3AG2B

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag2B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag2B02
1NDTA 1AACA 1OCOB 2QPDB 3CVCA 1KCWA 3MX0B 2OCCB 1TEGA 4HAKA 2IDUA 4A2GA 3FU9A 2HZHA 2X88A 2OV0A 2ZXWB 1MDAA 3QJQB 4BDVB 4F7KA 2HLEB 3AZUA 3H56A 4UANA 3S3CB 2JFCA 5F7AA 3UADA 2IWEA 1X9UA 1BEXA 4N4YB 1BXUA 4E9TA 3ASNB 2I7OA 4GP8B 2WSDA 3FPYA 2DYSB 4A67A 2VW7A 3NP4A 2DWSA 4G71B 2MTAA 1PMYA 4BXVA 1KV7A 2GBAA 1JXFA 3WIAA 2XV3A 3CDZA 3FU7B 2P80D 3FSZA 1SDDB 1AIZA 4E9RA 1UATA 3FYEB 2PCFA 2XXGA 4GP5B 1R1CA 4CSPA 1A4AA 3S3BB 1RZPA 4NB7A 1DYZA 2IH9A 2VM4A 1VLXA 1QHQA 1SHWA 3NSCA 1L9PA 3EHBB 1GSKA 1A4BA 5E9NA 1CURA 3JTBA 4HALA 2BO0A 2ZOOA 2EIMB 1AZNA 1PZCA 3OMIB 3L45A 2GI0A 1XMEB 2XYBA 4Q89A 2IAAC 3WKQA 4W9ZA 1PZBA 1ZDSA 1XB3A 2EIJB 2FT8A 1AAJA 2BP0A 1KDJA 1GR7A 1NIDA 2AZAA 5I28A 1PY0A 5D4JA 4RH4A 3PAUA 3T71A 3NJGA 1J9TA 2FQFA 4YSDA 2GHZA 3OMNB 1PLCA 1ET5A 2CUAA 3OQRA 4A2EA 4YL4A 1XB6A 3X1EA 1KCBA 2FNWA 1CC3A 1JZJA 3FQ2A 2FQEA 2NRDA 4UAHA 1KBWA 2HX9A 3ZX1A 2BP8B 3NJLA 2FJSA 1AS7A 4MFHA 4GXFA 4BK5C 4DP5X 1J5DA 1RCYA 4KNUA 4P5RA 4DPBX 2XWZA 2UXVA 3C75A 1TKWA 2QT6A 8PAZA 3QJVB 3PAVA 1ASOA 4HCIA 2YAQA 4HZ1A 2IH8A 3ASOB 3FSAA 3NP3A 2FT7A 2VM3A 5B1JC 3G5WA 2YAFA 1WA1X 3T6WA 3KW8A 2MRYA 2FTAA 5B1JA 2GC4C 4TXVB 4CSZA 4E9XA 2XVBA 1OE1A 4BWTA 2TSBA 4KNSA 3CZUB 3CVBA 2ZONA 4BWWA 4HCGA 5B7MA 2UXGA 2EILB 1JZHA 2Y69B 1KDIA 2VSMB 4N8UA 2J5WA 3DTUB 3PPSA 4JHVA 2PCYA 3IBOA 1WA0X 4GP4B 5AFAA 3RYMA 5B7EA 1E30A 1ID2A 5F7BA 3FYIB 4A2FA 1AQ8A 2IDQA 1CYXA 4M4RB 1J9RA 1ZPUA 2W88A 1ZDQA 1OE2A 3BQVA 3QJSB 1NWPA 1AZCA 1GYCA 1PLBA 4E9SA 1BQRA 2Q9OA 4AKQA 4DP4X 1RZQA 1NIEA 1MZYA 2A3TA 4AKOA 4QKTA 9PCYA 3X1NA 4W1TA 4E9QA 1OCRB 1HAUA 4YSPA 4KO5A 2YAMA 1SF5A 3U25A 3IN0A 1M9WA 5FC9A 2FQGA 1AZRA 4P5SA 1WAEA 1V54B 5PCYA 2YEVB 4K9JA 1BXAA 3T6ZA 5I6LA 1KYAA 3OM3B 3GDCA 3IEAA 1IBZA 5B3SB 3ZBMA 4UF7C 2HRHA 1JZFA 1MG2C 3AY2A 4YSUA 3CDZB 4AKPA 4BXSV 2XX0A 3ZDWA 2QPEB 3GYRA 2VW4A 2GSMB 4A66A 3IE9A 3TA4D 4DP0X 3QJUB 5I26A 2BWDA 5AZUA 3WG7B 1A65A 4A2DA 3NJKA 1JZGA 2CJ3A 4G7SB 2VW6A 2N0MA 4YVUA 3EH3B 2EINB 1ZIBA 1J9QA 1HAWA 2J56A 3MBWB 3NSDA 2GC7C 4YSTA 1SNRA 2XXFA 4EF3A 1GY2A 1KBVA 1SHXA 1GS7A 1EZLA 4HCFA 4DPCX 3IN2A 2XUWA 4E9WA 3WKPA 3HEIB 4X4KA 1SJMA 3WI9A 3EH4B 1JZEA 1WA2X 1L9SA 1NTDA 2BP0B 2AFNA 3WNJA 2DV6A 5TK2A 2PP7A 1IC0A 2IDSA 1CUOA 3NJNA 1NINA 1BAWA 1PLAA 2AVFA 2VN3A 3OD3A 3EH5B 4G7RB 5D4HA 3ABMB 4YSQA 1N70A 1AANA 2TSAA 2DYRB 1PAZA 2YAEA 4G7QB 1T5KA 4AX3A 1ASPA 2YQBA 3T6VA 3UAEA 1B3IA 7PAZA 5ANHA 2DY2A 4HHGA 4WKXA 1ETJA 2CBPA 4YSOA 2FQDA 1QLEB 4L0PB 1NPJA 3UAAA 1GS8A 3NJIA 1WS7A 5B1AB 3X2QB 3FPXA 1JXGA 1IUZA 2HX8A 1GY1A 4KNTA 2BW5A 2I7SA 3DIVA 4PCYA 5D4IA 3DKHA 3EF4A 5AKRA 2BZ7A 5I6PA 1AZBA 3TU6A 3H4HA 3OMAB 4DP9X 1V10A 2BW4A 2EIKB 4YVNA 2PPEA 4M3HA 2XV0A 2YARA 3SQRA 1E5YA 1RKRA 2BHFA 1MG3C 2HXAA 3NT0A 1AZUA 1L9OA 3NSFA 4HIPA 2JKWA 3NSYA 2PPFA 2H5UA 1FFTB 1OV8A 1PNDA 2PLTA 2Q5BA 1ET8A 1XB8A 4JKNA 2YAHA 2LLNA 3ABKB 1HFUA 4G70B 4KO9A 1OOWA 3V9EA 3TASA 2GB2A 1NPNA 1BYOA 1E67A 3X1BA 5B1KA 2H47C 1PZAA 2HX7A 2ZWNA 3UACA 1NIFA 5LDUA 3QQXA 1TEFA 4GYBA 3PCYA 1M57B 1E65A 4NERA 4DP2X 2Y1AA 4KO6A 2GIMA 5I5MA 4G72B 4FA7B 4YSEA 2B08A 1SF3A 3QPKA 1W6LA 2R7EA 3NJHA 4FAAB 1TU2A 2B3IA 4QLWA 4DPAX 1ET7A 1AOZA 2P80A 1GW0A 1ILSA 2E86A 2I85A 1BQKA 3PAZA 2BWIA 5PAZA 3D12B 2YXVA 3ERXA 3TBBA 2WO3B 2AANA 5I6MA 4BDVA 1J5CA 1WS8A 2BZCA 2UXFA 4DP6X 3PLYA 1N68A 2CALA 1V55B 1OE3A 1ZIAA 5B1BB 3NJJA 1NIBA 3FQ1A 1YLBB 1JOIA 3T6XA 6PCYA 2DWTA 1IKOP 3FU7A 3QJRB 5IY5B 1SDDA 2PPDA 4HHWA 1A3ZA 2XLLA 4ZK8A 5EHFA 2VSKB 4DP1X 3FSWA 2J57A 2JXMA 1OF0A 2PPCA 1ZV2A 3BVDB 3S8GB 5I6NA 3SBRA 5I6OA 1AS8A 3QJTB 2OJ1A 2PP9A 4NAJA 4YSRA 5TK4A 2QDWA 2YXWA 1FA4A 1BYPA 5I5JA 1PCSA 1NIAA 1KGYE 1PF3A 4E9YA 1W8EA 1URIA 3FU8A 2IDTA 2J55A 1L9QA 3ABLB 4KOBA 1A8ZA 2RACA 1L9RA 1W6WA 4DP8X 2X87A 3ABGA 4F2EA 3V9CA 3S3DB 3X1GA 4BWUA 2CAKA 3NJMA 1CYWA 1ADWA 3FSVA 4YSAA 3AG4B 4WTQA 5B7FA 4YSCA 3WNIA 2UX7A 2XV2A 1JZIA 1AR1B 2CCWA 3N55A 1ILUA 2W8CA 3PXLA 4JHUA 3CG8A 2XX1A 4E9VA 1JVOA 2UXTA 4AI7A 3KW7A 3CVDA 6PAZA 2PPAA 1AG6A 1BXVA 1AS6A 1NWOA 4A68A 3TBCA 1E5ZA 3JT2A 3GXUB 4F2FA 2BP8A 2UX6A 1PNCA 3SBPA 2IDFA 1NZRA 3AG1B 2YAPA 1M56B 4YSSA 1EHKB 3H4FA 3AG3B 1A4CA 3S8FB 3AW5A 1QNIA 4GY4A 2YAOA 1AG0A 3FS9A 2WO2B 2H3XC 1SFHA 1GS6X 2IWKA 3FT0A 1JERA 1L9TA 1X9RA 3N2JA 3FQYA 4DP7X 1ASQA 1F56A 1NICA 5I6KA 1JVLA 4Q8BA 7PCYA 2PP8A 4A2HA 3NYKA 2QDVA 2IWFA 3HB3B 3T9WA 1I53A 3ZIYA 5I5IA 3UGEA 4KO7A 3NJFA 1BQ5A 2HRGA 1IBYA 1OCCB 5A7EA 1DZ0A 2VMJA 1SFDA 1J9SA 1JXDA 4ENZA 2XU9A 3UABA 4PAZA 4KOCA 1OCZB 3X1FA 2R7EB 4AZUA 2FWLB 2AZUA 3SBQA 1MZZA 3AG2B 1FWXA 2FT6A
chains in the Genus database with same CATH superfamily
