3APQA

Crystal structure of j-trx1 fragment of erdj5
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
208
structure length
208
Chain Sequence
b'IQNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWSYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVTEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily C member 10
publication title Structural basis of an ERAD pathway mediated by the ER-resident protein disulfide reductase ERdj5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 65
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3apqA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apqA02
1IYIA 3M9KA 5DAKB 1GSYA 4IQ1A 2DJ3A 2B3SA 1PL1A 1GULA 1G7EA 3TB2A 1YY7A 4BL7A 1SJIA 4JBBA 3VFIA 3WYWA 3TJKA 3LSZA 3KH7A 2O89A 4ISDA 3BCKA 8GSSA 3Q18A 4HZ4A 1K0DA 3G9BA 2CX4A 3FKFA 5IMVA 1XW6A 4BVYA 1XBLA 2OE3A 2P0GA 3EMXA 3UARA 4HOJA 1FO5A 2LV3A 2OADA 3GKXA 1SENA 1LU4A 3D5JA 4F0BA 3ZREA 4J56E 4ML6A 3Q74A 2KOKA 2VIMA 3D6IA 1ZCPA 3GH6A 5HFIA 4K7OA 1BJXA 2I81A 3ED3A 4F2IA 2ZUPA 1W4VA 2YP6A 4GLTA 4NXIA 3LXZA 1WRYA 1ZGNA 1R4WA 4ZL9A 2K6VA 1N4CA 3GX0A 4YAPA 2GT6A 4CW9A 1ERWA 1A2JA 1EP8A 2HSHA 1X9MB 4HEA2 4MJEA 3TJGA 1NW2A 1GUMA 4K9ZA 4JR4A 4GRFA 1DE1A 1GUKA 2H0IA 2YZUA 2I1UA 4IP6A 4G2EA 1M9AA 2R6KA 2MMZA 3ZZXA 2FWGA 3WT1A 3APSA 4ML1A 1TKDB 1PMTA 1I9DA 5D8IA 2H19A 1PD21 1W89A 1AC1A 3M8NA 1PL2A 2OBIA 2DJKA 6GSXA 1Z7PA 1G7OA 2N5AA 4WR4A 1X9WB 2L6DA 4P3YB 1GSQA 2VL9A 3QDNA 5ELAA 5AGYA 5IOXA 5ID2B 4TR3A 3HJMA 1QGVA 4XTSA 4ZIJA 2GUZB 2C0DA 3RHCA 4Q5RA 3P7XA 2LJRA 1UC7A 1TK5B 2C1YA 5EL8A 1A8YA 4YH2A 2CVBA 2HNLA 4I97A 2R4VA 2ALBA 3OR5A 3TKSE 2WFCA 1TRWA 2PN8A 5ECHB 4XS4A 4XIHA 5LCZA 2CTQA 2H6XA 2PGTA 2VM1A 3DKSA 4MMMA 4K7NA 4ECBA 5G30A 2CTWA 3ZTLA 4BWQA 2HI7A 1EEMA 4EDZA 2AYTA 4V2LA 2FLSA 5GSSA 1XXUA 3RBTA 2MBTA 1R26A 2PVQA 4TXOB 3LJRA 1G6YA 3ME7A 1HNCA 4PQHA 1KNGA 2GT5A 1XWCA 9GSSA 4F03A 5F05A 5H5RA 2HFDA 1DBYA 4EL1A 1CQHA 2LQOA 1B8XA 3GN3A 1SD9A 4PX1A 1GNEA 3F4SA 1M7TA 1M2BA 5CREA 2FD3A 3ZIJA 4TR1A 2M72A 1C72A 3SBCA 3GMFA 3TRXA 3N9JA 4XCSA 4TKYA 1DSBA 4O92A 3ZL5A 5D9WA 3KMOA 1IYHA 2VCWA 4EC0A 5ECLB 4MPGA 5B6MA 3MDKA 3EU3A 5DAKA 1AUCA 4WF5A 2VD1A 3FZAA 4KSMA 2LO1A 3LYPA 3DIEA 3HD5A 5IMDA 4TN8A 2C4JA 1FHEA 2XBQA 1O6JA 3H8QA 1ERUA 4AF2A 2YWOA 1BEDA 2H01A 2O8VB 2P5QA 1TK8B 1YKAA 1BQ7A 2XBIA 3WT2A 1UVZA 4HUAA 4ZBAA 1Z5YE 4RUVA 1JHBA 3A5WA 4OCEA 5CRHA 3LEFA 3A2XA 2IMDA 4NWYA 3ZMLA 2L6LA 4ZILA 2VAFA 2QWPB 4BPYA 2GSRA 3UO3A 4TR0A 1TRVA 4K0GA 3VWVA 2KLXA 1N2AA 2GSTA 1ON4A 3KCMA 2HZEA 3L9VA 2H0GA 5JCUA 4RWUA 1VGLA 16GSA 3HJOA 2B7JA 1ZOFA 2RM6A 2AAWA 2YUAA 2LTKA 4IQAA 3VI7A 2QWOB 3RHBA 3D21A 1URMA 3I6AA 3HDCA 1GSFA 1EGOA 3MWHA 3F6FA 3IC4A 2C3TA 3R2QA 2VCZA 2K8VA 2LQQA 11GSA 1FB0A 2JACA 4L8EA 4I2TA 4KX4A 3HZ4A 2Z9SA 4KCAA 4IJIA 3NOFA 2M80A 2YS8A 2A2RA 2VCXA 2WULA 2HYXA 1RW1A 2K18A 4DSQA 3DEXA 3HXSA 5J9CA 1HYUA 3NZNA 2H1AA 3IAM2 4NHWA 1XZOA 1WOUA 4ZBDA 4I2UA 1ML6A 3QCPA 2B6MA 4EUYA 3VLNA 5ID2A 1XWGA 3GV1A 2KP2A 4YQVA 1XVWA 2GUZA 4WBRD 2VL2C 5G31A 4CDOA 1OKDA 4JU5A 1VF1A 2PU9C 2QWNB 4PUAA 3ZRDA 1AW9A 5IO0A 4O7HA 1JZDA 4WF4A 4FYCA 1Y6EA 4AJ7A 2C3QA 3TUEA 1XIYA 4F9ZA 3FR3A 4PQ1A 4E8EA 5B8BA 4HJ2A 3EYTA 1R5AA 1XBSA 2YWMA 1K0MA 1MD3A 1J0FA 4TW5A 3UVHA 4L0UA 4EDYA 2IMIA 1EP7A 4QQ7A 3ISOA 2B5XA 4Q5FA 4F82A 2GQMA 4JE1A 2H76A 3ZITA 4XS1A 4POMA 1Z6NA 3DYRA 1E2YA 2FCHA 1E6BA 5ECQB 3K8NA 1SL0B 6GSYA 5IOWA 3Q19A 1DE2A 1S3DA 5IM9A 3I43A 4JEDA 2YJ7A 1XW5A 1U6TA 2CX3A 3E0UA 2G2QA 2GS3A 3DGQA 4ECCA 3HJPA 2IMEA 4QL9A 4HQSA 4J57E 1GTBA 1X9SB 4BVXA 4I5QA 4POKA 1O81A 5L71A 4F0CA 3A3TA 5CNWA 1QK8A 4JRRA 5A4UA 1WWJA 5ECMB 1IURA 5HQPA 4I6XA 3KTBA 5HR2A 2MMNA 2RLIA 3IE3A 4FH8A 2DJ0A 1S3CA 2DIZA 5GZZB 2E7PA 2XC2A 2H72A 2LNSA 3GFKA 5B8AA 5HR1A 3E9JB 3U5RE 2LUSA 3MSZA 1A0RP 2CAIA 2L5LA 2M6YA 5G5EA 5ABRA 2MBSA 4DSSB 5ECNB 4DVCA 3TJJA 2LJAA 2WRTA 2REMA 3GIXA 4GQFA 1M0UA 2F8FA 3ZFLA 1QQ2A 2GLRA 2K9FA 1ST9A 4KGIA 2GVPA 2HT9A 10GSA 3H79A 3EU4A 5G1LA 1PQNA 4ACSA 3EE2A 2YNXA 2E2MA 1QXHA 2HZEB 3W6GA 3Q6OA 2JADA 1T7PB 1GWCA 3IV4A 4N10A 4PUFC 2PPTA 4E8HA 5GAPD 2NVLA 1VF3A 4POBA 5DCGA 4GSNA 3CRTA 3KTLA 2R5GA 1JZRA 5DVBA 4Q5NA 4MP4A 3FY7A 2X64A 1KTEA 3D4TA 2H0HA 1AQXA 5AN1A 2YZHA 2IWTA 4AJ8A 2AHEA 4GF0A 3L78A 1RK4A 3BVOA 2ES7A 4NPBA 5IMCA 5AIVA 5GSTA 2DJ1A 4OO4A 4O32A 5CYYA 4J7ZA 2JSYA 1K0OA 2LEGA 2G0FA 1XOBA 3HA9A 4RQXA 5DALA 1I5GA 4RI6A 3FR6A 5ECSA 2N05A 4RQRA 4LMWA 4XS6A 5D9TA 1RQMA 1WJKA 4OFTA 1CQGA 2PVOC 1PX7A 3F0IA 3FR9A 3ME8A 1ZL9A 1LBKA 3UVTA 1O8WA 3IR4A 3GYKA 3UBKA 1Q98A 1B9XC 1H4OA 4HS1A 2H6YA 3ZVJA 2B1LA 2VCTA 3IPZA 2AUVA 3LFLA 2GSSA 4D73A 2D2ZA 3FZ5A 3ZFBA 1Z9HA 3PR8A 4H86A 2GDRA 2HRNA 3QAGA 1PGTA 5DQYA 2QWRB 2CVKA 3DD3A 2H73A 2YWNA 2H70A 1GLQA 1Y25A 4NV5A 4MF6A 4IS0A 5C04A 2P5RA 2V6OA 1SYXA 2YJHA 1VF2A 3C73A 2FWHA 3KM6A 2H1DA 2VOCA 2PF4E 3UJ1A 1K0NA 3N5OA 1SKWB 5A4VA 2VLVA 2HE3A 3WGEA 1XPVA 3VK9A 3UCSC 4LL4B 5J5NA 1SD8A 5DBQA 4EVMA 2C3NA 14GSA 5IO2A 1TRUA 3L9UA 4IT5A 4K0NA 2FUG2 3V1WA 1SK0A 5FWGA 1TP9A 4WKWA 2H30A 1QMVA 4MA9A 5F0GA 1BYEA 3UMAA 3RDWA 4Z7XA 2DJJA 2LRTA 1FG4A 4KDYA 