1ZL8B

Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
SDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords LIN-7
publication title A General Model for Preferential Hetero-oligomerization of LIN-2/7 Domains: Mechanism Underlying Directed Assembly of Supramolecular Signaling Complexes
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 14
structure length 54
sequence length 54
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1zl8B00
1Y74B 1ZL8B 1RSOB 1Y76B 1VF6C 1Y74A 1ZL8A 1VF6A 3B40A 1Y76A
chains in the Genus database with same CATH superfamily
1AILA 2ZDIA 4CC6A 2VRZA 1Q6UA 4J9YB 2F43G 2CGNA 4O2BA 3BEHA 1E79G 4DR5O 2JGDB 5JH7A 3K5NA 3D36C 4HAMA 1SQGA 3JAWA 4DRXB 3JARA 3VQWA 4Z1VA 4K8ZA 1Y6XA 4Q20A 4EKWA 1H2LA 2LP7A 1R3IC 4WFGA 3ZBHA 2EINB 2HHHO 3ABMC 1N8RW 4FZ0A 5EIBD 2IJKA 1EM1A 4JI8B 2Q0OC 3ICXA 4JI8O 4YHHO 4G2KA 3LSSA 5H2FZ 1ZTEA 5GONA 1TGOA 3AG3B 2YC0A 1NI8A 3ABLB 2BE3A 1F7YA 1H8EG 3BRCA 4BIUA 3J80N 1BQ0A 2CGOA 4JI2O 5CA1A 3K9SA 3K08A 2WAMA 4LF6O 2YXHA 4NXNO 3ZMTA 1G1XB 2F66C 3I56V 3CMEV 2RJZA 2D3OW 5FNVA 3SPCA 2F93B 4ICGA 2HVJC 3ZMUA 1VQLV 2AW9A 2M6YA 4IHJB 3JD1A 3JSLA 4KHPB 2Q73A 1K97A 2EULA 1GKFA 1TUBA 3CMAV 1RSOB 1OCZC 4GCZA 4GX5A 2ZQMA 2ZR2A 1FXKB 2CE4A 4JTAB 4PI0A 4AQYB 1S77D 1P7BA 2GUZA 4I0XB 3PN1A 1KECA 4JGSA 3CRCA 3W7XA 4GX1A 1HP8A 3ZHQA 1QNMA 4E4EA 4ABMA 3TK1A 3MHHC 1VQ4V 4JAAA 1HNWO 5LYJA 4F6EA 1JR9A 4TQDA 3K03A 5JVDB 4DW0A 4H44B 1P7GA 2WSSG 3RWRD 1ZL8B 3FYEB 4PD4F 2NN4A 4TOIA 4H0LB 1EFRG 3WB2A 1K5QA 1NVPD 2KKWA 1XMQB 4TV8B 5BR8B 4JI3O 5FL7G 4MT8A 1VQPV 3ASOB 1S3JA 4J7ZA 4YJ2A 1JFFB 1XNQB 1JQ0A 1Y76A 4YY3O 1V55C 3UT5A 5EBMC 4DR7O 2B9ZA 2PTMA 3R65A 4O4LB 5JH7B 3CCLV 1WPBA 4FLZA 4WFHA 1WB8A 2OCCC 2VQEO 3JARB 2JVDA 1M56C 3L74H 3H01A 4ZOLB 3QO7A 4DV4B 2CH7A 3G80A 4U3JB 1SC5B 4MTOA 1N34B 2P90A 2ZM6B 2HKOA 4JI4B 4D6TH 3SR2C 1N34O 1T5EA 3OE7G 2P22C 4UB8Z 3FB5C 1Q8IA 2ZNIA 3ABKB 3L73H 3AK3A 1AI4A 1BMFG 3M7MX 3L9DA 2A0LA 1JA8A 3JYCA 5IE9A 2WLMA 2ZINA 1YCIA 3CSXA 3OGCC 1IBMB 5C93A 4IYIA 2ETNA 4JI7B 2EILB 3G67A 4LFAB 3OMIB 4DUZB 1OZ0A 1X59A 1IBMO 2EZPA 1NH2B 2P6JA 1NVPB 1Y74A 3JSNA 4RUEA 3ABMB 3HPLC 1IBKB 2A3QA 3CHXA 1CP9A 1BL8A 2EBOA 1MZEA 3GWKC 1PD3A 4JAUA 2AZ0A 1EN6A 1THZA 4LF8B 1V54C 2ZT9B 2Q68A 1DF5A 2XOKG 4LF7B 4LF8O 1Q7YW 3RYHA 5DM6V 4LF7O 2AHZA 3OEHG 4LF5B 1M1KW 4DUYB 1K4DC 2JGUA 3ZMVA 5BMVA 3M8AA 3D3IA 4J11A 3ASNB 4HBNA 3ZX6A 2HP8A 4PA9A 4LC1A 3ZHSA 4DV7B 4JYYA 1FKAO 1CPYA 2F23A 1Q82W 3LSQA 1VQ9V 4IL6Z 4HYOA 3CCVV 2OT5A 1RFYA 3H1KH 4OPAA 4NXMO 5EYPB 3JATB 1OCZB 4UV9A 3CPWU 5IY5C 3NR7A 4MTXA 4DK0A 1AJQA 1VP7A 5IWAB 4X64O 3H1HH 1BGYH 5KAFZ 5H5NA 4F4LA 2Y48A 4PA6A 1I5XA 3T1HO 3QTCA 3FYIB 4GX0A 5IJ0B 3CYOA 2WLLA 4UCRA 4WF9V 3SPHA 2Y69C 1PPJH 3QF7A 2A79B 4MVQA 5E1AC 2K1EA 5KUKA 3JD4A 1KB9F 1MNGA 4GZRB 1W0JG 4X1IB 3IC7A 2OTJV 1HNZO 3QVNA 3EXAA 5L3CA 4IGGA 1MMMA 2R9RB 4MW8A 4F6RA 1H8HG 3F5WC 1XUQA 3A2FA 4PDRA 4O4JA 1LUWA 1RPOA 5KHIA 3ETDA 1KBHA 1S5JA 2IM9A 1NJIW 3ZN0A 5GTHZ 3CCSV 1V55B 1KP3A 1VQMV 4B08A 4K3AA 5KHHA 4LH7A 4J41A 1FPOA 3HKCA 3G71V 2FYUH 2FTKA 1JCHA 2XAFA 2YICA 1WJZA 2Q0AA 3QG5A 4B3RO 4OPHA 2PI5A 2JDIG 3OEEG 4ZHQA 2QDOA 5IDJA 1H2MA 1AR5A 5LXTB 4QNHB 1HNXB 3U0ZA 4TQFA 5EC1C 4JI0O 1N33B 1OV9A 3SJAC 5JJNB 1N33O 2MW2B 3L72H 5JJJB 4UCOA 5LGTA 3HKDA 1VF6A 2QM8A 3ZEDA 1FXVA 1AI5A 5LP6C 3FX7A 1UJWB 1I0HA 2PYLA 4DV6O 4AI8A 5LHGA 2JGDA 2WA3A 2WLIB 5CBHA 5FPOA 4JI6O 4DRXA 2IBZH 2XAHA 4X62B 3B8MA 3O65A 1R3KC 2UXNA 1DLBA 2ZR3A 4L87A 1J95A 1H2KA 4EFEA 2Y0IA 1V54B 1NT2B 3DC6A 5FLXN 3E89A 2UXCO 3G6BA 2ZE6A 2RDCA 4JAVA 4UVAA 3K04A 4TT3G 1I08A 4B3MO 2IH3C 1N32O 3BHPA 4FIPC 3UO2A 2IW5A 4KL1A 1VQ6V 3PJSK 1Q86W 5J9PC 3OM3B 2FB5A 1YJ9V 3W7TA 5C8YB 3C90A 4N23A 1YI2V 1N36O 1XHZA 3TETA 2RMKB 3N27A 4IHJA 