3AG2B

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag2B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag2B02
4YSPA 1V54B 4YSQA 2CALA 1AZUA 2YXWA 3CDZA 3PCYA 4GP4B 4DP5X 5I6NA 2FWLB 3T71A 2YAQA 3MBWB 2UXTA 1KBVA 4DPAX 1MZYA 5TK4A 1QNIA 1AANA 2YAHA 1BXAA 1NIFA 2H5UA 2VW6A 4A68A 1AIZA 3FU8A 1A8ZA 1HFUA 2BP8A 5B3SB 2EIMB 2J5WA 4F2EA 3AG3B 1OE1A 2VW4A 4KO6A 4EF3A 3C75A 1AZRA 2QDVA 1JVLA 3FSVA 1JZGA 1TEGA 3EH4B 1SHXA 2PLTA 4YL4A 3X2QB 4KNTA 5B7EA 4A67A 2FT8A 2GC4C 2MTAA 1WS8A 4WKXA 4QKTA 4E9VA 4NB7A 3NSCA 4W1TA 1OCCB 4A2EA 1V55B 2ZONA 3FSAA 3BQVA 2A3TA 2XXFA 3IBOA 3BVDB 2OCCB 1DYZA 1WAEA 3AZUA 1X9RA 3DTUB 3T6ZA 2FT6A 2XV3A 3S3CB 4JKNA 2UX7A 2UX6A 4RH4A 3AG1B 3L45A 1HAUA 3FYEB 1SF3A 3PAVA 3N55A 3T6WA 5I6MA 5I6OA 3EH3B 3PPSA 4BWUA 4DP7X 3CG8A 3SQRA 2FQFA 1BYPA 5A7EA 1J5CA 2WO3B 5PAZA 3KW8A 5B1AB 2HRHA 1L9TA 4DP6X 3WNIA 6PAZA 1BYOA 7PCYA 1E67A 5IY5B 1W6LA 2IAAC 1W6WA 1JXFA 2BP0A 1E30A 1JZIA 5F7AA 3WI9A 1X9UA 2YXVA 1TEFA 2ZOOA 2UXGA 3ABGA 3OM3B 2IWFA 3JTBA 2CCWA 2IDQA 4P5RA 1GS8A 1L9RA 2LLNA 4G7SB 3FU7B 2AVFA 3S3DB 4L0PB 2HX9A 3NSYA 1ADWA 1NIBA 1OCZB 2DYSB 4YVUA 2B3IA 1ASQA 2Q5BA 4AX3A 4E9WA 9PCYA 1PAZA 1GS6X 2YAMA 1KDJA 1V10A 2IH8A 1AS8A 2ZWNA 1ILUA 1RZQA 3NJKA 2WSDA 3NJMA 4QLWA 2DWSA 4HALA 2B08A 2XWZA 4AZUA 1W8EA 3QQXA 1ETJA 3QJSB 1CC3A 3DKHA 2VM3A 1JZHA 4YSEA 5AFAA 3TBCA 3QJUB 4PCYA 2GBAA 3QJTB 1YLBB 2IDUA 2XLLA 2YEVB 1RCYA 5AKRA 4UANA 1J5DA 3T9WA 1NPJA 2R7EA 4HCGA 2NRDA 2YARA 4FAAB 3NSDA 3JT2A 2DY2A 4DPCX 2IWKA 5D4JA 3OMAB 1PCSA 4YSRA 2XV0A 2P80D 1NIEA 4DPBX 1IC0A 1OV8A 2Y1AA 5PCYA 1CUOA 2IH9A 5D4HA 2FQGA 2XYBA 4BK5C 2UXFA 3CVBA 2XXGA 1GW0A 3ZIYA 3DIVA 1A4BA 2PP9A 1IBZA 5B1KA 1FFTB 2MRYA 1E5ZA 2X87A 2BO0A 4HAKA 1M9WA 3IEAA 3T6XA 3EF4A 1T5KA 3CDZB 4A2HA 4AI7A 1IBYA 4YSSA 2HZHA 3ABLB 3FQ1A 1IUZA 1SFHA 1ET5A 3ASOB 3WKQA 5EHFA 2IDSA 1CYXA 3PXLA 2JFCA 1SJMA 3NP4A 2HX7A 3FS9A 4Q8BA 5I6KA 3MX0B 1NTDA 2TSAA 4BWWA 2BZCA 3GYRA 1SDDB 1PY0A 1AQ8A 1GY1A 2AZUA 4BXSV 3NJFA 3D12B 4A2DA 1GY2A 3X1BA 4KOCA 1ET7A 3PLYA 3ABMB 4P5SA 5I28A 4UF7C 3NJIA 4E9QA 3AG2B 4CSPA 1UATA 3X1NA 1OOWA 3UAEA 2EINB 2JKWA 3IE9A 5FC9A 1AZCA 3ZX1A 3QJVB 4BDVA 1ZIBA 5F7BA 3V9EA 1L9QA 2VMJA 2OJ1A 4NERA 1ZDQA 3IN2A 3NJHA 4BWTA 3S8FB 5B1JC 5I5JA 1WA1X 4F2FA 1OF0A 1N70A 2EILB 1VLXA 2H3XC 3TASA 2PP7A 2J57A 2GB2A 3EH5B 3WIAA 2HXAA 3SBQA 2I85A 2YQBA 1SFDA 1ZPUA 3UABA 5I6LA 1EZLA 2RACA 4W9ZA 3EHBB 2YAFA 3FPYA 2W88A 1GYCA 1A3ZA 2HLEB 3KW7A 1PZAA 1E65A 2I7SA 2E86A 1JXDA 3AY2A 1ASPA 1OE2A 2BP0B 4G7RB 4K9JA 1BEXA 4JHUA 3RYMA 2PPAA 1NDTA 1ZIAA 3ZBMA 3UAAA 2FQEA 5B1BB 4YVNA 2AANA 3CVCA 2VN3A 2BW4A 3IN0A 1FWXA 1AS6A 5D4IA 1WS7A 1NZRA 1GSKA 2EIJB 1ILSA 2PCFA 4A2GA 1KCWA 2QPDB 4AKQA 4Q89A 3U25A 4A66A 1KBWA 3S8GB 1L9PA 1NPNA 1OE3A 1A4AA 1BXVA 4KO5A 3SBRA 3OQRA 4E9YA 1NICA 4HZ1A 1XB8A 3GDCA 2UXVA 3OMNB 4E9RA 1KDIA 1E5YA 5ANHA 1WA2X 4BXVA 1QHQA 1B3IA 1BXUA 1NINA 2X88A 3ABKB 1AR1B 1CYWA 3AG4B 1MDAA 5B7FA 1BAWA 3OMIB 2IDFA 1PMYA 1KV7A 3OD3A 1CURA 1TKWA 6PCYA 8PAZA 3H56A 2Q9OA 4E9XA 4M3HA 4DP4X 1PLCA 5I5IA 2FT7A 1M56B 1MZZA 4HHGA 2R7EB 1XB3A 4YSTA 2CBPA 2GC7C 1KGYE 2PPCA 3QJRB 4FA7B 4GP5B 1NIAA 4N8UA 4NAJA 4M4RB 4YSOA 4G71B 4AKPA 4DP8X 2XU9A 3NJLA 3FYIB 2YAEA 3NP3A 4MFHA 1ZV2A 2PP8A 2PPEA 1TU2A 2VW7A 1A4CA 2PCYA 3AW5A 1PF3A 3CVDA 5TK2A 4YSAA 2OV0A 1AZBA 4GXFA 2IWEA 3X1GA 1MG3C 2XVBA 2EIKB 4WTQA 1FA4A 3HEIB 2BP8B 3NYKA 5LDUA 1AG0A 1PZCA 3HB3B 1ZDSA 2GI0A 1RZPA 1L9OA 1NWPA 5E9NA 2AFNA 3UACA 1JZEA 3TU6A 2FNWA 1SDDA 4G7QB 1HAWA 2XX0A 1N68A 4HIPA 4KNUA 1IKOP 3FU9A 2I7OA 3TA4D 4DP2X 4DP9X 2BW5A 4TXVB 2VM4A 2N0MA 1JVOA 4F7KA 4JHVA 1JOIA 3FQ2A 4E9TA 1ID2A 4X4KA 2QDWA 4PAZA 1RKRA 7PAZA 2GSMB 5I5MA 2DWTA 4YSCA 2VSKB 5I6PA 3QPKA 1BQKA 5I26A 3H4HA 2YAOA 2AZAA 3X1EA 5B7MA 1J9SA 3NJGA 4G72B 2FTAA 4ENZA 2ZXWB 4KOBA 1ET8A 4YSDA 5AZUA 4BDVB 1BQRA 2QPEB 2TSBA 1MG2C 4G70B 2J56A 1L9SA 1PZBA 3PAUA 1M57B 3GXUB 1PLAA 1QLEB 1XB6A 2XV2A 1SHWA 3CZUB 4HCIA 1AAJA 3FU7A 3FSZA 2BWIA 3NJJA 1PNCA 1DZ0A 1JXGA 2IDTA 2GIMA 3WG7B 1EHKB 4KNSA 4HHWA 1OCOB 1AG6A 1J9TA 2Y69B 1BQ5A 1I53A 4AKOA 4DP1X 1AOZA 3PAZA 3S3BB 3G5WA 1AACA 2P80A 1JERA 2FQDA 2CJ3A 1AS7A 4KO9A 3ASNB 1J9QA 2JXMA 4KO7A 4ZK8A 4CSZA 1WA0X 4GYBA 2QT6A 2J55A 2VSMB 3TBBA 4GY4A 3UADA 1URIA 2PPDA 2YAPA 1SNRA 5B1JA 3N2JA 3NJNA 2DYRB 4A2FA 2HRGA 3NSFA 3WKPA 1KCBA 1AZNA 1SF5A 1J9RA 3ERXA 3NT0A 1GR7A 1XMEB 1ASOA 1A65A 1NIDA 1F56A 2BHFA 3FSWA 3H4FA 4DP0X 2XUWA 3FQYA 3FPXA 4N4YB 3T6VA 2BWDA 1OCRB 2BZ7A 4UAHA 2CUAA 4YSUA 3UGEA 2PPFA 3FT0A 1NWOA 3X1FA 1JZJA 4E9SA 1PLBA 3QJQB 2HX8A 2XX1A 3V9CA 2GHZA 2DV6A 1PNDA 2WO2B 1JZFA 2CAKA 3ZDWA 3SBPA 1KYAA 2W8CA 2H47C 4GP8B 2FJSA 3WNJA 1GS7A 1R1CA 4HCFA
chains in the Genus database with same CATH superfamily
