3APQA

Crystal structure of j-trx1 fragment of erdj5
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
208
structure length
208
Chain Sequence
IQNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWSYYRYDFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily C member 10
publication title Structural basis of an ERAD pathway mediated by the ER-resident protein disulfide reductase ERdj5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 65
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3apqA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3apqA02
5KN1A 1GUKA 1N8JA 4KX4A 2GTUA 2C8UA 2LJKA 3FHKA 1HNAA 2O89A 1QMVA 4TXOB 5GZZB 4FYUA 1KBNA 2L6LA 5ID2A 2DSAA 2J23A 4HJ2A 2QWRB 2OACA 1GP1A 1ERUA 3IC4A 2H01A 3H4KA 1W89A 1GRXA 2MYGA 2R2JA 2B5XA 2F3MA 3FZ4A 2HSYA 1PGTA 5DCHA 5H5RA 4AF2A 2GZPA 3TGZA 4RWUA 1EEMA 5H5SA 3BBYA 4IJIA 1T4YA 3GUSA 5B6NA 5H5QA 1OC8A 5ABRA 5DAKB 2DBCA 1XWKA 4GCIA 3DRNA 4OFTA 1ERWA 1DSBA 1BQZA 2WB9A 4MH3A 1EP7A 2CZ2A 5CP1A 4FO5A 1SD8A 5ECRB 2RLIA 3UAPA 2H1AA 1R26A 1X5CA 3PR8A 5GSTA 1S3CA 2DC5A 1SK0A 5G1LA 5DDLA 3UVHA 5DALB 1GTBA 3IOSA 4ISDA 4HDEA 2VCTA 2K8VA 2V1MA 2KUCA 3LYKA 3H8QA 1PN9A 2KLXA 2C0DA 1SYRA 2K8SA 5CNWA 5IOWA 3GFKA 5E59A 4WR4A 4F0BA 1PX7A 5G31A 2HZFA 3VI7A 2YWIA 3VPQA 2GZZA 5GAND 1MD3A 1LU4A 1FB6A 3TOTA 1A23A 2ON5A 4KDYA 4DVCA 5AISA 2L6CA 1NZ6A 4IHUA 2B1KA 2VLVA 4J56E 3VK9A 3L0HA 1SK1A 2K9FA 5ECKB 2R37A 2VM1A 1OKTA 2FWHA 3F6DA 3G7JA 4LLRA 2N05A 1FVKA 2VO4A 2IMIA 2FWGA 6GSYA 3TRPA 4TRXA 1SJIA 4PNFA 4V2MA 3GKNA 2ZCTA 3A2WA 2YCDA 4IT5A 4JR4A 5ECNB 1XOAA 2YWOA 1WOUA 4TXOA 2CZ3A 4K7OA 5IMVA 2YS8A 1EV4A 2LUSA 1OC9B 1C72A 5J9CA 1R5PA 1SU9A 4IN0A 3UEMA 2GLRA 4XS6A 2LV3A 2EC4A 3HVSA 1RQMA 4NWYA 2GQKA 1XFLA 1EGRA 4TOPA 1DBYA 2I81A 2OCHA 3CSIA 3E3EA 3M3MA 3EINA 4NHWA 3TCOA 3E9JB 1T3BA 2GSTA 3DD3A 1Z6NA 2C3NA 4XS1A 5AN1A 3GNJA 2GSRA 3TOUA 5DAKA 4WBJA 2L5LA 4POLA 3MWHA 1B4PA 1ZMAA 5IMAA 1URMA 4YH2A 1SENA 1XBSA 3F63A 3M8NA 1AQWA 4PUFC 4ZIJA 3HJOA 2M46A 1X9MB 1V40A 4RI6A 4WR5A 2OJLA 5G2ZA 2L57A 3F9UA 3ZREA 18GSA 5IMZA 3RHBA 4TR0A 2YWMA 1SJZA 1VF3A 3K8NA 5F0GA 5DALA 2V2GA 3UL3A 2NBSA 5IO0A 1J9BA 4TXVA 3RHCA 2RM5A 1LBKA 5F05A 4FYCA 2LKUA 3UO3A 3KH9A 4RUVA 4ZB6A 5JWOB 2CQ9A 4EL1A 1JHBA 2BJXA 1OE7A 2GQLA 1I5GA 3GYKA 2H72A 3HDCA 5IQYA 3GN3A 1NW2A 1VGLA 2X8HA 1TU8A 2LEGA 5ECMB 3CTFA 4K8MA 5ECPB 1A0RP 2DIZA 1ON4A 4HU7A 1UC7A 5B6MA 5D93A 1Z6MA 4IW9A 4ZL7A 3R2QA 2WCIA 1CQGA 5LD0A 3MNGA 4L8EA 4YAPA 3VWXA 4F82A 1H4OA 3D22A 3LG6A 1YDKA 4POBA 1F37A 4EKZA 1PKZA 4RI7A 5D96A 1VRSD 3F0IA 5KEJA 1LJRA 3MSZA 4LMVA 4X0XA 4ZILA 4ML1A 1MDKA 3CBUA 1BYEA 4XTSA 4GF0A 3D5JA 2LJAA 3IA1A 5ELGA 3TRQA 2GGTA 2ON7A 5B7CA 2A2SA 1OVNA 2M72A 3LEFA 1JZWA 1GLQA 1G6YA 2V41A 3I6AA 1K3OA 2C1YA 3TJGA 4ILFA 3TUEA 5A4VA 4KCEA 1THXA 2I1UA 2NTOA 3TKSA 2B5YA 1R7HA 4PNGA 2H8LA 2HT9A 3HVXA 1X9WB 2WULA 1PKWA 3QAGA 3CXGA 1TK0B 3L78A 2EIRA 4J2FA 4YAVA 3Q74A 1FG4A 1XBLA 1ZZYA 3RPPA 1V57A 3A2XA 4I8BA 1WE0A 4HOJA 3KH7A 1QXHA 2AJQB 3EE2A 16GSA 4JEDA 2PF4E 4GLTA 4GSSA 2LGWA 3FR9A 2ZNMA 2XHFA 4MJEA 3CSHA 5D9XA 2OE3A 4DSSB 2N5FA 1MD4A 2DMLA 2FA8A 3HZ8A 3HVVA 1TP9A 3BD2A 2IMFA 1Y25A 1F6MC 1GSQA 1FB0A 2QWPB 4D73A 2A2RA 2BTOT 2RUFA 1PA3A 2H0IA 4MF7A 1V2AA 2O85A 2FLSA 2WZ9A 5J5NA 4K2DA 2PMTA 1QUWA 2PVQA 4G9HA 2H66A 2C0EA 3KMOA 5D8IA 2YV7A 3L9SA 3EVIA 2VAFA 1XXUA 2CTQA 20GSA 4O5RA 1V98A 4Q5RA 2CVBA 3I9V2 3VURA 3LFLA 4MZWA 2MMAA 4I2UA 3D6IA 4O92A 3KTBA 5INYA 1AXDA 4K0NA 2VUPA 4EF0A 2PERA 2WFCA 4O32A 1N4CA 4V2LA 3IK7A 3V1WA 6GSSA 2JSYA 4HQZA 3KJYA 3HJMA 1Q98A 3KGKA 1AAZA 1GSSA 1U6TA 4K7IA 2PGTA 4ECIA 3C8EA 1I9DA 3L9UA 2Y4UA 3IV4A 2VL2A 2JU5A 2PVOC 3LQ7A 3HYPA 1M7TA 3C73A 2NDOA 4LL1B 3DKSA 3GKXA 1XW6A 2C3TA 2N04A 4EO3A 1VF1A 4JBBA 4NV2A 2OADA 2AAWA 5AIVA 4BA7A 3D21A 2LNTA 3ZIJA 4DSRA 2LSTA 4IJ3A 2OE0A 2WRTA 1FOVA 3BCKA 4PX1A 2K6VA 3HHVA 1AUCA 3IRAA 3FEUA 1B48A 3U6VA 3NOFA 3IBHA 4BWQA 5J41A 3ZLPA 2EJ7A 5AGYA 3UOMA 2KOKA 2VL2C 3ISOA 5IIZA 1GTIA 2DMMA 5A5KA 1TJDA 3I43A 2GQMA 2MMZA 1TK5B 3TJBA 2H6YA 2KP2A 2P31A 5HR1A 3AY8A 4DSSA 2B7KA 1O6JA 5ECOB 4OWYA 4IQ1A 3QPMA 1XWAA 4MP4A 4KW6A 5A4UA 1GUHA 1UVZA 2IIYA 3FK8A 1XPVA 2DJJA 2YNXA 2LO1A 1R4WA 1OYJA 3HA9A 3J7Yb 2PPTA 1U87A 2B5EA 1WP0A 1THOA 2B1LA 1TDIA 5HR3A 2VD0A 3C1RA 3P90A 1M0UA 4GSNA 1O8WA 4MF6A 3DVWA 1F3BA 9GSSA 3UO2A 2IFQB 1NM3A 5F07A 2HFDA 2E7PA 2G0FA 5JCGA 1ZL9A 2B3SA 4J7ZA 1O85A 2IMKA 3APSA 1OE8A 3BCIA 1TI3A 2H1GA 3VWWA 3TJKA 1V58A 4FYBA 3TKSE 3ZL5A 5CO3A 3GIXA 2N5AA 1X0RA 1XW9A 2MZCA 2MMOA 1AQVA 4DEJA 4POKA 3FW2A 1IURA 1Z9HA 22GSA 2HYXA 1TRSA 4YQUA 2K18A 5DJLA 4N11A 5CRWA 2OBIA 2L4QA 4PUAA 4AGSA 4MPGA 5CREA 4BVYA 3ZRDA 2VD1A 2CTPA 3ZVJD 2GT6A 2X99A 4IBPA 3LWAA 3KXOA 1HDJA 3M1GA 1B4QA 3F3QA 3DMLA 2LJRA 5C04A 2H75A 2HXKA 5JCUA 5DJMA 5GSSA 2CT6A 4EDZA 1DE2A 2HSHA 3UJ1A 3WT1A 4PQ1A 1OAZA 3WD6A 4MCUA 1YY7A 1PQNA 1MDJA 2NPBA 4GQCA 2B7JA 3CMIA 2XBIA 1GH2A 5IO2A 1YJ6A 1G0TA 2XPEA 2YP6A 4EE0A 2HLSA 2EIOA 2OA7A 5HQPA 3Q18A 2YUAA 3H1NA 2JZRA 3O3TA 2F9SA 2JZTA 4WETA 1WPIA 1AW9A 3TKQA 4TN8A 4NHZA 5COHA 4XCSA 2H19A 4N10A 3BJ5A 1M2DA 