3APQA

Crystal structure of j-trx1 fragment of erdj5
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
208
structure length
208
Chain Sequence
IQNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWSYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DnaJ homolog subfamily C member 10
publication title Structural basis of an ERAD pathway mediated by the ER-resident protein disulfide reductase ERdj5.
pubmed doi rcsb
source organism Mus musculus
total genus 65
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3apqA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apqA02
3ZITA 1O7UA 1YQ1A 1ZGNA 4ECBA 1JHBA 2K9FA 3O3TA 2F8AA 2FHEA 2K8VA 1HQOA 2PN8A 4XS1A 4V1Ap 1K3YA 2V1MA 2IJYA 3DRNA 2R2JA 4IS0A 3WT2A 2DSAA 2JL4A 1K0BA 3LYKA 4Z7XA 3APQA 4WF5A 1EEMA 5A4WA 3MWHA 20GSA 5ECLB 5G5FA 1PSQA 2IMFA 4HDEA 4F03A 3CRTA 5IMZA 2NBSA 2OBKA 2KP2A 2PMTA 4DSSB 3U6VA 2GGTA 4J57E 2GSTA 2DJ0A 5ECHB 3U5RE 8GSSA 4HOJA 4POKA 5IM9A 3WGDA 2H75A 4K0NA 5E4WA 2H0GA 5CRWA 3C71A 1YKCA 2P5RA 1RQMA 2VO4A 1NHOA 3IDVA 3D6IA 3D4MA 4N30A 3S9FA 5INYA 3EURA 3N9JA 4MJBA 2R37A 1QGVA 4XCSA 1G0TA 2PUKC 1EEJA 2E7PA 1OAZA 1WJKA 2I3YA 3EC3A 4FIWA 2C0FA 3QAWA 4JE1A 2HSHA 4L8EA 2BJXA 3I43A 3M1GA 3E9JB 3FY7A 2WB9A 3H79A 1URMA 2X8GA 1TRWA 4ZXGA 3F6FA 4YQMA 2H72A 3CXGA 2HI7A 2GT6A 3HYPA 4TXOA 4KUNA 2GDRA 2R3XA 2MMAA 2F9SA 3H1NA 1H75A 2R6KA 5AIVA 3RBTA 3VURA 1GRXA 2GQMA 1ABAA 1XWGA 4CDOA 3KM6A 2CA8A 4KSMA 2FY6A 2LKUA 4J80A 1M2DA 2VLTA 3I6AA 1AUCA 2R5GA 1BG5A 3RHCA 4E8EA 5B7CA 3FW2A 2VCQA 2FUG2 2LV3A 2N5BA 1DE1A 1FPOA 5DJMA 1ERUA 3ZRDA 5GAPD 5ECSA 4ZL7A 4I2UA 1XWKA 3CTGA 2F8FA 1V57A 1Z3EA 1WPIA 3F4RA 1PL2A 1Z6MA 4MZBA 3VWXA 1O8XA 2L5OA 11GSA 1PMTA 1B9XC 3LXTA 2RLIA 3GX0A 2CZ3A 3VPQA 1OC8A 2VL2C 4KX4A 5CO3A 4TN8A 3C8EA 2IMEA 4KW6A 1V98A 4RI7A 2VCWA 5J9CA 2CTPA 2FCHA 4J7ZA 1XZOA 5F05A 5J5NA 1M2BA 2RIIA 1MD4A 1K0AA 2K18A 3DVXA 4N11A 4LL4B 4WR4A 2YZHA 2WZ9A 1ST9A 3WT1A 4WR5A 4TXVA 1SU9A 3GTUA 1XCCA 1ML6A 1O85A 2QC7A 1OYJA 2DMXA 1ILOA 1QQ2A 3FZ5A 1U88A 4MDCA 4TXOB 3IK9A 2H71A 3ZTLA 4PQ1A 4KA0A 5JWQB 3F4TA 1T3BA 1PX6A 1GLPA 3ZLPA 1IYIA 4XRDA 3DWVA 1PN9A 2LQQA 1YY7A 2KOKA 5A4VA 3KH9A 6GSSA 1MD3A 2FA8A 2JZTA 6GSVA 2CUGA 2F3MA 2GTUA 1GSYA 2VL9A 1Q98A 2YUAA 4GXZA 3QFAC 2BMXA 2H70A 4ZB8A 1ERWA 5LCZA 3LYPA 1X5DA 4EF0A 1GTIA 4ILFA 1GTBA 2DJ2A 3BBYA 3HJOA 2OACA 1FHEA 1M99A 1X9MB 1XBSA 2TRXA 4MABA 2XBQA 1J08A 4XTSA 1GSEA 4G19A 3F3QA 1F37A 4MF6A 4F2IA 3Q74A 3GUSA 4JR6A 1X5CA 3BJ5A 2MBTA 1M2AA 4O32A 1SL1B 3F0IA 5AISA 4KCAA 4G10A 3ZMLA 3R2QA 1GWCA 3I69A 3F4SA 3HDCA 1NSWA 1USBA 1YDKA 5EL8A 3RHBA 1GUKA 1MEKA 1GL8A 1TOFA 4OO5A 2LRCA 1C72A 4OMVA 4WXTA 3DXBA 4MA9A 4GQCA 5CP1A 3C7MA 1U3AA 2YN1A 4POLA 4MF5A 3KXOA 1F3AA 1DSBA 1SK2A 1PL1A 2VOCA 2AYTA 5E59A 2X8HA 1K3LA 1XOAA 5LD0A 5KN3A 2KHPA 2DLXA 7GSSA 3TKSE 5D96A 3F6DA 3G7JA 4IHUA 1TRVA 4JBBA 2VCTA 2NVLA 1Z6NA 2EC4A 1RW1A 5H5RA 3P2AA 4MF7A 2QSAA 2QWRB 1GUMA 4NHZA 5ELAA 4XS6A 3F8UA 3NIVA 4N0VA 1MDJA 1ZZYA 3MSZA 1JZRA 3TB2A 2QKEA 2DMMA 3IR4A 4E8HA 5F07A 3KP8A 1QFNA 5L71A 2YANA 3UBLA 5ABRA 4GRFA 5A4UA 1AQWA 3ME7A 3GKXA 1XXUA 3DGQA 1U6TA 1F2EA 2YOIA 3IOSA 4EXJA 3M9KA 5C00A 2B3SA 1T7PB 4YH2A 3FHKA 4TOPA 3KEBA 4FH8A 4NMUA 3HHVA 3UIWA 2H19A 1OE8A 2O89A 3LEFA 3GNJA 3KIJA 3M9JA 2LS5A 1R7HA 5GSSA 2C4JA 5F0GA 4FO5A 2OE0A 1E6BA 5B6NA 2YWNA 3US3A 4F0CA 2HE3A 4HI7A 4XS4B 2CVBA 4MJCA 3TRPA 4F0BA 2N05A 1VGLA 2HLSA 3TJGA 5EPFA 1EOHA 1J9BA 2I81A 1T4ZA 2M80A 2VD1A 2GZPA 2M6YA 3ZMKA 2CAIA 1F9MA 4J2FA 4BVYA 4AJ7A 3TOUA 4AJ8A 2H6XA 1JZWA 4OFTA 4ZILA 3VFIA 1PQNA 3ZIJA 1HNAA 2DJ3A 3GYKA 1A2LA 2GSQA 1JLWA 4HUAA 4ULXA 4GLTA 3GIXA 1TU7A 4GSTA 4WETA 1YEXA 4GQFA 3EWLA 4EKZA 4DSSA 4CHSA 5DCHA 1T4YA 3UL3A 3GRXA 5KN1A 1R5AA 4OFMA 2JSZA 4KCEA 1ZMAA 4AJ6A 5D8IA 2H0HA 3O6TA 4POBA 4IELA 1FOVA 3HXSA 2JSYA 1DBYA 2PBJA 3TKSA 2CX4A 5ELGA 5IOXA 3L4NA 3M3MA 4FYBA 2L59A 1K0DA 3TJJA 4MP4A 4IGJA 5G1KA 3F3RA 5DAKB 4RWUA 3HY2A 4EE0A 4WBJA 4F9ZA 2BTOT 1R4WA 1EP8A 1LJRA 3FZ4A 2IL3A 3L9VA 3GX8A 4HJ2A 5HFGA 1K0OA 2Z9SA 2DIZA 4TRXA 1WIKA 3CYNA 4HZ4A 4BWQA 4J56E 1SL0B 2CZ2A 4IJ3A 3Q19A 1B48A 2FGXA 4I2TA 4L0UA 3H8QA 1IURA 1XVQA 4L5LA 1TI1A 1ZCPA 2GLRA 1H4OA 1XW6A 2MZCA 3A2WA 4DEJA 1A8YA 2C3NA 2WS2A 2DIYA 2JZSA 1OC3A 2Y4UA 4NV5A 2G0FA 2H74A 1THOA 2P0GA 3UBKA 4Q5FA 1TK8B 4BPYA 3BOAA 10GSA 5HFKA 1FVJA 1FAFA 4ECJA 2L5LA 4GCIA 1R5PA 1FB6A 2LRNA 5G1LA 13GSA 4LMWA 1UVZA 1QUWA 3PGTA 1B8XA 4HU9A 4G9HA 1MDIA 5CRHA 4NWYA 4KDUA 4K7OA 2FA4A 3ZIVA 1WP0A 2OJLA 3GA4A 3HJPA 4PNFA 3Q6OA 2XHFA 3L9UA 3FZ9A 2CVDA 1MTCA 4EL1A 1E2YA 3ZZXA 4G2EA 2V41A 1SJZA 4XIHA 3W6GA 4BA7A 4PUFC 2ON7A 2PGTA 3G9BA 2HRNA 1W89A 3LGCA 3JCML 2EJ7A 1J0FA 2OE1A 22GSA 2YPMA 4RQXA 4O92A 1JLVA 1Q4JA 1A23A 1OKDA 3QOUA 1AW9A 4JR4A 4WF4A 2C3TA 2NTOA 5AN1A 4FYCA 3KZQA 5DQYA 4IW9A 3UCSC 4YAPA 1GP1A 4V2MA 5IPGA 14GSA 2LRTA 5D9VA 3G7YA 5IO0A 3IPZA 1SD8A 3ZFLA 4FYUA 2KP1A 1OC9B 1KTEA 4NPBA 2HNLA 1Z9HA 2YS8A 5CRDA 3GKMA 4WBRD 3ZL5A 4L5OA 6GSXA 1JZOA 4EDYA 1BX9A 1JZDA 3H93A 2B1LA 2J23A 3FZAA 4XRAA 1W4VA 2PF4E 3BVOA 1VF1A 4OWYA 3E0UA 3QPMA 1FB0A 4LMVA 1TKDB 5DVBA 