1ZL8B

Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
b'SDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIN-7
publication title A General Model for Preferential Hetero-oligomerization of LIN-2/7 Domains: Mechanism Underlying Directed Assembly of Supramolecular Signaling Complexes
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 14
structure length 54
sequence length 54
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1zl8B00
1ZL8B 1Y76B 1Y74B 1VF6A 1ZL8A 1RSOB 1VF6C 1Y74A 1Y76A 3B40A
chains in the Genus database with same CATH superfamily
1K4CC 2DYRB 3L75H 2XT9A 3MHHC 2UUCB 5LHIA 1A32A 3CB2A 1MSWD 1W0JG 1LNQA 3HKCB 4NXNB 3ICXA 4MTFA 1K5QA 1LUVA 3SYAA 4Q6GA 2ZCEA 4DV3B 4D7TA 4FMTA 1F4NA 5KLVH 4OGQB 1F4MA 3CCRV 4FM2A 3H9VA 4A5UB 1H2NA 2QEXV 1NTZH 5GONA 2N05A 2K9PA 3SPHA 4YY3O 4D6TH 4DR3B 1VMGA 4DK0A 1R3KC 1XQ8A 2ZNJA 2DW4A 4UXNA 5EBWC 4TUYA 3WFVA 4H44B 1XEQA 2UXCO 2JGDA 3D8CA 4LCUC 1SZXA 2QWRB 4EB6B 4O4JB 1HW7A 3CCUV 1ZL8B 1QVGU 5LP6A 2YXYA 4RO2A 1GN2A 2Q67A 4UCVA 3BA9A 4LH6A 4BAYA 1XMQB 4BW9A 5GW7A 4PJ0Z 3WG7B 1Q90D 1S5LZ 4RQEA 2ZM6B 5LA6A 3ML0A 2ETNA 4O4LB 1MNGA 4I4TA 2RCVA 3EVKA 5LYJA 1N36B 2A79B 2WLIA 3HKBB 1QBZA 5LMNB 4H33A 4DXWA 3S3WA 2B1IA 4BIZA 1AVMA 1I5XA 2A06H 4LF5O 1ZWIC 3QO7A 4FFKA 2WPDG 3B77A 4WFBV 1XHZA 2F4VO 1V55C 4NXMB 4I7ZB 1EM1A 5JVDA 1KYOF 3K06A 3TXQA 3FAVA 4TQFA 4LF6B 3GWKC 1K92A 3W7XA 5DN6G 1M90W 4FLVA 3HKEA 2CAZC 1LR1A 2RQ6A 1MOFA 4K8ZA 2KG7A 5J2TB 2Y48A 2NLJC 1E1RG 5L3EA 3LNMB 1SA0A 2QKSA 2QA4V 1BE3H 4IIJB 1NH2D 1AJQA 4I50A 4X20A 1K9MW 4F6RB 2IU3A 4YJ2B 2XUMA 2Q4PA 2R9IA 1D5NA 1EN5A 4FZ0A 3K5NA 5H2FZ 1YF2A 3CXHF 3SPIA 1X59A 2ZR2A 3ASOB 4LBEC 3VOUA 3OD4A 2VWKA 4R50A 1HDJA 3CEIA 4QPJA 2YC0A 3C3SA 2OTLV 2QWNB 5TISZ 4GKJB 4K0KO 4BIOA 5LOVA 3TGUH 4DRXB 2UXDO 4I55B 4KP4A 4DR2B 2HVJC 3VBBA 3DGEA 4LFCO 4LWSB 4JI8O 2YIBD 4X62O 1NZ6A 1CXZB 2E76B 1U96A 1RSOB 2ATKC 3CCMV 2CGOA 3JD1A 3WB1A 2JIZG 1RPRA 4CBCA 2B9ZA 3VQXA 1WB8A 5L3FA 3TETA 1BCCH 2ZE7A 1XMOO 1PNKA 1SRYA 1QNMA 1P84F 1NJIW 5EC2C 1HWYA 2P4KA 3B4SA 1NBMG 2IH1C 1IDSA 2DOSA 3JATA 4I0XB 3ZHRA 1H2LA 3G4SV 3N2GB 1HR0B 1SS3A 2PI5A 4FM1A 1WA8A 4YXWG 1YZBA 4WF9V 2LGWA 1GM8A 1K8AW 3ASNB 4DV7B 4J41A 1TVKA 2FKXA 3TJTA 1BGYH 4CH5A 4B3RB 2F66C 1SKVA 3E8BA 1M93A 5H9CA 4X66B 2W6IG 4GYCB 3DXRA 2A0LA 1D2DA 2F1MA 4JTAB 2P7TC 3CRCA 3C90A 5CB4A 1UJWB 2JEUA 1D5AA 4YY3B 5LMUO 1XI1A 3HKDA 3B2EE 5E79Z 4LF7O 5FNVA 4ZOLB 2OYQA 1MZEA 3RGBA 3KKYA 5ITZA 2LFRA 2OT5A 1QLEC 3FB5C 2UXCB 2QJ1A 5CMUA 4TUYB 4FLZA 2JGDB 3APQA 2O57A 3JSLA 1Y6XA 3RVZA 3RYHA 1R3LC 2P67A 4B3SO 2MW2B 3JAWA 2QWOB 5EK0A 3HB3B 4LFAO 1FXHA 4KXRA 3SGIA 4YJ3A 4K3AA 3DC5A 4MTGA 1JMKC 1VQ8V 2A9HA 3ABKB 4GUNA 5B1AB 3T1CA 4RWUA 2QWPB 4J7ZA 3I5DA 5B3SB 1SQBH 3E86A 5LA6B 2ZQMA 2N74A 4GCZA 5IT9N 2EZOA 3CPWU 1N8RW 2V4DA 4I4TB 4PA7A 1PL4A 1CEZA 1FD9A 2Q69A 1KP2A 2X6CA 2UUCO 1KUQA 3D36C 4W4KA 3ABLC 3JASA 1SETA 3FKSG 3O65A 3K58A 3CC4V 5JVDB 2EILB 5JWPA 4O2AA 1AP5A 2Z3YA 4WBNA 4OX9B 3HKEB 3OGIB 3CHXA 1FJGO 1O9GA 4X64B 1JX9A 2KG7B 2KB1A 1EZVH 4IYHA 3F7YC 3SPJA 2ZIOA 4X88A 1Q5OA 1FXKC 1NR7A 1SA0B 1L0LH 3T1HO 3JARB 5JQGB 1OCZB 4I50B 4X20B 2Q6AA 3SYOA 5IE9A 3RWRD 1ZLZA 2QWQB 2ZE8A 4GX5A 1CP9A 2M7WA 4UB8Z 2PGGA 3VQWA 1ENVA 4J7KA 3OM3B 2UXDB 4JZGA 1MA1A 4JTCB 1GRJA 3N2KA 4X62B 2A7WA 1GMGA 2AZ0A 4JYCA 4LNUA 2EIKC 2EIMC 3UQ8A 3CCEV 4P2ZA 3ETDA 1AP6A 2XAHA 4TOIA 5H6QA 4LF8O 4MVQA 1SQXH 1IVSA 4YHHB 2HJFC 4GT1A 2DWDC 4CZZA 4FZ1A 4I5SA 4PV1B 1X4TA 1AI4A 1AI5A 3BRCA 4DK1A 4B3MO 5GTHZ 3T2MA 3ZIAG 1RFYA 3CC7V 2DYRC 4JPRA 1WA8B 3M99B 1AJPA 1TVKB 2QKCA 4GLXA 5BZBA 4MVSA 2XTAA 3BAAA 3DXRB 4LF6O 2XAJA 1VF7A 2VQFB 4MVOA 4TV9A 3QO5A 1RPOA 3LSSA 3ABUA 3AK2A 1WPBA 2FMLA 2GTAA 2OIGA 3FYEB 2PYJA 4LF7B 3EXAA 1L0NH 3HKDB 3K5OA 