1ZL8B

Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
b'SDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIN-7
molecule tags Protein binding
source organism Caenorhabditis elegans
publication title A General Model for Preferential Hetero-oligomerization of LIN-2/7 Domains: Mechanism Underlying Directed Assembly of Supramolecular Signaling Complexes
pubmed doi rcsb
total genus 14
structure length 54
sequence length 54
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1zl8B00
1Y76A 1RSOB 3B40A 1Y74A 1ZL8B 1Y74B 1ZL8A 1VF6A 1VF6C 1Y76B
chains in the Genus database with same CATH superfamily
4JI7O 3EFFK 1IBLB 2P5OA 1HR0O 4UCVA 2CTPA 1Y67A 2V4DA 1NU1H 1OCCB 2GHYA 1R3IC 3ABLC 4TV8B 5LXTA 4X89A 1NR7A 1THZA 3TGUH 4RQFA 5CA0A 3NR7A 4X66O 4DV3O 4FLZA 3E22B 1L8DA 1AI7A 1Z5VA 3OTOO 1OHHG 4Q6GA 3BCCH 2QWOB 1PV0A 4PA9A 1XDCA 3RGBA 1Q81W 5LP6C 1ZWIC 2CTWA 5KX5B 2YICA 1S5JA 1ZLZA 3ZRWB 1KBHA 2ZR3A 3T1HB 3ZS8C 2EILC 3CRQA 1KQSU 3LUTB 5ITZB 1H2GA 3A2FA 3FYIB 4PDMA 4AI8A 3J81N 4LFCO 4P9PA 2JDIG 4CC5A 3F5TA 4DV0B 2YXLA 2YS8A 2XASA 5LGNA 3GWOA 2JIZG 1TUBB 2DN9A 2WSSG 4JI4B 2R9RB 2OIGA 2FMLA 2CH7B 2YIDA 3RYHB 2E76B 4DV6B 4UCUA 3L75H 4LH6A 4JAVA 2IBZH 4IL6Z 3TJTA 1NBMG 1NTMH 2UUCO 5CA3A 1Q86W 1VQKV 1YZBA 3RVYA 4BW9A 3ZEDA 5KHJA 2QWNB 4DW0A 1F4MA 1GM8A 4FLUA 4DV7O 5KMGB 3SGIA 4ZBMA 3JD2A 3WB1A 1O9GA 3K79A 1XMOB 1PD3A 3JYCA 2RJZA 3DTUB 1HNWB 1V9PA 2K1EA 2N04A 3EVKA 4GT1A 1U96A 2HLDG 2QKAA 4JYAO 4LF8B 2YI8A 1XNRO 1N34B 5FL7G 4B08A 3HKEB 4FFKA 2R9IA 5B1NA 1M4UA 4YJ3A 1WAZA 4U7NA 2DYRC 5J2TB 1PNLA 1SC5B 1NJIW 1V55B 3ETEA 4JI4O 1HNXO 3D36A 3B77A 4XBFA 3VQWA 3CYOA 4GKJB 2E5LB 4QE7A 5KHHA 3MD0A 3JALA 2CH7A 5LGTA 1N4CA 5IYCO 4PI2A 1JA8A 1YVWA 4JI0B 3ZHSA 5FNVA 5IT9N 4FJCC 5CA1B 3T1YB 5C93A 4C7UA 1XHXA 2HHHB 3AK3A 4BIOA 4ZHQB 1IDSA 3W7TA 2EIKC 1VQMV 4FPPA 2M7WA 4BIZA 2E75B 4J9YB 4GX1A 4UCOA 1Q7YW 3AG3C 4DR2O 4PA7A 2GV9A 5CB4B 4GX0A 3GVMA 4YY3B 3GB7C 3Q4HA 3JATB 3P3PA 4DYLA 3WB2A 4RUEA 5L3EA 4NR1A 2JRIA 4I9WA 1MABG 2XNDG 3T1HO 1HDJA 3C3TA 4DK0A 5CA0B 2MK3A 1OZ0A 2ZNJA 4JZ2A 2P67A 1BHBA 1L0NH 2HP8A 4R7CA 2Y48A 4TWKA 5ITZA 2RQ6A 4GCZA 4LNUB 3UT5A 4JI1O 1I0HA 3DC6A 1N8RW 1H2SB 4GKJO 4MW3A 3RT3C 2YEVB 3K5NA 5BXZA 5BMVB 3ZMZA 2F66C 4OPAA 4JI0O 1G6UA 3U0ZA 5B3SB 1M57C 1I94O 1QQCA 4O4LA 4FFBA 1NKDA 3OW2U 1SQPH 3WG7B 1SQQH 2VQFO 2HHHO 3ZX6A 1F4NA 2XAFA 3Q4HB 3CPWU 1TGOA 5B66Z 5HFLA 1Y66A 1JCHA 4ZKIA 4FLTA 3CD6V 1QR8A 4LF4B 3JARB 3JARA 4CH4A 2MW2B 3ZRWA 4BW5A 3BY6A 1YSCA 1VF6C 1AP5A 1KC8W 3UO3A 1XHZA 4FIPC 1YEWA 3MAQA 5IYZB 1N0NA 5L3FA 3CRCA 3JD1A 4QE9A 3ASNC 1VQOV 1XNRB 1N34O 3ZMTA 2HG5C 4UVAA 2UU9B 1K4CC 1Q43A 1NH2D 1CP9A 2EJRA 1VQ8V 2PY5A 1SF9A 4MVOA 5J2TA 4DXWA 3CJHB 1EBOA 3UT5B 4UVCA 5IYDO 1K5SA 2AW9A 4LC1A 2EIJB 4IHJA 1KECA 3W7XA 4O2AB 2ZE7A 1VMGA 4DV5O 2OWOA 1SQFA 5JQGB 4MTOA 3SPGA 3JSLA 1J95A 4GX2A 4CC6A 5KA5A 1QLEC 5IJ9B 1FKAO 3JALB 4UFZA 1HP8A 1WJZA 3K0GA 3N27A 1B04A 1JJ2U 4GX5A 3DXRA 2UXDO 3K58A 5B3SC 3KCXA 4DR6O 4X9QA 2RN9A 4K3AA 2EBOA 2XTAA 3HKCB 3IAYA 1SKVA 3AK2A 1D5AA 2LFSA 3QTCA 4I0XA 1BHAA 4LF7B 4JGSA 5LOVB 1HNZO 3JAWB 2EINC 5E79Z 2A0LA 3BEHA 3M8AA 1EZVH 3CP1A 2XHBA 1M9NA 3JCUZ 1SQBH 5CB4A 4IT5A 3ZIAG 3PJSK 2AHYA 5K1PA 1AROP 3IC7A 5CBHA 4DV2O 3APQA 3OMIB 4J7JA 2VWJA 1OCZC 4LWSB 5L3CA 3UO2A 1K5QA 4HBNA 4LFCB 1P84F 1Y76A 3ETQA 2P4VA 2HR3A 4Z2WA 4AQYB 4TT3G 2W6IG 2YXYA 4I4TB 4UUJC 2QWPB 5L3GA 2ZXWC 5EC1C 1Y74B 4YXWG 2YIBA 2ZE6A 2NLJC 3BRCA 3MHHC 4W4LA 3S3WA 2Q0OC 2UUBB 1X4TA 1HWYA 3QO5A 2PYLA 5IE9A 1X59A 5JQGA 3T2MA 2Q5ZA 3JD4A 1Q5OA 1I08A 2H94A 1IXBA 1SZXA 1W0KG 2IU0A 4O4IB 4DR1B 1FXKB 1OCZB 2GSMB 3SPCA 2DW4A 3FFQA 1KKDA 1F7YA 2DYSC 5L3BA 4WBNB 5EBLC 4X62O 2X0LA 2HKOA 2XAQA 2UXXA 4OGQB 5IDJA 3FB7C 2BSKB 4MVSA 3ZN0A 4Z1MG 4PDLA 3G67A 