2HRFA 3TRXA 2GT5A 3HA9A 4ZB6A 3J7Yb 2VL3A 3KP9A 2AUVA 3ZVJD 5IMAA 3IAS2 2WDUA 3RPNA 2H1GA 1M0UA 4HZ2A 3C1SA 5D73A 2H01A 1B9YC 2B5EA 2LEGA 4QL7A 1SK0A 3FYGA 2B7JA 1A2MA 2C80A 5G31A 5KEJA 2JACA 1WOUA 2VIMA 4AGSA 1AAZA 2LNTA 5ECPB 3WGXA 3IV4A 4ID0A 4XHMA 4BL7A 2X8CA 4GTUA 2E2GA 3KGKA 2H1AA 5AGYA 2VLUA 1BEDA 1RK4A 3HZ4A 1PD21 5IOWA 1QXHA 2H30A 4MJAA 2MBSA 5IO2A 1GH6A 3FR9A 4V2NA 5D9TA 5CYYA 4JZQA 5ECQB 2QWQB 3LQ7A 2EIQA 5JWRB 4P3YB 2H8LA 5ECKB 2DN9A 1A0RP 3NOFA 3QR6A 5D93A 1K3OA 3FR3A 3A2VA 5ID2B 2CAQA 1X9WB 3UAPA 1K0NA 1O81A 1EV4A 4GF0A 2H76A 5CAXA 2RM5A 1CQGA 3VWWA 2YZUA 2VD0A 4POMA 1S3CA 1GSQA 3ZFBA 4DSQA 1U3IA 4MJEA 1THXA 3GSSA 1GNWA 2L6CA 2AHEA 1XWBA 3TJBA 1T1VA 2HZEB 2DC5A 2PVQA 1TK5B 3MNGA 3ERWA 2LGWA 2LJKA 3C1RA 3WD6A 5IPHA 3IAM2 4XS4A 2VM1A 2M72A 4MH3A 4K1FA 2MMZA 3DVWA 4JRRA 2VM2A 5HQPA 2XPEA 4MZCA 1BJXA 2O85A 2N5FA 4O5RA 3LFLA 4DVCA 2H6YA 3KMNA 4IVFA 2AAWA 4ZL9A 1GSDA 2YJ7A 4Q5QA 1WJZA 1TW9A 3UOMA 4D73B 2GSRA 1KNGA 2OBIA 1ZYQB 3TKSC 1YF1A 2V6OA 2GUZA 4MPFA 1A8LA 4V2LA 4K9ZA 3RAZA 2J9HA 1UC7A 1PKZA 4MZWA 1SJIA 2KLXA 1BYEA 3PR8A 3CBUA 5ECIB 5ENUA 2VAFA 1G6YA 5DDLA 1FG4A 3EYTA 3FRCA 2FWEA 3TKRA 1T8EB 4EUYA 4HJMA 5HR1A 4EC0A 1SYXA 3AY8A 2B5XA 3D22A 2LJAA 2CTRA 1GNEA 3KH7A 3EMXA 2MMOA 2KQXA 2K6VA 2A2RA 3EVIA 4X0XA 3SBCA 3H4KA 3BD2A 1B4QA 4GSNA 2LQOA 2V32A 2VCXA 1VRSD 2K8SA 1NZ6A 4PQIA 3W8SA 3GKNA 5F8BA 3HKRA 3VWVA 2NPBA 1XWCA 2JADA 1YF0A 2C0DA 5DAKA 4MH2A 2C1YA 1YKAA 2F51A 4IKHA 4OCFA 4WEYA 2TIRA 3UO3A 3CSHA 2L4QA 2IMDA 3D5JA 3CSJA 4YQVA 4IQAA 2ON5A 2IPAA 18GSA 1TXXA 2HT9A 5GZZB 2V2GA 3CMIA 2GUZB 3GMFA 4IP6A 4RUVA 5EY6A 3VI7A 2VLVA 2REMA 12GSA 4RI6A 3TJKA 3VPTA 2ALBA 3PH9A 5KN2A 1SKSB 1XVWA 4K8MA 1ZYEA 2C0GA 5GAND 2C8UA 4JU5A 3EINA 4ECIA 1N8JA 2LJRA 2IFQB 4OO4A 4KDXA 2X99A 4YQUA 3HCZA 4TR0A 3EU4A 2RM6A 3UEMA 3A3TA 1TK0B 4PX1A 6GSYA 2YWOA 2CTWA 5AIXA 5FWGA 1FVKA 2OCHA 3UARA 1G6WA 1TJDA 1JFUA 1S3DA 3DEXA 3DKSA 4Q5RA 3LJRA 2HYXA 2GZYA 2I9HA 3CRUA 1DE2A 5F06A 2QWPB 1VF4A 3FR6A 4I6XA 3VLNA 1I9DA 4ECCA 1TI3A 4CW9A 3GV1A 4QL9A 2E0QA 5G2ZA 4NAXA 2YP6A 4TR1B 1GLQA 3GN3A 3HVXA 2RUEA 4X43A 4K7IA 5ECRB 3M0FA 5ECNB 2YCDA 1YJ6A 3EU3A 3IHQA 1HDJA 1PKWA 4NHWA 2LSTA 2Y4TA 1OC9A 3GKKA 1Z7PA 3OR5A 4LLRA 3QD9A 3F63A 3GSTA 4TVEA 4TR4A 4EVMA 2DJ1A 1PGTA 2YV9A 3FK8A 2GQKA 1WE0A 5FHIA 2GSSA 5DALB 2OE3A 1X0RA 5JCUA 3D4TA 4I5QA 2H1BA 5HR3A 1Y25A 4KH7A 1IYHA 3ZYWA 4OCEA 1M9BA 1Y6EA 3WYWA 5D9XA 3P8WA 2A4VA 2FWFA 4TW5A 4KDYA 2EIOA 1OVNA 1DUGA 3P7XA 1EGOA 4AF2A 2IN3A 5DJLA 2HFDA 5JWOB 2H73A 1K0MA 3MDKA 4ISDA 2WJUA 2VUPA 3TJFA 9GSSA 2R4VA 3D0ZA 1R26A 3CTFA 3TGZA 4IN0A 2WULA 1BQZA 3E3EA 2CQ9A 4K2DA 4X1UA 5ECOB 5H5SA 2HSYA 1OKTA 1V58A 3L78A 1PA3A 1XIYA 5DCGA 2PERA 2OA7A 2QWOB 3QCPA 1HNCA 4GSSA 1SJ6A 2IIYA 5JCWA 6GSWA 2ZUPA 4ZBDA 2DJKA 4GWRA 2VCVA 3N5OA 3TKPA 3TKQA 5B8BA 3EMPA 3VWUA 4MK3A 1OE7A 1UA5A 3BCKA 1O6JA 2PWJA 3G7IA 5ID2A 1XWAA 4MPGA 3A2XA 3V1WA 3HZ8A 4O7HA 2VCZA 1HNBA 2WCIA 4MMMA 1TU8A 3QFBC 1AXDA 2P5QA 2YV7A 2KUCA 2QGVA 1SK1A 4IP1A 3EE2A 2L6LA 3DIEA 3SWLA 3UMAA 5IQYA 3LG6A 2JU5A 1HD2A 4K0GA 2B7KA 4NXIA 5J9BA 1A0FA 5J4UA 5J3RA 4KAEA 1SYRA 2HZEA 3GFKA 4LA1A 4ML6A 2FD3A 2HXKA 5LNKe 2O87A 3KTLA 1PRXA 1X9SB 2G2QA 4EO3A 4IBPA 2E2MA 2B1KA 5ECMB 3IA1A 2A2SA 3GL3A 3APSA 3DMLA 4PUAA 4EDZA 1AQXA 5G5EA 2CX3A 1GULA 1ERTA 4JEDA 1LU4A 1QK8A 2WRTA 2EIRA 3QMXA 1FAAA 4OD7A 4PURA 4D73A 2AV4A 5IMCA 2FLSA 3KD0A 4ZIJA 4K7NA 2CT6A 3D21A 1NW2A 2N5AA 1M9AA 2H1DA 4F82A 4LL1B 1Z7RA 1GH2A 3LSZA 5HR2A 1LBKA 3O76A 1TP9A 5IMVA 1XW9A 1SD9A 3CSIA 2OKAA 4BWSA 2L57A 2I4AA 5G30A 4BVXA 4I97A 1S3AA 1BQ0A 5IMFA 17GSA 4H86A 3L9SA 4QQ7A 1WRYA 1EOGA 2DJJA 2L6DA 3AG7A 2GQLA 1O8WA 2QSIA 1WWJA 2CVKA 5B6MA 1U87A 1N4CA 4NV2A 4PQHA 2TRCP 1M7TA 2LO1A 1TRUA 3P90A 3LXZA 4Q5NA 2OADA 1VF2A 3K8NA 1QMVA 4ZL8A 4DSRA 1ERVA 1BQ7A 3IRAA 3ME8A 3TDGA 1WMJA 1AIUA 3APOA 1TTZA 1GSUA 4PXOA 3UJ1A 1YEPA 5C04A 3QAGA 5CREA 3GURA 3M8NA 4HQZA 3GHAA 1XBLA 1AQVA 3ISOA 2RUFA 2LUSA 2H66A 4HQSA 1XPVA 3DD3A 2B5YA 4MCUA 4KSOA 1MDKA 1PX7A 2B6MA 3GTUB 4KB3A 4ZBBA 1ACVA 3HVVA 4HEA2 2O7KA 1XOBA 1XFLA 5HFIA 3ERFA 2VL2A 5J41A 1SKWB 2P31A 3IK7A 2IWTA 2NDOA 3TOTA 5KN0A 1VF3A 1SL2B 3L0HA 3UO2A 2YNXA 3Q18A 1ZL9A 3UVHA 1F6MC 3W8JA 5D9WA 3C73A 4OFNA 2IFQA 5JCGA 2FWHA 4MLYA 4TKYA 5A5KA 2GS3A 1K0CA 1EP7A 2H0IA 2YWIA 3WGEA 2MYGA 4TR3A 2DBCA 3I9V2 3J7Yk 16GSA 3RPPA 5CNWA 3PINA 1A24A 4IJIA 4HS1A 2GVPA 2FNOA 2CTQA 4WKWA 1EV9A 2PPTA 2ZCTA 2YJHA 1GTAA 1EWXA 4IQ1A 2DMLA 1FO5A 4V1Ag 4ACSA 3FEUA 2GZZA 5H5QA 1TRSA 3IBHA 2XBIA 2L4CA 2FWGA 3RDWA 2X64A 2C0EA 3KJYA 4PGTA 3QDNA 1XW5A 1NHYA 3IC4A 1HYUA 3F9UA 1TDIA 3TCOA 4KE3A 2IMKA 1T00A 4ML1A 4K6XA 5CRGA 3QAVA 4ZB9A 2XPDA 4TR1A 3FKFA 5HR0A 2V6KA 1Z5YE 1B4PA 2AJQB 2M46A 3ZVJA 4I8BA 1N2AA 2ZNMA 1BAYA 2PU9C 5DBQA 1G7EA 2XC2A 1V2AA 1O73A 3KCMA 3VK9A 1AC1A 2HZFA 6GSTA 3MAKA 1X5EA 3GH6A 1I5GA 2MMNA 2D2ZA 5IIZA 3VI5A 1F3BA 3KMOA 4IT5A 2WGRA 3HD5A 19GSA 2IMIA 2H6ZA 3GL5A 5DALA 1YZXA 1GUHA 1SKRB 3ED3A 5FT3A 1ON4A 1G7OA 4KGIA 1NM3A 3NZNA 1CQHA 2CV4A 3ZREA 2PVOC 1FW1A 1SENA 1GSSA 3TRQA 3KTBA 1UN2A 3BCIA 3ERGA 4ZBAA 3TUEA 1EGRA 4N0ZA 3IXRA 4HU7A 3LORA 2JZRA 3GH9A 4L0WA 5IMDA 3DYRA 2AB6A 2I1UA 2WFCA 3IE3A 2LNSA 2C3QA 1GSFA 2O8VB 3HVSA 5B8AA 1A2JA 3UVTA 1KBNA 2ES7A 5GSTA 4KNDA 4N10A 2YWMA 1ZOFA 1V40A 5COHA 2N04A 1KEBA 1V9WA 3A5WA 1EZKA 3LWAA 3HJMA 2QWNB 4RQRA 1GTUA 5EVOA 5DQSA 4PNGA 6GSUA 2LTKA 4YAVA
