1ZL8B

Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
SDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A General Model for Preferential Hetero-oligomerization of LIN-2/7 Domains: Mechanism Underlying Directed Assembly of Supramolecular Signaling Complexes
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
molecule keywords LIN-7
total genus 14
structure length 54
sequence length 54
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1zl8B00
1ZL8B 3B40A 1Y74B 1VF6C 1VF6A 1ZL8A 1RSOB 1Y76A 1Y74A 1Y76B
chains in the Genus database with same CATH superfamily
4H13B 3CRQA 1PL0A 5E79Z 1HNZO 3B8NA 4UB6Z 5LA6B 3SJBC 3E22B 4DW0A 4AI8A 4J7JA 2XAGA 1VQ8V 3CCUV 4NTWA 3AG1B 2OT5A 3S3WA 3UT5B 4PDMA 1B04A 1IBMO 4JPRA 4XDJA 4UVCA 4JI6O 2EINB 1IBMB 4BWAA 3CC2V 3N2KA 3BFRA 3WG7B 1SZTA 4BIZA 1WNSA 1A32A 4P9PA 1K92A 2Y69B 1IX9A 5CN0A 4JAVA 1P7GA 3FYIB 1ZL8A 2Y0PA 1K4CC 4J11A 1F4MA 4C7UA 1YVWA 4CS3A 2EIJC 1JFFA 3B40A 2OCHA 3RW0A 1AR5A 3LNMB 1AJPA 2YI9A 1LNQA 4OPAA 2WLLA 2AHYA 1KP2A 4PV1B 1FFTB 4JI2B 1KU9A 3ZJZA 2VQEB 2QKSA 4GYCB 2KKWA 4GX5A 3VQYA 1PV0A 1EM1A 1K33A 2QWNB 4FLUA 1GO3F 1IBKB 3E35A 4QJFB 1N33O 2PI5A 3ABKB 3RYHA 1OCOB 2EX3A 5C8YA 1IBKO 3CCJV 1QBZA 4RO2A 3H1JH 3OGIB 3TXQA 2HVKC 2G38A 3ML0A 1FAFA 1Q5OA 4DV7B 1CEZA 3PJSK 4B3TO 2A0LA 3ASOB 4GX1A 5BXZA 4K35A 3CEIA 1Q8IA 5J2TA 3IGAC 4J9ZB 4DUYO 4PI2A 1KC8W 1IBLB 3SYPA 4I0XB 2GTSA 4JI6B 4LFAB 2NLJC 2W0XA 2VQEO 2GUZB 2CTQA 1Y74B 5C93A 3K0GA 3JAWB 2B9ZA 2VS0A 3PN1A 2QA4V 3BY6A 2ZKOA 1H2GA 4Z1VA 2RCVA 2X0LA 3DC6A 2LQTA 4ZI7B 1GN4A 2ZM6O 4DV3B 3RYFA 1F23A 2RDCA 1HNXO 5K1XA 2CTWA 3F7VC 2OIEA 2XNDG 2EBOA 1BSMA 4BW9A 1NR7A 3JAKA 1N0NA 5LL6Y 2A79B 2OIGA 1P7BA 1NVPD 1FD9A 2CE4A 3AG2B 2Z3YA 4JGSA 2Y4UA 5EBLC 5BR8B 3IJ4A 2EIKC 4LFAO 1XNRO 4P9OA 2DYSC 4UV9A 3W7WA 3ZN1A 5DEDA 1NZ6A 4NTYA 1G4YB 1BZKA 1NH2B 1PP9H 5EC2C 2UXBB 1VIBA 2HFEC 3FKSG 5EIBD 3KCYA 5LXTB 5CA1B 4GKJB 1L1FA 2OTLV 4GLXA 2LGQA 3QO8A 4J41A 4IHJA 3RGBA 1N36O 1Q43A 3E2EA 3K59A 4I50B 1WA8A 1N36B 4JYAB 1S5LZ 3QO5A 1TVKA 1XBLA 5CA0A 3SPCA 2UUAO 5BMVA 2Q73A 3AG7A 3T2MA 4LF7B 3FB6C 1M4UA 3ASOC 3AG4C 4IGGA 4TT3G 3ZHTA 3IC9A 4H33A 4MTFA 3HKEB 2DYRB 2HG5C 2WLHA 4I9WA 3CCEV 3OUFA 4JI0O 2PGGA 1M57C 2ZIOA 4EB6A 1QCEA 4WFHA 4K0KO 2ZIMA 1GM8A 4JI0B 1PNLA 3JARB 3VOUA 2XAQA 2QWQB 2QWPB 4LF5B 1MG1A 3IC7A 4GKJO 3WB2A 3WB0A 4DV7O 4U7OA 4DUYB 1TUEB 2E5LB 3T4ZA 2W0FC 1OV9A 5KHHA 4DV1O 3UCSC 4DR3B 1F51A 3HKBA 4K3AA 5L3DA 1SC5B 2Z0AA 3ASNB 5LGNA 5JQGA 3RYIB 1DGSA 2UUCB 2QKCA 1N32O 2LFSA 5AG2A 1SQXH 1IDSA 4NTXA 3K9SA 4MTOA 5B1OA 3E8HA 4PA4A 1WA8B 4UXNA 2UXCO 3CRCA 4BR6A 1LUWA 4LF8B 4PA9A 2WLKA 2UU9O 1W0KG 4W4KA 2DQ0A 1V55B 4DR4O 2BTQB 2D3OW 3K5LA 1R73A 5IE9A 3CJHB 3FD9A 2ZDIC 1G8MA 2GHYA 4N23A 4WFAV 1YZBA 2LP7A 4FFBB 2EZOA 1VEWA 1QLNA 4UCUA 3CMAV 1XREA 4F6RA 3SJQC 5D5QA 1OCCC 1I0HA 1AI6A 1YTFD 3UO3A 2Q67A 1RM1C 4RUEA 3ZBHA 5ITZB 2PUSA 1PKXA 5FNVB 2XAFA 5B3SB 3OTOB 1Q6HA 5EZYA 4LF5O 3OD4A 5D5PA 4LF6O 4D7SA 1I08A 3OTOO 3SYAA 2C2AA 3L71H 3AEIA 1QLEC 2QM8A 4FMTA 5JJJB 3JAKB 1EZJA 1RSOB 2DJVA 1YHQV 4CC6A 4X65O 1SS3A 1YF2A 1Q3EA 4NB5A 3OE7G 4J80A 1FXVA 4HNAA 3B8MA 1DK1A 5DM6V 4DK1A 4AILC 2JGDB 1YJWV 3ZX6A 1Q6IA 2OWOA 2KQXA 1KUQA 2PYJA 4PELA 3OR6C 1K97A 2LGWA 4QPJA 2HVJC 2WPDG 1XNRB 1J5EB 2PF4E 4O4JA 1S77D 4YHHO 1KB9F 2XUMA 3L72H 1WLEA 5EIBC 3ABTA 5J2UA 1VMGA 4LF9B 1TAEA 4E4EA 2YS8A 3GWKC 5TISZ 2JRIA 3FYEB 5ITZA 5JJEB 4U7NA 2QKAA 1SQFA 4ZIBA 3RVZA 1XNQO 4JTDB 4FZ1A 3EVKA 3I56V 2IBZH 3AK2A 1HDJA 3DXRA 4EKWA 1KQSU 1OCCB 3W7UA 1GAXA 2Q7GA 5EYPB 2B5UA 5EK0A 2ARHA 3NXSA 3JAWA 3L9DA 5IWAB 4TQFA 1GN3A 3TCUA 3GVMA 3QG5A 4LF4B 2UXCB 5KX5B 5JH7B 5KHKA 3OTFA 4O4HB 1R3LC 3APQA 4MW8A 4BW5A 3DXRB 1FKAO 2YUAA 5KUMA 1GTOA 2Q7HA 2HHHB 4MW3A 4OX9B 3A0RA 5B66Z 1RM1B 