5JMRA 5EU3B 5EEVA 1XXFC 3CH8A 4YHNA 2AJYH 5D7IE 3CVCA 3HTLX 4Y16A 1T2QH 1HINH 1UD8A 3GSNL 1CE1H 1KXTA 3D3VB 1T2JA 4ORGA 3OHXB 4DW1A 1RUKL 5AAPA 1HR0B 3V9FA 3PWVA 2WQRA 5E24E 2VDQH 2ZXWB 3QJQB 4LSUH 5KVEL 4TSAL 3SGEH 5CINH 2NY6C 4ELMB 1CFMA 4UANA 3WUWB 1QO3B 2YEVA 2FH6A 4UTCA 3OAZK 5FYLD 2TAAA 2YQ2A 4DKEL 1HL9A 1BX2A 4JI3O 1ERNA 3C2AH 4GAYA 5F1KC 3ZDXE 1S5IH 4JI4B 4X7TA 5B3SC 3T3PF 1HKLL 3CE1A 1MRCH 1JPGB 4GW1A 4BKSC 2MPAH 3QJFA 2EH8H 3QYCA 3SGDI 1A7NL 4R7NA 4ABWA 2YS8A 1KOAA 2OTPA 3RA7L 1ZA3B 2K0RA 2IF7A 5C0IA 1ZXQA 3TGXA 2FHBA 2MTPA 1MZEA 1BBDH 1LD9B 1IX2A 4IJTA 2ILMA 2MJWA 3JTSA 2GY5A 4NB7A 4P9MH 4E2OA 2WVVB 3U4BH 3SDAA 2HCZX 3UP6A 3UTTA 2LQRA 3FT4B 4M6MH 4IEFB 4C4KT 1RJYA 3U30B 3HC0A 5ALCL 3IFOB 1S7XB 3MBWA 1BMWA 5AYUH 2BRQA 1VQ6V 5C0FB 4XNQB 4CKQA 4LARH 2CR3A 2QPFA 3L45A 1N59B 3IJHA 4LLMA 1CLYL 1TAEA 1QI5A 4MB4A 2EEBA 1ZDSA 2Z4QB 1SHMA 3QGVA 1WZ1H 3CU1A 4N90E 4FS0A 1AR2A 4X9IA 5DEGA 5J89A 1KECA 3GBLA 1A6ZA 4ORZC 3L74H 2BSTB 5DTFA 5GRUL 3W3BA 1J9TA 1JTTA 4HWNA 2J88H 3FCTA 1KPVB 1OB0A 2VDPB 3FO9B 3MC0A 3EW3B 4PIRF 1MJUH 3BWAA 3OKEB 1IM9B 2AHZA 1FZKA 4O2FA 4P9HH 3HE6D 3V5HA 2AQRA 3H8NA 2LGQA 5FA4B 1EM1A 5LVEA 5BVJA 4XAWH 1RUML 2H8PA 1I3VA 4S1QH 4P5TD 2FNWA 1P7QD 4NJAH 2DQHH 3NIFB 3NQKA 4ZUUB 3VGDA 1BF5A 2WSKA 1NMCB 1R5IA 1KIUB 1KZYA 2XIIA 4XVSH 1C8PA 2XAHA 4KY1L 4MFHA 3QR2A 4YDLB 2UXBO 1NLDL 1XREA 5I1EH 1RCYA 4XVUD 4M7JH 4R7LA 5DQJB 4JKKA 3L7FB 4OF0A 2VQUA 3B3IB 3KPOB 3QDGD 4XN4A 2FL5A 2ZOKB 4I87A 5DHYB 1ETZB 3DVIA 2GBVA 3GSOA 4UV9A 2IH8A 2ZP8A 3A0BZ 5EC1A 1NBZA 2DEWX 3QA3B 2EXWC 3RDTB 4V1DE 4YWGH 5TDNB 2FEDD 4IRSB 4IK7A 3UXFA 5J3HD 1XEDA 3KW8A 4QOKA 1RFYA 1R3LB 4XMUA 3RZCC 4ZFFA 3JALB 4HBNA 2JKNA 5ILTH 3B8MA 1YUKB 4W4KA 5BMVA 4G28B 4G6JH 4DR4O 2YPVH 2YGVA 3LKSA 4R2GC 1YEWA 3C6SA 1MHCA 5JCOA 4F9PC 3WO4C 2JI2A 4WUUB 1MCLA 3SIKA 2YGQA 3MLXH 4OY9A 3EYUL 4WAFA 2GJJA 4XC3H 2EYSB 2EILB 3MRMB 4H8HA 2FR4B 4AE0A 3N1MC 4O4HA 3U1PA 5JORA 4ISVB 4JHVA 4QXUH 2R59A 3B9EA 3ZBHA 2AEQL 2QTVA 3RYMA 5K9OA 3C8KA 4AIZA 4BZ1A 3MHSC 2F0CA 4J80A 2UXBB 4DGVH 5D93C 3JD1A 4OZIB 3PXJA 4X0NA 3K2UL 1TETH 3IXAA 3RFZC 3F12A 3M46A 2YOAA 4NYLB 4HLZH 3MRLB 4P23B 4MA3A 3RE0A 3G6DH 3OJ2C 3GSXA 2BLFA 1GPOL 2VUKA 4G11A 9PCYA 4GUPA 1OCRB 1EFXD 1T1ZB 3TBWB 4Q52A 2YAMA 3ZVVA 4MAZA 1M9WA 3TCUA 4HYOA 4JYCA 2DQDH 3CC2V 4FQLH 1ZHNA 5C0RH 3ZGHA 1TTGA 2APTA 2F2HA 2AKRB 4K07A 5F97E 2BOCB 1A9BA 4DR4B 1FO0L 1A21A 3A6CL 1J18A 4KMTH 1K8DB 3FN0L 2IW5A 1SYVB 1WZMA 2BH0A 4LPVA 2Z5UA 1N8ZB 1OTSD 1VCBC 3OF6D 2VXVH 3L2MA 3ZT5A 2G3ZA 3KBFA 2BSRA 3KGSA 2PETA 3RUGA 4IRJD 1JZFA 4OBSA 2P3YA 1MG2C 5CFHA 2J73A 1I7TB 3OKYA 4TS6A 5GS0C 1QEXA 1H8HG 3OBAA 5BO0D 3ZHSA 2VW4A 1T4KA 4QRPB 2QSVA 2N74A 3MBED 1YEEH 5C0CA 1TYRA 4KZDL 3VXPB 4EKJA 5K9JH 2G60L 3SCMC 4J2QA 4N2DA 4OR1A 2P43B 3THMH 4KQ0A 2D7MA 3ZL1A 1ULVA 3M8AA 1PZ3A 5FOBB 1OP9A 2FBJH 5D7KD 2AEIT 4YEFA 3GSNA 3U10A 3HS0C 1KIQA 1ZIBA 3C8HA 4PV8B 2XASA 5DLML 4H0LB 4UAOC 5HGHA 3SPJA 3ARFB 4LEOB 3IDXL 3UAFA 1PX3A 2XXFA 4NZ8A 1XO8A 1DFXA 2V17L 2V0AA 4MLSA 2FWOA 4XNAA 5EO1A 4EDXB 1CQKA 3HPJA 1YY9D 4H13C 3V0HA 1Q5OA 6TAAA 4X4KA 2WXGA 5D2LF 3LIZH 1WA2X 4YHIB 1L9SA 4BW5A 3ARBC 5LHGA 3FU5A 4HBQA 3LD8B 3P2BA 3HZVB 4QXWA 3K6IA 4XMKL 3ZQWA 3K08A 4POZD 3NJNA 1FPOA 4FM0A 3CMOL 1WITA 3L9RB 1J5EO 2XQ0A 3ROOB 2XG5B 2QQKH 1X44A 5D4HA 1N0LA 3RGVA 3U1QA 4AZ8A 5KBLA 1AI5A 2IM9A 2E8YA 4N1CA 5JUEL 4BW9A 4OFQA 3CFBB 4HA1A 4TL4A 4CADB 1FNAA 1NCAL 2XT9A 2YQBA 3S96A 1TSRA 2C9UA 3LSOB 1OP3K 1ETJA 4GLRI 4PV1C 4L29B 1QATA 4WGWB 4YSOA 4LKXA 1YTFB 2WVSA 3N85H 4L0PB 3CMGA 1P6FA 5IVNA 4Q9QH 3W37A 1MIEL 3IDYC 3GJEA 2Y5QA 2XDHA 2KC0A 1UYWL 4CN6A 2HTLD 3D3IA 3OKKA 4UT9L 1AZBA 5FO9A 2PR4L 3BUTA 3OMAB 1LEIB 3U6RB 3WIHL 1HSAA 5ANME 3WOVA 4NKOA 5JO5B 3MRKA 1MNUL 4JPVL 3MO1B 3NT0A 2OYQA 4QWWD 3NZ8A 3TEXA 4E68A 4JNXA 3Q6FB 5IUSA 1J5EB 1FLRL 1HXYA 1NANH 3C5ZD 3CSBA 2AJXH 2E6QA 3T2MA 2ZIOA 1IBDA 4ZW7A 1TJHH 4N25A 1NAKH 1F4WH 2LLLA 3TO4C 4DEUA 1SDAB 3PJSK 5L4FA 5B1KA 2NY5L 5BMFL 1BFOB 3JCZA 3MRRA 2YRBA 3UZQA 1KLUA 2GBUA 5DRXB 3RPIA 4OF8A 3DI3B 4NHUB 1FRGH 1PLGH 4ABVA 5JIQA 4A04A 4LF9O 1U8NB 3K4ZA 5J2TA 1FNHA 1P5VB 3MSPA 1W72A 2GIMA 2AK4D 1FNSL 1KYUA 2B16A 5LCVL 3KZIZ 3L5XL 3O6LL 2YGPA 5IG7B 1BZQK 1IEBB 3OPUA 4ZX6A 3JD2A 1BLIA 2MPVA 1QSFB 4RLDA 5TE4L 2DD8H 2B3IA 3S3XA 4U3SA 1BIIA 4AQYO 2EXTA 2JMRA 4N1EA 1JOYA 4C4BA 1EZVH 3QSKB 5IYZA 4MJ6B 4B9CA 5L8JB 3DX7B 2VH5L 4ODHH 1XIWD 1U8CA 3HKCB 3D12B 1EJ6A 1WWAX 4U1HA 3CUPB 3TBVB 4AL8C 1MIML 2NOYA 5TF1L 2OMYB 1NL0H 5JPNA 4DZBA 3VQWA 2WGNB 5FYKE 1JN6B 2KI6A 2O5XL 2CE4A 1DVFC 1I3UA 1NCDL 3KYKH 5FA3B 4AIOA 5JIHA 4Y16D 2RH0A 4O02A 3ALPA 4XPTL 1DE4B 1CWVA 3EH1A 3FDWA 5GGUB 5HDQH 4LF9B 3QUMH 5ES4B 2ERJC 3BIKA 1P69B 3LKPB 3LKOA 4ZXBC 3VYNA 1YLBB 4IDLA 1I9RL 2JB5L 4NNXB 3T6XA 1URZA 1C08A 5HBBA 4I50A 3QQDA 2FB5A 4L1DA 1SDDA 4YJ3B 5DGRA 2CTQA 2AVGA 2XZAL 1FYJA 3JUZA 3LRSB 4XHJC 5DJZB 4ABMA 1DL7H 1P4IH 4MXVE 5ICXB 4MNHB 1TUBB 4AQYB 4DR6O 3OR6B 1XF1A 1KZQA 1NMBH 5FYLE 4FMKA 3RWJA 2ED9A 3EHBC 5I6OA 2GBOA 1FNGA 5KOMC 2P67A 1AJ7L 4HS6A 4LOFA 3DSNA 1IO4C 3LNNA 2C9XA 4APQB 1K5QA 4NAJA 5TK4A 4ELKB 2Y1YA 4MMZB 2D7TH 5F7EH 3SDXA 3EZJB 4W9EC 1HL8A 1UWFA 4AV0A 4FQIL 2WXKA 5LGUA 4UZGA 1L9QA 4FJZA 4TWKA 3V9CA 2BSEA 3NCFB 1IEAA 4X4XB 3UTTD 2Q76B 5ISZB 3GXPA 4ODWB 1A6VH 1J8HD 2OQJA 1BT8A 