3AG2B

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag2B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag2B02
1TEFA 1A4AA 5I5MA 4HAKA 1JVOA 2PPCA 4KOCA 2BP8A 4HCGA 2LLNA 6PAZA 1J5CA 1WS7A 5I6LA 1ET7A 1L9TA 3OMNB 3BVDB 4A2HA 1AZCA 1PZBA 2AZUA 3UADA 2XVBA 1L9RA 1BYPA 1AS7A 1WA0X 1RKRA 2VMJA 5LDUA 1AG6A 3PLYA 3V9EA 3TASA 1E5ZA 1MZYA 1SF3A 2BW5A 3PAZA 1PMYA 2GC7C 3FSZA 4MFHA 1XB3A 4CSZA 1GYCA 3S8GB 1JXDA 1SDDA 3KW7A 1OOWA 2FNWA 1DYZA 1BQRA 3WKQA 1JZJA 1KYAA 4G7QB 1W8EA 5I6NA 1ILUA 1J9TA 4E9WA 4AZUA 2YAMA 3WNJA 9PCYA 2XUWA 2AVFA 1ET8A 3S3DB 1QNIA 2Q5BA 1OE1A 1AZUA 3QJRB 3NP3A 1PAZA 3L45A 3NJLA 1PZAA 2PCFA 1JXGA 5I6MA 5E9NA 3SBQA 1NTDA 1OCCB 4DP0X 4YL4A 1MZZA 3GDCA 5B3SB 3AG3B 1AZBA 4HCIA 2FT7A 4E9VA 4KO5A 1EZLA 2XV2A 3JT2A 4Q8BA 1AZRA 3IN0A 4Q89A 2CAKA 1SHXA 3TA4D 4HHWA 2P80A 2UXVA 3FU8A 2I85A 2Q9OA 2UX6A 5F7AA 3C75A 4M4RB 5FC9A 1JZIA 6PCYA 1AS6A 2Y1AA 1NINA 1XMEB 4A2GA 4BXVA 4M3HA 1PF3A 2FT6A 1KDIA 1KDJA 1JERA 1SDDB 4BWWA 1IUZA 2WSDA 2AANA 4YSEA 2IWEA 2IWFA 3FQYA 1M9WA 1CYXA 1L9SA 4YSUA 5B1AB 1I53A 4A2FA 4HZ1A 1AR1B 5D4HA 1KGYE 3NJFA 1FA4A 3WIAA 3NSCA 1KBWA 4NAJA 3T6VA 2MTAA 3FYIB 1HAUA 5B1JC 1JZEA 1CUOA 2UXGA 2YARA 4E9RA 1L9QA 2YQBA 3ZIYA 2IWKA 3UAEA 3CDZA 2GBAA 3KW8A 2XX1A 2PP8A 3NJNA 4GY4A 4FAAB 2IDSA 4YSOA 4N8UA 4JHVA 1M56B 1HAWA 2HX8A 2BWIA 4PCYA 1NWOA 2H3XC 1JZFA 3SBRA 3AY2A 4BDVB 1AS8A 1KCWA 1ZDSA 1OF0A 2JFCA 1AG0A 1NIAA 1GS7A 3IBOA 3PPSA 1ASQA 2BHFA 1E67A 2QDWA 4QLWA 4KO6A 3S8FB 2XV0A 3MX0B 1JOIA 3CDZB 1BXUA 1CC3A 1PLBA 5I28A 3AG4B 3NJIA 1E5YA 2DY2A 5I5JA 2CJ3A 1J9QA 3ABMB 1ILSA 4DP9X 4DP6X 4KNSA 3QJSB 3QQXA 3IE9A 4DPAX 1OE2A 1FWXA 2EILB 3QPKA 5I6KA 3OQRA 1GR7A 1R1CA 4DPBX 2NRDA 