1ZL8B

Nmr structure of l27 heterodimer from c. elegans lin-7 and h. sapiens lin-2 scaffold proteins
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
SDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A General Model for Preferential Hetero-oligomerization of LIN-2/7 Domains: Mechanism Underlying Directed Assembly of Supramolecular Signaling Complexes
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
molecule keywords LIN-7
total genus 14
structure length 54
sequence length 54
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1zl8B00
1Y74A 1RSOB 1VF6C 3B40A 1Y76A 1ZL8A 1ZL8B 1Y76B 1Y74B 1VF6A
chains in the Genus database with same CATH superfamily
2ZIOA 2WLMA 3ZMUA 3CJHB 2R9RB 2OWOA 2XOKG 1M57C 3AG2C 4JZ2A 5D5QA 2B9ZA 4R50A 4X66B 3SJCC 1NH2D 3JYCA 5GTHZ 4O2BB 3SPHA 3CEIA 5LMUO 3N2GB 1YDXA 2JS5A 3G80A 1NVPB 4MT8A 5CA0B 2UXBB 2P90A 3L71H 3KKYA 1E1QG 3I56V 1S3JA 3VQVA 2NLJC 2A0LA 1A32A 2BSKA 4RAIA 5BR8B 5LP6C 4NXNB 2ZR2A 3VQWA 4PA9A 1SQVH 3VQYA 4NTYA 3UT5B 2HJDA 2GUZB 1MNGA 3CMAV 2RCVA 3C3SA 1AB3A 4F6RA 2QWPB 1FXHA 2KQXA 2UUBB 1Q82W 4EB6A 2OT5A 2IJIA 4QE9A 3KCYA 2EJRA 1US6A 2JDIG 4GX2A 1XBLA 5LGNA 4KHPB 4WF9V 3GWKC 4E2LA 2MK3A 3ABKB 3U10A 3ABUA 1BMFG 4MSWC 3RT3C 4DRXA 1DK1A 1AI6A 2F4VO 2V7QG 3RYFA 2QE7G 4PA3A 1K92A 5B1BC 3S3WA 3UO2A 4TQFA 1Y6XA 2EX3A 1SESA 2ZE8A 3KCXA 1YSCA 1AJPA 3ZMTA 1RM1C 1PNLA 3E8HA 5E1AC 1BHBA 2LW7A 4DUYO 3JARB 4NVPA 4FJCC 1H2GA 3JALA 1IURA 2IJHA 2JRIA 1Y67A 1XUQA 2CE4A 1Y4MA 3AG1C 2XHBA 4MVRA 4JI3O 3ZRWB 1H8EG 3K5OA 1R1BA 2PF4E 4KHPO 1TAEA 1J5EB 5B1BB 4YJ2B 3P3NA 5TISZ 1JOYA 1QLNA 3QVNA 5HFMA 5JJEB 2AHZA 3ABLC 3C3TA 4DR1O 1PV0A 2RNBA 3HKCA 4FLUA 3A0RA 5AG2A 2QGNA 4KL1A 2ZQMA 1TA8A 1CP9A 4ABMA 2IW5A 2VWJA 1XILA 2Q8VA 3U0ZA 1EBOA 4WFEA 1VQOV 1Q5OA 4JASA 4KXRA 4FIPC 4GLXA 1Q86W 1N32B 1VF7A 2E74B 3UT5A 2FTKA 5LOVA 4PA6A 1M56B 4DXWA 4MTOA 4LWSA 1TUBA 2ZXWC 2CDYA 4FZ0A 1L1FA 1XOUA 1XI1A 2F66C 1HNWO 1B6QA 4O4HB 1GTOA 1Q3EA 1DF4A 1YTFB 1FXKB 2MW2B 4J7ZA 1AR1B 3K3WA 2QWNB 4ZOLA 3CE2A 4MVZA 4X66O 2ZIMA 3DC5A 4UXNA 1KP3A 2RJZA 5CA1B 4CZZA 5KA6A 5LXTA 3W7XA 3BRCA 1Z2GA 4DV7O 3ASNC 3HKEA 2EINB 2HLDG 2HKOA 4IYIA 3AG3B 3SGIA 3U11A 1M4UA 3CHXA 5H6RA 1OCCC 1RPOA 4GYCB 5BY1A 2N05A 3ZEDA 4F6RB 2UXCB 2JJ1G 3BA9A 1BGYH 2Q7EA 2IU0A 2F23A 5H2FZ 3QTCA 5KAIZ 5B66Z 4Z1MG 1IXBA 4HZ3A 3M7MX 3UO3A 3CXCU 2YDEA 3JD4A 3HKBB 2BSKB 3OEHG 1URFA 2XNDG 1FJGO 1YIJV 5GONB 2BOCC 2UXXA 3JD2A 2IBZH 3B09A 3ZN1A 2WWWA 4DR7O 5A2QN 2XAQA 1JR9A 1GN4A 1TGOA 1Q6HA 4LNUA 1Q7YW 4W4KA 4O2BA 5BZBA 4WBNA 3TCUA 2ITDC 2HEPA 2Q5ZA 1ZSPA 2PUSA 4UB8Z 3RGBA 1ORQC 2YXHA 2LGQA 4O4IB 3JCZA 1BZKA 5IDJA 3CCJV 4UUJC 4JAUA 4MS2A 4UV9A 3CRCA 3JAMN 4CS4A 1N8RW 5FNVB 3OMIB 1EN4A 2IH3C 4QNHB 2ZCEA 4L8JA 4JTDB 4PDLA 2Y4TA 4DUYB 4ICGA 1Z5VA 3A0BZ 4JI8O 3LUTB 4J7KA 2B1GA 5L3GA 2LW1A 5DEDA 4C7UA 1K9MW 3JSLA 3OMNB 3EFFK 1BCCH 4GKKB 3CCRV 2QJ1A 2DWEC 1GRJA 1PD3A 5BMVB 1THZA 2F95B 4B3MO 1OHHG 5LYJB 3K5NA 3ABMC 1BT8A 4DYLA 2W6IG 3K58A 4FMTA 1F4NA 2Z5UA 2Z0AA 3L75H 4GCZA 1I94O 4X88A 2JIZG 4I9QA 2HVKC 1X59A 3OW2U 3UCSC 2AZ0A 1OV9A 2E5LO 4B3TB 3Q4HB 4DV1O 1BQ0A 2PI5A 1FYJA 2PYJA 1EN5A 3AG7A 1E1RG 3F5TA 1N4CA 1VF6C 4DV0B 1L8DA 5F2VO 3WB1A 4LF4O 4DR2B 1MABG 4RO2A 1WAZA 4JTCB 4PA7A 3B40A 3T4ZA 2ETNA 2PY5A 4YXWG 1VQ5V 1ZTEA 4DK1A 1Q90D 4Q20A 1NT2B 1R3KC 5L3FA 4DR4O 4G27B 1MG1A 3WG7B 4NTWA 1WNSA 1SA0A 1F51A 3FYEB 3SJBC 3T2MA 3TETA 4KFMA 5KX5B 1H2LA 3FAVB 1XNQO 1QLEC 4JAAA 5L3DA 4NR1A 3WU2Z 2EBOA 1R3IC 1ZAUA 1N32O 1I08A 4GX1A 2X6AA 3DC6A 4DV0O 2UU9O 4B3SO 4J80A 4UCUA 3T1YO 2ZE5A 3E89A 3AK1A 3B8MA 1B06A 4XDJA 4P2ZA 3MAQA 2UUCO 4J11A 5H9CA 2CGOA 1F7YA 1QVGU 5CMUA 1ZWIC 1ZLZA 4GKKO 2YIDA 4UVBA 2XASA 3RWRD 4D6TH 3T1YB 1QU7A 4TV9A 1P7GA 1W0KG 4WCEV 2JEUA 3BVOA 1JJ2U 4NYKA 4LFCB 4U3JB 