1FXKC 3N06B 3OXSB 5EUKA 1N18A 3IJSA 1PD3A 1I9RH 3FZUC 3MJ8B 1V54B 1V7ML 2VZ1A 4HMEA 3GHBH 5CCJA 3VU1A 2CALA 4DP5X 1ZVSB 2FE0A 4GP4B 2YC0A 3LNGA 2MCMA 3OKLA 4PGEA 2UXTA 3SYOA 4OFYA 4YDJB 2H6PB 2HLFC 4LNRB 1RM1B 5B1AC 2Z7UA 3KG5A 4JQVA 4QRTB 1RUPH 3KZIZ 1IC5L 1PKQA 5TE6L 1CG9A 1TVHA 4D3CH 3BPNB 4LF4O 1PG7L 4YPGA 5BOJA 1N12A 1SXSA 2PUSA 1Q0YH 2XACC 2CDGA 3C5SA 4GKNB 2ZUWA 5FUOH 3TBWB 4F2EA 2XKNB 4QGTA 4B3SB 1NCUA 1QYGL 3FUMA 3O2WH 3V55A 5DHVH 1MA1A 2NQCA 1Q38A 1HSBB 3MV9D 5J7CC 1ED3A 2DAVA 4LRIC 4GKKO 4UZSA 3UPAA 2P45B 2YZ8A 3E35A 1R3JC 4IDLA 2HVKC 2QFRA 4ZI7B 5HYQA 3V4PA 3TVMC 3T8XB 5JDJA 1AO7B 2ZOLA 3BVUA 3NSCA 2ODHA 4G7VL 4GMTL 2YXLA 2QKCA 1FZJA 2ZCKL 4NT6B 3LKQB 5I1IL 1JNJA 3VFMA 3PL6C 4EIBA 5JW4R 4RDBA 4QPKA 3K0YA 1RZKH 3NK3A 3FQRB 3AZUA 4PV9A 4K15A 2NX5E 3QUYB 3DWTA 3RY5A 4CMHB 5HJGA 3SDDA 3Q48A 5GHWH 4LDLB 5E9DB 5LJYH 1X7TA 5IT2H 2YD0A 2BCKA 3WB2A 3ROLB 3HPLA 4K7FB 3MGTA 2A73A 3D8MA 2YPLD 2A6DA 4ZMWA 2A1WL 2DOSA 3WNIA 3KYAA 5JHLA 5T1KB 5IMOA 3WDJA 4KTYA 5IY5B 2DTML 1KXVC 2IAAC 1EXGA 4LF9B 2WTRB 3PWVA 5DQDH 4ODHH 2XZCL 3AXHA 1VQPV 3TEXA 4P57A 2V8MA 1IB5A 3NCFB 5HI4C 5EIIB 3LZOA 2AQ2A 4F7TB 2ZOKB 3LH8A 4NJ9H 2J8OA 1T5WB 4OGAC 3T0ED 3FTGB 3O6FD 3F7QA 4DKDC 4FX5A 3OJVC 4N6RA 5ESVA 1A7RH 3F8UB 2XVGA 2JELL 3LAFA 4KI5F 2JDIG 3VD0A 1L6PA 5TE4H 1LUWA 2QQKH 5FGBC 3FZUD 1TJHL 5HDBB 1QFUH 4AENA 4KITB 1ZHNB 1N19A 1BZOA 3UYOD 1KY6A 1F4YH 1CJYA 3MLRH 3VXTB 4PWKA 2DLTA 4WO0A 2HLFD 5TQ2H 2BOBA 3ZTNL 4HZ3A 3S0PA 1AZZC 4AYFA 2BSEA 4MA7L 5DA4A 4DV4B 1DE4A 5EN3A 5A16B 1ID5I 1HH9B 3CX2A 3NJKA 1LL1A 4JGNA 4XN1A 2WLNA 2PTTA 4RDQG 2W5PA 3VSVA 1OL0A 1K4DA 4HMCA 2Q7NA 1FGNH 1GRJA 3L7EA 4JQIA 1C16A 5ISZB 2GIXA 2HHHB 3QUMB 1QKZL 4BBWA 5GIRA 1A6VH 4CBPA 1I7ZB 1LEIB 4RMBA 1WAAE 2L6LA 4OIIH 3V5KA 3CRAA 2WLYA 4S0HA 4WKZA 2RIKA 1EBPA 2D3JA 4ZUWA 5HVGB 3V0VA 1R5IA 4RBPK 3C2AL 4NQXB 1LEGB 4LH6A 3FKUS 3PL6D 2MOQA 1Q43A 1GMGA 1CDJA 1SGKA 3ZHRA 2IBBA 3B8YA 5IK3B 5SX4H 5KSAC 3O3EB 5IM7A 3UZVB 4MVBC 3B4NA 1KC8W 4U2YA 6FABH 2D7QA 1BLNB 1UFUA 4LF6B 5JUEH 3CN0A 3QZWG 5AW8B 1RUQL 3T2QA 3GLAA 3OR7A 5GISL 3FB7C 3QI9B 1J1PH 3OPZH 2GBOA 1IU1A 2BRQA 2V2WB 1SHMA 4RMTA 2OKMA 4EIGB 4KKBC 4AIZA 5SWZB 3IFPA 5CXPA 1VMGA 4G80A 1NMAH 2Q4PA 4K3AA 1IJ9A 2AJYH 3DUHA 5H4YA 1C8PA 1HNFA 3LRSA 5DJCB 4S2SA 4HC1H 3WJJC 2X87A 2FLBT 4P59L 3E1F1 2YSUB 1T5KA 1WA8B 5KHHA 4UMGA 5JORB 3FOMB 5C09B 2HZHA 3QG6B 3ABLB 1GM9A 1XF4B 3ZY7A 5GZNA 2JJSA 3WKQA 4OGAD 1U91B 2V9RA 1AQDB 3PXLA 5EHFA 3MXWL 5E8NB 1EZVX 3NP4A 4KQ4L 1EHLL 4X42A 4PCSA 3EO9H 1TO5A 5H37A 1B2WL 2OMTB 3JT0A 1K8DA 2CNZA 1ZK9A 4BIOA 2WBJA 3M88A 4Z9KB 4HOWA 5JW4Q 3BRCA 1FIGL 3KXFE 4BXSV 4X4XA 2HT3C 1J0ZA 4I3RL 5DA0B 2YSSB 4XZUB 4U7MA 4Z3TA 4Q58C 2GJ6B 1QR8A 1TFHA 4P2CG 3AG2B 4NZRL 3DX6B 1VADB 4ADGA 1OOWA 1FSKB 4M56A 3LH2H 3BP6A 4OKVB 4ELKB 5FUZH 1K33A 1T1WB 1RPOA 2JKJA 3BGMA 3GZQA 3QJVB 4JRWA 5ANMB 1KKDA 1H0DB 2Z6FA 1GGUA 2ZUYA 1LQSR 2IXQA 4N2FA 2UVFA 4LF5B 5AB2A 5GGRY 3AGVA 2D3NA 5B1JC 4JM2C 1ANUA 5I5JA 2AXGB 5FO7A 3VX1A 4I55A 2OI9B 4F2FA 4LP8A 2YUWA 1AMYA 2DMGA 4M8UA 4FOMA 4EDXB 1I8UA 3GO1H 2J12B 4KPHH 5GGVY 4KZEH 4JCWA 1F51A 1R75A 2CE4A 1FLTX 2C9VA 1FYTB 3SD2A 3UABA 3IDYB 5IYDO 1DBJL 1WIUA 5KSAD 3IF1B 1DJSA 2WKOF 4OSUL 1A3ZA 4MVBD 4KFZC 2YBGA 1XCTB 3BRFA 3IFOB 4AV0A 1GZQA 3EDKA 5EIQA 2DQFA 4JYAO 5C9JB 4YHIB 1ASPA 2EKJA 1ZCRA 3VXMA 4FMTA 3NFSH 4ELMF 4IIJB 4QE9A 1BEXA 1T7VA 2CE6A 4H88L 4RGOL 5GQBA 1FCGA 3JATB 1NDGB 3B37A 1S8DA 5CBHA 1J86A 5D70H 3U36A 3ILEA 4KKBD 5A3IC 1I3RA 4JI3O 3H2WA 3US0A 3MC0A 4R96A 3TYFB 2Z91A 4LXFA 4GJTB 1RPRA 3DX9B 2CGZA 4KXZH 5BZDB 2WXGA 4TSFG 2HT2C 3IU4H 1WS7A 5LXTA 1NCCL 3P3SA 4FYQA 4U3JA 4M1DH 2NSMA 1MLBA 1E2WA 5GRXG 2GJPA 3U25A 1VEWA 5AW7B 3V0IA 4AEIH 1SJEB 1TQCC 1A47A 4G6AC 3RFZC 4IEFB 3OAYH 1QNMA 3ULVH 3WS6A 4I7ZC 3WJMB 4HGWB 1FJGB 5FCUL 1LHZA 5DTFB 2ZE6A 2F4VB 5T5FA 1QHQA 4JHWL 3S36L 3ZW3A 5FDWA 4KTEH 4R9HA 3U2SA 1FP5A 3HC0B 4KJPC 1NINA 3UAJA 1U8OA 3G6BA 2GI7A 2IAMB 3WFVA 1AR1B 1HOEA 3AG4B 1XBDA 2V2XA 2YD7A 3D4GA 3DGDA 4ZNEE 5CAYB 2HT3D 1E4JA 2XFGB 4EE2A 2VJXA 1KV7A 2CHXA 2SEBA 4AM0B 2R59A 4JG1H 4YJ3B 4HH9B 5K59F 4OJDH 3NCYP 5H4ZA 2XAGA 3BFQG 1YRKA 1D7CA 3ARRA 4XN2A 4C56E 4CC5A 4GG6F 2Q0ZX 1FH5L 1SJHB 1FN4B 1FVCB 2YPVH 4XT1C 2R7EB 3KPLA 4YSTA 5LVEA 1EJOL 2WQVA 3QNXA 3EBHA 1VFBA 3SKOB 4P2OC 4FA7B 3M6DA 1BSMA 4FXKC 1XR9B 4WNJA 3P0VH 4JM2D 3D39A 1XNQO 1IFHL 2MW2B 2R8SH 4ODVL 2A9HA 3CK0L 4RMWA 5GGSB 1EEYB 3AREC 5IJBC 4NQSA 3V6FA 1DSFL 4R50A 1FFPB 3BIAX 3U2JA 3GMQA 3JALA 1QR1A 4G6ML 5TK2A 2P90A 1HTYA 4XBGA 2DYPD 4HLJA 1W0VA 3NEEA 5E8EB 5C7ZA 1ZHLB 2CJUL 1R24A 2L4OA 4YBQC 2ALWA 1N36B 3K7UA 4IU2A 3RDTC 1SOQA 3TBTB 3F5WC 2G2RA 4JPWH 4X4YB 3JASB 1MQ8A 5EU3B 3O81A 1ZSPA 3CRMA 2JSFA 2P67A 5CJOH 3MRQA 2P22C 3P1VA 5C0DA 1JPST 5TTRA 4EN3A 2VLLA 3N1QC 3CSFA 1DVFB 3VDCA 2WTOA 3V4VB 5A3ID 3DX7A 3H9VA 7TAAA 1BZKA 4LVEA 1IAOA 1BJMA 4XPGL 2PR9A 3SO3B 3M86A 4KK6C 4LSUH 4P5MB 3TO2A 3ECWA 3ARBC 5DC9B 4JO2L 4GSRA 3ULUH 2DDQL 1H3VA 3QDGE 4QOKB 5DYOA 1GYWA 1DLHA 1WG3A 2OMWB 3IFNH 3TWCL 3K6IA 1HNZO 3L1GA 4G6AD 3OEEG 4B3EA 1EHAA 1NS1A 4OV5A 5D2NE 3K03A 1SXZA 3CLFL 2A38A 4NXNB 4I0KA 4LF3B 3C9NB 4GKOA 4G72B 2XSKA 5E4EC 5JIKA 1LP9B 5FM5M 1ZVYA 2WW8A 4YY3O 5CSZB 2N59A 5D71L 4UVAA 2FYUH 1BBJA 4KJPD 4OZHB 3G6DL 1MCWM 1FIEA 2H41A 4UUJB 4UT6L 4OW6A 3WSQL 