2YXVA 5PAZA 2IH8A 3FPYA 3AW5A 4G70B 3SQRA 3S3CB 3ABLB 5IY5B 2FQEA 2GB2A 2VN3A 2X88A 1NIBA 2DV6A 2VW4A 2YEVB 3CG8A 4G71B 1ZDQA 3EH5B 4YSAA 4E9YA 4P5RA 4YSCA 1BQ5A 1IBZA 1HFUA 1SNRA 2HZHA 5D4JA 3JTBA 2QPDB 3X2QB 2IDQA 1V55B 4F2FA 2QPEB 1JZHA 4W9ZA 4YVNA 5AFAA 4HALA 3T71A 1A3ZA 1IBYA 3GYRA 3FU7A 2YAOA 3FT0A 3PAVA 3AG1B 2OJ1A 4E9SA 4WTQA 2CALA 1NIEA 2FWLB 1YLBB 1NIFA 4GP5B 1TEGA 2FQGA 3U25A 4K9JA 1QHQA 2P80D 7PCYA 1AOZA 1N68A 4YSSA 1IKOP 1A8ZA 2WO2B 3RYMA 2PCYA 4GP4B 2Y69B 3NJJA 1OCRB 3EHBB 2HLEB 1T5KA 1WS8A 3QJQB 5EHFA 4AKPA 1PY0A 3ASOB 4E9TA 2QDVA 3NJGA 3ZDWA 4AX3A 1ID2A 2J57A 1AQ8A 3NSYA 1A4CA 2QT6A 2XYBA 3NT0A 3FQ1A 2R7EB 2BO0A 2FQDA 5I6PA 3AG2B 1M57B 1SJMA 1FFTB 2PP7A 1PNCA 1PCSA 2YAQA 1GS6X 1AANA 2PPDA 3SBPA 4A2DA 1SFHA 4RH4A 2EINB 4BWUA 4G7SB 2UXFA 4YSTA 2CUAA 5F7BA 4DP1X 2E86A 2FQFA 4E9QA 3ERXA 1A65A 5PCYA 1IC0A 4EF3A 4JKNA 2OV0A 4KNUA 1BXVA 4GYBA 1KBVA 3T6ZA 3MBWB 5B1BB 2JKWA 2AZAA 1X9RA 2RACA 3CZUB 2B3IA 3HEIB 4KO9A 3ZX1A 2CCWA 2CBPA 3DKHA 4ZK8A 2R7EA 2XXGA 4BDVA 3DTUB 2IDTA 3FYEB 2FT8A 2EIJB 5B1KA 3HB3B 3TBBA 2VM4A 4YVUA 5AZUA 3T6WA 1AZNA 3WG7B 2GHZA 1OCZB 2YAFA 3EH3B 1PZCA 1UATA 2UX7A 2DYSB 1B3IA 2PPFA 2N0MA 4WKXA 2XV3A 4DP2X 5A7EA 2BP8B 1KV7A 3WNIA 3NYKA 1X9UA 3N55A 4AKOA 2WO3B 3ABKB 1BQKA 1ZV2A 5B7EA 1GY1A 1WAEA 1J9SA 3QJVB 1NPJA 4BK5C 1V10A 1RZPA 2W8CA 2YXWA 3PXLA 2IH9A 1ZPUA 3NJMA 2BW4A 4YSQA 2ZONA 1L9PA 3CVBA 2PP9A 2VM3A 3D12B 4BWTA 5B7FA 4AKQA 3IEAA 4G72B 2I7OA 2VSKB 4E9XA 2XLLA 3N2JA 5I6OA 1CURA 2XX0A 2MRYA 3WI9A 1GW0A 1ETJA 4CSPA 2H5UA 1MDAA 1N70A 5ANHA 3FSVA 2XU9A 3UAAA 2B08A 2IDFA 1BXAA 2ZOOA 3CVDA 3FSAA 3G5WA 4W1TA 1XB6A 2J56A 1URIA 2DWSA 1ASPA 4KOBA 1V54B 3AZUA 1W6LA 1E30A 