2HP8A

Solution structure of human p8-mtcp1, a cysteine-rich protein encoded by the mtcp1 oncogene,reveals a new alpha-helical assembly motif, nmr, 30 structures
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
68
structure length
68
Chain Sequence
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cysteine motif
molecule keywords HU-P8
publication title Solution structure of human p8MTCP1, a cysteine-rich protein encoded by the MTCP1 oncogene, reveals a new alpha-helical assembly motif.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1997-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08991 MTCP1 Mature-T-Cell Proliferation I type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2hp8A00
1HP8A 1U96A 1Z2GA 2RN9A 2HP8A 2LQTA 2RNBA 1U97A 2LGQA
chains in the Genus database with same CATH superfamily
1JVMA 3CC7V 1K9MW 2QKAA 3A0RA 2ZDIC 1OCZB 3KKYA 1ENVA 1GN3A 3LUTB 3TJTA 4MTFA 3SPCA 4DO2A 3JARB 3ZN0A 4QNHB 3RYCA 5FLXN 2FB5A 2L6LA 4IIJB 4GKKO 2AZ2A 4DV2O 4JTAB 1URFA 3B40A 3ML0A 3HKEB 1NT2B 4PA6A 1Y4MA 1KYOF 5BY1A 5J2TB 2QM4A 4LWSB 1MOFA 2VRZA 1VARA 1VP7A 4BIUA 4I4TB 2UUCB 1NTKH 3P32A 4YIPA 3BY6A 1ZAUA 3CJHA 4CZZA 4E2LA 4LF6B 1SQGA 2Q7GA 3H1KH 2HHHB 4UCUA 2XUMA 3AG4B 4EB6B 2CUGA 4DV1O 5IYZB 5KUMA 4JI8O 1K33A 2KG7A 5CB4B 4FLWA 3IJ4A 3JCZA 1US6A 1SESA 4X1KA 4XBFA 5JWPA 3FKSG 3CYOA 2YIDA 1EN6A 3S3WA 3K9AA 1EFRG 4HBNA 2YIBD 2BSKA 2EILB 2XTAA 4R8CA 3LSUA 1VQ7V 3J7AU 3K79A 4FM1A 2PUSA 1HNZB 4IHJA 3RFRA 2XAGA 5A2QN 1OCOB 1YIJV 4X8AA 3H1HH 4FFBB 4O4HA 4U7OA 5EBLC 3SYCA 5LA6B 1YCIA 5L3FA 4BR6A 3ETDA 5K1PA 1N0NA 1OZ0A 4PA9A 4B3TO 3UT5A 3WG7B 1QBZA 3RT3C 4KUMA 3FYEB 3K0DA 1KBHA 5EYPB 5KAFZ 2QWQB 1VIBA 1XDCA 2VQEB 3OUFA 3HKDB 1PPJH 1L1FA 3F5WC 4DR2B 1PL0A 2DN9A 5DEDA 3W7UA 5E1AC 3U11A 2FYUH 2LFRA 1FXVA 4FK5C 4WCEV 1FXHA 4FJCC 3GB7C 4N23A 2QWPB 4CBCA 2K9PA 1M57C 4JTDB 3ABLC 1TGOA 5KX5B 2Y0IA 2RMKB 4LF4B 3CCRV 2R9IA 2QGNA 3HKCB 1GMGA 1N33O 3Q4HB 4GKJO 3A0HZ 2GSMB 1B3QA 3E35A 1KP2A 1BSMA 2UXDB 3AG1B 5LYJB 3BPZA 1E79G 5KHKA 1QVGU 1R3LC 4N21A 4PJ0Z 1XMQB 4CH6A 4JI4O 4LF7O 2XASA 4FLZA 2GV9A 1XI1A 4IGGA 5K1XA 1ZLZA 3ABMB 3N2KB 5IJ9B 4WBNA 4FMTA 4FLYA 4YJ3B 5B1NA 3KG2A 2Y4UA 1LUVA 4JV5O 1P7GA 4MTXA 1MZFA 4XDJA 1Q7YW 1QLEC 1L0NH 4GKKB 3RBZA 2YEVB 5CN0A 2R70A 4HNAB 4PA7A 4MVOA 3AG2C 1PNKA 1KECA 2Y69B 5DM6V 2RCVA 3QO8A 4Z2WA 2KSDA 1H2NA 3RVYA 4DYLA 1N0JA 4GX2A 1ORQC 4R7CA 1RM1C 1QCEA 5J9PC 3STZC 5FL7G 4TV8A 3SPHA 1RP3B 1V54B 1Q81W 1OJHA 3ZRXA 4WFHA 4O4LB 5C8YA 4DV1B 4JI8B 3ABTA 4GLXA 4WFEA 1H2SB 1YHQV 3T1YB 1QR8A 4NTXA 1YJ9V 3ZMVA 3G71V 3K59A 2WLJA 4UB8Z 1JQ0A 2N74A 2GTAA 1YTFB 4DUYO 4JGSA 1BL8A 4YJ2A 3K5OA 1GM9A 1O9HA 2QTSA 2RNBA 2BOCC 4B3MO 5IYBO 1PNMA 3BA8A 4DXWA 1BS3A 4B3RO 4LNUA 3MDSA 4J7JA 5ITZB 3SGIA 4WFAV 2CTRA 1AJPA 3EXAA 5EZYB 1V55B 4CS3A 1SA0A 4ABMA 2C2AA 1VQLV 2OIGA 3FAVA 1CP9A 2WLIB 3BVOA 2UU9B 1IBMO 1H2KA 1OCZC 1G1XB 4TOIA 2Q8VA 4RO2A 1YVWA 2QSAA 3K03A 1QLNA 1FXKB 3L73H 2R9RB 2EIMB 1H8HG 4PDMA 2IH1C 4G28B 5LL6Y 4LFAB 3WB0A 4PHZA 1VQ5V 4K8ZA 5BMVA 3JASB 4C7UA 2ZXWB 3RYHA 1Q82W 3E8FA 3E83A 1GRJA 3CMAV 1DF4A 4TWKA 1FFTB 3T2MA 4YY3O 1BMFG 4OXSA 4X62B 3CRMA 3ZRWB 4NTYA 5IY5C 1NBMG 1VQKV 1AI5A 5EBMC 3BA9A 4O2AA 4CC6A 1RSOB 2QDOA 3AG4C 2WLNA 2DYRB 2LQTA 3VQXA 3IC7A 3CCVV 1VMGA 4J41A 5CA1B 1ZUQA 1N33B 1IXBA 2LW7A 5JH7A 4GKJB 3JD4A 2E5LO 2EILC 4L87A 1Z5VA 2QM8A 5B5EZ 2A06H 1GM7A 4JI5O 2Y0PA 1XHXA 4JI4B 3HKBB 1OCOC 3R66A 2F66C 3GWOA 3UCSC 3HR0A 1GTOA 1Y6XA 5H5NA 3JSNA 2IH3C 4WFBV 5B3SB 3M99B 1CEZA 2JVDA 3ZEDA 5LP6B 4MW3A 2OT5A 2QE7G 5BZBA 4ZOLB 2RJZA 3DTUB 4JV5B 2Q7EA 4DRXB 2OIEA 2QKCA 2CTWA 4O4JA 5JVDB 2HKOA 1YEWA 1Y76A 1DK1A 3STLC 1JFFA 2DYSB 1YITV 1I5YA 2DQ3A 4R50A 1GK9A 3CRCA 3P3NA 1I7FA 1XUQA 4X64O 4X65B 4DR6O 4JASA 2CDYA 3CCJV 5JCOC 3PJSK 4KHPO 