2HG5C 1N0JA 2P5OA 3RYIA 4YY3B 1KYOF 5JH7B 2XTAA 4QPKA 3UKMA 5C8YB 2OIEA 1J5EO 1NU1H 1AR4A 4IL6Z 1YJ9V 3P30A 4XBFA 3EVKA 3ZRVA 4MVOA 1I5XA 4FLYA 2FMLA 1BE3H 4FK5C 3W7WA 4DV4O 4R8CA 3E22A 2JEXA 3ZMZA 2HR3A 3DXRB 2UUCB 3CSXA 2UXBO 4ZHQB 2RMKB 3MHSC 1YF2A 2ZE6A 2P4KA 1AI5A 3FYIB 3JAWA 3K04A 1FXKA 1IBKO 5B1OA 4NKGB 2ZM6O 2GDSA 3LNMB 5DN6G 4CC5A 3CYOA 4JI7B 4O4IA 3RYHA 4U7OA 3EHBB 2EJ7A 3CRRA 1XNQB 4MTXA 1HNXB 1D2DA 4LWSB 4IYHA 3ASNB 3BEHA 4AI8A 4TV9B 3AK3A 1JFFB 3EXAA 2CGNA 1YJWV 4JYAB 5CB4A 2DYRB 3W7TA 3ETGA 2IU3A 4HNAA 4I55B 2PTMA 5DM6V 1UFIA 2XAGA 4QGPA 3B4SA 3ZMVA 2EIKC 4PDMA 3OEEG 1S5HC 2ZDIA 4UCTA 3STLC 1VQ6V 2EIMB 4GX5A 5B1NA 2CAZC 3G71V 5IYBO 4DR1B 1OJHA 1DGSA 2EIJB 1AVMA 1KECA 4FLXA 4I50A 3ZCCA 3E83A 1HDJA 5CN0A 2W0XA 1SA0B 4FPPA 2X0LA 3K08A 1CEZA 3J80N 1WB7A 2DQ0A 1XQ8A 3ZHVA 3FKSG 2YI8A 2JJ2G 3G4SV 4F4LA 4PI2A 5IY5B 3SYPA 1SERA 4IIJB 2WA3A 1N36O 5EIBC 1I5YA 4XDLA 2XAJA 4O4LA 3SYAA 2X6BA 5JQGA 2Q6AA 4G2KA 4WFFA 2UU9B 3HKBA 4LF4B 3F7YC 4DR5B 4TUYA 1GN6A 2QM8A 2QWOB 3QNEA 2ADPA 3L72H 1NR7A 1FFTB 4UFZA 2ILMA 3J81N 1IBLO 3HR0A 4P9OA 1VMGA 3K0DA 4RWUA 1VQNV 1RP3B 3ZRSA 4AILC 4QIWF 2UUAO 4I5SA 4MW3A 4ZIBA 4DV2O 3ZHTA 1B04A 4X64B 3IC9A 2JGDA 1GKFA 1N33B 3ASOC 4ZBMA 1FFXA 3LNNA 4G28B 1MA1A 4TT3G 1H8HG 2EZOA 1M1KW 3HKEB 4DR3O 3D8CA 4YJ2A 1XHXA 3A8TA 4QJFB 3E22B 2XT9A 3ZRWA 1AROP 3JATB 5BR8O 3W7SA 4DV4B 4I55A 1K8AW 3ZRXA 1RSOB 1FJGB 3HKDA 5KHHA 1FPOA 1GH6A 1QNMA 4FFBA 2Q73A 2E5LB 3OE7G 4B3TO 1S5JA 3O65A 1GM8A 5KHIA 1F4MA 3ASOB 5CBHA 5CA1A 1R6TA 2BTQB 1XMOO 1AP5A 3K5MA 1YXBA 3SJAC 3FB6C 4LFCO 2VQFB 4YJ3A 5B1AC 2CTWA 1S72V 1WN7A 4MVQA 2PZSA 5EYPA 2HJFC 1G8MA 3DGEA 2QEXV 1W59A 4H37A 3CS5A 2P67A 4TOIA 4FLVA 2P6JA 1HW7A 5JCOC 1NH2B 4BIUA 4CS3A 2ADQB 2QDOA 3CX5F 3OD4A 3FX7A 1H2MA 1WLEA 1HWYA 3FB8C 1Y74A 2Q7HA 3G6BA 2CTQA 1FS0G 2OTLV 2JGUA 4JI2O 3W7UA 2VQEO 5KX5A 4LF8B 2CH7A 2GV9A 5C93A 2Y4UA 1K3EA 1V55C 3I5DA 3BHPA 1O9HA 4OX9O 5LGUA 4JI7O 1Q6UA 1JQ0A 3RYCA 5LP6B 3JASA 4B7KA 3BCCH 2C2AA 1AR5A 4WFHA 1R3JC 1XEQA 1E79G 3H1JH 2IH1C 4JGSA 4LF7O 4YIOA 1HNZO 2JS3A 1M57B 3AG2B 3OM3B 1DLBA 2WPDG 3CRMA 4O4LB 4DRXB 5LMUB 5IJ0A 1YHQV 2OTJV 4YY3O 3IGAC 3VOUA 4DW0A 2YUAA 5JWPA 3QF7A 1AI4A 3SDLA 1SRYA 1TVKA 5E79Z 3CCSV 1OZ0A 3FD9A 3E8GA 5IWAO 4FLZA 3T1CA 3CCEV 1PNKA 2YXYA 3APQA 4MTGA 4YHHO 2WLKA 1YI2V 5KA5A 1VIBA 3IC7A 4NB5A 2XUMA 4FM0A 3N2KB 1SQFA 4X62O 3BY6A 5FLXN 5B5EZ 1HR0B 3RVYA 2W6JG 2JGDB 2ZXWB 4DK0A 4K35A 2R9IA 3LDCA 2CTRA 4BIOA 2UXDO 4CBCA 2OYQA 2FKXA 4JAVA 1KP2A 2V1DA 1P49A 3QO5A 2N04A 5IYCO 2BCCH 3OT7A 4JI2B 4DV1B 2EIKB 1VQ7V 3ZHSA 4R6ZA 1KBHA 5EBLC 1SQBH 5LP6A 2AXTZ 5IWAB 3D36C 1YJNV 2A7WA 3CRAA 3CC2V 2AW9A 1BL8A 2Q0OC 1QR8A 3A0HZ 4X62B 3OTOB 4LCUC 1X4TA 2QKCA 2ATKC 5EBWC 1VQ4V 4OPHA 4I0XA 3OMAB 3P3PA 1EN6A 2M6YA 3DXRA 3K59A 1N34B 3VBBA 2DYSC 1K7DA 1VP7A 1EZVH 1VQKV 3FFQA 5LGTA 1EFRG 1YEWA 2ZNJA 4LF9O 2WLLA 4LF5O 4CH4A 2VS0A 3P32A 5EBMC 4DV5B 3K79A 5IYDO 4K8XA 2JK5C 4JI0B 4JYYA 1KKCA 2WLIB 5J2TA 1LUVA 2A9HA 1L0NH 4LH7A 4ZI7A 3K9SA 1ZUQA 5FPOA 1HR0O 3D3IA 2DYSB 5EZYB 3OTOO 1XMOB 4WBNB 4UCSA 1AI7A 3LDEA 3JAKA 3E86A 2HHHB 3BABA 3GWOA 1VARA 3JCUZ 1BHAA 4K0KB 4JI3B 1OCZC 1R73A 1UPGA 1W0JG 1S0VA 4PDVA 2KG7B 3IJ4A 1SQGA 5JVDB 1M5IA 2GHYA 1T5EA 1H2SB 5IYZA 4UV8A 5J9PC 4DV2B 5B1AB 1K4CC 1SZTA 1G4YB 4MVUA 2DYRC 4I50B 1MZFA 1FAFA 5J2UA 4FLTA 2Q0AA 2WAMA 2LQTA 3BAAA 2R9AA 2EULA 1QCEA 3HKDB 2PI4A 1WPBA 4F6EA 3AG4C 5L3CA 4J10A 2CK3G 1ROPA 1QLEB 4RQEA 4U3JA 3SPGA 3H1KH 3AG3C 4HAMA 4X1IB 3JSNA 4BW5A 4I4TA 4YHHB 4YIPA 2EILB 2Z3YA 2E76B 2QWQB 5LA6B 4I0XB 2QKAA 2BTOA 3QO7A 4OGQB 3TXSA 3B77A 3MHHC 3ZJZA 4Z1VA 3QG5A 4DR4B 1YITV 2ZNIA 4CS2A 2YIBA 1WB8A 2YS8A 1GO3F 2NN4A 2UXDB 2F93B 4ZKIA 5GTIZ 3ABLB 4UB6Z 3RVZA 3C90A 3RFRA 1DTOA 3ICXA 4LNUB 3X2QB 4U3FH 1MOFA 2QTOA 