3AG2B

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag2B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag2B02
1TEGA 1PLCA 7PAZA 1SDDA 2N0MA 3FSWA 1YLBB 2EIKB 2BP8B 2YAQA 3X1GA 1AS8A 4KNSA 1NIDA 3ABLB 1BXUA 4E9SA 2JKWA 2J57A 3CVCA 4JKNA 2YXVA 1NWPA 3OM3B 3OMIB 2DWSA 1AZUA 3T9WA 3CG8A 3BQVA 1SNRA 2HXAA 2GC7C 1WA2X 1WAEA 1KGYE 2YARA 4DP8X 4UANA 1AZBA 1JZHA 2IDFA 2XV0A 3MBWB 1A65A 2CALA 1IUZA 1ILSA 4AKOA 2OV0A 3JTBA 1L9RA 2FWLB 1BQRA 2PCFA 4G72B 1UATA 2HRGA 2PPAA 5FC9A 2UXVA 3GYRA 1FFTB 1PZCA 2IDQA 3SBQA 5A7EA 1M9WA 3WNJA 1MZYA 4DP4X 4CSPA 1BQKA 2DV6A 1OF0A 5B1KA 5I6LA 2WSDA 1JZJA 3FQYA 1PAZA 1NPNA 1ASQA 4NERA 5AKRA 1GY2A 1KYAA 3NJFA 4N8UA 2H5UA 4YVNA 2XX1A 3CDZB 4EF3A 3AG1B 2XUWA 1A3ZA 3NT0A 1ET8A 4KO7A 2PPFA 1GY1A 5D4IA 3H56A 1QNIA 1JXDA 2IWFA 2FT6A 1J5DA 3UADA 3UACA 2GI0A 2CBPA 4YSOA 1CYXA 2XU9A 4HCGA 4DPCX 2PPDA 2LLNA 3NSYA 2PCYA 1E65A 1N68A 1PLBA 2QT6A 5B1BB 3HB3B 1SF3A 3QQXA 4K9JA 2FNWA 3NJHA 2VW4A 1FA4A 4JHVA 3PLYA 4E9RA 3CVDA 4X4KA 1A4AA 3G5WA 4QKTA 2PP9A 1BEXA 3FT0A 1L9SA 5I5JA 1ZIBA 3X1FA 3CDZA 4HHGA 3PPSA 4FAAB 4HCIA 3NJMA 1IKOP 4KOCA 4YSRA 2H47C 2H3XC 5PCYA 5D4JA 4GP8B 2YAEA 4PCYA 1J9SA 3FPYA 4E9TA 3QJVB 5LDUA 1AR1B 2TSAA 1M57B 4A67A 4YL4A 4BWUA 1KBVA 1AG6A 2P80D 2B08A 2FT7A 1CC3A 1ZIAA 2BWDA 3TBCA 2PP7A 4YVUA 3QJSB 5E9NA 4YSUA 4BWTA 3TA4D 4F2EA 1DYZA 2IDSA 1MG2C 3S3BB 4YSEA 3ABMB 1IBYA 1AOZA 4M3HA 3WNIA 4ZK8A 4DP7X 5I5MA 1ZPUA 2BW4A 4KO5A 2VSMB 1AACA 3IBOA 1PNDA 4L0PB 8PAZA 2A3TA 2RACA 1AZRA 1X9UA 2GB2A 2IWKA 3HEIB 1XMEB 3ZBMA 3UAEA 3WIAA 3SBRA 2FQGA 3X1NA 2ZOOA 4HZ1A 4DPBX 4UF7C 4W1TA 2PPEA 3FQ2A 1AAJA 2HX8A 2EIMB 5B1AB 2XXGA 1KCWA 2BP8A 3ABKB 4G70B 1PLAA 2EIJB 1TKWA 2QDVA 2VSKB 4Q89A 2WO3B 3WKQA 2IDTA 2UXFA 1NDTA 3EF4A 3UAAA 1SF5A 1IC0A 6PCYA 4BXVA 1SHXA 2XLLA 1KCBA 2E86A 5D4HA 3FSVA 4GXFA 1OE3A 4AX3A 2PLTA 4A2FA 4YSCA 2GSMB 1SFHA 2FTAA 2FJSA 3ASOB 1GS6X 1GS7A 2FQDA 4KNTA 4AZUA 2NRDA 2P80A 1RKRA 4A68A 2R7EB 2XX0A 3H4HA 3FSZA 4E9XA 1GS8A 3CVBA 3X1BA 1ET5A 2Y1AA 1GSKA 1ZDSA 1AS7A 2XVBA 7PCYA 2OCCB 1PF3A 2MTAA 3QJTB 2I85A 1QLEB 2VW6A 2GC4C 1AZCA 4A2HA 4MFHA 4HALA 2BZ7A 1IBZA 3CZUB 4AKQA 3H4FA 1KDIA 4BXSV 3NJIA 2Y69B 1NIAA 3NP4A 2X87A 1SHWA 1GW0A 4YSSA 1B3IA 5F7BA 2EINB 2BZCA 2XV3A 4DP9X 2YAHA 4DPAX 5I6PA 2X88A 2IAAC 3S8GB 3KW7A 4G71B 3NSDA 1L9TA 1J5CA 1AZNA 3AG4B 2BWIA 2BP0A 4HCFA 1X9RA 3RYMA 1E5YA 2BP0B 2WO2B 4HIPA 3AY2A 4JHUA 1EZLA 3T6VA 1AS6A 1ASPA 2DYRB 4M4RB 1A4BA 2VMJA 3T6ZA 2HRHA 3S3CB 1J9TA 5I6NA 1HAWA 5B7MA 3NSCA 2AFNA 3PCYA 3EHBB 5I6KA 3V9CA 1V10A 2W8CA 3T71A 1E5ZA 1BQ5A 4FA7B 3UGEA 1QHQA 4KOBA 2ZONA 1PNCA 1NPJA 1W6WA 2I7OA 4YSQA 2DY2A 3FU7B 4KNUA 4WTQA 1JZFA 4YSTA 3PAZA 1BYOA 1OE1A 2Q9OA 1PMYA 4KO6A 4DP1X 1PZAA 5I5IA 1JERA 9PCYA 3U25A 4UAHA 1R1CA 4A2EA 4E9VA 3X1EA 4RH4A 2DYSB 1NINA 3N2JA 1NIBA 3BVDB 2JXMA 3JT2A 1URIA 4A2DA 4P5SA 4QLWA 2AVFA 1WA1X 3FYEB 2IH9A 5I6OA 3MX0B 4BDVA 4WKXA 1PCSA 1V54B 1M56B 2J55A 3ZX1A 2EILB 3IN0A 1MG3C 1ZDQA 2TSBA 3WI9A 5I6MA 1NICA 3EH4B 2FQFA 3D12B 3FU9A 1CUOA 1MDAA 2YAMA 4G7RB 1ID2A 3ZDWA 4F2FA 3NJGA 4N4YB 1BXAA 1W8EA 5AFAA 4DP2X 1CYWA 2IWEA 2VN3A 2YXWA 4YSPA 5B3SB 4AI7A 5F7AA 3TASA 3GXUB 3PAUA 1J9RA 1OCZB 3SQRA 3QJQB 1OOWA 2VW7A 1HFUA 1ETJA 4E9QA 1CURA 3PAVA 3GDCA 1NWOA 3DIVA 4CSZA 3TBBA 3IN2A 1DZ0A 3FYIB 1ET7A 2AZAA 1JXFA 1WS8A 3KW8A 4G7QB 3AG3B 1OCOB 2HX7A 3AG2B 3S8FB 3T6XA 3IE9A 2HZHA 2IH8A 4AKPA 2QDWA 1W6LA 2BHFA 2BO0A 3ERXA 3FQ1A 5B7EA 3QJUB 4BDVB 5I28A 2B3IA 1PY0A 3L45A 2UXGA 5B1JC 1L9OA 3FS9A 3NJNA 2QPEB 1AQ8A 2GBAA 5IY5B 2YEVB 1SFDA 3NJLA 1A8ZA 1JZEA 4YSAA 2PP8A 3NSFA 3NP3A 4HHWA 1RZPA 1ADWA 1NZRA 2DWTA 3WG7B 4P5RA 4PAZA 4YSDA 1WA0X 1NIEA 2HX9A 1OCCB 3AW5A 1TEFA 1NTDA 2XWZA 3TU6A 1BYPA 2CUAA 4W9ZA 1ZV2A 2CJ3A 2MRYA 4NB7A 1F56A 1SJMA 1XB6A 5ANHA 1XB8A 3FPXA 2XV2A 1ILUA 2GHZA 2UXTA 3V9EA 2ZWNA 3DKHA 4BK5C 1BXVA 5TK2A 3SBPA 1OE2A 1NIFA 1N70A 3OMAB 1WS7A 2YAPA 5B1JA 3PXLA 1EHKB 1XB3A 4ENZA 2UX6A 4DP6X 1E30A 2CCWA 3AZUA 1TU2A 2QPDB 2VM3A 3OMNB 1L9PA 2CAKA 3DTUB 2I7SA 4E9WA 1OCRB 1GR7A 4A2GA 2ZXWB 5TK4A 4G7SB 4BWWA 1ASOA 3OD3A 2FQEA 5EHFA 2AANA 5PAZA 2J56A 2HLEB 4A66A 3QJRB 3EH3B 3FU7A 1AIZA 2AZUA 2XYBA 4TXVB 5AZUA 1JVOA 2J5WA 1AANA 2Q5BA 3NJKA 4KO9A 1A4CA 3S3DB 1V55B 4GP5B 2PPCA 1VLXA 2JFCA 1JOIA 1MZZA 1OV8A 2GIMA 2OJ1A 3OQRA 1HAUA 2VM4A 3C75A 4HAKA 3EH5B 2W88A 1FWXA 2XXFA 1J9QA 1RCYA 3FU8A 4GY4A 1JZIA 1KDJA 1KBWA 4GP4B 3IEAA 4F7KA 1BAWA 1JZGA 2UX7A 3ASNB 2YAFA 3N55A 1KV7A 3X2QB 3FSAA 5I26A 4Q8BA 1SDDB 2R7EA 3QPKA 1JVLA 3WKPA 1RZQA 1AG0A 1T5KA 1PZBA 3NYKA 2YQBA 4E9YA 6PAZA 4NAJA 1JXGA 3ABGA 1GYCA 2YAOA 4DP0X 3T6WA 2IDUA 2FT8A 4DP5X 3NJJA 1I53A 2BW5A 4GYBA 1L9QA 3ZIYA 3UABA 1E67A 5B7FA
chains in the Genus database with same CATH superfamily