4EFBA 2DW5A 3WEXA 4FI7A 3SYAA 4R5XA 1QLEB 3CC1A 4LOVA 4IOIA 2K4WA 2PCPA 2XV2A 5H37G 1VFAB 2QGBA 3CZUB 3K74B 4N90D 2VO5A 3QEUA 1PM9A 2Q7HA 4HS3B 2FMLA 2FDBP 2ORBH 4NQDA 4EFEA 4XB8A 5ESAB 1FJ1A 3O3DA 2G2PA 3GUFA 3WU1A 1L7TL 4U3HA 4HHWA 1DQDH 4F9PC 2CO1A 3SCMC 3LIZL 2QBWA 5CMUA 4PS7A 3DJ9A 4JZOB 4YHZH 1KJ2H 4AW7A 3N1FC 5KVFH 5B1OA 4HOMA 3CXDH 3ALPA 5LAPA 3WNKA 4W4LA 4KH2A 3D34A 5I18H 3ILPB 3ARED 1BV8A 3H1JH 1OLZA 3A23A 3ESMA 4P5TA 5IWAB 2DEXX 1A0QL 2BNRE 5D6DC 2FX9L 2AMGA 3FFOA 3FT2B 5FHAL 5HGDA 4F8LA 4LR3A 1LO4H 1OGAE 2YOCA 1NA8A 3LKPA 2K6WA 4L3ED 3RPKA 4U1LA 1H2MA 5IOPB 4M62H 4P0DA 2XPZA 3AT0A 4WDIB 4RGNC 4XDJA 4D7SA 4X5PA 2A5UA 4HXAH 4LAQH 2PWGA 3KYNA 1WBYA 1U33A 5DEDA 2VQ1B 5J2TA 3K59A 4LCIH 3SJQC 2NXZC 4F7CB 5JZ7C 2C3HA 3RTQA 5CD3A 4K3GA 4O2EA 1FO0B 2VR5A 3WY2A 3EOBA 1TMCB 3KPRD 3U0WL 3SJVA 4FADA 3LSQA 2BVOB 3QQ4A 3CFBB 4IGBA 1XF2B 4X0KA 3T0VA 3O2VL 4NSKA 3CFDB 4KK6D 3P4OA 4YQXL 1TTBA 2QHLA 3VFNA 1F86A 4WW2F 3ZE0E 3ARBD 5B3JE 4APQB 1IEBA 1G4MA 2WN2A 3MUY1 1DLFL 3HFMH 4LF7B 2YFOA 2BDNL 2VR3A 2FJSA 4W6WB 3WNJA 3OW2U 2ZP8A 2R27A 2XTJE 2DPKA 1XL4A 1YNTF 2YQ3A 3QEQD 4JFFD 3RNQB 3UTSD 1NAMH 2VDQB 4M8VA 3WYRA 4JGUA 2H94A 3VXRB 1UZ6E 2RB8A 3MA9L 1WT5C 3FUHA 4OD3L 3E9UA 3K0GA 3PCYA 4OJFL 3G6JF 4N9GB 4UOQA 5I8OL 3T71A 1A1MA 4ZPTA 4A5UB 3ZMZA 1PW3A 3CFMA 5HYFA 1XDCA 3ETGA 1XHHA 3V6OC 3BPLC 3VJ6B 2QV2A 2OIGA 3ELQA 3FU8A 5DJ8A 4X98A 1FFQA 1GAFH 1PSKL 2YJQA 1VQ5V 3LPWA 4PJEE 1EK3A 2R51A 1AZRA 4KAQL 2QEXV 5IFAH 3EOTH 2ADFH 5DQJB 4U1KA 5D7SL 3RJQB 1QLRB 2DM7A 2H32H 4CC6A 1BQLL 1VA9A 5DC2A 4BD4A 3QDME 4LBEC 3QHFL 2J8UE 4OZIB 2ZR2A 4KNTA 1TVDA 4P2QB 4MVRA 3VI3E 32C2B 4FJZA 4LQ1A 2PYED 3DYOA 4NQCB 1INEH 5EU6A 4OB5L 3K6SA 4HWBL 3E2HC 4FQLL 2VZVA 3QWOA 5I8KH 4MMYB 3MV8E 1FI8C 1FDLH 4ANXA 3FCTA 4ZOBA 2NZ9C 3VG0H 4JJ5B 3ZKNC 3F04A 1A21A 3PWPA 1R73A 3B9DA 4JFTA 4ZUUB 4RGND 4RAIA 2D4FA 4WWNA 1NMCC 3CCHB 3GI9L 4OZ4B 3IDNB 2NW3A 5IE9A 1LWJA 2YJLA 1HNWB 3BDBA 2VDLB 3C5ZB 4UT9L 3W7WA 2EYRB 4RISH 4TL4A 4OLEA 4XVTH 3O3BA 2LABA 3H54A 2WGNB 1KBPA 1L6XA 2X4UB 1YEIH 3QTCA 3F85A 3HNSH 3MXVL 5JH7B 3QVAA 4FI6A 4X7TB 4PJBF 3TBYA 5C7XL 5EBLA 2VL5A 3SD5A 2W6JG 1MCDA 3N50A 1EAOA 3QCUL 3WI9A 5F9OH 5KZCB 4PS4H 4XDLA 2NNAA 4ZW8A 5CEYB 1IBFA 3L5JA 2B1GA 4DKEH 2C8NA 5SWSE 3VM7A 4QRSB 2IDQA 3Q8AA 5AALA 4WY7H 4R6ZA 1ZT1B 3O2DL 3O4LD 1KENH 5H35A 2FECL 5KSVB 2COQA 4GSDL 3U0PB 4ELDA 1NSNL 4FA8A 2E0PA 2COVD 1WAZA 3NUKA 1JSYA 3RUGB 1XL6A 1DFBL 3GSVA 3NFPA 3APCA 2XXCB 2QPUA 3QXDB 5T1LD 1A7QH 4JFXA 4K23H 1M1XB 1LM8V 3TT3H 3UGUA 3P3YA 2OX5A 1AJ7H 4GBXB 1RZFL 5HDLA 1N64L 3MNMA 3MHSC 1UCBL 4DV2O 4TS6A 4LEOA 3VOUA 1BP3B 3U11A 1HKFA 3PP4L 4N2GA 4PJHF 2WAQA 3HAEB 5IF0A 2X7LA 1NC2A 1CTMA 3I50L 2B15A 2FX8L 3U7WL 4NQQA 4PGJA 5AFAA 2IADB 4GAJL 1T80A 1O9WA 4JQVC 4R2GC 1NQTA 3QFDA 1X7QB 1BE3H 1OJHA 1Y18B 1BHGA 3LEXB 3S3JA 4UCFA 5JW5A 5F3FA 1YMMB 2YEVB 1XGPA 1XR8A 1KTLA 2FB5A 4N28A 4CZZA 2QADD 4WWKA 4X6BB 2XDHA 4HPOH 4XBPA 1BOYA 4F8PA 2QWRB 2NZ9D 2CMRH 2IQ9L 1CXEA 3ZKND 2ZX9A 1OGPA 3MCKB 4NN6C 1AY1H 1KEMH 2ZSVA 4NI3A 4TNFA 5B39A 1Z9MA 4ODUA 5PCYA 3WNPA 3DC6A 1JV2A 2H1PL 3FJTA 1JK9A 4M4PA 1NGXA 5I1CL 3D33A 5E1AA 1DGSA 2BIMA 2WZPA 2VLJB 4L8SA 3ES6A 3ILQC 4KKCD 4PRHE 2IJHA 2XPYA 1ZLWH 3H9SD 1CDHA 1YEDA 1CD1A 2PP9A 3WO3B 3TH3T 5JPMB 2GSGA 3Q5OA 2GITA 1TZOA 5EZOH 2X4PB 1A7PH 3FO1B 2UUCO 1T5XB 1ZLSH 3C8KA 2P1YA 1JWUA 2NY5L 3RL2A 4AI7A 1TQVA 4LSDA 3QH3B 3GEWB 3APNA 2BVQB 2DKSA 3ASOB 3X11A 5KW9H 5TDPA 2PF6A 2R56H 4JO1L 4XCNB 1SJMA 1YPZF 4Y9GA 4U6YA 4FABH 4YPJA 3L4TA 4HT1L 1A14L 4P49A 3QULB 4NUJA 3L6FB 4N3TA 2PZSA 5E6SB 5DJDB 5CEXB 2CCLA 1VGEL 2VDKL 4AJWA 2VLKB 3DO7B 4NNXA 5ILTL 5CZVL 3P0GB 3GMPB 2A83B 3Q7JA 5E8DH 5KSBF 3D3IA 4QJFB 1WISA 5FKAB 1VKXB 4YIPA 3ABMB 1YJ9V 4X1YA 1UB6A 2AXHA 3AC0A 3WN5B 5H2BA 3PHSA 3BA8A 3NJIA 3QCTL 4E9QA 5LGJB 1KTBA 4HUWB 2F58L 3T77B 1S7WA 4X80L 5IJVA 3K5OA 1I9RL 3OB8A 1X5FA 4IJTA 4LKXB 5FC9A 3GHBL 4G59C 5CU9A 5T5NF 4HP5A 5HHOE 2VMJA 4PCKA 4PSPA 3V0WL 3LDDA 4LFCB 3IJ8A 3D2UB 3N2KB 4BR6A 4OD2A 4OFYD 1AO7E 4AT6A 1KFGA 2BOBC 4GKSB 4J1UA 1WBXA 5LCVH 1N6UA 5I23A 1RI8A 1UQSB 4ZRGA 4ABUA 3WO4C 1FG2A 1MCOH 2YD8A 3WDHA 5EYPB 1J5EB 3KL0A 4PS8A 4AYMC 1K4DC 1O9HA 1Q0YL 3K6OA 5FUOL 2W9EH 2VIRA 1V8HA 3MUGA 4KQ0A 3DSFL 4WHYG 2ATKA 5HGAA 4R7NB 1SYSB 4JO8A 3ZR6A 5KMGA 4O2BA 3MOBH 3TX4A 2IC2A 5GTIZ 3GDBA 3QJXA 4YDKH 5SX4I 3JZ7A 4LPWA 1JGDB 1JXDA 1B4JH 1CGTA 1I9EA 2KQMA 3GMOA 1LEKA 1BVNT 4OM1H 1Z32X 2BMKA 3GIVA 3IDJA 1DEEA 5IW3A 5E24E 1AZVA 3ZBMA 3VQXA 4B9FA 3QJFA 3LV3A 3ILQD 1RZKL 2VJ0A 5D7JB 5I6XB 5JHBA 3KMDA 4C7UA 2AI0L 5F1IB 5LB1A 3UG5A 1VDGA 2VN3A 1W0KG 2BW4A 4LEXH 4MZIA 1GCYA 2WUBH 1FWXA 2ICEA 4LHQB 1TUEB 2ARWA 4L9DA 5I1LA 2RGSA 3SDDD 2F66C 1KTJA 1P6WA 4A7GA 3I56V 1AGCB 4YR6B 5IT2L 5AOLA 3LEVH 1F90L 4QXTB 4QRFA 3PE9A 2X6AA 2Y1VA 5KS9B 5E5LA 2Z5UA 1NPNA 1PZDA 1AQKL 4PWFA 3MRRB 5JHDB 3ARDB 3ILDA 1ZXQA 2EIEA 2ENPA 1G5GA 5HDBE 1T66C 1NCAH 1UD6A 3ZPDA 4GQ9H 4BXVA 4ORZC 2KG7B 4QNHB 5DQDL 1KGJA 1HL8A 2UU9B 5DD5L 4KMLB 3VFRA 1J1OL 2WTPA 1T21B 