1THZA

Crystal structure of avian aicar transformylase in complex with a novel inhibitor identified by virtual ligand screening
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of avian aminoimidazole-4-carboxamide ribonucleotide transformylase in complex with a novel non-folate inhibitor identified by virtual ligand screening.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 217
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2004-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1thzA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1thzA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1thzA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1thzA02
2YVQA 2IU3A 1CS0A 4EHIA 1C30A 1BXRA 1PL0A 2X8WA 1G8MA 1VMDA 1S8AA 1M9NA 1M6VA 2B1IA 1PKXA 1S89A 1OZ0A 1THZA 2B1GA 1T36A 1KEEA 1P4RA 2XW6A 1CE8A 1A9XA 1JDBB 2IU0A 4A1OA 1EGHA 1C3OA 1WO8A 1IK4A 1B93A 1ZCZA 3ZZMA 5H3LA
chains in the Genus database with same CATH superfamily
2YMQA 3E9RA 4L7QA 2V6GA 4BMDA 1F8YA 3B8EA 2Q68A 2AB0A 1H5QA 1KVSA 4OF4A 4TZKA 3UK6A 2NWQA 3RYIA 1GYQA 3M49A 4BIZA 4KX3A 3T7TA 2G9RA 4LFAB 4LVNA 5JDIA 3JR3A 3LRXA 3KQTA 5JJJB 1RCFA 2G08A 2IGTA 3X1WA 4DREA 4A36A 4WKOA 1QORA 1WJZA 3JYPA 3NKVA 1V5IA 2GUZB 2V1DA 5FA8A 4H35A 4EUFA 3ZHRA 1FS6A 3FB6C 4JI1B 2XMGA 5EPUA 1QZZA 1R4MB 3FNRA 3ABKB 4MVZA 1WTAA 4IYHA 4X97A 5F52A 1PNRA 1GNPA 2DQ4A 5TRTA 2UYOA 4ZP1A 5J4HA 3UK2A 3UG6A 2ZB3A 2BD0A 2GYWA 3GN1A 1VCOA 1IDN1 1QHGA 4YRKA 3GJ7A 1VKRA 4ZZIA 3SR3A 5ENDA 1XI2A 1W0KG 2YASA 5G1NA 3TCXB 4JUFA 2Y0IA 3U9TA 1VF5B 2AR9A 3VYTB 3O65A 2IBZH 4E6PA 5TPZA 1GQYA 4DJJA 1CJSA 2O5VA 3S1AA 5JVDF 1O97D 5DKFA 4FC7A 3BWMA 2C7OA 1PFQA 2CWDA 5CVJA 3KQYA 4OPAA 5GM1A 3GHYA 5DN6G 1Y1KE 2YNMC 5HDBB 1A04A 3SHWA 4O4JB 4AJKA 1R66A 1IUPA 2VJKA 4HR7A 4RF2A 3HJTA 4R9VA 4ZOCA 4LY9A 5KCZA 1AQNA 3V4RA 4GZ5A 2XVZA 1HI9A 3RS5A 1PZGA 4J9VA 3USCS 2W4LA 2JZNA 4LR3A 2JIPA 1Y4SA 3CKKA 3VPGA 2IUTA 5DLYA 3R7WA 3TOXA 1JJ7A 3IHWA 2OCCC 2YMPA 2JI9A 5DEOA 3BXPA 1R27A 2F48A 4L50A 3GZTB 1UF9A 4P9CA 1PJLA 3EW9A 4QPPA 4HBNA 1ULHA 5A7GA 2W6ID 2EJWA 4JI4O 1CF9A 2DR0A 2XGOA 5DXAA 4DVGA 4EKWA 2R7LA 2ZSDA 1SBTA 1VHTA 3IO5A 3L6CA 1F17A 1MVNA 1VMDA 3P9CA 3QTBA 4NR0A 1KBOA 3FRJA 4F3RA 1UX0A 1EA5A 4LG1A 4JSTA 3NNDA 3NYQA 4EWLA 3V1UA 1Q84A 5J1SB 3GJRA 4Y6SA 1U3CA 2G28A 2GJ4A 2YFHA 4K6MA 5IAJA 3AJEA 2QPAA 3BFKA 3GT4A 4PZUA 3BF7A 2WWYA 3U0ZA 1CG6A 1LWNA 3DKRA 1NT4A 3BQ9A 3LT2A 4KFUA 4KQ2A 1LKZA 2I03A 1MPXA 2ILMA 3DVAB 1NXQA 3IUMA 3IR7A 4QGAA 4CQMA 1QPZA 1GRJA 1RAEA 1CF4A 4ZRMA 1W35A 3QLJA 2Z43A 1K86A 2DLNA 3ZHYA 1MCZA 2GDZA 3FFXA 4INAA 2WNHA 2ECOA 3BXXA 3LSYA 3C3PA 3N8DA 1O57A 3JALB 1EXWA 2OCDA 4JQCA 1XDUA 4KE6A 1TUIA 3FAZA 3FN4A 5DI3A 3RS2A 1EFRG 3VKUA 3NP7A 1Y6RA 2CT8A 1XCPA 3IEIA 3TAHA 3MRVA 2O5EA 5EKDA 3PR2B 1J7JA 4FDAA 1MRZA 2CMHA 2I6GA 4ANFA 4MVSA 2BCJQ 4OQDA 6PFKA 1KMMA 3JYQA 2LCFA 4GSYA 5DP2A 1H66A 4DNXA 4D8UA 3K6SA 1UINA 1CZHA 2A94A 2NN3C 1IPEA 5LGUA 1JMVA 5AKXA 1V95A 3UV3A 4ZIRA 3VQXA 3A6KA 3LHSA 1DRJA 2A0YA 4YJ3F 5EMJA 3TLEA 4ZOBA 2GGSA 3QNMA 1EBBA 1ZJWA 3SDBA 1IK4A 2W6IA 1JEQB 2OGSA 4ZT6A 3ZWMA 5DRTA 3Q7PA 1QAMA 2Q3LA 1RBMA 1Z6PA 5C51B 3VNSA 2HK8A 3C15C 2FJPA 3NHZA 2B69A 4Q7QA 1ECGA 4AMVA 5JD4A 5CVEA 1NKSA 4NAUA 2A57A 1YFJA 1JQLB 1PLJA 4LF7O 4LTMA 4K9QA 4G1UC 5CMLA 1U9YA 3E05A 2HHLA 5L3QB 1QTQA 2WWTA 3FZGA 4PFQA 4Z8XA 1NZ6A 1WW8A 1LRJA 1RRMA 1GZ6A 4RKYA 1BW9A 1TQHA 1KIMA 1Z6YA 4UCQA 4B6RA 4ZO6A 1AM4D 3NOVA 2CJFA 4NQZA 3C97A 2J9ZB 2QNBA 2ORWA 1Z5ZA 4R0NA 3R40A 3BEDA 4LJSA 3QPCA 5JSHA 3LK7A 4WFAV 4NESA 1GN2A 4JLSA 1IHYA 3T5MA 5K4AA 1KVQA 2Q2QA 2Q3JA 2YXNA 3WWEA 4BY9E 1QGAA 3CZ9A 3CZ4A 2UUBB 1Q2XA 1R5NA 2RBKA 4GD3Q 3SIPA 3LUKA 6YASA 3EPLA 1VMGA 3TZKA 1UADA 1XXHA 3CYFA 4H15A 4NPAA 3AG2B 2A33A 4O1IA 4XWYA 2RGYA 4AD8A 2NTEA 4IUBS 3VZPA 1S9HA 2PBFA 3HDGA 1XD8A 4J1TC 4CT0A 3L6RA 5B3JC 5BWMA 1PP4A 1OWLA 1UK6A 5G0SA 4YX9A 2QVYX 3EUEA 3VJRA 2ZPTX 5GWXA 2CE7A 3S5JA 4EVRA 2XAFA 4TTRA 5DM4A 1P33A 3Q6IA 4TWKA 1VQ5V 1DQNA 2FG5A 3QTCA 2FXVA 3ZJ5A 2X76A 1P9OA 4YY3O 4KXRA 4JI7O 1WDTA 2AI1A 2J41A 2P78A 3LCVB 4M0EA 1RJ9A 2Q28A 2YI9A 3T0GA 4C14A 1QHSA 1NTMH 3PWSA 4MEAA 3CPJB 2R7NA 1U5CA 4QEKA 3UPDA 3M5PA 1H1LB 4FYXA 5LCXA 4DBVO 4YALA 4OI4A 1M6WA 1Y0BA 5T8KA 2IEGA 16PKA 4QDUA 3UK0A 1BE3H 1EFKA 1Y7IA 1DUVG 1U9IC 3N8KA 4PYNA 1H1TA 1JIUA 3PTLA 1XZAA 3ZLTA 1TYEB 4HWKA 4Q01A 2D00A 1TK3A 3MGGA 2O3JA 3ANYB 2R6FA 2AT1A 4J29A 1G55A 4Q1VA 4O2AA 3UV7A 5A5GA 3HFRA 1Q7EA 1SHUX 3L8FA 1AV6A 4Y9DA 1NHGA 2DBYA 1GNQA 2MSNA 2P2GA 3TEJA 2W2TA 1AR5A 3EOZA 1ITZA 4BMOB 3HXQA 1PAUA 2I2CA 3BJZA 3NUZA 3AIOA 4L8FA 4TT8A 4CQLB 4X66O 2INGX 4PHFA 4CM4B 4ZCRA 5PNTA 3DEIA 1YHNA 1PG5A 1K6JA 3QXJA 3WL6A 4OQMA 3NVKI 4HNAB 1XMJA 1IBKO 4LW8A 3RG2A 2PEZA 3M6XA 4O4LA 1KBQA 1PFKA 4HH0A 4B0OA 1U97A 4UHFA 3ZWNA 2GHIA 3MXOA 1UOOA 2W0FC 2PZAA 1UUFA 3OQMA 1K6MA 5CEEA 5DZSA 3IAXA 1T2FA 2N9UA 1D2GA 3REOA 3NWBA 3ZMTA 1F5SA 2P40A 4HXYA 4CMJA 1Y8ZA 4CODB 2CKDA 4UCSA 2O3SA 1HC7A 1ZXBA 3AF4A 4FGWA 5FA5A 3L9DA 1NYQA 1ZC3A 3T4UA 2GPAA 3E7DA 1RLMA 1X92A 4OOFA 1P6OA 2V0GA 1K4DC 1P2DA 2J5KA 3KT6A 