2HP8A

Solution structure of human p8-mtcp1, a cysteine-rich protein encoded by the mtcp1 oncogene,reveals a new alpha-helical assembly motif, nmr, 30 structures
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
68
structure length
68
Chain Sequence
b'MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HU-P8
publication title Solution structure of human p8MTCP1, a cysteine-rich protein encoded by the MTCP1 oncogene, reveals a new alpha-helical assembly motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cysteine motif
total genus 34
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1997-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08991 MTCP1 Mature-T-Cell Proliferation I type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2hp8A00
1HP8A 2LQTA 2HP8A 2LGQA 2RNBA 1Z2GA 1U96A 1U97A 2RN9A
chains in the Genus database with same CATH superfamily
2F95B 5LXTB 3SJBC 2OYQA 4H37A 2YI9A 1WB8A 4B3MB 4JI8O 4TV8A 1F23A 4EFEA 1KBHA 4O4LB 1S76D 4LF8O 2BE3A 2AHZA 1AI4A 4XBFA 1VIBA 4UB8Z 1S0VA 2QWNB 4I0XA 3CX5F 4RQEA 1AJPA 3FX7A 1K92A 2R70A 2OIEA 2P90A 3TXQA 3ZCCA 5CBGA 5GONA 3RYCA 3APQA 3W7UA 4JZ2A 1QLEB 1M9NA 3P3NA 1M5IA 4HAMA 4UCOA 1ZAUA 4CS4A 1YTFB 1VF5B 1XMOB 1S5JA 4KUMA 5DECA 3CCJV 4MVRA 5H2FZ 2NNUA 1ZX3A 4P9OA 1QCEA 3A8TA 2LP7A 4PHZA 4JAVA 3E8GA 4LFAB 5EK0A 3HKCA 1NS1A 2YS8A 1DLBA 5F2VO 3SDLA 1P7BA 2LFSA 3AG1C 3E35A 1PL4A 1DGSA 1S5HC 3F5WC 4YIOA 5LGNA 5CA0B 5FL7G 3ZMZA 2LW7A 1J95A 1O9GA 1G4YB 3WFVA 4OXSA 3JARB 1YJWV 5KHKA 2Q8VA 3K03A 4X64O 4GT1A 3GWOA 5BR8B 4Q20A 1VQMV 2D3OW 5KUMA 3QG5A 2ZNIA 1Z2GA 3CWBH 3B8MA 1DTOA 4JF3A 1NJIW 3FKSG 1Q8IA 1IZ3A 3M8AA 4UXNA 4DR1O 3T1YO 3BA9A 4JGSA 4X9QA 3W7WA 1N36B 2HEPA 1XNRB 3JASA 3RWRD 3W7TA 2NR5A 4HYOA 4LNUB 5ITZA 2VQEO 1H2KA 2Q4PA 1XL6A 4UCTA 1QNMA 3WB0A 4D7TA 5IE9A 5IYZB 3JAKA 1HDJA 3CXHF 2EBOA 1ZSPA 3QO7A 4YIPA 2IW5A 4UCUA 2L6LA 4DK0A 2EZOA 4JI6O 4QPJA 3D8CA 3H1KH 1GK9A 3DC5A 3OMNB 4QGPA 1UJWB 2LW1A 4J42A 2ZIMA 4NTYA 5L3CA 1FJGO 3OGCC 4L8JA 3CCQV 2QTOA 5JVDA 5EYPA 2KG7A 2XAQA 1N33B 4HZ3A 5CN0A 3RGBA 5EBWC 2X0LA 4LR3A 2CH7B 1AROP 2DYRC 2XAGA 1BT8A 1YVWA 3LNNA 2PUSA 3RYIB 4GUNA 4X8AA 3SYCA 4DV6B 3SPGA 1K5SA 5LHGA 5D5QA 3SPJA 4IHJB 2R9AA 2A3QA 1VF6A 4CH5A 2JEXA 1QBZA 1XBLA 4BW5A 3RN4A 1N32O 4W4LA 4F6RA 1JR9A 1IBKO 3ZRWA 3RW0A 1DF4A 1B06A 4G2KA 2X6CA 5LHHA 4DV0B 3ZX6A 1VQ7V 1VQ8V 4I50A 1K3EA 4X1IA 4RAIA 1AB3A 4JTAB 4DR7B 2QWOB 4R8CA 5EZYB 2YXLA 3BFRA 3E22B 4LH7A 1PKXA 3ZHVA 1ZLZA 1H2NA 5FNVA 4DUYO 1M1KW 4DR4B 4CZZA 3HKBB 1AR5A 4OX9B 4YXWG 5KX5A 4B3TB 3T4DA 2Z0AA 3DTUB 1RSOB 1NH2B 3R66A 3LDCA 1NVPB 5LOVB 5LA6B 4JI0O 1FXKC 5J2TB 2FYUH 4CS3A 4DRXB 3ZMTA 4LP8A 4PDVA 3ZRXA 5KMGB 3DC6A 1EN4A 1N34B 3CPWU 1THZA 5IJ0B 1K73W 3B4SA 1XREA 3ABTA 2CTQA 2N05A 3JATB 4L87A 2HVJC 3RYHA 2ZM6B 4DR5B 2UUBB 1G8MA 5FPRA 3ZHRA 2RNBA 4X66B 3HKEB 4ZHQB 4J9YB 4PA7A 3UT5A 4GX5A 2OCCC 2JS5A 1FFXA 3OTOO 5EBMC 5L3DA 4O4HA 4TOIA 2ZR3A 2WLLA 1Q43A 4NR1A 3G6EV 1NVPD 1BS3A 1AJNA 2V4DA 5JQGA 2HJDA 4B3SO 4QJFB 2ZINA 3M7MX 4JI7O 1JX9A 4JZGA 1MA1A 5JJEB 2XTAA 4ZI7A 2OCCB 1PD3A 3G67A 2P6JA 1VF7A 2R72A 2FL4A 1B04A 1F51A 4N21A 2Q7HA 3OM3B 1FXVA 4YJ2A 4JI3O 4JTDB 4MVOA 4O4JB 1HR0B 3OW2U 5KUKA 3IC7A 3JSNA 5L3GA 4K8XA 3ICXA 1ZL8B 1KD1W 3BABA 1PL0A 1SA0A 4U3JA 3KCYA 2FKXA 1NBMG 2VWJA 3ABUA 5LXTA 1YZBA 1IURA 1WB7A 1M56C 2WA4A 1WPXA 2JDIG 4O4LA 5B3SC 3C90A 4JV5O 4FM2A 3E8HA 3JAWB 4LFCB 1Q6IA 4PDLA 1B3QA 2LO1A 2PZSA 4JI1B 2HP8A 3BA8A 3LNMB 2PYLA 2NN4A 4MVUA 5FLXN 5B3SB 3WG7C 4UVBA 2QGNA 4WFEA 1IXBA 2Q9LA 2XNDG 4J11A 1FYJA 3DGEA 2Q0AA 4DV3B 1CEZA 2CTRA 1PNKA 5L3FA 3JAMN 4X65O 3ETDA 1BGYH 2A7WA 4GKKO 5IY5C 3UKMA 4JI8B 2GHYA 3WG7B 2PI4A 1AI5A 2E75B 3K5LA 3E86A 4BWAA 5JCOC 1VQPV 2QEXV 5CA0A 4DV7O 1VMGA 2G38A 5IY5B 2VRZA 3C3TA 3HKDB 5LP6C 3JARA 5IYBO 