3GKNA 1YEPA 4ZL8A 3DWVA 4G10A 2O7KA 5IMFA 3A2VA 5D9XA 4KCEA 3APOA 2A4VA 2DMLA 1JZOA 1LJRA 1T00A 3L4NA 4MCUA 2MYGA 3WD6A 3F3RA 1XOAA 2MMOA 3G7YA 3HZ8A 3IDVA 3VPTA 3VWUA 2Y4UA 2FHEA 5F06A 3ZIVA 1TI3A 2C8UA 2H1BA 2PERA 5KN2A 2GQLA 5HFKA 3KJYA 3QOUA 2GZYA 4TXVA 3FK8A 4KH7A 5D9VA 1NHYA 18GSA 4HDEA 2OJLA 4J2FA 3L9SA 1A0FA 1G0TA 4Q5QA 4DSSA 2KHPA 1V40A 2C0FA 3KEBA 2TIRA 2BMXA 4BA7A 3M3MA 1TU8A 3MNGA 4OFNA 3GKKA 2PBJA 2CTPA 1NZ6A 5E59A 3QFAC 1DUGA 1MEKA 4WXTA 3NIVA 2ON7A 5IPHA 5AIXA 4NV2A 5HR3A 3BBYA 3GUSA 3ZMKA 1BG5A 4KDXA 4OO5A 2MMAA 1Q4JA 1A2LA 1GLPA 1XVQA 1SL1B 4KDUA 3D0ZA 4I8BA 4TOPA 4MZWA 3KP8A 1F37A 5ECPB 6GSSA 2C0EA 1X5CA 1SKSB 1B4PA 1X0RA 3LG6A 2KP1A 19GSA 12GSA 4IELA 3LGCA 5J4UA 13GSA 2QC7A 3FZ4A 4HJMA 3CBUA 2IFQB 6GSTA 1EZKA 2X8HA 4WETA 2FY6A 5IQYA 2H74A 3A2WA 2KQXA 2OE0A 6GSVA 1GRXA 3F4RA 4KW6A 2WDUA 4OCFA 5D73A 3KP9A 5DALB 3HYPA 5G1KA 3IHQA 2F3MA 1BAYA 2V32A 1A23A 2WS2A 6GSWA 3UIWA 3TJFA 2VD0A 2VM2A 3RAZA 2FWEA 2CUGA 1KEBA 1F3AA 1N8JA 1K0BA 3C7MA 2L4CA 4HU9A 3GH9A 1OE7A 1PA3A 3M1GA 4OMVA 4GSTA 5CAXA 4WEYA 2FWFA 3GKMA 4JZQA 2GGTA 3QD9A 2J23A 3PGTA 1VRSD 3L0HA 1KBNA 1GSEA 4ID0A 5JWOB 3QMXA 2X99A 2VCVA 4D73B 2AV4A 5IPGA 4L5OA 4IJ3A 5EY6A 3GSTA 2LKUA 2QSIA 1ZYEA 3LQ7A 2NBSA 1Z6MA 3TKSC 3G7IA 1V57A 1YQ1A 1K3LA 2N5FA 2VL2A 3KZQA 3TKPA 2RUFA 2V2GA 3M9JA 1V98A 3ZYWA 1PKZA 4KB3A 3F4TA 2MZCA 1TTZA 4MJCA 5HFGA 20GSA 3FRCA 1JZWA 3J7Yk 1EOHA 1GSUA 3PINA 3FW2A 1U3IA 3O3TA 4G19A 3TKSA 3CYNA 4CHSA 4O5RA 3CSHA 4BWSA 4AJ6A 3U6VA 1PSQA 3KXOA 1TI1A 4L0WA 3FYGA 3UOMA 5H5SA 1PN9A 1ILOA 2IMKA 3ERGA 5DJLA 3BCIA 1SK2A 2ON5A 4MF7A 5F07A 3LXTA 1GTAA 1AAZA 2OBKA 3VI5A 1M99A 2GTUA 1SJZA 4OWYA 2IMFA 2OKAA 3GNJA 1OVNA 3TDGA 2DJ2A 1FAFA 3KIJA 3C71A 4FO5A 4ZB6A 2R3XA 3CSIA 3IAS2 3G7JA 3C8EA 2A2SA 1YZXA 2N5BA 2CZ3A 2YCDA 3ERFA 2I9HA 4MK3A 2TRCP 1XWAA 3VPQA 4V2NA 2IPAA 1GUHA 4J80A 5DCHA 5CRGA 1EGRA 2PMTA 1FAAA 2IIYA 3GHAA 3EWLA 2DIYA 4IVFA 4N11A 2YV9A 5CP1A 1T1VA 2H71A 3CTGA 4G9HA 2WGRA 1FB6A 2LS5A 2K8SA 2IN3A 4ULXA 2L6CA 4NAXA 1XWBA 1BX9A 3TCOA 2NPBA 1NHOA 3KH9A 2B7KA 3I69A 4MH3A 5ELGA 1QUWA 4IN0A 3GL3A 1K3OA 3EMPA 1BQ0A 2CV4A 4V1Ap 2BTOT 2LRNA 3CXGA 2B5EA 4TRXA 2H6ZA 3CMIA 2OA7A 1YF1A 3UEMA 5GAND 2H1GA 3GA4A 3IK9A 2R37A 4MJAA 4KUNA 3DVXA 2LNTA 2C80A 2JZSA 2M46A 3IRAA 1FOVA 2EIQA 3HVVA 1AXDA 5ECOB 2QGVA 2OE1A 1YF0A 1O85A 2B1KA 4OFMA 4X43A 1A24A 3H93A 4KA0A 3H1NA 1WIKA 4AGSA 2F9SA 1SKRB 1F9MA 4FYBA 1J08A 3GTUB 3TRQA 5J41A 3DMLA 2IFQA 1HD2A 4ZL7A 1O73A 2RIIA 1AQVA 1GH2A 4IW9A 5DDLA 1FVKA 5IMAA 4NMUA 3BD2A 3IA1A 5KN3A 2VUPA 3P2AA 2FA8A 3QR6A 3F6DA 1Z3EA 5A5KA 4MJBA 3KD0A 4MZBA 4JR6A 1THOA 1ERTA 2XPDA 4LA1A 4MF5A 3APQA 1T4ZA 2HXKA 5C00A 2DN9A 4EE0A 1GL8A 1AIUA 1M2AA 1OAZA 3BJ5A 2EIOA 5JWRB 2JZRA 2H8LA 2EJ7A 1OC8A 1TRSA 2JL4A 4K1FA 22GSA 4K6XA 5G5FA 3EURA 4L5LA 5D93A 1ERVA 4ZB8A 1ABAA 3ZLPA 1WJZA 2L5OA 2WJUA 2NTOA 2V41A 3EVIA 2V1MA 2FA4A 2IJYA 3ERWA 2WZ9A 5LNKe 1SYRA 1SJ6A 4EO3A 4POLA 4XHMA 3TKRA 3LORA 4EXJA 5HR0A 4MLYA 2O85A 5LD0A 5E4WA 2GQKA 1V9WA 1MD4A 5FHIA 4NHZA 1OC9B 4MABA 4IBPA 2VLUA 1T4YA 3IXRA 2DBCA 4TVEA 5JCGA 4KE3A 5COHA 1ZZYA 2O87A 2QKEA 1WPIA 3DVWA 4MDCA 3CSJA 1HNBA 1V58A 2X8CA 5B6NA 1MDKA 3O76A 4X1UA 1T3BA 3TRPA 1YKCA 4EF0A 4TR4A 1U87A 3D22A 1R7HA 1WMJA 3HKRA 3KMNA 1FVJA 3I9V2 1O8XA 1BQZA 2FNOA 1GP1A 5D96A 5G2ZA 4WBJA 3P8WA 6GSUA 2XHFA 1OYJA 4GSSA 2RUEA 1YEXA 4PQIA 3TOUA 3IK7A 2H66A 1XW9A 2JSZA 1TXXA 3QAWA 2FGXA 3FZ9A 4PXOA 5JCWA 4IHUA 4GTUA 4WR5A 4XRDA 2C0GA 2QWQB 1GTIA 4DEJA 1GSDA 4YAVA 4YQUA 1FW1A 2LRCA 3QFBC 1O7UA 2DMXA 2B5YA 3VWXA 5EPFA 1HNAA 1MDJA 3W8SA 1VF4A 3GRXA 4GQCA 4KNDA 1G6WA 1USBA 2E0QA 3JCML 4EKZA 4ZB9A 2NDOA 4V1Ag 3IOSA 3KGKA 2H75A 2CQ9A 4IP1A 5DQSA 1EEJA 2OACA 2TRXA 3M0FA 4XRAA 3FHKA 2L57A 2YOIA 2PWJA 3LWAA 1U88A 2YN1A 2X8GA 3QAVA 4IKHA 1OE8A 5AISA 2OCHA 2VCQA 2ZCTA 1JLWA 2I3YA 4PGTA 4ZXGA 4GCIA 1TU7A 2R2JA 4LL1B 1X5EA 1ZMAA 3CRUA 2VL3A 3UL3A 2CZ2A 3LYKA 4MH2A 1FPOA 2JU5A 4V2MA 3GL5A 2DC5A 2EC4A 1TJDA 2EIRA 4FYUA 1K0CA 5ECRB 3HVSA 2F51A 3D4MA 4QL7A 2KUCA 5ECIB 3TGZA 5ENUA 3DXBA 1R5PA 1SU9A 1A8LA 5JWQB 1XWKA 4YQMA 3GTUA 1M2DA 1T8EB 2QSAA 3HHVA 2YV7A 1F6MC 1GSSA 1QFNA 3EINA 4PNFA 3CTFA 1AQWA 4FIWA 3F3QA 5KN0A 4LMVA 1XCCA 1GH6A 1V2AA 2Y4TA 17GSA 5IIZA 2LJKA 2VO4A 4X0XA 3MAKA 4PURA 3O6TA 2LGWA 4HI7A 1F3BA 1TOFA 5H5QA 2GZPA 2HSYA 4ECJA 3EC3A 3IBHA 2RM5A 1OKTA 1EWXA 1J9BA 3C1SA 1S3AA 5CO3A 5INYA 2GZZA 1ZYQB 3F9UA 2WB9A 1OC3A 1EV4A 4GXZA 2YPMA 1HQOA 2ZNMA 2F8AA 2HZFA 5J9BA 1UN2A 1XFLA 4N30A 4K2DA 1PX6A 2V6KA 1MDIA 2P31A 3UAPA 3FEUA 1GTUA 2CVDA 2DSAA 1HDJA 3PH9A 2JZTA 5KEJA 2CT6A 2GSQA 1U3AA 4K7IA 1THXA 4ZBBA 3WGDA 2DLXA 3GSSA 2L4QA 3W8JA 3F8UA 5CRDA 1NSWA 2I4AA 3AY8A 5A4WA 1NM3A 1ACVA 3VURA 1EV9A 1YJ6A 2HLSA 4HU7A 3UBLA 3QPMA 2CTRA 3ZVJD 4XS4B 2IL3A 4OD7A 1OC9A 4MPFA 3GURA 2L59A 3GX8A 1EOGA 4MZCA 1JFUA 1SL2B 4KSOA 4PNGA 2N04A 1JLVA 2BJXA 1Z7RA 4KAEA 3DRNA 1B9YC 4RI7A 1M9BA 4GWRA 1GNWA 3US3A 1WP0A 3RPPA 3S9FA 4ECIA 3C1RA 5F8BA 2DMMA 2J9HA 2YWIA 5KN1A 1SK1A 2E2GA 3J7Yb 7GSSA 1A2MA 2CA8A 1MTCA 4TXOA 5IMZA 4DSRA 4ILFA 3VWWA 4K8MA 3RPNA 3BOAA 2XPEA 3TJBA 1F2EA 1YDKA 2AB6A 2VLTA 5FT3A 2HRFA 1TK0B 3TKQA 2YANA 1H75A 3AG7A 1K0AA 5EVOA 5CRWA 4N0VA 4LLRA 4N0ZA 3H4KA 2CAQA 3E3EA 1TDIA 3UO2A 1K3YA 5ECKB 3WGXA 3P90A 4TR1B 1TW9A 5B7CA 4HQZA 3HY2A 3HVXA 1B48A 1PKWA 1PRXA 5DJMA 2WCIA 1X5DA 2PUKC 1B4QA 3SWLA 4HZ2A 1UA5A 1WE0A 2LSTA 3F63A 4IGJA 3HCZA 3TOTA 2AJQB 5J3RA