4DQ0A 5HKAA 3KQUA 4R2WA 3RC3A 2ZB4A 1XAHA 2P6JA 2XA2A 4B3MB 4I4TF 4Y2HA 3U31A 1Y74A 1Z2GA 3VKFA 5KDOA 3MNFA 2SNIE 3L1KA 4NJEB 1MB2A 2FWAA 2VJPA 1JW9B 2X9VA 4BFSA 2C4NA 2VT2A 2C7VA 4P5PA 3Q11A 3TZEA 1FW8A 5JJEB 1G21B 4ZBMA 1N4DA 5CLGA 4L5AA 1QQAA 1UP6A 2DHRA 2QTLA 5BSEA 3G67A 1KK3A 2OCBA 3IA7A 4CLHA 4MCIA 4OP2A 2XW6A 1TAHA 3ZMUA 3BG5A 3KHUA 1N34B 5IDVA 1BC5A 1ONSA 1JHYA 3OJLA 2EIMC 4F4LA 2V65A 3JATA 1VXOA 4Y6LA 1PNLA 3HH8A 2FHPA 4BQFA 1GA4A 1GKIA 3ZGVA 2IHNA 4HWSA 2O8CA 3DYVA 2GO1A 2Q3HA 1X3LA 1TGVA 2XRFA 4RTOA 1VI2A 4TXHA 5U9CA 3L8YA 1Q86W 2J46A 3MIZA 5I7UA 4ZA2A 4YIOA 2VT3A 5AVRA 2IK8A 3K03A 3A4IA 4MW3A 3IEXA 3NJ4A 3WBBA 3VUFA 4EA6A 1CYEA 1U7DA 4JLWA 1DX9A 3BGWA 3OJ0A 4UM8B 1G0OA 1OIVA 3LH5A 4NYIR 1LBSA 3OH8A 4R68A 2WJIA 4TWIA 4U9HS 5EAIA 3HSYA 3C0KA 2O7NA 4UOZA 2G5PA 1JWAB 2HADA 4FUTA 3WBFA 1SBNE 3N59A 3PITA 3KCXA 1LTKA 3A3YA 4O0LA 5J1TB 2IPNA 5FUVA 3WLQA 2GASA 3ROGA 1TC2A 1J70A 1JEEA 2WIKA 4RD3A 1P1IA 2JLXA 4L2IB 3FLAA 1CJMA 1YR2A 5AQEA 1P2SA 1T0HB 3TLMA 3MHSC 4DWWA 1BVRA 3N2LA 2DH6A 3H5LA 1T5IA 1VHQA 3TG2A 2I9KA 3WIDA 3E1SA 3DEZA 1B0AA 1CS0A 1EUDA 1JKJA 1P6XA 1XRQA 2H16A 4WADA 1WP7A 2ZCJA 2PBLA 2NT3A 4B6JA 3GLIE 2IW1A 3AKCA 2YDXA 3U60B 1WAZA 2CFRA 1PVDA 2AUNA 4Y1GA 2XVYA 3G7UA 3P5SA 1DMRA 3E53A 1OFTA 4C3ZA 1T0JB 4FFBB 1LSSA 1UXOA 2XJ4A 4OJNA 3KOUA 2B9ZA 2YFKA 4RELA 2ONJA 1UWZA 4FDUA 1E3MA 3A1EA 3A8TA 2QYOA 4EFNA 1F6BA 3VQYA 3H2JA 3KZ1E 4PLWA 1WSAA 2IYRA 2V45A 3WA7A 2AJLI 1SVUA 3TNDA 3JRNA 2XXAB 2GKGA 3HGTA 1Z36A 3PA8A 5FQOA 1EBUA 3VV2A 4A27A 3I04A 4GM1A 4I55B 2OZLA 1FFEA 2XUOA 1NJSA 2GK7A 1BHSA 1E2EA 2WW8A 1ZESA 4AY2A 1KYWA 4BO4A 1KETA 4F38A 4BNDA 5KS2A 3BPZA 4ZDJA 1JKFA 2I7VA 4TMFA 2AKEA 4QA9A 5HG0A 2PUTA 4ZHSA 4CKZA 3A1SA 2JGRA 2BFFA 2OM6A 1LBEA 3M7IA 2M6RA 4FK8A 2ZNJA 2J5XA 4G28B 5AFSA 1QF6A 1XYVA 5C32A 5J47A 3P0EA 2CW5A 4KN6A 3SHQA 3COYA 1VPDA 1JSXA 2Z0AA 2OTJV 1XDWA 4M46A 2M98A 3IOBA 4PO8A 4LFBO 1ZVMA 3D43A 4C4AA 5A5DA 2PE5A 1QP7A 1Y4AE 4LFAO 1GPLA 2GF0A 1MG5A 2Z5GA 3AHFA 3CTMA 5E4YA 2W42A 2IXAA 2KB0A 4MKZA 5REQA 1ZUD1 3Q6MA 1JBEA 4NRDA 1JSRA 2HBRA 3VHLB 1BQ3A 5E95A 2OD7A 5EWMA 5SYMA 2BRUA 3KKEA 2AYYA 2P3OA 4M1KA 5CM9C 2OFXA 5DXFA 2NUTA 3WL3A 3DBRA 1ZTEA 3BXHA 4U4AA 1QIDA 3FGZA 4UHEA 1GRCA 3SQLA 1ZM7A 2PLAA 4E4EA 4B08A 2GEKA 3FYHA 1G8MA 3WOVA 5LWQA 3E8SA 2GEVA 3AXTA 5EQTA 4JL5A 3QMWA 3QPAA 4AJEA 3KT3A 1L7DA 3Q1LA 3DBLA 1I5XA 1PKXA 1S9DA 2E82A 4Q05A 4NTXA 5HKLA 2ODAA 5B30A 1BMDA 3OHPA 2IUYA 1SZTA 4FC6A 3PQ2A 4P7KA 5HM6A 2O0KA 4KDEA 4IV0A 4EJ6A 4YV0A 2DR3A 2EFEB 1AY0A 2NO6A 3IODA 1T6BY 2C8KA 4DHEA 1BXGB 2FTKE 2XMCA 3SF8B 2PLWA 3WMWA 5ALGA 4LGVA 3D7MA 3TLCA 4IR7A 4YAGA 1GGNA 1XZHA 1P45A 1XZJA 2OBBA 3DEAA 4A8PA 1JEYB 3IDZA 5BR7A 4MQEB 2JRCA 2OV8A 3JVVA 3LUTB 4FXOA 4NYJQ 1KQNA 2EW1A 4PZEA 2XAQA 4Y67A 4M8KA 3L82B 4BXOB 4OBBA 4TQ9A 1IJFA 3CCLV 4FKBA 4JY7A 4KQ1A 2MW2B 4UHJA 3SQOA 2FRDA 3CC7V 3QVSA 4J0FA 2UZ4A 3N2KA 2C7BA 1EK6A 2C2KA 2WRZA 4I3GA 2HW8A 1Z2OX 4XVRA 3KR9A 5C1PA 4C0XA 1E99A 3R44A 3ZK8A 4XYGA 1X1CA 2RHDA 4RNCA 1GO2A 1V39A 2GCPA 1EFVA 2GDJA 4KIFA 4NU6A 3DBVO 3NTRA 4ZXPA 5HBGA 2IXEA 2J9FB 2L82A 2QVLA 1AKNA 1RI2A 1VLZA 1ACLA 1XMXA 3BH0A 3OFND 1HSZA 4H6PA 4KE9A 5JHGB 3ZDDA 1C7RA 3OESA 2A4MA 1H6CA 4YCCA 4OXSA 4PHZA 1DJNA 1NL3A 1VRVA 1B1AA 2BAGA 3VZBA 4FW8A 2I5PO 1AN9A 3LRTA 3ABKC 3H84A 4DW0A 4MV9A 1N33B 1ZUWA 4PXSA 3VNBA 1GILA 2N75A 3PLAE 3K9AA 1EXNA 1GO3F 2HJHA 3F98A 1T9HA 3AQ4A 5IBPA 2OQ2A 2ZBVA 1U0NA 4JUCA 2GVZC 3NM4A 3SYOA 4ND4A 4OK5A 2GT1A 4WFFA 4DV2O 1Q1ZA 2P6PA 2W4IA 2ZRDA 4MJLA 4N0PA 4NFHA 2EVWX 3FLEA 2XQIA 1LV8A 4X7RA 5CH5A 3BGIA 3PKJA 3RZUA 1SBYA 2XECA 4N6GA 3UXMA 2HA7A 3HVKA 4QJFB 5ILQA 3VX3A 1QR2A 1ZNWA 2E5LO 3ZD7A 4DCJA 4J0DA 2JJYA 2VZLA 2Y0CA 2QRNA 3EA5A 4RH3A 4W4LA 1EWKA 2ECPA 2OCPA 3ORRA 4JBXA 4PAGA 5AKKA 1RPZA 3PXAA 3G80A 1IN5A 1Y6JA 4FHCA 2BYTA 4BB6A 4KFSA 1L7OA 2WINI 3C48A 1E9DA 1OH5A 3C4QA 2AXTZ 3ED5A 2Q6KA 1YJCA 3LL7A 4DIBA 3O0DA 3SY8A 5JAMA 5DCAJ 1Q17A 3ZQUA 3LY9A 1VB5A 2O3UA 1O6GA 3ZJTA 3ZZ0A 3LQRA 3PJFA 3H11A 4J6EA 3FAVA 2YBDA 2GM9A 2P22C 3AJ9A 4E21A 3BTVA 2RGXA 3V55A 2VPTA 4JELA 2L35A 4JZGA 4D6TH 3H7AA 3P9KA 4GL2A 1F2TB 3N74A 3GGPA 3MJEA 4OLFA 2ODEA 4NCIA 3AU8A 4GPD1 2QLCA 1ZGGA 3ADDA 1CEQA 1VP3A 1HDZA 2CGEA 3QWIA 4QDJA 5FULA 4OX9Y 3KVYA 3OZVA 3IKTA 1JFFA 2LW7A 4NBLA 1E1LA 2HHJA 1XTSA 3RANA 1PNQA 1KJNA 3RCBA 3H11B 1WVMA 2H00A 4K6FA 4LWOA 1KH3A 4YRAA 1RYHA 5LGTA 2CCGA 3AP2A 1ZA2A 3CLTC 2WJYA 3I0ZA 3R5HA 3OMIB 3GAMA 5JSYA 1XZQA 2A79B 1A5ZA 2IS2A 2CUGA 4FYVA 4HWTA 1U4SA 3ZJVA 4X3OA 3H04A 4P93A 4U7PB 4DYLA 3T6KA 4TV8A 1YBVA 2I6UA 3H9UA 5EC1C 3X2EA 4A0GA 4E4RA 1FMCA 1AQ6A 3ADBA 1E9SA 4BKUA 4BB9A 3ABSB 1FMTA 4YMSA 2B5VA 4B9EA 4LNHA 1I4EB 3WYGA 1W5FA 2B83A 1J8VA 2N47A 3E2PA 3OZXA 4G1VA 2WK1A 1TJPB 3FUWA 2QQ0A 5TC4A 1CZRA 1FJGB 4EG0A 3W5CA 1WB7A 1I94B 2Z0MA 5SZIA 1WUTA 1XZLA 1ECBA 2ZM6O 4BPRA 4QODA 2JHCA 4NZPA 1XRJA 1Z0KA 1GUDA 4IHKA 3T7IA 2GK4A 1ZRNA 2JH8A 3ZWXA 3JPWA 2FR5A 2WLKA 3FROA 2J5BA 4HNUA 2KB1A 1JR2A 1E7QA 2A5GA 2PUCA 3WADA 4ICIA 3W7SA 1H9CA 4HADA 1WG8A 3WMEA 4BX9A 5D5HA 4G0NA 3UVEA 3DVQX 4FYWA 4HY3A 4XB6B 2J3MA 