1GSMA 1R33A 1RURH 2FMLA 3QQ3A 1YNKL 2V9TA 3N9GL 5DLMH 5K1PA 4FN0A 1AHMA 2J2ZB 3QORC 3QJZA 5DD6A 1A66A 3PL6C 2B39A 4ZSOB 4HPOL 4S1DC 4TQEL 4OFVA 5AZ2L 2DQTL 4Y4KB 3AVEA 3NFPA 1NJ9A 2VDPB 4GMSH 5AKSA 1WP8A 2XN9A 3NIFB 5AWNH 1MJ7L 4F9LC 3T0DA 3P0GB 5I0VA 1IGCL 2UZIH 1I94O 5E4EC 2WWWA 3MRFA 4FCAA 1F97A 3QG7H 3ESNA 3CDGA 3BDBA 3PDOA 3CG8A 5GRVL 2ICEA 2X1PA 1BOGB 4IBYA 3SE4C 4PGBA 1KGYE 1BD2E 3OGIB 4G6FB 4I4WB 2DI7A 1HC1A 3V0EA 1HILB 1A65A 3QT2A 5C9JB 3ZMRA 3AG7A 2Y2WA 3NTCH 4KRPD 2W1NA 5KSVA 2Z31D 3BQUB 1TGOA 4PVNA 4E2LA 1BXXA 4J4PD 4U4BA 3EBIA 1MCKA 3FRPA 2KG7A 5FFLA 2IPKB 2WNXA 3P0VH 3RUGF 5LKNA 2P42B 2LFSA 1JNLL 5DZAA 4X89A 2UYLA 1QWUA 2IVFC 3VMNA 4YHYC 1MREL 1NDGA 1BJ1J 2QJ1A 3T2QA 1OCWH 2EH8H 2D2OA 2XQYG 1EPFA 1QO3A 4LIQL 1B3QA 3KCPB 4CH4A 5MI0C 2XA8H 1KT2B 5LGJA 3LVEA 2PYED 3KM2A 3QDGE 1ZHNB 3GSOA 4IRJB 5JQ6L 1KYAA 5HGHA 4PG2A 4WFEA 2XZQL 4CADB 3FO9A 4FLOA 2FNBA 3ZUCA 2J25A 2GPZA 3Q0HA 5JYLA 1RZ8B 1D7CA 3THML 1UA6H 1JZ3A 5CILL 2P8MA 5DJYB 2J5LC 3R1GH 4PGEB 1J5EO 3D7PA 1AY1L 2XZCH 4FZEL 4E9LA 1BG1A 3MNDA 1FJGO 4LHUG 5KYUB 4RAVB 3TA3A 1ZA3A 3BCDA 2F53E 2MNJB 3E2EA 3FAXA 2ZIOA 4L4TE 3HB3B 4ODXB 3WHE0 1B06A 5H37A 4M1DH 2P48B 4R84A 3CFKB 5BO1L 2FBJL 2PR4L 4PRHE 3CVDA 3H53A 3HC3L 4L5FE 1BQHA 1T3FB 2EYTB 4QHNB 1L5GA 4U1HB 1FNAA 1SYSB 2H3NA 3I6LE 5LG1A 1FHGA 4JI3O 4YHPB 4D0DB 3ZDZB 1XHXA 1JPTL 2HT2C 3Q9PA 4OZFH 1KCSL 1JFQH 5E1IA 5D5QA 5LCVL 5HXMA 3TS8A 1VACB 1WN7A 3ZL4H 2QADD 1BP3B 2DQHH 3OR6A 3HC4L 3E83A 3V0FA 1DQJB 1MW1A 1ZLUK 3QDMD 2A74B 2KT6A 4JAMA 5C6TL 5JOFA 4XH2B 3TT3L 2AK1L 2VABA 3IJ9A 1X4YA 2VLKA 5FECB 32C2A 1L8DA 2AK4A 1B0WA 2RJMA 5F8QC 1SHSA 3GO1L 3LIZL 3VXQB 2IPTH 4OM0H 4CSSA 4FFZH 4KHPB 3VWKD 4TQIA 1S7RB 4NM8L 3K6FA 2ICCA 3QYCA 3IAPA 2GY5A 2K4AA 4F7MB 5LMNO 2AXWA 3GSNL 3QUZD 5TDNA 4L2LA 1YEIH 4HUVB 4I18A 3VXOA 1P1VA 4ABMA 4AUJA 3N41F 3QISA 2HFEA 4OR1A 4NRYA 1JI1A 1LO4H 1WP6A 1XIWA 3G6JF 3M1BA 3IBOA 4H25B 4PG9B 5F7DB 2NY3C 8PAZA 5HJDA 2ARJQ 1JPGA 3Q5OA 3A4DA 5T33H 5EF1A 4NQEA 5DRNB 3KYMB 3O41A 5E0FA 5FA3A 3LN4A 1V55C 1QBML 1HK6A 1MCPH 2IWKA 3L5XL 2FGWH 3IGKA 1GN3A 1BQ0A 2JCWA 1GXEA 2W9LA 3Q6FB 5C93A 2KB1A 2FQGA 4TVPE 2GJJA 4W1TA 5L4IA 5EN2A 1O5PA 2CDYA 4ZMQA 1WCQA 4M6OH 1IBLB 2EIJB 1TKWA 1GHFH 1ZTXL 2G9KA 2VSKB 4HA1A 4AQ8C 2F9BT 2MQ3A 4O2BA 2Q7EA 3W39A 4N5EC 1GOFA 1JNHB 1CGUA 2VUKA 3VH8B 1Z32X 1II4E 1WFIA 3B56A 4A2FA 3LRSB 1HL5A 4TTDD 1CL7I 4UOJA 4DR1B 4GS7C 3RAJL 1S9WA 5IHUH 2DMBA 4HP5A 4KBPA 5F2FA 4M5YH 3OTOB 1N9PA 3FSZA 1MAJA 3JTSB 3RBSA 3HS9A 1A9EA 1KB5B 1QZ1A 2KL6A 3X11A 5HTSA 1TTUA 5I0DA 2E6QA 3KXFD 4JFTA 1PW3A 4JS7A 1XMOB 3CCMV 2ZNXA 4U3FH 3RWRD 1NBYA 4LCWE 4TRPL 5E1GA 2CIKA 2HFEB 4LSTH 3VFGH 2R1YA 1SXBA 4A5UB 3VXRB 4FMFA 3B8MA 4K8RC 4O9HH 3NJIA 1A6UL 1P84K 2A6JB 4IRSD 1WITA 2NXYD 3QULB 5C09E 1HX0A 3U9UA 1MH5A 2EDEA 2GFBB 1SHWA 1GCFA 1AGBA 3E8VA 1EAPB 2EINB 2BC4B 3G5XB 5ALCH 4DPAX 5I6PA 3FMGL 1D2PA 4NGHL 3S8GB 1UUNA 3U36B 2QKAA 4JFDB 5DJZA 3C6EA 1CDIA 5D7HA 3D3VD 3AG4B 1FGNH 6FABL 4O58L 2R9AA 3MLRL 5DZJA 4M1CC 1VKXA 1VF5B 1SJXA 3AY2A 2EDXA 3TO4D 3JASB 4F1SA 3W38A 1TUPA 3HZKB 3FUIA 3GS7A 1TU2B 3FAWA 2IV8A 4OT1H 1C16A 4M6NL 3IDMA 3GXFA 3Q06A 3VSUA 3I75B 2BIQA 2HVBA 3EHBB 1Z0MA 3A22A 2YA2A 4G8AC 1URZA 1T83C 5E6UB 1WAAE 5LHHA 4NAQA 3RVUD 4R7XA 3OUSA 3T71A 3TWCL 3WNNA 1OP9A 1L5GB 2CE6A 5ID0B 4DTGL 4GUQA 4QCIB 3ES6B 4FA7B 3QZWB 1GJWA 3FQTB 3LH2H 3OZKA 3PWVA 4CBZA 2ZE5A 1RI8A 1SZNA 2XBDA 3QZBA 1Q6IA 2DQDL 2FIRT 4M7LT 3SO3C 3U0WL 1FCCA 4LPUA 4FNLH 1H2MA 2J8OA 3ZKQD 1AMYA 1HXYA 2JJSA 2EVIA 3OB0K 4RAVA 3DX8A 3IU3B 5T3XH 3SPHA 3B9DA 3UXFA 2V8MA 1HWYA 5CA3A 1U8MB 3T1YB 1MEXL 2CGRH 2K0RA 1MXDA 5JW4Q 1A4KA 5D7JA 1HL9A 3NQIA 4JE4B 3US0A 4HLZH 1KECA 2COVD 5F88B 2MPAL 3T65B 4AT6B 3QDJD 2ZKMX 2JCCB 35C8H 4U1SB 3B9KC 4HF5H 5HGHB 4EI0A 5LGHL 4WKXA 4PJ7B 3OAUL 4EZKA 4AQEB 3ZX1A 5IMOA 1PKOA 3LXAA 4GQZA 4RISH 1ZDQA 4AE1A 2F1AA 1KULA 1KC5H 2PXYD 2XWRA 4C8XA 4N0UB 2VDMH 3A5VA 3DX6B 1DUYB 1MDAA 4QRTB 3TBSB 5FOBB 3VXUE 4OSUH 1A7OH 2XTJD 3BH8A 4BK8A 4DV4B 5E6IB 1REIA 5J7CC 1KY6A 3GSWA 3WSQH 2ZXAA 3FQNA 4FXKB 3BMVA 3VCLA 4JI7O 1WBYB 3FZUC 2QKIC 1PZDA 2DDQH 5JHMA 3P3PA 1JCKA 3LS5L 1A02N 4YE4L 4PRDB 3ZE0F 3UJIL 2E7CA 3OSVA 4NZTH 5C9JA 4DSYA 1N5YL 5ESVA 3UTSA 3IGAB 3QXTA 4OF3A 4D9QD 4ZMNA 3EOTL 3TBBA 3LKRA 3L3JB 1DZ0A 4HBCH 3T8VA 5IFHH 4G7VH 2MTPA 1NBZB 2X7RB 4G7QB 3TTSA 3CZKA 3AG2B 1BMWA 4TUOB 4WBNA 2Z4QB 4PIRF 3VFTB 2BS8A 2XTSA 3FK3A 4QNPF 3ZUNC 3HRPA 5B1NA 3ZVVA 4GX1A 4HKXB 1LWRA 5B39A 3IC7A 4E4EA 4EUPA 5C0CD 1BFVL 1Q0YL 3MBED 1MFBL 1VZIA 4N2DA 1FG9C 2R4SL 1EZVH 1JR9A 2GTQA 3QQ3B 4ZT1A 3WLWC 4TNVF 2Z65C 4NQTA 2PO6B 4CW1B 3BP6B 3VFWA 3VD5A 1A8ZA 3K72A 5DJXB 3VDCA 3SD5A 4RSYA 4WAFA 2FSEA 2V5RA 1TVHB 3DROB 5CU9A 4PJCA 3SDDA 4I1NB 1UWEL 4H33A 4DUXA 5CSGA 3BRCA 1K4DC 3TIDB 5FW7A 4EQ3A 1NM9A 3ETEA 2W9DL 1MFEH 3CVHH 2KLTA 2EJ7A 4ALAH 4D7TA 4U6XA 4BSWB 1RIUH 2EKSB 2VMDA 2ZCLL 4X0KA 2VLKD 1TITA 3MROA 5ETUB 3ZZQA 1IGYB 4Y1SA 1G4MA 1YEHL 5DVPA 3RKDD 3LRHA 2XV2A 4XPFL 4LCCA 3V0VB 3A23A 4U6HB 5L8KB 4NC2B 3BEVB 4U1MA 2VZ3A 4PP2A 4A04A 3OMAB 1XGYL 2LW3A 2ZT9C 2VL5A 3GSRB 4TMPA 4PI2A 5CJXA 3A24A 3UIYA 4BFKA 4R8WL 1MWAL 1PIFA 1MLCA 3BA9A 4DV1O 3QB7C 5DD1L 2CKBL 1VFAB 2VMEA 3IJHA 2X70A 4PRNA 4NQCE 1F86A 1SOSA 4LCUA 4WW2C 3WJMB 1NH2B 1Q9LA 2ZKWA 2AI0H 3NACL 3ZYJA 4B9JA 4DUZB 3VJ6B 