chains in the Genus database with same CATH superfamily
3VOUA 1LNQA 2UXDB 2MK3A 2B9ZA 1VARA 1IYIA 1BGYH 3LSSA 3QO8A 3M9KA 3IFXA 1VF6C 4CZZA 3Q4HB 5DAKB 2X6AA 4PA4A 1GSYA 4IQ1A 2DJ3A 2Q67A 1WPBA 2B3SA 2Q73A 1PL1A 1GULA 4HNAB 1G7EA 3DXRB 3BEHA 3TB2A 4G2KA 2P67A 2VQFB 1YY7A 1M1KW 2CGOA 3ZHSA 4FLZA 1SJIA 4JBBA 3JAWA 4BL7A 2ETNA 1IBMB 3UKMA 4UCSA 3CYOA 4QPJA 3VFIA 4PDVA 3E22A 4I50B 4GLXA 3WYWA 3TJKA 3LSZA 5B1NA 1O9HA 1M3IA 3KH7A 2O89A 4ISDA 3BCKA 8GSSA 1KP3A 5IJ0A 3Q18A 1ZL8A 4HZ4A 1K0DA 4CH3A 3G9BA 2CX4A 1M57B 3FKFA 3THOA 5LP6B 2AW9A 4LF9B 5KHGA 5IMVA 1XW6A 1B3QA 2NR5A 1P84F 4I4TB 1XBLA 4YJ3B 1VF6A 3AG3B 4J9YB 2QEXV 2OE3A 2P0GA 4BVYA 3EMXA 3UARA 4HOJA 1FO5A 3H9VA 2LV3A 1HNZO 2Q7GA 4UCVA 1KYOF 2OADA 1XQ8A 1SENA 1LU4A 3GKXA 3D5JA 4F0BA 3ABKB 4LF6B 3ZREA 3AG4C 1AP5A 3S3XA 4J56E 4ML6A 3Q74A 2KOKA 3A8TA 2YDEA 5J9PC 3TCUA 3JARB 2VIMA 3NR7A 3K9SA 3D6IA 5B1BB 2LFRA 3K57A 1N32B 2QA1A 1ZCPA 5IWAO 3GH6A 5HFIA 4K7OA 1BJXA 3CCEV 2I81A 1Q6HA 3CRAA 3ED3A 4F2IA 3HKCB 2ZUPA 1W4VA 3RBZA 4BIOA 2YP6A 4GLTA 1H8EG 4NXIA 3LXZA 4K8ZA 1WRYA 2R9IA 1ZGNA 1R4WA 1GN4A 4ZL9A 2K6VA 1N4CA 4X1YA 1SC5B 3GX0A 4JASA 4YAPA 2HFEC 5LA6A 4D7TA 2GT6A 4CW9A 4TOIA 3T1HO 1ERWA 4DV7O 1A2JA 1EP8A 5KHKA 1PP9H 2EIKB 2HSHA 1X9MB 4HEA2 2XAGA 1FFTB 4GCZA 4MJEA 3TJGA 1NW2A 1GUMA 4K9ZA 4JR4A 4TUYB 1I08A 4GRFA 3WB1A 1DE1A 1QQCA 1RM1B 1GUKA 4NTXA 2H0IA 3L70H 2JEXA 1H2KA 2YZUA 2I1UA 2PYJA 1SQQH 4IP6A 1N8RW 4IL6Z 2WLLA 3CC2V 1J95A 5IDJA 4G2EA 3ZJZA 1M9AA 1W59A 3JD1A 4UB6Z 3CMEV 4ZOLB 3STLC 2R6KA 2MMZA 3ZZXA 3R65A 3P30A 5ITZA 2FWGA 3WT1A 1ZAUA 4ZBMA 3U11A 4LF7B 3APSA 5F2VO 4FLVA 4ML1A 1E79G 1S77D 1TKDB 1PMTA 1JFFB 2XUMA 3EVKA 3RVZA 3U0ZA 1I9DA 5D8IA 2H19A 4X88A 1PD21 1W89A 1T5EA 4DW0A 1K73W 1AC1A 1W0JG 3M8NA 1HW7A 2ZIMA 3SJAC 5C93A 2PI5A 1H2LA 1PL2A 2OBIA 2DJKA 6GSXA 2FL4A 1Z7PA 4WFHA 3OR7C 4UB8Z 1G7OA 2N5AA 4X1KA 4WR4A 1X9WB 4LF4B 2L6DA 4P3YB 1K34A 1GSQA 2VL9A 3QDNA 3N2KB 5AGYA 5ELAA 5IOXA 1K7DA 1NTKH 1VF7A 3X2QB 5ID2B 4TR3A 3HJMA 1QGVA 4I55B 3ZHVA 4X64O 4XTSA 4ZIJA 1BHAA 4DRXA 5IYCO 2GUZB 2C0DA 2WLMA 2Q7EA 2P4KA 4O4LA 4DR6B 3RHCA 5CMUA 4H37A 4J11A 2HR3A 1Z5VA 3CCLV 3P7XA 4K5RA 4ZHQA 4Q5RA 2UXCB 2VS0A 2LJRA 1TAEA 1V54C 1FFXB 2HJDA 1UC7A 4NR1A 1TK5B 3NXSA 1OJHA 1Y4MA 2C1YA 5EL8A 1A8YA 4YH2A 5IE9A 2CVBA 2HNLA 4JZ2A 1G6UA 4I97A 4TSFG 4K8XA 4K2XA 2R4VA 1OCZC 2ALBA 2A0LA 3OR5A 3TKSE 4OPAA 3SYOA 2EIMB 4DR5B 1IVSA 2WFCA 3J80N 2W0XA 4KXRA 1OCOB 1ROPA 1TRWA 2PN8A 5ECHB 4XS4A 4XIHA 5LCZA 3CB2A 4EEQA 2CTQA 2H6XA 2PGTA 2VM1A 3ICXA 3QG5A 3DKSA 1R1BA 4MMMA 3W7SA 4K7NA 4ECBA 5G30A 3T1YB 2CTWA 3ZTLA 1Z2GA 2HI7A 1EEMA 4BWQA 1Y76A 2E5LO 1Q43A 4EDZA 3STZC 2F4VB 2AYTA 4NKGB 4V2LA 3E8FA 2FLSA 3CC4V 4MTOA 4LP8A 4DR7B 5GSSA 1K9MW 4YHHB 2P22C 1XXUA 3RBTA 4UXNA 2EINB 2MBTA 4TV9A 4JYAO 1R26A 2PVQA 4TXOB 3LJRA 1G6YA 4U7NA 5H9CA 3ME7A 2ZR3A 3GWKC 5J2UB 3CCJV 3QO7A 1HNCA 4PQHA 4WF9V 4P9OA 3U10A 5EYPA 2AHYA 1XMQO 1KNGA 2GT5A 3QVNA 1XWCA 1KECA 9GSSA 4F03A 5F05A 2P7TC 5H5RA 2HFDA 3MYDA 4A5PA 1DBYA 1TUBA 3ABLB 3MD0A 2AZ0A 4EL1A 1SA0B 1CQHA 2LQOA 1B8XA 5EBMC 2D3OW 3GN3A 3M8AA 3J81N 1SD9A 4PA3A 3R3EA 4O4IB 4I0XB 1IBKO 3CXHF 4F6EA 1H2MA 4LNUA 4PX1A 1GNEA 3ZMZA 3F4SA 1M7TA 1KC8W 1M2BA 4MTFA 5CREA 4JV5B 4DV0B 2PTMA 2FD3A 3ZIJA 2HHHO 3B8NA 3SYAA 3OD4A 4TR1A 2M72A 3QF7A 1N33B 1C72A 4LF5O 3SBCA 3GMFA 4EB6A 2IJIA 1DTOA 2HRKA 4R6ZA 3TRXA 2BOCC 1X4TA 3N9JA 4XCSA 4KHPB 4R50A 3K08A 4TKYA 1SETA 3BY6A 1YITV 3ABTA 1DSBA 4O92A 2ZT9B 4DV1O 3TETA 3K06A 5D9WA 3ZL5A 3D3QA 3KMOA 1OHHG 1IYHA 1EN5A 2VCWA 2P06A 3K04A 4EC0A 3K79A 3OTFA 5ECLB 4NTWA 1M57C 4MPGA 1D2DA 5B6MA 3MDKA 3EU3A 3SYQA 1IBLB 3AG3C 4NXMB 5DAKA 2E75B 2ZE6A 3LW9A 2X6CA 1AUCA 4WF5A 2VD1A 2OIGA 1PNMA 2YIBD 4K0KB 1BCCH 3FZAA 1OCCB 4KSMA 2LO1A 3JAWB 4HNAA 2DKIA 3LYPA 2R9AA 2ITDC 1YTFB 3ABKC 3DIEA 3DXRA 3HD5A 3LUTB 4FLXA 4ZIBA 5A2QN 5IMDA 3E22B 1IXBA 4TN8A 2C4JA 2G38A 2F66C 4B3MO 1FHEA 1JA8A 4DR2O 3CS5A 4DV3B 1O6JA 2XBQA 4O2BA 3H8QA 4W4KA 5GW7A 5IJ0B 2JK5C 1ERUA 4AF2A 4WFEA 2YWOA 1BEDA 2H01A 2O8VB 2P5QA 1TK8B 5LXTA 1VQMV 1YKAA 1YTFD 1XDCA 1BQ7A 2WLHA 2XBIA 3SDLA 4BVYB 3WB2A 3WT2A 1ZSPA 1UVZA 4HUAA 1JJOA 4ZBAA 1Z5YE 3ZMUA 1MABG 1WN7A 4LBEC 4RUVA 1JHBA 3A5WA 1AI5A 4OCEA 4I4TA 4YJ3A 4CH6A 3LDDA 1SQXH 4JI8O 4YY3B 3LEFA 5CRHA 4KF9A 2PUSA 2NN4A 3A2XA 4DR4B 2IMDA 4NWYA 5H2FZ 4B3RB 2OTLV 3ZMLA 2L6LA 4ZILA 3CC7V 2VAFA 1DLBA 2QWPB 2XOKG 3K59A 4BPYA 2NLJC 2GSRA 3A0BZ 4ICYA 4FQUA 3UO3A 4TR0A 4XBFA 4CBCA 1TRVA 3JARA 4EFBA 4K0GA 3VWVA 2UUCO 2UXDO 1DF4A 1VQ7V 1YDXA 4NYKA 2A2PA 2KLXA 1FXVA 1DF5A 1RM1C 1N2AA 4X20B 2A4HA 1AROP 2GSTA 1ON4A 3KCMA 2Z3YA 1B6QA 3OE7G 4A5UB 2HZEA 3TGUH 3L9VA 2H0GA 5JCUA 4RWUA 1VGLA 4H33A 2QR4A 4KL1A 4X1YB 5LA6B 1IBMO 2QTSA 16GSA 2YXLA 3HJOA 2B7JA 2EZPA 4D6TH 1ZOFA 2RM6A 2HRAA 3LNMB 4WFFA 