2HP8A

Solution structure of human p8-mtcp1, a cysteine-rich protein encoded by the mtcp1 oncogene,reveals a new alpha-helical assembly motif, nmr, 30 structures
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
68
structure length
68
Chain Sequence
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of human p8MTCP1, a cysteine-rich protein encoded by the MTCP1 oncogene, reveals a new alpha-helical assembly motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cysteine motif
molecule keywords HU-P8
total genus 34
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1997-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08991 MTCP1 Mature-T-Cell Proliferation I type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2hp8A00
2RNBA 2RN9A 1U97A 2LQTA 2LGQA 1U96A 1Z2GA 2HP8A 1HP8A
chains in the Genus database with same CATH superfamily
4ZI7B 1YEWA 5DN6G 1XL6A 1N32O 1TVKB 1XNRO 1URFA 5B3SB 3AG1C 2NN4A 2LW7A 3NR7A 1VF6C 4L87A 4H0LB 3B77A 1SA0A 4DV7O 2F23A 3AG4C 5KMGB 4UUJC 4F6RB 4CS2A 4RO2A 5J2TB 2JJ1G 1YIJV 2IJIA 4TV9B 2PUSA 4OX9O 2QM8A 2UUAO 3ZMSA 3BFRA 5CMUA 5GONA 2VWJA 4LFBO 1A32A 1FXKC 1P7BA 4OXSA 2OYQA 4NXNO 3M99B 2OCHA 3QVNA 4JV5B 2K1EA 1AJNA 1OCCB 1IURA 1D2DA 5IYZA 4JYYA 3FKSG 1S77D 4TSFG 2VRZA 4GT1A 5H6RA 1G4YB 3HKBA 3BY6A 3D36A 1R6KA 2WA4A 5AG2A 5H9CA 4N21A 1KKDA 2KQXA 3K58A 4GX1A 4NB5A 2QGNA 4PA7A 4JPRA 2QKCA 4O4IB 4FLTA 2XUMA 2O57A 1XMQO 2XASA 4G28B 4J9ZB 4MTOA 1SETA 4YJ3A 1BT8A 1FXVA 1FFXB 4J11A 4O4LB 3I55V 2PZSA 3AG1B 1U97A 3K57A 5JH7B 3JARA 2ZINA 2AXTZ 1AJPA 3JASB 3ZHVA 2LGWA 2ITCC 3SYOA 1KYOF 1NR1A 5ITZB 2BOBC 2GDSA 3CJHA 2ATKC 1J95A 3ML0A 1XDCA 2V4DA 1AP6A 3ABLB 3ABUA 1VF6A 3JAWA 5J2TA 4NTXA 1QR9A 1MA1A 1EM1A 3JYCA 2UUAB 5EZYB 1TUBB 2CK3G 4UB8Z 3FYEB 1B3QA 4FLYA 4PDVA 5LOVB 2PYJA 4IIJA 2JGDB 3MHHC 5LMUB 1N34B 2EBOA 1K73W 2R9AA 4PJ0Z 4JI8O 2JEXA 1XL4A 1BQ0A 4CS3A 4DV2B 2Q0AA 3E8BA 3UT5A 1AI7A 2FYUH 5IT9N 1PD3A 1YI2V 1SF9A 1AILA 4PHZA 2Y69C 5KHJA 1SQQH 3VBBA 3H1JH 5KHGA 4JI3B 3UKMA 4KFMA 4NYKA 3THOA 4UVAA 1ENVA 2WPDG 4JI3O 1RFYA 3R66A 2ZE8A 4J41A 4ABMA 1HR0O 1N8RW 4DR2O 4WCEV 2LP7A 2CTQA 4JI7O 2YC0A 4IYIA 4JI6B 1KB9F 2KG7B 1R3KC 4UCUA 4LF8B 4BIZA 5C8YA 3KG2A 5EZYA 3U10A 4FLUA 1JOYA 4DR3O 1WPXA 1JFFB 3RN4A 3HKEA 2ZR2A 3ZRXA 5LBQA 3F7VC 1F4MA 3RYHB 5B5EZ 4DR1B 5E1AC 2HG5C 4W4KA 4JF3A 4LF4O 2ZNJA 4PELA 3G6EV 3ZHRA 3QO7A 2ZT9B 5KHHA 3AK3A 5LMNO 3F5WC 2WLIA 1M4UA 1KMIZ 5CBGA 5LYJB 4L8JA 3SR2C 3VQVA 2E74B 2OWOA 3N2KA 1VF5B 3HKBB 5JQGA 1BGYH 3TJTA 2VWKA 2BOCC 4LR3A 2F66C 4UXNA 1L1FA 3T4DA 2P6JA 2QR4A 3RYIA 1VQPV 3RVYA 4IL6Z 3RGBA 4ASUG 1TA8A 1JR9A 4JI1O 2A9HA 1YTFD 1YHQV 4JI0B 3E22A 3E83A 2UXDO 4MTFA 2ZKOA 5LGUA 4XDKA 2YXLA 3B8NA 1JX9A 5GTIZ 3OD4A 2HVKC 4CH5A 2UXDB 1JPXA 3APQA 5TISZ 3CS5A 3UO3A 1LUVA 4PI0A 3E86A 4LF9O 5D5QA 3HKDB 3QO5A 2WSSG 3H01A 3Q4HA 1SC5B 4PA9A 1QCEA 3FAVB 4JAUA 4QE9A 5B1AC 3WB2A 1VF7A 4O4HB 3L70H 2PI5A 1JJOA 2RCVA 1QNMA 4DV7B 1D5AA 1NTMH 1R3IC 1EZJA 1S5JA 1Q90D 1OCCC 2ZXWC 2ZIOA 3MDSA 4X1YB 1E1RG 1TAEA 2ZD9A 1IZ3A 1YXBA 2A06H 2OCCC 4GKJB 3F7YC 3U0ZA 2ITDC 3E2EA 2LGQA 1DTOA 3BPZA 2UXBB 2H8PC 4B7EA 2QM7A 1RM1B 2LFRA 1BS3A 1GN6A 2WLKA 1IBMB 4PA3A 5J2UA 4DR5B 1B6QA 3OEHG 3AG4B 1DF5A 1GMGA 4WF9V 4JI0O 2PYLA 1R6NA 3WB1A 3JD0A 3G6BA 1EN5A 1PM9A 3G4SV 3ABMC 3JAKB 1IXMA 4J10A 3B4SA 4CC5A 3ABMB 4KHPO 1WP8A 1YSCA 2CDYA 1WA8B 3OAAG 4Z1MG 1OHHG 1XQ8A 1Y67A 1ROPA 1I7FA 4HNAA 4KHPB 4X66O 2XHBA 3JSLA 2FTKA 2MK3A 3HKDA 4MTGA 1S76D 4BR6A 5LMNB 2M6YA 4CBCA 1BQZA 1ZWIC 2ILMA 3FB7C 3FX7A 3T1HB 3ZMZA 2RJZA 3ASNC 2DQ3A 3AK1A 4O4HA 2ZIMA 2WLLA 4KP4A 4CH3A 1UPGA 2HLDG 1M57B 2AHZA 2FMLA 1F7YA 2N05A 1MZEA 2L6LA 3H1KH 1H2MA 2DWDC 3DGEA 2YUAA 2ZQMA 2FKXA 1YJNV 4NTWA 4X1IA 2XAJA 1AR1B 5LMUO 3JCUZ 2M7WA 3OGIB 4LFAO 1V54B 4O2BB 3K5MA 1M9NA 1AVMA 