4FZ1A 5A9GA 1XL4A 2DWEC 1YJWV 2N04A 3N2GB 4RQFA 4BW5A 4RAIA 2DQ0A 1OCCB 3BRCA 2RDCA 4ZBMA 2UUBO 2P4VA 1YDXA 3K58A 2NNUA 3JD0A 1K4CC 3OEHG 3AG1C 4UXNA 1OHHG 2YIBA 2F95B 1MSDA 4B3MB 4QPJA 5GONA 4JI6O 1SERA 4B3RB 1Q43A 1BCCH 3CRAA 4MT8A 3QG5A 1OCRB 3CJHB 2A0LA 5B1AC 5AG2A 1ZWIC 1F7YA 5CBFA 3K06A 2K1EA 4TT3G 1H2GA 3ZRSA 1JR9A 1IBMB 1PV0A 1IVSA 4DR7O 1EN4A 2KG7B 3D8CA 3ZJZA 1EBOA 4LCUC 2BTOA 4NXNO 3LNNA 3FB8C 2OTJV 5KHGA 1R6NA 1SZXA 1L0LH 3X2QC 2BSKB 5EBWC 1F4MA 4F6RA 4YXWG 1W0KG 2WA4A 4UV8A 1M9NA 2Q6AA 3ZCCA 3ETEA 4JYAO 1LUWA 1MMMA 3JATB 1NKDA 4YY3B 5HFMA 4LF8O 1G8MA 2H94A 1WAZA 3J80N 1SQPH 4O2BB 3ZBHA 1TAEA 4DR5O 2IJKA 1UPGA 4IT5A 4JPRA 2KB1A 1JA8A 3UT5B 2GHYA 1XMOO 1TVKA 2QM7A 3QVNA 2D3OW 2NN4A 4J9ZB 1MSWD 5JJEB 4KL1A 5EIBD 1EZJA 1QVFU 3UQ8A 2E5LB 4AQYO 3D36C 2CGOA 3F7YC 4H33A 1IZ3A 4WF9V 1K92A 1E1QG 1JJ2U 4D7TA 1VQ8V 4P2ZA 3ZS8C 4JI5B 4MW8A 4FZ0A 2ARHA 3ZMUA 3JAWA 2LW1A 5LOVA 3L9DA 4AI8A 3GWKC 5GTHZ 3G4SV 2KQXA 5F2VO 4LF9O 1V55C 2IJHA 1HR0B 3VBBA 3QO7A 4UVCA 3VQWA 2Z3YA 4J42A 3T1HB 2EULA 4TUYB 2Q4PA 3APQA 2XNDG 4BWAA 3APOA 1RPRA 4JYYA 1H2LA 1FXKC 1K4DC 2EIMC 2ZR2A 1QNMA 4DR1O 3RN4A 2UUAB 3B8NA 1F51A 1SQQH 3E22B 3CE2A 4CH5A 3SJBC 1M4UA 2E75B 4DV6O 5J2UB 1YF2A 4B3SB 2QR4A 1NR7A 3ZMTA 2ADPA 1N34B 4LFCO 1PD3A 4YIOA 5LMUO 1N36O 1K34A 1VF6A 4NYKA 5EK0A 1FAFA 3T1CA 1SQFA 4I0XA 1XEQA 2QWRB 4WBNB 5EC2C 5KA6A 1YTFD 1K7DA 3I5DA 2XHBA 3R65A 3ASNC 2DYRC 1COWG 5LGNA 5IT9N 4LP8A 3QF7A 3ZRVA 1JPXA 3CS5A 5LHHA 1P4RA 2R72A 4X1IB 1O9GA 1BHAA 2HLDG 3G80A 4J11A 1VQ6V 4JF3A 4DR3B 4FVMA 3VQVA 2CE4A 1HDJA 3PN1A 4NKGB 4ZI7A 4JI6B 2EINB 2AGAA 4UCOA 2JJ1G 3RYFA 2F43G 5LHGA 4MVZA 1U97A 2LO1A 4TV8B 1XILA 4UFZA 4DV4B 3OMNB 4EFEA 2WPDG 4RUEA 4PD4F 1KP3A 2EIKB 4NR1A 4KP4A 5FPRA 5C8YB 5LP6C 1IBKO 3T4DA 5KHJA 4LFBO 1SS3A 4NXNB 3DSQA 2YUAA 4J7ZA 1JCHA 4ZHQA 4LR3A 2ZNIA 5FNVB 2ZM6O 5L3BA 4UCTA 3UO2A 2O57A 4X9QA 4FPPA 1DLBA 3RVZA 4LNUB 3CRRA 4JYAB 3ZMSA 1SA0B 3JYCA 2QKSA 4PDRA 2VQFO 5H6RA 1FFXA 5EC1C 4TQDA 4X20A 5L3GA 3DXRA 5B66Z 3NR7A 2HJDA 4JYBA 5KMGA 1TUEB 4K35A 2BTQA 1VF6C 4D7SA 3L74H 4DV5O 1XNQO 4WFGA 3M8AA 4U3JB 2P90A 2PY5A 3JALA 2CTPA 5IJ0A 4I9QA 4AQYB 3BEHA 4MVQA 4X1YA 2X6AA 2GUZB 2FTKA 2ZE5A 1WA8B 4IL6Z 3B2EE 5LBQA 3OD4A 4B7EA 2E3CA 3FX7A 5KLVH 1Y74A 1AI7A 3P30A 4LH6A 3E8GA 1Q5OA 1LNQA 2PI4A 4DV7O 4IIJA 3K04A 4O2AB 5BR8B 1WPXA 3HKEA 3G6BA 1XQ8A 1F23A 3UKMA 5KAIZ 3K5NA 3RGBA 1DTOA 3VQYA 3AG3B 5JH7B 5J2TA 4LWSA 3CCUV 4DR1B 4K8XA 4I55A 2HEPA 4I4TA 4DV2B 2EJ7A 2IW5A 2HVKC 3K08A 3JAKA 2A9HA 2HR3A 2UXBO 4PELA 4JZ2A 4I50A 4JTCB 2JEXA 1S76D 2Q9LA 5LMUB 1LR1A 3D3QA 4DK0A 4EB6A 1RFYA 4MVUA 2KKWA 1M93A 1PNLA 5CB4A 1EN5A 2GDSA 4Q6GA 3W7TA 5LHIA 5CBGA 4P9PA 1BGYH 1R3KC 3ZHQA 4CH4A 1ROPA 2P22C 3DC6A 1TUBB 4P9OA 1VF7A 2QWNB 3P3PA 1AI6A 1KUQA 4O4JB 3EVKA 1SKVA 1D2DA 4GX0A 4D6TH 1JFFB 2P7TC 4L8JA 5B1BB 2CGNA 2PI5A 3LSSA 4FLUA 2JGDB 4DV0O 2ZE7A 1G4YB 2ZQMA 3O9OA 1N32O 2Y48A 1NVPB 5LA6A 4FIPC 1VQPV 3OAAG 3I56V 1R3JC 3A0BZ 5IDJA 1AVMA 1XL6A 1GN4A 4PV1B 2Z5UA 2WLLA 2IU0A 3WFVA 3FB7C 1BHBA 1GN2A 5EYPA 1IBKB 4ZIBA 3AK2A 1B6QA 3LSQA 3E8BA 2W6JG 1GKFA 1TA8A 2QWOB 3CCSV 4B3TB 5JCOA 2PYLA 4QE9A 3ABKB 2JEUA 2ZM6B 3F7VC 2EZOA 4CS2A 4HZ3A 2G38A 5GONB 3K9SA 1YZBA 3OT7A 3OMIB 3JD2A 2YI9A 2AZ0A 1Z5WA 5E79Z 5KX5A 1S77D 3S3XA 4W4KA 2VQFB 1NJIW 4MSWC 2X0LA 4I7ZB 3CD6V 2IU3A 4OPAA 3Q4HA 5IYDO 4KFMA 3DC5A 2PTMA 3MHSC 5LYJA 4OX9O 2ADQB 1NTZH 4GZRB 4I9WA 2XAFA 3GVMA 2HFEC 2LP7A 1SZTA 3LNMB 1YI2V 1VQ9V 5B1OA 3OTFA 3N2KA 3E89A 4GX1A 2Q0OC 1SETA 4NXMO 4JYCA 2F4VO 2JS5A 1AB3A 4LF7B 4J10A 2YC0A 2ZD9A 1GM8A 3AEIA 4O4IA 4OPHA 4GUNA 5IE9A 2WLKA 3W7XA 4J7KA 4B7KA 3SR2C 2WLHA 4HNAA 3FFQA 3SPJA 3CEIA 5CA0B 1PKXA 4UCSA 3QTCA 3WG7C 1H2MA 2BE3A 1SQBH 2X6CA 1XREA 4QPKA 2ZKOA 4G2KA 4JI3O 4FLVA 5CMUA 3H1LH 2FL4A 2ZIOA 2HVJC 