3AG2B

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag2B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag2B02
2MRYA 4BWUA 1OE3A 2JFCA 4DP9X 3FYIB 4G7RB 3FU7B 4E9YA 1YLBB 2IH9A 1OF0A 1OCOB 3ABMB 2XWZA 4GP4B 2CAKA 2CCWA 2H5UA 1ZIAA 2AZUA 5I26A 1CURA 1V55B 3X2QB 1TKWA 2XXGA 3PAVA 1RZQA 2XU9A 2OJ1A 1JXFA 3IN2A 3NJGA 3T6VA 1NINA 1NPJA 2XXFA 4HALA 3S3CB 5ANHA 1X9UA 2CALA 1AZCA 3X1GA 5AFAA 1IBYA 2YXWA 2Y1AA 3NJMA 1QLEB 1NIEA 2GI0A 2ZWNA 4G72B 4YSSA 4HHWA 4HCGA 2YEVB 2TSBA 3NJNA 2FT8A 4HZ1A 2J5WA 1JXDA 4DPAX 2PCFA 1E67A 1MG2C 3C75A 4HAKA 4KOBA 1XB3A 1BXAA 1AQ8A 4KNTA 3NT0A 2YAPA 1B3IA 4MFHA 3S8GB 2FQFA 2BHFA 3T9WA 5I6MA 2B08A 1T5KA 3H4HA 3TU6A 2VSKB 3AG3B 2VN3A 4N4YB 2AVFA 4KO7A 1MG3C 4BWWA 2YAOA 4BXSV 2YXVA 3T71A 3AZUA 1NWOA 2GC7C 4P5SA 5PAZA 3NJLA 3NSYA 1ZV2A 1PLBA 1SJMA 5E9NA 4PCYA 4BWTA 2FT6A 4GYBA 1BXUA 2XYBA 3EHBB 2IWFA 2PPFA 2BZ7A 4F2FA 2BW4A 1XB6A 1A8ZA 3ZIYA 3AG2B 1BQ5A 2I85A 4AI7A 5I6OA 4YVUA 1AG0A 3FQYA 3EH3B 3TA4D 1W6WA 3KW7A 3V9CA 3WKQA 2J56A 2GC4C 1AZUA 2DWSA 4HIPA 1J9SA 5FC9A 5D4IA 4QKTA 1SF5A 4A2FA 3WG7B 2YQBA 4HCIA 2QPDB 1TEFA 1WA2X 2FQGA 3PPSA 4DPBX 2J55A 2UXFA 4DP0X 1AZRA 2CJ3A 3FPYA 3PCYA 4KNSA 3U25A 2VW6A 1CYXA 5I5MA 2P80D 1FWXA 4HCFA 1AS8A 1L9TA 4YSDA 1JERA 2GHZA 2OV0A 2EILB 3OMAB 2XLLA 3FU7A 1N70A 3UGEA 3T6XA 1E30A 1TU2A 2ZOOA 1PNDA 1W6LA 1FA4A 1MZZA 3OQRA 3ZDWA 4YSRA 3QJSB 5B7FA 1CYWA 1BYPA 1GR7A 3PAZA 1W8EA 4DP7X 2Q9OA 1X9RA 2IWEA 1JZFA 2HRHA 3FSWA 4A2DA 4E9RA 1AS7A 2LLNA 2IAAC 3NSFA 4A2HA 2VMJA 3FSZA 4UANA 1M9WA 2HZHA 4G7QB 1ILSA 3X1NA 3WI9A 3X1EA 1BQRA 1KBWA 1JOIA 1XB8A 2DY2A 2GBAA 4Q89A 4DP6X 2PP8A 3ASOB 1ASPA 1F56A 1NZRA 3GYRA 3FQ2A 2W8CA 2BWIA 3FT0A 1WS7A 2DWTA 4A67A 4YSCA 1UATA 5B1BB 2IH8A 3OD3A 4M4RB 2WO2B 4RH4A 3QJQB 1BQKA 5F7BA 2UX6A 3FS9A 1ZDQA 1AACA 3QJRB 1ET5A 1GS8A 1DYZA 2WSDA 1GS6X 4DP1X 3QQXA 1VLXA 2J57A 1KV7A 3ASNB 1SHXA 4G70B 3MX0B 3X1BA 1OCZB 2VM3A 2PP7A 1IUZA 1JZHA 3BQVA 2EIJB 3CVDA 1NWPA 3QJTB 5B1JC 3IBOA 2IDFA 3ABLB 2PPCA 1SFHA 1V10A 3IN0A 1JVLA 3SBPA 2AFNA 2VM4A 4QLWA 2XV3A 1PLCA 4KOCA 2JKWA 3HB3B 2IDTA 2QDWA 1PF3A 1M57B 2HRGA 4YSPA 1N68A 3UAEA 4KNUA 5B1JA 1R1CA 2OCCB 1ASQA 3WNIA 1URIA 2X87A 2YAEA 2NRDA 2BWDA 1AR1B 3ERXA 2PPDA 3CG8A 3WKPA 4E9SA 1WAEA 1RCYA 1OE1A 1RZPA 3L45A 5TK4A 4YSQA 1PZCA 1KBVA 2YARA 1CC3A 5B7MA 2ZXWB 5I6LA 4KO9A 3FSVA 3CDZB 1J9TA 3EH5B 4YSTA 4FAAB 1NIDA 2XX1A 4E9TA 2FQDA 3OMNB 1L9RA 3FYEB 4AKOA 2Q5BA 1NIFA 1GYCA 1ADWA 2E86A 4HHGA 1NIBA 1J9RA 4W1TA 4NAJA 1E5YA 3D12B 2P80A 2QT6A 4NERA 4BDVB 2HXAA 7PAZA 1WA1X 4ZK8A 7PCYA 1NTDA 2TSAA 2IDQA 3X1FA 3T6WA 3UAAA 1L9PA 4ENZA 2GIMA 5AKRA 4YSEA 4KO5A 4YSOA 1QHQA 3IE9A 4JKNA 3NJFA 4UAHA 2PPAA 3CVBA 5LDUA 3DTUB 4G7SB 3NJKA 1ETJA 5I5IA 4YVNA 3NSDA 1AS6A 3UACA 1XMEB 5B3SB 1JXGA 1J5DA 2PCYA 4AKQA 1L9OA 1SNRA 4DP8X 1PAZA 4BK5C 3DKHA 1L9SA 3SQRA 3T6ZA 5IY5B 1NICA 1JZEA 1DZ0A 2H3XC 1A4AA 1BEXA 2H47C 8PAZA 2HX7A 6PCYA 1PZBA 1J5CA 3AW5A 4NB7A 1GSKA 2X88A 1ZDSA 3G5WA 2I7SA 2EINB 3PLYA 1WA0X 4A66A 2AZAA 1OCRB 1AZNA 3EH4B 4E9VA 2YAHA 1AIZA 2MTAA 4K9JA 3HEIB 3NP4A 3NJIA 5TK2A 4GY4A 3CVCA 2FTAA 1HAWA 3CZUB 4F2EA 1EHKB 3QPKA 3GDCA 1I53A 1SDDA 4DP5X 5B1KA 3KW8A 1IBZA 4CSPA 2UXVA 4A2EA 5B1AB 3BVDB 1MDAA 4GP5B 1FFTB 1JVOA 4YSUA 2UXGA 2R7EA 4AKPA 2UXTA 2YAFA 3WNJA 3OMIB 2YAQA 1JZJA 4AX3A 1BXVA 4E9XA 1KCBA 2XUWA 1NPNA 4AZUA 5I5JA 5PCYA 2IDUA 1GS7A 1WS8A 3FQ1A 2DYRB 2Y69B 1QNIA 3ABKB 4F7KA 3DIVA 4G71B 3CDZA 1NIAA 4P5RA 3JT2A 2ZONA 3QJUB 1OCCB 5A7EA 1KYAA 4DP4X 2JXMA 1KDIA 2XV2A 1M56B 1AANA 1ZIBA 2BP0A 2IDSA 4BDVA 5I6PA 1SDDB 3FSAA 6PAZA 3MBWB 1PCSA 1NDTA 5I6NA 2FJSA 2VSMB 1RKRA 4N8UA 3TBBA 1HAUA 2R7EB 2XVBA 4M3HA 1OE2A 2GSMB 1ILUA 4CSZA 1JZGA 1AAJA 1ET7A 3AG1B 3OM3B 4GXFA 1AZBA 2HX8A 4YSAA 2BW5A 4BXVA 4E9QA 2EIKB 1KDJA 2FQEA 2HX9A 4WTQA 4X4KA 3V9EA 9PCYA 3S3DB 2AANA 1SF3A 3S8FB 1ZPUA 3UADA 1HFUA 5D4HA 5F7AA 2PP9A 3JTBA 4PAZA 1ET8A 2BP0B 3N2JA 1CUOA 1E5ZA 2XV0A 2DYSB 3FPXA 1GW0A 3N55A 4KO6A 1BAWA 5EHFA 2IWKA 2GB2A 4UF7C 2I7OA 3SBRA 4A68A 2VW7A 2BP8A 2FT7A 1V54B 3PXLA 3RYMA 3ZBMA 3NSCA 5AZUA 3ZX1A 2EIMB 2XX0A 2WO3B 4JHVA 2BO0A 3ABGA 2PLTA 3H4FA 1J9QA 3UABA 1GY2A 3TASA 4W9ZA 4A2GA 2YAMA 1E65A 4L0PB 3AY2A 5I6KA 1MZYA 4EF3A 1A65A 1A4CA 1IKOP 1OOWA 1SHWA 5B7EA 1SFDA 4DPCX 1A4BA 3S3BB 3NYKA 2W88A 3NJHA 3GXUB 1AOZA 1PMYA 5D4JA 4FA7B 5I28A 1PZAA 1PLAA 3IEAA 1ASOA 3TBCA 2CBPA 2A3TA 3SBQA 2VW4A 3H56A 1ID2A 2UX7A 2FNWA 4YL4A 2BP8B 2QDVA 1OV8A 1EZLA 2FWLB 3NJJA 3QJVB 4GP8B 3WIAA 4JHUA 1JZIA 1BYOA 2N0MA 2B3IA 2QPEB 3FU8A 2DV6A 2HLEB 3EF4A 4TXVB 1KCWA 1AG6A 2RACA 1L9QA 1PNCA 4DP2X 2CUAA 1KGYE 1PY0A 3NP3A 4Q8BA 1TEGA 1IC0A 3FU9A 1A3ZA 3PAUA 4WKXA 3AG4B 4E9WA 2BZCA 2PPEA 1GY1A
chains in the Genus database with same CATH superfamily