4H13B 1MNGA 1KQSU 5JQGB 1HNZO 5KMGA 5BR8B 5LA6B 4FPPA 4LF9B 4JTAB 1HNZB 1M57C 4JI5B 1S5LZ 3LSUA 2EX3A 1PV0A 1N4CA 4GX5A 1OCRB 2QTOA 2Q6AA 5IJ9B 1SQPH 1SQXH 1WA8A 1QR8A 5GONB 4JI2B 2NLJC 4EEQA 3OUFA 2X7RB 4FVMA 3N27A 4BW5A 2QWOB 1IBMO 2VQFO 1GAXA 3ZEDA 2BTQA 3ABKC 1BHBA 2GTAA 1VQNV 2CTPA 3ZN0A 2R9RB 3OTFA 1K7DA 5JH7A 4DV6O 1MMMA 3UQ8A 5DECA 4JZGA 5BR8O 1K5SA 1WP7A 2WLLB 3DTUB 2YXHA 2QA4V 4PA4A 3SDLA 4YHHB 3TXQA 1M1KW 1H2GA 3CC2V 4IIJB 4DR3B 1W2BU 4RQFA 1Q8IA 3D3IA 5LHHA 5LHIA 4LFAB 4Z1VA 5JCOA 3ZMUA 1VQ5V 1KP2A 3JASA 3JATB 2DYSB 1WB7A 5FPOA 4YY3O 4LWSA 2CH7A 3JD1A 4MTXA 4TQDA 2ZE5A 3OE7G 1RSOA 3RVZA 2EIMC 3RT3C 2KB1A 5ITZA 3X2QC 4G2KA 4HYOA 2ZM6B 3DC6A 3HR0A 4O2AB 2B9ZA 1N36B 1EN4A 3SJAC 1XREA 3CP1A 1SS3A 2EILB 1JMKC 3CCLV 4JI1B 4GUNA 2DYSC 3TETA 4DV6B 2BTQB 4CZZA 4Q20A 4B3MO 3MHSC 3LSSA 5K1XA 3VOUA 3CE2A 4C7UA 3AG3C 1VQ6V 3APOA 4ZHQB 3D8CA 1Q82W 2IW5A 3A0HZ 2UUCB 4MSWC 4LNUA 4BAYA 1BHAA 3S3XA 5IYCO 1JA8A 2HHHB 5IWAB 1BL8A 4IGGA 4J7KA 4FLVA 1V55C 2HJFC 1I94B 3FD9A 3ZN1A 3P3NA 1FXKA 1HNXB 1QU7A 3RW0A 2IU3A 1MG1A 1VMGA 4I55B 1Q86W 3QG5A 3HKEB 1ORQC 1EN6A 2WAMA 1N32B 3E89A 2DE0X 5IJ9A 1DF4A 1YITV 2WLIB 1F4NA 2HJDA 5B1AB 1N0JA 5KA6A 2CH7B 4TQFA 4X20A 3IC7A 5CBHA 4DYLA 1VP7A 4PV1B 3SPCA 3JATA 2YI9A 4ZBMA 1KECA 1YVWA 2QKAA 1AI4A 4E2LA 4Z2WA 1R73A 5IDJA 4LC1A 2VQEB 2WLHA 3OR7C 1U96A 2KKWA 4QGPA 1Q3EA 1QHTA 1NQTA 3CSXA 1I94O 3I56V 1VQLV 1IVSA 4JI4B 2X6CA 3P3PA 2RN9A 2Q7EA 5IJ0B 3EFFK 1FYJA 4J80A 3WU2Z 1FFTB 3CCUV 2Y4TA 4K0KO 3UM7A 4PI2A 2EIJB 5CA1A 5L3GA 2QWRB 3LDCA 3K0DA 2Z0AA 4LH7A 4LP8A 4NXMB 1FJGO 2ODMA 3K79A 1BSMA 1TVKA 4RAIA 3W7SA 4H44B 2OTJV 1H2LA 5B1OA 4DUZB 4G27B 2Q7HA 4HAMA 2YIAA 3K0GA 4I0XB 4P9OA 3FYIB 4F6RA 3CMAV 1Q7YW 2AHYA 1KKCA 4FFBA 3ZHTA 4JGSA 2DQ0A 4O4JB 1JQ0A 2QJ1A 2HHHO 5KUMA 5IE9A 3BA9A 2IU0A 4EKWA 2A0LA 1VQ9V 2UXNA 3QO8A 4DV0B 2CAZC 2ZR3A 4R6ZA 4DR6B 1S5HC 4WBNB 5JVDB 3ETGA 3WG7B 2Y0PA 4FZ1A 1CEZA 2E5LO 1Y74A 3JAMN 2PI4A 3SPHA 1JVMA 3RYFA 2VS0A 1QVGU 4FFKA 2F4VB 2L35A 4DUYO 4I9WA 1HNXO 4UVCA 1HP8A 3EVKA 4X1YA 4RQEA 5LXTA 1XMOB 2JIZG 1SERA 4ICGA 4DR6O 2BE3A 2UUBO 3T4ZA 4B7KA 4I50A 1OZ0A 3ZHSA 3CJHB 3L71H 2F43G 1XNQB 3ZCCA 1WLEA 5J9PC 4P2ZA 1US6A 4K8XA 1VQKV 2Q67A 4ZOLA 3CB2A 4DO2A 4DV5B 4H37A 1AROP 5KLVH 3JCZA 4K0KB 5BMVA 2QKSA 4YHHO 1GO3F 4LFCB 2F93B 4U7NA 3SPJA 3OUSA 1O9HA 3HB3B 2EILC 4YIPA 2HEPA 2KG7A 1XMOO 4WBNA 2GBOA 4FLWA 3WFVA 1R6TA 4JASA 5CA1B 1HWYA 1H8HG 2PY5A 2YS8A 4EFBA 3GWOA 3AG2C 1Y74B 1XMQB 4GX2A 3M7MX 5F2VO 4K8ZA 2Q8VA 4HNAB 3MD0A 3EHBB 1T5EA 1K5QA 3JARB 4LF4B 4NR1A 4B3RB 3SYCA 1QLNA 4NXMO 1E1QG 4TT3G 4W4LA 5FNVA 1FJGB 2QSAA 1B06A 1L0NH 1KC8W 5L3BA 3RYFB 2X6BA 5IJ0A 1L8DA 1LR1A 4BIUA 3LDDA 3Q4HB 4QIWF 2D2CB 1NU1H 4JYAB 2Q73A 3CRQA 4NXNB 2OIEA 4XBFA 2Q5ZA 4FJCC 4OX9B 1FPOA 2Q68A 2YEVB 3M8AA 2QDOA 3GVMA 1HR0B 4R50A 5CN0A 2E3CA 4P9PA 2F4VO 3K9AA 4X1KA 3D3QA 5BMVB 2ADPA 4JI6O 2R9IA 1PL0A 3CCQV 2W6JG 4D6TH 5DEDA 5EBMC 5CA0B 2E5LB 2JK5C 1OCZC 5IYDO 3CX5F 3TXSA 5GTHZ 3FB5C 3JALB 1OCRC 5IY5B 4HBNA 1GRJA 1G8MA 4QPJA 2ZCEA 3RWRD 2LQTA 4YIOA 5LXTB 3RBZA 2B1IA 5K1PA 4X62O 2W6IG 1JFFA 1THZA 5E79Z 1TUEB 1J5EO 2B5UA 3CCVV 3STZC 3ABLC 3JD4A 2DYRC 2W0FC 1SA0B 2F95B 2V7QG 1H8EG 5FL7G 1EBOA 5KUKA 5LGTA 4IHJB 5H5NA 4JYAO 1SZTA 1AI5A 1SKVA 1QQCA 2CGNA 5A9GA 4LFCO 4PA6A 4DR1O 1IBLB 5KHKA 2UU9B 1SQFA 1GN4A 5J2UB 4DV4O 2OIGA 4LWSB 4UCTA 5H2FZ 2WLJA 3ASNB 1HNWO 1J5EB 1P4RA 3L75H 3FAVA 4R7CA 1IDSA 2LW1A 4PD4F 1V55B 5FNVB 1FXHA 1YCIA 2QM4A 3N2KB 1TGOA 1NVPB 4DV1O 2OCCB 4TWKA 4DW0A 3MAQA 3O65A 1FXKB 1Y76B 2EINB 2RDCA 3X2QB 2DN9A 3ZS8C 1JJ2U 4QNHB 4YJ2A 3CCEV 3A2FA 4LNUB 1AJQA 3E22B 5B1BC 1IBLO 4B08A 4JTDB 5EC1C 4J7JA 3LUTB 1OCOB 3IJ4A 1R1BA 3SGIA 4RUEA 2GTSA 2CTWA 1OCOC 1P7GA 4IT5A 3ZRWA 3SYQA 2P4KA 2X6AA 4X1KB 5KAIZ 5FPRA 3S3WA 1N34O 5LGNA 3OTOO 