3F7VC 4NKOB 5IQMA 4CVZB 1ACYH 2CLZB 2BSRB 4HUWB 5AW6B 3NZHH 1AGEA 3CCHB 5IY5C 1U6AL 3APDA 3D48R 5EEVA 1TFHA 3ZHRA 2KDYA 1RSYA 4BWWA 1E2VA 1QFWH 5HFLA 4HXAL 4X9GA 2ZCKL 4KXDA 4NUPA 3O2DA 4L8SA 3QJRB 5I1LA 1D5BA 1EGJH 4L4VA 5IUCA 1AXSB 4O4HB 1VQ7V 3FU7A 4K7PY 4OQTH 3E86A 3PGFL 2B1HH 4E42A 5EZIH 3ULVC 3EYUL 4UM9A 4UQAA 1BVKA 3ARFD 2X3BA 4KP4A 3D87B 1M6UA 1RHHB 3WTXA 2IJIA 1NT2B 5AG2A 2FEDD 1KDJA 4QAWA 1IDSA 4GRWF 1MHEA 4U0QB 4PJXE 4L3CB 1UD4A 4FFVC 4NLAA 1QLEH 5E8PA 3TT1H 1UT9A 2NX5E 2BSTB 1KYFA 1CGVA 2UX7A 3SZKC 3WFBH 2YBRA 2FE0A 4JO2H 2NR6A 1MCNA 3I85A 3U6XA 3DBSA 5FWRA 1DQML 1JDCA 2QWPB 2XC8A 4FXLA 4MVRA 1SPDA 2RR3A 5E03A 3EOBB 1GGCL 1IGFH 1EK3A 4DR1O 1GGIL 4AUUA 2VLLB 3QXAA 2VXTL 1KCVH 1JXGA 4V2BA 2Q7YA 4JY6A 5CEXA 2YUXA 2WQ8A 4LFHG 4UZUA 2V37A 3QIUC 3MOBL 4H44C 4TTDC 2XNAB 4HOXA 3K7UA 4CC1A 5B38G 5KSBE 1XNRB 5DJZB 1E43A 1ZSDB 1SDDA 1HSBB 4G82A 1QR1A 1PL3A 3UO1L 3C60D 1TPXB 1UQSB 4AWJC 1U8NA 5AB9A 3OXRB 1OOAA 2PI5A 4I13B 4XPGL 5I8OL 3EIFA 4M02A 1YMMB 3U9UB 3HAEH 2B59A 4H8UA 1HHJB 2AGJL 1JSYA 4WI9A 4E9SA 2JKWA 1D9KD 1KD1W 3R19A 4M7LH 1ENVA 1KPUA 3OR7A 4X9BA 1RZKL 1X5XA 1AZUA 4XO5A 4B7KA 4H0GA 4AW7A 1SNRA 4OGYL 4MQ7B 2K6WA 2UXNA 2D7NA 3SKJH 2XETA 3RY6A 5JTWA 1QUNA 3GQFA 4QOKD 3TBYB 3CGTA 3IGUA 5HYQA 3IPEA 4DERA 4PA9A 4D6TH 5BQDA 3ZTNL 5JMRA 4NUJA 5KS9F 3I9GH 2UUAB 3GJEA 4HEPA 4WCYH 3UGUA 1BF8A 1IX2A 2H1XA 4K5LA 4N6RA 2K9UA 7FABH 3JVGC 3MLSL 2A2QT 2XKNA 1ZWIC 2ZKHH 3MXVH 1E5CA 1QU7A 3ATFA 4PGDB 2ZDIA 2YUAA 1S77D 1OTTC 1S7SA 1TQUA 2BJML 4JKMA 2BSKB 1OF0A 1CD1A 5I1KL 1J88A 5B1KA 4HLEA 2EZPA 2YI9A 3OW2U 2ED9A 3V5KA 3CQQA 3RWHB 1HOEA 4PWGA 4JE0A 5TGBA 3WN5A 5IK3A 4NERA 4NUQA 5IJ9A 5K33A 2E27L 3IAYA 3BKCH 1ACXA 2NTSP 5JOEA 3BEWA 1FXKA 3DDGA 2FWOB 3LNIA 5ITBL 4WWOA 2HVKC 3OV6A 2OCJA 4NWTL 4U2ZA 2DWEC 4KHPO 4LSVL 1XDCA 5DI8B 2JQAA 2NXYB 2GI0A 4M8UA 4HCGA 2EH7H 3HLKA 3LRKA 4FYQA 3FO2B 4DGIL 1TG8A 1B2WH 3IFXA 4XNXH 3UTPD 4IOIA 1TO4A 3I6SA 3UZEA 3DX0A 4I18B 1DCLA 1OAQH 3HPLB 3NQKA 1NFDB 3FB6C 2ICWJ 3UBXI 1N0LA 3SCMB 1WPCA 4QHLA 2B3RA 2WMPA 3U7YL 4AEIH 3JUYA 2Y48A 4JPVL 5I76B 1OF2A 1ZIBA 1ZJBA 2OR8A 1HCVA 1ZEAL 1HHIA 4BRJA 3DV6A 3EYVA 1SQPH 4LL4A 5A2CA 3R8BB 1OAKL 1V3KA 2QVMA 4UQ2A 5FYLE 5INCB 5IP4A 4LVHC 3NIFE 5EC2C 1BD2A 1RIHH 3EO1B 4GP8B 5EZOL 4DGVL 4FQQA 3FPYA 2IMMA 3QJVB 3SJQC 3IKCA 3O6FC 3E6FA 4XXWC 1RK0A 4MAUH 4JPVH 3U83A 4PB0L 3OZLA 5LNEA 1FH2A 1J10A 3TESA 4OJEH 2FT7A 4LPYA 3ZKMD 5EORH 5BVJA 1G7LA 5BS0B 3BZDA 1WHOA 2PF4E 4H2CA 4NYLB 4BWTA 4K8RD 1T4KA 1WEJL 4QO1A 1IBKB 1MG2C 3R0MA 4YSEA 3DOIA 1JIBA 5C0NC 1AOZA 5I82A 5F0MB 3PWNB 4FLYA 2VDPL 1Q90D 1ZPUA 2XRAH 1Y07A 4JHAL 1S7WB 2VSMB 1SQVH 2IJKA 3WLBB 1RPQA 1MI5B 3V6OC 3LH8A 5F1NB 2RACA 3FL7A 1DEDA 4N22A 1A0QL 5JA9A 3E6FB 4PRAA 4OLWH 1FNHA 1MHCB 5IHZB 4ZIBA 1D5RA 4W4OA 3RWFA 4N2HA 2H6PA 1G5AA 2ADJA 1RL1A 3F5WB 4E2OA 2E27H 2XVKA 3Q8CA 1UXWB 1Q1PA 3DV6B 3N91A 3VQXA 2JF1A 2VDRL 2Z7UA 4ZAKC 2OTLV 1QCEA 3WKQA 2BSDA 4Z7OB 2DQEH 3HE7B 3DSQA 2UXFA 4CVXA 2AZ2A 2Y9RT 1PY4A 4GG6F 1OB0A 2AQ3A 4PPTA 3TXSA 3TYGH 3LZRA 3WNPA 1F3JB 3DV4B 4HLJA 4GW1A 4PRHA 2YGNA 3PABA 4H13C 1QEWA 1WTLA 4EI6A 4G8GA 5C07E 1JYWA 2WOYA 4FX5A 5C0RL 4WCYL 1CO1A 2FJSA 3I9GL 1QTSA 3JCZA 1QBAA 2AV7A 2CWRA 3QTCA 3MN8A 1RKRA 1IVSA 4KUZH 3F7VA 2AJZB 3V4VH 4LLVB 8FABA 4FYTA 4DV4O 2UZXB 4DR4O 3BWAA 3SGKC 2G5BA 3IFNH 1SLWA 3JALA 4AYBA 1TZGL 4N20A 5CAYB 2VR6A 4X7TB 5CZRA 1DDHB 5CJXC 1PG7W 2I85A 3OTFA 3ZYZA 2LGQA 4E41B 1KXQA 4M7LL 2BNUB 2ICEB 1GK9A 3CHRA 1D7FA 1CGWA 4P46B 3ECVA 1MNNA 3M7OA 3B8SA 1U3ZA 4D9RD 4GRMB 4JFEB 4AW4A 1WZLA 5IROA 4X7SH 4HOWA 1T66D 4TQ8A 4EI5D 3T1YO 2QWRB 1FD9A 4D9LH 5J3HD 4M03A 4OIAA 1IO4C 2ESVE 5D72L 4J1UA 4W81A 5CFAA 4POZD 1R6VA 3TL5A 1ZPLA 1UT1A 2ZG1A 3KHOA 2VZUA 4JZJA 2DQEL 1DGSA 1KGWA 3U46B 2BWIA 1WTGT 5DO8A 5KLVH 2OXGB 1Y1DA 3BMWA 4NZUH 4LASL 5MENA 3ZE1B 3VW3L 3QRLA 2ZYSA 4N87A 1U3HA 3K3QA 2VMJA 3QARA 5CCGE 4A7TA 5IVXF 5LAXA 2DIEA 1F51A 1J0HA 2PGGA 1JHKL 4PJ8B 2ZAHA 1T7VA 2AFNA 2WPGA 1MCRA 4BJLA 4RAUB 1T2QL 5EFIB 5I6KA 2Q4PA 5AVQB 4E5XA 3T3PF 4GRMA 4OCLC 1ZHKB 3O6ML 4Y9CA 3MRHA 2GITA 5DU7A 3SBWC 2LU3A 1HHJA 2C9VA 4HD5A 1QHQA 4S1SH 1R34A 4FZ8H 4Q14A 5DRZA 4LLUA 4OI9A 4XNBA 3L5JA 3KL0A 2DY2A 2YR3A 1SM3L 4R7LA 5IOPB 2E76B 1BQLL 1QR1B 2AJVH 4G8FB 4Y5VC 2Q9OA 5EZIL 2Q8AL 5HHNB 5KTEL 1MJ8L 1PZAA 1NGXA 1ZGLA 2RH0A 3FKSG 4HWZB 3EADA 4HWNA 4NQXA 5JHDB 3VM5A 2IBGA 4AE0A 1OW0C 4LNRB 4A7QA 2ZUQC 3X1EA 4XPBH 4G83A 1J8HA 1EMTL 1K2DA 1LO5B 3QNEA 1TZHB 3IS0X 4HS8H 1URIA 1JYVA 4X9IA 3TJHD 5CFHA 4Q6IC 3S4SB 3QXAB 3U82B 4YIOA 1JGVH 2AF2A 3FB6B 3J07A 2LTQB 2I5YL 3MX0B 3QJHB 3B2VH 2JCCF 2P8LA 4TKWA 4A7UA 5I2IA 1B0RB 4LF8B 2VE6A 4O2CA 1R5WA 4JFPB 5INCA 1MFCL 3OAWA 5FKAA 4G7RB 2D7TL 3B9KA 3KNBB 1KIPA 3ZQ9A 2X6BA 3WEAA 4XX5A 4CSTA 4EIUA 1A3QA 5HHOD 2V8LA 1OAQL 1TQBC 4J8QA 5HHOB 2BVOA 2K1EA 4M7JL 2VIRB 2YK1H 1WC7B 1UWYA 4PBWD 3PQYB 5IBLC 3RVWC 4OD3H 1B2WL 5JR1H 1QR4A 3HKEB 2AP2A 4H88L 3GUTA 4WI2A 4U3SB 4CSZA 2PYFB 3KWWA 4NNXB 4IU3A 1GYUA 4L4VB 2EXWD 3V4PL 1WS8A 3NDZE 5E51A 