4NUPA 1PNLA 3QQNA 4FLZA 5GZNC 3AS1A 4NJ9L 5J1AA 3SDCB 2DIAA 1A7RL 3SDAA 3GRWA 4HV8A 5H94B 5LOVA 5TGBA 5HXMA 1E9OA 4XMWA 4M3HA 5C0NC 2CM5A 3WFDH 4EPSA 4EUPA 1LO5A 1MIMH 1T04B 3GMLB 3HN5A 5TE4L 5ISZE 2QQKL 2WBJC 5GGQH 1ZT4A 3MRGA 1L6ZA 1KPRA 1M56B 1QFUL 2QKIB 3D0VB 4JZJB 4NP9A 4AQEA 4DR3B 1DSWA 3MLRL 2VE6B 1N0NA 3JWNE 5TQ2L 4PQXA 3NIDF 2BSED 2H0FA 5DT1H 4MCZB 3UG4A 4Y4KB 3UIYA 1FGNL 3T1YB 3NEOA 3U7YH 4UNVA 3VTMA 1F4HA 3VH8B 2OTWB 1A6VL 3Q05A 1I7TB 4I5BB 1UXSA 1A9VA 4AH2B 1YEKH 4DVBB 1NDMA 2JJVA 1PL4A 2UXBB 3JVFC 1ZDSA 4OD1H 5EU5B 4AQAB 4YLBA 1VIWA 3AAZB 1EX0A 3EADA 4X6DB 1R3KA 1JZEA 5SWZE 4DRXA 1YN6B 3PHOA 4AV4A 5GJSL 2F23A 1K8IA 1OZTG 4I1NB 1MHEA 4FJCC 4LLUA 2Z93A 4XGZA 3TPUA 3W2DH 5I1GH 3OGIB 3AXLA 4DP9X 1KXQE 4B95C 1RSYA 6FABL 2Y3AA 1ORSA 1Z2KA 1JOIA 2NYYC 4PV1B 2XBZA 2E9GA 4PWEA 2P7TB 5C09E 1J8KA 4LEBA 4ZIBA 1GL4B 1QSFA 2QPSA 3BAWA 3L7FB 4KXZI 3EJQA 1J1PL 3VGAC 5L0QC 2ZNJA 3OPZL 2CO7B 5I1JH 4XCYB 1ZGLM 3MODH 3HE7C 4QRRB 4MZRA 3H2QA 1NMAL 4KDWA 4DPRA 4IIQC 2AJYL 5AW0B 1IMHC 3A5VA 3TNMB 1MPAH 1XEQA 1T66D 3T4ZA 2FTAA 4NP4H 4FP8L 4KOBA 3EFFB 4HC1L 4YSDA 3MUHL 3UBGA 1QLFA 4F5CA 3I55V 2XA3A 5ABZA 1FE8H 5J11C 4YZFE 4LFBB 2GJ6E 2OM5A 2D7PA 5GZND 1A64A 4BIZA 1XB6A 4FMFA 4JFEB 1L0LH 1B3JA 4W81A 1U92A 5AG2A 2Z1PA 1KCKA 5C0ND 5ANME 3EO9L 4FE9A 4IS6A 5IFHH 4H1LA 2HKOA 1CDUA 2WBJD 3UAJC 3QQ3B 1P5VA 2AJXH 4WJG3 4DOHB 5HY9A 4U1GB 3ZKSD 3WB1A 3WOVA 1A02N 3ECQA 5EA0H 3FRPB 4XN4A 2R39A 2G4EA 1DVQA 1FYTE 2OXGA 4H8WL 3LH2L 3SDXA 3WEBA 3WHE1 3G04B 5FUZL 3L54A 1HP8A 1CLOL 1F41A 2VN5A 4ZMAT 2YAPA 1VPOH 3SQOH 4EOWH 4OCSH 2DRUA 3N2JA 4NGHL 1TSHA 3OKEA 5J4MA 2H6UA 5FF6B 1LE9A 5B38B 1IGJB 2BHFA 2EIMC 3GO1L 4KZEL 3AG3C 5GW7A 4G9FA 1CE6A 3I2CH 15C8L 2A9MH 3RTLA 3WIFB 4FZ1A 5I2IB 5AVWB 2TAAA 4NAQA 2EDTA 4Z7WB 5L4MA 4HQQH 1FAIH 2Y7MA 4OQTA 3WUWB 1YY8B 4OUUB 3FT0A 4G7YH 3MRMA 3G67A 1FC2D 1MUJB 2G0KA 2NYYD 1HCVA 3HZKB 4W93A 4P9HC 3OB0H 1V55C 2FKXA 3VXMD 3UGXA 2DWEB 1U3NA 2GJZB 4FG6C 3Q5TA 1PNDA 2YPKB 1RU9L 4PWJA 2ZUTA 3SBPA 4FHBD 2V7QG 4FZ8H 1G7QA 3MN8A 4WFFE 1FL6A 2YD9A 4L8BA 4QO1A 1GS7A 1YEEH 4RFEB 1XGUB 3KEDA 3DROA 2OMNA 3NPZB 5F70A 3T1FB 3U82B 1BJ1H 1QG3A 3L3GA 5I76A 1JDDA 1FZOA 3IU4L 12E8H 1NLBH 4I5SA 4M1DL 2KSDA 4Z7VF 4HIJB 3VXUD 3X12B 1D9KA 1CQKA 5D96C 2Y9RT 1CGUA 4AYSA 2WWKO 4P3CH 3ZHSA 4AEIL 3N85H 4C4UA 4KTGA 1CD0A 4BKSC 2Q69A 2AXJA 1DK1A 2G60H 1U36A 5IJ0A 2ICES 4KTDH 3SKNB 4Q6YA 5IQMA 3H7BA 4JRYB 1TU2B 5T3ZH 4KTEL 3BZ4A 3DV4A 2RJZA 3UAJD 4HIXL 3FOLB 2R69H 4UQDA 3I5DA 2R2HA 4X5LA 4JG1L 1OZ0A 1OAQH 2PW2A 5I9QB 4E9VA 4EUPG 3ULVF 4FLHA 1SN5A 4X4ME 2IH3A 3SOBL 4RNRB 4JI5B 3JARB 3CFUA 4LMQE 2A6KB 3M8OL 4HWEL 4XOAA 3VMPA 1MN4A 3FXIC 3QUGA 2YPVL 3T0EB 1CWVA 2JCCB 3O6FB 3F7KA 4FNQA 2YUXA 3G5XB 2ZNIA 4GAFB 2RFXB 1UCTA 4YEEA 3NMEA 2UXDO 1X3DA 1IKNC 1FXKB 1SLVA 2UX7A 3B34A 3D39D 3P0VL 4HJJL 3HJ0A 1FNGB 1ES0B 2R8SL 3QDJA 1U8NB 2HN7B 4NC1E 4TMPA 3PAYA 2EAEA 4P5TC 1AGFB 3EJTA 2XG5A 4DH2A 3ZDZE 5JMOC 2YGPA 1ZL8A 1L3WA 5B1AB 1S9YA 4LL4A 1JZ3A 3GNML 4NM4H 1MW0A 1FNEB 3BJLA 3US1A 2LT9A 1E67A 2M6YA 2VC2B 3EO0B 2CPCA 2X2IA 4JPWL 4TKWA 3MRIA 1WB7A 5IIEB 4G8IA 3FRUB 4QOKE 3VGBA 2YXVA 5KOVC 5CJOL 2NXYC 3B6SB 4FQPA 1GVIA 1K9MW 1KQSU 5F3HA 4FG6D 4EN3D 1SEBA 2UXGA 1R3JB 3W37A 2HVKB 4H20H 3OM3B 4QI3A 4Z7UB 3RTQC 1U41A 4Y7OC 3TVMB 4Z3FA 4G42B 4G7SB 1LP9E 1ZLWK 2YRPA 3OKKA 3TZVA 4IGBC 5JVDB 2HJLA 4OF0A 3RWJB 4LSUL 3QC5X 3WTXA 4OZHE 4GAGH 1FFRA 1Y7VA 3GI8H 3VRIA 4LCUA 3BWAA 2W9DH 3ULUL 2J1WA 1HYSC 4LHUB 1WVZA 5BO1H 4AE1A 2ARHA 2HB0A 4FFYH 1NFDF 1YAIA 4HXBH 1KTDB 4KK9C 2GHYA 3IFNL 1LO2L 5IHBA 1BX2A 4LKCB 3BW9B 4I4TA 1DDTA 2H0PA 1XCXA 4PN6A 3JWOH 5ICXB 1G6RA 2DWSA 3QHTC 4NKOB 4JY6A 3PN1A 1WQVT 2OZ4H 5C1MB 1W8EA 4B7IA 2WN3A 4EIUA 1BCIA 2JIXA 1U93A 1ETJA 3ULUF 1EA9C 5DGRA 2K7QA 4XPAH 1C1EH 2DMBA 3TIDB 4B97A 2E4FA 4C83B 4PD4J 2I27N 3VFOA 4PCYA 4WIQA 3HZMB 3PS6A 2O61B 1EVTC 4J8QA 4DCQB 4H1LG 4NQDD 4XODA 4AC2A 4IBVA 1PIFA 5CWSA 3K5RA 3HPJB 1DQDL 5F7FA 1ZGLP 4P9PA 3OZLA 1JMKC 4I85A 4YHZL 3R0MA 4PV8B 1KJ2L 5KVFL 5F89B 4Y4FA 3OAAG 3CXDL 2ZCHL 2R0WH 1NIEA 4BIUA 2ZXGA 3MREA 3FQ4A 2WLJA 4J10A 1Y6XA 2MH4A 4OCLC 5FO2A 5I18L 5JW4N 1GKFA 1BZEA 1WUZA 1OWWA 4P5TD 1SOSA 4WV1A 4EVNB 3EDEA 4X6CF 1ZLUH 1WEJH 5DLLA 2FO4B 1LO4L 3RQ3A 5F3BB 2DQJH 3HR6A 4B53A 5ID0A 2I9LB 4OJCA 1JP5A 1OALA 4GCZA 5TF1H 3NJVA 4HVBA 4M62L 2ESVE 2Z31A 1I1CA 4BW5A 4LASL 3IEAA 4QXVA 3EF4A 1WK0A 3BEVA 4HXAL 4NPYB 2WLKA 1R6VA 1NBZA 3F12B 4LAQL 1QFWH 2O6PA 1IUZA 1Y67A 3ZRXA 3PDOA 4LCIL 4Y16A 3UKMA 2IDSA 5EMYA 4E2LA 1CGXA 3RTQD 5J13C 2WB7A 3VXRE 5DSCB 3KPMB 5H9CA 1DEDA 3CDGA 3SJVD 1CGSL 4UCVA 4IGBD 3L95A 4LAJH 4Y5XA 5EBLC 4CL7A 3LQMA 1D5ZA 1M71B 2J3SA 3CU1A 5GGTH 5LGYA 2IH1A 3MO1A 2VDOH 1UWGH 5KSAB 1P7KA 3CGTA 1AIFB 5EF1A 1HYSD 3VB8A 4CAGA 2O4EA 5LBSH 4LVOB 1LQBC 3PLYA 5KA5A 4EI6A 1GN2A 4KK9D 3NXSA 3HFML 4ZXBA 5C0FA 1HCFX 3LKRA 4CH4A 1LD9A 4PJ7B 3RI5K 4JI1B 3FB7B 1K97A 2KZWA 3QUMH 3UAEA 1NAML 2VDRB 4FFBA 4A63A 3JV4A 4Q0XH 2DBLH 2RJMA 3CCLV 2ICWA 1YSOA 4NERA 1QUNB 4NENA 4P2QE 3WKML 