1FKAO 1KB9F 2Z5UA 5IYCO 1YITV 2B5UA 3ASNC 2ITDC 2KB1A 1HW7A 4MSWC 1TAEA 4K8ZA 2IJIA 2HR3A 1RP3B 1D5NA 3OR7C 1H8EG 2IJJA 3T1HB 5LP6B 1GKFA 4D7SA 4K0KO 3FAVB 1I0HA 2A9HA 4O4IB 2DWEC 1M90W 3HPLC 5L3BA 2HHHO 2W0XA 3ZHUA 2ODMA 3FB5C 5IYDO 4LNUA 1OCZB 4WCEV 1FPOA 4X1YB 2EIMC 2HJFC 4MVSA 4PDRA 1WAZA 1Q90D 2IU0A 1BQZA 2ZNJA 5IYZA 3AG4C 1WJZA 3CE2A 5JQGB 4X64B 3WU2Z 1IVSA 4MTGA 1ZWIC 2ZDIA 4MTFA 3TXSA 1U97A 4GX0A 4DV1B 4J9ZB 3K79A 3CCUV 4NXNB 4CBCA 1Q7YW 2GTAA 1VP7A 4DO2A 3CXCU 2EIMB 5KAFZ 4AILC 2YDEA 5H6RA 1YHQV 3AG4B 3UO3A 3ETEA 4MTOA 4DR1B 2EIJC 2EJ7A 3FD9A 2ATKC 3SR2C 4X88A 4WFAV 2JJ1G 2P67A 1K97A 3G6BA 2Y0PA 1KMIZ 1E1QG 3K0DA 4WFBV 4U3FH 4DR3O 5KAIZ 4FIPC 2CH7A 1AJQA 2CDYA 3CMEV 3LSQA 2JK5C 1YEWA 3RYIA 4U3JB 2E3CA 1NTKH 1RFYA 3E2EA 3K5NA 2ADPA 3MHHC 2OIGA 1I5YA 1GN4A 4J7KA 4IHJA 4X62B 1O9HA 4DUZO 4JI5B 4UVCA 2EIKB 4UFZA 2JGUA 2MK3A 2IH3C 2VS0A 3CYOA 1R6KA 2DN9A 2UXDB 1P7GA 4DW0A 4DV4O 1I5XA 2QR4A 3IFXA 1FJGB 3ZIAG 5KHJA 3GB7C 4UV9A 1OV9A 2UUAB 4FJCC 2B9ZA 5EZYA 3JD2A 3E22A 1KP3A 4ABMA 1I94O 2LFRA 3CSXA 4B3RB 1ZUQA 3QNEA 2ZE7A 1J5EB 3HKBA 1MNGA 1Q6UA 4AQYO 1RSOA 3L71H 4FPPA 3U11A 3OD4A 5A9GA 5LOVA 2GUZB 5LA6A 4DR2O 2ARHA 3L75H 3F7VC 5J2TA 1XI1A 5DM6V 3T4ZA 2HVKC 4DRXA 4LFBB 1IBKB 1TGOA 4UCRA 2CUGA 2ZE6A 2EZPA 4LF6O 4CC5A 4D6TH 1TUBB 1YJNV 1CP9A 3CB2A 2WLIB 5KMGA 4H33A 4P2ZA 4PV1B 1M4UA 2Q7EA 1OCRC 1QR8A 1E79G 5KLVH 1EN5A 5IJ0A 4H0LB 4KHPO 3AG3C 5LL6Y 2E74B 5CBHA 2YC0A 2IBZH 3JATA 3K9AA 1KYOF 5CBFA 1CXZB 1H38A 2WLKA 2BTOA 5IJ9B 3TETA 2DQ0A 4IYIA 4FM1A 3AG1B 4ZIBA 3NXSA 3LSUA 1SQPH 2YXYA 4UVAA 3HKEA 4ZHQA 3UO2A 4DV2O 1JJ2U 5CA1B 1XHXA 3GWKC 1EZVH 5B5EZ 4LBEC 1G6UA 1PM9A 1N0JA 3QF7A 2QA4V 4YY3O 1Q86W 2CE4A 4JI0B 2K1EA 4FLYA 1UPGA 2F4VO 3OT7A 2X6AA 1GTOA 1QVGU 2RN9A 2UUCO 4TSFG 3ZRSA 1COWG 2B1IA 2P06A 3ZN0A 3WB2A 3ABMC 3D3IA 4UB6Z 1Z5WA 3B2EE 4FLZA 1KP2A 2O57A 1Q81W 3BCCH 5LMUO 3ZS8C 4LF4O 1EM1A 3GVMA 4FK5C 1P4RA 2A0LA 1IXMA 3G4SV 1SQXH 3VQXA 4C7UA 4A5UB 5H9CA 2UXBO 4O4JA 2DE0X 1E1RG 2PGGA 3ABMB 5TISZ 1Y76B 5A2QN 4NKGB 1ZL8A 2LQTA 4O2AB 1HNWO 3CS5A 2KSDA 2UXNA 4PI2A 3K5MA 3F5TA 1Q6HA 4NXMO 3F7YC 1LUVA 3QO8A 3I56V 3QO5A 3TK1A 1XILA 1L0NH 4MT8A 3JAWA 2YXHA 4ZBMA 3RYFB 1MMMA 3W7SA 3FYIB 2HG5C 4JAAA 2OT5A 1VQ5V 4JI3B 1ORQC 3E89A 2YIBA 1NI8A 2EINC 5DEDA 2DYRB 2KKWA 5K1XA 3AK1A 4BAYA 2GBOA 1HNZO 4HNAB 5KA6A 1LUWA 3A0RA 3OGIB 2RCVA 4MVZA 1S3JA 2ADQB 2XOKG 1H2LA 2ZD9A 1LNQA 5E79Z 2AXTZ 2EINB 1HWYA 3ZMUA 4LFAO 4XDJA 5LGTA 2UXCO 2Y69C 4JV5B 4PA4A 4CH6A 3AG7A 1WN7A 4J7JA 3Q4HB 2QWPB 4YJ3B 4GYCB 2YIDA 1W2BU 4LF9B 1D5AA 1JPXA 4TQFA 4PJ0Z 3HKDA 2WWWA 3D3QA 5CB4B 1A32A 1FD9A 2Y69B 3CC2V 3SYOA 3D36A 2IJKA 3ZBHA 3OFNG 4UCVA 1WPBA 3CC7V 2W6IG 4KL1A 1KU9A 4JI2O 5JCOA 2CAZC 3J7AU 2YEVB 5IWAO 4E2LA 3W7XA 1MZFA 4PA6A 2XAFA 5GTHZ 4TV9B 4GKKB 2QJ1A 2F43G 5LP6A 3L72H 1H2SB 2E5LB 4ICGA 2AGAA 4QE9A 1FXKB 4H44B 1N8RW 1EFRG 4LF7O 5H5NA 3FAVA 1KQSU 4O4IA 1N36O 1XNRO 5C8YB 1KUQA 1KECA 1YJ9V 3RVYA 4DV7B 2BOBC 2GTSA 2OCHA 1XNQO 1HP8A 4GKJB 3TJTA 4X1YA 2QWRB 4KFMA 1OHHG 4JI4O 5AG2A 2Q73A 4OPHA 1BCCH 4X89A 1FAFA 2WLMA 1KC8W 4HBNA 4J41A 2F23A 1B6QA 3VBBA 1JOYA 4JYAO 4PELA 3JALB 1R6TA 1AR4A 2WPDG 2JJ2G 3CMAV 2Z3YA 3IAYA 4YHHB 1K9MW 1X4TA 1SQFA 3STZC 3DSQA 3LUTB 3JD4A 1Y74B 3IJ4A 4DXWA 1DF5A 3H1IH 2OTLV 2F66C 2HHHB 5KHIA 1FXHA 5BZBA 1JJOA 2QM8A 3ETGA 3K58A 3ABKC 4KP4A 4FZ1A 3S3XA 3JSLA 2YICA 2BTQB 1R3IC 4PA3A 2DYSC 5JH7B 1QU7A 1GN6A 3K57A 1K8AW 4GCZA 4GLXA 4RUEA 1AP5A 4MTXA 4KXRA 2ZQMA 5B66Z 3JD1A 2X7RB 2DYSB 1SC5B 5LGUA 5B1AC 3N2GB 4DV0O 3BRCA 1SRYA 2YI8A 3VOUA 3AG2C 4X1KB 5D5PA 4G28B 1KKCA 1M56B 2Q7GA 1HNXB 3FFQA 3ASOC 3BVOA 3ZHQA 4MW8A 4ZOLB 2RQ6A 4CH3A 2QSAA 4IT5A 4PD4F 4OX9O 1IBLO 2WLHA 2YUAA 1WP8A 3SJQC 2ZR2A 1Q82W 1JVMA 3MAQA 1T5EA 3ASOB 1QVFU 2GUZA 2CTPA 1XEQA 3E8BA 3RVZA 4I9QA 4LF8B 1R1BA 