3HB3B 4UFZA 1WPBA 1PM9A 4B3RB 2AXTZ 5GTHZ 3RYIA 1XNQB 1VF7A 3G6BA 3N2KB 1TA8A 4FZ0A 4JZ2A 4DXWA 3D8CA 1O9GA 4E2LA 3O9OA 5B1NA 4IIJB 4JI5B 4DR6O 1K5QA 1LUVA 3SPIA 1THZA 2ITCC 2UUBO 3JALA 1J5EO 3LSUA 3OR7C 3RYCB 4J9YB 3ZMTA 4DV5B 1E79G 3FB8C 4UCTA 5DECA 2YSUB 2GBOA 3ZMZA 2Q8VA 1VQ7V 4FPPA 2Q68A 5KUKA 2MW2B 4JTAB 3Q4HA 3GWOA 5LP6C 1ZWIC 4NYKA 1WB8A 4DV6B 2N04A 2R9IA 1N34B 2B1IA 2YIBD 3BEHA 1ZSPA 4PHZA 3ZHVA 1GM7A 3T4DA 1JQ0A 1AI5A 1RPOA 1BQ0A 1FJGO 3ZHSA 3C3TA 2P5OA 5BMVB 2DMXA 5EZYB 2WLNA 1P49A 1YJNV 3ZHRA 4GUNA 3ZEDA 1U96A 5KAFZ 4DR2B 2IH1C 1SQVH 4NKGB 4B3MO 3C90A 5H5NA 1M5IA 2XHBA 3W7SA 4H44B 2YXYA 2E75B 5CA3A 1JVMA 4JI5O 4YIOA 2UXDB 4TQDA 2H94A 1JJ2U 5FPOA 1R6TA 1VQ4V 2R9AA 3DGEA 3ASNC 3MDSA 4I5SA 2ZD9A 1FXKC 1AP5A 1ZX3A 4PA7A 2JGDA 1SF9A 4I7ZB 1AI7A 2Q4PA 4B3RO 4YJ2A 4WCEV 2UXBO 5IJ0B 4KUMA 3OUSA 2V7QG 3ETDA 4JI3B 1I5YA 1SQQH 1XL4A 5H9CA 5J2UB 2EIMC 2ZXWB 2VRZA 2KG7A 1G6UA 2ZE7A 3I55V 1HR0O 2HJDA 4DR5O 1HNWB 4BIOA 3M8AA 3KCXA 1XI1A 1ZL8B 1K4DC 4FLWA 3DSQA 1VP7A 3FB5C 4FFKA 4FJCC 1DTOA 3ZMVA 1NS1A 1WP8A 4ZOLA 3IAYA 1XQ8A 2F93B 2PI4A 1ZAUA 4MTGA 4LF6B 2XAHA 1GN2A 1IZ3A 3SDLA 2K9PA 2R9RB 2WA4A 3ZRSA 2AW9A 2BOCC 1KMIZ 3ZMUA 1UFIA 1OHHG 3CX5F 1BL8A 1VQ9V 4CH6A 4DV6O 5EYPA 4X8AA 3K5NA 2W6JG 2GTAA 1NI8A 3WFVA 2DYRC 5BY1A 2QM7A 1V54B 2EINC 1QR9A 5H2FZ 1GM9A 3U11A 1AB3A 5KA5A 4XBFA 5CA0B 1RP3B 2ODMA 1YITV 2Y4TA 3CHXA 4QPKA 4I50A 4I55B 1YIJV 1NKDA 2QWRB 2H8PC 1SQBH 2V1DA 5CBFA 2E3CA 1BCCH 2QTOA 5BR8O 3W7XA 2WLIA 2Q5ZA 1YXBA 1FXKB 1YSCA 5LOVB 4ZHQA 4HZ3A 3BA8A 2A7WA 3L75H 5LGTA 3F5TA 1NVPB 2BE3A 2ZQMA 1SERA 4JZGA 4IHJB 4DR4B 2EIMB 1X4TA 2ZNIA 4X1KB 1VQ5V 5L3CA 1MABG 1I94B 2CH7B 1NU1H 4IYHA 5L3BA 3D36C 1B3QA 1SA0A 2ZNJA 3H1HH 2Q0AA 3JD4A 5B1AC 4NXNO 5H6RA 1AR1B 1Z2GA 4I55A 1OCOC 3SYQA 1KYOF 2DQ3A 4I0XA 1JR9A 4TOIA 1TVKB 5KAIZ 2X6BA 5J2TB 4LCUC 5FL7G 4B7EA 4YJ3A 3KKYA 4U3JA 5JJNB 2UXDO 1SKVA 5EBMC 4MSWC 2QJ1A 4JV5B 1BS3A 2ADPA 1BE3H 3VQXA 4PJ0Z 5IJ9A 2Y48A 1N0JA 3ETQA 1W0JG 5KLVH 5CBHA 1OJHA 1P84F 4X1YB 1R3IC 1Y67A 3CWBH 3ZHUA 2YIBA 5LYJB 4ZHQB 2O57A 1JMKC 2AHZA 3TXSA 1NTKH 4UUJC 2GDSA 4IYIA 2P7TC 2P6JA 1V54C 4DRXB 4B3SB 4RUFA 3JD1A 3VBBA 4AQYB 1M93A 1XILA 4LNUB 2YXLA 3P3NA 4ZBMA 3B4SA 3JATB 1M90W 1K7DA 1HW7A 3KG2A 4LC1A 3K58A 1RPRA 3JD2A 3K06A 1I5XA 4FM0A 4PDVA 2ZM6B 1IXMA 4YY3O 3F7YC 2CAZC 4TV8A 1JA8A 1BHBA 4JI1O 1FS0G 4FM1A 4HNAB 4K8ZA 5LP6B 1M9NA 1YDXA 2P4VA 1MZEA 3A8TA 2Y69C 4JAUA 3BAAA 2YEVA 3EHBB 1HWYA 4X9QA 3LUTB 4JTCB 3K03A 1YCIA 5IWAO 2JS3A 4UCVA 1Z5WA 4LWSA 2WLJA 1W59A 4GX2A 1K5SA 3SPJA 2IJKA 3RN4A 3G80A 4IT5A 3TETA 1B06A 1I7FA 4X89A 5F2VO 2NR5A 5CB4B 4MVQA 1NT2B 4R6ZA 1Q86W 3RT3C 4X62B 4ASUG 3OW2U 2DWDC 4MT8A 3UT5A 4JI8O 4DV2O 3JALB 1EFRG 4UCOA 1FFXB 1DF5A 2X6CA 4GKKB 5LMNO 4O2BA 3GB7C 4JI1B 1ZUQA 2QTSA 3ZRVA 2R72A 2WLMA 4JYYA 1T5EA 4JYCA 1Q81W 4CH3A 3A2FA 3OEHG 4RQFA 2FB5A 4QIWF 4CC5A 4DV3O 1NH2D 1BT8A 2E76B 1BGYH 2QEXV 4DO2A 3M7MX 4K0KB 1PNMA 2QE7G 2NN4A 4D6TH 4LF9O 5KMGA 3DTUB 2KG7B 5IY5B 3IFXA 3BRCA 2IU3A 5J9PC 2A06H 3CP1A 1M56B 4DR1B 4X62O 5KHJA 5KX5A 1OCRB 2ZR2A 4F6EA 5C8YB 1JOYA 2UXXA 2JK5C 1H38A 4DR6B 3SPGA 3N27A 3MHSC 1IBLO 4LWSB 4XDKA 1K34A 1V55C 1IURA 1FFXA 4A5UB 4B3MB 4XDLA 3BCCH 2XOKG 1WP7A 1COWG 4PA6A 4LF4O 3K79A 2RNBA 1XMOB 4FM2A 5CBGA 4FLVA 1N4CA 4KFMA 3JSNA 5CB4A 2EULA 2F95B 5LMUB 4QE9A 5IJ9B 4YHHB 5HFLA 3ZMSA 3SYOA 1QVFU 3J80N 5B1BC 3CE2A 3HKDB 5LHIA 3OT7A 4FLTA 3WG7C 2LW1A 3WB1A 5KMGB 3QF7A 4PDRA 3O65A 4JAAA 3P32A 3MAQA 2XASA 2DOSA 4YY3B 3JATA 4ABMA 1Q6UA 1F4NA 4JI4O 3EFFK 4DR2O 2P4KA 1ROPA 3ZS8C 2IJJA 4H0LB 4LH7A 3Q4HB 3P3PA 4JI4B 4WFBV 3A0BZ 3T1HB 2BCCH 4UVBA 1AROP 4X66B 4DV4B 2CUGA 4DR7B 4O4JB 2QSAA 4FVMA 4EFEA 2KSDA 4O4LB 1VF6C 4OPHA 2GV9A 1R6KA 4B3SO 4KXRA 2FYUH 3HPLC 1KD1W 3CCRV 4WF9V 4GT1A 