4J9ZB 4JZGA 1IZ3A 1G1XB 2D2CB 1PL0A 2JVDA 2Q7GA 2ZD9A 3AG1B 3MDSA 1LR1A 1IBKB 4LFAB 1ZX3A 5KMGB 4AQYB 3LSQA 1S5LZ 3CRQA 1G6UA 5KUKA 5IJ9B 4H44B 5D5PA 2XAFA 2UXCO 5B3SC 4JI4B 3F5WC 1GAXA 1XDCA 2L35A 3ZX6A 3CD6V 2VWKA 1N33O 3CCMV 1OCCB 4X8AA 1K73W 4LF8O 3QO8A 1U96A 4DV3O 3G67A 1Q81W 4OX9B 4JI4O 1WP8A 3FB7C 5IYZB 2D3OW 1VQMV 3E8BA 4ASUG 3E2EA 1MSWD 4TUYB 5KAFZ 1BSMA 2KG7A 4LF9B 1TVKB 2PGGA 4DV6O 3OTFA 1KC8W 2XAHA 2B1IA 3SPJA 2DQ3A 1AILA 2RN9A 3BA8A 2EIMC 1N0NA 2OIGA 1KKDA 4HNAB 3KG2A 1TUEB 4O2AB 4KUMA 1OCOB 2Q68A 3SR2C 1NI8A 1QQCA 2YSUB 4JV5O 1K5SA 3OAAG 4PV1B 1AJQA 1YVWA 3M8AA 4UCRA 1J95A 1RPRA 4X65B 1PPJH 2GSMB 2UUAB 1D5AA 3BPZA 1ZL8A 2WLIA 3UQ8A 3CCUV 4JI1O 5KUMA 4TSFG 1NTKH 1GM9A 2YC0A 1OCZB 4QE7A 4B3MB 3JD3A 4BAYA 3AK2A 2E3CA 2P7TC 1P84F 2DWDC 2ZINA 1PNMA 3K0GA 1VQPV 2QSAA 3WB2A 4JI8B 2B5UA 3THOA 5CBFA 3H1IH 1W2BU 4HBNA 3N27A 4W4LA 1Y76A 4YJ3B 5FNVA 3ZHQA 3SYOA 2UUBO 1YCIA 2YEVB 5IT9N 1V55B 4N21A 2HHHO 4RUEA 4E4EA 4LF7B 2BE3A 4O4HA 4X1KA 1XHZA 1NQTA 5EZYA 3CWBH 1JVMA 3CB2A 4FFBB 1I94B 2Y69B 2VQEB 1XL4A 3LSUA 4A5UB 5ITZB 1D5NA 3OR6C 3STZC 4TV8A 1O9GA 1M56C 1H38A 3NXSA 1BS3A 4IIJA 2H8PC 3WB0A 3ZHRA 1AJNA 3VQXA 2EIJC 4OXSA 5GONA 4EKWA 5L3BA 4IHJA 2WLNA 3H01A 3K06A 4IT5A 3CXHF 2LGWA 3WG7C 3RW0A 4WFBV 4ZHQA 1IX9A 1M9NA 4JPRA 3GB7C 5IJ9A 3HB3B 1F23A 2OCCC 2HFEC 1BQZA 4B3SB 1M93A 3MD0A 5JH7A 4TWKA 2DE0X 4JI0O 4NXNO 4D7TA 1B3QA 3ETEA 1FXKC 2W0FC 3AEIA 1NS1A 4B3RB 2YXLA 3H1LH 3KZIZ 2Y0PA 3JARA 4JI6B 1I0HA 2G38A 3RN4A 2YEVA 2ZM6B 2BTQA 5EC1C 2EILC 4DR2O 4K3AA 3ZN0A 4JTAB 2EZPA 4B3RO 3CCLV 3JD1A 4P9PA 3D3QA 1IDSA 2YIAA 1Z5WA 3OUFA 5KLVH 1JFFA 1OCRC 5ITZA 4ZI7B 5BMVA 1L0LH 5CB4B 4JI5O 4GUNA 4UCVA 5IE9A 2ITCC 3TGUH 2P4VA 1MZEA 2Q4PA 2NNUA 3CC4V 4RUFA 2K1EA 3OFNG 2KSDA 2L6LA 4DO2A 1WA8A 3RYHB 3LSSA 5LYJA 3FB5C 2QA4V 3I55V 4BW9A 4BR6A 5EC2C 2QM4A 4PHZA 5DECA 4D7SA 1NKDA 2AZ2A 2KKWA 3HKCB 3J7AU 3NR7A 1VF6A 2WLHA 4XDKA 2YIBD 3T1HO 3ZMSA 5K1XA 4DUZB 2ZR3A 1Q6IA 4PELA 5K1PA 5BXZA 4I7ZB 1R6NA 5C8YA 3SJQC 3DSQA 1IBMO 3ETDA 4PD4F 1EM1A 1SS3A 1WP7A 4LF6O 5LHIA 4MW8A 4O4JB 4I9WA 3F7VC 4O4JA 3APOA 5IJ0B 2A06H 1TUBB 1XMQB 4Z2WA 2DOSA 4IGGA 4LF5B 5LOVB 4FVMA 1MMMA 2WLJA 1RSOA 2DMXA 2ZT9B 4N23A 3OR7C 4LP8A 2WLLB 2BOBC 2F4VB 2VQFO 4EFBA 1WPXA 4CH3A 2R72A 4QPJA 1GN2A 2R70A 4B7EA 4H0LB 1V54C 2IJKA 1XNRB 1PM9A 1SQQH 1QVFU 4FFKA 5FPRA 2Y69C 2CH7B 1VEWA 5IY5C 1FFXB 1R3LC 1HNZB 1KQSU 3OGIB 4OPAA 4RQFA 1U97A 4X89A 3K57A 5J2UB 5FL7G 1SZXA 2QKSA 3RBZA 4NTXA 3RYIB 5GW7A 4BWAA 4EB6B 1NR1A 1M90W 1K4DC 1XL6A 1NBMG 1XREA 1HP8A 2E75B 1GM7A 4TV8B 4DV7B 1H2NA 4J9YB 4JYAO 3JD0A 1RFYA 1GMGA 1FXVA 3S3XA 3WFVA 1SQPH 2LFRA 4FLWA 5LA6A 3DTUB 1N34O 2DJVA 4FM2A 3E8FA 1Q8IA 1JMKC 1HNWB 1LUWA 1KUQA 1AP6A 1JCHA 5CA3A 2H3OA 1QHTA 3CJHA 1LNQA 4AQYO 4X1YA 1JA8A 3OGCC 1PKXA 2ZDIC 5L3EA 2WA4A 3CP1A 3GVMA 1GN3A 1XMQO 1YTFD 2FYUH 3PN1A 4EEQA 4DR3B 2A79B 1K34A 1OCOC 4AHCA 4FZ1A 1OCRB 3TXQA 1WA8B 3G6EV 2AGAA 3IAYA 2Y48A 5JVDA 2V4DA 1SC5B 3K9AA 2M7WA 4P30A 3TJTA 3BFRA 1K33A 5LHHA 2IJJA 2ODMA 4JV5B 1XNRO 1JPXA 2Y0IA 1JX9A 1KMIZ 3IFXA 5H6QA 4LFAO 2DN9A 4LFBB 3CMEV 4DR5O 4K8ZA 1GK9A 1P4RA 5JJJB 5A9GA 2Q9LA 4ZOLB 2YICA 4BIZA 5JQGB 5CA0A 3K5LA 4HYOA 3PJSK 5LHGA 4X1KB 1N36B 5EK0A 1QBZA 2GBOA 4LFBO 3RYCB 3CCQV 1KB9F 5J2TB 4DR6O 4GKJO 3L70H 3FAVA 2X7RB 2VRZA 3L73H 4LC1A 4LF6B 4X9QA 5LBQA 2YI9A 5KHJA 3M99B 2FL4A 3L74H 2LO1A 4X1IA 2A3QA 1P7BA 1EZJA 4PA4A 3B8NA 1CXZB 2QM7A 1SKVA 4I4TB 2CTPA 2F1MA 1RM1B 1H2KA 2NR5A 2P22C 3AG4B 1KU9A 3N2KA 4FM1A 3HPLC 2K9PA 2AHYA 1ENVA 1NJIW 5JJNB 1Q43A 4DV3B 5CBGA 4NXMB 4K0KO 2PYLA 4LR3A 2QR4A 3E35A 4H33A 3A2FA 2GTAA 1CPYA 5KMGA 5H5NA 1COWG 1VQ9V 2GUZA 4GX0A 4X65O 3TK1A 4CH5A 2CUGA 4DV5O 4GKJB 4DR6B 2X6CA 2N74A 2ZE7A 5HFLA 1UJWB 4B08A 3SYCA 3ZBHA 1S77D 4X1YB 3T4DA 