3APQA

Crystal structure of j-trx1 fragment of erdj5
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
208
structure length
208
Chain Sequence
IQNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWSYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of an ERAD pathway mediated by the ER-resident protein disulfide reductase ERdj5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords DnaJ homolog subfamily C member 10
total genus 65
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3apqA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apqA02
3E9JB 2DMMA 4IGJA 5E59A 2IIYA 5JCGA 2JSYA 1QUWA 1XZOA 1GLPA 1J0FA 2XPDA 1YEXA 3VK9A 2DJKA 3DMLA 3HVVA 1ZGNA 3N9JA 4ML1A 1MTCA 4WBJA 3MDKA 1F9MA 1BX9A 1M2AA 5HR3A 1W4VA 2X8GA 1TW9A 1KEBA 4RUVA 1HNBA 2YOIA 2YWIA 1TDIA 2WRTA 1TK5B 3LWAA 3GKKA 1XOBA 5ECKB 1K0NA 2BTOT 1ZZYA 1G0TA 2KLXA 4WETA 1R5AA 4OO4A 4FO5A 2ON5A 1OC8A 5JWOB 1TK8B 3ME8A 4G9HA 5ECPB 3FW2A 1SJIA 1PKZA 4WKWA 4WXTA 5ECOB 3SWLA 2XBIA 4ML6A 1ZYQB 2HSYA 4O5RA 3F4RA 3IK7A 3CRUA 1NHOA 3GH9A 5ECQB 1XW5A 2LV3A 3QOUA 2CTQA 4YQVA 2FWFA 2I4AA 1SU9A 5DJLA 4K7IA 1TRVA 3GH6A 4JZQA 2F3MA 3LXZA 2GLRA 2H01A 4XS1A 1EOGA 1MDJA 4JR6A 5DAKB 2V2GA 4EXJA 3MAKA 1B8XA 5KN2A 1UC7A 2WULA 1TU8A 3GX8A 2LEGA 3HY2A 2PF4E 2GQMA 1URMA 3A3TA 2PMTA 3F3RA 4ECJA 2C3QA 4EF0A 1JHBA 4KNDA 1V57A 3P90A 1AC1A 3EWLA 3EU3A 1PQNA 5IOXA 4RWUA 4MJBA 1SD8A 3TKSC 4OFMA 6GSTA 2KP1A 2QWOB 5E4WA 2TIRA 1U6TA 3D4TA 3BD2A 3WGDA 5B7CA 1QMVA 3UL3A 1I9DA 5A4WA 2CTWA 4G19A 1T7PB 4F03A 3GNJA 1EEMA 3O76A 3TRPA 2FWGA 1ON4A 1M9AA 5GZZB 2HT9A 2YV9A 3QD9A 2GQLA 3RDWA 3HD5A 5ECNB 1Z6NA 2YNXA 1F37A 1PGTA 2YCDA 2GQKA 5J9CA 3CYNA 5FHIA 5JWQB 2OBIA 1UN2A 1C72A 17GSA 4KAEA 1XWBA 4HZ4A 1GTBA 4NXIA 4HZ2A 2MZCA 2IL3A 1V58A 3NIVA 3L0HA 2B7KA 4MZBA 1PN9A 5IMDA 2C3TA 4TVEA 2VO4A 3C73A 4GSTA 2HYXA 2LRNA 2I3YA 2IFQB 3QR6A 4ZL9A 4IHUA 1A0FA 1VF4A 1HNCA 3HHVA 1KBNA 3IAM2 3K8NA 4TXOA 2B3SA 4JU5A 1BQ0A 2X64A 3CBUA 2VL9A 3GKMA 4OD7A 1THOA 4CDOA 4KCEA 1BEDA 5COHA 3GTUA 1AQWA 5CRWA 3R2QA 4DSSA 1YZXA 2QSAA 2HI7A 1EGRA 1B4QA 3Q19A 4X0XA 5B6MA 4KDUA 2DIYA 4ZL7A 1XBLA 2WS2A 2IMIA 3EURA 2C0EA 3IPZA 2J9HA 3UEMA 2LRCA 2ZNMA 1IURA 4YQMA 4HEA2 2YN1A 5AN1A 2FGXA 3I6AA 5LD0A 1Z9HA 5EVOA 2FY6A 4O7HA 3CRTA 3QMXA 1YF0A 2H1DA 1F3AA 2CV4A 5J5NA 4H86A 2YPMA 3HYPA 1JLVA 2VLTA 2MBTA 3DGQA 4QL7A 3C1SA 4WEYA 2HLSA 2P5RA 4HDEA 2IMKA 5IQYA 4J80A 1K0OA 4DSQA 3A2XA 2YUAA 2I9HA 1K0DA 3UBLA 1QK8A 4J56E 3VFIA 2CVBA 3UVHA 5DALA 4YAVA 3IE3A 1FHEA 1G6YA 4JRRA 5J9BA 3IK9A 3KXOA 4LMWA 1UVZA 4BWSA 4FH8A 4K1FA 1T1VA 5DALB 5B6NA 2JSZA 4AJ8A 2H73A 2HNLA 3O6TA 2OE1A 2YWNA 1Y25A 3GUSA 1PRXA 1U88A 1A2JA 5EL8A 2JADA 2A4VA 5CNWA 5DJMA 1GULA 2QWRB 3G7YA 1PX7A 4KGIA 4P3YB 1HYUA 2DLXA 4EDYA 3EINA 1DUGA 4N10A 3VWWA 4CHSA 2KQXA 4OMVA 5AIXA 3U6VA 3DKSA 5D9XA 3EE2A 4HOJA 4ZBAA 3KGKA 3M9JA 5AISA 2NTOA 1GSEA 1XWCA 2M46A 3GSSA 1EZKA 2CVKA 2V41A 1GSQA 3VPTA 2N5BA 1SL2B 3GRXA 1NW2A 1M2DA 4PQHA 4HJ2A 3CSHA 4TR1A 5CRGA 3EMPA 3F6FA 1U87A 5CRHA 1PA3A 2VL2C 3APSA 2OBKA 5AGYA 4WR5A 1WRYA 2DJ2A 1S3DA 1T8EB 4NHWA 3TRQA 1N4CA 1Z6MA 2GSQA 3TKSE 1YQ1A 3FRCA 1HD2A 5CAXA 4K0GA 3J7Yk 3WD6A 2REMA 4NV5A 22GSA 1GSSA 1YY7A 1TU7A 4K7NA 1YKAA 4AGSA 2AV4A 2LJAA 1TRUA 3L9VA 1HQOA 2C1YA 6GSWA 2XPEA 1WMJA 5ECLB 5DQSA 4DSSB 5CRDA 3GTUB 3TDGA 3VPQA 1WPIA 1ZMAA 1EGOA 3US3A 3KIJA 1BG5A 4ACSA 3TRXA 2QGVA 1AIUA 4OFTA 4PX1A 5CP1A 4X43A 2DJJA 5KEJA 5GSTA 2P5QA 4XCSA 2F9SA 2PU9C 1CQHA 2D2ZA 3Q6OA 3FK8A 2K6VA 1XPVA 3FR6A 4GRFA 5F0GA 2R37A 2GS3A 3L9SA 2IMFA 4TR0A 3ZYWA 3ZLPA 5J3RA 3C7MA 2YJ7A 12GSA 2A2RA 4ZB8A 3ISOA 4POBA 5KN0A 1U3AA 4ECBA 5G5EA 3PGTA 2DJ3A 4ZILA 1A23A 4BL7A 2OE0A 4NPBA 3LORA 4HS1A 6GSYA 2PBJA 3DRNA 4MZCA 5IM9A 4DVCA 5G5FA 4YH2A 1K0MA 3HA9A 3W8JA 5FWGA 2OJLA 3Q18A 2LNSA 3UO2A 2LTKA 2DJ0A 5F05A 2H0HA 1SL0B 2HZEA 3GYKA 4XHMA 5EPFA 1SJ6A 3KD0A 2H1GA 5DAKA 2E2MA 2MMZA 1OKTA 4V1Ag 3G7IA 1S3AA 3IBHA 3EVIA 1GH2A 5IIZA 5A4UA 1MDIA 2VCQA 1EV9A 1ZOFA 1K0BA 4ZBDA 1SKRB 4IQ1A 1X5DA 4L0UA 1FW1A 2IMEA 1AAZA 4FYUA 3IHQA 5DQYA 1IYHA 1X0RA 2H6YA 4Q5FA 18GSA 1TP9A 3FY7A 2HRFA 5D73A 5HFKA 2WJUA 2R2JA 1GL8A 5G30A 5EY6A 2RUEA 1X9MB 3F3QA 1GH6A 4KH7A 11GSA 1Z7PA 3TKQA 2KUCA 3EMXA 2H0GA 4WR4A 1KTEA 1ERWA 1O8WA 3HVXA 2O8VB 3KH7A 2PUKC 3O3TA 4K8MA 2K9FA 3J7Yb 4I5QA 2AAWA 6GSVA 3I43A 5D9VA 1A8YA 3KEBA 2WDUA 3F63A 2CX4A 2VCZA 4IQAA 1GNWA 4EO3A 1MD4A 5J41A 1GSYA 3L9UA 3GL3A 3N5OA 4IELA 4F82A 3M0FA 4V2NA 2GVPA 2WB9A 2GSSA 4FIWA 1EEJA 2IPAA 4TKYA 4K0NA 2RLIA 1FAAA 1VF2A 3PR8A 5L71A 2ZUPA 3EU4A 5HR1A 2FLSA 3E3EA 1G7OA 2YS8A 2KHPA 4ID0A 2OE3A 4IKHA 4MF5A 1PL1A 2QWQB 1ACVA 1VRSD 4G2EA 1FO5A 2AYTA 2VL2A 7GSSA 2B5EA 2E2GA 2VM2A 1V98A 1GSFA 1O7UA 2L5OA 4DEJA 3GURA 4ISDA 3FZAA 4L0WA 3FHKA 4KDYA 4KB3A 2E0QA 2XHFA 2B5YA 2PGTA 2A2SA 1K3OA 3M1GA 4GSSA 2LQOA 2V1MA 1GTAA 3QFAC 1O85A 2K8SA 5ECSA 2RM5A 2CA8A 3ZREA 1TXXA 2R6KA 2OACA 1X9WB 1N2AA 1SYRA 4OFNA 1JFUA 1TKDB 4K6XA 3ERGA 4MH3A 4N11A 1FVKA 2H76A 3KM6A 1WJKA 4ZB6A 2L4CA 2MYGA 3TUEA 2B1LA 1SK2A 1FOVA 3F0IA 4J2FA 1XXUA 2G2QA 4PXOA 2HFDA 1GWCA 2L4QA 13GSA 1HDJA 3LYKA 