1YJNV 3CCQV 5LOVB 4MTGA 4X66O 1RPOA 3KZIZ 4OGQB 3RYIA 1JMKC 4LH7A 1P7BA 5IWAO 2MW2B 1NH2B 3CHXA 3TCUA 1ZTEA 3D36A 3RYCB 2X7RB 3ZIAG 1IDSA 4R6ZA 3HB3B 4MS2A 4RWUA 5ITZA 4JAAA 2DOSA 4UUJC 1S3JA 5CBHA 2YI8A 4DUYB 3CXCU 2OCCB 2RQ6A 5L3DA 1MABG 5EZYA 1N8RW 1QR9A 4JI7O 2OCHA 1N32B 2HHHO 2WLIA 1FD9A 1P84F 4GT1A 3ABLB 5EIBC 1V9PA 4I0XB 2ATKC 2YSUB 5FPOA 3ZHVA 3UO3A 1FXKA 1OV9A 1KD1W 3ABMC 2QTOA 2N05A 2LFSA 4ZKIA 3JASA 1YXBA 4P30A 3ZMZA 2DE0X 2YS8A 4X1KB 2P4KA 4H37A 4JZGA 4TV9A 3ETQA 4QE7A 2YXLA 2JIZG 2QJ1A 2ODMA 2ZINA 1ZL8A 2ETNA 2Y69C 2ITDC 5HFLA 3K5MA 3H01A 3WB2A 1S72V 1T5EA 4IHJB 2Q5ZA 1HP8A 5JQGA 1WB7A 2CAZC 1I94O 1S5JA 2DWDC 1KC8W 1QLEB 1W59A 4O4HB 1J95A 3SYPA 1U96A 5CA1A 4UVBA 1N4CA 3JD3A 3AG2B 1V54C 4H0LB 5IYCO 3G6EV 3RW0A 4OX9B 1KQSU 2VQEO 2P06A 1DGSA 1WPBA 1NZ6A 4FLTA 2AHYA 1GN6A 1NU1H 4K0KO 3CMEV 3IAYA 4DR2O 2CK3G 3BABA 2XAHA 2M6YA 1M1KW 2ZE8A 2DMXA 2WLMA 2VWKA 1K5SA 4NTWA 2EBOA 1P49A 2MK3A 5LP6A 1I08A 2F4VB 4ZOLA 3K3WA 4LF4O 1JJOA 1FFXB 2EZPA 2ZCEA 3DXRB 1WN7A 1MA1A 5JVDA 5C93A 1I5XA 2Q69A 3OFNG 3OW2U 1Q6IA 3C90A 4J80A 2YICA 3OGIB 4HAMA 1XMQO 2QA4V 3ABKC 4FM2A 1S0VA 5IJ0B 3CXHF 3WU2Z 2EIJB 1HWYA 3N2GA 2ZXWC 3E8HA 1Q86W 4X64B 4DR6B 4CC5A 1D5AA 2V4DA 1Y74B 4KHPB 1AILA 1S5LZ 4WFFA 3AG7A 5D5PA 4X66B 1AP6A 1W0JG 1PM9A 2NR5A 1FJGO 1R6KA 3KCYA 4DV3O 1BT8A 5IWAB 3QO5A 2V7QG 4UB6Z 5GTIZ 5GW7A 1NTMH 4YHHO 3EFFK 2JJ2G 4KXRA 3JSLA 3TXQA 2B9ZA 2UUBB 1NVPD 4I55B 2W0FC 4DK1A 1BZKA 3JAKB 4EEQA 3OEEG 2WSSG 1AJQA 3SPGA 3ZHTA 1MG1A 3K0GA 4H44B 5IY5B 4I50B 1KKCA 2UXCO 3ABUA 4JI7B 1JOYA 3HPLC 2AXTZ 3M7MX 1WP8A 3CX5F 3B09A 3T1YO 2P67A 4JAUA 4JI1O 3AK1A 4PDVA 4UCVA 3A2FA 2YXYA 2PYJA 1SRYA 4DR4O 5B3SC 3OTOO 4DUZO 2JRIA 1IBLO 2CH7A 4DR7B 2L35A 5H6QA 3ICXA 1MZEA 3IC9A 3CCLV 1FKAO 4JI0O 3N27A 1QHTA 3G67A 1GH6A 1Q8IA 3JATA 2FMLA 4YJ2B 2DYSC 2YXHA 4TSFG 3CRQA 1QQCA 1AR1B 2VS0A 2UU9O 4U3FH 4O2BA 1SF9A 4MVSA 3CWBH 5LGUA 3U10A 2H3OA 2F23A 2WLLB 1M90W 1I94B 4LF8B 3EHBB 3SDLA 4LFAO 3FAVB 3CCEV 4XDKA 2Q67A 4H13B 4GX5A 4DR5B 1CPYA 1OCCC 4BAYA 1K97A 3E86A 1XMOB 2YDEA 4K0KB 3CC2V 1M56B 1A32A 3ASOB 4X62O 5BMVB 1K5QA 2OCCC 2Q73A 2JK5C 3RYHB 2P5OA 2JDIG 4CH3A 4G27B 2F93B 5LXTA 4BIOA 2HG5C 1R3IC 2W0XA 4TUYA 3SYQA 3JARA 1Q6UA 1OCRC 3FYIB 4LF9B 3NXSA 4QGPA 1AP5A 3E22A 3TGUH 1WP7A 4NB5A 3C3TA 5J2UA 2BCCH 3TXSA 3KCXA 2HP8A 3JCUZ 1MNGA 1Q6HA 5TISZ 3SYAA 3BCCH 5LMNO 3ZN1A 3RWRD 3SJAC 5B1AB 4PA3A 3B77A 1S5HC 2M7WA 1NS1A 4B08A 3AK3A 4DV6B 1IURA 1W2BU 4PI2A 1NH2D 2JGUA 4PA4A 4X88A 2OWOA 1XHZA 4PDLA 4LFCB 4O4IB 2CTQA 3ETGA 1N36B 3OMAB 5IYZA 2JS3A 4JAVA 2UXNA 1J5EO 1FJGB 3B8MA 3JAMN 4LBEC 1DF5A 4DV3B 4X1IA 3X2QB 1Y66A 1NQTA 3CSXA 3ZHRA 1VQ4V 3TK1A 1VEWA 4YHHB 4GCZA 4X65O 5JJJB 3H1IH 1BQZA 3OE7G 1SC5B 2EJRA 3OUSA 1Q3EA 2QEXV 1XOUA 4DW1A 2LGQA 1Y76B 4EFBA 4U7NA 1F4NA 2P6JA 3JD1A 2Z0AA 4XDLA 2UXCB 4FFBA 3H1JH 3L70H 4X89A 3OR6C 3ZHUA 1Z2GA 3RYIB 4JI1B 2IM9A 2OTLV 1EM1A 1FPOA 4W4LA 1K3EA 4LF5O 3MHHC 3D3IA 1XBLA 2AHZA 5FNVA 4DR4B 2PF4E 2Q0AA 3OTOB 4DUZB 1AR4A 3MAQA 1IBLB 1VQMV 1H38A 2F1MA 3I55V 4LFBB 2ZR3A 4MVRA 4Z1MG 4JI0B 3HKDA 3FB5C 2AW9A 2ZNJA 2XAJA 3OR7C 1R1BA 2A79B 1AROP 4DW0A 5H9CA 4ICGA 1WNSA 2EIJC 2A3QA 3J81N 4MVMA 2V1DA 1ZX3A 1BQ0A 5KA5A 1KMIZ 4RUFA 1VF5B 1M5IA 5KHIA 3B4SA 1KU9A 2B1GA 3T4ZA 1HW7A 1PL4A 3CPWU 4BW9A 2RN9A 1THZA 4AHCA 3HKCA 2Q7HA 2WA3A 4U3JA 1G6UA 3SPIA 1QU7A 4I5SA 1VQOV 2GUZA 4TV9B 3C3SA 1WA8A 3BFRA 1R6TA 4BIZA 2LJ2A 2XOKG 4DV5B 1ZL8B 4F6RB 4RQEA 1XNQB 2ZT9B 2ZIMA 2E76B 2IBZH 3ASNB 5IJ9A 1WB8A 2EINC 2NLJC 5JQGB 4JI2O 5CA3A 5BXZA 4YJ3A 1WLEA 1HNXO 2A7WA 1Y67A 5KUKA 1H8EG 2EIKC 4ASUG 4J9YB 2UXXA 4DV7B 3TETA 2YEVA 2BOBC 4Q20A 1FYJA 3SJQC 3L75H 4F4LA 3LDEA 1KKDA 1HNWO 5L3CA 1TVKB 4UVAA 3K5LA 2EX3A 3CP1A 2W6IG 1XNRO 5LMNB 1D5NA 2LGWA 3E2EA 1AI4A 1FS0G 2WWWA 1HR0O 2GTSA 2UXBB 3T1HO 