2LJ2A 3ABTA 2HVJC 4DR7B 3ABMB 1SETA 2IM9A 1KD1W 3X2QC 3UM7A 4R7CA 2EINC 1FKAO 1NTMH 4JYCA 2O57A 5LMNO 2GTSA 4L87A 2P06A 3Q4HA 4X64O 2H94A 3JAWB 2QWRB 1JJOA 4U7NA 1PP9H 3N2GA 3JASB 4J41A 4NXMO 5JCOA 4JI6O 4LH6A 5LL6Y 1VF5B 3ABKC 3SPCA 1HNXO 5KHGA 1S76D 3R66A 2KB1A 2WSSG 3O9OA 2OCCB 5B3SB 1Y66A 1Y74B 4WFAV 1YZBA 3CC7V 2Q67A 4LBEC 4UVAA 4PDRA 3ZIAG 3OUSA 1NZ6A 3LDDA 2HP8A 4EFEA 4MVSA 2ZKOA 1PL4A 2LFSA 3B2EE 1VQLV 3D36A 4O2AA 5EYPB 3ETQA 1K97A 3SYQA 4CH6A 1IVSA 3H1HH 3ML0A 5KHKA 1DF5A 4JI1B 3CPWU 2QTSA 2Q69A 1IBLB 1K5QA 1FD9A 3JAKB 3CCVV 1NTZH 1V54B 1I7FA 3ZHUA 4PJ0Z 3R65A 4TQDA 4J7JA 1VQ8V 4Q6GA 4UCOA 1Y76B 4KP4A 3T1HB 4J42A 4GT1A 4DUZO 4X20B 2RDCA 1MSDA 2UXNA 3RYFB 1IBMB 3K03A 2ARHA 2F43G 3JATA 5EIBD 4MVMA 1R6KA 4DV6B 4MTFA 4H13B 4CC6A 5LMNB 1IXMA 3H9VA 1SQXH 3L9DA 2LP7A 2OCHA 2FB5A 4JYBA 3SPIA 1V9PA 2RQ6A 1WJZA 4IHJB 2DW4A 5LXTB 3ZS8C 1NVPD 4GZRB 4JI5B 1QR9A 4UVCA 1SF9A 4WFGA 4PI0A 1ZL8B 4JF3A 3JALB 4DW1A 4X20A
chains in the Genus database with same CATH topology
1Y74A 1RSOB 1VF6C 3B40A 1Y76A 1ZL8A 1ZL8B 1Y76B 1Y74B 1VF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y74 A;  1RSO B;  1VF6 C;  3B40 A;  1Y76 A;  1ZL8 A;  1ZL8 B;  1Y76 B;  1Y74 B;  1VF6 A; 
#chains in the Genus database with same CATH topology
 2ZIO A;  2WLM A;  3ZMU A;  3CJH B;  2R9R B;  2OWO A;  2XOK G;  1M57 C;  3AG2 C;  4JZ2 A;  5D5Q A;  2B9Z A;  4R50 A;  4X66 B;  3SJC C;  1NH2 D;  3JYC A;  5GTH Z;  4O2B B;  3SPH A;  3CEI A;  5LMU O;  3N2G B;  1YDX A;  2JS5 A;  3G80 A;  1NVP B;  4MT8 A;  5CA0 B;  2UXB B;  2P90 A;  3L71 H;  3KKY A;  1E1Q G;  3I56 V;  1S3J A;  3VQV A;  2NLJ C;  2A0L A;  1A32 A;  2BSK A;  4RAI A;  5BR8 B;  5LP6 C;  4NXN B;  2ZR2 A;  3VQW A;  4PA9 A;  1SQV H;  3VQY A;  4NTY A;  3UT5 B;  2HJD A;  2GUZ B;  1MNG A;  3CMA V;  2RCV A;  3C3S A;  1AB3 A;  4F6R A;  2QWP B;  1FXH A;  2KQX A;  2UUB B;  1Q82 W;  4EB6 A;  2OT5 A;  2IJI A;  4QE9 A;  3KCY A;  2EJR A;  1US6 A;  2JDI G;  4GX2 A;  1XBL A;  5LGN A;  4KHP B;  4WF9 V;  3GWK C;  4E2L A;  2MK3 A;  3ABK B;  3U10 A;  3ABU A;  1BMF G;  4MSW C;  3RT3 C;  4DRX A;  1DK1 A;  1AI6 A;  2F4V O;  2V7Q G;  3RYF A;  2QE7 G;  4PA3 A;  1K92 A;  5B1B C;  3S3W A;  3UO2 A;  4TQF A;  1Y6X A;  2EX3 A;  1SES A;  2ZE8 A;  3KCX A;  1YSC A;  1AJP A;  3ZMT A;  1RM1 C;  1PNL A;  3E8H A;  5E1A C;  1BHB A;  2LW7 A;  4DUY O;  3JAR B;  4NVP A;  4FJC C;  1H2G A;  3JAL A;  1IUR A;  2IJH A;  2JRI A;  1Y67 A;  1XUQ A;  2CE4 A;  1Y4M A;  3AG1 C;  2XHB A;  4MVR A;  4JI3 O;  3ZRW B;  1H8E G;  3K5O A;  1R1B A;  2PF4 E;  4KHP O;  1TAE A;  1J5E B;  5B1B B;  4YJ2 B;  3P3N A;  5TIS Z;  1JOY A;  1QLN A;  3QVN A;  5HFM A;  5JJE B;  2AHZ A;  3ABL C;  3C3T A;  4DR1 O;  1PV0 A;  2RNB A;  3HKC A;  4FLU A;  3A0R A;  5AG2 A;  2QGN A;  4KL1 A;  2ZQM A;  1TA8 A;  1CP9 A;  4ABM A;  2IW5 A;  2VWJ A;  1XIL A;  2Q8V A;  3U0Z A;  1EBO A;  4WFE A;  1VQO V;  1Q5O A;  4JAS A;  4KXR A;  4FIP C;  4GLX A;  1Q86 W;  1N32 B;  1VF7 A;  2E74 B;  3UT5 A;  2FTK A;  5LOV A;  4PA6 A;  1M56 B;  4DXW A;  4MTO A;  4LWS A;  1TUB A;  2ZXW C;  2CDY A;  4FZ0 A;  1L1F A;  1XOU A;  1XI1 A;  2F66 C;  1HNW O;  1B6Q A;  4O4H B;  1GTO A;  1Q3E A;  1DF4 A;  1YTF B;  1FXK B;  2MW2 B;  4J7Z A;  1AR1 B;  3K3W A;  2QWN B;  4ZOL A;  3CE2 A;  4MVZ A;  4X66 O;  2ZIM A;  3DC5 A;  4UXN A;  1KP3 A;  2RJZ A;  5CA1 B;  4CZZ A;  5KA6 A;  5LXT A;  3W7X A;  3BRC A;  1Z2G A;  4DV7 O;  3ASN C;  3HKE A;  2EIN B;  2HLD G;  2HKO A;  4IYI A;  3AG3 B;  3SGI A;  3U11 A;  1M4U A;  3CHX A;  5H6R A;  1OCC C;  1RPO A;  4GYC B;  5BY1 A;  2N05 A;  3ZED A;  4F6R B;  2UXC B;  2JJ1 G;  3BA9 A;  1BGY H;  2Q7E A;  2IU0 A;  2F23 A;  5H2F Z;  3QTC A;  5KAI Z;  5B66 Z;  4Z1M G;  1IXB A;  4HZ3 A;  3M7M X;  3UO3 A;  3CXC