3IGKA 2V9RA 4IT5A 1OE3A 1M6UA 2ZX5A 2JFCA 1FYTA 5E8EB 3U1SH 1GJIA 1J10A 4DP9X 4B3SO 1NM4A 3QDJA 3VFTB 3W7XA 1BFSA 1S8DB 5HGHB 2FO1A 4HG4J 5BZBA 1Q9LA 1F02I 3UTTD 3EFDH 1OCOB 4CVZB 1KXVA 3GQFA 2ZE5A 1XMQO 1RL1A 2A9AA 4QIRA 4B50A 3QWNA 3K5OA 3EZJB 2WUBL 3OR7C 4B5ZA 1J8HE 3OL2A 3QH3A 5HJGA 4IGBD 3OE7G 1HSBB 1JXFA 3FZUC 3QFJE 1KJ2H 1NINA 4CJ0A 2HRPL 2J1YA 3T0WA 2PW1A 4PLNC 1GXEA 4ODUB 5T8IA 4QI3A 1BGXL 4OXSA 4TT3G 5F9JB 5IUSA 2DN7A 4XNMB 4OGAD 4YSSA 1U93A 2APSA 5AAMC 2VQFB 1OGAE 1JNNL 4XMPL 1ACZA 2FYYA 1UKTA 5HFLA 3CC5B 3KMDA 1KB3A 2R0WL 3U36A 2W07A 5DGRA 1Y76A 1MNGA 4DPAX 1KC5L 1MG2C 2ZCKH 1F8TL 5CZKA 2FR4B 1DZBA 1B0WA 3BLKA 1RUAH 5CP7A 5BZDB 1NAMA 2ODHA 3IDIB 2B2XH 5EV7A 2X3AA 4NPKA 5EC1A 3VACA 3O2WL 4X6BA 2XYCA 4POYA 5C7ZA 4RIRA 1X59A 5K1JA 5I1HH 4FNSA 1RHHB 4XI5C 5KVFL 3AK2A 2VLKB 2W6JG 3WNOA 3LX9A 4YDKL 2YXVA 2HH0L 1J1PH 3ESPA 4XPAL 4OQTA 2H1XA 2F74A 1AI5A 4LLQB 3JVGA 4E42B 4LESA 1CGWA 5BMVA 4AQ1B 1YAIA 4OGQB 5KLVH 4AILC 2V7NB 4PWIA 3VWKD 2R1YA 2OTPA 5ITZB 1HNWO 1BJ1J 2NT0A 5IBUG 4PRAA 5AG9A 1HNYA 4HUVA 1EXGA 3BPNB 3D07A 1HDMA 2OMVA 5GGUA 4M8VA 2ARJA 2ZR2A 4U6XA 4XHQA 5TH2A 1KPUB 5J2TA 2XTJC 2XJLA 1UM4L 3DX3A 5AVXB 3L17A 2OZ4A 3KW7A 5HYJD 1MSPA 4YPGA 4MMZB 4QMEA 2BP5M 5KHHA 2ISDA 2LV4A 4XC1L 5D1QC 1AO7B 1E5UI 4MKTA 4TUOA 3IDYB 5F7KC 1U8LA 4LOUC 5IYDO 4PP1D 1CICB 3HN3A 4JPIB 4NQED 1BQHB 2JWYA 1JE6A 3U25A 4I48B 5TE6L 1YECL 3ULUH 2O6FA 5LDSA 3S5LG 2Y5TA 4G6FD 2DQGL 4F5CE 1EZVX 1ZLWK 3FU7A 3MRIB 4DN4L 2Y07L 1CFSA 1E30A 4JJ5A 3T6XA 2A1WH 1TU2A 2PWFA 3RWEA 5K9QI 4UCVA 1FA4A 2CKBA 3AU1B 3FT3B 2EIJC 3MRLA 5B1NA 3ECBA 3O2DL 1GHFL 3IXTB 1N8ZA 5KYUA 3IJ7A 1KIRB 1L0YA 2Z4TA 3AXLB 4ZAKC 4L1LA 3CWBH 3DYPA 4YLBA 2CO1A 3O11B 1QFHA 2OMXA 2FHCA 4YE4H 4LP5A 4AH2A 2Q86A 2GSGA 2HWZH 4J3WA 2BVQA 4OT1H 1NCBH 2BCKB 3QEQE 4QY8A 4YXKL 3O9WC 4BEIA 4E9RA 3B7SA 5BMFL 1ZLEA 2H2SC 5HYEA 5IJKC 2OCJA 4LF9O 3P02A 4AVHA 4F6RB 4GRLB 2UZIL 3OR6C 5BQ7B 3RWFB 1THZA 1NGZA 3R0NA 4KTGA 3V0FA 2BNRD 2P7TB 4H0LB 3G5VB 5DD6B 4Z95H 3II3A 2CAZC 2VDNH 2E4TA 3Q8EA 1ZUQA 2ZPKH 4PA3A 1OL0A 1RUPL 2G3ZA 2QVMA 3LZRA 3TXSA 4HAFA 3RURA 2BWIA 5DC2A 3TO4A 1HWWA 1KWKA 4QYOB 3L3OB 3ETSA 4PWFA 1SQFA 2XV6B 1U8HB 4JO1H 2NX5E 5KX5B 4GKSA 3NFPB 2W5PA 4J5VA 1QFWL 4QCIB 2F5BH 1HNFA 4QHPA 5EU6B 4B41A 4F57H 3X11A 2X4TB 4Y5YC 4U7MA 3D2UA 4QRSB 2HTKD 3L4TA 4GH7B 1RK7A 4U3JB 1MJ8L 5F0JB 3FHEA 3M8AA 1ZVYA 3X13A 3KWVA 1OCZB 4DO2A 1NBYA 3LSOA 5J6GA 4LOEA 4R96B 2HT2D 2ADIB 3U9PH 3VRIB 1G7QA 2GIYA 2R2BB 4KDWA 4MSWA 5GGRB 1AR1D 3MLSL 1M7DB 1Q0YL 1WCBB 4X62B 1QSED 4HIHB 5DEJA 3RWIA 1F6AA 3OWRA 5CEYB 3ILQC 2VDRL 2UUBO 1T5XA 4DV6B 2JJWA 1JV2A 3BDYH 1EHNA 1EHAA 1IFRA 1T83C 3RI5K 5E1HB 3QXAA 3L72H 3DK0A 3UZVA 1BZQK 4BYHA 2QDWA 2NY1D 3GWJA 1N68A 1BMZA 1OGTB 1LEKB 3L4YA 1JPTH 4OFPA 1JN6B 3UAEA 3VXRE 3WNIA 2A6IB 3UG3A 2RDCA 2J8UB 5BZWB 4HUNB 2R1XB 4MWFB 4MCNA 3QNXA 3BSZL 3RVWD 5E6YA 1OPGH 3ZX6A 2XWCA 3NDYE 4I0CC 2O57A 4QRRE 3ZUNC 1G1XB 1MFEH 1K85A 2BIIA 1HQRB 4KKCD 4X6CE 3MFGB 1JHKL 5FF6B 2FWOA 4LDOB 1UJWB 3J07A 5CMAB 1EBOA 3VYNA 3UBXI 3FBKA 2JGDA 4MJ6A 2E5LO 5AL0A 1Q9WB 2L3BA 3I84A 1FRGH 1OKEA 3VXOB 1XX9C 2WPDG 4UDTB 2EDBA 3H42L 1GOGA 5DD1H 3D5OF 1AD9A 3H7BA 2GHYA 4YY3O 2DTMH 1T1WB 3MKKA 5TE4L 3T0EE 5JUEL 5F9DC 4BDVB 1E5YA 5DZOA 1O9HA 3VSUA 4GUQA 3QORC 4X6EB 1XCTA 1EFXD 3F62A 5IHHA 1DBJL 3KPRB 4WUUD 1OAQH 5HHPA 1KIPA 4LFAO 2GW5A 1DLBA 3A67H 2OQJB 2GAZA 2WLZA 4HIXL 1J8KA 2JJSA 4R97C 4U1KB 4XMKH 2BNQA 3G5XA 3DMMB 1YZBA 3GS0A 4LMQE 1S7XB 4NUGH 32C2A 5CLZA 5HDBE 3A4AA 1OTUC 4MT8A 5ITBH 1RZKL 5B3SB 1DGSA 1VACB 2DYRC 2EDEA 1ACYH 1FFOB 1YNTA 1SS3A 3O4OC 2B8OT 2OSLA 2Q7AA 2VR5A 2XTSA 3QUXA 1KIUA 4AEFA 4L4JA 2G5RA 4YPJA 3E6FA 5BRZD 2OL3H 4X8GA 2EVJA 5LO7A 1KGWA 1ZLUH 2Q67A 3E9UA 1GSKA 2YICA 1AE6L 4TQIA 1WZKA 3EFFB 4XZ4A 1U8PB 2H32H 3GRWL 3K3WA 3LKSA 4AQEB 4MCZB 4BFIA 1IQDA 2ZDIC 2LFRA 1K5NB 2A4CA 5T1KA 2CPUA 5LWYL 3B8YA 1CDCA 2MTAA 1YMMD 2RHEA 4LKCB 3B3IB 3FRPB 3CVCA 4M3KB 1KMIZ 4ODHH 4X9BA 1AVMA 3NRQA 3VE0B 3P73A 4A6YH 4EI5C 4TUJA 5JHDB 5DJ6A 2GJRA 1VSCA 2YGNA 5LXVA 4LF4O 3ULVL 2CM6A 5HGDA 4NZ8A 1W8NA 1TENA 1TEYA 2NUPB 3P4MA 5DRZB 2PYED 1IT9L 2ESVB 2Y2YA 1FFTB 5GRWA 2Y48A 1AZVA 2LABA 4M7ZC 3M7MX 3EOAB 4NQXA 4AGLA 4B0MM 2GY7B 4I18C 3VQ2C 4WTWA 4UDUB 2M8XA 2I24N 5FA4B 1HWYA 2G2PA 3Q06A 2Q8VA 3W82A 3IC7A 4JRWA 4N0UE 3ZHSA 1A1OA 1SA0A 1G5GA 3PIQA 4DF9A 1IBBA 4N5ED 3BIKB 3NIFE 3BGMA 5DTFA 4YXLH 3UTQB 1XBRA 3CQFA 4M5ZL 3BKYL 3MLWH 3OAAG 1I4FB 2ZNIA 3MODL 2IC2A 2EDFA 4IU2A 5DHXB 3PQYD 2R29A 4PPTA 1YNTF 4AYSA 4ECNA 4IJ3B 5KOVC 2FGZA 3LDCA 5I18L 3MJ7B 2AJ3B 1F1DA 5DZNA 1FV1A 2WAQA 3RY5A 3WSQL 4Y4FD 4ISVA 4KI1A 5L8JB 4PVLA 1XREA 4L8BB 1I08A 5CJOL 2VQUA 3K6SB 1TETL 3D48R 2CLRB 3HFFA 3IETB 4KKBD 4W6XB 2EUZA 1O9VA 4J3OG 3BQUA 3QG7H 4O51A 2WA3A 4XDLA 2A6JB 5E4IA 1AC6A 3CPWU 4UQ3A 5B21A 2ENJA 2GUOB 2V5SA 4JKMA 5HPMA 3L95A 4ZUUA 2VDKH 3H9SB 3TT1H 1JZGA 3NDZE 3DUHA 4HDIB 3PHOA 4ONFL 4UU9B 7FABH 4IBZA 5ICZB 5H4ZA 3JCUZ 4KL1A 1KCVL 4R3SA 2HX8A 4GJTB 3RB5A 3KS0H 3KYOA 3O6FC 4X6FB 4KK5C 1FFPB 3RL2A 2ATPA 4QKXB 3W39B 2W80C 4ZMTA 1FO0A 4OCRL 4WTQA 4JO5A 3ZDXB 3CSXA 3D8MA 1LMIA 4KJWD 2EDXA 1A7PL 1ZPLA 4E36A 4KI5E 2ZAIA 4JPSA 2W60A 1INDL 4D9QE 3BHBA 4N68A 1NUNB 4N9GB 2XETA 3UBXB 2Q8AH 4U1LB 5D4HA 3ZUCA 2FWSA 2NY2B 1C12B 3O6ML 1K8DB 1BVLB 3L1GA 3NPSB 4FFVD 