3BAAA 3H9VA 3JAWB 4O4LA 1UFIA 1TUBA 2WAMA 3F5TA 2IJIA 1J5EB 1AJNA 1GO3F 5KHHA 2UUAO 2PGGA 2R9AA 3QNEA 2GBOA 1WJZA 3CC4V 2JGDA 4B3SO 1SQXH 3DGEA 3K57A 1N34O 4FFKA 1M56C 3VOUA 2HJFC 1JX9A 3OGCC 4NVPA 1L8DA 3ASOC 1CXZB 2UUCO 2XAQA 4TQFA 2XT9A 4DV0B 4LF6O 1PP9H 3FD9A 1Q90D 4UV9A 1M57B 1BE3H 4IYHA 1AR5A 3LDCA 5DECA 4Z1VA 5L3EA 4IYIA 3W7WA 2YIAA 3ZX6A 4AILC 4LF5B 4DR3O 2Q68A 2H8PC 2D2CB 3L72H 2OYQA 1VQNV 1EZVH 3CB2A 2ITCC 2IJJA 2ZDIA 4HYOA 3AG3C 5D5QA 4DV4O 1HNZO 5DN6G 1R73A 3MD0A 1X4TA 1YSCA 2Y4TA 3SYOA 3U0ZA 1E1RG 1I0HA 3ZRWA 4ZI7B 4E4EA 1K8AW 2X6BA 3RYFB 2E74B 3FB6C 2VWJA 2DJVA 1RSOA 3OM3B 4FM0A 4QIWF 2CH7B 4EKWA 2FKXA 2ZE6A 5H2FZ 4CS4A 3A8TA 4ZHQB 4K3AA 1RM1B 5B1BC 4FLXA 3IFXA 3HKBA 2DW4A 1B06A 4UCRA 3SJCC 3UM7A 3L71H 5JJNB 1IX9A 5LGTA 4JI2B 1X59A 5CA0A 4NXMB 2B1IA 1B04A 4GYCB 1NI8A 1UJWB 1NR1A 4A5UB 1HNXB 4X20B 4DRXA 3W7SA 1GAXA 3IGAC 3WB1A 5KMGB 4MTOA 2B5UA 2BTQB 2UXDO 3LDDA 4LC1A 1HNWB 4F6EA 3CCMV 1KB9F 1SQVH 4PI0A 3THOA 1ZSPA 1XNRB 1IXMA 3BHPA 3JALB 4QJFB 3O65A 4JI3B 2ILMA 4X1YB 2PZSA 1K73W 5BR8O 3ZHSA 5LXTB
chains in the Genus database with same CATH topology
1HP8A 1U96A 1Z2GA 2RN9A 2HP8A 2LQTA 2RNBA 1U97A 2LGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HP8 A;  1U96 A;  1Z2G A;  2RN9 A;  2HP8 A;  2LQT A;  2RNB A;  1U97 A;  2LGQ A; 
#chains in the Genus database with same CATH topology
 1JVM A;  3CC7 V;  1K9M W;  2QKA A;  3A0R A;  2ZDI C;  1OCZ B;  3KKY A;  1ENV A;  1GN3 A;  3LUT B;  3TJT A;  4MTF A;  3SPC A;  4DO2 A;  3JAR B;  3ZN0 A;  4QNH B;  3RYC A;  5FLX N;  2FB5 A;  2L6L A;  4IIJ B;  4GKK O;  2AZ2 A;  4DV2 O;  4JTA B;  1URF A;  3B40 A;  3ML0 A;  3HKE B;  1NT2 B;  4PA6 A;  1Y4M A;  1KYO F;  5BY1 A;  5J2T B;  2QM4 A;  4LWS B;  1MOF A;  2VRZ A;  1VAR A;  1VP7 A;  4BIU A;  4I4T B;  2UUC B;  1NTK H;  3P32 A;  4YIP A;  3BY6 A;  1ZAU A;  3CJH A;  4CZZ A;  4E2L A;  4LF6 B;  1SQG A;  2Q7G A;  3H1K H;  2HHH B;  4UCU A;  2XUM A;  3AG4 B;  4EB6 B;  2CUG A;  4DV1 O;  5IYZ B;  5KUM A;  4JI8 O;  1K33 A;  2KG7 A;  5CB4 B;  4FLW A;  3IJ4 A;  3JCZ A;  1US6 A;  1SES A;  4X1K A;  4XBF A;  5JWP A;  3FKS G;  3CYO A;  2YID A;  1EN6 A;  3S3W A;  3K9A A;  1EFR G;  4HBN A;  2YIB D;  2BSK A;  2EIL B;  2XTA A;  4R8C A;  3LSU A;  1VQ7 V;  3J7A U;  3K79 A;  4FM1 A;  2PUS A;  1HNZ B;  4IHJ A;  3RFR A;  2XAG A;  5A2Q N;  1OCO B;  1YIJ V;  4X8A A;  3H1H H;  4FFB B;  4O4H A;  4U7O A;  5EBL C;  3SYC A;  5LA6 B;  1YCI A;  5L3F A;  4BR6 A;  3ETD A;  5K1P A;  1N0N A;  1OZ0 A;  4PA9 A;  4B3T O;  3UT5 A;  3WG7 B;  1QBZ A;  3RT3 C;  4KUM A;  3FYE B;  3K0D A;  1KBH A;  5EYP B;  5KAF Z;  2QWQ B;  1VIB A;  1XDC A;  2VQE B;  3OUF A;  3HKD B;  1PPJ H;  1L1F A;  3F5W C;  4DR2 B;  1PL0 A;  2DN9 A;  5DED A;  3W7U A;  5E1A C;  3U11 A;  2FYU H;  2LFR A;  1FXV A;  4FK5 C;  4WCE V;  1FXH A;  4FJC C;  3GB7 C;  4N23 A;  2QWP B;  4CBC A;  2K9P A;  1M57 C;  4JTD B;  3ABL C;  1TGO A;  5KX5 B;  2Y0I A;  2RMK B;  4LF4 B;  3CCR V;  2R9I A;  2QGN A;  3HKC B;  1GMG A;  1N33 O;  3Q4H B;  4GKJ O;  3A0H Z;  2GSM B;  1B3Q A;  3E35 A;  1KP2 A;  1BSM A;  2UXD B;  3AG1 B;  5LYJ B;  3BPZ A;  1E79 G;  5KHK A;  1QVG U;  1R3L C;  4N21 A;  4PJ0 Z;  1XMQ B;  4CH6 A;  4JI4 O;  4LF7 O;  2XAS A;  4FLZ A;  2GV9 A;  1XI1 A;  4IGG A;  5K1X A;  1ZLZ A;  3ABM B;  3N2K B;  5IJ9 B;  4WBN A;  4FMT A;  4FLY A;  4YJ3 B;  5B1N A;  3KG2 A;  2Y4U A;  1LUV A;  4JV5 O;  1P7G A;  4MTX A;  1MZF A;  4XDJ A;  1Q7Y W;  1QLE C;  1L0N H;  4GKK B;  3RBZ A;  2YEV B;  5CN0 A;  2R70 A;  4HNA B;  4PA7 A;  4MVO A;  3AG2 C;  1PNK A;  1KEC A;  2Y69 B;  5DM6 V;  2RCV A;  3QO8 A;  4Z2W A;  2KSD A;  1H2N A;  3RVY A;  4DYL A;  1N0J A;  4GX2 A;  1ORQ C;  4R7C A;  1RM1 C;  1QCE A;  5J9P C;  3STZ C;  5FL7 G;  4TV8 A;  3SPH A;  1RP3 B;  1V54 