4PA6A 1FS0G 1FFXA 3WB0A 3ZJZA 3A0BZ 3CRMA 5FNVB 1S76D 4JI3B 4F6EA 2EULA 1YVWA 4MTXA 3DSQA 2YXHA 3K0DA 1HNXO 1H2KA 1YI2V 3K9AA 2RDCA 4H37A 3ZBHA 2XAQA 2OCCB 4ABMA 4GKJO 1E1QG 1YTFD 2CTRA 2WA4A 3S3XA 2FTKA 4DR2O 1TUEB 4FLUA 3SR2C 5JCOA 3JAWB 2QKAA 4O4HA 4LFAB 3RT3C 5J2UB 4DW0A 1FAFA 3MAQA 4DR1O 2K1EA 1Q6IA 2YIBA 2M6YA 5CA1A 3A8TA 5A9GA 4DR6B 3WG7C 1XNRB 4DV4O 3ZMZA 1EBOA 5CBGA 4DR4B 3ZCCA 1SQFA 2PZSA 4ZHQB 1Z2GA 2P6JA 1B6QA 2F43G 3ZS8C 2YIAA 5KHJA 3E8HA 3RYCA 1Q81W 3CCSV 1QLNA 5JJEB 3JALA 2N04A 2PTMA 1VQMV 2GBOA 4DV7O 1OJHA 5LGUA 1NTMH 4UV9A 2AW9A 4B3RO 4GZRB 4X66O 3GB7C 2IH3C 4JI7O 5JH7B 4R6ZA 3JASB 4XDKA 2LQTA 2DE0X 2CGNA 4GX0A 4J9ZB 2EIJB 4Z1MG 4NB5A 1KBHA 2Z5UA 4JYAB 2WLLA 4AHCA 3RVYA 1P7BA 5BXZA 4N23A 4O2AB 1N0NA 5L3CA 3I56V 1FJGB 3A0HZ 1YHQV 5EIBC 2D2CB 2AHZA 1XOUA 4UVCA 3R66A 1JJ2U 3T1HB 3PN1A 5LBQA 3FB6C 2EJRA 1ZUQA 4L87A 3ETGA 4BW5A 2XNDG 4DO2A 3ASOC 3UO2A 3JYCA 3SYQA 3OW2U 3J7AU 2QDOA 5LGTA 1B06A 3E8FA 2YUAA 4UCUA 1SQQH 2B5UA 3CE2A 3K9SA 4X1IA 3ZHUA 2FYUH 1E79G 3N2KB 2ZR3A 3SJAC 2VQEB 1VQLV 4QIWF 4RUFA 2DQ3A 2DYSB 2LJ2A 2LW7A 3CMEV 4LNUB 1AR5A 2Q0OC 3MD0A 1K5SA 2XAGA 4KHPO 2KQXA 2PUSA 5DM6V 3Q4HA 1Z5WA 3L72H 1YXBA 3OGCC 1OCRB 4LF8B 3HPLC 3CXCU 1BZKA 4X65O 4P9PA 2E5LB 4RAIA 2ZDIA 1VF5B 4J10A 3CJHA 2V7QG 5LGNA 4B3MB 2Q7GA 1R3JC 1AILA 2IJJA 3OR6C 2DN9A 5D5QA 2LFSA 3P3NA 1COWG 1IBKO 5CBFA 4TT3G 5KUMA 1WLEA 2YEVA 4J80A 3ASNC 3ABTA 2HKOA 3E22B 1GN4A 2IBZH 1THZA 1XNQO 5L3DA 4IT5A 1ZTEA 3ABMB 3K5LA 1PV0A 1XHXA 2AGAA 3OEEG 4RUEA 4DUZB 3ZRWA 3JD0A 1WJZA 3AG4B 2L6LA 4DV0B 3IGAC 3ZEDA 3KCYA 3PJSK 5HFLA 2QGNA 2XHBA 4TV9B 4KL1A 1I94O 4OX9O 3SYPA 4J7JA 2GHYA 4X64O 1LUWA 5EIBD 3K57A 4MVUA 1GN3A 5KUKA 3W7SA 2OIEA 1HNXB 3LSQA 3KZIZ 1J5EO 2EX3A 5IYZA 4J9YB 2RN9A 2H94A 3BY6A 1QQCA 3M7MX 1XL6A 1MABG 4K8XA 1SZTA 4NYKA 3W7WA 1I5YA 2W6JG 1OCCB 1Q43A 2Y0IA 3AG1B 4DR1B 4U3JB 4O4HB 5LXTA 1N4CA 3E83A 4MW3A 5KX5A 5IJ0A 3ABKC 4IHJA 5CA1B 4DV4B 4E2LA 3T1YB 5B1AC 3IC7A 2ITCC 3OE7G 4WFAV 4YHHO 3AG7A 2CTWA 4FK5C 4PHZA 2EINB 1P49A 5B3SC 3IJ4A 4UCTA 3DTUB 4FM0A 1VQNV 3F5WC 4TV8A 2WSSG 1K7DA 1IX9A 5AG2A 2CH7A 1GK9A 4PD4F 3WU2Z 1GH6A 5EBLC 1S5JA 3STLC 1R3IC 1VF6A 5L3BA 1FPOA 2FB5A 1DTOA 1DF4A 3JSNA 3JALB 2IU0A 4JI7B 1FYJA 3B8MA 4XBFA 4E4EA 4EKWA 3ZRVA 2Q0AA 1YIJV 4LP8A 1JQ0A 1G8MA 1VQ7V 4KFMA 4X1YA 2YXLA 1HNWB 2VQFO 3SJCC 4UUJC 4QPKA 1FXVA 1KB9F 5LL6Y 2EILC 1JPXA 2RMKB 3FFQA 3QG5A 3E2EA 5GONB 1VQ9V 4PA9A 3K03A 1Y74A 4ZBMA 3BFRA 4DUYB 1EZJA 2WLLB 3NXSA 3ZN0A 2F23A 1VEWA 2HHHB 4PDVA 5JJNB 2BE3A 1O9HA 2F95B 4JI3O 4JI6O 1ZAUA 3LDCA 4X8AA 3SPGA 1OCZC 1CPYA 2UXBB 4G27B 3OMIB 3QVNA 3VQVA 1M56B 1FXKA 3OT7A 4UV8A 4ZI7A 4YIOA 1PKXA 3LSUA 2IW5A 2B1GA 2ZKOA 1L1FA 1FFTB 4B3TO 1BL8A 4U7OA 1SC5B 1I08A 1VQ5V 2ADQB 2QE7G 2ITDC 5LP6B 4R7CA 1OHHG 2ZD9A 2HLDG 4DV2O 1WN7A 3FB7C 1S77D 2H3OA 1WNSA 4O2BA 2BSKA 1H2SB 4KHPB 4DR6O 1XNRO 4WFHA 4NR1A 4NVPA 4N21A 2BTQA 1K73W 4DR4O 1M57B 3Q4HB 4X65B 4R8CA 4UCSA 3OTOB 4LC1A 2Q8VA 5EC1C 4JZ2A 4JI0O 2MK3A 4I9QA 3CJHB 1AB3A 4JTDB 1IBKB 4X1KA 5LYJB 1J95A 2WLIB 4MVRA 4HAMA 1SQVH 3CRQA 1XL4A 2Q9LA 3HR0A 2G38A 2YEVB 4DR7O 1R6TA 1XNQB 4IYIA 1JR9A 4H13B 1K33A 2IJHA 3BEHA 4ASUG 5KHIA 1QVFU 1YJNV 2PY5A 1VQOV 4LFBB 3OEHG 1TUBA 3ZRWB 2GUZA 3K08A 4UVAA 1ROPA 3FAVB 4JYAO 2WLNA 1JVMA 1I94B 4WFGA 4JI2B 2OTJV 2BOBC 1PL0A 2DJVA 5B66Z 4PI0A 2QM8A 4MVMA 1KD1W 1N32O 2L35A 1Q7YW 1TA8A 4OXSA 3EFFK 3C3TA 1UFIA 1J5EB 1MG1A 4EFBA 4O4IA 3TK1A 1OZ0A 2OCCC 5IYZB 1HP8A 2XOKG 1S0VA 1XDCA 1NS1A 3H01A 2ZXWB 2UUAB 3TCUA 5LOVB 4AQYO 1WPXA 3ZMSA 3D3IA 4NTYA 2OWOA 4O4JA 2VQEO 3JCZA 1PP9H 2WLHA 1Y4MA 5BY1A 1JFFA 2E75B 1ZL8A 3BPZA 2NNUA 1YJ9V 1Q6HA 1M9NA 5K1XA 4LF4O 3OUSA 2R9RB 2E5LO 5KAIZ 1Q86W 1QCEA 3OMNB 5KMGA 3KCXA 1B04A 1IBMB 1P7GA 4JF3A 3IC9A 4DV1B 2RJZA 3JATB 