5H37A 2JI1A 3JARA 1E5ZA 4MVUA 5LBSL 2KKWA 1NFIA 1YHPA 3HPLB 3MBEC 5D70L 4LRNL 5EWIL 5DLLA 3TEUA 3QIBD 3FPXA 1EJOH 3SE4A 3OUFA 1M71B 1NT2B 1CZ8H 4WV1C 4KO6A 5LOVA 4BZ1H 3X12A 1IXBA 2BSSA 3JBG7 4Y5XC 3VXSB 2D73A 4CC6A 5GONB 3C8HA 2DMXA 5D96C 3PGFH 4UQBA 2PO6D 4IL6Z 5GISL 5E5MA 1WQVT 2QJ1A 1G9NL 1QACA 1MEXL 3PXLA 5C0AD 3VX1A 3O8XB 4I9WA 5KUMA 3KCPA 1I9EA 4RNRB 2SEBA 1H2GA 2KLSA 1HKLL 4NJ9L 3A24A 4K0OA 5KSBB 5HHQB 1NR1A 2IJIA 4MA8L 2UUCB 4N2MA 1AIFB 4YAQB 3QFDB 3TEZA 1XGTB 4XPGH 4EZJA 2AGJH 4DERA 5LJYH 5C0CB 1TTAA 4JG1H 2MPAL 4X2UA 4AVJA 2HLFC 4MCYA 3RZCA 1NCNA 2XBTA 4P2CG 2YUAA 4LEOA 1NBCA 4R7NB 5E8NA 2AEWA 1VKXB 4FFZL 5DQDL 4APQD 1GGTA 5E8EA 1T89A 3DROB 2AJXH 2C34A 1B3JA 3HBZA 4QGYA 1IC5L 3FQNB 4PBWD 3VFTA 5A1AA 2ZNWA 3TPUB 1S8DA 2D3NA 1FLRL 5HGHA 3PP3H 2QPUA 3TBCA 3TFKD 2XOTA 4CVZA 1YEEL 4NKOB 3S35X 2WCPA 3V6OE 1I7TB 1PAMA 1PNKA 2R9AA 1XH3B 2ZYHA 5A2IH 1SY6A 2X6UA 1XWVA 5DEFB 2VSDA 3EYFB 4PJ9C 2XZCL 2LO1A 2QPEB 1RZ8B 1KJ2B 2DPKA 4UOJA 4E9LA 5IJ0A 4PBDA 3LQAH 1XDCA 1FZJA 1Q7YW 1R3JA 3ABTA 2DIBA 2RACA 4F7TB 3B7TA 2OKMA 3FW6A 3O9OA 2JIXB 3GTNA 3CFNA 4HT1L 3TIEB 1PY0A 3NP3A 5F9JA 3DX0A 4OZHB 4WI7A 5IVZB 2EVGA 3CZSA 5FYLD 3S3WA 4UCRA 1AGBB 5EIBD 2VQTA 3CC5A 5EUOE 4CH5A 1WFIA 3MACH 4XP6H 4ZPTB 2NY5H 1OF0A 2AJYH 4Y2LA 3ZDYB 1XR8B 5BZDA 3GHPA 4OLZH 5AZEL 1MNNA 2F23A 4W9LC 4NHUA 3H55A 4MVBC 1H19A 4RLDA 5E2JA 4AIOA 1OGAD 1YN6B 1RHHA 1UFUA 2O5YH 3MOBH 4X4ME 3OV6A 5H2BB 5KVEL 1YYML 5IFAL 3FFCA 1S7TB 1LDPH 2KKQA 3QQNA 3JVFC 4LLQA 1ZSDB 4AQ1A 1WZAA 2V7NA 3FL7A 3U2SA 3D0LA 1R24A 4QTIL 4BKSC 2EKSB 3ZE2E 2PYLA 5AQ0A 3ZJZA 4D0CB 5L4FA 4RRPA 3AS3A 5SX5K 5EZIL 3MRHB 4M62L 2R70A 1AJPA 4M5YH 1WP7A 3CMOL 3BUBA 4QPJA 1A6ZB 1FPTL 4MMZA 3U0ZA 1G9HA 1KTKE 4F37F 3PL6A 4U7NA 1AO7A 2CIKB 2CHZA 4O58L 4XCNB 3SY6A 3ZZQA 1TJGH 1CICA 3QHTC 4M1DH 4P23D 4OF8A 5CJXA 2IQ9H 3EYOA 3OGCA 1GYUA 2C5DC 4I48A 3T71A 4RGNE 2Y1YA 2FX7L 1PG7W 3HZKB 1UD4A 3QYNA 3MRQA 1MCLA 2UWEE 3VFGL 2ZX6A 3BFOA 3NJLA 3NSYA 2F9BT 3B83A 3MRIA 3QUYC 4PGZA 5JW3H 3U0WL 2VR9A 4GYBA 1KCSH 4LF6B 1BXUA 4B9KC 4BFNA 1CEZA 4ZS6C 3ZN0A 1I1AB 3WL9B 3AU1A 3FT3A 4HKJB 1GGYA 3F5WC 3A22A 3RX8A 4DR1O 3PS6A 4I0PC 4A2MA 1KIRA 5C08A 4F1ZA 3AXLA 2MNWA 2FJHB 5AW1B 2P26A 3HMXH 2DYPB 3STLB 1QPKA 2WVTA 1BREA 4AE0A 1PS3A 1F4YL 4HHAB 2FL5B 2ICEA 4NHCL 2AABL 4GZRB 2VAAB 2BY3A 2ZP0T 3PPSA 4YEEA 1Z5HA 5ESVB 4I13B 4X8XA 3PJSB 1UHVA 4JFXB 4IOFC 5BQ7A 4HVBA 2XIIA 3RWFA 1D6EB 1UGKA 4DAGL 4U6YB 2VDNB 2YIHA 3FT9A 3G5VA 3IMWA 4YSDA 1P5UA 3C6EA 1JRHL 1YEKH 4CU7A 1BZKA 3B09A 4AIZB 5E4OA 3UGEA 3BWUC 4ODSL 1U2CA 1QI5A 3L3OA 1KFAL 2MKLC 4LCCC 4U4IA 5E6RB 3QQ4B 2XQ0A 4GAYB 5KX5A 1F97A 3LB6C 5D7IE 5KG9B 1U91B 1N8RW 1BZ7A 3IU3B 3R4DA 1RZKC 3ABLC 3STBA 2A74C 4PRIB 3KBHE 4MX7B 4O4YL 5F1KC 3VXUB 4B3RB 2QTVA 4JYBA 4QRSA 3RUGB 3QZWG 4U3JA 1NC2A 3ZSSA 4KXRA 4AOFA 1DQQA 1JPXA 2Y23A 4U2YA 5A43C 3DWTA 1GH7A 2R2BA 5GGRA 1ZVNA 4TQPA 1HZHH 3AT0A 1UZ8B 2GG1A 2Y5EA 2GTSA 1FJGO 1M7DA 1ZTMA 3LHPL 3NXSA 1IIIA 4L1DA 4NCC1 4LL4A 1A6WL 5EU7E 4JYAB 4HIHA 2K6WA 3EOTL 3MV8A 3HUJB 4NUMA 3ZRCC 1L3NA 5F2VO 5LGNA 1MH5A 4G9FA 2O72A 2QVKA 1T2JA 5C0IB 1VQNV 2B3RA 1KBGL 5DD5H 5AVZB 1KELL 1MRCL 1F4HA 3C3TA 2AV1B 4PA9A 3GHEL 2XN2A 1RIVL 3SYPA 1J0YA 3H7LA 2OMNA 4LSTH 1LEKA 5F7BA 1JN6A 3GLDA 4BSJA 2PYJA 2A6IA 4NO5B 1XGPB 4KK9C 4UV4L 2GTQA 2H1PH 3ARBD 3BAYA 5BZWA 3ULVC 3SKUD 3U48A 1LO5A 1X7SA 5E4EB 4WEEA 1YVLA 3HG4A 4LSPL 3ZU8A 3B6SB 4MVZA 3X1BA 4KXBA 2Y36L 3GUFA 5FF6A 2Q3XA 4JM2B 2WN2A 4J8RB 3LQZA 3HA0A 3HE7D 5CMAA 3VXRD 1ORQC 3OR7A 4J4PA 4IKNA 3BP4B 4HEPG 4JFTA 2HG0A 1CLZH 2IPUG 1I8UA 4XBPB 1LO0H 3JZ7A 4P2OC 3RWJB 4LVNC 4UDTA 1QMUA 2VM4A 3D2TA 4AI8A 1YEGH 2BSDA 3UAJC 3ARDC 5EN3A 3MUUA 5CFHA 2AI0H 2MQGA 2XPYA 1KTBA 1KJ3H 3T1YO 3CSFA 4TNFA 4YDNA 5HHMB 4LLMA 5AAMA 5HD8C 5FW7A 3P2TA 1HR0O 2BC4B 1U96A 1ZKAA 2C1PB 1URIA 3OTFA 1OZTG 4NC1C 3IGAC 3HZMB 1DVSA 3CFEB 3K2UL 1RZIA 3HC4H 3KVQA 5D7HA 1E3FA 5AB2A 1BIHA 2OQJA 3SODB 1T1XB 2CJTA 3JXAA 1EFRG 1VB9A 1CDHA 2CBOA 4KMTL 1NKRA 4U1KA 3WEAA 3ZKMC 3ML0A 4FN0A 1S9WA 2YUWA 4OLEA 4LHUA 4JV5O 3LEYH 5IBUB 1C5BL 5AEAA 1IAKA 3ZHRA 1VACA 5FWQA 3MYJB 1RXLA 3OPZL 4NQDD 3NTCH 1IBLO 3JD1A 1U8NB 4LPYA 3OKLB 3CJHB 2OL3B 5D7JA 4N2KA 1PX3A 1KXQA 3FN9A 1GYCA 4KQ3L 4X0KA 1GRJA 1ONQB 2WXGA 4DUXA 2H32B 2ZR3A 4OJDH 3CZGA 1U8PA 2HXAA 4GI9A 4AQEA 2HG5C 4NQCE 4MCZA 5I0DA 2J3SA 2F95B 3MGAA 2JNZA 4UOW1 1K5NA 1WFJA 2M7WA 3ZRXA 2CO3A 2OT5A 3BVXA 1E40A 4MRCA 2PPAA 3S5LB 2XNAB 4YWGH 3CD4A 4DGIH 4LKCA 3B3IA 1ETJA 3FRPA 1NFAA 4PLOB 5I5IA 1GK9A 1CBVL 4A6YB 2CO6A 3W9DB 5I8CB 1SQPH 1S7UA 5D1QA 2D4DA 3VE0A 5JHDA 3UACA 4IBUA 1Z6JT 3QXUA 4RWYH 4A7SA 1L9OA 1PAZA 2GBVA 2QFRA 3UGXA 3EGDB 5HJ3B 1LE9B 2ESVA 1DZ0A 2BS8A 2H3XC 1BEXA 5BOPA 3BZEA 1Y0LB 3EOAA 1ZLDA 4LR3A 4NB7A 4LNUB 2FJFB 4UDUA 4DW2L 1FP5A 2PR4L 1QO3A 4IBQA 3CN0A 4LCIH 4XNZB 1VCAA 5AZ2L 5CBEA 3MCLL 1A1MA 2RMNA 3T0DA 4XVTL 3BIKA 2DQUL 4UT9H 3UTQA 3EFOB 3ZPDA 4YR6A 4FABL 2QPFA 4PWEA 3LDBC 4ZAKA 3NVQA 3CZNA 4AUYA 3FUDA 3RTQC 3QEHA 4FQXC 4ESKA 3C5ZD 1CDGA 4LVEA 3BEWA 