2EINC 4GYCB 4X8AA 2PTMA 1VQ4V 5C93A 2UU9O 3CMEV 4TOIA 4DR5O 1UFIA 3H9VA 3JAKA 4LF5O 3W7TA 3CD6V 1Z2GA 4X62B 3T1YO 4TUYA 4WFEA 2EZPA 3ASOC 4QE7A 1OV9A 4X65O 1NH2D 4WFHA 5JWPA 3A0RA 4UCVA 1Q81W 3CXHF 1H2SB 4CC6A 3ZHUA 4QPKA 2XAHA 3E8GA 2HR3A 3ETQA 2DJVA 4FFBB 3T1CA 3UCSC 3W7UA 3J7AU 4DR7O 1GM8A 5EC2C 5L3FA 1RSOB 1I5YA 3CXCU 1PL4A 2DW4A 3C3SA 4FLZA 4UCOA 3WB0A 1IXBA 2GSMB 3KCYA 4O2AA 2JEUA 4LH6A 4O4JA 2YIBA 3R65A 1FD9A 3K04A 5CBFA 2P4VA 4F6EA 4DXWA 4JV5O 1YJWV 2DMXA 1S0VA 3OW2U 3W7XA 1Q43A 3T1YB 3ETDA 1Z5VA 2WLNA 4B3RO 3IC9A 3JD2A 5LYJA 3HKCB 2E75B 4DR2B 2ADQB 2HFEC 4MVMA 1K8AW 2EIKC 2JS5A 5B3SC 3ZRSA 4FMTA 4DV3B 1PNMA 1ZLZA 4UV8A 2YIDA 1M90W 1QLEB 4O4IA 1YJ9V 1GN2A 2WWWA 5LL6Y 4GKKO 3OMIB 3CCMV 2LO1A 4JI2O 3G71V 4DR7B 3OTOB 1JCHA 2YI8A 3UT5B 1RPRA 2P5OA 1S72V 1Y66A 2YDEA 3DXRB 5BY1A 5IY5C 4I4TB 1BMFG 3ZJZA 2CGOA 5B66Z 4WFAV 4FLXA 3L9DA 3F5TA 4X64O 1X59A 3G67A 2CTRA 4D7SA 3IAYA 3P32A 4I7ZB 4YJ3B 4MVOA 3NXSA 4O4LA 2JS3A 4CS4A 3LNNA 3K5OA 3LNMB 1P84F 3UO2A 2D3OW 1SESA 1TUBA 3AG2B 1M56B 4U3FH 4J9YB 2QWNB 3ZMTA 2P22C 2NNUA 4LBEC 3JD3A 5JJEB 4JI8B 4B3SO 2W0XA 4PDMA 4DV2O 2ZE7A 1GH6A 5LP6A 2EIKB 1HDJA 1OJHA 1VQ8V 2QTSA 2EJ7A 3AEIA 4B3SB 3P30A 1YF2A 3QTCA 4B3TB 1XI1A 4TV8A 4IYHA 1R3JC 3B8MA 2QE7G 4MS2A 2FL4A 3T2MA 2H94A 4FM0A 1YTFB 3SPIA 4FK5C 1IX9A 1NR7A 3RYCA 4PDRA 2XAGA 5LP6C 3SYPA 1Z5WA 3ZHQA 3QNEA 2IJKA 2Q0OC 2N74A 3JAWB 4ZHQA 1QBZA 4MW8A 1Q6UA 2VQFB 4FM2A 5BZBA 1XOUA 5EYPA 4LF5B 5CB4B 2ZE6A 4LF8O 3K59A 3DSQA 3STLC 2DYRB 5LOVA 2UUCO 4B3TO 1Y76A 5CA0A 3OT7A 1W0KG 1UJWB 3LDEA 4MVRA 4D7TA 2XAQA 5L3DA 4DV3O 3N2GA 4UV9A 5HFMA 1CPYA 2QWQB 1FFXA 1QVFU 4U3JA 4BIOA 2IBZH 1OCZB 3CWBH 4KXRA 4YXWG 2XTAA 3G80A 3CEIA 2HKOA 5B1NA 2GUZA 4AILC 3BCCH 4RWUA 3C90A 1GM9A 4K35A 4Q6GA 2NR5A 2AZ2A 1L0LH 2FB5A 3QF7A 4X66B 1LNQA 2YEVA 5FLXN 1W0JG 3BABA 3RYHA 1RM1C 4JI7B 4K3AA 1WNSA 3I5DA 1GN3A 1D5NA 2XAFA 4FM1A 2XNDG 1MSWD 2EULA 4I4TA 1N33O 2QWPB 5IYBO 3VQXA 1XUQA 4TV8B 4AHCA 3CCSV 4H33A 1N0NA 1QLEC 1AR5A 2JGDA 2Y69B 3JALA 4GKJO 4A5UB 4EB6B 2Q7GA 4FZ0A 2OTLV 3ZBHA 4JZ2A 1F51A 2UXCO 1M5IA 1V9PA 1YDXA 5GW7A 5C8YB 2V1DA 1W59A 1NS1A 3OR6C 4X1IB 5B1BB 1XHZA 1FAFA 4DK0A 5KHIA 1MZFA 2CUGA 2MW2B 3RFRA 3CRRA 4X9QA 1N36O 3DXRA 2B1GA 4J42A 1I08A 3L73H 3C3TA 3ICXA 4ZIBA 1NTKH 1SZXA 1G1XB 4WFBV 1FS0G 2RQ6A 3EXAA 1GK9A 3ABKB 2GUZB 2IM9A 3RYCB 1NT2B 3CRMA 2BSKA 3H1IH 2P90A 4MT8A 3BEHA 2DOSA 2K9PA 2XT9A 4I55A 1VQMV 2ARHA 4UB6Z 4WFFA 5BXZA 1Q5OA 1Q6IA 1AI6A 2A79B 1GTOA 2G38A 4DV0O 5JJJB 3ZRWB 3SPGA 5IWAO 1GKFA 5EIBD 5JCOC 1O9GA 3KZIZ 2PGGA 2JDIG 5JJNB 3W7WA 2JJ2G 2UXCB 3SJQC 1CP9A 3OMNB 4BW9A 3ZX6A 2RMKB 4OPAA 2ZM6O 1P49A 3IGAC 3T1HO 2XOKG 3AG3B 1PP9H 1HW7A 2A7WA 4OPHA 4I50B 4MVZA 1N33B 4JAVA 5CB4A 4UCSA 5EK0A 1VQ7V 3B40A 2IJHA 1PNLA 3U11A 3CYOA 2UXBO 4B3MB 2Z3YA 2WLMA 1KP3A 2AW9A 4X64B 5H6QA 2EIMB 3BRCA 3VQYA 4AQYB 3JSNA 2GHYA 2R70A 3L74H 3VQWA 3FB6C 4DRXA 4DUZO 4JI4O 1KBHA 3CPWU 2LJ2A 2OT5A 4UFZA 3SYAA 4QJFB 5HFLA 4O2BA 3CC4V 5CA3A 1IBKO 4ZOLB 2YSUB 4UVBA 2CE4A 4ZKIA 2Q9LA 4EB6A 3HPLC 4E4EA 1SQVH 3H1LH 5EBWC 5KA5A 2BSKB 2AZ0A 1M56C 4PDLA 4HZ3A 3TK1A 1AP5A 3AG7A 1PPJH 5LA6A 2P06A 3DC5A 4AI8A 4DR4O 2N04A 3OGCC 1BCCH 4MW3A 4JYBA 1WN7A 2Y48A 5KX5A 5DM6V 1Y4MA 3TCUA 1XBLA 3OEEG 1AR4A 4I9QA 2ZNIA 1YZBA 1MSDA 3GB7C 2WA3A 3CCJV 1NKDA 2GV9A 3A0BZ 1KD1W 4CH6A 4KUMA 1E79G 2DWEC 3E35A 1K34A 3ZRVA 1ZTEA 2A3QA 4UCRA 3ASOB 1M93A 1XNQO 1ZUQA 1VQOV 1BE3H 3KCXA 4JTCB 3A8TA 3AK2A 1X4TA 2YXYA 4P30A 3ZIAG 2QEXV 4FIPC 4J7ZA 3CC7V 1KUQA 3J81N 1VEWA 1GM7A 1B04A 1BZKA 5D5PA 2H3OA 4I0XA 1DK1A 1CXZB 4AQYO 1FKAO 1K9MW 2AGAA 1XHXA 3O9OA 3OMAB 1NTZH 3SJBC 2IH3C 4DK1A 5KAFZ 1VARA 1WJZA 4MVSA 4DR4B 2YICA 1EFRG 1LUWA 1ZAUA 2PF4E 2EIJC 4MVQA 3OM3B 3KKYA 1K4DC 4F4LA 1IBKB 1ZX3A 2KSDA 4YY3B 5L3CA 4NKGB 4MVUA 2EZOA 4TV9A 3ABTA 