3NJKA 3PAUA 2PPAA 5I5IA 4UF7C 3QJUB 1SFDA 1AACA 4G7RB 1RCYA 3X1GA 2X87A 5AKRA 2GIMA 1NZRA 1J9RA 1NWPA 2I7SA 3X1BA 4UANA 4YSPA 2W88A 2ZWNA 4ENZA 3PCYA 4DPCX 1OV8A 1W6WA 1RZQA 2VSMB 1NDTA 3FPXA 4GP8B 4GXFA 1CYWA 1NPNA 2HXAA 3H4FA 4A2EA 2DYRB 2PPEA 3BQVA 4HCFA 2HX7A 1NICA 4NB7A 2IAAC 4PAZA 3FS9A 3X1FA 3IN2A 4DP8X 4FA7B 2HRHA 3CVCA 4AI7A 1GY2A 2FTAA 3X1EA 3FQ2A 1OCOB 1WA1X 2XWZA 1A4BA 2TSAA 1GSKA 1AIZA 3TBCA 1BEXA 1J5DA 5TK4A 2VW7A 2J55A 3ZBMA 3S3BB 4YSDA 1DZ0A 3GXUB 1NIDA 2BWDA 2TSBA 2ZXWB 4A68A 2HX9A 3FU9A 3UACA 3T6XA 2UXTA 2GI0A 1L9OA 1SHWA 8PAZA 7PAZA 2EIKB 2DWTA 4YSRA 3OMIB 1PLCA 2BZCA 3ABGA 1MG3C 2OCCB 1F56A 3V9CA 1SF5A 3DIVA 3NJHA 1ASOA 1ZIAA 1VLXA 2BP0B 3OD3A 1GS8A 1OE3A 2A3TA 3H56A 4JHUA 3TU6A 3OM3B 1QLEB 2YAEA 3H4HA 4KO7A 1TU2A 3UABA 1JVLA 2J5WA 4P5SA 4DP5X 1PLAA 5B1JA 3WKPA 4HIPA 3NP4A 2XXFA 3NSFA 2FJSA 3FSWA 2GC4C 3ASNB 1KCBA 1XB8A 5I26A 3X1NA 3UGEA 4X4KA 4BXSV 2JXMA 4NERA 3OMAB 2BZ7A 4TXVB 1ADWA 2GSMB 2YAHA 1BAWA 2IDUA 2PLTA 4A67A 4L0PB 4DP7X 1MG2C 2BP0A 4HHGA 5B7MA 2H47C 3QJTB 1PNDA 4F7KA 3EH4B 2VW6A 4KNTA 2AFNA 2YAPA 4DP4X 3T9WA 2EIMB 1EHKB 1E65A 1AAJA 1ET5A 1ZIBA 3NSDA 1JXFA 2HRGA 3EF4A 4F2EA 1BYOA 3FU7B 4QKTA 1TKWA 4UAHA 1JZGA 5D4IA 1WA2X 4N4YB 5TK2A 4A66A
chains in the Genus database with same CATH superfamily
5L4IA 5I5MA 4UT6A 2NCMA 2BP8A 3O2WH 4W9DC 1Z66A 1WFOA 5GGVY 5I6LA 2B9BA 3N42B 1XGUB 2VZOA 1MHEB 2AZUA 5C0CB 4JO8A 2XVBA 1H8SA 1MWAH 3GZPA 4ADJA 2B59A 5CLWA 5G2NA 3D5OF 4W6XB 3NSJA 5LN4A 1ETZB 1K6QH 4HYTB 3RE0A 3SDCC 3BABA 4YQXH 1PL3A 1GM7A 4JFDA 2HYMA 5I16B 2E7MA 1HKLH 2XWRA 3G5XB 5KUKA 2PCPB 2Z0UA 2NY4B 2HTLC 4FQ1H 4HKXB 4F91B 4RGMC 1HH9B 1HHKA 4K7FA 2ZUTA 3EJCA 1I8AA 3CIAA 