1ZL8B

Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
SDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIN-7
publication title A General Model for Preferential Hetero-oligomerization of LIN-2/7 Domains: Mechanism Underlying Directed Assembly of Supramolecular Signaling Complexes
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 14
structure length 54
sequence length 54
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1zl8B00
1Y76A 1ZL8A 3B40A 1RSOB 1VF6C 1Y74A 1Y76B 1ZL8B 1VF6A 1Y74B
chains in the Genus database with same CATH superfamily
4EEQA 2HG5C 1ZL8A 3K08A 5H9CA 5KAFZ 3OUSA 1VF7A 1V9PA 2OIGA 4BW9A 1SQQH 4X62B 2F95B 2EULA 5EIBD 2IJKA 3TXSA 1NBMG 3RYHA 3M99B 5B1BC 1JMKC 3OR7C 2RMKB 2Y4UA 5IYDO 1P49A 2F1MA 3IAYA 4GCZA 1G8MA 1G6UA 3OMAB 2XOKG 3ICXA 3T1HB 1WJZA 2KQXA 3E22A 4X65B 1EN5A 1UJWB 1AJNA 4X88A 2V1DA 2EZOA 4NYKA 5LP6B 5LA6A 4RQFA 1BQ0A 4C7UA 2EIMB 3OTFA 2JGDA 2EIKC 3VBBA 2G38A 1FXKA 3HKBA 4MVRA 1WB7A 1RP3B 1FFTB 2P4KA 4GT1A 2E3CA 3A0BZ 1Q6IA 4JI3O 3QG5A 1HNXO 1Q3EA 4MS2A 2UUCO 2YXHA 4WFBV 1KQSU 5LOVA 3UQ8A 2DYSB 4NXNB 2ADPA 4MVQA 1FAFA 2AXTZ 3I56V 3D3QA 3THOA 3JD1A 1I5YA 4ICGA 2HHHB 1W0KG 4ZI7B 2JRIA 4J7KA 2BSKA 4FIPC 2Q4PA 1HP8A 1V55B 4B3MB 3CCMV 1KP2A 3AG3C 5LHHA 2UUAO 3A2FA 4DV7O 1BHBA 3SYPA 2PTMA 4D6TH 5B1AB 4J7ZA 4X9QA 4AI8A 1FPOA 1KYOF 2ZIMA 3OAAG 4I4TB 3CMAV 1ROPA 3JD4A 3E35A 1XMOO 2GV9A 4I9WA 2GDSA 3KZIZ 2VS0A 4R8CA 4P9OA 5IT9N 2XAFA 1MNGA 2A06H 1MSDA 4DR1O 2CDYA 4PA3A 3SYAA 1S5HC 1GM8A 4UVAA 4X1YA 1RPRA 4DUYO 4JF3A 2VQFO 1AJPA 4QE7A 2R9AA 2W0FC 2QWOB 5LMUO 2UU9O 2Y69B 1FYJA 4LF6B 3SGIA 4X64O 3RW0A 1FD9A 4JI2O 3OFNG 4YHHO 1SETA 2JS3A 2FKXA 2D3OW 3TCUA 1FS0G 4DV2B 1SQVH 2PUSA 4CS4A 1KBHA 3S3XA 4I55B 4CH5A 1JPXA 4JYAO 3SJCC 4KUMA 3R65A 2Y48A 1THZA 4PA4A 4DYLA 1TA8A 4R7CA 5EZYA 4LF9B 1S5JA 4X1IB 4KP4A 2QA4V 1QQCA 4J80A 3LDEA 2X6BA 2UXDB 1N36O 4KL1A 3SPCA 4DV5B 3ZMVA 2IU0A 1NTKH 5FNVB 1PD3A 2QE7G 1NR1A 2BOBC 1F7YA 4RUEA 3ZBHA 3E8HA 3KG2A 1ZUQA 4IHJB 2KKWA 3H1KH 5J2UA 3FFQA 5EC2C 2F66C 3UKMA 3WFVA 4AHCA 3QTCA 3OD4A 1IURA 1DGSA 2VQEO 1WAZA 2K1EA 3SPHA 4B08A 2PYJA 2O57A 4YIOA 5LMNO 2ZM6B 2LGQA 4WBNB 3AEIA 5JVDB 4DR5B 2K9PA 1N0JA 1KMIZ 2ZT9B 2HR3A 3K5LA 5IJ0B 1NZ6A 3BHPA 1NU1H 1Y74B 2ITDC 4JI7B 3ZRSA 1R1BA 2A7WA 2WLHA 2CGOA 1KKCA 2CTRA 3N2GB 3CJHA 3OTOB 2EZPA 4CH4A 1TVKB 2AHZA 2YIDA 3G80A 4K0KB 2QR4A 1OCZB 4IYHA 4DV3O 5CA1A 4DW0A 1NI8A 3JARA 2VWJA 4DR2B 3ZRVA 2WAMA 2XHBA 4TOIA 2JDIG 3JAKB 1XL4A 2JEUA 4LF8B 1YF2A 1SQFA 2OT5A 1GN4A 5LXTA 4JTCB 3EXAA 3HPLC 2UXCO 3WB0A 1NQTA 5BMVB 3SJAC 3RVYA 2DYRC 4GUNA 3ZX6A 2C2AA 2EJRA 4NTXA 4FZ1A 4HNAA 4GKJO 4DV6O 1BQZA 1L8DA 2BTQA 4DRXB 4RWUA 2YI9A 1W59A 1VQ9V 1ZSPA 1H8HG 3K79A 5C8YA 3P3NA 3FYEB 5EBLC 2P90A 3DSQA 1J95A 3UM7A 2YC0A 3ZMSA 4TQDA 3GVMA 1K97A 4J9ZB 2H3OA 4WFHA 2AGAA 5JWPA 3ZEDA 1SESA 4AILC 3Q4HB 1WB8A 5KHGA 4JI1B 2UXXA 2WA4A 4FM1A 2F43G 5KHJA 4O4IA 4O2AA 4LF5O 3F5TA 2RJZA 3OM3B 2P67A 1RM1B 4KHPO 1FXVA 1IXBA 2P22C 4ZOLA 5ITZB 2UXNA 5H6QA 2P5OA 1VMGA 5IY5B 1OV9A 4JI0B 4ZBMA 5D5PA 2AW9A 1YZBA 5IJ9B 1XILA 2EBOA 1URFA 2ZINA 4IIJB 1Y76A 1NS1A 1QR8A 2QDOA 4GX1A 3CC7V 3B77A 3OE7G 2WLIA 3K3WA 3FB7C 3HKDB 3C3SA 5GTHZ 5B5EZ 3DXRA 3K04A 4JI6O 3CX5F 1L0NH 1WPBA 1TGOA 1AI4A 4UVCA 3AG2B 3QO5A 4IYIA 1Q5OA 3K9AA 4EB6A 4FLWA 2L35A 4NXMO 5HFMA 4KFMA 3ZRXA 5CBGA 4WFEA 1VF6C 4CS3A 1QVFU 3KCXA 4X66B 5EC1C 2UXBO 4JAUA 1Y66A 3MD0A 5IE9A 2Q8VA 3ABTA 4J7JA 5DEDA 1Z5VA 2YIBD 3BRCA 1N33B 1WP8A 1Q7YW 1BHAA 3ZN0A 4GKKB 3CRCA 4O4HA 4FJCC 4ZHQA 5BZBA 2E5LO 3F7YC 2LQTA 1IXMA 4H44B 2FTKA 3CHXA 4UCTA 1GH6A 3BABA 4UCVA 3WG7B 1XHZA 4DK1A 1MMMA 4DV1B 1AP5A 4OX9O 3RYCA 1SZTA 4UVBA 4WCEV 5GW7A 3CCUV 1ZL8B 2X0LA 2LFRA 1PNLA 5B1NA 4JI5O 2ZNJA 4LWSA 1K3EA 3NXSA 3CCQV 2QSAA 4JI8B 3ASNB 