2ZE7A 2V7QG 5B1OA 2WA4A 5IY5B 1LNQA 3J7AU 2UUAB 4UFZA 3T4DA 1RSOA 1SA0A 3K5MA 4YJ3B 1XREA 4X66O 4K35A 4B3SB 4BW5A 3GVMA 2QTOA 5IYCO 1FXKA 3M99B 1K9MW 2GV9A 3E8GA 3L71H 4O4HB 4I0XA 2Y69B 2F95B 4NB5A 5FPRA 2N05A 3OTOB 1CXZB 4JV5B 1GM8A 3FB6C 4DR1B 5L3DA 2CDYA 4DR1O 4R50A 3E83A 5JVDA 3HR0A 2MK3A 1Z5WA 3DC5A 2Q8VA 4O2AB 1ZL8A 4K0KB 1XL4A 1WLEA 4QE7A 4UCTA 1ORQC 2BOBC 4DV0B 4UUJC 4JI5B 1GAXA 5K1PA 2UUBB 5IYZB 2ADQB 1EBOA 1XMOO 3K59A 3HKEA 2FL4A 3MD0A 4PDLA 2CAZC 4TV8A 1QLNA 4JYAB 1J5EO 2KQXA 2P5OA 1SQXH 1JFFA 1Q6IA 3RW0A 3BPZA 2CK3G 3NXSA 3E22B 4JYCA 4DR5B 4WBNB 1SERA 5H6RA 4DV2O 2YIBA 3ABTA 4O4LA 2L35A 2EILC 3JAMN 1H2SB 2PUSA 3W7UA 5KHKA 4ASUG 2HHHB 4DR3O 2ZD9A 4R6ZA 4ZOLA 4P2ZA 3BA9A 1SF9A 4U3JA 1SETA 3SPGA 1PNKA 4X9QA 4HZ3A 1VQNV 2QA4V 2QSAA 3K9AA 5KA5A 1YVWA 4YHHB 2BSKB 5CBGA 1PV0A 4LFBO 3RYFB 5CN0A 4FFKA 3SYAA 2EJ7A 4KFMA 1NKDA 3D3QA 5LP6B 1M5IA 4RQFA 4JI2B 2IH1C 1KC8W 3C3TA 4LP8A 4LF6B 5LHHA 1VF7A 2Q7GA 4NXNB 2EIJC 3Q4HA 4B3TB 3D36A 4OGQB 3ASNC 2VWKA 4B3TO 1OHHG 3RBZA 4MW3A 1OCOC 2LW1A 4WFAV 5IJ9B 2R70A 5DN6G 1ZWIC 4X1YB 2YIBD 1HR0O 1MA1A 1LR1A 1SA0B 4YIOA 1YIJV 3CCUV 1YJWV 3VQVA 1NBMG 4KUMA 3K79A 2GTAA 1WNSA 2ZIMA 3E2EA 1XI1A 1DGSA 5LMUO 3G6EV 1HNWB 3CRMA 4JYBA 2UUCO 2V4DA 4FZ1A 4P9OA 4BIZA 1VQOV 1A32A 5B66Z 3FB7C 4P9PA 2FMLA 3CRQA 1NTKH 3RYCB 4UCSA 5EYPA 2BTQB 5A2QN 1QQCA 1OJHA 3JATA 1NH2D 1SESA 4JI3B 3HKEB 1SZXA 5A9GA 2LO1A 4RWUA 4DV5O 4X65O 1ZAUA 1V9PA 3ZN1A 2Q9LA 3D8CA 3FFQA 4MVOA 4JTCB 4YY3B 3CCMV 1XEQA 1AI6A 1ZX3A 1D5NA 5IJ0A 3OR6C 4DR4B 5ITZB 4DR7B 3AG1C 1K4CC 4UCUA 4PDMA 4DR4O 4UVCA 5F2VO 5E79Z 3BY6A 3TJTA 2XUMA 4FFBB 5BXZA 1GN6A 2VQEB 4X1IA 3FKSG 1XNRO 4FLWA 3K57A 3T1YO 3A0RA 3WB0A 1H38A 1L0LH 4E2LA 4CH3A 4OX9O 1RPRA 2Q7HA 4WFEA 1BS3A 2A7WA 3ZCCA 3E8HA 4UXNA 4EEQA 1YF2A 3UCSC 4DV3O 2E76B 4MTFA 1B04A 4I55B 1Q81W 3SYCA 3ZHVA 3DTUB 1PM9A 2YI9A 1YZBA 3DXRB 2GTSA 1D2DA 4Z1MG 2B5UA 3E8FA 1RM1C 4UV8A 2OIEA 1W0KG 1BE3H 3Q4HB 3KCYA 2OCHA 1QR9A 1VQ7V 1AROP 2XAGA 5TISZ 3B2EE 4CS2A 3B8NA 4ZBMA 3OMAB 4H33A 2QWQB 5LA6B 3CCEV 5IT9N 2W6JG 5IYBO 3MDSA 1R3LC 2X7RB 1MZFA 3N2GB 5LXTA 2AZ2A 4U7OA 2ZE8A 1JMKC 4PA7A 1EN4A 5KA6A 2ADPA 3O9OA 2ZXWC 2DW4A 3W7WA 3U10A 4JI1O 4YIPA 2VQFO 4FLTA 1N0JA 1S5HC 2PF4E 4PHZA 2AHYA 3CXCU 4PA4A 2EIJB 3WB1A 4QJFB 3CRRA 4AHCA 5J2TA 1D5AA 3WU2Z 3P32A 3IAYA 1Q90D 1IBLO 2KB1A 2WLKA 1PP9H 2JEXA 2LW7A 4NTXA 1CEZA 2DQ0A 4BW9A 1OCOB 2WLIA 2EIKC 4NXMB 2ZNJA 3KZIZ 3SJBC 2NR5A 4LH6A 3E86A 1ZSPA 4QGPA 2X6AA 5EK0A 1SQPH 2DWEC 3BAAA 2EIMC 4FVMA 4H13B 4PELA 4X64B 5LGNA 1K8AW 3CD6V 3LDCA 3P3PA 3OGIB 4MS2A 4DR6O 1AJNA 2WPDG 3UM7A 2QWNB 5D5QA 3T1HB 1GM7A 4MSWC 2VWJA 3ZRWB 1PL4A 1S72V 3I55V 3JCZA 4ZI7B 3OD4A 2UU9O 2YI8A 1K33A 1VQKV 1B06A 4X88A 2DE0X 4TV9B 1Q43A 1HNZB 2QR4A 5C8YA 2UXBO 1K7DA 4LNUB 1Y4MA 4X1KB 1SQBH 4LF4O 4X20B 2XASA 3MHSC 2F1MA 2QEXV 2XTAA 2QKAA 1M57C 3B09A 4FLXA 1FFXB 5L3EA 4YJ3A 3B40A 2PGGA 5CBFA 2ZKOA 5L3BA 2JS5A 1BHAA 4O4HA 5LOVB 1NTZH 3FB8C 5DECA 3AG1B 3WG7C 1IDSA 2XNDG 2OIGA 4U3FH 1Q6HA 3OT7A 4QE9A 3RYIB 1FYJA 3S3XA 1I94O 2YXLA 3F5TA 5LBQA 4LF9O 1O9HA 1WAZA 1DK1A 2N74A 5LMNO 1K92A 1EN5A 4B3RB 2D2CB 1YXBA 1L0NH 2P4KA 5H9CA 4O2AA 2ATKC 1US6A 2P7TC 2QTSA 2PY5A 4W4KA 4I5SA 4DV1O 1NR1A 3OMNB 3SPJA 3BABA 3JD2A 4JI0B 3ZMSA 3DSQA 5IYZA 2CTWA 2V1DA 1URFA 1YEWA 3E8BA 2JIZG 5L3FA 4IIJB 4LWSA 1VQ5V 2OTLV 1RM1B 5JCOC 4BR6A 3CX5F 2X6CA 1FJGB 5J2TB 2DQ3A 1YHQV 4DV6B 3E22A 2E5LO 1FJGO 4WBNA 3CJHB 3K0DA 4JI6B 1XOUA 3RVYA 3TXSA 2G38A 4JZ2A 2JEUA 2ODMA 1COWG 3JD0A 3CC4V 1TVKB 1Q5OA 2UXCB 2A9HA 2ZXWB 5EZYB 3SJCC 2BSKA 4B3MB 4OXSA 4Q6GA 5CA0B 1N32B 3RYFA 4NKGB 3JAKB 2IJHA 1M4UA 4MTGA 5JCOA 2AXTZ 1YITV 5LP6A 3JCUZ 4CS4A 3CXHF 3KCXA 2HLDG 2E74B 1HWYA 3AG2C 1QBZA 2M7WA 2EIKB 4CH4A 1N36B 1QR8A 3T4ZA 2Z5UA 3QO8A 