3C3SA 3SYCA 4B3TB 1MA1A 1SETA 2AGAA 4CS2A 3CC4V 1G1XB 2VWJA 2WLLB 3ZN0A 1MNGA 3CJHA 4TV8B 2QDOA 1NQTA 2BTQA 2W6IG 1MZFA 1W2BU 3K5OA 1TUBA 5IYCO 2P22C 2CGOA 1M57B 4X20B 5EBWC 1N32B 3FFQA 4RAIA 1GK9A 3APOA 1N8RW 4U3FH 4O4HA 3CD6V 4KL1A 3K0DA 1AR4A 5B1BB 3LNNA 3E83A 4WBNA 1URFA 4KHPB 1N33B 3CPWU 2GSMB 4X64B 5JCOC 4WFEA 4LFCB 3TJTA 4DR1O 2HLDG 1BMFG 1UPGA 1DF4A 2VQFB 2LFRA 3FAVB 1EBOA 4F4LA 2M6YA 1BQZA 4JASA 2IU0A 3CCLV 1FJGB 2DN9A 1AI4A 4DV1B 3CRAA 2ADQB 1HR0B 2Q6AA 1TUBB 3J7AU 2Q0OC 2R70A 2M7WA 3MD0A 2JDIG 2WA3A 2MK3A 3BVOA 3ABMC 3EXAA 3SR2C 4ZKIA 3JCUZ 3L74H 3JAMN 5JVDA 4GCZA 1L0LH 3OM3B 4WBNB 2F1MA 1OCZC 1QU7A 3RYHB 4JI7B 3E86A 3UM7A 3TK1A 3X2QB 3HKCB 5HFMA 1K73W 3HKBB 3THOA 4I4TB 3JARA 1RFYA 3RYCA 5B5EZ 4L87A 4J7ZA 4X64O 4BIUA 5EC1C 4J7KA 4LFBB 3RVYA 1S3JA 2YIAA 1H2SB 3HR0A 3G6EV 4O2AB 1VQKV 1WN7A 2CH7A 3B09A 1GH6A 1VQ6V 1Q90D 4X20A 4NXNB 4NVPA 1SESA 3JD0A 4LF7O 1Y74A 2JS5A 5LMNB 3TGUH 4PDLA 2L35A 3JASA 1NBMG 4CS4A 3T1HO 1FXKA 1R6NA 1Q7YW 5L3GA 4X66O 5LHHA 3H9VA 3STLC 1XUQA 2FL4A 4N21A 4RQEA 1AILA 2BTOA 1H2KA 5KHIA 1YEWA 2CTPA 1JJOA 1GN6A 3HKDA 3AK3A 1TGOA 2HKOA 4TUYB 5LXTA 5L3EA 1H8EG 4IL6Z 1D5AA 3U0ZA 3JD3A 2CTRA 4TSFG 2P06A 5IYBO 1XDCA 3W7TA 2EILC 1NR1A 1E1RG 4Z1MG 4R50A 2BSKB 4J42A 1WB7A 1J95A 5CA1A 3MHHC 4R7CA 4JI2O 3G71V 3ABLC 2HR3A 5A9GA 4O4LA 4GKKO 2PZSA 4NR1A 4EEQA 4YJ3B 2YIDA 3DC5A 3H1KH 1E1QG 3L70H 2F43G 3F5WC 4JF3A 2LJ2A 3T1CA 1H8HG 4LFCO 2IH3C 3SJAC 1F7YA 3FX7A 3KZIZ 1JCHA 4KHPO 1SQGA 3WU2Z 1VQNV 4OGQB 4IIJA 4PI0A 3H1IH 4HBNA 2ZT9B 4DYLA 4RWUA 2XTAA 2PYLA 4ZI7A 4GX0A 4DW1A 4DR5B 2OCCC 3E8BA 1HNWO 3STZC 1EN6A 2Q9LA 1YI2V 3JYCA 1Y6XA 4MTXA 3QO7A 2RMKB 3G4SV 2FKXA 2WLIB 2UXNA 5KHGA 2EJRA 3K3WA 5GW7A 2HP8A 3E8GA 2ZE5A 4LP8A 1XMOO 2F4VB 4LF8O 4MS2A 3ZRWB 2OTJV 3T1YB 1K9MW 4G28B 1JFFB 5IDJA 3OFNG 2EILB 4OX9O 2IJHA 4DV0O 3I5DA 4YJ2B 4JI8B 3LDEA 1H2LA 2RN9A 4LFBO 5GTIZ 3RBZA 1FYJA 3D36A 2Q7EA 1ZTEA 1P4RA 3R65A 4I9QA 5H6QA 4FFBA 3JSLA 1XHXA 3K08A 4X88A 1M56C 2A9HA 4DR7O 4B7KA 3CCMV 1PD3A 1WJZA 3LSSA 4AQYO 1WPXA 2XT9A 4MVOA 1KP3A 3ETEA 5B1AB 3UO2A 2X7RB 1S5JA 1NTMH 2E5LO 3T1YO 3RFRA 3JASB 2FTKA 1XMQB 2F23A 3ZRWA 5JH7A 4ICGA 2P67A 2YXHA 4DK0A 4DRXA 1KECA 5LGUA 3K57A 3LSQA 2UUCO 2JGUA 1S5HC 3B2EE 2BOBC 5JCOA 1VQMV 5LYJA 4O4IB 3N2GA 2CGNA 4UCSA 4X1YA 1AJNA 5LA6A 2IJIA 1S0VA 2ZR3A 3CC7V 4MVMA 1MSWD 2PTMA 2F66C 1ORQC 2GUZA 3ZCCA 4QNHB 2V4DA 3UKMA 3H1LH 3P30A 3BHPA 4TUYA 3B77A 4DUZO 4B08A 2ITDC 4FLXA 4YIPA 1S76D 1UJWB 1OCZB 1QQCA 1JPXA 2YDEA 4UV8A 2BSKA 3M99B 1SZXA 4CZZA 3D3QA 3AG3C 4X1IB 4DR3O 3BPZA 4G2KA 2AZ2A 3S3XA 3OMIB 3VQWA 1JX9A 3BA9A 1U97A 1L0NH 1Y4MA 2JJ1G 1LR1A 1AJQA 4UVAA 1QR8A 4O4IA 3ZIAG 2WSSG 2PY5A 1US6A 3ABLB 4I4TA 2VWKA 3H01A 4HYOA 1K8AW 1SRYA 1XEQA 5LBQA 2F4VO 1MSDA 3OMAB 1S72V 4MVZA 2WWWA 5B3SC 4MVRA 3CB2A 4DV2B 3LDCA 2HEPA 1GMGA 1QNMA 5CMUA 1MMMA 2DE0X 1HNZB 2OYQA 2JVDA 1Y76B 3CCQV 3CXCU 3CCSV 4L8JA 2ZE6A 2JEXA 4F6RB 1D2DA 4LH6A 4O2AA 4FIPC 2RJZA 3QTCA 2YC0A 4BAYA 4P2ZA 4D7TA 1HP8A 5GONB 4FLZA 2JJ2G 1OZ0A 3RWRD 2DW4A 1D5NA 2EIJB 1M1KW 4G27B 5E1AC 1QVGU 3G67A 4JV5O 1ENVA 3D3IA 4DUZB 3K04A 1NTZH 4Q6GA 1HNXB 4O2BB 4GZRB 1PL4A 1RSOA 4LR3A 4JI3O 2VQFO 3ABMB 2QM4A 4CH4A 3E89A 3CCVV 3OMNB 4P30A 1XMQO 3CRMA 1WAZA 2YICA 4LNUA 3X2QC 1IXBA 4EB6B 5A2QN 4AHCA 4UCRA 3U10A 2QR4A 2ILMA 1EZVH 2NNUA 5JQGB 1VQPV 2E74B 4WFFA 1YTFB 1B6QA 3SGIA 3QVNA 1K3EA 2ZXWC 3E8FA 5BZBA 5FPRA 5L3FA 4DV4O 2EZPA 2JEUA 1CP9A 4UB8Z 5IY5C 5LMUO 3SJCC 4TV9A 3OGCC 4MVSA 4X1KA 2ZE8A 2N74A 2X6AA 3FAVA 5IYZB 4JYBA 3RYFB 2HJFC 3LDDA 3HKCA 4QE7A 4FLYA 1KKDA 1FXHA 2KB1A 3N2GB 4HAMA 3CS5A 3SPHA 5LHGA 2DWEC 5LOVA 1VF6A 4JYAO 2Q69A 2CDYA 4NXMO 4YXWG 4CH5A 2ZINA 2XAJA 3A0HZ 2IM9A 2LO1A 4MVUA 4U3JB 4Z2WA 2IW5A 1YJ9V 5IYZA 2ETNA 2K1EA 2B1GA 3CSXA 1R1BA 