4N30A 6GSUA 4HI7A 3RDWA 2VCXA 2VM2A 2QWOB 1N2AA 1ERTA 3ZVJA 4YQVA 1WJKA 2PUKC 4KCAA 1NSWA 4ZB9A 1SD9A 5B8BA 3O76A 5A4WA 5IMFA 4IP6A 2VOCA 2WGRA 4QQ7A 4QL7A 4ECJA 1T00A 4KNDA 4OMVA 2IFQA 3Q19A 4JZQA 3EMPA 1O73A 1KNGA 3BOAA 2P5RA 3VWUA 2FD3A 3M9KA 4L5OA 3SBCA 4N0ZA 2C80A 4K9ZA 3EC3A 3FRCA 2LQQA 4PQIA 2LQOA 1XZOA 3HCZA 1CQHA 1K3LA 3GH6A 4XIHA 3LXTA 1WMJA 4LL4B 3KMNA 4D73B 5LNKe 3NIVA 1JFUA 1OC3A 1PD21 1TK8B 1VF4A 1SL1B 2I9HA 2GSQA 4ID0A 1EGOA 4OD7A 4OFMA 5J3RA 3FY7A 2GSSA 4MJBA 3GURA 4ZBBA 1AQXA 1GULA 4MK3A 1Z7PA 2DJKA 5C00A 4AJ6A 2L59A 1TXXA 3HY2A 1U3IA 3D4TA 4K7NA 4MH2A 1JZOA 2TRXA 1ZGNA 3DIEA 2CTRA 2JZSA 3KIJA 4MZCA 1B8XA 4MF5A 1A24A 1O81A 1J0FA 1U3AA 4KA0A 4WKWA 2VIMA 1PSQA 4OCFA 2PWJA 3F4TA 3KCMA 2XBQA 2YV9A 4IQAA 3ED3A 4WF5A 5CAXA 4XRAA 3QAWA 1XVWA 2C3QA 4NV5A 1USBA 5F06A 1ZCPA 1GSFA 4K0GA 2CAIA 5ENUA 4E8HA 1MTCA 1FW1A 1ZYQB 2YANA 1O8XA 2F8AA 3FZ5A 5G5EA 2DLXA 3TDGA 3QMXA 3J7Yk 3F4RA 5D9TA 3ZIVA 5ECLB 1DE1A 4GRFA 3UARA 1A8YA 3ZFBA 5CRHA 1A0FA 5KN0A 1WIKA 2C0FA 2YPMA 2R6KA 5AIXA 3N9JA 4MMMA 3ZTLA 4OFNA 1R5AA 4V1Ap 5HR0A 1YF0A 5EPFA 1HQOA 5LCZA 3ZITA 1VF2A 3TKSC 2WJUA 4PGTA 4KH7A 1EOHA 4F2IA 1SL2B 3QR6A 1A2MA 1GTAA 4EDYA 2LS5A 1B9YC 2O8VB 1JZRA 4OCEA 4KDUA 2FNOA 4V1Ag 3EMXA 1HD2A 1HNBA 4ZBDA 1ZYEA 5KN2A 5B8AA 1XW5A 1OKDA 1F9MA 2E2GA 4ECBA 3ERGA 1ERVA 1XWCA 4NPBA 5HFKA 3GV1A 1Y6EA 2IMDA 3GKKA 1PRXA 2LRCA 3C1SA 2GDRA 3F8UA 5ECQB 1FPOA 4XHMA 1KTEA 2WDUA 3IHQA 3HXSA 1TI1A 2VCVA 1XOBA 4WEYA 2R5GA 2KQXA 2REMA 2IPAA 4XS4A 3AG7A 3D0ZA 2HRFA 2I3YA 2VL9A 2H0HA 5JWQB 1EZKA 3F6FA 2CUGA 2JL4A 3UMAA 4Q5QA 1T4ZA 4MA9A 1G6WA 1FAFA 4ML6A 4RQRA 2CV4A 1G7OA 4POMA 5EY6A 2X8GA 2VCQA 3RAZA 3GX8A 3KP9A 2GZYA 3CTGA 5L71A 4K6XA 3IE3A 2DJ3A 1E2YA 1QQ2A 1K0AA 4JE1A 3WT2A 1ST9A 1YKAA 1GNWA 5F8BA 1UN2A 2QKEA 4GSTA 10GSA 2NVLA 3PINA 4E8EA 1FHEA 4ZL8A 3W6GA 3TB2A 2RUEA 3EWLA 1EEJA 3HZ4A 4G10A 1F2EA 4IS0A 2AUVA 4CW9A 3KD0A 2VL3A 3OR5A 4O7HA 1QK8A 2YN1A 2MBTA 1IYIA 3DVXA 3H79A 3LYPA 17GSA 2H30A 2P0GA 3HJPA 13GSA 1Z7RA 4OO5A 2JSZA 4KDXA 1V9WA 4KSOA 2Z9SA 3IK9A 2DIYA 1FVJA 1G7EA 2GUZB 2VCWA 2QC7A 1TOFA 2AB6A 4X1UA 1MDIA 2VLUA 2VLTA 4TR4A 1AC1A 3IAM2 3CYNA 2FY6A 3A5WA 1A2LA 3UVTA 3DYRA 4P3YB 3GTUB 4MJAA 6GSWA 1WJZA 2IWTA 1T7PB 3QD9A 3VI5A 3TKRA 3N5OA 2RIIA 4MABA 4ACSA 2DJ1A 3G7IA 2V6OA 4L5LA 3WGDA 2ES7A 1SKSB 2FWEA 5G5FA 2HI7A 3VLNA 1SKWB 4GWRA 4BWSA 1Z3EA 4BVXA 1YZXA 2BMXA 2IMEA 2RM6A 1IYHA 4KSMA 4MLYA 3FYGA 1BX9A 2I4AA 4KUNA 5ECIB 2ZUPA 3E0UA 3F3RA 3FR3A 4ZL9A 1PMTA 3EU3A 3VWVA 1YEPA 1K0BA 4NAXA 4HZ2A 1JLWA 2GT5A 3ERWA 5E4WA 4JR6A 3L9VA 3MDKA 2FA4A 1GLPA 2CA8A 4I6XA 3CSJA 3JCML 3W8JA 8GSSA 5KN3A 3Q6OA 2H70A 4XRDA 3PH9A 1GSUA 4MJCA 1RW1A 1HYUA 2A4VA 1XWBA 3FZ9A 4KGIA 3GSSA 6GSXA 1GSEA 4KB3A 3UIWA 4JU5A 3DXBA 2HZEA 3FZAA 2OBKA 1H75A 19GSA 2PU9C 1FAAA 2IL3A 3LORA 2FWFA 5DVBA 2FUG2 3D4MA 5DBQA 4AJ8A 2GUZA 3TKPA 5D9WA 4LMWA 2LNSA 2F51A 3ME7A 4Q5FA 5IOXA 3KTLA 1B9XC 4YQMA 4PQHA 1TW9A 3US3A 1BQ7A 1GSDA 3QAVA 4HQSA 2OE1A 3A2VA 2F8FA 5GAPD 1X9SB 3ZYWA 2VCZA 2X64A 1GL8A 3CRUA 3PGTA 3O6TA 1GNEA 1T8EB 2KP1A 3IR4A 3L4NA 3RBTA 3GTUA 1NHOA 1EOGA 2IN3A 5HFIA 1GSYA 1TTZA 2JACA 4KE3A 5FWGA 3LJRA 1BEDA 4G19A 4CHSA 2OKAA 4L0WA 1K0DA 4CDOA 4WXTA 1Q4JA 2G2QA 2QWNB 3DEXA 3I69A 2MMNA 2TIRA 2CVDA 4HZ4A 3KP8A 1PL1A 4PURA 1JZDA 2TRCP 1M2BA 4I2TA 1PL2A 4HS1A 2CVKA 3UCSC 2ALBA 4ECCA 2D2ZA 2GVPA 4TR3A 2YZHA 1M2AA 2E2MA 2MBSA 4V2NA 2H73A 2H74A 2GS3A 3GRXA 2CX4A 3ZMLA 2EIQA 5J4UA 2V6KA 3VPTA 1M9BA 4EXJA 5EVOA 3GSTA 1TRUA 4TW5A 1K0CA 5ELAA 2H0GA 3HD5A 2CTWA 3UBKA 1EP8A 2FGXA 5FHIA 4KAEA 2LRTA 3UBLA 4X43A 4WBRD 1ABAA 1X5DA 4Z7XA 1GWCA 1S3DA 3LGCA 1F3AA 2E0QA 5CRGA 2V32A 4L0UA 4ZB8A 1ML6A 2AHEA 3LXZA 1SYXA 1BQ0A 4XS4B 4EUYA 5HFGA 2H1BA 2H6XA 3GMFA 5IMCA 3C7MA 2HRNA 1RK4A 4WF4A 3WYWA 2H76A 4K1FA 2QWQB 5J9BA 1HNCA 2HE3A 2L6DA 3GL5A 4Q5NA 3APQA 3IDVA 3M0FA 1XWGA 1PX6A 2DJ2A 5IMDA 4F03A 1K0MA 3ZZXA 2JADA 3GHAA 1SKRB 3CRTA 11GSA 3EYTA 3GKMA 2PBJA 1XIYA 2J9HA 5D73A 2FCHA 3M9JA 5IPHA 3P8WA 2PN8A 5D9VA 2O87A 2M80A 2L5OA 4HJMA 3VFIA 4J80A 2WS2A 1XVQA 1QGVA 5DQYA 1OC9A 1TRVA 2YJHA 14GSA 4TR1B 2B6MA 3FKFA 3ZFLA 4GTUA 2XPDA 3U5RE 2QSAA 4I97A 1ZOFA 3IXRA 4FH8A 4F0CA 3P2AA 4TKYA 2FHEA 3ZMKA 2H1DA 5JCWA 1EV9A 2R3XA 2DMXA 1GH6A 4ULXA 3W8SA 2CAQA 4NMUA 1NHYA 3IAS2 1X5EA 2P5QA 3EU4A 3LSZA 4OO4A 2QGVA 3APOA 4HUAA 5DQSA 3IPZA 4JRRA 1BG5A 5ID2B 4IVFA 4IP1A 4TVEA 6GSTA 1Z5YE 3HKRA 5IM9A 1DUGA 1GUMA 6GSVA 2L4CA 3MAKA 1UA5A 1SK2A 4BPYA 2QSIA 2YWNA 1TKDB 1BAYA 2YZUA 4GQFA 1M99A 4DSQA 3RPNA 1KEBA 3H93A 5HR2A 1U88A 1QFNA 2AV4A 1O7UA 2H71A 1GTUA 2N5BA 1K0OA 4H86A 3QDNA 1K0NA 3WGEA 2HNLA 4EC0A 4IKHA 2Y4TA 2M6YA 2H6ZA 4J57E 2X8CA 2LTKA 7GSSA 1A8LA 2DJ0A 1M9AA 3QCPA 3F4SA 3EURA 3S9FA 1ILOA 5ECSA 2AYTA 2DN9A 4N0VA 2C4JA 3A3TA 4HU9A 4QL9A 4IELA 3TRXA 1SL0B 1A2JA 1W4VA 3SWLA 3DGQA 1J08A 3TJFA 1FO5A 3WGXA 4FIWA 1WRYA 1YKCA 4F9ZA 2YJ7A 4MDCA 4HEA2 1BJXA 2IJYA 1EWXA 3G9BA 4ZXGA 3ME8A 5JWRB 1YF1A 1YQ1A 1JLVA 4ZBAA 3ERFA 4RQXA 3GL3A 4NXIA 1AIUA 5G1KA 3GA4A 4PXOA 5CYYA 3QOUA 1XCCA 4G2EA 3P7XA 4BL7A 2LRNA 3DWVA 5DCGA 5IPGA 1K3YA 1S3AA 5G30A 3TJJA 1E6BA 3NZNA 3GH9A 3KEBA 4TR1A 2YOIA 1T1VA 3QFAC 12GSA 2O7KA 4MPFA 3FR6A 4MZBA 1SJ6A 1MEKA 4EVMA 5CRDA 2XC2A 1ACVA 2CX3A 5EL8A 3QFBC 4AJ7A 2HZEB 1TU7A 5ECHB 1YEXA 1TRWA 4I5QA 3G7YA 3GX0A 3C71A 4LA1A 4IGJA 2KHPA 5FT3A 3KZQA 1WWJA 2C0GA 3BVOA 2R4VA 4GXZA 3KM6A