5CMUA 1TUBA 4DV4B 2WLIA 1OCCC 2WA3A 4I5SA 2ZXWC 3AEIA 3LSSA 1W0JG 4DR5O 1RM1C 2ZM6O 2UUBO 5HFLA 2PF4E 5IJ9A 4LC1A 2IM9A 3CRCA 1UFIA 4B08A 1SKVA 2C2AA 1W0KG 1V9PA 3JCUZ 5CA1A 1BL8A 2WSSG 3CCEV 4XDKA 2AZ2A 1RM1B 4WF9V 2BSKB 4IGGA 1GRJA 2FTKA 3ASNB 5J2UB 1H2MA 4LF5O 2DJVA 1VQ4V 2ZE5A 1MABG 4KHPB 1US6A 3KZIZ 4WBNB 1QHTA 4FFBB 1PP9H 1R73A 2Q5ZA 3CRAA 4W4KA 1GO3F 2UXXA 2H8PC 3CCSV 4TUYB 4LWSB 5JWPA 4BIUA 4QIWF 1HR0O 4O2BB 3U0ZA 3J80N 1SQVH 3K0GA 4DV2B 2ZE8A 2ZT9B 4QPKA 1Y76A 4LH6A 3SPIA 4YY3B 2GDSA 2JIZG 2ZIOA 4PA9A 4O2AA 1BQ0A 5EIBD 3T1YB 3SJCC 4LCUC 1LR1A 3N2KB 2D2CB 2UUCB 4F6EA 1WNSA 1Y6XA 3ABLC 4QE7A 3RT3C 5LMNO 3SYAA 3CCLV 5E1AC 2VQEB 1K4DC 3RYFA 5LMUB 4LF4B 1R6NA 2EIJB 2V1DA 4N23A 4JI1O 2W6JG 4JYBA 3H1HH 4DV5O 1PNMA 2LGWA 3DXRB 3K04A 3SPCA 5JJNB 1K7DA 2UXBB 3ABLB 3FB6C 4UCSA 4JI6B 3CCMV 4NTXA 3T2MA 1VQOV 4I4TB 2MW2B 4HNAA 2DMXA 4JASA 4DV3O 1HNWB 4ZKIA 1SF9A 2RDCA 3BEHA 1VQ6V 5L3EA 4J80A 4NXMB 1XMQO 1M93A 1QLEC 4TWKA 2LGQA 4BIZA 2JRIA 1L0LH 4K35A 1I08A 2R9IA 1V55C 3H1JH 5C93A 2QWQB 1AILA 2CGOA 3Q4HA 5IT9N 4YJ3A 4EEQA 3AK3A 1BZKA 3ZN1A 4R50A 1L8DA 1PV0A 3RBZA 1ZTEA 4JYCA 1NR1A 2QKAA 5CB4A 4Z1MG 1V55B 4IYHA 1N32B 3SGIA 1JQ0A 1HNZB 3OEEG 3ZMVA 1JCHA 1VQNV 3CHXA 4JPRA 2YEVA 3BAAA 4FZ0A 2XUMA 1AP6A 3T1HO 4PDMA 4TV9A 3FB7C 2JGDA 2P4VA 1FXKA 2HKOA 2UXCB 1YIJV 4DUYB 3STLC 4B7KA 5C8YA 3ETQA 2B1GA 1GAXA 1BE3H 2QTSA 2AZ0A 4I55A 4K3AA 4UUJC 1OCRB 3BHPA 3AG3B 1FS0G 3CEIA 1RPOA 2KQXA 5LYJB 1ROPA 3H01A 4GZRB 1SQGA 1XHZA 4TT3G 4JI2B 4P9PA 2XAJA 2VQFO 4CS2A 1YTFD 3BY6A 4DV1O 1NTMH 3JALA 5IWAB 1IBMO 4NXNO 4MS2A 1K4CC 4CC6A 3OAAG 5K1PA 3MHSC 2FMLA 4LF7B 1YDXA 1NU1H 1Y74A 3C3SA 3ZRVA 1F7YA 1NT2B 2QE7G 3CJHB 3IGAC 1QLNA 3VQYA 2ZDIC 3I55V 4FMTA 1WA8B 1WP7A 2F1MA 4NB5A 1OJHA 3E8FA 1X59A 1TUEB 1GM7A 3WB1A 1BSMA 1XNQB 2BTQA 2UU9O 1PNLA 1SQQH 1PPJH 5JH7A 2CTWA 3OTOB 3P32A 3LDDA 1GMGA 1XQ8A 3J81N 4JI4B 2K9PA 3OR6C 1R3KC 5EC2C 1TVKB 1RPRA 4WFGA 4X20B 1AVMA 1P84F 4DYLA 4DR6O 3ZHSA 4B3SB 4RO2A 5J9PC 3E83A 2IH1C 3QTCA 4X62O 4JI5O 2JEUA 4JI7B 4JYAB 3K06A 2X6BA 3IC9A 3MD0A 4B3MO 2DWDC 4MW3A 1N0NA 2HLDG 3JCZA 3KKYA 3EHBB 3SPHA 2GSMB 5H6QA 5BMVB 4FFKA 2UXDO 1JFFB 3N2GA 4EB6B 2LJ2A 3CRMA 4IIJB 3EFFK 2EJRA 2RMKB 4I9WA 4X1KA 2DQ3A 2UUAO 2PTMA 3O65A 1H8HG 2A06H 2E76B 1S77D 2XAHA 1G1XB 2Q67A 1NTZH 5JJJB 3A2FA 2IJHA 2WLNA 4GX2A 4ZOLA 5KHGA 4B3RO 2CK3G 3L9DA 5LHIA 1J5EO 1EBOA 1YF2A 1XMOO 4XDLA 4FLVA 3TGUH 4BR6A 3M99B 2ZKOA 3PJSK 2N04A 2Y4UA 3ZHTA 4JTCB 4TV8B 4PI0A 1MOFA 4Z2WA 2N74A 2Q6AA 1WLEA 3TCUA 4FLTA 4LFBO 2ITCC 3MDSA 3R65A 4FVMA 1VEWA 2DW4A 4I0XB 3N27A 2XHBA 3U10A 4MVQA 4EFBA 5GONB 3SYQA 1F4MA 3RYCB 2V7QG 2EX3A 2QM7A 2Q68A 4UV8A 2R9RB 3B8NA 5BR8O 2YSUB 1NR7A 5HFMA 1IBLB 2VWKA 3HB3B 1XDCA 3CP1A 2DOSA 3KCXA 2P5OA 1R3LC 3OMAB 4X65B 2FB5A 3CRRA 1MSDA 2QDOA 1F4NA 2YIAA 2ETNA 2JGDB 4DK1A 2BSKA 5IDJA 3HKCB 4JYYA 3UCSC 5J2UA 3ML0A 1GM9A 1IDSA 5B1BC 1VARA 3KG2A 3ZJZA 2QKCA 4P30A 4OGQB 4I55B 3I5DA 1IX9A 1XL4A 4MVMA 2NLJC 4WBNA 1Z5VA 1XUQA 3SJAC 3G80A 3JD3A 2OWOA 3S3WA 3CD6V 3H1LH 4FFBA 3EVKA 3UM7A 5B1BB 4OPAA 2BOCC 2WLJA 4TUYA 4LWSA 1VQLV 1DK1A 4O2BA 1SZTA 1SESA 3B77A 4B7EA 1L1FA 1QQCA 1NH2D 3A0HZ 1CPYA 2XT9A 4K0KB 1GM8A 4J7ZA 1AI7A 3X2QC 3ZMSA 1BHAA 3JASB 4LF5B 3N2KA 3K5OA 1N33O 3P30A 5ITZB 3JYCA 3OUFA 4F4LA 1Y66A 3OMIB 3NR7A 1FFTB 3OTFA 1K34A 3LDEA 4DV6O 2Q69A 3JAKB 3X2QB 5FPOA 2H3OA 1BHBA 1NZ6A 3DXRA 4IL6Z 1OCOC 4J10A 3OUSA 2ILMA 1ENVA 3ABKB 3PN1A 4Z1VA 4FLUA 2RJZA 1M57C 2PI5A 4I4TA 1OZ0A 2PYJA 3K59A 2QKSA 4TQDA 5JVDB 4AI8A 5EYPB 2KG7B 4DR7O 1VF6C 1OCOB 4GX1A 1VQ9V 1SETA 1EZJA 2ZCEA 5BXZA 3UQ8A 5LMNB 2P22C 3EXAA 4DR3B 1MSWD 1M57B 5B1AB 4DR4O 1TA8A 1GN3A 3THOA 3AG2B 1MG1A 5KHHA 4B3TO 3K3WA 4DV5B 1JA8A 2M6YA 1R3JC 4LF9O 4NVPA 4DUZB 1V54C 3P3PA 3VQVA 4F6RB 2EILC 4FLXA 3RFRA 3ZRWB 1K33A 2XASA 3B40A 