1XILA 3B09A 5EYPB 3E8FA 1KU9A 5EBLC 4GX0A 1NH2B 2UXXA 4LF7B 1K97A 4JI5O 4U3JB 4X88A 1PNKA 2HVJC 2VQEO 1VIBA 4TUYB 2ETNA 3FFQA 4XDLA 5EIBC 4DUYB 2UUBB 4LF7O 5IYZB 3CCRV 2X0LA 4KL1A 4YJ2B 1XEQA 4IHJA 4LF6B 2R72A 2EJRA 4JAAA 4WFGA 1I0HA 2IH1C 1NVPD 4X20B 3SJCC 3K5LA 2Y0IA 3RYIB 2F1MA 3H1HH 1SQBH 1EZVH 1NI8A 3ZMVA 1MABG 1S3JA 3BAAA 3D36C 2HP8A 4EFEA 1H38A 1ZL8B 1RPOA 2ZXWB 2Y4UA 4GLXA 3BHPA 1NJIW 3B2EE 4RUFA 5KX5B 2JRIA 4R8CA 3N2GB 1RP3B 2Q4PA 3CRCA 3K08A 1WAZA 1ZSPA 1F23A 4ZI7A 4CH4A 3K5NA 4LFBB 2Q69A 4DW1A 3PJSK 4GZRB 2P67A 4DV1B 2BCCH 1AB3A 2Z5UA 4NTYA 1NBMG 1K4CC 1XNRB 3TGUH 3J80N 4BWAA 1PKXA 4DV4B 1SQGA 1H2NA 3IFXA 3E8HA 3WG7C 3BVOA 3K03A 1V54C 2IJJA 3BA8A 1G6UA 4U7OA 2JGUA 4JYCA 2BTOA 3CHXA 3ETEA 4LF6O 3LSQA 4NVPA 2P7TC 4GKKB 1Q6HA 4I5SA 2YIBD 3K3WA 3FB8C 1K3EA 5LP6B 1DLBA 1NZ6A 3GWKC 1H2KA 4DRXB 1WPBA 2ZDIC 1COWG 4X89A 3L72H 3K9SA 5LHGA 1K33A 4XDJA 1Y6XA 3PN1A 1ZL8A 2E76B 4DV5O 1R3LC 2JVDA 1SRYA 4N23A 5A2QN 4OGQB 1MOFA 1I5XA 2RNBA 5L3EA 4GCZA 1DGSA 2LFSA 2ZDIA 3K06A 1HNWB 3CRAA 2C2AA 1K92A 3OFNG 4X65B 4LCUC 1WB8A 5JVDA 3HKCA
chains in the Genus database with same CATH topology
2RNBA 2RN9A 1U97A 2LQTA 2LGQA 1U96A 1Z2GA 2HP8A 1HP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNB A;  2RN9 A;  1U97 A;  2LQT A;  2LGQ A;  1U96 A;  1Z2G A;  2HP8 A;  1HP8 A; 
#chains in the Genus database with same CATH topology
 4ZI7 B;  1YEW A;  5DN6 G;  1XL6 A;  1N32 O;  1TVK B;  1XNR O;  1URF A;  5B3S B;  3AG1 C;  2NN4 A;  2LW7 A;  3NR7 A;  1VF6 C;  4L87 A;  4H0L B;  3B77 A;  1SA0 A;  4DV7 O;  2F23 A;  3AG4 C;  5KMG B;  4UUJ C;  4F6R B;  4CS2 A;  4RO2 A;  5J2T B;  2JJ1 G;  1YIJ V;  2IJI A;  4TV9 B;  2PUS A;  4OX9 O;  2QM8 A;  2UUA O;  3ZMS A;  3BFR A;  5CMU A;  5GON A;  2VWJ A;  4LFB O;  1A32 A;  1FXK C;  1P7B A;  4OXS A;  2OYQ A;  4NXN O;  3M99 B;  2OCH A;  3QVN A;  4JV5 B;  2K1E A;  1AJN A;  1OCC B;  1IUR A;  1D2D A;  5IYZ A;  4JYY A;  3FKS G;  1S77 D;  4TSF G;  2VRZ A;  4GT1 A;  5H6R A;  1G4Y B;  3HKB A;  3BY6 A;  3D36 A;  1R6K A;  2WA4 A;  5AG2 A;  5H9C A;  4N21 A;  1KKD A;  2KQX A;  3K58 A;  4GX1 A;  4NB5 A;  2QGN A;  4PA7 A;  4JPR A;  2QKC A;  4O4I B;  4FLT A;  2XUM A;  2O57 A;  1XMQ O;  2XAS A;  4G28 B;  4J9Z B;  4MTO A;  1SET A;  4YJ3 A;  1BT8 A;  1FXV A;  1FFX B;  4J11 A;  4O4L B;  3I55 V;  2PZS A;  3AG1 B;  1U97 A;  3K57 A;  5JH7 B;  3JAR A;  2ZIN A;  2AXT Z;  1AJP A;  3JAS B;  3ZHV A;  2LGW A;  2ITC C;  3SYO A;  1KYO F;  1NR1 A;  5ITZ B;  2BOB C;  2GDS A;  3CJH A;  2ATK C;  1J95 A;  3ML0 A;  1XDC A;  2V4D A;  1AP6 A;  3ABL B;  3ABU A;  1VF6 A;  3JAW A;  5J2T A;  4NTX A;  1QR9 A;  1MA1 A;  1EM1 A;  3JYC A;  2UUA B;  5EZY B;  1TUB B;  2CK3 G;  4UB8 Z;  3FYE B;  1B3Q A;  4FLY A;  4PDV A;  5LOV B;  2PYJ A;  4IIJ A;  2JGD B;  3MHH C;  5LMU B;  1N34 B;  2EBO A;  1K73 W;  2R9A A;  4PJ0 Z;  4JI8 O;  2JEX A;  1XL4 A;  1BQ0 A;  4CS3 A;  4DV2 B;  2Q0A A;  3E8B A;  3UT5 A;  1AI7 A;  2FYU H;  5IT9 N;  1PD3 A;  1YI2 V;  1SF9 A;  1AIL A;  4PHZ A;  2Y69 C;  5KHJ A;  1SQQ H;  3VBB A;  3H1J H;  5KHG A;  4JI3 B;  3UKM A;  4KFM A;  4NYK A;  3THO A;  4UVA A;  1ENV A;  2WPD G;  4JI3 O;  1RFY A;  3R66 A;  2ZE8 A;  4J41 A;  4ABM A;  1HR0 O;  1N8R W;  4DR2 O;  4WCE V;  2LP7 A;  2CTQ A;  4JI7 O;  2YC0 A;  4IYI A;  4JI6 B;  1KB9 F;  2KG7 B;  1R3K C;  4UCU A;  4LF8 B;  4BIZ A;  5C8Y A;  3KG2 A;  5EZY A;  3U10 A;  4FLU A;  1JOY A;  4DR3 O;  1WPX A;  1JFF B;  3RN4 A;  3HKE A;  2ZR2 A;  3ZRX A;  5LBQ A;  3F7V C;  1F4M A;  3RYH B;  5B5E Z;  4DR1 B;  5E1A C;  2HG5 C;  4W4K A;  4JF3 A;  4LF4 O;  2ZNJ A;  4PEL A;  3G6E V;  3ZHR A;  3QO7 A;  2ZT9 B;  5KHH A;  3AK3 A;  5LMN O;  3F5W C;  2WLI A;  1M4U A;  1KMI Z;  5CBG A;  5LYJ B;  4L8J A;  3SR2 C;  3VQV A;  2E74 B;  2OWO A;  3N2K A;  