1NGYB 1WIOA 4MWFA 1N0LA 3V0JA 4DIXA 5T3ZH 3QTCA 1PS3A 3P2TA 2QWQB 1W8EA 1LE9A 4AV4A 4AZUA 4KKQA 3JAKB 2Q86A 2D3JA 4NZDA 3AAZB 1F4MA 1FCGA 4RRPM 3HKZA 4U3HA 2FLBT 3ZE0E 1AZUA 4Q56A 4UNVA 4M7ZB 3NJLA 1H3PL 1HN1A 2GITB 1HIMH 1PZAA 3OZKA 1LEGA 4LL4A 1KIQB 3U7WL 1GC1H 1NMBH 2KHAA 4MRBA 4DP0X 2OXGA 3L72H 3G5ZA 1CLZL 2Q2LA 3ARFA 3B4NA 2ADJB 2IEPA 1AZBA 1FNEB 3OB0K 4C54A 5FGCB 2H7WA 4Q8BA 3L74H 4YBQC 4MCNA 1JFHA 1TQBC 1VZHA 2A7WA 2CAKA 2RJMA 3QDJA 1OF2A 4TUOA 1U8CB 4PVNA 4O02L 3AMKA 4JI6B 4RGNB 1V3KA 3IT8D 5DJ8B 1RZFH 2D8KA 3SKUD 1NL0L 1Y4MA 3ZE2F 4RWUA 1G9MC 5L3BA 2Y1AA 2BRQA 4NM4L 3SYQA 3CFIC 2XKSA 2CBMA 3RVUC 1SETA 1Q6IA 3SQBB 3TH3T 5KJRH 2AVGA 5EU6A 2X7RB 1HI6B 3K5NA 2CJUH 5FA4B 1DBJL 1LEGB 1JL8A 1M05B 5F9OH 1CEZA 4ADIA 4MNHB 1UA3A 5B1AB 4QRFA 4R5XA 1IB5A 1AR1B 2OTPA 4ZS6C 1YF2A 2BM3A 3IJSA 3NSCA 4YHKL 1FNEA 2N3JA 5TE4H 3T6VA 5AL0A 5B1AC 3E6FB 4OGAC 1VEOA 2R29H 3RZCC 4GKLA 3WEAA 5L2KA 1E4XI 1VFUA 4FNLH 3JVGC 4X6DB 2WCPA 5CCGE 1G9MH 3CDZA 5B3JE 1CLYL 2G0LA 1BQLL 4IGBB 1SN5A 3L3KB 2WNWA 4NPKA 2F5BH 1RZGB 1VCAA 2E0PA 4ATTA 1YN7B 2IXQA 1CDGA 1F8TH 1I94B 1UC6A 3DPBA 4GAYB 1ZA6B 4LNRB 3FUKA 5KJ4A 2CG9X 2R69L 2AV7B 2CIKB 4Q52A 2PABA 2A73B 3UG4A 4D3CH 5ANMA 2CXKA 3VFTA 4OR1A 5DK2A 1M7UA 1Y07A 4AZ8A 1QR4A 1ETA1 5GISH 4GKKO 5H37A 3SKMA 1MHCB 3A23A 4H2CA 1Q90A 3KH4A 4NDMB 1NZ6A 2AC0A 4XNXH 3BPOB 2C3VB 1YEHL 1HDMB 3U6XA 4PP1C 4J11A 4J2XA 3ZZQA 2XN9E 4X5QA 1GGTA 5C8YB 1DEDA 3KLHC 2EBOA 4FLYA 1SJEA 1SEQH 3QJFA 3CDGB 4WI2A 4KI5F 4JZJC 5DWUL 5D7IF 2XKNB 3MV9E 3QIWD 3ZKMD 4Z5RA 4P4KB 1QHTA 3K3QA 3D51A 3HHSB 1J7VR 1EMTL 1SYVA 3APDA 1U93B 4A7QA 2EIDA 1K8DA 5EU3B 2P43B 2QVMA 2R8SH 5JXED 3D69A 5H2FZ 3PQYA 3T2NL 4OZIE 1XMWA 