4DV5O 5JVDB 4Q20A 1X59A 1Y66A 2A3QA 5FNVA 5K1PA 4LBEC 3CYOA 3K9AA 3VQVA 1GRJA 1IVSA 4QGPA 2ATKC 3AG1C 4EFBA 2UU9B 1QHTA 4R8CA 1PNKA 1N34O 1O9HA 1CXZB 1EN4A 2ZCEA 2N05A 3ICXA 1H2NA 2QWOB 2L6LA 3OEEG 1EN5A 1R3KC 5IJ0A 2WAMA 1XOUA 4CBCA 1ZLZA 3ETGA 3CMEV 1PPJH 3UQ8A 4X1IA 2UUAB 1FPOA 4NXMB 4ZOLB 4TWKA 4J10A 1MOFA 2H3OA 2LW7A 4KP4A 4TV9B 3ZRXA 1VQOV 1Q82W 3HKEA 3E22A 1XHZA 1Z5VA 4OXSA 1VF5B 3QNEA 4PA3A 1KBHA 2EIKB 1AVMA 2DYSB 4PD4F 4WFGA 1SQPH 3BABA 2OCCB 3ZHQA 3L73H 3FB7C 3NR7A 1NJIW 3ABUA 3AG2C 4K8XA 4JI7O 1VARA 1Y76A 1VQLV 2D2CB 1SA0B 2JIZG 5JWPA 2YEVB 2EJ7A 3J81N 2P90A 4H37A 3OAAG 5LP6A 2ZDIA 1I94O 1BHAA 4X65B 2AZ0A 3ABKC 3R66A 2Y0IA 3CRRA 1XL6A 3CXHF 2UUBB 1DLBA 5FLXN 5GONA 5DN6G 4FK5C 1QLEB 2QGNA 1GKFA 3AG4B 4W4LA 1V9PA 2Z5UA 1R3JC 3JCZA 3AG3B 1H2MA 2HHHO 5IT9N 2CK3G 2RQ6A 5IYDO 1KKCA 1L8DA 1CPYA 1OCRC 2YI8A 4DV0B 2FMLA 1AP6A 3K5MA 5KA6A 3AK1A
chains in the Genus database with same CATH topology
1ZL8B 3B40A 1Y74B 1VF6C 1VF6A 1ZL8A 1RSOB 1Y76A 1Y74A 1Y76B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZL8 B;  3B40 A;  1Y74 B;  1VF6 C;  1VF6 A;  1ZL8 A;  1RSO B;  1Y76 A;  1Y74 A;  1Y76 B; 
#chains in the Genus database with same CATH topology
 4H13 B;  3CRQ A;  1PL0 A;  5E79 Z;  1HNZ O;  3B8N A;  4UB6 Z;  5LA6 B;  3SJB C;  3E22 B;  4DW0 A;  4AI8 A;  4J7J A;  2XAG A;  1VQ8 V;  3CCU V;  4NTW A;  3AG1 B;  2OT5 A;  3S3W A;  3UT5 B;  4PDM A;  1B04 A;  1IBM O;  4JPR A;  4XDJ A;  4UVC A;  4JI6 O;  2EIN B;  1IBM B;  4BWA A;  3CC2 V;  3N2K A;  3BFR A;  3WG7 B;  1SZT A;  4BIZ A;  1WNS A;  1A32 A;  4P9P A;  1K92 A;  2Y69 B;  1IX9 A;  5CN0 A;  4JAV A;  1P7G A;  3FYI B;  1ZL8 A;  2Y0P A;  1K4C C;  4J11 A;  1F4M A;  4C7U A;  1YVW A;  4CS3 A;  2EIJ C;  1JFF A;  3B40 A;  2OCH A;  3RW0 A;  1AR5 A;  3LNM B;  1AJP A;  2YI9 A;  1LNQ A;  4OPA A;  2WLL A;  2AHY A;  1KP2 A;  4PV1 B;  1FFT B;  4JI2 B;  1KU9 A;  3ZJZ A;  2VQE B;  2QKS A;  4GYC B;  2KKW A;  4GX5 A;  3VQY A;  1PV0 A;  1EM1 A;  1K33 A;  2QWN B;  4FLU A;  1GO3 F;  1IBK B;  3E35 A;  4QJF B;  1N33 O;  2PI5 A;  3ABK B;  3RYH A;  1OCO B;  2EX3 A;  5C8Y A;  1IBK O;  3CCJ V;  1QBZ A;  4RO2 A;  3H1J H;  3OGI B;  3TXQ A;  2HVK C;  2G38 A;  3ML0 A;  1FAF A;  1Q5O A;  4DV7 B;  1CEZ A;  3PJS K;  4B3T O;  2A0L A;  3ASO B;  4GX1 A;  5BXZ A;  4K35 A;  3CEI A;  1Q8I A;  5J2T A;  3IGA C;  4J9Z B;  4DUY O;  4PI2 A;  1KC8 W;  1IBL B;  3SYP A;  4I0X B;  2GTS A;  4JI6 B;  4LFA B;  2NLJ C;  2W0X A;  2VQE O;  2GUZ B;  2CTQ A;  1Y74 B;  5C93 A;  3K0G A;  3JAW B;  2B9Z A;  2VS0 A;  3PN1 A;  2QA4 V;  3BY6 A;  2ZKO A;  1H2G A;  4Z1V A;  2RCV A;  2X0L A;  3DC6 A;  2LQT A;  4ZI7 B;  1GN4 A;  2ZM6 O;  4DV3 B;  3RYF A;  1F23 A;  2RDC A;  1HNX O;  5K1X A;  2CTW A;  3F7V C;  2OIE A;  2XND G;  2EBO A;  1BSM A;  4BW9 A;  1NR7 A;  3JAK A;  1N0N A;  5LL6 Y;  2A79 B;  2OIG A;  1P7B A;  1NVP D;  1FD9 A;  2CE4 A;  3AG2 B;  2Z3Y A;  4JGS A;  2Y4U A;  5EBL C;  5BR8 B;  3IJ4 A;  2EIK C;  4LFA O;  1XNR O;  4P9O A;  2DYS C;  4UV9 A;  3W7W A;  3ZN1 A;  5DED A;  1NZ6 A;  4NTY A;  1G4Y B;  1BZK A;  1NH2 B;  1PP9 H;  5EC2 C;  2UXB B;  1VIB A;  2HFE C;  3FKS G;  5EIB D;  3KCY A;  5LXT B;  5CA1 B;  4GKJ B;  1L1F A;  2OTL V;  4GLX A;  2LGQ A;  3QO8 A;  4J41 A;  4IHJ A;  3RGB A;  1N36 O;  1Q43 A;  3E2E A;  3K59 A;  4I50 B;  1WA8 A;  1N36 B;  4JYA B;  1S5L Z;  3QO5 A;  1TVK A;  1XBL A;  5CA0 A;  3SPC A;  2UUA O;  5BMV A;  2Q73 A;  3AG7 A;  3T2M A;  4LF7 B;  3FB6 C;  1M4U A;  3ASO C;  3AG4 C;  4IGG A;  4TT3 G;  3ZHT A;  3IC9 A;  4H33 A;  4MTF A;  3HKE B;  2DYR B;  2HG5 C;  2WLH A;  4I9W A;  3CCE V;  3OUF A;  4JI0 O;  2PGG A;  1M57 C;  2ZIO A;  4EB6 A;  1QCE A;  4WFH A;  4K0K O;  2ZIM A;  1GM8 A;  4JI0 B;  1PNL A;  3JAR B;  