1VF5 B;  3HKB B;  5JQG A;  1BGY H;  3TJT A;  2VWK A;  2BOC C;  4LR3 A;  2F66 C;  4UXN A;  1L1F A;  3T4D A;  2P6J A;  2QR4 A;  3RYI A;  1VQP V;  3RVY A;  4IL6 Z;  3RGB A;  4ASU G;  1TA8 A;  1JR9 A;  4JI1 O;  2A9H A;  1YTF D;  1YHQ V;  4JI0 B;  3E22 A;  3E83 A;  2UXD O;  4MTF A;  2ZKO A;  5LGU A;  4XDK A;  2YXL A;  3B8N A;  1JX9 A;  5GTI Z;  3OD4 A;  2HVK C;  4CH5 A;  2UXD B;  1JPX A;  3APQ A;  5TIS Z;  3CS5 A;  3UO3 A;  1LUV A;  4PI0 A;  3E86 A;  4LF9 O;  5D5Q A;  3HKD B;  3QO5 A;  2WSS G;  3H01 A;  3Q4H A;  1SC5 B;  4PA9 A;  1QCE A;  3FAV B;  4JAU A;  4QE9 A;  5B1A C;  3WB2 A;  1VF7 A;  4O4H B;  3L70 H;  2PI5 A;  1JJO A;  2RCV A;  1QNM A;  4DV7 B;  1D5A A;  1NTM H;  1R3I C;  1EZJ A;  1S5J A;  1Q90 D;  1OCC C;  2ZXW C;  2ZIO A;  3MDS A;  4X1Y B;  1E1R G;  1TAE A;  2ZD9 A;  1IZ3 A;  1YXB A;  2A06 H;  2OCC C;  4GKJ B;  3F7Y C;  3U0Z A;  2ITD C;  3E2E A;  2LGQ A;  1DTO A;  3BPZ A;  2UXB B;  2H8P C;  4B7E A;  2QM7 A;  1RM1 B;  2LFR A;  1BS3 A;  1GN6 A;  2WLK A;  1IBM B;  4PA3 A;  5J2U A;  4DR5 B;  1B6Q A;  3OEH G;  3AG4 B;  1DF5 A;  1GMG A;  4WF9 V;  4JI0 O;  2PYL A;  1R6N A;  3WB1 A;  3JD0 A;  3G6B A;  1EN5 A;  1PM9 A;  3G4S V;  3ABM C;  3JAK B;  1IXM A;  4J10 A;  3B4S A;  4CC5 A;  3ABM B;  4KHP O;  1WP8 A;  1YSC A;  2CDY A;  1WA8 B;  3OAA G;  4Z1M G;  1OHH G;  1XQ8 A;  1Y67 A;  1ROP A;  1I7F A;  4HNA A;  4KHP B;  4X66 O;  2XHB A;  3JSL A;  2FTK A;  2MK3 A;  3HKD A;  4MTG A;  1S76 D;  4BR6 A;  5LMN B;  2M6Y A;  4CBC A;  1BQZ A;  1ZWI C;  2ILM A;  3FB7 C;  3FX7 A;  3T1H B;  3ZMZ A;  2RJZ A;  3ASN C;  2DQ3 A;  3AK1 A;  4O4H A;  2ZIM A;  2WLL A;  4KP4 A;  4CH3 A;  1UPG A;  2HLD G;  1M57 B;  2AHZ A;  2FML A;  1F7Y A;  2N05 A;  1MZE A;  2L6L A;  3H1K H;  1H2M A;  2DWD C;  3DGE A;  2YUA A;  2ZQM A;  2FKX A;  1YJN V;  4NTW A;  4X1I A;  2XAJ A;  1AR1 B;  5LMU O;  3JCU Z;  2M7W A;  3OGI B;  4LFA O;  1V54 B;  4O2B B;  3K5M A;  1M9N A;  1AVM A;  4H13 B;  1MNG A;  1KQS U;  5JQG B;  1HNZ O;  5KMG A;  5BR8 B;  5LA6 B;  4FPP A;  4LF9 B;  4JTA B;  1HNZ B;  1M57 C;  4JI5 B;  1S5L Z;  3LSU A;  2EX3 A;  1PV0 A;  1N4C A;  4GX5 A;  1OCR B;  2QTO A;  2Q6A A;  5IJ9 B;  1SQP H;  1SQX H;  1WA8 A;  1QR8 A;  5GON B;  4JI2 B;  2NLJ C;  4EEQ A;  3OUF A;  2X7R B;  4FVM A;  3N27 A;  4BW5 A;  2QWO B;  1IBM O;  2VQF O;  1GAX A;  3ZED A;  2BTQ A;  3ABK C;  1BHB A;  2GTA A;  1VQN V;  2CTP A;  3ZN0 A;  2R9R B;  3OTF A;  1K7D A;  5JH7 A;  4DV6 O;  1MMM A;  3UQ8 A;  5DEC A;  4JZG A;  5BR8 O;  1K5S A;  1WP7 A;  2WLL B;  3DTU B;  2YXH A;  2QA4 V;  4PA4 A;  3SDL A;  4YHH B;  3TXQ A;  1M1K W;  1H2G A;  3CC2 V;  4IIJ B;  4DR3 B;  1W2B U;  4RQF A;  1Q8I A;  3D3I A;  5LHH A;  5LHI A;  4LFA B;  4Z1V A;  5JCO A;  3ZMU A;  1VQ5 V;  1KP2 A;  3JAS A;  3JAT B;  2DYS B;  1WB7 A;  5FPO A;  4YY3 O;  4LWS A;  2CH7 A;  3JD1 A;  4MTX A;  4TQD A;  2ZE5 A;  3OE7 G;  1RSO A;  3RVZ A;  2EIM C;  3RT3 C;  2KB1 A;  5ITZ A;  3X2Q C;  4G2K A;  4HYO A;  2ZM6 B;  3DC6 A;  3HR0 A;  4O2A B;  2B9Z A;  1N36 B;  1EN4 A;  3SJA C;  1XRE A;  3CP1 A;  1SS3 A;  2EIL B;  1JMK C;  3CCL V;  4JI1 B;  4GUN A;  2DYS C;  3TET A;  4DV6 B;  2BTQ B;  4CZZ A;  4Q20 A;  4B3M O;  3MHS C;  3LSS A;  5K1X A;  3VOU A;  3CE2 A;  4C7U A;  3AG3 C;  1VQ6 V;  3APO A;  4ZHQ B;  3D8C A;  1Q82 W;  2IW5 A;  3A0H Z;  2UUC B;  4MSW C;  4LNU A;  4BAY A;  1BHA A;  3S3X A;  5IYC O;  1JA8 A;  2HHH B;  5IWA B;  1BL8 A;  4IGG A;  4J7K A;  4FLV A;  1V55 C;  2HJF C;  1I94 B;  3FD9 A;  3ZN1 A;  3P3N A;  1FXK A;  1HNX B;  1QU7 A;  3RW0 A;  2IU3 A;  1MG1 A;  1VMG A;  4I55 B;  1Q86 W;  3QG5 A;  3HKE B;  1ORQ C;  1EN6 A;  2WAM A;  1N32 B;  3E89 A;  2DE0 X;  5IJ9 A;  1DF4 A;  1YIT V;  2WLI B;  1F4N A;  2HJD A;  5B1A B;  1N0J A;  5KA6 A;  2CH7 B;  4TQF A;  4X20 A;  3IC7 