chains in the Genus database with same CATH superfamily
5KN1A 1SA0A 1GUKA 3FB5C 1N8JA 4KX4A 2GTUA 2C8UA 2LJKA 3FHKA 1HNAA 2HR3A 1FJGB 3JASB 4UCVA 3QF7A 2O89A 1QMVA 4U3JA 4TV8B 3RVYA 1QCEA 4TXOB 5GZZB 3CMAV 4FYUA 1A32A 3P32A 1KBNA 2L6LA 3AG3B 1S5HC 5ID2A 2DSAA 2J23A 1Y76B 4IHJB 2IM9A 3DC5A 5LOVA 4HJ2A 3IC7A 2QWRB 2OACA 1GP1A 2B1IA 3OTOB 4DV6O 2QTSA 4JYYA 3JCZA 1ERUA 3IC4A 2H01A 3H4KA 1W89A 3CQFA 3BAAA 2P7TC 3FB8C 1GRXA 4R7CA 3SYAA 2MYGA 4QIWF 2R2JA 4LFCB 5KOXA 2B5XA 2F3MA 3FZ4A 4DUZB 2HSYA 1N8RW 3LDDA 1PGTA 5DCHA 3CXCU 1U96A 5H5RA 1OCZB 3AG1B 4AF2A 1NQTA 2ILMA 4JI1O 3TJTA 4NXMB 4FLYA 2GZPA 3TGZA 2HVJC 4RWUA 2XT9A 1VQ8V 1WB8A 1EEMA 5H5SA 2ZNIA 3BBYA 2Q7GA 1BT8A 3B8MA 4IJIA 1T4YA 3GUSA 5B6NA 5H5QA 4NB5A 4DV1O 2WLIB 1OC8A 5ABRA 4F4LA 5DAKB 2DBCA 2ADPA 1XWKA 3ZRXA 4GCIA 3DRNA 2GHYA 5EC1C 4AHCA 4B08A 3A0BZ 4H13B 3A8TA 5EIBD 4I7ZB 3A2FA 1L8DA 2QEXV 4OFTA 4RQEA 1ERWA 1DSBA 5KMGA 2LJ2A 3OTFA 1BQZA 3OM3B 2QM7A 1CPYA 2WB9A 1EP7A 5CA0B 4K3AA 2CZ2A 4MH3A 5CP1A 1KQSU 4FO5A 2B5UA 4X66B 3CD6V 1FXKA 1SD8A 5ECRB 2RLIA 5D5QA 5ITZA 1GAXA 3ABLB 3UAPA 3ZCCA 1QU7A 2H1AA 1R26A 1X5CA 1ZL8B 4DR6B 3TGUH 3PR8A 5GSTA 2VWKA 1S3CA 1O9HA 2DC5A 1Z2GA 3AK2A 3SJCC 2ZKOA 1NTKH 1SK0A 5DDLA 5G1LA 3UVHA 5DALB 1GTBA 4DR4B 3IOSA 4ISDA 1QVGU 4HDEA 2VCTA 1J5EO 2K8VA 5KX5B 2V1MA 2Z0AA 2OIGA 1GM8A 3RYFA 2KUCA 1COWG 2GSMB 3LYKA 1B04A 2XNDG 3H8QA 2X6CA 1PN9A 2KLXA 2C0DA 4DK1A 1SYRA 2K8SA 5CNWA 5IJ0A 5IOWA 3GFKA 3LDCA 4ZHQB 4K0KO 5E59A 3VBBA 3T1CA 4WR4A 4U7NA 4XDJA 1Z5WA 4X1YB 4NTXA 1WNSA 4F0BA 4DV2O 1PX7A 3JARB 4LF6O 5G31A 2HZFA 3IHGA 3VI7A 4O5UA 3KG2A 2QR4A 2YWIA 1SQPH 2GZZA 3VPQA 5GAND 4MTXA 1MD3A 1S72V 1LU4A 1FB6A 4DV7B 3TOTA 1A23A 2ON5A 1THZA 1AR5A 4KDYA 1JX9A 4DVCA 2IH3C 1F23A 5AISA 2L6CA 3EPTA 1VQOV 1NZ6A 4RUEA 4IHUA 3G4SV 2IU3A 4K8XA 2B1KA 2VLVA 4J56E 3VK9A 3K59A 2P6JA 3L0HA 1U97A 3CC7V 4DR2B 1SK1A 5FLXN 1M93A 2K9FA 4J41A 5ECKB 2R37A 2VM1A 1Q81W 1OKTA 1KMIZ 3ASOC 2FWHA 3F6DA 4EB6B 3MHHC 3WB2A 3G7JA 4LLRA 3ZRVA 2N05A 2BTQA 4MSWC 1FVKA 2VO4A 2IMIA 1KKDA 1WP8A 1QBZA 1WA8A 1Z5VA 3Q4HA 2FWGA 5LHGA 6GSYA 3TRPA 4TRXA 1V54C 3CS5A 1SJIA 3IFXA 4PNFA 4GT1A 1M9NA 4V2MA 3ABKC 2FKXA 1F7YA 4TT3G 3GKNA 2ZCTA 3E2EA 3A2WA 2YCDA 1XI1A 4IT5A 1VQPV 4UCOA 4JR4A 5ECNB 3JASA 4K0KB 2AW9A 1XOAA 2YWOA 4ZIBA 1WOUA 4TXOA 1K9MW 5C8YB 2CZ3A 4K7OA 3UT5B 5IMVA 2YS8A 1S5JA 1W2BU 1EV4A 2LUSA 5L3BA 4PA7A 1OC9B 4ZI7A 3W7TA 1C72A 5J9CA 1R5PA 1SU9A 4IN0A 3UEMA 2GLRA 4WFEA 4XS6A 1NS1A 2LV3A 2QA1A 2EC4A 3HVSA 1RQMA 4NWYA 3PPUA 2GQKA 5B1BC 3RVZA 1XFLA 5EBMC 1EGRA 4TOPA 1N34O 1DBYA 3ZHUA 2I81A 4O4JB 2OCHA 3CSIA 4LF4B 2IH1C 1H8HG 3E3EA 4HBNA 3JATB 3ZMVA 1PN0A 2RCVA 3EINA 3M3MA 4K35A 4NHWA 3TCOA 3E9JB 4JTCB 3LSUA 1N0JA 4BIUA 1VQNV 1N33B 3BPZA 1T3BA 2GSTA 3DD3A 1Z6NA 2C3NA 4BW9A 4XS1A 2UUAB 4GX1A 5AN1A 3GNJA 2GSRA 1AR1B 3TOUA 5DAKA 4WBJA 2V1DA 2L5LA 4POLA 1JVMA 4UCUA 3MWHA 4X89A 4DR1O 1VARA 1XHZA 1B4PA 1URMA 1ZMAA 1VQ4V 5IMAA 2CGOA 4YH2A 1SENA 1XBSA 3F63A 3OEHG 1MSDA 3M7MX 3SPJA 4UCSA 3M8NA 1QNMA 1AQWA 4PUFC 4J9YB 1Y6XA 2ADQB 3I5DA 3HJOA 4ZIJA 2M46A 1X9MB 4H37A 1V40A 4TSFG 4CY8A 3D3IA 4DXWA 5BMVB 4RI6A 3N27A 4WR5A 5CA0A 4B3RO 2OJLA 5G2ZA 4A5UB 2L57A 4Q20A 3F9UA 3WG7B 3T1YO 4W4KA 1FFTB 3ZREA 18GSA 2JEUA 3ZHSA 5IMZA 1RPOA 3RHBA 3ZJZA 4TR0A 1ZYPA 2YWMA 1SJZA 3ABTA 1VF3A 3K8NA 5F0GA 3FKSG 2Q9LA 5DALA 2V2GA 1OCZC 3UL3A 2NBSA 5IO0A 1URFA 1J9BA 4KHPO 4TXVA 3TETA 5KX5A 1SC5B 2RM5A 3QO8A 3RHCA 1LBKA 5F05A 4FYCA 2LKUA 3UO3A 3KH9A 4RUVA 4ZB6A 1PD3A 2LW1A 5JWOB 4TOIA 2CQ9A 2R0PA 4PJ0Z 4PHZA 4EL1A 1JHBA 2BJXA 1OE7A 2GQLA 1I5GA 3GYKA 2H72A 3U0ZA 4X65B 3RYHB 4ZBMA 5J2TB 4USSA 4X1YA 3HDCA 5IQYA 3JARA 3GN3A 3E8FA 4NYKA 1NW2A 4U7OA 1VGLA 4YY3O 2RDCA 2X8HA 2EULA 1XNRO 3ZS8C 1TU8A 1WB7A 2LEGA 2W6IG 5ECMB 3CTFA 4K8MA 5ECPB 1A0RP 2DIZA 3CRRA 3G71V 1BCCH 3CEIA 5A2QN 1ON4A 4HU7A 1UC7A 5B6MA 2QA4V 5D93A 3DXRB 3VOUA 4ABMA 1Q6IA 1Z6MA 4IW9A 4ZL7A 3R2QA 2WCIA 1AR4A 3CP1A 1M90W 5LD0A 1CQGA 5IYCO 1KD1W 2ARHA 1VQKV 1Q7YW 1EFRG 3MNGA 3ABLC 4L8EA 2OT5A 4YAPA 3VWXA 3OGCC 2OTLV 3N2KB 1H4OA 4F82A 3ZMUA 4DV3O 3D22A 1K4DC 2P67A 3GB7C 3LG6A 1YDKA 4POBA 3A5IA 2F4VO 1VQLV 1FS0G 4EB6A 2A7WA 1M56B 1K3EA 3H1LH 2QM4A 1F37A 5CB4B 1NVPB 4EKZA 4MVOA 2PYLA 2WLLB 4DUYB 1WLEA 4P2ZA 2ZIOA 3AG4C 1PP9H 2EINB 1PKZA 2LGQA 4HZ3A 4DV0O 4RI7A 5D96A 5KHJA 1VRSD 2A79B 2B9ZA 3F0IA 5KEJA 1LJRA 3MSZA 3LNMB 4LMVA 4CC6A 4EEQA 4X0XA 4ZILA 3ETEA 3FX7A 4ML1A 1TVKB 1MDKA 3CBUA 3ABUA 4LF8O 1BYEA 3KKYA 4XTSA 1CP9A 3RYIB 4GF0A 3D5JA 5LA6A 4PV1B 2JGDB 4JI8B 2LJAA 4FLZA 3IA1A 4BL7B 5ELGA 3TRQA 1YZBA 2FMLA 3HKEB 1YJNV 4B3MO 2GGTA 2A2SA 3RW0A 2WLMA 2ON7A 1QVFU 5B7CA 1UJWB 2GTAA 1OHHG 2AHYA 5JH7A 1OVNA 5C8YA 2M72A 1XMQB 3LEFA 2HFEC 1JZWA 3CCJV 1GLQA 2HHHB 1VF6A 3SDLA 4F6RB 2R0CA 1VQ6V 4I55B 1B6QA 4JI6B 2KSDA 1G6YA 5DECA 2V41A 3I6AA 