3K9SA 1G7JB 3B5GA 5EWIH 3V4PA 4H88L 2KG7A 3E8UH 2MK3A 3LPWA 4OZIF 1RJZB 1RLWA 5AEAA 3UG4A 3MLYL 3CG8A 4UMGA 5DU7A 1QFUH 3ULAB 5FCUH 5I0YA 3OE7G 3OB0H 3SDDB 3V4VL 4Y2LA 4ZD3H 1SN0A 4DR6B 1IKFL 2P1YA 5DD3L 1AE6H 1EO8L 2J7LA 2HKAA 2I07A 1JWUB 4BFNA 4G6KH 1RZ7L 2GEEA 5IB3B 3FTWA 1GKOA 4K23H 1KUQA 4OZHB 2IFFL 1QW9A 4BH7B 2F68X 1TVKB 3F7VA 3VG9B 3T0XA 4U0RC 4UYPA 3GJFK 5IEHB 3FFOA 3BEVB 2RR3A 5LP6C 5HDLA 4OT1L 5BJTB 5AG2A 1OT4A 5CUSL 1WUNT 4N2CA 4MVSA 3JXAA 2H3XC 4U6XB 4FNUA 1IAMA 5LOVA 3T4AC 4WUKH 2VZ1A 3H0TA 3ICXA 1DBKH 1FC1A 1HWYA 2D31A 3SE4A 1Y74A 4R8WL 1AHKA 5C9JB 3AMKA 2ZX6A 3CFEA 3IDNA 3VGAB 3BSZL 1F23A 4YO0B 3DETD 5IFAL 2ZNJA 5A7EA 4FA6A 3MLRL 1G9NC 4IDJH 3QDGE 3CSTA 1CZ8H 3FFDB 2R29L 3ZDZB 3PGFL 1I9JH 4MA7L 2E75C 4UT9A 1WP8A 4AZUA 4HIHB 1DQVA 5LNDA 1U93A 5T8IA 5KZCD 3BP5B 3HG5A 2P7TA 4PTTA 1AACA 4CC4C 5HGBA 1NCWL 4G6AD 4JL2A 4TLKA 2ZKHL 4MAUL 4HC1L 4JZ2A 4GW5A 4DFHA 2WTRB 3VFRB 4OGXL 4A2GA 5KVFH 5B39B 3MN8A 3GK8H 4I18C 5KYWA 2QVTA 4EAEA 4WU5A 4ZO7A 1SQVH 2P48B 4PRIA 4ZAKC 4MXWL 1SMOA 1PNLA 4DR2B 3QNFA 5CLWA 3GI8L 2OK0H 4L1LA 4JQXA 3U11A 4WVRA 3VQMA 4GT7A 4CKVX 5LWYL 5DZJA 1MFAL 3HUJF 4W9DC 5E56A 1ZA6A 2FATH 1R3HB 3N42B 4Y4KB 3UMNA 4HWEH 3HI5L 1LWHA 4YDMA 3WE6A 4HUXA 1KCVH 2WNXA 4FJYA 5JW4R 4A67A 2Z35A 1R0AH 1S9WB 3HG1B 5E8DL 3L72H 5C09D 4JGSA 2RFXA 1CFNA 2LAGB 4QF1B 5AW1B 5KUMA 3WIAA 2VMCA 3L6FB 1PL3A 2HA1A 3L7EA 4L9LB 1YXBA 4X5WA 4QRTA 4YEEA 2GVYA 3U9WA 2OMTB 4GP5B 4FHJA 1W0WB 3AB0B 3OKLB 5C6TH 3OKNA 3BPLB 5E5MA 1O9WA 5LGYA 3FTUA 4HKJA 1JGVL 4P3CH 3QISA 1KNOA 5I1LB 2YMOA 3HKBB 3B7YA 2WXQA 3BH9B 3QHFL 2NUTA 1S7TA 3OLEA 1I4FA 2Z0AA 1I7ZA 4LF8O 2BRRH 3E9UA 3NSXA 4JUSA 5EC2C 2X4UA 5C0CD 4GMTH 1KYOF 1ZT4B 4YUEH 1T1XA 1KBPA 3ETTA 4RWYH 4X4ZA 5DVMA 4AIEA 5I1CH 1OTTD 1SRYA 1JGEA 2K3HA 5IGXL 3F5WB 1A32A 2HJFC 5AW8B 2E6PA 1EN5A 3MLUL 1OANA 5T1MB 3KNBA 4A2MA 2AJUL 4KQ4H 5JVDB 1D9KB 3S37X 3PAUA 3EJSA 3WIFB 3CXHF 4B9KC 4LL1A 4U6YA 3OQRA 3BJ91 3M07A 4NUQA 1JSYA 1XB6A 3Q3GA 3X1EA 3LQZB 5J6HA 3F6JA 3AK3A 1E28B 4RIRA 5T1LB 5F9WC 3IC7A 4PP1D 3H01A 1L5GB 3GSQA 4F6EA 1KJVB 1OSYA 3L3HA 4HXAH 3VWKC 2LVEA 4XMVA 1PZ5B 2NW3A 2RQEA 2Q7NA 4O58L 4K5PA 3CZFA 3RGVD 2YO3A 4LF8B 4DP5X 1J5DA 3RWEB 1IBBA 1DFBL 4UT6L 2NDFA 3G5VB 3JASB 5D2NA 3PFUA 3LNDA 1JV2B 4JFUA 4LLWA 3UP1A 2CHWA 3IBEA 4OLZL 3CCLV 2P24A 1FORL 1S7RA 3QORB 2VC2L 4KKLD 2YD7A 4KUZH 4Z7WA 4Q6IA 4XCEA 3UC0L 3QUKA 4AILC 4OIIL 3HJEA 4NC1C 2X6UA 2B15A 3AITA 3G5WA 4Z7VA 4AMKH 4GKLA 4OV5A 4FZ0A 3ZHTA 1INEL 4JHWH 1G1KA 1RJLB 2LE9A 3EBGA 1R24B 4GLXA 1SJHB 4JG5A 2FUTA 3ME0B 1BHAA 5D96C 1WFJA 3IRPX 1RUPL 4X5QA 1FG2A 2HUEA 3UBXB 4YXHL 4M7KH 5B7MA 4TNWF 2OZNA 1VQ9V 1L3WA 4UTBH 1NCCL 5AKSA 4Z7NE 4G42A 1WA0X 1S8DB 3X13B 5AFAA 2K78A 3IKCA 1UZ6F 3HN5A 5B7EA 4DT2A 3BPOB 4Y5VA 4DW2L 2YMXH 4LSVH 1CDCA 1MCPH 3BP7B 1K6QL 3F6LA 4A55A 1BOGB 1RD6A 3MODL 4XDJA 1MW3A 2X4TB 2VR3A 4LCUC 1X5XA 3MLPA 5FL7G 4NUGH 1HQ4A 4L8SA 1ZGLB 3VD5A 1U95B 4KO5A 2R51A 3U25A 4R0LC 1RZ8B 1OZTG 3UCSC 3QUYB 1SY6A 4HJTA 4PYGA 4QHUA 4K55A 1AGEA 4N6RB 1H0DB 1T7YA 3IGAA 4JFYB 1RMFL 1P9MA 3KXFB 5BQ7B 5BZDA 1BMFG 2AK4E 5KN5B 1BE3H 1MI5A 5TE6H 5I0VA 1Z5VA 3CFCH 3UBGA 3VCLB 1FJGO 1LO4H 5E2JA 4FXGB 2P8MA 4S1RL 1HNGA 4PJ7E 1NBCA 4YSUA 2EEXA 4LKCA 4X20A 1DUZB 1JL8A 2V5SA 3TNNA 1UWXH 2CMRL 2Z91A 1SXCA 1JI1A 1G7IA 2CK0L 3G5ZB 1XMWA 3J2PA 4PRNA 4Q56A 1MOEA 3SE8L 3T8XB 1AILA 1M2VA 3WTXA 5IJ0B 4QO1B 32C2B 3LN9A 4UUJA 1NM9A 3MAQA 1NGZB 4OLUL 3RWIB 3QQNA 2C9RA 4GO8A 4RUFA 2VLRA 4FQ1H 1U0QA 2PTUA 1M71A 3FBKA 3WNNA 4KTYA 2P9RA 4MQSB 1WHPA 3LZFL 1GJIA 3WN5B 4N2GA 2Q8AL 1WG3A 3KPTA 3QS3A 3TBYA 4BJLA 5F88B 4MS8D 2YICA 3VI4A 3HE6C 4FQJH 4PB0H 2AMGA 1D6EB 4CL7A 1TITA 5EF0A 2ARWA 2BTQB 4DPCX 1J5HA 2UWEB 1HIML 1BP3B 2VABA 4S0SD 5E6IC 3WFCH 3WS6A 5BCAA 1JZEA 4L1BA 4IK6A 1UG9A 2X70A 4QRRA 2QWRB 3DX9A 4XAKD 1FJGB 2Q87A 5C0JA 3DRQA 2IDSA 1EZSA 2WKLA 4FHKA 3RKDD 3BP6B 1XCXA 1GJUA 4P4KB 1TXKA 1S78C 1Z5LB 3OR7C 2V37A 3CFDB 3ZIAG 1N70A 1U58A 4GO9A 4NKMB 2ADJB 4QXTB 2DYRB 4XZUB 1AR1C 4PRHA 2NTFA 1O9VA 1RH8A 3ZDYF 3P1VA 3VNYA 2DQIL 1IARB 4P5MA 2Z31A 4TVUA 5HJ3B 3BABA 3FMGL 4NO2B 4HOZA 1F4XL 1LK2A 1BVKA 4G7VH 4GKNA 2BSED 3P73A 1MCWM 4FJ6A 5J3HC 3A0OA 4X9QA 1A7PL 1ACXA 2P52A 5L6YL 1WS7A 4G80A 5DC0A 3T8MA 4KJPC 2VLJB 2XTJD 3US9A 5D1XA 4PCYA 1N26A 2XPZA 4XN7A 2ZAGA 3EF4A 1NOAA 1BG9A 3UTTE 3KDMB 2V2WB 1J8HE 1JDAA 2CGRH 2EVIA 2CJTA 1SQGA 1IZJA 3SGKA 1YMMA 4UM9A 3WMQA 1RKRA 1PIFA 1YN7A 3RNKB 4C56B 1WEJL 2YLHA 2CH8A 1LO2H 2GJ6A 4QJ4B 1Z3GH 1LDSA 2Y4SA 5K39B 5BRQA 4WKZA 4QPEA 5INDB 1FFTB 3DMMB 4S1DC 5DK2B 1OP5K 1CIDA 2GPZA 3LQAH 5DA0B 1WVZA 2H0JA 4NQCD 2DN7A 4MBOA 5IB1B 3ARWA 3NRPA 4G70B 5CZVH 3TTSA 4AH2B 1ZD6A 2VQFB 3STBA 4F58H 3G08A 5JQGA 1E67A 2WUCL 5I2IA 2ZWNA 4JPKL 1FDLL 3U9PH 1XF5A 1YNTB 4NZDA 4RX4A 3TURA 4TUKL 2WOBA 1AKPA 2P4KA 3FC8A 5CKGA 4KGLA 3BAYA 4KXBA 4BQBA 4ZMNA 1H3WM 2HRPL 3JARA 3P11L 3I3DA 1SF3A 4MZ3A 2VQ1B 2MNWA 3L95A 1BSMA 4XTRD 4KVNH 4OZGA 1OTSC 3BUQA 2QKIB 4R84A 4ZSOB 1GO3F 1IILE 3B7RL 4HH9B 3FTVA 3OAUL 4O51A 4F8QA 