1GH6A 3CRQA 1SQBH 2JVDA 4I50B 1N34O 4Q6GA 4X1IB 4G27B 4U7OA 2P4KA 4JAUA 5LBQA 3CCVV 2E5LO 5EBLC 1YXBA 1XMQB 1V54B 1Y67A 5EIBC 2CGNA 2EILB 2QM4A 1U96A 5FNVB 3D36C 1EN6A 1I94B 3L74H 1XOUA 3CCRV 1Q3EA 3K9SA 4X66O 3A0BZ 1OCCB 5KX5B 3O9OA 4RWUA 4DW1A 4U7NA 4NTWA 4AQYB 4GKJO 1SZXA 2H94A 2ZXWB 4DR2B 1NKDA 5LYJA 4EKWA 5DN6G 5CA3A 1AR1B 2YIBD 2AHYA 1QR9A 4R6ZA 3CC4V 3APOA 5KA5A 2M7WA 4LF6B 4BIOA 2Y48A 1VQKV 2BCCH 4WFFA 3SYPA 1D2DA 4WFHA 1OCZC 1YCIA 4YHHO 5EC1C 3G71V 4R7CA 1NQTA 3OE7G 3RYHB 1I7FA 4I7ZB 4QNHB 5GW7A 4ASUG 3VQWA 2L35A 3ZEDA 4RUFA 2AW9A 3CJHA 2JS3A 4RQFA 1WA8A 1SS3A 3L70H 3UT5B 3T1CA 1JMKC 1FFXB 5BY1A 4O4HB 1KKDA 1AI6A 5B1OA 2WLLB 1S5LZ 3AK2A 5B1NA 1TVKA 4BW9A 4X20A 2A79B 3H9VA 2OTJV 2F4VB 3JD0A 2Y0IA 1N4CA 4E4EA 2GV9A 2VQFB 1P49A 2W0FC 1IBMB 1URFA 1SERA 4ZI7B 3K08A 4NYKA 3BPZA 1Y4MA 5BMVA 3FYEB 1JFFA 4FLWA 4LFCO 1YSCA 2Q0OC 4EB6A 1W59A 2PY5A 4IIJA 4YJ2B 4FM0A 2IU3A 4AHCA 3HR0A 1GN2A 3OEHG 5GTIZ 2F93B 1HNXO 1Q5OA 3FB8C 3L73H 1S72V 2WAMA 2P7TC 2Y4TA 2EIKC 1BMFG 2HFEC 2UU9B 4H13B 1MZEA 1SA0B 1K5QA 4CH4A 3B09A 2EULA 1YI2V 1H2GA 4DR6B 3QVNA
chains in the Genus database with same CATH topology
1HP8A 2LQTA 2HP8A 2LGQA 2RNBA 1Z2GA 1U96A 1U97A 2RN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HP8 A;  2LQT A;  2HP8 A;  2LGQ A;  2RNB A;  1Z2G A;  1U96 A;  1U97 A;  2RN9 A; 
#chains in the Genus database with same CATH topology
 2F95 B;  5LXT B;  3SJB C;  2OYQ A;  4H37 A;  2YI9 A;  1WB8 A;  4B3M B;  4JI8 O;  4TV8 A;  1F23 A;  4EFE A;  1KBH A;  4O4L B;  1S76 D;  4LF8 O;  2BE3 A;  2AHZ A;  1AI4 A;  4XBF A;  1VIB A;  4UB8 Z;  1S0V A;  2QWN B;  4I0X A;  3CX5 F;  4RQE A;  1AJP A;  3FX7 A;  1K92 A;  2R70 A;  2OIE A;  2P90 A;  3TXQ A;  3ZCC A;  5CBG A;  5GON A;  3RYC A;  3APQ A;  3W7U A;  4JZ2 A;  1QLE B;  1M9N A;  3P3N A;  1M5I A;  4HAM A;  4UCO A;  1ZAU A;  4CS4 A;  1YTF B;  1VF5 B;  1XMO B;  1S5J A;  4KUM A;  5DEC A;  3CCJ V;  4MVR A;  5H2F Z;  2NNU A;  1ZX3 A;  4P9O A;  1QCE A;  3A8T A;  2LP7 A;  4PHZ A;  4JAV A;  3E8G A;  4LFA B;  5EK0 A;  3HKC A;  1NS1 A;  2YS8 A;  1DLB A;  5F2V O;  3SDL A;  1P7B A;  2LFS A;  3AG1 C;  3E35 A;  1PL4 A;  1DGS A;  1S5H C;  3F5W C;  4YIO A;  5LGN A;  5CA0 B;  5FL7 G;  3ZMZ A;  2LW7 A;  1J95 A;  1O9G A;  1G4Y B;  3WFV A;  4OXS A;  3JAR B;  1YJW V;  5KHK A;  2Q8V A;  3K03 A;  4X64 O;  4GT1 A;  3GWO A;  5BR8 B;  4Q20 A;  1VQM V;  2D3O W;  5KUM A;  3QG5 A;  2ZNI A;  1Z2G A;  3CWB H;  3B8M A;  1DTO A;  4JF3 A;  1NJI W;  3FKS G;  1Q8I A;  1IZ3 A;  3M8A A;  4UXN A;  4DR1 O;  3T1Y O;  3BA9 A;  4JGS A;  4X9Q A;  3W7W A;  1N36 B;  2HEP A;  1XNR B;  3JAS A;  3RWR D;  3W7T A;  2NR5 A;  4HYO A;  4LNU B;  5ITZ A;  2VQE O;  1H2K A;  2Q4P A;  1XL6 A;  4UCT A;  1QNM A;  3WB0 A;  4D7T A;  5IE9 A;  5IYZ B;  3JAK A;  1HDJ A;  3CXH F;  2EBO A;  1ZSP A;  3QO7 A;  4YIP A;  2IW5 A;  4UCU A;  2L6L A;  4DK0 A;  2EZO A;  4JI6 O;  4QPJ A;  3D8C A;  3H1K H;  1GK9 A;  3DC5 A;  3OMN B;  4QGP A;  1UJW B;  2LW1 A;  4J42 A;  2ZIM A;  4NTY A;  5L3C A;  1FJG O;  3OGC C;  4L8J A;  3CCQ V;  2QTO A;  5JVD A;  5EYP A;  2KG7 A;  2XAQ A;  1N33 B;  4HZ3 A;  5CN0 A;  3RGB A;  5EBW C;  2X0L A;  4LR3 A;  2CH7 B;  1ARO P;  2DYR C;  2XAG A;  1BT8 A;  1YVW A;  3LNN A;  2PUS A;  3RYI B;  4GUN A;  4X8A A;  3SYC A;  4DV6 B;  3SPG A;  1K5S A;  5LHG A;  5D5Q A;  3SPJ A;  4IHJ B;  2R9A A;  2A3Q A;  1VF6 A;  4CH5 A;  2JEX A;  1QBZ A;  1XBL A;  4BW5 A;  3RN4 A;  1N32 O;  4W4L A;  4F6R A;  1JR9 A;  1IBK O;  3ZRW A;  3RW0 A;  1DF4 A;  1B06 A;  4G2K A;  2X6C A;  5LHH A;  4DV0 B;  3ZX6 A;  1VQ7 V;  1VQ8 V;  4I50 A;  1K3E A;  4X1I A;  4RAI A;  1AB3 A;  4JTA B;  4DR7 B;  2QWO B;  4R8C A;  5EZY B;  2YXL A;  3BFR A;  3E22 B;  4LH7 A;  1PKX A;  3ZHV A;  1ZLZ A;  1H2N A;  5FNV A;  4DUY