3RPPA 1K3LA 1LBKA 5CYYA 1DSBA 1YJ6A 2QSIA 2H30A 2X8HA 2DMXA 3C71A 3OR5A 1WP0A 4DSRA 3D0ZA 1XWAA 1SKWB 2GSTA 2JZTA 1WOUA 5IMFA 3E0UA 3UJ1A 3TB2A 1O8XA 2GTUA 2OA7A 3A5WA 2VLUA 2FWEA 3D5JA 2EC4A 5H5SA 5J4UA 2CZ2A 2NPBA 3TKSA 3AG7A 4MJCA 2GZZA 3W6GA 1XBSA 3LFLA 1NZ6A 2X8CA 1G6WA 3P2AA 2VM1A 3KP9A 2ON7A 4HU7A 4KUNA 2QWPB 4RI6A 1M2BA 4TR3A 1QGVA 5INYA 4TR1B 4NHZA 4I2TA 2MMAA 3IOSA 2VLVA 1WJZA 3CXGA 3D4MA 4ZIJA 3SBCA 1R4WA 3IA1A 5DCGA 3ZITA 2LJRA 3ZMKA 2HZFA 1RW1A 2JACA 3HVSA 1J08A 3TOTA 4MP4A 3Q74A 4HU9A 5D9WA 1OE7A 2O87A 1DE1A 5F07A 2O85A 2X99A 3D21A 3ZVJD 4O32A 4LLRA 1A2MA 1RK4A 1R26A 2H0IA 4EDZA 3GFKA 3QAVA 2V6KA 4Q5QA 3EYTA 3QCPA 2XC2A 2P0GA 2EIQA 3ZTLA 1WE0A 1V9WA 3GSTA 4V2LA 5LNKe 5ENUA 5ABRA 3EC3A 2KP2A 3DEXA 1GLQA 4IP1A 5G1KA 3TJFA 1OKDA 4PURA 2N5FA 5DBQA 3HKRA 3JCML 4BPYA 4GF0A 2AJQB 2FNOA 2H6XA 1F3BA 1SENA 1Z7RA 1DBYA 3CSJA 2F51A 5B8BA 2YZUA 4Q5RA 1SL1B 3F4SA 6GSUA 2CVDA 2PVQA 1IYIA 1B9YC 3H8QA 4KE3A 4GLTA 3G9BA 3TJBA 4MH2A 3P8WA 4MMMA 4D73B 5C04A 1T00A 1X5CA 1W89A 2QKEA 1M9BA 1K0AA 4L8EA 3WT2A 4I97A 4ZXGA 3F8UA 4ECCA 4G10A 5DVBA 3ZIVA 3D22A 2G0FA 2OADA 2JZSA 2EIRA 3CTGA 2VCVA 4E8EA 3HJOA 2C3NA 2YP6A 2L6DA 1GUKA 4BWQA 3H1NA 5KN3A 2IJYA 3GIXA 2PERA 2CT6A 2DJ1A 2VOCA 3BJ5A 1SKSB 3KP8A 2V6OA 1A2LA 3VI7A 3NOFA 5CREA 5G31A 4GXZA 4N30A 3ZFLA 4MPGA 4IBPA 1WIKA 4ZB9A 3HXSA 2ES7A 5G1LA 2J23A 4IVFA 1AQXA 2IMDA 5HFIA 3PINA 2B1KA 4ZL8A 5IPGA 3FZ5A 4N0ZA 1XFLA 1V2AA 2O89A 3ERWA 3RBTA 1XW9A 1EP7A 2O7KA 2LO1A 3LSZA 1VF3A 3IR4A 2M6YA 1T4YA 5IMCA 1A8LA 1T4ZA 2VIMA 4E8HA 4CW9A 2FA4A 3LXTA 4KCAA 3KH9A 4YQUA 4X1UA 3I9V2 4MF6A 4MLYA 1A24A 3VLNA 3ZRDA 2H71A 1EP8A 3C8EA 3QAWA 3M9KA 2FD3A 5HR2A 1GNEA 3HDCA 2OKAA 3FZ4A 1YDKA 2XBQA 1HNAA 3RAZA 5DCHA 3L4NA 3ERFA 1TK0B 3C1RA 3U5RE 1BJXA 1A0RP 3ZFBA 3IV4A 3GKXA 5IMAA 1MEKA 2CTPA 2VCWA 4PNFA 3APOA 2N5AA 3DYRA 3UOMA 1TI1A 2C0DA 2GGTA 2JU5A 2WGRA 3A2VA 3BCKA 2I81A 2NVLA 2C4JA 4IJ3A 2M72A 3DIEA 5A5KA 1ILOA 3I69A 4TN8A 2MMOA 4AJ7A 4AF2A 2HRNA 2M80A 3HJMA 2R4VA 1WWJA 2I1UA 5IO0A 1KNGA 4BVYA 1V40A 1XVWA 3H93A 1XWGA 2DC5A 3F9UA 4IJIA 2LJKA 4TOPA 1XCCA 3MWHA 3L78A 1XOAA 1MDKA 2LSTA 2CAIA 5H5RA 3TOUA 2LGWA 4LL4B 1B9XC 3QFBC 3DXBA 3TGZA 1Z3EA 4NV2A 4POKA 3M8NA 3CSIA 4XRAA 4KA0A 1TJDA 1VF1A 2FA8A 2H74A 1ERTA 4ULXA 1K3YA 2GDRA 3H4KA 2WZ9A 4EL1A 5ECRB 3LEFA 1DE2A 5F8BA 1FVJA 1JZDA 2ZCTA 4KW6A 2FUG2 3BVOA 5ECIB 1NM3A 1OAZA 3AY8A 1ZL9A 2AHEA 1UA5A 4JBBA 1H4OA 2YJHA 3WGXA 2IWTA 4OWYA 2CUGA 5IMZA 3LJRA 2JZRA 1QXHA 2V32A 3DVXA 4ILFA 4MA9A 2AB6A 5F06A 2PVOC 1I5GA 3A2WA 2QC7A 3LQ7A 1X5EA 2C80A 1E2YA 4MF7A 4RQRA 4V2MA 2LQQA 5IO2A 1B48A 2EIOA 2PWJA 1RQMA 2EJ7A 1PL2A 3APQA 1AW9A 4IS0A 2KOKA 2B5XA 3KZQA 4PUAA 2H75A 4GCIA 4F0BA 1YEPA 3DVWA 3HJPA 4MK3A 1K0CA 4LA1A 3VURA 4F2IA 5IOWA 1F2EA 4OCEA 4XIHA 4EVMA 1OVNA 3UMAA 5ELGA 2H1BA 4F9ZA 1QFNA 1GRXA 4NMUA 14GSA 3KMOA 3RHBA 2R3XA 4WF4A 20GSA 3RHCA 2VD1A 5D9TA 2N05A 4HUAA 4TW5A 2TRXA 2HE3A 2IFQA 3FZ9A 4L5OA 2GSRA 1GSDA 4RI7A 5H5QA 1GSUA 1M99A 3D6IA 4KSOA 3VI5A 3FYGA 4XTSA 3UIWA 4K9ZA 5B8AA 5GAND 3QPMA 3V1WA 2LNTA 5ID2B 1VGLA 3KTBA 2WCIA 1FPOA 1GTIA 5CO3A 2GT5A 2RM6A 5JCWA 4ZBBA 3GKNA 1SJZA 1EOHA 5JWRB 2GT6A 3H79A 3UVTA 1EV4A 1SK1A 4IN0A 3ZVJA 3S9FA 1FB6A 4K2DA 2IN3A 4QQ7A 2DSAA 3CMIA 4MJAA 1PKWA 2OCHA 2VUPA 4BA7A 3LG6A 4GQFA 5D8IA 3KCMA 4J7ZA 8GSSA 1Z5YE 5IMVA 2YANA 4TRXA 1PD21 4XS4A 2BMXA 2FCHA 4QL9A 1SD9A 4PGTA 1TI3A 4XRDA 5DDLA 2H70A 1Y6EA 4EC0A 2YWOA 4TR4A 2GUZA 2CZ3A 4EKZA 2GZYA 1XW6A 2N04A 2HSHA 2C8UA 3DWVA 3TKPA 4MZWA 4HQZA 2GUZB 4PQ1A 1Q4JA 1H75A 5FT3A 2DN9A 3IC4A 4XS6A 3LYPA 2YZHA 1O73A 2DMLA 2VD0A 4V1Ap 1AUCA 1LJRA 1F6MC 4HQSA 2YWMA 1SK0A 3WT1A 4HJMA 2L57A 4MDCA 3ZZXA 2YV7A 2LUSA 1R7HA 4GWRA 4D73A 1NHYA 3VWXA 4I2UA 1B4PA 4IT5A 4GSNA 1X9SB 3UO3A 4MABA 4PUFC 1AQVA 1ZYEA 3WYWA 1BYEA 4AJ6A 2RUFA 3FKFA 2BJXA 3GMFA 4I8BA 3F4TA 1PX6A 3PH9A 3KMNA 2H66A 3FR9A 1ABAA 2P31A 4J57E 1EWXA 4OCFA 1S3CA 1FB0A 1LU4A 1OC9A 3UBKA 4PQIA 1XWKA 3HZ4A 1GTUA 1XIYA 1JZOA 4WBRD 5ECHB 5IPHA 3MNGA 1OE8A 5C00A 1N8JA 1E6BA 3HZ8A 1G7EA 1OC9B 5HR0A 1O81A 2PN8A 2VCTA 5JCUA 2NDOA 4EUYA 1GUMA 3BCIA 1TOFA 3ME7A 4MCUA 1TTZA 3QAGA 4TXVA 1YF1A 2VAFA 2TRCP 5GAPD 3GL5A 4EE0A 2FWHA 1T3BA 3UCSC 1JLWA 2L59A 4I6XA 1TRWA 1GP1A 4JE1A 3ZIJA 2R5GA 1SYXA 5LCZA 3HCZA 4L5LA 1USBA 1XVQA 5A4VA 3IXRA 4TXOB 5HFGA 2FHEA 4Z7XA 1Q98A 3F6DA 4FYBA 4YAPA 1ML6A 4MJEA 4NWYA 3P7XA 1OYJA 4N0VA 2Z9SA 3TJGA 2Y4UA 3TCOA 3BBYA 3QDNA 1BQ7A 5ID2A 1FAFA 4OO5A 2K18A 1OC3A 5G2ZA 1TRSA 5GSSA 4MPFA 6GSXA 2L6LA 2VCXA 3IDVA 4Q5NA 4XS4B 5ELAA 4GTUA 10GSA 3RPNA 4K7OA 4KX4A 2GZPA 1M7TA 3VWUA 3G7JA 3ZMLA 1ST9A 2LRTA 1NSWA 2DIZA 4RQXA 4IW9A 3IAS2 3GN3A 1R5PA 3VWVA 2MBSA 3IRAA 2H6ZA 4JR4A 1J9BA 2CAQA 4POMA 2H19A 1ERUA 2WFCA 2E7PA 2DBCA 1PSQA 3GX0A 2JL4A 1PMTA 16GSA 3KJYA 2CX3A 9GSSA 1CQGA 5AIVA 3GHAA 2B7JA 4FYCA 2NBSA 3NZNA 2K8VA 2CTRA 2MMNA 2L5LA 1THXA 4KDXA 5KN1A 3ED3A 2F8FA 5ECMB 2H72A 3UARA 3BOAA 4NAXA 2PPTA 2C0GA 2QWNB 3GA4A 4ECIA 1YKCA 4POLA 19GSA 3ZL5A 5D93A 3W8SA 4BVXA 2L6CA 3M3MA 3FR3A 6GSSA 1U3IA 3MSZA 2LKUA 3CTFA 4PNGA 2LS5A 1ERVA 3DD3A 4O92A 3GV1A 1GUHA 1O6JA 2HZEB 3TKRA 2Y4TA 1FG4A 3KTLA 1M0UA 3FEUA 2C0FA 1AXDA 4KSMA 2ALBA 5HQPA 1JZWA 3TJKA 4IP6A 5D96A 3TJJA 1BQZA 2RIIA 4HI7A 3WGEA 3LGCA 4JEDA 4WF5A 1BAYA 2H8LA 3UAPA 1MD3A 2AUVA 2B6MA 2H1AA 2HXKA 4F0CA 2VL3A 2CQ9A 1QQ2A 4LL1B 4LMVA 1ZCPA 1JZRA 4GQCA 2F8AA