4Y2OB 1BPVA 2CAZC 3BKYH 2GSIA 2D73A 2YO3A 4FNLL 4GXVH 4M7KH 4NQCE 5E6ZA 3SZ6A 4DHLA 1JNHA 4L8CB 3MR9B 1CXIA 5EOCJ 4M3KB 3IKCA 3FCSA 4K94H 5JIIA 1GAFL 4PJAB 2F7OA 3RJDA 5IFAL 2AHIA 3EOTL 2ADFL 2DQHL 3L17A 4JO3H 4W9ZA 2GTAA 5CZXC 1CICA 4L5FH 4GI8A 3G5ZA 4I88A 4TLUA 2QM4A 5LGNA 4PG9B 1TOXA 2VCOA 5CZRA 4YE0A 1JDCA 3B9EA 3J27A 4TRPH 1INEL 5EU6D 4JHUA 2OS7A 4LOFA 5JA9A 2V17H 5EU4A 4UU9B 4QCIA 2NMSA 5I8KL 1J0JA 1HU8A 5IKCB 1FDLL 3BABA 1QWUA 3ZRVA 2EDMA 2A9CA 4WWKC 1UWEH 1XD1A 4PGDA 4YNYA 4K8XA 1ACXA 2VAAA 4YVNA 3VG0L 5CP7A 3HKDA 5K39A 4E41A 3PWPD 2ARJQ 3JV6B 1FLRL 1EIBA 3FB6A 3L9RA 2N1KA 3S5YA 5FLVA 5AKTA 2QPDB 5E1AC 2EICA 4JANB 1YUHA 2F54A 5E2JA 4L8SC 4HWNA 4QXUH 4JM2B 3ZEDA 4L8DA 4OCYH 1CLZL 5K9QG 2X44D 1GM8A 3GPEA 1TLMA 4RISL 4XVTL 5KYWB 3E8GA 3M17A 4NOBA 4X8JA 1OTSC 1YEIL 3HNSL 2R9IA 3RUGE 4ZTOL 4UDTB 4OVVA 5J5EA 2WWMC 2XN1A 5F9OL 5GGRB 5B7FA 4X20A 3QFGA 4PS4L 2OTUB 4H13C 2ROXA 4ECNA 3D87B 3NOIA 1JNLL 4MA3B 2P5WD 1FFNB 1ZA6B 2O5ZH 4DKEL 5TISZ 1FL5B 2DI8A 2OMVA 4CH3A 2Q6WA 2J71A 3UCSC 1YQVH 4HJSA 1KENL 3VCLA 2K1EA 3LSUA 3W5NA 1P84K 2DTSA 2O1AA 2QVTA 4X5XA 3GLDA 5BVJB 1JK8A 2XN2A 3SO5A 3LKNA 2D3LA 2Z35A 3BMVA 4Y2DB 2VH5H 4K7PY 4X6EA 5I0YA 4G2KA 4GH7B 4X2UA 5JQGB 1A6ZB 3CZFA 4PJ5A 3POHA 4N8VA 1WP7A 3FB5C 1FGVH 4DETA 5JWPA 5L3EA 1YMME 3ABTA 3KVPA 1HQ4A 1WZLA 2I26N 4FLYA 1AJ7L 1GRWA 1T1XA 2M7WA 1W15A 1IBHA 3KCPB 4BQBA 2B4CH 1D6VH 3EYFA 3QUHA 1PF3A 4LGRB 3CVDA 4AQ8A 4GG8A 3QO8A 4MTFA 1NC2D 1ZV5A 2AITA 2EYTB 4MJIB 4YDLC 2DQIL 5LP6A 4D2NA 4H37A 3RFZB 1IURA 5CZXD 1HN1A 1XH0A 4I7ZB 1MG3C 3KNBA 3EG9A 2Y23A 2R1XA 3WDIA 2QGNA 3T4AB 2V3FA 3H6AA 1B9KA 4R0LA 1KB5H 2Z3YA 2VLJE 4ZFOB 5LBGA 2HP4A 3IMRA 1P49A 4X99B 5E4IA 1OCOC 5KVGE 3GWJA 2ATKC 4B3VA 4N86A 1YECH 3K5NA 1HILB 1XI1A 4WWKD 4HPOL 3QQDB 4O4IB 2P4AB 1DCLA 3NZ8A 2LW7A 1SBSH 3EFOB 3P73B 4KNUA 3FT3B 5JIHA 2CMRL 4DO4A 1TSRA 2CXKA 2N04A 4J2XA 4Z5RB 1AY1L 1KEML 1MH5A 2JQAA 1S7VB 3QO1B 4PG2A 4GT0A 4PW9A 1DVYA 3IDIB 4PAZA 1IM9A 1F3RB 2NUTA 5FA4B 3VYNA 3ZU8A 4ANKA 1MW1A 4DV3B 2WZPD 4P2OB 2BC4B 2VQTA 3MRFB 3H9HA 3MROA 4FXKB 3K08A 3L70H 3BLBA 5FM5O 4E5XA 1RSOA 1NFIA 1N9PA 4QPEA 2JE8A 3WHE0 2BY1A 2VSCA 2MFNA 4IRZA 2CRMA 2ICEC 2VLKE 3AREB 3LZNA 3OKOB 1KMGA 1OTSD 5EZOL 5HHMD 5JA8B 4PJDF 1YN7A 1A7PL 4ELMA 3RJOA 1XCQA 5L3GA 3ET9F 5L3FA 3DV6B 1J0YA 1MVYA 3VBBA 1XNRB 3KBFA 2J88H 2WWMD 4JN2A 4L3EB 4QY8A 5JR1H 5JJNB 4UCUA 4DZ8B 5KW9L 4HUUB 4WFEA 2ZF9A 3RDTB 2R56L 3P40A 4CSTA 3F5WB 1OGAA 4HCIA 3WTYA 1CT8A 4FABL 5CN3A 1EMTH 4NWUL 1EFXA 3BO8B 4DV0O 4PRNA 1J8SA 5GS2D 3T0WA 2ADPA 4ALAL 4F1SA 1HHIA 4NYLA 1E5BA 2YMTA 3MRPA 1P7HL 1RIUH 2BSKA 1F13A 4AYEC 1AOZA 1R0AL 3PAZA 3CXHK 1I7FA 3KPRB 2Y0IA 3H53A 3FUKA 1W0WB 3SDAC 3LDCA 3JD0A 1CDYA 3ROOA 5KANI 3M8AA 2VXUH 3EFDH 4ZMTA 1CGVA 3ARBB 1G94A 1HXMB 4CSZA 3AACA 4XWOC 3B2DC 4CKQA 1LUVA 3HE6A 4BQCA 4LQFH 4UV4H 2PPDA 1IC1A 2G9HB 4QLRA 4KUZL 3VXUB 3UTSB 4JFFB 1CFQA 2ZUQC 5LCVL 4JE0A 3ERXA 5E4EB 1QEWB 2Z4QB 3GB7A 1MCOL 3WE6B 1RHHB 5DURB 2J4WH 3V4VH 4D9RD 2W9EL 3V0FA 4DR7O 4S0SD 4Z77B 2VS0A 5ICYA 2CUAA 1JZDC 3APMA 4TLSA 1SZTA 3MOBL 3GSWA 1JPGA 1U42A 1FXHA 3OUSA 3EGXB 5DRXA 4OY9A 3MHZA 4PRDB 3LZLA 2D7NA 5EFIA 1B4JL 1RP8A 1S7TB 4Y5VA 1T20A 1F18A 4OM1L 1R3KC 3U4EB 1DJIA 3A4DA 3SCMB 3NCMA 1RFDH 3C5JB 3L2MA 4F37K 4XO9A 1WH0A 5JHDE 4D0DA 4F7PB 5C6TL 3UCRA 1ZX3A 3KPOB 1PZ3A 2H47C 3NCYS 4YFEA 3WAKA 1IBKO 3CPUA 4QKTA 3CFCH 1ZSDB 4G8AC 4JPIB 1QWHA 4MASA 4KRPC 4LEXL 4TWKA 5DFTA 3P3NA 5FYJE 2WUBL 3VI3A 4JTCB 3ZMEA 4X66B 1E6OH 3W38A 2FWLB 1TITA 1QLEH 2EDKA 4V1DB 3LEVL 1KBVA 2VMEA 4J3OG 5GRYA 4XPBH 4Y9CA 3SGEH 3BEWB 3CV5A 4WF7A 3UO2A 1QBZA 1S9WB 4GUCA 4HZLB 4TNWK 1H3UA 4XP4H 1Y1UA 1TZHB 2VW6A 4DO5A 2R70A 1OGSA 2ZKYA 4I2XB 2C9XA 5FYKD 4GQ9L 4JYYA 4MJ5B 4PIRF 4LVHC 3RVUC 2VLMD 2NXZB 1AR5A 4W4KA 1MSPA 3G9AB 1AD9A 1XBLA 5LQBH 1XTLA 5B7EA 4DV6B 4A67A 2J2ZB 1WS8A 3I6LE 3FTZA 5EO0B 5CM1A 1M05B 4TTDC 4V2BA 4ZUTA 3SDAD 3HZVB 2EXYD 2VTFA 3DOSB 1RZJC 4W9KC 3WFDL 1MIML 1CI5A 1Q90A 3BAIA 2LQTA 4U1NA 5DJXA 1BEYH 2E8YA 2OW6A 3I6GB 4XWOD 5GGQL 1U6AH 2XXFA 4UBDC 2WNGA 4KH9A 3K9SA 1OK8A 3O4LB 3O11B 3R66A 5IVXB 4J7ZA 3KLSA 4X6DE 4JL1A 1XD0A 1HAUA 5IVZB 4K07A 3C6EA 4MNQA 4HW6A 4LCYB 3W9EB 4BWUA 2OJEA 2GFBB 5B3NA 5LHHA 3BEHA 2C5DC 5FAAA 2GT9A 4BM7A 1U8IA 2EEFA 5E8PB 2EIDA 1QTSA 5LGHH 5T1LB 2NY4C 3GBNH 3U7YL 3RGVA 43CAB 3KW8A 4JI2O 4NO2B 2HRHA 3DRQA 3OKDA 1L9TA 5BY1A 4UT6A 1U58B 1KGXA 2G9KA 4NQVB 3MCYA 4HKJB 6PAZA 4PVNA 3BPLB 3K5MA 1P4RA 1MRCL 1YEKL 4FQXA 4H5SB 2XHBA 1OSPH 4OD1L 4ONGH 4Z2WA 5D2LB 3D18B 1IDSA 1G9MH 1FYHB 1P9MA 4L4JA 4MCYA 5F7AA 3LKSA 4JR9L 2LW3A 4QRRE 1DUYA 1GZPA 4F9LA 2A79B 2VXTH 3LIZA 4LBEB 5I1GL 3W2DL 5FK9B 4O4HB 1YDPB 2CLZA 2X6CA 1N8ZA 5I15H 3TJHC 2F53A 1PDKA 1PV0A 4W9GC 3E2HB 3FAWA 5LA6B 1X6LA 2HX9A 2X40A 2HFEA 3CSYB 3II3A 1UH3A 4GRMB 1VQ7V 4MD0B 5LNGA 3MTRA 4RMRA 2B3IA 1RJYA 4E5XG 3RYHA 1J1XH 1R3IH 4JFEE 4GUPB 1EO5A 3LNHA 5I1JL 2Y6SC 3MODL 2EIZA 1DQMH 2JB5H 3EXJA 1L3NA 5DC4B 3P02A 1N0LB 4WUUB 4FG0A 4L8JA 4YIOA 2KKQA 5BR8B 1NGYA 1MPAL 4DOHE 