3W5HA 4M0MA 1DKUA 3DCYA 5DK4A 5HKKD 5L3QA 1SOVA 4NCKA 4BBAA 4GX2A 3H99A 3GO4A 4U63A 1DCTA 3OZFA 4CUJA 1XL0A 2A5JA 2Q6IA 4NS4A 1OCZC 1GNVA 1NVEA 3H18A 4LF6B 4DILA 4FLUA 2HA5A 4RAQA 4YCMA 2CBXA 5AJZA 4HLUA 1BMQA 1ECCA 1I2CA 3TTWA 1VL5A 3QX8A 3IEMA 4NG5A 1N2ZA 2FPLA 4KH1A 4A92A 1BS9A 1MBZA 3PQEA 1B16A 3A4VA 4F2WA 3H1EA 3B13B 1BDJA 1ZHFA 4L9AA 2OYQA 4IL6Z 1NBMG 3HU5A 5TF4A 3AESB 3JQEA 1SM4A 5GOTA 1OXKB 2PT9A 3OTWA 1XCBA 3V7YA 4TKVB 1MB0A 4I55F 4IRMA 3NXSA 4JQSA 4IT5A 1OF1A 1N2IA 2CSUA 1NM5C 2PZMA 4LY3A 1IIRA 4HNGA 5K4GA 3A58B 3NBUA 2QP9X 3BN3A 3FIUA 3EGEA 2MDTA 3DYIA 3QFSA 4ENUA 3CCEV 4KHZA 3RK0A 5IFKA 3BMNB 3PQ3A 1IHUA 4KAXA 2EWVA 4A6XA 4X62O 4CH6A 2BC9A 3CCMV 4NYMR 1E3QA 3R2JA 4M36A 4C7OB 1Q22A 2QG6A 3CMMA 3MM4A 4ARIA 2EX1A 4PS0A 1MAVA 2UVPA 1C4WA 2GEBA 1LTQA 1PW5A 4TL7A 3M1AA 5AVOA 1EWTA 1R88A 2VH1A 5DYYA 4JI8O 4ABTA 5K3SA 3V9PA 2IOQA 3WB0A 4C3VA 1NFFA 2OT3B 5A6VA 1E1RG 4MTLA 5H83A 1RNLA 1KYVA 2PHZA 1KY2A 1H0RA 2AFIA 3CRVA 2ZIWB 2GN6A 2ONZA 3DO6A 2V7WA 3GFQA 1IXBA 1B6TA 4TMKA 5ALUA 4KLAA 3RU7A 2XASA 1YKSA 3S1LA 4ZVUA 1XWFA 3AT1A 1SD5A 2C0CA 2H57A 3FPLA 1G5PA 1GTVA 5E9AA 2D3OW 4OSEA 1H38A 1Y8RA 5CH3A 4WKBA 3PEYA 2P30A 2UXDO 3OZUA 3ZBPA 3ETCA 3OCWA 1EFPA 4OFBA 3E2MA 3WK9A 5BOSA 2O95A 4YT2A 3L6OO 2O54A 1PDWA 2O2IA 1YR7A 3SJBC 2XGMA 3G49A 3VVBA 4MYSA 2NLJC 1UJ6A 4KQHA 2WWWA 2QN1A 2Z4TA 4JR0A 1OIWA 4WN9A 3S5UA 1KBZA 2UXCO 1H93A 1CXZA 5D7NA 4R2MA 4DEVA 3KWLA 4GM0A 1IUOA 3HWRA 4QBTA 5F4BA 2VQFO 2PKQO 2I4OA 3P4YA 4P54A 3A1DA 4DIOA 4L6IA 4XX0B 4LJAA 5ECYA 4MPDA 2LGWA 4FZRA 1PR0A 3MCWA 3TL6A 1I3LA 2AC7A 3PJSK 4K9NA 5A7FA 1G3QA 4KUHA 3EODA 4IWXA 3FNEA 3LX4A 4CIDA 3EY9A 5AVYA 3KZVA 4W1SA 2VT7A 5FFNA 4KQCA 2OGUA 5DJ5A 3PG5A 3PQ4A 3I01M 3Q9UA 5I6DA 4QO7A 3UT6A 3L84A 3DV0A 2I1QA 1Z9BA 4FDTA 3M0EA 4QNHB 3X2QB 3D6JA 4RPHA 4MRVA 1IZ3A 5HIKA 1H4TA 3HR8A 1CW2B 1Z83A 2X22A 3L5OA 4FMBB 3K79A 4IXTA 3SJ7A 1F60A 4RXUA 1SWVA 1DOAA 1CVLA 1ZMOA 2PL9A 2XOEA 3IP6A 1UWCA 4FMCB 4KNWA 1RCTE 4KYIB 1GT91 1KJWA 4H08A 3A6LA 4JWTA 3L7NA 5GP1A 5JRDS 3AZPA 3RZVA 1HX7A 1HDOA 1G64A 4H1HA 5GTDA 4K9PA 4IQ8A 4CI9A 1LRLA 3HYCA 4HFRA 1XWIA 2E21A 1PT6A 4EA9A 4ER0A 1LI4A 4FYIA 1N77A 3BFXA 5K0CA 5FNVF 4KACA 1XQ9A 3CCUV 3RKRA 4A2PA 4BOYA 1XZ8A 3ZDRA 2CNOA 2X2OA 3M1IA 5BRNA 1ES9A 1ZI6A 2WHYA 4DA9A 1B93A 9ABPA 2BGNA 4BVJA 1S72V 5CJPA 2Q0OC 5KOHB 5LUAA 4O2BA 1LQ2A 3EHEA 5EK0A 5JR3A 3VQWA 2J4CA 3QNEA 1FP6A 4OHVA 5H82A 3UH1A 5B5SA 1U7WA 2Q1XA 1P31A 2VP6A 4KK3A 3U17A 4CUKA 1SD2A 5EY5B 2WJ3A 4DDHA 3DAGA 4EO4A 2W48A 2JFVA 5A7HA 2PA0A 4QE7A 1F2UA 2DYKA 2FX3A 4MAMA 2O2GA 4MS4B 2F64A 2GK6A 3REQA 1A4XA 1XHFA 3MOIA 1BWQA 3GLIB 5K0EA 2AZXA 1WY5A 5KKCA 1Q3TA 3KAQA 4PY2A 3OFVA 2P4VA 2CXQA 3K15A 1O89A 2ZBGA 5JZ9A 1TO2E 2ZJ8A 3KJNA 4B84A 4UD6A 1Y5NA 1NC3A 5K6AA 3RRJA 1AJQA 1XTVA 1Z4NA 2V8BA 4PANA 5CITA 5JJCA 2NXWA 3KX2A 3T0FA 4INJA 3T9AA 5AUOB 1AZSC 4ZDWA 3ENWA 1Z45A 2PX0A 3RE1A 1XEQA 3O47A 3R3XA 2VF7A 1Q5OA 3GLIA 1XMOB 2WD7A 1PYGA 2AC4A 3RJTA 4IX1A 5IBCA 2JIOA 2ON6A 1SR8A 4AJ2A 3QNWA 2VIIA 3HBFA 4G4SO 4WWHA 4BCDA 5HHTA 3Q98A 5CA3A 1RYZA 4AMUA 4PCVA 1NQ5A 2J30A 1KYXA 4F56A 4PG8A 2P9GA 4P5DA 3IQDB 4DN6A 1H2WA 2XF2A 5EXEA 3U11A 4F7OA 1GQRA 4MW5A 4YJGA 2J0QA 4L16A 4CTJA 1YUBA 4ALMA 4DJAA 3BS4A 3IS3A 4E12A 2WTAA 4XUGB 2PXXA 2PKYX 3IFSA 2W5UA 3QG1A 3PNPA 4PIMA 1RI3A 5K05A 1C9MA 2PZFA 3PCTA 1DG9A 5EMMA 4HNTA 5JQGB 2YV2A 1KFJB 2ISQA 4ZCMA 1WMFA 3D9QX 4B4OA 2IDMA 1Z5VA 1GPYA 1XZPA 1GXSA 3FWPA 4ZFTA 1Z25A 3AHDA 1E1QD 2JVDA 3K8QA 5ALIA 1TRKA 5CCBA 1IZYA 2FMHA 1DHTA 4GKAA 1DE0A 3QXCA 3IKJA 4H3VA 4PLCA 4GG1A 4EHBA 3A2NA 1OR8A 3PTZA 3U7IA 3V1KA 3L0DA 4CKWB 2G06A 4RA9B 4UUJC 4HN9A 4QT4A 1DKNA 2HA6A 5K6AC 4QUIA 2ZXWC 2BLLA 1ISSA 3GLHE 4GOKA 1BGVA 1CT9A 1XDDA 3QOYA 4HWGA 3R9WA 3VTZA 2PKEA 3HWSA 1DT3A 1AV7A 1PT7A 4UPDA 4XPZA 5DGDA 1XMQO 4ZJUA 1Y81A 4PFKA 4D4LA 4D9IA 4YACA 1ST2A 1XAIA 5DYGA 1RPOA 3DFUA 3EGDB 2F4VB 4OM7A 2NUTB 2ZJOA 4R1MA 2IP1A 4YDSA 1RXCA 1JDNA 1EG7A 5KHJA 2VC2B 2I7DA 3JQCA 4JJ8A 2BKXA 2RK6A 4XSVA 3UY4A 4OWPA 1YXMA 2IV3A 1XNQB 3ZJYA 3L5KA 1CQPA 1CZLA 5LHHA 4ND1A 3B89A 4FR5A 4NMWA 4HFMA 4M0FA 3IPXA 2ZAMA 4KAJA 4KQWA 4OB6A 4OQFA 2H92A 4TVOA 3BD6A 4BN0A 2DQSA 3HJCA 5LNK1 3T06B 3KR2A 5I8PA 3K9CA 4OTZA 5MGNA 3CPSA 4W4KA 4UMDA 3UM9A 3CJHB 3DFZA 3C6YA 3T99A 3U4IA 1XIVA 1FQOA 2FPMA 3ANXA 2ZUWA 3AUAA 2WF8A 4XCVA 4BNKA 4KR6A 4P5EA 1W76A 1E96A 2LGQA 3U3RA 4GI1A 4YCJA 3WIBA 4JB0A 3QU9A 1N5DA 1P7WA 2ZS7A 3ZU4A 2QA4V 1ORWA 4P36A 2C1EA 2M6LA 5C46F 5KLVH 1LCIA 1KFCB 1T9GS 1YZHA 2G67A 4OHXA 5LQKA 3SZGA 1CUDA 5CFRA 3S81A 5HRUA 3TD2A 5DNYB 3AR5A 3C3JA 2MTBA 2X5NA 3LKBA 3W4JA 5JEEA 621PA 1KH1A 1SEVA 2OCIA 3IEPA 1Z07A 4CKCA 2DU8A 1H9BA 5T41A 1E77A 2NQTA 2VDLB 3KB6A 1DBSA 4JR1A 3COZA 4ETWA 3UPUA 3F4BA 2FR6A 2ZS8A 2CAZC 3K8YA 1GARA 2JJMA 3EAGA 3BH6A 3L3BA 3OP1A 2WQZA 3C2QA 3EGIA 4IO1A 2QSAA 5KNBA 4GXQA 1FLAA 3E3LA 3TXAA 3GT0A 1FFDA 4BZWA 4JODA 4BP1A 3U3MA 1UEXC 2C00A 2VR1A 2HRDA 4P3XA 2BZ1A 1JHQA 1K98A 2I6FA 2UUOA 3OPVA 1WPGA 2EQ5A 1OPXA 2CK3D 3AERA 3H4MA 2G80A 1N8TA 1PYOA 3PEFA 4PRLA 1G60A 1Q92A 5DGCA 5IEBA 3RC9A 3GJYA 4CM8B 3KVOA 