1JQ0A 1GKFA 1PM9A 1K33A 1NVPD 3CRQA 2B1IA 5L3GA 5FLXN 3D36C 1BE3H 4O4JA 5KX5A 3E22B 3H1HH 2XASA 4ABMA 3K5OA 4MT8A 4HAMA 3RBZA 1NVPB 5LA6B 2AHYA 1YSCA 5KUMA 3I5DA 5H6RA 3APQA 1FXKB 2OCHA 3KKYA 4J11A 3AK2A 4K8XA 2EX3A 2N04A 3B09A 3VQWA 1HNXB 3ZMTA 4HYOA 4UCOA 2ZE7A 5CA0B 5LOVB 4B3TO 2QTOA 1K9MW 1GAXA 4X1KA 3QVNA 1I94O 1R3IC 3SJQC 4TWKA 3JAWB 3ZS8C 4NKGB 1S76D 1B06A 2Q68A 2GHYA 1S72V 3CB2A 4K35A 1HWYA 4I9QA 2BSKB 3ABMB 3HKCA 3ZIAG 2IJJA 1OCRC 2IM9A 4U3JA 2UUAB 1YEWA 3LSUA 4DV7B 3JALA 4FLZA 3L71H 3CC4V 4L87A 3SPGA 1YJ9V 4PV1B 4BIUA 1UFIA 2DN9A 4U3FH 4EFEA 1XMOB 4PI2A 2PI4A 5CB4A 1VF6A 3ZCCA 3ZHTA 4LH6A 4DR1B 3UT5A 5GONA 2MW2B 2WLLA 4YY3O 4O4LA 4X1YB 5EIBC 2XT9A 5J2TA 4DUYB 4GZRB 5B3SB 2E74B 5LMUB 2UU9B 2QWQB 4X64B 4JI2B 4YHHB 4MW3A 3ZRWA 4K8ZA 4CH6A 3K06A 4FFBB 1XOUA 3R66A 4Z2WA 2GTAA 4LFCO 2OYQA 1RSOA 1FFXA 3HKEA 2Z3YA 2NNUA 3N2KB 3JYCA 1M56B 1V54B 3AG4B 1NTZH 3TK1A 4WF9V 4DV0O 4JYAB 3VQYA 1PNMA 4UB6Z 1GRJA 5B1BB 1BSMA 4F6RA 1I08A 5EZYB 4D7TA 4LH7A 2CTQA 4OGQB 2HJFC 1N36B 1AR4A 3D36A 3A0HZ 4DUZO 3K0GA 3I55V 4JTAB 4GYCB 3ZHSA 1QU7A 1N4CA 4XBFA 4B3SO 4YXWG 1V55C 4DK0A 5J2UB 5IYZA 1KB9F 4H33A 2VQEB 3OEEG 2Q67A 4P9PA 2PI5A 5B1AC 5LMNB 1YDXA 4GX0A 5LGUA 3P30A 4UV8A 1AI5A 4MVSA 3RYIA 3N27A 5EYPA 1SRYA 1Y6XA 2CH7B 3PJSK 3CCJV 1ZX3A 2NR5A 1PPJH 2V7QG 3CS5A 4LCUC 1N8RW 2EINC 2Q0OC 4PHZA 2WLNA 5B1OA 4FLVA 3W7UA 3JASA 2ZCEA 3CJHB 4JASA 1F4MA 1Q6UA 2JS5A 1B04A 2WA3A 4L8JA 5CA3A 4XDLA 1Q90D 4DV3B 1NKDA 1S3JA 5CA1B 3B4SA 3JARB 3SDLA 3H1IH 1J5EO 4JZGA 5CMUA 2VRZA 2FMLA 1HW7A 1WLEA 2IJIA 2L6LA 3J81N 2ODMA 1XHXA 4GLXA 1XDCA 1AI6A 2UXCB 3FB6C 2XTAA 1M93A 1KECA 4J9YB 3S3WA 1DTOA 2ZXWC 4TV8B 3E86A 4X20A 1NTMH 4QJFB 4B3RO 5EBMC 1BS3A 1PL4A 3AK3A 4B7EA 1I5XA 2OTLV 4E4EA 4GKJB 4DV6B 1ZTEA 1SA0A 2BTQB 1VQNV 4ZKIA 3G4SV 1W0JG 2QWRB 2Q6AA 2YXYA 1L0LH 5C8YB 2E76B 1JJOA 1YITV 3LNNA 3OR6C 2Q0AA 1BZKA 2M6YA 2ZE6A 5E1AC 3SPIA 3GB7C 1XNRO 4AQYO 1ENVA 3CYOA 3FAVA 2R9RB 2EIJB 1M57C 4RQEA 3IC7A 3RYFA 3F5WC 3RT3C 4BWAA 1Q6HA 4LF5B 4O4IB 4O2AB 2F4VO 4DR4O 1B3QA 4YJ2A 4KHPB 4I50A 3CCRV 4ZOLB 1HR0O 1XMQO 1DK1A 4N21A 5JH7A 2UUBO 1OCZC 1PP9H 1YHQV 2WLJA 4O2BB 4KXRA 5GTIZ 2QKCA 3CP1A 3G67A 2QWPB 1ZAUA 4UFZA 2JJ2G 1O9GA 4JI4B 3RWRD 4CBCA 3OUFA 3BY6A 1Y76B 2DQ3A 1IZ3A 3K58A 5L3FA 4TUYB 5CBHA 1AILA 1VQ6V 5LYJA 1VQLV 1KD1W 2QM8A 3K5MA 1U96A 5KA6A 2WLIB 2IBZH 2RNBA 1D5NA 4U7NA 2Y4TA 1YCIA 4B7KA 5AG2A 3DXRB 1R6TA 3RVZA 1N32O 1K8AW 4JI6B 4PDMA 2H8PC 3BA9A 1NJIW 1SERA 1MSWD 3T1YO 3QO7A 3E8GA 4QGPA 3E89A 4EB6B 2XAQA 4NB5A 4NXMB 4PI0A 1WN7A 2DQ0A 1H2SB 4P30A 2FB5A 1TUBA 2WWWA 5KHKA 2UXBB 3P3PA 1EN6A 4DV2O 3RFRA 1YXBA 4O4HB 4I55A 3ABKC 4ZHQB 2E5LB 1SF9A 3ASOB 2YDEA 3QO8A 4UCUA 1HNWO 2FL4A 1US6A 5KA5A 4OX9B 2DYRB 3BAAA 4LF4B 3OW2U 3CEIA 1RM1C 1CP9A 3AG7A 2YI8A 4JI5B 4FLXA 2JJ1G 1AP6A 1OCOB 3WB1A 2XUMA 3E2EA 3A8TA 3NR7A 2JIZG 1Y67A 2OWOA 1JCHA 4O4JB 3E8BA 1JFFA 3X2QC 5KX5B 3CCLV 3BCCH 1L1FA 3LDCA 3ZHUA 2M7WA 1K4DC 1JOYA 1E1RG 3JATA 3ZMZA 2GBOA 3FYIB 4X8AA 1PL0A 5JJJB 4I7ZB 3N2GA 3LDDA 2OTJV 1MZFA 2EILB 4TT3G 4JTDB 3EHBB 2X6CA 1ZWIC 5B66Z 1Z5WA 3JSLA 2Y0PA 3W7WA 1IBLO 4B3TB 2QM7A 3BEHA 4X1KB 1I94B 2GUZA 3FX7A 3JAKA 3W7SA 3EFFK 4LF8O 4NTYA 4YJ3A 1DF5A 3D3IA 1Q81W 2QKSA 3K0DA 5KLVH 3OGIB 3FKSG 3VQVA 3HKCB 3WG7C 2KG7A 2QKAA 2ETNA 5CN0A 4MVMA 3AG1B 5KHIA 3B8NA 3QF7A 4U3JB 1BL8A 1EZVH 4HZ3A 3JAMN 1YTFB 2HJDA 3C90A 3JALB 1XNQO 1JVMA 4I0XB 2ZD9A 3L74H 2CE4A 5CB4B 1WA8A 3ASNC 5L3EA 4PA7A 2CAZC 2Y0IA 3UT5B 3T2MA 3OMIB 1IDSA 4YY3B 4O4LB 3RYHB 4FVMA 5J2TB 3PN1A 1M1KW 4LFAO 2RQ6A 3CSXA 1XL6A 3CMEV 2OCCC 2ZIOA 1X59A 5F2VO 3Q4HA 3WU2Z 5DN6G 3TXQA 1P84F 3K9SA 3FB5C 3ZMUA 5K1PA 1SZXA 1Z2GA 1DF4A 1SQGA 1FXKC 4LFCB 1RSOB 1NT2B 3HKEB 2N05A 3T4DA 2DWDC 1GN3A 4DV0B 2JGDB 2YUAA 3ZJZA 3T4ZA 