1IXMA 1JCHA 2JJ1G 1US6A 3UM7A 1DGSA 2CH7B 3U0ZA 2JEXA 2GSMB 2P5OA 5B1BB 4NKGB 3X2QB 4OPHA 5BR8B 5FPOA 3CWBH 4DUZO 5JJJB 4TWKA 1JJOA 4DV0O 1BHBA 2EIJC 4X1YB 5CB4B 3BVOA 4G28B 3H1KH 4W4LA 1N33B 5LHGA 1G6UA 3THOA 3AK1A 3ZRXA 4Z2WA 4J11A 4FLWA 2LGQA 3UO3A 1BQZA 3M8AA 2AHYA 1Y74B 1M1KW 2Q73A 4FLXA 1NU1H 2VS0A 1N34B 1F51A 4JI6B 5KHHA 1B3QA 4NTXA 5ITZB 1Q82W 2NN4A 2CK3G 4WFEA 5IY5B 4JI1O 4F6RA 5B1OA 3E8GA 1NT2B 4LF9B 2UUBO 4ZI7B 4B3TB 2KKWA 4Z1VA 3OAAG 3RYHB 3AG2B 4DV6O 1NVPB 2YDEA 4NTWA 4QGPA 4DV2B 4JYBA 4PDMA 1YEWA 2DYSC 3ZMUA 4X9QA 4YJ3B 1XILA 3T1YO 1RSOA 4O2BB 2BSKB 1OCRC 1PD3A 4JI4B 4GX2A 2QTSA 4FLTA 3SJBC 2R72A 2ODMA 3AEIA 1VIBA 2BTQB 3QTCA 2P90A 1R73A 3FX7A 4JI0B 4ICGA 3I55V 4BIUA 3P32A 2IM9A 1KC8W 5C8YA 2CE4A 2WA3A 2YICA 2JRIA 3B40A 3H1JH 3CCLV 3IAYA 4I0XA 4X1KB 1R6NA 1EFRG 2ZE5A 4AI8A 1Y76A 3N2GA 2HJDA 4DR7B 4PDLA 5KA5A 1H8HG 3ZRSA 2HP8A 3ABMC 4QNHB 3RYIA 3EHBB 3J81N 3AG4C 2IJKA 3AG3B 5BMVA 1HNWO 3N27A 4GKKO 1OCOB 2QTOA 1TUBB 4CC6A 2JGUA 2GUZB 3STZC 4BR6A 1RM1B 1AROP 2D3OW 4DUYO 4JYYA 4WBNB 5H5NA 2HHHO 1SERA 2JVDA 1N32B 1K97A 3P30A 1KU9A 1ORQC 1MZFA 2Q7HA 2X0LA 4YIPA 1KKDA 2DWEC 4ZOLA 2JJ2G 2UXBO 3W7TA 3ZHTA 2GV9A 2Q68A 4O4IB 5IYDO 4MT8A 1VQ4V 4Q20A 4AQYB 4CH4A 1OV9A 1OCCC 3G67A 3T4DA 1R6KA 3AG1C 1ZSPA 5JCOC 5IWAO 3JD4A 3LDEA 4JASA 3E35A 4MS2A 2AXTZ 1JFFB 4HBNA 2ADPA 3E89A 1KQSU 4LF4B 2WAMA 4FPPA 1JOYA 2EINC 3OTOO 2W0FC 3BA8A 5FLXN 5IJ9A 2Y69B 1V54B 4WCEV 4XDLA 3RYFA 2R9AA 2W0XA 3JCUZ 5KMGB 1I0HA 2RNBA 2EBOA 1SESA 1G4YB 1NR1A 4D7SA 2Y4TA 4UCRA 1UPGA 2GTSA 5FPRA 1VARA 2HEPA 3G6BA 1KECA 4F4LA 2WLJA 3SDLA 2YI9A 1GM7A 1N0JA 4LFBO 1BSMA 1AR1B 3L70H 1V9PA 2X6AA 1GM9A 4FFBA 4GX1A 3LUTB 2H8PC 3CS5A 4JI2O 3CCQV 4L8JA 5CA0A 1AJNA 4UCOA 1Q6UA 4DV5B 2HFEC 2V1DA 1DLBA 3RN4A 3RW0A 5EYPA 1FFXB 1IZ3A 2WWWA 1QHTA 3IFXA 3K79A 4IGGA 2QM7A 5LHHA 4FJCC 3SYCA 1GO3F 5H6RA 3LDDA 4DR5B 4JI5B 3ZX6A 3ZHSA 3QNEA 1M56C 1NH2B 2Q7EA 4JI1B 4JAUA 3JARA 5JQGA 1K4DC 2Q5ZA 2UUBB 1GN6A 1SF9A 2X6BA 4LH7A 5IDJA 2UUAO 3ETEA 4DV6B 1H38A 5LP6C 2QR4A 1AI6A 3D3QA 1H2GA 2GDSA 4U7NA 1PM9A 4HNAA 2JS3A 5L3GA 4MW8A 1H8EG 3ZMTA 1M57C 1XUQA 3MHSC 1FKAO 4JV5O 4FVMA 2UXXA 1BS3A 4K35A 4B08A 4B7KA 5J9PC 2UU9O 1IBMO 4DV1O 3K04A 1GKFA 3NR7A 2ZDIC 3W7UA 4EEQA 5HFMA 3RYCB 2VWJA 3ZHQA 1W0KG 5C8YB 5IYBO 3L73H 2F93B 5BR8O 1Y76B 1VQKV 5EBMC 2ARHA 3D36A 5CBHA 4X89A 1GTOA 5K1PA 1VQ6V 1NQTA 3RYIB 4TQDA 4GKKB 4P9OA 1N33O 5BMVB 1S3JA 3UCSC 4CS4A 4I9WA 2BTOA 1DK1A 1V55B 2YSUB 1SQGA 3R65A 2PF4E 2AZ2A 3GVMA 4WFFA 4FLYA 2EJ7A 3U10A 3BCCH 1HNZO 3B8NA 4QE7A 5D5PA 1N34O 5B1NA 3H1IH 3T4ZA 3OR7C 2P06A 1H2MA 3CMAV 1PNLA 2DQ0A 1W2BU 3TXSA 1Z5VA 4AILC 1BQ0A 1IURA 4JGSA 4LF9O 2C2AA 3G71V 3L9DA 2WLKA 1WP7A 1YDXA 3ZHVA 4PI2A 2ZXWC 3JD3A 1KKCA 3JAKA 3FYIB 1MMMA 5KHKA 2ZNIA 4X1IB 1T5EA 5DEDA 1Q8IA 1F23A 3BHPA 5IWAB 1NKDA 4MVZA 3SPCA 5C93A 4JI4O 2QM4A 4EFEA 4CS3A 5J2UA 5A2QN 2Y0PA 1IBLO 1SQPH 1PNMA 2EZPA 2JK5C 5EZYA 3OUFA 3G80A 3UT5A 1R1BA 1QR9A 4UB6Z 3CCJV 2X7RB 3CX5F 5IJ9B 3RYFB 1S72V 2HR3A 4ZHQA 2ZIMA 3CD6V 3B09A 4DYLA 5B1BC 1VF6C 2JDIG 3X2QC 5FL7G 3MDSA 4MSWC 4UFZA 3H1LH 2ZT9B 3HKCA 4QE9A 4JAAA 4DW1A 5JH7A 4NXNO 4LF5B 1S5HC 3QO8A 4OPAA 3L74H 2CUGA 4DV3O 2F4VB 1K34A 1AR4A 4FFBB 3WB2A 3CRAA 3F5TA 4B7EA 4CS2A 1W59A 5CA0B 3SJQC 1M4UA 3CRRA 1Q3EA 2A3QA 2E3CA 1K3EA 4IL6Z 4RQFA 5EYPB 4XDJA 3K3WA 2VRZA 2UXNA 1PPJH 3RFRA 2R70A 4DR3O 2Y4UA 4JAVA 1F7YA 4MTOA 2HVKC 4PA4A 3OFNG 4LR3A 5IY5C 3GWOA 3JAMN 2P22C 1TAEA 2NR5A 1M5IA 1QLEB 3AG2C 5KA6A 1EN4A 1YCIA 5KAFZ 4EB6A 2YIDA 1NTKH 1BMFG 5IYCO 1YSCA 2LP7A 3CP1A 1XREA 4K0KB 5F2VO 5LXTB 4UVBA 4LFCB 4HNAB 5KX5B 4JI8B 5IJ0B 1QR8A 1EN6A 4CH3A 4IHJB 3AK3A 4JV5B 1XMQO 2CTPA 2IJIA 2UU9B 4C7UA 2OCHA 3BABA 4KUMA 1QU7A 4FIPC 4TV8B 1BT8A 1Y66A 2ZM6O 2DMXA 1WAZA 1XMOB 1TGOA 