B;  1Q81 W;  1OJH A;  3ZRX A;  4WFH A;  4O4L B;  5C8Y A;  4DV1 B;  4JI8 B;  3ABT A;  4GLX A;  4WFE A;  1H2S B;  1YHQ V;  3T1Y B;  1QR8 A;  4NTX A;  1YJ9 V;  3ZMV A;  3G71 V;  3K59 A;  2WLJ A;  4UB8 Z;  1JQ0 A;  2N74 A;  2GTA A;  1YTF B;  4DUY O;  4JGS A;  1BL8 A;  4YJ2 A;  3K5O A;  1GM9 A;  1O9H A;  2QTS A;  2RNB A;  2BOC C;  4B3M O;  5IYB O;  1PNM A;  3BA8 A;  4DXW A;  1BS3 A;  4B3R O;  4LNU A;  3MDS A;  4J7J A;  5ITZ B;  3SGI A;  4WFA V;  2CTR A;  1AJP A;  3EXA A;  5EZY B;  1V55 B;  4CS3 A;  1SA0 A;  4ABM A;  2C2A A;  1VQL V;  2OIG A;  3FAV A;  1CP9 A;  2WLI B;  3BVO A;  2UU9 B;  1IBM O;  1H2K A;  1OCZ C;  1G1X B;  4TOI A;  2Q8V A;  4RO2 A;  1YVW A;  2QSA A;  3K03 A;  1QLN A;  1FXK B;  3L73 H;  2R9R B;  2EIM B;  1H8H G;  4PDM A;  2IH1 C;  4G28 B;  5LL6 Y;  4LFA B;  3WB0 A;  4PHZ A;  1VQ5 V;  4K8Z A;  5BMV A;  3JAS B;  4C7U A;  2ZXW B;  3RYH A;  1Q82 W;  3E8F A;  3E83 A;  1GRJ A;  3CMA V;  1DF4 A;  4TWK A;  1FFT B;  3T2M A;  4YY3 O;  1BMF G;  4OXS A;  4X62 B;  3CRM A;  3ZRW B;  4NTY A;  5IY5 C;  1NBM G;  1VQK V;  1AI5 A;  5EBM C;  3BA9 A;  4O2A A;  4CC6 A;  1RSO B;  2QDO A;  3AG4 C;  2WLN A;  2DYR B;  2LQT A;  3VQX A;  3IC7 A;  3CCV V;  1VMG A;  4J41 A;  5CA1 B;  1ZUQ A;  1N33 B;  1IXB A;  2LW7 A;  5JH7 A;  4GKJ B;  3JD4 A;  2E5L O;  2EIL C;  4L87 A;  1Z5V A;  2QM8 A;  5B5E Z;  2A06 H;  1GM7 A;  4JI5 O;  2Y0P A;  1XHX A;  4JI4 B;  3HKB B;  1OCO C;  3R66 A;  2F66 C;  3GWO A;  3UCS C;  3HR0 A;  1GTO A;  1Y6X A;  5H5N A;  3JSN A;  2IH3 C;  4WFB V;  5B3S B;  3M99 B;  1CEZ A;  2JVD A;  3ZED A;  5LP6 B;  4MW3 A;  2OT5 A;  2QE7 G;  5BZB A;  4ZOL B;  2RJZ A;  3DTU B;  4JV5 B;  2Q7E A;  4DRX B;  2OIE A;  2QKC A;  2CTW A;  4O4J A;  5JVD B;  2HKO A;  1YEW A;  1Y76 A;  1DK1 A;  3STL C;  1JFF A;  2DYS B;  1YIT V;  1I5Y A;  2DQ3 A;  4R50 A;  1GK9 A;  3CRC A;  3P3N A;  1I7F A;  1XUQ A;  4X64 O;  4X65 B;  4DR6 O;  4JAS A;  2CDY A;  3CCJ V;  5JCO C;  3PJS K;  4KHP O;  4FZ1 A;  5A9G A;  1XL4 A;  2DWE C;  1YJW V;  2N04 A;  3N2G B;  4RQF A;  4BW5 A;  4RAI A;  2DQ0 A;  1OCC B;  3BRC A;  2RDC A;  4ZBM A;  2UUB O;  2P4V A;  1YDX A;  3K58 A;  2NNU A;  3JD0 A;  1K4C C;  3OEH G;  3AG1 C;  4UXN A;  1OHH G;  2YIB A;  2F95 B;  1MSD A;  4B3M B;  4QPJ A;  5GON A;  4JI6 O;  1SER A;  4B3R B;  1Q43 A;  1BCC H;  3CRA A;  4MT8 A;  3QG5 A;  1OCR B;  3CJH B;  2A0L A;  5B1A C;  5AG2 A;  1ZWI C;  1F7Y A;  5CBF A;  3K06 A;  2K1E A;  4TT3 G;  1H2G A;  3ZRS A;  1JR9 A;  1IBM B;  1PV0 A;  1IVS A;  4DR7 O;  1EN4 A;  2KG7 B;  3D8C A;  3ZJZ A;  1EBO A;  4LCU C;  2BTO A;  4NXN O;  3LNN A;  3FB8 C;  2OTJ V;  5KHG A;  1R6N A;  1SZX A;  1L0L H;  3X2Q C;  2BSK B;  5EBW C;  1F4M A;  4F6R A;  4YXW G;  1W0K G;  2WA4 A;  4UV8 A;  1M9N A;  2Q6A A;  3ZCC A;  3ETE A;  4JYA O;  1LUW A;  1MMM A;  3JAT B;  1NKD A;  4YY3 B;  5HFM A;  4LF8 O;  1G8M A;  2H94 A;  1WAZ A;  3J80 N;  1SQP H;  4O2B B;  3ZBH A;  1TAE A;  4DR5 O;  2IJK A;  1UPG A;  4IT5 A;  4JPR A;  2KB1 A;  1JA8 A;  3UT5 B;  2GHY A;  1XMO O;  1TVK A;  2QM7 A;  3QVN A;  2D3O W;  2NN4 A;  4J9Z B;  1MSW D;  5JJE B;  4KL1 A;  5EIB D;  1EZJ A;  1QVF U;  3UQ8 A;  2E5L B;  4AQY O;  3D36 C;  2CGO A;  3F7Y C;  4H33 A;  1IZ3 A;  4WF9 V;  1K92 A;  1E1Q G;  1JJ2 U;  4D7T A;  1VQ8 V;  4P2Z A;  3ZS8 C;  4JI5 B;  4MW8 A;  4FZ0 A;  2ARH A;  3ZMU A;  3JAW A;  2LW1 A;  5LOV A;  3L9D A;  4AI8 A;  3GWK C;  5GTH Z;  3G4S V;  2KQX A;  5F2V O;  4LF9 O;  1V55 C;  2IJH A;  1HR0 B;  3VBB A;  3QO7 A;  4UVC A;  3VQW A;  2Z3Y A;  4J42 A;  3T1H B;  2EUL A;  4TUY B;  2Q4P A;  3APQ A;  2XND G;  4BWA A;  3APO A;  1RPR A;  4JYY A;  1H2L A;  1FXK C;  1K4D C;  2EIM C;  2ZR2 A;  1QNM A;  4DR1 O;  3RN4 A;  2UUA B;  3B8N A;  1F51 A;  1SQQ H;  3E22 B;  3CE2 A;  4CH5 A;  3SJB C;  1M4U