chains in the Genus database with same CATH superfamily
3E9JB 2FYUH 1KB9F 2DMMA 3EFFK 4IGJA 3C3TA 5E59A 3ZRWB 2IIYA 2VQEB 1I5XA 5JCGA 2JSYA 1QUWA 2VWKA 2QKSA 4TQDA 4DR4O 2EIKB 1XZOA 5L3EA 3RYHB 1GLPA 1M1KW 1J0FA 2C2AA 2XPDA 1XMQB 1YEXA 3VK9A 1P84F 3AG2C 1AP6A 1L0NH 1PPJH 5CA1B 5LHGA 2DJKA 3DMLA 5FPRA 3I56V 3HVVA 1VQKV 5LOVB 1ZGNA 3M8AA 3N9JA 1MTCA 4ML1A 4WBJA 3T1HO 3MDKA 1X4TA 2YDEA 2A2PA 4USSA 1F9MA 3ETQA 5LXTB 1BX9A 1M2AA 5HR3A 3ASNC 4JI6B 2PZSA 1W4VA 4LF5O 1Q43A 1VF6A 1WPXA 2X8GA 2HLDG 2HSMA 1HNXB 4I5SA 1TW9A 1KEBA 4RUVA 3U11A 1GTOA 3QF7A 1HNBA 2YOIA 2YWIA 1TDIA 5LP6B 1JFFA 4IIJB 5KUMA 3TCUA 1JZRA 2WRTA 1TK5B 4F6EA 4BIOA 3LWAA 4JAAA 1AP5A 3GKKA 1XOBA 4GX2A 3CEIA 4DR5B 2ZD9A 5ECKB 1NKDA 1VF5B 1K0NA 2BTOT 1ZZYA 3CSXA 3VOUA 1G0TA 5EBWC 2KLXA 1YZBA 2WA3A 4WETA 1R5AA 1SKVA 2WLLA 4FLUA 1GM7A 3QVNA 3LNMB 4OO4A 1HNWO 3B8MA 2ON5A 4XBFA 3I55V 1OC8A 4FO5A 5JWOB 2P06A 2BE3A 4YXWG 2ZNJA 2ZE8A 3JAMN 3ME8A 1OCCC 4G9HA 5ECPB 5DN6G 1TK8B 3FW2A 2XAGA 3ASNB 1SJIA 4IGGA 1PKZA 4WKWA 1H38A 1ZYPA 4WXTA 5ECOB 2EILC 3FB7C 3DSQA 2XBIA 4ML6A 4CC5A 1ZSPA 4PI0A 3SWLA 3CHXA 2HSYA 4O5RA 1GM9A 3F4RA 3IK7A 4JF3A 3CRUA 1NHOA 5ITZB 3GH9A 5ECQB 3BHPA 3U10A 1XW5A 2LV3A 2F43G 3QOUA 3K9SA 2CTQA 4GCZA 4YQVA 1NVPB 2FWFA 2I4AA 3A5IA 1SU9A 4U3FH 1V54B 5DJLA 4K7IA 1TRVA 2Z3YA 3GVMA 3GH6A 4JZQA 2F3MA 3LXZA 4TQFA 4WF9V 2GLRA 2AZ0A 2H01A 4XS1A 3TK1A 1EOGA 2E5LO 2A79B 3ASOB 3B8NA 3CD6V 1MDJA 4R7CA 1I94O 4JR6A 4JI8B 1OZ0A 5DAKB 2V2GA 3ZMTA 4EXJA 3MAKA 1B8XA 1FJGB 2YIDA 3W7SA 3KKYA 1CEZA 1UC7A 5KN2A 4X1KA 1MNGA 1TU8A 2WULA 4JYBA 3GX8A 4BVXB 1R73A 1PNMA 1O9GA 1IZ3A 5E1AC 1S3RA 5EYPB 2LEGA 3HY2A 2PF4E 2DJVA 2GQMA 1URMA 4W4KA 3A3TA 1XMOB 2Q7EA 1L8DA 3SJQC 2PMTA 3F3RA 5JJNB 3FAVA 5LBQA 4ECJA 4FM2A 3OUFA 2NR5A 2JJ2G 4DV5O 2C3QA 4MVUA 4EF0A 3ZMSA 4D7SA 1JHBA 3RYFB 4KNDA 1S5JA 3SPIA 5CB4B 1V57A 3P90A 1AC1A 3EWLA 4EIQA 2VS0A 3EU3A 5EZYA 1PQNA 3FAVB 5IOXA 3Q4HB 4I50B 4N23A 4RWUA 4MJBA 4I0XA 1EZJA 1SD8A 3G67A 5KA5A 3TKSC 4K5SA 4OFMA 6GSTA 2KP1A 2ZXWB 5IJ0A 3K0DA 2QWOB 5E4WA 1UPGA 3O65A 4MW8A 1KKDA 2TIRA 4FLXA 3RW0A 1U6TA 3GWKC 3D4TA 5KX5A 1AB3A 3BD2A 4NYKA 1HWYA 3WGDA 2VWJA 5B7CA 1SQFA 1QMVA 4QGPA 3UL3A 1I9DA 5A4WA 3K0GA 1N33B 4J11A 2CTWA 4G19A 3OW2U 1T7PB 4F03A 5BR8B 3KZIZ 3GNJA 1EEMA 3O76A 3TRPA 2FWGA 1LR1A 1RPRA 1ON4A 1M9AA 5GZZB 1US6A 4YKFA 2VQFB 4FK5C 2HT9A 4DV2B 2YV9A 3QD9A 1I7FA 2GQLA 1ZTEA 5IYZB 2YIBD 4EFBA 3RDWA 2RDCA 5DECA 4DV1B 2A3QA 4H13B 3HD5A 5ECNB 1Z6NA 4DR2O 1IBLB 4NVPA 2YNXA 1F37A 4UXNA 4O4HB 1PGTA 2O57A 4N21A 2YCDA 3CCLV 3ZHRA 4QPJA 4TV9B 5EC1C 3FD9A 2GQKA 5J9CA 4I55A 3CYNA 3T1YO 1Q90D 3BPZA 4JAUA 4YY3O 4YHHO 5FHIA 5JWQB 2OBIA 4DUZO 1C72A 17GSA 3THOA 1UN2A 4KAEA 1XWBA 4HZ4A 1GTBA 4I9QA 4HZ2A 4B3TB 2F1MA 4NXIA 2MZCA 2IL3A 1V58A 3NIVA 3L0HA 4UV8A 2B7KA 4MZBA 1R3IC 4WFGA 4LFBB 1KYOF 2UUBO 1PN9A 4BL7B 2P90A 3ZN0A 4DV5B 5IMDA 2C3TA 4TVEA 1VMGA 4PA9A 2HG5C 4GUNA 2VO4A 4BVYB 3C73A 4GSTA 3SJAC 4X64B 2HYXA 1BCCH 2LRNA 4Z2WA 1KQSU 1EN4A 1XI1A 1WA8A 1XNRB 1FJGO 4O5UA 1VQ9V 4E2LA 2I3YA 5L3DA 2IFQB 1FXKB 1XEQA 4W4LA 3QR6A 3P30A 3AEIA 4ZL9A 4IHUA 1A0FA 3RVZA 1VF4A 1VQ8V 1HNCA 3HHVA 2QJ1A 3JD3A 1VQ7V 2RJZA 4NR1A 4OPAA 4J7KA 4PV1B 2ZM6B 3P32A 3FB5C 4WFHA 3CMEV 1KBNA 3IAM2 3K8NA 4TXOA 1IDSA 2B3SA 1SETA 4JU5A 1XL4A 2EINC 1AJPA 1BQ0A 3ZN1A 2A4HA 2VL9A 2X64A 3CBUA 3GKMA 4OD7A 4LF8B 1THOA 3G80A 2QTOA 4UCUA 2UUAO 1PN0A 4KCEA 1K97A 4CDOA 3IC8A 1BEDA 2GDSA 4YKGA 3E8BA 5COHA 3JSLA 2WLJA 1AQWA 3GTUA 1GMGA 1RP3B 5CRWA 3R2QA 4DSSA 4LCUC 1YZXA 2QSAA 1LUWA 5CBHA 2HI7A 3RYHA 3OMAB 3JCUZ 1EGRA 2QM8A 1B4QA 3BRCA 4TUYA 3Q19A 4X0XA 5B6MA 5GW7A 4KDUA 2DIYA 4ZL7A 1XBLA 2WS2A 5JVDB 2IMIA 3EURA 2C0EA 3IPZA 2J9HA 3UEMA 4HNAA 2XAQA 2LRCA 2ZNMA 1IURA 2X6AA 1QR9A 1Q7YW 4YQMA 4HEA2 1JJOA 4MVOA 2BTOA 2YN1A 2LW1A 5AN1A 1JQ0A 4DR1O 2FGXA 3I6AA 2E3CA 1Z9HA 5LD0A 3F5TA 1D2DA 5EVOA 2FY6A 5JH7A 3CRTA 3QMXA 4O7HA 1YF0A 4ICGA 1N34B 1IXMA 2YEVA 2H1DA 1F3AA 3DXRA 4GKKB 2CV4A 5J5NA 3OR6C 4H86A 1EZVH 4C7UA 3RYIB 4DV2O 3IJ4A 2YPMA 1GRJA 2BSKA 3HYPA 2HVKC 1JLVA 2VLTA 3T4ZA 2MBTA 3K5NA 4BIZA 1RSOB 2Q68A 4LH7A 1HNZO 2HP8A 4O5QA 3DGQA 4QL7A 4GKJB 3C1SA 2WA4A 3JD4A 3RYCA 4WEYA 4F6RA 2HLSA 2HRAA 4LNUB 1M5IA 2P5RA 3PJSK 4HDEA 2IMKA 1VQNV 3ABKB 4J80A 5L3BA 1X59A 5IQYA 4KFMA 3RVYA 1FXHA 1K0OA 2RQ6A 2OYQA 4DSQA 3A2XA 2YUAA 2I9HA 3IC7A 5KAIZ 4KL1A 1K0DA 2RCVA 1GN4A 2QTSA 1QK8A 4J56E 3UBLA 3VFIA 2CVBA 3UVHA 1ZYQB 1N36B 5DALA 4YAVA 2ZCEA 3IE3A 1FHEA 1G6YA 4JRRA 5J9BA 3IK9A 3KXOA 1WB7A 4LMWA 2JVDA 2ITDC 5KUKA 1UVZA 4BWSA 4WFFA 4FH8A 1TVKA 4K1FA 4R6ZA 1T1VA 4MTOA 5DALB 2D3OW 1CPYA 2DYRC 2QKAA 3N2GA 5B6NA 5DM6V 2JSZA 4AJ8A 2H73A 3DTUB 3RWRD 2HNLA 4GLXA 3O6TA 4IL6Z 1RPOA 5GONB 1M57B 3RFRA 2OE1A 2YWNA 1Y25A 3CCSV 3GUSA 4MS2A 2MW2B 2AZ2A 1PRXA 1SZTA 4OX9B 1BZKA 3ZCCA 1LUVA 1U88A 4X9QA 5BRTA 