3LSUA 3BCCH 5IJ9A 3AG7A 3X2QC 4X1YA 5JJEB 1I5YA 2Z0AA 1XL6A 1NU1H 2EIMB 4DXWA 2IU3A 4G27B 4X66B 2O57A 4O4IB 3JALB 5BY1A 1NR7A 4CBCA 3EVKA 1GN4A 4CC5A 4EFBA 1YTFD 3FAVB 1KYOF 3CS5A 1FXHA 3LDDA 1KUQA 4HNAB 4JTDB 1G4YB 1XHXA 1GN2A 5CA3A 2X6BA 5KMGB 4DYLA 1HDJA 2DYSC 4GLXA 2GSMB 1TUEB 1Y66A 1P84F 2DYRB 4N21A 1Y67A 1H2NA 4NTWA 3RYCA 5JQGB 1OCCC 2BTQA 3APOA 1QLEC 1M57B 5HFLA 2ZDIC 5J2UB 3H1IH 1XMOB 1ZLZA 1N4CA 1FFTB 3FD9A 1J5EB 4BIOA 1JJOA 3W7SA 1TA8A 1QVGU 1R6NA 3WG7B 4LWSB 4QPJA 1B3QA 1NTMH 2BTOA 2ZIOA 1WN7A 5ITZA 4GKJO 3ZJZA 4DV2B 3AG4C 3ZRXA 4CZZA 2H8PC 2YEVB 3OW2U 4FFBA 2AGAA 1JJ2U 2EX3A 4C7UA 1KKDA 4DR3B 2YS8A 3CWBH 3ZS8C 2RCVA 1R1BA 3ETGA 3G4SV 4H37A 1SZTA 1F4NA 1YTFB 4BAYA 4CH6A 4LFBB 1GN3A 2YXYA 4I9WA 3UQ8A 1H2GA 3S3WA 3CB2A 3RT3C 4I55A 1AB3A 2QE7G 2PI4A 1KU9A 2Y4TA 3ZRVA 1O9GA 3CE2A 3E35A 4XDLA 3DXRA 1SRYA 2L6LA 1SQVH 2KG7B 3H1LH 2KSDA 4FLYA 3KG2A 3K58A 1NZ6A 1XILA 2NNUA 3RFRA 4J7JA 2QM7A 3K06A 1M90W 3CC2V 1NS1A 4R7CA 2CUGA 5GW7A 1JOYA 1HR0B 1LUVA 1BHBA 5LA6A 2LFRA 2QJ1A 3BFRA 4LFCB 3OFNG 3IJ4A 2JRIA 5KX5B 3N2GA 4LFCO 1IXBA 1WA8A 2QWPB 3MAQA 3IGAC 2FKXA 1U97A 2R9AA 4I4TB 2Y0PA 4TWKA 3P3NA 1K3EA 1VIBA 1FAFA 4FM1A 2QWOB 4R8CA 1P49A 3ML0A 1JPXA 4U7NA 2QGNA 2BCCH 1SKVA 5LMUB 4WFBV 3AG2B 4KHPO 1WP7A 2UUCB 1PL0A 3ZRSA 3VQYA 3TCUA 1B6QA 3A0HZ 3I5DA 4K8XA 2R9IA 1IXMA 3X2QB 4AQYO 4FJCC 1PNMA 1IVSA 3T1CA 4EB6B 3JASB 3J81N 4KXRA 1QHTA 5K1XA 1VMGA 1W59A 4WCEV 4DV5B 2WWWA 4FM2A 1BSMA 4X65B 1OCRC 2YIAA 3N2KB 5HFMA 1SQQH 2LGWA 2DOSA 5B1BC 3ZRWA 1PNLA 5KAIZ 1EZJA 3LUTB 3AK2A 2IJJA 1YSCA 4ZI7A 2K9PA 3SGIA 2BOCC 3ETEA 3UO3A 2DYSB 2YIDA 1Z5VA 3GB7C 4A5UB 1I7FA 4I50B 1S0VA 4TV9A 5EBWC 4TUYB 1XMQO 2PZSA 5BR8O 1XNRB 3T1YB 4LNUA 1G8MA 1EZVH 1OCCB 3HKBB 4X1KA 1R73A 1QLEB 5B1AC 4FLVA 2CTPA 4RAIA 1XNQO 4OX9B 3OUSA 4X20A 2HJDA 3ZHTA 1AR1B 1MG1A 4O2BB 2OWOA 3F7VC 1SS3A 3OR7C 1AP5A 1FFXA 4DV3B 5LL6Y 1BT8A 3JAWB 3H1JH 3SYOA 1GK9A 2WLJA 1BZKA 3AK1A 3OUFA 2WLHA 5LOVA 3RN4A 1KD1W 1E1RG 4DV4O 3LNMB 1ROPA 1KKCA 3AG4B 2Z3YA 3RYIA 4D7TA 3CC7V 1XQ8A 3K5OA 2ZM6O 4JI4O 1IZ3A 4RUFA 4LCUC 2E75B 4JASA 4X8AA 2CTQA 5GONB 2ARHA 3TGUH 4XDKA 3K5LA 4FM0A 1VF5B 4IYHA 5CA1B 3OTFA 1GO3F 1W2BU 1AR4A 1WA8B 4AILC 3VQXA 1F51A 2NLJC 2DJVA 2ITDC 4JI7O 4LFAO 4JI1B 5FNVB 5KUMA 4DUZO 1QVFU 1VARA 2VQFB 3ZIAG 2R72A 1M93A 2LFSA 4IIJA 5KHJA 4MVMA 5GTIZ 3ZHRA 4Z2WA 2DWDC 3CEIA 1IBKO 1TUBB 1R3JC 1IBLB 3ZMZA 1XDCA 4RQEA 3CJHA 4YXWG 1GH6A 2YDEA 4GUNA 4B7EA 2GUZB 1S76D 4QIWF 3RVZA 2QWRB 3CP1A 4JF3A 4XDJA 4LF5O 2OYQA 4DUYO 2LGQA 3HB3B 4NTYA 1KP2A 1TVKA 5LYJB 2CTRA 4FMTA 3OAAG 2Q67A 2GBOA 4DR6B 5LHIA 3SJQC 5EZYA 1BQZA 5CA0A 4GX2A 4DV7O 3JAKA 5D5PA 2DMXA 4I9QA 4L8JA 4ZKIA 1WP8A 2UU9B 3AEIA 1PKXA 4J42A 2W0XA 4CS3A 1ZUQA 1GTOA 2EZOA 2ILMA 1R6TA 5L3GA 3RGBA 3THOA 5B3SC 4KP4A 2UXBB 2JK5C 4UB6Z 3K0GA 1UFIA 4MVRA 5IWAO 4FPPA 4YJ2B 3VOUA 1U96A 1M9NA 4LF4B 1Y76B 4FK5C 4BWAA 1MSWD 4DO2A 2DYRC 5IYDO 4J10A 3STZC 3UT5B 2XAJA 5BZBA 1JX9A 3B77A 1MSDA 1OCRB 3R66A 4IT5A 4O4IA 5LGUA 1F23A 3K3WA 3JALA 2JS3A 5EBLC 1JVMA 5B1BB 4ZIBA 2IJIA 4D7SA 4NR1A 3FAVA 2CH7B 3P30A 3ETQA 1N0NA 2JJ2G 4HNAA 1I94B 1S5LZ 4LF9B 4J9ZB 3BVOA 5LMNB 4PI2A 5KMGA 3STLC 4UCVA 4GYCB 5B1AB 4FLUA 5B1NA 5CB4A 4DV1B 1VF6C 2RNBA 4MVSA 4NYKA 5JQGA 3U11A 3L70H 3SYQA 3L75H 3QO5A 5J2UA 5H6QA 2OCCB 1M56B 2ZE5A 1GMGA 1KQSU 2GHYA 1K34A 3GWOA 3A8TA 2B1IA 4LBEC 1Y74B 2B1GA 1FS0G 2LQTA 4MVUA 2E3CA 4DK1A 1QU7A 2Q7EA 4W4LA 1IX9A 4XBFA 2EINC 1HW7A 2UXXA 2E5LB 2JJ1G 2QM4A 4WFFA 2P06A 1RP3B 2YEVA 1HNXO 2W6IG 2XT9A 3RYHB 1WPXA 1K73W 2DN9A 3H9VA 1BCCH 2ZCEA 4PV1B 3AG3C 5BMVB 1YDXA 1VEWA 3ABLC 1DF4A 2YUAA 4I7ZB 1G6UA 2EJRA 4X89A 2Q6AA 2Q5ZA 3LNNA 1AI7A 2IU0A 3ZHUA 1Z2GA 2P67A 4TSFG 4PJ0Z 4X62O 4B7KA 3CCQV 1K5SA 3SDLA 3EFFK 1X4TA 4UVBA 4DW1A 2UXDB 2KG7A 