1F11B 1XF2B 1JZDC 3O9WA 2KH2B 1A14L 1FVEB 5HHVL 5F6HJ 3UDWC 5IJKA 1EHKB 4JFFB 1BFVH 5SV4A 3DUSB 3K6SA 4BAYA 3IETA 2CLRA 2Y3NA 4U1SA 5B1KA 4JG0H 4LC1A 3SIKA 3CE2A 2NY3B 2W0FC 3T4YB 1XFPA 3L5WB 1R0AH 1XF1A 4G80B 2VDKB 2YAQA 4JS7A 3U6RB 3H9SA 1KCBA 4HDIA 3FSOA 2YQGA 4UU9A 4OB5H 4WFFE 3T2QA 2X0VA 3TLRA 3VFSA 1ZV9A 2XWTB 4U7KA 5LG1A 1YHQV 4HLZG 1MJUH 5B1CA 1FZOA 3C6LA 3LV3B 3N6YA 4X6FA 1FFPA 4XNQA 2DYSC 2YD9A 3VDCA 1I94O 2V3EA 1WFNA 1X5LA 4Q4EA 4OZ4B 3P3PA 2VQEO 1CG9B 2CA4A 3GO1L 4Y5YA 1RM1B 3MLPA 4QOKE 2R8SL 5FPOA 1CF8H 1IVSA 3BH8B 3GXMA 2QKCA 2DQEL 1XGYL 4N9GA 3JQOB 5DHYB 3UBXA 4EI6A 1KYAA 4EUPG 3WIFA 1FLTX 4N2IA 3FU5A 1BVLA 2ADGB 4JGUA 1JTOA 5LHHA 3K0YA 1TPXC 3HPLA 1K73W 4YGVB 3U7AA 2DMHA 3HI6L 1R6VA 5IHLB 2NZIA 1NDTA 3K0GA 4Z1VA 1YRKA 3D36C 4FFYL 1D9KC 3VXSA 4DK6A 4BH8B 5GONA 3D9AH 5KYXB 4QHNB 5KJRH 2XC8A 3AG1B 3WFBH 4UCTA 4RNRA 1A6UL 3IT8D 4KGLA 4OV6F 5GS2D 2WPGA 4UQ2B 4FLTA 5HHQA 1FH5H 1B3QA 2NQDA 1GYAA 4D3CL 1AIFA 5D7LB 4YAQA 1KCKA 1XGTA 2E27L 2NY4D 4OD3H 3KGUA 5C0CA 5SWQB 4W4LA 3KL3A 3MJ6A 4HS8H 5DFTA 4EEEA 1ZMYA 4N1EA 4R7NA 2NSQA 2NZ1A 1LMKA 3HC3H 5AYTA 1VKXA 2DWDC 3K8LA 3DROA 4JPVH 4R4NC 1QR4A 5CINH 3UAFA 2IH3B 4HQQL 1KTLA 4ZMLA 4TULL 3TVMB 3PGCB 4Z6AT 4L1SA 1UWGH 1MAML 1T5EA 4NKOA 2A5UA 2F15A 3SBRA 3H0TB 4PRHD 5GS0L 2ZX8A 5IVXA 4U33A 3BRGC 2L7UA 1FNSL 4FJ6A 4OFIA 4YHLL 1RHFA 4FM1A 3EYFA 4DR4B 3K2IA 2WO3B 1HH6B 3OKMB 1KJ2A 5CN2A 4PJXE 1NA8A 4IHJA 3QORA 4U6VH 3ZMTA 3U9UB 1WJ3A 5EORH 4F7TA 2N59A 3FO0H 1QRKA 3SCMB 2X05A 4Z7NB 3QULA 1M5IA 3TIEA 3H1IH 3ARUA 4PBXA 4N0YL 3CC4V 1TCRB 2WCGA 4GKNB 4OZHA 5IVZA 5HHOB 3EBHA 1GTFA 3VQYA 1AGBA 1R3KC 2LLGA 4LLVB 2EUWA 3RYCB 4I55B 4HPYL 4PJ0Z 2F18A 1FL3B 1C5CL 1FGNL 2VJXA 1IGTA 3LQMA 4ZPTA 4CADA 5I28A 2A83B 1PLAA 1JPFB 2Y06L 3B4NA 4IKJA 4YBLC 4JKPH 3NRFA 2YD4A 3QR0A 4MJ4A 1EHXA 3QW9A 2CBPA 1XR8A 5TF1H 4K3EH 2P4AB 3EYVB 1YY9D 2VW4A 5I76A 3OTOO 4H2AA 3MRFA 8CGTA 4JFZH 4LPWA 4U1GB 2CBTA 3O45B 3VCLB 2QQQA 4PCSA 1BSMA 5HP5A 1QP1A 4N8CL 4PJ7E 4OLYH 1DF4A 3BISA 4JO3L 3F58L 3FTXA 1CTNA 4YHPB 5D6DC 5DHEA 5GGQL 3FU8A 3S36L 1H6FA 3HBQA 1TJIL 1CBJA 5T1DL 1WLEA 1AG6A 3PDOB 1ZSDA 5EZOH 1CK0L 5L7XH 4PVMA 2ZDIA 1YYLL 2WO4A 3K8MA 4WSJA 5F93C 4TLUA 3ARTA 3PAUA 5G55A 2EKSA 4K7PX 2WBWB 3SE3C 3AG4B 1GN3A 4XO3A 4D0CA 5EG6C 4WFGE 4DK5A 3AG3C 2GJ6D 4YVNA 2C26A 3VVWA 1EXUB 5AOLA 5IVXF 1VGKB 2AJVL 1BHAA 2NQ3A 3WUZA 4IU3B 1F41A 3MTRA 4JPQA 2DQCL 4HUXA 3E8FA 2F8OA 3BWSA 2VXTH 4MZ2A 3RBGA 1SQMA 4GBXD 1X4XA 4OZGB 3APFA 3D3VE 2DEWX 3EYSH 2XXGA 5FLVA 4ZQKA 3MNWB 1TUBB 4B9IA 3O0RL 5KSAC 3HKBB 2ZAHA 4OZHF 5EA0H 5IHZB 1B6UA 4GYCB 3ARVA 5GGTL 4JFEB 1I5XA 4HALA 1GAFL 1URLA 1L6ZA 4IYKA 5CU5A 4G8GB 5F6IB 3G04B 5ANHA 4F58H 2VZ1A 1I3UA 1RVFL 4PG2A 3QZPA 5C0NC 4JFSA 3WU2Z 1P69B 1OHHG 4LL9A 4D8PA 5LMUB 3ZBHA 4IS6B 1J5HA 3IRCA 4UV8A 1I1AA 2VH5H 5EEZA 2EXWD 5I66B 1CE6B 2NW3B 1O7DE 3DJSA 1CXHA 2F1EA 3P0VL 1JXDA 3VTTA 1GL4B 1ZT7B 5CEZH 5JXAL 1QPXA 3RL1B 4DN3L 4HLZH 1TZGH 3EHBD 2GIXA 1BXAA 1X5AA 3CQPA 4JQXC 5LN4A 3F7VC 2I26N 2OCHA 4PJ5D 5FYJE 3IJ4A 3F7KA 1URZA 1UASA 3GIZH 2VAAA 1DCLA 2BVUA 4IJTA 2RCSH 1A3LH 3WAKA 3DVNB 5ESVA 2B1HL 1P7QB 3PJSA 1JD9A 4JFXA 2YI9A 3UXFA 3TK1A 2X1XR 2W81C 5IT9N 4EUPH 5IP4A 4U6YA 2VABB 5I71B 3CRAA 3AZUA 1F51A 3O6FA 4UNIA 2IO5A 3UJIL 3I9GH 1R3LB 4AIZA 1PLBA 1I75A 1TO4A 2XBDA 4FM2A 4OM1H 3IPEA 5H8DA 1W80A 4NFCA 5EEXA 2XYBA 4P46D 2IWFA 1QLEH 2PPFA 5EBMB 1JHLH 1SQQH 1DVFC 2PTVA 3D4CA 3ETBF 3QQ4A 3C60B 4GAYA 3HR6A 3SJVD 4NRZB 1AGDA 3WD5H 1TNNA 3IU3A 1RLWA 5DJZA 5I19H 1XIWC 1RSFA 2Q1EA 4MX7A 3BAIA 1MVUB 5CBHA 2FYVA 4CU6A 3ULUF 2H9GB 2A9HA 3RUGA 3E0GA 4XCFH 3N1GC 2YBGA 4L23A 3W7WA 4WV1A 3WG7B 4W9FC 3AREC 2EULA 3ARPA 2JS5A 4Y5XA 2ZF9A 2YGQA 1UZ8A 4OGXL 4ONHA 4DW0A 3KPMB 1TITA 1DEDA 5L4IA 3GI8H 3TESA 2R0KL 1W0WB 4JKWA 3TM6A 4OCXL 1HYSC 2XVGA 2AXWA 4N90D 3O3UN 1PJ9A 4OLXL 1A6AB 3SPJA 3CBJB 4WVRA 1YF2A 4YHKH 5J7CC 3C9NB 4PU2A 4LGPB 1W6LA 2WMPA 5I1EL 3N44B 3DHMA 4L3CA 3TBTA 1MZFA 1BYPA 4HISA 4Q20A 1XGPA 3UEQA 5F7HA 1OEZW 1JFQH 3LTVA 3UTOA 3GXIA 2AEQL 2D2CC 2XZAL 2KPWA 4TOYH 4R2GD 2AW9A 4GFTB 2A6DA 5EDXA 4L3ED 5BS0D 4DR7O 4P2QE 2BCMA 4FVMA 4JM2A 1HE8A 1N5AB 3TN0B 5J3HD 1CWVA 3ATAA 2J1WA 4GKZB 2X4SB 4J8RA 3QXTA 2PTUA 2R69L 5MP6L 2GITA 2V17L 4NOBA 3BP4A 1YMHB 1R17A 4PJ9A 2ID5A 2DL2A 2PP8A 4AGPA 1KULA 3O2DA 3I50H 1OP3K 4EN3C 4NTWA 4Q97A 1UM5L 3FQ2A 3BT2L 4CH3A 2PN5A 1Z5LA 3NH7L 1H3PH 3WFDL 3WYRA 2WO2B 2D7OA 3SDXA 1Y6XA 2L6LA 3RUGF 1G1KA 1TQCC 1PD0A 3K80A 2D03H 3LSUA 1BECA 1OW0C 4DV1O 2K6ZA 4RMBA 5IK3A 5CD5C 2WWOA 3HZMA 3BA8A 1AY1L 3BPNC 3CFEA 4Z8FH 4LCWD 1E9QB 3QQXA 2YZ1A 3HKFA 3IFOB 4IBSA 1T1XA 3KJ6H 4DTGL 3E1ZA 1T7YA 1OSPH 5E9DE 2NY6C 3MO1A 3WDIA 2R4SH 3CVDA 1T7WA 2YK1L 1Y66A 2AMUA 2WNWA 4J39A 3CVHL 2A77L 3E2HB 2Y4TA 4EE2A 3E89A 3AFLA 4HJTA 2WBJC 3IGLA 4GEIA 5CKAA 3CJHA 2HJKA 2OL3A 3DJZA 5F1NB 1SRYA 2X41A 1ONQA 4FP8H 4PJHE 3SGKA 5JO5A 2A9DA 3NABL 1N6QH 5J4MA 3NIGB 2YIBD 2ZOWA 3WOVA 3GSVB 2BSEA 4JM2F 4LFBO 2H8PA 4N6RB 1MJJB 4X65O 3SQOL 1JV5B 1U6AH 3P2DA 4YL9A 3WKPA 1Z9SB 