4O4JB 3DSQA 4IHJB 3ABUA 3UCSC 4TUYA 4FMTA 2ITCC 3FAVB 3J80N 2ZDIC 3L73H 2AGAA 3RBZA 1IBMB 1YJNV 4WFGA 1MZEA 1PP9H 1DGSA 3CCSV 1WA8B 4DV6O 1BCCH 4ZIBA 5LYJA 4F6EA 4L8JA 4O4HA 1KD1W 1JFFA 5LGUA 5GONB 3OUFA 5J2UB 1GTOA 3ICXA 4I4TA 3D3QA 4IGGA 4JI2O 3F7VC 1AI6A 3BPZA 1IURA 3B8NA 3B2EE 4UV8A 1FD9A 3B40A 3ASOC 4HZ3A 3LSSA 4XDKA 3HKBB 1OCRB 1HW7A 1JVMA 2DE0X 2Z5UA 3O65A 1TUEB 2AZ0A 3H1IH 5IY5B 1M90W 4X65B 3CCUV 3OFNG 4DV1B 3E2EA 1XMOO 2RCVA 4J10A 2WWWA 2BOCC 1SETA 4U3FH 4D7TA 1F51A 4MS2A 4X66B 4DV3B 1GM7A 4UB6Z 3S3XA 1IVSA 2V7QG 2YEVA 3QNEA 3AG4B 2QM8A 1GO3F 4NTYA 5FPOA 4IYIA 3E35A 1ZL8B 2XAHA 5BR8B 1AI5A 4X88A 5B1AB 3G6EV 1XMQO 4LH7A 1I5YA 4GLXA 4IIJA 1OJHA 2VRZA 3SR2C 3SYOA 2HVKC 4A5UB 2A3QA 2B1GA 4X1KB 4JTAB 3ABKC 5GONA 2O57A 4G27B 4JV5B 1YHQV 5EIBC 3CCQV 4JTDB 2HJFC 5LHGA 3JAWA 2QJ1A 4JPRA 1SQXH 4FM2A 2QWRB 5GW7A 4JI6O 1VQLV 3T4ZA 4WFBV 1QLNA 4J42A 2LGQA 4DV4B 1E1QG 1V54B 1Q90D 4NTWA 4MVMA 3E8HA 4MTFA 2PYJA 2CTQA 3P30A 1WB7A 5KUKA 3HKEA 4FK5C 3BFRA 1IBKB 2YIAA 1WNSA 3A8TA 3ASNB 1HNWO 3R66A 4DR7O 1AJNA 5KUMA 2KG7A 4ZOLB 4PJ0Z 5LOVA 4LF9O 3G71V 4OXSA 2ETNA 2QR4A 5HFMA 1GKFA 3HPLC 2ZCEA 4B7KA 5CN0A 1S3JA 4NXMO 4K0KO 4XDLA 4JASA 4UXNA 3W7SA 1N32O 2BCCH 3PN1A 1CXZB 1YDXA 2LQTA 3CE2A 4JAUA 3O9OA 4DR5B 4JI1B 2UUAB 4DUZB 4X64B 1B6QA 2B5UA 4RUFA 2XUMA 1QCEA 4LFBO 2G38A 2ODMA 1AI4A 3NXSA 2DOSA 4WF9V 1I94B 3CCVV 2ZM6B 5EBMC 4U3JB 4FLVA 2HJDA 2CGOA 3UM7A 4CH5A 4WFAV 3ZCCA 1BMFG 5EZYA 4F4LA 1AJQA 1ZAUA 1R3LC 5H6RA 3WB0A 5EZYB 5A2QN 3OTFA 2Y0IA 4UCSA 3JSNA 3ZHQA 4LFAO 3JAMN 2EINB 2H3OA 2CAZC 1EN6A 1TA8A 3CRMA 1V54C 1PNMA 2ZE5A 2JVDA 5J9PC 3BVOA 3QVNA 4Z1VA 3ETDA 2VS0A 1FXKC 4K0KB 2CGNA 1VEWA 5IWAO 4X20B 4WFFA 3ZBHA 1GN3A 4LR3A 4YJ3B 4UCTA 1N0JA 1R3JC 1NTKH 4MVQA 1N33B 2R72A 5H2FZ 4B3TO 1IZ3A 2ILMA 3QO7A 1AR5A 3RFRA 2UXBB 3SPHA 4XDJA 2L6LA 1P4RA 1J5EO 4FFBB 1W59A 4EKWA 3RYFA 5BMVA 1Y74A 5LXTB 1AJPA 4G2KA 2X6CA 4FZ0A 2Y69B 4O2AA 3G6BA 1WN7A 3JCZA 5DECA 3T1CA 2NNUA 2N05A 2WLIB 5CMUA 1DK1A 2FL4A 3ZHTA 2WLLA 5B1OA 2PF4E 3D36C 3CCRV 2WA4A 2JS5A 4ZHQA 1OCOB 4DR6B 1L1FA 2FKXA 3OGCC 3EXAA 3UKMA 3CSXA 4J9ZB 2AZ2A 1YIJV 2P06A 5EYPA 3OEEG 5JVDB 2GBOA 3B4SA 5DEDA 2Q0AA 1P7BA 1P49A 2QEXV 2XT9A 2PI4A 3CWBH 3WU2Z 5JCOC 4OX9B 3CC2V 1ZL8A 2ZKOA 1IX9A 2QKCA 1FXVA 3MDSA 1OCOC 2F1MA 4KXRA 3RYHA 3RYFB 2EIKB 4TV9B 1K92A 2YIBD 1S76D 3AG1C 1XNQO 4H37A 4JI2B 4DK1A 1RP3B 3AEIA 4BWAA 3HKCA 2P7TC 4CS2A 4DR1O 3CHXA 3ZMUA 1SQVH 4O4IA 3ABMC 1TVKA 1DTOA 4X1IA 4LF6B 3RN4A 1BSMA 1QU7A 2UUCB 1K8AW 2M6YA 2ITDC 4TQFA 3AG1B 3LDCA 1Z2GA 2QSAA 5F2VO 1H8EG 3CCEV 1LUVA 2Y69C 3OAAG 4QPJA 1BQ0A 4MTGA 2QGNA 4HNAA 3SYCA 4JYYA 4TSFG 1RM1C 3CXHF 3OGIB 3H1JH 4YHHB 1H2NA 4X62B 5JJEB 3CCLV 2UXNA 1OCCC 1VQ7V 3E86A 1PKXA 2LW7A 4YJ2A 1AILA 2EZPA 2FB5A 5A9GA 1FPOA 2EJ7A 2VQEB 3OD4A 3FB8C 4NKGB 3FAVA 2ZE8A 1J5EB 2W0XA 3L70H 2PTMA 5B5EZ 3FD9A 4PDVA 2IJHA 1VARA 4DR3B 1SQGA 1UPGA 3B8MA 1BT8A 1G8MA 2ZT9B 4FM1A 1EFRG 4YIOA 1R6TA 4B3MO 4D6TH 1KU9A 4ABMA 1XREA 2ZXWB 1HNXB 4PELA 2OT5A 4N23A 1ROPA 3M99B 4MVZA 4WBNA 4I5SA 3K0DA 4B3SO 4EFBA 2EILB 1K97A 1Z5WA 1FAFA 3FYEB 1N36O 1PPJH 3OMNB 1ZX3A 5GTIZ 2F93B 3CC7V 3OM3B 1NVPB 4F6RA 4OPHA 1YXBA 1B3QA 1XBLA 5LP6B 3D8CA 3K9AA 1M5IA 1AVMA 2F4VO 2P22C 2L35A 4JI5B 3U11A 4WFHA 5LL6Y 3ASOB 3K3WA 4HAMA 2A79B 5LMNB 3FB5C 1SESA 2JEXA 5KHGA 4YY3O 3ZRSA 1JR9A 1WPXA 1NI8A 2W0FC 3K06A 3F7YC 3SYAA 4MVUA 3CCMV 2RDCA 3SJBC 3K5OA 1Q8IA 1S0VA 1M57B 2WLNA 2Q7HA 5BZBA 3KG2A 1I5XA 3HB3B 3TETA 1BQZA 4PV1B 1IBMO 2BTQB 1MSWD 4JV5O 5LHHA 1YJWV 1VF6A 2Q7GA 1GK9A 4QPKA 1GN6A 1FJGO 2EIMC 2F43G 4RO2A 3STZC 5EYPB 2XAGA 1MSDA 3N2KB 1M56C 5CBFA 3C3SA 1KB9F 3W7UA 4LF5O 2Q9LA 4GUNA 1K3EA 3ABTA 2R9AA 4EB6B 3CXCU 2Q4PA 3ZMVA 1O9HA 2AXTZ 1CPYA 2NR5A 3CJHA 2WLIA 3VQVA 2Q68A 1MA1A 4DR7B 3HKDB 3CCJV 