3E8FA 3HKBB 1VP7A 5IJ9A 4WFGA 1M5IA 3ABUA 4JI3B 3ABLC 3ZHVA 1QVGU 1XI1A 2UUCB 4MTXA 4UB8Z 4DUZB 1N34O 4DO2A 2JK5C 3ETDA 2YEVA 3LSQA 4DR3O 3ABMC 4B3SB 4EFBA 5IYBO 1S77D 3J80N 3LSSA 1K4CC 2QGNA 3SR2C 1M90W 2HVKC 4W4KA 5IYZB 3B40A 4A5UB 4MVOA 1GN6A 1VF5B 4XDKA 2BE3A 1EFRG 3K5NA 4J42A 1SKVA 3STLC 2ATKC 2LW7A 1E79G 4TSFG 3RYIB 1HNZO 1MZEA 1YI2V 5EYPB 5EK0A 3MAQA 5JQGA 2B9ZA 4MVZA 1VQKV 4MVUA 1FXHA 3JD3A 2QM4A 1QLEB 5E79Z 1EZJA 2YS8A 2P7TC 4PD4F 4G2KA 1H8EG 1AJQA 1XREA 4JV5O 3DGEA 4H13B 3SPJA 5B3SC 1IBKO 4R50A 4J10A 3JASB 3TETA 1S0VA 1D2DA 4IT5A 4TV9A 1RFYA 4PA9A 3JSNA 4LF7O 4DV4O 1GK9A 3W7TA 2IJHA 2QJ1A 4JZ2A 3OEHG 2VQFB 5J9PC 4PELA 4DR6O 1J5EB 1OCCB 4JYBA 1VARA 2CK3G 4EKWA 3J7AU 5LP6C 3CXCU 2WLMA 1M56C 1V54C 3AG4C 4MTOA 1IBMO 2EIMC 4FMTA 1G4YB 2CUGA 2DE0X 2BTOA 4MW8A 1Q43A 5BR8O 5IDJA 4JI8O 4FPPA 3K59A 4GX2A 1IVSA 1H2NA 4NR1A 4JPRA 3VQXA 1M4UA 4X20B 5JJNB 3ZN1A 4B3RB 3UCSC 5CBFA 3LNMB 1KU9A 3T1CA 4MTFA 3CRMA 4PJ0Z 3B2EE 1SQBH 2DYSC 3ETEA 5IWAO 4IL6Z 2Q7EA 1SA0B 1JR9A 2BCCH 2H94A 3O9OA 1VQMV 1KKDA 5HFLA 2ARHA 2DWEC 1PNKA 5LL6Y 4UCSA 1QLNA 3L9DA 3BVOA 3OMNB 1VEWA 2YXLA 1YJNV 1SQPH 1VQ4V 3UO3A 2WSSG 2Q9LA 1TUEB 2JVDA 3G71V 1XNRB 3P32A 2EIKB 4AQYB 3FAVB 3RGBA 1GO3F 4PDRA 5CA0A 1AVMA 4NVPA 4LBEC 3RYFB 1VQ7V 4P2ZA 4YIPA 3CRRA 2F4VB 3B8MA 3JAWA 4BIOA 1XUQA 4DR4B 4LNUA 1K5SA 3DC6A 4LFBO 4YJ2B 5BY1A 2JEXA 3SYCA 3WB2A 4I50B 3TGUH 1HR0B 1XMQB 5KMGA 3L73H 5JH7B 2UUBB 2BOCC 2NLJC 4FK5C 4RO2A 2Q69A 2HP8A 1W2BU 4DR7O 4JYYA 2PYLA 5D5QA 2Y69C 1I7FA 3CCVV 2Z0AA 4HBNA 3K03A 4LR3A 4OPHA 5DECA 1IX9A 1XEQA 4X89A 5LYJB 4FLUA 4Q6GA 2B1GA 3MHHC 1FJGO 2Q7HA 3SYOA 1FKAO 3AG3B 1VQ8V 1N32B 1Y4MA 4BR6A 4QE9A 1PKXA 2CTWA 2EINB 3JCUZ 1K73W 4X62O 3E83A 1AR5A 5LXTB 2LP7A 3L75H 3T1YB 2ITCC 2WLKA 1AI7A 2HVJC 1Q86W 5BXZA 3IJ4A 1KP3A 1S5LZ 2GSMB 1LUWA 3BFRA 3L72H 1TUBB 3T1HO 4QNHB 4E2LA 1U97A 4X65O 4FFBA 4PDVA 5DM6V 4HNAB 1H2KA 3H01A 2X6AA 4D7SA 5LP6A 2F23A 2KB1A 3N2KA 3AK1A 4DW1A 1KUQA 1NR7A 5C93A 4H37A 2R9IA 5JCOC 4UUJC 2ZNIA 2KSDA 2XAHA 2P4VA 2QTSA 1JA8A 2EIJC 5H5NA 3ETGA 1HNWB 3IC9A 2ZXWB 4GX5A 3JD2A 5LGTA 2XNDG 4Z1VA 4RAIA 3QNEA 2RCVA 1EM1A 1PV0A 1R3JC 4WFFA 2ZKOA 2HFEC 4JAVA 4NXNO 2EJ7A 2XAGA 5LHGA 2D2CB 5KHHA 3LUTB 3ML0A 5TISZ 2HHHO 4ZI7A 1VIBA 3GWOA 4PA6A 4JYCA 2XAJA 2WPDG 2A79B 2ILMA 3IFXA 1R6KA 1K7DA 5L3CA 1ZLZA 1F51A 4BIZA 1JFFB 4G27B 2CH7A 3K57A 4B3MO 2PZSA 1X4TA 2W6JG 2DJVA 2DOSA 4W4LA 5A2QN 3JATB 1M57B 4I4TA 4CH3A 1XBLA 4RUFA 3UO2A 1R3LC 3H9VA 2V4DA 4Z1MG 5FPRA 1F23A 3HR0A 4BW5A 1WNSA 1QHTA 1IBLB 1JX9A 4MSWC 2VWKA 5KAIZ 3CE2A 1G1XB 3W7XA 1P4RA 2GUZB 4LF6O 2Q73A 1VQPV 1SS3A 4YJ3B 3SJBC 2LW1A 2DMXA 4F4LA 2AZ0A 1WP7A 1K5QA 4JAAA 3ASOC 1P7BA 2PF4E 3DC5A 5EBWC 1H2MA 2KG7B 3BPZA 3H1JH 5K1XA 4TV8A 1CXZB 1O9HA 1AROP 3G6EV 3C3TA 2F93B 1GM7A 2JGUA 2IU3A 2ZR2A 1DLBA 1XNQB 4LF9O 3FB8C 4X1IA 1OZ0A 1AR1B 3RYCB 3GWKC 3SYQA 2HKOA 3U11A 5A9GA 1N0NA 4G28B 2UXDO 1WA8B 4DV5O 1OCOC 3CRAA 5FNVA 1H2GA 1LUVA 1R3KC 4K3AA 5JJEB 2A3QA 5IY5C 1HDJA 1MOFA 2GTSA 4LWSB 3KCYA 2HEPA 3OGCC 4IHJA 4OXSA 3U10A 1BT8A 2IH3C 2QWNB 4LFAB 3ABKB 5JCOA 2A0LA 2ZR3A 1RPOA 2Q5ZA 2P6JA 1SC5B 3BA8A 2CTPA 2E75B 4R6ZA 3F7VC 1K92A 4PDLA 1ORQC 2ZM6O 4TQFA 4WBNA 5JVDA 2MK3A 5IYCO 4DR5O 3CXHF 2R70A 5IJ0A 4OPAA 2EILC 2X7RB 1Y74A 1GTOA 2HLDG 4JI7O 4H0LB 5FPOA 4O2BA 3AG2C 1WPXA 3IGAC 1COWG 3RN4A 3ETQA 4JI4O 3OTOO 5FL7G 1Q8IA 1TVKA 2ZQMA 4K0KO 4TUYA 1GMGA 4BAYA 3EVKA 2CGNA 3G6BA 4CS2A 1N34B 3X2QB 3ZHRA 1R73A 4DR2O 2YEVB 1D5AA 1VQOV 2LO1A 2P06A 4DR3B 4JGSA 1QR9A 2LGWA 4I5SA 3H1LH 2QEXV 3AG1C 1K34A 5KUKA 1YTFD 1A32A 2YICA 4Q20A 4ASUG 3O65A 3FD9A 2ZDIC 5BMVA 1SQXH 4FM0A 4FFKA 1HNZB 3DTUB 4MTGA 4QPKA 2ADQB 1H2LA 5JQGB 2YIAA 2LFSA 1OJHA 1BMFG 1OHHG 2B5UA 4DRXA 1CEZA 4UV9A 4JV5B 4J41A 3JD0A 1QNMA 1IBKB 1CPYA 