3K0GA 4O4LA 1VP7A 1YJWV 5E1AC 3CYOA 3HKBA 1NI8A 1ZX3A 3CC2V 1N36O 2Z0AA 5LMNO 2WLMA 4H0LB 4BWAA 3E22A 2PYLA 4PELA 3F7VC 5DECA 3LNNA 2XASA 3AG3C 3CSXA 1MSDA 3ABLB 3JD2A 3K5MA 1GAXA 1OCOC 1U97A 2ILMA 2KSDA 3DC6A 1RM1C 2BOCC 1RP3B 4NXMO 3UKMA 2P4VA 1P4RA 2HG5C 1DF5A 4DV5O 3ZMVA 1KP3A 2LO1A 1HNZB 3ZN1A 4P30A 2ZE6A 3H1HH 5J2TA 5CN0A 5LMUB 1XBLA 3A2FA 4U3FH 4IIJA 4DR5O 4JI5O 1URFA 2JS5A 3P3PA 3APOA 3OMAB 4YJ2A 1WP8A 4HZ3A 3FB8C 3QF7A 5CA3A 1FXKB 3ETQA 2LW1A 1I7FA 3VQYA 4CH6A 2ZINA 3U11A 2YI8A 3OTFA 1NVPD 3L71H 5B5EZ 4PDRA 3K59A 1KMIZ 5KHGA 4DRXA 3JAKB 4I55A 1YTFB 3O9OA 2QSAA 4LWSA 4ZIBA 4ZKIA 4B3SB 3J80N 2CDYA 1WB7A 1AI7A 4HYOA 1VQPV 4U3JA 3RBZA 1IBLB 2EIKB 4J42A 2EIMB 2PI4A 2Y69C 1V54C 1BHAA 4QJFB 5EZYB 3UT5B 2YS8A 2XAFA 2BCCH 1IXBA 1JA8A 1G1XB 2CTQA 5GTIZ 1Y67A 3G6EV 1L8DA 3A0RA 1YITV 4PA3A 2FL4A 4CC5A 4TSFG 1HR0O 3KG2A 2E74B 3CCVV 3FD9A 4G2KA
chains in the Genus database with same CATH topology
1ZL8B 1Y76B 1Y74B 1VF6A 1ZL8A 1RSOB 1VF6C 1Y74A 1Y76A 3B40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZL8 B;  1Y76 B;  1Y74 B;  1VF6 A;  1ZL8 A;  1RSO B;  1VF6 C;  1Y74 A;  1Y76 A;  3B40 A; 
#chains in the Genus database with same CATH topology
 1K4C C;  2DYR B;  3L75 H;  2XT9 A;  3MHH C;  2UUC B;  5LHI A;  1A32 A;  3CB2 A;  1MSW D;  1W0J G;  1LNQ A;  3HKC B;  4NXN B;  3ICX A;  4MTF A;  1K5Q A;  1LUV A;  3SYA A;  4Q6G A;  2ZCE A;  4DV3 B;  4D7T A;  4FMT A;  1F4N A;  5KLV H;  4OGQ B;  1F4M A;  3CCR V;  4FM2 A;  3H9V A;  4A5U B;  1H2N A;  2QEX V;  1NTZ H;  5GON A;  2N05 A;  2K9P A;  3SPH A;  4YY3 O;  4D6T H;  4DR3 B;  1VMG A;  4DK0 A;  1R3K C;  1XQ8 A;  2ZNJ A;  2DW4 A;  4UXN A;  5EBW C;  4TUY A;  3WFV A;  4H44 B;  1XEQ A;  2UXC O;  2JGD A;  3D8C A;  4LCU C;  1SZX A;  2QWR B;  4EB6 B;  4O4J B;  1HW7 A;  3CCU V;  1ZL8 B;  1QVG U;  5LP6 A;  2YXY A;  4RO2 A;  1GN2 A;  2Q67 A;  4UCV A;  3BA9 A;  4LH6 A;  4BAY A;  1XMQ B;  4BW9 A;  5GW7 A;  4PJ0 Z;  3WG7 B;  1Q90 D;  1S5L Z;  4RQE A;  2ZM6 B;  5LA6 A;  3ML0 A;  2ETN A;  4O4L B;  1MNG A;  4I4T A;  2RCV A;  3EVK A;  5LYJ A;  1N36 B;  2A79 B;  2WLI A;  3HKB B;  1QBZ A;  5LMN B;  4H33 A;  4DXW A;  3S3W A;  2B1I A;  4BIZ A;  1AVM A;  1I5X A;  2A06 H;  4LF5 O;  1ZWI C;  3QO7 A;  4FFK A;  2WPD G;  3B77 A;  4WFB V;  1XHZ A;  2F4V O;  1V55 C;  4NXM B;  4I7Z B;  1EM1 A;  5JVD A;  1KYO F;  3K06 A;  3TXQ A;  3FAV A;  4TQF A;  4LF6 B;  3GWK C;  1K92 A;  3W7X A;  5DN6 G;  1M90 W;  4FLV A;  3HKE A;  2CAZ C;  1LR1 A;  2RQ6 A;  1MOF A;  4K8Z A;  2KG7 A;  5J2T B;  2Y48 A;  2NLJ C;  1E1R G;  5L3E A;  3LNM B;  1SA0 A;  2QKS A;  2QA4 V;  1BE3 H;  4IIJ B;  1NH2 D;  1AJQ A;  4I50 A;  4X20 A;  1K9M W;  4F6R B;  2IU3 A;  4YJ2 B;  2XUM A;  2Q4P A;  2R9I A;  1D5N A;  1EN5 A;  4FZ0 A;  3K5N A;  5H2F Z;  1YF2 A;  3CXH F;  3SPI A;  1X59 A;  2ZR2 A;  3ASO B;  4LBE C;  3VOU A;  3OD4 A;  2VWK A;  4R50 A;  1HDJ A;  3CEI A;  4QPJ A;  2YC0 A;  3C3S A;  2OTL V;  2QWN B;  5TIS Z;  4GKJ B;  4K0K O;  4BIO A;  5LOV A;  3TGU H;  4DRX B;  2UXD O;  4I55 B;  4KP4 A;  4DR2 B;  2HVJ C;  3VBB A;  3DGE A;  4LFC O;  4LWS B;  4JI8 O;  2YIB D;  4X62 O;  1NZ6 A;  1CXZ B;  2E76 B;  1U96 A;  1RSO B;  2ATK C;  3CCM V;  2CGO A;  3JD1 A;  3WB1 A;  2JIZ G;  1RPR A;  4CBC A;  2B9Z A;  3VQX A;  1WB8 A;  5L3F A;  3TET A;  1BCC H;  2ZE7 A;  1XMO O;  1PNK A;  1SRY A;  1QNM A;  1P84 F;  1NJI W;  5EC2 C;  1HWY A;  2P4K A;  3B4S A;  1NBM G;  2IH1 C;  1IDS A;  2DOS A;  3JAT A;  4I0X B;  3ZHR A;  1H2L A;  3G4S V;  3N2G B;  1HR0 B;  1SS3 A;  2PI5 A;  4FM1 A;  1WA8 A;  4YXW G;  1YZB A;  4WF9 V;  2LGW A;  1GM8 A;  1K8A W;  3ASN B;  4DV7 B;  4J41 A;  1TVK A;  2FKX A;  3TJT A;  1BGY H;  4CH5 A;  4B3R B;  2F66 C;  1SKV A;  3E8B A;  1M93 A;  5H9C