chains in the Genus database with same CATH superfamily
4GKKO 3ZITA 2IU3A 1O7UA 1YQ1A 4PDLA 1ZGNA 4MNNA 4ECBA 1I94O 1JHBA 1NR7A 2K9FA 2P4VA 1LUVA 3H01A 3O3TA 2AHZA 2F8AA 3P32A 2FHEA 2K8VA 1HQOA 2PN8A 4XS1A 4V1Ap 1K3YA 1IVSA 4HNAB 2V1MA 3JD3A 2IJYA 2UXNA 3DRNA 1XL6A 2R2JA 4WBNB 4IS0A 5H6QA 3WT2A 2IJJA 4P9PA 4UVBA 4F6EA 3E2EA 2DSAA 2JL4A 1K0BA 3AG3C 3T1HO 2A4HA 3LYKA 4Z7XA 1A32A 3FB8C 3APQA 2E5LO 4WF5A 4K0KB 1FJGO 1EEMA 5A4WA 4PA3A 1WA8B 4BW5A 20GSA 3TETA 1YF2A 3MWHA 1M57C 4ZBMA 5ECLB 5G5FA 1PSQA 2IMFA 4HDEA 4F03A 1KU9A 3CRTA 5IMZA 2NBSA 2OBKA 2KP2A 3WG7B 3THOA 1PL4A 2CE4A 4JV5B 2PMTA 4DSSB 3U6VA 2NLJC 1D5AA 2GGTA 2GSTA 4J57E 3AG2C 2DJ0A 5ECHB 2DKHA 1OJHA 2F23A 3U5RE 1K8AW 8GSSA 4TV8A 4YJ2B 4HOJA 1DTOA 4POKA 5IM9A 2H75A 3WGDA 1Y74A 4K0NA 5E4WA 2P4KA 2H0GA 3GWKC 5CRWA 2FMLA 1YITV 3C71A 1YKCA 3IC8A 3ASNC 1JPXA 1N0JA 5FNVA 2ZE5A 4XDJA 3E22B 2P5RA 5BMVB 2DW4A 4K8ZA 5LHGA 1RQMA 5IE9A 4B3RB 2VO4A 1NHOA 4D6TH 4FZ1A 1G8MA 2V1DA 3QF7A 3IDVA 1XQ8A 3D6IA 3D4MA 4N30A 5B1BC 3S9FA 3SJAC 1B06A 3F7YC 2M7WA 2UU9B 5INYA 3EURA 3N9JA 4MJBA 2R37A 1QGVA 4IIJB 4XCSA 1G0TA 2PUKC 1EEJA 2E7PA 3CS5A 1OAZA 1WJKA 2NNUA 2I3YA 4PELA 3EC3A 2WSSG 1IXMA 3ML0A 4CY8A 2RN9A 3LW9A 4FIWA 3ZMTA 3CC4V 2ITCC 2C0FA 3QAWA 3K0GA 5CA1B 2RCVA 4X88A 4JE1A 3W7UA 2HSHA 4L8EA 4JYBA 2VS0A 2PUSA 3LSUA 2BJXA 3I43A 5KHJA 3M1GA 4DR2O 3E9JB 3FY7A 2WB9A 3H79A 2QM4A 1URMA 2X8GA 1JA8A 1TRWA 2QM8A 3MHSC 3KG2A 4ZXGA 3F6FA 1VF5B 1N0NA 5IDJA 4YQMA 2H72A 3LDDA 3ZCCA 3CXGA 1K92A 5KUKA 2GT6A 2HI7A 4X62O 4DUYO 3HYPA 3CEIA 2ZD9A 3ZHQA 4KUNA 4TXOA 3CRQA 2GDRA 3K57A 2R3XA 1KP3A 2MMAA 2F9SA 3H1NA 1H75A 3BHPA 2QA2A 2Q9LA 3JAMN 3CJHB 1KD1W 2R6KA 5AIVA 3RBTA 5L3BA 5D5QA 2XAGA 3VURA 1GRXA 3A5IA 2GQMA 1ABAA 2UUAO 2X4AA 1XWGA 2HHHO 5H9CA 3STZC 4CDOA 1L0LH 3KM6A 3RYFB 2CA8A 4KSMA 4LBEC 2FY6A 2LKUA 4J80A 1TUEB 1M2DA 2VLTA 1P49A 3I6AA 1AUCA 3GVMA 2R5GA 1BG5A 3TXSA 3RHCA 4E8EA 5B7CA 3FW2A 2VCQA 3CXHF 2FUG2 3CSXA 2LV3A 2N5BA 1DE1A 1FPOA 3F5TA 5BZBA 4NB5A 4MVMA 2YDEA 4H13B 5DJMA 1ERUA 3ZRDA 4GKJB 1CP9A 5GAPD 2E75B 1MMMA 5ECSA 4ZL7A 4I2UA 1XWKA 4E4EA 3CTGA 2F8FA 1M56B 4K35A 4K5RA 2CH7A 3ABMC 1V57A 1Z3EA 1WPIA 3F4RA 1TAEA 1L8DA 4JTDB 1PL2A 1Z6MA 4ZI7A 4IGGA 4MZBA 3VWXA 4LF4B 1O8XA 2L5OA 4DR5B 11GSA 1PMTA 1B9XC 1VMGA 1E1QG 3SPGA 2RLIA 3LXTA 3GX0A 1ZL8B 4ZKIA 2CZ3A 3VPQA 3JSLA 2PI4A 1OC8A 2VL2C 4KX4A 2R9IA 3PN1A 3K5MA 1BZKA 3CC2V 4TN8A 1PV0A 5CO3A 3C8EA 4DR4B 2IMEA 4KW6A 1V98A 4RI7A 2VCWA 2X6BA 1NTZH 2CTPA 2FCHA 5J9CA 3ZHTA 2VWJA 4J7ZA 3ZJZA 1XZOA 5F05A 5J5NA 1VQKV 1OCZB 1M2BA 2RIIA 1KUQA 1MD4A 1K0AA 2K18A 3DVXA 4N11A 4LL4B 3SPIA 1XNQO 4WR4A 2YZHA 1T5EA 3Q4HB 3CC7V 2WZ9A 1KBHA 1XHZA 2LJ2A 4YKGA 4LC1A 1ST9A 3WT1A 3T2MA 4TXVA 4WR5A 1XHXA 1SU9A 3GTUA 1XCCA 1Z5VA 4F6RA 1VQ9V 1ML6A 1O85A 2QC7A 2DMXA 1OYJA 1ILOA 2Q8VA 4O4HA 1QQ2A 5KMGB 2LW1A 2ZT9B 4DV1O 3FZ5A 2YIBA 1U88A 4MDCA 4UCSA 5B3SC 4TXOB 1JFFA 3IK9A 2H71A 2DKIA 3D8CA 3ZTLA 4PQ1A 1YEWA 1M9NA 4KA0A 5JWQB 3F4TA 1T3BA 1PX6A 4LFCB 3AEIA 1GLPA 4W4LA 3ZLPA 2ZDIA 1IYIA 4XRDA 2P06A 4UB8Z 3DWVA 1PN9A 2LQQA 4FPPA 1YY7A 2KOKA 5CBGA 5A4VA 4H37A 2HRKA 3RYHB 5JJJB 4GZRB 3KH9A 2YIDA 2PYJA 3W7WA 3PPUA 6GSSA 1L0NH 4DXWA 4JI6O 1MD3A 2FA8A 2JZTA 4MVZA 6GSVA 2NR5A 2CUGA 1OCRC 5LXTB 1LNQA 1HNWO 4JI2B 2DWEC 2F3MA 2GTSA 4J7KA 2FKXA 1O9GA 2OTLV 2GTUA 2ITDC 2RJZA 1GSYA 4Z2WA 1V54B 1UFIA 1I5YA 1RM1C 1UPGA 3FAVB 1E1RG 3ASOB 2VL9A 1Q98A 2YUAA 4GXZA 3QFAC 3RWRD 2BMXA 2H70A 4ZB8A 5JVDA 1ERWA 4JI5O 5LCZA 3LNMB 3LYPA 1PD3A 1X5DA 4EF0A 1GTIA 4CH3A 3A0RA 4ILFA 4B7EA 1GTBA 1ZYPA 2DJ2A 1M3JA 3OGIB 2EINC 3BBYA 2VQEB 3HJOA 2OACA 1FHEA 1M99A 3CMAV 1Q8IA 3SYCA 1X9MB 4X65B 1XBSA 2TRXA 4MABA 4YIPA 2XBQA 1J08A 4XTSA 1SZXA 1GSEA 4G19A 3F3QA 3G71V 1F37A 4MF6A 4F2IA 3ETDA 3Q74A 4I9QA 2QJ1A 3GUSA 4JR6A 1X5CA 1HNXO 3D3IA 3BJ5A 2MBTA 1G4YB 1M2AA 2DYRC 4O32A 3F0IA 1SL1B 5AISA 2VWKA 4KCAA 4FFKA 4G10A 3ZMLA 3ZHRA 4X8AA 3B8MA 3R2QA 5KHGA 1W0JG 4B3SB 1GWCA 3I69A 3F4SA 3G67A 4R7CA 5EK0A 1QVFU 3HDCA 1NSWA 4RO2A 1USBA 1YDKA 3QO5A 5EL8A 1AR1B 3HKDA 4DV4O 3OTOO 3RHBA 2WLLB 1GUKA 1MEKA 1BHBA 1GL8A 1HP8A 1P84F 1TOFA 4OO5A 2LRCA 1C72A 2HR3A 4OMVA 4WXTA 3DTUB 3DXBA 4MA9A 3MHHC 1VF6C 4GQCA 5CP1A 4G2KA 3C7MA 2PGGA 2QTOA 5KOXA 1U3AA 2YN1A 4POLA 4MF5A 3KXOA 5K1PA 4BAYA 2EIJC 1F3AA 1R6NA 1DSBA 1SK2A 1PL1A 2VOCA 2AYTA 5E59A 5TISZ 2X8HA 1K3LA 2YXYA 1XOAA 5LD0A 1QR9A 1Z5WA 4MTGA 2KHPA 5KN3A 1IBLO 3D36A 3AG2B 3HB3B 1N8RW 2DLXA 7GSSA 4JI4B 1IXBA 3TKSE 1K4CC 3R66A 5D96A 3F6DA 3C90A 5FPOA 3G7JA 4BL7B 4IHUA 3CQFA 1YJ9V 1Y67A 3CCVV 1TRVA 4JBBA 2VCTA 3L74H 3FB6C 2NVLA 1Z6NA 4QPKA 4J7JA 3ASNB 5IYZB 2EC4A 4FK5C 5LMNB 1RW1A 1R3JC 5H5RA 2WLIB 5JH7A 2YSUB 4EB6B 3P2AA 4MF7A 2QSAA 1K73W 3H1IH 3DXRA 3EXAA 2LQTA 2XHBA 5GSSA 2QWRB 5B1BB 4FLYA 1GUMA 2LP7A 2H94A 2OTJV 4NHZA 5ELAA 5IJ0B 