3EXJA 4WBNA 2YXVA 1FDLL 2VMFA 5EOTB 2WVVA 1A6PA 3FPYA 3VYNA 4NQDA 4AGLA 3CN4A 1Z1WA 1QRKA 4Q58C 3RTQD 3LNNA 2QSVA 2F5AH 4IRZL 3TA3B 3AGWA 1QEWA 2XTLA 2DWDB 4JFYB 4K7PY 1OAUL 3SB3A 4LHUB 2R0WH 4ZOBA 2RH0A 2ZDIC 1A6UL 3DMMB 3NCXA 1AZZC 1W72B 4GBXA 4ZMVA 5BV7B 1ZDQA 5EIBC 3GO1H 3ZE1E 4YSAA 1G9NC 1QKZL 3RWDB 3L7FA 4X9YA 3WFCL 1V3JA 2YMXL 3VM5A 2VXQH 3JZ7A 4GKZB 3TNMB 1U8PA 4PJDF 2WNGA 2RIKA 4B7IA 4U7MA 4TQEH 3X2QB 3UIYA 3C60B 4CH3A 4Q97A 4FK5C 4OJCA 2QPEB 4RZCA 3HJ0A 4PLOB 1AI7A 4RFEA 2BC4B 4LF5B 3VXRE 4KHTL 2ITCA 2OL3A 4F20A 2DQTL 2BOCA 4RRPG 1UB5A 4JDEB 4Y5YA 5KVMC 1N32B 1DBMH 3PAVA 3CTTA 2BSRA 5E8EA 4WI9A 3I2CL 2VT0A 1Z0NA 3EHBC 1UM5L 5HHMD 1NIEA 2QSAA 1AGBA 2FWLB 2BINA 1FGNH 2G5UA 2P46B 3VJ6B 3FT4B 4HAGA 4K9JA 2AW9A 1N68A 1QBLH 4OVUA 5ICYA 5D7LE 1XCXA 2DWEA 3G7TA 3QYNA 3P9LA 2DQEL 2N56A 4M8QB 1NI8A 1CGSL 2Y2YA 4QY8B 5E8PB 1LYQA 4PVMA 1S4IA 3QIWA 4NN7C 4IBSA 1J8KA 4H88L 3KCPA 5DUJA 1N3NB 3KL5A 3LKNA 4NC1C 4PRPE 3QZPA 4YBLB 4Y8DC 2YUZA 3ZMEA 1A6TA 1SXCA 5T8IA 3ETEA 2F6AA 4EIGB 5FK9A 2IV9A 4S2SA 4HKBA 2IQ9L 3FX7A 2OMVB 2VCOA 4XRCA 5MERB 4ZUVA 3NCEB 4ONHA 5L0QB 1KMIZ 4Q6IC 2Y3NA 1M5IA 4NC2B 1SXBA 4PV9B 2R70A 4DP1X 4KFMA 1A7QH 1QPXA 2BXZA 1I31A 1KIPA 1X5MA 2NY5C 3DVNA 3ERXA 3F6JA 4TLKA 5I1KH 2IJIA 3UGUA 2OA9A 3U82B 2ALWA 2EJRA 3BP7A 4FLZA 4OZIF 1T1YB 3CFDB 1NGZB 3PDGA 1MFAH 2FX7H 4U6XB 3IMTA 3IJ4A 4L3AA 4NB5A 1U42A 1X3DA 3K1KC 4RCAA 4XZUA 3ARSA 5B8CA 3B9KB 1AXIB 1NKOA 1YEIH 2CA3A 3O6FC 3NFSH 4I1NB 2CTQA 4X7SL 5B4MD 3SR2C 3KYKH 3VTAA 4EQ3A 3NABH 5EBLB 2XVGA 5SWSB 2GK2A 4C83B 4FF9A 4MS2A 3FAXA 2IJHA 5A43C 4IS6A 5B1NA 3FHQA 1NU1H 4HIIA 4UOW1 1KBGL 2CA4A 2P28B 3HKBB 2P49B 4O9HH 4LMQE 4OJAA 4TSBL 3K5LA 