5C9KA 5HVWA 4XPFH 4Q0XL 4PJDE 4PR5A 5CGBA 1SRDA 2OR8A 4XN1A 1EEZB 5JW5A 3QFJB 1RZJC 3I55V 2QR0B 3QQ9D 1U8PB 2EC9U 2YC1B 4BCZA 5HYSG 4QE9A 2YXVA 3AXLB 1E7VA 3ZKMD 4K94L 1OTUC 2OKMA 5KBKA 1J5CA 3W39A 3BDXA 3J27A 5IT2L 3G6BA 2XFXA 5IHLB 1UXWA 2FZ3B 3SQBA 1JVMA 1OE3A 1ZLEA 1YPZE 2EDOA 3BE1H 3G6JA 4OM0H 4HEMA 3GMMA 1LEGB 1CVRA 3REVA 5TGBB 1Q8IA 1VDGA 4XX1G 5FYKU 1K3IA 3UQ8A 3ZOAA 5ERWB 3ECVA 5KTEH 3KLHC 5DVPA 3FO2B 2W60A 4PRID 3RIFF 2C4FU 5DMJB 5FM4A 4DCQB 2CH7B 1RIHH 3RPKA 1G7LB 2Y5EA 3L4CA 3SDYL 2HG5A 2PPDA 2XQBL 3EGSB 1O9GA 4PGDB 3WLBA 2VSKB 1LK3H 3EDFA 4LLQB 2J57A 1YC8A 4ODSL 3OHMB 1CXIA 4H1LA 4OW6A 4XHQA 2B2XH 4NDMB 4QGYA 1LO0L 2PXYD 3QDHA 3E8BA 4HPYH 4DV6O 2JE8A 2P49B 2XETA 3BI9X 3CHOA 1JPFB 2ZCLH 4O4YL 1ODAA 1YEDA 4OCRH 1Y7VA 3RWHB 1VEWA 1QZ1A 1AFVH 5JPMA 3RVXC 3CFKA 3CD6V 1XMOO 3O8XB 4X99B 1FA4A 4WJ5B 4LQFH 4U1MB 5C09E 1WAZA 1XCQA 2CIIA 2WINA 2BCMA 2DEYX 4QPKA 4KOBA 5IK3B 2WQSA 3U0ZA 4EDWL 3IPEA 4XT1C 4XOAA 5AW0B 2UUDK 4N1HB 5E95B 5CWSB 1T0PB 2HTLC 4M48H 1DJXA 5AOIA 2XPYA 3O2VL 4WTQA 5I8OH 1JZ7A 1VQNV 5G5DA 1SJVA 3D7PA 3L13A 3F04A 5KVDE 4Q9CA 4DQOL 3N55A 3TVMD 4Z78B 4W4OC 4MTGA 1F4HA 3KLQA 4B3VA 1Q82W 4XZ4A 2F1AA 4YE0A 1I1FA 3VD2A 4AYFB 5IR1A 4WO0A 4QWWC 4GEIA 3CVDA 4HV8A 2B0SL 3RHWF 5I9QC 5C0CE 3ABZA 5J9PA 3CBJB 5AVVB 3CEIA 1DVZA 4W9JC 1HHJA 1UOKA 3N3EA 1SOXA 4Y5XA 1CDHA 3FN9A 4DV6B 5D70H 4KBPA 4ZOLB 5ESQA 4JZGA 1H3PL 2FSDA 3B8SA 1PD1A 5E8OA 3E2HB 2LFRA 1Q9WB 5IMMB 1OZ0A 2ATKA 1AI7A 2WZAA 1EJOH 4MDRA 5AW9B 4MD0A 3D07A 2X3CA 1LE9A 3VDCA 1OGTA 2Y2WA 2GUZA 3GM8A 5J2UA 1G1OA 1ROCA 5FUZL 3O0RH 4G1MB 4MMXC 2JKJA 3QRGL 1BFTA 2EDDA 3DRTA 3RYCA 1K2DA 2CD0A 3MUJA 5J8OA 1PFOA 1QI4A 3LXUX 2ENYA 4P2OB 3CZSA 4MA8L 3T3MB 2VR5A 4LSPL 3VFSB 5CO1A 3VXMD 1KC5H 4Y2DA 3TYGL 5JIDA 1RFDH 3STZA 1KTLB 1KYOJ 1QSEB 5I66A 5T1KA 5LGTA 3C08H 4N24A 3L3JA 4FABH 4UDTA 4W9CC 3UGEA 1JZ3A 5AAMA 1ZCRA 4DO2A 2F54A 2OYLA 2JK5A 2YQ3A 1XIWC 2CKBL 1JMXA 2VXSL 5E2VH 4IKIA 5E1IA 1P6AB 4KOCA 4OB5L 4O2CB 1T83C 3G67A 3S3JA 1BQ0A 2BIPA 2OTUA 5B21A 3SDLA 4DKTA 1EN4A 2HKFL 3CXHJ 4L37A 1MY5A 1WFUA 3L3GB 4TVPL 2UWEF 5CFAA 4IMKA 3JD0A 2QWOB 4U0QB 5DMIH 3N44B 2R2BB 4RAVA 3MV9A 4X6FA 3ZO9A 2QV2A 4I4WA 4JM0A 3W82A 1TG8A 2B59A 2X4QA 3BAIA 2F18A 4KKZA 3ESNA 1GGYA 2ZYIA 3DX8B 2K1MA 1OAJA 5C0DB 3VRJA 3S35L 5DECA 2QVKA 5DJCA 5KANG 4NAQA 4WK0B 4CAGA 1XI1A 3CCUV 3QE5A 4ZZKA 4NC2B 4U6VH 3ASNB 3F2LA 2NY6B 2R8SL 4Z6AT 3HKEA 3MUGB 4JAVA 2R0KL 4DRXA 1PSKL 2A6DA 2Q7YB 3AY4A 5IW1B 1I3RB 1JXFA 1IU1A 1AI4A 3DNKA 2BSBA 1MHHA 2P47B 2XG4B 5LYJA 3STLA 5BOJA 2X7LA 1NFDF 4BH8A 1CF1A 4XNZC 4ZUSA 1QHOA 4KFZC 1WIPA 3OL2A 3FH5A 3SDAC 1MI5D 2QSAA 4AMWA 1UM5L 5I1KL 3KPPA 4D6TH 3MRDA 3W1ZA 5H8DA 1TQSA 1VZGA 2EEDA 4RRPA 2OSWA 1WTGT 3UZEC 2EDBA 2W0FB 4FMFA 5E7FA 4JG0L 5D1ZA 4G9FD 2XYBA 4N85A 6FABH 3BKML 3GEFA 2AF2A 3DTXA 2VLRD 4FNLL 4I4TB 1XB3A 1JMZA 2FGZA 5B4MC 4X6CB 4FVMA 4G8GB 1FFXA 4XXCA 3ZYJA 4NKDA 5IESL 1PX4A 5MEQA 3T71A 2B77A 2AXGB 2GHZA 1XDTT 2K8QA 4L87A 4EO5A 1NBYB 2V1DA 3P3YA 3EGXB 2H8PC 1NUNB 3TCLB 3JTTB 4GX0A 2Y7SA 3OLIA 5FGSA 2DL9A 2X09A 4QRRD 5KX5B 2C1PB 2PYFB 3N9GL 4XCCL 5IUCA 3QH3B 4HZAA 4LIQE 3QG6B 3BD4A 1CLZH 4X1YA 4MMYB 4ZNEE 4HIIA 3U4AA 5LAXA 4XAKE 5I1GH 3CRCA 3MV7A 4JPRA 2F53D 4QE7A 4PUBH 4EZJA 4QRQB 4UTAA 5IV2A 1UQSA 4H40A 1U8JA 2DQGL 5H94A 4BHUI 3VD4A 4PY8I 2Z31D 5EC1C 3X3FL 5MEPB 1TR7A 1KN2L 4H0GA 5C0GB 2X4NA 2YPLD 1YEKL 4GUQA 5FHBL 1MVUA 2VMFA 4WFGA 3NP3A 4N2MA 1VF6A 2FSEA 2BNRB 3MRJA 1LVEA 4ZJ9A 2CSPA 4TLSA 2PNDA 5DQ9B 4PJXE 4AEIL 1WISA 4KTDL 3VXSB 1CGWA 2ZNXA 1SN5A 4MSWB 5F44A 3VFNA 2AJVH 5F6HJ 3MYJB 1G6RL 5JCOC 1G0XA 5DQDH 2XTJE 4EKXA 3LDCA 5EIIB 3RIKA 1M1SA 3HPLA 5EBGA 2JLLA 4PV9B 3U7AA 2X2JA 2XAFA 2K7PA 4E41D 1ZJAA 4E36A 1X5GA 2B1HH 4YXKL 4TTGA 1IL1A 1HEZB 5KAQG 1ZDQA 2TRYA 1NWPA 2I5YL 3JV6B 2ZSWB 1KTKE 2YSSB 4NQCE 2AK1L 3U46B 2E9WA 3K71A 4L3EA 1AQKL 1IIKA 4TQEH 4AG4H 5MENB 5FB8B 2B4CC 1LP9A 1Q0YL 1FAIH 3TNMA 2AI0L 3VQVA 3NA9L 1ZSHA 3V4UL 1DVTA 3EDJA 4FTVA 4ZS7H 3BLPX 5FFGA 1J11A 2SEBA 2Z8WC 4N87A 5D7LA 4NR1A 2H32H 3EUUA 3IETA 1KFAH 2DW4A 4DV4O 1X4ZA 1QLFB 3AQYA 4MXQD 1ZV9A 4ACPA 4X4YB 5IT9N 3LPGA 4QLRA 3QDMA 3IJ7A 3TA3B 1AC0A 2R23A 4IOIB 4D7SA 3H7LA 3I02B 1G1CA 3U4KA 1FYTB 4NQVB 4UF7C 5BRZA 5AL8A 4NQDA 4ATWA 2CKBA 2KZWA 4JEGB 4MJHA 4M02A 1GJWA 2HMIC 5ENWA 5DHEA 2Z64C 3FFCD 4FCHA 1SQMA 5IROA 1NVPD 2KUTA 1ETA1 1W16A 2VR4A 4ZPTB 5B38G 2VDPL 5DS1A 2V2TB 4IIJA 3APNA 3CCRV 4RBPH 4OFPA 2YXFA 2XAGA 2RN9A 2DOSA 3RJDA 1EBOA 3LZRA 2N0MA 1FP5A 1F6FB 2X0LA 2I24N 5CBAB 3OGCA 1QQDA 2QADD 3HR5B 4NOBA 2ODIA 4M8UA 1HINL 1CE1L 1HAWA 3RVUD 1AI6A 4K8ZA 5CBHA 1IAIH 5KS9B 1AOHA 3SKOA 5ITZB 4BSJA 3BIBX 1Y18B 2VDQL 3QFGA 2HT4C 1I8MA 1KBVA 1FXKC 4JPQA 1EZLA 4DV4B 1V7NL 3HI1A 3IN2A 4LU5H 4FQXB 1ZS2A 2Q8BH 1P2CA 4GMSL 4PRIE 4TV9A 3AVEA 3ES6A 2AS5M 3QARA 5IMOB 3MJ8A 2OXHA 3D5OF 3L8QA 5DMYA 4X98A 3MR9A 1S5IL 4ODXA 1TZHB 4XP4H 4LASH 4B3SO 1CUOA 4CVXA 3RGVC 1X4TA 1MRCL 3BKJL 4N28A 1A7QH 3KVQA 2AVFA 4MB5A 5JQ6L 4OLEA 2EH8L 4G7RB 4GG6E 4K3EH 1QQCA 4PJIA 4NXMO 