2A0LA 2XNAA 3PHSA 1MABG 4N8VG 4LPUA 4XVSL 4J3VA 1TZOA 2VITB 2Q8BH 4JFPB 4A6YA 2QQKL 3W9DA 1CD1B 4GQZA 3ILPB 1IJNA 4MLSA 1DUYB 2BOLA 4XN8A 2VDML 4NQCD 5JDJA 4KO9A 4OLWH 3SDXF 1U92B 4GSUA 4M6NL 4U1NB 3BAWA 3Q8AA 5HJ3A 5KS9B 1LE9A 3M8OL 1KGCE 3JYBA 1A3RH 4Y8AA 2E59A 4EPSA 1S5HB 4EN2A 2VL5A 1FIGL 2B0SH 3ZT6A 3QUYA 2EDMA 4LNUA 2FJFA 3EJSA 4JRYB 4L1BA 2P80A 1NTMH 1ID5I 4QJ4B 3BVVA 3M1OA 2IDQA 3HKCB 2LT9A 3HZYB 4NZDA 3V5HA 1PU0A 4IHOA 5E1AB 5E8DL 4JREC 3EFOA 4I0PA 1QHQA 3IE9A 3HHSB 1KPVB 3BWZA 2JVDA 3QUZC 4XTRD 3OMZA 4DQAA 1G7MB 1MCCA 4OPHA 3FTYA 3QDHA 2FBJL 3ZHNA 1NLDH 1V7NL 1XF2A 3ROOB 5C86A 5GS0C 1HH9B 1J8SA 5FM4A 1AS6A 4FCHA 3J27A 1NUDA 1IBKO 3DUSA 2WXHA 2YPVH 5F8RC 5JOFA 4DRXB 3TCLB 4H1LH 1SQBH 4HJ0D 1SVBA 1L3WA 3T4YA 2VO5A 4ALAL 4P2RD 3VGFA 4I9QA 1RSYA 1ETZA 3QEGL 5D93B 1E7UA 5JHBA 1MCPL 4WWKD 5DF0A 3B4SA 1JPSH 4KTEL 2XWTA 1COBA 4NPYA 3WY1A 3CCHB 2BK8A 1S2EA 3CZFB 4LCCA 5L6YH 3LV3A 3MRCA 1BAGA 1XMWA 1KIQB 4XXCA 2G2RB 3W7UA 1BZ9A 3R19A 1HQ4B 1SF9A 2D3OW 4GS7C 4MJIB 5IMMB 3CFDB 4MJ2A 2A74A 3WS6A 5MHSE 1CFTB 1GJWA 1F4WL 1H9VA 1N0LB 4B96A 2UXDO 4KZCA 3PV7A 4G27B 3VQLA 4FULA 4AGNA 3KXFE 3BH8A 1Q9OA 3NCYP 4PRPB 1JMZA 4V1DE 4GXVL 1S77D 3GJEB 1HAWA 3TEXA 4DKAA 5LGHL 5LGYA 2MCPH 1NEZB 3BAJA 4XCEB 4W9JC 4AEEA 4PCTA 2GYSA 1GCFA 1PZ5B 4YGVA 3GRWA 2Y7QB 3ZDZE 4JPKH 4ZD3H 3HC0B 2F8VA 1B2WL 3NZSA 4YE4L 3C3SA 1UD8A 3D85D 3B1TA 4KVCL 4LO9A 5F96L 1YPZE 5KYXA 4S2SA 1HCZA 4AL8L 4W93A 3KPNA 3JV6A 3S5YA 3QZLA 4WU7A 4EO5A 4A1RA 4UQ2A 1GKEA 5IJBC 3Q2CA 4DR6O 3B5GA 5BPPA 3OKEB 3CLEL 3LPOA 4G71B 1H3XA 5D7LA 1MRFH 3VFVA 3PHAA 2ZE6A 1XSIA 2O5XH 4Z95L 4XVJL 3OG4B 2C9AA 1AJNA 4Q52A 1YY8B 1JFFB 1J0HA 4HIEA 3JATA 1VEPA 2QTSA 5EO1B 5JJJB 1V54C 5DI8B 4JO1L 3MNMA 2YUZA 2GUZA 4HUMB 2X7RB 4PB0L 3SYOA 3FB7B 1J8HB 3DGDA 4O4HA 4NO2B 5F1OB 2OP4H 4X5XB 4R4FH 1KKCA 3CCVV 1ORQA 4ZDHB 2OYKA 4KK8C 6PAZA 5JCOC 5AENA 5DCCA 3DXRB 3G6JE 3PGCA 1KEMH 3LKRB 4MVRA 3H0TA 4M6OL 3S97C 3WNNA 1AHKA 5JIIA 3IGFA 1WBZB 2Q0ZX 4NT6B 3KWWA 4FFTA 3GBLA 3UAJA 4JCLA 1WH0A 2UXNA 1AZBA 3N9GH 4LSRL 1HH6A 3K2KA 3OKMA 1SVCP 5G4MA 5C2BL 5LGJB 4K8RD 4UQCA 3L3KB 4HF5H 5DJCB 3IGAA 3SCMA 2F1BA 4AEIH 5HHOA 3UX9B 2UUDK 3W7TA 1P6FA 3QO5A 1I0HA 3S8FB 3DSQA 1S3RA 2IIJA 4LPTA 3MMEB 1ET8A 2KPNA 4H40A 4PIBA 1NMBL 2EO9A 3K5NA 1FL3A 4PJEE 1CFVH 2A83A 1JPFA 1T80A 4JFHE 3JT0A 4RAVA 1GW0A 1JPST 5DMIH 5EHFA 3EYVA 4ZMYA 3SYCA 2Z7WA 3O45A 3VCLA 5BV7L 3RN4A 3GI9L 4YK4C 1T4KB 1F6LL 4ZUVA 2PCFB 5GZND 4KHPO 1D7CA 5E00A 5DS8B 4YHPA 2HPOA 2C3HA 2G30A 2HG5A 5J9PB 1LR1A 5KVGL 2YD7A 4L48A 3PDOA 3IJ8A 4XPFH 4L05A 3SDAB 1LP9A 1PD6A 4L0PB 2VXVH 5LBSA 1NBVL 6TAAA 5DMKB 3WHE1 4EBQL 1SN5A 2AQ3A 3Q2WA 5GJTH 1ZGLP 5DD1L 3I56V 4EIZC 4DSYA 4U7OA 3Q6GH 4GUPB 5BUGA 2P6JA 2XKSA 3D69A 3S3BB 2VXSL 1QPPA 3E8VA 1EXUA 5C0JA 3QCTH 1KN4H 2YWYA 3K6IA 2X6CA 4NQVB 4ZZKA 4YX2H 4JQIL 4EZKA 4RETB 3TJHC 3WGUB 5LCVL 1EM1A 5LMNB 1PZSA 2XTJD 3CN2A 5C0FB 1KYOF 3GLAA 4CSTA 2Q7NA 3FUNA 1YTFD 2J1KA 3X3GL 1EDHA 4OZGA 4UBDC 4UT7H 1HNXO 2QM7A 1AXSB 2QDVA 2FWLB 4D9RE 4ZTPL 4PY8J 1JZ6A 4Z7NF 2CTPA 2APWA 3DX8B 1TUBA 2HJLB 2R0ZH 4KXDA 3UC0L 1VHPA 1N26A 1CDYA 1RUQH 3HKBA 2F53B 2QHLA 5DZVA 5IHZA 3QC6X 4XNXL 3ZE1B 3N04A 2GT9B 3L9RB 4FFZA 4S1DD 2YN5A 3G04A 2Z92B 1BMWA 4MYWB 4JFDA 4JI3B 4U49A 4HSCX 4YDJB 1VFOA 1MFNA 1LEGB 1IXMA 1SDAB 4UCSA 2CU9A 4GFXA 1G6UA 1R5IB 4FQXA 4WO4D 3RTQA 4IS6A 4QRPE 4DUZO 4I4WB 1FVCA 4HWBA 4Y1AE 5E03A 5I66A 4YE0A 2JK5A 4PJ8B 4CNIB 1Y07A 1L7IL 3TF7C 3DOSA 2A4EA 2X9ZA 3D33A 2C9XA 2FX8H 3HMXA 1JDDA 1ZT7A 2F7RA 5L3CA 3GBMH 3HHRB 3RL1A 1W59A 4DZBB 2Z31C 5AUMB 1NANH 4HV8B 3OSKA 1UCBL 4L4VB 3VFWB 1J5IA 3KPOB 1F0LA 2OTWA 4B7KA 3I55V 1JYWA 1CURA 4TNWF 2BY1A 1HN1A 2W0FA 1V55B 2X1QA 3MTXA 5EOQL 2PY5A 5DVMA 1X4ZA 1LP9F 4F7PA 3FUHA 2JEXA 5KSVB 3TGUH 2H2SD 3DVNA 5J13C 1IFHH 1UM6H 5SX4I 1KN2L 1AHWB 2IH1B 4EUPB 5IYZB 1TVHA 3ZHKA 1DFBL 1S7WB 2YSSB 4PLJC 3H85A 1XGRA 2BIOA 2X40A 5LP6C 1UB6B 3S3CB 4KROB 4QRQA 1A6VL 3II2A 3GINA 4L4TE 2NY7H 1R3LA 4WIQA 3BKJH 3GWKC 4ODWB 4JBSA 5F2FA 4KZEH 3ZMUA 4O4IB 4L3FA 1FYTE 1QLEB 2HVBA 1N0XH 2JMRA 3QDJE 4JUTA 1KC8W 4L2YA 4XPBH 2GEEA 5K1VA 3D3IA 4PM1A 5FUOH 3C60A 2FGWH 3QEUB 4PYGA 5HYFA 4JR9H 3DSFH 1OAKH 3L9BA 4OZGF 2P5EE 3WCYA 5KBMA 4YZWA 4PRDB 1WD9A 1KENH 3IDUA 3PWJB 4P5TB 4W4KA 3EG9B 2H9GA 4B3SB 1AQ8A 1MY5A 2WTOA 4WHYH 5B38G 5HDLA 2DLHA 4ZFQA 1GMEA 4FHJA 2IANB 4KH9A 3DYOA 2VN3A 3K91A 1EZVH 1XMQB 1GZHC 3M7OA 4KO7A 4LF7B 4XP1L 5ISZA 1MI5A 3VFMB 3F7LA 2BS71 4HK3J 2JJUA 2FIRT 2F19H 1PL4A 2XRAL 4I50A 4P9ML 2GC7C 1MLCB 3CFKB 1AKJD 3VRLF 1SXAA 5FPIA 1WJZA 1NOFA 1ZLVH 4ONGH 3ILQD 3VXNB 1JMKC 2JKNA 3OXSB 1JIBA 2VDKL 4OCWL 4X6CB 3UG5A 3SE8L 1X5JA 2WW8A 1ADQL 1NCAL 2E76B 3FQYA 1HCYA 2BTQB 4LSUL 2C1OB 2DWDA 5HDQH 4KKPA 2I60H 2CE4A 2DWSA 5EBLB 4X7CC 1ESOA 3SYQA 1RJZB 5KANG 2P4VA 2YPKA 4PP2B 1WA2X 2J55A 3FJTA 3T0EB 4GKZA 4W6YB 2X4SA 3PCYA 2IAMC 4P05A 2VR7A 4MTOA 3EXAA 1DQJB 3D1MC 1OF2B 1YMHA 4NP4H 3APCA 1JYXA 4HCFA 3WJJC 3BO8B 4HEMA 3KYKL 1A3QA 4XP4H 5T3ZH 3IMUA 1SYSA 3R0MA 1LUWA 2AKRA 1RFDL 