3VOU A;  2XAQ A;  2QWQ B;  2QWP B;  4LF5 B;  1MG1 A;  3IC7 A;  4GKJ O;  3WB2 A;  3WB0 A;  4DV7 O;  4U7O A;  4DUY B;  1TUE B;  2E5L B;  3T4Z A;  2W0F C;  1OV9 A;  5KHH A;  4DV1 O;  3UCS C;  4DR3 B;  1F51 A;  3HKB A;  4K3A A;  5L3D A;  1SC5 B;  2Z0A A;  3ASN B;  5LGN A;  5JQG A;  3RYI B;  1DGS A;  2UUC B;  2QKC A;  1N32 O;  2LFS A;  5AG2 A;  1SQX H;  1IDS A;  4NTX A;  3K9S A;  4MTO A;  5B1O A;  3E8H A;  4PA4 A;  1WA8 B;  4UXN A;  2UXC O;  3CRC A;  4BR6 A;  1LUW A;  4LF8 B;  4PA9 A;  2WLK A;  2UU9 O;  1W0K G;  4W4K A;  2DQ0 A;  1V55 B;  4DR4 O;  2BTQ B;  2D3O W;  3K5L A;  1R73 A;  5IE9 A;  3CJH B;  3FD9 A;  2ZDI C;  1G8M A;  2GHY A;  4N23 A;  4WFA V;  1YZB A;  2LP7 A;  4FFB B;  2EZO A;  1VEW A;  1QLN A;  4UCU A;  3CMA V;  1XRE A;  4F6R A;  3SJQ C;  5D5Q A;  1OCC C;  1I0H A;  1AI6 A;  1YTF D;  3UO3 A;  2Q67 A;  1RM1 C;  4RUE A;  3ZBH A;  5ITZ B;  2PUS A;  1PKX A;  5FNV B;  2XAF A;  5B3S B;  3OTO B;  1Q6H A;  5EZY A;  4LF5 O;  3OD4 A;  5D5P A;  4LF6 O;  4D7S A;  1I08 A;  3OTO O;  3SYA A;  2C2A A;  3L71 H;  3AEI A;  1QLE C;  2QM8 A;  4FMT A;  5JJJ B;  3JAK B;  1EZJ A;  1RSO B;  2DJV A;  1YHQ V;  4CC6 A;  4X65 O;  1SS3 A;  1YF2 A;  1Q3E A;  4NB5 A;  3OE7 G;  4J80 A;  1FXV A;  4HNA A;  3B8M A;  1DK1 A;  5DM6 V;  4DK1 A;  4AIL C;  2JGD B;  1YJW V;  3ZX6 A;  1Q6I A;  2OWO A;  2KQX A;  1KUQ A;  2PYJ A;  4PEL A;  3OR6 C;  1K97 A;  2LGW A;  4QPJ A;  2HVJ C;  2WPD G;  1XNR B;  1J5E B;  2PF4 E;  4O4J A;  1S77 D;  4YHH O;  1KB9 F;  2XUM A;  3L72 H;  1WLE A;  5EIB C;  3ABT A;  5J2U A;  1VMG A;  4LF9 B;  1TAE A;  4E4E A;  2YS8 A;  3GWK C;  5TIS Z;  2JRI A;  3FYE B;  5ITZ A;  5JJE B;  4U7N A;  2QKA A;  1SQF A;  4ZIB A;  3RVZ A;  1XNQ O;  4JTD B;  4FZ1 A;  3EVK A;  3I56 V;  2IBZ H;  3AK2 A;  1HDJ A;  3DXR A;  4EKW A;  1KQS U;  1OCC B;  3W7U A;  1GAX A;  2Q7G A;  5EYP B;  2B5U A;  5EK0 A;  2ARH A;  3NXS A;  3JAW A;  3L9D A;  5IWA B;  4TQF A;  1GN3 A;  3TCU A;  3GVM A;  3QG5 A;  4LF4 B;  2UXC B;  5KX5 B;  5JH7 B;  5KHK A;  3OTF A;  4O4H B;  1R3L C;  3APQ A;  4MW8 A;  4BW5 A;  3DXR B;  1FKA O;  2YUA A;  5KUM A;  1GTO A;  2Q7H A;  2HHH B;  4MW3 A;  4OX9 B;  3A0R A;  5B66 Z;  1RM1 B;  3HB3 B;  4UFZ A;  1WPB A;  1PM9 A;  4B3R B;  2AXT Z;  5GTH Z;  3RYI A;  1XNQ B;  1VF7 A;  3G6B A;  3N2K B;  1TA8 A;  4FZ0 A;  4JZ2 A;  4DXW A;  3D8C A;  1O9G A;  4E2L A;  3O9O A;  5B1N A;  4IIJ B;  4JI5 B;  4DR6 O;  1K5Q A;  1LUV A;  3SPI A;  1THZ A;  2ITC C;  2UUB O;  3JAL A;  1J5E O;  3LSU A;  3OR7 C;  3RYC B;  4J9Y B;  3ZMT A;  4DV5 B;  1E79 G;  3FB8 C;  4UCT A;  5DEC A;  2YSU B;  2GBO A;  3ZMZ A;  2Q8V A;  1VQ7 V;  4FPP A;  2Q68 A;  5KUK A;  2MW2 B;  4JTA B;  3Q4H A;  3GWO A;  5LP6 C;  1ZWI C;  4NYK A;  1WB8 A;  4DV6 B;  2N04 A;  2R9I A;  1N34 B;  2B1I A;  2YIB D;  3BEH A;  1ZSP A;  4PHZ A;  3ZHV A;  1GM7 A;  3T4D A;  1JQ0 A;  1AI5 A;  1RPO A;  1BQ0 A;  1FJG O;  3ZHS A;  3C3T A;  2P5O A;  5BMV B;  2DMX A;  5EZY B;  2WLN A;  1P49 A;  1YJN V;  3ZHR A;  4GUN A;  3ZED A;  1U96 A;  5KAF Z;  4DR2 B;  2IH1 C;  1SQV H;  4NKG B;  4B3M O;  3C90 A;  5H5N A;  1M5I A;  2XHB A;  3W7S A;  4H44 B;  2YXY A;  2E75 B;  5CA3 A;  1JVM A;  4JI5 O;  4YIO A;  2UXD B;  4TQD A;  2H94 A;  1JJ2 U;  5FPO A;  1R6T A;  1VQ4 V;  2R9A A;  3DGE A;  3ASN C;  3MDS A;  4I5S A;  2ZD9 A;  1FXK C;  1AP5 A;  1ZX3 A;  4PA7 A;  2JGD A;  1SF9 A;  4I7Z B;  1AI7 A;  2Q4P A;  4B3R O;  4YJ2 A;  4WCE V;  2UXB O;  5IJ0 B;  4KUM A;  3OUS A;  2V7Q G;  3ETD A;  4JI3 B;  1I5Y A;  1SQQ H;  1XL4 A;  5H9C A;  5J2U B;  2EIM C;  2ZXW B;  2VRZ A;  2KG7 A;  1G6U A;  2ZE7 A;  3I55 V;  1HR0 O;  2HJD A;  4DR5 O;  1HNW B;  4BIO A;  3M8A A;  3KCX A;  1XI1 A;  1ZL8 B;  1K4D C;  4FLW A;  3DSQ A;  1VP7 A;  3FB5 C;  4FFK A;  