2W0XA 4TV9B 2RN9A 3M7MX 5GONB 4LF7B 2WLLB 4U7OA 4DV4B 1YIJV 2A9HA 1BGYH 1Q82W 1JJ2U 1YJWV 3OT7A 4CZZA 1T5EA 4DR6B 3M8AA 3VOUA 4IGGA 2NN4A 3TJTA 4LF4O 3MHSC 3A0RA 5LGNA 1IBMB 3ZRWB 4JI1O 1QCEA 1QBZA 3D8CA 2AZ2A 5BR8B 4NTWA 3U0ZA 1FFXB 4LC1A 2PGGA 1E1QG 5ITZA 4DXWA 1MA1A 4XDJA 1LNQA 1MG1A 4JI0O 5LHIA 2YSUB 4ZIBA 4F6RB 5L3BA 1VQ5V 1GM9A 2DW4A 1UPGA 2Q7GA 5IWAB 4IIJA 4FM2A 4UCRA 3APOA 2OCCB 4LP8A 5H2FZ 2PY5A 1NH2D 1YVWA 1B6QA 1F4NA 3HKDA 1M9NA 1AB3A 4QIWF 1EN4A 4F6EA 1TAEA 4UXNA 3MDSA 3CCSV 1GN2A 1R6NA 3L70H 1NH2B 3CD6V 3CPWU 1BCCH 2LJ2A 1QLEC 3ABLB 4N23A 4QPJA 2FYUH 4CC6A 3JCZA 2IH1C 4FZ0A 1EBOA 1I0HA 4LNUB 4X66O 4CC5A 4LFBB 1P7GA 3CC2V 3STZC 4WFAV 5KMGB 2Z5UA 3CWBH 1N33O 2RDCA 1XQ8A 2IW5A 1LR1A 3ZHQA 4GKKO 5L3DA 4DR7B 1OCCC 2W6IG 1KC8W 2ZE5A 5LBQA 3CCEV 1H38A 4I0XA 2ZDIA 2R72A 2YIBA 2ZE8A 4FLTA 4DV1O 2N74A 1FJGB 1MABG 4FLYA 3HB3B 1OCRB 2OIEA
chains in the Genus database with same CATH topology
1Y76A 1ZL8A 3B40A 1RSOB 1VF6C 1Y74A 1Y76B 1ZL8B 1VF6A 1Y74B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y76 A;  1ZL8 A;  3B40 A;  1RSO B;  1VF6 C;  1Y74 A;  1Y76 B;  1ZL8 B;  1VF6 A;  1Y74 B; 
#chains in the Genus database with same CATH topology
 4EEQ A;  2HG5 C;  1ZL8 A;  3K08 A;  5H9C A;  5KAF Z;  3OUS A;  1VF7 A;  1V9P A;  2OIG A;  4BW9 A;  1SQQ H;  4X62 B;  2F95 B;  2EUL A;  5EIB D;  2IJK A;  3TXS A;  1NBM G;  3RYH A;  3M99 B;  5B1B C;  1JMK C;  3OR7 C;  2RMK B;  2Y4U A;  5IYD O;  1P49 A;  2F1M A;  3IAY A;  4GCZ A;  1G8M A;  1G6U A;  3OMA B;  2XOK G;  3ICX A;  3T1H B;  1WJZ A;  2KQX A;  3E22 A;  4X65 B;  1EN5 A;  1UJW B;  1AJN A;  4X88 A;  2V1D A;  2EZO A;  4NYK A;  5LP6 B;  5LA6 A;  4RQF A;  1BQ0 A;  4C7U A;  2EIM B;  3OTF A;  2JGD A;  2EIK C;  3VBB A;  2G38 A;  1FXK A;  3HKB A;  4MVR A;  1WB7 A;  1RP3 B;  1FFT B;  2P4K A;  4GT1 A;  2E3C A;  3A0B Z;  1Q6I A;  4JI3 O;  3QG5 A;  1HNX O;  1Q3E A;  4MS2 A;  2UUC O;  2YXH A;  4WFB V;  1KQS U;  5LOV A;  3UQ8 A;  2DYS B;  4NXN B;  2ADP A;  4MVQ A;  1FAF A;  2AXT Z;  3I56 V;  3D3Q A;  3THO A;  3JD1 A;  1I5Y A;  4ICG A;  2HHH B;  1W0K G;  4ZI7 B;  2JRI A;  4J7K A;  2BSK A;  4FIP C;  2Q4P A;  1HP8 A;  1V55 B;  4B3M B;  3CCM V;  1KP2 A;  3AG3 C;  5LHH A;  2UUA O;  3A2F A;  4DV7 O;  1BHB A;  3SYP A;  2PTM A;  4D6T H;  5B1A B;  4J7Z A;  4X9Q A;  4AI8 A;  1FPO A;  1KYO F;  2ZIM A;  3OAA G;  4I4T B;  3CMA V;  1ROP A;  3JD4 A;  3E35 A;  1XMO O;  2GV9 A;  4I9W A;  2GDS A;  3KZI Z;  2VS0 A;  4R8C A;  4P9O A;  5IT9 N;  2XAF A;  1MNG A;  2A06 H;  1MSD A;  4DR1 O;  2CDY A;  4PA3 A;  3SYA A;  1S5H C;  1GM8 A;  4UVA A;  4X1Y A;  1RPR A;  4DUY O;  4JF3 A;  2VQF O;  1AJP A;  4QE7 A;  2R9A A;  2W0F C;  2QWO B;  5LMU O;  2UU9 O;  2Y69 B;  1FYJ A;  4LF6 B;  3SGI A;  4X64 O;  3RW0 A;  1FD9 A;  4JI2 O;  3OFN G;  4YHH O;  1SET A;  2JS3 A;  2FKX A;  2D3O W;  3TCU A;  1FS0 G;  4DV2 B;  1SQV H;  2PUS A;  4CS4 A;  1KBH A;  3S3X A;  4I55 B;  4CH5 A;  1JPX A;  4JYA O;  3SJC C;  4KUM A;  3R65 A;  2Y48 A;  1THZ A;  4PA4 A;  4DYL A;  1TA8 A;  4R7C A;  5EZY A;  4LF9 B;  1S5J A;  4X1I B;  4KP4 A;  2QA4 V;  1QQC A;  4J80 A;  3LDE A;  2X6B A;  2UXD B;  1N36 O;  4KL1 A;  3SPC A;  4DV5 B;  3ZMV A;  2IU0 A;  1NTK H;  5FNV B;  1PD3 A;  2QE7 G;  1NR1 A;  2BOB C;  1F7Y A;  4RUE A;  3ZBH A;  3E8H A;  3KG2 A;  1ZUQ A;  4IHJ B;  2KKW A;  3H1K H;  5J2U A;  3FFQ A;  5EC2 C;  2F66 C;  3UKM A;  3WFV A;  4AHC A;  3QTC A;  3OD4 A;  1IUR A;  1DGS A;  2VQE O;  1WAZ A;  2K1E A;  3SPH A;  4B08 A;  2PYJ A;  2O57 A;  4YIO A;  5LMN O;  2ZM6 B;  2LGQ A;  4WBN B;  3AEI A;  5JVD B;  4DR5 B;  2K9P A;  1N0J A;  1KMI Z;  2ZT9 B;  2HR3 A;  3K5L A;  5IJ0 B;  1NZ6 A;  3BHP A;  1NU1 H;  1Y74 B;  2ITD C;  4JI7 B;  3ZRS A;  1R1B A;  2A7W