1A14H 4MYPA 2OQJA 3WEBA 5C0GB 1JF1A 4ZMAT 5J6HB 4UT7L 1PKXA 4ZW5A 4X8AA 3QUHA 1B3IA 3BIBX 2V7NB 3BP7B 5I1HH 3QEHB 1VJSA 4JO2L 5AOIA 1F90L 1U2CA 2ZKMX 1UWXK 5KJ7E 5F7EL 5BR8O 1GH7A 3GMMA 2NZ9D 4J23A 2WBXA 1ZXKA 2XPGB 4PJHB 2NSXA 1AY1H 3BQUD 1J9SA 4I18A 4I2XB 4QCIB 4TNVF 5JXAH 5ABAA 5TE6H 5BR8B 1CLCA 3AREA 4MAYD 3S98A 2H32A 4G1MB 1PV0A 4LPYA 3X3GL 2RMKB 2VDQB 4E41A 4R4FH 5JO5B 4POZC 4RGNE 3NK4A 1D2PA 4UT6H 4M5YH 4HJ0C 1FNLA 3HKFA 3REVB 3E2EA 4YXKL 2R0ZL 2V2WB 2KZ1B 4PB0L 3LS4L 4HWUA 4DZBA 5IEHB 3MUGA 2QHRH 4JQIL 1ZEAL 4MX7B 4E42B 3DYOA 2NYZA 4X6CF 1V8HA 4M3KB 3IEAA 3IXTA 3U0WH 2ODMA 4BSWA 1MCOH 4LPTA 5DURD 2PUQT 1RJYB 4FNRA 4WNSA 3UZVB 3P32A 35C8H 1K5SA 1XNRO 2BIHA 2F53B 2V6HA 3FH5A 4RVBA 1Z0MA 4Z0BL 4JAMB 4CN1A 2VR7A 1U8IA 3T2OA 5TGBA 2HUEA 1FLRH 2F53E 5BRZE 1NA8A 5T33L 4HS8L 4JKPL 2OYQA 3ME0B 4FMKA 3WFZA 1BLIA 1MFUA 5AL8A 5IJKC 1BREA 2HLFC 2PPAA 4O4IB 3ZL1A 2IMNA 1YMHB 5DEFA 2RNBA 3FCGA 1FQ9C 1S7UB 3ZQWA 2ZXDA 1OM3L 4V1DE 4XO9A 1MFCL 4UOW0 2ED7A 5F72S 4XWGL 1MOEA 3LN4B 3GWJA 3X1BA 1LO4L 1WC7A 5FYJL 1VACB 4MD4B 4OH2A 5FHBH 3D0LB 2ADFL 5DEJA 2EADA 1YJ9V 4K8RL 5F1NA 2UUBB 3EKCA 4PJFE 5MI0C 1GGIL 4PJAF 1BJ1H 2E75C 4YDJA 3X1FA 4GI8A 4DVRH 3ZTJH 2VRKA 3O6FD 5HD8D 5DUML 3WS6A 1A6WH 4MX7A 5SX5H 4PYHA 1Q94A 3MRCB 4GG6A 4W4LA 4N0YH 2XWDA 5F7WC 3H9HB 2G2RA 3EZ8A 4O2AA 2DYPA 4OB5L 1J87A 2XZCH 3O0RH 5J13C 4JTDB 3MXVL 3FB5A 3MRRA 3ZHNA 3ULVE 4NOBA 2BX5A 4MB1A 3UTTE 3VWKB 2NYYD 3EZJB 4KROB 5BZDB 5FGCE 2O1AA 4W6YB 1YEGL 5HI4C 1P7QA 2VAAB 4H8WH 3NZ8A 3C6SA 3SDAC 5I71C 1XCQB 1YEKL 2D7PA 2Z92A 4A6YH 1U8OA 3OSKA 1MLBA 1VENA 2D7MA 4LLUB 5DVPA 3T6XA 2ZNIA 2OMBA 3N9GL 3VQ2C 4AGQA 5CCKL 2DWTA 2Y0SA 3EJZD 3JVFC 4GRWB 4PJ5B 