1OCRC 1K3OA 3T1HB 2C1YA 3F7VC 3TJGA 5LXTB 4ILFA 1ORQC 5LP6B 3TUEA 5A4VA 4KCEA 1THXA 1HWYA 2I1UA 4XIHA 1GM9A 4O4JA 2NTOA 1ROPA 4R6ZA 3TKSA 2RN9A 4LNUB 1I08A 2B5YA 2UXDO 1R7HA 4PNGA 2H8LA 2HT9A 3HVXA 1IXBA 1L0LH 2HJDA 3ASNB 3JATA 3OE7G 4BIOA 4GKJO 4JAAA 1X9WB 2WULA 1PKWA 3JCUZ 4X1KB 2CH7B 3QAGA 1HR0B 2OTJV 3CXGA 1TK0B 3L78A 4WBNB 2EIRA 4J2FA 4G27B 4YAVA 1DTOA 1JCHA 3CSXA 3Q74A 4ZOLB 2YI9A 1FG4A 1XBLA 1ZZYA 3RPPA 1XILA 1V57A 3A2XA 1WE0A 4I8BA 2ZNJA 3U10A 4HOJA 3KH7A 3CCQV 1K33A 1QXHA 1EM1A 4O2BA 4LFBB 3EE2A 2AJQB 2IJJA 5KA6A 4LF5O 1EN6A 4UVCA 16GSA 4JEDA 2PF4E 4LF8B 4EIPA 4GLTA 2ZM6O 4GSSA 2LGWA 2O57A 2BCCH 1NVPD 3FR9A 2ZNMA 2XHFA 4LF9B 4MJEA 1NH2B 4DR7B 3CSHA 5D9XA 2OE3A 2WA3A 3OAAG 4DSSB 3H1IH 4D7SA 1RSOA 2N5FA 3RT3C 1MD4A 2DMLA 2FA8A 1ZTEA 2R0GA 3HZ8A 3HVVA 1TP9A 3BD2A 2IMFA 4QE7A 1Y25A 1F6MC 1GSQA 1FB0A 2QWPB 4UUJC 4D73A 2YIBA 5IYZB 1SKVA 2A2RA 3R65A 2DYSC 1L1FA 1IBMB 2BTOT 2RUFA 1PA3A 2H0IA 1JJOA 4X62B 4MF7A 1V2AA 2ZDIA 3RYHA 2FLSA 2O85A 3STLC 5J2TA 2WZ9A 5J5NA 3CXHF 2PMTA 1QUWA 4K2DA 2PVQA 5E1AC 3SYCA 1IVSA 4G9HA 3E89A 4HSCX 2AXTZ 2H66A 4O2AA 2C0EA 3KMOA 1KKCA 5D8IA 4JI4O 2ETNA 3D36A 1EBOA 4JASA 2YV7A 5BZBA 3I55V 3L9SA 4A5PA 4JZGA 3EVIA 2VAFA 1XXUA 2CTQA 3TCUA 3ZHTA 3DXRA 3WG7C 2UZ8A 2XASA 2LQTA 5LHIA 20GSA 5ITZB 2H94A 1G6UA 3PJSK 4MW8A 1R73A 3N2KA 1DF5A 4O5RA 1V98A 3HPLC 4MVMA 4JV5O 4Q5RA 1T5EA 1K5QA 2CVBA 4W4LA 2IW5A 3I9V2 3VURA 3LFLA 1HNXO 4G0IA 3KZIZ 4MZWA 1SZTA 2MMAA 4UVBA 2Q6AA 1I94B 4I2UA 3LSQA 3D6IA 3ZRSA 4O92A 3ZBHA 2IJKA 4CY6A 5CB4A 3KTBA 3CCSV 5INYA 2WLLA 1VF7A 1AXDA 4K0NA 2VUPA 3FYIB 1HP8A 4EF0A 1M3IA 2PERA 2WFCA 4O32A 1VF5B 2K9PA 5EBWC 1N4CA 3RWRD 4V2LA 1FJGO 3IK7A 3V1WA 6GSSA 2JSYA 3K57A 1NH2D 4HQZA 1TVKA 1I7FA 4UCRA 3KJYA 3HJMA 3K04A 1Q98A 3KGKA 1AAZA 1GSSA 4F6EA 3AK1A 2JGDA 1YIJV 1NR1A 3H1JH 2DWDC 1U6TA 4K7IA 2PGTA 4ECIA 3C8EA 3D36C 3HKEA 4WCEV 1I9DA 3OTOO 1EN5A 3L9UA 2Q4PA 2Y4UA 4BVYB 3E83A 3IV4A 4FPPA 2VL2A 2JU5A 2PVOC 3J80N 2IU0A 3LQ7A 4F6RA 3HYPA 5JJJB 1M7TA 4LFCO 1KB9F 3C73A 2NDOA 3RBZA 2M7WA 3DKSA 4LL1B 1XHXA 5JJNB 2W0FC 5LXTA 1H2LA 3GKXA 3CRCA 1XW6A 4FFKA 5LP6A 3J7AU 2C3TA 2N04A 4NXMO 4EO3A 4XBFA 3KCXA 1VF1A 4IIJB 4FLTA 1W0KG 4JBBA 1M56C 4NV2A 5J2UB 2OADA 2AAWA 4JV5B 4XDKA 2EINC 4PTSA 5DM6V 5AIVA 2F95B 3D21A 4BA7A 4CS4A 3C90A 1XDCA 4PDRA 4UB8Z 2LNTA 3N2GB 2XHBA 3ZIJA 4WBNA 4DSRA 2LSTA 4IJ3A 4UXNA 2OE0A 2WRTA 1FOVA 3EFFK 4FMTA 3BCKA 4ZOLA 1YCIA 4PX1A 2K6VA 2HSMA 2MK3A 3K0DA 1K4CC 3HHVA 1AUCA 3IRAA 3FEUA 1B48A 3U6VA 3NOFA 4Z1VA 4X66O 1VQMV 3IBHA 2YSUB 4BWQA 5GTIZ 5LGNA 3ZLPA 2EJ7A 5AGYA 5J41A 3UOMA 1RP3B 2KOKA 2VL2C 3ISOA 4EFBA 3L71H 3CC4V 5IIZA 3CHXA 3ZRWA 4ZI7B 4DR6O 1GTIA 2GV9A 1IX9A 3CB2A 2DMMA 5A5KA 1TJDA 3I43A 2X6BA 2GQMA 4GCZA 1KUQA 4PA4A 2MMZA 1TK5B 4DR4O 2H6YA 2KP2A 3TJBA 4B7EA 2P31A 3AY8A 5HR1A 4P30A 5LP6C 1NR7A 2B7KA 1O6JA 5ECOB 4OWYA 3CPWU 4IQ1A 3OFNG 3QPMA 1XWAA 4MP4A 2R9AA 4KW6A 5A4UA 2Q0OC 1GTOA 2VQEB 1YVWA 1GUHA 1UVZA 1SRYA 3ASNC 2IIYA 3G67A 3FK8A 5IYZA 1XPVA 3SPIA 4JI3B 2DJJA 3TXQA 2YNXA 3ML0A 4DV4B 2LO1A 1R4WA 1I5XA 1OYJA 3HA9A 2RJZA 3J7Yb 2PPTA 1U87A 2B5EA 1WP0A 3QVNA 2WLNA 2F66C 4DV7O 5IT9N 1THOA 2B1LA 1TDIA 5HR3A 2VD0A 3C1RA 1GN4A 4JAVA 1HNZB 1Y74B 3P90A 1M0UA 4GSNA 1O8WA 4MF6A 3DVWA 1F3BA 3AK3A 3NR7A 4TWKA 3CCLV 2HRAA 4K8ZA 9GSSA 3UO2A 2F43G 1E79G 2YXLA 1VP7A 2XAQA 2Y69B 1XL4A 2IFQB 5H2FZ 1NM3A 5F07A 1OJHA 3L75H 1GN3A 2HFDA 2E7PA 2G0FA 4O5QA 4O4IB 4DR2O 5JCGA 2A3QA 4CS2A 3G6EV 1ZL9A 2B3SA 1MOFA 3EHBB 5L3EA 4O4LB 3F5WC 1M57B 4J7ZA 1O85A 2QE7G 2IMKA 3APSA 2KG7B 1OE8A 4YHHO 4I4TB 3F5TA 3BCIA 1TI3A 2H1GA 3VWWA 5GONB 3W7UA 4DYLA 3TJKA 2LFSA 1V58A 4FYBA 3TKSE 3ZL5A 5CO3A 3GIXA 3S3WA 3CRAA 1FFXB 2N5AA 1X0RA 2EIJB 2OCCC 3K5NA 1XW9A 4UCTA 2MZCA 2MMOA 1AQVA 2ZR2A 3MD0A 4DEJA 1M5IA 4POKA 1HW7A 1NTZH 2YICA 3FW2A 3SGIA 1R6NA 1IURA 1Z9HA 1CXZB 22GSA 1H2NA 4EFEA 4WFAV 1TRSA 2HYXA 5H6QA 4YQUA 5HFMA 2K18A 1GMGA 4OGQB 5DJLA 4N11A 4X20B 5CRWA 2OBIA 1N36B 2L4QA 4PUAA 1ZWIC 4H44B 4GKKB 4UV9A 4AGSA 5CMUA 1KYOF 4MPGA 5CREA 4BVYA 3ZRDA 2VD1A 2CTPA 4QJFB 4K5RA 3ZVJD 5L3CA 4OPAA 3JAMN 2GT6A 1FXKC 4JI7B 2X99A 4I5SA 4IBPA 3LWAA 3KXOA 1HDJA 3M1GA 4EIQA 3F3QA 1B4QA 4AI8A 3DMLA 2LJRA 5C04A 4LF4O 2H75A 2RNBA 2HXKA 5JCUA 5DJMA 1QR9A 4IL6Z 2PI4A 5GSSA 2CT6A 1SQQH 3E35A 4DO2A 4EDZA 1DE2A 1SZXA 2XAJA 4IIJA 2HSHA 1N33O 3UJ1A 4PQ1A 5KHGA 1OAZA 5J2UA 3WT1A 5B1AB 3WD6A 3MYDA 3DTUB 1NU1H 4YHHB 4MCUA 1JR9A 2UUAO 1YY7A 2ZT9B 1PQNA 1MDJA 2BOCC 1ZSPA 1AILA 2NPBA 4GQCA 1BE3H 2B7JA 1IZ3A 3CMIA 2EBOA 3N2GA 2XBIA 1GH2A 5IO2A 2JDIG 2NLJC 2EILB 4LH6A 5K1PA 2XAGA 5LMNB 1YJ6A 2CGNA 4JI5B 4QE9A 2LFRA 1JQ0A 4GYCB 1V55B 1G0TA 2XPEA 2YP6A 4EE0A 3OMAB 2HLSA 2EIOA 2OA7A 5LA6B 2RQ6A 3K03A 3Q18A 5HQPA 2HP8A 2YUAA 1QQCA 3H1NA 1I5YA 2JZRA 3O3TA 2F9SA 4OPHA 2JZTA 4WETA 2EJRA 4MS2A 1WPIA 1AW9A 3TKQA 3CJHB 4TN8A 1IBLO 4NHZA 5JH7B 5COHA 4XCSA 2YXHA 2Q73A 2H19A 5EBLC 3FB7C 2A0LA 4FVMA 4N10A 4IYHA 5KLVH 2XOKG 1X59A 3BJ5A 4PA9A 3SYOA 1R3KC 3JD1A 1M2DA 1G4YB 4TQFA 4WFBV 5EIBC 4B3TB 3JAWB 4N30A 6GSUA 2YXYA 5C93A 2UUBB 4HI7A 2VCXA 3RDWA 2VM2A 2QWOB 1SQVH 1N2AA 