4LF6O 1UWEH 1PZ5A 1NMBL 1GOHA 2QHRL 1CFNA 5GGUA 3THOA 3E8UL 3OKEB 1JBJA 2Y5EA 1HZKA 4IJ3B 4DKFH 1L0PA 3L70H 4XBGA 2BO0A 1WWAX 2BHFA 2EEFA 3ERXA 4HQQH 4OLXH 5HHXL 1BMGA 1H8NA 1LK2B 2B3IA 2EXYC 1MCSA 5AW8B 5K9KB 3LDCA 1KF9B 5KOVC 5JW4M 3BEWB 2HLFD 2NDGA 3BAWA 4UTAA 5B1JC 3DC5A 3I56V 4I9WD 1R3IL 4BUHA 2APBA 2OZ4H 3BP4B 5FAAA 5K1XA 1YPZE 4PJ5D 5GRVK 2CPUA 3V5KB 3C9NB 1S9XB 5T5FA 1UJTA 2ZICA 1HNZO 4TSAL 3F7PC 2NCMA 2EDDA 4XDKA 5EZJA 2EIMC 3REWB 2WLLB 1N7ML 4A7GA 1KTLB 4UT9A 4Z7NE 5IFHL 2R69L 4S10A 1SN5A 3QUHA 1ORSA 3CC4V 3ZHFA 3PHOB 1TEFA 3VD4A 1H15A 1SMAA 4KHXH 1BYPA 3IXAA 2YEQA 4JG5A 1EEUA 4WKZA 4ZPTA 4PJXF 3GHEH 3MLXH 5D1ZC 2BFVH 3GWOA 2AK4D 5D7IB 3NIDF 1RZKH 1H3PH 4JKLA 3TCLB 2UU9B 1P6FA 1RERA 4LHUD 3WJJA 4IK6A 3I3BA 3LNEA 1YC7A 4HKJB 4KK8D 4MX7B 3AT9A 4IEFA 4WTZG 5D2NA 3UC0H 1RZFL 1RJYB 1ITCA 4JRYB 4ZMXA 5I8OH 4N2BA 4XNQA 4S0TD 2UX6A 4GMTL 1IKFL 3WIIH 3HHSB 2F95B 5E8OB 3WE6B 3L4CA 3FOLB 1KGJA 3NSJA 3C8KA 4GW5B 4WV1B 2DB8A 4H8WC 1BJ8A 1CJYA 3QIBD 1WBZA 4WI4A 1RSFA 5EIBC 4FGMA 4IRSB 3QDME 5E9DA 4KGLA 4TL5A 4XOCA 3DETC 1MHPH 35C8L 4MAYC 5D7JC 1ZAGA 1YEDA 3F2LA 2F6AA 5B38B 2VQUA 3RVTD 2MPAH 3FBKA 1YN6A 2LFGA 3FJTA 1RZJC 5EO9B 1VQLV 2PCFB 3MV9E 2CH7B 4R7CA 4R0LA 1DQMH 4RFNB 1MJUL 4AV0A 1KMGA 4MJ6B 1NCHA 5F1KC 4BZ2L 5FEBA 5K9JH 3HC0A 1W72L 5ESVB 4RRPA 1HNYA 4TQDA 3FRPG 1ZHLB 4GP5B 4O51A 4LEOB 1NCAH 4BH7A 5EOQL 2DMCA 2H8PA 1U93A 3QDHA 4LSPH 1UWXH 1YYLL 4K7PH 1JZ8A 4MVBC 3D0VB 3RE0A 2YXLA 5EBMB 5E8DL 4AHCA 1QRNE 3D0VA 4WTXA 4GP4B 1F02I 3ZRSA 3IEAA 4XP5L 4NO0D 2YD1A 3LMJL 4JI6B 1ECYA 1IL1A 1B6QA 1DUZB 2JJ1G 2HKHL 3INUH 5MHSD 3G5ZA 5A3ID 4OI7A 4Q9QL 1A7BA 3KBFA 2GABA 4GEIA 1EGJL 1JVLA 3HZVB 4GKZA 3EJRA 4Y9FA 1EJFA 1ZT4A 4OD2B 3WKPA 1RUKH 1F6FB 3MO1B 3OXRA 4FTDA 4HEPG 3VTMA 1HNZB 4AJVA 2OZNA 1R9FA 3DNKA 1VQ8V 1CB4A 4NN5C 1XR8B 5GTHZ 1OEZW 5I1LB 4GYBA 2IM9A 1HI6A 1ZA6B 2OMXA 1TVDA 1JYNA 1JV5B 3H1LH 3CXDL 5EWIH 1FO0H 3WEBA 2CKBH 1I94B 2N0MA 7TAAA 3CLWA 1AZZC 1I1RA 3AWGA 4CVZA 2XIBA 3AREB 4IDLA 2YAQA 4U3JA 1CIUA 1DSFH 1U8OB 1XGYH 2HYMA 1NIDA 1T1YB 3MV8E 4Y5YB 2KQMA 3S36X 4N8CH 5CM1A 4LSTL 4F8QA 2ZOUA 5KHKA 1F4YH 4IKLA 2MCPL 4JFFB 4HJ0D 1S7TB 2YUZA 4KROD 3BY6A 1S9YB 4S11A 4PA6A 1YEHH 3OM3B 2J5LB 5EZLB 2ADYA 3S98A 2HJKA 2ZCLH 2EVFA 3P54A 5C70A 4B3SB 3QFGA 2QEXV 3ZKNC 3EDEA 1JHLH 4P2RB 4X66O 4XB7A 3H1HH 3KH4A 1IUZA 3UTQA 1WIUA 1NCNA 2FX9L 2QSQA 2P47B 3S0PA 1JK8A 2EDJA 4BSJA 4DO6A 1KPVA 3K0DA 3N2GB 3SCMC 2ZSWB 3X13B 5KYWB 4X7EC 1EM1A 2AQRA 4PJ8C 1RIVL 1DR9A 4WIQA 4X99A 2BNQB 4GLRI 4LDCA 4XCYB 3KWTA 3PHQB 1NC2D 1WA8B 1S9XA 1TJMA 5L2KA 3SPGA 1R3JB 3VD9A 3ILQD 2DV6A 3MO1A 2C5DC 5EUOB 3A6CH 2DWEB 4P5TB 1ML0A 2P3YA 2V5TA 1O9HA 1VERA 5I1CL 3VRLF 1UB6A 1FE8H 1UJ3C 1XZ0A 3QWRA 4YNYB 4J23A 1ZS8A 3RUGB 5K9OA 1ANUA 4UQ3B 1E4WH 1OT4A 2Q76B 2WB1A 2YD6A 4DYLA 3KGRA 1ZSPA 3MRGB 2CO6B 1RJLB 3IJHB 4PRNB 3FF8A 4YVNA 1PNKA 1CYGA 2FGWL 5EMYA 1R6NA 4QPKA 1MCPL 2CO4A 1OARH 3ILEA 4ZUUA 4EFEA 3QUZA 3VB8A 1F00I 2OSXA 4FNUA 2JGDB 2Z5UA 2D2CC 2FVNA 5G4OA 3UADA 2N04A 3VI4A 3R0NA 2BOCA 1S4IA 2OL3A 2WWNA 3HZMA 1MNGA 2WTOA 4I3RL 1CS6A 4B7IA 1GN6A 3RWCA 3EOAA 1ERNA 1DQTA 3CZLA 3W37A 3FFQA 4U49A 1NMAH 4H26B 1O5DT 2DDQL 4WO4D 3LSQA 3NK3A 3PQYA 3QWNA 5L4FA 1XHHA 1WUZA 4WI0A 5GJTH 4FFZL 3JZYA 1IM9A 3DIFA 3GZPA 3T1HO 2FIKB 3LIZH 4FQHB 4C4UA 4ICXA 5I5JA 5E6IC 4PMFA 1XXFC 3ULVF 2FSEB 3TT3H 4KRMB 5B5EZ 3KMDA 4OUOA 4O2CB 5I0XA 1R3JA 3M45A 3OAUH 5DD0L 3QPXH 4GW4A 4Y2LA 2NSQA 1DHKA 3VFMB 2KH2B 4CN4A 1WICA 4QRBA 5CCHE 1N6QL 4EN3B 1S76D 2YAEA 4YY3O 4L37A 3LQAC 5BMFL 2OTWA 4KY2A 4BELD 2Z1KA 4G8EA 4I5BA 4S1RH 4AQEA 5AW0B 4P5TA 1RUPL 4MA7H 2XZAL 2V2XA 3QEHA 3NEEA 4FG6C 5FA4A 4F7EA 4OZIE 1KELH 4I5SA 3NRPA 5L2KB 4W4KA 5KHIA 2GJ6A 4CC4C 3N06B 2YICA 1S9VA 3C90A 3LZFH 3UZEC 4EUPH 4TUOA 3U6XS 4NRYB 2GUZA 3HC3H 4S1QH 1J48A 4EKWA 2FBJH 1I3VA 2PR4H 2YGOA 4PJGF 4PJ6A 1A7QH 5IFJA 4YJ3A 43C9A 3C5SA 1MIEH 3JD2A 3H1JH 4I77H 4NHUB 2IDSA 3S3BB 4FNLL 3RHWK 3QDMA 2WQVA 5E9DE 3R65A 3T77A 2IANA 3ARZA 4KKPA 4QIRA 4J3OG 5FYJD 1J18A 3IRZA 3UTSB 2O5NA 3HG5A 1J05A 3QQ9C 1S7UB 1UXMA 2OPCA 4Y9EA 3N04A 2WXIA 4HSQA 5D7EA 1X9UA 2P7TC 1SQMA 3SYQA 1P84F 1BVLB 5KSAC 2GB2A 2XOKG 5I19H 5JLZA 3CVHA 3K71A 1U92B 1Y18B 5KS9B 5EFIA 1DBAH 2UWEB 4WWKD 4OT1L 1VMGA 3CMOL 5ADOH 3PJSB 3SBRA 2AJUH 3W7UA 5HYFA 1VACA 1PV0A 2BVUA 5FF6A 1ROPA 3LSOB 2AQ1A 2VXQL 3RY6C 1OKEA 1A1OA 2V3DA 2VDQL 4GQQA 4IMLA 5IR1B 1CMOA 3SKNA 1ZWIA 2XA8L 5C0DB 1H8OA 2D7QA 3LEXA 2WO4A 2QGNA 3QO8A 3EF4A 4AENA 1MREH 5FYKL 3A21A 4X8XA 4Y2OA 3FMGH 1ZT4B 4OD2A 1JNLH 1CLZL 2GSMB 3BUQA 3L5IA 4JPWL 1NEPA 3S5YA 3T2OA 4TSFG 1UB5A 4ODXA 5A2QN 4ZUTB 3IJ8A 4HGKC 1ADQA 2XX0A 3HG1D 5J9PB 5BZDB 2BTOA 2C9RA 2H6UA 1N0XL 3KAAA 1GMIA 3BO8B 1MCBA 4KVNH 3QUXD 1OIOA 5D7IF 4HLZG 1GYVA 3UAJA 2MHAB 2AEWA 5FV1L 3C60C 4F3FB 4IGGA 3QG7L 4Z78B 4KKBC 2RHEA 4KRNA 1I75A 3O4OC 3VXSE 4HD9A 4H0HB 4NN6C 4XVSL 4WK4B 1PSKL 2WLHA 1A7NH 2WZ5A 4H8PA 3C6LD 3UCQA 2WLIA 4GMSL 3RL2B 4QJFB 3H9SB 3L4YA 3JT0A 1NCIA 3C5ZD 4D0CA 2IAMB 5GZND 3DVNA 2HT4D 1I7UB 1NFAA 