5JOEA 2J8UE 4M62H 1TCMA 5GSRB 3FUFA 2H1PH 3QIBA 4FI8A 1ASPA 1SERA 3IPFA 2WLIA 3T6VA 2Y22A 1ZKAA 3H3PH 2KS0A 2R4RH 3O2DL 4JGJA 4KVCH 5E4IA 4ZG1A 3N44F 2GCYA 3GZKA 3PWPB 3K81A 1BBDL 2B5UA 3ABTA 1HCVA 1EJ8A 2XJLA 4WHTA 3BOVA 1N67A 3EYOA 3IU4H 3U4BL 4N0FB 1RK0A 3G5XB 2R0ZH 4PV1B 1RZFH 3MROB 4UQDA 4X5XB 1MSWD 2F1MA 1P7KA 2H32B 3TU6A 5F93C 2FIKB 3FQNB 3MRBA 5EZJA 1J7VR 3K5RA 5AYUL 2A7BA 2UXXA 1M56C 3O3DB 1ZLWK 2EDTA 3IDYB 3BESR 1B88A 2GTAA 4P48A 1MPAL 2DMGA 3KLLA 3SJVD 2WIMA 5CCGE 3R1GH 4Y8DC 3TN0D 4PP2B 2WBJA 2Y5TA 1WZ1L 4KXAA 5C8YA 1ZE3C 2PPFA 4P2QB 1WAAF 2ZTBA 3FW6A 4PWJA 4NN6B 4L8CA 3ABKB 2J88L 3HZKB 3AS0A 5F7HA 1MJUL 3OPZH 5IVOA 4DGUA 1NQBA 4OX9O 1QBMH 3TWCL 3B9KA 3SGIA 1G84A 4XAWL 4HGWB 3QQXA 4RMTA 3FK3A 2DQHL 3MJ9H 5ECJE 1MAMH 1W8OA 2XAJA 1HNWB 3L5IA 4V2CB 4L5FE 2UVFA 3MI6A 2ZCKH 1MRFH 4ODUA 3WDIA 3WMPA 4GUCA 2OM5A 4M5YH 5CSZA 1Q9KA 4M7JL 4EN2A 2RTTA 1ED3A 3QO0B 3K0GA 4FXTA 1M4KA 3O4LB 3W9EB 5EU3A 4LSSL 1YNLH 5CZXC 3VXME 3D18B 4Z7UB 4YFDB 1Y1UA 2FD6H 1GYWA 2F54D 5M94B 3G7TA 1N9PA 3D3VA 3OHXA 4YWGL 5D5MB 3LKRB 2E74C 1XSJA 2X7RB 3NIGE 3TBBA 5JPNC 3LXAA 2Q9LA 2AANA 1RAMA 4WFEA 3D39B 2OMBA 2PCPB 1F58H 5ILTL 4ELMA 3WUWA 2YPVL 4KU1A 1QO3A 1CMOA 3N0AA 4OX9B 6CGTA 5FECB 3S3SA 1QABA 3MLXL 3MV9D 2MMXA 4XC3L 2MOGA 2PWHA 4ZW6A 3THOA 3SOBH 2EH7H 1D5ZB 1JPGA 1Y07A 4MS8C 1JYXA 1DVFB 9CGTA 4GCZA 4PJ5B 4F7CB 1HCZA 2OULB 4X66B 3DUSB 3AM8A 2BP5M 2WHVA 1MFNA 1UURA 1ZA3A 3KWUA 1GMEA 1XGQB 4DGVL 3CX2A 5AKTA 2YA0A 1DEEB 4XPAH 4GH7B 3LSUA 1C16B 2IG2L 3GLZA 4FNTA 5EHFA 4ZXBB 3SBWA 1HZLA 1HW7A 2VTFA 4OJEH 1LD9A 3QZWB 3CVHH 3RKDC 1GL4B 4I89A 2FX7H 4HH8A 1NBVH 1E1QG 2WVVA 4OCMC 1WJZA 3FT4A 4UQEA 2CJUL 4IEFA 4X80H 3UC2A 1U9KA 2GTQA 4NZRH 4GRLD 3IFOA 3ULVD 1S7XA 2H2PD 4LFHG 5C0FA 4ZTPL 4XNQA 1VF5C 3ESVF 1X5ZA 2OTJV 3FO0H 5CEYB 4KMTL 3ZQ9A 1N59A 1CDGA 3L81A 5DJ2B 4YLCA 1OQOA 3UTZB 3X1GA 1KT2B 1ZSDB 1L0PA 4B7LA 2Z4QA 2XACC 2X53A 1HHKB 5A1AA 1MI5E 2FUQA 4PJ9B 4IBVA 2BSTA 4YE4H 3WNIA 2UX7A 1A25A 3MV01 5AB2A 2XV2A 2CCWA 1KPVA 3QAZC 3FQUB 1ILUA 3FO9A 3U1SH 2XBZA 4B3RB 2EE3A 5D1ZD 3OKEA 1IM9A 4J3OC 4JS7A 4WTXA 3N0PB 1BF2A 5CCHE 3EYSH 2D2CC 4TULL 5FA4A 4RGMC 5K9JL 2VKWA 3THML 3BPNB 2YEQA 2IMMA 2ED8A 4NN5C 2FBJL 4BRJA 3N91A 4G9FE 2DM4A 3BD5A 4ZUUA 3AG1C 4NCC1 3GS7A 3OT7A 3F7VC 1AYRA 4AOFA 1KIUA 2NCMA 4Z95H 2VLRE 4GI8A 2G30A 2JJWA 1BPVA 2R39A 4XX5A 2DQUH 4BFOA 1NKDA 4NFCA 4MLIA 1U2HA 5DQJA 5E9DB 4EXPX 1IRAY 3L7FA 2CA4A 3B3IA 3KPOA 3II3A 2WQVA 2ZOKA 3L9EA 3MXVH 5D1QC 1ETZA 3LIZL 5DHYA 5F0PB 4Z5RB 3EJJX 3FS9A 2NY1C 4R9HA 4DK5A 3H1JH 4ONFH 2NMSA 3QA3A 3RDTA 2ZOTA 2ZX7A 2A83B 5HDOA 5TDNA 4IRSA 4QRRE 3SE4C 3F5TA 3S37L 1F7YA 1R3LA 3MV7D 1A4JB 2QQKL 3DJSA 2FYYB 1A7OH 2PP8A 1GTOA 3DXRB 3JALA 2H1LM 3A47A 3D08A 4RNRB 4NZFA 4YLQT 3VW3L 2QHRH 3C60B 3T9WA 3RJQB 3P69A 4WUUA 2F53E 1BQ5A 1DLFH 3NQIA 5GISH 2R70A 2CBQA 3QQ9C 3VI3B 3CVHB 2EYSA 4WFGD 3MRMA 2D7NA 2FR4A 4ZFOB 1U33A 2PW2B 4ISVA 1MCFA 2YPLE 2VWEC 3RIAK 5GGSB 2DQ0A 3BX7C 4I88A 1MZZA 1TU2B 1NCTA 4OZIA 2WXMA 4GRWF 5A6IA 3CDYA 3TZVD 2WZ5A 1B2YA 3BWSA 4H8UA 4NYLA 1GN2A 3MRLA 4HAKA 1G7QB 4JHBA 4P23A 3ZYOA 4A7GA 1GC1H 4D3CH 4OH2A 3EJZD 5JHLL 4EIUA 4N5ED 2HZHA 4IRZL 3Q2NA 1B9KA 1T1ZA 1ZJBA 3TBWA 4BFRA 1IM3B 4R90H 4JQXC 4F7KA 3FUMA 2HLEB 2X0VA 2AJXL 2AQPA 3ZKXB 2G2PA 2VDMH 5CJQH 2CGYA 2AKRA 2C9SA 4JFQB 4XNUH 4K2UL 2Q67A 1YEGL 2BOCA 4ZAKB 4E41E 4FZ1A 4JI5O 3W2DH 2YSUB 2VXTH 5AWNH 1BXUA 1K8DA 1NAKL 1TDQA 2I7OA 3PNWB 5A2QN 1SYVA 2WSDA 2FIRT 3QUZB 1N8ZA 1F2XK 4R7XA 3S5LB 1WZKA 3TJTA 4FDWA 2C3GA 3K79A 1PLGL 1XX9C 3S36X 1RVFH 3HCVB 5D7LD 1XWVA 4MDIB 1I7TA 1N3NB 2R2EB 4KHPB 4QRPA 3CK0H 1A7BA 2C9VA 2VDNH 4JRLA 4M43H 4CMMB 1V5JA 3GXNA 5D7IF 4PVLA 2WKOF 4XO4A 3VXPA 4PMFA 5JMOC 2DD8L 1IGCH 1PKOA 1QFWH 5FOBA 4CU8A 3ML0A 5BRZD 2OFQA 4NQDD 5A2JH 2E7LA 1V8HA 4LWSB 1GSKA 4PV8A 1HS6A 1OHHG 3WB2A 3IJEB 3D8MA 4X6DE 4XP9H 1HESA 1KPUB 3ARFA 3JTBA 4JGMA 4LEOA 4YXLH 4J11A 5IROD 4ZTOL 4BCXA 2DYPD 4ZNCD 2EIJC 1US6A 2QDOA 2F93B 1AXTH 1TZIB 2ZE5A 2E6JA 2Y7NA 4EDXA 4K7PX 2YPVA 3ATDA 4JI5B 2OL3L 3FFCE 3T2PA 5AAWA 2YRZA 3WJMB 3CS5A 1F4AA 1UHVA 4WDIB 4X4ME 3KYKL 4YHIA 1XZ0B 2CTRA 4JE0A 1KDJA 5CBFA 5DZOA 5LXGH 2I9TB 3HZVA 3KYMB 4HJSA 2BX5A 3UT5B 1I9IH 3QUML 3MDSA 5EG6C 3L9RA 5SWSD 4ICWA 3CDFA 3ROOA 3ETGA 2XG5A 2HJFB 4ZS6D 3UJTH 1NCOA 1IGMH 1O5PA 4YL4A 3CFBA 4IOSD 4QKXB 3LHPH 3T1YO 4CADA 4B41A 3SZ6A 4J2XA 1OGAB 3MRPB 1DL7L 3LSOA 3KS0J 5I0DA 4L29A 3NJVA 2Z92B 1RZKH 4JN1H 5KANI 1NH2D 4R26H 1NMBL 4LHJB 5D5MF 4DERA 5DFVD 2VAJA 3VGHA 5D2NC 3FOLB 4HJEA 5FDYA 2CRZA 2VDMB 4Q6IC 1CT8B 3K6NA 4H37A 3C75A 5F7EL 5C0BB 4C7UA 5SX5K 1C9SA 4FOMA 3U6RA 4QRUB 1LEIA 2X4SB 4EMZA 4C54A 2VN5A 1KJ2H 3DWTA 2QSTA 5JO5A 1F6LL 4AEHH 3LSSA 3MO1A 2MCMA 2X0WA 1TNNA 5IMLB 1A6VL 4NI3A 3CHSA 3L3IB 4JTCB 3PGCB 3Q6FA 4CSZA 4QRAA 3EXAA 3NFSH 2OAAA 5IYDO 2JVDA 4LFHD 4AQEB 4LEEA 1F4YH 1JHLH 1CG9B 2VDNB 3V0DA 3E8UL 4PM1A 1KLGB 4KXZH 3P0VH 3DC5A 3T1YB 4Q74A 3MZGB 4BWWA 4HCGA 5EUOF 4EOWH 2BXYA 5FCUL 1VQOV 4BFIB 2F7OA 1XNRB 5D96B 1BFOA 4Q97A 4ZD3L 4HBCL 