2A06H 2UXDO 1FD9A 4MVZA 4P30A 1VQ8V 2N04A 2W0FC 3IC9A 3SPIA 3C3SA 5DEDA 1GRJA 2ITCC 2PYJA 2LJ2A 1FXKC 1AP6A 1L1FA 2WLLB 3VBBA 1SQFA 5AG2A 1KMIZ 2HJFC 3IFXA 3TXQA 1IURA 4G28B 2RQ6A 3CCRV 2Q69A 3UKMA 3WFVA 5KX5A 5B5EZ 3ABUA 2XHBA 2QKCA 1ENVA 3QNEA 1AVMA 2C2AA 4I4TA 2QKSA 3LDEA 5EIBC 3DGEA 1Q3EA 5KLVH 3B4SA 4F6RB 4CH5A 3CCJV 2HVKC 5B3SB 2XAQA 2RN9A 4O4JB 2P4VA 2UUAO 2WLNA 4LR3A 4PDVA 2GDSA 1R6KA 1L8DA 2H94A 4B3SO 3ASOC 5CB4B 1DTOA 4EB6A 3JASA 2F4VB 3APQA 3F7YC 1QCEA 5CMUA 4NVPA 5EC2C 1F4MA 3HKCB 3OTOO 1YJNV 2HFEC 2F4VO 4JV5O 4GKKB 4JPRA 4GKKO 2HR3A 3CRAA 3N2KA 5KHGA 1WB7A 1UPGA 2HEPA 3T2MA 1GM9A 1NQTA 4J7KA 2H3OA 2Y4UA 1MOFA 3A0BZ 4ZHQB 1P4RA 4DR2B 4PA3A 1MABG 4K0KO 1E1QG 1AJPA 2Q4PA 1TAEA 4GKJB 2VS0A 4DR2O 4GT1A 2HG5C 4DV0O 3SYPA 2YSUB 4JI5O 3KKYA 4J80A 2UUBO 4I50A 3EHBB 4TUYA 1XBLA 4QPKA 4RO2A 3ABKC 2X0LA 3BA8A 4JYAO 3HKDB 4JZGA 3HKBA 3JD3A 5JWPA
chains in the Genus database with same CATH topology
1Y74B 1ZL8B 1RSOB 1Y76B 1VF6C 1Y74A 1ZL8A 1VF6A 3B40A 1Y76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y74 B;  1ZL8 B;  1RSO B;  1Y76 B;  1VF6 C;  1Y74 A;  1ZL8 A;  1VF6 A;  3B40 A;  1Y76 A; 
#chains in the Genus database with same CATH topology
 1AIL A;  2ZDI A;  4CC6 A;  2VRZ A;  1Q6U A;  4J9Y B;  2F43 G;  2CGN A;  4O2B A;  3BEH A;  1E79 G;  4DR5 O;  2JGD B;  5JH7 A;  3K5N A;  3D36 C;  4HAM A;  1SQG A;  3JAW A;  4DRX B;  3JAR A;  3VQW A;  4Z1V A;  4K8Z A;  1Y6X A;  4Q20 A;  4EKW A;  1H2L A;  2LP7 A;  1R3I C;  4WFG A;  3ZBH A;  2EIN B;  2HHH O;  3ABM C;  1N8R W;  4FZ0 A;  5EIB D;  2IJK A;  1EM1 A;  4JI8 B;  2Q0O C;  3ICX A;  4JI8 O;  4YHH O;  4G2K A;  3LSS A;  5H2F Z;  1ZTE A;  5GON A;  1TGO A;  3AG3 B;  2YC0 A;  1NI8 A;  3ABL B;  2BE3 A;  1F7Y A;  1H8E G;  3BRC A;  4BIU A;  3J80 N;  1BQ0 A;  2CGO A;  4JI2 O;  5CA1 A;  3K9S A;  3K08 A;  2WAM A;  4LF6 O;  2YXH A;  4NXN O;  3ZMT A;  1G1X B;  2F66 C;  3I56 V;  3CME V;  2RJZ A;  2D3O W;  5FNV A;  3SPC A;  2F93 B;  4ICG A;  2HVJ C;  3ZMU A;  1VQL V;  2AW9 A;  2M6Y A;  4IHJ B;  3JD1 A;  3JSL A;  4KHP B;  2Q73 A;  1K97 A;  2EUL A;  1GKF A;  1TUB A;  3CMA V;  1RSO B;  1OCZ C;  4GCZ A;  4GX5 A;  2ZQM A;  2ZR2 A;  1FXK B;  2CE4 A;  4JTA B;  4PI0 A;  4AQY B;  1S77 D;  1P7B A;  2GUZ A;  4I0X B;  3PN1 A;  1KEC A;  4JGS A;  3CRC A;  3W7X A;  4GX1 A;  1HP8 A;  3ZHQ A;  1QNM A;  4E4E A;  4ABM A;  3TK1 A;  3MHH C;  1VQ4 V;  4JAA A;  1HNW O;  5LYJ A;  4F6E A;  1JR9 A;  4TQD A;  3K03 A;  5JVD B;  4DW0 A;  4H44 B;  1P7G A;  2WSS G;  3RWR D;  1ZL8 B;  3FYE B;  4PD4 F;  2NN4 A;  4TOI A;  4H0L B;  1EFR G;  3WB2 A;  1K5Q A;  1NVP D;  2KKW A;  1XMQ B;  4TV8 B;  5BR8 B;  4JI3 O;  5FL7 G;  4MT8 A;  1VQP V;  3ASO B;  1S3J A;  4J7Z A;  4YJ2 A;  1JFF B;  1XNQ B;  1JQ0 A;  1Y76 A;  4YY3 O;  1V55 C;  3UT5 A;  5EBM C;  4DR7 O;  2B9Z A;  2PTM A;  3R65 A;  4O4L B;  5JH7 B;  3CCL V;  1WPB A;  4FLZ A;  4WFH A;  1WB8 A;  2OCC C;  2VQE O;  3JAR B;  2JVD A;  1M56 C;  3L74 H;  3H01 A;  4ZOL B;  3QO7 A;  4DV4 B;  2CH7 A;  3G80 A;  4U3J B;  1SC5 B;  4MTO A;  1N34 B;  2P90 A;  2ZM6 B;  2HKO A;  4JI4 B;  4D6T H;  3SR2 C;  1N34 O;  1T5E A;  3OE7 G;  2P22 C;  4UB8 Z;  3FB5 C;  1Q8I A;  2ZNI A;  3ABK B;  3L73 H;  3AK3 A;  1AI4 A;  1BMF G;  3M7M X;  3L9D A;  2A0L A;  1JA8 A;  3JYC A;  5IE9 A;  2WLM A;  2ZIN A;  1YCI A;  3CSX A;  3OGC C;  1IBM B;  5C93 A;  4IYI A;  2ETN A;  4JI7 B;  2EIL B;  3G67 A;  4LFA B;  3OMI B;  4DUZ B;  1OZ0 A;  1X59 A;  1IBM O;  2EZP A;  1NH2 B;  2P6J A;  1NVP B;  1Y74 A;  3JSN A;  4RUE A;  3ABM B;  3HPL C;  1IBK B;  2A3Q A;  3CHX A;  1CP9 A;  1BL8 A;  2EBO A;  1MZE A;  3GWK C;  1PD3 A;  4JAU A;  2AZ0 A;  1EN6 A;  1THZ A;  4LF8 B;  1V54 C;  2ZT9 B;  2Q68 A;  1DF5 A;  2XOK G;  4LF7 B;  4LF8 