4RTJA 1UAQA 2JJ2D 4DOMA 4WN9B 4D3YA 4H4CA 3ABLC 2Q41A 1UOEA 2C94A 4U8GA 2NV0A 5KJFA 3O8OB 1T3HA 2O20A 3G59A 1QS0A 5A9RA 4FE3A 2WLLB 4UEOA 1GLNA 1HGXA 3WQHA 5J4YA 1M34A 1RAAA 2E75B 2PYDA 2ORVA 2OXFA 2P27A 4OV6B 5LD2C 2FEMA 1P1BA 2QRVA 4I50B 4X95A 5I9IA 2O2EA 1MTOA 1I6LA 1OREA 2R7MA 1USGA 2RARA 2D8AA 3L8CA 3ROQA 3VR3A 2NP6A 3AG7A 4RABA 3EGCA 3LZCA 4Q4JB 1OHHG 2JANA 3CZPA 2Q62A 4FQ7A 2LW1A 4W1PA 2XT9A 1UKAA 1IZ7A 1Z4PX 1UPFA 2C83A 4MUHA 1D5WA 3GLQA 4LF5B 1UZLA 1QRSA 2QN7A 4TV8F 2F93B 2Q46A 2EP8A 1CUBA 3MTAA 4I14A 1USWA 4MVRA 1MOPA 1O96B 2DYRC 2E37A 1GPMA 2PSSA 1F4PA 5DH9A 1GNLA 1F2TA 1SETA 4GLBA 3UAYA 5JEDA 1ZN7A 4WZAA 1L8OA 4V1CB 4HDRA 2O8EB 4DGQA 1UPAA 4HH1A 4DQVA 4PF1A 1PHRA 3FSJX 1RWMA 4GOMD 4MUFA 1TAEA 1G6HA 1R8SA 1TYBE 2HKIA 3OI7A 1EK2A 3X1XA 4KPFC 3DFIA 1R4ZA 1EFTA 4AMGA 3EZNA 1WHSA 2ZRBA 4ZYUA 2FDXA 3KE8A 2W2OA 4KI0A 4WZAB 3OGCC 3FCUB 1JAIA 3WKAA 1AUPA 1AR4A 1SUFA 1AO0A 4W63A 3LZDA 3T38A 3VSCA 4YRBA 3NH9A 3FCCA 4MQFB 3P9NA 3WLSA 4HATA 5AYVA 3D3EA 3X1JA 1A77A 1RLJA 4J75A 3H9VA 5J2TA 1VQ8V 3LO5A 2DCUA 3DE3X 2GXAA 5BV8A 1Z2AA 4LDPA 1YK1A 3M4XA 4PG7A 5IKMA 2DMRA 4EELA 1EFLA 3R75A 2VDQB 4TLEA 2W8BB 2C82A 2XDYA 2BFCA 3EEQA 4JT8A 4AZ3A 1NMQA 2B5UA 2O06A 3KB2A 3W04A 1IXRC 4MI3A 1KO1A 2XNJA 2YUIA 5BURA 2NPOA 1Y7PA 4REMA 3NHWA 4ZI3A 1VSQA 5LQJA 3FETA 3U1VA 2O8DA 4XBFA 3EQ6A 2XNDG 1MW9X 1EUZA 1YE5A 2VHQA 3KEFA 3F7TA 1SVMA 5GMOA 4AG3A 5B57C 4OPHA 1N36O 1M7HA 1BJRE 1SAYA 2BZ0A 4RFVA 3U5ZB 3AG1B 3G4SV 1SU6A 2NVUA 2OIEA 2JLWA 1XV5A 1VIDA 3O38A 5FO1A 3NRCA 2BY4A 3CLVA 1DDOA 4KZKA 5IBRA 1TT7A 5AVUA 5HUHA 4D46A 3M3PA 1NQWA 4MWOA 1ZBQA 3AGQA 3IMFA 3LMKA 4PAMA 2XD9A 4NP6A 4RX1A 1KGDA 1SOMA 5ARDA 1ZINA 4IAOA 1TZ2A 1APBA 1XZBA 3RRBA 5AKGA 4ZOAA 2WQ7A 1YVPA 3LW7A 2H4JA 2QZSA 3DWFA 3L4EA 4IFIA 3U80A 4X24A 4QFCA 4Q93A 1H4SA 4PXYA 4DMUB 4OKNA 1DJOA 1HLPA 3DEJA 1K97A 4DIKA 2ETXA 3ES9A 4M37A 1E6EA 2V7QD 4Q7MB 4QUEA 3GWGA 5TPWB 3TD9A 2GPSA 1WKCA 2FSIA 2QGNA 2OHIA 2R00A 3F1KA 3OOJA 3W6PA 3OF5A 1MVLA 3LUGA 4PRYA 3NBXX 1OX6A 4IS2A 3QLEA 4L5YA 3F71A 4ZAXA 4Z6KA 4BVAA 1R0SA 5C35A 4WFBV 2BDUA 2CNBA 4Q3DA 1E8MA 2EIMB 1ZHHA 3UW1A 5K4HA 3FVVA 5FF9A 3TE6A 3ADCA 4BATA 2GUZA 1ZSNA 1D2MA 2VXYA 2ZM6B 3DP9A 4UAUA 4UU1A 2QN2A 2WZQA 3O9MA 3DLCA 3HRIA 2TMDA 1VJGA 4OY3A 5FLXN 3E22A 1V45E 3L40A 2PQ2A 4RM3A 4EZBA 5C8YF 5KYTA 2C5SA 4BB5A 1DQYA 2ZBUA 2BWJA 1WA8B 1DBQA 2NN4A 3KKOA 4JLOA 4WIFA 2PRZA 4DG5A 3ZXYA 1Q0LA 2EKLA 1OCCC 2HMWA 4EW2A 1FSFA 3OBBA 2F9MA 4HDNB 1DKMA 2AFIE 1MP0A 3GG2A 1CUWA 1R6AA 5I9BA 1H4QA 2VYFA 3I4LA 4J0GA 1EVEA 3K96A 1RC0A 4JZ2A 1OILA 2CTWA 4AU1A 5AW3A 1UCFA 3K9BA 4R98A 4A5SA 1D2NA 3EFFK 2OVFA 2VCYA 3ZVRA 3IT1A 1ZY2A 5KX5F 3OGIB 2WKSA 4E14A 2YXPX 3I6YA 3ZWPA 4Q7LA 2PIDA 3TIFA 1TYCA 2DCMA 4X63A 3SZOA 4G8BA 2ZWPA 3I5XA 2FUKA 2HF8A 2ICAA 2Q6AA 1JLHA 3RFRA 1IN6A 2QAJA 3D7RA 6GPBA 3ZR4B 5JZVA 2GD1O 1V6CA 1WF3A 3ILSA 4O2RA 3EMKA 3WZLA 1JJFA 4KDFA 3WL7A 3TLGB 3FX2A 1NA5A 1N2CA 3SIRA 4U3JB 3BE4A 1SXJC 4Q3CA 1ABBA 1GCAA 2B7LA 3D6MA 4GKJB 2GJKA 2IHYA 1R6KA 3CR7A 3G85A 2DAPA 4U2EA 5B66Z 3G8DA 4DADA 5L53A 1A2QA 1JWLA 1MSWD 4GZ3A 2SCUB 1A9XA 1Q0PA 1PGNA 1QQTA 1Z2NX 2QD4A 2JLSA 4FILA 2ZSIA 4E0BA 2GD2A 4QAJA 1Z6QA 2H5LA 3EXFB 2OV6A 3HK2A 2YQZA 2CKMA 2H7VA 1K27A 5JT1A 1RZRA 1ZHOA 3L75H 4JP5A 5IDQA 3FSGA 2OHFA 3A6PC 4QE3A 3BEOA 1M1YA 4UE2A 1M73E 1VCHA 3I37X 3AERB 4LF4O 1BXRB 1YS9A 2Z57A 4GECA 4JU9A 3DMGA 1QG6A 3KFLA 4QIHA 1Q1BA 2ZUVA 5D8DA 5D7BA 2QBYB 4GMDA 2QUJA 4X64O 3CR8A 3HCNA 4D57A 3I1JA 4KRXA 2XBMA 1PJTA 1I0IA 1SKUA 3II6X 2KE5A 1RQRA 1M2HA 4EAQA 4QFTA 2ECFA 1PT9A 2CXHA 1NFRA 3C70A 4G5RA 2CUKA 3SNHA 3APOA 4MUKA 5E7QA 1NUTA 1Z3CA 4LZWA 4DDVA 4HFJA 2AG8A 4HQNA 2PYJA 2QWPB 1B0PA 3FOEC 4QWMA 1MIOA 1VB3A 1KA9H 3QIAA 4BEBA 4QQKA 3IV9A 1IY1A 1UMDB 3EYAA 3KELA 3IH5A 1FTWA 1CULC 1GM9A 1EQ2A 4TN5A 1EXDA 3FBTA 4FQ5A 3KOWA 4BGUA 7ADHA 1W0KA 3UXYA 3K5NA 3FUXA 4XOIA 4H31A 1OBOA 1Z6GA 1N1GA 2VQDA 2XHEA 4ZVKA 5AVJA 1PZXA 1ZOOA 1RHKA 2KPOA 7MDHA 3QVMA 3O95A 3H86A 4QYWA 3PR3A 3KSUA 4BO7A 2XAGA 1I5EA 4H0FA 5CJJA 3KDSE 5EJ5A 3GD5A 1KPIA 2WD8A 3MF4A 4HAUA 3WLOA 2FGKA 1Q6HA 4IDFA 3MMPA 1K6XA 3MFQA 1GRQA 1MV8A 2ZWIA 4MMXB 1A72A 4FZ1A 1QDEA 3OCXA 4E2FA 2ZM5A 3K09C 1V48A 1V47A 4N39A 1G4AE 5JADA 2GSDA 2PGLA 3BXFA 1RACA 1K2WA 1NMXA 4C5CA 5ADWA 1T8WA 2EJ7A 2UUCB 4DDKA 4YMHA 3GWOA 1D03A 1KD1W 3L07A 3WX0A 4W5OA 1RRKA 2Y69C 2D0DA 4CMAA 4IIGA 5JAPA 1C0LA 2O2JA 1T4CA 4L3VA 3RVLA 4DJEC 2C2OA 3GLSA 3FTFA 5BSRA 5KNCD 5IK2A 4OHFA 5AVKA 1W85A 2D7JA 1T3SA 3QMPA 2J3IA 2C29D 2B1RA 3DQZA 1TF7A 3FJ1A 3ASOC 1ODLA 2GCEA 5LDHA 4NCBA 2R97A 3CUEF 1KZGB 3VRHA 4B6OA 1CPYA 4BKPA 4IIJF 5JO9A 3HUDA 4PZDA 1DXHA 1XXHB 2JIBA 4YCNA 2F1HA 1PQWA 2HWWA 3H9QA 3KXPA 3ND6A 3CT4A 1H8HD 1VCMA 1VYVA 4R3WA 2XZPA 3RABA 3AFNA 4BFWA 5JUWA 5BUQA 2O3TA 1HNZO 5FD8A 1F4LA 2PWBA 5KUTA 1PNTA 3N8GA 1TL7C 4UUAA 1H2ZA 1NURA 2G0AA 4P3YA 3I0MA 1E1RD 1ZH6A 2EX4A 2QENA 3RUCA 3V8BA 4A8JC 2AMLA 3NALA 2F00A 1QRRA 3FYCA 4G4IA 3AJRA 4XQCA 1PL6A 2IYOA 1MH9A 2IJHA 3SC2B 3T4XA 2IA5A 2G82A 2GN8A 1QOQB 2LVBA 3AOGA 2NU9B 2NVUB 2P9QA 1EESA 3IT2A 3S2GA 4D9EA 2EARA 3GZNB 2O7PA 