2PCYA 2G9HB 3KH4A 2NQDA 1AE6L 3LH2H 3MACL 5DRXA 3VFOB 1H15B 2R4SH 4NHUA 4Y5VC 4PW3A 2ZXBA 4G6KL 1VKXB 3IAYA 1U8NA 3Q6GL 3ECBB 2BPBA 4K23L 3SJVE 1P5VA 5GRXG 2ZR2A 3T1WA 3BQVA 3QJSB 1AZCA 3Q43A 1BAFH 5IG7A 1IEBA 1JTOA 1UUNA 2C9AA 2DJ4A 1QSFA 2LT9A 2PUQT 3FQRB 1H3VA 4L8SC 5GGQH 3B9KD 1NIEA 3LIZA 5FOJA 1CDIA 3X1NA 2QVIA 2VQEB 1C5BH 3BAWA 1G1YA 3KL0A 4UINH 3VGBA 4LCUB 5T3ZD 4MJ6A 2X1XR 3DX7A 2IGTA 5D6CB 4WUKL 3IGAC 3HKCA 4IMLB 1P9MC 1O5DT 4BUQA 1RZGB 3APFA 5LLIC 1DBKL 1J8RA 4R0LB 3CUPA 2XZCH 2APVA 4KXCA 3TBVA 2OMYA 1QNZL 1V55C 3UIZA 5AVQB 1K3EA 4J3BA 4P9OA 2CRMA 4X9BA 5BS0B 1JN6A 1IBZA 4LVOC 1HSBB 5FA3A 2NYYD 2ZX8A 3EJTA 5LGHH 3P9WB 4WWID 4XO9A 4Y4FB 2YJQA 4JCMA 1EH9A 5GGUA 1DE4A 1FFOB 5BXFB 1IVLA 4U1JB 4XNMB 1CLOH 1CZ8L 3LKPA 4H33A 4BR6A 3EYVB 4NNXA 1I9JL 4WFED 2EAEA 3E1ZA 4QEGA 4UUJC 1CD0A 5JQHC 3K0DA 4YJ3A 1YO4A 2BY1A 3NJKA 1Z2KA 5LHHA 2FX9H 3LRSA 5DJZA 5ICXA 4MNHA 5CEZE 2NZIA 3VD9A 2Y07H 3EH3B 1TUBA 1MF2H 3OR6A 5CIPH 1J9QA 3ML9A 5FUCE 5C3LD 2GC7C 3OUSA 3GIZH 3GK8L 1R3KB 1ID5I 4Q6GA 3MV9E 5E0FA 1ZLDA 1YJNV 3LEVH 5FYJH 3UOAB 4APQA 4ELKA 1E8XA 3WS6C 3AS3A 1MJ7H 2VXUL 4MMZA 2OK0L 3K5MA 2P5EB 2IJIA 3A21A 3NCYP 4RAHA 2X05A 2WANA 2NY2D 3KVDD 2FATL 4HWEL 3VI3F 3CZNA 4KRPC 3FF8A 1KCVL 5DVLA 4OGZA 4X4XA 1JWMB 2Q76A 5AVYB 1S9XB 5ISZA 1KC8W 4ODWA 3JT0A 1YG9A 2ZNWA 4IIQB 2KLTA 3MQIA 3MNWB 1G7JA 2YAEA 5HDBF 2VDOH 1RJZA 1ML0A 5ABAA 4YHZH 5GZOA 1XF3B 2Y7OA 3N1FC 4JR9H 2CM6A 1F1DA 3QF7A 1X5HA 5F9AC 1FVDB 3RNQB 5C6TL 3N41B 4FG0A 1TA8A 4FGMA 3SDDA 5DUBB 1T04B 5D1XC 1S9YB 3FULA 3FPXA 1S7SB 3X2QB 1JWUA 4JTDB 1MXGA 2BZDA 4FFVC 4P3CL 5D1ZI 4BFBD 1JNHB 2PO6B 5IB3A 4FYRA 2NXYB 1LMKA 3PG2A 3X17A 5I6PA 1KSRA 2KDGA 4OZHA 3A67H 4G83A 2Q7HA 3TBSB 3ML8A 2A6IB 3QEQB 1TVKA 4BH7A 1V10A 1MZFA 3SGKC 2YK1H 4H8WH 1IM9D 1L0NH 4GMTL 3DO7B 4CH3A 5IEHA 3BEVA 3SQRA 5K59E 5DRNB 1JE6A 3QIUD 2YD1A 2NY3B 4HWZB 5BJTA 2Q8VA 1RP9A 4U6XA 5CR8A 3PP3K 2XSKA 3KGTA 4KQ4L 2Z8RA 3JUYA 2HP8A 1ACYH 1VZHA 4FG6C 4GXVH 4J3WA 3ZSSA 3K1DA 1Z5HA 1NPNA 2OJZH 1VQ8V 2R1WB 3BFQG 3EDKA 2ED6A 3M1BB 5C9JA 5LGKA 1VFBB 3I75B 3JAMN 1J1PH 2XICA 2HT3C 3HLAB 5IBUB 5CA3A 2AHIA 3ETEA 3K1KC 3SY6A 4YO0A 1JDDA 3RDTD 2CK3G 2ATPB 1A1OB 4FNPA 4NBYB 4IRSD 4HXAL 1XF4B 1P6WA 2PTTB 3FFDA 4MXQC 4NNPH 5E2WL 3T3PE 4GSXA 1G87A 2ENQA 1KJMB 4UDUB 2GKIA 5IVZB 4HIHA 4UIMB 4P2RB 3UJIL 1EAJA 3BP5A 2WNGA 3MV7E 4AV4A 1FPTH 5AZ2H 5DHVH 3IDJB 2P80A 2CUMA 2GI7A 1IT9H 1XSOA 2WTRA 1GAFH 3ETBF 3PE9A 3VFRA 5B39A 1G9EA 3T1FB 3ERXA 2WVUA 1VQPV 3MU3A 2F1EA 1L6ZA 4WFGE 2LFGA 2UXFA 1CFBA 3IF1B 2FJUB 2WN2A 2VDOB 2OA9A 2YR3A 3SJAC 2C7FA 4OJFH 4U1LB 3RVUC 4Y4KA 1R3HA 4P23D 5B1BB 2QGCA 4M7KL 5DR5H 3HVDA 4JYBA 4ONHB 4UTBL 4KI5C 3T09A 3MNVB 1ZS8B 1S9WA 4L4TD 5J11C 3HG1A 2A0LD 1UA7A 4EJ1C 3VDBA 3Q06A 4QF1A 3WE1A 4PMEA 4NZTH 3LMJL 4PRBB 4PVNA 5FGBC 2FNBA 3L6FA 3NG5A 4L9LA 4AM0B 4LSVL 4WHDA 2PGGA 1MCPL 3OLGA 3QCVH 4NS0A 4Y7OC 2OMTA 3VSUA 1CS6A 1W0WA 3OKLA 4ELDA 3VD3A 2ZPKH 5B22A 5ICYB 4LF4O 4NUGL 4QMEA 2PYLA 1MY7A 5EOTB 3QJTB 2UZIH 5T1DH 5JPMC 4TT3G 5I1LA 3A24A 3BH9A 3HKBA 2A9MH 1R1BA 2PWGA 2Y6SC 2Z9TA 3OZ9H 1VPOH 1KCUL 5E5LA 5GZNC 3G6AB 2EIMC 3BZ4B 5C71A 5LMUO 4LH7A 2W94A 1ZT4A 2P06A 2CU9A 5IB2B 3TT1H 4HT1H 4F2EA 2Z34A 3HR0A 3P3TA 3WYRA 2Z1KA 1LO4L 3F5WA 2AEPH 5LO7A 1JZ6A 3DTDA 2WSPA 3T0BA 5T1MA 5B7FA 1P53A 3O6FB 5JVDA 1D9KA 3AC0A 5BRZE 2BC4B 5HFMA 1AVAA 1SVZA 1TPXC 2C4FT 4NQDE 1E9OB 3WIFA 4MXVF 4DK1A 2BNQB 1BGXH 2GJZB 5J9PC 3QZPA 1YZBA 2UXTA 3LQZA 2RQ8A 5CN1A 2HJDA 2D9CA 6PAZA 1E28A 2X3BA 5T1LA 3QO5A 3W7TA 4WY7H 3LAFA 2X6CA 1L5GA 5GONB 5DHVB 4FQ1L 4LF4B 4TUOB 1JGLH 2WN3A 2NCEA 4AGPA 3NCEB 4BAYA 1KJVA 5FX3A 4WFFA 4Q4IA 1CL7H 1BM7A 2PI5A 3B77A 2ATKC 1EDYA 1PZ5A 1EZJA 1XQ4A 3VXOB 4OCNC 4K8XA 3RWEA 3WJJA 1XZWA 5LMUB 3G5VA 3JASA 1JV2A 2N1KA 4P2AA 5SWSE 4IBUA 3DJ9A 3QORA 1XR9B 1RSYA 3MOAH 4M1CD 4HFUH 4WO4B 2YIBD 4DV3B 4XWOC 1DBBH 4HG4K 1INDH 3L4TA 1YTFD 4KUCF 4Y2DC 4KKBC 3ULUH 3STZC 1RJLA 3OZKA 4K3GA 4M9PA 1R24A 4A2HA 4JYAO 1SJHA 2JSFA 2QVMA 2B5IC 3ME0A 2JVUA 4UNUA 5AAMC 1MJ8H 3HB3B 1FHGA 2IPTH 4PJIE 2NYKA 4HCRH 1R6VA 2JK5C 2G3XA 2VLLB 5JYLA 2JIXD 3RY5A 2VRQA 1G9HA 3UBXA 4G7VL 2VMJA 3V7AG 3S4SG 5HYJB 4F80A 5IQ9B 5KSBB 3DPDA 4Y2OB 1S8DA 3X13A 4U7OA 3KYOB 3WL9B 4JX0A 1J0JA 4QGPA 1CCZA 3CGTA 5L3FA 4WEUD 4X2UA 1VHPA 4IMKC 2ZIDA 2FT6A 4HU2A 4CGTA 1NDTA 1P49A 3BP7A 3W0WE 4ZMLA 1BOGA 5HI4C 2CGRL 5IVXF 3OGOE 2X4TA 2GSGB 4JO2H 2EO9A 4DSYA 1JQ0A 2JJ2G 1F13A 1Y1DA 1UWEH 2CO6B 1LO2L 1MQKH 1ZGLA 1YI2V 2OV0A 1U95A 1Z3GL 3AQXA 2VLKB 1V54C 5DS2A 1RZ8A 1CLVA 1NUFA 3QUYA 3LQAL 3TEUA 4AGQA 3C2SA 4JYAB 2LFSA 4N6RA 1H0DA 5L7XL 5CZVL 5E1AB 2M2DA 3RTQB 4JFYA 5FO2A 4F58L 3KXFA 4PN6A 4PS8A 4RMRA 3S97C 4FULA 5BQ7A 5KN5A 4MBRA 1ADQA 3VCLA 1EUUA 5F2FA 1ZT1B 5FKPB 3U9PL 4FXGA 3ULVC 5D2LE 3MXWH 2H2PC 3STLC 2O5YH 1F86A 3FU7B 3PF2A 1DUZA 4JG1H 2ZCHH 2DWXA 4LNVA 4AY0A 2DQEH 2GK0B 2WM0A 2X28A 4K9EH 5DUMH 3G5ZA 5T3ZE 2NXZC 2LLGA 5DURB 4YNYB 3T8XA 1FE8H 5T3XH 1JZ5A 4KNQA 5IJ0A 4PJGB 4QO1A 1GKFA 32C2A 3BN9D 2OZ4L 5FW7A 3RWIA 2JIZG 