A;  5CBH A;  4DYL A;  1VP7 A;  4PV1 B;  3SPC A;  3JAT A;  2YI9 A;  4ZBM A;  1KEC A;  1YVW A;  2QKA A;  1AI4 A;  4E2L A;  4Z2W A;  1R73 A;  5IDJ A;  4LC1 A;  2VQE B;  2WLH A;  3OR7 C;  1U96 A;  2KKW A;  4QGP A;  1Q3E A;  1QHT A;  1NQT A;  3CSX A;  1I94 O;  3I56 V;  1VQL V;  1IVS A;  4JI4 B;  2X6C A;  3P3P A;  2RN9 A;  2Q7E A;  5IJ0 B;  3EFF K;  1FYJ A;  4J80 A;  3WU2 Z;  1FFT B;  3CCU V;  2Y4T A;  4K0K O;  3UM7 A;  4PI2 A;  2EIJ B;  5CA1 A;  5L3G A;  2QWR B;  3LDC A;  3K0D A;  2Z0A A;  4LH7 A;  4LP8 A;  4NXM B;  1FJG O;  2ODM A;  3K79 A;  1BSM A;  1TVK A;  4RAI A;  3W7S A;  4H44 B;  2OTJ V;  1H2L A;  5B1O A;  4DUZ B;  4G27 B;  2Q7H A;  4HAM A;  2YIA A;  3K0G A;  4I0X B;  4P9O A;  3FYI B;  4F6R A;  3CMA V;  1Q7Y W;  2AHY A;  1KKC A;  4FFB A;  3ZHT A;  4JGS A;  2DQ0 A;  4O4J B;  1JQ0 A;  2QJ1 A;  2HHH O;  5KUM A;  5IE9 A;  3BA9 A;  2IU0 A;  4EKW A;  2A0L A;  1VQ9 V;  2UXN A;  3QO8 A;  4DV0 B;  2CAZ C;  2ZR3 A;  4R6Z A;  4DR6 B;  1S5H C;  4WBN B;  5JVD B;  3ETG A;  3WG7 B;  2Y0P A;  4FZ1 A;  1CEZ A;  2E5L O;  1Y74 A;  3JAM N;  2PI4 A;  3SPH A;  1JVM A;  3RYF A;  2VS0 A;  1QVG U;  4FFK A;  2F4V B;  2L35 A;  4DUY O;  4I9W A;  1HNX O;  4UVC A;  1HP8 A;  3EVK A;  4X1Y A;  4RQE A;  5LXT A;  1XMO B;  2JIZ G;  1SER A;  4ICG A;  4DR6 O;  2BE3 A;  2UUB O;  3T4Z A;  4B7K A;  4I50 A;  1OZ0 A;  3ZHS A;  3CJH B;  3L71 H;  2F43 G;  1XNQ B;  3ZCC A;  1WLE A;  5J9P C;  4P2Z A;  1US6 A;  4K8X A;  1VQK V;  2Q67 A;  4ZOL A;  3CB2 A;  4DO2 A;  4DV5 B;  4H37 A;  1ARO P;  5KLV H;  3JCZ A;  4K0K B;  5BMV A;  2QKS A;  4YHH O;  1GO3 F;  4LFC B;  2F93 B;  4U7N A;  3SPJ A;  3OUS A;  1O9H A;  3HB3 B;  2EIL C;  4YIP A;  2HEP A;  2KG7 A;  1XMO O;  4WBN A;  2GBO A;  4FLW A;  3WFV A;  1R6T A;  4JAS A;  5CA1 B;  1HWY A;  1H8H G;  2PY5 A;  2YS8 A;  4EFB A;  3GWO A;  3AG2 C;  1Y74 B;  1XMQ B;  4GX2 A;  3M7M X;  5F2V O;  4K8Z A;  2Q8V A;  4HNA B;  3MD0 A;  3EHB B;  1T5E A;  1K5Q A;  3JAR B;  4LF4 B;  4NR1 A;  4B3R B;  3SYC A;  1QLN A;  4NXM O;  1E1Q G;  4TT3 G;  4W4L A;  5FNV A;  1FJG B;  2QSA A;  1B06 A;  1L0N H;  1KC8 W;  5L3B A;  3RYF B;  2X6B A;  5IJ0 A;  1L8D A;  1LR1 A;  4BIU A;  3LDD A;  3Q4H B;  4QIW F;  2D2C B;  1NU1 H;  4JYA B;  2Q73 A;  3CRQ A;  4NXN B;  2OIE A;  4XBF A;  2Q5Z A;  4FJC C;  4OX9 B;  1FPO A;  2Q68 A;  2YEV B;  3M8A A;  2QDO A;  3GVM A;  1HR0 B;  4R50 A;  5CN0 A;  2E3C A;  4P9P A;  2F4V O;  3K9A A;  4X1K A;  3D3Q A;  5BMV B;  2ADP A;  4JI6 O;  2R9I A;  1PL0 A;  3CCQ V;  2W6J G;  4D6T H;  5DED A;  5EBM C;  5CA0 B;  2E5L B;  2JK5 C;  1OCZ C;  5IYD O;  3CX5 F;  3TXS A;  5GTH Z;  3FB5 C;  3JAL B;  1OCR C;  5IY5 B;  4HBN A;  1GRJ A;  1G8M A;  4QPJ A;  2ZCE A;  3RWR D;  2LQT A;  4YIO A;  5LXT B;  3RBZ A;  2B1I A;  5K1P A;  4X62 O;  2W6I G;  1JFF A;  1THZ A;  5E79 Z;  1TUE B;  1J5E O;  2B5U A;  3CCV V;  3STZ C;  3ABL C;  3JD4 A;  2DYR C;  2W0F C;  1SA0 B;  2F95 B;  2V7Q G;  1H8E G;  5FL7 G;  1EBO A;  5KUK A;  5LGT A;  4IHJ B;  5H5N A;  4JYA O;  1SZT A;  1AI5 A;  1SKV A;  1QQC A;  2CGN A;  5A9G A;  4LFC O;  4PA6 A;  4DR1 O;  1IBL B;  5KHK A;  2UU9 B;  1SQF A;  1GN4 A;  5J2U B;  4DV4 O;  2OIG A;  4LWS B;  4UCT A;  5H2F Z;  2WLJ A;  3ASN B;  1HNW O;  1J5E B;  1P4R A;  3L75 H;  3FAV A;  4R7C A;  1IDS A;  2LW1 A;  4PD4 F;  1V55 B;  5FNV B;  1FXH A;  1YCI A;  2QM4 A;  3N2K B;  1TGO A;  1NVP B;  4DV1 O;  2OCC B;  4TWK A;  4DW0 A;  3MAQ A;  3O65 A;  1FXK B;  1Y76 B;  2EIN B;  2RDC A;  3X2Q B;  2DN9 A;  3ZS8 C;  1JJ2 U;  4QNH B;  4YJ2 A;  3CCE V;  3A2F A;  4LNU B;  1AJQ A;  3E22 B;  5B1B C;  1IBL O;  4B08 A;  4JTD B;  5EC1 C;  4J7J A;  3LUT B;  1OCO B;  3IJ4 A;  1R1B A;  3SGI A;  4RUE A;  2GTS A;  2CTW A;  1OCO C;  1P7G A;  4IT5 A;  3ZRW A;  3SYQ A;  2P4K A;  2X6A A;  4X1K B;  