1YTFB 4LF9B 1XQ8A 4O2BB 1NVPD 2XOKG 2D3OW 1AR4A 1YITV 1ZTEA 3P3NA 3K5MA 4I50A 2VQEO 2DJVA 5FPRA 4CZZA 3CB2A 2OCCC 4FZ1A 1Q6UA 2OYQA 3D3IA 1QR9A 2YI9A 3WG7C 2KQXA 3TXQA 2IW5A 3AG4C 4ASUG 4DRXB 1MG1A 2R70A 4JZGA 3RWRD 2Y0PA 1GMGA 1AP6A 4I9QA 2E3CA 3L74H 4Q20A 1R1BA 1D2DA 3IC9A 3K03A 4B3SB 1GH6A 4U3JA 4LCUC 4P30A 1E1RG 3T1YO 3ML0A 1MNGA 2QTSA 4DV5B 1VIBA 2JGDA 1VF7A 4LF5B 1NZ6A 1URFA 2QTOA 1OCRC 4JI8O 1KP3A 4B7EA 2WLMA 4LFBB 1JX9A 1ENVA 3OR7C 5KAIZ 3CMEV 2A9HA 2EIJC 3TXSA 4W4KA 2HFEC 3U10A 2OTLV 3FB6C 2VWKA 4F6RB 3JAKA 4KFMA 5LMNO 2X6AA 2WA3A 1SS3A 2Q6AA 5D5QA 2LGWA 2QM4A 5FLXN 1K73W 1T5EA 3GWKC 3LSUA 3FKSG 2IJJA 3CEIA 1VQ6V 3APOA 3OE7G 2IH1C 4J41A 4O2BA 3BHPA 4D7SA 4GKKB 3N2GA 3CC4V 4BR6A 2EULA 5BY1A 2GTSA 4DO2A 4UV9A 3CRAA 1QHTA 2OCHA 1VQ9V 2GTAA 5H9CA 4ZI7B 2CK3G 2YC0A 1VQNV 1DLBA 1XEQA 1N32B 3L71H 5H5NA 2RMKB 4PA4A 4NVPA 5H6QA 3BAAA 4UVBA 4PI0A 3DXRB 4DR4O 2BSKA 4H13B 4EEQA 3N2KA 3G4SV 1XUQA 3KKYA 4L87A 3E22A 4X64O 1XNQB 4ZOLA 4KHPO 3I5DA 1PNKA 4B3RB 4JYCA 1XL6A 4TV8A 3IGAC 1Q6IA 4J7KA 2ZD9A 3AK1A 1HR0B 4WFEA 1DF5A 4LNUA 1UFIA 1TVKB 4X1IB 1US6A 2DMXA 3K9SA 2LO1A 3ABLB 1QVGU 1JQ0A 2ZIOA 3ZMSA 5EK0A 2LFRA 3L9DA 1SERA 1FFXA 2QE7G 5LMUB 1M1KW 1R3KC 1NR1A 1KKCA 4JAAA 3ETGA 4R6ZA 3VOUA 4GKKO 5LA6B 3OMAB 4MVRA 3OTOB 1K33A 1L0LH 2EX3A 2Q8VA 2GUZA 3RVZA 2JS3A 2CDYA 3OT7A 4X65O 2QKSA 2BOBC 1ZUQA 1NQTA 5B1AC 1XL4A 4TOIA 4NYKA 1YTFD 3DC5A 4R50A 4JF3A 4LWSA 4N21A 4ZI7A 4DUYB 1M93A 1VF5B 1UJWB 2OCCB 1SA0A 1CEZA 4K8XA 2DQ3A 3G80A 5CA1A 2DQ0A 5JJJB 1NTZH 1RPRA 5C8YB 5LA6A 2JGDB 2YDEA 2JJ2G 4UCRA 1PL0A 3SPJA 2QWQB 2Q69A 1JOYA 3ZN1A 4KL1A 1FFTB 3JD0A 1FXKA 2P4KA 3X2QC 5K1XA 3K08A 4IYHA 2CE4A 5LMUO 2HEPA 3MHSC 1QBZA 2Q7EA 3AG7A 4RAIA 3AG2C 4LF7O 4X20A 2UU9O 3RYIA 1F23A 1RM1B 1VP7A 3A0RA 2C2AA 3HR0A 2DWDC 4X1YA 4LP8A 5IYBO 4GYCB 4CS3A 4DV1O 1VQ4V 2Q67A 2KG7B 1S5LZ 4DV2B 2RNBA 5AG2A 3H1HH 3T4DA 4FLXA 2ZNIA 4DUYO 4WCEV 5CBGA 2X6BA 4KUMA 3ABKB 2JK5C 3WFVA 1SRYA 1NT2B 1JJOA 2WPDG 2ZR2A 4TUYB 3H01A 5JH7B 4P2ZA 5KX5A 1S72V 4E4EA 4O4JA 5BR8O 2EIMB 3L72H 4BIUA 1GAXA 1JFFB 1XMQB 2CUGA 2KKWA 4I50B 3I55V 5E1AC 3ZHUA 5LYJB 4TV9A 1YCIA 3VBBA 5IY5C 3E8GA 2ARHA 4P9OA 1LUWA 4PA3A 2UUAO 4MTXA 2PI5A 4DUZO 4H44B 1ZSPA 1B06A 2X7RB 3ZHVA 1GM9A 1XOUA 4JI5O 2WLLB 2LP7A 4QJFB 5JCOA 3OEHG 3ZJZA 4DR2B 1HNZB 3TCUA 4UB8Z 4EFEA 1JPXA 4YJ2B 3W7WA 4DV4O 1VQPV 4FLYA 3QG5A 1IXMA 2H8PC 4DV7B 2V1DA 2WLHA 4HYOA 2PUSA 4I7ZB 2PGGA 2F4VB 3H1KH 5FNVB 2GDSA 5JVDA 1BL8A 3UQ8A 1H8HG 1G4YB 4LF8O 1DF4A 4CS4A 3JATA 2IU3A 3TK1A 1K9MW 2Z0AA 3JASB 2BTQA 3RW0A 3IJ4A 3ZRVA 1AB3A 1PL4A 4DRXA 2B9ZA 3FX7A 1V55C 2IH3C 1WB8A 5JWPA 2OTJV 4PDRA 1KYOF 2UXCO 2E74B 1VQ5V 2OIEA 5IJ0A 3RYCA 4DR3O 2KB1A 1K7DA 4DV0O 4NXNO 1ORQC 3SPIA 4J80A 4DR5O 1KP2A 4B3MB 4MT8A 4DW1A 4X1KA 1MZFA 1U97A 4TQDA 1QNMA 5DM6V 5IYZA 4BAYA 5TISZ 2W6JG 1SA0B 1BGYH 2YXHA 3SYQA 1KUQA 3STLC 3HKBA 1H2MA 4G28B 4I55B 5LBQA 4FVMA 2Q73A 3M7MX 3BA8A 4RQEA 3C90A 1P7GA 3N2GB 4CH3A 2IM9A 5KAFZ 1LNQA 1BS3A 2IJIA 3LNMB 2BE3A 5IJ9A 4LFAB 1TUBA 3AG2B 5KLVH 2DWEC 2JEUA 3RYCB 1EM1A 1BE3H 4JYBA 3VQYA 5EC2C 2Z3YA 4H33A 2DYRB 1RFYA 2XAJA 2DYSB 3KZIZ 5DN6G 4K8ZA 1Q3EA 2FYUH 4KP4A 5EIBD 4H0LB 2BTOA 4QGPA 3OR6C 2YUAA 2YSUB 5IWAB 3E8BA 5LP6A 4LBEC 3DGEA 1W2BU 1Y4MA 1GN2A 2PZSA 1RSOA 1SZTA 4OX9O 1H2LA 1KMIZ 4MW8A 1WP8A 4CBCA 1Q82W 1JMKC 1R6KA 4U7OA 4O4HB 2LW1A 4B3RO 2E5LO 2P6JA 4X1YB 5C8YA 1I7FA 2UXBO 1WA8A 3E89A 1LR1A 2IJKA 3AG3B 3IFXA 3R65A 2JJ1G 2VQFB 2QA4V 4JI8B 1QLEB 1RSOB 3P32A 5KMGA 2F95B 4QNHB 3SJCC 1IBKO 4E2LA 2B1IA 4J7ZA 1G1XB 1S77D 4QIWF 4EB6A 1COWG 2ZDIA 2NN4A 4LF4O 5L3DA 2WLKA 1IBLO 4K35A 3A0HZ 5EBWC 2A06H 3VQXA 3SJQC 2ADPA 3KCYA 2AHZA 4PA6A 5KHKA 1WP7A 1WLEA 3A0BZ 4NB5A 5JH7A 4FLWA 3QF7A 2UXCB 2HVJC 4X8AA 5D5PA 3H9VA 1MOFA 2KSDA 2WLJA 