1C1EH 4BZ1L 2HT3D 3BPZA 3N2GB 5IQLA 5E5LA 3JWNC 4B53A 4FFWD 1ZS8B 2VR8A 1CD9B 5CILH 5J5EA 5B7FA 1QSFD 1CYWA 4I3RH 1CIDA 2JS3A 3QS3A 5AVRB 5JQ6H 1HNWB 4UAOB 5HDBB 1QD0A 3BMWA 3OEHG 1MRDH 2AAVA 4X7SL 1NUGA 5SV3A 2DJMA 1M1SA 3MROB 4AEHL 1IVTA 3IFOA 5EC2C 3ZMNA 5IMKB 2A9BA 3VU1A 4ALAC 2VXUH 2NUTA 4O02H 1UGNA 4A2HA 5I24A 2VMJA 1MCIA 3ZXAC 3MN8A 1Q0XL 1M9WA 1P7GA 3LH9A 1YC7A 3MJ8B 4OJEH 4AJ0A 5MEQA 3Q05A 3WDJA 4CKQA 2OCCC 4YIPA 1OAZH 2DY2A 2UZPA 4WTXA 3RAJL 3N44F 4FQIL 5L88L 5ILTH 4QJ5B 4GMTH 4UTBH 3VXMA 1F56A 3EJRA 1G7LB 5F1NA 1ZHKA 5FKPB 4F9PC 4RESB 2F68X 4YSCA 4NWTL 3V4UH 4AK1A 3NA9H 3EDKA 4KUCF 1P2CA 5IHUH 4KP4A 3VW3H 3JALB 2QGDA 3SDCD 2D3JA 1BE3H 3IRPX 3BABA 4ZTOL 3JASB 3CMAV 4GW5A 3GSVA 3N2KB 2V9UA 2WQSA 1ZJBA 1MJJA 2WSDA 4LEXH 3I9AA 1Q8MA 3SGDI 4H7VA 2J57A 2GBOA 1Z9SA 1UKSA 4Z3GA 4HUUB 2OR9H 2HEPA 3QJOA 4YO0A 5T1LB 3WO4C 2VITA 3GTTA 1CD1A 1ECZA 2WOYA 3ILPA 3RWGB 1DUYA 3CJJA 5IE9A 5AW2B 4Z3IA 1NWPA 5TFSH 1UWEL 3IB4A 4AL8C 4LF9B 5DT1H 4AW7A 4EI5D 4N0UB 3U0PA 4W9GC 3CRQA 1U92A 2G60H 1EHLH 3IN0A 3NIFB 1JDCA 1MCWW 2AFNA 2ITDB 2P8PB 4HBQA 4P59H 3NUKA 4KAQL 3W2DH 5CSZA 1S5HA 3RWHB 4OLZL 3F3HA 3Q4HB 4Q6IB 1BMFG 1FH2A 1A7OL 4JRYA 4Y2DC 5KA5A 5FA3B 2XWBA 5IT2L 3VQMA 2RQ6A 4JY5L 1PQZB 4UILL 3ZT7A 5I0WA 3BRDA 4OGYH 4XNUL 1VFMA 5E1AA 3D18B 3JTSB 5D8JH 1PJWA 3HTLX 1MPAH 4UUJB 3HHSA 5LBGA 4BZ2H 4X64O 1EDQA 2EYRB 5DFVD 4J9ZB 1IKNA 1KGCD 1PL3A 2G0KA 4N2AA 2QGEA 2L8AA 1SOSA 1PSKH 3ROOA 1V3KA 3ZHLA 1MHPL 4YSQA 1PZCA 1HH9A 3IJ9A 2OJEA 1JF1B 1O0VA 3MRBB 3AVEA 4HUWA 1HW7A 2ZCHH 2EINC 4H1LB 4JQVA 4DRXA 2PYFA 1E90A 2W94A 2H6OA 4B9JA 3OMNB 4YOKA 1WEJL 4DKEL 3BUDA 3IDXH 2CH8A 5JORB 1M42A 2UUBB 5HI3C 4S1SL 4CUCA 1PG7X 4KKNA 2ZIOA 3THOA 4OJYA 5DJ8B 4NAJA 4TVPE 2OR7A 1JJUA 2QT6A 2XI9A 1GPOL 3AABA 2K1EA 5FOJA 3K71B 1BBJA 1VEWA 4PJCB 5CGMA 2IQ9L 1DVFA 1U8MB 1BFOA 3WMPA 4GAGH 1JGVH 2SODB 3K6FA 5CGYC 4CGTA 5FGCB 2G2RA 1HQ4A 4Z3EA 5IMMA 1XIWA 4MJIA 3CFDA 1EAPB 4ZMAT 3CVBA 2JEUA 1CFTA 1N0LA 4ILDA 1BQUA 1P9MC 3L81A 3QDGA 4LQ1A 4PRPA 2GTZB 5ES4B 5BV7C 2J4WL 1N4XL 5K1XA 1B4JL 5J1TC 2HJFC 1NEZA 1RZ7H 2AERT 4XCEA 5D1XD 5L8KB 3BZ4A 2NLJB 2Y7QA 4G6JL 1MHEB 3GSWB 1OT2A 2OSYA 4DV2O 4JI6O 1IC7H 3HC0A 3MUY1 2E5LB 1B0GB 2H47C 1BW8A 2JV6A 1KWGA 5C9JB 3U9WA 4OR1A 4LBEB 4WHTB 2E9JA 5CCGE 1G84A 4XPHL 3LAFA 3WEMA 5I1JL 4HLEA 4YY3B 3VWJC 4TTGA 2WZPA 3OXRB 4A7GA 2XXMB 1DLFL 2VXQL 4LIQE 2AZAA 3BPCA 3LIZL 2H6PA 4JRXA 3RX5A 3IFLL 2BNQE 5BW7C 1IM3D 1E4XH 2BSTB 2MQ3A 2YQ3A 3BXNB 1YY8A 1JFFA 1ODUA 5DEDA 4J3UA 4LFAB 4Z5RB 5IMLB 1T03H 2GBTA 5JPNC 3Q9QA 4JGNA 2G9HA 2Z91B 5EO1A 4XAKD 4FFKA 2BX5A 4KJQC 4ZX6A 5JA9A 1BZEA 5T3XE 3RPBA 1P7BA 2EZPA 4YS4A 2R27A 3EADA 3SKJH 1W2KT 4FLHA 4X5XA 4ZDHA 3HJEA 3LHAA 2UXVA 1RUKL 1K34A 3DXRA 1YUKB 2JB6B 2LU3A 2TRHA 3O0LA 3QHFH 4N28A 3LKRA 4F9LA 3OAZK 2IALB 4NT6A 4FTVD 4BFGA 1NUFA 3RYIB 3AGVA 2IDUA 2A06H 3PDDA 4K3AA 1QUNA 1LO2H 1BQ0A 5LN8A 2MHAB 1J0KA 4UNVA 1F45A 3PAYA 1OW0A 1T22B 4K71B 3W9EB 1S5IH 2DQMA 3DJ9A 4JI8O 1CFQB 5K59F 5DJCA 1Q86W 1NIAA 4GMSH 1GO3F 4M8UA 4FLRA 2I27N 3UBGA 5LAXB 2H94A 1VPOH 4AGQA 1HXKA 4R7CA 1FORH 2CNZA 5KYNA 3OJ2C 4UIKH 5TE7H 4YHML 3MZTA 1PFOA 4HC1L 1J5OH 4LSTL 1XCQA 4WKZA 3TV3H 3V4PH 2P8MB 4Y4HB 5HY9A 2ZUXA 4N0RA 2XPGB 4EZMA 4LF4B 4H0GA 4QPKA 4OD1L 4DO6A 2C4FT 2EDLA 2WBJA 4L18A 3K72B 4EB6A 4A7GF 2XVBA 1WC7B 3CSTA 1HEJC 4U05A 3NAAL 1ET7A 5TF0A 3ZE2B 3SKOA 3P0YH 2CLZB 1M3JA 3NQIA 4MVBD 3D06A 3B2DC 4JN1L 2DKMA 3ARWA 3FFOA 1N3NB 1II4E 1KB5A 1CLZL 4JFHD 4QWWC 4DHLA 5FDWA 3T0AA 5L0QC 2D4FA 3REVB 4KJYA 1FFXA 3CH1A 2AANA 2E56A 4NJAL 3QJHB 1EVUA 1MXDA 2JJ1G 1RIHH 2UZYB 4GIOA 3ECWA 2DI9A 4LARH 5I8OH 5H35A 4FQLH 1KJ3L 3B2UC 3JTBA 3S35H 3ZYJA 2A6KA 4NQVA 2XWJB 1S9YB 3LS5L 1I9RL 2WYZA 5ICUA 1QVFU 4XN2A 1NQTA 3FB5A 1WP8A 3RVZA 5C0FA 4GAJL 2UWEB 4OJFH 4UF7C 1DJXA 3RU8L 1KBPA 5A7BA 1AXSA 2H26B 3OHXC 1Q72L 1S46A 2QWNB 3IAPA 5FHBL 3MVSA 1BG1A 5E6IB 2HJLA 5I1KL 4MA3B 3HBGA 1XH1A 2F53A 1C5DB 4GLRH 3TZVC 4X1YA 2J21A 4BHUI 3EFFK 3GIVA 5IB4B 2GT9A 3W38A 3L9RA 2RJZA 1KKDA 1C7SA 5IBTH 4S11A 1KGIA 3UABA 1KCRH 3UROR 3ES6B 4M8QA 5DMGC 5DJYA 3TH2T 1BBDH 4YDJA 1OTSC 4IRSD 2ZKMX 3L4CA 1LEGA 1NGWB 1D7DA 1R5IA 3QUZA 3KLQA 2DBLH 4NNYA 4ZI8A 2NSXA 2Y9RT 4MXQC 1XVSA 5FYJH 1RJYB 5DC0A 4CNIA 2HP8A 4LHQB 3ABUA 4DV3O 1VQKV 3BAXA 1ZGLB 4FA7B 1PZAA 1IAIL 1S7QB 4DZBA 1EGJH 3CZJA 3L4XA 4RBPK 3VFWA 4L4VA 4MZ3A 2AXGB 3KPOA 4I9WE 4MJ5A 1H2KA 5DLMH 1FBIL 5LL6Y 4ABMA 2QADD 3BDXA 1R1BA 3BZFA 1TJHH 2KQMA 1QBMH 1YDXA 2XAJA 5CP3A 1EZLA 3GBDA 2ZNJA 5ECJE 4C4KT 3TEYA 2GV9A 2B3IA 2ZIMA 2VZTA 3CX5F 1AHWA 1A8JH 4Z76A 5IB1B 2B1IA 5IYZA 1KB9K 3DI3B 2YEQA 2YSSA 1S7WA 2ZD0A 5CJQL 5GJSH 2YKLH 1D6VL 2C3VA 4CC5A 3CSGA 3PXHA 1XZ0A 2F7PA 4Y5VB 2HP4A 3P30L 4IGBC 4EKWA 1W16A 4JKLA 4ODWA 1KGYE 4O4IA 4XXDB 2ZXGA 4FFBB 3HFML 4TNEA 5CLWA 3D50A 2J6EL 3H53A 4LCIL 3QXDB 3GMOA 3QRGL 4BWUA 1QR8A 3EYUH 3MA7B 3QEUA 4CS3A 4LSQL 1KZQA 3DOIA 3FYIB 3B7YA 4OGAC 1YLBB 1AXTH 2GABA 3LB6D 5D2NB 1MZEA 1GM8A 4I85A 4PRDA 5HYSG 4I87A 4PTTB 4XPTL 5LQBL 3SN6N 4JN2A 