2AAWA 2YUAA 1R6KA 5LMNO 2H8PC 2LTKA 4IQAA 3VI7A 1KKDA 2QWOB 3RHBA 2RCVA 4MNNA 3IC9A 1PM9A 1VEWA 3ZMSA 2DYSC 4J7JA 3D21A 1URMA 3I6AA 3AG1B 5GTIZ 4LF9O 3HDCA 5BRTA 1GSFA 4TUYA 4FMTA 1EGOA 3MWHA 2WLLB 3F6FA 1UPGA 3IC4A 2L35A 2C3TA 2YI8A 2VCZA 2K8VA 2LQQA 3R2QA 3RYCB 3X2QC 4JI2B 11GSA 1YCIA 1FB0A 2JACA 2W6IG 4L8EA 3RFRA 4I2TA 4KX4A 3L73H 3HZ4A 1URFA 1XILA 5CBHA 3AG2B 2Z9SA 4IJIA 3NOFA 4QE9A 2M80A 4KCAA 5LMUO 2Q9LA 1N32O 3IC7A 1NH2D 2YS8A 1XG8A 2A2RA 2B5UA 2EJRA 4G0IA 2R72A 1JFFA 5DM6V 2VCXA 2WULA 2HYXA 1RW1A 1VMGA 4JTAB 4L8JA 2K18A 4DSQA 3DEXA 4PV1B 4DUZB 3HXSA 5J9CA 4FJCC 1H2SB 3S3WA 1HYUA 2ZM6B 3CJHA 3E86A 4G28B 5KHJA 1QLEC 2H1AA 3T4DA 3N27A 3IAM2 3NZNA 1RPOA 3AK2A 4Z1MG 4NHWA 3CRQA 1XZOA 1WOUA 4ZBDA 4I2UA 1TUEB 1ML6A 1VQNV 2AZ2A 1OCOC 1NVPB 3QCPA 3BCCH 1YJWV 1G4YB 1K8AW 1VQOV 1QR8A 3N2KA 2B6MA 4EUYA 4LFCB 3VLNA 5ID2A 4DRXB 1XWGA 3GV1A 4NXNB 4O4LB 2KP2A 5CB4B 4YQVA 4I55A 2FMLA 4IHJB 1XVWA 2GUZA 4WBRD 2VL2C 4R7CA 1QLNA 4GKKO 1X59A 5G31A 4CDOA 4JI3B 1OKDA 4JU5A 1G8MA 1VF1A 2PU9C 2QWNB 4PUAA 5B3SC 2EINC 4CH4A 1THZA 3ZRDA 1AW9A 5IO0A 4O7HA 4FZ1A 1JZDA 4WF4A 4B3SB 4MW8A 4FYCA 1N0JA 1Y6EA 4AJ7A 4LF7O 3C3TA 4Z1VA 2RQ6A 2C3QA 2ADQB 3TUEA 3ABLC 1WB7A 3I5DA 1XIYA 4F9ZA 3LSUA 1WLEA 1XNRB 3OW2U 3WFVA 3FR3A 2DJVA 2DWEC 4PQ1A 4GKJB 4E8EA 5B8BA 1VF5B 4HJ2A 3ZRVA 3BA9A 4ASUG 4GYCB 3EYTA 2JJ1G 1R5AA 1XBSA 2YWMA 1K0MA 5LHIA 5IY5C 1MD3A 1V9PA 1J0FA 4TW5A 5B1OA 3UVHA 5FNVA 4X65O 4L0UA 4EDYA 4LFBB 4K35A 2IMIA 1V54B 1EP7A 3ISOA 4QQ7A 5EC2C 4LF4O 2B5XA 4Q5FA 4F82A 5LOVA 5LBQA 3JAKB 2ZIOA 2WAMA 3JASB 2GQMA 4JE1A 1OCZB 1RP3B 2H76A 3ZITA 5IJ9B 4XS1A 2M7WA 4IGGA 4JYBA 4N23A 4POMA 5J2UA 1Z6NA 3DYRA 2HP8A 4RQFA 1E2YA 2FCHA 4BAYA 4DR6O 1E6BA 5ECQB 3K8NA 1SL0B 6GSYA 2RJZA 5IOWA 3Q19A 4P30A 1DE2A 1S3DA 1SA0A 5JH7B 2UXCO 1EFRG 4TQDA 3KKYA 5IM9A 4X8AA 4JGSA 2EIJC 3I43A 4JEDA 4PDMA 2YJ7A 1GKFA 4O4IA 1XW5A 2KB1A 1F4MA 1U6TA 1Q8IA 2YI9A 3LDEA 2HEPA 3CHXA 2CX3A 2Q7HA 1D5AA 2FTKA 3E0UA 4DR5O 5CN0A 2G2QA 1F23A 2GS3A 4H0LB 3DGQA 3K9AA 4ECCA 3FYEB 4EB6B 3HJPA 3FX7A 2IMEA 2YXHA 2ZKOA 4QL9A 4HQSA 4J57E 4P9PA 1K5SA 2FB5A 1GTBA 1VQ6V 3T1YO 1X9SB 4BVXA 4I5QA 3N2GB 4G0LA 4LF8B 2ZNJA 2N74A 4POKA 1O81A 3SPHA 1BHBA 2F4VO 1OZ0A 4F0CA 1Q3EA 3A3TA 5L71A 5CNWA 4DR7O 3GWOA 2YIBA 3H1IH 1QK8A 1RFYA 4JRRA 5A4UA 1WWJA 5ECMB 4GZRB 4EKWA 1IURA 5HQPA 3JCUZ 3L9DA 3RYHB 1M93A 4HAMA 5BY1A 4I6XA 3KTBA 5HR2A 2MMNA 2X4AA 2RLIA 2Y48A 2VWKA 2QKSA 3IE3A 4FH8A 3M99B 2DJ0A 1S3CA 2DIZA 5GZZB 1XEQA 2OTJV 2E7PA 2XC2A 4JI1B 1FD9A 2Y0IA 2YIAA 4JI0B 3IAYA 3UT5B 2H72A 2LNSA 3GFKA 5B8AA 5HR1A 3E9JB 2RMKB 4R8CA 3U5RE 4O2BB 2LUSA 3MSZA 4JZGA 1A0RP 2CAIA 1GM9A 2L5LA 2M6YA 5LXTB 1JOYA 1J5EO 5G5EA 5ABRA 2MBSA 1OV9A 4DSSB 5ECNB 3OT7A 2LW1A 4NTYA 4JV5O 1R73A 4DV0O 1O9GA 4DVCA 5JWPA 4UVBA 3TJJA 2LJAA 2WRTA 1F7YA 3KCYA 1SKVA 4GX0A 2REMA 1N33O 3KZIZ 1R6NA 3GIXA 4GQFA 3QO5A 1M0UA 2F8FA 3CCQV 3ZFLA 1QQ2A 2GLRA 2K9FA 1ST9A 3BABA 3AEIA 4KGIA 2GVPA 3ETQA 2HT9A 10GSA 3H79A 3EU4A 2VWJA 2B1GA 5G1LA 5KAFZ 3IJ4A 1E1QG 4O4HA 1PQNA 5BXZA 4G27B 4ACSA 2OIEA 3SJBC 3A5IA 3EE2A 1QNMA 2YNXA 3AG1C 3E8GA 1JMKC 4YJ2A 2E2MA 4MTXA 1DK1A 5L3CA 1QXHA 2ITCC 1IBLO 2HZEB 3W6GA 4NXMO 3Q6OA 4RAIA 4X20A 5FPOA 2JADA 5KLVH 4K0KO 3DC5A 1T7PB 1GWCA 3IV4A 4N10A 2PYLA 1SQVH 1XMOB 2PPTA 4PUFC 4E8HA 2OYQA 5GAPD 5BMUA 2AHZA 2NVLA 1VF3A 3VQYA 4POBA 5DCGA 4GSNA 3AG2C 4AQYO 3CRTA 1D5NA 1M9NA 1XNQO 2R70A 3KTLA 5AG2A 2R5GA 1JZRA 5DVBA 1I0HA 4Q5NA 4MP4A 3FY7A 2X64A 1KTEA 3D4TA 2H0HA 3F5TA 1AQXA 5AN1A 2YZHA 4TT3G 2IWTA 4AJ8A 4CS4A 2ZE5A 2K1EA 4JF3A 1AR1B 2AHEA 5FPRA 4GF0A 4P2ZA 5LGNA 1RK4A 3BVOA 3L78A 2ES7A 4NPBA 4CY8A 3SYPA 5IMCA 5AIVA 3CRCA 4YY3O 3W7WA 5GSTA 4DV4B 2DJ1A 4DR4O 4O32A 4OO4A 5CYYA 4J7ZA 4O2AB 4X1IB 1Z5WA 4LFAB 2JSYA 1K0OA 2JIZG 3RYCA 3ZRWA 3JAMN 5KHIA 5FL7G 2LEGA 1M56C 2G0FA 3RN4A 1XOBA 1I94B 3HA9A 3EXAA 4RQXA 5DALA 1SQBH 1ZWIC 4GT1A 1I5GA 1KU9A 4RI6A 3FR6A 5ECSA 2N05A 3K5OA 3TK1A 3L72H 3JSLA 4RQRA 2DYSB 4LMWA 3CJHB 4XS6A 5D9TA 3F7YC 4IIJB 1RQMA 1WJKA 2YICA 4OFTA 1YSCA 1CQGA 4DR3B 1HNWB 4G0KA 2ZE7A 3B09A 1KQSU 4UCRA 2PVOC 1PX7A 3F0IA 4H13B 2IU3A 1K3EA 3FR9A 3ME8A 1Q86W 1ZL9A 2RNBA 1U96A 3VBBA 1LBKA 1BZKA 3UVTA 2UXBB 3FB6C 2DQ0A 4FLUA 1O8WA 3IR4A 3HKEA 3MAQA 5CB4A 3GYKA 1GRJA 1Q5OA 1JCHA 3LNNA 4IHJA 3UBKA 1Q98A 3SPIA 1B9XC 2ZR2A 1H4OA 4HS1A 3SR2C 2H6YA 4Z2WA 1SQGA 3ZVJA 2B1LA 4PI0A 1N0NA 2VCTA 2FKXA 3BA8A 3E2EA 2AUVA 3IPZA 3LFLA 2GSSA 2WSSG 4F4LA 2D2ZA 3FZ5A 4D73A 1NBMG 1QLEB 3ZFBA 1Q81W 1YJ9V 2UU9B 2HVKC 1Z9HA 4JI2O 3PR8A 1Y74B 4H86A 2GDRA 2HRNA 3QAGA 4DO2A 1PGTA 5DQYA 5IYZB 2QWRB 1NTZH 3CQFA 2CVKA 3DD3A 2H73A 2YWNA 2H70A 1GLQA 1Y25A 4NV5A 3RWRD 4MF6A 4I7ZB 4BW5A 2JGDB 3ZCCA 1XHXA 4IS0A 3WU2Z 5C04A 2DOSA 2P5RA 1SYXA 2V6OA 5FNVB 2YJHA 4PDLA 4DUZO 1VF2A 5LGUA 3C73A 1BL8A 3OM3B 2FWHA 3KM6A 1NS1A 3K5MA 2ZM6O 2H1DA 2LJ2A 2PF4E 5LOVB 2VOCA 3UJ1A 1K0NA 3N5OA 4UVAA 1SKWB 3ASOC 1N34B 4O5UA 4E4EA 4JTCB 1ENVA 2CDYA 5B3SB 5H6QA 5J2TA 5A4VA 4XDLA 3JYCA 2VLVA 2HE3A 3WGEA 3JAKA 1XPVA 3VK9A 3UCSC 2LFSA 3FFQA 4LL4B 5J5NA 4QGPA 3JASA 5IJ9A 4EIQA 4NXNO 4RUFA 1SD8A 2VRZA 4JI7O 5JVDA 