A;  4X66 B;  2W6I G;  4GYC B;  3DXR A;  2A0L A;  1D2D A;  2F1M A;  4JTA B;  2P7T C;  3CRC A;  3C90 A;  5CB4 A;  1UJW B;  2JEU A;  1D5A A;  4YY3 B;  5LMU O;  1XI1 A;  3HKD A;  3B2E E;  5E79 Z;  4LF7 O;  5FNV A;  4ZOL B;  2OYQ A;  1MZE A;  3RGB A;  3KKY A;  5ITZ A;  2LFR A;  2OT5 A;  1QLE C;  3FB5 C;  2UXC B;  2QJ1 A;  5CMU A;  4TUY B;  4FLZ A;  2JGD B;  3APQ A;  2O57 A;  3JSL A;  1Y6X A;  3RVZ A;  3RYH A;  1R3L C;  2P67 A;  4B3S O;  2MW2 B;  3JAW A;  2QWO B;  5EK0 A;  3HB3 B;  4LFA O;  1FXH A;  4KXR A;  3SGI A;  4YJ3 A;  4K3A A;  3DC5 A;  4MTG A;  1JMK C;  1VQ8 V;  2A9H A;  3ABK B;  4GUN A;  5B1A B;  3T1C A;  4RWU A;  2QWP B;  4J7Z A;  3I5D A;  5B3S B;  1SQB H;  3E86 A;  5LA6 B;  2ZQM A;  2N74 A;  4GCZ A;  5IT9 N;  2EZO A;  3CPW U;  1N8R W;  2V4D A;  4I4T B;  4PA7 A;  1PL4 A;  1CEZ A;  1FD9 A;  2Q69 A;  1KP2 A;  2X6C A;  2UUC O;  1KUQ A;  3D36 C;  4W4K A;  3ABL C;  3JAS A;  1SET A;  3FKS G;  3O65 A;  3K58 A;  3CC4 V;  5JVD B;  2EIL B;  5JWP A;  4O2A A;  1AP5 A;  2Z3Y A;  4WBN A;  4OX9 B;  3HKE B;  3OGI B;  3CHX A;  1FJG O;  1O9G A;  4X64 B;  1JX9 A;  2KG7 B;  2KB1 A;  1EZV H;  4IYH A;  3F7Y C;  3SPJ A;  2ZIO A;  4X88 A;  1Q5O A;  1FXK C;  1NR7 A;  1SA0 B;  1L0L H;  3T1H O;  3JAR B;  5JQG B;  1OCZ B;  4I50 B;  4X20 B;  2Q6A A;  3SYO A;  5IE9 A;  3RWR D;  1ZLZ A;  2QWQ B;  2ZE8 A;  4GX5 A;  1CP9 A;  2M7W A;  4UB8 Z;  2PGG A;  3VQW A;  1ENV A;  4J7K A;  3OM3 B;  2UXD B;  4JZG A;  1MA1 A;  4JTC B;  1GRJ A;  3N2K A;  4X62 B;  2A7W A;  1GMG A;  2AZ0 A;  4JYC A;  4LNU A;  2EIK C;  2EIM C;  3UQ8 A;  3CCE V;  4P2Z A;  3ETD A;  1AP6 A;  2XAH A;  4TOI A;  5H6Q A;  4LF8 O;  4MVQ A;  1SQX H;  1IVS A;  4YHH B;  2HJF C;  4GT1 A;  2DWD C;  4CZZ A;  4FZ1 A;  4I5S A;  4PV1 B;  1X4T A;  1AI4 A;  1AI5 A;  3BRC A;  4DK1 A;  4B3M O;  5GTH Z;  3T2M A;  3ZIA G;  1RFY A;  3CC7 V;  2DYR C;  4JPR A;  1WA8 B;  3M99 B;  1AJP A;  1TVK B;  2QKC A;  4GLX A;  5BZB A;  4MVS A;  2XTA A;  3BAA A;  3DXR B;  4LF6 O;  2XAJ A;  1VF7 A;  2VQF B;  4MVO A;  4TV9 A;  3QO5 A;  1RPO A;  3LSS A;  3ABU A;  3AK2 A;  1WPB A;  2FML A;  2GTA A;  2OIG A;  3FYE B;  2PYJ A;  4LF7 B;  3EXA A;  1L0N H;  3HKD B;  3K5O A;  4PA6 A;  1FS0 G;  1FFX A;  3WB0 A;  3ZJZ A;  3A0B Z;  3CRM A;  5FNV B;  1S76 D;  4JI3 B;  4F6E A;  2EUL A;  1YVW A;  4MTX A;  3DSQ A;  2YXH A;  3K0D A;  1HNX O;  1H2K A;  1YI2 V;  3K9A A;  2RDC A;  4H37 A;  3ZBH A;  2XAQ A;  2OCC B;  4ABM A;  4GKJ O;  1E1Q G;  1YTF D;  2CTR A;  2WA4 A;  3S3X A;  2FTK A;  4DR2 O;  1TUE B;  4FLU A;  3SR2 C;  5JCO A;  3JAW B;  2QKA A;  4O4H A;  4LFA B;  3RT3 C;  5J2U B;  4DW0 A;  1FAF A;  3MAQ A;  4DR1 O;  2K1E A;  1Q6I A;  2YIB A;  2M6Y A;  5CA1 A;  3A8T A;  5A9G A;  4DR6 B;  3WG7 C;  1XNR B;  4DV4 O;  3ZMZ A;  1EBO A;  5CBG A;  4DR4 B;  3ZCC A;  1SQF A;  2PZS A;  4ZHQ B;  1Z2G A;  2P6J A;  1B6Q A;  2F43 G;  3ZS8 C;  2YIA A;  5KHJ A;  3E8H A;  3RYC A;  1Q81 W;  3CCS V;  1QLN A;  5JJE B;  3JAL A;  2N04 A;  2PTM A;  1VQM V;  2GBO A;  4DV7 O;  1OJH A;  5LGU A;  1NTM H;  4UV9 A;  2AW9 A;  4B3R O;  4GZR B;  4X66 O;  3GB7 C;  2IH3 C;  4JI7 O;  5JH7 B;  4R6Z A;  3JAS B;  4XDK A;  2LQT A;  2DE0 X;  2CGN A;  4GX0 A;  4J9Z B;  2EIJ B;  4Z1M G;  4NB5 A;  1KBH A;  2Z5U A;  4JYA B;  2WLL A;  4AHC A;  3RVY A;  1P7B A;  5BXZ A;  4N23 A;  4O2A B;  1N0N A;  5L3C A;  3I56 V;  1FJG B;  3A0H Z;  1YHQ V;  5EIB C;  2D2C B;  2AHZ A;  1XOU A;  4UVC A;  3R66 A;  1JJ2 U;  3T1H B;  3PN1 A;  5LBQ A;  3FB6 C;  2EJR A;  1ZUQ A;  4L87 A;  3ETG A;  4BW5 A;  2XND G;  4DO2 A;  3ASO C;  3UO2 A;  3JYC A;  3SYQ A;  3OW2 U;  3J7A U;  2QDO A;  5LGT A;  1B06 A;  3E8F A;  2YUA A;  4UCU A;  1SQQ H;  2B5U A;  3CE2 A;  3K9S A;  4X1I A;  3ZHU A;  2FYU H;  1E79 G;  3N2K