A;  2E75 B;  4DV6 O;  5J2U B;  1YF2 A;  4B3S B;  2QR4 A;  1NR7 A;  3ZMT A;  2ADP A;  1N34 B;  4LFC O;  1PD3 A;  4YIO A;  5LMU O;  1N36 O;  1K34 A;  1VF6 A;  4NYK A;  5EK0 A;  1FAF A;  3T1C A;  1SQF A;  4I0X A;  1XEQ A;  2QWR B;  4WBN B;  5EC2 C;  5KA6 A;  1YTF D;  1K7D A;  3I5D A;  2XHB A;  3R65 A;  3ASN C;  2DYR C;  1COW G;  5LGN A;  5IT9 N;  4LP8 A;  3QF7 A;  3ZRV A;  1JPX A;  3CS5 A;  5LHH A;  1P4R A;  2R72 A;  4X1I B;  1O9G A;  1BHA A;  2HLD G;  3G80 A;  4J11 A;  1VQ6 V;  4JF3 A;  4DR3 B;  4FVM A;  3VQV A;  2CE4 A;  1HDJ A;  3PN1 A;  4NKG B;  4ZI7 A;  4JI6 B;  2EIN B;  2AGA A;  4UCO A;  2JJ1 G;  3RYF A;  2F43 G;  5LHG A;  4MVZ A;  1U97 A;  2LO1 A;  4TV8 B;  1XIL A;  4UFZ A;  4DV4 B;  3OMN B;  4EFE A;  2WPD G;  4RUE A;  4PD4 F;  1KP3 A;  2EIK B;  4NR1 A;  4KP4 A;  5FPR A;  5C8Y B;  5LP6 C;  1IBK O;  3T4D A;  5KHJ A;  4LFB O;  1SS3 A;  4NXN B;  3DSQ A;  2YUA A;  4J7Z A;  1JCH A;  4ZHQ A;  4LR3 A;  2ZNI A;  5FNV B;  2ZM6 O;  5L3B A;  4UCT A;  3UO2 A;  2O57 A;  4X9Q A;  4FPP A;  1DLB A;  3RVZ A;  4LNU B;  3CRR A;  4JYA B;  3ZMS A;  1SA0 B;  3JYC A;  2QKS A;  4PDR A;  2VQF O;  5H6R A;  1FFX A;  5EC1 C;  4TQD A;  4X20 A;  5L3G A;  3DXR A;  5B66 Z;  3NR7 A;  2HJD A;  4JYB A;  5KMG A;  1TUE B;  4K35 A;  2BTQ A;  1VF6 C;  4D7S A;  3L74 H;  4DV5 O;  1XNQ O;  4WFG A;  3M8A A;  4U3J B;  2P90 A;  2PY5 A;  3JAL A;  2CTP A;  5IJ0 A;  4I9Q A;  4AQY B;  3BEH A;  4MVQ A;  4X1Y A;  2X6A A;  2GUZ B;  2FTK A;  2ZE5 A;  1WA8 B;  4IL6 Z;  3B2E E;  5LBQ A;  3OD4 A;  4B7E A;  2E3C A;  3FX7 A;  5KLV H;  1Y74 A;  1AI7 A;  3P30 A;  4LH6 A;  3E8G A;  1Q5O A;  1LNQ A;  2PI4 A;  4DV7 O;  4IIJ A;  3K04 A;  4O2A B;  5BR8 B;  1WPX A;  3HKE A;  3G6B A;  1XQ8 A;  1F23 A;  3UKM A;  5KAI Z;  3K5N A;  3RGB A;  1DTO A;  3VQY A;  3AG3 B;  5JH7 B;  5J2T A;  4LWS A;  3CCU V;  4DR1 B;  4K8X A;  4I55 A;  2HEP A;  4I4T A;  4DV2 B;  2EJ7 A;  2IW5 A;  2HVK C;  3K08 A;  3JAK A;  2A9H A;  2HR3 A;  2UXB O;  4PEL A;  4JZ2 A;  4I50 A;  4JTC B;  2JEX A;  1S76 D;  2Q9L A;  5LMU B;  1LR1 A;  3D3Q A;  4DK0 A;  4EB6 A;  1RFY A;  4MVU A;  2KKW A;  1M93 A;  1PNL A;  5CB4 A;  1EN5 A;  2GDS A;  4Q6G A;  3W7T A;  5LHI A;  5CBG A;  4P9P A;  1BGY H;  1R3K C;  3ZHQ A;  4CH4 A;  1ROP A;  2P22 C;  3DC6 A;  1TUB B;  4P9O A;  1VF7 A;  2QWN B;  3P3P A;  1AI6 A;  1KUQ A;  4O4J B;  3EVK A;  1SKV A;  1D2D A;  4GX0 A;  4D6T H;  1JFF B;  2P7T C;  4L8J A;  5B1B B;  2CGN A;  2PI5 A;  3LSS A;  4FLU A;  2JGD B;  4DV0 O;  2ZE7 A;  1G4Y B;  2ZQM A;  3O9O A;  1N32 O;  2Y48 A;  1NVP B;  5LA6 A;  4FIP C;  1VQP V;  3OAA G;  3I56 V;  1R3J C;  3A0B Z;  5IDJ A;  1AVM A;  1XL6 A;  1GN4 A;  4PV1 B;  2Z5U A;  2WLL A;  2IU0 A;  3WFV A;  3FB7 C;  1BHB A;  1GN2 A;  5EYP A;  1IBK B;  4ZIB A;  3AK2 A;  1B6Q A;  3LSQ A;  3E8B A;  2W6J G;  1GKF A;  1TA8 A;  2QWO B;  3CCS V;  4B3T B;  5JCO A;  2PYL A;  4QE9 A;  3ABK B;  2JEU A;  2ZM6 B;  3F7V C;  2EZO A;  4CS2 A;  4HZ3 A;  2G38 A;  5GON B;  3K9S A;  1YZB A;  3OT7 A;  3OMI B;  3JD2 A;  2YI9 A;  2AZ0 A;  1Z5W A;  5E79 Z;  5KX5 A;  1S77 D;  3S3X A;  4W4K A;  2VQF B;  1NJI W;  4MSW C;  2X0L A;  4I7Z B;  3CD6 V;  2IU3 A;  4OPA A;  3Q4H A;  5IYD O;  4KFM A;  3DC5 A;  2PTM A;  3MHS C;  5LYJ A;  4OX9 O;  2ADQ B;  1NTZ H;  4GZR B;  4I9W A;  2XAF A;  3GVM A;  2HFE C;  2LP7 A;  1SZT A;  3LNM B;  1YI2 V;  1VQ9 V;  5B1O A;  3OTF A;  3N2K A;  3E89 A;  4GX1 A;  2Q0O C;  1SET A;  4NXM O;  4JYC A;  2F4V O;  2JS5 A;  1AB3 A;  4LF7 B;  4J10 A;  2YC0 A;  2ZD9 A;  1GM8 A;  3AEI A;  4O4I A;  4OPH A;  4GUN A;  5IE9 A;  2WLK A;  3W7X A;  4J7K A;  4B7K A;  3SR2 C;  2WLH A;  4HNA A;  3FFQ A;  3SPJ A;  3CEI A;  5CA0 B;  1PKX A;  4UCS A;  3QTC A;  3WG7 C;  1H2M A;  2BE3 A;  1SQB H;  2X6C A;  1XRE A;  4QPK A;  2ZKO