3EHBB 4PD4F 2WAMA 4NXNB 3I56V 1R6NA 4AILC 1WPBA 4AQYO 2ZINA 4NTXA 3K04A 4CH6A 5B1BC 2EZOA 2LJ2A 1E79G 3CRRA 1Q6HA 5GTHZ 1BZKA 1NS1A 2ZM6O 4JI6B 4DR4B 1GRJA 3CX5F 3THOA 4FM0A 3JD3A 3H1LH 4J11A 1NH2B 2QDOA 1EN4A 2ADQB 3RYIB 3K59A 4ICGA 4JTCB 4KHPB 4MSWC 2ATKC 3OUSA 1K4DC 4R8CA 3HKDA 1PM9A 5JJNB 1Y76B 4JI3B 3E83A 2QM7A 3B09A 3BABA 3K57A 1H38A 4I55A 1H2KA 2ZQMA 1R73A 1OV9A 3SJAC 3J7AU 2UXDB 1GN4A 3ZHRA 4JI7B 1FYJA 2JGUA 3ZRXA 1N36B 3K5LA 4LF6O 1W0JG 2D2CB 3JASA 1YI2V 3BA9A 1EN5A 3X2QB 3QO8A 1EZJA 1MMMA 2GUZB 1FS0G 1TAEA 3LSQA 5B1BB 4RWUA 3LDEA 4NXMB 2A7WA 1QVFU 4I0XB 3CS5A 4PHZA 1D5NA 1XILA 3ABMB 1FFXB 1K34A 4GZRB 4IIJB 3LDDA 2P90A 4YHHO 1N33O 1Y6XA 3F5WC 1RPOA 4B3TB 3JAKB 4JYAB 3LNNA 1AR1B 4YIPA 1A32A 1M56B 2CTRA 2F23A 3SDLA 4AHCA 1S5HC 5J2UA 2UUBO 5KHIA 2Y4TA 1YJ9V 2FTKA 1YF2A 2N74A 2K9PA 4HNAB 4O4LB 2ZIMA 4JI3O 5KA6A 5IJ0B 3SYPA 3E8FA 3CMAV 2Y4UA 1XI1A 1FJGB 5LHIA 1FXHA
chains in the Genus database with same CATH topology
1Y76A 1RSOB 3B40A 1Y74A 1ZL8B 1Y74B 1ZL8A 1VF6A 1VF6C 1Y76B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y76 A;  1RSO B;  3B40 A;  1Y74 A;  1ZL8 B;  1Y74 B;  1ZL8 A;  1VF6 A;  1VF6 C;  1Y76 B; 
#chains in the Genus database with same CATH topology
 4JI7 O;  3EFF K;  1IBL B;  2P5O A;  1HR0 O;  4UCV A;  2CTP A;  1Y67 A;  2V4D A;  1NU1 H;  1OCC B;  2GHY A;  1R3I C;  3ABL C;  4TV8 B;  5LXT A;  4X89 A;  1NR7 A;  1THZ A;  3TGU H;  4RQF A;  5CA0 A;  3NR7 A;  4X66 O;  4DV3 O;  4FLZ A;  3E22 B;  1L8D A;  1AI7 A;  1Z5V A;  3OTO O;  1OHH G;  4Q6G A;  3BCC H;  2QWO B;  1PV0 A;  4PA9 A;  1XDC A;  3RGB A;  1Q81 W;  5LP6 C;  1ZWI C;  2CTW A;  5KX5 B;  2YIC A;  1S5J A;  1ZLZ A;  3ZRW B;  1KBH A;  2ZR3 A;  3T1H B;  3ZS8 C;  2EIL C;  3CRQ A;  1KQS U;  3LUT B;  5ITZ B;  1H2G A;  3A2F A;  3FYI B;  4PDM A;  4AI8 A;  3J81 N;  4LFC O;  4P9P A;  2JDI G;  4CC5 A;  3F5T A;  4DV0 B;  2YXL A;  2YS8 A;  2XAS A;  5LGN A;  3GWO A;  2JIZ G;  1TUB B;  2DN9 A;  2WSS G;  4JI4 B;  2R9R B;  2OIG A;  2FML A;  2CH7 B;  2YID A;  3RYH B;  2E76 B;  4DV6 B;  4UCU A;  3L75 H;  4LH6 A;  4JAV A;  2IBZ H;  4IL6 Z;  3TJT A;  1NBM G;  1NTM H;  2UUC O;  5CA3 A;  1Q86 W;  1VQK V;  1YZB A;  3RVY A;  4BW9 A;  3ZED A;  5KHJ A;  2QWN B;  4DW0 A;  1F4M A;  1GM8 A;  4FLU A;  4DV7 O;  5KMG B;  3SGI A;  4ZBM A;  3JD2 A;  3WB1 A;  1O9G A;  3K79 A;  1XMO B;  1PD3 A;  3JYC A;  2RJZ A;  3DTU B;  1HNW B;  1V9P A;  2K1E A;  2N04 A;  3EVK A;  4GT1 A;  1U96 A;  2HLD G;  2QKA A;  4JYA O;  4LF8 B;  2YI8 A;  1XNR O;  1N34 B;  5FL7 G;  4B08 A;  3HKE B;  4FFK A;  2R9I A;  5B1N A;  1M4U A;  4YJ3 A;  1WAZ A;  4U7N A;  2DYR C;  5J2T B;  1PNL A;  1SC5 B;  1NJI W;  1V55 B;  3ETE A;  4JI4 O;  1HNX O;  3D36 A;  3B77 A;  4XBF A;  3VQW A;  3CYO A;  4GKJ B;  2E5L B;  4QE7 A;  5KHH A;  3MD0 A;  3JAL A;  2CH7 A;  5LGT A;  1N4C A;  5IYC O;  4PI2 A;  1JA8 A;  1YVW A;  4JI0 B;  3ZHS A;  5FNV A;  5IT9 N;  4FJC C;  5CA1 B;  3T1Y B;  5C93 A;  4C7U A;  1XHX A;  2HHH B;  3AK3 A;  4BIO A;  4ZHQ B;  1IDS A;  3W7T A;  2EIK C;  1VQM V;  4FPP A;  2M7W A;  4BIZ A;  2E75 B;  4J9Y B;  4GX1 A;  4UCO A;  1Q7Y W;  3AG3 C;  4DR2 O;  4PA7 A;  2GV9 A;  5CB4 B;  4GX0 A;  3GVM A;  4YY3 B;  3GB7 C;  3Q4H A;  3JAT B;  3P3P A;  4DYL A;  3WB2 A;  4RUE A;  5L3E A;  4NR1 A;  2JRI A;  4I9W A;  1MAB G;  2XND G;  3T1H O;  1HDJ A;  3C3T A;  4DK0 A;  5CA0 B;  2MK3 A;  1OZ0 A;  2ZNJ A;  4JZ2 A;  2P67 A;  1BHB A;  1L0N H;  2HP8 A;  4R7C A;  2Y48 A;  4TWK A;  5ITZ A;  2RQ6 A;  4GCZ A;  4LNU B;  3UT5 A;  4JI1 O;  1I0H A;  3DC6 A;  1N8R W;  1H2S B;  4GKJ O;  4MW3 A;  3RT3 C;  2YEV B;  3K5N A;  5BXZ A;  5BMV B;  3ZMZ A;  2F66 C;  4OPA A;  4JI0 O;  1G6U A;  3U0Z A;  5B3S B;  1M57 C;  1I94 O;  1QQC A;  4O4L A;  4FFB A;  