O;  1Q7Y W;  3RYH A;  5DM6 V;  4LF7 O;  2AHZ A;  3OEH G;  4LF5 B;  1M1K W;  4DUY B;  1K4D C;  2JGU A;  3ZMV A;  5BMV A;  3M8A A;  3D3I A;  4J11 A;  3ASN B;  4HBN A;  3ZX6 A;  2HP8 A;  4PA9 A;  4LC1 A;  3ZHS A;  4DV7 B;  4JYY A;  1FKA O;  1CPY A;  2F23 A;  1Q82 W;  3LSQ A;  1VQ9 V;  4IL6 Z;  4HYO A;  3CCV V;  2OT5 A;  1RFY A;  3H1K H;  4OPA A;  4NXM O;  5EYP B;  3JAT B;  1OCZ B;  4UV9 A;  3CPW U;  5IY5 C;  3NR7 A;  4MTX A;  4DK0 A;  1AJQ A;  1VP7 A;  5IWA B;  4X64 O;  3H1H H;  1BGY H;  5KAF Z;  5H5N A;  4F4L A;  2Y48 A;  4PA6 A;  1I5X A;  3T1H O;  3QTC A;  3FYI B;  4GX0 A;  5IJ0 B;  3CYO A;  2WLL A;  4UCR A;  4WF9 V;  3SPH A;  2Y69 C;  1PPJ H;  3QF7 A;  2A79 B;  4MVQ A;  5E1A C;  2K1E A;  5KUK A;  3JD4 A;  1KB9 F;  1MNG A;  4GZR B;  1W0J G;  4X1I B;  3IC7 A;  2OTJ V;  1HNZ O;  3QVN A;  3EXA A;  5L3C A;  4IGG A;  1MMM A;  2R9R B;  4MW8 A;  4F6R A;  1H8H G;  3F5W C;  1XUQ A;  3A2F A;  4PDR A;  4O4J A;  1LUW A;  1RPO A;  5KHI A;  3ETD A;  1KBH A;  1S5J A;  2IM9 A;  1NJI W;  3ZN0 A;  5GTH Z;  3CCS V;  1V55 B;  1KP3 A;  1VQM V;  4B08 A;  4K3A A;  5KHH A;  4LH7 A;  4J41 A;  1FPO A;  3HKC A;  3G71 V;  2FYU H;  2FTK A;  1JCH A;  2XAF A;  2YIC A;  1WJZ A;  2Q0A A;  3QG5 A;  4B3R O;  4OPH A;  2PI5 A;  2JDI G;  3OEE G;  4ZHQ A;  2QDO A;  5IDJ A;  1H2M A;  1AR5 A;  5LXT B;  4QNH B;  1HNX B;  3U0Z A;  4TQF A;  5EC1 C;  4JI0 O;  1N33 B;  1OV9 A;  3SJA C;  5JJN B;  1N33 O;  2MW2 B;  3L72 H;  5JJJ B;  4UCO A;  5LGT A;  3HKD A;  1VF6 A;  2QM8 A;  3ZED A;  1FXV A;  1AI5 A;  5LP6 C;  3FX7 A;  1UJW B;  1I0H A;  2PYL A;  4DV6 O;  4AI8 A;  5LHG A;  2JGD A;  2WA3 A;  2WLI B;  5CBH A;  5FPO A;  4JI6 O;  4DRX A;  2IBZ H;  2XAH A;  4X62 B;  3B8M A;  3O65 A;  1R3K C;  2UXN A;  1DLB A;  2ZR3 A;  4L87 A;  1J95 A;  1H2K A;  4EFE A;  2Y0I A;  1V54 B;  1NT2 B;  3DC6 A;  5FLX N;  3E89 A;  2UXC O;  3G6B A;  2ZE6 A;  2RDC A;  4JAV A;  4UVA A;  3K04 A;  4TT3 G;  1I08 A;  4B3M O;  2IH3 C;  1N32 O;  3BHP A;  4FIP C;  3UO2 A;  2IW5 A;  4KL1 A;  1VQ6 V;  3PJS K;  1Q86 W;  5J9P C;  3OM3 B;  2FB5 A;  1YJ9 V;  3W7T A;  5C8Y B;  3C90 A;  4N23 A;  1YI2 V;  1N36 O;  1XHZ A;  3TET A;  2RMK B;  3N27 A;  4IHJ A;  2ZE7 A;  2V7Q G;  5B1O A;  2WA4 A;  5IY5 B;  1LNQ A;  3J7A U;  2UUA B;  4UFZ A;  3T4D A;  1RSO A;  1SA0 A;  3K5M A;  4YJ3 B;  1XRE A;  4X66 O;  4K35 A;  4B3S B;  4BW5 A;  3GVM A;  2QTO A;  5IYC O;  1FXK A;  3M99 B;  1K9M W;  2GV9 A;  3E8G A;  3L71 H;  4O4H B;  4I0X A;  2Y69 B;  2F95 B;  4NB5 A;  5FPR A;  2N05 A;  3OTO B;  1CXZ B;  4JV5 B;  1GM8 A;  3FB6 C;  4DR1 B;  5L3D A;  2CDY A;  4DR1 O;  4R50 A;  3E83 A;  5JVD A;  3HR0 A;  2MK3 A;  1Z5W A;  3DC5 A;  2Q8V A;  4O2A B;  1ZL8 A;  4K0K B;  1XL4 A;  1WLE A;  4QE7 A;  4UCT A;  1ORQ C;  2BOB C;  4DV0 B;  4UUJ C;  4JI5 B;  1GAX A;  5K1P A;  2UUB B;  5IYZ B;  2ADQ B;  1EBO A;  1XMO O;  3K59 A;  3HKE A;  2FL4 A;  3MD0 A;  4PDL A;  2CAZ C;  4TV8 A;  1QLN A;  4JYA B;  1J5E O;  2KQX A;  2P5O A;  1SQX H;  1JFF A;  1Q6I A;  3RW0 A;  3BPZ A;  2CK3 G;  3NXS A;  3E22 B;  4JYC A;  4DR5 B;  4WBN B;  1SER A;  5H6R A;  4DV2 O;  2YIB A;  3ABT A;  4O4L A;  2L35 A;  2EIL C;  3JAM N;  1H2S B;  2PUS A;  3W7U A;  5KHK A;  4ASU G;  2HHH B;  4DR3 O;  2ZD9 A;  4R6Z A;  4ZOL A;  4P2Z A;  3BA9 A;  1SF9 A;  4U3J A;  1SET A;  3SPG A;  1PNK A;  4X9Q A;  4HZ3 A;  1VQN V;  2QA4 V;  2QSA A;  3K9A A;  5KA5 A;  1YVW A;  4YHH B;  2BSK B;  5CBG A;  1PV0 A;  4LFB O;  3RYF B;  5CN0 A;  4FFK A;  3SYA A;  2EJ7 A;  4KFM A;  1NKD A;  3D3Q A;  5LP6 B;  1M5I A;  4RQF A;  4JI2 B;  2IH1 C;  1KC8 W;  3C3T A;  4LP8 A;  4LF6 B;  5LHH A;  1VF7 A;  2Q7G A;  4NXN B;  2EIJ C;  3Q4H A;  4B3T B;  3D36 A;  4OGQ B;  3ASN C;  2VWK A;  4B3T O;  1OHH G;  3RBZ A;  