5DBQA 4EVMA 2C3NA 14GSA 3FD9A 2QJ1A 5IO2A 3SPGA 1TRUA 3L9UA 4IT5A 4K0NA 1M5IA 4J9ZB 4YKGA 4JI3O 1K92A 3C3SA 2Z5UA 2UZ8A 4DUYO 4DK1A 4CC5A 3CCMV 3KG2A 5JH7A 5IY5B 2FUG2 2QM7A 2NNUA 1WP7A 3V1WA 1AVMA 1SK0A 3OMIB 5FWGA 1TP9A 4WKWA 2H30A 1QMVA 4MA9A 2LW7A 2EILC 3CP1A 4FLYA 5F0GA 1BYEA 4B3SO 3UMAA 3RDWA 4KUMA 4O4JA 2QTOA 5L3GA 4Z7XA 1L8DA 2Q68A 2DJJA 2LRTA 1FG4A 4KDYA 3G67A 2LQTA 3ZMTA 5KAIZ 3GKNA 4BVXB 1YEPA 1NTMH 4H44B 4ZL8A 1JR9A 3DWVA 4G10A 4K3AA 3N2GA 4PD4F 2O7KA 2ATKC 4B08A 4JI4B 3A2VA 5D9XA 5IMFA 4LFBO 4KCEA 4JAUA 3APOA 2A4VA 2EIJB 2DMLA 1JZOA 1LJRA 1JX9A 1T00A 3L4NA 4MCUA 4DV6O 2RN9A 5CA3A 2MYGA 3WD6A 1NQTA 3F3RA 1XOAA 3HKDA 2MMOA 3G7YA 4ZI7A 3HZ8A 3IDVA 3VPTA 3VWUA 2Y4UA 2FHEA 1HNZB 5F06A 3ZIVA 3RYHA 1MG1A 2PGGA 2BOBC 5BR8B 1TI3A 4JI5B 3J7AU 1PD3A 3OEEG 4PA6A 1AI4A 2C8UA 2H1BA 3L74H 1KKCA 2PERA 5KN2A 4K5SA 3WB0A 2GQLA 5HFKA 3KJYA 2GDSA 3QOUA 3UT5A 4TQFA 1FOHA 1M90W 3MIXA 3ZIAG 2GZYA 3FK8A 4KH7A 4TXVA 5D9VA 1NHYA 18GSA 4HDEA 2OJLA 4J2FA 2P6JA 1A0FA 3L9SA 1ZLZA 4EFEA 1HR0B 2XAFA 4UCTA 1G0TA 4Q5QA 4X66O 4DSSA 2KHPA 3UQ8A 1V40A 2C0FA 1GM8A 2FYUH 3G6BA 2ZNIA 1GM7A 4JYYA 2TIRA 3KEBA 2BMXA 1GAXA 2HJFC 4BA7A 3M3MA 2W0FC 1TU8A 3T1HB 4MT8A 4LCUC 3MNGA 4OFNA 1N36B 3BHPA 3GKKA 1Y67A 2PBJA 2CTPA 3GB7C 2JDIG 1NZ6A 4B7KA 4LF8O 5E59A 3QFAC 2P90A 1DUGA 4JI6B 4O4HB 1A32A 4XDJA 1Q6UA 1MEKA 4PI2A 4WXTA 3NIVA 4UFZA 4YJ2B 2ON7A 4BR6A 5IPHA 3H1KH 1WAZA 5LL6Y 4Z2TA 5AIXA 1FXHA 4NV2A 5HR3A 3BBYA 1K4DC 3GUSA 3ZMKA 1BG5A 1R3LC 3H1LH 1VQPV 4KDXA 4OO5A 5GONB 2ZE8A 3RVYA 2MMAA 1LR1A 1Q4JA 4FVMA 2ZCEA 1JJ2U 2XNDG 5KOWA 1A2LA 1GLPA 1JQ0A 4JI1O 1R3JC 2VQFO 1SF9A 5KA5A 1XVQA 4JI0O 5L3FA 1SL1B 3ZN1A 3HVNA 4KDUA 3D0ZA 4I8BA 4ZKIA 4TOPA 5DECA 4MZWA 4L87A 3KP8A 4LWSA 4AHCA 3FB7C 2WLJA 1F37A 4DR1B 5ECPB 1EBOA 4MVQA 6GSSA 1R3KC 2C0EA 4USSA 2EX3A 2X49A 4OGQB 2UUBB 4FK5C 1BE3H 1X5CA 4OPHA 1SKSB 1B4PA 1X0RA 3LG6A 2BSKA 2KP1A 1ZYPA 2F93B 19GSA 2QA2A 4U3FH 2EZOA 12GSA 4IELA 3EFFK 2K9PA 3LGCA 3GVMA 3K0GA 4FM0A 5J4UA 13GSA 2QC7A 3FZ4A 5B66Z 4HJMA 3CBUA 2UUAB 2IFQB 6GSTA 1EZKA 2X8HA 1NH2B 4WETA 1ZYNA 2WA3A 2FY6A 5IQYA 2ADPA 2H74A 4CH5A 5KX5B 4X64B 3A2WA 2KQXA 3BAAA 2OE0A 6GSVA 1GRXA 3F4RA 4KW6A 3ZRWB 1PPJH 4LF6O 2WDUA 4OCFA 2Q0OC 4YXWG 4O2AA 4X1IA 5D73A 3KP9A 3CPWU 5DALB 3HYPA 5G1KA 3IHQA 3ZHTA 3H1HH 4QE7A 3DTUB 2F3MA 1BAYA 3P3PA 4GUNA 2ZINA 2A06H 2DKHA 2V32A 1A23A 2WS2A 6GSWA 3UIWA 3TJFA 2VD0A 2VM2A 1YHQV 2A7WA 1P7BA 3RAZA 4WFGA 2FWEA 3PJSK 3OTOB 1KP2A 3VQWA 2CUGA 4IIJA 1KEBA 1F3AA 1H8HG 1N8JA 1K0BA 3C7MA 2L4CA 4HU9A 2DE0X 1VQ5V 2ZXWC 2JRIA 3B4SA 3GH9A 3HB3B 1OE7A 2DQ3A 1PA3A 3M1GA 1S72V 1FXKB 3BRCA 4OMVA 4GSTA 4QNHB 1AJNA 5CAXA 4WEYA 3HKEB 2FWFA 4JPRA 1GN2A 1YJNV 3GKMA 2E5LB 2GGTA 1M56B 4JZQA 3QD9A 5CBFA 2J23A 2BTQA 2Q69A 2OT5A 3PGTA 5BZBA 1VRSD 3L0HA 2YC0A 1KBNA 1GSEA 4ID0A 4JYAB 3QMXA 5JWOB 3LSQA 2X99A 3CE2A 2VCVA 4D73B 2AV4A 5FLXN 5IPGA 1PL4A 5C8YA 4L5OA 1XMQB 4IJ3A 4HSCX 2XASA 5EY6A 4DV4O 3GSTA 4BWAA 2IM9A 4C7UA 4LFAO 2QKAA 2UXNA 3ABUA 4J41A 5A9GA 2LKUA 2QSIA 1Y74A 1ZYEA 1TGOA 1NI8A 3FAVB 2YEVB 3O65A 1XHZA 3D3IA 4X9QA 5IYZA 1K4CC 2Q6AA 3LQ7A 4KP4A 2NBSA 2JJ2G 4FFBB 3CCRV 1IBKB 2HLDG 1Z6MA 3TKSC 3JD3A 2QGNA 3G7IA 1OCRC 5H5NA 3W7TA 1V57A 1YQ1A 2JGDA 1K3LA 2ZDIC 2N5FA 2VL2A 4PA9A 3CCVV 3CRMA 3KZQA 3TKPA 2RUFA 2V2GA 1HNWO 3SPJA 5J2TB 3M9JA 1V98A 2ODMA 4TV8B 3ZYWA 3A0HZ 4Z2UA 4F6RA 1PKZA 4KB3A 3F4TA 1SZXA 3BPZA 2IJHA 2MZCA 1TTZA 4J10A 1YI2V 2P5OA 5JVDB 3AK3A 2UXBO 4MJCA 5HFGA 20GSA 1ZTEA 3JALB 3IGAC 3ZHUA 4J7KA 3FRCA 1JZWA 2CH7B 5EIBD 3J7Yk 3ABMB 1EOHA 4PTSA 1GSUA 1YF2A 3PINA 3FW2A 1U3IA 3O3TA 4G19A 3TKSA 3CYNA 4CHSA 1BS3A 4O5RA 5TISZ 3K0DA 3MDSA 3CSHA 4BWSA 4AJ6A 2GBOA 3U6VA 1PSQA 2ZDIA 5JCOC 2YIDA 2O57A 3ASOB 3KXOA 1TI1A 2UU9O 1U97A 3OEHG 4L0WA 4O4JB 3FYGA 3UOMA 5H5SA 1BSMA 1PN9A 3F5WC 1ILOA 4AILC 5JJNB 1QCEA 2IMKA 3ERGA 3G80A 5DJLA 3P32A 4YIPA 2P4VA 1SK2A 3BCIA 4BIKA 2ON5A 4MF7A 5F07A 4DK0A 3LXTA 1GTAA 1AAZA 2OBKA 3VI5A 1W0KG 4B3MB 3FMWA 3CEIA 1M99A 2GTUA 1SJZA 4OWYA 2IMFA 4HBNA 1NU1H 2OKAA 4QPKA 1OVNA 3GNJA 3FKSG 4HZ3A 3TDGA 2XTAA 2DJ2A 4LH7A 1FAFA 3KIJA 3C71A 5CBGA 4FO5A 4ZB6A 1N34O 2HKOA 3HKDB 4YHHO 4ZI7B 1ZX3A 2R3XA 3CSIA 3IAS2 2IU0A 3G7JA 3C8EA 1Q6IA 4UV8A 2A2SA 1YZXA 2X7RB 4BIZA 5KMGB 5JCOA 3IHGA 3RW0A 2EILB 2N5BA 4UVCA 2CZ3A 2XAHA 1WPXA 1VQ4V 2YCDA 4JAVA 3ERFA 2I9HA 5CA0A 1JVMA 4MK3A 4GX5A 2TRCP 4JAAA 3HPLC 1XWAA 3VPQA 2DW4A 4V2NA 2UUCB 2IPAA 2ZD9A 2E76B 2VQEB 1GUHA 4J80A 5DCHA 2X6BA 5CRGA 3HR0A 1EGRA 2WLKA 3B8MA 5IT9N 2RDCA 4MVZA 2PMTA 3WG7B 2WLIB 1FAAA 2IIYA 3GHAA 1RSOA 5JJEB 3EWLA 2DIYA 4IVFA 4N11A 1VIBA 2YV9A 5CP1A 1PNLA 1T1VA 2H71A 3CTGA 4G9HA 5IYDO 4HYOA 1FB6A 2WGRA 4LC1A 3CCUV 2LS5A 2JS3A 4U3JA 1GO3F 5KUKA 2K8SA 3QNEA 2IN3A 1PNKA 4ULXA 2CE4A 2L6CA 4NAXA 3JD0A 1XWBA 5LMNB 4KHPO 1BX9A 4MVSA 2PI4A 1VQ9V 3TCOA 2NPBA 1NHOA 4GX2A 3KH9A 2GTSA 3TXSA 4X62B 2B7KA 3I69A 1SQPH 4JI4O 4MH3A 5ELGA 4MVUA 1NKDA 4FLWA 1QUWA 3GL3A 1K3OA 4IN0A 3EMPA 1BQ0A 3CSXA 3T1CA 1PN0A 2CV4A 1WP8A 2BTOT 2LRNA 4V1Ap 4LR3A 3CCSV 3CXGA 2B5EA 4TRXA 2H6ZA 2Q5ZA 3CMIA 5BR8O 1YF1A 1CPYA 3L71H 4DW1A 2OA7A 