1NKD A;  3OW2 U;  1SQP H;  3WG7 B;  1SQQ H;  2VQF O;  2HHH O;  3ZX6 A;  1F4N A;  2XAF A;  3Q4H B;  3CPW U;  1TGO A;  5B66 Z;  5HFL A;  1Y66 A;  1JCH A;  4ZKI A;  4FLT A;  3CD6 V;  1QR8 A;  4LF4 B;  3JAR B;  3JAR A;  4CH4 A;  2MW2 B;  3ZRW A;  4BW5 A;  3BY6 A;  1YSC A;  1VF6 C;  1AP5 A;  1KC8 W;  3UO3 A;  1XHZ A;  4FIP C;  1YEW A;  3MAQ A;  5IYZ B;  1N0N A;  5L3F A;  3CRC A;  3JD1 A;  4QE9 A;  3ASN C;  1VQO V;  1XNR B;  1N34 O;  3ZMT A;  2HG5 C;  4UVA A;  2UU9 B;  1K4C C;  1Q43 A;  1NH2 D;  1CP9 A;  2EJR A;  1VQ8 V;  2PY5 A;  1SF9 A;  4MVO A;  5J2T A;  4DXW A;  3CJH B;  1EBO A;  3UT5 B;  4UVC A;  5IYD O;  1K5S A;  2AW9 A;  4LC1 A;  2EIJ B;  4IHJ A;  1KEC A;  3W7X A;  4O2A B;  2ZE7 A;  1VMG A;  4DV5 O;  2OWO A;  1SQF A;  5JQG B;  4MTO A;  3SPG A;  3JSL A;  1J95 A;  4GX2 A;  4CC6 A;  5KA5 A;  1QLE C;  5IJ9 B;  1FKA O;  3JAL B;  4UFZ A;  1HP8 A;  1WJZ A;  3K0G A;  3N27 A;  1B04 A;  1JJ2 U;  4GX5 A;  3DXR A;  2UXD O;  3K58 A;  5B3S C;  3KCX A;  4DR6 O;  4X9Q A;  2RN9 A;  4K3A A;  2EBO A;  2XTA A;  3HKC B;  3IAY A;  1SKV A;  3AK2 A;  1D5A A;  2LFS A;  3QTC A;  4I0X A;  1BHA A;  4LF7 B;  4JGS A;  5LOV B;  1HNZ O;  3JAW B;  2EIN C;  5E79 Z;  2A0L A;  3BEH A;  3M8A A;  1EZV H;  3CP1 A;  2XHB A;  1M9N A;  3JCU Z;  1SQB H;  5CB4 A;  4IT5 A;  3ZIA G;  3PJS K;  2AHY A;  5K1P A;  1ARO P;  3IC7 A;  5CBH A;  4DV2 O;  3APQ A;  3OMI B;  4J7J A;  2VWJ A;  1OCZ C;  4LWS B;  5L3C A;  3UO2 A;  1K5Q A;  4HBN A;  4LFC B;  1P84 F;  1Y76 A;  3ETQ A;  2P4V A;  2HR3 A;  4Z2W A;  4AQY B;  4TT3 G;  2W6I G;  2YXY A;  4I4T B;  4UUJ C;  2QWP B;  5L3G A;  2ZXW C;  5EC1 C;  1Y74 B;  4YXW G;  2YIB A;  2ZE6 A;  2NLJ C;  3BRC A;  3MHH C;  4W4L A;  3S3W A;  2Q0O C;  2UUB B;  1X4T A;  1HWY A;  3QO5 A;  2PYL A;  5IE9 A;  1X59 A;  5JQG A;  3T2M A;  2Q5Z A;  3JD4 A;  1Q5O A;  1I08 A;  2H94 A;  1IXB A;  1SZX A;  1W0K G;  2IU0 A;  4O4I B;  4DR1 B;  1FXK B;  1OCZ B;  2GSM B;  3SPC A;  2DW4 A;  3FFQ A;  1KKD A;  1F7Y A;  2DYS C;  5L3B A;  4WBN B;  5EBL C;  4X62 O;  2X0L A;  2HKO A;  2XAQ A;  2UXX A;  4OGQ B;  5IDJ A;  3FB7 C;  2BSK B;  4MVS A;  3ZN0 A;  4Z1M G;  4PDL A;  3G67 A;  4O4J B;  3DSQ A;  4IHJ B;  3ABU A;  3UCS C;  4TUY A;  4FMT A;  2ITC C;  3FAV B;  3J80 N;  2ZDI C;  3L73 H;  2AGA A;  3RBZ A;  1IBM B;  1YJN V;  4WFG A;  1MZE A;  1PP9 H;  1DGS A;  3CCS V;  1WA8 B;  4DV6 O;  1BCC H;  4ZIB A;  5LYJ A;  4F6E A;  4L8J A;  4O4H A;  1KD1 W;  1JFF A;  5LGU A;  5GON B;  3OUF A;  5J2U B;  1GTO A;  3ICX A;  4I4T A;  3D3Q A;  4IGG A;  4JI2 O;  3F7V C;  1AI6 A;  3BPZ A;  1IUR A;  3B8N A;  3B2E E;  4UV8 A;  1FD9 A;  3B40 A;  3ASO C;  4HZ3 A;  3LSS A;  4XDK A;  3HKB B;  1OCR B;  1HW7 A;  1JVM A;  2DE0 X;  2Z5U A;  3O65 A;  1TUE B;  2AZ0 A;  3H1I H;  5IY5 B;  1M90 W;  4X65 B;  3CCU V;  3OFN G;  4DV1 B;  3E2E A;  1XMO O;  2RCV A;  4J10 A;  2WWW A;  2BOC C;  1SET A;  4U3F H;  4D7T A;  1F51 A;  4MS2 A;  4X66 B;  4DV3 B;  1GM7 A;  4UB6 Z;  3S3X A;  1IVS A;  2V7Q G;  2YEV A;  3QNE A;  3AG4 B;  2QM8 A;  1GO3 F;  4NTY A;  5FPO A;  4IYI A;  3E35 A;  1ZL8 B;  2XAH A;  5BR8 B;  1AI5 A;  4X88 A;  5B1A B;  3G6E V;  1XMQ O;  4LH7 A;  1I5Y A;  4GLX A;  4IIJ A;  1OJH A;  2VRZ A;  3SR2 C;  3SYO A;  2HVK C;  4A5U B;  2A3Q A;  2B1G A;  4X1K B;  4JTA B;  3ABK C;  5GON A;  2O57 A;  4G27 B;  4JV5 B;  1YHQ V;  5EIB C;  3CCQ V;  4JTD B;  2HJF C;  5LHG A;  3JAW A;  2QJ1 A;  4JPR A;  1SQX H;  4FM2 A;  2QWR B;  5GW7 A;  4JI6 O;  1VQL V;  3T4Z A;  4WFB V;  1QLN A;  4J42 A;  2LGQ A;  4DV4 B;  1E1Q G;  1V54 B;  1Q90 D;  4NTW A;  4MVM A;  3E8H A;  4MTF A;  2PYJ A;  2CTQ A;  3P30 A;  1WB7 A;  5KUK A;  3HKE A;  4FK5 C;  3BFR A;  1IBK B;  2YIA A;  1WNS A;  3A8T A;  3ASN B;  1HNW O;  3R66 A;  4DR7 O;  1AJN