3GLFA 2ZI6A 4Q7KA 4ZMSA 4WRRA 1IVNA 1C1XB 2RQ6A 1NJFA 3C8UA 4FR0A 4BVGA 4RTKA 1QQBA 4BIMA 4FONA 1TYDE 1BWSA 2D4HA 4XYLA 4AKIA 2AZDA 1CJUC 2XUKA 1TF2A 4JK3A 3SYRA 1VMIA 3D4LA 4YASA 2VH5R 3PRHA 5UKDA 2AQIA 1WCWA 2AOXA 2EZ4A 2JNWA 3QFTA 1F06A 1SXGA 2DWCA 4MH0R 4NABA 5L7TA 3GPLA 1NKTA 2EFJA 2FR8C 3FUUA 1Y1LA 2C4MA 3KDAA 3NHBA 4WJZA 5A03A 4D81A 5HXAA 1F6DA 1W30A 1Y34E 2C92A 2P6UA 3K04A 2UVQA 3GBVA 3LQ4A 4X61A 4WLFA 3KYJB 3SC6A 3SR0A 2D5NA 1MAAA 2Z2ZA 1OX7A 4JB3A 4DR3O 3WHLA 5E6UA 5BQXA 4BW5A 4P7JA 1OJLA 3BF8A 4HAZA 4MYRA 2I2XB 1NW3A 3FTCA 3DSQA 2VDNB 1MJGA 1MZPA 1VE7A 1MC1A 2W90A 1LU9A 3CLUD 3ZDXB 2D1TA 5IYBO 2PGAA 2HJGA 1BSVA 3GAZA 3OTQA 5AOVA 4N82A 1QGED 2F8MA 3K1JA 5ANRB 2IPLA 3C45A 4XIYA 2C54A 3SXUA 5BYKA 4EKGA 5AVQA 2O3QA 1Z34A 2VZ9A 3U56A 3H13A 3PEWA 3OUFA 1AP6A 2F62A 1YBHA 2Q7XA 5IBQA 5C5CA 3PF9A 1DAFA 4L5IA 3JQFA 3JD1A 5CEJA 3AG5A 4G6ZA 4L0MA 3GBSA 2Q1WA 2JAUA 2CNLA 3U3DA 4DRXB 3FKQA 1VIAA 4HDKB 2B1IA 1OXXK 3EB9A 5K8LA 3IDQA 4WINA 3I72A 1UBEA 4CN9A 3G2QA 3TPCA 5I47A 2WG2A 3VTAA 1JF8A 2JJ1D 3T3NA 3P9RA 4GOJA 1S8FA 3QU7A 4DUZO 4RS3A 2WIAA 4M9SA 3DZDA 2HPVA 2VDUE 1R0LA 4P83A 5DF1A 4ESEA 2PUBA 3INYA 1YS4A 3EZ9A 1A2KC 2C9MA 3FKSD 4M3NA 2IH1C 3L7DA 3WGKA 1TPZA 2Y6VA 2XCOA 2CVQA 4QASA 5D2CA 1UPBA 4MVUA 4OFWA 1GYPA 1IBLB 1XZKA 3EZYA 5AM1A 5FLKA 1PFWA 4ZCIA 1L4EA 4QHSA 1EK0A 3NWOA 1TTHA 2ENWA 3ETJA 4OGFA 4O25A 2YOFA 2JBHA 4J91A 4DC0A 3I55V 1QJCA 2TYSB 2MIIA 2WF5A 4FD2A 4FFNA 4M99A 1EGMB 1P7CA 4UDXX 4ZO9A 1R12A 5HGJA 4V3CA 3RWMB 3PIDA 4BN5A 4BZPA 3N5CA 5BWBA 3JASA 5LOVA 2OTCA 1AD2A 1LEHA 4QU5A 5L3DA 2FG6C 2HMYB 1V54C 3U9SA 2BKLA 4D3XA 3PS9A 3HA7A 2E0IA 2O6HA 3TDNA 1VK9A 5GIOE 1M1NA 4LRXA 5AK0A 3MS4A 1H2XA 1QZXA 3E3MA 3U7QB 4HOYA 1UJCA 4EFMA 2HLDG 1Y3DE 4OI0A 4MDEA 4ROTA 4B82A 4YJ3A 4IGEA 3COWA 3T0IA 2BHSA 2JVIA 3THSA 3ZIAG 4JYCA 3WGTA 1D1SA 4ZOLF 3ZZMA 3U7FB 2P2YA 2YVQA 3IBSA 3K2QA 4MULA 4CU5A 4S1TA 3UXHA 2CDBA 3DFFA 1PK7A 3H5WA 3NHMA 1IG0A 3LOUA 4UBNA 3PIRA 1DX4A 3SEZA 1QVVA 1KSHA 2CUZA 1H1LA 5C8YB 1R0BA 3I6ZA 4UEKA 3VTFA 2E49A 4EYKA 3K3PA 2NNLD 2C77A 3K1YA 2AR0A 7REQB 1GM8A 1RP1A 3OA2A 4RGYA 3PDCA 2TMGA 5L3ZA 2KW5A 2KSDA 1NBIA 1P18A 3G2KA 2NZUG 2A0WA 1GY8A 3ZDAA 4IDDA 5CEFA 3C6ZA 1U3VA 1DWOA 2EKBA 3ZCTA 5BSKA 2VPYA 1K6IA 1RBYA 2ZIVB 2X7RB 3SDZA 3WWZA 1TGOA 4GSKA 1SIWA 3DOIA 1T5SA 3NI2A 5ITSA 2VKQA 1G4UR 4XQ0A 4CL2A 5ITWA 1KK1A 4GRAA 5FR2A 3QOXA 2BLNA 1HLGA 4AWXA 4EUEA 4M87A 1E9EA 1NVXQ 5HQ3A 3HKDB 3MOGA 1LUVA 1RLTA 1Z4LA 3WWPA 4YRIA 1QONA 1JG2A 3OUTA 5B1NA 2YXEA 2L19A 1LFAA 4IY1A 5DHSA 1LH0A 4L51A 1AUXA 3C7TA 2EJCA 1VHLA 4H4DA 1CIPA 2FMIA 4WLVA 1Z29A 3NO4A 2YQ4A 4JROA 4Z9FA 3SHVA 1X1RA 1ZGBA 2BMDA 4D6PA 5AXAA 1D8AA 2VYVA 3HB5X 2I1VB 5LUBA 4CH5A 3DHWC 3RYHA 2ZJ2A 2HRQA 1KI9A 3EF1A 3VO1A 4HFNA 4EFLA 1FRQA 2EBHX 3AF5A 3DBLB 3L4SO 3M5DA 2FPPB 1BFUA 4OAPA 2IWRA 2DFPA 1TKCA 3UJPA 2POCA 3FB1A 2WLNA 1U5BB 3GUCA 3ZVNA 3DF7A 4N3GA 1CUSA 4CM1A 4I1RA 1DI0A 5EZQA 2YZ2A 4ZT2A 5KDDA 1WBDA 2HEIA 1Q21A 1E7MA 3LLSA 1JS1X 1ZGJA 3O9ZA 4GR9A 5DYNA 4CN8A 3NDBB 3M9WA 1MB9A 2WMYA 2X4LA 4ARUA 1JSZA 3OO1A 3HVJA 2RGEA 3IVMA 3KJFA 2QXUA 4X90A 3RBXA 2DKOA 1LR1A 2C7PA 2HYDA 5BNZA 1AQUA 1NVMB 4S0XA 1N5MA 5BMVF 1ZNZA 2DFKB 2DJIA 5FJIA 3K31A 3O8QB 1RKBA 2HWKA 3GJ3A 3C6KA 2DLDA 4C21A 1ISFA 1SGWA 2AOTB 3F1LA 1U96A 2IJIA 1G2PA 1PJAA 1TA9A 1YZYA 2CMGA 2ZROA 1Y1QA 4F1JA 3BCSA 5DBEX 4D5EA 2BGWA 5DI9A 1OROA 1HE3A 1H2GA 3S3XA 1U3UA 3ETQA 3V1MA 2AI3A 4LS3A 4Z53A 1PQYA 4UVGA 2IH5A 5FPHA 1NXSA 5FUWA 1K2VN 2FW0A 5M34A 3A10A 4GOXA 4L22A 2BGGA 2XITA 1G63A 4OJYA 4MP6A 2RE8A 3IQWA 2IOFK 2O5RA 2A0FA 5JS7A 1YDWA 3CO5A 4ID3A 2ATKC 3GWZA 5CX1A 3P9IA 2IHVA 2C97A 1OA0A 3WFIA 1XAGA 3L05A 4CG1A 2QLBA 1KSGA 4K9MA 3UATA 1GKLA 3QUSA 3MINB 1AZTA 1HL7A 2X9NA 3QWHA 3CS5A 3RDPA 2JBWA 3CWCA 4KN5A 2RSLA 1MG0A 1NY6A 1H94A 2YJ3A 4RUKA 2NU8A 1KAEA 3DS8A 1GAEO 1JA9A 4XPIA 1ONPA 1JKJB 3BK2A 1V3UA 1T2AA 3MJ4A 4XVHA 3A05A 4R2JA 4BRWA 1SHZA 1JG6A 1T2CA 2HJWA 3AUFA 3OMXA 2XWPA 3IOMA 1AQLA 4Z1VA 1RWVA 2X0LA 4NY1A 4UE6A 5BVHB 2P41A 5C7IO 2D7DA 3PNOA 3MGCA 4JC0A 2Z2JA 4YRCA 4ZRDA 1IL0A 4W9NA 5ILOA 1XTIA 3K0FB 3CB2A 2GEUA 3D0OA 1KERA 3MS2A 1RWPA 4LTDA 4PIPA 5CVDA 4ZQGA 3N3BC 4N8SA 4DIDA 1KRXA 5FWXB 3P96A 4UB6Z 2H29A 3VH2A 4DV6O 3DMNA 1PL4A 4J11A 3WE7A 4CV3A 3C8MA 3QTLA 1LQTA 1SU4A 2O7RA 3EK2A 4EHAA 2R2AA 3VPDA 4TMVA 4LP8A 4R1SA 5EERA 3DVRX 5FI3A 3NC0C 4ZYXA 3NBFA 4JJZA 5EN4A 1KXJA 5J2UF 3GJZA 1V54B 3ULKA 4F9TA 5JSUA 4Q03A 2C04A 3BQNB 1A2BA 8LDHA 5BYBA 3QXGA 3JWGA 1K7DA 5K1XA 3GEGA 1NN3A 4YDHB 5H6QA 5DDIP 2GCNA 2E5WA 2ERCA 1NYRA 1EBFA 2P91A 3KJEA 3PXUA 1B6RA 5EP4A 3QV1A 3OKFA 2ZZKA 2B8TA 3VM6A 1WQ1R 2EG5A 3M4JA 1GPWB 4WFKA 5KINB 2QWQB 2EILB 2VDJA 4PBTA 4BJ6A 4PLTA 1S02A 3OQBA 2C84A 5AW5A 2WJHA 5JASA 2C5BA 4F3KA 4GUNA 2CL0X 4WBNF 2C7RA 4A15A 1ADJA 4J16A 1XRLA 3IX7A 4RIGA 4BC1A 4DLSA 2NO4A 3LPCA 1XL4A 1E9CA 1AKEA 5IARA 4YXWA 4R2IA 1X9IA 2NSHA 4RGQA 3T3EA 4RF5A 1VIBA 1JQEA 5EYPB 3GT3A 3OIDA 3OPMA 2EL7A 4GAEA 4JBLA 2D5IA 2DBZA 4X7MA 5E7IA 5KIAA 3OEYA 3C3BA 1W2HA 1ENVA 5EMNA 5L3RA 3RS7A 1Y7LA 3O6VA 3OJCA 4MO9A 4MW1A 4D0RA 4RCZA 