1XG8A 2ADPA 2KG7B 4DR6B 4XS6A 3TCUA 2FYUH 3F8UA 2CK3G 3NIVA 4N0VA 1MDJA 4X1YA 1ZZYA 3MSZA 4NXMO 1KP2A 5KHHA 1JZRA 3TB2A 2WPDG 2QKEA 4X64O 2DMMA 2H3OA 4DV2O 1HR0B 3IR4A 5F07A 4E8HA 1BL8A 3KP8A 1QFNA 2R0CA 3UT5B 5L71A 3N2KB 2YANA 3UBLA 2UUBO 5ABRA 4GRFA 4PDMA 1YIJV 3ZN1A 2YXHA 3F5WC 5A4UA 1AQWA 4MVRA 1OCOB 2WLJA 2EJRA 3ME7A 2GSMB 3GKXA 1XXUA 2L35A 1SC5B 2HSMA 3DGQA 1U6TA 1F2EA 1I08A 2E76B 2YIAA 1W0KG 1YDXA 4TWKA 2YOIA 3IOSA 3HR0A 4EXJA 2DYSC 2YEVB 3M9KA 5C00A 2B3SA 1T7PB 1MSDA 1F7YA 4YH2A 3DC5A 4X1IA 3B8NA 4MT8A 3FHKA 4TOPA 3KEBA 4FH8A 2P90A 1B04A 3HHVA 4IL6Z 4NMUA 4PA9A 1OE8A 1GAXA 3O9OA 5KAFZ 2H19A 2O89A 2X0LA 3WB2A 4BIOA 5LMUO 3LEFA 2YI9A 5EYPB 2A7WA 3JASA 3GNJA 5IJ9B 3KIJA 3M9JA 3JD2A 1XOUA 3OUSA 2V7QG 1K5QA 4JI1O 1R7HA 1S5HC 1SA0B 3HKDB 2C4JA 3BCCH 1E6BA 2OE0A 4FO5A 5F0GA 5B6NA 4MVSA 2YWNA 3US3A 4F0CA 1IX9A 2HE3A 1S72V 4HI7A 4XS4B 2CVBA 2Q67A 2WLMA 4MJCA 3TRPA 3ZRWA 5CA3A 5CN0A 1SQGA 2P22C 1SQVH 3ZN0A 2XOKG 4F0BA 4JI0O 2N05A 1SKVA 4MW3A 3JSNA 1VQ8V 1QQCA 1Y6XA 2F1MA 4I0XB 1VGLA 2HLSA 5EPFA 1JQ0A 3TJGA 4ZHQA 1Q7YW 1EOHA 1J9BA 4LR3A 2I81A 3AG1C 1M5IA 1T4ZA 2M80A 1IBMB 2GHYA 3K5NA 5LOVA 4LFAB 2VD1A 4FLXA 2GZPA 2HEPA 2M6YA 2WLNA 3K3WA 3SJQC 3JYCA 5JQGB 2QKCA 3ZMKA 4FLWA 2CAIA 3ABMB 4JI7O 1F9MA 4J2FA 1XMOO 1AB3A 2ZM6B 4AJ7A 5ITZA 3T1CA 4BVYA 3TOUA 4AJ8A 4FM0A 5BR8B 2H6XA 1JZWA 4OFTA 4ZILA 4HNAA 3VFIA 1PQNA 3ZIJA 2XAJA 1HNAA 3RVYA 4GX0A 1WB8A 2DJ3A 3GYKA 3B09A 4WBNA 3HPLC 1A2LA 5JJNB 2GSQA 1YSCA 1WPXA 3JAWB 3JD0A 5EIBC 1Y76B 1JLWA 4HUAA 3GB7C 4BIUA 1K3EA 3K5LA 4ULXA 4GLTA 3GIXA 1IBKB 1TU7A 4MVOA 1WA8A 3ABUA 4GSTA 4WETA 1YEXA 5KX5B 4GQFA 3EWLA 4EKZA 3JARA 4JTCB 2VQFO 2Z5UA 3VQWA 4I4TB 4DSSA 5AG2A 1KB9F 4CHSA 5DCHA 1T4YA 3UL3A 5LP6B 3GRXA 5KN1A 1R5AA 5K1XA 4I55B 1G1XB 4OFMA 1AP5A 2JSZA 3H1HH 2F4VO 4KCEA 1ZMAA 3E8BA 5BRTA 1FFTB 1ZSPA 5D8IA 4AJ6A 3CRMA 2EILC 2H0HA 3O6TA 4POBA 3E22A 2ODMA 4UXNA 5BMVA 4IELA 1FOVA 3ZHUA 3HXSA 4CS4A 3OW2U 2JSYA 1DBYA 2A06H 4DV5O 4QJFB 3HKBB 1NU1H 2E74B 2Y0IA 3NXSA 2PBJA 3TKSA 3OTFA 2CX4A 4QNHB 4X66O 5ELGA 1N33B 5IOXA 2Q0AA 3L4NA 3RFRA 3M3MA 1J5EB 1Q5OA 1FXKC 5LYJB 4RQEA 4FYBA 1V9PA 2L59A 1KKCA 1K0DA 3TJJA 4MP4A 5CA1A 4IGJA 5G1KA 3F3RA 4UCRA 5DAKB 4RWUA 3HY2A 4EE0A 2Q68A 1EBOA 2HJDA 4WBJA 2BTOT 4F9ZA 4DK1A 4X20A 1R4WA 4LNUB 2ZE6A 4L8JA 5KOWA 1EP8A 1LJRA 4DR1O 1D5NA 3FZ4A 2IL3A 3L9VA 4LF9B 3CRCA 4DR7B 3GX8A 4HJ2A 2BE3A 5HFGA 3CCMV 3N2GB 1K0OA 1M93A 4K0KO 2Z9SA 2DIZA 4TRXA 1WIKA 3VOUA 3FKSG 2XT9A 3CYNA 1RSOB 3RYIB 4HZ4A 4BWQA 5CBHA 4J56E 3CJHA 1SL0B 1HNZB 2CZ2A 1M1KW 4IJ3A 4JV5O 3Q19A 4BR6A 3EFFK 1B48A 2FGXA 4JGSA 4BVYB 2JDIG 2Z0AA 4I2TA 5ITZB 4L0UA 3H8QA 1IURA 1ENVA 2EINB 3T4ZA 2Q7EA 1XVQA 4I9WA 3AK3A 2C2AA 4DYLA 1GN4A 2A3QA 1TI1A 4L5LA 3RYFA 1ZCPA 2GLRA 4DW0A 5F2VO 1XEQA 5B5EZ 1H4OA 1XW6A 2MZCA 1U96A 2UXDB 3A2WA 4DEJA 1A8YA 2C3NA 2WS2A 1SESA 3ABTA 1JVMA 2DIYA 4GCZA 2JZSA 3OMNB 1OC3A 1X4TA 2Y4UA 4NV5A 1JJ2U 1GO3F 2G0FA 1BS3A 4W4KA 1NR1A 2H74A 1EM1A 3JARB 1THOA 2PY5A 3PJSK 2P0GA 4Q5FA 3UBKA 1TK8B 1AJNA 1K5SA 4BPYA 3FYIB 3BOAA 1GM8A 2Y69C 3W7TA 4HBNA 1QLNA 1YHQV 10GSA 1ZUQA 2BTQB 2RQ6A 1TGOA 4J41A 5HFKA 2WLKA 1FVJA 4NTWA 4JASA 4LF5B 1FAFA 2L5LA 4GCIA 4ECJA 4LH7A 1R5PA 1FB6A 1ZL8A 2LRNA 5G1LA 4LFBB 13GSA 4LMWA 1UVZA 1QUWA 1SQPH 3PGTA 5LGUA 1I94B 2DE0X 1B8XA 5DM6V 4HU9A 2VRZA 1H8EG 4B7KA 4G9HA 1MDIA 4DRXB 5CRHA 4NWYA 3AK2A 3WU2Z 4KDUA 1WB7A 4GT1A 4BIZA 4K7OA 2FA4A 2ZIOA 3ZIVA 3MDSA 4FMTA 1WP0A 2OJLA 3GA4A 3HJPA 4PNFA 3Q6OA 3QO8A 2JS5A 5L3EA 4UV8A 2XHFA 2E5LB 3FZ9A 3L9UA 4O4JB 5JJEB 4XDKA 3J80N 1FJGB 2CVDA 3Q4HA 1MTCA 4EL1A 1E2YA 3ZZXA 5E79Z 4G2EA 2V41A 3ZMVA 4X20B 1SJZA 4CS3A 4JAVA 4O2BB 1DF5A 4XIHA 3W6GA 4BA7A 4PUFC 4ICYA 2ON7A 4WFAV 2PGTA 3G9BA 2HRNA 4IHJB 5KMGA 3VQVA 1W89A 4QGPA 2XUMA 1TUBB 4U3FH 4DV3O 3LGCA 3JCML 2EJ7A 1JX9A 1J0FA 2OE1A 1GM7A 4MVUA 22GSA 3BA9A 2RDCA 2YPMA 4RQXA 1S3JA 2AW9A 2JGDB 4O92A 1JLVA 2XASA 5KA6A 1FS0G 1Q4JA 2FTKA 2P6JA 1A23A 1OKDA 5JWPA 5KA5A 4USSA 3QOUA 1K9MW 3FYEB 3UKMA 1AW9A 1R6TA 3E86A 3ZHSA 3L75H 3RYHA 4JR4A 3QO7A 2Q0OC 4WF4A 2C3TA 2NTOA 5AN1A 4AILC 3ETQA 4FYCA 3KZQA 3TXQA 2UXBO 1XREA 4UFZA 4IW9A 5DQYA 5LXTA 3UCSC 4YAPA 3TGUH 1B3QA 1GP1A 4V2MA 3VQYA 5IPGA 4PA6A 14GSA 2LRTA 5D9VA 3G7YA 5IO0A 3IPZA 1SD8A 1VQ5V 1P7BA 3ZFLA 3FAVA 1F4MA 1S3RA 4YHHO 4DR2B 4LF7O 4FYUA 2KP1A 1OC9B 1KTEA 4NPBA 3I5DA 3ABLC 2HNLA 2IW5A 2YS8A 1Z9HA 3OFNG 5CRDA 1X59A 2GBOA 3GKMA 3RW0A 4WBRD 1XMQB 4DUYB 5KLVH 1PNKA 3ZL5A 4KXRA 4L5OA 1WP8A 6GSXA 1XUQA 2BSKB 1FXVA 3SPJA 3K9AA 5IYBO 1JZOA 4EDYA 1BX9A 1JZDA 4LF6O 1GN2A 4HZ3A 3H93A 2B1LA 3B2EE 1BMFG 3ETGA 3WB1A 2J23A 3FZAA 4XRAA 1W4VA 2PF4E 3BVOA 1VF1A 4B3TB 4OWYA 3E0UA 2UUAB 1Q6HA 3QPMA 5EC1C 3SDLA 1FB0A 4LMVA 1WP7A 1TKDB 5DVBA 2HRFA 4JI8O 4O4LA 3TRXA 2GT5A 3HA9A 4ZB6A 3J7Yb 2VL3A 3KP9A 1CPYA 2AUVA 3ZVJD 1VQLV 5IMAA 2HP8A 1U97A 2WLLA 3IAS2 3R3EA 2ZXWB 1W59A 2WDUA 3RPNA 2H1GA 1SQFA 1M0UA 4HZ2A 4PDVA 3C1SA 5D73A 2H01A 1VQPV 1B9YC 2B5EA 2LEGA 4B3MO 4HYOA 4P9OA 3CD6V 4QL7A 1SK0A 3FYGA 3X2QC 2B7JA 1A2MA 3E8HA 3JD4A 4CY6A 2C80A 3S3XA 4JI2O 5G31A 2BTOA 5KEJA 4WF9V 2JACA 3FB7C 1WOUA 