4FJC C;  1DTO A;  3ZMV A;  1NS1 A;  1WP8 A;  4ZOL A;  3IAY A;  1XQ8 A;  2F93 B;  2PI4 A;  1ZAU A;  4MTG A;  4LF6 B;  2XAH A;  1GN2 A;  1IZ3 A;  3SDL A;  2K9P A;  2R9R B;  2WA4 A;  3ZRS A;  2AW9 A;  2BOC C;  1KMI Z;  3ZMU A;  1UFI A;  1OHH G;  3CX5 F;  1BL8 A;  1VQ9 V;  4CH6 A;  4DV6 O;  5EYP A;  4X8A A;  3K5N A;  2W6J G;  2GTA A;  1NI8 A;  3WFV A;  2DYR C;  5BY1 A;  2QM7 A;  1V54 B;  2EIN C;  1QR9 A;  5H2F Z;  1GM9 A;  3U11 A;  1AB3 A;  5KA5 A;  4XBF A;  5CA0 B;  1RP3 B;  2ODM A;  1YIT V;  2Y4T A;  3CHX A;  4QPK A;  4I50 A;  4I55 B;  1YIJ V;  1NKD A;  2QWR B;  2H8P C;  1SQB H;  2V1D A;  5CBF A;  2E3C A;  1BCC H;  2QTO A;  5BR8 O;  3W7X A;  2WLI A;  2Q5Z A;  1YXB A;  1FXK B;  1YSC A;  5LOV B;  4ZHQ A;  4HZ3 A;  3BA8 A;  2A7W A;  3L75 H;  5LGT A;  3F5T A;  1NVP B;  2BE3 A;  2ZQM A;  1SER A;  4JZG A;  4IHJ B;  4DR4 B;  2EIM B;  1X4T A;  2ZNI A;  4X1K B;  1VQ5 V;  5L3C A;  1MAB G;  1I94 B;  2CH7 B;  1NU1 H;  4IYH A;  5L3B A;  3D36 C;  1B3Q A;  1SA0 A;  2ZNJ A;  3H1H H;  2Q0A A;  3JD4 A;  5B1A C;  4NXN O;  5H6R A;  1AR1 B;  1Z2G A;  4I55 A;  1OCO C;  3SYQ A;  1KYO F;  2DQ3 A;  4I0X A;  1JR9 A;  4TOI A;  1TVK B;  5KAI Z;  2X6B A;  5J2T B;  4LCU C;  5FL7 G;  4B7E A;  4YJ3 A;  3KKY A;  4U3J A;  5JJN B;  2UXD O;  1SKV A;  5EBM C;  4MSW C;  2QJ1 A;  4JV5 B;  1BS3 A;  2ADP A;  1BE3 H;  3VQX A;  4PJ0 Z;  5IJ9 A;  2Y48 A;  1N0J A;  3ETQ A;  1W0J G;  5KLV H;  5CBH A;  1OJH A;  1P84 F;  4X1Y B;  1R3I C;  1Y67 A;  3CWB H;  3ZHU A;  2YIB A;  5LYJ B;  4ZHQ B;  2O57 A;  1JMK C;  2AHZ A;  3TXS A;  1NTK H;  4UUJ C;  2GDS A;  4IYI A;  2P7T C;  2P6J A;  1V54 C;  4DRX B;  4B3S B;  4RUF A;  3JD1 A;  3VBB A;  4AQY B;  1M93 A;  1XIL A;  4LNU B;  2YXL A;  3P3N A;  4ZBM A;  3B4S A;  3JAT B;  1M90 W;  1K7D A;  1HW7 A;  3KG2 A;  4LC1 A;  3K58 A;  1RPR A;  3JD2 A;  3K06 A;  1I5X A;  4FM0 A;  4PDV A;  2ZM6 B;  1IXM A;  4YY3 O;  3F7Y C;  2CAZ C;  4TV8 A;  1JA8 A;  1BHB A;  4JI1 O;  1FS0 G;  4FM1 A;  4HNA B;  4K8Z A;  5LP6 B;  1M9N A;  1YDX A;  2P4V A;  1MZE A;  3A8T A;  2Y69 C;  4JAU A;  3BAA A;  2YEV A;  3EHB B;  1HWY A;  4X9Q A;  3LUT B;  4JTC B;  3K03 A;  1YCI A;  5IWA O;  2JS3 A;  4UCV A;  1Z5W A;  4LWS A;  2WLJ A;  1W59 A;  4GX2 A;  1K5S A;  3SPJ A;  2IJK A;  3RN4 A;  3G80 A;  4IT5 A;  3TET A;  1B06 A;  1I7F A;  4X89 A;  5F2V O;  2NR5 A;  5CB4 B;  4MVQ A;  1NT2 B;  4R6Z A;  1Q86 W;  3RT3 C;  4X62 B;  4ASU G;  3OW2 U;  2DWD C;  4MT8 A;  3UT5 A;  4JI8 O;  4DV2 O;  3JAL B;  1EFR G;  4UCO A;  1FFX B;  1DF5 A;  2X6C A;  4GKK B;  5LMN O;  4O2B A;  3GB7 C;  4JI1 B;  1ZUQ A;  2QTS A;  3ZRV A;  2R72 A;  2WLM A;  4JYY A;  1T5E A;  4JYC A;  1Q81 W;  4CH3 A;  3A2F A;  3OEH G;  4RQF A;  2FB5 A;  4QIW F;  4CC5 A;  4DV3 O;  1NH2 D;  1BT8 A;  2E76 B;  1BGY H;  2QEX V;  4DO2 A;  3M7M X;  4K0K B;  1PNM A;  2QE7 G;  2NN4 A;  4D6T H;  4LF9 O;  5KMG A;  3DTU B;  2KG7 B;  5IY5 B;  3IFX A;  3BRC A;  2IU3 A;  5J9P C;  2A06 H;  3CP1 A;  1M56 B;  4DR1 B;  4X62 O;  5KHJ A;  5KX5 A;  1OCR B;  2ZR2 A;  4F6E A;  5C8Y B;  1JOY A;  2UXX A;  2JK5 C;  1H38 A;  4DR6 B;  3SPG A;  3N27 A;  3MHS C;  1IBL O;  4LWS B;  4XDK A;  1K34 A;  1V55 C;  1IUR A;  1FFX A;  4A5U B;  4B3M B;  4XDL A;  3BCC H;  2XOK G;  1WP7 A;  1COW G;  4PA6 A;  4LF4 O;  3K79 A;  2RNB A;  1XMO B;  4FM2 A;  5CBG A;  4FLV A;  1N4C A;  4KFM A;  3JSN A;  5CB4 A;  2EUL A;  2F95 B;  5LMU B;  4QE9 A;  5IJ9 B;  4YHH B;  5HFL A;  3ZMS A;  3SYO A;  1QVF U;  3J80 N;  5B1B C;  3CE2 A;  3HKD B;  5LHI A;  3OT7 A;  4FLT A;  3WG7 C;  2LW1 A;  3WB1 A;  5KMG B;  3QF7 A;  4PDR A;  3O65 A;  4JAA A;  3P32 A;  3MAQ A;  2XAS A;  2DOS A;  4YY3 B;  3JAT A;  4ABM A;  1Q6U A;  1F4N A;  4JI4 O;  3EFF K;  4DR2 O;  2P4K A;  1ROP A;  3ZS8 C;  