1A2JA 5EL8A 2JADA 4UCOA 2A4VA 5CNWA 5GONA 5DJMA 1GULA 2QWRB 3CRCA 3G7YA 5LXTA 4DV6O 1PX7A 4KGIA 5HFMA 4P3YB 1VF6C 1HYUA 2FL4A 2IBZH 4DV0O 3ABLB 2DLXA 4EDYA 2BTQB 1DUGA 3EINA 4N10A 3VWWA 1W2BU 4CHSA 2KQXA 4OMVA 5AIXA 3U6VA 4O4IB 3DKSA 2YICA 1N32O 5D9XA 3OT7A 3EE2A 4HOJA 4ZBAA 5A9GA 3KGKA 3M9JA 5AISA 2NTOA 3AK1A 4JTDB 2PI4A 1MG1A 1BHAA 1GSEA 3ETDA 1XWCA 2M46A 3GSSA 1EZKA 3JSNA 4JI7O 2CVKA 2V41A 1GSQA 3VPTA 1QLEC 1AI6A 1K3EA 4FZ1A 4HNAB 4NXMO 1OCRB 2N5BA 3O9OA 4PA7A 3SYOA 4UVBA 1SL2B 1E1QG 3GRXA 1NW2A 1M2DA 1Y76A 4PQHA 4HJ2A 4JI4B 3N27A 1H2NA 3CSHA 4TR1A 5JQGA 2A7WA 5CRGA 5IOWA 3DC6A 3EMPA 3F6FA 2EIMC 1U87A 5C8YA 5CRHA 4Z2TA 1PA3A 4PDRA 3SPJA 2VL2C 3APSA 2FMLA 2OBKA 1NI8A 5AGYA 4WR5A 1WRYA 2DJ2A 1M3IA 1S3DA 4JI6O 4NHWA 1T8EB 3BAAA 5KHGA 3TRQA 4HYOA 1N4CA 3FYEB 2CGNA 5IE9A 1P4RA 1YQ1A 1Z6MA 2GSQA 3FRCA 1HD2A 3TKSE 4Q6GA 3SYPA 5CAXA 3ZRSA 1M56B 3E89A 5H5NA 4K0GA 2KSDA 1OCRC 4JPRA 2NN4A 5CBGA 3J7Yk 1RFYA 3E22B 3WD6A 4YJ2A 2REMA 1YJNV 4NV5A 22GSA 1GSSA 3M99B 1M56C 4BW5A 2OCCC 4AQYB 1YY7A 1H8HG 1TU7A 1ZYNA 4K7NA 4JI7B 1DF5A 1Y74B 1YKAA 4AGSA 2AV4A 2WAMA 2LJAA 1NJIW 4JI2O 1TRUA 3S3XA 3L9VA 1HQOA 1VIBA 2C1YA 6GSWA 4LF9O 2XPEA 3ZS8C 4QE9A 1WMJA 5ECLB 5DQSA 2Q4PA 4DSSB 5CRDA 4XDLA 2DE0X 4WFBV 1Q86W 3L9DA 3GTUB 3TDGA 3VPQA 1WPIA 2HJFC 1KC8W 1ZMAA 1OCOC 2CAZC 2WWWA 3OFNG 1EGOA 1KUQA 1Y4MA 4AHCA 5D5PA 3US3A 3KIJA 1BG5A 4NXNB 5JVDA 4ACSA 4FMTA 2Q6AA 2NLJC 1NU1H 2PY5A 3ETEA 3TRXA 4LF6O 2QGVA 1AIUA 3CWBH 4XDJA 2RN9A 4OFTA 4PX1A 5CP1A 4X43A 2DJJA 2WLNA 4K5RA 1U97A 1MMMA 5KEJA 4X8AA 2AXTZ 5GSTA 4PA6A 3K57A 2P5QA 3DXRB 2F9SA 4XCSA 2PU9C 1CQHA 2D2ZA 4X1YB 4UB8Z 2QA4V 3FK8A 2IH3C 3Q6OA 2K6VA 1OCZC 1XPVA 3FR6A 4GRFA 1P7GA 2DQ3A 3OM3B 4JZGA 5F0GA 1JFFB 2R37A 2GS3A 3CXCU 2IMFA 3L9SA 4Z2UA 4UV9A 4TR0A 3F5WC 3FFQA 1KMIZ 3EXAA 3BA9A 3JD1A 2P6JA 3ZYWA 4DO2A 3JALB 3ZLPA 1WLEA 5J3RA 3C7MA 2YJ7A 12GSA 2ZE6A 4TUYB 2A2RA 4BAYA 4ZB8A 3ISOA 1FD9A 2PTMA 4POBA 5KN0A 4B3MB 1U3AA 4ECBA 2XT9A 4B3RB 3JASB 5G5EA 3CQFA 2GTSA 3T1CA 3PGTA 1M90W 5BY1A 5KHKA 1SC5B 3R65A 2DJ3A 4IIJA 1DGSA 3K08A 4CH6A 3D3IA 4ZILA 1P49A 1A23A 4BL7A 3LW9A 2OE0A 2UXDB 4NPBA 5H2FZ 3RYCB 4KHPO 2IJHA 4LFCO 5IDJA 3LORA 4HS1A 6GSYA 2PBJA 3DRNA 4MZCA 5LMNB 1HP8A 2UXCO 5IM9A 4DVCA 3SDLA 1D5NA 5G5FA 1QVGU 1K33A 2P67A 4YH2A 3DGEA 3CE2A 1K0MA 3BABA 4LR3A 3HA9A 4J41A 3W8JA 1PM9A 2NNUA 4MVQA 5KMGB 5FWGA 2OJLA 3ZHVA 3D36C 3Q18A 4DRXA 2LNSA 3UO2A 4LWSB 3HVNA 4JYAO 2E76B 2LTKA 2DJ0A 2YC0A 5F05A 2H0HA 1YCIA 4JI1B 4FM1A 3IGAC 1SL0B 3SYCA 2HZEA 3GYKA 4XHMA 5EPFA 2OTLV 1SJ6A 2ARHA 3CCRV 3KD0A 2H1GA 5DAKA 2E2MA 2MMZA 1VQ6V 4GX5A 3E86A 1OKTA 4V1Ag 3ZIAG 3G7IA 1F4MA 2DYRB 4I50A 1NS1A 4DW1A 1S3AA 3IBHA 4QJFB 3EVIA 1GH2A 5IIZA 5A4UA 2HEPA 3R66A 1MDIA 1XMOO 4GKKO 2F95B 1KBHA 1PFOA 2VCQA 3UM7A 5B3SC 4X65B 1EV9A 1GAXA 1Q8IA 2KG7B 3HKBA 1ZOFA 1K0BA 3CC2V 4ZBDA 1SKRB 2E75B 4IQ1A 1X5DA 2KG7A 3WG7B 1SA0B 2JS5A 3W7TA 4L0UA 1FW1A 5EYPA 2IMEA 1UFIA 1AAZA 2GSMB 4FYUA 4WFAV 3IHQA 5KOXA 2UXXA 1T5EA 5DQYA 1NTKH 4GT1A 1IYHA 3AG3B 1X0RA 4X1IA 4TSFG 1GKFA 4G0LA 3MDSA 2H6YA 3RGBA 3ZHUA 2ZQMA 4Q5FA 4U7OA 3OGIB 18GSA 1TP9A 3FY7A 1GN3A 1YF2A 4JI3B 2HRFA 5KHHA 5D73A 1OHHG 4MVMA 3HKDA 3MHHC 5HFKA 2WJUA 3F7VC 2R2JA 5G30A 1GL8A 4ZHQB 1HNXO 5EY6A 1DF4A 2RUEA 3K58A 1X9MB 1IXBA 3F3QA 1GH6A 4B3SO 2G38A 2ZR3A 4WFEA 3X2QC 4KH7A 3J80N 11GSA 1OCCB 3QG5A 1Z7PA 3TKQA 2IW5A 2KUCA 4LF4O 3EMXA 2H0GA 2FB5A 5C93A 4O4LA 5B1NA 3ZMVA 1KTEA 4JI1O 1ERWA 4WR4A 1O8WA 3HVXA 2O8VB 1KKCA 1TA8A 2UUCO 3KH7A 2PUKC 3O3TA 1XNRO 4K8MA 5LYJA 2K9FA 3FB8C 3J7Yb 4I5QA 3B77A 2AAWA 1XILA 4O2AB 5IJ9B 4X62O 6GSVA 4LF5B 5BMVB 1JPXA 2EIJB 5BXZA 1YXBA 5KHIA 3I43A 5D9VA 4O2AA 1A8YA 3KEBA 2WDUA 3CB2A 3TXSA 3F63A 2CX4A 5LA6A 2ZE5A 3K03A 2VCZA 4IQAA 1GNWA 4JI3O 2EIKC 4EO3A 1MD4A 5J41A 3AK2A 1GSYA 3L9UA 3GL3A 4QNHB 3N5OA 1L0LH 4IELA 3SYAA 1K5QA 4EEQA 4BR6A 3J81N 2WLMA 1Q6IA 4F82A 1XNQO 3M0FA 3CRAA 2P22C 4V2NA 2GVPA 3SJCC 2WB9A 4GYCB 2GSSA 4JI4O 4FIWA 4ZIBA 4DR7O 1EEJA 3AG4B 2IPAA 4TKYA 3L73H 1N0NA 2XASA 1MOFA 4K0NA 2RLIA 3W7WA 1FAAA 1VF2A 3GB7C 3PR8A 5L71A 2H94A 2ZUPA 1KU9A 3EU4A 2FLSA 5HR1A 3E3EA 1NH2B 3WB1A 1G7OA 2YS8A 2KHPA 3OAAG 1V54C 4JI0O 2OE3A 4ID0A 4IKHA 4MF5A 1S77D 1PL1A 2QWQB 1ACVA 1VRSD 4G2EA 1FO5A 2AYTA 4F4LA 3E8GA 1S72V 2QM7A 5D5QA 3L74H 2ZM6O 3T2MA 2VL2A 7GSSA 2B5EA 2E2GA 2UU9O 2VM2A 2W6IG 1V98A 1R6TA 2N74A 3CYOA 3OE7G 1GSFA 1QU7A 3PN1A 1O7UA 4I4TA 4JI2B 3ZRWA 2L5OA 3OEEG 2WLIB 4NB5A 4DEJA 4WCEV 1XUQA 4GZRB 3HKEA 5JJEB 3GURA 4ISDA 5JQGB 3FZAA 4L0WA 3FHKA 1B3QA 2QGNA 4KDYA 4KB3A 2E0QA 2XHFA 2B5YA 2PGTA 2A2SA 1K3OA 3M1GA 2HRKA 2KB1A 3OEHG 2LQOA 4GSSA 2F66C 2V1MA 1GTAA 2ZKOA 4ZHQA 4KXRA 5LOVA 3UT5A 4EB6A 2F8AA 3A0BZ 3QFAC 1R3KC 3PPUA 2VQEO 1O85A 4E4EA 2K8SA 4JGSA 5ECSA 5IY5C 2B1GA 2RM5A 2CA8A 3ZREA 5IYDO 1TXXA 1XREA 4J10A 2R6KA 2DWEC 2OACA 4B7EA 1X9WB 2JGUA 1N2AA 1SYRA 4YJ2B 3G71V 4OFNA 1R1BA 1TUEB 2WLKA 3CS5A 2BTQA 2OTJV 4OX9O 1JFUA 4K6XA 1TKDB 1BMFG 3ERGA 1Q81W 3E83A 1Q5OA 4MH3A 4N11A 1FVKA 2H76A 2RMKB 3SJBC 3KM6A 1QLEB 1WJKA 4ZB6A 2L4CA 2MYGA 3TUEA 1SA0A 2B1LA 3MYDA 1XL6A 1SK2A 1FOVA 