A;  2WLH A;  2CGO A;  1KKC A;  2CTR A;  3N2G B;  3CJH A;  3OTO B;  2EZP A;  4CH4 A;  1TVK B;  2AHZ A;  2YID A;  3G80 A;  4K0K B;  2QR4 A;  1OCZ B;  4IYH A;  4DV3 O;  5CA1 A;  4DW0 A;  1NI8 A;  3JAR A;  2VWJ A;  4DR2 B;  3ZRV A;  2WAM A;  2XHB A;  4TOI A;  2JDI G;  3JAK B;  1XL4 A;  2JEU A;  4LF8 B;  1YF2 A;  1SQF A;  2OT5 A;  1GN4 A;  5LXT A;  4JTC B;  3EXA A;  3HPL C;  2UXC O;  3WB0 A;  1NQT A;  5BMV B;  3SJA C;  3RVY A;  2DYR C;  4GUN A;  3ZX6 A;  2C2A A;  2EJR A;  4NTX A;  4FZ1 A;  4HNA A;  4GKJ O;  4DV6 O;  1BQZ A;  1L8D A;  2BTQ A;  4DRX B;  4RWU A;  2YI9 A;  1W59 A;  1VQ9 V;  1ZSP A;  1H8H G;  3K79 A;  5C8Y A;  3P3N A;  3FYE B;  5EBL C;  2P90 A;  3DSQ A;  1J95 A;  3UM7 A;  2YC0 A;  3ZMS A;  4TQD A;  3GVM A;  1K97 A;  4J9Z B;  2H3O A;  4WFH A;  2AGA A;  5JWP A;  3ZED A;  1SES A;  4AIL C;  3Q4H B;  1WB8 A;  5KHG A;  4JI1 B;  2UXX A;  2WA4 A;  4FM1 A;  2F43 G;  5KHJ A;  4O4I A;  4O2A A;  4LF5 O;  3F5T A;  2RJZ A;  3OM3 B;  2P67 A;  1RM1 B;  4KHP O;  1FXV A;  1IXB A;  2P22 C;  4ZOL A;  5ITZ B;  2UXN A;  5H6Q A;  2P5O A;  1VMG A;  5IY5 B;  1OV9 A;  4JI0 B;  4ZBM A;  5D5P A;  2AW9 A;  1YZB A;  5IJ9 B;  1XIL A;  2EBO A;  1URF A;  2ZIN A;  4IIJ B;  1Y76 A;  1NS1 A;  1QR8 A;  2QDO A;  4GX1 A;  3CC7 V;  3B77 A;  3OE7 G;  2WLI A;  3K3W A;  3FB7 C;  3HKD B;  3C3S A;  5GTH Z;  5B5E Z;  3DXR A;  3K04 A;  4JI6 O;  3CX5 F;  1L0N H;  1WPB A;  1TGO A;  1AI4 A;  4UVC A;  3AG2 B;  3QO5 A;  4IYI A;  1Q5O A;  3K9A A;  4EB6 A;  4FLW A;  2L35 A;  4NXM O;  5HFM A;  4KFM A;  3ZRX A;  5CBG A;  4WFE A;  1VF6 C;  4CS3 A;  1QVF U;  3KCX A;  4X66 B;  5EC1 C;  2UXB O;  4JAU A;  1Y66 A;  3MD0 A;  5IE9 A;  2Q8V A;  3ABT A;  4J7J A;  5DED A;  1Z5V A;  2YIB D;  3BRC A;  1N33 B;  1WP8 A;  1Q7Y W;  1BHA A;  3ZN0 A;  4GKK B;  3CRC A;  4O4H A;  4FJC C;  4ZHQ A;  5BZB A;  2E5L O;  3F7Y C;  2LQT A;  1IXM A;  4H44 B;  2FTK A;  3CHX A;  4UCT A;  1GH6 A;  3BAB A;  4UCV A;  3WG7 B;  1XHZ A;  4DK1 A;  1MMM A;  4DV1 B;  1AP5 A;  4OX9 O;  3RYC A;  1SZT A;  4UVB A;  4WCE V;  5GW7 A;  3CCU V;  1ZL8 B;  2X0L A;  2LFR A;  1PNL A;  5B1N A;  4JI5 O;  2ZNJ A;  4LWS A;  1K3E A;  3NXS A;  3CCQ V;  2QSA A;  4JI8 B;  3ASN B;  1JQ0 A;  1GKF A;  1PM9 A;  1K33 A;  1NVP D;  3CRQ A;  2B1I A;  5L3G A;  5FLX N;  3D36 C;  1BE3 H;  4O4J A;  5KX5 A;  3E22 B;  3H1H H;  2XAS A;  4ABM A;  3K5O A;  4MT8 A;  4HAM A;  3RBZ A;  1NVP B;  5LA6 B;  2AHY A;  1YSC A;  5KUM A;  3I5D A;  5H6R A;  3APQ A;  1FXK B;  2OCH A;  3KKY A;  4J11 A;  3AK2 A;  4K8X A;  2EX3 A;  2N04 A;  3B09 A;  3VQW A;  1HNX B;  3ZMT A;  4HYO A;  4UCO A;  2ZE7 A;  5CA0 B;  5LOV B;  4B3T O;  2QTO A;  1K9M W;  1GAX A;  4X1K A;  3QVN A;  1I94 O;  1R3I C;  3SJQ C;  4TWK A;  3JAW B;  3ZS8 C;  4NKG B;  1S76 D;  1B06 A;  2Q68 A;  2GHY A;  1S72 V;  3CB2 A;  4K35 A;  1HWY A;  4I9Q A;  2BSK B;  3ABM B;  3HKC A;  3ZIA G;  2IJJ A;  1OCR C;  2IM9 A;  4U3J A;  2UUA B;  1YEW A;  3LSU A;  4DV7 B;  3JAL A;  4FLZ A;  3L71 H;  3CC4 V;  4L87 A;  3SPG A;  1YJ9 V;  4PV1 B;  4BIU A;  1UFI A;  2DN9 A;  4U3F H;  4EFE A;  1XMO B;  4PI2 A;  2PI4 A;  5CB4 A;  1VF6 A;  3ZCC A;  3ZHT A;  4LH6 A;  4DR1 B;  3UT5 A;  5GON A;  2MW2 B;  2WLL A;  4YY3 O;  4O4L A;  4X1Y B;  5EIB C;  2XT9 A;  5J2T A;  4DUY B;  4GZR B;  5B3S B;  2E74 B;  5LMU B;  2UU9 B;  2QWQ B;  4X64 B;  4JI2 B;  4YHH B;  4MW3 A;  3ZRW A;  4K8Z A;  4CH6 A;  3K06 A;  4FFB B;  1XOU A;  3R66 A;  4Z2W A;  2GTA A;  4LFC O;  2OYQ A;  1RSO A;  1FFX A;  3HKE A;  2Z3Y A;  2NNU A;  3N2K B;  3JYC A;  1M56 B;  1V54 B;  3AG4 B;  1NTZ H;  3TK1 A;  4WF9 V;  4DV0 O;  4JYA B;  3VQY A;  1PNM A;  4UB6 Z;  1GRJ A;  5B1B B;  1BSM A;  4F6R A;  1I08 A;  5EZY B;  4D7T A;  4LH7 A;  2CTQ A;  4OGQ B;  2HJF C;  1N36 