O;  1M1K W;  4DR4 B;  4CZZ A;  3HKB B;  1AR5 A;  4OX9 B;  4YXW G;  5KX5 A;  4B3T B;  3T4D A;  2Z0A A;  3DTU B;  1RSO B;  1NH2 B;  3R66 A;  3LDC A;  1NVP B;  5LOV B;  5LA6 B;  4JI0 O;  1FXK C;  5J2T B;  2FYU H;  4CS3 A;  4DRX B;  3ZMT A;  4LP8 A;  4PDV A;  3ZRX A;  5KMG B;  3DC6 A;  1EN4 A;  1N34 B;  3CPW U;  1THZ A;  5IJ0 B;  1K73 W;  3B4S A;  1XRE A;  3ABT A;  2CTQ A;  2N05 A;  3JAT B;  4L87 A;  2HVJ C;  3RYH A;  2ZM6 B;  4DR5 B;  2UUB B;  1G8M A;  5FPR A;  3ZHR A;  2RNB A;  4X66 B;  3HKE B;  4ZHQ B;  4J9Y B;  4PA7 A;  3UT5 A;  4GX5 A;  2OCC C;  2JS5 A;  1FFX A;  3OTO O;  5EBM C;  5L3D A;  4O4H A;  4TOI A;  2ZR3 A;  2WLL A;  1Q43 A;  4NR1 A;  3G6E V;  1NVP D;  1BS3 A;  1AJN A;  2V4D A;  5JQG A;  2HJD A;  4B3S O;  4QJF B;  2ZIN A;  3M7M X;  4JI7 O;  1JX9 A;  4JZG A;  1MA1 A;  5JJE B;  2XTA A;  4ZI7 A;  2OCC B;  1PD3 A;  3G67 A;  2P6J A;  1VF7 A;  2R72 A;  2FL4 A;  1B04 A;  1F51 A;  4N21 A;  2Q7H A;  3OM3 B;  1FXV A;  4YJ2 A;  4JI3 O;  4JTD B;  4MVO A;  4O4J B;  1HR0 B;  3OW2 U;  5KUK A;  3IC7 A;  3JSN A;  5L3G A;  4K8X A;  3ICX A;  1ZL8 B;  1KD1 W;  3BAB A;  1PL0 A;  1SA0 A;  4U3J A;  3KCY A;  2FKX A;  1NBM G;  2VWJ A;  3ABU A;  5LXT A;  1YZB A;  1IUR A;  1WB7 A;  1M56 C;  2WA4 A;  1WPX A;  2JDI G;  4O4L A;  5B3S C;  3C90 A;  4JV5 O;  4FM2 A;  3E8H A;  3JAW B;  4LFC B;  1Q6I A;  4PDL A;  1B3Q A;  2LO1 A;  2PZS A;  4JI1 B;  2HP8 A;  3BA8 A;  3LNM B;  2PYL A;  2NN4 A;  4MVU A;  5FLX N;  5B3S B;  3WG7 C;  4UVB A;  2QGN A;  4WFE A;  1IXB A;  2Q9L A;  2XND G;  4J11 A;  1FYJ A;  3DGE A;  2Q0A A;  4DV3 B;  1CEZ A;  2CTR A;  1PNK A;  5L3F A;  3JAM N;  4X65 O;  3ETD A;  1BGY H;  2A7W A;  4GKK O;  5IY5 C;  3UKM A;  4JI8 B;  2GHY A;  3WG7 B;  2PI4 A;  1AI5 A;  2E75 B;  3K5L A;  3E86 A;  4BWA A;  5JCO C;  1VQP V;  2QEX V;  5CA0 A;  4DV7 O;  1VMG A;  2G38 A;  5IY5 B;  2VRZ A;  3C3T A;  3HKD B;  5LP6 C;  3JAR A;  5IYB O;  1FKA O;  1KB9 F;  2Z5U A;  5IYC O;  1YIT V;  2B5U A;  3ASN C;  2ITD C;  2KB1 A;  1HW7 A;  4MSW C;  1TAE A;  4K8Z A;  2IJI A;  2HR3 A;  1RP3 B;  1D5N A;  3OR7 C;  1H8E G;  2IJJ A;  3T1H B;  5LP6 B;  1GKF A;  4D7S A;  4K0K O;  3FAV B;  1I0H A;  2A9H A;  4O4I B;  2DWE C;  1M90 W;  3HPL C;  5L3B A;  2HHH O;  2W0X A;  3ZHU A;  2ODM A;  3FB5 C;  5IYD O;  4LNU A;  1OCZ B;  4WCE V;  1FPO A;  4X1Y B;  2EIM C;  2HJF C;  4MVS A;  4PDR A;  1WAZ A;  1Q90 D;  2IU0 A;  1BQZ A;  2ZNJ A;  5IYZ A;  3AG4 C;  1WJZ A;  3CE2 A;  5JQG B;  4X64 B;  3WU2 Z;  1IVS A;  4MTG A;  1ZWI C;  2ZDI A;  4MTF A;  3TXS A;  1U97 A;  4GX0 A;  4DV1 B;  4J9Z B;  3K79 A;  3CCU V;  4NXN B;  4CBC A;  1Q7Y W;  2GTA A;  1VP7 A;  4DO2 A;  3CXC U;  2EIM B;  5KAF Z;  4AIL C;  2YDE A;  5H6R A;  1YHQ V;  3AG4 B;  3UO3 A;  3ETE A;  4MTO A;  4DR1 B;  2EIJ C;  2EJ7 A;  3FD9 A;  2ATK C;  3SR2 C;  4X88 A;  4WFA V;  2JJ1 G;  2P67 A;  1K97 A;  3G6B A;  2Y0P A;  1KMI Z;  1E1Q G;  3K0D A;  4WFB V;  4U3F H;  4DR3 O;  5KAI Z;  4FIP C;  2CH7 A;  1AJQ A;  2CDY A;  3CME V;  3LSQ A;  2JK5 C;  1YEW A;  3RYI A;  4U3J B;  2E3C A;  1NTK H;  1RFY A;  3E2E A;  3K5N A;  2ADP A;  3MHH C;  2OIG A;  1I5Y A;  1GN4 A;  4J7K A;  4IHJ A;  4X62 B;  1O9H A;  4DUZ O;  4JI5 B;  4UVC A;  2EIK B;  4UFZ A;  2JGU A;  2MK3 A;  2IH3 C;  2VS0 A;  3CYO A;  1R6K A;  2DN9 A;  2UXD B;  1P7G A;  4DW0 A;  4DV4 O;  1I5X A;  2QR4 A;  3IFX A;  1FJG B;  3ZIA G;  5KHJ A;  3GB7 C;  4UV9 A;  1OV9 A;  2UUA B;  4FJC C;  2B9Z A;  5EZY A;  3JD2 A;  3E22 A;  1KP3 A;  4ABM A;  1I94 O;  2LFR A;  3CSX A;  4B3R B;  1ZUQ A;  3QNE A;  2ZE7 A;  1J5E B;  3HKB A;  1MNG A;  1Q6U A;  4AQY O;  1RSO A;  3L71 H;  4FPP A;  3U11 A;  3OD4 A;  5A9G A;  5LOV A;  2GUZ B;  5LA6 A;  4DR2 O;  2ARH A;  3L75 H;  3F7V C;  5J2T A;  1XI1 A;  5DM6 V;  3T4Z A;  2HVK C;  4DRX A;  4LFB