1NCTA 3N9GH 4HYTB 2HSIA 2BOBC 1NDGB 5F7BA 3CC7V 2CDFB 1IBBA 1WIOA 2WBJA 2XV3A 4NM4L 1I8MB 1TZHA 4ZQKA 5BNXD 5F9DC 4FHKA 4J11A 3HNSH 4GW1B 2XI9A 4D94A 1VCAA 4GBXD 4XP6L 4MDIA 2RCSH 2YKKA 5CR8A 2YD9A 2XHNA 2JS3A 4G5ZH 2E74B 5B38A 4WLCA 4HWZA 5KANG 4W9DC 4PR5A 3T6VA 4XC1L 2DYRB 1YEFL 2D4FA 1UXWA 1RPUA 1A4BA 4OJCA 5I9QC 1EAPA 3CTTA 4H20H 4HSCX 3WS3A 5GSVA 4FLSA 4PTTA 1D5MA 1MFVA 4KRLB 2P8PB 4I8DA 4ONHB 5GISH 4H8QA 1G7MA 1CXLA 2C3WA 2O5XL 2VDLH 2XT1B 3KYNA 5T33L 1BQZA 4JPIA 1HKFA 1UADC 1NCOA 1NCWL 4ZSOE 4Z7QE 1DLBA 2EC8A 3T4ZA 3EBGA 3NFNB 4RVBA 1LO4L 3SGEH 3VWJC 1NBYB 1RZIB 4AV4A 3P02A 3UGEA 1CQYA 4LWSA 2J73A 3MGAA 5I8CA 3ZDZE 3SDYL 3OKLA 1PNCA 1VB9A 4LDEB 3CX2A 1MSPA 4OLUL 3IFPA 2XFGB 1UD6A 5KSBA 1MF2L 5DD5L 4ZMYA 4NM8H 5DYOA 3RPIA 3I6GA 3FTSA 4HK3N 1R1CA 4OM0L 2PXYA 4HFUH 2CBTA 3S7GA 3X3FL 1AO7B 1UFUA 4GG8B 1BVOA 4DGWC 2A38A 2MEJB 3BPCA 3TV8A 3UTZB 3VRIA 1JVMA 1NIBA 4IJTA 5GS0D 4IBZA 3DVFA 4PV1B 4UDUB 3HC4H 2Z0UA 4WHDA 2DJ4A 4YBLC 1I9JH 1ROCA 2BRRH 3G04A 1D5IL 1IGIH 3LEVL 4AGOA 4AMKL 1LVEA 4XN5A 3BP4A 5AG8A 3QXDA 4F6EA 4NWUL 3VSTA 4NKQB 3HG1E 4ODHL 4DWHA 3GI9H 1HXMB 1CGYA 5H94B 1C08B 4C54A 5JVDA 4JTAB 3VGAC 4MD4A 1E3ZA 4LVOC 3PP3H 1NGPL 1BXAA 1KTDA 2NLJC 5IHWA 3ARDD 2CUHA 2ESVA 3CLEH 4MRBA 4M1DL 3J8F7 5SX4H 3V4UH 2TRYA 1R24A 3ILPA 3MKGA 3OKEA 3SGKA 1T0NA 3DYOA 3ZGHA 4D7PA 4WJ5B 4U1KB 4Y89A 1GA2A 1OOWA 4YHNB 4A37A 3KPRE 4J7KA 3E7JA 1XIWB 4AQOA 1CURA 4NNXA 2H3OA 3DIVA 4RO2A 2AV7B 1F6LL 1H6FA 2C9PA 2XTJE 4Z7OE 2NY2B 3SGJA 1IEAB 4BCYA 5HYIA 3IN2A 5SWSD 4EI6B 2NNAA 9CGTA 2WNWA 5IB2A 3DX2A 1VQ4V 1BZ7B 3V6ZA 4JFHD 4FQXA 5IG7B 4ZMOA 5KVEH 4O2AA 4JO4L 3T1FA 1XHZA 1L7TH 2HZHA 4M7KL 1COBA 4OGXH 4Z7IA 1QTPA 3VB9A 4RBPH 5CLYA 2E4TA 3D30A 3QCUL 4GSQA 1Q9OA 2CUMA 4K8RH 3P30A 1CT8B 1OCWL 2EH8L 1K2DB 1LO5A 2VMCA 2NQCA 3QUML 3FS9A 5H9CA 1HWWA 4KFZC 4LMQE 4YDJA 4NS0A 4ODSL 4C56E 4JJOA 3QJHA 2RB8A 1N59A 3FQUA 4WHTB 3FB6A 2W07A 1YEEL 3S4SA 1IBMB 2F7OA 4BKLA 4KVCH 2BSSA 2DWDA 4MVMA 2VISA 3MBWA 3ULUH 2FYYA 4TUKL 1E4JA 4JDVB 4JDEB 4YFLI 4PJ9B 3QEUB 1A5FL 3BQUA 4A6YB 3ARFB 2VQ4A 5IFAL 1H6UA 4Y1AA 2F8XC 3FU6A 5HHNA 3CN1A 2DWDC 2L8AA 4OPAA 4Y4HD 3ULUE 4NB7A 4O4IB 2WD0A 1MSDA 5JHLH 4K3DL 1Q4NX 3D34A 4FS0A 3MRMB 2J1KA 4M1GH 4PJ8A 4TT3G 3FAVB 4TV8B 3AAZB 5A6MA 1ZANL 2YA0A 3OX8B 3ZHDA 4F5CA 1TYRA 4X66B 3TV3H 1OALA 3SE3A 5IV2B 3WO3B 4LIQE 1D6VL 4OJDH 5FFGA 1NVPD 4AL8H 4Z3TA 1K6QL 1XBLA 1VJSA 3B77A 1KZQA 3MZTA 2OBGA 4MNQB 5KVDE 1KFAL 2TRHA 4ZO8A 1BW8A 2J2ZA 1SA0B 4U1LB 5BO0D 2AXGB 5CIPH 1KIRA 1ZT7A 3C2SA 1Z2KA 5LWYH 4MZIA 5CGYC 4PREA 5EHFA 1X5AA 3H2WA 3P2TA 4RNRB 2VWKA 4ZFOL 4WI5A 3QUKB 5KW9L 1IE5A 3SJCC 4WFAV 4PBDA 4LCWD 1OSYA 2ROXA 4XWGL 1MAML 4JASA 4M43H 4NJ9L 2FX7L 5HYSG 4HS3A 2A77H 4C55A 1VPOL 1QBLL 1C5DA 3UYPA 1PP9H 3X14B 1Z0NA 5F7YC 3UFIA 4WFHA 1Q9KA 4G3YH 4BW9A 2VERA 5LCVA 1T7WA 1D9KC 4KMLB 1E3XA 5T1DH 2Q2EB 3CFBA 2VDMB 2WIIB 4WWKC 3IETA 1D5AA 1N3NA 3L54A 1CFBA 1EX0A 2YD7A 4X6BA 4EO5A 1G9HA 3DSNA 4RUEA 1KTKE 2FK9A 5CBEB 3EJSA 4ZX3A 3GJFA 3O65A 1Q43A 4PREB 4CN6A 4YK4B 3IDNA 2DYPA 4HJJH 3U30C 1EAJA 1KACB 4XVUC 1QAWA 3KE0A 3RZCD 4DW2H 4QIWF 4P59L 4M7ZC 3MAQA 3M1CA 1T7XA 2CGYA 5TQ0H 1EZVX 2ICWA 4AENB 2P5WA 3MRLA 3UABA 3C60B 2X6UA 4P5TC 3LDDA 4OZHB 4GRLD 1K3ZA 1VAHA 4BSVB 1RZ7H 4ZFFA 3UTSD 4JHWL 2G75B 2NT0A 2ATKC 3ARDA 2ISDA 4K71B 3WFCL 4R4NC 2I32A 1MLCB 3BKYH 1AS8A 1E5BA 3I84A 3CVIL 4UM8B 1VF6A 3JWOH 4IBSA 4ZDHB 3F5WA 1VIWA 1FZOA 2M26A 3IJSB 4G8IA 4U1MB 3TH3T 2A74C 2YXVA 1XGQB 3EO0A 3MRNA 4FFYH 3PNWB 1P5VA 3T9WA 2AKRA 3IJYB 2Z35B 4F6RB 4UMGA 3TN0A 3GK8H 4XR8C 1WYJA 5F1NA 4OI8A 2X5PA 1TJIH 5F96H 2BY2A 2GEEA 1IFHH 3P73B 1QSEE 3BDYL 4GXVH 3GSQB 4JRXB 1ZLDA 1M7IA 4ALAC 2XN9D 3BPNC 5FFOA 1B90A 1HU8A 4OCWH 4I0PC 5I8KL 1L9RA 3SKUD 2ETWA 2CRZA 3QXWA 5C8YB 3QNFA 3V52H 2XN1A 3A0OA 1WD8A 3L4TA 1B0IA 2UXVA 1TVHA 4FKEA 3SPIA 2DQFA 4G2KA 3BVNA 5JHDE 1QRND 2OSYA 4K94H 1MQKL 4IKKA 2GTWB 3OPZL 1M56C 4P9HL 3WFZA 4OF6A 2QVTA 4YJ2A 1HHIB 4W93A 3QI9D 4Y16C 4RMBA 4LVHB 4GW4B 2F53B 2RTTA 4XBEH 5AD0B 4EB6A 1PNMA 1JAEA 1JHTA 5K39B 5H6RA 1T03H 2CAZC 5CEZE 1FNEA 3CSFA 3TJTA 3FTZA 1BSMA 3HPLA 1URFA 1NANI 2HKAA 2YD4A 3A4FA 2GCYB 5FGSA 5HGDA 1UZGA 3CFMA 1INQA 2AQQA 1XCQB 3VFRB 4U6YB 3J80N 1CYXA 4RFOH 4HXBH 5DRXA 1N0LB 3SCMA 5HVHB 4HU2A 5IEKA 5BV7H 4AXWB 2LLNA 2HJFC 4OZHE 2QPSA 3PWLA 3CH1A 3DJSA 1KTBA 2QQNL 5GZOC 4TULH 2BOCB 2OL3B 3BSGA 2LGNA 3DARA 5JVDB 1A4AA 4D8PA 1KOAA 3APMA 2ZUYA 1G7HB 4QJ4B 5ALBH 3MLZL 5M94B 5FYLD 2PP9A 2ZQKA 1VEOA 3KVDD 3TEZA 3AG3C 3GMOA 3SGJC 4I3SH 1QLEC 1NH6A 4HHGA 4ACTA 5JDSA 4L0ZA 3HA0A 4LCUB 4HULB 2YXYA 2NXZB 3RUGA 5K9OB 4UDUA 1JNNL 5DJDA 2ID5A 2QEJA 2BMKA 1YEJL 5CJBA 1NGZB 1ZV9A 1QUPA 1DQKA 2VN7A 3MNZA 4ZFQA 1WVZA 4QLRA 4CNIB 5HSFA 2R1WB 4BK4A 4HUNB 4XCYA 4NUJB 5FYLH 2JELH 1NL0H 1F4XL 4OFKA 5I30L 3QEQB 4F2MA 2X4QB 4X4YB 3WNOA 3QQNA 2XQBH 3CAFA 1EIBA 2UZPA 2ZZUT 1BLNB 2EUVA 3D52A 3EJCA 4FQIH 5HDBF 3P4LA 1KLFA 4ONGH 5M95B 2AQSA 1DYZA 2VLRD 4BFBD 3QCTH 1YDPB 1T21B 1RZIA 2Q3AA 2OXHA 1JN6B 3ARXA 1KPUB 3F12B 3OR7B 