A;  5KUM A;  2KG7 A;  4ZOL B;  4PJ0 Z;  5LOV A;  4LF9 O;  3G71 V;  4OXS A;  2ETN A;  2QR4 A;  5HFM A;  1GKF A;  3HPL C;  2ZCE A;  4B7K A;  5CN0 A;  1S3J A;  4NXM O;  4K0K O;  4XDL A;  4JAS A;  4UXN A;  3W7S A;  1N32 O;  2BCC H;  3PN1 A;  1CXZ B;  1YDX A;  2LQT A;  3CE2 A;  4JAU A;  3O9O A;  4DR5 B;  4JI1 B;  2UUA B;  4DUZ B;  4X64 B;  1B6Q A;  2B5U A;  4RUF A;  2XUM A;  1QCE A;  4LFB O;  2G38 A;  2ODM A;  1AI4 A;  3NXS A;  2DOS A;  4WF9 V;  1I94 B;  3CCV V;  2ZM6 B;  5EBM C;  4U3J B;  4FLV A;  2HJD A;  2CGO A;  3UM7 A;  4CH5 A;  4WFA V;  3ZCC A;  1BMF G;  5EZY A;  4F4L A;  1AJQ A;  1ZAU A;  1R3L C;  5H6R A;  3WB0 A;  5EZY B;  5A2Q N;  3OTF A;  2Y0I A;  4UCS A;  3JSN A;  3ZHQ A;  4LFA O;  3JAM N;  2EIN B;  2H3O A;  2CAZ C;  1EN6 A;  1TA8 A;  3CRM A;  1V54 C;  1PNM A;  2ZE5 A;  2JVD A;  5J9P C;  3BVO A;  3QVN A;  4Z1V A;  3ETD A;  2VS0 A;  1FXK C;  4K0K B;  2CGN A;  1VEW A;  5IWA O;  4X20 B;  4WFF A;  3ZBH A;  1GN3 A;  4LR3 A;  4YJ3 B;  4UCT A;  1N0J A;  1R3J C;  1NTK H;  4MVQ A;  1N33 B;  2R72 A;  5H2F Z;  4B3T O;  1IZ3 A;  2ILM A;  3QO7 A;  1AR5 A;  3RFR A;  2UXB B;  3SPH A;  4XDJ A;  2L6L A;  1P4R A;  1J5E O;  4FFB B;  1W59 A;  4EKW A;  3RYF A;  5BMV A;  1Y74 A;  5LXT B;  1AJP A;  4G2K A;  2X6C A;  4FZ0 A;  2Y69 B;  4O2A A;  3G6B A;  1WN7 A;  3JCZ A;  5DEC A;  3T1C A;  2NNU A;  2N05 A;  2WLI B;  5CMU A;  1DK1 A;  2FL4 A;  3ZHT A;  2WLL A;  5B1O A;  2PF4 E;  3D36 C;  3CCR V;  2WA4 A;  2JS5 A;  4ZHQ A;  1OCO B;  4DR6 B;  1L1F A;  2FKX A;  3OGC C;  3EXA A;  3UKM A;  3CSX A;  4J9Z B;  2AZ2 A;  1YIJ V;  2P06 A;  5EYP A;  3OEE G;  5JVD B;  2GBO A;  3B4S A;  5DED A;  2Q0A A;  1P7B A;  1P49 A;  2QEX V;  2XT9 A;  2PI4 A;  3CWB H;  3WU2 Z;  5JCO C;  4OX9 B;  3CC2 V;  1ZL8 A;  2ZKO A;  1IX9 A;  2QKC A;  1FXV A;  3MDS A;  1OCO C;  2F1M A;  4KXR A;  3RYH A;  3RYF B;  2EIK B;  4TV9 B;  1K92 A;  2YIB D;  1S76 D;  3AG1 C;  1XNQ O;  4H37 A;  4JI2 B;  4DK1 A;  1RP3 B;  3AEI A;  4BWA A;  3HKC A;  2P7T C;  4CS2 A;  4DR1 O;  3CHX A;  3ZMU A;  1SQV H;  4O4I A;  3ABM C;  1TVK A;  1DTO A;  4X1I A;  4LF6 B;  3RN4 A;  1BSM A;  1QU7 A;  2UUC B;  1K8A W;  2M6Y A;  2ITD C;  4TQF A;  3AG1 B;  3LDC A;  1Z2G A;  2QSA A;  5F2V O;  1H8E G;  3CCE V;  1LUV A;  2Y69 C;  3OAA G;  4QPJ A;  1BQ0 A;  4MTG A;  2QGN A;  4HNA A;  3SYC A;  4JYY A;  4TSF G;  1RM1 C;  3CXH F;  3OGI B;  3H1J H;  4YHH B;  1H2N A;  4X62 B;  5JJE B;  3CCL V;  2UXN A;  1OCC C;  1VQ7 V;  3E86 A;  1PKX A;  2LW7 A;  4YJ2 A;  1AIL A;  2EZP A;  2FB5 A;  5A9G A;  1FPO A;  2EJ7 A;  2VQE B;  3OD4 A;  3FB8 C;  4NKG B;  3FAV A;  2ZE8 A;  1J5E B;  2W0X A;  3L70 H;  2PTM A;  5B5E Z;  3FD9 A;  4PDV A;  2IJH A;  1VAR A;  4DR3 B;  1SQG A;  1UPG A;  3B8M A;  1BT8 A;  1G8M A;  2ZT9 B;  4FM1 A;  1EFR G;  4YIO A;  1R6T A;  4B3M O;  4D6T H;  1KU9 A;  4ABM A;  1XRE A;  2ZXW B;  1HNX B;  4PEL A;  2OT5 A;  4N23 A;  1ROP A;  3M99 B;  4MVZ A;  4WBN A;  4I5S A;  3K0D A;  4B3S O;  4EFB A;  2EIL B;  1K97 A;  1Z5W A;  1FAF A;  3FYE B;  1N36 O;  1PPJ H;  3OMN B;  1ZX3 A;  5GTI Z;  2F93 B;  3CC7 V;  3OM3 B;  1NVP B;  4F6R A;  4OPH A;  1YXB A;  1B3Q A;  1XBL A;  5LP6 B;  3D8C A;  3K9A A;  1M5I A;  1AVM A;  2F4V O;  2P22 C;  2L35 A;  4JI5 B;  3U11 A;  4WFH A;  5LL6 Y;  3ASO B;  3K3W A;  4HAM A;  2A79 B;  5LMN B;  3FB5 C;  1SES A;  2JEX A;  5KHG A;  4YY3 O;  3ZRS A;  1JR9 A;  1WPX A;  1NI8 A;  2W0F C;  3K06 A;  3F7Y C;  3SYA A;  4MVU A;  3CCM V;  2RDC A;  3SJB C;  3K5O A;  1Q8I A;  1S0V A;  1M57 B;  2WLN A;  2Q7H A;  5BZB A;  3KG2 A;  1I5X A;  3HB3 B;  3TET A;  1BQZ A;  4PV1 B;  1IBM O;  2BTQ B;  1MSW D;  4JV5 O;  5LHH A;  1YJW V;  1VF6 A;  2Q7G A;  1GK9 A;  4QPK A;  1GN6 A;  1FJG O;  2EIM C;  2F43 G;  4RO2 A;  3STZ C;  