4UVCA 3F0IA 5EBMC 3JD0A 3HKCB 4J2FA 1WB8A 1QCEA 1XXUA 2G2QA 4PXOA 2HFDA 1YIJV 1MSWD 5IT9N 1GWCA 1Z5WA 2L4QA 3EPTA 13GSA 2JGDA 5EZYB 5CB4A 3RT3C 1HDJA 3NXSA 1PL0A 3T4DA 3LYKA 1TAEA 3RPPA 1K3LA 4X64O 1LBKA 3ABMC 2K1EA 5CYYA 3W7UA 3QO8A 1DSBA 1YJ6A 4U7NA 1ZL8B 1O9HA 2Q7GA 2QSIA 3CCMV 2H30A 2X8HA 3E8FA 4RO2A 5AG2A 4CC6A 1I5YA 1ROPA 2DMXA 3C71A 4NTYA 1QLNA 3G6BA 1A32A 2W0XA 3OR5A 1WP0A 2ZIOA 4DSRA 2A0LA 3D0ZA 4G0IA 1XWAA 1SKWB 1YI2V 2GSTA 3HKDB 2JZTA 1WOUA 1G8MA 1GM8A 3AG4C 5IMFA 5KX5B 5H9CA 3E0UA 1QBZA 3UJ1A 3TB2A 1O8XA 2GTUA 2OA7A 3A5WA 2CK3G 2VLUA 3JATA 2FWEA 1ZUQA 2XAFA 4DXWA 2ZDIC 3D5JA 2EC4A 1MZFA 3CRRA 2DQ0A 5H5SA 5J4UA 4WBNA 1S0VA 2CZ2A 2NPBA 4JV5B 5LGTA 2YIAA 1AR1B 2UXNA 3TKSA 3AG7A 4MJCA 2GZZA 3LDEA 1JJ2U 3W6GA 1XBSA 3LFLA 1NZ6A 2H3OA 2Q0OC 4DV0B 4TV9A 2X8CA 1G6WA 3P2AA 5DEDA 3E2EA 4PTSA 2VM1A 2Q7HA 4G2KA 3KP9A 1P7BA 3K9AA 4MTFA 4AQYO 4R50A 2ON7A 4HU7A 4KUNA 2QWPB 4RI6A 1SQXH 4PDVA 2BOCC 1K34A 1QQCA 1LNQA 2M7WA 1VQPV 1M2BA 2EX3A 1QGVA 1YITV 4NHZA 3VBBA 4P9PA 4TR1B 4I2TA 3CXHF 2MMAA 4QE7A 1F4NA 3IOSA 1AI7A 2VLVA 3W7XA 1VP7A 5LMUO 1WJZA 3AG3C 4EIPA 3E8HA 4X66B 1YJ9V 2BCCH 3CXGA 3D4MA 4ZIJA 2Q69A 3SBCA 1R4WA 2PUSA 1PD3A 3IA1A 5DCGA 3ZITA 2LJRA 3ZMKA 2HZFA 1RW1A 4UCVA 1Q82W 4PHZA 2JACA 1WP7A 1FFTB 3KG2A 3HVSA 4FPPA 4EB6B 4GKJO 1B6QA 3JCZA 3H01A 5E79Z 1J08A 3TOTA 3FB6C 3ZMUA 4MP4A 3ETGA 5JCOC 4ZI7A 4CY8A 3Q74A 1YSCA 3BEHA 3C90A 3P3NA 1H2MA 4I0XB 4HU9A 1YTFD 1OE7A 2O87A 1VF7A 5D9WA 2ITCC 5CMUA 1DE1A 1JA8A 5F07A 2O85A 2X99A 1N34O 3LSSA 3SR2C 3D21A 5B5EZ 4JAVA 5J2TB 3ZVJD 3SPGA 5FL7G 4O32A 4LLRA 1A2MA 1KECA 1M93A 1RK4A 1N8RW 2QR4A 1R26A 2H0IA 4KUMA 4EDZA 3GFKA 3GWOA 4U3JB 3LDDA 3ZRVA 3QAVA 2V6KA 1JMKC 2EZOA 1HNZB 4Q5QA 2P4KA 3HR0A 3EYTA 2Q0AA 2JEUA 3QCPA 3K5MA 2P0GA 2XC2A 3CP1A 1VARA 4RAIA 2EIQA 3AG1B 3ZTLA 2V7QG 4BIUA 5LYJB 4U3JA 1V9WA 2E74B 1WE0A 3GSTA 4V2LA 5LNKe 5ENUA 3ABKC 4YJ3A 5JCOA 4LF9B 5ABRA 4YIOA 3EC3A 4UCSA 2KP2A 3DEXA 1GLQA 4IP1A 5G1KA 3TJFA 3K79A 1UJWB 1OKDA 4ASUG 4PURA 2N5FA 5DBQA 2X7RB 1S3JA 3HKRA 4RQFA 3JCML 4BPYA 1OV9A 4LFAO 4GF0A 2AJQB 3K59A 5L3FA 2FNOA 2H6XA 1F3BA 1SENA 1Z7RA 1PL4A 4CH5A 1MA1A 3OD4A 1DBYA 1NT2B 3CSJA 2F51A 5B8BA 2YZUA 2UXBB 4Q5RA 1SL1B 3F4SA 6GSUA 1PKXA 1FFXA 2CVDA 2PVQA 4FVMA 1B9YC 2UUBB 1IYIA 3H8QA 4KE3A 2R9AA 3CCVV 4DK1A 4GLTA 3G9BA 3TJBA 2Y0IA 1OJHA 2GTAA 4MH2A 4ABMA 2H8PC 4XDKA 3P8WA 4MMMA 4DYLA 3ABMB 1V55B 1RM1C 4D73B 3CRMA 1AR4A 2DKHA 1T00A 2CH7B 5C04A 1X5CA 1W89A 2QKEA 1M9BA 1K0AA 5CA0B 4L8EA 3WT2A 3CRQA 4I97A 4ZXGA 3F8UA 4ECCA 4G10A 5DVBA 3ZIVA 4JI5O 5B1BB 2R9IA 3D22A 4PDMA 3H1IH 1EN5A 1AI5A 2KKWA 2G0FA 2OADA 4L8JA 1F51A 1XMQO 2JZSA 1DTOA 2EIRA 4JYAB 3CTGA 2VCVA 3UKMA 4LF7B 4DR2B 4DUYO 1IBLO 4E8EA 2XAJA 4TV8A 3HJOA 1FXKC 5EC2C 2C3NA 2YP6A 4HBNA 4B3SB 5LMNO 2L6DA 3VQVA 5IJ0B 1GUKA 4BWQA 1PNLA 3H1NA 4FFKA 5J2UB 5KN3A 1MZEA 2IJYA 3GIXA 2X0LA 2PERA 1W59A 2CT6A 2DJ1A 2VOCA 4H37A 3BJ5A 1SKSB 1E79G 3KP8A 4R8CA 2V6OA 1B06A 1A2LA 3VI7A 3NOFA 3K3WA 1VQOV 3WB2A 3BA8A 5CREA 2QKCA 4X62B 4GX1A 2LFSA 5G31A 4GX0A 3P3PA 4GXZA 2R72A 3STLC 4N30A 3ZFLA 2WLLB 3HB3B 4MPGA 1IBMO 4IBPA 1WIKA 4ZB9A 3HXSA 1AILA 1U96A 2ES7A 5G1LA 2J23A 3H1KH 4IVFA 4EFEA 2HKOA 5LGNA 2EZPA 1AQXA 2IMDA 1Q3EA 4LF6B 3FX7A 1AR5A 2QM4A 3PINA 5HFIA 3LNNA 4QIWF 4TOIA 3CJHA 2B1KA 4ZL8A 5IPGA 1HR0B 4NTXA 4X65O 3A8TA 3FZ5A 4N0ZA 2OIGA 1XFLA 1V2AA 2A06H 4LFAB 2O89A 2EIMB 1G1XB 3VQWA 2GHYA 3HKEB 3ERWA 3RBTA 1XW9A 1EP7A 2O7KA 2LO1A 3OMNB 1XG8A 2ZDIA 3LSZA 1VF3A 3IR4A 2M6YA 1T4YA 2QA1A 1SF9A 2Q5ZA 1BE3H 4BIKA 5IMCA 1A8LA 4RUFA 1T4ZA 2VIMA 2DW4A 1I94B 4E8HA 4CW9A 4O2BA 2FA4A 3LXTA 4KCAA 4LWSA 3B2EE 3KH9A 4YQUA 4X1UA 3I9V2 3ZBHA 4X1KB 4MF6A 4MLYA 1A24A 2OCCB 3VLNA 4ZBMA 3ZRDA 2H71A 2ADPA 4JTAB 1EP8A 2YIBA 3C8EA 4O4JA 1WAZA 3QAWA 3M9KA 2FD3A 5HR2A 1GNEA 3HDCA 2D2CB 2OKAA 3FZ4A 4DK0A 2IM9A 1YDKA 2XBQA 1HNAA 3RAZA 2YXHA 3L70H 5DCHA 3MD0A 3B09A 3L4NA 3IC9A 4FFBA 5H6RA 3ERFA 1TK0B 1VQMV 3C1RA 2YI9A 3J7AU 4LF4B 3U5RE 1BJXA 2UXCB 1A0RP 3ZFBA 4YY3B 3WFVA 1Z5VA 3IV4A 3GKXA 2PI5A 5LP6A 5GTIZ 3RBZA 1W0KG 3HKCA 4LC1A 5IMAA 3D3QA 1MEKA 2CTPA 2EILB 4DV4B 2VCWA 4PNFA 5K1PA 1QR8A 4FFBB 4CBCA 1AI4A 3APOA 4JYYA 4PA3A 2N5AA 3DYRA 1NTMH 4UB6Z 3UOMA 5KHJA 1TI1A 2C0DA 1EN6A 2DWDC 2GGTA 2JU5A 2WGRA 3SYQA 1ZLZA 3A2VA 3BCKA 1Y66A 2Z5UA 2I81A 2NVLA 2C4JA 4IJ3A 1SZXA 3K5OA 2M72A 3DIEA 5A5KA 1OCOB 4FLZA 4MW3A 5J9PC 1WP8A 1ILOA 3CCJV 3I69A 4TN8A 4J42A 4KHPB 3STZC 1KP3A 3T1HB 2MMOA 4AJ7A 4AF2A 4X1YA 3SPHA 2HRNA 3WG7C 2M80A 2R0PA 3HJMA 2R4VA 1WWJA 2I1UA 5IO0A 1KNGA 4BVYA 4RUEA 5IWAO 1V40A 2HJDA 1XVWA 3H93A 1XWGA 2YSUB 2V1DA 2DC5A 5F2VO 5JJJB 3F9UA 4IJIA 2LJKA 4TOPA 2LJ2A 1XCCA 1CP9A 1IX9A 3MWHA 3L78A 3S3WA 1XOAA 1MDKA 2LSTA 2CAIA 5H5RA 1AJNA 3TJTA 4FJCC 5CN0A 3FMWA 3TOUA 2LGWA 4LL4B 1B9XC 4B7KA 1R3JC 3QFBC 1B04A 3DXBA 2QEXV 3CMAV 3TGZA 3BCCH 1GN6A 3IFXA 1Z3EA 3BFRA 4JASA 1H2SB 4NV2A 4POKA 1NBMG 3M8NA 1NR7A 3ASOC 3CSIA 4XRAA 3K04A 4CH3A 4K8XA 1H2KA 4KA0A 3OTFA 5JWPA 1TJDA 3ML0A 1VF1A 2FA8A 2H74A 4ZOLA 1YEWA 1Y67A 3ZHSA 1ERTA 1K3YA 4ULXA 2GDRA 3H4KA 4HAMA 3JARA 3CC4V 2WZ9A 4MSWC 