5KAI Z;  5FPR A;  3S3W A;  1N34 O;  5LGN A;  3OTO O;  2EIN C;  4GYC B;  4X8A A;  2PTM A;  1VQ4 V;  5C93 A;  2UU9 O;  3CME V;  4TOI A;  4DR5 O;  1UFI A;  3H9V A;  3JAK A;  4LF5 O;  3W7T A;  3CD6 V;  1Z2G A;  4X62 B;  3T1Y O;  4TUY A;  4WFE A;  2EZP A;  3ASO C;  4QE7 A;  1OV9 A;  4X65 O;  1NH2 D;  4WFH A;  5JWP A;  3A0R A;  4UCV A;  1Q81 W;  3CXH F;  1H2S B;  4CC6 A;  3ZHU A;  4QPK A;  2XAH A;  3E8G A;  2HR3 A;  3ETQ A;  2DJV A;  4FFB B;  3T1C A;  3UCS C;  3W7U A;  3J7A U;  4DR7 O;  1GM8 A;  5EC2 C;  5L3F A;  1RSO B;  1I5Y A;  3CXC U;  1PL4 A;  2DW4 A;  3C3S A;  4FLZ A;  4UCO A;  3WB0 A;  1IXB A;  2GSM B;  3KCY A;  4O2A A;  2JEU A;  4LH6 A;  4O4J A;  2YIB A;  3R65 A;  1FD9 A;  3K04 A;  5CBF A;  2P4V A;  4F6E A;  4DXW A;  4JV5 O;  1YJW V;  2DMX A;  1S0V A;  3OW2 U;  3W7X A;  1Q43 A;  3T1Y B;  3ETD A;  1Z5V A;  2WLN A;  4B3R O;  3IC9 A;  3JD2 A;  5LYJ A;  3HKC B;  2E75 B;  4DR2 B;  2ADQ B;  2HFE C;  4MVM A;  1K8A W;  2EIK C;  2JS5 A;  5B3S C;  3ZRS A;  4FMT A;  4DV3 B;  1PNM A;  1ZLZ A;  4UV8 A;  2YID A;  1M90 W;  1QLE B;  4O4I A;  1YJ9 V;  1GN2 A;  2WWW A;  5LL6 Y;  4GKK O;  3OMI B;  3CCM V;  2LO1 A;  4JI2 O;  3G71 V;  4DR7 B;  3OTO B;  1JCH A;  2YI8 A;  3UT5 B;  1RPR A;  2P5O A;  1S72 V;  1Y66 A;  2YDE A;  3DXR B;  5BY1 A;  5IY5 C;  4I4T B;  1BMF G;  3ZJZ A;  2CGO A;  5B66 Z;  4WFA V;  4FLX A;  3L9D A;  3F5T A;  4X64 O;  1X59 A;  3G67 A;  2CTR A;  4D7S A;  3IAY A;  3P32 A;  4I7Z B;  4YJ3 B;  4MVO A;  3NXS A;  4O4L A;  2JS3 A;  4CS4 A;  3LNN A;  3K5O A;  3LNM B;  1P84 F;  3UO2 A;  2D3O W;  1SES A;  1TUB A;  3AG2 B;  1M56 B;  4U3F H;  4J9Y B;  2QWN B;  3ZMT A;  2P22 C;  2NNU A;  4LBE C;  3JD3 A;  5JJE B;  4JI8 B;  4B3S O;  2W0X A;  4PDM A;  4DV2 O;  2ZE7 A;  1GH6 A;  5LP6 A;  2EIK B;  1HDJ A;  1OJH A;  1VQ8 V;  2QTS A;  2EJ7 A;  3AEI A;  4B3S B;  3P30 A;  1YF2 A;  3QTC A;  4B3T B;  1XI1 A;  4TV8 A;  4IYH A;  1R3J C;  3B8M A;  2QE7 G;  4MS2 A;  2FL4 A;  3T2M A;  2H94 A;  4FM0 A;  1YTF B;  3SPI A;  4FK5 C;  1IX9 A;  1NR7 A;  3RYC A;  4PDR A;  2XAG A;  5LP6 C;  3SYP A;  1Z5W A;  3ZHQ A;  3QNE A;  2IJK A;  2Q0O C;  2N74 A;  3JAW B;  4ZHQ A;  1QBZ A;  4MW8 A;  1Q6U A;  2VQF B;  4FM2 A;  5BZB A;  1XOU A;  5EYP A;  4LF5 B;  5CB4 B;  2ZE6 A;  4LF8 O;  3K59 A;  3DSQ A;  3STL C;  2DYR B;  5LOV A;  2UUC O;  4B3T O;  1Y76 A;  5CA0 A;  3OT7 A;  1W0K G;  1UJW B;  3LDE A;  4MVR A;  4D7T A;  2XAQ A;  5L3D A;  4DV3 O;  3N2G A;  4UV9 A;  5HFM A;  1CPY A;  2QWQ B;  1FFX A;  1QVF U;  4U3J A;  4BIO A;  2IBZ H;  1OCZ B;  3CWB H;  4KXR A;  4YXW G;  2XTA A;  3G80 A;  3CEI A;  2HKO A;  5B1N A;  2GUZ A;  4AIL C;  3BCC H;  4RWU A;  3C90 A;  1GM9 A;  4K35 A;  4Q6G A;  2NR5 A;  2AZ2 A;  1L0L H;  2FB5 A;  3QF7 A;  4X66 B;  1LNQ A;  2YEV A;  5FLX N;  1W0J G;  3BAB A;  3RYH A;  1RM1 C;  4JI7 B;  4K3A A;  1WNS A;  3I5D A;  1GN3 A;  1D5N A;  2XAF A;  4FM1 A;  2XND G;  1MSW D;  2EUL A;  4I4T A;  1N33 O;  2QWP B;  5IYB O;  3VQX A;  1XUQ A;  4TV8 B;  4AHC A;  3CCS V;  4H33 A;  1N0N A;  1QLE C;  1AR5 A;  2JGD A;  2Y69 B;  3JAL A;  4GKJ O;  4A5U B;  4EB6 B;  2Q7G A;  4FZ0 A;  2OTL V;  3ZBH A;  4JZ2 A;  1F51 A;  2UXC O;  1M5I A;  1V9P A;  1YDX A;  5GW7 A;  5C8Y B;  2V1D A;  1W59 A;  1NS1 A;  3OR6 C;  4X1I B;  5B1B B;  1XHZ A;  1FAF A;  4DK0 A;  5KHI A;  1MZF A;  2CUG A;  2MW2 B;  3RFR A;  3CRR A;  4X9Q A;  1N36 O;  3DXR A;  2B1G A;  4J42 A;  1I08 A;  3L73 H;  3C3T A;  3ICX A;  4ZIB A;  1NTK H;  1SZX A;  1G1X B;  4WFB V;  1FS0 G;  2RQ6 A;  3EXA A;  1GK9 A;  3ABK B;  2GUZ B;  2IM9 A;  3RYC B;  1NT2 B;  3CRM A;  2BSK A;  3H1I H;  2P90 A;  4MT8 A;  3BEH A;  2DOS A;  2K9P A;  2XT9 A;  4I55 A;  1VQM V;  2ARH A;  4UB6 Z;  4WFF A;  5BXZ A;  1Q5O A;  1Q6I A;  1AI6 A;  2A79 B;  1GTO A;  2G38 A;  