3UEMA 4JI5O 5GAND 2H1GA 3B2EE 3GA4A 3IK9A 2R37A 3ETDA 4NVPA 3OGIB 4MJAA 4KUNA 5GONA 1H2GA 4KFMA 3DVXA 2QA4V 4GX1A 2LNTA 5L3DA 3ZHRA 5LMUB 2C80A 2JZSA 1QBZA 4B3TB 4LWSB 3E83A 1COWG 3A0RA 2M46A 3IRAA 1FOVA 5BMVB 3D36C 3RYFB 5KA6A 3T2MA 2EIQA 3HVVA 1AXDA 1K97A 4DV3O 2WLNA 3VQXA 4PELA 1FYJA 2OE1A 2QM8A 1O85A 1YF0A 2B1KA 2QGVA 4OFMA 4X43A 1A24A 2BSKB 3H93A 2ARHA 4KA0A 2CK3G 4DV5B 3H1NA 1WIKA 1HR0O 2PY5A 4AGSA 1V55C 3OMNB 2F9SA 2HSMA 1SKRB 1F9MA 1L1FA 5E1AC 4FYBA 2JGUA 1J08A 3GTUB 3TRQA 5J41A 3DMLA 2IFQA 3JATB 1HD2A 4ZL7A 1O73A 5EZYA 1AQVA 1N36O 2RIIA 1GH2A 4IW9A 5D5PA 5KX5A 1FXKC 3UM7A 4B3RO 5DDLA 1FVKA 5IMAA 5D5QA 1H38A 2B1IA 4GKKB 1L0NH 4QIWF 4JI6O 4NMUA 3FB5C 3BD2A 3IA1A 5KN3A 2VUPA 3P2AA 2FA8A 3QR6A 2Q8VA 3F6DA 3D36A 1Z3EA 4BW9A 5A5KA 4MJBA 1P49A 3KD0A 4MZBA 4JR6A 4WCEV 1CXZB 1THOA 4WBNB 5DEDA 1NT2B 1SZTA 1ERTA 2XPDA 4LA1A 2V7QG 1LUVA 4DXWA 4MF5A 3APQA 1T4ZA 1PV0A 2HXKA 5C00A 1PKXA 1SQFA 2DN9A 4EE0A 1GL8A 5EBWC 1AIUA 1B06A 1M2AA 3W7UA 1OAZA 2GHYA 4I5SA 3RYIA 3SJQC 4CS3A 3JD2A 4DV2B 3BJ5A 2EIOA 4MS2A 2R9RB 1K33A 3KCXA 4D7SA 5JJJB 2R0PA 5JWRB 2V4DA 4DR1O 3JSNA 5EBLC 2JZRA 1Q7YW 2H8LA 1FXKA 2BTQB 2EJ7A 1M4UA 2WA4A 5KHHA 3ZRSA 4ABMA 2UUBO 1OC8A 1TRSA 4X65B 2JL4A 4K1FA 3QTCA 22GSA 1GN3A 1SRYA 2GSMB 3BFRA 4LH6A 2IW5A 3B77A 1VQ8V 4K6XA 1IZ3A 5G5FA 3EURA 1Q90D 4L5LA 3JD4A 5LYJB 2W6JG 5D93A 1MOFA 1ERVA 5C8YB 2UUAO 4ZB8A 5EIBC 2BTOA 1ABAA 4O5QA 3ZLPA 4OX9B 1HWYA 1WJZA 3TXQA 3C90A 2L5OA 2WJUA 2LP7A 2UXXA 1IX9A 3I55V 2JS5A 2NTOA 2V41A 3EVIA 2E74B 3K3WA 2ZXWB 2V1MA 1YXBA 2FA4A 3ZS8C 3HKBB 2IJYA 3ERWA 2WZ9A 5LNKe 1SYRA 1SJ6A 4EO3A 3FAVA 3G4SV 2YEVA 4I9WA 4X4JA 4XHMA 4POLA 3ABMC 3TKRA 3LORA 4EXJA 5HR0A 3L75H 4MLYA 2O85A 4FFBA 2OCCC 5LD0A 5E4WA 1FKAO 5EC1C 2E3CA 3MHHC 2GQKA 4Z2RA 1V9WA 1P7GA 1MD4A 5FHIA 1RPRA 2XAQA 4JTDB 3OTOO 1OC9B 4NHZA 1EN4A 1F51A 3OR6C 5B1AC 4MABA 4F6RB 4IBPA 2PZSA 1FJGB 1QR9A 3W7XA 2VLUA 1T4YA 3IXRA 4TV8A 4E2LA 2DBCA 1LUWA 4UCOA 4TVEA 2KG7B 3EPTA 3E8HA 4LFCO 4YKFA 5JCGA 2WPDG 1XI1A 5L3BA 1EN6A 4KE3A 5COHA 1MZFA 2ILMA 1ZZYA 2O87A 2QKEA 1WPIA 3DVWA 4MDCA 3CSJA 1MSDA 1HNXB 3JALA 1HNBA 2EULA 1V58A 2DYRC 2X8CA 1MDKA 5B6NA 1E1RG 1TVKB 3O76A 2CH7A 1T3BA 4X1UA 3TRPA 1OCRB 1YKCA 4EF0A 4TR4A 3I56V 1U87A 3D22A 1R7HA 1UJWB 1WMJA 2MW2B 2QKCA 3HKRA 3KMNA 3JCZA 1FVJA 1XL6A 2F95B 3I9V2 1O8XA 1BQZA 2FNOA 1GP1A 1L0LH 3ZX6A 5D96A 5G2ZA 4WBJA 1XREA 1AP6A 3P8WA 6GSUA 3ASNB 5EK0A 1AILA 2XHFA 1SS3A 1OYJA 4GSSA 2RUEA 1YEXA 4PQIA 3TOUA 1XNRO 3IK7A 3A2FA 4ICGA 4GKJO 2H66A 3E8BA 1CP9A 1XW9A 2JSZA 2A3QA 1TXXA 1J5EB 2R0GA 3QAWA 1S5HC 2FGXA 3FZ9A 5JQGB 1HP8A 1S3JA 4BIUA 4NB5A 4PXOA 5JCWA 3G71V 4IHUA 4GTUA 4WR5A 3VQVA 5CA1A 3WG7C 4XRDA 2F1MA 4I9QA 1QU7A 2C0GA 2QWQB 5LHHA 1GTIA 4DEJA 1GSDA 4YAVA 4YQUA 2Q4PA 1FW1A 2LRCA 3QFBC 1O7UA 2DMXA 5KUMA 2B5YA 3VWXA 2Y69B 1WA8A 5KMGA 5EPFA 4MVMA 1HNAA 1MDJA 3W8SA 1VF4A 2XAJA 2IJKA 1W2BU 3GRXA 5CA0B 4GQCA 1G6WA 4KNDA 1USBA 2E0QA 3JCML 4QJFB 4EKZA 2H94A 4ZB9A 2NDOA 4V1Ag 1ZUQA 5IWAB 3IOSA 3KGKA 5IYBO 1KMIZ 2CQ9A 2H75A 5LP6C 3OFNG 4IP1A 5DQSA 3SYCA 4Q20A 3ZMVA 1EEJA 3ETGA 2ZQMA 3ZRXA 2OACA 5LHGA 1US6A 2TRXA 3Q4HA 1RSOB 3M0FA 4FFKA 1I5XA 4XRAA 3FHKA 4YIOA 4J42A 1MZEA 2L57A 1PL0A 2YOIA 2PWJA 3ZN0A 1UFIA 3LWAA 1U88A 2Z0AA 4BL7B 2WLIA 3K58A 2YN1A 2X8GA 3QAVA 4IKHA 4UCUA 1OE8A 2XT9A 4U3JB 1SERA 2QM4A 5AISA 4PHZA 1CEZA 4AQYB 1XNQB 5B1BC 3M7MX 4DV7B 2OCHA 2VCQA 3EHBB 4I50A 2ZCTA 1ZL8B 1JLWA 2I3YA 4RUEA 3DC6A 5K1PA 3K5NA 4PGTA 4ZXGA 4GCIA 1R6TA 1TU7A 2R2JA 4LL1B 3CMAV 1X5EA 3CWBH 4WFAV 5L3EA 4WFBV 1ZMAA 3CRUA 3TJTA 3D8CA 5LP6A 2VL3A 3UL3A 4CY6A 1Y66A 3RT3C 2CZ2A 3O9OA 3LYKA 3F7VC 3ZBHA 3ETEA 4MH2A 1FPOA 2XHBA 2JU5A 4V2MA 3GL5A 2DC5A 2EC4A 1TJDA 2EIRA 1DGSA 4UUJC 2EIKC 1K0CA 4FYUA 2QE7G 2OWOA 5ECRB 3HVSA 2F51A 4FPPA 3SGIA 1AI6A 5B5EZ 2AGAA 2VQEO 4FM2A 3D4MA 5BMVA 2A9HA 3RYFA 3HKCA 4CS2A 3G6EV 4QL7A 1P4RA 1KD1W 2KUCA 5ECIB 4MW3A 3DGEA 3TGZA 2GV9A 4B7EA 1VQKV 5ENUA 3DXBA 1R5PA 5H6RA 5EZYB 1A8LA 1SU9A 1XWKA 5JWQB 3AG4B 4YQMA 3GTUA 1M2DA 3OUFA 1T8EB 1QHTA 2QSAA 3JATA 3HHVA 1FS0G 1F6MC 2YV7A 1GSSA 2AXTZ 4MTGA 1QFNA 4FIPC 3EINA 4PNFA 3ZHQA 3CTFA 1AQWA 3CX5F 1MA1A 3F3QA 4X62O 1VP7A 3PN1A 3SJCC 4RQEA 4CC6A 4FIWA 5KN0A 4LMVA 5LGTA 2LGQA 2F43G 2D2CB 2C2AA 1GH6A 1TA8A 3DSQA 3T4ZA 1V2AA 1XCCA 2Y4TA 2H3OA 17GSA 3R66A 5IIZA 2CAZC 2LJKA 5ECOB 2V1DA 2VO4A 5HFLA 2JVDA 4X0XA 1V55B 3MAKA 4PURA 1MMMA 3O6TA 2LGWA 4HI7A 1IDSA 1F3BA 4WBNA 5ITZB 1TOFA 5H5QA 2GZPA 2HSYA 4ECJA 4ZOLA 4IYHA 3EC3A 1B04A 3IBHA 3PPUA 2RM5A 3RYIB 5KOXA 1OKTA 1EWXA 1J9BA 3OUSA 3C1SA 1XMOO 1S3AA 4B3TO 1AI7A 5CO3A 5INYA 1AR5A 2GZZA 1ZYQB 3F9UA 2WB9A 1GN6A 1AJQA 5E79Z 1EV4A 3FB8C 4MVOA 1YZBA 1OC3A 2WWWA 4GXZA 2YPMA 1HQOA 4MSWC 4X1KB 3K5LA 5DN6G 4DV5O 1BT8A 2ZNMA 2F8AA 2HZFA 5J9BA 2X0LA 1UN2A 1XFLA 4N30A 2EIMC 4K2DA 1PX6A 2V6KA 2HVJC 4JYCA 4PA7A 1MDIA 5LYJA 2IH3C 4XDKA 2P31A 3UAPA 3FEUA 2A79B 1GTUA 3CRRA 4OXSA 3IC8A 2F23A 2CVDA 2DSAA 1HDJA 2YXYA 4JI7B 3PH9A 1AJPA 2JZTA 1H2NA 5KEJA 1NR1A 2CT6A 2GSQA 4AI8A 1U3AA 4K7IA 1GK9A 4IYIA 1THXA 4ZBBA 4ZHQB 2DLXA 3GSSA 3WGDA 1GTOA 2L4QA 1M3JA 3W8JA 1I94O 