5C97A 5JPNB 1BF2A 5JXAL 3VFOA 1QFWM 5C0DA 4RFOL 1BFSA 4WW2F 1DJWA 5I18H 4K3JL 3VMPA 3ZHSA 2NY6B 4A7VA 1SDYA 4DV0B 3KPPB 3QZWA 1AZRA 4P9MH 1JDDA 4PTTB 4JPKL 3SY0B 5IMKB 1Y1UA 4P46C 4R7DA 1AJ7L 2VM9A 2P46B 4ZUSA 4G7YH 3WIAA 4ZX6A 3RZCB 2CBQA 3KPLB 2PO6C 4MXWL 2ZE8A 1FNGB 3NUKA 3X1NA 1IC7L 3WIHA 4RGNC 4XBEL 2YZ1A 3BN9C 2HX8A 3GJFK 3OEEG 2ZCHL 3O0RL 2R9HC 2JIXD 4X5WB 4JYAB 4ELKB 5CEXB 3QJFA 1OANA 1U8PA 4JI2O 3IGLA 4UCOA 2Q7YB 2Z4QA 2EE3A 1Q6UA 1NBVL 1CXKA 4JQXC 5E2TH 3DX1A 1KJ2H 6PCYA 1M5IA 1KJVB 3D05A 3FTUA 2QGBA 4NKGB 1J5HA 3U36A 4ANVA 2EDLA 2JSFA 3V6BR 2BC4A 3V52L 3IPFA 4NUMA 4Z95H 2K9PA 1KN4L 4HZLB 3RPKA 2GFBA 2VC2H 4B3RO 2DWXA 3Q13A 1H2GA 2WUCH 3C6LA 3GBLA 3HE7C 4Q56A 1IXBA 2OYLA 3WV0A 4JY5L 3K4DA 1VCBC 5DHEA 4JI8O 1UH2A 2DZEA 2OMVA 2P4AB 5C0IB 1NBQA 2AERT 3BGFC 1SBSH 3C5XA 1COWG 1PF3A 1AGDB 5CEYB 5ISZE 2IPUK 4OAWA 3GIVA 5EK0A 5DA0B 5A1AA 1M2OA 3K2IA 4XVTH 5F70A 2NXZC 5LP6A 3L7EB 5EUOE 1KC8W 4IIZA 1J11A 4LBEA 3ROOB 3ZMUA 5BV7C 3QHZH 1LDPL 1Q94A 2MQGA 5H2BA 1QLFA 1ADQH 5DMKB 4BCXA 2O61A 1S9WB 2B5UA 3KPQA 4TLSA 1CGSL 3E3QE 4ODUA 1MNUL 2BIIA 2HG5B 4ORGA 5I1AA 4JHBA 4KI1A 1NBVH 4F58L 2C1OB 4QNPE 4JRFA 3PJSK 2NY5L 4XMLH 1UOKA 2P44B 4DUZO 2QR0B 1O7VA 4KZCA 3AITA 1Y74B 3BH4A 4ACPA 4GAGH 5EN3A 1PTZA 1CXZB 3T6ZA 3G6JE 1DJZA 2ZXGA 1FXVA 2JIZG 3JV6A 3CE2A 1KBKA 4N8VA 3NA9H 1NLBL 1ZHBA 3EDKA 5L0QB 2RGSA 1S7UA 2ZPKH 4P9ML 5E95B 2ATAA 5EOTB 3V8OA 2WINA 4K3JH 3MSPA 1Z5LA 2CKBA 4ISVB 3COOA 3QO0A 2Z6FA 1LL1A 1EH9A 1I8KB 2ZYIA 3VXMA 2QL1A 1SVCP 4Y4FB 5HYJE 1NPJA 1QBLH 3JD4A 3DXAE 4YSQA 3QCVH 4JZOB 4WFEE 4MVSA 1Y76A 5CSBA 3UX9B 3PAZA 1RM1B 3RB5A 1J5OH 1HHHB 4NI6A 1MIMH 2CG9X 4UAHA 4PW3A 3F7KA 4ZQTA 4DESA 3JAWB 2XG5B 2ZD9A 3MFFA 2BP3A 4YXHL 3R8QA 3SDCC 1PQZB 5CGMA 2ZF8A 3JT2A 4B9IA 3OKOA 1HDJA 1IBHA 2BIOA 3C9NA 1K8AW 1D6EA 2QVIA 4JN2A 2CDEA 2DOSA 4UU9B 4Y1AE 4ATWA 5DJXA 5SWZE 1TAEA 2CLRB 2WBXA 1KFAH 1V54B 1CI3M 2WANA 3EYOB 1DBMH 4ERSL 5LNGA 3QWOA 4NC1E 1MG3C 4L4TD 1PKQE 4UFZA 2VQ1A 4OZFA 3FB7A 4LSUH 3T4YB 3S35X 4KPHH 3B2PA 4QOKB 3DK0A 2ZIDA 3MLZH 4G9FD 4L4JA 1D7DA 3TNMA 3ZDWA 4C57C 3AS3A 3T4AC 1JOYA 2VUOA 4KKLC 1YNTA 1ZVSA 4AQAA 2IWEA 3SDXF 4N9OB 2JH2A 1KUMA 1TSHA 3L9YA 4HHAA 5F93C 2DJVA 3FO1A 4S1DD 2D31B 5FPIA 4UVCA 2QQNH 2WCPA 2YPVA 3X11B 1J9RA 2QFRA 3SYCA 3QJQB 4YZWA 5FPOA 3CB2A 2EADA 3HHRB 4HJTA 4L5FL 3ZZ1A 1WCBB 2ADIA 3D0LA 5GRWA 3ZGIA 2IQAA 2JB6B 1PVHA 1FAKT 5DS2A 3TOPA 1I3UA 4KXAA 2FWSA 5E6IA 4DK6A 2EAEA 1Z3GH 4WZ9A 4TNWF 5G2NA 2RQ8A 1JXFA 1RJLA 1UG9A 3SE4A 1FL5A 2YZ8A 1FAFA 3CC1A 5EZYB 1ORQC 4APXB 4N0UA 4P4KA 5I16A 1MABG 5DN6G 1W6LA 4MA3A 3GMQB 3ZE1F 3ZSTA 3VQYA 4POYA 4UYPA 1CXEA 1ZCRA 4OBSA 3IMTA 4H40A 3CWGA 3KZIZ 5FDWA 4KH2A 2WZAA 5JQIB 1ZHNA 3GSOB 4GKSA 1R6KA 1G9EA 3M6DA 4IBUA 2C4FT 2VDOH 5DJAB 4LDOB 2N1TE 2YLKA 1Q72H 1CP9A 1DVFC 4PDRA 3GI8H 4K35A 3BHBB 1KYOJ 1KPVB 3BUYA 2X12A 3D08A 1WUNT 1NC4A 3IGFA 1HNGA 1L7TL 1RV6X 5GRJH 1BECA 1R3KB 4KY1L 5D1ZA 1ETZB 2AJ3A 1RZPA 3DLQR 5DTFB 1NAMB 3F5WC 5GRUL 2PF6A 2VLME 1HQRA 4P5RA 3FTVA 4L87A 1OCCB 2CUGA 3E1F1 4IOSD 2WN3A 4L3FA 4N68A 1XF3B 4ODWB 5DXWA 3TU6A 4DH2A 4XAWH 1QI5A 2OIGA 1QSFE 3P30H 5ELIA 5FHAL 1KYUA 5J3HC 2MRYA 5GS2D 4PWIA 2P22C 3MRJA 3SDCB 2ZOTA 2FEEI 1FORL 1G9MH 4B9ZA 1ILUA 2GY7B 4LAJH 1JWUA 3QFJA 2O6EA 3FFDB 4RMVA 4PG2C 5J56B 4JI1O 5ANME 5J6GB 3GMLA 4HAMA 2XTLA 3K5LA 3G3LA 5DFTA 5B39G 3ILDA 2DLGA 1XB3A 5IJVB 3K2UH 3R7RA 1R6TA 4PJ9D 3BRDA 1KBGH 2FKXA 4RCAA 5DR5L 1H8HG 2PN5A 5BXFB 1HI6B 3LD8C 2H6OA 4MD5B 4X6DF 3AQXA 3ZMEA 3IDMB 3OKDA 4X1IB 5IQ9A 1OM3L 4X8JB 2VDNH 4JFDA 2I69A 3FCUB 2XIIA 3GVMA 5ISZA 2IANE 2OJZL 2H1PH 4X5LA 5CLXA 2FAUA 4DV5B 4HIXH 4NN5B 4P59H 4G42B 1ZVNA 2NLJA 1ND0A 3QAQA 1IM9D 3T3PB 4ELMF 4LF4B 3VGGA 3UBXB 1YAIA 2AXTZ 2O5ZH 2QQQA 2E47A 2VWEC 4ONFH 4EEEA 3BP7B 2NY4C 5AZUA 2XAQA 1W8NA 3DXRA 1MCOH 2HH0L 3FFCE 3GEFA 1MF2H 4R26L 3FTGA 2DTSA 3O6FB 2G5RA 3D36A 4DT2A 4IT5A 4LF7B 3WFHA 1ZLUH 3U7WH 2X42A 1OD7A 1UD5A 3CN0A 4M9PA 4U6VL 5G55A 3HC0B 1B4JL 4PJ0Z 4XBFA 3ZBHA 4BIZA 5GISL 4AG4H 1MMMA 1MAMH 1WGOA 2YD5A 1J8SA 5CHNA 5DVLA 1KT2A 2A99A 4J8RB 1KYOK 5JO5B 2EUWA 2A79B 1YEFH 3L5WB 5A7BA 2QSCL 2YQBA 2JXMB 2CNYA 1BOYA 4GX0A 2ZXWC 2YAOA 3HLAB 4GSDL 1BM3H 2BSED 4R97C 5LWYL 4NYKA 5BMVA 1I53A 3LEYL 4LKXA 2BW5A 3CUPB 3I02A 3DXAA 3HNSL 2NT1A 4W9IC 3D3VE 2CTPA 3BGMB 3ILQC 4E0RA 3E3QC 5KOMC 5LUMA 4H8VA 1E9PB 3DOHA 4JRYA 3ARPA 3CQPA 5J13B 4FERA 3D39E 2J6WA 1ZANH 4KX9A 1WZAA 1A7NL 3B7YA 3EFDL 4I88A 3P4MA 4MVUA 4QXVA 4DV7O 5BRZA 3ZDYF 1IGJA 2B1AH 1QPKA 2CHNA 3EJZC 1OQOA 3O8XD 3WMPA 3IXAB 2DBLH 5LOVA 2EIZA 2UXCB 4CS4A 3S2CA 4JBSA 2EILC 4TNFA 1WA2X 1U95B 4OAWB 1PKQA 4QDGA 4DP8X 1AGDA 3RBZA 1A5FH 1I08A 1CLOH 3E8FA 2HRPH 1JZHA 1FL3B 1VADA 3D25A 4ZODA 1D5ZB 2CALA 1TYEB 2H1LM 2OM5A 1T4KB 3JV0A 4OZIA 4I2XB 4CH5A 1JPFB 4HS6B 1RUMH 3JXAA 4BGLA 4AYGA 1UATA 3GD1C 4HCRL 4QRRB 3US9A 4LNVA 4Z77A 2CR6A 2AJYH 3KLKA 3OLEA 5JOFB 3BHPA 2QHLA 1FAIL 4ODSH 1JGUL 1HKLL 3WNJA 1DP0A 2MIZA 4PD4J 1PDKB 3VXQA 3C5JB 3H0TB 2ZF9A 32C2B 3F58L 2Z8RA 1QLRA 5D7KE 1JZJA 3RYHB 