1ERTA 3ZVJA 4YIPA 4YQVA 4WFFA 4X65O 1WJKA 2PUKC 4KCAA 2AHZA 4AILC 5CBGA 1NSWA 2YC0A 4ZB9A 4LWSB 1SD9A 5B8BA 3O76A 5A4WA 2Y0IA 5IMFA 4IP6A 2H3OA 2VOCA 2WGRA 4QQ7A 3M99B 1Y74A 4ASUG 4QL7A 4ECJA 4E4EA 3E8BA 1F4MA 4O2BB 1VQ5V 1T00A 4KNDA 4N21A 4OMVA 2IFQA 3Q19A 5CA1B 1Q6HA 3NXSA 3EMPA 3AG3C 1O73A 1KNGA 2FL4A 2P5RA 3BOAA 4JZQA 2R70A 3VWUA 1N0NA 4O4IA 1AP6A 4PI0A 3SJAC 2FD3A 3M9KA 3ZN1A 4L5OA 3SBCA 1GO3F 1TUEB 2PZSA 4N0ZA 2C80A 4O4LA 5HFLA 4K9ZA 2BSKA 2JEXA 1IBLB 1BS3A 4FM0A 3EC3A 4L8JA 3FRCA 2KG7A 1RSOB 4I4TA 1R6TA 4B3SB 2LQQA 1NBMG 4DUYO 4PQIA 3AEIA 4QGPA 2LQOA 1XZOA 3HCZA 1CQHA 1K3LA 3GH6A 3L9DA 5GONA 2QKSA 1IBKB 2BE3A 1NJIW 3LXTA 5IDJA 1WMJA 2X7RB 2AZ0A 4LL4B 3KMNA 3AG1C 4JI2B 2AGAA 4JTDB 4D73B 5LNKe 1GK9A 4X9QA 3CCVV 4DRXB 1DGSA 4TQDA 5IWAB 1FFXA 2VQFB 1YF2A 3NIVA 1JFUA 1OC3A 1PD21 2EZPA 4FLVA 4FZ0A 4JI8O 4RO2A 1TK8B 2XAHA 4LR3A 1VF4A 3R3EA 1SL1B 3WFVA 2I9HA 2LP7A 3BA8A 2GSQA 4EKWA 1XMQO 3HR0A 4ID0A 5B3SB 5JWQB 1EGOA 3W7WA 2HHHO 1ENVA 4O2AB 3ETGA 4X20A 1AI4A 4OD7A 3FYEB 4OFMA 4JI6O 5J3RA 2OWOA 1JFFB 3RYCB 3T1HO 3FY7A 1Y67A 4IGGA 2MW2B 2GSSA 4MJBA 3ICXA 2L35A 2FTKA 5K1XA 4G28B 1QHTA 5AG2A 3GURA 1M57C 4ZBBA 1AQXA 3UM7A 1GULA 3PN1A 4MK3A 3CYOA 1Z7PA 4DR5O 2NR5A 3ABMB 4GUNA 2DJKA 4I0XB 5C00A 1W0JG 1S76D 3U11A 4AJ6A 1H2GA 3MHSC 1XL6A 4KFMA 4I9QA 2L59A 1TXXA 4YKGA 4P9OA 5EC2C 1HR0O 3HY2A 2N74A 4J7KA 1U3IA 3D4TA 4K7NA 4X1IA 4HNAB 2DKIA 5KUKA 4MH2A 2EIJC 2PUSA 1JZOA 2TRXA 3JYCA 2Z3YA 1ZGNA 3DIEA 2CTRA 2JZSA 4LP8A 1XNQB 3KIJA 1G8MA 4LFBO 2DYRB 4MZCA 4C7UA 4D7TA 5JJEB 1B8XA 1K5SA 4MF5A 1A24A 1O81A 1XOUA 1J0FA 1XEQA 3OR6C 1X4TA 1N32B 4XDLA 4FFBB 4JYAB 1U3AA 4KA0A 4WKWA 4NTWA 5KUMA 4LF9O 3H9VA 4DR7O 1P49A 2VIMA 1YSCA 3IJ4A 2WLKA 1JA8A 3CJHA 4JGSA 3UKMA 1PSQA 2PWJA 3F4TA 3BA9A 4OCFA 3KCMA 2XBQA 2YV9A 3BFRA 3GVMA 4IQAA 3ED3A 1PM9A 3OD4A 4WF5A 5CAXA 4XRAA 3QAWA 5LHHA 2GBOA 2UXXA 1XVWA 2Q68A 2C3QA 4NV5A 5FPRA 4FM1A 1USBA 5F06A 2R72A 1ZCPA 5BR8B 1BZKA 2B1GA 3JAWA 1GSFA 4K0GA 2CAIA 5ENUA 3P30A 1R3IC 4E8HA 1MTCA 1FW1A 1IBMO 1ZYQB 4DR5B 2YANA 4Z2WA 1F4NA 1O8XA 4X62O 3CX5F 4R50A 1XUQA 1YDXA 2VWJA 2X0LA 2F8AA 3FZ5A 5G5EA 2DLXA 2KB1A 3TDGA 1AJQA 1ZAUA 3QMXA 3J7Yk 3OMIB 3F4RA 5D9TA 3B09A 5ECLB 1K73W 3ZIVA 1DE1A 4LWSA 3L74H 4YJ3A 4GRFA 3UARA 1A8YA 4MT8A 2LW7A 3X2QB 2HJFC 1SF9A 2Y0PA 2JK5C 2D2CB 3FFQA 2XUMA 2ZXWB 3K5MA 3ZFBA 4J42A 2ZIMA 5IY5B 5CRHA 1A0FA 1MMMA 5LL6Y 5KN0A 2A9HA 3S3XA 1SERA 1WIKA 2C0FA 2BTOA 3T4ZA 2YPMA 2R6KA 1P4RA 4MTGA 5AIXA 4YJ2B 2QTOA 5CA1A 3N9JA 1PV0A 1JMKC 1VF6C 4MMMA 4WF9V 3ZTLA 1MABG 3ZRWB 2QA2A 1L0NH 1P84F 4OFNA 1AP5A 4Z2RA 1R5AA 4V1Ap 5HR0A 1I94O 2V4DA 3K5OA 3QTCA 1TGOA 1YF0A 3HKDB 5EPFA 1HQOA 1PL4A 5LCZA 3I56V 4G2KA 1SETA 4CC5A 3ZITA 1VF2A 3TKSC 2WJUA 3VQXA 4JI0B 4PGTA 1P7BA 3B4SA 4KH7A 1EOHA 3OMNB 4F2IA 2A4HA 1SL2B 3QR6A 1M1KW 4FLXA 1A2MA 4GZRB 1GTAA 1PL0A 1G1XB 4EDYA 1DK1A 4DRXA 5EZYB 2DW4A 1B9YC 2LS5A 2O8VB 3BY6A 1JZRA 3E86A 4KDUA 4OCEA 3ZN0A 2Q7HA 2FNOA 4V1Ag 3EMXA 1HD2A 1LNQA 1HNBA 4ZBDA 1ZYEA 5JCOA 5KN2A 4H0LB 5B8AA 1XW5A 2IJHA 2Q0AA 1OKDA 1F9MA 4MVQA 2E2GA 2EZOA 4ECBA 3ERGA 1ERVA 1XWCA 4NPBA 4FK5C 3BEHA 3HKCB 5KAIZ 1K7DA 2XTAA 3O9OA 3GV1A 5HFKA 1Y6EA 2IMDA 1W59A 4PA6A 3GKKA 1E1RG 4Z2UA 2F1MA 2Q8VA 1JFFA 1GM7A 1PRXA 3RYCA 2LRCA 3C1SA 2GDRA 1S3JA 3F8UA 5ECQB 1FPOA 2BOBC 4XHMA 1KTEA 2G38A 2W6JG 2WDUA 3IHQA 4DW0A 3HXSA 1Q8IA 3UQ8A 1TI1A 2VCVA 4HAMA 1XOBA 5IYDO 1NKDA 4WEYA 3DC6A 2R5GA 2DE0X 2KQXA 5LMUO 1QLNA 2REMA 1KU9A 3T2MA 2IPAA 4XS4A 4I0XA 3ZHVA 1LUVA 1Y66A 3ZHQA 2HKOA 2UXBB 3AG7A 3QO7A 2X6AA 1YEWA 3B77A 3D0ZA 2HRFA 3ZEDA 2I3YA 4G0LA 1MA1A 2VL9A 2H0HA 4HNAA 4YXWG 1YI2V 1EZKA 2H8PC 2WSSG 2CUGA 2ZR3A 2JL4A 5JWPA 3E22B 3F6FA 3UMAA 4Q5QA 1D5AA 4OX9B 1T4ZA 4MA9A 3AG2B 1G6WA 1FAFA 4DV5B 2ZDIC 5LYJA 4ML6A 4RQRA 2CV4A 1GN2A 1VQ9V 1JJ2U 1G7OA 4POMA 5B3SC 5EY6A 2X8GA 3ASOB 1EZJA 2HRKA 3VQVA 2VCQA 4FFBA 4P9PA 3RAZA 1MZEA 1YTFB 3GX8A 3KP9A 5EYPB 2GZYA 3SPHA 2ODMA 1H2MA 2P5OA 1E1QG 4AQYB 2CDYA 3CTGA 5L71A 4K6XA 3IE3A 3ABKB 3K06A 2DJ3A 1E2YA 1QQ2A 1K0AA 1UFIA 4JYCA 3D8CA 4CS3A 4JE1A 3WT2A 1Y4MA 1RPRA 1ST9A 3ABMC 2VQEO 1YKAA 1GNWA 5F8BA 3L72H 1UN2A 2QKEA 5DN6G 4GSTA 4MNNA 3CCUV 2UXNA 4BIZA 10GSA 4JI3O 2WA4A 1HNWB 2NVLA 3PINA 4E8EA 1FHEA 3JSNA 3SR2C 4DV4O 4CZZA 1AB3A 4ZL8A 1DLBA 5LMUB 3W6GA 3TB2A 5BXZA 2RUEA 3WB1A 3EWLA 1EEJA 3HZ4A 3LDEA 1HNZO 1F2EA 4G10A 4IS0A 3K9AA 2AUVA 4CW9A 5J9PC 3KD0A 2VL3A 5KHIA 2DYRC 3OR5A 4O7HA 1PNLA 1QK8A 2RMKB 2W0XA 4WFGA 4NXNB 2YN1A 2MBTA 1AJNA 3L73H 1IYIA 1NI8A 3DVXA 3H79A 2FB5A 3LYPA 17GSA 2H30A 5A9GA 1VQ7V 2YIAA 2P0GA 1XMOB 3HJPA 13GSA 1YXBA 3IC8A 1Z7RA 2F93B 4OO5A 2JSZA 4YJ2A 4KDXA 2E5LB 1V9WA 3CMEV 1MSWD 1JPXA 2QJ1A 4KSOA 4PDVA 2Z9SA 1PNMA 2OIEA 4MTFA 2DIYA 1FVJA 3IK9A 4MVUA 3ETQA 1G7EA 3JAKA 2GUZB 1PFOA 2YEVB 2UXCB 1FXHA 1AROP 2E75B 2HEPA 3SPGA 2VCWA 4GX2A 4X64B 1TOFA 2QC7A 3HKDA 4N23A 4I9WA 4CH5A 2QM8A 2AB6A 1GKFA 1MDIA 4X1UA 2VLUA 4PD4F 3LNNA 2VLTA 4TR4A 1AC1A 3IAM2 2P22C 2FYUH 3CYNA 2FY6A 3ZHRA 3JALA 3WU2Z 4MVSA 4TV9A 1FOHA 1YTFD 1YHQV 5FNVB 3A5WA 1A2LA 4TUYB 2JGUA 3UVTA 3DYRA 5EZYA 3ZIAG 4P3YB 1EZVH 3GTUB 