2VIMA 4AGSA 2XTAA 1AAZA 3ABKB 3JALB 2LNTA 4DV0B 3L70H 5ECPB 3WGXA 2H8PC 3IV4A 1PNMA 4ID0A 4XHMA 4BL7A 2X8CA 4JI3B 1PFOA 4GTUA 1SETA 2UUCO 2E2GA 3KGKA 2H1AA 4UVCA 2QE7G 2VLUA 5IYZA 1BEDA 5AGYA 1QNMA 3RBZA 3SPHA 4JYCA 1RK4A 3HZ4A 1OCCB 1PD21 3ZRSA 2W0FC 2ZNJA 2WLIA 5IOWA 2OIEA 1V55C 4O2AB 4OGQB 4EB6A 4FVMA 4X65O 5EZYB 3CRAA 1QXHA 3CRRA 3E89A 2H30A 4MJAA 2MBSA 5IO2A 1GH6A 3FR9A 4V2NA 5D9TA 5CYYA 2OCCB 3T1YO 5IJ0A 4JZQA 5ECQB 2QWQB 2KG7A 3LQ7A 2EIQA 1XNQB 5JWRB 1QLEC 4TQDA 4MTXA 2H8LA 2DN9A 4P3YB 5ECKB 1A0RP 3NOFA 2EIKB 3OAAG 3CMEV 3QR6A 5D93A 1K3OA 4KUMA 3A2VA 4IYHA 3FR3A 5ID2B 4MVQA 2CAQA 4B3SO 2ZQMA 1K0NA 1EZJA 3UAPA 1X9WB 2IBZH 2EIMB 5C8YB 1O81A 5BMUA 3M99B 4G28B 1EV4A 3UT5A 4GF0A 2H76A 3N2KA 4WFFA 5CAXA 2RM5A 1CQGA 3VWWA 4OPHA 2A2PA 3B4SA 2YZUA 4GX5A 2VD0A 1MG1A 3G6EV 4DV1B 1GK9A 1N32B 4DUZB 4POMA 3OGCC 1S3CA 4GX2A 4RQFA 1GSQA 5H5NA 2R0GA 3ZFBA 4DSQA 1Q90D 1U3IA 4MJEA 1THXA 4DW1A 2YEVA 4J9ZB 2E3CA 4H44B 5GTIZ 3GSSA 1GNWA 2L6CA 4GYCB 1P7GA 1WAZA 2JEXA 1F51A 2AHEA 4E2LA 1XWBA 3TJBA 1B6QA 4K8XA 2WWWA 1T1VA 4O4LB 2HZEB 4MTOA 2DC5A 1H2LA 3BY6A 1PM9A 5EYPA 2PVQA 4YJ3B 5IJ9A 1TK5B 4JI6B 2KSDA 4YKFA 3K08A 1SA0A 3MNGA 4PD4F 4OX9B 3ERWA 2LGWA 1Q86W 2LJKA 1HNWB 3C1RA 3C3SA 3WD6A 5IPHA 3K06A 4DV7B 3S3WA 3IAM2 4XS4A 2VM1A 2M72A 4CC6A 4MH3A 4K1FA 2MMZA 3AG3B 3CCJV 3DVWA 4JRRA 2A79B 2VM2A 5HQPA 3SR2C 3CPWU 4NYKA 2XPEA 4MZCA 1BJXA 2O85A 1Q43A 2N5FA 4O5RA 3LFLA 4DVCA 4I0XA 4YXWG 3A0BZ 4JI5B 3QNEA 3DSQA 2H6YA 3KMNA 4IVFA 1M57B 2AAWA 1FD9A 2EX3A 4ZL9A 1GSDA 2YJ7A 2ADQB 4Q5QA 5L3GA 4ZIBA 1WJZA 4L87A 5JQGA 1TW9A 1NQTA 3UOMA 1HR0O 4D73B 2GSRA 1KNGA 5KHKA 4YIOA 4I5SA 4FZ0A 4LP8A 1N36O 5J2TB 2OBIA 1HNXB 1ZYQB 3OUFA 3TKSC 5J9PC 4NXNB 4X4JA 3LUTB 5B1NA 4YY3O 1YF1A 2V6OA 2GUZA 3IHGA 4WFGA 4MPFA 4Z1VA 1A8LA 3JAWA 1Y76A 4V2LA 4K9ZA 3ZMSA 3RAZA 2ZE7A 2J9HA 2Q4PA 1UC7A 1S76D 4LF8B 1PKZA 4DV4B 4MZWA 4JYYA 5KX5A 2ZE8A 4ASUG 1SJIA 2KLXA 1BYEA 4I4TA 3PR8A 4EFEA 3T4DA 3CBUA 1FFXB 5ECIB 5ENUA 1H2KA 4QPJA 4BIKA 5LP6A 4Q6GA 2VAFA 1BCCH 5EIBD 1G6YA 4I55A 5FL7G 1FG4A 5DDLA 3EYTA 2AHYA 4TT3G 3FRCA 2FWEA 3TKRA 4BVXB 1KMIZ 4EUYA 1T8EB 4HJMA 5HR1A 4KHPO 4EC0A 1SYXA 2HFEC 3AY8A 3C3TA 2B5XA 2R9RB 3D22A 3IC9A 2LJAA 1SZTA 2CTRA 3CXCU 1GNEA 3KH7A 3EMXA 2MMOA 2KQXA 1NTMH 2K6VA 2A2RA 3EVIA 3HKBA 4X0XA 3SBCA 3SYQA 3U11A 4FQUA 1D2DA 3H4KA 3RYCA 3BD2A 1B4QA 1N34B 2UXCB 4GSNA 1NT2B 2LQOA 2V32A 1TVKB 2VCXA 1VRSD 2K8SA 4FM1A 2D2CB 4UV9A 2P5OA 1NZ6A 1NBMG 5LYJA 4PQIA 2JJ2G 3TK1A 3W8SA 4TSFG 2IU0A 3GKNA 3MYDA 3HKRA 5F8BA 3VWVA 2NPBA 1XWCA 3RGBA 2JADA 1YF0A 2C0DA 5DAKA 1EN4A 2KB1A 1ROPA 4MH2A 4LNUA 2C1YA 2A9HA 1BE3H 1DF4A 1H2NA 1YI2V 4CZZA 4NXMB 3CCLV 2JJ1G 1GN6A 4AQYO 1YKAA 4X64B 2LW7A 3ZMUA 4DV2B 3ZHVA 2G38A 2F51A 4IKHA 3N2GA 5DEDA 4LWSB 5IYCO 3CX5F 1MABG 1K7DA 1EN5A 1VF7A 1RSOA 3RYIA 4OCFA 1ZWIC 2QA4V 2UUBB 5HFLA 4WEYA 2TIRA 3UO3A 3CSHA 3MIXA 3E35A 3E8GA 1ORQC 1SQBH 2DJVA 5GONB 2L4QA 2IMDA 3D5JA 4JYAO 4H0LB 3JCUZ 3CSJA 4YQVA 3ABLB 2F95B 4IQAA 2ON5A 3SGIA 1EN6A 5IWAO 2HRAA 2IPAA 2QTSA 18GSA 1TXXA 2HT9A 4KP4A 4QE9A 5GZZB 3ZRXA 2V2GA 2LGQA 3CMIA 5LGTA 4TV9B 5CA0B 5HFMA 1SRYA 2GUZB 3GMFA 4IP6A 4RUVA 4JF3A 1AR4A 3CCEV 2X7RB 5EY6A 2R9AA 3VI7A 5LMUB 2VLVA 2REMA 4X1KA 12GSA 2HKOA 3UQ8A 4RI6A 4DR3B 1OCZC 4JI1B 1K33A 3TJKA 3L73H 5A2QN 3VPTA 2HLDG 2ALBA 3UIWA 3PH9A 1UJWB 4UVAA 4Q20A 5KN2A 1SKSB 1XVWA 1F23A 4K8MA 1ZYEA 2C0GA 1AVMA 5GAND 4JI0B 2C8UA 4FLZA 1Y66A 3BAAA 2CGOA 2BTQA 4CS2A 3KCYA 2Q7HA 4JU5A 3EINA 3OD4A 2XAFA 3CCQV 5FLXN 4ECIA 1N8JA 1VF6A 2LJRA 2ILMA 4U3JB 1WPBA 2IFQB 4O4IA 3QTCA 4LF9O 4KDXA 4OO4A 1LUWA 2X99A 3D3QA 4YQUA 2HVKC 4DR7O 3HCZA 4JI7B 4DO2A 4DV6O 1AJQA 4IYIA 4TR0A 3JAKB 1XMOB 3RYCB 2OYQA 1XNRO 1QCEA 2R70A 3EU4A 2RM6A 5B3SB 3UEMA 2OT5A 3A3TA 3IJ4A 1TK0B 4PX1A 4DRXA 6GSYA 2YWOA 4MSWC 1K4DC 2CTWA 5AIXA 1BGYH 5FWGA 1FVKA 5LA6B 2OCHA 3UARA 3BFRA 1G6WA 4JTAB 3OMAB 4O4JA 2DQ0A 3CCSV 1TJDA 1JFUA 1S3DA 3DEXA 5BY1A 4WFHA 4I7ZB 3K58A 2GDSA 3DKSA 3FD9A 4Q5RA 3LJRA 3JATB 2X49A 4O2BA 2HYXA 2VQFB 3FFQA 2GZYA 2AZ0A 1R3IC 2I9HA 2UXDO 3CRUA 1OCRB 1DE2A 2B1IA 1NKDA 4IHJA 4A5UB 1VQOV 2ZKOA 4G0KA 5F06A 1TUBA 2QM7A 2QWPB 1VF4A 3FR6A 4I6XA 3VLNA 1NH2D 2KKWA 3CYOA 2FL4A 4H33A 2ZNIA 1I9DA 1RM1B 3HKEB 4ECCA 1TI3A 2JGDA 3G4SV 4CW9A 3GV1A 4QL9A 2E0QA 5G2ZA 4DV5B 2XAHA 5LHIA 4NAXA 2YP6A 5E1AC 4J11A 4TR1B 1GLQA 1P4RA 4X66B 1VQ4V 3FX7A 3GN3A 2RUEA 3HVXA 4LF5O 1QU7A 2Q69A 1K97A 4U7OA 4X43A 3ZRVA 4LFBO 4EEQA 1CXZB 1GTOA 4K7IA 4B3RO 5CMUA 5ECRB 3AG4C 3M0FA 4X1KB 4CC5A 2PYLA 3K5OA 4UB6Z 5ECNB 2QEXV 3BEHA 5H2FZ 1FYJA 2DYRB 2XAQA 2YCDA 4UCOA 3QVNA 4R50A 1BT8A 2UU9O 1YJ6A 4CH5A 3EU3A 1VQ6V 3IHQA 1HDJA 1PKWA 4NHWA 1MNGA 2PTMA 5CBFA 2Z3YA 2LSTA 1L1FA 4DR1B 2WAMA 4P30A 1AJPA 2Y4TA 4ICGA 1OC9A 1Q3EA 3GKKA 1Z7PA 1XDCA 2DQ3A 3OR5A 4LLRA 3QD9A 2JGUA 2JVDA 2QKAA 3F63A 3GSTA 4TVEA 4TR4A 1GM9A 4EVMA 2DJ1A 1PGTA 2DWDC 5EBWC 2YV9A 5B1AC 3FK8A 2BSKA 1AI7A 1J95A 3NR7A 1R6KA 2GQKA 3G80A 1WE0A 5FHIA 2GSSA 5DALB 2JEUA 4GLXA 4GKKB 2OE3A 3DC6A 2EIJB 4O4IB 1X0RA 5JCUA 2OIGA 3D4TA 2HJFC 3RT3C 4I5QA 2BOCC 2H1BA 3OEEG 4A5PA 4D7TA 5HR3A 1JJOA 