA 2XV1A 4Y2VA 2EJBA 1PNQA 1TLFA 3CF4A 1SBZA 4OHFA 1NI4A 1JJIA 2VJLA 4L1KA 1RYZA 5AXAA 2C5LA 1FUIA 5CVTA 1E1NA 2CE7A 2R0QC 4DLLA 1S2IA 1MF7A 3OQIB 3F9RA 4GBJA 4QSHA 1CF9A 1FSGA 3ETHA 2ZRLA 1MQSA 4P3YA 1TM2A 4EDHA 2YHIB 3EA5A 2P6NA 2SBTA 4BYMA 4JJ6A 5J2TA 1PI3A 4PA4A 1MB4A 3BWYA 2FI1A 1PRYA 2GPWA 3GXOA 2ZDIA 3K5NA 2EIMC 3KV1A 5DTQA 2D06A 5B6IA 4DPLA 1GG5A 1G21E 3JQAD 4YJHA 4A6PA 3LX5A 5C53B 3DMHA 4I55F 3FAZA 2C57A 4J0EA 3KXPA 3UZUA 1X9HA 4K9OA 3UCEA 3K4QA 2Y0CA 1XRSB 4OG2A 1BZYA 1OFUA 2G0AA 2GXAA 2AZ2A 1X74A 2G4CA 2G5CA 5ITWA 4BVKA 1XBTA 4RH0A 4J2TA 5COAA 2IOFA 4JQSA 1YB1A 2JBWA 1YZ3A 2PNJA 1Z0IA 4G09A 4CRWB 3IP1A 2F6RA 2C9MA 3FF1A 1D5WA 4HZGA 5EY5B 2I7VA 4RPJA 5TISZ 4L2IA 3ZJ5A 1S2OA 4EUKA 2R87A 3TVTA 2FLVA 2W6ZA 2OQIA 5U9CA 1Z4MA 1G41A 3S2ZA 2A9JA 2X9GA 2WWYA 1NSYA 4MAFA 1P4JA 4IG9A 2GKGA 2P1DA 4C0WA 1Z6TA 2O8CB 2FZ5A 1YF3A 1SK9A 1TW3A 5CDFA 4D02A 3IMFA 4UMFA 4DK1A 4UUMA 4LF9B 1HDCA 4YMTA 1QJ4A 3VTFA 4P1ZA 4GP7A 1EA5A 3BXOA 4BEWA 5FEUA 4H7EA 3SVZA 1I5XA 3UUEA 1YJBA 5JVDA 3MUFA 3FDXA 2C42A 2H9YA 4MUMA 3UAGA 3QLUA 2FY8A 4D43A 3EOZA 3FPLA 1HDZA 3GJZA 4XGIA 3AG3B 2B1IA 2VRCA 3SZMA 1QR6A 5B2ZA 5A5EA 2PIDA 2COUA 2ZJ7A 1WHSB 5A4KA 2X8JB 2BHRA 3D8CA 5C8XA 5B4VA 1NVKA 4DYLA 4ZD5A 3RUFA 1ACLA 3H99A 2HT6A 2P6OA 4BNNA 1BX0A 2B8TA 1S89A 4AZVA 5DM4A 2C77A 4DCOA 2JA1A 2D74A 1R8XA 4HVTA 4Y1EA 3TTSA 2GJ9A 2W2MA 3FBTA 4AJ2A 3MHSC 2YWBA 3EVNA 4ZCRA 1V1JA 4M1QA 2H5LA 5AXCA 2ZI7A 4RDIA 4MW3A 2P65A 1BE3H 2VRCD 3AG2C 3T1QA 3SPJA 2PUVA 3O1IC 2O8FA 1JYSA 4WKOA 1R50A 3K53A 2ZSJA 4TZ6A 1KY2A 1GFSA 3VOTA 2G4LA 1D5CA 1M6EX 1J1UA 5EIBD 3AY6A 5I7SA 5EP2A 1GNQA 2QE7A 1TM1E 4BFXA 3FSRA 3VYRB 4HNSA 1FDVA 5IC4A 5L51A 5GIOE 1W36D 3ZRWB 2WF6A 3E7WA 1XQ6A 4QX6A 2ZQMA 2Y1LA 2ZJFA 1LC0A 5IYZA 4AY5A 4P2ZA 2J87A 1OV6A 1XZKA 4C7VA 1BROA 1SEPA 2W93A 4DR6O 1G291 1XQ8A 1ZRHA 5DJ5A 3WWZA 1SA0A 4L3OA 2YJTD 3MRVA 3R5SA 5JH7B 4E4RA 2GK6A 1W2GA 1KYQA 5G1PA 1V43A 3B3FA 5HBGA 5IKEA 3KFVA 1QVAA 1SVWA 2WVHA 3GJ6A 3B8FA 2QE7D 4NAUA 4KQ1A 1U7HA 1I3KA 2XYQA 2JFQA 2V55B 1OCRB 4JC5A 3HEMA 2HX1A 4FOOA 3D2LA 3D9QX 1E0KA 1AI5A 3L5OA 1IB0A 3WL7A 3I9NA 3L77A 1N3IA 1G5HA 4JPRA 3EXEB 3JU3A 3VRHA 4JI5O 2BFEB 3KB1A 2UYHA 1R3LC 4D3FA 4MB2A 2FA9A 1JFFB 4UVAA 1ZK4A 4MHOA 3NYRA 4C0SA 2PX4A 4GECA 3BRSA 4WIFA 2YS7A 1ILWA 3UK1A 3W8EA 3ADBA 3O8DA 2Q62A 4ZRNA 4W9NA 1XL1A 1M0EA 1N2CE 1WCV1 1YVDA 1K68A 2JVIA 3LQQA 3T7DA 4KQFA 3LBNA 3O38A 4DMCA 3GJ0A 4D56A 1U63A 4M1MA 2GK4A 1DK1A 1A4XA 4NRDA 2I34A 2C5GA 2J5QA 4J41A 1RLUA 4TQDA 2WB4A 4BWFB 5K51A 5L53A 5CB4F 4LXIA 2GBLC 4HTFB 1FXUA 3L7JA 1LW6E 4WN3A 5CM2Z 4WBNA 5DM6V 1USIA 2FK7A 5JRJA 4NATA 1W4LA 5LYJF 3EYWA 3OT5A 1E69A 1IEQA 2ZRQA 1O58A 5DHFA 2ECQA 3L8GA 4MUFA 4CG2A 3I12A 2XEDA 3DV0B 5AK3A 1HLFA 3E3LA 4JDUA 1GQRA 1E5LA