1NGZA 2DEXX 4BUGA 2O30A 1X4XA 2FO4B 2VMEA 2OCHA 1UM4H 1CICB 3O9OA 3QPQD 4UILH 2J1ZA 3WN5A 1CO1A 5F88A 1LLAA 5EU7E 2L0DA 4KFMA 4W81A 1D6EA 5CJOH 2O26U 2BTQA 2ITFA 2UWEA 5K69A 5KEZA 1T21B 3DV4B 4JI6B 5H9CA 3MUHL 4G6FB 4WFEE 1GR7A 2H6OA 2YHGA 5GS3A 1ICTA 1QHPA 5B1CA 1NC2D 4DH2A 3NMEA 1G5AA 1LGVA 1A3LH 1DHKA 3BP6A 3DLQR 3EBHA 5KTEL 1THCA 2ID5A 4P4KA 5F96L 1Z5LA 3CFDA 4APQD 4NKMA 4QXTA 5JNYB 4A7TA 4TVSa 1ZUQA 2ADJA 4N2FA 3MHZA 4XZUA 3KM1A 4OZFH 1ZWIB 4NI6A 4X6EB 5CEZL 1EO7A 4MNQD 5HJ3A 3AK2A 2QWPB 2Z1PA 3FQ2A 1LYQA 2PN5A 4NO2A 4AQ1B 5ABZA 3T8VA 5KA6A 2D7OA 3TETA 4TYUA 2YIHA 3OG4B 2B2XL 4GSRA 5ISZD 1YF2A 4HPYL 2VLJA 1SLXA 4X8XA 1OKEA 2ZCLL 2DMHA 4OCRL 1AFVL 3VD7A 1ONQB 2H9GB 3KDMA 1HE8A 4OD1H 5I74B 3L4XA 1JK9B 3FQXB 4F91B 4YS4A 2V2WA 3CVIH 3RB7A 5GZOD 2DBJA 5TE7L 1YNKL 5HDWA 1U36A 2FT7A 2VM3A 4I48B 5BUGA 4L2YA 3RNKA 1H3UA 4C56A 1NA8A 1FVCB 2YAFA 1X5LA 1J5OH 3DSQA 1SM3L 3CBRA 1J8SA 4RCAA 3E1F1 4WQOA 3IE4A 1U8MB 5K39A 1L4IA 1DBJL 4M48L 4OZ4B 1K4CC 3DMMA 5INDA 5DK2A 4F5CA 1UEYA 5FNVB 4FQCL 1BQLH 4PJBB 5FPOA 2NZ1A 5IB1A 5L3GA 4AH2A 2A9NH 1ZLUH 3IJYB 2WTPA 4CJ1A 4DKEH 3HPLC 2Y69B 2DLIA 5AW2B 1KDIA 5IZ7A 4ZI7B 4PDRA 3CCQV 4WHYH 3KS0H 4AUUA 2WAMA 2W9EH 3BYTA 1YNTA 4GP4B 5AUMB 2VRAA 5D70L 1NLBL 4MA1B 5B1OA 4Z7QB 3M17B 3HNTL 1ZX3A 4NKGB 2VQ1A 4OKDA 5I73B 4GUOA 5L0QC 1T3FB 3GVMA 1EJOL 2QKIA 4ZSOA 3TXSA 2GHYA 1N34O 4AKQA 4HH9A 1TZGL 3ZHQA 3RTLA 3O0RL 4LOEA 2IALB 2UY6B 4MQXC 5T33H 4XNYL 4Y0GA 3E35A 1EEZA 2W6JG 3QFJA 5FC9A 5DO2D 2QR0A 1U8PA 2YC1A 1XSIA 5E6RB 4N26A 3LTVA 4PYHA 5I71B 3AXLA 4N0CD 3JVFC 4HEPA 2RCSH 2CCVA 4RWUA 4EEQA 4YJZL 4OZFB 4UCTA 5MEOB 2FZ3A 2P5WB 3IEAA 4FABL 2J6EA 4I0PD 2JEXA 4MVMA 1LEGA 3OAWA 4FN0A 3U36B 4WNQB 5TGBA 4QY8B 4DN4L 2JQZA 2GT9B 3L2NA 4JTAB 3E0GA 3OAZH 4HFWB 5ERWA 3FO2A 4DO6A 3Q2LA 4DCQA 2CH7A 4FFWC 1ECYA 1G7LA 1J8KA 3MLWH 4PGDA 3EGSA 4LLAA 2ZUUA 3K8MA 1EANA 3BA9A 3OGCC 4JJOA 1N34B 4LLQA 4J41A 1U8OB 5KG9B 1P7BA 4HAGA 1M4UA 3MTRA 2HJLB 4YK4B 4OZIE 2QTOA 4NDMA 5JLZB 5MP6L 2BK8A 2OT5A 4NRZB 4UBDD 1ZTXE 3HG1D 2WZPD 3ALXA 2F7RA 1S76D 4DHLA 5H2FZ 1JPFA 3RWHA 4KROD 1U8QB 3HE7B 1RQ5A 1TQWA 4CDGC 4DETA 3O8XA 4X99A 4WJ5A 4L4TE 4U1MA 2CNYA 2EZOA 4PHXA 2CBTA 3NK3A 1FXKB 5IK3A 3G9VA 5CHNB 4U6VL 3EKCA 4LAJH 4TQDA 4U1NB 4JV5O 1L9MA 4YIPA 3J81N 5K1JA 3VMOA 3ETBJ 1RP3B 1B0IA 1PP9H 5CWSA 5IFHH 5KVGH 3IMTA 1N36O 3QIBC 4YSQA 2HB0A 5IWAO 2O6FA 1EUTA 1E3ZA 3ZN6A 3ZQXA 1BD2D 5IW6B 4N68A 4LSTH 1GRWA 4Z78A 2DY2A 4WKXA 4DOHB 1YY8B 1GIGH 2K4AA 3RVVD 4R8CA 4AYFA 4G8FB 4O2EB 3IGLA 2FMLA 4HETA 4N2KA 1GS8A 1TJGH 2DW5A 1B4TA 3NJIA 2IOOA 3ZRFC 1MCWW 1J12A 2ICWB 4AM0Q 2OYPA 4ZOLA 4OGAC 4AYGA 5IYBO 5D6DC 1QRND 5IMMA 1Q9WA 1UWGH 4JRXB 2BW4A 4OU3A 3OJDB 2QM8A 4F9LA 2WBJC 4X0KB 5T1LD 2GJRA 3B8YA 2HHHO 3KCPB 4BKTC 3HOGA 5E9AA 4RGNB 1L0QA 4G1MA 4CA4A 3X3GH 3ULSB 1GPOH 4LDEB 3ZPDA 2APFA 5L2KB 1N36B 4P2OA 5IWAB 4PJAB 25C8L 1HFUA 3VFSA 5IJBC 4XDLA 3KPQB 3B9KC 3V8OA 1A6TB 1FXVA 4O00A 1KTLA 1QSEA 4QTIL 3DBXB 3H85A 3QORD 4PJGF 1LMIA 2J21A 1XILA 5LDUA 3JWOC 5A2IH 3D0VB 1XH0A 2CUIA 3QXUA 1I8LC 3BH8B 4LRNH 5E51A 3HUJE 4NERA 4ZMVA 4LR3A 1OCZC 1CLZL 1ITBB 3I84A 3FF7A 1JNLH 4O2CA 3E3QC 4GRMB 5I1GL 3UAJA 4RAUB 4TMPA 5IHBA 2NNUA 1J0KA 2IANB 1TEYA 1HHIB 3QHZL 2G2NA 4PUBL 4UOJA 3L3GA 1HWGB 4KZDH 3DX3A 3B2EE 2NYYC 3QZNA 5IQMA 5HJBA 4P3WA 5EFIB 3TXQA 5KMGB 1KQSU 2R2BA 4YGVB 3OHXC 3C6LB 1AOZA 2HHHB 4IHOB 1WCBB 5KJ4A 4B9JA 1PKQE 3KWTA 4PJ0Z 4JK0D 4ZODA 2ZXWC 5HHMB 2MSPA 2IBGA 1ZL8B 1AD0B 1WS8A 3VXTB 4ZO9A 1PJWA 2AJVL 3OC8A 3DX8A 5C0DA 5DJAB 4E42B 4FERA 4Z1PA 3D4GA 5LBSH 3NBNA 1OAQH 4M5TA 5DQDL 3ASWA 2YD2A 4GSUA 4P46C 4G7YH 5GXBB 3Q05A 2ZUWA 4Z76B 4OM1H 2OTLV 2OCJA 2DM3A 2UV3A 3N43B 4KWUA 3ZE0B 3MUGA 3QIWB 2CRIA 4EI0A 3AM8C 4RUEA 1JFQL 3IDMB 1E7UA 5E8NB 4AQAB 2W0PA 2Q7YA 4JHAH 5IW1A 3CMOH 1I3RA 1IGJB 4HK0B 3SBWC 2B1HL 1T0OA 1E0OB 1QUPA 2KZ1B 1Z9SB 4HHWA 5IY5B 2OW7A 2XG4A 3P77B 4F20A 4UZUA 4HIEB 1OWWA 1Q72H 2AQNA 3UYOD 1CLCA 1M3IA 3KXFD 1NCAH 2AMUA 3V6OA 4DFIA 5JXED 2F08A 3BVDB 3ZE1B 3U30C 4AG4L 1NFIB 2WQUA 3IFPB 4UCFA 4NENB 1NBMG 3I6GB 4ZS7L 2V5YA 4JFOB 2HFEB 4ZW5A 5L8KB 2P22C 3ZRWB 4Z2WA 4PI2A 2Q3XA 2W0FA 2IH1B 1QPKA 1URIA 3B2MA 1WD8A 2PR4H 1O0VA 3CN4A 3L5JA 4KH9A 4LPXA 3AREB 4PJ8B 4DIXA 4BGDA 1VARA 2R9HD 1FO0B 3L3KB 4BYHA 4BWUA 2X42A 3AS1A 1MVFA 4I4TA 1MNUH 1VF5B 1JCKA 2C3VB 4P2YA 4PBVC 3S36L 4X6CA 4MTOA 4WEBH 2IMNA 3QQ4B 3GMQB 4G8GA 3CZGA 4B3TO 5D71H 5E23A 3S5ZA 5T3ZL 2AXGA 2DJUA 4WV1C 3B34A 4P49A 3FUNA 1NBYA 3E22B 5F1SA 3EGXA 4E9VA 3EUDA 1S9VB 4N8VG 5G55A 5TH2B 3TCLA 3JTTA 5GS0H 1DF4A 5DD1L 5GS2H 2B1IA 3QAZB 3ESUF 4YR6B 5KX5A 5IHUH 2NY5H 1NMCC 5BMFH 1CD9B 1E5ZA 2C1PA 2PYFA 3ZE2B 2FX8L 3QH3A 3QG6A 2JCCB 4MMYA 4YDLC 3DK2A 4QCIB 2V2XB 3RWFB 4P4KD 1OP3H 5E1QA 4KK8D 3AG1B 2ZKXA 4PJCB 3H9SB 4QRQA 3L5XH 3O6LH 2KZKA 4DR5O 4LU5L 2Q8BL 1FQ9C 2BIHA 4Y19B 5TE4H 5MEPA 1MNGA 5C0GA 3RDTC 4KKCD 3JWNH 1OALA 5IJCC 1G0YR 2BNRA 1MDTA 4FQQB 1R3LC 1TO5A 2NT1A 3QCTL 4LASL 4MNQE 4XP4L 5D1QB 5DQ9A 3RUGF 1K3ZA 3V52L 2VLJD 5I75B 1E5BA 4B3TB 2VH5H 