1S76D 3HKBA 1NVPD 3F8UA 4DUYB 5CRDA 1NSWA 1QVGU 3H1JH 4W4LA 2I4AA 2CGNA 3AY8A 5HFMA 5A4WA 1NM3A 2IBZH 1ACVA 1FFXA 1R3IC 3VURA 1EV9A 1YJ6A 1YVWA 2HLSA 4HU7A 1KB9F 3UBLA 1MSWD 1I7FA 3QPMA 2DWDC 2CTRA 3MHSC 4DR3O 2HHHB 4XS4B 3ZVJD 2IL3A 4OD7A 1OC9A 4LF5B 4MPFA 3GURA 2L59A 4PDRA 3GX8A 1EOGA 1JFUA 3OMAB 4MZCA 4KSOA 4PNGA 1SL2B 3B40A 4DV2O 3E89A 2N04A 3ASNC 4TWKA 1EZVH 1WNSA 1Y76B 1JLVA 2BJXA 1Z7RA 4KAEA 2KG7A 3DRNA 1NR7A 1S5JA 1B9YC 4DV1B 4RI7A 2JEUA 1M9BA 4GWRA 1GNWA 1YIJV 3US3A 4N21A 1WP0A 3RPPA 2BCCH 2IJJA 3H01A 1YEWA 4ECIA 5GTHZ 3S9FA 1MNGA 4U7OA 2DMMA 3C1RA 1S5LZ 4TV9B 5F8BA 2J9HA 4MVRA 2YWIA 5KN1A 4DV6B 4Q6GA 1SK1A 1TVKA 2OCCB 2E2GA 1S0VA 1PFOA 3J7Yb 1IXMA 1SESA 7GSSA 3ZEDA 1EM1A 1A2MA 5EYPB 4FZ0A 2HG5C 2CA8A 1KUQA 1MTCA 4TXOA 5IMZA 3OGCC 4OX9O 1NJIW 4RO2A 1Q82W 3ML0A 4FM1A 5B1AB 4ILFA 2BE3A 4DSRA 1GMGA 3P3NA 1TUBB 3VWWA 3SPCA 4K8MA 3RPNA 1XUQA 2KSDA 2EBOA 1WB8A 3BOAA 3E35A 3CD6V 2Y69C 4X89A 2XPEA 3TJBA 1BMFG 1F2EA 1YDKA 2AB6A 2VLTA 5FT3A 3AK1A 2HRFA 1TK0B 3TKQA 2YANA 1H75A 1XL4A 3AG7A 1K0AA 5EVOA 1Y6XA 4UV9A 1G1XB 2IH1C 4DR2B 4LNUB 5CRWA 3CXCU 4LLRA 4N0VA 4N0ZA 3H4KA 3OAAG 4FLTA 2CAQA 4I0XA 1XOUA 3E3EA 2GTAA 3UO2A 1F4NA 2DYRB 3FYIB 3RGBA 1K3YA 1TDIA 5ECKB 3WGXA 2R0CA 1I5YA 4X66B 5CA1B 5JQGA 3P90A 4TR1B 1TW9A 2YSUB 1K5QA 4HQZA 5B7CA 5K1XA 3HY2A 3HVXA 2Q0AA 2QDOA 1AB3A 1B48A 1PKWA 1PRXA 5DJMA 1FJGO 1JPXA 2WCIA 1OCCC 3K03A 4PJ0Z 1AR4A 1X5DA 4JI8B 4EIPA 1VQLV 2Y0PA 1WA8B 2PUKC 1KBHA 1B4QA 1ORQC 3SWLA 4HZ2A 1UA5A 1WE0A 2LSTA 2KKWA 1S3RA 3F63A 4IGJA 1QVFU 4DYLA 1HNXO 3HCZA 3LDCA 3TOTA 1EZJA 2AJQB 5J3RA
chains in the Genus database with same CATH topology
1IYIA 3M9KA 5DAKB 1GSYA 4IQ1A 2DJ3A 2B3SA 1PL1A 1GULA 1G7EA 3TB2A 1YY7A 4BL7A 1SJIA 4JBBA 3VFIA 3WYWA 3TJKA 3LSZA 3KH7A 2O89A 4ISDA 3BCKA 8GSSA 3Q18A 4HZ4A 1K0DA 3G9BA 2CX4A 3FKFA 5IMVA 1XW6A 4BVYA 1XBLA 2OE3A 2P0GA 3EMXA 3UARA 4HOJA 1FO5A 2LV3A 2OADA 3GKXA 1SENA 1LU4A 3D5JA 4F0BA 3ZREA 4J56E 4ML6A 3Q74A 2KOKA 2VIMA 3D6IA 2QA1A 1ZCPA 3GH6A 5HFIA 4K7OA 1BJXA 2I81A 3ED3A 4F2IA 2ZUPA 1W4VA 2YP6A 4GLTA 4NXIA 3LXZA 1WRYA 1ZGNA 1R4WA 4ZL9A 2K6VA 1N4CA 3GX0A 4YAPA 2GT6A 4CW9A 1ERWA 1A2JA 1EP8A 2HSHA 1X9MB 4HEA2 4MJEA 3TJGA 1NW2A 1GUMA 4K9ZA 4JR4A 4GRFA 1DE1A 1GUKA 2H0IA 2YZUA 2I1UA 4IP6A 4G2EA 1M9AA 2R6KA 2MMZA 3ZZXA 2FWGA 3WT1A 3APSA 4ML1A 1TKDB 1PMTA 1I9DA 5D8IA 2H19A 1PD21 1W89A 1AC1A 3M8NA 1PL2A 2OBIA 2DJKA 6GSXA 1Z7PA 1G7OA 2N5AA 4WR4A 1X9WB 2L6DA 4P3YB 1GSQA 2VL9A 3QDNA 5ELAA 5AGYA 5IOXA 5ID2B 4TR3A 3HJMA 1QGVA 4XTSA 4ZIJA 2GUZB 2C0DA 3RHCA 4K5RA 4Q5RA 3P7XA 2LJRA 1UC7A 1TK5B 2C1YA 5EL8A 1A8YA 4YH2A 2CVBA 2HNLA 4I97A 4K2XA 2R4VA 2ALBA 3OR5A 3TKSE 2WFCA 1TRWA 2PN8A 5ECHB 4XS4A 4XIHA 5LCZA 2CTQA 2H6XA 2PGTA 2VM1A 3DKSA 4MMMA 4K7NA 4ECBA 5G30A 2CTWA 3ZTLA 4BWQA 2HI7A 1EEMA 4EDZA 2AYTA 4V2LA 2FLSA 5GSSA 1XXUA 3RBTA 2MBTA 1R26A 2PVQA 4TXOB 3LJRA 1G6YA 3ME7A 1HNCA 4PQHA 1KNGA 2GT5A 1XWCA 9GSSA 4F03A 5F05A 5H5RA 2HFDA 3MYDA 4A5PA 1DBYA 4EL1A 1CQHA 2LQOA 1B8XA 3GN3A 1SD9A 3R3EA 4PX1A 1GNEA 3F4SA 1M7TA 1M2BA 5CREA 2FD3A 3ZIJA 4TR1A 2M72A 1C72A 3SBCA 3GMFA 2HRKA 3TRXA 3N9JA 4XCSA 4TKYA 1DSBA 4O92A 3ZL5A 5D9WA 3KMOA 1IYHA 2VCWA 4EC0A 5ECLB 4MPGA 5B6MA 3MDKA 3EU3A 5DAKA 3LW9A 1AUCA 4WF5A 2VD1A 3FZAA 4KSMA 2LO1A 2DKIA 3LYPA 3DIEA 3HD5A 5IMDA 4TN8A 2C4JA 1FHEA 2XBQA 1O6JA 3H8QA 1ERUA 4AF2A 2YWOA 1BEDA 2H01A 2O8VB 2P5QA 1TK8B 1YKAA 1BQ7A 2XBIA 4BVYB 3WT2A 1UVZA 4HUAA 4ZBAA 1Z5YE 4RUVA 1JHBA 3A5WA 4OCEA 5CRHA 3LEFA 4KF9A 3A2XA 2IMDA 4NWYA 3ZMLA 2L6LA 4ZILA 2VAFA 2QWPB 4BPYA 2GSRA 4ICYA 4FQUA 3UO3A 4TR0A 1TRVA 4K0GA 3VWVA 2A2PA 2KLXA 1N2AA 2A4HA 2GSTA 1ON4A 3KCMA 2HZEA 3L9VA 2H0GA 5JCUA 4RWUA 1VGLA 16GSA 3HJOA 2B7JA 1ZOFA 2RM6A 2HRAA 2AAWA 2YUAA 2LTKA 4IQAA 3VI7A 2QWOB 3RHBA 4MNNA 3D21A 1URMA 3I6AA 3HDCA 5BRTA 1GSFA 1EGOA 3MWHA 3F6FA 3IC4A 2C3TA 3R2QA 2VCZA 2K8VA 2LQQA 11GSA 1FB0A 2JACA 4L8EA 4I2TA 4KX4A 3HZ4A 2Z9SA 4KCAA 4IJIA 3NOFA 2M80A 2YS8A 4G0IA 2A2RA 2VCXA 2WULA 2HYXA 1RW1A 2K18A 4DSQA 3DEXA 3HXSA 5J9CA 1HYUA 3NZNA 2H1AA 3IAM2 4NHWA 1XZOA 1WOUA 4ZBDA 4I2UA 1ML6A 3QCPA 2B6MA 4EUYA 3VLNA 5ID2A 1XWGA 3GV1A 2KP2A 4YQVA 1XVWA 2GUZA 4WBRD 2VL2C 5G31A 4CDOA 1OKDA 4JU5A 1VF1A 2PU9C 2QWNB 4PUAA 3ZRDA 1AW9A 5IO0A 4O7HA 1JZDA 4WF4A 4FYCA 1Y6EA 4AJ7A 2C3QA 3TUEA 1XIYA 4F9ZA 3FR3A 4PQ1A 4E8EA 5B8BA 4HJ2A 3EYTA 1R5AA 1XBSA 2YWMA 1K0MA 1MD3A 1J0FA 4TW5A 3UVHA 4L0UA 4EDYA 2IMIA 1EP7A 4QQ7A 3ISOA 2B5XA 4Q5FA 4F82A 2GQMA 4JE1A 2H76A 3ZITA 4XS1A 4POMA 1Z6NA 3DYRA 1E2YA 2FCHA 1E6BA 5ECQB 3K8NA 1SL0B 6GSYA 5IOWA 3Q19A 1DE2A 1S3DA 5IM9A 3I43A 4JEDA 2YJ7A 1XW5A 1U6TA 2CX3A 3E0UA 2G2QA 2GS3A 3DGQA 4ECCA 3HJPA 2IMEA 4QL9A 4HQSA 4J57E 1GTBA 1X9SB 4BVXA 4I5QA 4G0LA 4POKA 1O81A 5L71A 4F0CA 3A3TA 5CNWA 1QK8A 4JRRA 5A4UA 1WWJA 5ECMB 1IURA 5HQPA 4I6XA 3KTBA 5HR2A 2MMNA 2X4AA 2RLIA 3IE3A 4FH8A 2DJ0A 1S3CA 2DIZA 5GZZB 2E7PA 2XC2A 2H72A 2LNSA 3GFKA 5B8AA 5HR1A 3E9JB 3U5RE 2LUSA 3MSZA 1A0RP 2CAIA 2L5LA 2M6YA 5G5EA 5ABRA 2MBSA 4DSSB 5ECNB 4DVCA 3TJJA 2LJAA 2WRTA 2REMA 3GIXA 4GQFA 1M0UA 2F8FA 3ZFLA 1QQ2A 2GLRA 2K9FA 1ST9A 4KGIA 2GVPA 2HT9A 