A;  4G2K A;  4JI3 O;  4FLV A;  5CMU A;  3H1L H;  2FL4 A;  2ZIO A;  2HVJ C;  1YJN V;  3CCQ V;  5LOV B;  4MTG A;  4X66 O;  1RPO A;  3KZI Z;  4OGQ B;  3RYI A;  1JMK C;  4LH7 A;  1P7B A;  5IWA O;  2MW2 B;  1NH2 B;  3CHX A;  3TCU A;  1ZTE A;  3D36 A;  3RYC B;  2X7R B;  3ZIA G;  1IDS A;  4R6Z A;  3HB3 B;  4MS2 A;  4RWU A;  5ITZ A;  4JAA A;  2DOS A;  4UUJ C;  1S3J A;  5CBH A;  2YI8 A;  4DUY B;  3CXC U;  2OCC B;  2RQ6 A;  5L3D A;  1MAB G;  5EZY A;  1N8R W;  1QR9 A;  4JI7 O;  2OCH A;  1N32 B;  2HHH O;  2WLI A;  1FD9 A;  1P84 F;  4GT1 A;  3ABL B;  5EIB C;  1V9P A;  4I0X B;  2ATK C;  2YSU B;  5FPO A;  3ZHV A;  3UO3 A;  1FXK A;  1OV9 A;  1KD1 W;  3ABM C;  2QTO A;  2N05 A;  2LFS A;  4ZKI A;  3JAS A;  1YXB A;  4P30 A;  3ZMZ A;  2DE0 X;  2YS8 A;  4X1K B;  2P4K A;  4H37 A;  4JZG A;  4TV9 A;  3ETQ A;  4QE7 A;  2YXL A;  2JIZ G;  2QJ1 A;  2ODM A;  2ZIN A;  1ZL8 A;  2ETN A;  2Y69 C;  2ITD C;  5HFL A;  3K5M A;  3H01 A;  3WB2 A;  1S72 V;  1T5E A;  4IHJ B;  2Q5Z A;  1HP8 A;  5JQG A;  1WB7 A;  2CAZ C;  1I94 O;  1S5J A;  2DWD C;  1KC8 W;  1QLE B;  1W59 A;  4O4H B;  1J95 A;  3SYP A;  1U96 A;  5CA1 A;  4UVB A;  1N4C A;  3JD3 A;  3AG2 B;  1V54 C;  4H0L B;  5IYC O;  3G6E V;  3RW0 A;  4OX9 B;  1KQS U;  2VQE O;  2P06 A;  1DGS A;  1WPB A;  1NZ6 A;  4FLT A;  2AHY A;  1GN6 A;  1NU1 H;  4K0K O;  3CME V;  3IAY A;  4DR2 O;  2CK3 G;  3BAB A;  2XAH A;  2M6Y A;  1M1K W;  2ZE8 A;  2DMX A;  2WLM A;  2VWK A;  1K5S A;  4NTW A;  2EBO A;  1P49 A;  2MK3 A;  5LP6 A;  1I08 A;  2F4V B;  4ZOL A;  3K3W A;  4LF4 O;  1JJO A;  1FFX B;  2EZP A;  2ZCE A;  3DXR B;  1WN7 A;  1MA1 A;  5JVD A;  5C93 A;  1I5X A;  2Q69 A;  3OFN G;  3OW2 U;  1Q6I A;  3C90 A;  4J80 A;  2YIC A;  3OGI B;  4HAM A;  1XMQ O;  2QA4 V;  3ABK C;  4FM2 A;  1S0V A;  5IJ0 B;  3CXH F;  3WU2 Z;  2EIJ B;  1HWY A;  3N2G A;  2ZXW C;  3E8H A;  1Q86 W;  4X64 B;  4DR6 B;  4CC5 A;  1D5A A;  2V4D A;  1Y74 B;  4KHP B;  1AIL A;  1S5L Z;  4WFF A;  3AG7 A;  5D5P A;  4X66 B;  1AP6 A;  1W0J G;  1PM9 A;  2NR5 A;  1FJG O;  1R6K A;  3KCY A;  4DV3 O;  1BT8 A;  5IWA B;  3QO5 A;  2V7Q G;  4UB6 Z;  5GTI Z;  5GW7 A;  1NTM H;  4YHH O;  3EFF K;  2JJ2 G;  4KXR A;  3JSL A;  3TXQ A;  2B9Z A;  2UUB B;  1NVP D;  4I55 B;  2W0F C;  4DK1 A;  1BZK A;  3JAK B;  4EEQ A;  3OEE G;  2WSS G;  1AJQ A;  3SPG A;  3ZHT A;  1MG1 A;  3K0G A;  4H44 B;  5IY5 B;  4I50 B;  1KKC A;  2UXC O;  3ABU A;  4JI7 B;  1JOY A;  3HPL C;  2AXT Z;  3M7M X;  1WP8 A;  3CX5 F;  3B09 A;  3T1Y O;  2P67 A;  4JAU A;  4JI1 O;  3AK1 A;  4PDV A;  4UCV A;  3A2F A;  2YXY A;  2PYJ A;  1SRY A;  4DR4 O;  5B3S C;  3OTO O;  4DUZ O;  2JRI A;  1IBL O;  2CH7 A;  4DR7 B;  2L35 A;  5H6Q A;  3ICX A;  1MZE A;  3IC9 A;  3CCL V;  1FKA O;  4JI0 O;  3N27 A;  1QHT A;  3G67 A;  1GH6 A;  1Q8I A;  3JAT A;  2FML A;  4YJ2 B;  2DYS C;  2YXH A;  4TSF G;  3CRQ A;  1QQC A;  1AR1 B;  2VS0 A;  2UU9 O;  4U3F H;  4O2B A;  1SF9 A;  4MVS A;  3CWB H;  5LGU A;  3U10 A;  2H3O A;  2F23 A;  2WLL B;  1M90 W;  1I94 B;  4LF8 B;  3EHB B;  3SDL A;  4LFA O;  3FAV B;  3CCE V;  4XDK A;  2Q67 A;  4H13 B;  4GX5 A;  4DR5 B;  1CPY A;  1OCC C;  4BAY A;  1K97 A;  3E86 A;  1XMO B;  2YDE A;  4K0K B;  3CC2 V;  1M56 B;  1A32 A;  3ASO B;  4X62 O;  5BMV B;  1K5Q A;  2OCC C;  2Q73 A;  2JK5 C;  3RYH B;  2P5O A;  2JDI G;  4CH3 A;  4G27 B;  2F93 B;  5LXT A;  4BIO A;  2HG5 C;  1R3I C;  2W0X A;  4TUY A;  3SYQ A;  3JAR A;  1Q6U A;  1OCR C;  3FYI B;  4LF9 B;  3NXS A;  4QGP A;  1AP5 A;  3E22 A;  3TGU H;  1WP7 A;  4NB5 A;  3C3T A;  5J2U A;  2BCC H;  3TXS A;  3KCX A;  2HP8 A;  3JCU Z;  1MNG A;  1Q6H A;  5TIS Z;  3SYA A;  3BCC H;  5LMN O;  3ZN1 A;  3RWR D;  3SJA C;  5B1A B;  4PA3 A;  3B77 A;  1S5H C;  2M7W A;  1NS1 A;  4B08 A;  3AK3 A;  4DV6 B;  1IUR A;  1W2B U;  4PI2 A;  1NH2 