1V7QA 2LUOA 1X7ZB 2ZR3A 3L7LA 4C04A 4NS1A 2VHWA 4QZVA 3AB7A 3OTGA 4EHKA 3SHOA 1R4MA 4IXMA 1PGPA 4C0LA 4LQLA 4D4IA 5BN4A 2HEPA 5DYTA 3W2FA 1F23A 1W19A 1M2GA 4D92A 4U1RA 1U0GA 2WLTA 3R20A 4ZYTA 1ZIDA 4P4TA 2YYZA 3PNVA 4DR2O 2IDJA 4KFRA 1DEHA 2ADFA 2BV3A 1DVRA 1OU4A 5IVHA 2XNDD 1NFQA 521PA 2WJ4A 1SQXH 1UC4B 4MW9A 4ZJYA 3WZ2A 3I2HA 4FYJA 1RI4A 2VDRB 1OMOA 2XGGA 2JASA 1E5QA 1JJIA 4EFDA 2C8LA 1EUQA 2Q5ZA 3ZWCA 4BCCA 1FEZA 5FOQA 4C0KA 3K70B 5TQ0A 1I7QB 1YIJV 3ZGXA 2Y1DA 4B3HA 2B1GA 4L5CA 1SQFA 1RJDA 5I48A 1M76A 2OGWA 1GA1A 1FA9A 4X65O 4GH5A 6NULA 1BAPA 3KNZA 4Q39A 3G5LA 4QGGA 4E88A 1V4BA 3R7WB 1XO1A 4TL9A 1BA2A 1JDSA 1GPH1 3MTDA 5I8ZA 3SLKA 1UQTA 1VCIA 4O59O 4CDMA 4FR2A 3GUUA 4EGSA 3VNAA 1E2JA 3HYSA 5IN4A 4BX3A 5CX4A 5LZ8A 1N2GA 3D3WA 4X5OA 2H9AA 3M2TA 5C81A 3OO0A 3U4CA 3S2SA 3SPXA 1PG0A 2VAPA 4YT5A 4FN4A 3OE5A 3GJ6A 4CM4A 4DMHA 3BJRA 4UUNA 2WLIB 821PA 1TZJA 5I4CA 3J81A 4BO2A 5MDHA 2QTHA 2VDMB 1R9MA 1SZCA 2YMMA 4RSRA 3ZCSA 1DTOA 2PD3A 4PPGA 4RZ2A 1A1VA 1DAHA 1I3OA 2UZAA 3BIFA 5CDSA 4R71A 4LCPA 3LVRE 4G8CA 3DBHA 3ZE6A 3KLBA 5E9WA 1AGRA 4H33A 1RRPA 2P5YA 4NCNA 3HEBA 3V00A 4CT5A 4E4YA 5U4XA 3UA4A 4PG4A 2LV8A 4P9EA 4C5BA 3KKNA 1ZIYA 2DOKA 4RY2A 4UU7A 4FFSA 5CYFA 2Y48A 1NTRA 3S7ZA 1GCUA 4BFYA 1S4MA 2ZRIA 1K7CA 3FPGA 2J0UA 1E6MA 4MLDA 2JEZA 3BRWD 2WUEA 4LRUA 4NEHB 1L7XA 2V98A 4P33A 4X1OA 3SKYA 3TX6A 1XJCA 1V55C 3NC4A 4UM9D 5TQ2B 1AKTA 3JD0A 3OT1B 4BLQA 2FYTA 1R5BA 1UWKA 2QZPA 3FVTA 3I53A 1YCGA 4OA8A 2LBPA 3FE2A 3KG2A 1Y74B 3A0BZ 1P1RA 5H02A 4NZNA 4BP9A 1V26A 1GFSA 4E2LA 2P2LA 5AW0A 5HW0A 1XU7A 2ZRMA 1XDGA 1LW7A 2YY6A 2JI4A 2QN8A 3DTVB 4XDZA 2CTRA 2QRHA 3ZDFA 1Q19A 3JD4A 3TI7A 2K6GA 1FYDA 1Z8HA 2CLKB 1R64A 4C4TA 2OCYC 1WLSA 4I9NA 1C9KA 2HU7A 4F2DA 5HDQA 4WD3A 3K5IA 1B8NA 2BR3A 4YCDA 4HAIA 1KGSA 4PCLA 1HTBA 4REOA 2A9KA 1CR2A 3E22B 2YJTD 5HE8A 1KB9F 2FMXA 1N8SA 3PFNA 3KUUA 2W6NA 4JGGA 4U5QA 1TEZA 5H59A 2DUUA 1WOYA 3H9JA 3RFXA 2VUIB 4TRMA 4PRKA 5KTMA 1FZTA 5FOSA 4D9NA 2OBMA 3JSAA 1W34A 3ZPXA 4ACBA 5J4KA 2C3PA 3C3MA 3B6ZA 4U0JA 3A3NA 4IP0A 1VMEA 3GBPA 1RYFA 1KY3A 1BZYA 1IK6A 1N2OA 2BBOA 4N21A 1I9CA 1KSJA 3M5WA 1TFUA 2FGJA 1CTQA 2YIBA 3CV3A 1T5TA 2F8SA 3COPA 3G2JA 3RTEA 3GGGA 2QUAA 3ENNA 2P4EA 4UHDA 3ONDA 2WQ6A 3OZRA 2ZJAA 3FTPA 2JVJA 1CX9B 3F6CA 2VDVE 2D2XA 2ID4A 5IVDA 1JALA 4AXBA 2QX7A 3BCRA 3F4LA 1IN8A 4V2UA 2BEJA 5K1ZA 3BGOS 4FVMA 5K5EA 4YJ3B 3LHFA 1EU1A 3TKLA 5KTSA 1G5HA 2FSFA 2D8MA 1Z8DA 3L7KA 4Z2WA 5IWAB 2WPDG 1K9MW 1DBIA 4HGPA 5CXSA 5FORA 3FGNA 5KA5A 2VS0A 1ETUA 3HLKA 3Q8WA 4H7PA 1VL0A 1GLGA 1J56A 1K4MA 1XVVA 3AF2A 3JPYA 3LO8A 3FLMA 1NF9A 4HBZA 4KPUB 3GNSA 4ZT7A 5JFOA 3LFHA 1V1JA 5TMPA 3AO0B 3BMOA 1R0WA 4F4UA 4AKHA 2QWXA 1Q5PA 1VRWA 3L18A 4EY3A 3W3AD 2ZJ0A 5LQNA 1RKVA 1B7GO 2XWSA 3B8HA 4DDMA 4S2UA 4EBFA 1E62A 2YZ7A 4FQ8A 4HGOA 1ZD2P 3ZUPA 4ZKDA 3QE9Y 1B0ZA 4R9SA 4ZU1X 2IXDA 3EG9B 3LIPA 2JFQA 3C3SA 1QH1B 4J7XA 4YI3A 1EQUA 5EVJA 4H18A 1GPDG 2NUBA 3N2IA 3SDSA 3Q0EA 1LUAA 1W36C 1JT2A 2V6MA 5CK4A 3VNRA 1T2EA 1P0PA 2QKCA 3LDEA 4AB1A 3SYNA 8ATCA 3IJEB 1LV7A 4D7TA 3ZOZA 4BYGA 3GXOA 1DAEA 1I7DA 4A23A 4R6ZA 3TJTA 3ILYA 4IHJB 1AF4A 1L7VC 3Q4HB 1WM1A 2CL6X 2FWRA 3GUHA 3HJUA 3NNNA 4TS3A 1NUAA 3GYGA 2PD6A 1N1DA 3MC1A 4XXHA 1K3EA 4LV6A 4B8ZA 4QUGA 3HDTA 3C8ZA 4GPIB 1T2DA 3WV5A 1FXKA 5TISZ 2EJTA 3OLCX 3T4DA 1DTEA 2NV2B 2QA5A 3HP4A 2YDEA 3RK1A 4JI0O 2B8JA 3QYFA 1M72A 4IILA 3CVJA 4K46A 4OHPA 3G9QA 3G2MA 2QD2A 4Z4FA 2DPGA 2FV8A 1XU9A 2PSFA 1E4EB 1VKZA 3IDOA 4PHTA 3ZZUA 2P0AA 3QI2A 4DLTA 3I8XA 2YV4A 1GRVA 2XBUA 4KL8S 4ENSA 2HO4A 2IC5A 5J2TB 2ZT6A 3FMPB 5EOVA 3DZBA 4X1KB 5DLEA 4FOPA 1BT8A 2UXNA 1BU5A 1VE1A 2ISSD 1VBKA 4A2WA 4UMEA 4KHPB 4AP9A 1U98A 3B4SA 1R18A 2H4XA 3PGMA 2ZCEA 3UFXB 1U3FA 4B44A 4KRFA 1R16A 3HA5A 5EG5A 3IQFA 1QQCA 4K1XA 4F5DA 1AK2A 1LDYA 1HNWO 1E4EA 1K66A 3DTTA 2R79A 2FQ1A 2EFCB 4RO2A 2FW6A 2NZ2A 1MABB 3D54D 1LBHA 1S2GA 3B1XA 3P2KA 4MVJA 1V4NA 2WU8A 4RVNA 4DIFA 4RVOA 5LL6Y 4MR9A 3PNQA 2LCQA 3RGWS 1K7XB 3RWBA 4G36A 3VC1A 3VC7A 2IHJA 3HYNA 4BO6A 2IUEA 3AEUA 3ROMA 3G0OA 3MWEA 1M33A 3BB4A 3L7YA 2JHFA 3PT9A 4MJ3A 4PSKA 2XYQA 5J59A 3W78A 4V0ME 1MC8A 1CUVA 2CXUA 1QTIA 1X70A 3LBIA 4FCTA 5JXIA 4U6QA 4XSHA 3ZMZA 3TCUA 4B43A 3K72B 3QBVA 3EVCA 1ECJA 2H0RA 2HUPA 5T3YA 1OZAA 2XQVA 4BGIA 4QECA 1G8FA 4IJUA 1B42A 4CKBB 4HC4A 5F21A 3A0RA 2NTVA 2Z9BA 1TM4E 3H8SA 1CTTA 2BFBB 3DBOB 4FNAA 4R4JA 1EYZA 1FTNA 1RRFA 2ZR9A 3W5IA 1QP4A 2ZAGA 3UHPA 4G84A 4HDSA 3ZQ6A 4FOOA 3AUJB 3P0FA 4Y2QA 1F1BA 3X1MA 3BQMB 4K5QA 2WPDA 4URWR 3SZUA 4LDZA 2ZSJA 3RC7A 3B7GA 3Q8MA 4JQOA 1RWOA 3GVMA 4IUCS 2FW9A 1TMGE 3Q10A 2C31A 5EJIA 3R9IA 2CE4A 1I33A 1YBFA 1YONA 3ABUA 2BT4A 5C0OE 5E3HA 3DZKA 4YP7A 2VYVD 5B36A 1AX9A 4DT1A 3K5MA 1KMHA 2OG1A 1Q44A 1V1MA 3B1VA 5KTOA 5KZMB 3D2BA 5JH7A 2CSXA 5ERXA 1KYIA 1PZNA 1A8SA 2QM0A 1KQGA 1O08A 2R6CA 4MCHA 4UNPA 1IWOA 3N1UA 1JHXA 1B2RA 4V0SA 5DP1A 3SX0A 4EB3A 4XGQA 1PQ4A 3ZY5A 4PX3A 5DWQA 4WDRA 4BKMA 2YMLA 5JOQA 2XGJA 4MUAA 3OMNB 3DHVA 3QKSB 4G0OA 4DR6O 1F5NA 4M0KA 1DDGA 4BDTA 4O2BB 1Z26A 3ELYA 3MYYA 4HGZA 1DV2A 5ADUS 2Q6VA 2Q7HA 3OX4A 2VHCA 4JFRA 2C7QA 4K3UA 4Q7EA 1Y9DA 2Z9CA 