4NP4L 1NCHA 1NMCB 3JWDC 3ZE0F 3EGDA 4C57C 2OULB 1KIUA 3I6KB 4CGUB 1D9KC 3H9SB 1FE8L 2HA1A 2Y3NA 5E51A 4A39A 4CUCA 5IEKB 3BXNA 4IKKA 4MD5A 3HNTH 5IQ9A 4JB9H 2HSIA 3MLXH 5A6LA 2CLVA 4TTDD 2W94A 5D9SA 4KWUA 2JGDA 3QORA 4LIQE 5DD1L 5L8KB 1CFSB 5IFHL 3ETQA 1NPJA 4WBNB 1QBBA 4I4WA 1HHJB 2OMUB 5DHMC 3DHMA 4PDVA 1KCVH 2AV1B 3PU7A 3VRJB 3CU7A 1DQIA 2XPGA 2ZAIA 4UBDD 4E0RA 4GEJA 3EDJA 3UTZB 3WHXA 1IBGH 2A77L 1YHQV 4Q20A 3D0LA 4KXAA 4YK4C 5EA0L 4NUMA 2IH3C 2CCVA 3OXSA 4M6OH 3ZHFA 1T0MB 3G08B 2ZP0T 3MJ8A 5D4HA 4ZFGH 1IM3A 4KZ0A 4PJEF 3S35X 2JQMA 1ZWIB 4Z7WE 5IG7A 2NY4D 3K8MA 5I30H 4GO6B 1YF2A 2H6PA 3OEHG 4YDJA 2J8UF 4N0FA 5KUMA 4EOWL 3SQOL 3MRLB 3MJ6A 4HLZH 3IJSB 5HYEA 2Z92A 1IQWH 4KRNA 1JN6B 1MY5A 2XKNA 5ACZA 4F58H 3ARGB 4G8EA 3OKLB 5DJ0A 2F1EA 4K5MA 1AQMA 3CN2A 5LMUB 2Y48A 1PD0A 4G9FD 3I2CL 3IB4A 2A9ML 5DD0H 4R2GB 1CG9B 1TVHB 4ZI7A 4HQQL 1FAIL 3CNKA 4B9ZA 3HMXA 3TJHD 1MJ7H 4G7YL 3SKMA 4YX2H 1AO7A 2CDGB 4K5NA 1FFXA 2J7LA 2F0CA 2VUKA 1GY1A 2AABL 3C12A 1IIKA 4NT6A 1JGUH 4RESB 1T0NB 1KLFA 4OLYL 3CYOA 1IJNA 3VD4A 1ULVA 4FZ8L 5B1BC 2Y6SD 4NN6B 3V4PB 4DEPC 4JRYE 5LMNO 4UF7C 5HYQB 1UATA 1YEEL 2ZOLB 3QUYA 4A38A 1AJQA 4PJBA 4CILA 4B0MM 2NT0A 3ASNC 1AQHA 5IVNA 3VFMB 1THZA 4MTMA 1DJWA 3WFEH 1NLBL 5E9DA 4LCUC 4B5ZA 3GC3A 3SBWA 2VRKA 1D9KD 4HUMB 3ROLA 3SPHA 2VXSL 4P3CL 3T4DA 5FS5A 5CKGA 1WA1X 4IL6Z 1OZUA 4UT9A 2BSDA 3GEFA 4LLVA 2O5YL 5CN2A 2O6CA 4KTDL 5JXEA 3TASA 2DQGH 2WTRA 2XWEA 3EZ8A 3T0EE 2NX5D 2JCCE 4JI7O 2ZX5A 3KLHC 1HJCA 2GB2A 1GMIA 2BCKB 1QVFU 2QHRH 5T3ZL 3HHSA 4LP5A 3MGTB 2MEJB 1EZLA 1NGPH 5JDSA 4F7TA 5EIIA 3MJ7B 1KBGL 1T5WA 2A6DB 2F95B 1TETH 3N91A 3KW7A 1KCLA 3NAAH 1V5JA 1OAQL 4PY8I 3PWVB 5GS0C 3S37L 2FIRT 3O2DA 4GZRB 4QEGA 3GBLA 3DGGB 4YXWG 5KVGH 2DL2A 5HHXH 1DVTA 1WFJA 3ALWA 1V3LA 4L87A 2YRLA 3B2PA 2X10A 1I9IL 4N6RB 5ESVB 4YMPA 4OT1H 2D2CB 3UJIH 4NC2B 3LNDA 3NTCH 3O45B 3RW0A 5E99H 1BBDL 3HBQA 1O7DC 5F7NC 2QVKA 1HH9A 4XO3A 5HI5C 3GBEA 1R17A 4RVBA 2Q7YA 3N42B 4AENB 4N22A 4BHUA 5CMAB 3QDJD 4G6FD 4WV1C 5CGMA 2D31B 3DX1A 4L1SA 5FWQA 3CAFA 3CN3A 2WY3B 5T33L 1LEIA 3CHSA 4ES8A 3G5YB 2GG1A 1DE4B 1QFWI 4OGQC 4NM4L 2Z31C 4CS4A 4PA3A 2C4XA 2EECA 2FJFA 3ZRSA 5KHJA 1WA2X 2NUPB 1JTOA 4DR4O 2DMHA 4AOFA 3DXAB 3L7EB 4M6AA 3PJNA 4NQXA 2VDMB 3P2DA 1CO1A 1Z3GH 1UA6H 4ODSH 4G8GB 4DN3H 4Y16C 4PW3A 1CMOA 3ZZSA 2P8LB 1OXYA 4ZUSA 2Q10A 4FQJH 4WKZB 1IE4A 2PCXA 3FTWA 4F20A 4IKIA 3TZVD 3V0VB 1DF4A 1A3LH 1R5IB 1XWVA 4KMTH 2N01B 2H3NA 3QP3A 4L4TA 2IH1C 4GAGL 2EDBA 3GI8L 4FNPA 2IMMA 2W9DL 5IM7B 4FFYL 4ZXBC 4HXBL 5FFOA 2CKBH 2R2CA 1YPZA 2I9TA 3TCUA 4YC2C 3O9OA 1YO4A 3JAKA 2FATH 4I0PD 1AD0B 5HTSA 3KLHD 2XG4A 4WO4B 4WFHA 2EXSA 5CFAA 4YDMA 3FOMA 1IBBA 5ABAA 4AIZB 5SX5H 5HVWA 2JIXD 1B9ZA 1QMUA 1WAPA 2A74A 4G80B 5KSBA 1XF4A 4XPAL 3Q4HA 3IFLH 4Z3HA 1XILA 2YC1A 4QTHA 1HE7A 1U91A 2XVBA 2YD1A 1M6OA 3SDLA 3HI1B 4CW1A 1KTRL 5E2VH 4IRSC 1TZAA 2J73A 4XCEA 2FD6H 2FWOA 4AE0A 1SOKA 4G7QB 3ULAB 3LUTB 3ZKQD 3A4AA 5M95B 2IGTA 4W70A 2ZWKA 2YSSA 3FU9A 1CICC 1QFWM 4XZUA 4DP2X 2ITCA 3U9PL 2E46A 4Y4FD 2EDWA 4JHVA 2R0WL 1AMXA 1QRNB 4YHYB 5J2UB 2C1OA 1ID2A 2LAAA 4AJ0A 4X4XB 2AVGA 5D5MB 4NCDA 4P3DA 5I75C 1Y66A 1H0DA 2P8PA 3OHXA 4G6JH 2VSKB 2C7UA 3T3MB 5A7BA 1WEJL 2A6IA 2FZ3B 1OAJA 4TV8B 1XOUA 2DN9A 2DQJL 1NL0H 2C9PA 2H9GB 5TF1L 2AZ0A 2Z31D 3S36X 4CDGC 4I9WA 2XIBA 3FB6C 4MTXA 3QCVH 3BP6B 4WCYH 2DOCA 2BFGA 5F1NA 4QJ4B 4QT5A 4DUWA 3RRQA 4LF4B 4NQEA 1YEFH 5K9KB 3CBJB 2QTOA 1QFWL 1EPFA 4NRZA 3HC4H 3BAEL 3ZT7A 4PJ7E 3QO5A 3IF1A 4Y16D 3LNNA 5FO7B 5I8CA 1M7XA 3JAWA 3FU7A 5B8CA 4P48A 1JJUA 4KXBA 4KROC 4BCXA 4YHIA 3N5AA 3DYPA 2AHZA 3CJHB 4LLAA 3C2SA 3LZQA 4JPQA 4IIJA 1VJSA 3BX7C 5KN5B 5GGTL 5EEXA 3TPKA 4DP1X 3H8NA 2VDOL 3JATA 1UM5H 2G3MA 2FH6A 1I1FA 4GX2A 1NOAA 4LOUD 3GMNB 5F0JB 3S3BB 1DBBL 2I60H 4ZXBD 3CBKB 3O6KH 1GZQB 5IT9N 5AAWC 4ZS7L 3BVTA 4KO9A 4PJAE 2JXMA 2XA8H 4X9FA 3VGAB 3MD0A 1WZAA 2XWJB 3F01A 1S8DB 4IK6A 3W7UA 4JAMB 2DBLL 2J55A 4Q0XL 3LXCA 3U36B 2E5EA 3CX5K 4F57L 3HE7B 1GN3A 4FNSA 4I1RA 1MFBH 2DQTH 4FYSA 4IIQB 2Z91B 2D7TH 1ETB1 1FV1A 2XTSA 3NJNA 3BKYL 2BWQA 4GXVL 4H8QA 1OP3H 4BA8A 5E6RB 1ASOA 5LXTB 4DW0A 4U3JB 5DTFA 2JEUA 4ZDHB 4ZMLA 1KEGH 4XP9H 1MLBB 1BM7A 4K94L 5EB9A 5EIIG 4AQ8C 5J11B 2N3JA 2IAMA 1D7BA 5J57B 1Y6MR 5G4OA 4JO3L 5LP6C 3BPOC 1EHNA 1I8KB 1P0SE 1CICD 4L5FL 4GINA 4AM0A 4HH9A 2EVHA 2WQSA 5EEYA 5EDXA 2EZOA 5FDWB 1YG9A 4YDNA 4PA4A 2AAAA 2KZBA 2L04A 3V52H 3HZYB 5JW3H 1IX9A 1MFVA 1U8OB 1N5YH 2V17L 2V2XB 2YQ2A 4ZMXA 5E5RB 3CH1B 1E2ZA 4B27A 4TVPE 1J05B 2OCCC 1UWEL 1AR2A 1EUTA 4NZDA 3RB7A 1XR9A 3N1GC 4HEPA 3AG1C 2PW1B 4E41D 2XFXA 3UMNA 4X9BA 1ZUQA 1AXSA 3U1PA 4PG2C 1LJMA 2LQRA 4FLWA 4X4MA 4XN9A 2WWWA 3KGTA 4LF8B 3QNXB 4FN0A 1VFBB 4JRXB 5FYKU 2F54D 1M9SA 3EXAA 1GKEA 1WYJA 4QXUL 2AJZB 3D39B 1GOHA 1ND0A 3JWNG 4HAFA 1ITCA 4J3OD 2LLLA 5CIPH 3ZE2F 3TBTA 2L7UA 3T1WA 4X4YA 2EIMB 2R23B 3AG3B 1X6NA 1AP2A 1NM9A 2A9NL 3QPQC 4KROD 1QW8A 3GMQB 3JALB 1QR1B 3LN5A 1Z66A 4RAVB 4XBGB 4O4JA 5SWQA 1SHXA 2F7RA 4EIZC 1B4RA 2EJRA 1R24B 5HYSB 2R0ZH 3AK1A 3FAVB 