2IJJ A;  4H0L B;  4LH7 A;  3Q4H B;  3P3P A;  4JI4 B;  4WFB V;  3A0B Z;  3T1H B;  2BCC H;  4UVB A;  1ARO P;  4X66 B;  4DV4 B;  2CUG A;  4DR7 B;  4O4J B;  2QSA A;  4FVM A;  4EFE A;  2KSD A;  4O4L B;  1VF6 C;  4OPH A;  2GV9 A;  1R6K A;  4B3S O;  4KXR A;  2FYU H;  3HPL C;  1KD1 W;  3CCR V;  4WF9 V;  4GT1 A;  3C3S A;  3SYC A;  4B3T B;  1MA1 A;  1SET A;  2AGA A;  4CS2 A;  3CC4 V;  1G1X B;  2VWJ A;  2WLL B;  3ZN0 A;  1MNG A;  3CJH A;  4TV8 B;  2QDO A;  1NQT A;  2BTQ A;  2W6I G;  1MZF A;  1W2B U;  3K5O A;  1TUB A;  5IYC O;  2P22 C;  2CGO A;  1M57 B;  4X20 B;  5EBW C;  1N32 B;  3FFQ A;  4RAI A;  1GK9 A;  3APO A;  1N8R W;  4U3F H;  4O4H A;  3CD6 V;  4KL1 A;  3K0D A;  1AR4 A;  5B1B B;  3LNN A;  3E83 A;  4WBN A;  1URF A;  4KHP B;  1N33 B;  3CPW U;  2GSM B;  4X64 B;  5JCO C;  4WFE A;  4LFC B;  3TJT A;  4DR1 O;  2HLD G;  1BMF G;  1UPG A;  1DF4 A;  2VQF B;  2LFR A;  3FAV B;  1EBO A;  4F4L A;  2M6Y A;  1BQZ A;  4JAS A;  2IU0 A;  3CCL V;  1FJG B;  2DN9 A;  1AI4 A;  4DV1 B;  3CRA A;  2ADQ B;  1HR0 B;  2Q6A A;  1TUB B;  3J7A U;  2Q0O C;  2R70 A;  2M7W A;  3MD0 A;  2JDI G;  2WA3 A;  2MK3 A;  3BVO A;  3ABM C;  3EXA A;  3SR2 C;  4ZKI A;  3JCU Z;  3L74 H;  3JAM N;  5JVD A;  4GCZ A;  1L0L H;  3OM3 B;  4WBN B;  2F1M A;  1OCZ C;  1QU7 A;  3RYH B;  4JI7 B;  3E86 A;  3UM7 A;  3TK1 A;  3X2Q B;  3HKC B;  5HFM A;  1K73 W;  3HKB B;  3THO A;  4I4T B;  3JAR A;  1RFY A;  3RYC A;  5B5E Z;  4L87 A;  4J7Z A;  4X64 O;  4BIU A;  5EC1 C;  4J7K A;  4LFB B;  3RVY A;  1S3J A;  2YIA A;  1H2S B;  3HR0 A;  3G6E V;  4O2A B;  1VQK V;  1WN7 A;  2CH7 A;  3B09 A;  1GH6 A;  1VQ6 V;  1Q90 D;  4X20 A;  4NXN B;  4NVP A;  1SES A;  3JD0 A;  4LF7 O;  1Y74 A;  2JS5 A;  5LMN B;  3TGU H;  4PDL A;  2L35 A;  3JAS A;  1NBM G;  4CS4 A;  3T1H O;  1FXK A;  1R6N A;  1Q7Y W;  5L3G A;  4X66 O;  5LHH A;  3H9V A;  3STL C;  1XUQ A;  2FL4 A;  4N21 A;  4RQE A;  1AIL A;  2BTO A;  1H2K A;  5KHI A;  1YEW A;  2CTP A;  1JJO A;  1GN6 A;  3HKD A;  3AK3 A;  1TGO A;  2HKO A;  4TUY B;  5LXT A;  5L3E A;  1H8E G;  4IL6 Z;  1D5A A;  3U0Z A;  3JD3 A;  2CTR A;  4TSF G;  2P06 A;  5IYB O;  1XDC A;  3W7T A;  2EIL C;  1NR1 A;  1E1R G;  4Z1M G;  4R50 A;  2BSK B;  4J42 A;  1WB7 A;  1J95 A;  5CA1 A;  3MHH C;  4R7C A;  4JI2 O;  3G71 V;  3ABL C;  2HR3 A;  5A9G A;  4O4L A;  4GKK O;  2PZS A;  4NR1 A;  4EEQ A;  4YJ3 B;  2YID A;  3DC5 A;  3H1K H;  1E1Q G;  3L70 H;  2F43 G;  3F5W C;  4JF3 A;  2LJ2 A;  3T1C A;  1H8H G;  4LFC O;  2IH3 C;  3SJA C;  1F7Y A;  3FX7 A;  3KZI Z;  1JCH A;  4KHP O;  1SQG A;  3WU2 Z;  1VQN V;  4OGQ B;  4IIJ A;  4PI0 A;  3H1I H;  4HBN A;  2ZT9 B;  4DYL A;  4RWU A;  2XTA A;  2PYL A;  4ZI7 A;  4GX0 A;  4DW1 A;  4DR5 B;  2OCC C;  3E8B A;  1HNW O;  3STZ C;  1EN6 A;  2Q9L A;  1YI2 V;  3JYC A;  1Y6X A;  4MTX A;  3QO7 A;  2RMK B;  3G4S V;  2FKX A;  2WLI B;  2UXN A;  5KHG A;  2EJR A;  3K3W A;  5GW7 A;  2HP8 A;  3E8G A;  2ZE5 A;  4LP8 A;  1XMO O;  2F4V B;  4LF8 O;  4MS2 A;  3ZRW B;  2OTJ V;  3T1Y B;  1K9M W;  4G28 B;  1JFF B;  5IDJ A;  3OFN G;  2EIL B;  4OX9 O;  2IJH A;  4DV0 O;  3I5D A;  4YJ2 B;  4JI8 B;  3LDE A;  1H2L A;  2RN9 A;  4LFB O;  5GTI Z;  3RBZ A;  1FYJ A;  3D36 A;  2Q7E A;  1ZTE A;  1P4R A;  3R65 A;  4I9Q A;  5H6Q A;  4FFB A;  3JSL A;  1XHX A;  3K08 A;  4X88 A;  1M56 C;  2A9H A;  4DR7 O;  4B7K A;  3CCM V;  1PD3 A;  1WJZ A;  3LSS A;  4AQY O;  1WPX A;  2XT9 A;  4MVO A;  1KP3 A;  3ETE A;  5B1A B;  3UO2 A;  2X7R B;  1S5J A;  1NTM H;  2E5L O;  3T1Y O;  3RFR A;  3JAS B;  2FTK A;  1XMQ B;  2F23 A;  3ZRW A;  5JH7 A;  4ICG A;  2P67 A;  2YXH A;  4DK0 A;  4DRX A;  1KEC A;  5LGU A;  3K57 A;  3LSQ A;  2UUC O;  2JGU A;  1S5H C;  3B2E E;  2BOB C;  5JCO A;  1VQM V;  5LYJ A;  4O4I B;  3N2G A;  2CGN A;  4UCS A;  