B;  2ZR3 A;  3SJA C;  2VQE B;  1VQL V;  4QIW F;  4RUF A;  2DQ3 A;  2DYS B;  2LJ2 A;  2LW7 A;  3CME V;  4LNU B;  1AR5 A;  2Q0O C;  3MD0 A;  1K5S A;  2XAG A;  4KHP O;  2KQX A;  2PUS A;  5DM6 V;  3Q4H A;  1Z5W A;  3L72 H;  1YXB A;  3OGC C;  1OCR B;  4LF8 B;  3HPL C;  3CXC U;  1BZK A;  4X65 O;  4P9P A;  2E5L B;  4RAI A;  2ZDI A;  1VF5 B;  4J10 A;  3CJH A;  2V7Q G;  5LGN A;  4B3M B;  2Q7G A;  1R3J C;  1AIL A;  2IJJ A;  3OR6 C;  2DN9 A;  5D5Q A;  2LFS A;  3P3N A;  1COW G;  1IBK O;  5CBF A;  4TT3 G;  5KUM A;  1WLE A;  2YEV A;  4J80 A;  3ASN C;  3ABT A;  2HKO A;  3E22 B;  1GN4 A;  2IBZ H;  1THZ A;  1XNQ O;  5L3D A;  4IT5 A;  1ZTE A;  3ABM B;  3K5L A;  1PV0 A;  1XHX A;  2AGA A;  3OEE G;  4RUE A;  4DUZ B;  3ZRW A;  3JD0 A;  1WJZ A;  3AG4 B;  2L6L A;  4DV0 B;  3IGA C;  3ZED A;  3KCY A;  3PJS K;  5HFL A;  2QGN A;  2XHB A;  4TV9 B;  4KL1 A;  1I94 O;  4OX9 O;  3SYP A;  4J7J A;  2GHY A;  4X64 O;  1LUW A;  5EIB D;  3K57 A;  4MVU A;  1GN3 A;  5KUK A;  3W7S A;  2OIE A;  1HNX B;  3LSQ A;  3KZI Z;  1J5E O;  2EX3 A;  5IYZ A;  4J9Y B;  2RN9 A;  2H94 A;  3BY6 A;  1QQC A;  3M7M X;  1XL6 A;  1MAB G;  4K8X A;  1SZT A;  4NYK A;  3W7W A;  1I5Y A;  2W6J G;  1OCC B;  1Q43 A;  2Y0I A;  3AG1 B;  4DR1 B;  4U3J B;  4O4H B;  5LXT A;  1N4C A;  3E83 A;  4MW3 A;  5KX5 A;  5IJ0 A;  3ABK C;  4IHJ A;  5CA1 B;  4DV4 B;  4E2L A;  3T1Y B;  5B1A C;  3IC7 A;  2ITC C;  3OE7 G;  4WFA V;  4YHH O;  3AG7 A;  2CTW A;  4FK5 C;  4PHZ A;  2EIN B;  1P49 A;  5B3S C;  3IJ4 A;  4UCT A;  3DTU B;  4FM0 A;  1VQN V;  3F5W C;  4TV8 A;  2WSS G;  1K7D A;  1IX9 A;  5AG2 A;  2CH7 A;  1GK9 A;  4PD4 F;  3WU2 Z;  1GH6 A;  5EBL C;  1S5J A;  3STL C;  1R3I C;  1VF6 A;  5L3B A;  1FPO A;  2FB5 A;  1DTO A;  1DF4 A;  3JSN A;  3JAL B;  2IU0 A;  4JI7 B;  1FYJ A;  3B8M A;  4XBF A;  4E4E A;  4EKW A;  3ZRV A;  2Q0A A;  1YIJ V;  4LP8 A;  1JQ0 A;  1G8M A;  1VQ7 V;  4KFM A;  4X1Y A;  2YXL A;  1HNW B;  2VQF O;  3SJC C;  4UUJ C;  4QPK A;  1FXV A;  1KB9 F;  5LL6 Y;  2EIL C;  1JPX A;  2RMK B;  3FFQ A;  3QG5 A;  3E2E A;  5GON B;  1VQ9 V;  4PA9 A;  3K03 A;  1Y74 A;  4ZBM A;  3BFR A;  4DUY B;  1EZJ A;  2WLL B;  3NXS A;  3ZN0 A;  2F23 A;  1VEW A;  2HHH B;  4PDV A;  5JJN B;  2BE3 A;  1O9H A;  2F95 B;  4JI3 O;  4JI6 O;  1ZAU A;  3LDC A;  4X8A A;  3SPG A;  1OCZ C;  1CPY A;  2UXB B;  4G27 B;  3OMI B;  3QVN A;  3VQV A;  1M56 B;  1FXK A;  3OT7 A;  4UV8 A;  4ZI7 A;  4YIO A;  1PKX A;  3LSU A;  2IW5 A;  2B1G A;  2ZKO A;  1L1F A;  1FFT B;  4B3T O;  1BL8 A;  4U7O A;  1SC5 B;  1I08 A;  1VQ5 V;  2ADQ B;  2QE7 G;  2ITD C;  5LP6 B;  4R7C A;  1OHH G;  2ZD9 A;  2HLD G;  4DV2 O;  1WN7 A;  3FB7 C;  1S77 D;  2H3O A;  1WNS A;  4O2B A;  2BSK A;  1H2S B;  4KHP B;  4DR6 O;  1XNR O;  4WFH A;  4NR1 A;  4NVP A;  4N21 A;  2BTQ A;  1K73 W;  4DR4 O;  1M57 B;  3Q4H B;  4X65 B;  4R8C A;  4UCS A;  3OTO B;  4LC1 A;  2Q8V A;  5EC1 C;  4JZ2 A;  4JI0 O;  2MK3 A;  4I9Q A;  3CJH B;  1AB3 A;  4JTD B;  1IBK B;  4X1K A;  5LYJ B;  1J95 A;  2WLI B;  4MVR A;  4HAM A;  1SQV H;  3CRQ A;  1XL4 A;  2Q9L A;  3HR0 A;  2G38 A;  2YEV B;  4DR7 O;  1R6T A;  1XNQ B;  4IYI A;  1JR9 A;  4H13 B;  1K33 A;  2IJH A;  3BEH A;  4ASU G;  5KHI A;  1QVF U;  1YJN V;  2PY5 A;  1VQO V;  4LFB B;  3OEH G;  1TUB A;  3ZRW B;  2GUZ A;  3K08 A;  4UVA A;  1ROP A;  3FAV B;  4JYA O;  2WLN A;  1JVM A;  1I94 B;  4WFG A;  4JI2 B;  2OTJ V;  2BOB C;  1PL0 A;  2DJV A;  5B66 Z;  4PI0 A;  2QM8 A;  4MVM A;  1KD1 W;  1N32 O;  2L35 A;  1Q7Y W;  1TA8 A;  4OXS A;  3EFF K;  3C3T A;  1UFI A;  1J5E B;  1MG1 A;  4EFB A;  4O4I A;  3TK1 A;  1OZ0 A;  2OCC C;  5IYZ B;  1HP8 A;  2XOK G;  1S0V A;  1XDC A;  1NS1 A;  3H01 A;  2ZXW B;  2UUA B;  3TCU A;  5LOV B;  4AQY O;  1WPX A;  3ZMS A;  3D3I A;  4NTY A;  