5EBGA 3Q8EA 4OJYA 5ERWA 3NRFA 4J3WA 1QNZL 1X4XA 1PAZA 2P67A 3L4UA 3LB6C 4J3OH 4N25A 1SJHB 4F8NA 2H3NB 2Z7WA 1FFRA 2VXSL 4OFIA 2H5UA 3LS4L 4N1HB 4Y7OC 3T0ED 1THZA 3IK2A 5ICUA 3TFKD 2QQKL 1LO0H 4ZS6C 1HNXO 5DGRA 5K69A 5CKGA 4TQPA 3B8NA 1Y6MR 2C3VB 4LNUA 3DO7A 2CO7B 1CXHA 3GTNA 3DGEA 1F4AA 4CU8A 1RP9A 2OYKA 2H26A 3VXNB 3D50A 3ZHLA 5BRPA 3B7UX 3NIFF 1GGBH 2N7AA 5KZCD 1A7PH 4MTXA 2VZOA 4Q4EA 1N26A 4CADA 4QXWA 4JCMA 3WXVL 4MCYA 1MLBB 5L4MA 4PBVC 2EVJA 4JGUA 2JVDA 4G1EA 1IQDA 4S1RL 1HDMA 5DJAA 2CD0A 1OGAA 3O0LA 4DXWA 5DRWA 1T1WA 1DBJL 4W70A 1N6QH 3MC0A 3KR3L 4AYFB 1K9MW 4CNIA 4HC1H 5PCYA 5AW2B 3O4LA 3OKMB 1B9KA 4CMHB 1J8HB 3KPRA 1K85A 1IVLA 5ID1A 5EC1A 4M6ML 2ZUQB 1AG6A 2Q69A 2ZYRA 4M8QB 5EZYA 3OF6D 5KN5B 2JK5B 2ZDIC 3Q2CA 5CN0A 4N3UA 4U1JA 3N42F 1X5FA 1DVFA 3NCXA 1QSZA 4NQDA 1EN5A 4PJ7E 4WSKA 1WCBA 4ZNCD 4EOWL 5I1IL 1AR1C 1LWJA 4X6FA 1OB1A 3B2UC 2JGUA 2ZNJA 3Q6GH 4XBPA 3NOIA 2IXQA 3V6FB 1HILA 4F20A 2BW4A 1YN7B 4ZBMA 2FLMA 4L0PB 1M7DA 4E5XB 1I82A 1MJJA 1G7PB 4UWQB 2CDGB 3L3IB 1CZ8L 5D2LE 2ZWLT 5AW1B 2EIJC 4RDBA 4H0IA 3VWJA 3HEIB 1MHHB 3UAEA 4UV9A 1V27A 2ITCA 3Q2WA 5EU5A 5MENB 4X62B 2H32A 4MSWB 2G2PA 1E42A 2G3MA 2OXGA 1TLKA 3HR5B 1UQSA 4GQPH 4JX0A 5K39A 4MQSB 1MN4A 2CM5A 4WO0A 4ZMLA 3T09A 4YX2H 2DJSA 3RRQA 2F53A 4UM9D 5DD6B 1P4RA 5F7WC 1JQ0A 3UAAA 5JNYB 3EO9H 3HJEA 1AVAA 2R0KH 2XPGB 3L4XA 4OM1H 1PG7H 4RLDA 1JK9B 1E9OB 1HQ4B 1Y0LB 1KTRL 2GTAA 3KPMA 4JY6B 3BYTA 4LVEA 4PJAE 3Q4HB 2QA4V 4P8QA 4F9LA 1UPGA 2EC9T 2DMKA 4ILDA 4PB9H 1DF5A 1Z5HA 2HEPA 2F74B 1X6LA 4OZ4A 2FX9H 5ICZA 3AS2A 4J10A 1O6SA 4GKNA 4NDMA 3HKDB 4XVSH 3ZX6A 5DJ6A 2Y1AA 5L88L 3DSFL 4I55B 1LP9B 2VN6A 2OCCB 4D9QE 4JPSA 1XGPB 4YHKL 3CZEA 1B6DA 5AW9B 1A6PA 3REVB 3K5MA 5DM6V 3DUSB 1KENH 1RHHA 2APWA 3EOYG 1GL4B 3MLTB 2CU9A 2WP3O 4TLKA 3C09C 3QA3A 1YZZA 4EVNB 2WAHA 2HN7A 4NZRL 4YK4C 1K8DA 2D0FA 1NIAA 2XSKA 3PABB 1HEHC 2AMUA 4KZEL 4MMXC 2WOBA 1Z9SB 3M8OL 3QH3A 4BGDA 3LKPA 3CFCH 2DQUL 1FO0L 1CDYA 4CVXB 3CCSV 4NO2A 3T2PA 4BINA 5IQLA 4NXSA 2HTKC 3FUMA 4MXQC 4ADIA 1PFCA 2NMSA 4Z0XB 4JANA 5DHYB 1CN4A 4BCZA 1XMQB 4GQ9L 1Y66A 5HGBB 2O61B 3SE8L 4NTWA 4PJIE 1RUKL 3BKJL 1ASPA 1JGDB 3GSVB 4GIAA 3VTTA 4M4RB 5BCAA 3KLLA 3O9WC 3DUUB 3ROOA 4C83B 1DBAL 5ADOL 1K5QA 1AOHA 2HKHH 2P6JA 3TJEH 5I6NA 4NENA 4TPRH 5I19L 1P53A 3LQAH 3APQA 1MRFH 2EEAA 4PJCF 4DKAA 4QRRD 5EU6A 2Q6WA 1RJCA 4TWKA 2Z31B 4HYOA 3MMEB 3HKDA 3FONA 1R3HA 3PUCA 4KOBA 2AVGA 1A9VA 4FQCL 3DHUA 3EYSL 2P5WE 3C6LB 3CPLA 3JYBA 5C09B 2BY3A 3BZFA 2ZUUA 4LBEC 3EFOA 1CD8A 4NKDB 2PYEB 1IAIH 5GIRA 3QIUA 4DV6B 3MRRB 1L4IA 1J1PL 1P4LA 4KTEH 5IBLD 1EN4A 2XZAH 1RUPH 4MA7L 2DYSB 4MMZB 3IB4A 1DL7L 5HI4D 3N2JA 4PHXA 1FFNB 4WNQB 4CC4A 1YVWA 3C5ZC 4P5SA 3STLB 1IBGL 1HQ4A 1QHPA 4OGQC 4Y16B 1JYXA 4BDVA 4LF9O 2VTFA 5DD0H 1BIIA 2J55A 3L9EA 4LVNB 1CG9A 1IM3B 4X65B 2FQFA 1TZIA 4IHOB 2BFGA 2IW5A 1QSEA 3DO3A 3FT4B 1CUOA 3AEIA 4OV6F 1ID2A 2DQ6A 5F72S 5GJTL 1BM7A 1F3DJ 4NT6A 3DI3B 2I60H 2EDMA 4PJ7F 4DP2X 2HFEC 4Z3HA 1L7IL 3BFWA 2G2NA 4YDIH 3MRRA 3SE6A 3A6OA 2PYEA 5GIRB 3ZJAA 2BVTA 5T1JA 1UC6A 1N36B 4G9FB 1HFUA 5K5YA 5LGUA 4DOHB 5IYZB 1MW2A 1TUBA 2AAAA 3GNML 4B9YA 1OB1B 5IJ0B 3VXMD 4F4LA 1R3HB 3SQBA 1DJHA 3ZTCC 4JK0D 4JDZA 1VZHA 4X6DA 3L2LA 1HS6A 1ZTMA 2BOCC 3O3BA 1YHQV 4FXTA 4NQDE 4GZRB 2WVVB 2CIIB 4UNUA 3EGSB 3H01A 4H1LB 3VI3F 3SKMA 1XH2A 4UVAA 4TSAH 4BUGA 5JIPA 5J1SC 3O9WB 4NENB 2HKFL 2EC9U 4K3AA 2MQ0A 1YJ9V 5FL7G 3AG1C 4DK0A 2OZ4L 3DVGA 2NY2C 3P77B 3DXAD 4LBAA 4N2NA 4ABUA 3DJRA 1RULH 4OQTA 1T6WA 2LQTA 3GSVA 4GUOA 4R4BA 2BSEA 3G5VA 2YS4A 4X42A 1MY5A 4XCCL 3NJNA 2YMXH 1GKFA 2YUWA 2WXOA 2Z31C 3X3GH 4ABVA 4EBQL 4UTBH 5HHXH 3F64A 4PJXA 3U9PL 1M2VA 1JZEA 4XN2A 2L7QA 2VJ0A 4IHJA 3TLRA 4D8PB 1M9NA 4KKAD 2IFFH 2MSPA 4MCYB 4ZAKD 1RVFH 4K8XA 1PL4A 1WE5A 3CSYB 1MRDH 3KYKL 4HWBA 1A3LH 1JHLL 5E8EB 2J72A 1OCZC 4AQ1A 5DUJA 2QM8A 2AQTA 3DO7B 1G1XB 2HN7B 4PLJC 3RYCB 1R75A 1TJXA 4OKDA 3RUGE 1K97A 2F8IA 1FVCA 3P11L 5FYKD 1KJ3L 3BAEH 1J1OH 2AW2A 4PJAA 2GHZA 2OULB 1CLYL 4AIOA 2F08A 5EO0A 1OE2A 5AZEL 3W9EB 1S2EA 3PXLA 4YHIA 3DHMA 3S5LB 2D7TH 3D18A 2EZ0D 1H5BC 4FP8H 3RNKB 3MV7D 3A0RA 3D09A 1I0HA 1G0XA 3NH7H 1QP1A 1TU2A 1EDHA 2QGEA 2XNAA 3A0HZ 2QPDB 2JB5L 4M93B 2V1DA 2XJLA 1TVKA 3RWDA 2CHZA 4HNAB 4A2GA 5LL6Y 4X88A 4A38A 5D6CB 3Q4HA 1SQQH 2X9WA 2CKNA 4UCVA 3ME0B 3CFEA 4P48A 1OW0A 5DHDA 4APQC 2VCOA 4XE5B 2ZUWA 4XPBL 2E75B 2RBLA 1FL3A 1VADB 2WP3T 1K5WA 5B22A 4LARL 4YHZH 5BVPH 4JAVA 4M8VA 4J28A 3B2MA 3BZFB 5KTEH 1I1AB 1AANA 2Q5BA 4KI5F 2H32B 3WNLA 3IS1X 4H8WL 5ICXB 1KJMA 2PPCA 3ATDA 5JMOC 1MCCA 4XP5H 3WEXA 4LLDA 2OR9H 1P4IL 3C75A 4FC3E 3TZVC 4UVBA 3WEMA 2BPBA 3QUGA 2Z92B 4LSPL 4IIQC 1HWGB 5JJEB 3O6MH 1DSYA 4IDJL 1UEMA 5EOQH 3MLWL 5C0BA 3WUZA 2OK0L 4JFEE 4XI5D 4PJFA 4DUVA 1T2QH 2EYRB 2D3LA 1BVZA 1W72H 5I6XC 1XNQO 2F58H 3JTSA 4ZOEA 4AYMC 3MGOA 2VLRA 1MJUH 3N5AA 4XOAA 2Q7GA 3SJVE 2Q67A 2P8PA 3B37A 3ORJA 4ONHA 3DX4A 3FQXA 4OUUB 3MODH 3E80A 1BHGA 4PA7A 3ABGA 5CBAB 1G7QB 5D2NC 1V9PA 2ZOLB 3HRZC 1AR4A 3VJ6A 3ZKND 2FT8A 2E6PA 2IALA 1MHPL 2KPWA 4DP5X 