3W7SA 3CRQA 4U3FH 4B7KA 2UUCO 3X2QC 4MJAA 1N36O 2ZXWC 6GSWA 1QLEB 3RN4A 1WJZA 3SYPA 4GKKO 2IWTA 5IY5C 1T7PB 2Z5UA 2QKCA 3QD9A 3VI5A 3HKCA 3TKRA 3N5OA 4JI7O 2RIIA 4I50B 5KAFZ 3BABA 2CK3G 2DJ1A 3KCYA 4MABA 4ACSA 1LR1A 3G7IA 2V6OA 1WP7A 4L5LA 3H01A 1XREA 3BHPA 3WGDA 2ES7A 3IGAC 2FWEA 1SKSB 5G5FA 2K1EA 2HI7A 3VLNA 1SKWB 2PY5A 2BSKB 4GWRA 2WLJA 4BWSA 1Z3EA 1BMFG 4UVAA 4BVXA 1YZXA 2BMXA 2CE4A 5B66Z 1OZ0A 2IMEA 2RM6A 1K97A 1IYHA 1BSMA 4KSMA 3JD2A 3DGEA 4NVPA 2VRZA 4Z1MG 4MLYA 3FYGA 4DSSA 4QNHB 1BX9A 2ZD9A 2PYJA 2I4AA 4KUNA 5ECIB 4JYBA 5E79Z 2V7QG 5LMNO 4JI5O 2ZUPA 2WAMA 3E0UA 2NNUA 1SQFA 1BGYH 1D5NA 3E22A 3WB0A 3F3RA 4NTYA 1OCCB 3FR3A 1FXVA 4ZL9A 4D6TH 1PMTA 3EU3A 3LW9A 4DV6B 3VWVA 3HB3B 1YEPA 3BCCH 1K0BA 1O9GA 4GX0A 3E8GA 4NAXA 2UUCB 4J7JA 4PDMA 5EYPA 3AG4B 5IJ9A 3G80A 4HZ2A 1JLWA 2GT5A 3F7YC 1S5LZ 3QNEA 3ERWA 4JI1B 4B3TO 5E4WA 4JR6A 4JZ2A 1H2KA 2UUBO 3L9VA 2ITCC 5BY1A 5IYBO 3MDKA 2JS5A 2FA4A 2DQ3A 2QKAA 1OCOB 4X8AA 1GLPA 2CA8A 3CWBH 4DV1B 2EIKB 4I6XA 1VIBA 5CBHA 3CSJA 3JCML 3W8JA 5LGUA 8GSSA 1NTMH 4GXZA 2DQ0A 4H33A 2WLHA 5KN3A 3Q6OA 4LH7A 2H70A 4XRDA 3PH9A 1GSUA 3GWKC 1SQBH 4X1IB 4MJCA 1RW1A 2P90A 2F23A 3J81N 1HYUA 3AG2C 1OCRB 1M4UA 2A4VA 1XWBA 3FZ9A 4KGIA 3GSSA 6GSXA 1GSEA 4KB3A 3R66A 3UIWA 2VS0A 2A2PA 2QGNA 4X88A 5B1NA 5TISZ 1YJWV 4JU5A 3DXBA 2HZEA 3FZAA 4OXSA 4RUFA 4LC1A 3B2EE 2OBKA 1H75A 19GSA 3W7XA 2PU9C 1WPXA 1FAAA 2IL3A 3LORA 3K9SA 2FWFA 5DVBA 2FUG2 3D4MA 5DBQA 4AJ8A 2OYQA 3CCRV 4B3SO 1J5EB 2GUZA 3TKPA 5D9WA 2YEVA 4WFHA 2LNSA 2F51A 3ME7A 4LMWA 2DJVA 4Q5FA 2JIZG 1IBKO 5IOXA 2DOSA 3LSSA 1MNGA 3KTLA 1B9XC 4YQMA 4JI2O 4PQHA 3E8HA 1TW9A 3US3A 1BQ7A 1GSDA 5DEDA 4TV8A 4FQUA 3QAVA 1XG8A 2VQFO 5IWAO 3CC2V 2E74B 3HKBB 2OE1A 4HQSA 4DV2B 4LF7O 4LF6B 3A2VA 1R1BA 2WPDG 1M3JA 2IJIA 2F8FA 5GAPD 1X9SB 4PA3A 3ZYWA 2VCZA 1Y76A 4IHJA 2X64A 1GL8A 3CRUA 5FNVA 2ZQMA 4TUYA 3PGTA 3O6TA 4G0KA 1GNEA 5IE9A 1T8EB 2KP1A 3IR4A 3L4NA 3FAVB 3RBTA 3GTUA 1NHOA 1Q82W 1EOGA 2IN3A 5HFIA 4YJ3B 1VMGA 2C2AA 5L3GA 2DWEC 3OR7C 1GSYA 1TTZA 2JACA 4KE3A 5FWGA 3ZMTA 3LJRA 1KC8W 1BEDA 4G19A 4CHSA 1SQGA 2EIMB 2OKAA 4L0WA 1K0DA 3JD3A 3EVKA 1UPGA 4CDOA 3L70H 4WXTA 1Q4JA 2G2QA 2P4VA 4I50A 1KP2A 2QWNB 4UFZA 5B1OA 3DEXA 1J95A 3I69A 2MMNA 3K58A 1BHBA 2TIRA 1Q3EA 4RAIA 2CVDA 4HZ4A 3H1KH 1PNKA 2DYSB 3KP8A 4KXRA 1PL1A 1TA8A 4PURA 4FZ1A 1JZDA 2YIDA 2WLIA 2TRCP 5FPOA 4KP4A 1M2BA 4I2TA 1PL2A 2Q69A 4HS1A 1NT2B 2CVKA 3UCSC 4LCUC 4GLXA 5B5EZ 2ALBA 5D5PA 1KBHA 4ECCA 1AI6A 2D2ZA 2GVPA 5CBFA 1R3LC 3VQWA 3SJQC 4TR3A 1ZLZA 4O4HB 2JJ2G 2YZHA 3JSLA 1XNQO 1M2AA 2E2MA 4DK0A 1MZFA 2MBSA 1VEWA 3OT7A 4V2NA 3TK1A 4LF7B 2H73A 4QPJA 3K5LA 4HYOA 2GS3A 2H74A 3GRXA 1N32O 2CX4A 1PPJH 3BRCA 4JYAO 2EIQA 3ZMLA 5J4UA 1ZL8A 1DF4A 2KKWA 1CEZA 2V6KA 1QLEC 3VPTA 2PGGA 4GX5A 1M9BA 5EVOA 4EXJA 3GSTA 1I0HA 1TUBB 2YI8A 1TRUA 2X4AA 4TW5A 1KP3A 2UU9O 1K0CA 4CH4A 5ELAA 2H0GA 1F51A 2Y69C 3HD5A 2CTWA 3OW2U 3UBKA 1N34B 1EP8A 5JVDB 4RQFA 2FGXA 5FHIA 4PDLA 4KAEA 2LRTA 4ICGA 3UBLA 3D3QA 3K08A 4WBRD 4X43A 4ZHQA 1ABAA 1X5DA 4Z7XA 2E3CA 5BR8O 1B3QA 1GWCA 1S3DA 1F3AA 2E0QA 3LGCA 5CRGA 2V32A 4L0UA 4PI2A 4ZB8A 1ML6A 2AHEA 3LXZA 1SYXA 1BQ0A 3T4DA 4XS4B 4CH6A 4EUYA 5HFGA 2H1BA 2ZE6A 2H6XA 3GMFA 2EX3A 5IMCA 4DR1B 3IC9A 3C7MA 3FB6C 4DW1A 1R6KA 1ZUQA 4NR1A 2HRNA 4MVRA 4MVZA 2ZE7A 1RK4A 2ZE5A 4WF4A 3OUFA 3WYWA 2JS3A 2H76A 4K1FA 1OCCC 2QWQB 3O65A 5J9BA 1KECA 1HNCA 2HE3A 2L6DA 5LYJB 3GL5A 4Q5NA 3APQA 4B3RB 3IDVA 3M0FA 4K2XA 3STZC 5GW7A 4CH3A 2CAZC 3T1YB 1XWGA 1PX6A 3HVNA 2NN4A 2DJ2A 5IMDA 4F03A 2AZ2A 1K0MA 1RM1B 1PKXA 1ZX3A 3ZX6A 3ZZXA 2JADA 3GHAA 4K5SA 1IDSA 4KF9A 1SKRB 3CRTA 11GSA 4IYIA 3EYTA 2UU9B 3SYQA 4KHPB 2PBJA 3GKMA 1XIYA 3K0GA 2J9HA 2ATKC 5H6RA 4JI0O 5D73A 2FCHA 1OCOC 1LUWA 3M9JA 5GTHZ 5IPHA 1FD9A 2EIKC 2ITDC 3P8WA 2PN8A 4J9ZB 5D9VA 4KUMA 1S77D 3MDSA 2O87A 2M80A 2L5OA 4HJMA 3VFIA 4ZKIA 3HKBA 1XQ8A 4J80A 4JPRA 4BWAA 5B1AC 2WS2A 3UT5A 5CA3A 1XVQA 2YIBD 4JTAB 1QGVA 5DQYA 5F2VO 1OC9A 1TRVA 2YJHA 4YY3B 14GSA 1B06A 4TR1B 1Q90D 3OGIB 1XNRB 1H8EG 1RFYA 3OUSA 1BL8A 5FL7G 2B6MA 3FKFA 1P7GA 2X49A 3ZFLA 1EN4A 3FAVA 1FYJA 4GTUA 2EILC 2XPDA 3U5RE 4BIKA 5KOWA 3CCMV 2QSAA 4I97A 1ZOFA 3IXRA 1V55C 4FH8A 4F0CA 2DKHA 3CE2A 5KA5A 3P2AA 2FHEA 4TKYA 3ZMKA 5L3DA 2H1DA 4KL1A 5JCWA 4DV3B 2YDEA 1EV9A 2R3XA 4L87A 4YKFA 2DMXA 1GH6A 3ZMZA 4ULXA 5JQGB 4CBCA 1Q6UA 3RFRA 2F4VB 2D3OW 3W8SA 2GDSA 2ZE8A 2CAQA 1GRJA 3ZMSA 2A06H 3IAYA 3JAKB 4NMUA 1NHYA 1SA0B 2P06A 3IAS2 1S0VA 1X5EA 2P5QA 4DV0B 3FD9A 3EU4A 4FM2A 3K79A 2UXBO 3LSZA 4OO4A 4LBEC 1QR8A 2QGVA 3VQYA 3APOA 4HUAA 5DQSA 4MW3A 4U3JB 3K3WA 1OV9A 3C3SA 3IPZA 4O4HA 4JRRA 1AVMA 4OX9O 2R9RB 3JALB 1BG5A 5BMVA 4TV9B 5ID2B 4DV5O 4IVFA 1V9PA 4IP1A 1WPBA 5LOVB 4TVEA 6GSTA 1JOYA 4B3MB 1Z5YE 3HKRA 5LGTA 1D2DA 1DUGA 5IM9A 1Q5OA 2ZINA 4J10A 5KHKA 1GUMA 6GSVA 2L4CA 4UB6Z 3MAKA 2EIMC 1Q86W 1YJ9V 1UA5A 1R3JC 3JD0A 2PTMA 1SK2A 2QSIA 2YWNA 4BPYA 1TKDB 1TUBA 1BAYA 4AQYO 2YZUA 4GQFA 1M99A 4JF3A 5LBQA 4DSQA 3RPNA 1KEBA 3H93A 5HR2A 4LFAO 1U88A 1AI5A 2Q7EA 4X4JA 2PI5A 1QFNA 3ETDA 2AV4A 1O7UA 2HVKC 5JVDA 2UXDB 4DR3O 2H71A 2WWWA 3EXAA 2OCCB 3SPCA 