U;  2YDE A;  3JD4 A;  3HKB B;  2BSK B;  3OEH G;  1URF A;  2XND G;  1FJG O;  1YIJ V;  5GON B;  2BOC C;  2UXX A;  3JD2 A;  2IBZ H;  3B09 A;  3ZN1 A;  2WWW A;  4DR7 O;  5A2Q N;  2XAQ A;  1JR9 A;  1GN4 A;  1TGO A;  1Q6H A;  4LNU A;  1Q7Y W;  4W4K A;  4O2B A;  5BZB A;  4WBN A;  3TCU A;  2ITD C;  2HEP A;  2Q5Z A;  1ZSP A;  2PUS A;  4UB8 Z;  3RGB A;  1ORQ C;  2YXH A;  2LGQ A;  4O4I B;  3JCZ A;  1BZK A;  5IDJ A;  3CCJ V;  4UUJ C;  4JAU A;  4MS2 A;  4UV9 A;  3CRC A;  3JAM N;  4CS4 A;  1N8R W;  5FNV B;  3OMI B;  1EN4 A;  2IH3 C;  4QNH B;  2ZCE A;  4L8J A;  4JTD B;  4PDL A;  2Y4T A;  4DUY B;  4ICG A;  1Z5V A;  3A0B Z;  4JI8 O;  3LUT B;  4J7K A;  2B1G A;  5L3G A;  2LW1 A;  5DED A;  4C7U A;  1K9M W;  3JSL A;  3OMN B;  3EFF K;  1BCC H;  4GKK B;  3CCR V;  2QJ1 A;  2DWE C;  1GRJ A;  1PD3 A;  5BMV B;  1THZ A;  2F95 B;  4B3M O;  1OHH G;  5LYJ B;  3K5N A;  3ABM C;  1BT8 A;  4DYL A;  2W6I G;  3K58 A;  4FMT A;  1F4N A;  2Z5U A;  2Z0A A;  3L75 H;  4GCZ A;  1I94 O;  4X88 A;  2JIZ G;  4I9Q A;  2HVK C;  1X59 A;  3OW2 U;  3UCS C;  2AZ0 A;  1OV9 A;  2E5L O;  4B3T B;  3Q4H B;  4DV1 O;  1BQ0 A;  2PI5 A;  1FYJ A;  2PYJ A;  1EN5 A;  3AG7 A;  1E1R G;  3F5T A;  1N4C A;  1VF6 C;  4DV0 B;  1L8D A;  5F2V O;  3WB1 A;  4LF4 O;  4DR2 B;  1MAB G;  4RO2 A;  1WAZ A;  4JTC B;  4PA7 A;  3B40 A;  3T4Z A;  2ETN A;  2PY5 A;  4YXW G;  1VQ5 V;  1ZTE A;  4DK1 A;  1Q90 D;  4Q20 A;  1NT2 B;  1R3K C;  5L3F A;  4DR4 O;  4G27 B;  1MG1 A;  3WG7 B;  4NTW A;  1WNS A;  1SA0 A;  1F51 A;  3FYE B;  3SJB C;  3T2M A;  3TET A;  4KFM A;  5KX5 B;  1H2L A;  3FAV B;  1XNQ O;  1QLE C;  4JAA A;  5L3D A;  4NR1 A;  3WU2 Z;  2EBO A;  1R3I C;  1ZAU A;  1N32 O;  1I08 A;  4GX1 A;  2X6A A;  3DC6 A;  4DV0 O;  2UU9 O;  4B3S O;  4J80 A;  4UCU A;  3T1Y O;  2ZE5 A;  3E89 A;  3AK1 A;  3B8M A;  1B06 A;  4XDJ A;  4P2Z A;  3MAQ A;  2UUC O;  4J11 A;  5H9C A;  2CGO A;  1F7Y A;  1QVG U;  5CMU A;  1ZWI C;  1ZLZ A;  4GKK O;  2YID A;  4UVB A;  2XAS A;  3RWR D;  4D6T H;  3T1Y B;  1QU7 A;  4TV9 A;  1P7G A;  1W0K G;  4WCE V;  2JEU A;  3BVO A;  1JJ2 U;  4NYK A;  4LFC B;  4U3J B;  2HG5 C;  1N0J A;  2P5O A;  3RYI A;  4YY3 B;  1KYO F;  5JH7 B;  2XTA A;  4QPK A;  3UKM A;  5C8Y B;  2OIE A;  1J5E O;  1NU1 H;  1AR4 A;  4IL6 Z;  1YJ9 V;  3P30 A;  4XBF A;  3EVK A;  3ZRV A;  4MVO A;  1I5X A;  4FLY A;  2FML A;  1BE3 H;  4FK5 C;  3W7W A;  4DV4 O;  4R8C A;  3E22 A;  2JEX A;  3ZMZ A;  2HR3 A;  3DXR B;  2UUC B;  3CSX A;  2UXB O;  4ZHQ B;  2RMK B;  3MHS C;  1YF2 A;  2ZE6 A;  2P4K A;  1AI5 A;  3FYI B;  3JAW A;  3K04 A;  1FXK A;  1IBK O;  5B1O A;  4NKG B;  2ZM6 O;  2GDS A;  3LNM B;  5DN6 G;  4CC5 A;  3CYO A;  4JI7 B;  4O4I A;  3RYH A;  4U7O A;  3EHB B;  2EJ7 A;  3CRR A;  1XNQ B;  4MTX A;  1HNX B;  1D2D A;  4LWS B;  4IYH A;  3ASN B;  3BEH A;  4AI8 A;  4TV9 B;  3AK3 A;  1JFF B;  3EXA A;  2CGN A;  1YJW V;  4JYA B;  5CB4 A;  2DYR B;  3W7T A;  3ETG A;  2IU3 A;  4HNA A;  4I55 B;  2PTM A;  5DM6 V;  1UFI A;  2XAG A;  4QGP A;  3B4S A;  3ZMV A;  2EIK C;  4PDM A;  3OEE G;  1S5H C;  2ZDI A;  4UCT A;  3STL C;  1VQ6 V;  2EIM B;  4GX5 A;  5B1N A;  2CAZ C;  3G71 V;  5IYB O;  4DR1 B;  1OJH A;  1DGS A;  2EIJ B;  1AVM A;  1KEC A;  4FLX A;  4I50 A;  3ZCC A;  3E83 A;  1HDJ A;  5CN0 A;  2W0X A;  1SA0 B;  4FPP A;  2X0L A;  3K08 A;  1CEZ A;  3J80 N;  1WB7 A;  2DQ0 A;  1XQ8 A;  3ZHV A;  3FKS G;  2YI8 A;  2JJ2 G;  3G4S V;  4F4L A;  4PI2 A;  5IY5 B;  3SYP A;  1SER A;  4IIJ B;  2WA3 A;  1N36 O;  5EIB C;  1I5Y A;  4XDL A;  2XAJ A;  4O4L A;  3SYA A;  2X6B A;  5JQG A;  2Q6A A;  4G2K A;  4WFF A;  2UU9 B;  3HKB A;  4LF4 B;  3F7Y C;  4DR5 B;  4TUY A;  1GN6 A;  2QM8 A;  2QWO B;  3QNE A;  2ADP A;  3L72 H;  1NR7 A;  1FFT B;  4UFZ A;  2ILM A;  3J81 N;  1IBL O;  3HR0 A;  4P9O A;  