4MW3 A;  1OCO C;  2LW1 A;  4WFA V;  5IJ9 B;  2R70 A;  5DN6 G;  1ZWI C;  4X1Y B;  2YIB D;  1HR0 O;  1MA1 A;  1LR1 A;  1SA0 B;  4YIO A;  1YIJ V;  3CCU V;  1YJW V;  3VQV A;  1NBM G;  4KUM A;  3K79 A;  2GTA A;  1WNS A;  2ZIM A;  3E2E A;  1XI1 A;  1DGS A;  5LMU O;  3G6E V;  1HNW B;  3CRM A;  4JYB A;  2UUC O;  2V4D A;  4FZ1 A;  4P9O A;  4BIZ A;  1VQO V;  1A32 A;  5B66 Z;  3FB7 C;  4P9P A;  2FML A;  3CRQ A;  1NTK H;  3RYC B;  4UCS A;  5EYP A;  2BTQ B;  5A2Q N;  1QQC A;  1OJH A;  3JAT A;  1NH2 D;  1SES A;  4JI3 B;  3HKE B;  1SZX A;  5A9G A;  2LO1 A;  4RWU A;  4DV5 O;  4X65 O;  1ZAU A;  1V9P A;  3ZN1 A;  2Q9L A;  3D8C A;  3FFQ A;  4MVO A;  4JTC B;  4YY3 B;  3CCM V;  1XEQ A;  1AI6 A;  1ZX3 A;  1D5N A;  5IJ0 A;  3OR6 C;  4DR4 B;  5ITZ B;  4DR7 B;  3AG1 C;  1K4C C;  4UCU A;  4PDM A;  4DR4 O;  4UVC A;  5F2V O;  5E79 Z;  3BY6 A;  3TJT A;  2XUM A;  4FFB B;  5BXZ A;  1GN6 A;  2VQE B;  4X1I A;  3FKS G;  1XNR O;  4FLW A;  3K57 A;  3T1Y O;  3A0R A;  3WB0 A;  1H38 A;  1L0L H;  4E2L A;  4CH3 A;  4OX9 O;  1RPR A;  2Q7H A;  4WFE A;  1BS3 A;  2A7W A;  3ZCC A;  3E8H A;  4UXN A;  4EEQ A;  1YF2 A;  3UCS C;  4DV3 O;  2E76 B;  4MTF A;  1B04 A;  4I55 B;  1Q81 W;  3SYC A;  3ZHV A;  3DTU B;  1PM9 A;  2YI9 A;  1YZB A;  3DXR B;  2GTS A;  1D2D A;  4Z1M G;  2B5U A;  3E8F A;  1RM1 C;  4UV8 A;  2OIE A;  1W0K G;  1BE3 H;  3Q4H B;  3KCY A;  2OCH A;  1QR9 A;  1VQ7 V;  1ARO P;  2XAG A;  5TIS Z;  3B2E E;  4CS2 A;  3B8N A;  4ZBM A;  3OMA B;  4H33 A;  2QWQ B;  5LA6 B;  3CCE V;  5IT9 N;  2W6J G;  5IYB O;  3MDS A;  1R3L C;  2X7R B;  1MZF A;  3N2G B;  5LXT A;  2AZ2 A;  4U7O A;  2ZE8 A;  1JMK C;  4PA7 A;  1EN4 A;  5KA6 A;  2ADP A;  3O9O A;  2ZXW C;  2DW4 A;  3W7W A;  3U10 A;  4JI1 O;  4YIP A;  2VQF O;  4FLT A;  1N0J A;  1S5H C;  2PF4 E;  4PHZ A;  2AHY A;  3CXC U;  4PA4 A;  2EIJ B;  3WB1 A;  4QJF B;  3CRR A;  4AHC A;  5J2T A;  1D5A A;  3WU2 Z;  3P32 A;  3IAY A;  1Q90 D;  1IBL O;  2KB1 A;  2WLK A;  1PP9 H;  2JEX A;  2LW7 A;  4NTX A;  1CEZ A;  2DQ0 A;  4BW9 A;  1OCO B;  2WLI A;  2EIK C;  4NXM B;  2ZNJ A;  3KZI Z;  3SJB C;  2NR5 A;  4LH6 A;  3E86 A;  1ZSP A;  4QGP A;  2X6A A;  5EK0 A;  1SQP H;  2DWE C;  3BAA A;  2EIM C;  4FVM A;  4H13 B;  4PEL A;  4X64 B;  5LGN A;  1K8A W;  3CD6 V;  3LDC A;  3P3P A;  3OGI B;  4MS2 A;  4DR6 O;  1AJN A;  2WPD G;  3UM7 A;  2QWN B;  5D5Q A;  3T1H B;  1GM7 A;  4MSW C;  2VWJ A;  3ZRW B;  1PL4 A;  1S72 V;  3I55 V;  3JCZ A;  4ZI7 B;  3OD4 A;  2UU9 O;  2YI8 A;  1K33 A;  1VQK V;  1B06 A;  4X88 A;  2DE0 X;  4TV9 B;  1Q43 A;  1HNZ B;  2QR4 A;  5C8Y A;  2UXB O;  1K7D A;  4LNU B;  1Y4M A;  4X1K B;  1SQB H;  4LF4 O;  4X20 B;  2XAS A;  3MHS C;  2F1M A;  2QEX V;  2XTA A;  2QKA A;  1M57 C;  3B09 A;  4FLX A;  1FFX B;  5L3E A;  4YJ3 A;  3B40 A;  2PGG A;  5CBF A;  2ZKO A;  5L3B A;  2JS5 A;  1BHA A;  4O4H A;  5LOV B;  1NTZ H;  3FB8 C;  5DEC A;  3AG1 B;  3WG7 C;  1IDS A;  2XND G;  2OIG A;  4U3F H;  1Q6H A;  3OT7 A;  4QE9 A;  3RYI B;  1FYJ A;  3S3X A;  1I94 O;  2YXL A;  3F5T A;  5LBQ A;  4LF9 O;  1O9H A;  1WAZ A;  1DK1 A;  2N74 A;  5LMN O;  1K92 A;  1EN5 A;  4B3R B;  2D2C B;  1YXB A;  1L0N H;  2P4K A;  5H9C A;  4O2A A;  2ATK C;  1US6 A;  2P7T C;  2QTS A;  2PY5 A;  4W4K A;  4I5S A;  4DV1 O;  1NR1 A;  3OMN B;  3SPJ A;  3BAB A;  3JD2 A;  4JI0 B;  3ZMS A;  3DSQ A;  5IYZ A;  2CTW A;  2V1D A;  1URF A;  1YEW A;  3E8B A;  2JIZ G;  5L3F A;  4IIJ B;  4LWS A;  1VQ5 V;  2OTL V;  1RM1 B;  5JCO C;  4BR6 A;  3CX5 F;  2X6C A;  1FJG B;  5J2T B;  2DQ3 A;  1YHQ V;  4DV6 B;  3E22 A;  2E5L O;  1FJG O;  4WBN A;  3CJH B;  3K0D A;  4JI6 B;  1XOU A;  3RVY A;  3TXS A;  2G38 A;  4JZ2 A;  2JEU A;  2ODM A;  1COW G;  3JD0 A;  3CC4 V;  1TVK B;  1Q5O A;  2UXC B;  2A9H A;  2ZXW B;  5EZY B;  