5EYP B;  2XAG A;  1MSD A;  3N2K B;  1M56 C;  5CBF A;  3C3S A;  1KB9 F;  3W7U A;  4LF5 O;  2Q9L A;  4GUN A;  1K3E A;  3ABT A;  2R9A A;  4EB6 B;  3CXC U;  2Q4P A;  3ZMV A;  1O9H A;  2AXT Z;  1CPY A;  2NR5 A;  3CJH A;  2WLI A;  3VQV A;  2Q68 A;  1MA1 A;  4DR7 B;  3HKD B;  3CCJ V;  1YTF B;  4LF9 B;  1XQ8 A;  4O2B B;  1NVP D;  2XOK G;  2D3O W;  1AR4 A;  1YIT V;  1ZTE A;  3P3N A;  3K5M A;  4I50 A;  2VQE O;  2DJV A;  5FPR A;  4CZZ A;  3CB2 A;  2OCC C;  4FZ1 A;  1Q6U A;  2OYQ A;  3D3I A;  1QR9 A;  2YI9 A;  3WG7 C;  2KQX A;  3TXQ A;  2IW5 A;  3AG4 C;  4ASU G;  4DRX B;  1MG1 A;  2R70 A;  4JZG A;  3RWR D;  2Y0P A;  1GMG A;  1AP6 A;  4I9Q A;  2E3C A;  3L74 H;  4Q20 A;  1R1B A;  1D2D A;  3IC9 A;  3K03 A;  4B3S B;  1GH6 A;  4U3J A;  4LCU C;  4P30 A;  1E1R G;  3T1Y O;  3ML0 A;  1MNG A;  2QTS A;  4DV5 B;  1VIB A;  2JGD A;  1VF7 A;  4LF5 B;  1NZ6 A;  1URF A;  2QTO A;  1OCR C;  4JI8 O;  1KP3 A;  4B7E A;  2WLM A;  4LFB B;  1JX9 A;  1ENV A;  3OR7 C;  5KAI Z;  3CME V;  2A9H A;  2EIJ C;  3TXS A;  4W4K A;  2HFE C;  3U10 A;  2OTL V;  3FB6 C;  2VWK A;  4F6R B;  3JAK A;  4KFM A;  5LMN O;  2X6A A;  2WA3 A;  1SS3 A;  2Q6A A;  5D5Q A;  2LGW A;  2QM4 A;  5FLX N;  1K73 W;  1T5E A;  3GWK C;  3LSU A;  3FKS G;  2IJJ A;  3CEI A;  1VQ6 V;  3APO A;  3OE7 G;  2IH1 C;  4J41 A;  4O2B A;  3BHP A;  4D7S A;  4GKK B;  3N2G A;  3CC4 V;  4BR6 A;  2EUL A;  5BY1 A;  2GTS A;  4DO2 A;  4UV9 A;  3CRA A;  1QHT A;  2OCH A;  1VQ9 V;  2GTA A;  5H9C A;  4ZI7 B;  2CK3 G;  2YC0 A;  1VQN V;  1DLB A;  1XEQ A;  1N32 B;  3L71 H;  5H5N A;  2RMK B;  4PA4 A;  4NVP A;  5H6Q A;  3BAA A;  4UVB A;  4PI0 A;  3DXR B;  4DR4 O;  2BSK A;  4H13 B;  4EEQ A;  3N2K A;  3G4S V;  1XUQ A;  3KKY A;  4L87 A;  3E22 A;  4X64 O;  1XNQ B;  4ZOL A;  4KHP O;  3I5D A;  1PNK A;  4B3R B;  4JYC A;  1XL6 A;  4TV8 A;  3IGA C;  1Q6I A;  4J7K A;  2ZD9 A;  3AK1 A;  1HR0 B;  4WFE A;  1DF5 A;  4LNU A;  1UFI A;  1TVK B;  4X1I B;  1US6 A;  2DMX A;  3K9S A;  2LO1 A;  3ABL B;  1QVG U;  1JQ0 A;  2ZIO A;  3ZMS A;  5EK0 A;  2LFR A;  3L9D A;  1SER A;  1FFX A;  2QE7 G;  5LMU B;  1M1K W;  1R3K C;  1NR1 A;  1KKC A;  4JAA A;  3ETG A;  4R6Z A;  3VOU A;  4GKK O;  5LA6 B;  3OMA B;  4MVR A;  3OTO B;  1K33 A;  1L0L H;  2EX3 A;  2Q8V A;  2GUZ A;  3RVZ A;  2JS3 A;  2CDY A;  3OT7 A;  4X65 O;  2QKS A;  2BOB C;  1ZUQ A;  1NQT A;  5B1A C;  1XL4 A;  4TOI A;  4NYK A;  1YTF D;  3DC5 A;  4R50 A;  4JF3 A;  4LWS A;  4N21 A;  4ZI7 A;  4DUY B;  1M93 A;  1VF5 B;  1UJW B;  2OCC B;  1SA0 A;  1CEZ A;  4K8X A;  2DQ3 A;  3G80 A;  5CA1 A;  2DQ0 A;  5JJJ B;  1NTZ H;  1RPR A;  5C8Y B;  5LA6 A;  2JGD B;  2YDE A;  2JJ2 G;  4UCR A;  1PL0 A;  3SPJ A;  2QWQ B;  2Q69 A;  1JOY A;  3ZN1 A;  4KL1 A;  1FFT B;  3JD0 A;  1FXK A;  2P4K A;  3X2Q C;  5K1X A;  3K08 A;  4IYH A;  2CE4 A;  5LMU O;  2HEP A;  3MHS C;  1QBZ A;  2Q7E A;  3AG7 A;  4RAI A;  3AG2 C;  4LF7 O;  4X20 A;  2UU9 O;  3RYI A;  1F23 A;  1RM1 B;  1VP7 A;  3A0R A;  2C2A A;  3HR0 A;  2DWD C;  4X1Y A;  4LP8 A;  5IYB O;  4GYC B;  4CS3 A;  4DV1 O;  1VQ4 V;  2Q67 A;  2KG7 B;  1S5L Z;  4DV2 B;  2RNB A;  5AG2 A;  3H1H H;  3T4D A;  4FLX A;  2ZNI A;  4DUY O;  4WCE V;  5CBG A;  2X6B A;  4KUM A;  3ABK B;  2JK5 C;  3WFV A;  1SRY A;  1NT2 B;  1JJO A;  2WPD G;  2ZR2 A;  4TUY B;  3H01 A;  5JH7 B;  4P2Z A;  5KX5 A;  1S72 V;  4E4E A;  4O4J A;  5BR8 O;  2EIM B;  3L72 H;  4BIU A;  1GAX A;  1JFF B;  1XMQ B;  2CUG A;  2KKW A;  4I50 B;  3I55 V;  5E1A C;  3ZHU A;  5LYJ B;  4TV9 A;  1YCI A;  3VBB A;  5IY5 C;  3E8G A;  2ARH A;  4P9O A;  1LUW A;  4PA3 A;  2UUA O;  4MTX A;  2PI5 A;  4DUZ O;  4H44 B;  1ZSP A;  1B06 A;  2X7R B;  3ZHV A;  1GM9 A;  1XOU A;  4JI5 O;  2WLL B;  2LP7 A;  4QJF B;  5JCO A;  3OEH G;  3ZJZ A;  4DR2 B;  1HNZ B;  3TCU