1VMG A;  3K0D A;  4RWU A;  1VQN V;  1RP3 B;  3ZRS A;  4AIL C;  4QIW F;  2UUA O;  4I5S A;  4MW3 A;  4ZIB A;  4DV2 O;  3ZHT A;  1B04 A;  4X64 B;  3IC9 A;  2JGD A;  1GKF A;  1N33 B;  3ASO C;  4ZBM A;  1FFX A;  3LNN A;  4G28 B;  1MA1 A;  4TT3 G;  1H8H G;  2EZO A;  1M1K W;  3HKE B;  4DR3 O;  3D8C A;  4YJ2 A;  1XHX A;  3A8T A;  4QJF B;  3E22 B;  2XT9 A;  3ZRW A;  1ARO P;  3JAT B;  5BR8 O;  3W7S A;  4DV4 B;  4I55 A;  1K8A W;  3ZRX A;  1RSO B;  1FJG B;  3HKD A;  5KHH A;  1FPO A;  1GH6 A;  1QNM A;  4FFB A;  2Q73 A;  2E5L B;  3OE7 G;  4B3T O;  1S5J A;  3O65 A;  1GM8 A;  5KHI A;  1F4M A;  3ASO B;  5CBH A;  5CA1 A;  1R6T A;  2BTQ B;  1XMO O;  1AP5 A;  3K5M A;  1YXB A;  3SJA C;  3FB6 C;  4LFC O;  2VQF B;  4YJ3 A;  5B1A C;  2CTW A;  1S72 V;  1WN7 A;  4MVQ A;  2PZS A;  5EYP A;  2HJF C;  1G8M A;  3DGE A;  2QEX V;  1W59 A;  4H37 A;  3CS5 A;  2P67 A;  4TOI A;  4FLV A;  2P6J A;  1HW7 A;  5JCO C;  1NH2 B;  4BIU A;  4CS3 A;  2ADQ B;  2QDO A;  3CX5 F;  3OD4 A;  3FX7 A;  1H2M A;  1WLE A;  1HWY A;  3FB8 C;  1Y74 A;  2Q7H A;  3G6B A;  2CTQ A;  1FS0 G;  2OTL V;  2JGU A;  4JI2 O;  3W7U A;  2VQE O;  5KX5 A;  4LF8 B;  2CH7 A;  2GV9 A;  5C93 A;  2Y4U A;  1K3E A;  1V55 C;  3I5D A;  3BHP A;  1O9H A;  4OX9 O;  5LGU A;  4JI7 O;  1Q6U A;  1JQ0 A;  3RYC A;  5LP6 B;  3JAS A;  4B7K A;  3BCC H;  2C2A A;  1AR5 A;  4WFH A;  1R3J C;  1XEQ A;  1E79 G;  3H1J H;  2IH1 C;  4JGS A;  4LF7 O;  4YIO A;  1HNZ O;  2JS3 A;  1M57 B;  3AG2 B;  3OM3 B;  1DLB A;  2WPD G;  3CRM A;  4O4L B;  4DRX B;  5LMU B;  5IJ0 A;  1YHQ V;  2OTJ V;  4YY3 O;  3IGA C;  3VOU A;  4DW0 A;  2YUA A;  5JWP A;  3QF7 A;  1AI4 A;  3SDL A;  1SRY A;  1TVK A;  5E79 Z;  3CCS V;  1OZ0 A;  3FD9 A;  3E8G A;  5IWA O;  4FLZ A;  3T1C A;  3CCE V;  1PNK A;  2YXY A;  3APQ A;  4MTG A;  4YHH O;  2WLK A;  1YI2 V;  5KA5 A;  1VIB A;  3IC7 A;  4NB5 A;  2XUM A;  4FM0 A;  3N2K B;  1SQF A;  4X62 O;  3BY6 A;  5FLX N;  5B5E Z;  1HR0 B;  3RVY A;  2W6J G;  2JGD B;  2ZXW B;  4DK0 A;  4K35 A;  2R9I A;  3LDC A;  2CTR A;  4BIO A;  2UXD O;  4CBC A;  2OYQ A;  2FKX A;  4JAV A;  1KP2 A;  2V1D A;  1P49 A;  3QO5 A;  2N04 A;  5IYC O;  2BCC H;  3OT7 A;  4JI2 B;  4DV1 B;  2EIK B;  1VQ7 V;  3ZHS A;  4R6Z A;  1KBH A;  5EBL C;  1SQB H;  5LP6 A;  2AXT Z;  5IWA B;  3D36 C;  1YJN V;  2A7W A;  3CRA A;  3CC2 V;  2AW9 A;  1BL8 A;  2Q0O C;  1QR8 A;  3A0H Z;  4X62 B;  3OTO B;  4LCU C;  1X4T A;  2QKC A;  2ATK C;  5EBW C;  1VQ4 V;  4OPH A;  4I0X A;  3OMA B;  3P3P A;  1EN6 A;  2M6Y A;  3DXR A;  3K59 A;  1N34 B;  3VBB A;  2DYS C;  1K7D A;  1VP7 A;  1EZV H;  1VQK V;  3FFQ A;  5LGT A;  1EFR G;  1YEW A;  2ZNJ A;  4LF9 O;  2WLL A;  4LF5 O;  4CH4 A;  2VS0 A;  3P32 A;  5EBM C;  4DV5 B;  3K79 A;  5IYD O;  4K8X A;  2JK5 C;  4JI0 B;  4JYY A;  1KKC A;  2WLI B;  5J2T A;  1LUV A;  2A9H A;  1L0N H;  4LH7 A;  4ZI7 A;  3K9S A;  1ZUQ A;  5FPO A;  1HR0 O;  3D3I A;  2DYS B;  5EZY B;  3OTO O;  1XMO B;  4WBN B;  4UCS A;  1AI7 A;  3LDE A;  3JAK A;  3E86 A;  2HHH B;  3BAB A;  3GWO A;  1VAR A;  3JCU Z;  1BHA A;  4K0K B;  4JI3 B;  1OCZ C;  1R73 A;  1UPG A;  1W0J G;  1S0V A;  4PDV A;  2KG7 B;  3IJ4 A;  1SQG A;  5JVD B;  1M5I A;  2GHY A;  1T5E A;  1H2S B;  5IYZ A;  4UV8 A;  5J9P C;  4DV2 B;  5B1A B;  1K4C C;  1SZT A;  1G4Y B;  4MVU A;  2DYR C;  4I50 B;  1MZF A;  1FAF A;  5J2U A;  4FLT A;  2Q0A A;  2WAM A;  2LQT A;  3BAA A;  2R9A A;  2EUL A;  1QCE A;  3HKD B;  2PI4 A;  1WPB A;  4F6E A;  3AG4 C;  5L3C A;  4J10 A;  2CK3 G;  1ROP A;  1QLE B;  4RQE A;  4U3J A;  3SPG A;  3H1K H;  3AG3 C;  4HAM A;  4X1I B;  3JSN A;  4BW5 A;  4I4T A;  4YHH B;  4YIP A;  2EIL B;  2Z3Y A;  2E76 B;  2QWQ B;  5LA6 B;  4I0X B;  2QKA A;  2BTO A;  3QO7 A;  4OGQ B;  3TXS A;  3B77 A;  3MHH C;  3ZJZ A;  4Z1V A;  3QG5 A;  