1A4UA 2JH3A 2JFGA 4L4UA 2H63A 3QFCA 3T2MA 1RQGA 3R6LA 1PNKA 1KS2A 5I3ZA 4DR1O 2LIVA 3K4QA 4FFBA 3M5CA 3RT7A 4JLJA 4H13B 3WJ2A 4MKGA 2GZAA 1DWUA 2K2QB 3KJGA 4Y1RA 5HQTA 4ISBA 1IM5A 1O5IA 1KMQA 4FEAA 2P1DA 4JJ7A 4UTVA 2KS6A 4RDIA 1PX0A 1TVKA 4JLMA 4EK9A 3EJ6A 3U4MA 1NYLA 2IZZA 3ETGA 1UDXA 3O3CA 4MHOA 3SXUB 1YE8A 3TKAA 4R7ZA 4WSOA 1NR7A 1TIKA 3GR6A 1VM6A 3LT1A 4D4JA 4NV3A 2HXYA 1YI8A 2K7FA 1BS2A 3KTAA 4ITUA 3W8RA 2FX2A 4YRNA 1M5TA 2HSDA 4EABA 2R85A 4HVLA 4YAWA 3SQNA 2PY6A 5AVVA 5J5AA 4KITC 3P0IA 3S99A 6REQA 3V2UA 1PJ2A 3K0FA 4FGKA 2X6BA 1I01A 1P1KA 4BCBA 2E4UA 2V7GA 3ICVA 3JCZA 4GLXA 3E9EA 5KYXA 3W4KA 1G7TA 4CIYA 3K94A 3BTOA 4JP2A 5SZHB 1HYQA 4PZYA 1JTKA 2DQ3A 4TTAA 3TB4A 1FNSA 3GEDA 2O8EA 9MHTA 1ZM9A 5DW0A 3UUGA 5EZ6B 2W22A 4NCJA 1WL8A 2BGUA 2OEPA 3WMRA 1FBNA 1TKRA 2QPTA 4WCFC 2Q2VA 3DGEC 4I5DA 2X58A 3PHIA 3TTUA 2XI4A 5JVDA 1GNTA 2RH5A 4HAOA 3RAGA 1IZ9A 1QRTA 2XCLA 1XPOA 4MTXA 1QRAA 4CR7A 2VJQA 5LL6P 1QCYA 2FR0A 1SCDA 1X15A 2PCJA 1T1IA 1VE5A 3EUWA 2X9GA 1FU4A 1RSZA 2ACWA 1UKVY 2MYPA 2QUIA 2QX4A 3LT5A 4OXIA 3ASOB 1TCUA 2PX2A 5BN5A 5ADHA 5LOVF 1JJVA 5FL7G 3P2MA 4I8DA 4BGVA 3DG9A 1PW7A 5LD2B 3FNFA 4G2TA 4WNIA 1DOZA 3KKPA 5KOIA 2IHUA 4K3VA 5CTJA 4M9CA 3V1NA 1NW9B 3WGZA 1NSFA 4MQBA 3SYPA 2AWOA 3KYDB 2C9DA 1GM7A 4LV8B 5ARBA 4MLPA 2P5TB 2WFZA 1C0PA 3FOCA 3RVBA 4O8YB 3GIDA 1HORA 3WLLA 3EGDA 1PD1A 1TM1E 1VQNV 3U49A 1DAOA 4QICA 4NYKA 5KYUB 4MWEA 1YASA 3CX4A 1X7ZA 5HJEA 4MIYA 4C4PA 1LI5A 2Y1GA 3ETLA 1UEIA 3PUIA 3OEWA 5FYQA 4AN0A 4RJ2A 3SWWA 2F59A 4KIUA 2NXCA 3L9WA 4LBYA 3GJTA 4N5HX 3K57A 5AM4A 4MXDA 1L7BA 4Y6RA 1ODCA 4RZUA 3UAXA 3I6QA 2IT1A 2L18A 3BEHA 3KU4A 4ZICA 2ZQMA 2QEQA 2V7EA 2IM9A 4JH0A 4MS2A 1SERA 4OXRA 5BMVA 4IH1A 2P5SA 2KMLA 2VTKA 5KNDD 3DL4A 2OCLA 4I3FA 1NPYA 3DZFA 1J99A 2OAQ1 3UAZA 3VH3A 3VZDA 4Z7NB 3U3OA 1AXEA 1BCCH 1A98A 4XIIA 4ZU3A 3IRUA 3KEQA 2VHJA 2EKQA 2VWHA 3VZQA 4C87A 3FCAA 4PDRA 1HETA 1J7KA 5LP1A 5FT9A 3I83A 5JCPA 2V8OA 4H1WA 2HU5A 4XDKA 4IH9A 2W6MA 4HN2A 3FMOB 4AROA 4JI5B 4L85A 4HVAA 3AI1A 3V7NA 4XWOA 1L0LH 4ZK2A 3LDCA 2FZLA 9LDTA 1U2SA 3SGLA 3CRQA 5AJTA 4G8JA 2TS1A 1O0BA 4UDOA 1U99A 1E3TA 3RIYA 2D1YA 3ITKA 4OGKA 2RMKA 3D7LA 2UXCB 3QV2A 1C1DA 1K92A 1F3LA 1ZBDA 1DELA 3G5TA 3M6MD 4DLWA 3QI7A 1J09A 4IM7A 3JYLA 4O08A 4HWPA 3H1BA 3ROEA 1IMOA 2BBTA 1RMYA 1B3QA 4PBSA 4RJLA 5FADA 3BB3A 3QEJA 4LNAA 1E6UA 2PU7A 3DDHA 1FU8A 1YVEI 2OCHA 2B9VA 4LA4A 1GQQA 3IVCA 4M1QA 3TGWA 3WV4A 1GRNA 7REQA 4ZCQA 1T1JA 1BNCA 1WWKA 2YXLA 1C7FA 2SKEA 4UJ5A 4UHCA 4XW2A 3UMJA 3WI7A 4KDRA 2QX9A 3H1HH 3MOSA 1I7FA 1A7AA 2E4YA 4II3A 1DLIA 1YNSA 5CVVA 4PX5A 5KREA 2CYCA 4M1WA 4D3SA 1Y8AA 3I8SA 1OVGA 3Q2IA 3W5AA 1FFXA 3IPLA 4U9UA 2VYCA 3KRTA 1DC7A 3CNQS 4DQLA 1MAHA 2NZJA 5K0JA 4D79A 3VZSA 2HIGA 2AEJA 3IIEA 1NU8A 2FWBA 2IQIA 2Q9UA 5FH9A 4J9ZB 3U4GA 2QORA 1D6JA 1KZ9A 4YIHA 3BC1A 4KITB 4R7CA 5A3RA 4W99A 5F3WB 2VJDA 4DNFA 1T6ZA 4OQQA 2Z3GA 2FB5A 1FD9A 1NOKA 3RBVA 3K4PA 3G2IA 1HTTA 3L7OA 3PQ7A 2Q7GA 5KJEA 4F9GA 1AURA 3EOBI 3T3OA 4BVFA 2XWBF 1G3RA 4KXUA 1SUIA 3SP1A 3SLRA 2J3EA 3ETEA 5CX1B 1FLNA 1AB6A 2XUIA 3D4BA 5I51A 3ESQA 3ZKWA 3DC5A 5HF6A 1TOAA 2AOUA 2B78A 3AR3A 4N49A 1V1RA 3PX3A 2PMEA 1DQRA 2CZCA 1G6UA 4DYDA 2NPIA 1TAUA 2O8BA 4U2DA 1J0DA 1AXRA 2JA2A 2HXSA 5JAZA 4IGKA 1TVMA 4J0IA 4MINA 4PYMA 1Q7CA 3SOPA 3K08A 4C4RA 1NMYA 1G6OA 3I1IA 4MUJA 4RA6B 3AZOA 2UVDA 5K3FA 5BN3B 2XNDA 2XAHA 1F20A 3LU1A 1UBSB 3QU5A 3QUQA 1NLZA 5P21A 4FLTA 4KE7A 2YWCA 2PVPA 4P3NA 1ZP6A 4FFMA 5AUQA 3SS9X 1YXBA 4F85A 1XRSB 3SQWA 2BOCC 3IHTA 3HKCB 3ETNA 3ZE1B 1QNMA 5JSZB 1I5OA 2QL9A 3K70D 3CRZA 3U6KA 1E64A 3WIEA 1Z5NA 3Q8XB 2OV1A 1RLUA 1WKBA 3CKLA 4HLQB 3RS8A 3DLHA 1HMYA 4YT8A 3WVNA 1U3WA 5T4HA 5BN3A 3DMOA 1KYQA 1JDJA 1ZW6A 3E9ZA 1AGYA 2CXPA 4B7AA 4NSNA 3MCZA 4H16A 5TMDA 1VG8A 3G23A 1OXUA 3K16A 4C6TB 1F0YA 1LB1B 4IQGA 2I6XA 4I4TB 1AKYA 3OTIA 3JAWA 4UVBA 4FPXA 1Y6QA 4I8XA 4R2XA 4U7NA 5JSZA 3H3XA 1AI4A 3KHTA 3N2NA 4JASB 1BXZA 1TRHA 2W71A 4WLEA 4LDJA 2PGJA 3FYUB 3RUIA 3SC4A 4AW9A 4HEJA 3O92A 2J32A 1GV1A 4MUMA 4DL9A 5JWPA 5FBLB 4S2EA 5BXZA 2KKWA 1KAOA 2XOKD 2XUGA 3DW3X 4DMRA 2AUMA 3PHBE 4HAWA 5HZHA 2EHDA 2AKAB 1U2GC 1KQFA 2NNUA 1VSTA 2DULA 2O1SA 1N0JA 1C8LA 3G6KA 3EZ2A 4MA0A 1OXMA 2FUNB 3ITNA 4I2NA 2FZ4A 1QK4A 4URYR 5FLEX 4FN5A 4OKSA 2BZSA 1W5EA 1HNZB 2BELA 1SUBA 3H2BA 2IP4A 1VFPA 3HXPA 1JG3A 1RXEA 3B7WA 3LYHA 2QW1A 4QOFA 4TT3D 4RXMA 5ER9A 5KC8A 1D2CA 2V9PA 1MXFA 2QAGB 3EIXA 4WOKA 5FBKA 3OEHG 1KNQA 2ZRPA 4A8TA 1X1AA 3RB8A 5LMZA 5L9AA 3FMIA 4M88A 1CB7A 3KUXA 3L1JA 1RDFA 1YS7A 5JAQA 5A9SB 5L3GA 3OM1A 1SCUA 4KMRA 1WB6A 3LECA 4B4VA 1XI1A 4LF4B 4ZTUB 5C31A 3IPRA 2CYAA 4BVKA 2ZTLA 1X9GA 3WGGA 2J3DA 1SKBA 2IY9A 1UQRA 2G5GX 1AKMA 3IALA 4UPVA 2FWPA 1QDLB 5D84A 1Z8FA 3OCUA 5ALRA 5JO0A 5AHWA 1XTZA 1ORRA 5H4GA 1G1AA 1H6AA 4P92A 1KRWA 3FCOA 2PSEA 3U10A 4AY4A 1JGTA 4B7UA 4MROA 1E94E 4GKJO 3LWZA 1P3JA 1T36B 4MQLA 3OECA 4FLMA 4PYOA 4QSMA 5A0FA 1UFQA 4HS9A 3EGOA 4JFAA 3KV1A 2ZYGA 2H1RA 1COWD 3GGOA 1CLUA 1OFUX 4JLBA 4K6CA 4YAEA 4HAMA 4LFCO 4OBEA 4UEJA 4XWAA 4FB5A 3A6HA 2F1MA 2I2BA 3KQSA 4FFDA 1WB4A 2F6RA 4NBSA 4RQFA 4MUIA 2H5JA 