3F7VC 1Y25A 4KH7A 1VEWA 4FLVA 1IYHA 4LH6A 2ZDIC 3B77A 3ZYWA 1H2GA 2ARHA 4OCEA 5CB4B 3OE7G 1WNSA 2Y0PA 4DK0A 1M9BA 1Y6EA 4KL1A 3WYWA 2B9ZA 3T1HB 3P8WA 1PP9H 5D9XA 3LSQA 2A4VA 2FWFA 1VQ7V 4TW5A 3A2FA 2JIZG 4KDYA 2EIOA 4O5UA 2ETNA 1OVNA 1DUGA 3WB0A 3W7SA 3P7XA 1EGOA 2ZR3A 3FB5C 4AF2A 2IN3A 5DJLA 2HFDA 5JWOB 2H73A 3N27A 2N74A 1K0MA 2IJHA 3IFXA 5EBMC 3MDKA 1E79G 4HAMA 4QIWF 4ISDA 4Z2RA 1KYOF 3MAQA 2WJUA 2VUPA 1URFA 3TJFA 1IDSA 2IM9A 3IGAC 9GSSA 1S5JA 3HKCA 1R26A 2R4VA 3CTFA 3D0ZA 3TGZA 1XI1A 4IN0A 2WULA 5JCOA 4F4LA 1VQNV 1BQZA 3L72H 5H6RA 2P67A 3JALA 1THZA 1SERA 3E3EA 2CQ9A 2ZR2A 4GKJO 4K2DA 4X1UA 5ECOB 3G6BA 5H5SA 2AZ2A 2HSYA 1PL0A 1VARA 1OKTA 1OCOC 1V58A 3L78A 1PA3A 1YZBA 4PJ0Z 4RUEA 1XIYA 3P3PA 4LCUC 5DCGA 2PERA 2OA7A 2QWOB 3QCPA 4LF4O 1HNCA 4PA7A 4DR5O 4GX1A 1XMQO 1SJ6A 4GSSA 2IIYA 5JCWA 6GSWA 4O2AA 5EZYA 2ZUPA 4TUYB 5J2UB 4ZBDA 5KAIZ 1W2BU 2LFSA 2DYSB 1AI5A 1MA1A 2DJKA 4GWRA 1Q6UA 3SJCC 1WN7A 2VCVA 3N5OA 3FMWA 3A0HZ 1GRJA 3TKPA 3TKQA 5B8BA 3CCRV 4B3TO 3EMPA 3VWUA 4DR4O 1PNLA 3H9VA 4MK3A 1OE7A 1UA5A 1FXKA 1DK1A 2R72A 3BCKA 1O6JA 2PWJA 3G7IA 5ID2A 1MOFA 1XWAA 3A2XA 4MPGA 3V1WA 3HZ8A 4O7HA 2VCZA 5C8YA 1HNBA 2WA3A 2F43G 2WCIA 1R1BA 1QBZA 1RPOA 4MMMA 1TU8A 3QFBC 1AXDA 4DV3B 2P5QA 2YV7A 2MK3A 4ZOLA 2KUCA 4X62B 2QGVA 1SK1A 4IP1A 1NVPD 3EE2A 2L6LA 4AHCA 3DIEA 3VBBA 2Q73A 1COWG 1KQSU 3SWLA 3UMAA 1H38A 3OR7C 5IQYA 3LG6A 1H8HG 4I50A 2JU5A 1JCHA 1HD2A 4K0GA 4J9YB 2B7KA 3AG1B 4Z2TA 3D36C 4NXIA 5J9BA 1I7FA 1A0FA 5J4UA 1F4NA 4TV8B 2Q6AA 1WLEA 4PI2A 2HHHB 5J3RA 1Y74B 4G0LA 2X6AA 3J7AU 1GMGA 1SYRA 4KAEA 1NI8A 2HZEA 4DV0O 3RN4A 3GFKA 2CDYA 5FPRA 3BA8A 4LA1A 5FNVB 2FD3A 3K04A 4ML6A 4YJ3A 1NS1A 4GUNA 2HXKA 5LNKe 2O87A 3KTLA 1PRXA 4JI3O 4LFCO 2G2QA 1X9SB 2UXBB 4G27B 4EO3A 4K2XA 1M4UA 5KUMA 4IBPA 2E2MA 1OZ0A 2B1KA 1YXBA 5ECMB 3IA1A 2A2SA 3GL3A 3CB2A 1VQMV 3APSA 2AXTZ 3B40A 3DMLA 3ICXA 1Y4MA 4PUAA 4EDZA 1AQXA 4YHHB 4LF7B 3OMIB 2IJKA 5G5EA 2CX3A 2UZ8A 1JR9A 3HKCB 1GULA 5LP6C 1S77D 1ERTA 4JEDA 1LU4A 1QK8A 2WRTA 2EIRA 1S0VA 3JD1A 3QMXA 1FAAA 4OD7A 4PURA 4NVPA 4XDLA 1IZ3A 4LF6B 4D73A 3DGEA 2AV4A 5IMCA 5J2TA 2JS3A 5IYDO 3SYAA 2EILB 1YJNV 2FLSA 3KD0A 4ZIJA 4K7NA 2VQEO 1N32O 2CT6A 3D21A 4DUZO 1NW2A 2N5AA 1M9AA 2H1DA 1RPRA 4O5QA 3SYPA 4JI8B 2YC0A 1HW7A 5IY5C 2PI5A 4F82A 3ZBHA 4LL1B 1Z7RA 3HVNA 5EC2C 4MTFA 1GH2A 2LFRA 3LSZA 3OT7A 5HR2A 1LBKA 3O76A 1TP9A 2HG5C 1I0HA 1FXKB 4WFBV 5IMVA 1XW9A 1FFXA 1KKDA 2Q7GA 1ZTEA 4Z1MG 1SD9A 3A8TA 1MSWD 3CSIA 4B3MB 1R3KC 2OKAA 1FKAO 4BWAA 2L57A 4BWSA 4PA4A 2I4AA 5G30A 4BVXA 4I97A 1PPJH 4PTSA 4OX9O 3O65A 3KZIZ 4ZOLB 1BQ0A 1S3AA 3TJTA 5IMFA 1S5LZ 17GSA 4DV7O 4H86A 3L9SA 4NR1A 4QQ7A 3I56V 1WRYA 1ZLZA 1H2MA 1EOGA 2DJJA 2L6DA 3AG7A 2GQLA 1O8WA 2QSIA 2QDOA 1NJIW 1QVGU 2UUCB 4I50B 1WWJA 3SPCA 3ZX6A 2CVKA 1TVKA 5B6MA 2V4DA 2CH7B 1U87A 1N4CA 4FJCC 4X89A 4NV2A 4PQHA 4UCUA 1JOYA 2TRCP 4OXSA 3I55V 1KECA 1M7TA 4ZI7B 2LO1A 1TRUA 1PKXA 3P90A 1HWYA 3KCXA 4WCEV 2LS5A 3LXZA 2OADA 4JPRA 4Q5NA 1VF2A 3K8NA 1SF9A 1QMVA 4JI4O 4ZL8A 1AP6A 2RNBA 2D3OW 4DSRA 1I5XA 1ERVA 2YXLA 3H1LH 1BQ7A 4TQFA 3MD0A 3T1YB 3P30A 3IRAA 3ME8A 3QG5A 3TDGA 1WMJA 1YJWV 1AIUA 1Z2GA 3APOA 2CAZC 1LR1A 5LMNO 4NXNO 1GSUA 1TTZA 4PXOA 4FLTA 3UJ1A 1YEPA 3AG4B 3QAGA 5CREA 5C04A 2IJIA 3R65A 3UM7A 3GURA 1MZFA 3M8NA 4HQZA 1Q81W 4LWSA 3WG7C 2HVJC 3GHAA 4EFBA 1H2SB 1XBLA 4BW9A 1AQVA 3ISOA 2RUFA 4N23A 3VQXA 2LUSA 4JAAA 4LF8O 4DR6O 1ZX3A 2QGNA 1SS3A 1QR8A 3M8AA 2H66A 4HQSA 1YCIA 1R3LC 3LDEA 4J10A 1XPVA 3BRCA 3DD3A 4JZGA 4FFBA 5GONA 2B5YA 2YICA 4UUJC 4MCUA 4KSOA 4EIPA 1AI6A 5BXZA 2F93B 2Y69B 4B08A 4UCVA 1NTKH 1MDKA 3CE2A 1PX7A 2B6MA 3GTUB 4KB3A 4F6RB 4ZBBA 2B1GA 1ACVA 3HVVA 4JAUA 4HEA2 2GV9A 3U10A 5B1AB 4O4HB 3IAYA 2O7KA 5GTHZ 1XOBA 4TV9A 3W7XA 1Q82W 1XFLA 3ERFA 5CA0A 5HFIA 2VL2A 2ZCEA 1JFFB 2Q5ZA 4R6ZA 5J41A 2P31A 4TOIA 3IK7A 1SKWB 4KFMA 2IWTA 1YTFB 2NDOA 1N34O 4CH6A 3TOTA 2UXCO 3OTOB 5KN0A 2X6CA 2NN4A 3L71H 1VF3A 1SL2B 4KF9A 2ZINA 1CEZA 3L0HA 5L3DA 3UO2A 2YNXA 3Q18A 1ZL9A 1XILA 1NH2B 1M3IA 3LDCA 3OM3B 3UVHA 1F6MC 3W8JA 2W6JG 5D9WA 3M7MX 2BCCH 3C73A 4OFNA 1K34A 3GWOA 4U3JA 4FLUA 2IFQA 4K5SA 5JCGA 4RAIA 2RMKB 2FWHA 4MLYA 5C93A 3K0DA 2YI8A 1IBLB 4FM2A 4TKYA 5A5KA 1GKFA 2B5UA 2GS3A 3LNNA 1K0CA 3JAKA 3L9DA 4C7UA 1EP7A 2H0IA 1N36B 3CP1A 2IH1C 5JVDB 2YWIA 3WGEA 1GN3A 2MYGA 4TR3A 3CHXA 1IBMO 2GTAA 2DBCA 4LFAO 3I9V2 3J7Yk 2R0PA 16GSA 3RPPA 1US6A 4YY3B 2F66C 3PINA 4IJIA 5CNWA 5LA6A 4HS1A 2QKSA 1A24A 1YVWA 2GVPA 1DGSA 3OEHG 3EPTA 2FNOA 2CTQA 2ZM6O 1R73A 4NTXA 4WKWA 3ZMZA 5BR8O 1EV9A 2PPTA 2EBOA 2ZCTA 4UCTA 5D5PA 3JATA 4WFEA 1GTAA 1AROP 1EWXA 2YJHA 3WFVA 2DMLA 4IQ1A 1FO5A 4V1Ag 4D7SA 3JCZA 3LSSA 4ACSA 1ZAUA 3FEUA 2GZZA 5H5QA 1TRSA 3IBHA 5B66Z 4P2ZA 2XBIA 2L4CA 2FWGA 3RDWA 2X64A 1VIBA 2C0EA 3KJYA 1QHTA 4PGTA 4DR3O 3QDNA 1BSMA 1IBKO 1XW5A 1M56C 1M90W 2XNDG 3HKEA 4R8CA 1NHYA 4KHPB 4OPAA 3U0ZA 3IC4A 1HYUA 3F9UA 1TDIA 3TCOA 2WA4A 4FFBB 4PHZA 4FIPC 4KE3A 2IMKA 1T00A 3ZEDA 3EHBB 2PZSA 3K59A 4ML1A 4K6XA 5CRGA 3QAVA 5LBQA 4ZB9A 2XPDA 4TR1A 1SQXH 3FKFA 5HR0A 3EVKA 2V6KA 1EZVH 1Z5YE 3STLC 1B4PA 2UXXA 2AJQB 3SYOA 2M46A 