4PGEB 3ZE1F 3S98A 1NMAH 1FYTD 2Y5QA 2IANA 3PG2A 3PAVA 2ZIDA 2CDEB 5K5YA 1XI1A 4GRMB 3OAUL 1HCVA 5LGTA 1SJEA 3N40F 5E4AA 2NPLX 2V2WB 3VTAA 1BFVL 2JKJA 1JGDB 1KACB 5HVHC 3MV7A 5F7EH 3ME0A 4ZXBB 3ZTNL 3I6GA 3CFMA 4WUKH 5EOCH 1MLCA 4XC3H 4BIKA 3CFKA 2WC7A 5A6LA 1RLBA 1AZCA 4AG4H 1AI1L 5LG6A 1NSNH 1TVBB 4J6RL 3VXNA 2AK1H 3JD0A 1EN4A 4HYOA 1FYJA 1GC1L 4OB5L 4NIKB 4XOBA 4N2NA 4JHAH 1CI5A 2J5WA 2BTQA 2OYQA 4YDIL 3RX7A 3SSGA 5D71L 4HXAL 2N05A 4E41A 4FLSA 4PS7A 3ULVD 5C1MB 5GGTA 2HMID 1T6VN 2OSXA 2DEXX 3FFCE 2K45A 4PS4L 1OT1A 3O41B 4RDQG 2W65B 3NZHH 4JX0A 2NYYC 4IYHA 1XHHA 4R7DB 2DQJH 5HYIA 5DD3L 1MG3C 1OALA 2YAOA 4ODVL 1TCMA 3IVKA 3KYAA 1DQJA 1ZY9A 4QRBA 2WXFA 4Y19D 1V3JA 1BM7A 2X53A 3VD7A 3Q1SH 3BO8A 1RUMH 4XP5H 3KH4A 3N42B 1JZ4A 1F5WA 3N2GA 3UBFA 4NZFA 4P2OD 1Q6HA 3A6BH 1IGCH 2Q2LA 2ZUYA 4S0HA 1TVKA 1ZS8A 2HVKB 3F6LA 4ANWA 4JM4L 1AI6A 1JP5A 3LN4B 5G2NA 2VLMD 3MLYL 5I6OA 4NXMO 4MRBA 2LW1A 2JCCA 4G3YH 5KANI 2QWQB 5ACLA 1H6UA 3H1LH 1AO7E 1A9VA 3EH3B 3VXTA 2XZZA 3VFUA 2E8YA 4H8WL 3DBXB 2DLFL 1AZUA 2QM8A 2CM5A 2BDNL 2ZNXA 1THAA 3NMEA 3OZKA 4O02B 5IMKA 2EAEA 1NGXB 2BNUB 2HR3A 4TQDA 5E23A 1E4XI 3BVNB 1IIKA 3H9HB 4FXGC 4JGSA 4W6WB 3QYMA 1VQPV 4J23A 2BJMH 4P5MA 5IEKB 1NMCC 3Q2VA 3MJ8A 2W91A 3HS0B 4G1EA 2KZWA 2A3QA 1Y1UA 2AEOA 5FYLL 1M7XA 1CYXA 1QKZH 4JPVL 2WY3B 4M3JA 1FWXA 2I9TB 1AHMA 2QKIA 1QFPA 2MEJB 1IARB 4K23L 5E9AA 3QRFM 2VTFA 5FKPA 3P11H 2HKFL 2N4IA 3OKDB 5C08E 3Q2LA 1BD2D 1T2QL 3LY6A 2EJRA 3Q3GB 3AWGA 4J3OC 1WHOA 4KDVA 5AD0B 2WQWA 3ZDWA 3M7FB 5FHAH 3JALA 1MREH 1ZD6A 1GR7A 1CE1L 2CNYA 3QISA 3W5NA 3JASA 1OAYH 4G82A 5J56B 3N2KA 4YLCA 5DO8A 1YUHB 2G5UA 2UXXA 3P3NA 4DR1B 3ESVF 1INEH 2P5WD 4PGDA 1I8MB 3ZTDC 3DV6B 2VQ1B 3UTSA 4KJPC 5FLXN 4M93B 2LLNA 4JMXA 2IAAC 3IDJB 2XN9A 1E43A 3KEDA 3I2CH 1FG2B 3B7UX 2HTKC 2OMBA 3IAGC 5I6LA 1X44A 2MH4A 1FNFA 1JMXA 3PP4H 3TONA 2HT2C 4B7IA 3HMWH 3BFWA 3NZ8B 1BX2B 4Z7IA 1HHGB 4B60A 2AJSL 2I07B 2ITDA 3QA3B 4Y88A 1G87A 3HR5B 2JCCF 3GK8L 4LF3B 3B8MA 4K5NA 3RWHA 2PNDA 1K4DC 3Q4HA 4Q6IA 4X8JA 1XMOO 2VMFA 5FA3A 1MCSA 3QK0A 2PUSA 1KYFA 1R3HB 1QSVA 4FZEH 2QQLH 4L5FE 3VH8A 1VF5B 1XQ8A 3QJRB 3G6DH 3D18A 3ARQA 3FB8B 4LGRB 4ZNEA 1CN4A 2IXQB 3A5VA 4UUJA 5DU7A 1JPGA 5JLZB 2EYRA 5L7XL 3AU0A 2Z31A 3TBSB 2J5LB 1CMOA 1PD3A 2O30A 3MV8E 2ATKC 2XACC 2AJZB 4KY1H 4OUUB 4IRJD 3L70H 4G9FE 3V0HA 2CKNA 1JF1A 3I85A 3D2UD 2YPVA 5DA4A 4TRPL 4KKCC 3AQXA 3IC9A 4RGMB 4J7ZA 4H1LA 4JB9H 2Z1PA 4RX4D 3UTTB 3VM5A 3WKNA 4ZO8A 1S3KH 1FJGB 1CDIA 1JWSB 1KTDA 3ARXA 3A0RA 3FD9A 1A5FL 3HIZA 4O9HH 5LP6A 5JORA 4AMKH 4NO0A 2VXTL 4OBSA 2FEEL 5LXGL 5B38B 4FQ2L 2YBRA 2EXTA 1PF3A 1WZ1L 4GX1A 2Y4SA 4QOKB 2J71A 3UO1L 2LQTA 1R5VB 3SOTA 4PJCA 1FF5A 2AQRA 1WAZA 1U8MA 2YLKA 5I8EB 3GEWB 4P49A 1IX9A 4TSBL 4GLRI 2ITEA 3E8BA 2NTFB 1EAPA 3CVHA 3L5XH 4LE8A 2XAQA 3WNLA 3C08L 3UJTL 2Y72A 4XMUA 3VX0A 1KCLA 2GTZA 1KBVA 1U8QB 4IIQC 1CC3A 2VH5L 2CBQA 2VE6B 4P2AA 1FSKC 1J9TA 1E5BA 4WHCA 1VQ9V 2NLJA 1QEWB 1MHEA 3CCQV 4IBLT 1TZGL 1B0GA 5C9JA 1GZPB 3DO3A 5JVDB 4HJIA 4QRUA 1E3ZA 4LBEA 2C8NA 4WHTA 4K94L 3WN6A 3D12B 1TQBB 1PGRB 1QBLH 2RFXB 1MIEL 3OXRA 3VWKB 3T1YB 1QYGH 5IQMA 5FS5A 4WFHA 5BO1L 4YSOA 3JSNA 1HR0B 3KPLA 2Y22A 4S1QH 1DBKH 1WO2A 2DMKA 5AVTB 3ZN6A 4HMEA 4EQ3A 3BXNA 3KPPB 2P5OA 5IMLA 3US0A 4I5BB 5BOJA 4PV1C 2F4VO 3THML 2QSCH 5DR5H 1KXQE 4TMPA 3SGJA 3MLVH 3OD4A 3WD5L 1SNRA 4R26L 3M1CA 2ORBL 4G2KA 4JLRA 4RFEA 4X4YB 5I19L 4JV5B 5C09A 1DO6A 2CR0A 1NICA 2JB6A 1JZEA 2YGOA 3E2HC 3ATDA 3GLEA 3QIWB 4PJCF 3CNKA 5AOJA 1IBLB 4Z7VA 5FO8B 3DXAD 3KGSA 2VJ0A 4XCFL 3VG9C 3DX7B 3WJMA 1BVZA 2HYMA 5B5EZ 1TFPA 4PFEA 3M99B 2CGRH 2EVHA 2Q5ZA 1GKOA 1KUQA 2W0XA 4YDLC 3DIDA 2WLYA 2MHAA 4NZUL 5LA6B 2Y0IA 5F7LB 4Z77A 4FLZA 5BXFB 1K33A 1T22A 1Z9LA 5C7XL 1RZJH 5GTIZ 2OTJV 3W9EA 1NH6A 5D1QE 4AHCA 2LW7A 2J72A 5JHDE 4AQ8C 3PGDA 4RFNB 3T8XB 3SE9H 2DD8L 1XR9B 4U7SA 5TK2A 4N2CA 2R4RH 3FB6C 1LNUB 3KHQA 2I5YL 1VQ5V 4XMLH 5JPMC 2ESVE 4A7QA 2BSRB 2XG4B 3V4PB 3EGSB 4OFQA 1FS0G 2RMKB 2V3FA 2XPGA 3KLSA 4K7PY 3D25A 1D5ZB 4HUCA 5B1AB 3MRDB 3LNEA 1D2DA 3QHZL 4Y4FC 2V2XB 2VCOA 3B9KB 2JCWA 4KKBC 1WC7A 3BW9B 3AK3A 1WB8A 5D1ZB 2XUWA 4F9PA 4M9OA 1MN4A 2VGLM 3U30B 4H8QA 2N7BA 2BNRB 2CLZA 2VYRE 4D0BB 1WS8A 3QE5A 3BPOC 4WK4B 1P6AB 1AP6A 3T0VA 3Q8CA 2NNAB 3B9DA 4UZGA 3WN5B 3MHZA 1V5JA 5KW9L 1N3NA 3X3FL 1XOUA 2IPKB 1YG9A 1HDJA 1G0DA 3WDHA 1ZLSH 1SLVA 3QJHA 2K7PA 5JHLH 1A6TB 1RU9L 2UZYA 5JOPE 3T0BA 3D3VB 5AYQA 4F2MA 4PI0A 4Z7VF 4P4KB 5HPOA 3GB7B 4FL4C 2CCLA 1S9YA 2XWJA 4FLUA 3M07A 3H9SE 5LAPA 4I7ZC 1I8LC 3TJPA 4ZSOB 4CGUB 2UWEA 4M3HA 3P9MB 3GSNH 1BF5A 4FKHA 1QSEB 2H26A 3QIBC 4LEEA 1KT2B 1MAKA 4FERA 5E5UB 4Y2DA 1GC1C 3P54A 3IJEB 4MA3A 4X5PA 3CMEV 1R73A 1C5DA 4XNYL 2OI9B 4LK4A 1OM3H 2XHBA 3KYNA 1G94A 5IB4A 3WTXA 4DVBB 4H8UA 1MW0A 1TQTA 5KSAD 3ES6A 1ANUA 2OA9A 3K7UA 4DFIA 2NY1B 1JK8B 1QR1B 1I94B 1MIMH 2OX5B 3QNFA 2LGQA 1JCHA 1QNZH 5C0ND 2VQEB 1ZPUA 5B3JF 5CSBA 5GRVL 1TYEB 2JXMB 1RJYA 4X80H 4ETQB 1N6QL 3F6JA 4FJYA 3TPKA 2BP0B 2OIEA 3SBWC 1WTLA 4FEMA 4HD5A 4PR5B 2BRRL 1RULL 3FFDB 2D7NA 