3ULVE 4G6AC 4HMEA 1H3VA 3UAJC 1X5HA 4Z7UB 3H3PL 1JXKA 4X20A 1VF6C 1EFXD 4MNHB 4QHUB 4XPTH 5B7FA 2X28A 1XH0A 2JJSC 4A7GF 1KCLA 4KZ0A 3HLAA 4GRLB 4MLSA 2M6YA 2WQSA 4D9LL 2R69A 1YLBB 1G1CA 2KZKA 3LOWA 4GMTH 5EN2B 5AW4B 3HE6D 1OTUD 4X7SL 1VQ6V 3GSNA 4MB5A 3PP4H 2VZTA 4FVMA 2OSWA 1ZRUA 5BOJA 3B4SA 1H5BA 2N1KA 3RFZA 1MG1A 2O72A 5F9OL 3IC9A 1P5UA 2APXA 4JKNA 1CFQB 1SJVA 3MHSC 2JCCE 4HIIB 3D2UB 2D8KA 3P3UA 4CZZA 4X1YB 2BFVL 3LRMA 4TSBH 3BRGC 2ZWZA 3M1BB 4NPKA 3ROLB 4YWGL 1WAEA 4WI6A 2BVQA 4GAAA 3O4LE 4BFNA 2XV0A 5IMMA 5ICZB 3S8WA 2HT3D 2G3XA 2KKWA 4JHZA 4HGWA 4Y4KC 3LJ3A 3DRTA 3RWGB 1DVTA 2DM4A 5A16B 2NLJB 3AU0A 3CSPA 2HFTA 2R51A 4M6AA 4CW1A 3ZT5A 3EFFB 5ISZB 4BK5A 1GCYA 1KV3A 2BY1A 5ESQA 3UTOA 4OZHF 3ELAT 2M2DA 4CSPA 2DWYA 1IGML 3QORD 2W0KA 2VXUL 2VDRH 3F6IA 4KKAC 2Y4TA 3BXNB 3EYQC 3VQ1C 1IT9H 3K5OA 1A3RH 3LTVA 2OFQA 1ASQA 4I0XB 4ORZC 4POUB 1C5CH 1FFXA 4UQ9A 3SDDD 3P3SA 1X5LA 5IR1A 4I0PB 5HGGS 4PSPA 4O2EA 3E8UH 4GSUA 1KWGA 1TENA 3NT0A 2DAVA 4CBPA 5IM7A 1BX2B 1T3FA 1WFJA 2ED6A 4LK4A 3SGIA 3TGUH 3ZT6A 2SODB 3BRFA 1BEYL 1U41A 2JKXA 1JPFA 3D07A 1RFDH 3O45B 4HS6A 2QWNB 3BAIA 1C7TA 4L1DA 4V1DB 3D85A 3O45A 4V1DA 2PPDA 3ARFA 4I9XA 4F33B 5KX5A 1QNMA 5ICYB 1IIKA 4NQQA 1R5IB 2FNWA 3SE3C 4DGUA 4M93C 3BUTA 2IANB 4H1LG 1NKDA 1E8XA 3BH8B 5LOVB 4K94C 2W94A 3G5WA 3RU8L 1R3LA 1YITV 3FQUB 4Y19A 3CP1A 4FLHA 1XREA 3MD0A 2A5UA 4FFTA 1FP5A 1ZTEA 1MFCH 1QRNB 4P30A 2R56H 2F4VO 1OGTA 1UD2A 3O2WH 3WTYA 3T0XA 3W9DB 3FO9B 5KMGA 5ADPH 1U3NA 1SOKA 4Z7UF 4X98A 4KHTH 4UNIA 4YSRA 4TVPH 5LB1A 5C92A 5ESQB 2WQRA 2X2IA 2BCKA 2ZP0T 2W81C 3OKYA 3H9SD 1NUFA 2AJSH 2A9AA 2EIBA 1HNWO 5ADPL 3SSGA 1E4XI 4O02B 2ILMA 2Q68A 4A2LA 4DR3O 4DHLA 5IVXA 1I7ZB 4OIIL 1QR8A 2BOBB 3T4AA 5E7FA 5IJBC 5J1AB 5FUCC 1LM8V 2ZWYA 3IU4L 1OCOC 2ZX6A 3SDAD 3SJAC 3QS2A 1BQLH 4OPHA 3ABUA 4KQ4L 1WFNA 4DJMA 5HI3C 4DCQA 2ADGB 2YDEA 4KGJA 2YSSB 3FC8A 4AJWA 4MXVE 2AGAA 5HFMA 1IMHC 4G6MH 2IQAB 5J6HB 2WWMD 4DGIH 2QJDA 5IM7B 1DLFL 1AACA 2PW2B 1U8KA 2HG0A 3HW7A 1CFTA 4HIHA 1QZNA 3KPSD 3L9DA 3Q8BA 4DEWA 3BWSA 4O5LL 4G5AA 5HI5D 2ZP9A 2DQCH 1I3GH 3DX7B 4XTRC 4PGJA 2HHHB 3VFSA 3QUZB 2EXYD 5DC4B 2X1QA 4F9PC 3QNYA 3D85D 1GZQA 3VW3H 2VO8A 3PWPA 5BS0D 1QLRB 1L3NA 3GRWH 3GMNA 4P3DB 2GEQA 1FYTA 4QPEA 3LPWA 1Q9WB 4Q52A 1SXAA 2OCCC 2BJMH 3W57A 1NDTA 1FNSH 2AV1A 4M5ZH 2XTAA 1JVKA 2DWEA 5D1ZI 5C0BE 5FO7A 4DN4L 3FQXB 2ZKHL 1S7VA 2O6PA 1OAUH 5D4HA 1SEQH 3ECWA 2XA3A 4Z7AA 5HYJA 3QULA 3OKOB 4KAQH 3L3HB 3VQ2C 1CVSC 1O9ZA 1Y76B 1OSZB 2PZSA 5F1OB 1PKXA 2MMXA 4JYBA 2BVQB 1RSOA 2NRDA 4RETB 3RGBA 1AQDA 4XCEA 5C0BB 4KMTL 3UTTD 1KCRL 1PX4A 1HL4A 2MWCA 3IFPB 3SODB 2BDNH 5KA5A 1RHFA 4JI6O 1EBOA 2Z92A 2QQLH 1QQCA 2BSBA 3L2NA 1GGYA 4FHJA 4JZOA 1RK1B 4OLZH 3MJ9L 3FHAA 2Y24A 3MLVL 5KSUA 1L0YA 4OLZL 3WEXB 5TFSH 5EF3A 5ACZA 1I7FA 1FCGA 1AZCA 1GN4A 4MFHA 5CBHA 2UUBB 4TLTA 2VQTA 4BHUI 1OSPH 4KMTH 3PG2A 4N23A 2ZWSA 1OLZA 1AKJA 4LO9A 3V4VL 4BXSV 1YY9D 4ZPVB 4X20B 2Y69B 4QHUA 2Q2LA 3HR6A 3K06A 5C0RH 3SE9H 3V4PA 1B0GB 3UDWA 1KCUL 5TF1L 5HYSB 1G7IB 1NAMH 2YC0A 5KAIZ 4L23A 3RIFK 2BZCA 5TDOB 1N32B 4XPTL 3MRBA 3VRJA 3H3PH 2MJWA 1H0DA 1BHBA 3GSXB 3O3EA 1FNSL 5ITZA 2PXYC 3RWDB 4PJ8D 4DIXA 4PJ5A 2UXDO 1A21A 3TIEB 3HI1A 2N4IA 3HFFA 2AS5M 3EAKA 5TH2B 2IQ9L 4RDQF 4IM8A 1JX9A 4ZRGA 2VXTH 3VQLA 5GS2H 3VDBA 3TGXA 2A6IA 1GW6A 2DLHA 3OAZH 1FH5H 4PJFB 3V5HA 5ISZD 1NKOA 4YEEA 3KDMB 4YE0A 4G11A 3OLDA 4R0LC 1J9TA 2J71A 3SOTA 5DECA 1HAWA 1I3GL 5B7MA 4YHMH 4NBXB 3UBHA 4BQ8A 1OHZA 2UUCB 4NQSA 3ETBJ 4F9PA 3AROA 3MLWH 1P1ZA 4OCSH 2ZKYA 5J1TC 1TQCC 4QRPE 4K3EL 2WUBH 3PPEA 1THAA 1FSKC 3TEUA 2C9SA 1M6OB 3GLZA 4G6ML 4MAYA 2NW3B 4P2RD 4MCZB 5FXCH 3TNNB 2X44D 5IT9N 3QDGA 3T0EB 1DTUA 4TNWK 2E3VA 3N1GC 3K3WA 4JL2A 5C0IA 4YSTA 3K04A 1P84J 3QRBA 4AY0A 4YDZA 3OTOO 5EIIG 4DUWA 2R0ZL 5EORL 4GPVA 4X5XB 5BVPL 5B4MD 4OQTL 3UEZA 3IXTB 3I55V 1EJ8A 1XGUA 2XWXA 2FL4A 4OLYL 4TN9A 3O8XA 5EB9A 1XT5A 2FECI 5F6HJ 1DQJA 1FPTH 4L8BA 3L1OL 4M00A 1NMCC 1DVFD 1HH9B 2LU5A 4LT7A 5EZOH 4QOKA 5DC9B 4DGVH 4Z8FH 2AVFA 4JRLA 1S7QA 4NIYE 3E9TA 4OCMC 3OZ9H 2CMRH 3TBWA 5BXFA 2H0FA 4IRSA 3ABTA 4IKNA 3VD0A 4U1IB 5D1ZD 2R56L 5IMKA 3D12B 1GC1C 2WXKA 1MOFA 1MWAH 1QWHA 2R23A 5J6GA 4OZGB 3B5HA 4U1NB 3SKOA 1T2XA 3T1WA 5IJ0A 3RZCA 1ID5I 3AXLB 5GGSY 4B96A 4R7DB 3SDCA 2OXHB 4PHZA 2D3NA 1C12B 3B83A 5CEZD 4UQBA 2PNDA 3DRTB 1OCCC 3OR6C 4RQQB 3SQOL 2L04A 4CUCA 2F7PA 1FV1B 2HR3A 1H38A 4E9QA 1OP3K 2EH7L 4HG4J 3GDCA 2W9DH 3S36L 5GW7A 2EULA 2W5PA 4N5UA 2KLSA 4C47A 1EJOH 2ED7A 5LVEA 5D7LD 3QO0B 3FUJA 1PFOA 3FT4A 1Z9LA 1UEYA 1Z3RA 4P2RE 5F9WB 4JF3A 2IFFL 3QZPA 5ITBH 4BQ6A 1RZKC 5DGQA 5IB3B 5IZ7A 5AVZB 2BS9A 4QRPD 4Z5RA 1A3RL 1AI7A 2YPKA 1D5NA 4NXMO 2MOVA 2YMXL 2HJFA 2VXUH 1G6RL 1ZK9A 2ZG2A 5MP6H 4DR7B 1BGXH 3L45A 4W4OC 2UYLB 1AH1A 4QE7A 1FFNA 1HN1A 1Q0YH 3BWUF 4WNQA 5BW7A 4MMZA 4JZNA 1PEZA 1G7HA 2W65B 1BJ1H 4YHHO 3RDTC 5DJ8A 5IYBO 1YY8B 1SFDA 3RVWD 1HHKA 5EIIA 4PV9B 5EU7E 5T1KB 1OWRM 4KI5E 1QVOB 3FZUD 2J8UA 4YPGB 1DE4B 1IJNA 3KLHC 4RGOH 3RYFA 1OZ0A 1QSED 4YSDA 1PZ5B 4FPPA 1K34A 4DPR