B;  1IBK B;  1TGO A;  4UCR A;  2CUG A;  2ZE6 A;  2EZP A;  4LF6 O;  4CC5 A;  4D6T H;  1TUB B;  1YJN V;  1CP9 A;  3CB2 A;  2WLI B;  5KMG A;  4H33 A;  4P2Z A;  4PV1 B;  1M4U A;  2Q7E A;  1OCR C;  1QR8 A;  1E79 G;  5KLV H;  1EN5 A;  5IJ0 A;  4H0L B;  4KHP O;  3AG3 C;  5LL6 Y;  2E74 B;  5CBH A;  2YC0 A;  2IBZ H;  3JAT A;  3K9A A;  1KYO F;  5CBF A;  1CXZ B;  1H38 A;  2WLK A;  2BTO A;  5IJ9 B;  3TET A;  2DQ0 A;  4IYI A;  4FM1 A;  3AG1 B;  4ZIB A;  3NXS A;  3LSU A;  1SQP H;  2YXY A;  4UVA A;  3HKE A;  4ZHQ A;  3UO2 A;  4DV2 O;  1JJ2 U;  5CA1 B;  1XHX A;  3GWK C;  1EZV H;  5B5E Z;  4LBE C;  1G6U A;  1PM9 A;  1N0J A;  3QF7 A;  2QA4 V;  4YY3 O;  1Q86 W;  2CE4 A;  4JI0 B;  2K1E A;  4FLY A;  1UPG A;  2F4V O;  3OT7 A;  2X6A A;  1GTO A;  1QVG U;  2RN9 A;  2UUC O;  4TSF G;  3ZRS A;  1COW G;  2B1I A;  2P06 A;  3ZN0 A;  3WB2 A;  3ABM C;  3D3I A;  4UB6 Z;  1Z5W A;  3B2E E;  4FLZ A;  1KP2 A;  2O57 A;  1Q81 W;  3BCC H;  5LMU O;  3ZS8 C;  4LF4 O;  1EM1 A;  3GVM A;  4FK5 C;  1P4R A;  2A0L A;  1IXM A;  3G4S V;  1SQX H;  3VQX A;  4C7U A;  4A5U B;  5H9C A;  2UXB O;  4O4J A;  2DE0 X;  1E1R G;  2PGG A;  3ABM B;  5TIS Z;  1Y76 B;  5A2Q N;  4NKG B;  1ZL8 A;  2LQT A;  4O2A B;  1HNW O;  3CS5 A;  2KSD A;  2UXN A;  4PI2 A;  3K5M A;  3F5T A;  1Q6H A;  4NXM O;  3F7Y C;  1LUV A;  3QO8 A;  3I56 V;  3QO5 A;  3TK1 A;  1XIL A;  1L0N H;  4MT8 A;  3JAW A;  2YXH A;  4ZBM A;  3RYF B;  1MMM A;  3W7S A;  3FYI B;  2HG5 C;  4JAA A;  2OT5 A;  1VQ5 V;  4JI3 B;  1ORQ C;  3E89 A;  2YIB A;  1NI8 A;  2EIN C;  5DED A;  2DYR B;  2KKW A;  5K1X A;  3AK1 A;  4BAY A;  2GBO A;  1HNZ O;  4HNA B;  5KA6 A;  1LUW A;  3A0R A;  3OGI B;  2RCV A;  4MVZ A;  1S3J A;  2ADQ B;  2XOK G;  1H2L A;  2ZD9 A;  1LNQ A;  5E79 Z;  2AXT Z;  2EIN B;  1HWY A;  3ZMU A;  4LFA O;  4XDJ A;  5LGT A;  2UXC O;  2Y69 C;  4JV5 B;  4PA4 A;  4CH6 A;  3AG7 A;  1WN7 A;  4J7J A;  3Q4H B;  2QWP B;  4YJ3 B;  4GYC B;  2YID A;  1W2B U;  4LF9 B;  1D5A A;  1JPX A;  4TQF A;  4PJ0 Z;  3HKD A;  2WWW A;  3D3Q A;  5CB4 B;  1A32 A;  1FD9 A;  2Y69 B;  3CC2 V;  3SYO A;  3D36 A;  2IJK A;  3ZBH A;  3OFN G;  4UCV A;  1WPB A;  3CC7 V;  2W6I G;  4KL1 A;  1KU9 A;  4JI2 O;  5JCO A;  2CAZ C;  3J7A U;  2YEV B;  5IWA O;  4E2L A;  3W7X A;  1MZF A;  4PA6 A;  2XAF A;  5GTH Z;  4TV9 B;  4GKK B;  2QJ1 A;  2F43 G;  5LP6 A;  3L72 H;  1H2S B;  2E5L B;  4ICG A;  2AGA A;  4QE9 A;  1FXK B;  4H44 B;  1N8R W;  1EFR G;  4LF7 O;  5H5N A;  3FAV A;  1KQS U;  4O4I A;  1N36 O;  1XNR O;  5C8Y B;  1KUQ A;  1KEC A;  1YJ9 V;  3RVY A;  4DV7 B;  2BOB C;  2GTS A;  2OCH A;  1XNQ O;  1HP8 A;  4GKJ B;  3TJT A;  4X1Y A;  2QWR B;  4KFM A;  1OHH G;  4JI4 O;  5AG2 A;  2Q73 A;  4OPH A;  1BCC H;  4X89 A;  1FAF A;  2WLM A;  1KC8 W;  4HBN A;  4J41 A;  2F23 A;  1B6Q A;  3VBB A;  1JOY A;  4JYA O;  4PEL A;  3JAL B;  1R6T A;  1AR4 A;  2WPD G;  2JJ2 G;  3CMA V;  2Z3Y A;  3IAY A;  4YHH B;  1K9M W;  1X4T A;  1SQF A;  3STZ C;  3DSQ A;  3LUT B;  3JD4 A;  1Y74 B;  3IJ4 A;  4DXW A;  1DF5 A;  3H1I H;  2OTL V;  2F66 C;  2HHH B;  5KHI A;  1FXH A;  5BZB A;  1JJO A;  2QM8 A;  3ETG A;  3K58 A;  3ABK C;  4KP4 A;  4FZ1 A;  3S3X A;  3JSL A;  2YIC A;  2BTQ B;  1R3I C;  4PA3 A;  2DYS C;  5JH7 B;  1QU7 A;  1GN6 A;  3K57 A;  1K8A W;  4GCZ A;  4GLX A;  4RUE A;  1AP5 A;  4MTX A;  4KXR A;  2ZQM A;  5B66 Z;  3JD1 A;  2X7R B;  2DYS B;  1SC5 B;  5LGU A;  5B1A C;  3N2G B;  4DV0 O;  3BRC A;  1SRY A;  2YI8 A;  3VOU A;  3AG2 C;  4X1K B;  5D5P A;  4G28 B;  1KKC A;  1M56 B;  2Q7G A;  1HNX B;  3FFQ A;  3ASO C;  3BVO A;  3ZHQ A;  4MW8 A;  4ZOL B;  2RQ6 A;  4CH3 A;  2QSA A;  4IT5 A;  4PD4 F;  4OX9 O;  1IBL O;  2WLH A;  2YUA A;  1WP8 A;  3SJQ C;  2ZR2 A;  1Q82 W;  1JVM A;  3MAQ A;  1T5E A;  3ASO B;  1QVF U;  2GUZ A;  2CTP A;  1XEQ A;  3E8B A;  