3D36A 3VXSA 4I55B 2EP6A 4K3EL 4MSWA 4EUPH 4G43B 4M62L 3MYJA 4PI0A 5ISZE 2H1PL 3GWKC 3Q8FA 5LBVA 1JR9A 5ID1B 2EILC 4KVCL 3H3PL 5EIIA 5C0BD 2FB4H 3KLKA 1USZA 1VRSA 1IAOB 1SFDA 4C56D 1PYWB 1SXAA 4D8PB 4XCFH 3IU4L 3M6DA 4PV9A 2ZSVB 1OK8A 3KPNB 4IBZA 5IBTH 3S0PA 4MB1A 2FWLB 1OPGL 2IJKA 1OSZB 2JB5H 4FKKA 1L0XA 1HEZA 2L04A 4I3RL 1IFRA 1OXYA 3JV6A 4JZJB 2EDEA 3PDOB 2BE3A 2ZSWA 4UNIA 2YSSA 2H6UA 3U46A 4X65O 3WAKA 5GRZA 1OCRC 5F6HI 1VCAA 4LCYB 5FB8A 5AVWB 5MENA 1CTNA 3R1GL 3CB2A 2WNWA 1CDBA 4ETQB 5BR8B 1E43A 1N6QH 1NI8A 4XODA 1ZHKB 1AHWB 2B1GA 1VGKB 1AJ7H 4Z1VA 2EDQA 2BOCC 2Q2LA 3QCUH 5CD3B 4DUXA 1XTMA 4P9HC 3TBTB 1CD8A 1N8OE 2JFCA 5F7AA 4X4YA 4B9YA 4LFBO 4F7PB 1J86A 3CE2A 1QLFA 1TFHA 3QXDB 4YLBA 1IXMA 4GP8B 1M3JA 1DUYB 4P05A 2ADQB 3TA3A 4IOIA 5DJDA 2EE2A 1KYFA 1IBHA 1Q38A 3I02A 4DPRA 4YBLB 4G71B 1L1FA 1FYTA 1VB9A 4NQVA 4O4JB 1Q0XH 2Q2EB 2XV3A 3M8OH 4MYPA 2Q6WB 4JUTA 1CDUA 1OGPA 3WKYA 4IBTA 2ZCKL 1MRFL 3IFNH 4ZPTA 3SO3C 1T7ZA 2V2TA 1R1CA 4M5YL 3RX5A 5J12B 1K4DB 3ZDZE 2CTWA 5EEUA 3EJQA 3T4YB 2R2HB 2E7LC 3SGDH 1YNLL 2JH2A 1DP0A 4QNPE 3DOHA 2FD6L 4H0LC 3ZDYE 5CBAA 3HR5A 3ARFC 1M2OA 3QI9C 1DQMH 4FNRA 3VXUD 2UZPA 5KS9A 1LWJA 5ITZA 4PJAF 1QWHA 1Y18A 5AAWC 1QP1A 2APBA 4R96B 5F7YC 3GLDA 4HLEA 3I56V 2BS71 1F58L 5LXVA 4FQXA 4W9ZA 3LD8C 2UU9O 4YJ2B 3CLEH 3P2TA 5IMOA 4UNVA 2EIJB 2J3SA 1TQCC 1BGYH 4GKKB 5FW8A 1MCHA 4OF5A 2BVPB 4FG2A 3ZJAA 1FFPB 1GGTA 1TZHA 3UEZA 3I3EA 4L3CB 5F3BB 2J20A 5AB9A 3P9LB 3V7AE 4JRYD 3OMNB 1N8RW 3PJSB 4XVJL 5GSRA 4ES8A 4R8WH 4XPAL 4ANWA 2E3CA 1PEWA 2NRDA 3ZHVA 3PWPA 4M8QB 2XVGA 1KMIZ 4XI5C 3U7WL 4C83B 4TQFA 1ZTXL 3BSZH 4G27B 1V3MA 5IFAH 3QPXL 1U3NA 1DJWA 3D51A 3CXDH 4FZEL 5E99L 3A0HZ 3T77B 5CU9A 1CGYA 4N0FA 3G5XA 1IBKO 1JWSB 4X80L 4AJYV 3X11B 3MROA 4NZRL 4X5XA 3PGFH 3NOIA 2NSMA 2H32A 2XRAH 4LEBA 5CZRA 2FIKA 1I75A 3FQNA 4MA7H 5KSVB 2R0WL 5I23A 2C3HA 3KG5A 5LQBH 3O3DA 4HCIA 4OFDA 3ZDXB 2E7MA 3ARDB 1VQMV 3FO0L 4XNDA 3MOBH 1BD2E 1NCWH 4DYLA 2ZDIA 4K3AA 4Y9BA 3ZE0F 3FB6C 3ATEA 4JAAA 3F3HA 3B37A 4XOCA 4PP2A 5B1JA 1OAKH 4QJ3B 3R66A 2DS4A 4P2QA 2VSCA 1D3CA 5DA4A 3WBDA 4AIXA 1P84F 3FQ4A 3K5LA 4DJMA 4G5ZL 3HZKA 4U1KB 3U1SL 5AD0B 1C7TA 4L3FA 3CVBA 1NEZB 4JFPB 1MFAH 2XXCB 1QRNE 2WLNA 4HPHA 3EO0B 4PTUB 4LVNC 4HGWA 3HI5H 4ZBMA 3V4VB 5ESVB 1T5EA 5DVOA 3T0EB 3DYPA 3FYIB 5F7BA 4BE5A 2J2ZB 1BG1A 4P2OD 2DIJA 4GB9A 1YEHH 4Z95L 3U4EB 3D06A 1FFNB 1BS3A 4NM8H 2WCSA 3I9GH 3VQ2C 1T0MB 2ZCZA 3MJGX 1M9SA 3EADA 3VD0A 1IB5A 1GGIL 2DQUL 3SDXF 5J13B 2Z8SA 1OWRM 2YEZB 3FFQA 1Z0MA 3O4LA 3W9EA 3WAJA 5AVZB 4A6YL 3AUVA 3MXVL 4PJ6A 4TM9A 3D18A 1HU8A 2XA8H 3QWNA 4XOEA 4Z7UA 4JCWA 3DX0A 1JGVH 1DQTA 3D69B 2Q4PA 3UROR 1WAEA 5D5MA 3LKRA 3CRQA 1OLLA 3ILPB 2CLRB 3LQMA 4A7UA 4XVTL 1A7OL 4WWKB 3D39A 1SETA 2PCPA 3F7QA 5EU6D 2ETNA 1FAKT 3GDCA 4LOUC 2F19H 1HHGB 2QJDA 4Y5YC 5FECA 1TTCA 1DLFL 5GISL 4L0YA 4J3OF 1NU1H 1UFUA 4JN2B 4MQTB 4BXSV 5HVGB 1D5ZA 4PH8A 3ZDWA 3CXHK 4WFBV 1DVFA 35C8H 3MLUH 3ZHLA 1I9EA 4PJ5A 1YJDL 3IE9A 3V5DB 4F7CA 3DUSA 4EUPG 2PYJA 2M6YA 4PJCF 4X83A 1XGQA 3CLFH 1A65A 1DEEA 1SYSB 2CJ3A 1C16A 2H3KA 3QUGA 4ZXBA 4WWPA 3D30A 3OR6C 5A16B 4GNKB 2ZKWA 4FFYH 2NY6D 3VO0A 2CHXA 3V2AR 3Q2WA 3TV3H 3QZWA 3GGWB 5EF3A 4WENB 1AKJD 1MW2A 4K8RH 2LAAA 5I16B 1GY2A 3V0JA 2IBBA 4MMZC 4A7VA 2PZSA 3LZOA 1WLEA 1TQBB 4O58H 4R90L 4W9HC 1A7RL 1DFBH 5CJQL 3W5NA 5DF0A 4OLZH 1CDYA 2XWEA 3W2DL 1FORH 1MLCB 2IGFH 2VC2H 5CEYA 3H9VA 3I9AA 3H53A 5TK2A 5DJ2A 4YMPA 5AG9A 2ZXQA 1QSZA 4YHMH 3UC0H 3UTZA 1KT2A 1ZSDA 2OXGB 3KXFE 1PLAA 2B1AH 5F3HB 1HHKA 3K5SA 3MJ9A 3NIDF 4DK6A 4A39A 1HWWA 1DJZA 4BGLA 1SBSH 1GKEA 1RVFL 2YD9A 4PJ9A 1U8IB 4KRPB 5HHQB 3L75H 1H6UA 3WS3B 3CJJA 3ECUA 2BOBB 5J1SC 2VL5B 2ZD9A 4UYQA 1E5AA 2A1WH 2VDNL 3EFOB 3FQUA 3FAVB 3QEUB 4M43L 4TNWK 3SDDC 4Y8AA 2CBPA 3HW7A 1RUPH 4S1SH 4AITA 2ITDB 2PYED 3ZGIA 1IGCL 4BIZA 4KY2A 1QFWL 4K7PY 1QSVA 5FDWB 1YVLA 4HKXB 1T80A 2Z7ZA 3BQUB 1FZJB 2I7SA 2GBTA 2BZ7A 4JFHD 2ZYSA 4DUVA 2OIGA 3UTPD 3PWUB 1IQWL 2XHBA 2APWA 2XWRA 3Q5OA 4GFXA 4GLRH 1AXTL 2CR6A 3U79A 1WPCA 5E9DA 3A2FA 1IZ3A 1QBAA 5HHNB 3G5YB 4BZYA 1AYOA 5FF6B 2X4PB 3PWLB 4Z5RA 3ARUA 1DN0B 1FGVL 1NCNA 4CBZA 2UWEE 3A4DA 4MAYB 7CGTA 3P30L 2A83A 1OPOA 2CXKA 4K7FB 2Q5BA 2LLNA 3GSWB 2MWCA 1OLZA 3LPOA 3QUHA 5E79Z 1FBIH 1A4JA 4U7MA 2YUAA 2FYYA 3UJTL 3DXRA 1T6WA 2GB2A 5JJJB 1IGML 1BWWA 3INUL 3KJ4B 4JFDD 4RNRA 2GIYA 4AGNA 4DVBB 2BIMA 1KGIA 5IWLA 3C60A 4UU9B 1HL5A 3FTYA 1WYJA 3B2UC 2HPTA 4PREB 5EBWB 1HNZO 3VI3A 1OIOA 1JD7A 3CVHA 3WTVA 4JN1L 2BNRD 1IBLO 4JPSA 3KLSA 5F89B 2DL2A 4N0CC 3E8HA 2PW2A 4ZFOA 2YC0A 1WFTA 2CLZB 1TLKA 5GGSA 3NJHA 1JPEA 1S3KL 2CK0H 1TU2A 2VLJE 3SE8H 5ACLA 4BIUA 3ATFA 1GGBH 3VFUB 3RZCD 4UFZA 2VC2B 1KJ2L 4AUJA 1NFDE 1QPPA 3RB5A 1GW0A 1OAXH 2D73A 1G7QA 2R27A 4HPOH 4MNGE 2C3XA 5PAZA 5E94B 3L9DA 1R3JC 1WGOA 2V9TA 4Q7DA 4CC4A 1BAGA 3D4ZA 4YDVB 4LHUB 1QR8A 2Q0OC 1DQJB 1FIEA 1VFAB 1HCYA 2H0EA 2F66C 1IM3A 1G7PB 4J3XA 2Q8AH 1U3ZA 4C56E 3WDHA 5DWUL 1LWRA 4EI5B 1F4YL 3AWEA 2CALA 2O6EA 4JFQA 4Y4KC 5FYKH 1KIRB 4TSCH 4ZAKA 5BV7L 1F3JB 2XWJB 2NY4B