B;  1AR4 A;  3D36 A;  3A0H Z;  4DUZ O;  3K0G A;  3I55 V;  4JTA B;  4GYC B;  3ZHS A;  1QU7 A;  1N4C A;  4XBF A;  4B3S O;  4YXW G;  1V55 C;  4DK0 A;  5J2U B;  5IYZ A;  1KB9 F;  4H33 A;  2VQE B;  3OEE G;  2Q67 A;  4P9P A;  2PI5 A;  5B1A C;  5LMN B;  1YDX A;  4GX0 A;  5LGU A;  3P30 A;  4UV8 A;  1AI5 A;  4MVS A;  3RYI A;  3N27 A;  5EYP A;  1SRY A;  1Y6X A;  2CH7 B;  3PJS K;  3CCJ V;  1ZX3 A;  2NR5 A;  1PPJ H;  2V7Q G;  3CS5 A;  4LCU C;  1N8R W;  2EIN C;  2Q0O C;  4PHZ A;  2WLN A;  5B1O A;  4FLV A;  3W7U A;  3JAS A;  2ZCE A;  3CJH B;  4JAS A;  1F4M A;  1Q6U A;  2JS5 A;  1B04 A;  2WA3 A;  4L8J A;  5CA3 A;  4XDL A;  1Q90 D;  4DV3 B;  1NKD A;  1S3J A;  5CA1 B;  3B4S A;  3JAR B;  3SDL A;  3H1I H;  1J5E O;  4JZG A;  5CMU A;  2VRZ A;  2FML A;  1HW7 A;  1WLE A;  2IJI A;  2L6L A;  3J81 N;  2ODM A;  1XHX A;  4GLX A;  1XDC A;  1AI6 A;  2UXC B;  3FB6 C;  2XTA A;  1M93 A;  1KEC A;  4J9Y B;  3S3W A;  1DTO A;  2ZXW C;  4TV8 B;  3E86 A;  4X20 A;  1NTM H;  4QJF B;  4B3R O;  5EBM C;  1BS3 A;  1PL4 A;  3AK3 A;  4B7E A;  1I5X A;  2OTL V;  4E4E A;  4GKJ B;  4DV6 B;  1ZTE A;  1SA0 A;  2BTQ B;  1VQN V;  4ZKI A;  3G4S V;  1W0J G;  2QWR B;  2Q6A A;  2YXY A;  1L0L H;  5C8Y B;  2E76 B;  1JJO A;  1YIT V;  3LNN A;  3OR6 C;  2Q0A A;  1BZK A;  2M6Y A;  2ZE6 A;  5E1A C;  3SPI A;  3GB7 C;  1XNR O;  4AQY O;  1ENV A;  3CYO A;  3FAV A;  2R9R B;  2EIJ B;  1M57 C;  4RQE A;  3IC7 A;  3RYF A;  3F5W C;  3RT3 C;  4BWA A;  1Q6H A;  4LF5 B;  4O4I B;  4O2A B;  2F4V O;  4DR4 O;  1B3Q A;  4YJ2 A;  4KHP B;  4I50 A;  3CCR V;  4ZOL B;  1HR0 O;  1XMQ O;  1DK1 A;  4N21 A;  5JH7 A;  2UUB O;  1OCZ C;  1PP9 H;  1YHQ V;  2WLJ A;  4O2B B;  4KXR A;  5GTI Z;  2QKC A;  3CP1 A;  3G67 A;  2QWP B;  1ZAU A;  4UFZ A;  2JJ2 G;  1O9G A;  4JI4 B;  3RWR D;  4CBC A;  3OUF A;  3BY6 A;  1Y76 B;  2DQ3 A;  1IZ3 A;  3K58 A;  5L3F A;  4TUY B;  5CBH A;  1AIL A;  1VQ6 V;  5LYJ A;  1VQL V;  1KD1 W;  2QM8 A;  3K5M A;  1U96 A;  5KA6 A;  2WLI B;  2IBZ H;  2RNB A;  1D5N A;  4U7N A;  2Y4T A;  1YCI A;  4B7K A;  5AG2 A;  3DXR B;  1R6T A;  3RVZ A;  1N32 O;  1K8A W;  4JI6 B;  4PDM A;  2H8P C;  3BA9 A;  1NJI W;  1SER A;  1MSW D;  3T1Y O;  3QO7 A;  3E8G A;  4QGP A;  3E89 A;  4EB6 B;  2XAQ A;  4NB5 A;  4NXM B;  4PI0 A;  1WN7 A;  2DQ0 A;  1H2S B;  4P30 A;  2FB5 A;  1TUB A;  2WWW A;  5KHK A;  2UXB B;  3P3P A;  1EN6 A;  4DV2 O;  3RFR A;  1YXB A;  4O4H B;  4I55 A;  3ABK C;  4ZHQ B;  2E5L B;  1SF9 A;  3ASO B;  2YDE A;  3QO8 A;  4UCU A;  1HNW O;  2FL4 A;  1US6 A;  5KA5 A;  4OX9 B;  2DYR B;  3BAA A;  4LF4 B;  3OW2 U;  3CEI A;  1RM1 C;  1CP9 A;  3AG7 A;  2YI8 A;  4JI5 B;  4FLX A;  2JJ1 G;  1AP6 A;  1OCO B;  3WB1 A;  2XUM A;  3E2E A;  3A8T A;  3NR7 A;  2JIZ G;  1Y67 A;  2OWO A;  1JCH A;  4O4J B;  3E8B A;  1JFF A;  3X2Q C;  5KX5 B;  3CCL V;  3BCC H;  1L1F A;  3LDC A;  3ZHU A;  2M7W A;  1K4D C;  1JOY A;  1E1R G;  3JAT A;  3ZMZ A;  2GBO A;  3FYI B;  4X8A A;  1PL0 A;  5JJJ B;  4I7Z B;  3N2G A;  3LDD A;  2OTJ V;  1MZF A;  2EIL B;  4TT3 G;  4JTD B;  3EHB B;  2X6C A;  1ZWI C;  5B66 Z;  1Z5W A;  3JSL A;  2Y0P A;  3W7W A;  1IBL O;  4B3T B;  2QM7 A;  3BEH A;  4X1K B;  1I94 B;  2GUZ A;  3FX7 A;  3JAK A;  3W7S A;  3EFF K;  4LF8 O;  4NTY A;  4YJ3 A;  1DF5 A;  3D3I A;  1Q81 W;  2QKS A;  3K0D A;  5KLV H;  3OGI B;  3FKS G;  3VQV A;  3HKC B;  3WG7 C;  2KG7 A;  2QKA A;  2ETN A;  5CN0 A;  4MVM A;  3AG1 B;  5KHI A;  3B8N A;  3QF7 A;  4U3J B;  1BL8 A;  1EZV H;  4HZ3 A;  3JAM N;  1YTF B;  2HJD A;  3C90 A;  3JAL B;  1XNQ O;  1JVM A;  4I0X B;  2ZD9 A;  3L74 H;  2CE4 A;  5CB4 B;  1WA8 A;  3ASN C;  5L3E A;  4PA7 A;  2CAZ C;  2Y0I A;  3UT5 B;  3T2M A;  3OMI B;  1IDS A;  4YY3 B;  4O4L B;  3RYH B;  4FVM A;  5J2T B;  3PN1 A;  1M1K W;  4LFA O;  2RQ6 