3ZVJA 4MS2A 4CH4A 2EULA 4I8BA 1MZEA 4XBFA 3H1JH 1N2AA 4EIQA 3J81N 2ZNMA 3CCUV 1BAYA 1AI4A 2PU9C 1ZYNA 5DBQA 2K1EA 1G7EA 1KC8W 2XC2A 3AK1A 1V2AA 1O73A 3KCMA 2K9PA 1N33O 2DOSA 4J42A 5EBLC 1BHAA 3VK9A 2JK5C 4X9QA 1AC1A 2HZFA 1J5EO 6GSTA 2ZXWC 3MAKA 1X5EA 4EKWA 2MW2B 4QE7A 3GH6A 4Z2UA 5LHHA 2AGAA 1SQQH 2EZPA 5JH7B 4AQYB 5B1OA 1I5GA 2MMNA 3IC7A 4PI0A 2A0LA 3DXRB 2D2ZA 1RP3B 5IIZA 2JRIA 4NTYA 3VI5A 1TA8A 1VP7A 3ETEA 1FOHA 5A9GA 1F3BA 3SJBC 5IT9N 3KMOA 1OV9A 4IT5A 5L3CA 2WGRA 4RUFA 4AI8A 3HD5A 19GSA 2IMIA 2H6ZA 3GL5A 3H1KH 5DALA 4X1YB 1YZXA 1GUHA 4NKGB 1OHHG 1SKRB 5JCOC 4JYAB 3E8FA 2EZOA 3BPZA 3ED3A 3ABKC 3X2QB 1ON4A 5FT3A 1G7OA 2CGNA 2QR4A 3K03A 5LGNA 1NM3A 4KGIA 5L3FA 3NZNA 1CQHA 3K9SA 4YJ2A 5IWAB 3KKYA 2CV4A 1AR5A 4CBCA 3ZREA 2PVOC 5GW7A 2QA1A 3P3NA 4MW8A 1FW1A 1FXHA 5CB4A 1SENA 1GSSA 3TRQA 2YIBD 2ZIMA 1HNZO 3BABA 1OCCC 4K3AA 3KTBA 1RFYA 1UN2A 3BCIA 2OWOA 2ATKC 3ERGA 1PN0A 4ZBAA 3TUEA 1EGRA 2FB5A 1Q6IA 2W6IG 5DECA 4N0ZA 1YTFD 2OCCC 1V55B 3RVZA 3ZS8C 3IXRA 5IY5B 4X1IB 4IIJA 1AILA 3LORA 4HU7A 2JZRA 3GH9A 4L0WA 5IMDA 3DYRA 2AB6A 4PV1B 2I1UA 2WFCA 2EIKC 4N21A 4G0IA 3IE3A 2Y48A 2LNSA 1V54C 1DLBA 3E83A 1QLEB 2C3QA 3ASOC 1GSFA 2P7TC 2O8VB 3HVSA 5B8AA 1A2JA 4ABMA 3UVTA 3JASB 2EIMC 1NVPB 1KBNA 2O57A 2ES7A 5KHIA 5GSTA 4KNDA 4U7NA 2F4VB 4N10A 3CWBH 2YWMA 2WLHA 5DN6G 1ZOFA 2BOBC 2IH3C 5LL6Y 1V40A 5COHA 3OR6C 2N04A 3ZRWB 1KEBA 4HSCX 1XL4A 1EFRG 1V9WA 3A5WA 1G6UA 1EZKA 4DV6B 2W0XA 3ZIAG 3LWAA 1XNRB 3HJMA 1JMKC 2QWNB 4PDRA 1GTUA 4RQRA 4ZHQB 5EVOA 5DQSA 4PNGA 6GSUA 2LTKA 4JZ2A 1O9HA 4YAVA 4TUYA 5LOVB 3K79A 5J2UA
chains in the Genus database with same CATH topology
3ZITA 1O7UA 1YQ1A 1ZGNA 4MNNA 4ECBA 1JHBA 2K9FA 3O3TA 2F8AA 2FHEA 2K8VA 1HQOA 2PN8A 4XS1A 4V1Ap 1K3YA 2V1MA 2IJYA 3DRNA 2R2JA 4IS0A 3WT2A 2DSAA 2JL4A 1K0BA 2A4HA 3LYKA 4Z7XA 3APQA 4WF5A 1EEMA 5A4WA 3MWHA 20GSA 5ECLB 5G5FA 1PSQA 2IMFA 4HDEA 4F03A 3CRTA 5IMZA 2NBSA 2OBKA 2KP2A 2PMTA 4DSSB 3U6VA 2GGTA 4J57E 2GSTA 2DJ0A 5ECHB 2DKHA 3U5RE 8GSSA 4HOJA 4POKA 5IM9A 3WGDA 2H75A 4K0NA 5E4WA 2H0GA 5CRWA 3C71A 1YKCA 3IC8A 2P5RA 1RQMA 2VO4A 1NHOA 3IDVA 3D6IA 3D4MA 4N30A 3S9FA 5INYA 3EURA 3N9JA 4MJBA 2R37A 1QGVA 4XCSA 1G0TA 2PUKC 1EEJA 2E7PA 1OAZA 1WJKA 2I3YA 3EC3A 4CY8A 3LW9A 4FIWA 2C0FA 3QAWA 4JE1A 2HSHA 4L8EA 2BJXA 3I43A 3M1GA 3E9JB 3FY7A 2WB9A 3H79A 1URMA 2X8GA 1TRWA 4ZXGA 3F6FA 4YQMA 2H72A 3CXGA 2HI7A 2GT6A 3HYPA 4TXOA 4KUNA 2GDRA 2R3XA 2MMAA 2F9SA 3H1NA 1H75A 2QA2A 2R6KA 5AIVA 3RBTA 3VURA 1GRXA 3A5IA 2GQMA 1ABAA 2X4AA 1XWGA 4CDOA 3KM6A 2CA8A 4KSMA 2FY6A 2LKUA 4J80A 1M2DA 2VLTA 3I6AA 1AUCA 2R5GA 1BG5A 3RHCA 4E8EA 5B7CA 3FW2A 2VCQA 2FUG2 2LV3A 2N5BA 1DE1A 1FPOA 5DJMA 1ERUA 3ZRDA 5GAPD 5ECSA 4ZL7A 4I2UA 1XWKA 3CTGA 2F8FA 4K5RA 1V57A 1Z3EA 1WPIA 3F4RA 1PL2A 1Z6MA 4MZBA 3VWXA 1O8XA 2L5OA 11GSA 1PMTA 1B9XC 3LXTA 2RLIA 3GX0A 2CZ3A 3VPQA 1OC8A 2VL2C 4KX4A 5CO3A 4TN8A 3C8EA 2IMEA 4KW6A 1V98A 4RI7A 2VCWA 5J9CA 2CTPA 2FCHA 4J7ZA 1XZOA 5F05A 5J5NA 1M2BA 2RIIA 1MD4A 1K0AA 2K18A 3DVXA 4N11A 4LL4B 4WR4A 2YZHA 2WZ9A 4YKGA 1ST9A 3WT1A 4WR5A 4TXVA 1SU9A 3GTUA 1XCCA 1ML6A 1O85A 2QC7A 1OYJA 2DMXA 1ILOA 1QQ2A 3FZ5A 1U88A 4MDCA 4TXOB 3IK9A 2H71A 2DKIA 3ZTLA 4PQ1A 4KA0A 5JWQB 3F4TA 1T3BA 1PX6A 1GLPA 3ZLPA 1IYIA 4XRDA 3DWVA 1PN9A 2LQQA 1YY7A 2KOKA 5A4VA 2HRKA 3KH9A 3PPUA 6GSSA 1MD3A 2FA8A 2JZTA 6GSVA 2CUGA 2F3MA 2GTUA 1GSYA 2VL9A 1Q98A 2YUAA 4GXZA 3QFAC 2BMXA 2H70A 4ZB8A 1ERWA 5LCZA 3LYPA 1X5DA 4EF0A 1GTIA 4ILFA 1GTBA 1ZYPA 2DJ2A 3BBYA 3HJOA 2OACA 1FHEA 1M99A 1X9MB 1XBSA 2TRXA 4MABA 2XBQA 1J08A 4XTSA 1GSEA 4G19A 3F3QA 1F37A 4MF6A 4F2IA 3Q74A 3GUSA 4JR6A 1X5CA 3BJ5A 2MBTA 1M2AA 4O32A 1SL1B 3F0IA 5AISA 4KCAA 4G10A 3ZMLA 3R2QA 1GWCA 3I69A 3F4SA 3HDCA 1NSWA 1USBA 1YDKA 5EL8A 3RHBA 1GUKA 1MEKA 1GL8A 1TOFA 4OO5A 2LRCA 1C72A 4OMVA 4WXTA 3DXBA 4MA9A 4GQCA 5CP1A 3C7MA 5KOXA 1U3AA 2YN1A 4POLA 4MF5A 3KXOA 1F3AA 1DSBA 1SK2A 1PL1A 2VOCA 2AYTA 5E59A 2X8HA 1K3LA 1XOAA 5LD0A 5KN3A 2KHPA 2DLXA 7GSSA 3TKSE 5D96A 3F6DA 3G7JA 4BL7B 4IHUA 1TRVA 4JBBA 2VCTA 2NVLA 1Z6NA 2EC4A 1RW1A 5H5RA 3P2AA 4MF7A 2QSAA 2QWRB 1GUMA 4NHZA 5ELAA 4XS6A 3F8UA 3NIVA 4N0VA 1MDJA 1ZZYA 3MSZA 1JZRA 3TB2A 2QKEA 2DMMA 3IR4A 4E8HA 5F07A 3KP8A 1QFNA 2R0CA 5L71A 2YANA 3UBLA 5ABRA 4GRFA 5A4UA 1AQWA 3ME7A 3GKXA 1XXUA 2HSMA 3DGQA 1U6TA 1F2EA 2YOIA 3IOSA 4EXJA 3M9KA 5C00A 2B3SA 1T7PB 4YH2A 3FHKA 4TOPA 3KEBA 4FH8A 4NMUA 3HHVA 3UIWA 2H19A 1OE8A 2O89A 3LEFA 3GNJA 3KIJA 3M9JA 2LS5A 1R7HA 5GSSA 2C4JA 5F0GA 4FO5A 2OE0A 1E6BA 5B6NA 2YWNA 3US3A 4F0CA 2HE3A 4HI7A 4XS4B 2CVBA 4MJCA 3TRPA 4F0BA 2N05A 1VGLA 2HLSA 3TJGA 5EPFA 1EOHA 1J9BA 2I81A 1T4ZA 2M80A 2VD1A 2GZPA 2M6YA 3ZMKA 2CAIA 1F9MA 4J2FA 4BVYA 4AJ7A 3TOUA 4AJ8A 2H6XA 1JZWA 4OFTA 4ZILA 3VFIA 1PQNA 3ZIJA 1HNAA 2DJ3A 3GYKA 1A2LA 2GSQA 1JLWA 4HUAA 4ULXA 4GLTA 3GIXA 1TU7A 4GSTA 4WETA 1YEXA 4GQFA 3EWLA 4EKZA 4DSSA 4CHSA 5DCHA 1T4YA 3UL3A 3GRXA 5KN1A 1R5AA 4OFMA 2JSZA 4KCEA 1ZMAA 5BRTA 4AJ6A 5D8IA 2H0HA 3O6TA 4POBA 4IELA 1FOVA 3HXSA 2JSYA 1DBYA 2PBJA 3TKSA 2CX4A 5ELGA 5IOXA 3L4NA 3M3MA 4FYBA 2L59A 1K0DA 3TJJA 4MP4A 4IGJA 5G1KA 3F3RA 5DAKB 4RWUA 