2Q5ZA 1MG1A 1GTUA 2N5BA 1K0OA 4H86A 3QDNA 4GKJB 4QPKA 1K0NA 3WGEA 1SS3A 2R9IA 2HNLA 4EC0A 4IKHA 5BMUA 1HNWO 2Y4TA 3QG5A 2M6YA 2H6ZA 2QDOA 4J57E 2E76B 2X8CA 4Q6GA 3LUTB 2JRIA 1AJPA 2LTKA 4BVXB 7GSSA 1A8LA 4NKGB 2DJ0A 1SESA 4PELA 1M9AA 3QCPA 3F4SA 3EURA 1TAEA 3CCEV 3S9FA 2Y48A 1US6A 1K92A 1ILOA 5KMGB 5ECSA 2AYTA 2DN9A 4N0VA 2C4JA 3A0HZ 3A3TA 4HU9A 4LF5B 1FXKB 4NXNO 4QL9A 4IELA 3TRXA 1SL0B 1A2JA 1W4VA 3SWLA 2ZM6B 1K34A 2IBZH 3DGQA 1H2SB 1J08A 3TJFA 1XMOO 2JJ1G 3A0RA 3P3PA 4FIWA 3WGXA 1FO5A 1WRYA 4YIOA 4BAYA 5JCOC 1YKCA 4F9ZA 2YJ7A 4MDCA 2E5LO 4MTOA 4HEA2 1BJXA 2IJYA 1K8AW 1EWXA 5KHHA 2XAFA 3G9BA 3RGBA 4ZXGA 3B40A 4FLWA 3B8NA 3ME8A 4JAUA 5L3FA 1ZYNA 5JWRB 1YF1A 1YQ1A 3RYFB 1JLVA 4ZBAA 2UXCO 3ERFA 4RQXA 1S3RA 3GL3A 2ZCEA 5IJ9B 4ICYA 1AIUA 4NXIA 3MIXA 5IJ0B 4X64O 1V54B 5G1KA 3GA4A 1SQXH 4UV8A 3OEEG 4LFAB 4FLUA 4PXOA 2HLDG 5CYYA 3QOUA 3RYIA 1XCCA 3FMWA 4DR3B 5CN0A 4G2EA 4R8CA 3P7XA 4BL7A 3TXSA 1GN6A 2GTSA 3QO5A 3GWOA 2LRNA 3DWVA 1WAZA 5DCGA 5IPGA 3H1HH 4BR6A 1K3YA 1S3AA 5G30A 3TJJA 1BHAA 5H9CA 1E6BA 3NZNA 3GH9A 3KEBA 4TR1A 3M8AA 1T1VA 4I55A 3SJBC 4JI4B 2YOIA 3QFAC 12GSA 4J11A 4E2LA 1H38A 1Q43A 1FKAO 4Z2TA 2O7KA 4DUZO 2HG5C 4MPFA 3FR6A 1IXMA 4MZBA 1YITV 1SJ6A 1MEKA 4EVMA 3CRMA 2JVDA 2P4KA 4FIPC 5BRTA 5H5NA 5CRDA 5B1BB 2XC2A 1ACVA 3P3NA 1AI7A 4LNUA 2CX3A 5EL8A 2Q67A 3QFBC 4AJ7A 2HZEB 1TU7A 1RM1C 1WN7A 5ECHB 1YEXA 4FJCC 1TRWA 2BTQB 4I5QA 1HNXB 3G7YA 3THOA 5JQGA 3GX0A 3MAQA 1WA8B 3JD4A 3C71A 4LA1A 3Q4HB 4IGJA 2KHPA 5FT3A 4X1KA 2CH7A 1WWJA 3BVOA 2C0GA 3G6BA 2R4VA 3KZQA 5EK0A 3C3TA 4BW5A 3DSQA 3KM6A
chains in the Genus database with same CATH topology
5KN1A 1GUKA 1N8JA 4KX4A 2GTUA 2C8UA 2LJKA 3FHKA 1HNAA 2O89A 1QMVA 4TXOB 5GZZB 4FYUA 1KBNA 2L6LA 5ID2A 2DSAA 2J23A 4HJ2A 2QWRB 2OACA 1GP1A 1ERUA 3IC4A 2H01A 3H4KA 1W89A 1GRXA 2MYGA 2R2JA 5KOXA 2B5XA 2F3MA 3FZ4A 2HSYA 1PGTA 5DCHA 5H5RA 4AF2A 2GZPA 3TGZA 4RWUA 1EEMA 5H5SA 3BBYA 4IJIA 1T4YA 3GUSA 5B6NA 5H5QA 1OC8A 5ABRA 5DAKB 2DBCA 1XWKA 4GCIA 3DRNA 4OFTA 1ERWA 1DSBA 1BQZA 2WB9A 4MH3A 1EP7A 2CZ2A 5CP1A 4FO5A 1SD8A 5ECRB 2RLIA 3UAPA 2H1AA 1R26A 1X5CA 3PR8A 5GSTA 1S3CA 2DC5A 1SK0A 5G1LA 5DDLA 3UVHA 5DALB 1GTBA 3IOSA 4ISDA 4HDEA 2VCTA 2K8VA 2V1MA 2KUCA 3LYKA 3H8QA 1PN9A 2KLXA 2C0DA 1SYRA 2K8SA 5CNWA 5IOWA 3GFKA 5E59A 4WR4A 4F0BA 1PX7A 5G31A 2HZFA 3IHGA 3VI7A 4O5UA 2YWIA 3VPQA 2GZZA 5GAND 1MD3A 1LU4A 1FB6A 3TOTA 1A23A 2ON5A 4KDYA 4DVCA 5AISA 2L6CA 3EPTA 1NZ6A 4IHUA 2B1KA 2VLVA 4J56E 3VK9A 3L0HA 1SK1A 2K9FA 5ECKB 2R37A 2VM1A 1OKTA 2FWHA 3F6DA 3G7JA 4LLRA 2N05A 1FVKA 2VO4A 2IMIA 2FWGA 6GSYA 3TRPA 4TRXA 1SJIA 4PNFA 4V2MA 3GKNA 2ZCTA 3A2WA 2YCDA 4IT5A 4JR4A 5ECNB 1XOAA 2YWOA 1WOUA 4TXOA 2CZ3A 4K7OA 5IMVA 2YS8A 1EV4A 2LUSA 1OC9B 1C72A 5J9CA 1R5PA 1SU9A 4IN0A 3UEMA 2GLRA 4XS6A 2LV3A 2QA1A 2EC4A 3HVSA 1RQMA 4NWYA 3PPUA 2GQKA 1XFLA 1EGRA 4TOPA 1DBYA 2I81A 2OCHA 3CSIA 3E3EA 1PN0A 3EINA 3M3MA 4NHWA 3TCOA 3E9JB 1T3BA 2GSTA 3DD3A 1Z6NA 2C3NA 4XS1A 5AN1A 3GNJA 2GSRA 3TOUA 5DAKA 4WBJA 2L5LA 4POLA 3MWHA 1B4PA 1ZMAA 5IMAA 1URMA 4YH2A 1SENA 1XBSA 3F63A 3M8NA 1AQWA 4PUFC 4ZIJA 3HJOA 2M46A 1X9MB 1V40A 4CY8A 4RI6A 4WR5A 2OJLA 5G2ZA 2L57A 3F9UA 3ZREA 18GSA 5IMZA 3RHBA 4TR0A 1ZYPA 2YWMA 1SJZA 1VF3A 3K8NA 5F0GA 5DALA 2V2GA 3UL3A 2NBSA 5IO0A 1J9BA 4TXVA 3RHCA 2RM5A 1LBKA 5F05A 4FYCA 2LKUA 3UO3A 3KH9A 4RUVA 4ZB6A 5JWOB 2CQ9A 2R0PA 4EL1A 1JHBA 2BJXA 1OE7A 2GQLA 1I5GA 3GYKA 2H72A 4USSA 3HDCA 5IQYA 3GN3A 1NW2A 1VGLA 2X8HA 1TU8A 2LEGA 5ECMB 3CTFA 4K8MA 5ECPB 1A0RP 2DIZA 1ON4A 4HU7A 1UC7A 5B6MA 5D93A 1Z6MA 4IW9A 4ZL7A 3R2QA 2WCIA 1CQGA 5LD0A 3MNGA 4L8EA 4YAPA 3VWXA 4F82A 1H4OA 3D22A 3LG6A 1YDKA 4POBA 3A5IA 1F37A 4EKZA 1PKZA 4RI7A 5D96A 1VRSD 3F0IA 5KEJA 1LJRA 3MSZA 4LMVA 4X0XA 4ZILA 4ML1A 1MDKA 3CBUA 1BYEA 4XTSA 4GF0A 3D5JA 2LJAA 3IA1A 4BL7B 5ELGA 3TRQA 2GGTA 2ON7A 5B7CA 2A2SA 1OVNA 2M72A 3LEFA 1JZWA 1GLQA 2R0CA 1G6YA 2V41A 3I6AA 1K3OA 2C1YA 3TJGA 4ILFA 3TUEA 5A4VA 4KCEA 1THXA 2I1UA 2NTOA 3TKSA 2B5YA 1R7HA 4PNGA 2H8LA 2HT9A 3HVXA 1X9WB 2WULA 1PKWA 3QAGA 3CXGA 1TK0B 3L78A 2EIRA 4J2FA 4YAVA 3Q74A 1FG4A 1XBLA 1ZZYA 3RPPA 1V57A 3A2XA 4I8BA 1WE0A 4HOJA 3KH7A 1QXHA 2AJQB 3EE2A 16GSA 4JEDA 2PF4E 4EIPA 4GLTA 4GSSA 2LGWA 3FR9A 2ZNMA 2XHFA 4MJEA 3CSHA 5D9XA 2OE3A 4DSSB 2N5FA 1MD4A 2DMLA 2FA8A 2R0GA 3HZ8A 3HVVA 1TP9A 3BD2A 2IMFA 1Y25A 1F6MC 1GSQA 1FB0A 2QWPB 4D73A 2A2RA 2BTOT 2RUFA 1PA3A 2H0IA 4MF7A 1V2AA 2O85A 2FLSA 2WZ9A 5J5NA 4K2DA 2PMTA 1QUWA 2PVQA 4G9HA 2H66A 2C0EA 3KMOA 5D8IA 2YV7A 3L9SA 4A5PA 3EVIA 2VAFA 1XXUA 2CTQA 2UZ8A 20GSA 4O5RA 1V98A 4Q5RA 2CVBA 3I9V2 3VURA 3LFLA 4G0IA 4MZWA 2MMAA 4I2UA 3D6IA 4O92A 4CY6A 3KTBA 5INYA 1AXDA 4K0NA 2VUPA 4EF0A 2PERA 2WFCA 4O32A 1N4CA 4V2LA 3IK7A 3V1WA 6GSSA 2JSYA 4HQZA 3KJYA 3HJMA 1Q98A 3KGKA 1AAZA 1GSSA 1U6TA 4K7IA 2PGTA 4ECIA 3C8EA 1I9DA 3L9UA 2Y4UA 4BVYB 3IV4A 2VL2A 2JU5A 2PVOC 3LQ7A 3HYPA 1M7TA 3C73A 2NDOA 4LL1B 3DKSA 3GKXA 1XW6A 2C3TA 2N04A 4EO3A 1VF1A 4JBBA 4NV2A 2OADA 2AAWA 4PTSA 5AIVA 4BA7A 3D21A 2LNTA 3ZIJA 4DSRA 2LSTA 4IJ3A 2OE0A 2WRTA 1FOVA 3BCKA 4PX1A 2K6VA 2HSMA 3HHVA 1AUCA 3IRAA 3FEUA 1B48A 