3MLVH 1JGVH 4P0DA 1FGVH 3OMIB 5I1EL 1U3HA 1GMEA 4AJ0A 2FWSA 1N4CA 1RFDH 5H35B 2GJ6B 1IAIM 4W9LC 2QKSA 2RR3A 4X66B 4N85A 8CGTA 4UTBA 4MJ4A 4UVCA 2BK8A 3V6OA 3QI9B 4XTRD 1NMCB 2B20A 3SKMB 4XCEA 4UOZA 4YE0A 4R6UA 1TMQA 1JYXA 1AGDA 1IQDA 4I0KA 5I18L 4UYQA 2G5BA 3AWGA 5DA4A 2CHZA 1IM9B 4X5XB 4Y2OB 3MFGB 4BFEA 1E27A 5MI0B 2P1YA 5EBWC 1KCBA 3IXAB 1NBZA 3VFWA 1DVFD 2SEBB 4OUOA 5AZEL 3LY6A 5CB4B 1DUYA 1CFSB 2WKGA 4TUKH 1ZAUA 4AENA 3GIVA 2OMVA 4QYOB 5C0CE 2WQAA 3ULUD 4RMQA 4LE8A 1M1XB 5A2KH 4Y4KC 4LP8A 1UG9A 5D93B 1IVSA 1PNDA 1CU4L 3SGDI 4LBEB 2Z3YA 2YI8A 2WB1A 1EN4A 1ORSA 2COVD 5JDSB 3T2LA 3CNKA 4J27A 3DROB 4P3DA 5D5MA 4WJG3 4EUPB 1UTDA 1G6RH 1B4LA 3P3TA 3KHQA 3M46A 2D31B 1BYOA 4OCYL 5DD1H 2UUAO 5EN2B 1DQLL 2DQFB 3WFBL 5D1ZB 5IVXF 4NBZB 3KPLA 3Q5YA 3KLSA 1S7VA 5IGXH 1XGRB 4HS3B 2C3WA 2AHIA 1L9TA 4OZFG 4B9KC 7CGTA 2VUOA 1AZCA 2DLEA 5CLTA 2EP6A 3HAEA 3FD9A 4L4TA 2GSGA 1OJHA 4DN4H 1RKRA 1JPGB 4UQEA 5KVEL 4JAVA 3E8HA 2BOCB 2ZAIA 1ZLVH 4R0LB 4O5LH 2VRAA 2ZX7A 5HGDA 4GAJH 3FSZA 1EVTC 4LCWE 3STZA 1R3JA 2I69A 3QDAA 2A06H 4UT9A 2FK9A 4MRCA 3ZEDA 5HVWA 5JHLA 3QJHA 4K0OA 5TPWL 3E22A 4QJ3B 1MEXL 1T1ZB 3KW7A 3MBED 4X6BA 5ALCH 1A7OL 1DYZA 2AJSL 4XB3A 5F1OB 4L4VA 1TJHL 4TTDD 2C9RA 3QARA 4PGCA 1MIMH 3IMBA 3FFCE 4I4TB 2EKJA 5J1SC 5HYQB 4ESKA 3OGCA 5FHAL 4ZIBA 4Y1AE 2GUZB 1P7QB 2A1WL 1DEEB 4UV4H 4AIOA 2ZNWA 4KXZI 4ZJ9A 4GUNA 2G2NA 3HUJF 4P4RB 3DHPA 1R5WB 5EO9B 4M7LT 2GI7A 3MRQA 3FQUA 2K8QA 4P23A 3DX8B 2N4IA 5HVHB 3OKNB 2PCFA 4JY6B 2AQ2A 1I9JH 3UMNA 5IBTL 4AYFA 5I16A 4X9GA 5C0AA 1PKOA 3WJMA 2FBRA 2BS8A 5BS0B 3DMMA 1QLEL 1UZGA 2OSXA 1XL4A 5J6GA 1SYVB 3ZGHA 3L6FB 1DE4A 4HCIA 4M6NH 2NR6C 4PG9A 5DZ9A 2XV2A 1Y0LB 5BS0E 1XSOA 