A;  3CSX A;  1XL6 A;  3CME V;  2OCC C;  2ZIO A;  1X59 A;  5F2V O;  3Q4H A;  3WU2 Z;  5DN6 G;  3TXQ A;  1P84 F;  3K9S A;  3FB5 C;  3ZMU A;  5K1P A;  1SZX A;  1Z2G A;  1DF4 A;  1SQG A;  1FXK C;  4LFC B;  1RSO B;  1NT2 B;  3HKE B;  2N05 A;  3T4D A;  2DWD C;  1GN3 A;  4DV0 B;  2JGD B;  2YUA A;  3ZJZ A;  3T4Z A;  3E8F A;  3HKB B;  1VP7 A;  5IJ9 A;  4WFG A;  1M5I A;  3ABU A;  4JI3 B;  3ABL C;  3ZHV A;  1QVG U;  1XI1 A;  2UUC B;  4MTX A;  4UB8 Z;  4DUZ B;  1N34 O;  4DO2 A;  2JK5 C;  3ETD A;  2YEV A;  3LSQ A;  4DR3 O;  3ABM C;  4B3S B;  4EFB A;  5IYB O;  1S77 D;  3J80 N;  3LSS A;  1K4C C;  2QGN A;  3SR2 C;  1M90 W;  2HVK C;  4W4K A;  5IYZ B;  3B40 A;  4A5U B;  4MVO A;  1GN6 A;  1VF5 B;  4XDK A;  2BE3 A;  1EFR G;  3K5N A;  4J42 A;  1SKV A;  3STL C;  2ATK C;  2LW7 A;  1E79 G;  4TSF G;  3RYI B;  1HNZ O;  1MZE A;  1YI2 V;  5EYP B;  5EK0 A;  3MAQ A;  5JQG A;  2B9Z A;  4MVZ A;  1VQK V;  4MVU A;  1FXH A;  3JD3 A;  2QM4 A;  1QLE B;  5E79 Z;  1EZJ A;  2YS8 A;  2P7T C;  4PD4 F;  4G2K A;  1H8E G;  1AJQ A;  1XRE A;  4JV5 O;  3DGE A;  4H13 B;  3SPJ A;  5B3S C;  1IBK O;  4R50 A;  4J10 A;  3JAS B;  3TET A;  1S0V A;  1D2D A;  4IT5 A;  4TV9 A;  1RFY A;  4PA9 A;  3JSN A;  4LF7 O;  4DV4 O;  1GK9 A;  3W7T A;  2IJH A;  2QJ1 A;  4JZ2 A;  3OEH G;  2VQF B;  5J9P C;  4PEL A;  4DR6 O;  1J5E B;  1OCC B;  4JYB A;  1VAR A;  2CK3 G;  4EKW A;  3J7A U;  5LP6 C;  3CXC U;  2WLM A;  1M56 C;  1V54 C;  3AG4 C;  4MTO A;  1IBM O;  2EIM C;  4FMT A;  1G4Y B;  2CUG A;  2DE0 X;  2BTO A;  4MW8 A;  1Q43 A;  5BR8 O;  5IDJ A;  4JI8 O;  4FPP A;  3K59 A;  4GX2 A;  1IVS A;  1H2N A;  4NR1 A;  4JPR A;  3VQX A;  1M4U A;  4X20 B;  5JJN B;  3ZN1 A;  4B3R B;  3UCS C;  5CBF A;  3LNM B;  1KU9 A;  3T1C A;  4MTF A;  3CRM A;  4PJ0 Z;  3B2E E;  1SQB H;  2DYS C;  3ETE A;  5IWA O;  4IL6 Z;  2Q7E A;  1SA0 B;  1JR9 A;  2BCC H;  2H94 A;  3O9O A;  1VQM V;  1KKD A;  5HFL A;  2ARH A;  2DWE C;  1PNK A;  5LL6 Y;  4UCS A;  1QLN A;  3L9D A;  3BVO A;  3OMN B;  1VEW A;  2YXL A;  1YJN V;  1SQP H;  1VQ4 V;  3UO3 A;  2WSS G;  2Q9L A;  1TUE B;  2JVD A;  3G71 V;  1XNR B;  3P32 A;  2EIK B;  4AQY B;  3FAV B;  3RGB A;  1GO3 F;  4PDR A;  5CA0 A;  1AVM A;  4NVP A;  4LBE C;  3RYF B;  1VQ7 V;  4P2Z A;  4YIP A;  3CRR A;  2F4V B;  3B8M A;  3JAW A;  4BIO A;  1XUQ A;  4DR4 B;  4LNU A;  1K5S A;  3DC6 A;  4LFB O;  4YJ2 B;  5BY1 A;  2JEX A;  3SYC A;  3WB2 A;  4I50 B;  3TGU H;  1HR0 B;  1XMQ B;  5KMG A;  3L73 H;  5JH7 B;  2UUB B;  2BOC C;  2NLJ C;  4FK5 C;  4RO2 A;  2Q69 A;  2HP8 A;  1W2B U;  4DR7 O;  4JYY A;  2PYL A;  5D5Q A;  2Y69 C;  1I7F A;  3CCV V;  2Z0A A;  4HBN A;  3K03 A;  4LR3 A;  4OPH A;  5DEC A;  1IX9 A;  1XEQ A;  4X89 A;  5LYJ B;  4FLU A;  4Q6G A;  2B1G A;  3MHH C;  1FJG O;  2Q7H A;  3SYO A;  1FKA O;  3AG3 B;  1VQ8 V;  1N32 B;  1Y4M A;  4BR6 A;  4QE9 A;  1PKX A;  2CTW A;  2EIN B;  3JCU Z;  1K73 W;  4X62 O;  3E83 A;  1AR5 A;  5LXT B;  2LP7 A;  3L75 H;  3T1Y B;  2ITC C;  2WLK A;  1AI7 A;  2HVJ C;  1Q86 W;  5BXZ A;  3IJ4 A;  1KP3 A;  1S5L Z;  2GSM B;  1LUW A;  3BFR A;  3L72 H;  1TUB B;  3T1H O;  4QNH B;  4E2L A;  1U97 A;  4X65 O;  4FFB A;  4PDV A;  5DM6 V;  4HNA B;  1H2K A;  3H01 A;  2X6A A;  4D7S A;  5LP6 A;  2F23 A;  2KB1 A;  3N2K A;  3AK1 A;  4DW1 A;  1KUQ A;  1NR7 A;  5C93 A;  4H37 A;  2R9I A;  5JCO C;  4UUJ C;  2ZNI A;  2KSD A;  2XAH A;  2P4V A;  2QTS A;  1JA8 A;  2EIJ C;  5H5N A;  3ETG A;  1HNW B;  3IC9 A;  2ZXW B;  4GX5 A;  3JD2 A;  5LGT A;  2XND G;  4Z1V A;  4RAI A;  3QNE A;  2RCV A;  1EM1 A;  1PV0 A;  1R3J C;  4WFF A;  2ZKO A;  2HFE C;  4JAV A;  4NXN O;  2EJ7 A;  2XAG A;  5LHG A;  2D2C B;  5KHH A;  3LUT B;  3ML0 A;  5TIS Z;  2HHH O;  4ZI7 A;  1VIB A;  3GWO A;  4PA6 A;  4JYC A;  2XAJ A;  2WPD G;  