4EL1A 5ECRB 3AG2B 3LEFA 3A2FA 4IHJA 4P9OA 1DE2A 5F8BA 1FVJA 1JZDA 2ZINA 2ZCTA 2Q67A 2FUG2 1Y74A 4KW6A 3BVOA 2CH7A 1ZWIC 4CH4A 5FLXN 5ECIB 1NM3A 1OAZA 3AY8A 5FPOA 2R0CA 1Y76B 3N2KB 1ZL9A 1YVWA 3I5DA 2AHEA 1UA5A 5B1OA 2FTKA 4JBBA 4A5PA 1H4OA 2MK3A 2YJHA 2DKIA 4K2XA 4X4JA 2QDOA 1NVPD 2EIJC 5BZBA 1EM1A 1Q6HA 3WGXA 2IWTA 4OWYA 2CUGA 5IMZA 1AVMA 3LJRA 2JZRA 4LH6A 1SERA 1QXHA 2V32A 1J5EB 1K4DC 1TUBA 3DVXA 4ILFA 4MA9A 2AB6A 5F06A 3FYIB 2PVOC 3ICXA 3R3EA 2F4VB 1SQVH 2OT5A 1KD1W 1I5GA 3MAQA 3A2WA 3E35A 1K7DA 4L87A 4WBNB 2QC7A 3LQ7A 5KOWA 2GBOA 2JJ1G 4FZ0A 2UXBO 4TWKA 1X5EA 4LP8A 3FKSG 2C80A 1E2YA 4Z1VA 4MF7A 4RQRA 4V2MA 2LQQA 3BY6A 5IO2A 1B48A 2EIOA 2PWJA 4X88A 1NH2D 1H8EG 1SQGA 1RQMA 2EJ7A 3EVKA 1PL2A 3LUTB 3APQA 2BOBC 5IJ9A 1FKAO 1XHZA 1AW9A 4IS0A 4J9YB 2KOKA 2RNBA 2B5XA 1XNQB 3KZQA 1THZA 4MNNA 4PUAA 2H75A 4B3RO 4GCIA 4F0BA 1YEPA 1R6NA 3DVWA 2PGGA 3HJPA 4MK3A 4X20B 4A5UB 1K0CA 2WLIA 4LA1A 2DYSB 4HSCX 3QNEA 2P5OA 3AK3A 3VURA 4F2IA 3ZMZA 3K06A 2AGAA 1J5EO 1F2EA 4I4TB 4OCEA 1W0JG 3JAKA 1DK1A 4XIHA 2BSKB 4EVMA 1SESA 5EBLC 3RYIA 1OVNA 3JAWB 3UMAA 1H2GA 5ELGA 2H1BA 4F9ZA 1QFNA 2QE7G 2JK5C 3ZHTA 1GRXA 4NMUA 4BW9A 3K5LA 14GSA 3KMOA 3JAKB 3RHBA 3H1HH 1Q6UA 3F7YC 2R3XA 2IJJA 4WF4A 4UFZA 3G6EV 5KMGA 1SQPH 20GSA 4O4JB 5B1AB 1KP2A 3MHSC 1SQQH 4K35A 3RHCA 2VD1A 5D9TA 2N05A 4DR6O 3JATB 4X89A 4HUAA 1RSOA 4TW5A 4K0KO 2PYLA 3D36A 5B1AC 2UU9B 2HE3A 2TRXA 2IFQA 3FZ9A 4L5OA 1IVSA 2P4VA 4AILC 3QO5A 2GSRA 1GSDA 4RI7A 5H5QA 1GSUA 1M99A 3D6IA 5BMVA 4KSOA 1N33O 3VI5A 3FYGA 4XTSA 4UUJC 3UIWA 3KCYA 4YHHB 2YXYA 1S5LZ 4K9ZA 5B8AA 4IHJB 2ZXWC 1CXZB 3VQXA 5GAND 4KP4A 4B3TO 2HHHO 1DLBA 3QPMA 1NTZH 3V1WA 2LNTA 1SQBH 5ID2B 2GV9A 2HVJC 2ILMA 2IJIA 3OUSA 2ADQB 4JI0B 1VGLA 3KTBA 4PDLA 1FS0G 2WCIA 1G6UA 1YJWV 2VRZA 4ICYA 1FPOA 4MVZA 4CY6A 4TV8B 2Y69C 1GTIA 5CO3A 5FNVA 2GT5A 2RM6A 5JCWA 4ZBBA 3GKNA 3CJHB 1SJZA 1EOHA 1L1FA 1XQ8A 5JWRB 2GT6A 3H79A 3UVTA 1EV4A 1SK1A 4IN0A 4ZI7B 3ZVJA 3S9FA 1K92A 2WSSG 1EFRG 1FB6A 4K2DA 2IN3A 3CX5F 3ZJZA 4QQ7A 4CZZA 5HFLA 2DSAA 2ZE7A 3CMIA 2L35A 1BGYH 1PKWA 4MJAA 2OCHA 4LFBO 1S5HC 4OPHA 2VUPA 4BA7A 4CS2A 3LG6A 4GQFA 5D8IA 3KCMA 2Z0AA 4J7ZA 8GSSA 1XHXA 1Z5YE 5IMVA 1V9PA 4B08A 2LW7A 2Q73A 3E22A 4DR5O 2YANA 4TRXA 1PD21 4XS4A 2BMXA 2FCHA 4QL9A 1SD9A 4FLWA 4PGTA 1TI3A 1G4YB 4XRDA 2H70A 5DDLA 1Y6EA 4PA4A 1VEWA 4EC0A 5LL6Y 2YWOA 1PNKA 4TR4A 2GUZA 5LGUA 2CZ3A 4EKZA 3CC7V 1TGOA 4PI2A 4TT3G 2GZYA 2X49A 2JS3A 4DR3B 1COWG 1XW6A 4DR6B 2N04A 4MTXA 2HSHA 1VQ4V 2C8UA 4CS3A 3DWVA 4NTWA 3TKPA 5IYZA 2UUCB 1S76D 1I08A 4MZWA 4I9WA 4HQZA 2GUZB 4PQ1A 1Q4JA 1H75A 1K9MW 5FT3A 3JD2A 2DN9A 2Q8VA 3IC4A 3LYPA 4XS6A 5H6QA 1JVMA 2YZHA 4I55B 1R3LC 4X1IB 3X2QB 4FLVA 1O73A 4JI5B 2DMLA 2VD0A 4V1Ap 3NR7A 2YXLA 4DV4O 4NKGB 1AUCA 1NR1A 2XTAA 1F6MC 1LJRA 4HQSA 2YWMA 5B66Z 3L75H 1FXVA 1QHTA 1M9NA 1SK0A 4PJ0Z 5BR8O 1MSDA 1WA8B 3WT1A 4HJMA 4O2BB 2L57A 4MDCA 3ZZXA 4FM0A 3ZEDA 1MABG 2YV7A 2LUSA 1R7HA 4GWRA 4D73A 4Z1MG 1NHYA 3VWXA 4Z2RA 1AJQA 4I2UA 1B4PA 4IT5A 4DR1B 1URFA 4GSNA 1X9SB 4OXSA 3UO3A 4MABA 4JYCA 4PUFC 4J7JA 1AQVA 1ZYEA 3TGUH 4PELA 3D8CA 2IU0A 2ZNIA 3WYWA 1WNSA 4DR7B 2IJKA 5IY5B 1OCZB 1BYEA 1QNMA 2XOKG 4AJ6A 2RUFA 4O4HA 3ZX6A 3FKFA 2BJXA 5EK0A 3GMFA 4I8BA 2QA2A 3LDCA 3F4TA 3H1LH 2B5UA 2HR3A 3Q4HA 5GTHZ 1PX6A 3PH9A 2EINB 3KMNA 4JV5O 3G4SV 2H66A 3FR9A 1ABAA 1N0JA 2P31A 3OR7C 4J57E 4G28B 5KAFZ 1EWXA 1K5SA 1S3CA 1TVKB 4OCFA 4MVRA 1FB0A 1LU4A 1OC9A 2Y69B 1D5AA 3UBKA 4PQIA 1XWKA 3HZ4A 4DV3B 1GTUA 1M3JA 1XOUA 2EBOA 1JZOA 1ZL8A 1XIYA 4WBRD 2AHYA 5ECHB 5IPHA 3MNGA 2CDYA 1OE8A 5C00A 1PP9H 1N8JA 1E6BA 4LFCB 2YEVB 3HZ8A 1G7EA 1OC9B 5HR0A 4Q20A 2LQTA 3KCXA 4QPKA 1O81A 5JH7B 1F23A 5A2QN 4DRXB 2PN8A 4IYIA 2VCTA 4X66O 5LHHA 5JCUA 2K9PA 3CCUV 3B4SA 5EIBD 2NDOA 4EUYA 2JIZG 2CGOA 1GUMA 3BCIA 5BMUA 5J2UA 1WPBA 1JOYA 1TOFA 3ME7A 3JASA 4MCUA 1TTZA 3CCQV 4LNUA 3ABTA 4MT8A 4DR3O 3QAGA 4TXVA 1YF1A 5ITZA 2VAFA 2TRCP 4DV1O 5GAPD 3GL5A 2AW9A 4MVSA 4EE0A 2FWHA 4FLTA 1FFXB 4H33A 1HR0O 3RN4A 1T3BA 3UCSC 1JLWA 2L59A 3A0RA 4I6XA 1TRWA 1GP1A 4JE1A 3ZIJA 4DV7B 3OTOO 1IBKO 2R5GA 1BT8A 4OGQB 4YIPA 1SYXA 2ATKC 5LCZA 2ETNA 3HCZA 2W0FC 4L5LA 3IAYA 1USBA 1XVQA 5A4VA 3IXRA 4TXOB 5HFGA 2FHEA 1F7YA 1IBMB 1BS3A 5CBFA 1YTFB 4G27B 5CA0A 4Z7XA 1AROP 4J9ZB 1Q98A 2X6BA 1N32B 3F6DA 4FYBA 4YAPA 2UUAB 5B3SB 5FNVB 1ML6A 3ZRXA 4MJEA 4NWYA 3QO7A 3P7XA 1OYJA 4N0VA 2Z9SA 4P2ZA 4FQUA 3TJGA 2Y4UA 4YJ3B 3TCOA 2Q9LA 3ABUA 3WU2Z 3BBYA 3OGCC 2ZT9B 3M7MX 3T1YB 3QDNA 4JTCB 3CCEV 1BQ7A 4ZKIA 5ID2A 4DUZB 1XDCA 2E5LB 2EJRA 4KF9A 4UVAA 1FAFA 2CE4A 1QVFU 2V4DA 2WLHA 4OO5A 1ORQC 5B1BC 2K18A 5CA1A 1K73W 1OC3A 5G2ZA 5KLVH 1TRSA 3H9VA 2AHZA 5GSSA 2HFEC 4MPFA 4CS4A 4HZ3A 6GSXA 4AI8A 5J2TA 2L6LA 4JZ2A 2VCXA 3UQ8A 3IDVA 4UCTA 1JX9A 4DV7O 1IBKB 4Q5NA 4XS4B 5ELAA 1Y6XA 2HHHB 4GTUA 2A9HA 1FOHA 3RPNA 10GSA 4K7OA 4KX4A 2YI8A 4G0KA 2JRIA 3JALA 2GZPA 2JEXA 1M7TA 3VWUA 2DOSA 4MTGA 2R70A 3G7JA 3ZMLA 2LGQA 1GK9A 1VQ5V 1ST9A 2LRTA 1NSWA 2DIZA 2ZR2A 3AG1C 4JI8O 4RQXA 4IW9A 3HPLC 3IAS2 1E1RG 3GN3A 2Y0PA 1R5PA 3VWVA 2IU3A 3HKBB 2LP7A 4BWAA 2MBSA 1K8AW 4K3AA 1ZAUA 3IRAA 5C8YB 