4DR4 B;  1YIT V;  2ZNI A;  4CS2 A;  2YIB A;  1WB8 A;  2YS8 A;  1GO3 F;  2NN4 A;  2UXD B;  2F93 B;  4ZKI A;  5GTI Z;  3ABL B;  4UB6 Z;  3RVZ A;  3C90 A;  3RFR A;  1DTO A;  3ICX A;  4LNU B;  3X2Q B;  4U3F H;  1MOF A;  2QTO A;  4J9Z B;  4JZG A;  1IZ3 A;  1G1X B;  2D2C B;  1PL0 A;  2JVD A;  2Q7G A;  2ZD9 A;  3AG1 B;  3MDS A;  1LR1 A;  1IBK B;  4LFA B;  1ZX3 A;  5KMG B;  4AQY B;  3LSQ A;  1S5L Z;  3CRQ A;  1G6U A;  5KUK A;  5IJ9 B;  4H44 B;  5D5P A;  2XAF A;  2UXC O;  5B3S C;  4JI4 B;  3F5W C;  1GAX A;  1XDC A;  2L35 A;  3ZX6 A;  3CD6 V;  2VWK A;  1N33 O;  3CCM V;  1OCC B;  4X8A A;  1K73 W;  4LF8 O;  3QO8 A;  1U96 A;  4DV3 O;  3G67 A;  1Q81 W;  4OX9 B;  4JI4 O;  1WP8 A;  3FB7 C;  5IYZ B;  2D3O W;  1VQM V;  3E8B A;  4ASU G;  3E2E A;  1MSW D;  4TUY B;  5KAF Z;  1BSM A;  2KG7 A;  4LF9 B;  1TVK B;  2PGG A;  4DV6 O;  3OTF A;  1KC8 W;  2XAH A;  2B1I A;  3SPJ A;  2DQ3 A;  1AIL A;  2RN9 A;  3BA8 A;  2EIM C;  1N0N A;  2OIG A;  1KKD A;  4HNA B;  3KG2 A;  1TUE B;  4O2A B;  4KUM A;  1OCO B;  2Q68 A;  3SR2 C;  1NI8 A;  1QQC A;  2YSU B;  4JV5 O;  1K5S A;  3OAA G;  4PV1 B;  1AJQ A;  1YVW A;  3M8A A;  4UCR A;  1J95 A;  1RPR A;  4X65 B;  1PPJ H;  2GSM B;  2UUA B;  1D5A A;  3BPZ A;  1ZL8 A;  2WLI A;  3UQ8 A;  3CCU V;  4JI1 O;  5KUM A;  4TSF G;  1NTK H;  1GM9 A;  2YC0 A;  1OCZ B;  4QE7 A;  4B3M B;  3JD3 A;  4BAY A;  3AK2 A;  2E3C A;  2P7T C;  1P84 F;  2DWD C;  2ZIN A;  1PNM A;  3K0G A;  1VQP V;  2QSA A;  3WB2 A;  4JI8 B;  2B5U A;  3THO A;  5CBF A;  3H1I H;  1W2B U;  4HBN A;  3N27 A;  4W4L A;  1Y76 A;  4YJ3 B;  5FNV A;  3ZHQ A;  3SYO A;  2UUB O;  1YCI A;  2YEV B;  5IT9 N;  1V55 B;  4N21 A;  2HHH O;  4RUE A;  4E4E A;  4LF7 B;  2BE3 A;  4O4H A;  4X1K A;  1XHZ A;  1NQT A;  5EZY A;  3CWB H;  1JVM A;  3CB2 A;  4FFB B;  1I94 B;  2Y69 B;  2VQE B;  1XL4 A;  3LSU A;  4A5U B;  5ITZ B;  1D5N A;  3OR6 C;  3STZ C;  4TV8 A;  1O9G A;  1M56 C;  1H38 A;  3NXS A;  1BS3 A;  4IIJ A;  2H8P C;  3WB0 A;  3ZHR A;  1AJN A;  3VQX A;  2EIJ C;  4OXS A;  5GON A;  4EKW A;  5L3B A;  4IHJ A;  2WLN A;  3H01 A;  3K06 A;  4IT5 A;  3CXH F;  2LGW A;  3WG7 C;  3RW0 A;  4WFB V;  4ZHQ A;  1IX9 A;  1M9N A;  4JPR A;  3GB7 C;  5IJ9 A;  3HB3 B;  1F23 A;  2OCC C;  2HFE C;  1BQZ A;  4B3S B;  1M93 A;  3MD0 A;  5JH7 A;  4TWK A;  2DE0 X;  4JI0 O;  4NXN O;  4D7T A;  1B3Q A;  3ETE A;  1FXK C;  2W0F C;  3AEI A;  1NS1 A;  4B3R B;  2YXL A;  3H1L H;  3KZI Z;  2Y0P A;  3JAR A;  4JI6 B;  1I0H A;  2G38 A;  3RN4 A;  2YEV A;  2ZM6 B;  2BTQ A;  5EC1 C;  2EIL C;  4DR2 O;  4K3A A;  3ZN0 A;  4JTA B;  2EZP A;  4B3R O;  3CCL V;  3JD1 A;  4P9P A;  3D3Q A;  1IDS A;  2YIA A;  1Z5W A;  3OUF A;  5KLV H;  1JFF A;  1OCR C;  5ITZ A;  4ZI7 B;  5BMV A;  1L0L H;  5CB4 B;  4JI5 O;  4GUN A;  4UCV A;  5IE9 A;  2ITC C;  3TGU H;  2P4V A;  1MZE A;  2Q4P A;  2NNU A;  3CC4 V;  4RUF A;  2K1E A;  3OFN G;  2KSD A;  2L6L A;  4DO2 A;  1WA8 A;  3RYH B;  3LSS A;  5LYJ A;  3FB5 C;  2QA4 V;  3I55 V;  4BW9 A;  4BR6 A;  5EC2 C;  2QM4 A;  4PHZ A;  5DEC A;  4D7S A;  1NKD A;  2AZ2 A;  2KKW A;  3HKC B;  3J7A U;  3NR7 A;  1VF6 A;  2WLH A;  4XDK A;  2YIB D;  3T1H O;  3ZMS A;  5K1X A;  4DUZ B;  2ZR3 A;  1Q6I A;  4PEL A;  5K1P A;  5BXZ A;  4I7Z B;  1R6N A;  5C8Y A;  3SJQ C;  3DSQ A;  1IBM O;  3ETD A;  4PD4 F;  1EM1 A;  1SS3 A;  1WP7 A;  4LF6 O;  5LHI A;  4MW8 A;  4O4J B;  4I9W A;  3F7V C;  4O4J A;  3APO A;  5IJ0 B;  2A06 H;  1TUB B;  1XMQ B;  4Z2W A;  2DOS A;  4IGG A;  4LF5 B;  5LOV B;  4FVM A;  1MMM A;  2WLJ A;  1RSO A;  2DMX A;  2ZT9 B;  4N23 A;  3OR7 C;  4LP8 A;  2WLL B;  2BOB C;  2F4V B;  2VQF O;  4EFB A;  1WPX A;  4CH3 A;  2R72 A;  4QPJ A;  1GN2 A;  2R70 A;  4B7E A;  4H0L B;  1V54 C;  2IJK A;  1XNR B;  1PM9 A;  1SQQ H;  1QVF U;  4FFK A;  5FPR A;  2Y69 