2MTAA 1DVUA 3ARWA 4NB7A 1QA9B 1S7UA 2SODB 4KI1A 3AJ7A 3U30C 4HGMA 1YQVL 4A2EA 1V55B 3MRQB 3T0XA 3GTVA 5FEBA 5T8IA 3NG5A 3Q3GB 5C0DB 4MJIE 4GMSL 3PXHA 3H3KA 2LO1A 3Q6FB 4LMQI 4M6MH 4RWYH 4HF5H 1A7BA 2A3TA 1HEZB 2VH5L 4NFBA 1JHLH 1JNNL 2OMWA 4M7LT 5EU7C 1IAOB 4PJ5D 1A9BB 1FGVL 4LF3A 5T1DH 1K6QL 4FA6A 2B4CL 1D6VL 5D96B 4U6VH 2Q9LA 5DYOB 2NSXA 1DLHB 5A7EA 3HE6C 4OZHA 1M42A 2H6OA 3HR5B 4UUJA 1B88A 4XMKH 3RT3C 3VNZA 4OV5B 3E6FB 3GS7A 3HOGA 5JIDA 2P4KA 2E47A 1A4JA 1I9JH 5AVXB 3GB7C 4R97B 1BBJB 4WI9A 5AVTB 1KB5L 2B7DT 3JYBA 3M7FB 1K2DB 3HBPA 2ZOOA 2MKLC 4DR1O 3WEXB 3N0PB 2IWFA 1YECL 4X7DC 3A21A 1FXVA 2PCPB 2D7MA 3OL2A 1SBSL 4PLOB 1OY3B 1RMFL 2AZ2A 1BREA 2B0SH 3Q2LA 1FJ1B 5L9DH 1NIBA 4L3EE 4Y5VC 3LSOA 4PA7A 2EX3A 1RLBA 1M93A 3ILPA 1XVSA 1IM9D 1QHTA 3KYKH 3FT2A 1UWYA 9PCYA 3O9WA 1PAZA 3S96A 3REWA 4YO0B 2K6ZA 1ILUA 3Q1EA 5IOPA 4IM8A 3LN4A 3JXAA 1ENVA 1SLWA 1WWBX 4KFMA 3QIUC 4P5TB 2ZUXA 3QPQD 4EEEA 4MTGA 4PBWD 5HGDB 2J6WA 1PFOA 3D36A 3KPRE 5DHYB 2AC0A 3CHOA 4NNYA 5FPRA 2VQ1A 3DJZA 4QHKI 2VM3A 3BZFB 4POUB 5DJYA 5JR1L 1LWHA 4F7CA 1W16A 3PQYA 2WA3A 4WFED 3QJUB 3NABL 1MY7A 1OGAD 2NY3D 1MCHA 1N8OE 4D8PA 3O8XC 1EMTL 2OMXB 1CF8H 1EFXD 3PGDA 3TYGH 1Z7JA 3SGIA 2NXYB 3KYNB 1NUFA 2Q2EB 4IHBA 1BZQK 4KXDA 5J2TB 2GTZB 2WYHA 3NRPA 4ODTH 3VXUE 4CDHA 3UTSE 4CVZA 4JFFE 1I3GL 3RTQB 5CD3B 1S0VA 2EE2A 1FZKA 4O2EB 3VFTA 2AF2A 4WI3A 3EOBB 1KNOA 3SJVB 5C3TA 3QQ4B 4IGBB 1VQ6V 4HAGA 4X0KB 5D1ZA 4DPBX 1S6NA 4NSKB 1DQVA 3P4OB 5C70A 3VFNB 3UBXA 3EFDL 2IH9A 3VXRA 3BHBB 1EEUA 1IEBB 3E83A 2X1OA 2H2SD 4Z76A 1GZHC 1YJDH 3ZL4H 4O4YH 3HE6D 3U83A 4YFLF 1R47A 4LQFL 4M5TA 2V9QA 5GJTH 5CSBA 4JKMA 4P2RA 4AILC 3EDFA 3D9AH 1RJZA 3VJ6A 1M9WA 4NO3A 4BAYA 3T6XA 3FUNA 5EH1A 2WXMA 1N7ML 2FTKA 5DF0A 1OSZB 1UYWH 4ZPTB 3N40F 4MBOA 3T0DA 1UD5A 5DQJA 1QLRA 4A6YL 2LGNA 1DVXA 3VD3A 2EVFA 4JJHA 2B1HH 3Q8CA 4XBFA 4FQXC 4PA6A 1R9FA 5A6MA 4NQCA 4KVNH 4V1DE 1ZJAA 4MQXC 4K8RD 2GUOA 2AZUA 4APXB 3DVGA 2W59A 2VR7A 4UV7H 4X7EC 1CFNA 1PCXA 4U1KB 1RFDL 3VNYA 5DO2C 2YPVA 1GY2A 4GX5A 4QDGA 4F9LC 1YC8A 3FH7A 2HPOA 5IROA 4I2XE 1Q72L 4DK3A 1ODUA 4FCAA 3CFCL 1T5EA 1SYVB 3K6SB 5EU6B 5CILH 3IE9A 2Y06H 2HFEC 4RZCB 4ZUUA 1I4FA 4B3TB 3QWOB 1XMOB 2K4AA 4N24A 5CINH 1E6OL 3WFCH 4NTXA 4GIAA 2BY3A 3VE0A 4HD9A 1KWGA 3IDNA 3FTSA 3FCTB 2XICA 2OZNA 4CSSA 2VDNB 4JM4L 5E0QA 4AIOA 4XPBL 1JR9A 4ADJA 3C5ZA 1ZE3C 3C5XA 3MQIA 3MV8D 5DZPA 1L0XA 1LP9F 4L1DA 2WINA 5JH7A 3M99B 4HIQA 4LPVA 1HXKA 2I85A 4OLVH 3ABKC 2XYCA 4RO2A 4Y1AB 1XMQO 2XAQA 4FVMA 3O4LE 5CEYA 1QI3A 4R5VA 5IVXE 1GO3F 1R4XA 5J13B 3ECUA 4HPYH 1PZAA 2MHAA 4DEWA 1JCKA 3TBYB 4OTXH 1ZT1A 3CVHH 4N2AA 3WGVB 4UTBA 5EBLB 2C9UA 3QORC 2VL5B 5KSVA 4GLRH 4GO8A 4GIOA 3U0PA 1Q90D 1WTLA 1I0HA 4GPVA 2LTQC 4UOW1 1SY6H 3CX5F 3K57A 1BEYL 1G1KA 4KGJA 3FBQA 4UWQB 2TRHA 1J5OH 3JD3A 1A6WH 2KLRA 2ZNXA 4MVSA 3MYJA 1AI5A 5SX5K 3LPFA 1M1XA 2V9UA 5D2LE 4CJ1A 1KLGA 5H35B 5IBTL 2R1WA 4WI6A 1AS6A 1HNZB 3GQFA 4FTVA 1Q1JL 2B8OT 2HTLC 2IF7A 1YZZA 5LYJA 4MNQD 1KCWA 1J18A 1SRDA 1AVMA 2AEOA 3GSVB 1L4IA 1XREA 4YXHL 4JFXB 4WWOA 5DZAA 3GBNL 4GI9A 5LWYH 5FIEA 3RGVD 2DL9A 4DR2O 1KMIZ 2DIJA 1RM1C 1F42A 3OMNB 4PJIF 3TA3A 2F08A 3MBEA 2OX5B 2Y4SA 3L5HA 1Y18A 4FQXD 4J28A 2XAFA 3DX2A 2NDFA 1OSPL 4LEOB 4ONGL 3RP1A 4AG4L 5CLYA 3NBNA 3LB6C 4MQXD 5IF0B 2QSCH 2X7LB 2YEVA 2DM2A 4WLCA 2GVYA 2DWYA 1PMYA 5DO2D 4X6BA 1J10A 2FUQA 1CURA 2VDRH 4A1RA 4WUUE 3QFDB 4X83A 4FZEH 1KJ2A 2VZTA 3ABZA 5I15L 3W5MA 2F53D 5D4QA 4UV9A 5JW5B 3VQLA 3PGCA 5DO8A 3FFCA 4JI6O 1XR8B 1KTLB 3H9SE 3STBA 5FYLE 4KZDH 4HJ1A 1NTMH 4WCEV 1J11A 1E28A 1E7UA 2HTKC 3KHQA 4WWKB 4XBPB 1XSJA 2ILLA 3FF7A 1J1XL 3N43B 4BZ2L 2ZE0A 1R3IL 1F8TH 3BZDA 1OAKH 4BRVA 4WFGA 2FO8A 3V0JA 1NIAA 5KJRH 5D5QA 2OA9A 4NAJA 2ZSVB 4X9GA 1MQKH 4AKPA 5B39B 3LNFA 1JV2B 1U3JA 1BHAA 1ZV2A 2WQRA 2EXTA 4P23C 4V11A 3FO1A 5IQ7H 2VLRA 5E1AB 2XQYK 3OFNG 3ES6B 4JKLA 3SBWC 2I25N 4FXLA 1AZBA 2OLDA 2IWEA 3QR0A 2BVQA 1CD1B 3FT4A 1FNSH 3GSRB 1BGYH 3HNTL 4JB9L 4OFIA 1GC1H 2GITB 3MLXL 1OD9A 1IC7H 1PZCA 3BKJH 1M4KA 2WPGA 3DHJA 3TJTA 3L6FA 3LOWA 3CPLB 3C8KB 4QD2E 3QORD 5KVEE 3UACA 5CEXA 1XMWA 4Z6AT 3RL2B 3H55A 1H8NA 1PLGH 2QZQA 1TQTA 2VLKA 4R6UA 5EZYB 3DO7A 4H13B 1KCRL 3X11B 4PPTA 2RCSH 4OV6F 1MFCL 4X7SH 1KCVL 5FKAA 2Z7YA 3ZHKA 5FW8A 3KL5A 4MAYA 1G7MA 1BMWA 1A7OH 1JVOA 3UBXG 4NUJB 4A7VA 4HUWA 4FFVC 4PSRA 2KHAA 1MCKA 1R46A 4M6OL 4J3XA 2HTLD 1OP3K 2QDWA 1IIIA 2IBZX 4NNXB 3OTOO 4ZFGL 3TXQA 1IM3D 2Y4TA 2H2PC 2Y07L 3KLLA 3IGFA 3PWJA 1G0YR 2ZOTA 4BFIA 1UACH 5F8QC 1UB6B 2V7NA 2IJKA 4JO4H 5I30L 1BQKA 3FB5B 3INUH 1OGTB 2Y1ZA 2YAOA 1S7WB 1L0PA 3FH8A 1N0XH 3IGLA 3NJGA 4YHPA 5IJVB 5IVXF 2CRIA 1JZ6A 3PPEA 4H8UA 4M9OA 1BQRA 2JWYA 2QPEB 5FM4A 4UTAL 4NKGB 3LB6D 2PTVA 4YDLB 2WXLA 5A2AA 3ZDZF 5I1EH 5GGVH 3AT8A 4WHCA 4F93B 1WBXB 3L4CA 5DD0L 4DIXA 3FUFA 4BGDA 3KE0A 5TJWK 1MJ7L 3TF7C 4YX2L 3DI2B 3EFFK 5TH2B 1AO7D 3DYMA 3ZE1B 5KG9B 3W11C 4Q9QH 1MF2H 2A4ZA 2VIRB 1T7ZA 1OCOB 1YZBA 4Z3IA 3SJBC 2ATKB 2Y5QA 1JGUL 5KMGB 4HX1A 4O2BB 2DQEH 2HTKD 4FFZH 2C3WA 4U33A 2OYKA 4MLIA 3T2LA 3VFWA 