2XAHA 3OTOB 2H6ZA 2R0GA 1I0HA 4JR4A 1J9BA 2CAQA 4POMA 2ZIMA 2H19A 1ERUA 5IWAB 4D6TH 2WFCA 2E7PA 3ZHQA 2DBCA 1PSQA 3A0HZ 3LSUA 3GX0A 2JL4A 2B9ZA 16GSA 1PMTA 2WPDG 4FLYA 3KJYA 5LA6B 4NXNO 2CX3A 9GSSA 1CQGA 5AIVA 4DUYB 4TR3A 3JAWA 3GHAA 2OIEA 2F4VO 1K4CC 2B7JA 1H2LA 5TISZ 4I7ZB 3VQYA 4LF7O 3SGIA 4FYCA 2NBSA 3NZNA 4B3MO 2K8VA 2CTRA 3N2GB 3OMIB 4DR4B 1VQLV 2MMNA 2L5LA 3U0ZA 1THXA 4KDXA 5KN1A 1V55C 3L72H 2F8FA 3ED3A 5ECMB 2H72A 2F93B 3UARA 3BOAA 5CA3A 2OWOA 4FIPC 4H44B 4DW0A 2X4AA 4K8ZA 4NAXA 4P30A 4O4LB 2UZ8A 2PPTA 2C0GA 2QWNB 2XNDG 3GA4A 1WN7A 3H1JH 4D7TA 2R9RB 4ECIA 4UCRA 1YKCA 4POLA 19GSA 4PD4F 3ZL5A 5D93A 2P7TC 5LP6C 5LMUB 3W8SA 4BVXA 2L6CA 3M3MA 3FR3A 6GSSA 3WB0A 2VQFO 1RM1B 1U3IA 2W6JG 3LSQA 4O4IA 5IYBO 1JR9A 3MSZA 2LFRA 1GO3F 3DC5A 2LKUA 3CTFA 2JDIG 3C3SA 2JGDB 3IHGA 1GN2A 4PNGA 2LS5A 1EBOA 2XHBA 3RYFA 1ERVA 1BSMA 3DD3A 1PV0A 2ODMA 4X20A 4O92A 2B1IA 5INYA 5EIBC 1N36O 1ENVA 3N2KA 3GV1A 2FKXA 1TUBB 3L71H 2UXDO 1GUHA 1SRYA 5LHIA 3EHBB 1R6KA 1FXKA 1O6JA 2HZEB 5KA6A 3TKRA 2Y4TA 3B40A 1FG4A 2F23A 4NXMB 4IYHA 3KTLA 1HNWB 1M57C 1M4UA 1M0UA 3FEUA 2XUMA 2C0FA 3UT5B 1AXDA 4KSMA 2EULA 2IH1C 1BHBA 4H0LB 2X6CA 2ALBA 5HQPA 1SS3A 1JZWA 3TJKA 1JCHA 4IP6A 5L3CA 4LF8O 5D96A 3TJJA 5K1XA 2DYSC 1HW7A 1BQZA 3ABLC 4F6RB 2RIIA 4LBEC 4HI7A 3WGEA 4EKWA 1J95A 1YDXA 3LGCA 3MIXA 4JEDA 4WF5A 1BAYA 3JARB 2H8LA 3SPCA 3QTCA 5L3GA 4DV6B 4RQEA 3UAPA 3TETA 1BL8A 1MD3A 2AUVA 1ZX3A 2B6MA 4ZOLB 2H1AA 2HXKA 4DV3O 4F0CA 4K0KB 3TXQA 2VL3A 3CPWU 1NQTA 2PYJA 2CQ9A 1QQ2A 4LL1B 4LMVA 1FYJA 1Z2GA 1ZCPA 3JYCA 1YHQV 5IYCO 4GQCA 2Y48A
chains in the Genus database with same CATH topology
3E9JB 2DMMA 4IGJA 5E59A 2IIYA 5JCGA 2JSYA 1QUWA 1XZOA 1GLPA 1J0FA 2XPDA 1YEXA 3VK9A 2DJKA 3DMLA 3HVVA 1ZGNA 3N9JA 4ML1A 1MTCA 4WBJA 3MDKA 2A2PA 4USSA 1F9MA 1BX9A 1M2AA 5HR3A 1W4VA 2X8GA 2HSMA 1TW9A 1KEBA 4RUVA 1HNBA 2YOIA 2YWIA 1TDIA 2WRTA 1TK5B 3LWAA 3GKKA 1XOBA 5ECKB 1K0NA 2BTOT 1ZZYA 1G0TA 2KLXA 4WETA 1R5AA 4OO4A 4FO5A 2ON5A 1OC8A 5JWOB 1TK8B 3ME8A 4G9HA 5ECPB 3FW2A 1SJIA 1PKZA 4WKWA 1ZYPA 4WXTA 5ECOB 3SWLA 2XBIA 4ML6A 1ZYQB 2HSYA 4O5RA 3F4RA 3IK7A 3CRUA 1NHOA 3GH9A 5ECQB 1XW5A 2LV3A 3QOUA 2CTQA 4YQVA 2FWFA 2I4AA 3A5IA 1SU9A 5DJLA 4K7IA 1TRVA 3GH6A 4JZQA 2F3MA 3LXZA 2GLRA 2H01A 4XS1A 1EOGA 1MDJA 4JR6A 5DAKB 2V2GA 4EXJA 3MAKA 1B8XA 5KN2A 1UC7A 2WULA 1TU8A 3GX8A 4BVXB 2LEGA 3HY2A 2PF4E 2GQMA 1URMA 3A3TA 2PMTA 3F3RA 4ECJA 2C3QA 4EF0A 1JHBA 4KNDA 1V57A 3P90A 1AC1A 3EWLA 4EIQA 3EU3A 1PQNA 5IOXA 4RWUA 4MJBA 1SD8A 3TKSC 4K5SA 4OFMA 6GSTA 2KP1A 2QWOB 5E4WA 2TIRA 1U6TA 3D4TA 3BD2A 3WGDA 5B7CA 1QMVA 3UL3A 1I9DA 5A4WA 2CTWA 4G19A 1T7PB 4F03A 3GNJA 1EEMA 3O76A 3TRPA 2FWGA 1ON4A 1M9AA 5GZZB 4YKFA 2HT9A 2YV9A 3QD9A 2GQLA 3RDWA 3HD5A 5ECNB 1Z6NA 2YNXA 1F37A 1PGTA 2YCDA 2GQKA 5J9CA 3CYNA 5FHIA 5JWQB 2OBIA 1UN2A 1C72A 17GSA 4KAEA 1XWBA 4HZ4A 1GTBA 4NXIA 4HZ2A 2MZCA 2IL3A 1V58A 3NIVA 3L0HA 2B7KA 4MZBA 1PN9A 4BL7B 5IMDA 2C3TA 4TVEA 2VO4A 4BVYB 3C73A 4GSTA 2HYXA 2LRNA 4O5UA 2I3YA 2IFQB 3QR6A 4ZL9A 4IHUA 1A0FA 1VF4A 1HNCA 3HHVA 1KBNA 3IAM2 3K8NA 4TXOA 2B3SA 4JU5A 1BQ0A 2A4HA 2X64A 2VL9A 3CBUA 3GKMA 4OD7A 1THOA 4CDOA 1PN0A 4KCEA 3IC8A 1BEDA 4YKGA 5COHA 3GTUA 1AQWA 5CRWA 3R2QA 4DSSA 1YZXA 2QSAA 2HI7A 1EGRA 1B4QA 3Q19A 4X0XA 5B6MA 4KDUA 2DIYA 4ZL7A 1XBLA 2WS2A 2IMIA 3EURA 2C0EA 3IPZA 2J9HA 3UEMA 2LRCA 2ZNMA 1IURA 4YQMA 4HEA2 2YN1A 5AN1A 2FGXA 3I6AA 5LD0A 1Z9HA 5EVOA 2FY6A 4O7HA 3CRTA 3QMXA 1YF0A 2H1DA 1F3AA 2CV4A 5J5NA 4H86A 2YPMA 3HYPA 1JLVA 2VLTA 2MBTA 4O5QA 3DGQA 4QL7A 3C1SA 4WEYA 2HLSA 2HRAA 2P5RA 4HDEA 2IMKA 5IQYA 4J80A 1K0OA 4DSQA 3A2XA 2YUAA 2I9HA 1K0DA 4J56E 1QK8A 3UBLA 3VFIA 2CVBA 3UVHA 5DALA 4YAVA 3IE3A 1FHEA 1G6YA 4JRRA 5J9BA 3IK9A 3KXOA 4LMWA 1UVZA 4BWSA 4FH8A 4K1FA 1T1VA 5DALB 5B6NA 2JSZA 4AJ8A 2H73A 2HNLA 3O6TA 2OE1A 2YWNA 1Y25A 3GUSA 1PRXA 1U88A 5BRTA 1A2JA 5EL8A 2JADA 2A4VA 5CNWA 5DJMA 1GULA 2QWRB 3G7YA 1PX7A 4KGIA 4P3YB 1HYUA 2DLXA 4EDYA 3EINA 1DUGA 4N10A 3VWWA 4CHSA 2KQXA 4OMVA 5AIXA 3U6VA 3DKSA 5D9XA 3EE2A 4HOJA 4ZBAA 5AISA 3KGKA 3M9JA 2NTOA 1GSEA 1XWCA 2M46A 3GSSA 1EZKA 2CVKA 2V41A 1GSQA 3VPTA 2N5BA 1SL2B 3GRXA 1NW2A 1M2DA 4PQHA 4HJ2A 3CSHA 4TR1A 5CRGA 3EMPA 3F6FA 1U87A 5CRHA 4Z2TA 1PA3A 2VL2C 3APSA 2OBKA 5AGYA 4WR5A 1WRYA 2DJ2A 1S3DA 1T8EB 4NHWA 3TRQA 1N4CA 1Z6MA 2GSQA 3TKSE 1YQ1A 3FRCA 1HD2A 5CAXA 4K0GA 3J7Yk 3WD6A 2REMA 4NV5A 22GSA 1GSSA 1YY7A 1TU7A 1ZYNA 4K7NA 1YKAA 4AGSA 2AV4A 2LJAA 1TRUA 3L9VA 1HQOA 2C1YA 6GSWA 2XPEA 1WMJA 5ECLB 5DQSA 4DSSB 5CRDA 3GTUB 3TDGA 3VPQA 1WPIA 1ZMAA 1EGOA 3US3A 3KIJA 1BG5A 4ACSA 3TRXA 2QGVA 1AIUA 4OFTA 4PX1A 5CP1A 4X43A 2DJJA 4K5RA 5KEJA 5GSTA 2P5QA 4XCSA 2F9SA 2PU9C 1CQHA 2D2ZA 3Q6OA 3FK8A 2K6VA 1XPVA 3FR6A 4GRFA 5F0GA 2R37A 2GS3A 3L9SA 2IMFA 4Z2UA 4TR0A 3ZYWA 3ZLPA 5J3RA 3C7MA 2YJ7A 12GSA 2A2RA 4ZB8A 3ISOA 4POBA 5KN0A 1U3AA 4ECBA 5G5EA 3PGTA 2DJ3A 4ZILA 1A23A 4BL7A 3LW9A 2OE0A 4NPBA 3LORA 4HS1A 6GSYA 2PBJA 3DRNA 4MZCA 5IM9A 4DVCA 5G5FA 4YH2A 1K0MA 3HA9A 3W8JA 5FWGA 2OJLA 3Q18A 2LNSA 3UO2A 2LTKA 2DJ0A 5F05A 2H0HA 1SL0B 2HZEA 3GYKA 4XHMA 5EPFA 1SJ6A 3KD0A 2H1GA 5DAKA 