C;  2CH7 B;  1VEW A;  5IY5 C;  1FFX B;  1R3L C;  1HNZ B;  1KQS U;  3OGI B;  4OPA A;  4RQF A;  1U97 A;  4X89 A;  3K57 A;  5J2U B;  5FL7 G;  1SZX A;  2QKS A;  3RBZ A;  4NTX A;  3RYI B;  5GW7 A;  4BWA A;  4EB6 B;  1NR1 A;  1M90 W;  1K4D C;  1XL6 A;  1NBM G;  1XRE A;  1HP8 A;  2E75 B;  1GM7 A;  4TV8 B;  4DV7 B;  1H2N A;  4J9Y B;  4JYA O;  3JD0 A;  1RFY A;  1GMG A;  1FXV A;  3S3X A;  3WFV A;  1SQP H;  2LFR A;  4FLW A;  5LA6 A;  3DTU B;  1N34 O;  2DJV A;  4FM2 A;  3E8F A;  1Q8I A;  1JMK C;  1HNW B;  1LUW A;  1KUQ A;  1AP6 A;  1JCH A;  5CA3 A;  2H3O A;  1QHT A;  3CJH A;  1LNQ A;  4AQY O;  4X1Y A;  1JA8 A;  3OGC C;  1PKX A;  2ZDI C;  5L3E A;  2WA4 A;  3CP1 A;  3GVM A;  1GN3 A;  1XMQ O;  1YTF D;  2FYU H;  3PN1 A;  4EEQ A;  4DR3 B;  2A79 B;  1K34 A;  1OCO C;  4AHC A;  4FZ1 A;  1OCR B;  3TXQ A;  1WA8 B;  3G6E V;  2AGA A;  3IAY A;  2Y48 A;  5JVD A;  2V4D A;  1SC5 B;  3K9A A;  2M7W A;  4P30 A;  3TJT A;  3BFR A;  1K33 A;  5LHH A;  2IJJ A;  2ODM A;  4JV5 B;  1XNR O;  1JPX A;  2Y0I A;  1JX9 A;  1KMI Z;  3IFX A;  5H6Q A;  4LFA O;  2DN9 A;  4LFB B;  3CME V;  4DR5 O;  4K8Z A;  1GK9 A;  1P4R A;  5JJJ B;  5A9G A;  2Q9L A;  4ZOL B;  2YIC A;  4BIZ A;  5JQG B;  5CA0 A;  3K5L A;  4HYO A;  3PJS K;  5LHG A;  4X1K B;  1N36 B;  5EK0 A;  1QBZ A;  2GBO A;  4LFB O;  3RYC B;  3CCQ V;  1KB9 F;  5J2T B;  4DR6 O;  4GKJ O;  3L70 H;  3FAV A;  2X7R B;  2VRZ A;  3L73 H;  4LC1 A;  4LF6 B;  4X9Q A;  5LBQ A;  2YI9 A;  5KHJ A;  3M99 B;  2FL4 A;  3L74 H;  2LO1 A;  4X1I A;  2A3Q A;  1P7B A;  1EZJ A;  4PA4 A;  3B8N A;  1CXZ B;  2QM7 A;  1SKV A;  4I4T B;  2CTP A;  2F1M A;  1RM1 B;  1H2K A;  2NR5 A;  2P22 C;  3AG4 B;  1KU9 A;  3N2K A;  4FM1 A;  3HPL C;  2K9P A;  2AHY A;  1ENV A;  1NJI W;  5JJN B;  1Q43 A;  4DV3 B;  5CBG A;  4NXM B;  4K0K O;  2PYL A;  4LR3 A;  2QR4 A;  3E35 A;  4H33 A;  3A2F A;  2GTA A;  1CPY A;  5KMG A;  5H5N A;  1COW G;  1VQ9 V;  2GUZ A;  4GX0 A;  4X65 O;  3TK1 A;  4CH5 A;  2CUG A;  4DV5 O;  4GKJ B;  4DR6 B;  2X6C A;  2N74 A;  2ZE7 A;  5HFL A;  1UJW B;  4B08 A;  3SYC A;  3ZBH A;  1S77 D;  4X1Y B;  3T4D A;  2LJ2 A;  3ABT A;  2HVJ C;  4DR7 B;  3ABM B;  1SET A;  2IM9 A;  1KD1 W;  3X2Q C;  3UM7 A;  4R7C A;  2EIN C;  1FKA O;  1NTM H;  4JYC A;  2O57 A;  5LMN O;  2GTS A;  4L87 A;  2P06 A;  3Q4H A;  4X64 O;  2H94 A;  3JAW B;  2QWR B;  1JJO A;  4U7N A;  1PP9 H;  3N2G A;  3JAS B;  4J41 A;  4NXM O;  5JCO A;  4JI6 O;  4LH6 A;  5LL6 Y;  1VF5 B;  3ABK C;  3SPC A;  1HNX O;  5KHG A;  1S76 D;  3R66 A;  2KB1 A;  2WSS G;  3O9O A;  2OCC B;  5B3S B;  1Y66 A;  1Y74 B;  4WFA V;  1YZB A;  3CC7 V;  2Q67 A;  4LBE C;  4UVA A;  4PDR A;  3ZIA G;  3OUS A;  1NZ6 A;  3LDD A;  2HP8 A;  4EFE A;  4MVS A;  2ZKO A;  1PL4 A;  2LFS A;  3B2E E;  1VQL V;  3D36 A;  4O2A A;  5EYP B;  3ETQ A;  1K97 A;  3SYQ A;  4CH6 A;  1IVS A;  3H1H H;  3ML0 A;  5KHK A;  1DF5 A;  4JI1 B;  3CPW U;  2QTS A;  2Q69 A;  1IBL B;  1K5Q A;  1FD9 A;  3JAK B;  3CCV V;  1NTZ H;  1V54 B;  1I7F A;  3ZHU A;  4PJ0 Z;  3R65 A;  4TQD A;  4J7J A;  1VQ8 V;  4Q6G A;  4UCO A;  1Y76 B;  4KP4 A;  3T1H B;  4J42 A;  4GT1 A;  4DUZ O;  4X20 B;  2RDC A;  1MSD A;  2UXN A;  3RYF B;  1IBM B;  3K03 A;  2ARH A;  2F43 G;  3JAT A;  5EIB D;  4MVM A;  1R6K A;  4DV6 B;  4MTF A;  4H13 B;  4CC6 A;  5LMN B;  1IXM A;  3H9V A;  1SQX H;  3L9D A;  2LP7 A;  2OCH A;  2FB5 A;  4JYB A;  3SPI A;  1V9P A;  2RQ6 A;  1WJZ A;  4IHJ B;  2DW4 A;  5LXT B;  3ZS8 C;  1NVP D;  4GZR B;  4JI5 B;  1QR9 A;  4UVC A;  1SF9 A;  4WFG A;  4PI0 A;  1ZL8 B;  4JF3 A;  3JAL B;  4DW1 A;  4X20 A; 
#chains in the Genus database with same CATH homology
 1Y74 A;  1RSO B;  1VF6 C;  3B40 A;  1Y76 A;  1ZL8 A;  1ZL8 B;  1Y76 B;  1Y74 B;  1VF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...