3HY2A 4EE0A 4WBJA 4F9ZA 2BTOT 1R4WA 5KOWA 1EP8A 1LJRA 3FZ4A 2IL3A 3L9VA 3GX8A 4HJ2A 5HFGA 1K0OA 2Z9SA 2DIZA 4TRXA 1WIKA 3CYNA 4HZ4A 4BWQA 4J56E 1SL0B 2CZ2A 4IJ3A 3Q19A 1B48A 2FGXA 4BVYB 4I2TA 4L0UA 3H8QA 1IURA 1XVQA 4L5LA 1TI1A 1ZCPA 2GLRA 1H4OA 1XW6A 2MZCA 3A2WA 4DEJA 1A8YA 2C3NA 2WS2A 2DIYA 2JZSA 1OC3A 2Y4UA 4NV5A 2G0FA 2H74A 1THOA 2P0GA 3UBKA 4Q5FA 1TK8B 4BPYA 3BOAA 10GSA 5HFKA 1FVJA 1FAFA 4ECJA 2L5LA 4GCIA 1R5PA 1FB6A 2LRNA 5G1LA 13GSA 4LMWA 1UVZA 1QUWA 3PGTA 1B8XA 4HU9A 4G9HA 1MDIA 5CRHA 4NWYA 4KDUA 4K7OA 2FA4A 3ZIVA 1WP0A 2OJLA 3GA4A 3HJPA 4PNFA 3Q6OA 2XHFA 3L9UA 3FZ9A 2CVDA 1MTCA 4EL1A 1E2YA 3ZZXA 4G2EA 2V41A 1SJZA 4XIHA 3W6GA 4BA7A 4PUFC 4ICYA 2ON7A 2PGTA 3G9BA 2HRNA 1W89A 3LGCA 3JCML 2EJ7A 1J0FA 2OE1A 22GSA 2YPMA 4RQXA 4O92A 1JLVA 1Q4JA 1A23A 1OKDA 4USSA 3QOUA 1AW9A 4JR4A 4WF4A 2C3TA 2NTOA 5AN1A 4FYCA 3KZQA 5DQYA 4IW9A 3UCSC 4YAPA 1GP1A 4V2MA 5IPGA 14GSA 2LRTA 5D9VA 3G7YA 5IO0A 3IPZA 1SD8A 3ZFLA 4FYUA 2KP1A 1OC9B 1KTEA 4NPBA 2HNLA 1Z9HA 2YS8A 5CRDA 3GKMA 4WBRD 3ZL5A 4L5OA 6GSXA 1JZOA 4EDYA 1BX9A 1JZDA 3H93A 2B1LA 2J23A 3FZAA 4XRAA 1W4VA 2PF4E 3BVOA 1VF1A 4OWYA 3E0UA 3QPMA 1FB0A 4LMVA 1TKDB 5DVBA 2HRFA 3TRXA 2GT5A 3HA9A 4ZB6A 3J7Yb 2VL3A 3KP9A 2AUVA 3ZVJD 5IMAA 3IAS2 3R3EA 2WDUA 3RPNA 2H1GA 1M0UA 4HZ2A 3C1SA 5D73A 2H01A 1B9YC 2B5EA 2LEGA 4QL7A 1SK0A 3FYGA 2B7JA 1A2MA 4CY6A 2C80A 5G31A 5KEJA 2JACA 1WOUA 2VIMA 4AGSA 1AAZA 2LNTA 5ECPB 3WGXA 3IV4A 4ID0A 4XHMA 4BL7A 2X8CA 4GTUA 2E2GA 3KGKA 2H1AA 5AGYA 2VLUA 1BEDA 1RK4A 3HZ4A 1PD21 5IOWA 1QXHA 2H30A 4MJAA 2MBSA 5IO2A 1GH6A 3FR9A 4V2NA 5D9TA 5CYYA 4JZQA 5ECQB 2QWQB 3LQ7A 2EIQA 5JWRB 4P3YB 2H8LA 5ECKB 2DN9A 1A0RP 3NOFA 3QR6A 5D93A 1K3OA 3FR3A 3A2VA 5ID2B 2CAQA 1X9WB 3UAPA 1K0NA 5BMUA 1O81A 1EV4A 4GF0A 2H76A 5CAXA 2RM5A 1CQGA 3VWWA 2A2PA 2YZUA 2VD0A 4POMA 1S3CA 1GSQA 2R0GA 3ZFBA 4DSQA 1U3IA 4MJEA 1THXA 3GSSA 1GNWA 2L6CA 2AHEA 1XWBA 3TJBA 1T1VA 2HZEB 2DC5A 2PVQA 1TK5B 4YKFA 3MNGA 3ERWA 2LGWA 2LJKA 3C1RA 3WD6A 5IPHA 3IAM2 4XS4A 2VM1A 2M72A 4MH3A 4K1FA 2MMZA 3DVWA 4JRRA 2VM2A 5HQPA 2XPEA 4MZCA 1BJXA 2O85A 2N5FA 4O5RA 3LFLA 4DVCA 2H6YA 3KMNA 4IVFA 2AAWA 4ZL9A 1GSDA 2YJ7A 4Q5QA 1WJZA 1TW9A 3UOMA 4D73B 2GSRA 1KNGA 2OBIA 1ZYQB 3TKSC 4X4JA 3IHGA 1YF1A 2V6OA 2GUZA 4MPFA 1A8LA 4V2LA 4K9ZA 3RAZA 2J9HA 1UC7A 1PKZA 4MZWA 1SJIA 2KLXA 1BYEA 3PR8A 3CBUA 5ECIB 5ENUA 2VAFA 1G6YA 5DDLA 1FG4A 3EYTA 3FRCA 2FWEA 3TKRA 4BVXB 4EUYA 1T8EB 4HJMA 5HR1A 4EC0A 1SYXA 3AY8A 2B5XA 3D22A 2LJAA 2CTRA 1GNEA 3KH7A 3EMXA 2MMOA 2KQXA 2K6VA 2A2RA 3EVIA 4X0XA 3SBCA 4FQUA 3H4KA 3BD2A 1B4QA 4GSNA 2LQOA 2V32A 2VCXA 1VRSD 2K8SA 1NZ6A 4PQIA 3W8SA 3GKNA 3MYDA 3HKRA 5F8BA 3VWVA 2NPBA 1XWCA 2JADA 1YF0A 2C0DA 5DAKA 4MH2A 2C1YA 1YKAA 2F51A 4IKHA 4OCFA 4WEYA 2TIRA 3UO3A 3CSHA 3MIXA 2L4QA 2IMDA 3D5JA 3CSJA 4YQVA 4IQAA 2ON5A 2HRAA 2IPAA 18GSA 1TXXA 2HT9A 5GZZB 2V2GA 3CMIA 2GUZB 3GMFA 4IP6A 4RUVA 5EY6A 3VI7A 2VLVA 2REMA 12GSA 4RI6A 3TJKA 3VPTA 2ALBA 3PH9A 5KN2A 1SKSB 1XVWA 4K8MA 1ZYEA 2C0GA 5GAND 2C8UA 4JU5A 3EINA 4ECIA 1N8JA 2LJRA 2IFQB 4OO4A 4KDXA 2X99A 4YQUA 3HCZA 4TR0A 3EU4A 2RM6A 3UEMA 3A3TA 1TK0B 4PX1A 6GSYA 2YWOA 2CTWA 5AIXA 5FWGA 1FVKA 2OCHA 3UARA 1G6WA 1TJDA 1JFUA 1S3DA 3DEXA 3DKSA 4Q5RA 3LJRA 2X49A 2HYXA 2GZYA 2I9HA 3CRUA 1DE2A 4G0KA 5F06A 2QWPB 1VF4A 3FR6A 4I6XA 3VLNA 1I9DA 4ECCA 1TI3A 4CW9A 3GV1A 4QL9A 2E0QA 5G2ZA 4NAXA 2YP6A 4TR1B 1GLQA 3GN3A 3HVXA 2RUEA 4X43A 4K7IA 5ECRB 3M0FA 5ECNB 2YCDA 1YJ6A 3EU3A 3IHQA 1HDJA 1PKWA 4NHWA 2LSTA 2Y4TA 1OC9A 3GKKA 1Z7PA 3OR5A 4LLRA 3QD9A 3F63A 3GSTA 4TVEA 4TR4A 4EVMA 2DJ1A 1PGTA 2YV9A 3FK8A 2GQKA 1WE0A 5FHIA 2GSSA 5DALB 2OE3A 1X0RA 5JCUA 3D4TA 4I5QA 2H1BA 4A5PA 5HR3A 1Y25A 4KH7A 1IYHA 3ZYWA 4OCEA 1M9BA 1Y6EA 3WYWA 5D9XA 3P8WA 2A4VA 2FWFA 4TW5A 4KDYA 2EIOA 4O5UA 1OVNA 1DUGA 3P7XA 1EGOA 4AF2A 2IN3A 5DJLA 2HFDA 5JWOB 2H73A 1K0MA 3MDKA 4ISDA 4Z2RA 2WJUA 2VUPA 3TJFA 9GSSA 2R4VA 3D0ZA 1R26A 3CTFA 3TGZA 4IN0A 2WULA 1BQZA 3E3EA 2CQ9A 4K2DA 4X1UA 5ECOB 5H5SA 2HSYA 1OKTA 1V58A 3L78A 1PA3A 1XIYA 5DCGA 2PERA 2OA7A 2QWOB 3QCPA 1HNCA 4GSSA 1SJ6A 2IIYA 5JCWA 6GSWA 2ZUPA 4ZBDA 2DJKA 4GWRA 2VCVA 3N5OA 3FMWA 3TKPA 3TKQA 5B8BA 3EMPA 3VWUA 4MK3A 1OE7A 1UA5A 3BCKA 1O6JA 2PWJA 3G7IA 5ID2A 1XWAA 4MPGA 3A2XA 3V1WA 3HZ8A 4O7HA 2VCZA 1HNBA 2WCIA 4MMMA 1TU8A 3QFBC 1AXDA 2P5QA 2YV7A 2KUCA 2QGVA 1SK1A 4IP1A 3EE2A 2L6LA 3DIEA 3SWLA 3UMAA 5IQYA 3LG6A 2JU5A 1HD2A 4K0GA 2B7KA 4Z2TA 4NXIA 5J9BA 1A0FA 5J4UA 5J3RA 4G0LA 4KAEA 1SYRA 2HZEA 3GFKA 4LA1A 4ML6A 2FD3A 2HXKA 5LNKe 2O87A 3KTLA 1PRXA 1X9SB 2G2QA 4EO3A 4K2XA 4IBPA 2E2MA 2B1KA 5ECMB 3IA1A 2A2SA 3GL3A 3APSA 3DMLA 4PUAA 4EDZA 1AQXA 5G5EA 2CX3A 2UZ8A 1GULA 1ERTA 4JEDA 1LU4A 1QK8A 2WRTA 2EIRA 3QMXA 1FAAA 4OD7A 4PURA 4D73A 2AV4A 5IMCA 2FLSA 3KD0A 4ZIJA 4K7NA 2CT6A 3D21A 1NW2A 2N5AA 1M9AA 2H1DA 4O5QA 4F82A 4LL1B 1Z7RA 1GH2A 3LSZA 5HR2A 1LBKA 3O76A 1TP9A 5IMVA 1XW9A 1SD9A 3CSIA 2OKAA 4BWSA 2L57A 2I4AA 5G30A 4BVXA 4I97A 4PTSA 1S3AA 1BQ0A 5IMFA 17GSA 4H86A 3L9SA 4QQ7A 1WRYA 1EOGA 2DJJA 2L6DA 3AG7A 2GQLA 1O8WA 2QSIA 1WWJA 2CVKA 5B6MA 1U87A 1N4CA 4NV2A 4PQHA 2TRCP 1M7TA 2LO1A 1TRUA<