2A79 B;  2ILM A;  3IFX A;  1R6K A;  1K7D A;  5L3C A;  1ZLZ A;  1F51 A;  4BIZ A;  1JFF B;  4G27 B;  2CH7 A;  3K57 A;  4B3M O;  2PZS A;  1X4T A;  2W6J G;  2DJV A;  2DOS A;  4W4L A;  5A2Q N;  3JAT B;  1M57 B;  4I4T A;  4CH3 A;  1XBL A;  4RUF A;  3UO2 A;  1R3L C;  3H9V A;  2V4D A;  4Z1M G;  5FPR A;  1F23 A;  3HR0 A;  4BW5 A;  1WNS A;  1QHT A;  1IBL B;  1JX9 A;  4MSW C;  2VWK A;  5KAI Z;  3CE2 A;  1G1X B;  3W7X A;  1P4R A;  2GUZ B;  4LF6 O;  2Q73 A;  1VQP V;  1SS3 A;  4YJ3 B;  3SJB C;  2LW1 A;  2DMX A;  4F4L A;  2AZ0 A;  1WP7 A;  1K5Q A;  4JAA A;  3ASO C;  1P7B A;  2PF4 E;  3DC5 A;  5EBW C;  1H2M A;  2KG7 B;  3BPZ A;  3H1J H;  5K1X A;  4TV8 A;  1CXZ B;  1O9H A;  1ARO P;  3G6E V;  3C3T A;  2F93 B;  1GM7 A;  2JGU A;  2IU3 A;  2ZR2 A;  1DLB A;  1XNQ B;  4LF9 O;  3FB8 C;  4X1I A;  1OZ0 A;  1AR1 B;  3RYC B;  3GWK C;  3SYQ A;  2HKO A;  3U11 A;  5A9G A;  1N0N A;  4G28 B;  2UXD O;  1WA8 B;  4DV5 O;  1OCO C;  3CRA A;  5FNV A;  1H2G A;  1LUV A;  1R3K C;  4K3A A;  5JJE B;  2A3Q A;  5IY5 C;  1HDJ A;  1MOF A;  2GTS A;  4LWS B;  3KCY A;  2HEP A;  3OGC C;  4IHJ A;  4OXS A;  3U10 A;  1BT8 A;  2IH3 C;  2QWN B;  4LFA B;  3ABK B;  5JCO A;  2A0L A;  2ZR3 A;  1RPO A;  2Q5Z A;  2P6J A;  1SC5 B;  3BA8 A;  2CTP A;  2E75 B;  4R6Z A;  3F7V C;  1K92 A;  4PDL A;  1ORQ C;  2ZM6 O;  4TQF A;  4WBN A;  5JVD A;  2MK3 A;  5IYC O;  4DR5 O;  3CXH F;  2R70 A;  5IJ0 A;  4OPA A;  2EIL C;  2X7R B;  1Y74 A;  1GTO A;  2HLD G;  4JI7 O;  4H0L B;  5FPO A;  4O2B A;  3AG2 C;  1WPX A;  3IGA C;  1COW G;  3RN4 A;  3ETQ A;  4JI4 O;  3OTO O;  5FL7 G;  1Q8I A;  1TVK A;  2ZQM A;  4K0K O;  4TUY A;  1GMG A;  4BAY A;  3EVK A;  2CGN A;  3G6B A;  4CS2 A;  1N34 B;  3X2Q B;  3ZHR A;  1R73 A;  4DR2 O;  2YEV B;  1D5A A;  1VQO V;  2LO1 A;  2P06 A;  4DR3 B;  4JGS A;  1QR9 A;  2LGW A;  4I5S A;  3H1L H;  2QEX V;  3AG1 C;  1K34 A;  5KUK A;  1YTF D;  1A32 A;  2YIC A;  4Q20 A;  4ASU G;  3O65 A;  3FD9 A;  2ZDI C;  5BMV A;  1SQX H;  4FM0 A;  4FFK A;  1HNZ B;  3DTU B;  4MTG A;  4QPK A;  2ADQ B;  1H2L A;  5JQG B;  2YIA A;  2LFS A;  1OJH A;  1BMF G;  1OHH G;  2B5U A;  4DRX A;  1CEZ A;  4UV9 A;  4JV5 B;  4J41 A;  3JD0 A;  1QNM A;  1IBK B;  1CPY A;  2W0X A;  4TV9 B;  2RN9 A;  3M7M X;  5GON B;  4LF7 B;  2WLL B;  4U7O A;  4DV4 B;  1YIJ V;  2A9H A;  1BGY H;  1Q82 W;  1JJ2 U;  1YJW V;  3OT7 A;  4CZZ A;  1T5E A;  4DR6 B;  3M8A A;  3VOU A;  4IGG A;  2NN4 A;  3TJT A;  4LF4 O;  3MHS C;  3A0R A;  5LGN A;  1IBM B;  3ZRW B;  4JI1 O;  1QCE A;  1QBZ A;  3D8C A;  2AZ2 A;  5BR8 B;  4NTW A;  3U0Z A;  1FFX B;  4LC1 A;  2PGG A;  1E1Q G;  5ITZ A;  4DXW A;  1MA1 A;  4XDJ A;  1LNQ A;  1MG1 A;  4JI0 O;  5LHI A;  2YSU B;  4ZIB A;  4F6R B;  5L3B A;  1VQ5 V;  1GM9 A;  2DW4 A;  1UPG A;  2Q7G A;  5IWA B;  4IIJ A;  4FM2 A;  4UCR A;  3APO A;  2OCC B;  4LP8 A;  5H2F Z;  2PY5 A;  1NH2 D;  1YVW A;  1B6Q A;  1F4N A;  3HKD A;  1M9N A;  1AB3 A;  4QIW F;  1EN4 A;  4F6E A;  1TAE A;  4UXN A;  3MDS A;  3CCS V;  1GN2 A;  1R6N A;  3L70 H;  1NH2 B;  3CD6 V;  3CPW U;  1BCC H;  2LJ2 A;  1QLE C;  3ABL B;  4N23 A;  4QPJ A;  2FYU H;  4CC6 A;  3JCZ A;  2IH1 C;  4FZ0 A;  1EBO A;  1I0H A;  4LNU B;  4X66 O;  4CC5 A;  4LFB B;  1P7G A;  3CC2 V;  3STZ C;  4WFA V;  5KMG B;  2Z5U A;  3CWB H;  1N33 O;  2RDC A;  1XQ8 A;  2IW5 A;  1LR1 A;  3ZHQ A;  4GKK O;  5L3D A;  4DR7 B;  1OCC C;  2W6I G;  1KC8 W;  2ZE5 A;  5LBQ A;  3CCE V;  1H38 A;  4I0X A;  2ZDI A;  2R72 A;  2YIB A;  2ZE8 A;  4FLT A;  4DV1 O;  2N74 A;  1FJG B;  1MAB G;  4FLY A;  3HB3 B;  1OCR B;  2OIE A; 
#chains in the Genus database with same CATH homology
 1Y76 A;  1ZL8 A;  3B40 A;  1RSO B;  1VF6 C;  1Y74 A;  1Y76 B;  1ZL8 B;  1VF6 A;  1Y74 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...