A;  4UB8 Z;  4EFE A;  1JPX A;  4YJ2 B;  3W7W A;  4DV4 O;  1VQP V;  4FLY A;  3QG5 A;  1IXM A;  2H8P C;  4DV7 B;  2V1D A;  2WLH A;  4HYO A;  2PUS A;  4I7Z B;  2PGG A;  2F4V B;  3H1K H;  5FNV B;  2GDS A;  5JVD A;  1BL8 A;  3UQ8 A;  1H8H G;  1G4Y B;  4LF8 O;  1DF4 A;  4CS4 A;  3JAT A;  2IU3 A;  3TK1 A;  1K9M W;  2Z0A A;  3JAS B;  2BTQ A;  3RW0 A;  3IJ4 A;  3ZRV A;  1AB3 A;  1PL4 A;  4DRX A;  2B9Z A;  3FX7 A;  1V55 C;  2IH3 C;  1WB8 A;  5JWP A;  2OTJ V;  4PDR A;  1KYO F;  2UXC O;  2E74 B;  1VQ5 V;  2OIE A;  5IJ0 A;  3RYC A;  4DR3 O;  2KB1 A;  1K7D A;  4DV0 O;  4NXN O;  1ORQ C;  3SPI A;  4J80 A;  4DR5 O;  1KP2 A;  4B3M B;  4MT8 A;  4DW1 A;  4X1K A;  1MZF A;  1U97 A;  4TQD A;  1QNM A;  5DM6 V;  5IYZ A;  4BAY A;  5TIS Z;  2W6J G;  1SA0 B;  1BGY H;  2YXH A;  3SYQ A;  1KUQ A;  3STL C;  3HKB A;  1H2M A;  4G28 B;  4I55 B;  5LBQ A;  4FVM A;  2Q73 A;  3M7M X;  3BA8 A;  4RQE A;  3C90 A;  1P7G A;  3N2G B;  4CH3 A;  2IM9 A;  5KAF Z;  1LNQ A;  1BS3 A;  2IJI A;  3LNM B;  2BE3 A;  5IJ9 A;  4LFA B;  1TUB A;  3AG2 B;  5KLV H;  2DWE C;  2JEU A;  3RYC B;  1EM1 A;  1BE3 H;  4JYB A;  3VQY A;  5EC2 C;  2Z3Y A;  4H33 A;  2DYR B;  1RFY A;  2XAJ A;  2DYS B;  3KZI Z;  5DN6 G;  4K8Z A;  1Q3E A;  2FYU H;  4KP4 A;  5EIB D;  4H0L B;  2BTO A;  4QGP A;  3OR6 C;  2YUA A;  2YSU B;  5IWA B;  3E8B A;  5LP6 A;  4LBE C;  3DGE A;  1W2B U;  1Y4M A;  1GN2 A;  2PZS A;  1RSO A;  1SZT A;  4OX9 O;  1H2L A;  1KMI Z;  4MW8 A;  1WP8 A;  4CBC A;  1Q82 W;  1JMK C;  1R6K A;  4U7O A;  4O4H B;  2LW1 A;  4B3R O;  2E5L O;  2P6J A;  4X1Y B;  5C8Y A;  1I7F A;  2UXB O;  1WA8 A;  3E89 A;  1LR1 A;  2IJK A;  3AG3 B;  3IFX A;  3R65 A;  2JJ1 G;  2VQF B;  2QA4 V;  4JI8 B;  1QLE B;  1RSO B;  3P32 A;  5KMG A;  2F95 B;  4QNH B;  3SJC C;  1IBK O;  4E2L A;  2B1I A;  4J7Z A;  1G1X B;  1S77 D;  4QIW F;  4EB6 A;  1COW G;  2ZDI A;  2NN4 A;  4LF4 O;  5L3D A;  2WLK A;  1IBL O;  4K35 A;  3A0H Z;  5EBW C;  2A06 H;  3VQX A;  3SJQ C;  2ADP A;  3KCY A;  2AHZ A;  4PA6 A;  5KHK A;  1WP7 A;  1WLE A;  3A0B Z;  4NB5 A;  5JH7 A;  4FLW A;  3QF7 A;  2UXC B;  2HVJ C;  4X8A A;  5D5P A;  3H9V A;  1MOF A;  2KSD A;  2WLJ A;  3EHB B;  4PD4 F;  2WAM A;  4NXN B;  3I56 V;  1R6N A;  4AIL C;  1WPB A;  4AQY O;  2ZIN A;  4NTX A;  3K04 A;  4CH6 A;  5B1B C;  2EZO A;  2LJ2 A;  1E79 G;  3CRR A;  1Q6H A;  5GTH Z;  1BZK A;  1NS1 A;  2ZM6 O;  4JI6 B;  4DR4 B;  1GRJ A;  3CX5 F;  3THO A;  4FM0 A;  3JD3 A;  3H1L H;  4J11 A;  1NH2 B;  2QDO A;  1EN4 A;  2ADQ B;  3RYI B;  3K59 A;  4ICG A;  4JTC B;  4KHP B;  4MSW C;  2ATK C;  3OUS A;  1K4D C;  4R8C A;  3HKD A;  1PM9 A;  5JJN B;  1Y76 B;  4JI3 B;  3E83 A;  2QM7 A;  3B09 A;  3BAB A;  3K57 A;  1H38 A;  4I55 A;  1H2K A;  2ZQM A;  1R73 A;  1OV9 A;  3SJA C;  3J7A U;  2UXD B;  1GN4 A;  3ZHR A;  4JI7 B;  1FYJ A;  2JGU A;  3ZRX A;  1N36 B;  3K5L A;  4LF6 O;  1W0J G;  2D2C B;  3JAS A;  1YI2 V;  3BA9 A;  1EN5 A;  3X2Q B;  3QO8 A;  1EZJ A;  1MMM A;  2GUZ B;  1FS0 G;  1TAE A;  3LSQ A;  5B1B B;  4RWU A;  3LDE A;  4NXM B;  2A7W A;  1QVF U;  4I0X B;  3CS5 A;  4PHZ A;  1D5N A;  1XIL A;  3ABM B;  1FFX B;  1K34 A;  4GZR B;  4IIJ B;  3LDD A;  2P90 A;  4YHH O;  1N33 O;  1Y6X A;  3F5W C;  1RPO A;  4B3T B;  3JAK B;  4JYA B;  3LNN A;  1AR1 B;  4YIP A;  1A32 A;  1M56 B;  2CTR A;  2F23 A;  3SDL A;  4AHC A;  1S5H C;  5J2U A;  2UUB O;  5KHI A;  2Y4T A;  1YJ9 V;  2FTK A;  1YF2 A;  2N74 A;  2K9P A;  4HNA B;  4O4L B;  2ZIM A;  4JI3 O;  5KA6 A;  5IJ0 B;  3SYP A;  3E8F A;  3CMA V;  2Y4U A;  1XI1 A;  1FJG B;  5LHI A;  1FXH A; 
#chains in the Genus database with same CATH homology
 1Y76 A;  1RSO B;  3B40 A;  1Y74 A;  1ZL8 B;  1Y74 B;  1ZL8 A;  1VF6 A;  1VF6 C;  1Y76 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...