4DV0 O;  5JJJ B;  3ZRW B;  3SPG A;  5IWA O;  1GKF A;  5EIB D;  5JCO C;  1O9G A;  3KZI Z;  2PGG A;  2JDI G;  5JJN B;  3W7W A;  2JJ2 G;  2UXC B;  3SJQ C;  1CP9 A;  3OMN B;  4BW9 A;  3ZX6 A;  2RMK B;  4OPA A;  2ZM6 O;  1P49 A;  3IGA C;  3T1H O;  2XOK G;  3AG3 B;  1PP9 H;  1HW7 A;  2A7W A;  4OPH A;  4I50 B;  4MVZ A;  1N33 B;  4JAV A;  5CB4 A;  4UCS A;  5EK0 A;  1VQ7 V;  3B40 A;  2IJH A;  1PNL A;  3U11 A;  3CYO A;  2UXB O;  4B3M B;  2Z3Y A;  2WLM A;  1KP3 A;  2AW9 A;  4X64 B;  5H6Q A;  2EIM B;  3BRC A;  3VQY A;  4AQY B;  3JSN A;  2GHY A;  2R70 A;  3L74 H;  3VQW A;  3FB6 C;  4DRX A;  4DUZ O;  4JI4 O;  1KBH A;  3CPW U;  2LJ2 A;  2OT5 A;  4UFZ A;  3SYA A;  4QJF B;  5HFL A;  4O2B A;  3CC4 V;  5CA3 A;  1IBK O;  4ZOL B;  2YSU B;  4UVB A;  2CE4 A;  4ZKI A;  2Q9L A;  4EB6 A;  3HPL C;  4E4E A;  1SQV H;  3H1L H;  5EBW C;  5KA5 A;  2BSK B;  2AZ0 A;  1M56 C;  4PDL A;  4HZ3 A;  3TK1 A;  1AP5 A;  3AG7 A;  1PPJ H;  5LA6 A;  2P06 A;  3DC5 A;  4AI8 A;  4DR4 O;  2N04 A;  3OGC C;  1BCC H;  4MW3 A;  4JYB A;  1WN7 A;  2Y48 A;  5KX5 A;  5DM6 V;  1Y4M A;  3TCU A;  1XBL A;  3OEE G;  1AR4 A;  4I9Q A;  2ZNI A;  1YZB A;  1MSD A;  3GB7 C;  2WA3 A;  3CCJ V;  1NKD A;  2GV9 A;  3A0B Z;  1KD1 W;  4CH6 A;  4KUM A;  1E79 G;  2DWE C;  3E35 A;  1K34 A;  3ZRV A;  1ZTE A;  2A3Q A;  4UCR A;  3ASO B;  1M93 A;  1XNQ O;  1ZUQ A;  1VQO V;  1BE3 H;  3KCX A;  4JTC B;  3A8T A;  3AK2 A;  1X4T A;  2YXY A;  4P30 A;  3ZIA G;  2QEX V;  4FIP C;  4J7Z A;  3CC7 V;  1KUQ A;  3J81 N;  1VEW A;  1GM7 A;  1B04 A;  1BZK A;  5D5P A;  2H3O A;  4I0X A;  1DK1 A;  1CXZ B;  4AQY O;  1FKA O;  1K9M W;  2AGA A;  1XHX A;  3O9O A;  3OMA B;  1NTZ H;  3SJB C;  2IH3 C;  4DK1 A;  5KAF Z;  1VAR A;  1WJZ A;  4MVS A;  4DR4 B;  2YIC A;  1EFR G;  1LUW A;  1ZAU A;  2PF4 E;  2EIJ C;  4MVQ A;  3OM3 B;  3KKY A;  1K4D C;  4F4L A;  1IBK B;  1ZX3 A;  2KSD A;  4YY3 B;  5L3C A;  4NKG B;  4MVU A;  2EZO A;  4TV9 A;  3ABT A;  1XIL A;  3B09 A;  5EYP B;  3E8F A;  1KU9 A;  5EBL C;  4GX0 A;  1NH2 B;  2UXX A;  4LF7 B;  1K97 A;  4JI5 O;  4U3J B;  4X88 A;  1PNK A;  2HVJ C;  2VQE O;  1VIB A;  4TUY B;  2ETN A;  3FFQ A;  4XDL A;  5EIB C;  4DUY B;  2UUB B;  4LF7 O;  5IYZ B;  3CCR V;  2X0L A;  4KL1 A;  4YJ2 B;  1XEQ A;  4IHJ A;  4LF6 B;  2R72 A;  2EJR A;  4JAA A;  4WFG A;  1I0H A;  2IH1 C;  1NVP D;  4X20 B;  3SJC C;  3K5L A;  2Y0I A;  3RYI B;  2F1M A;  3H1H H;  1SQB H;  1EZV H;  1NI8 A;  3ZMV A;  1MAB G;  1S3J A;  3BAA A;  3D36 C;  2HP8 A;  4EFE A;  1H38 A;  1ZL8 B;  1RPO A;  2ZXW B;  2Y4U A;  4GLX A;  3BHP A;  1NJI W;  3B2E E;  4RUF A;  5KX5 B;  2JRI A;  4R8C A;  3N2G B;  1RP3 B;  2Q4P A;  3CRC A;  3K08 A;  1WAZ A;  1ZSP A;  1F23 A;  4ZI7 A;  4CH4 A;  3K5N A;  4LFB B;  2Q69 A;  4DW1 A;  3PJS K;  4GZR B;  2P67 A;  4DV1 B;  2BCC H;  1AB3 A;  2Z5U A;  4NTY A;  1NBM G;  1K4C C;  1XNR B;  3TGU H;  3J80 N;  4BWA A;  1PKX A;  4DV4 B;  1SQG A;  1H2N A;  3IFX A;  3E8H A;  3WG7 C;  3BVO A;  3K03 A;  1V54 C;  2IJJ A;  3BA8 A;  1G6U A;  4U7O A;  2JGU A;  4JYC A;  2BTO A;  3CHX A;  3ETE A;  4LF6 O;  3LSQ A;  4NVP A;  2P7T C;  4GKK B;  1Q6H A;  4I5S A;  2YIB D;  3K3W A;  3FB8 C;  1K3E A;  5LP6 B;  1DLB A;  1NZ6 A;  3GWK C;  1H2K A;  4DRX B;  1WPB A;  2ZDI C;  1COW G;  4X89 A;  3L72 H;  3K9S A;  5LHG A;  1K33 A;  4XDJ A;  1Y6X A;  3PN1 A;  1ZL8 A;  2E76 B;  4DV5 O;  1R3L C;  2JVD A;  1SRY A;  4N23 A;  5A2Q N;  4OGQ B;  1MOF A;  1I5X A;  2RNB A;  5L3E A;  4GCZ A;  1DGS A;  2LFS A;  2ZDI A;  3K06 A;  1HNW B;  3CRA A;  2C2A A;  1K92 A;  3OFN G;  4X65 B;  4LCU C;  1WB8 A;  5JVD A;  3HKC A; 
#chains in the Genus database with same CATH homology
 2RNB A;  2RN9 A;  1U97 A;  2LQT A;  2LGQ A;  1U96 A;  1Z2G A;  2HP8 A;  1HP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...