2OWO A;  4O4J A;  2VQE O;  3JCZ A;  1PP9 H;  2WLH A;  1Y4M A;  5BY1 A;  1JFF A;  2E75 B;  1ZL8 A;  3BPZ A;  2NNU A;  1YJ9 V;  1Q6H A;  1M9N A;  5K1X A;  4LF4 O;  3OUS A;  2R9R B;  2E5L O;  5KAI Z;  1Q86 W;  1QCE A;  3OMN B;  5KMG A;  3KCX A;  1B04 A;  1IBM B;  1P7G A;  4JF3 A;  3IC9 A;  4DV1 B;  2RJZ A;  3JAT B;  1IXM A;  1JCH A;  2JJ1 G;  1US6 A;  3UM7 A;  1DGS A;  2CH7 B;  3U0Z A;  2JEX A;  2GSM B;  2P5O A;  5B1B B;  4NKG B;  3X2Q B;  4OPH A;  5BR8 B;  5FPO A;  3CWB H;  4DUZ O;  5JJJ B;  4TWK A;  1JJO A;  4DV0 O;  1BHB A;  2EIJ C;  4X1Y B;  5CB4 B;  3BVO A;  4G28 B;  3H1K H;  4W4L A;  1N33 B;  5LHG A;  1G6U A;  3THO A;  3AK1 A;  3ZRX A;  4Z2W A;  4J11 A;  4FLW A;  2LGQ A;  3UO3 A;  1BQZ A;  3M8A A;  2AHY A;  1Y74 B;  1M1K W;  2Q73 A;  4FLX A;  1NU1 H;  2VS0 A;  1N34 B;  1F51 A;  4JI6 B;  5KHH A;  1B3Q A;  4NTX A;  5ITZ B;  1Q82 W;  2NN4 A;  2CK3 G;  4WFE A;  5IY5 B;  4JI1 O;  4F6R A;  5B1O A;  3E8G A;  1NT2 B;  4LF9 B;  2UUB O;  4ZI7 B;  4B3T B;  2KKW A;  4Z1V A;  3OAA G;  3RYH B;  3AG2 B;  4DV6 O;  1NVP B;  2YDE A;  4NTW A;  4QGP A;  4DV2 B;  4JYB A;  4PDM A;  1YEW A;  2DYS C;  3ZMU A;  4X9Q A;  4YJ3 B;  1XIL A;  3T1Y O;  1RSO A;  4O2B B;  2BSK B;  1OCR C;  1PD3 A;  4JI4 B;  4GX2 A;  2QTS A;  4FLT A;  3SJB C;  2R72 A;  2ODM A;  3AEI A;  1VIB A;  2BTQ B;  3QTC A;  2P90 A;  1R73 A;  3FX7 A;  4JI0 B;  4ICG A;  3I55 V;  4BIU A;  3P32 A;  2IM9 A;  1KC8 W;  5C8Y A;  2CE4 A;  2WA3 A;  2YIC A;  2JRI A;  3B40 A;  3H1J H;  3CCL V;  3IAY A;  4I0X A;  4X1K B;  1R6N A;  1EFR G;  2ZE5 A;  4AI8 A;  1Y76 A;  3N2G A;  2HJD A;  4DR7 B;  4PDL A;  5KA5 A;  1H8H G;  3ZRS A;  2HP8 A;  3ABM C;  4QNH B;  3RYI A;  3EHB B;  3J81 N;  3AG4 C;  2IJK A;  3AG3 B;  5BMV A;  1HNW O;  3N27 A;  4GKK O;  1OCO B;  2QTO A;  1TUB B;  4CC6 A;  2JGU A;  2GUZ B;  3STZ C;  4BR6 A;  1RM1 B;  1ARO P;  2D3O W;  4DUY O;  4JYY A;  4WBN B;  5H5N A;  2HHH O;  1SER A;  2JVD A;  1N32 B;  1K97 A;  3P30 A;  1KU9 A;  1ORQ C;  1MZF A;  2Q7H A;  2X0L A;  4YIP A;  1KKD A;  2DWE C;  4ZOL A;  2JJ2 G;  2UXB O;  3W7T A;  3ZHT A;  2GV9 A;  2Q68 A;  4O4I B;  5IYD O;  4MT8 A;  1VQ4 V;  4Q20 A;  4AQY B;  4CH4 A;  1OV9 A;  1OCC C;  3G67 A;  3T4D A;  1R6K A;  3AG1 C;  1ZSP A;  5JCO C;  5IWA O;  3JD4 A;  3LDE A;  4JAS A;  3E35 A;  4MS2 A;  2AXT Z;  1JFF B;  4HBN A;  2ADP A;  3E89 A;  1KQS U;  4LF4 B;  2WAM A;  4FPP A;  1JOY A;  2EIN C;  3OTO O;  2W0F C;  3BA8 A;  5FLX N;  5IJ9 A;  2Y69 B;  1V54 B;  4WCE V;  4XDL A;  3RYF A;  2R9A A;  2W0X A;  3JCU Z;  5KMG B;  1I0H A;  2RNB A;  2EBO A;  1SES A;  1G4Y B;  1NR1 A;  4D7S A;  2Y4T A;  4UCR A;  1UPG A;  2GTS A;  5FPR A;  1VAR A;  2HEP A;  3G6B A;  1KEC A;  4F4L A;  2WLJ A;  3SDL A;  2YI9 A;  1GM7 A;  1N0J A;  4LFB O;  1BSM A;  1AR1 B;  3L70 H;  1V9P A;  2X6A A;  1GM9 A;  4FFB A;  4GX1 A;  3LUT B;  2H8P C;  3CS5 A;  4JI2 O;  3CCQ V;  4L8J A;  5CA0 A;  1AJN A;  4UCO A;  1Q6U A;  4DV5 B;  2HFE C;  2V1D A;  1DLB A;  3RN4 A;  3RW0 A;  5EYP A;  1FFX B;  1IZ3 A;  2WWW A;  1QHT A;  3IFX A;  3K79 A;  4IGG A;  2QM7 A;  5LHH A;  4FJC C;  3SYC A;  1GO3 F;  5H6R A;  3LDD A;  4DR5 B;  4JI5 B;  3ZX6 A;  3ZHS A;  3QNE A;  1M56 C;  1NH2 B;  2Q7E A;  4JI1 B;  4JAU A;  3JAR A;  5JQG A;  1K4D C;  2Q5Z A;  2UUB B;  1GN6 A;  1SF9 A;  2X6B A;  4LH7 A;  5IDJ A;  2UUA O;  3ETE A;  4DV6 B;  1H38 A;  5LP6 C;  2QR4 A;  1AI6 A;  3D3Q A;  1H2G A;  2GDS A;  4U7N A;  1PM9 A;  4HNA A;  2JS3 A;  5L3G A;  4MW8 A;  1H8E G;  3ZMT A;  1M57 C;  1XUQ A;  3MHS C;  1FKA O;  4JV5 O;  4FVM A;  2UXX A;  1BS3 A;  4K35 A;  4B08 A;  4B7K A;  5J9P C;  2UU9 O;  1IBM O;  4DV1 O;  3K04 A;  1GKF A;  3NR7 A;  2ZDI C;  3W7U A;  4EEQ A;  5HFM A;  3RYC B;  2VWJ A;  3ZHQ A;  1W0K G;  5C8Y B;  