1YJ8A 2IZ7A 4NH0A 2CH7A 3HC7A 3NEYA 4G41A 3JX9A 5DM1A 4YCSA 2FL4A 4XOUA 5FX2A 3ESDA 1UAAA 4G81A 1R3LC 4F46A 2FOLA 3FB7C 3K0BA 4BNVA 2BFDB 2G9ZA 2VKTA 4MHTA 1FSPA 4F12A 3JQ8A 3PC6A 2Z6QA 1P2TA 3ILVA 4MVJE 2GM3A 5DHAA 2XUZA 3DM9B 4S05A 1L4HA 1LDBA 5HQ3B 3BSYA 4O2BF 4QBHA 1MX1A 3S1AB 4YIKA 1JDBC 5JC8A 3AINA 3BK7A 2A9JA 4Q4AB 3V32A 3C3CA 1CEXA 2B5OA 2C4WA 3ER6A 4C7BA 4ZQFA 3RWRD 3DDOA 2X1VA 1Y98A 4PNEA 4XH9B 2RHCA 1C30B 2ATVA 3T94A 3PNBA 2HQSA 2DUNA 2XF8A 4KQXA 5FOWA 3KO8A 2Q5EA 3INTA 4PW0A 3LSSA 2OR3A 1F0KA 4FYMA 4YB8A 1VG1A 3BICA 3RFTA 4EY8A 3EXG1 2C5HA 4BTEA 1OC2A 1Q11A 1DFIA 4EG1A 2O3RA 2C5FA 4YHHB 3HJNA 3RK4A 4LF8B 4J7JA 1SNYA 2BH9A 2V4MA 1S7CA 4P7FA 3WYBA 2M9MA 3TXQA 1E2UA 2VEOA 4OYRA 4PC3A 4BJ1A 3TG8A 2O8DB 4ZXFA 1GTZA 1S0UA 5EIXA 1AN0A 1O95C 3QXXA 5CXXA 2ZK7A 3FJYA 3SVZA 4DLVA 1C7JA 1EFHA 2V6JA 4AY6A 1YCIA 4WCEV 3L7JA 4WKGA 1JYFA 4BQRA 4CZ2A 3A28A 3DLIA 4GR5A 5ELMA 4X66B 1U1CA 3SXJA 2QAGC 2FOXA 4ZMBA 4G2NA 2WV9A 2F1IA 3DCNA 4TRNA 1Z13A 1RYYA 3UB3A 2I99A 4OU5A 4DT1B 4B6EA 5EJ7A 3L06A 1ZAKA 4XR4A 4PTYA 3E7XA 2BBSA 5L3BA 4F6RA 1XNRB 1T8YA 2ZBFA 3BHNA 5BO5A 4A91A 4EQ6B 9ATCA 4JAAA 2IPMA 5B1EA 4ZPJA 2OILA 5B6PA 4EG8A 3K6JA 3WYNA 2E1PA 3RVMA 2A9QA 5AIAA 1NR1A 1NS1A 1KAMA 4M4SA 5LQDA 3WP1B 5DLPA 3NFYA 5AK5A 4O8ZA 4EF5A 4W5TA 4BO8A 3FYUC 3P2JA 3OD1A 4MEBA 2BR5A 2FEXA 4L78A 4KR9A 2FPOA 2Q0XA 2D2FA 1ZM4A 2CJWB 3C8HA 4TVBA 2XOXA 1EHYA 2Q1YA 4S0ZA 3KZKA 2B1QA 1U9CA 2VXOA 4XA8A 1DEKA 5BSUA 3ZKAA 1P4GA 2YUAA 1CD5A 2IEDA 1R3DA 4LBEC 3TB6A 4ZGGA 5JXHA 3SPJA 1KDTA 4MW0A 2ZP1A 4GOOD 2OHGA 4H37A 1U2GA 1DARA 1CUUA 1TCAA 3AJ8A 3H87A 3LA6A 5FOTA 4O4IA 3PU6A 4ZDKA 1CJCA 3DEKA 3KKQA 3T5TA 3FFBA 1JDZA 1OGJA 3IE1A 3HJFA 3ENKA 2O5CA 1A82A 1G9SA 2HOQA 4E70A 2QB5A 3MMZA 2ZBQA 1QVFU 1CY0A 1QGDA 1TJ4A 1ULZA 2JAXA 3OPYA 5TVGA 1N0VC 4FLZA 4J4BA 3FWZA 5IP5A 3GH1A 3QVXA 3EQ2A 4N4AA 2DTXA 4JJEA 4CWAA 4ZEVA 1AHIA 3GHHA 3S70A 5A1TA 2ECKA 1MT3A 4KAFA 3SJQC 4WFIA 3TSCA 5BV1A 2FEPA 1KORA 3L6DA 3VKHA 1KAHA 4PC7A 1ZGAA 1N7GA 4GZ6A 4OD0A 4D3FA 3WGJA 1LPAB 3OQIB 2B0CA 2Z4RA 3LY8A 3I30X 3R74A 2ZR8A 3WRXA 2P2DA 4PE5B 5CT9A 3E18A 3CSSA 4WCFB 1KEWA 3GN2A 4B3IA 2HTFA 1Z56C 1ZIPA 2O1XA 2GN4A 2PRKA 4B6GA 1QE5A 3PI6A 1OAOA 2IHBA 4FMCF 4RUFA 4BV9A 2WTEA 5JWHA 3MZ0A 1Z73A 2C95A 1KE2A 5CFOA 2QK4A 1GPBA 1CY4A 1COWG 2O0JA 3DO8A 1VRCA 1QE0A 2YYYA 3BJMA 5B3AA 2YJ4A 1P44A 2H8PC 3R6TA 4RHYA 4G86A 4YLGA 2DWDC 3ZQJA 4BQOA 4DMCA 2Z2XA 4ND6A 5C7OO 2OXEA 1VKHA 1JA8A 2HQOA 2N42A 3GMIA 4HMOA 1CZKA 2ZYIA 2A58A 4WUVA 3BFRA 3OMWA 3H1KH 1LWOA 3KJQA 4E2XA 2VBFA 1YTFD 2E76B 1ZMBA 3K5OA 1L4KA 1A27A 4X85A 1XXHE 4RD0A 4X7PA 3SMQA 4UV9A 3PV0A 5HE9A 2CEKA 3WYDA 2VP4A 3TECE 1GDDA 2I78A 2VP3A 5JRJA 4EFKA 1J1IA 5JNTA 2DH5A 5IJAA 2EW2A 2Q29A 2YYSA 1E92A 4UM7A 1GPAA 1QAOA 1U0LA 3NU1A 4PCUA 3A36A 2Z09A 2ZJ1A 5EBMC 2YQ5A 1EH5A 3OZCA 3DF9A 4IVQA 3FBWA 5DBOA 2Z9DA 1P5ZB 2WFMA 1XPJA 1XG5A 3QKIA 1FFGA 3KE9A 1XJ5A 1M5IA 5LWHA 4DO2A 1ODFA 4J76A 3ZHSA 1IBCA 3IVAA 4PZZA 5FEMA 5EP2A 2WVHA 1GZHB 2HZBA 1IC6A 1BU8A 4Q9AA 4HEA1 4KUGA 4DBZA 1MB4A 2W2LD 1VGVA 3QKRA 3ANMA 1W96A 4HYQA 2DN9A 1ZD3A 4UZSA 4B4WA 5K8JB 1NRIA 3HYLA 3AZQA 4RF4A 4DLAA 1P73A 4DR2B 3D7NA 3I6IA 3NXKA 4ZQBA 3ILHA 4PWZA 3FVQA 1Q6YA 4ZAYA 4LCOA 3A14A 2QE7A 1YIAA 4LC1A 4TKMA 4F97A 2IS6A 3B6MA 1JKMA 3EFOA 3JZIA 4PEVA 4V0LA 5HMMA 2O2XA 3I64A 2O0HA 3Q3CA 2NZ8A 2IYVA 4LXIA 1A8HA 4OH7A 1HWYA 3ON5A 3UOWA 1W1WA 2XUAA 4G65A 4QGBA 3PC4A 3EWIA 4OI2A 3RRFA 4H7JA 4KQ6A 4RBNA 3LCJA 3A1UA 2FRVA 1X7XB 1P9WA 3ZHVA 3KZOA 4RVCA 4WNAB 5JXGA 3TRJA 1FXHA 1RWXA 1CBUA 5GV8A 2DPMA 5CLJA 1NYTA 2H4ZA 3AY3A 4NZYA 3JATB 5K6TA 1JHRA 1Z2DA 1JXOA 4RZSA 1DC6A 5KYGA 1K8AW 3MYRA 2FEWB 5DLQC 5KTRA 2FFAA 1QS0B 4YRQA 3S2UA 1SFRA 2GUGA 3H3FA 4DV1B 2J7PA 1JE0A 3BERA 2ZXFA 3WLEA 3T5PA 4CKBA 4ITVA 1SQ6A 5DV9A 3G6BA 3EDQA 1Z39A 2HNKA 2JGFA 2PUHA 4MW4A 2EBFX 2GTIA 3H1PA 3M3HA 4PN3A 3OTOO 2BH2A 2NSLA 2YVUA 1RSOA 3G3EA 4Q47A 2JFYA 3B1YA 1X59A 4GYWA 4YUWA 1NLFA 1J8DA 2H94A 4R05A 4JJGA 3ZIAA 2R11A 1JSCA 5DHTA 4BV3A 3ZDEA 2OXRA 3O4FA 3B7PA 1Y6GA 4FPPA 1AGPA 2V0CA 3O9VA 2Y0DA 4R31A 3NJRA 2XMQA 1G8YA 3CSXA 2V7BA 3NIBA 1LA2A 2P3LA 1KHHA 2VSOA 4N3NA 3TFWA 5BQFA 1PSWA 3HBMA 4YLEA 1NY5A 3K9GA 5IH3A 1E7WA 1RYMA 1W59A 1L7NA 4FVTA 7AT1A 1PJBA 2XX3A 3VHQA 4CBVA 5I7HA 1DS6A 2YNMA 4RQEA 3CUTA 4OATA 2G77B 3NORA 3G5AA 4UC0A 4HRWA 3OT7A 3ZU3A 1NVDA 2GV9A 3JCUZ 3NTLA 1G16A 1ZMRA 5A4FS 1ZXXA 3O4IA 4FIDA 4NBVA 1PV0A 4N23A 1QDUA 3E8MA 4H9GA 1IEQA 4PGHA 4EG4A 4X8LA 5ISMA 1I0ZA 2IJJA 4MGIR 3P9XA 4Q0MA 4HDOB 4E08A 1PQPA 3GGDA 3HJHA 1LLDA 1QCCA 3H9EO 3PWTA 1FFAA 1E5TA 4EF4A 4MCAA 1XTJA 2NQ2C 2YYAA 1VL8A 1HFJA 3IV6A 3G9XA 4IJQA 4KQFA 2OZPA 5I7AA 3VR2A 3STLC 1KL7A 5LP6A 1G5FA 2H2IA 3H1GA 4I55A 3QIVA 1GAQA 1U2DA 2QTCA 4LRTB 5BN4B 3ROTA 1VDZA 1W48A 4TVSA 3OM0A 1GVNB 4OXXA 3OAAA 2Z5VA 4R1PA 1A32A 1YKGA 2KWIA 5FA6A 5H16A 2R44A 5JARA 3OIUA 4M7WA 1Z2CA 3WTBA 4O3FA 4E2YA 5FOUA 2O8BB 3F7MA 3HCDA 1Z47A 4GPAA 1XHLA 4I6JA 4DLZA 2Q4TA 3ABRB 4K0KO 2XCTB 4BASA 5DGHA 4Q9DA 3FIJA 3LOPA 4MEJA 1T35A 5T5QA 1VF6C 5A5EA 5KU7A 3NETA 1OA1A 2OO5C 1D4OA 1FDOA 2HIAA 3CJQA