3SJC C;  2BSK A;  4B3M B;  4OXS A;  4Q6G A;  5CA0 B;  1N32 B;  3RYF A;  4NKG B;  3JAK B;  2IJH A;  1M4U A;  4MTG A;  5JCO A;  2AXT Z;  1YIT V;  5LP6 A;  3JCU Z;  4CS4 A;  3CXH F;  3KCX A;  2HLD G;  2E74 B;  1HWY A;  3AG2 C;  1QBZ A;  2M7W A;  2EIK B;  4CH4 A;  1N36 B;  1QR8 A;  3T4Z A;  2Z5U A;  3QO8 A;  3LSU A;  3BCC H;  5IJ9 A;  3AG7 A;  3X2Q C;  4X1Y A;  5JJE B;  1I5Y A;  2Z0A A;  1XL6 A;  1NU1 H;  2EIM B;  4DXW A;  2IU3 A;  4G27 B;  4X66 B;  2O57 A;  4O4I B;  3JAL B;  5BY1 A;  1NR7 A;  4CBC A;  3EVK A;  1GN4 A;  4CC5 A;  4EFB A;  1YTF D;  3FAV B;  1KYO F;  3CS5 A;  1FXH A;  3LDD A;  1KUQ A;  4HNA B;  4JTD B;  1G4Y B;  1XHX A;  1GN2 A;  5CA3 A;  2X6B A;  5KMG B;  4DYL A;  1HDJ A;  2DYS C;  4GLX A;  2GSM B;  1TUE B;  1Y66 A;  1P84 F;  2DYR B;  4N21 A;  1Y67 A;  1H2N A;  4NTW A;  3RYC A;  5JQG B;  1OCC C;  2BTQ A;  3APO A;  1QLE C;  1M57 B;  5HFL A;  2ZDI C;  5J2U B;  3H1I H;  1XMO B;  1ZLZ A;  1N4C A;  1FFT B;  3FD9 A;  1J5E B;  4BIO A;  1JJO A;  3W7S A;  1TA8 A;  1QVG U;  1R6N A;  3WG7 B;  4LWS B;  4QPJ A;  1B3Q A;  1NTM H;  2BTO A;  2ZIO A;  1WN7 A;  5ITZ A;  4GKJ O;  3ZJZ A;  4DV2 B;  3AG4 C;  3ZRX A;  4CZZ A;  2H8P C;  2YEV B;  3OW2 U;  4FFB A;  2AGA A;  1JJ2 U;  2EX3 A;  4C7U A;  1KKD A;  4DR3 B;  2YS8 A;  3CWB H;  3ZS8 C;  2RCV A;  1R1B A;  3ETG A;  3G4S V;  4H37 A;  1SZT A;  1F4N A;  1YTF B;  4BAY A;  4CH6 A;  4LFB B;  1GN3 A;  2YXY A;  4I9W A;  3UQ8 A;  1H2G A;  3S3W A;  3CB2 A;  3RT3 C;  4I55 A;  1AB3 A;  2QE7 G;  2PI4 A;  1KU9 A;  2Y4T A;  3ZRV A;  1O9G A;  3CE2 A;  3E35 A;  4XDL A;  3DXR A;  1SRY A;  2L6L A;  1SQV H;  2KG7 B;  3H1L H;  2KSD A;  4FLY A;  3KG2 A;  3K58 A;  1NZ6 A;  1XIL A;  2NNU A;  3RFR A;  4J7J A;  2QM7 A;  3K06 A;  1M90 W;  3CC2 V;  1NS1 A;  4R7C A;  2CUG A;  5GW7 A;  1JOY A;  1HR0 B;  1LUV A;  1BHB A;  5LA6 A;  2LFR A;  2QJ1 A;  3BFR A;  4LFC B;  3OFN G;  3IJ4 A;  2JRI A;  5KX5 B;  3N2G A;  4LFC O;  1IXB A;  1WA8 A;  2QWP B;  3MAQ A;  3IGA C;  2FKX A;  1U97 A;  2R9A A;  4I4T B;  2Y0P A;  4TWK A;  3P3N A;  1K3E A;  1VIB A;  1FAF A;  4FM1 A;  2QWO B;  4R8C A;  1P49 A;  3ML0 A;  1JPX A;  4U7N A;  2QGN A;  2BCC H;  1SKV A;  5LMU B;  4WFB V;  3AG2 B;  4KHP O;  1WP7 A;  2UUC B;  1PL0 A;  3ZRS A;  3VQY A;  3TCU A;  1B6Q A;  3A0H Z;  3I5D A;  4K8X A;  2R9I A;  1IXM A;  3X2Q B;  4AQY O;  4FJC C;  1PNM A;  1IVS A;  3T1C A;  4EB6 B;  3JAS B;  3J81 N;  4KXR A;  1QHT A;  5K1X A;  1VMG A;  1W59 A;  4WCE V;  4DV5 B;  2WWW A;  4FM2 A;  1BSM A;  4X65 B;  1OCR C;  2YIA A;  3N2K B;  5HFM A;  1SQQ H;  2LGW A;  2DOS A;  5B1B C;  3ZRW A;  1PNL A;  5KAI Z;  1EZJ A;  3LUT B;  3AK2 A;  2IJJ A;  1YSC A;  4ZI7 A;  2K9P A;  3SGI A;  2BOC C;  3ETE A;  3UO3 A;  2DYS B;  2YID A;  1Z5V A;  3GB7 C;  4A5U B;  1I7F A;  4I50 B;  1S0V A;  4TV9 A;  5EBW C;  4TUY B;  1XMQ O;  2PZS A;  5BR8 O;  1XNR B;  3T1Y B;  4LNU A;  1G8M A;  1EZV H;  1OCC B;  3HKB B;  4X1K A;  1R73 A;  1QLE B;  5B1A C;  4FLV A;  2CTP A;  4RAI A;  1XNQ O;  4OX9 B;  3OUS A;  4X20 A;  2HJD A;  3ZHT A;  1AR1 B;  1MG1 A;  4O2B B;  2OWO A;  3F7V C;  1SS3 A;  3OR7 C;  1AP5 A;  1FFX A;  4DV3 B;  5LL6 Y;  1BT8 A;  3JAW B;  3H1J H;  3SYO A;  1GK9 A;  2WLJ A;  1BZK A;  3AK1 A;  3OUF A;  2WLH A;  5LOV A;  3RN4 A;  1KD1 W;  1E1R G;  4DV4 O;  3LNM B;  1ROP A;  1KKC A;  3AG4 B;  2Z3Y A;  3RYI A;  4D7T A;  3CC7 V;  1XQ8 A;  3K5O A;  2ZM6 O;  4JI4 O;  1IZ3 A;  4RUF A;  4LCU C;  2E75 B;  4JAS A;  4X8A A;  2CTQ A;  5GON B;  2ARH A;  3TGU H;  4XDK A;  3K5L A;  4FM0 A;  1VF5 B;  4IYH A;  5CA1 B;  3OTF A;  1GO3 F;  1W2B U;  1AR4 A;  1WA8 B;  4AIL C;  3VQX A;  1F51 A;  2NLJ C;  2DJV A;  2ITD C;  4JI7 O;  4LFA O;  4JI1 B;  5FNV B;  5KUM A;  4DUZ O;  1QVF U;  1VAR A;  2VQF B;  