3RVZ A;  4I9Q A;  4LF8 B;  1R1B A;  5CMU A;  1TUB A;  4DV4 B;  2WLI A;  1OCC C;  2WA3 A;  4I5S A;  2ZXW C;  3AEI A;  3LSS A;  1W0J G;  4DR5 O;  1RM1 C;  2ZM6 O;  2UUB O;  5HFL A;  2PF4 E;  5IJ9 A;  4LC1 A;  2IM9 A;  3CRC A;  1UFI A;  4B08 A;  1SKV A;  2C2A A;  1W0K G;  1V9P A;  3JCU Z;  5CA1 A;  1BL8 A;  2WSS G;  3CCE V;  4XDK A;  2AZ2 A;  1RM1 B;  4WF9 V;  2BSK B;  4IGG A;  1GRJ A;  2FTK A;  3ASN B;  5J2U B;  1H2M A;  4LF5 O;  2DJV A;  1VQ4 V;  2ZE5 A;  1MAB G;  4KHP B;  1US6 A;  3KZI Z;  4WBN B;  1QHT A;  4FFB B;  1PP9 H;  1R73 A;  2Q5Z A;  3CRA A;  4W4K A;  1GO3 F;  2UXX A;  2H8P C;  3CCS V;  4TUY B;  4LWS B;  5JWP A;  4BIU A;  4QIW F;  1HR0 O;  4O2B B;  3U0Z A;  3J80 N;  1SQV H;  3K0G A;  4DV2 B;  2ZE8 A;  2ZT9 B;  4QPK A;  1Y76 A;  4LH6 A;  3SPI A;  4YY3 B;  2GDS A;  2JIZ G;  2ZIO A;  4PA9 A;  4O2A A;  1BQ0 A;  5EIB D;  3T1Y B;  3SJC C;  4LCU C;  1LR1 A;  3N2K B;  2D2C B;  2UUC B;  4F6E A;  1WNS A;  1Y6X A;  3ABL C;  4QE7 A;  3RT3 C;  5LMN O;  3SYA A;  3CCL V;  5E1A C;  2VQE B;  1K4D C;  3RYF A;  5LMU B;  4LF4 B;  1R6N A;  2EIJ B;  2V1D A;  4N23 A;  4JI1 O;  2W6J G;  4JYB A;  3H1H H;  4DV5 O;  1PNM A;  2LGW A;  3DXR B;  3K04 A;  3SPC A;  5JJN B;  1K7D A;  2UXB B;  3ABL B;  3FB6 C;  4UCS A;  4JI6 B;  3CCM V;  4NTX A;  3T2M A;  1VQO V;  4I4T B;  2MW2 B;  4HNA A;  2DMX A;  4JAS A;  4DV3 O;  1HNW B;  4ZKI A;  1SF9 A;  2RDC A;  3BEH A;  1VQ6 V;  5L3E A;  4J80 A;  4NXM B;  1XMQ O;  1M93 A;  1QLE C;  4TWK A;  2LGQ A;  4BIZ A;  2JRI A;  1L0L H;  4K35 A;  1I08 A;  2R9I A;  1V55 C;  3H1J H;  5C93 A;  2QWQ B;  1AIL A;  2CGO A;  3Q4H A;  5IT9 N;  4YJ3 A;  4EEQ A;  3AK3 A;  1BZK A;  3ZN1 A;  4R50 A;  1L8D A;  1PV0 A;  3RBZ A;  1ZTE A;  4JYC A;  1NR1 A;  2QKA A;  5CB4 A;  4Z1M G;  1V55 B;  4IYH A;  1N32 B;  3SGI A;  1JQ0 A;  1HNZ B;  3OEE G;  3ZMV A;  1JCH A;  1VQN V;  3CHX A;  4JPR A;  2YEV A;  3BAA A;  4FZ0 A;  2XUM A;  1AP6 A;  3T1H O;  4PDM A;  4TV9 A;  3FB7 C;  2JGD A;  2P4V A;  1FXK A;  2HKO A;  2UXC B;  1YIJ V;  4DUY B;  3STL C;  4B7K A;  5C8Y A;  3ETQ A;  2B1G A;  1GAX A;  1BE3 H;  2QTS A;  2AZ0 A;  4I55 A;  4K3A A;  4UUJ C;  1OCR B;  3BHP A;  3AG3 B;  1FS0 G;  3CEI A;  1RPO A;  2KQX A;  5LYJ B;  1ROP A;  3H01 A;  4GZR B;  1SQG A;  1XHZ A;  4TT3 G;  4JI2 B;  4P9P A;  2XAJ A;  2VQF O;  4CS2 A;  1YTF D;  3BY6 A;  4DV1 O;  1NTM H;  3JAL A;  5IWA B;  1IBM O;  4NXN O;  4MS2 A;  1K4C C;  4CC6 A;  3OAA G;  5K1P A;  3MHS C;  2FML A;  4LF7 B;  1YDX A;  1NU1 H;  1Y74 A;  3C3S A;  3ZRV A;  1F7Y A;  1NT2 B;  2QE7 G;  3CJH B;  3IGA C;  1QLN A;  3VQY A;  2ZDI C;  3I55 V;  4FMT A;  1WA8 B;  1WP7 A;  2F1M A;  4NB5 A;  1OJH A;  3E8F A;  1X59 A;  1TUE B;  1GM7 A;  3WB1 A;  1BSM A;  1XNQ B;  2BTQ A;  2UU9 O;  1PNL A;  1SQQ H;  1PPJ H;  5JH7 A;  2CTW A;  3OTO B;  3P32 A;  3LDD A;  1GMG A;  1XQ8 A;  3J81 N;  4JI4 B;  2K9P A;  3OR6 C;  1R3K C;  5EC2 C;  1TVK B;  1RPR A;  4WFG A;  4X20 B;  1AVM A;  1P84 F;  4DYL A;  4DR6 O;  3ZHS A;  4B3S B;  4RO2 A;  5J9P C;  3E83 A;  2IH1 C;  3QTC A;  4X62 O;  4JI5 O;  2JEU A;  4JI7 B;  4JYA B;  3K06 A;  2X6B A;  3IC9 A;  3MD0 A;  4B3M O;  2DWD C;  4MW3 A;  1N0N A;  2HLD G;  3JCZ A;  3KKY A;  3EHB B;  3SPH A;  2GSM B;  5H6Q A;  5BMV B;  4FFK A;  2UXD O;  1JFF B;  3N2G A;  4EB6 B;  2LJ2 A;  3CRM A;  4IIJ B;  3EFF K;  2EJR A;  2RMK B;  4I9W A;  4X1K A;  2DQ3 A;  2UUA O;  2PTM A;  3O65 A;  1H8H G;  2A06 H;  2E76 B;  1S77 D;  2XAH A;  1G1X B;  2Q67 A;  1NTZ H;  5JJJ B;  3A2F A;  2IJH A;  2WLN A;  4GX2 A;  4ZOL A;  5KHG A;  4B3R O;  2CK3 G;  3L9D A;  5LHI A;  1J5E O;  1EBO A;  1YF2 A;  1XMO O;  4XDL A;  4FLV A;  3TGU H;  4BR6 A;  3M99 B;  2ZKO A;  3PJS K;  2N04 A;  2Y4U A;  3ZHT A;  4JTC B;  4TV8 B;  4PI0 A;  1MOF A;  4Z2W A;  2N74 A;  2Q6A A;  