5IYB O;  3L73 H;  2F93 B;  5BR8 O;  1Y76 B;  1VQK V;  5EBM C;  2ARH A;  3D36 A;  5CBH A;  4X89 A;  1GTO A;  5K1P A;  1VQ6 V;  1NQT A;  3RYI B;  4TQD A;  4GKK B;  4P9O A;  1N33 O;  5BMV B;  1S3J A;  3UCS C;  4CS4 A;  4I9W A;  2BTO A;  1DK1 A;  1V55 B;  2YSU B;  1SQG A;  3R65 A;  2PF4 E;  2AZ2 A;  3GVM A;  4WFF A;  4FLY A;  2EJ7 A;  3U10 A;  3BCC H;  1HNZ O;  3B8N A;  4QE7 A;  5D5P A;  1N34 O;  5B1N A;  3H1I H;  3T4Z A;  3OR7 C;  2P06 A;  1H2M A;  3CMA V;  1PNL A;  2DQ0 A;  1W2B U;  3TXS A;  1Z5V A;  4AIL C;  1BQ0 A;  1IUR A;  4JGS A;  4LF9 O;  2C2A A;  3G71 V;  3L9D A;  2WLK A;  1WP7 A;  1YDX A;  3ZHV A;  4PI2 A;  2ZXW C;  3JD3 A;  1KKC A;  3JAK A;  3FYI B;  1MMM A;  5KHK A;  2ZNI A;  4X1I B;  1T5E A;  5DED A;  1Q8I A;  1F23 A;  3BHP A;  5IWA B;  1NKD A;  4MVZ A;  3SPC A;  5C93 A;  4JI4 O;  2QM4 A;  4EFE A;  4CS3 A;  5J2U A;  5A2Q N;  2Y0P A;  1IBL O;  1SQP H;  1PNM A;  2EZP A;  2JK5 C;  5EZY A;  3OUF A;  3G80 A;  3UT5 A;  1R1B A;  1QR9 A;  4UB6 Z;  3CCJ V;  2X7R B;  3CX5 F;  5IJ9 B;  3RYF B;  1S72 V;  2HR3 A;  4ZHQ A;  2ZIM A;  3CD6 V;  3B09 A;  4DYL A;  5B1B C;  1VF6 C;  2JDI G;  3X2Q C;  5FL7 G;  3MDS A;  4MSW C;  4UFZ A;  3H1L H;  2ZT9 B;  3HKC A;  4QE9 A;  4JAA A;  4DW1 A;  5JH7 A;  4NXN O;  4LF5 B;  1S5H C;  3QO8 A;  4OPA A;  3L74 H;  2CUG A;  4DV3 O;  2F4V B;  1K34 A;  1AR4 A;  4FFB B;  3WB2 A;  3CRA A;  3F5T A;  4B7E A;  4CS2 A;  1W59 A;  5CA0 B;  3SJQ C;  1M4U A;  3CRR A;  1Q3E A;  2A3Q A;  2E3C A;  1K3E A;  4IL6 Z;  4RQF A;  5EYP B;  4XDJ A;  3K3W A;  2VRZ A;  2UXN A;  1PPJ H;  3RFR A;  2R70 A;  4DR3 O;  2Y4U A;  4JAV A;  1F7Y A;  4MTO A;  2HVK C;  4PA4 A;  3OFN G;  4LR3 A;  5IY5 C;  3GWO A;  3JAM N;  2P22 C;  1TAE A;  2NR5 A;  1M5I A;  1QLE B;  3AG2 C;  5KA6 A;  1EN4 A;  1YCI A;  5KAF Z;  4EB6 A;  2YID A;  1NTK H;  1BMF G;  5IYC O;  1YSC A;  2LP7 A;  3CP1 A;  1XRE A;  4K0K B;  5F2V O;  5LXT B;  4UVB A;  4LFC B;  4HNA B;  5KX5 B;  4JI8 B;  5IJ0 B;  1QR8 A;  1EN6 A;  4CH3 A;  4IHJ B;  3AK3 A;  4JV5 B;  1XMQ O;  2CTP A;  2IJI A;  2UU9 B;  4C7U A;  2OCH A;  3BAB A;  4KUM A;  1QU7 A;  4FIP C;  4TV8 B;  1BT8 A;  1Y66 A;  2ZM6 O;  2DMX A;  1WAZ A;  1XMO B;  1TGO A;  3K0G A;  4O4L A;  1VP7 A;  1YJW V;  5E1A C;  3CYO A;  3HKB A;  1NI8 A;  1ZX3 A;  3CC2 V;  1N36 O;  2Z0A A;  5LMN O;  2WLM A;  4H0L B;  4BWA A;  3E22 A;  2PYL A;  4PEL A;  3F7V C;  5DEC A;  3LNN A;  2XAS A;  3AG3 C;  3CSX A;  1MSD A;  3ABL B;  3JD2 A;  3K5M A;  1GAX A;  1OCO C;  1U97 A;  2ILM A;  2KSD A;  3DC6 A;  1RM1 C;  2BOC C;  1RP3 B;  4NXM O;  3UKM A;  2P4V A;  1P4R A;  2HG5 C;  1DF5 A;  4DV5 O;  3ZMV A;  1KP3 A;  2LO1 A;  1HNZ B;  3ZN1 A;  4P30 A;  2ZE6 A;  3H1H H;  5J2T A;  5CN0 A;  5LMU B;  1XBL A;  3A2F A;  4U3F H;  4IIJ A;  4DR5 O;  4JI5 O;  1URF A;  2JS5 A;  3P3P A;  3APO A;  3OMA B;  4YJ2 A;  1WP8 A;  4HZ3 A;  3FB8 C;  3QF7 A;  5CA3 A;  1FXK B;  3ETQ A;  2LW1 A;  1I7F A;  3VQY A;  4CH6 A;  2ZIN A;  3U11 A;  2YI8 A;  3OTF A;  1NVP D;  3L71 H;  5B5E Z;  4PDR A;  3K59 A;  1KMI Z;  5KHG A;  4DRX A;  3JAK B;  4I55 A;  1YTF B;  3O9O A;  2QSA A;  4LWS A;  4ZIB A;  4ZKI A;  4B3S B;  3J80 N;  2CDY A;  1WB7 A;  1AI7 A;  4HYO A;  1VQP V;  4U3J A;  3RBZ A;  1IBL B;  2EIK B;  4J42 A;  2EIM B;  2PI4 A;  2Y69 C;  1V54 C;  1BHA A;  4QJF B;  5EZY B;  3UT5 B;  2YS8 A;  2XAF A;  2BCC H;  1IXB A;  1JA8 A;  1G1X B;  2CTQ A;  5GTI Z;  1Y67 A;  3G6E V;  1L8D A;  3A0R A;  1YIT V;  4PA3 A;  2FL4 A;  4CC5 A;  4TSF G;  1HR0 O;  3KG2 A;  2E74 B;  3CCV V;  3FD9 A;  4G2K A; 
#chains in the Genus database with same CATH homology
 1ZL8 B;  1Y76 B;  1Y74 B;  1VF6 A;  1ZL8 A;  1RSO B;  1VF6 C;  1Y74 A;  1Y76 A;  3B40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...