3ZIA G;  2R72 A;  1M93 A;  2LFS A;  4IIJ A;  5KHJ A;  4MVM A;  5GTI Z;  3ZHR A;  4Z2W A;  2DWD C;  3CEI A;  1IBK O;  1TUB B;  1R3J C;  1IBL B;  3ZMZ A;  1XDC A;  4RQE A;  3CJH A;  4YXW G;  1GH6 A;  2YDE A;  4GUN A;  4B7E A;  2GUZ B;  1S76 D;  4QIW F;  3RVZ A;  2QWR B;  3CP1 A;  4JF3 A;  4XDJ A;  4LF5 O;  2OYQ A;  4DUY O;  2LGQ A;  3HB3 B;  4NTY A;  1KP2 A;  1TVK A;  5LYJ B;  2CTR A;  4FMT A;  3OAA G;  2Q67 A;  2GBO A;  4DR6 B;  5LHI A;  3SJQ C;  5EZY A;  1BQZ A;  5CA0 A;  4GX2 A;  4DV7 O;  3JAK A;  5D5P A;  2DMX A;  4I9Q A;  4L8J A;  4ZKI A;  1WP8 A;  2UU9 B;  3AEI A;  1PKX A;  4J42 A;  2W0X A;  4CS3 A;  1ZUQ A;  1GTO A;  2EZO A;  2ILM A;  1R6T A;  5L3G A;  3RGB A;  3THO A;  5B3S C;  4KP4 A;  2UXB B;  2JK5 C;  4UB6 Z;  3K0G A;  1UFI A;  4MVR A;  5IWA O;  4FPP A;  4YJ2 B;  3VOU A;  1U96 A;  1M9N A;  4LF4 B;  1Y76 B;  4FK5 C;  4BWA A;  1MSW D;  4DO2 A;  2DYR C;  5IYD O;  4J10 A;  3STZ C;  3UT5 B;  2XAJ A;  5BZB A;  1JX9 A;  3B77 A;  1MSD A;  1OCR B;  3R66 A;  4IT5 A;  4O4I A;  5LGU A;  1F23 A;  3K3W A;  3JAL A;  2JS3 A;  5EBL C;  1JVM A;  5B1B B;  4ZIB A;  2IJI A;  4D7S A;  4NR1 A;  3FAV A;  2CH7 B;  3P30 A;  3ETQ A;  1N0N A;  2JJ2 G;  4HNA A;  1I94 B;  1S5L Z;  4LF9 B;  4J9Z B;  3BVO A;  5LMN B;  4PI2 A;  5KMG A;  3STL C;  4UCV A;  4GYC B;  5B1A B;  4FLU A;  5B1N A;  5CB4 A;  4DV1 B;  1VF6 C;  2RNB A;  4MVS A;  4NYK A;  5JQG A;  3U11 A;  3L70 H;  3SYQ A;  3L75 H;  3QO5 A;  5J2U A;  5H6Q A;  2OCC B;  1M56 B;  2ZE5 A;  1GMG A;  1KQS U;  2GHY A;  1K34 A;  3GWO A;  3A8T A;  2B1I A;  4LBE C;  1Y74 B;  2B1G A;  1FS0 G;  2LQT A;  4MVU A;  2E3C A;  4DK1 A;  1QU7 A;  2Q7E A;  4W4L A;  1IX9 A;  4XBF A;  2EIN C;  1HW7 A;  2UXX A;  2E5L B;  2JJ1 G;  2QM4 A;  4WFF A;  2P06 A;  1RP3 B;  2YEV A;  1HNX O;  2W6I G;  2XT9 A;  3RYH B;  1WPX A;  1K73 W;  2DN9 A;  3H9V A;  1BCC H;  2ZCE A;  4PV1 B;  3AG3 C;  5BMV B;  1YDX A;  1VEW A;  3ABL C;  1DF4 A;  2YUA A;  4I7Z B;  1G6U A;  2EJR A;  4X89 A;  2Q6A A;  2Q5Z A;  3LNN A;  1AI7 A;  2IU0 A;  3ZHU A;  1Z2G A;  2P67 A;  4TSF G;  4PJ0 Z;  4X62 O;  4B7K A;  3CCQ V;  1K5S A;  3SDL A;  3EFF K;  1X4T A;  4UVB A;  4DW1 A;  2UXD B;  2KG7 A;  2A06 H;  2UXD O;  1FD9 A;  4MVZ A;  4P30 A;  1VQ8 V;  2N04 A;  2W0F C;  3IC9 A;  3SPI A;  3C3S A;  5DED A;  1GRJ A;  2ITC C;  2PYJ A;  2LJ2 A;  1FXK C;  1AP6 A;  1L1F A;  2WLL B;  3VBB A;  1SQF A;  5AG2 A;  1KMI Z;  2HJF C;  3IFX A;  3TXQ A;  1IUR A;  4G28 B;  2RQ6 A;  3CCR V;  2Q69 A;  3UKM A;  3WFV A;  5KX5 A;  5B5E Z;  3ABU A;  2XHB A;  2QKC A;  1ENV A;  3QNE A;  1AVM A;  2C2A A;  4I4T A;  2QKS A;  3LDE A;  5EIB C;  3DGE A;  1Q3E A;  5KLV H;  3B4S A;  4F6R B;  4CH5 A;  3CCJ V;  2HVK C;  5B3S B;  2XAQ A;  2RN9 A;  4O4J B;  2P4V A;  2UUA O;  2WLN A;  4LR3 A;  4PDV A;  2GDS A;  1R6K A;  1L8D A;  2H94 A;  4B3S O;  3ASO C;  5CB4 B;  1DTO A;  4EB6 A;  3JAS A;  2F4V B;  3APQ A;  3F7Y C;  1QCE A;  5CMU A;  4NVP A;  5EC2 C;  1F4M A;  3HKC B;  3OTO O;  1YJN V;  2HFE C;  2F4V O;  4JV5 O;  4GKK B;  4JPR A;  4GKK O;  2HR3 A;  3CRA A;  3N2K A;  5KHG A;  1WB7 A;  1UPG A;  2HEP A;  3T2M A;  1GM9 A;  1NQT A;  4J7K A;  2H3O A;  2Y4U A;  1MOF A;  3A0B Z;  4ZHQ B;  1P4R A;  4DR2 B;  4PA3 A;  1MAB G;  4K0K O;  1E1Q G;  1AJP A;  2Q4P A;  1TAE A;  4GKJ B;  2VS0 A;  4DR2 O;  4GT1 A;  2HG5 C;  4DV0 O;  3SYP A;  2YSU B;  4JI5 O;  3KKY A;  4J80 A;  2UUB O;  4I50 A;  3EHB B;  4TUY A;  1XBL A;  4QPK A;  4RO2 A;  3ABK C;  2X0L A;  3BA8 A;  4JYA O;  3HKD B;  4JZG A;  3HKB A;  3JD3 A;  5JWP A; 
#chains in the Genus database with same CATH homology
 1Y74 B;  1ZL8 B;  1RSO B;  1Y76 B;  1VF6 C;  1Y74 A;  1ZL8 A;  1VF6 A;  3B40 A;  1Y76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...