2E2MA 2MMZA 1OKTA 4V1Ag 3G7IA 1S3AA 3IBHA 3EVIA 1GH2A 5IIZA 5A4UA 1MDIA 2VCQA 1EV9A 1ZOFA 1K0BA 4ZBDA 1SKRB 4IQ1A 1X5DA 4L0UA 1FW1A 2IMEA 1AAZA 4FYUA 3IHQA 5KOXA 5DQYA 1IYHA 1X0RA 4G0LA 2H6YA 4Q5FA 18GSA 1TP9A 3FY7A 2HRFA 5D73A 5HFKA 2WJUA 2R2JA 1GL8A 5G30A 5EY6A 2RUEA 1X9MB 3F3QA 1GH6A 4KH7A 11GSA 1Z7PA 3TKQA 2KUCA 3EMXA 2H0GA 4WR4A 1KTEA 1ERWA 1O8WA 3HVXA 2O8VB 3KH7A 2PUKC 3O3TA 4K8MA 2K9FA 3J7Yb 4I5QA 2AAWA 6GSVA 3I43A 5D9VA 1A8YA 3KEBA 2WDUA 3F63A 2CX4A 2VCZA 4IQAA 1GNWA 4EO3A 1MD4A 5J41A 1GSYA 3L9UA 3GL3A 3N5OA 4IELA 4F82A 3M0FA 4V2NA 2GVPA 2WB9A 2GSSA 4FIWA 1EEJA 2IPAA 4TKYA 4K0NA 2RLIA 1FAAA 1VF2A 3PR8A 5L71A 2ZUPA 3EU4A 5HR1A 2FLSA 3E3EA 1G7OA 2YS8A 2KHPA 4ID0A 2OE3A 4IKHA 4MF5A 1PL1A 2QWQB 1ACVA 1VRSD 4G2EA 1FO5A 2AYTA 2VL2A 7GSSA 2B5EA 2E2GA 2VM2A 1V98A 1GSFA 1O7UA 2L5OA 4DEJA 3GURA 4ISDA 3FZAA 4L0WA 3FHKA 4KDYA 4KB3A 2E0QA 2XHFA 2B5YA 2PGTA 2A2SA 1K3OA 3M1GA 2HRKA 4GSSA 2LQOA 2V1MA 1GTAA 3QFAC 3PPUA 1O85A 2K8SA 5ECSA 2RM5A 2CA8A 3ZREA 1TXXA 2R6KA 2OACA 1X9WB 1N2AA 1SYRA 4OFNA 1JFUA 1TKDB 4K6XA 3ERGA 4MH3A 4N11A 1FVKA 2H76A 3KM6A 1WJKA 4ZB6A 2L4CA 2MYGA 3TUEA 2B1LA 3MYDA 1SK2A 1FOVA 3F0IA 4J2FA 1XXUA 2G2QA 4PXOA 2HFDA 1GWCA 2L4QA 3EPTA 13GSA 1HDJA 3LYKA 3RPPA 1K3LA 1LBKA 5CYYA 1DSBA 1YJ6A 2QSIA 2H30A 2X8HA 2DMXA 3C71A 3OR5A 1WP0A 4DSRA 4G0IA 3D0ZA 1XWAA 1SKWB 2GSTA 2JZTA 1WOUA 5IMFA 3E0UA 3UJ1A 3TB2A 1O8XA 2GTUA 2OA7A 3A5WA 2VLUA 2FWEA 3D5JA 2EC4A 5H5SA 5J4UA 2CZ2A 2NPBA 3TKSA 3AG7A 4MJCA 2GZZA 3W6GA 1XBSA 3LFLA 1NZ6A 2X8CA 1G6WA 3P2AA 4PTSA 2VM1A 3KP9A 2ON7A 4HU7A 4KUNA 2QWPB 4RI6A 1M2BA 4TR3A 1QGVA 5INYA 4TR1B 4NHZA 4I2TA 2MMAA 3IOSA 2VLVA 1WJZA 4EIPA 3CXGA 3D4MA 4ZIJA 3SBCA 1R4WA 3IA1A 5DCGA 3ZITA 2LJRA 3ZMKA 2HZFA 1RW1A 2JACA 3HVSA 1J08A 3TOTA 4MP4A 4CY8A 3Q74A 4HU9A 5D9WA 1OE7A 2O87A 1DE1A 5F07A 2O85A 2X99A 3D21A 3ZVJD 4O32A 4LLRA 1A2MA 1RK4A 1R26A 2H0IA 4EDZA 3GFKA 3QAVA 2V6KA 4Q5QA 3EYTA 3QCPA 2XC2A 2P0GA 2EIQA 3ZTLA 1WE0A 1V9WA 3GSTA 4V2LA 5LNKe 5ENUA 5ABRA 3EC3A 2KP2A 3DEXA 1GLQA 4IP1A 5G1KA 3TJFA 1OKDA 4PURA 2N5FA 5DBQA 3HKRA 3JCML 4BPYA 4GF0A 2AJQB 2FNOA 2H6XA 1F3BA 1SENA 1Z7RA 1DBYA 3CSJA 2F51A 5B8BA 2YZUA 4Q5RA 1SL1B 3F4SA 6GSUA 2CVDA 2PVQA 1IYIA 1B9YC 3H8QA 4KE3A 4GLTA 3G9BA 3TJBA 4MH2A 3P8WA 4MMMA 4D73B 2DKHA 1T00A 5C04A 1X5CA 1W89A 2QKEA 1M9BA 1K0AA 4L8EA 3WT2A 4I97A 4ZXGA 3F8UA 4ECCA 4G10A 5DVBA 3ZIVA 3D22A 2G0FA 2OADA 2JZSA 2EIRA 3CTGA 2VCVA 4E8EA 3HJOA 2C3NA 2YP6A 2L6DA 1GUKA 4BWQA 3H1NA 5KN3A 2IJYA 3GIXA 2PERA 2CT6A 2DJ1A 2VOCA 3BJ5A 1SKSB 3KP8A 2V6OA 1A2LA 3VI7A 3NOFA 5CREA 5G31A 4GXZA 4N30A 3ZFLA 4MPGA 4IBPA 1WIKA 4ZB9A 3HXSA 2ES7A 5G1LA 2J23A 4IVFA 1AQXA 2IMDA 5HFIA 3PINA 2B1KA 4ZL8A 5IPGA 3FZ5A 4N0ZA 1XFLA 1V2AA 2O89A 3ERWA 3RBTA 1XW9A 1EP7A 2O7KA 2LO1A 3LSZA 1VF3A 3IR4A 2M6YA 1T4YA 2QA1A 5IMCA 1A8LA 1T4ZA 2VIMA 4E8HA 4CW9A 2FA4A 3LXTA 4KCAA 3KH9A 4YQUA 4X1UA 3I9V2 4MF6A 4MLYA 1A24A 3VLNA 3ZRDA 2H71A 1EP8A 3C8EA 3QAWA 3M9KA 2FD3A 5HR2A 1GNEA 3HDCA 2OKAA 3FZ4A 1YDKA 2XBQA 1HNAA 3RAZA 5DCHA 3L4NA 3ERFA 1TK0B 3C1RA 3U5RE 1BJXA 1A0RP 3ZFBA 3IV4A 3GKXA 5IMAA 1MEKA 2CTPA 2VCWA 4PNFA 3APOA 2N5AA 3DYRA 3UOMA 1TI1A 2C0DA 2GGTA 2JU5A 2WGRA 3A2VA 3BCKA 2I81A 2NVLA 2C4JA 4IJ3A 2M72A 3DIEA 5A5KA 1ILOA 3I69A 4TN8A 2MMOA 4AJ7A 4AF2A 2HRNA 2R0PA 2M80A 3HJMA 2R4VA 1WWJA 2I1UA 5IO0A 1KNGA 4BVYA 1V40A 1XVWA 3H93A 1XWGA 2DC5A 3F9UA 4IJIA 2LJKA 4TOPA 1XCCA 3MWHA 3L78A 1XOAA 1MDKA 2LSTA 2CAIA 5H5RA 3FMWA 3TOUA 2LGWA 4LL4B 1B9XC 3QFBC 3DXBA 3TGZA 1Z3EA 4NV2A 4POKA 3M8NA 3CSIA 4XRAA 4KA0A 1TJDA 1VF1A 2FA8A 2H74A 1ERTA 4ULXA 1K3YA 2GDRA 3H4KA 2WZ9A 4EL1A 5ECRB 3LEFA 1DE2A 5F8BA 1FVJA 1JZDA 2ZCTA 4KW6A 2FUG2 3BVOA 5ECIB 1NM3A 1OAZA 3AY8A 2R0CA 1ZL9A 2AHEA 1UA5A 4JBBA 4A5PA 1H4OA 2YJHA 2DKIA 4K2XA 4X4JA 3WGXA 2IWTA 4OWYA 2CUGA 5IMZA 3LJRA 2JZRA 1QXHA 2V32A 3DVXA 4ILFA 4MA9A 2AB6A 5F06A 2PVOC 3R3EA 1I5GA 3A2WA 2QC7A 3LQ7A 5KOWA 1X5EA 2C80A 1E2YA 4MF7A 4RQRA 4V2MA 2LQQA 5IO2A 1B48A 2EIOA 2PWJA 1RQMA 2EJ7A 1PL2A 3APQA 1AW9A 4IS0A 2KOKA 2B5XA 3KZQA 4MNNA 4PUAA 2H75A 4GCIA 4F0BA 1YEPA 3DVWA 3HJPA 4MK3A 1K0CA 4LA1A 3VURA 4F2IA 5IOWA 1F2EA 4OCEA 4XIHA 4EVMA 1OVNA 3UMAA 5ELGA 2H1BA 4F9ZA 1QFNA 1GRXA 4NMUA 14GSA 3KMOA 3RHBA 2R3XA 4WF4A 20GSA 3RHCA 2VD1A 5D9TA 2N05A 4HUAA 4TW5A 2TRXA 2HE3A 2IFQA 3FZ9A 4L5OA 2GSRA 1GSDA 4RI7A 5H5QA 1GSUA 1M99A 3D6IA 4KSOA 3VI5A 3FYGA 4XTSA 3UIWA 4K9ZA 5B8AA 5GAND 3QPMA 3V1WA 2LNTA 5ID2B 1VGLA 3KTBA 2WCIA 4ICYA 1FPOA 4CY6A 1GTIA 5CO3A 2GT5A 2RM6A 5JCWA 4ZBBA 3GKNA 1SJZA 1EOHA 5JWRB 2GT6A 3H79A 3UVTA 1EV4A 1SK1A 4IN0A 3ZVJA 3S9FA 1FB6A 4K2DA 2IN3A 4QQ7A 2DSAA 3CMIA 4MJAA 1PKWA 2OCHA 2VUPA 4BA7A 3LG6A 4GQFA 5D8IA 3KCMA 4J7ZA 8GSSA 1Z5YE 5IMVA 2YANA 4TRXA 1PD21 4XS4A 2BMXA 2FCHA 4QL9A 1SD9A 4PGTA 1TI3A 4XRDA 5DDLA 2H70A 1Y6EA 4EC0A 2YWOA 4TR4A 2GUZA 2CZ3A 4EKZA 2X49A 2GZYA 1XW6A 2N04A 2HSHA 2C8UA 3DWVA 3TKPA 4MZWA 4HQZA 2GUZB 4PQ1A 1Q4JA 1H75A 5FT3A 2DN9A 3IC4A 4XS6A 3LYPA 2YZHA 1O73A 2DMLA 2VD0A 4V1Ap 1AUCA 1LJRA 1F6MC 4HQSA 2YWMA 1SK0A 3WT1A 4HJMA 2L57A 4MDCA 3ZZXA 2YV7A 2LUSA 1R7HA 4GWRA 4D73A 1NHYA 3VWXA