4X1Y A;  1AJN A;  5LA6 A;  2IJI A;  1S0V A;  2ZR3 A;  3CC7 V;  4MVM A;  1MSW D;  2PTM A;  2F66 C;  1ORQ C;  2GUZ A;  3ZCC A;  4QNH B;  2V4D A;  3UKM A;  3H1L H;  3P30 A;  3BHP A;  4TUY A;  3B77 A;  4DUZ O;  4B08 A;  2ITD C;  4FLX A;  4YIP A;  1S76 D;  1UJW B;  1OCZ B;  1QQC A;  1JPX A;  2YDE A;  4UV8 A;  2BSK A;  3M99 B;  1SZX A;  4CZZ A;  3D3Q A;  3AG3 C;  4X1I B;  4DR3 O;  3BPZ A;  4G2K A;  2AZ2 A;  3S3X A;  3OMI B;  3VQW A;  1JX9 A;  3BA9 A;  1U97 A;  1L0N H;  1Y4M A;  2JJ1 G;  1LR1 A;  1AJQ A;  4UVA A;  1QR8 A;  4O4I A;  3ZIA G;  2WSS G;  2PY5 A;  1US6 A;  3ABL B;  4I4T A;  2VWK A;  3H01 A;  4HYO A;  1K8A W;  1SRY A;  1XEQ A;  5LBQ A;  2F4V O;  1MSD A;  3OMA B;  1S72 V;  4MVZ A;  2WWW A;  5B3S C;  4MVR A;  3CB2 A;  4DV2 B;  3LDC A;  2HEP A;  1GMG A;  1QNM A;  5CMU A;  1MMM A;  2DE0 X;  1HNZ B;  2OYQ A;  2JVD A;  1Y76 B;  3CCQ V;  3CXC U;  3CCS V;  4L8J A;  2ZE6 A;  2JEX A;  4F6R B;  1D2D A;  4LH6 A;  4O2A A;  4FIP C;  2RJZ A;  3QTC A;  2YC0 A;  4BAY A;  4P2Z A;  4D7T A;  1HP8 A;  5GON B;  4FLZ A;  2JJ2 G;  1OZ0 A;  3RWR D;  2DW4 A;  1D5N A;  2EIJ B;  1M1K W;  4G27 B;  5E1A C;  1QVG U;  3G67 A;  4JV5 O;  1ENV A;  3D3I A;  4DUZ B;  3K04 A;  1NTZ H;  4Q6G A;  1HNX B;  4O2B B;  4GZR B;  1PL4 A;  1RSO A;  4LR3 A;  4JI3 O;  2VQF O;  3ABM B;  2QM4 A;  4CH4 A;  3E89 A;  3CCV V;  3OMN B;  4P30 A;  1XMQ O;  3CRM A;  1WAZ A;  2YIC A;  4LNU A;  3X2Q C;  1IXB A;  4EB6 B;  5A2Q N;  4AHC A;  4UCR A;  3U10 A;  2QR4 A;  2ILM A;  1EZV H;  2NNU A;  5JQG B;  1VQP V;  2E74 B;  4WFF A;  1YTF B;  1B6Q A;  3SGI A;  3QVN A;  1K3E A;  2ZXW C;  3E8F A;  5BZB A;  5FPR A;  5L3F A;  4DV4 O;  2EZP A;  2JEU A;  1CP9 A;  4UB8 Z;  5IY5 C;  5LMU O;  3SJC C;  4TV9 A;  3OGC C;  4MVS A;  4X1K A;  2ZE8 A;  2N74 A;  2X6A A;  3FAV A;  5IYZ B;  4JYB A;  3RYF B;  2HJF C;  3LDD A;  3HKC A;  4QE7 A;  4FLY A;  1KKD A;  1FXH A;  2KB1 A;  3N2G B;  4HAM A;  3CS5 A;  3SPH A;  5LHG A;  2DWE C;  5LOV A;  1VF6 A;  4JYA O;  2Q69 A;  2CDY A;  4NXM O;  4YXW G;  4CH5 A;  2ZIN A;  2XAJ A;  3A0H Z;  2IM9 A;  2LO1 A;  4MVU A;  4U3J B;  4Z2W A;  2IW5 A;  1YJ9 V;  5IYZ A;  2ETN A;  2K1E A;  2B1G A;  3CSX A;  1R1B A;  4DV5 O;  5JVD B;  4Q20 A;  1X59 A;  1Y66 A;  2A3Q A;  5FNV A;  5K1P A;  4LBE C;  3CYO A;  3K9A A;  3VQV A;  1GRJ A;  1IVS A;  4QGP A;  2ATK C;  3AG1 C;  4EFB A;  2UU9 B;  1QHT A;  4R8C A;  1PNK A;  1N34 O;  1O9H A;  1CXZ B;  1EN4 A;  2ZCE A;  2N05 A;  3ICX A;  1H2N A;  2QWO B;  2L6L A;  3OEE G;  1EN5 A;  1R3K C;  5IJ0 A;  2WAM A;  1XOU A;  4CBC A;  1ZLZ A;  3ETG A;  3CME V;  1PPJ H;  3UQ8 A;  4X1I A;  2UUA B;  1FPO A;  4NXM B;  4ZOL B;  4TWK A;  4J10 A;  1MOF A;  2H3O A;  2LW7 A;  4KP4 A;  4TV9 B;  3ZRX A;  1VQO V;  1Q82 W;  3HKE A;  3E22 A;  1XHZ A;  1Z5V A;  4OXS A;  1VF5 B;  3QNE A;  4PA3 A;  1KBH A;  2EIK B;  1AVM A;  2DYS B;  4PD4 F;  4WFG A;  1SQP H;  3BAB A;  2OCC B;  3ZHQ A;  3L73 H;  3FB7 C;  3NR7 A;  1NJI W;  3ABU A;  3AG2 C;  4K8X A;  4JI7 O;  1VAR A;  1Y76 A;  1VQL V;  2D2C B;  1SA0 B;  2JIZ G;  5JWP A;  2YEV B;  2EJ7 A;  3J81 N;  2P90 A;  4H37 A;  3OAA G;  5LP6 A;  2ZDI A;  1I94 O;  1BHA A;  4X65 B;  2AZ0 A;  3ABK C;  3R66 A;  2Y0I A;  3CRR A;  1XL6 A;  3CXH F;  2UUB B;  1DLB A;  5FLX N;  5GON A;  5DN6 G;  4FK5 C;  1QLE B;  2QGN A;  1GKF A;  3AG4 B;  4W4L A;  1V9P A;  2Z5U A;  1R3J C;  3JCZ A;  3AG3 B;  1H2M A;  2HHH O;  5IT9 N;  2CK3 G;  2RQ6 A;  5IYD O;  1KKC A;  1L8D A;  1CPY A;  1OCR C;  2YI8 A;  4DV0 B;  2FML A;  1AP6 A;  3K5M A;  5KA6 A;  3AK1 A; 
#chains in the Genus database with same CATH homology
 1ZL8 B;  3B40 A;  1Y74 B;  1VF6 C;  1VF6 A;  1ZL8 A;  1RSO B;  1Y76 A;  1Y74 A;  1Y76 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...