1WLE A;  3TCU A;  4FLT A;  4LFB O;  2ITC C;  3MDS A;  3R65 A;  4FVM A;  1VEW A;  2DW4 A;  4I0X B;  3N27 A;  2XHB A;  3U10 A;  4MVQ A;  4EFB A;  5GON B;  3SYQ A;  1F4M A;  3RYC B;  2V7Q G;  2EX3 A;  2QM7 A;  2Q68 A;  4UV8 A;  2R9R B;  3B8N A;  5BR8 O;  2YSU B;  1NR7 A;  5HFM A;  1IBL B;  2VWK A;  3HB3 B;  1XDC A;  3CP1 A;  2DOS A;  3KCX A;  2P5O A;  1R3L C;  3OMA B;  4X65 B;  2FB5 A;  3CRR A;  1MSD A;  2QDO A;  1F4N A;  2YIA A;  2ETN A;  2JGD B;  4DK1 A;  2BSK A;  5IDJ A;  3HKC B;  4JYY A;  3UCS C;  5J2U A;  3ML0 A;  1GM9 A;  1IDS A;  5B1B C;  1VAR A;  3KG2 A;  3ZJZ A;  2QKC A;  4P30 A;  4OGQ B;  4I55 B;  3I5D A;  1IX9 A;  1XL4 A;  4MVM A;  2NLJ C;  4WBN A;  1Z5V A;  1XUQ A;  3SJA C;  3G80 A;  3JD3 A;  2OWO A;  3S3W A;  3CD6 V;  3H1L H;  4FFB A;  3EVK A;  3UM7 A;  5B1B B;  4OPA A;  2BOC C;  2WLJ A;  4TUY A;  4LWS A;  1VQL V;  1DK1 A;  4O2B A;  1SZT A;  1SES A;  3B77 A;  4B7E A;  1L1F A;  1QQC A;  1NH2 D;  3A0H Z;  1CPY A;  2XT9 A;  4K0K B;  1GM8 A;  4J7Z A;  1AI7 A;  3X2Q C;  3ZMS A;  1BHA A;  3JAS B;  4LF5 B;  3N2K A;  3K5O A;  1N33 O;  3P30 A;  5ITZ B;  3JYC A;  3OUF A;  4F4L A;  1Y66 A;  3OMI B;  3NR7 A;  1FFT B;  3OTF A;  1K34 A;  3LDE A;  4DV6 O;  2Q69 A;  3JAK B;  3X2Q B;  5FPO A;  2H3O A;  1BHB A;  1NZ6 A;  3DXR A;  4IL6 Z;  1OCO C;  4J10 A;  3OUS A;  2ILM A;  1ENV A;  3ABK B;  3PN1 A;  4Z1V A;  4FLU A;  2RJZ A;  1M57 C;  2PI5 A;  4I4T A;  1OZ0 A;  2PYJ A;  3K59 A;  2QKS A;  4TQD A;  5JVD B;  4AI8 A;  5EYP B;  2KG7 B;  4DR7 O;  1VF6 C;  1OCO B;  4GX1 A;  1VQ9 V;  1SET A;  1EZJ A;  2ZCE A;  5BXZ A;  3UQ8 A;  5LMN B;  2P22 C;  3EXA A;  4DR3 B;  1MSW D;  1M57 B;  5B1A B;  4DR4 O;  1TA8 A;  1GN3 A;  3THO A;  3AG2 B;  1MG1 A;  5KHH A;  4B3T O;  3K3W A;  4DV5 B;  1JA8 A;  2M6Y A;  1R3J C;  4LF9 O;  4NVP A;  4DUZ B;  1V54 C;  3P3P A;  3VQV A;  4F6R B;  2EIL C;  4FLX A;  3RFR A;  3ZRW B;  1K33 A;  2XAS A;  3B40 A;  1GH6 A;  3CRQ A;  1SQB H;  2JVD A;  4I50 B;  1N34 O;  4Q6G A;  4X1I B;  4G27 B;  4U7O A;  2P4K A;  4JAU A;  5LBQ A;  3CCV V;  2E5L O;  5EBL C;  1YXB A;  1XMQ B;  1V54 B;  1Y67 A;  5EIB C;  2CGN A;  2EIL B;  2QM4 A;  1U96 A;  5FNV B;  3D36 C;  1EN6 A;  1I94 B;  3L74 H;  1XOU A;  3CCR V;  1Q3E A;  3K9S A;  4X66 O;  3A0B Z;  1OCC B;  5KX5 B;  3O9O A;  4RWU A;  4DW1 A;  4U7N A;  4NTW A;  4AQY B;  4GKJ O;  1SZX A;  2H94 A;  2ZXW B;  4DR2 B;  1NKD A;  5LYJ A;  4EKW A;  5DN6 G;  5CA3 A;  1AR1 B;  2YIB D;  2AHY A;  1QR9 A;  4R6Z A;  3CC4 V;  3APO A;  5KA5 A;  2M7W A;  4LF6 B;  4BIO A;  2Y48 A;  1VQK V;  2BCC H;  4WFF A;  3SYP A;  1D2D A;  4WFH A;  1OCZ C;  1YCI A;  4YHH O;  5EC1 C;  3G71 V;  4R7C A;  1NQT A;  3OE7 G;  3RYH B;  1I7F A;  4I7Z B;  4QNH B;  5GW7 A;  4ASU G;  3VQW A;  2L35 A;  3ZED A;  4RUF A;  2AW9 A;  3CJH A;  2JS3 A;  4RQF A;  1WA8 A;  1SS3 A;  3L70 H;  3UT5 B;  3T1C A;  1JMK C;  1FFX B;  5BY1 A;  4O4H B;  1KKD A;  1AI6 A;  5B1O A;  2WLL B;  1S5L Z;  3AK2 A;  5B1N A;  1TVK A;  4BW9 A;  4X20 A;  2A79 B;  3H9V A;  2OTJ V;  2F4V B;  3JD0 A;  2Y0I A;  1N4C A;  4E4E A;  2GV9 A;  2VQF B;  1P49 A;  2W0F C;  1IBM B;  1URF A;  1SER A;  4ZI7 B;  3K08 A;  4NYK A;  3BPZ A;  1Y4M A;  5BMV A;  3FYE B;  1JFF A;  4FLW A;  4LFC O;  1YSC A;  2Q0O C;  4EB6 A;  1W59 A;  2PY5 A;  4IIJ A;  4YJ2 B;  4FM0 A;  2IU3 A;  4AHC A;  3HR0 A;  1GN2 A;  3OEH G;  5GTI Z;  2F93 B;  1HNX O;  1Q5O A;  3FB8 C;  3L73 H;  1S72 V;  2WAM A;  2P7T C;  2Y4T A;  2EIK C;  1BMF G;  2HFE C;  2UU9 B;  4H13 B;  1MZE A;  1SA0 B;  1K5Q A;  4CH4 A;  3B09 A;  2EUL A;  1YI2 V;  1H2G A;  4DR6 B;  3QVN A; 
#chains in the Genus database with same CATH homology
 1HP8 A;  2LQT A;  2HP8 A;  2LGQ A;  2RNB A;  1Z2G A;  1U96 A;  1U97 A;  2RN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...