3U6VA 3NOFA 3IBHA 4BWQA 5J41A 3ZLPA 2EJ7A 5AGYA 3UOMA 2KOKA 2VL2C 3ISOA 5IIZA 1GTIA 2DMMA 5A5KA 1TJDA 3I43A 2GQMA 2MMZA 1TK5B 3TJBA 2H6YA 2KP2A 2P31A 5HR1A 3AY8A 4DSSA 2B7KA 1O6JA 5ECOB 4OWYA 4IQ1A 3QPMA 1XWAA 4MP4A 4KW6A 5A4UA 1GUHA 1UVZA 2IIYA 3FK8A 1XPVA 2DJJA 2YNXA 2LO1A 1R4WA 1OYJA 3HA9A 3J7Yb 2PPTA 1U87A 2B5EA 1WP0A 1THOA 2B1LA 1TDIA 5HR3A 2VD0A 3C1RA 3P90A 1M0UA 4GSNA 1O8WA 4MF6A 3DVWA 1F3BA 2HRAA 9GSSA 3UO2A 2IFQB 1NM3A 5F07A 4O5QA 2HFDA 2E7PA 2G0FA 5JCGA 1ZL9A 2B3SA 4J7ZA 1O85A 2IMKA 3APSA 1OE8A 3BCIA 1TI3A 2H1GA 3VWWA 3TJKA 1V58A 4FYBA 3TKSE 3ZL5A 5CO3A 3GIXA 2N5AA 1X0RA 1XW9A 2MZCA 2MMOA 1AQVA 4DEJA 4POKA 3FW2A 1IURA 1Z9HA 22GSA 2HYXA 1TRSA 4YQUA 2K18A 5DJLA 4N11A 5CRWA 2OBIA 2L4QA 4PUAA 4AGSA 4MPGA 5CREA 4BVYA 3ZRDA 2VD1A 2CTPA 3ZVJD 4K5RA 2GT6A 2X99A 4IBPA 3LWAA 3KXOA 1HDJA 3M1GA 4EIQA 3F3QA 1B4QA 3DMLA 2LJRA 5C04A 2H75A 2HXKA 5JCUA 5DJMA 5GSSA 2CT6A 4EDZA 1DE2A 2HSHA 3UJ1A 3WT1A 4PQ1A 1OAZA 3WD6A 3MYDA 4MCUA 1YY7A 1PQNA 1MDJA 2NPBA 4GQCA 2B7JA 3CMIA 2XBIA 1GH2A 5IO2A 1YJ6A 1G0TA 2XPEA 2YP6A 4EE0A 2HLSA 2EIOA 2OA7A 5HQPA 3Q18A 2YUAA 3H1NA 2JZRA 3O3TA 2F9SA 2JZTA 4WETA 1WPIA 1AW9A 3TKQA 4TN8A 4NHZA 5COHA 4XCSA 2H19A 4N10A 3BJ5A 1M2DA 4N30A 6GSUA 4HI7A 3RDWA 2VCXA 2VM2A 2QWOB 1N2AA 1ERTA 3ZVJA 4YQVA 1WJKA 2PUKC 4KCAA 1NSWA 4ZB9A 1SD9A 5B8BA 3O76A 5A4WA 5IMFA 4IP6A 2VOCA 2WGRA 4QQ7A 4QL7A 4ECJA 1T00A 4KNDA 4OMVA 2IFQA 3Q19A 4JZQA 3EMPA 1O73A 1KNGA 3BOAA 2P5RA 3VWUA 2FD3A 3M9KA 4L5OA 3SBCA 4N0ZA 2C80A 4K9ZA 3EC3A 3FRCA 2LQQA 4PQIA 2LQOA 1XZOA 3HCZA 1CQHA 1K3LA 3GH6A 4XIHA 3LXTA 1WMJA 4LL4B 3KMNA 4D73B 5LNKe 3NIVA 1JFUA 1OC3A 1PD21 1TK8B 1VF4A 3R3EA 1SL1B 2I9HA 2GSQA 4ID0A 1EGOA 4OD7A 4OFMA 5J3RA 3FY7A 2GSSA 4MJBA 3GURA 4ZBBA 1AQXA 1GULA 4MK3A 1Z7PA 2DJKA 5C00A 4AJ6A 2L59A 1TXXA 4YKGA 3HY2A 1U3IA 3D4TA 4K7NA 2DKIA 4MH2A 1JZOA 2TRXA 1ZGNA 3DIEA 2CTRA 2JZSA 3KIJA 4MZCA 1B8XA 4MF5A 1A24A 1O81A 1J0FA 1U3AA 4KA0A 4WKWA 2VIMA 1PSQA 4OCFA 2PWJA 3F4TA 3KCMA 2XBQA 2YV9A 4IQAA 3ED3A 4WF5A 5CAXA 4XRAA 3QAWA 1XVWA 2C3QA 4NV5A 1USBA 5F06A 1ZCPA 1GSFA 4K0GA 2CAIA 5ENUA 4E8HA 1MTCA 1FW1A 1ZYQB 2YANA 1O8XA 2F8AA 3FZ5A 5G5EA 2DLXA 3TDGA 3QMXA 3J7Yk 3F4RA 5D9TA 3ZIVA 5ECLB 1DE1A 4GRFA 3UARA 1A8YA 3ZFBA 5CRHA 1A0FA 5KN0A 1WIKA 2C0FA 2YPMA 2R6KA 5AIXA 3N9JA 4MMMA 3ZTLA 2QA2A 4OFNA 4Z2RA 1R5AA 4V1Ap 5HR0A 1YF0A 5EPFA 1HQOA 5LCZA 3ZITA 1VF2A 3TKSC 2WJUA 4PGTA 4KH7A 1EOHA 4F2IA 2A4HA 1SL2B 3QR6A 1A2MA 1GTAA 4EDYA 2LS5A 1B9YC 2O8VB 1JZRA 4OCEA 4KDUA 2FNOA 4V1Ag 3EMXA 1HD2A 1HNBA 4ZBDA 1ZYEA 5KN2A 5B8AA 1XW5A 1OKDA 1F9MA 2E2GA 4ECBA 3ERGA 1ERVA 1XWCA 4NPBA 5HFKA 3GV1A 1Y6EA 2IMDA 3GKKA 4Z2UA 1PRXA 2LRCA 3C1SA 2GDRA 3F8UA 5ECQB 1FPOA 4XHMA 1KTEA 2WDUA 3IHQA 3HXSA 1TI1A 2VCVA 1XOBA 4WEYA 2R5GA 2KQXA 2REMA 2IPAA 4XS4A 3AG7A 3D0ZA 2HRFA 2I3YA 4G0LA 2VL9A 2H0HA 5JWQB 1EZKA 3F6FA 2CUGA 2JL4A 3UMAA 4Q5QA 1T4ZA 4MA9A 1G6WA 1FAFA 4ML6A 4RQRA 2CV4A 1G7OA 4POMA 5EY6A 2X8GA 2VCQA 2HRKA 3RAZA 3GX8A 3KP9A 2GZYA 3CTGA 5L71A 4K6XA 3IE3A 2DJ3A 1E2YA 1QQ2A 1K0AA 4JE1A 3WT2A 1ST9A 1YKAA 1GNWA 5F8BA 1UN2A 2QKEA 4GSTA 4MNNA 10GSA 2NVLA 3PINA 4E8EA 1FHEA 4ZL8A 3W6GA 3TB2A 2RUEA 3EWLA 1EEJA 3HZ4A 4G10A 1F2EA 4IS0A 2AUVA 4CW9A 3KD0A 2VL3A 3OR5A 4O7HA 1QK8A 2YN1A 2MBTA 1IYIA 3DVXA 3H79A 3LYPA 17GSA 2H30A 2P0GA 3HJPA 13GSA 3IC8A 1Z7RA 4OO5A 2JSZA 4KDXA 1V9WA 4KSOA 2Z9SA 3IK9A 2DIYA 1FVJA 1G7EA 2GUZB 2VCWA 2QC7A 1TOFA 2AB6A 4X1UA 1MDIA 2VLUA 2VLTA 4TR4A 1AC1A 3IAM2 3CYNA 2FY6A 1FOHA 3A5WA 1A2LA 3UVTA 3DYRA 4P3YB 3GTUB 4MJAA 6GSWA 1WJZA 2IWTA 1T7PB 3QD9A 3VI5A 3TKRA 3N5OA 2RIIA 4MABA 4ACSA 2DJ1A 3G7IA 2V6OA 4L5LA 3WGDA 2ES7A 1SKSB 2FWEA 5G5FA 2HI7A 3VLNA 1SKWB 4GWRA 4BWSA 1Z3EA 4BVXA 1YZXA 2BMXA 2IMEA 2RM6A 1IYHA 4KSMA 4MLYA 3FYGA 1BX9A 2I4AA 4KUNA 5ECIB 2ZUPA 3E0UA 3F3RA 3FR3A 4ZL9A 1PMTA 3EU3A 3LW9A 3VWVA 1YEPA 1K0BA 4NAXA 4HZ2A 1JLWA 2GT5A 3ERWA 5E4WA 4JR6A 3L9VA 3MDKA 2FA4A 1GLPA 2CA8A 4I6XA 3CSJA 3JCML 3W8JA 8GSSA 5KN3A 3Q6OA 2H70A 4XRDA 3PH9A 1GSUA 4MJCA 1RW1A 1HYUA 2A4VA 1XWBA 3FZ9A 4KGIA 3GSSA 6GSXA 1GSEA 4KB3A 3UIWA 2A2PA 4JU5A 3DXBA 2HZEA 3FZAA 2OBKA 1H75A 19GSA 2PU9C 1FAAA 2IL3A 3LORA 2FWFA 5DVBA 2FUG2 3D4MA 5DBQA 4AJ8A 2GUZA 3TKPA 5D9WA 4LMWA 2LNSA 2F51A 3ME7A 4Q5FA 5IOXA 3KTLA 1B9XC 4YQMA 4PQHA 1TW9A 3US3A 1BQ7A 1GSDA 4FQUA 3QAVA 4HQSA 2OE1A 3A2VA 2F8FA 5GAPD 1X9SB 3ZYWA 2VCZA 2X64A 1GL8A 3CRUA 3PGTA 3O6TA 4G0KA 1GNEA 1T8EB 2KP1A 3IR4A 3L4NA 3RBTA 3GTUA 1NHOA 1EOGA 2IN3A 5HFIA 1GSYA 1TTZA 2JACA 4KE3A 5FWGA 3LJRA 1BEDA 4G19A 4CHSA 2OKAA 4L0WA 1K0DA 4CDOA 4WXTA 1Q4JA 2G2QA 2QWNB 3DEXA 3I69A 2MMNA 2TIRA 2CVDA 4HZ4A 3KP8A 1PL1A 4PURA 1JZDA 2TRCP 1M2BA 4I2TA 1PL2A 4HS1A 2CVKA 3UCSC 2ALBA 4ECCA 2D2ZA 2GVPA 4TR3A 2YZHA 1M2AA 2E2MA 2MBSA 4V2NA 2H73A 2H74A 2GS3A 3GRXA 2CX4A 3ZMLA 2EIQA 5J4UA 2V6KA 3VPTA 1M9BA 4EXJA 5EVOA 3GSTA 1TRUA 2X4AA 4TW5A 1K0CA 5ELAA 2H0GA 3HD5A 2CTWA 3UBKA 1EP8A 2FGXA 5FHIA 4KAEA 2LRTA 3UBLA 4WBRD 4X43A 1ABAA 1X5DA 4Z7XA 1GWCA 1S3DA 3LGCA 1F3AA 2E0QA 5CRGA 2V32A 4L0UA 4ZB8A 1ML6A 2AHEA 3LXZA 1SYXA 1BQ0A 4XS4B 4EUYA 5HFGA 2H1BA 2H6XA 3GMFA 5IMCA 3C7MA