D;  2JGU A;  4PA4 A;  4X88 A;  2OWO A;  1XHZ A;  4PDL A;  4LFC B;  4O4I B;  2CTQ A;  3ETG A;  1N36 B;  3OMA B;  5IYZ A;  2JS3 A;  4JAV A;  2UXN A;  1J5E O;  1FJG B;  3B8M A;  3JAM N;  4LBE C;  1DF5 A;  4DV3 B;  4X1I A;  3X2Q B;  1Y66 A;  1NQT A;  3CSX A;  3ZHR A;  1VQ4 V;  3TK1 A;  1VEW A;  4YHH B;  4GCZ A;  4X65 O;  5JJJ B;  3H1I H;  1BQZ A;  3OE7 G;  1SC5 B;  2EJR A;  3OUS A;  1Q3E A;  2QEX V;  1XOU A;  4DW1 A;  2LGQ A;  1Y76 B;  4EFB A;  4U7N A;  1F4N A;  2P6J A;  3JD1 A;  2Z0A A;  4XDL A;  2UXC B;  4FFB A;  3H1J H;  3L70 H;  4X89 A;  3OR6 C;  3ZHU A;  1Z2G A;  3RYI B;  4JI1 B;  2IM9 A;  2OTL V;  1EM1 A;  1FPO A;  4W4L A;  1K3E A;  4LF5 O;  3MHH C;  3D3I A;  1XBL A;  2AHZ A;  5FNV A;  4DR4 B;  2PF4 E;  2Q0A A;  3OTO B;  4DUZ B;  1AR4 A;  3MAQ A;  1IBL B;  1VQM V;  1H38 A;  2F1M A;  3I55 V;  4LFB B;  2ZR3 A;  4MVR A;  4Z1M G;  4JI0 B;  3HKD A;  3FB5 C;  2AW9 A;  2ZNJ A;  2XAJ A;  3OR7 C;  1R1B A;  2A79 B;  1ARO P;  4DW0 A;  5H9C A;  4ICG A;  1WNS A;  2EIJ C;  2A3Q A;  3J81 N;  4MVM A;  2V1D A;  1ZX3 A;  1BQ0 A;  5KA5 A;  1KMI Z;  4RUF A;  1VF5 B;  1M5I A;  5KHI A;  3B4S A;  1KU9 A;  2B1G A;  3T4Z A;  1HW7 A;  1PL4 A;  3CPW U;  4BW9 A;  2RN9 A;  1THZ A;  4AHC A;  3HKC A;  2Q7H A;  2WA3 A;  4U3J A;  1G6U A;  3SPI A;  1QU7 A;  4I5S A;  1VQO V;  2GUZ A;  4TV9 B;  3C3S A;  1WA8 A;  3BFR A;  1R6T A;  4BIZ A;  2LJ2 A;  2XOK G;  4DV5 B;  1ZL8 B;  4F6R B;  4RQE A;  1XNQ B;  2ZT9 B;  2ZIM A;  2E76 B;  2IBZ H;  3ASN B;  5IJ9 A;  1WB8 A;  2EIN C;  2NLJ C;  5JQG B;  4JI2 O;  5CA3 A;  5BXZ A;  4YJ3 A;  1WLE A;  1HNX O;  2A7W A;  1Y67 A;  5KUK A;  1H8E G;  2EIK C;  4ASU G;  4J9Y B;  2UXX A;  4DV7 B;  3TET A;  2YEV A;  2BOB C;  4Q20 A;  1FYJ A;  3SJQ C;  3L75 H;  4F4L A;  3LDE A;  1KKD A;  1HNW O;  5L3C A;  1TVK B;  4UVA A;  3K5L A;  2EX3 A;  3CP1 A;  2W6I G;  1XNR O;  5LMN B;  1D5N A;  2LGW A;  3E2E A;  1AI4 A;  1FS0 G;  2WWW A;  1HR0 O;  2GTS A;  2UXB B;  3T1H O;  3BAA A;  3H9V A;  3JAW B;  4O4L A;  1UFI A;  1TUB A;  2WAM A;  3F5T A;  2IJI A;  1J5E B;  1AJN A;  1GO3 F;  5KHH A;  2UUA O;  2PGG A;  2R9A A;  3QNE A;  2GBO A;  1WJZ A;  3CC4 V;  2JGD A;  4B3S O;  1SQX H;  3DGE A;  3K57 A;  1N34 O;  4FFK A;  1M56 C;  3VOU A;  2HJF C;  1JX9 A;  3OGC C;  4NVP A;  1L8D A;  3ASO C;  1CXZ B;  2UUC O;  2XAQ A;  4TQF A;  2XT9 A;  4DV0 B;  4LF6 O;  1PP9 H;  3FD9 A;  1Q90 D;  4UV9 A;  1M57 B;  1BE3 H;  4IYH A;  1AR5 A;  3LDC A;  5DEC A;  4Z1V A;  5L3E A;  4IYI A;  3W7W A;  2YIA A;  3ZX6 A;  4AIL C;  4LF5 B;  4DR3 O;  2Q68 A;  2H8P C;  2D2C B;  3L72 H;  2OYQ A;  1VQN V;  1EZV H;  3CB2 A;  2ITC C;  2IJJ A;  2ZDI A;  4HYO A;  3AG3 C;  5D5Q A;  4DV4 O;  1HNZ O;  5DN6 G;  1R73 A;  3MD0 A;  1X4T A;  1YSC A;  2Y4T A;  3SYO A;  3U0Z A;  1E1R G;  1I0H A;  3ZRW A;  4ZI7 B;  4E4E A;  1K8A W;  2X6B A;  3RYF B;  2E74 B;  3FB6 C;  2VWJ A;  2DJV A;  1RSO A;  3OM3 B;  4FM0 A;  4QIW F;  2CH7 B;  4EKW A;  2FKX A;  2ZE6 A;  5H2F Z;  4CS4 A;  3A8T A;  4ZHQ B;  4K3A A;  1RM1 B;  5B1B C;  4FLX A;  3IFX A;  3HKB A;  2DW4 A;  1B06 A;  4UCR A;  3SJC C;  3UM7 A;  3L71 H;  5JJN B;  1IX9 A;  5LGT A;  4JI2 B;  1X59 A;  5CA0 A;  4NXM B;  2B1I A;  1B04 A;  4GYC B;  1NI8 A;  1UJW B;  1NR1 A;  4A5U B;  1HNX B;  4X20 B;  4DRX A;  3W7S A;  1GAX A;  3IGA C;  3WB1 A;  5KMG B;  4MTO A;  2B5U A;  2BTQ B;  2UXD O;  3LDD A;  4LC1 A;  1HNW B;  4F6E A;  3CCM V;  1KB9 F;  1SQV H;  4PI0 A;  3THO A;  1ZSP A;  1XNR B;  1IXM A;  3BHP A;  3JAL B;  4QJF B;  3O65 A;  4JI3 B;  2ILM A;  4X1Y B;  2PZS A;  1K73 W;  5BR8 O;  3ZHS A;  5LXT B; 
#chains in the Genus database with same CATH homology
 1HP8 A;  1U96 A;  1Z2G A;  2RN9 A;  2HP8 A;  2LQT A;  2RNB A;  1U97 A;  2LGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...