3VXSE 4DKTA 1ZGLA 2RALA 3CU7A 4AXWA 1QW8A 2NXZB 3GRGA 4M48L 5FYKE 2AXGA 2WKOA 3BD5A 2R51A 3CFBB 4JAMA 1ES0B 4OKDA 4APQC 5I1IH 3FKUS 3MLRL 3ZYZA 2VW7A 3ARFB 1Q94A 3I3DA 1CLYL 4Z7UA 3SDDC 1U3NA 3TFKC 3ZBMA 3RGVC 1DQMH 4S1RH 2XX0A 3AS1A 4XN9A 1MFDL 3OAWA 5C0CE 3ZL1A 4K7PH 2PLTA 1T6BX 1J9QA 4QHUB 1B0IA 4TUKL 4ZW6A 4Q56A 3MJ9L 4LNRB 4Y5VA 3VAEA 4H8WC 1QWHA 4D7BA 4EF3A 3JD4A 4K3DL 5DS2A 1LUVA 1GIGL 4G6KL 1UEYA 3QDMB 3X2QC 4FFBA 4LLWA 2B0SL 4HBCH 1SFDA 2FH6A 4MA1B 5LGKA 3V6ZA 1EAOA 4DW1A 1RMFL 3T09A 5I17A 4HXBH 3MA7A 4CN4A 1KJMB 3N27A 1MY7A 4LASH 5IVXE 3VRJB 5CBAB 4H37A 1QHTA 5D2NA 5EIBC 2H3NB 1KECA 4FPPA 3FB7C 2DAVA 4M1GH 5FEBA 4PTTA 1PCXA 2A3TA 3BP6B 4UT6H 2Z8SA 3FK3A 1H5BB 3DRQA 3F5TA 3L8QA 3L1EA 3MLXL 3WE6B 4LOFA 2X4QA 3FO2A 1VEOA 1DSFL 4RGOL 1KGJA 2CDEA 3RIKA 2FECI 1AR2A 4GRMA 4DV7O 5A2QN 2EDJA 3ARED 1ZE3H 3M86A 1CD8A 2RTTA 1VZIA 2V2WA 3A3YB 4BFJA 1OOAA 2HLEB 1JGDA 5KVDL 4DKDC 1KCWA 4OZHE 2Z0BA 3VWJA 4QNPF 4AITA 1NAMH 2AQ1A 2VLJB 1SKVA 1I8IB 1ZAUA 1BIIA 1YCSA 3SJBC 4YFDB 1TVBA 2HFGH 4EKXA 1K5SA 4GG6A 5BW7A 2E7CA 1TTRA 1KLUA 4OLUL 1P49A 4P2QB 1UACL 5G5DB 4X88A 1OLLA 15C8L 1TQUA 2V8LA 2WKOF 1A7NH 1GY1A 1OHZA 3QWRD 2RA1A 5TQ0L 2X9WA 2B59B 1BG9A 3GUTA 5DVLA 1P5VB 3KS0J 4Z7UF 1BHBA 2LU5A 4ERSH 4H26B 1IZKA 4KUMA 5F3HB 2FIKB 4K7FB 3WLBA 4GP4B 3UO2A 2DH3A 2OJZL 4MMXC 4Q6KA 2JQZA 3VXQB 3ZQXA 3AROA 3RFZB 5I26A 1N32O 1HOCA 3M17B 3O41A 2W65A 5EYPB 3KZ8A 4YEFA 5JDSA 3FQWB 4R7DA 3OTOB 5I82A 1XQ4A 3QIUB 2XU9A 2ROYA 4DH2A 3DIFB 1MFMA 4H88L 5I74C 2EDRA 2DOCA 4TSFG 4ZX5A 1FFNB 1ND0A 4ZD3L 1JJOA 4HULB 2CALA 4MNHB 2ARJQ 2B4CH 2VLKD 4OFVA 3M1BB 2OLDA 4PB9H 3H1JH 4DEPC 4EN3D 1NIEA 2A9NL 2QDOA 2X4UB 5AVUB 1KLGB 2HVKA 2VDPL 3PWUB 3ZR6A 3LNGA 5E9DB 2OMUB 3F65A 3OQ3B 1LXMA 1NCGA 3LKNB 5ACZB 1ZGLM 2QTOA 1E6OL 1VGEL 4JHBA 4NKIL 4C56A 3SPVB 3O4LA 3T77A 1YNKL 2YFOA 4ZX4A 3CWGA 1W0VB 3KPSA 4HGWA 1WT5C 3DBXA 4KOBA 1DL7H 5IFJA 2B20A 3BGFC 1F4MA 2EILC 2O5XL 4O02A 2D0HA 1NGXA 1ZHBA 2FHFA 3ULUE 3PP3K 3BX7C 2CKBH 5DJDB 3UGUA 1QA9A 5DZJA 1PKQA 1G6RH 3HCVB 3A0OA 4BHUA 3ZQ9A 3Q01A 2NY6D 5JR1L 1KU9A 4GG6F 3O6LH 2OMTB 3DV4B 1AO7D 4MDIA 1T1ZB 4ICWA 3C87A 5PAZA 4G7VH 4R4FL 1AD0B 4I2XB 4CDHA 4CVUA 4FNQA 1KYOK 4NYKA 3VQWA 1EUTA 3IJSB 4WGWB 3AUVA 4DGVL 5C8YB 3JD3A 5LXTA 3W1ZA 5AD0A 3Q3GA 4Y9FA 4ZO6A 3IMRA 2I85A 4YUEL 5LB1A 3ARGB 1E8ZA 3UCQA 3IXAB 1SUJA 1V05A 1TYJA 3EO9H 5TQ2L 2DJUA 2DDQH 2VZSA 4FLQA 4ORGA 3FQXB 2HKOA 3K4AA 3P9LA 3MV01 1WAAF 3MCKB 4NS0A 1KYOJ 2UU9O 4JZJC 4K8XA 3U46B 4QKTA 3D0VB 2ETNA 3I6LD 4BELD 2DKSA 1AGEB 4K9EH 1YEIH 1CU4H 1W15A 3NGBB 1L6XA 1TUEB 1DK1A 1BEYH 3RGBA 3N42F 3R06B 4K94C 5A16A 1X5MA 3CFCH 4EOWL 5IQ9B 1QLRB 2J8OA 4KUZL 4NC0B 1ADQA 3UYPB 3AM8C 1AS8A 2UVEA 1L9TA 2PUQT 1BX2A 1EVTC 1HHGA 2Y6TE 2I07A 4UOW0 1IGMH 3QA3A 3LKQB 3HR5A 4YDMA 3LRMA 4GRLD 4L1HA 3BN3B 5CCHE 4NGHL 1Y1DA 4ZKIA 5C0AB 4ZS7L 1M93A 4PLKD 5CN0A 2I69A 4PRBB 3E6HB 4FQQB 5DXWA 3V0VA 5GS2H 2ZUQC 1CYGA 3JV4A 4XB3A 3UC2A 4ZFOL 4RZCB 1R3HA 1FDLL 3RUGE 4UV7L 4WY7L 1A7RH 4U0RC 1LQBC 3FB8A 3V0WH 4BZ2A 2IXQA 4GXUM 4J42A 5JLZA 5F3BB 1A9BA 3HLKA 2VXVL 1KTCA 3REWA 1E6JL 1UH4A 5EU6D 5GJTL 4TQEL 2A73B 1FL5A 4G7QB 4FA6A 1JCVA 3ISRA 3QNYB 4NKMB 4OGZA 5GS0D 3JWOL 2CG9X 3UTTA 5FFLA 4TVPH 4CMMB 2CA3A 5CWSB 1RPRA 1JWSA 2ED6A 3HOGA 2NYZA 4PWGA 4TPRH 4YQXH 4BCXA 2ITCB 2RJMA 3HE7C 1DVXA 2EE2A 2EUXA 3IKKA 4Z23A 4J27A 2CLVB 2QKAA 5HYSB 5ABDE 2NY0B 1PNMA 5L3BA 4IGBA 5B1BB 3AJ7A 4M4RB 1Y74B 3NA4A 1UXSB 3HKDB 1EEZB 4IDJH 4UM9D 4N2EA 4GKJO 5DUML 4A38A 3U4EB 4OJCA 4V1DB 4ZHQB 3MGTB 2DB8A 5I8EA 1BM3L 4ZI7B 3RIAF 1MSWD 4QTHB 1ZHLB 3IDGA 5F7WC 1OB1B 2ENYA 2MQ0A 2Q20A 5EOTA 2DWEC 4FXTA 4WW2C 3ABZA 4G9DB 4UQAA 1HHKB 1YPZB 1U8QA 4DR7B 1Z5YD 2IV8A 3DRTB 2VE6A 1YEJL 2E3VA 4UZUA 2F08A 1CVRA 2PPCA 1P4BH 2DQIH 1MCRA 2B5IC 2OMZB 1UJ3C 1K3EA 1QEWA 1XCWA 1D5AA 2DQ0A 2GK0A 5HHME 3SDXE 3T4ZA 5FX3A 2DQTL 1OSZA 5GS1A 3QWQB 4C83B 1MCJA 3HB3B 4B7EA 2XFGB 4NOFA 3LH2H 4XZUB 3MGOB 1AP2B 4QXUL 1NDMB 3HW7A 1U4FA 1H8HG 4LDCA 5B1JA 1V8HA 5DHMC 2RFXA 4XHJC 1ASQA 1K2DB 3VWKA 2E46A 4F15B 4F7CB 2EDTA 4DV1B 4N0CD 5EEUA 4UAOC 2BSBA 2O6EA 5ADOL 5C0RL 2V9TA 3KPPA 5E2VH 3DX9B 5BR8B 4EMZA 1F4AA 4R4BA 5C09B 4I5BA 3KPRD 3PV6B 4K5MA 4Y4KB 3P3SA 4LP4A 1IFGA 1N6VA 2IADA 5EZPA 4AM0B 2ZCLH 4FMKA 1N5YH 1X5HA 1OAKL 3DSFL 5IMOA 3DTDA 2CMRL 4NP9A 3J8F7 1PNLA 2Y7LA 2UY7B 1JGLH 3AB0B 3CCJV 1WP6A 3OJVC 2BVPB 3T8VA 5GRXG 3DMMD 4P23B 4L8SC 4KK8D 4NQEA 4JJOA 5KAQF 5T1LD 4ZPVA 4BIZA 1CL7L 5L9DL 5F9OL 2G5BB 7PAZA 3QZMA 5IR1A 1I7UA 4MAYC 1E4HA 2ED8A 2L7JA 5TPWL 4WF7A 1GOFA 5LA6A 5BXFA 2CSPA 4KO5A 2EC9T 1I7ZB 2F7OA 4KU1A 4NWUH 4PWHA 4RRPG 5I6XB 1KCUL 2Z93B 1R6KA 3T8XA 3ASWA 4LFBB 1XV8A 4X65B 5F72S 2Z5UA 4N2OA 4JHZA 1ITBB 5DA0B 3TT3L 2IFFH 5AB9A 3NSDA 5I8KH 1QRND 1DTOA 1G9MH 4FXGA 3QXWA 3OJMB 2XG4A 3C5ZC 1JXGA 4MMYB 3EGSA 4A7VA 1V9PA 3BKCL 1D5ZA 3MRDA 2HCZX 2CBMA 5E79Z 2V2XA 4GT7A 4HIJB 5F1IA 3RP1A 4BRVA 3B9KA 4WK0B 3BW9A 3NSXA 4M7KH 3CFUA 1OCCC 4JL2A 3EJZD 1ZDSA 2Z7UA 2BNRA 4D0BA 2F58H 3MNVA 4YXHH 4F33B 4QRAA 2K3HA 3KYMB