5MEOB 4W9IC 1I5XA 1BWWA 2J5LC 1TT6A 1Z5WA 3QQ9C 5F1IA 1O9VA 2VQUA 4ORGA 3QZMA 3QUYD 4Q2ZA 3ETDA 1W9XA 5EOCH 2Q1EA 2BMKB 3GIVB 1PYWA 2P42B 3RUGF 1MFEH 3IDJB 4RMVA 1JZ7A 3WFEL 1AGCA 4YR6A 1WV7T 5E9DD 3LV3B 5DDHA 3TN0A 4QXTA 3G4SV 4BFJA 4F8QA 5KS9A 2EDQA 3MGOA 5F0PB 1SNRA 1QRKA 1UKQA 1UKSA 3MRRA 1WPBA 2ENSA 5JHDA 1NCNA 3JSSA 3GM0A 8CGTA 2RMKB 1XMEB 1CIDA 2X05A 4GW4B 2R2EB 5JXED 3CSTA 2J6EA 1BSIA 1CI3M 2B2XH 2RN9A 2DQGL 2KG7A 2QM7A 2BPBA 2K3HA 2OQJA 1Q5OA 1XSIA 4JRLA 4RSVA 4AEHH 3N2GA 2NY5C 1T21A 2A74C 1NGPL 5FKPA 3LQZA 1ROPA 5KVDE 1TETL 1UT2A 3NAAL 1OHZA 4IKLA 1CGYA 2PN5A 2DM3A 4AJYV 2B5IC 2G30A 1QFOA 4FFVD 1OCCC 2VOTA 3GMLA 3RVXC 3VFRB 3H9YA 4F2MB 3IGUA 2H2PD 5DZLA 5HHXL 1Y1DA 4GUNA 2EJ7A 3RVVC 3E2EA 5BJTB 3BUPA 5JMRA 1BZ7A 1B3QA 1Z9SA 4HV8B 5LOVB 4OT1L 2ITCC 3G6AB 5TGBB 3DXAE 1E9OB 3NTCL 3UJIL 2ZAHA 1OLLA 2DWDA 4EUPB 5E99L 3AG2C 1MI5A 3NSJA 5AL0A 4MCZA 4YSQA 1FSKC 1ZT4B 2OL3L 1KPRB 3HAEG 5I6NA 1EGJH 4G8GE 4MDIA 4AQEB 3N9GH 4DV2B 3EIFA 4J6RH 2HFGL 4WI7A 4DK5A 3OHXC 3VRLE 4QAMB 2HH0H 2OTWA 2BS9A 1A3RH 2YAHA 2ZUQB 5EBWA 5ADPL 4ABMA 1M90W 2HG5A 2AJ3A 2O26U 2E76C 3B2MA 2JKLA 3MX0A 2FBJL 4KK8C 5EU5A 4AQAA 5CLZA 5ACLA 4KKQA 3W11D 3TC9A 4Z7QF 3SE9H 1JZGA 4MA8H 2AGJH 1ZHKB 1Z3GL 1UA6L 2OMBA 3GJEA 3IDYC 1EZVH 5EN2A 3AWFA 4DN3L 3UL4A 2RTTA 2FT8A 3L4VA 1UXSB 4TOIA 2H45A 1YSCA 2APXA 2NLJA 2O72A 3D69B 3QQ9D 4FQJL 4K55A 5B8CC 2OCJA 2A6JB 1MCEA 3FONA 2ZONA 4PJDA 1A3LL 2J1KA 3LVEA 3QXVA 4CS3A 4KMTL 4B08A 4DRXB 3HHMA 2NY1C 2Z8WC 3PHOB 1ADQH 4L4TD 4LLUB 1MHEB 3D4ZA 1Z0NA 2Z93B 4LSTH 1S9XB 4XCYA 4KNQA 1VENA 2IBZY 1HT6A 2Y7OA 4BKTC 1A1OA 4QRRA 1RZKC 2E6JA 3LZRA 1H8SA 2CKBL 2IPUK 3ECVA 5CR8A 4KRPB 3HN3A 3L45A 4C55A 2AK1H 2NNCA 2FATL 1QSFB 5KYYB 1B06A 2XOKG 4HZAA 3SQBB 3CZJA 4W4OA 4OJYA 1TQWA 4A7TA 4WFHD 5IB4A 2UUCB 3KLDA 1KCUH 1JOYA 3QISA 3ZMTA 1EM1A 1KELH 1CPYA 3IFLL 4PP2B 3SSGA 1BYOA 1TYEB 1VEOA 4JFEA 1KN4H 1W6WA 3T2PA 3PWNA 1AVAA 1JXFA 5D5ME 2BIPA 5E2VL 3BAJA 1QLFB 5DEFA 4LVHB 5TDNB 3RVXD 5HVFB 3T3ME 2FD6L 2IOMA 3HMWL 4OJEH 3AUVA 3AG4C 4O58H 4DQOH 1TJGH 3RVVD 3PJSA 1ZT7A 3MMEB 5AQ0A 1FHNA 2GJ6D 3P30L 1MJUH 3ARFA 4IS6B 1BAGA 3UZEA 5HI3C 3OE7G 2CUMA 4WSGA 1JRHL 5CGYD 2UY6A 1P5VB 3F00A 3AS3A 4G43B 3CZSA 5I1DB 5HY9B 4OBSA 5AVSB 4G6JL 5B4MC 4PLKC 1RZQA 2WWKT 4XNQA 2W07A 4X1IA 5LCVA 3IYLW 5FF6A 1IQDB 2W38A 2OXGB 1RP3B 1M1KW 4HALA 2B08A 2X4QA 3QCVL 2ENJA 1IGJA 3MGAA 4WCYL 3SDXB 5B38A 3ENEA 1EJFA 2NY4B 4AMKH 4YBHA 4NQED 1CC3A 2GAZB 4YEFA 1FYTD 3ZO9A 5I2IA 1MXDA 4M61B 3WEAA 2UYLB 2IPKA 3OKEB 3RX9A 1RK0A 3WUWA 4OUUA 2ADGB 3Q2WA 1X4XA 3MCG1 5I74C 2HKAA 4PIBA 1D2DA 1VIBA 4UFZA 2XLLA 3HZKA 5CEZE 3BE1H 1C12A 4UANA 2QA4V 4ZD3H 3PNRB 1FNAA 3T9WA 1JCVA 1DLBA 4G9FB 4BZ1H 3WAJA 2DWEA 3BVWA 2NY1D 2GJZA 2YARA 3KYMA 2YPKA 1UM5L 2DY2A 5E5UB 2LGQA 5FLXN 2HFFB 3ZJAA 3OMAB 2I60L 3MRMB 5EUOB 3VMNA 2IO5A 3CD6V 1WHPA 3O6KL 1LK3H 1INQA 3SO3C 4YN3A 2XA8L 4QJ3B 2JKXA 5GPRA 1G9HA 4XAKD 1BQHB 1E8XA 4ABVA 3ZIYA 2VZUA 3MJ9H 3OD4A 1XUQA 1FL6B 1MJ8H 4L8BB 4QO1B 4HD5A 4Q6IB 1BMGA 1MFBL 5KBPA 4KZCA 3DROB 3JQOB 1XXDC 2D7TL 3W81A 4G83A 3SR2C 1FFTB 4K0KO 2EILC 3L3GB 5I76B 1BIHA 4JI0O 2FH8A 4EI5A 4JRYA 1CZ8H 1MIEH 3HKFA 3KWTA 2HVJA 1KEGL 1D9KB 4XP9L 1SVCP 3W7TA 4O02L 1SFHA 2IAMD 1HKLH 4UUJC 1X5LA 3BPZA 5IJ0B 2PWFA 3LKOA 2FX7L 2HX7A 1QR9A 3FS9A 4DTGH 5FECA 3H7BB 4OZFB 2IGFL 3QXAA 2EEBA 2QJDA 1XGYH 2CO2A 1SDDB 3JARA 1PY0A 3CD4A 3KDMA 4JRXE 3V52L 4OLZH 5KJ7E 1DDHA 3S4SB 2CGYA 3QS2A 1N5YL 3D39E 4JN1H 2CDEB 1QBAA 5HJBA 2OPCA 2R2HB 1KPUA 1Q9KA 3G5XA 3KJ6H 3W57A 4P5SA 9CGTA 4YK4B 4F6EA 2CO6B 2FJGB 2PW2B 2AXFA 4JS7A 2NCMA 1QW9A 5B4MD 4PLKD 1OK0A 5EG6C 2IH3B 2YGNA 3V6ZB 4BIKA 2L7QA 5GRWA 3D85A 1FNGA 1JZ2A 2WBXA 3L2LA 4JVPA 1Q9LB 1ZIBA 1M9NA 1M1SA 4H8WC 3HUJF 1AJNA 2ZM6O 2VN4A 3P54A 4BWTA 1KFAH 3KGUA 3O9WC 2A9DA 4J3UA 4LP4A 4YDVB 2G3ZA 1ZS2A 4ZOCA 4AXWA 1FNEA 4DERA 2JF1A 2RQ6A 3P2BA 3QDJB 3UO3A 4G6FB 3ARVA 1NCJA 4Z7OF 3L3HB 3R4DA 2JI1A 1V3MA 4NZUH 5JOPE 3FRUA 4ACTA 1ZPUA 3RGBA 2XG5B 1ZL8B 1S9YB 2B9BA 3IDGA 4WTZA 4X9YA 4OZGA 2HVKA 2M83A 4BE5A 2XC8A 5IB5A 2HLEB 4Z7UA 5E7FA 1ZEAH 2J8HA 4G28B 2R0ZL 3BDYH 3TVMA 5DUBA 3Q43A 4G42A 3TWYA 3WXWH 3W3BA 2KLTA 3GSNH 1OAZH 3N04A 4QRPA 3GD1C 3FUJA 2WV3A 3HIZA 3BWUF 1ZIAA 1SEBB 4M6ML 1ZKAA 4TUKH 4LHUA 4RGMC 4HF5L 4LK4A 5B1BB 3CDCA 2WSPA 4W9DC 1KTDA 1JHLL 5C07A 4DEPB 5E5MA 2AJSH 1N26A 2CK0H 5HHNB 3WY4A 4DW1A 3BW9A 4YHNA 2GW5A 2KQNA 4XMUA 1KTCA 3DXRA 5D1ZC 5DJAB 2BVTA 4ZAKB 3UIZA 2W9LA 2WKLA 4AKQA 5JHLH 4LCUB 3BWAB 4A66A 5K1VA 4G5AA 1X5KA 2CKNA 4ADIA 4JNXA 1KBWA 3MUZ1 4Z7AA 4U6VL 2JLLA 3TBSB 1BX2B 2UUDH 4XMKL 4NQDE 4HZ1A 4I4TB 2E8ZA 4FCHA 2B16A 1QX1A 4C83A 4OFDA 4UQ2A 1NM4A 4DVRH 5IHHA 1I9JL 4NCC2 4JY6B 4TQPA 4DCQA 1XZ0B 2B14A 1MNNA 5AL8A 1DVSA 1T83C 4OI7A 2P26A 2JIXB 1CYWA 1U93B 3V4PH 3FFQA 1BAWA 5ADOH 1DANT 4Z7WF 3M7MX 2YIAA 2KYIA 1BFOA 1AHWC 4KUCF 4A04A 4PV8A 1IBDA 1RPUA 1UXLA 4NZ8A 3LX9A 3B9AA 3BUBA 3W9DA 2EH8H 5K9OA 1PLCA 4LSVL 5HHQA 2B0SL 5FGBA 1SHSA 3CFTA 3B7UX 4L48A 5L9DL 3T6QC 5F7UA 3TF4A 1RVFH 1I82A 1DJYA