10GSA 3H79A 3EU4A 5G1LA 1PQNA 4ACSA 3A5IA 3EE2A 2YNXA 2E2MA 1QXHA 2HZEB 3W6GA 3Q6OA 2JADA 1T7PB 1GWCA 3IV4A 4N10A 4PUFC 2PPTA 4E8HA 5GAPD 5BMUA 2NVLA 1VF3A 4POBA 5DCGA 4GSNA 3CRTA 3KTLA 2R5GA 1JZRA 5DVBA 4Q5NA 4MP4A 3FY7A 2X64A 1KTEA 3D4TA 2H0HA 1AQXA 5AN1A 2YZHA 2IWTA 4AJ8A 2AHEA 4GF0A 3L78A 1RK4A 3BVOA 2ES7A 4NPBA 4CY8A 5IMCA 5AIVA 5GSTA 2DJ1A 4OO4A 4O32A 5CYYA 4J7ZA 2JSYA 1K0OA 2LEGA 2G0FA 1XOBA 3HA9A 4RQXA 5DALA 1I5GA 4RI6A 3FR6A 5ECSA 2N05A 4RQRA 4LMWA 4XS6A 5D9TA 1RQMA 1WJKA 4OFTA 1CQGA 4G0KA 2PVOC 1PX7A 3F0IA 3FR9A 3ME8A 1ZL9A 1LBKA 3UVTA 1O8WA 3IR4A 3GYKA 3UBKA 1Q98A 1B9XC 1H4OA 4HS1A 2H6YA 3ZVJA 2B1LA 2VCTA 3IPZA 2AUVA 3LFLA 2GSSA 4D73A 2D2ZA 3FZ5A 3ZFBA 1Z9HA 3PR8A 4H86A 2GDRA 2HRNA 3QAGA 1PGTA 5DQYA 2QWRB 2CVKA 3DD3A 2H73A 2YWNA 2H70A 1GLQA 1Y25A 4NV5A 4MF6A 4IS0A 5C04A 2P5RA 2V6OA 1SYXA 2YJHA 1VF2A 3C73A 2FWHA 3KM6A 2H1DA 2VOCA 2PF4E 3UJ1A 1K0NA 3N5OA 1SKWB 4O5UA 5A4VA 2VLVA 2HE3A 3WGEA 1XPVA 3VK9A 3UCSC 4LL4B 5J5NA 4EIQA 1SD8A 5DBQA 4EVMA 2C3NA 14GSA 5IO2A 1TRUA 3L9UA 4IT5A 4K0NA 4YKGA 2UZ8A 2FUG2 3V1WA 1SK0A 5FWGA 1TP9A 4WKWA 2H30A 1QMVA 4MA9A 5F0GA 1BYEA 3UMAA 3RDWA 4Z7XA 2DJJA 2LRTA 1FG4A 4KDYA 4BVXB 3GKNA 1YEPA 4ZL8A 3DWVA 4G10A 2O7KA 5IMFA 3A2VA 5D9XA 4KCEA 3APOA 2A4VA 2DMLA 1JZOA 1LJRA 1T00A 3L4NA 4MCUA 2MYGA 3WD6A 3F3RA 1XOAA 2MMOA 3G7YA 3HZ8A 3IDVA 3VPTA 3VWUA 2Y4UA 2FHEA 5F06A 3ZIVA 1TI3A 2C8UA 2H1BA 2PERA 5KN2A 4K5SA 2GQLA 5HFKA 3KJYA 3QOUA 1FOHA 3MIXA 2GZYA 4TXVA 3FK8A 4KH7A 5D9VA 1NHYA 18GSA 4HDEA 2OJLA 4J2FA 3L9SA 1A0FA 1G0TA 4Q5QA 4DSSA 2KHPA 1V40A 2C0FA 3KEBA 2TIRA 2BMXA 4BA7A 3M3MA 1TU8A 3MNGA 4OFNA 3GKKA 2PBJA 2CTPA 1NZ6A 5E59A 3QFAC 1DUGA 1MEKA 4WXTA 3NIVA 2ON7A 5IPHA 4Z2TA 5AIXA 4NV2A 5HR3A 3BBYA 3GUSA 3ZMKA 1BG5A 4KDXA 4OO5A 2MMAA 1Q4JA 5KOWA 1A2LA 1GLPA 1XVQA 1SL1B 4KDUA 3D0ZA 4I8BA 4TOPA 4MZWA 3KP8A 1F37A 5ECPB 6GSSA 2C0EA 4USSA 2X49A 1X5CA 1SKSB 1B4PA 1X0RA 3LG6A 2KP1A 1ZYPA 19GSA 2QA2A 12GSA 4IELA 3LGCA 5J4UA 13GSA 2QC7A 3FZ4A 4HJMA 3CBUA 2IFQB 6GSTA 1EZKA 2X8HA 4WETA 1ZYNA 2FY6A 5IQYA 2H74A 3A2WA 2KQXA 2OE0A 6GSVA 1GRXA 3F4RA 4KW6A 2WDUA 4OCFA 5D73A 3KP9A 5DALB 3HYPA 5G1KA 3IHQA 2F3MA 1BAYA 2DKHA 2V32A 1A23A 2WS2A 6GSWA 3UIWA 3TJFA 2VD0A 2VM2A 3RAZA 2FWEA 2CUGA 1KEBA 1F3AA 1N8JA 1K0BA 3C7MA 2L4CA 4HU9A 3GH9A 1OE7A 1PA3A 3M1GA 4OMVA 4GSTA 5CAXA 4WEYA 2FWFA 3GKMA 4JZQA 2GGTA 3QD9A 2J23A 3PGTA 1VRSD 3L0HA 1KBNA 1GSEA 4ID0A 5JWOB 3QMXA 2X99A 2VCVA 4D73B 2AV4A 5IPGA 4L5OA 4IJ3A 5EY6A 3GSTA 2LKUA 2QSIA 1ZYEA 3LQ7A 2NBSA 1Z6MA 3TKSC 3G7IA 1V57A 1YQ1A 1K3LA 2N5FA 2VL2A 3KZQA 3TKPA 2RUFA 2V2GA 3M9JA 1V98A 3ZYWA 4Z2UA 1PKZA 4KB3A 3F4TA 2MZCA 1TTZA 4MJCA 5HFGA 20GSA 3FRCA 1JZWA 3J7Yk 1EOHA 4PTSA 1GSUA 3PINA 3FW2A 1U3IA 3O3TA 4G19A 3TKSA 3CYNA 4CHSA 4O5RA 3CSHA 4BWSA 4AJ6A 3U6VA 1PSQA 3KXOA 1TI1A 4L0WA 3FYGA 3UOMA 5H5SA 1PN9A 1ILOA 2IMKA 3ERGA 5DJLA 3BCIA 1SK2A 2ON5A 4MF7A 5F07A 3LXTA 1GTAA 1AAZA 2OBKA 3VI5A 3FMWA 1M99A 2GTUA 1SJZA 4OWYA 2IMFA 2OKAA 3GNJA 1OVNA 3TDGA 2DJ2A 1FAFA 3KIJA 3C71A 4FO5A 4ZB6A 2R3XA 3CSIA 3IAS2 3G7JA 3C8EA 2A2SA 1YZXA 3IHGA 2N5BA 2CZ3A 2YCDA 3ERFA 2I9HA 4MK3A 2TRCP 1XWAA 3VPQA 4V2NA 2IPAA 1GUHA 4J80A 5DCHA 5CRGA 1EGRA 2PMTA 1FAAA 2IIYA 3GHAA 3EWLA 2DIYA 4N11A 4IVFA 2YV9A 5CP1A 1T1VA 2H71A 3CTGA 4G9HA 2WGRA 1FB6A 2LS5A 2K8SA 2IN3A 4ULXA 2L6CA 4NAXA 1XWBA 1BX9A 3TCOA 2NPBA 1NHOA 3KH9A 2B7KA 3I69A 4MH3A 5ELGA 1QUWA 4IN0A 3GL3A 1K3OA 3EMPA 1BQ0A 1PN0A 2CV4A 2BTOT 2LRNA 4V1Ap 3CXGA 2B5EA 4TRXA 2H6ZA 3CMIA 2OA7A 1YF1A 3UEMA 5GAND 2H1GA 3GA4A 3IK9A 2R37A 4MJAA 4KUNA 3DVXA 2LNTA 2C80A 2JZSA 2M46A 3IRAA 1FOVA 2EIQA 3HVVA 1AXDA 5ECOB 2QGVA 2OE1A 1YF0A 1O85A 2B1KA 4OFMA 4X43A 1A24A 3H93A 4KA0A 3H1NA 1WIKA 4AGSA 2F9SA 2HSMA 1SKRB 1F9MA 4FYBA 1J08A 3GTUB 3TRQA 5J41A 3DMLA 2IFQA 1HD2A 4ZL7A 1O73A 2RIIA 1AQVA 1GH2A 4IW9A 5DDLA 1FVKA 5IMAA 4NMUA 3BD2A 3IA1A 5KN3A 2VUPA 3P2AA 2FA8A 3QR6A 3F6DA 1Z3EA 5A5KA 4MJBA 3KD0A 4MZBA 4JR6A 1THOA 1ERTA 2XPDA 4LA1A 4MF5A 3APQA 1T4ZA 2HXKA 5C00A 2DN9A 4EE0A 1GL8A 1AIUA 1M2AA 1OAZA 3BJ5A 2EIOA 5JWRB 2R0PA 2JZRA 2H8LA 2EJ7A 1OC8A 1TRSA 2JL4A 4K1FA 22GSA 4K6XA 5G5FA 3EURA 4L5LA 5D93A 1ERVA 4ZB8A 1ABAA 4O5QA 3ZLPA 1WJZA 2L5OA 2WJUA 2NTOA 2V41A 3EVIA 2V1MA 2FA4A 2IJYA 3ERWA 2WZ9A 5LNKe 1SYRA 1SJ6A 4EO3A 4X4JA 4XHMA 4POLA 3TKRA 3LORA 4EXJA 5HR0A 4MLYA 2O85A 5LD0A 5E4WA 2GQKA 4Z2RA 1V9WA 1MD4A 5FHIA 4NHZA 1OC9B 4MABA 4IBPA 2VLUA 1T4YA 3IXRA 2DBCA 4TVEA 3EPTA 4YKFA 5JCGA 4KE3A 5COHA 1ZZYA 2O87A 2QKEA 1WPIA 3DVWA 4MDCA 3CSJA 1HNBA 1V58A 2X8CA 5B6NA 1MDKA 3O76A 4X1UA 1T3BA 3TRPA 1YKCA 4EF0A 4TR4A 1U87A 3D22A 1R7HA 1WMJA 3HKRA 3KMNA 1FVJA 3I9V2 1O8XA 1BQZA 2FNOA 1GP1A 5D96A 5G2ZA 4WBJA 3P8WA 6GSUA 2XHFA 1OYJA 4GSSA 2RUEA 1YEXA 4PQIA 3TOUA 3IK7A 2H66A 1XW9A 2JSZA 1TXXA 2R0GA 3QAWA 2FGXA 3FZ9A 4PXOA 5JCWA 4IHUA 4GTUA 4WR5A 4XRDA 2C0GA 2QWQB 1GTIA 4DEJA 1GSDA 4YAVA 4YQUA 1FW1A 2LRCA 3QFBC 1O7UA 2DMXA 2B5YA 3VWXA 5EPFA 1HNAA 1MDJA 3W8SA 1VF4A 3GRXA 4GQCA 4KNDA 1G6WA 1USBA 2E0QA 3JCML 4EKZA 4ZB9A 2NDOA 4V1Ag 3IOSA 3KGKA 2H75A 2CQ9A 4IP1A 5DQSA 1EEJA 2OACA 2TRXA 3M0FA 4XRAA 3FHKA 2L57A