3SJCC 4PJXA 1E6JL 3SJVA 1WAAE 2WWWA 2I85A 1IE4A 3QFJB 3UC2A 5FC9A 1JZIA 2XY2A 3L16A 3LZFH 4MD4A 4YHMH 3LDCA 1UXMA 2Z3FA 4OF8A 1ACXA 3GKWL 4BH7B 4BKLB 4U6HB 4X20A 3FUFA 4XVJL 4S0HA 5AZ2H 4HSQA 2C3VA 2VLME 1M2VA 4P3CH 5GW7A 1EWHA 1I8MB 5CJXC 1FRGL 2FT6A 4XCCH 4X1KA 1I8LC 1I1FB 4AQ1B 1R34A 2UUDH 2Y36H 4IOFC 2DTMH 4C4UA 5J8OA 1P49A 1BQHG 4FJCC 4LO9A 1P5UC 1SJEB 2VLLB 2HAZA 3WJMB 2FYYB 3WB2A 3CFCL 4PJ9C 4A2FA 4HOMA 3MOBL 4ZUTB 3NJFA 1BX2B 2JJTC 4GW4A 3RWCA 2X1PA 3DIFB 3KLQA 1HEZA 3LQAH 2BCKA 3L95A 1V5JA 1J8HE 4LK4A 3QWRD 3I5DA 5E2WL 3BH8A 3KYOA 3FT2B 3G80A 4P5TC 1JD9A 2VABA 4NXNO 3GJFA 4JYCA 4XP9H 1EFXD 1CDCA 1NMCC 4PRPD 3DO7A 2R1YA 4F58L 3DDFA 2W0FC 4P2RE 2GTQA 2Q8AL 3PGFH 3DHUA 3QR0A 1NR7A 2DL2A 4JHVA 5EBGA 4D94A 1HAWA 2HX8A 1T1ZA 4E0RB 2B1GA 4KV5E 3KPQA 4XP6L 1R75A 1UVQA 3DX2A 1MVUB 3RWGA 2VQ1A 3IAGC 3DXRA 1KB3A 1AXTH 2WOYA 2W0XA 4RDQG 1CF1A 4FQJL 4FLVA 4AMKH 3IBEA 3FJTA 4Z76A 4GXUN 4BFNA 1HC1A 1JZ7A 2Z7WA 3AUVA 3MV8A 3MCYA 2BWQA 4FFWD 5F3HA 4U6TA 3VFOB 4HJGA 1KB5H 3GMOA 2Q0OC 2VDMH 1Q0YH 1D5IL 5I28A 2FZ3B 3NJIA 4ODHL 4HHAA 4W9HC 2CJ3A 3HNTL 3QEHA 2BSKB 1T89C 4DW2L 4FM1A 4KNSA 2MNUA 1TETH 4X8JA 4OLVL 3SPCA 4NO3B 2IDCA 3ILEA 4BELD 3RJOA 5I17A 2E47A 3DX9B 3TBYB 3D4GA 2Z4QB 1T1WB 3HG3A 1BMWA 4KY2A 3T1FA 2R2EB 5EBLA 1EZVY 5JW3H 2XY1A 1DK1A 3CMEV 5IYDO 2V4LA 2WLJA 5E99L 3S3CB 4Z0XA 2NY3D 4DGIL 5FB8B 4DV1B 1AIFA 1U92A 4UQ9A 5B1CA 2HG0A 4QYOA 4KITB 1IEBA 2QEXV 2RHEA 1VIBA 1EQWA 1BZ8A 3FN9A 2IGLA 2HLDG 5C2BL 4ONGL 1SNRA 4TLTA 1Q9KB 5F7MC 4HZAA 1L5GB 3GBEA 3VE0A 2ZP8A 3JXAA 4ISVA 3T3MF 3UGXA 2IDQA 1VFBB 1E5CA 2Q7EA 5LKNA 1WD9A 5GRJL 3B2DC 1JRHI 3J07A 4LEBA 1X4YA 3EJQA 1FHNA 5BO1H 3U7YL 4L0ZA 1M6OB 4I0PB 5F6HJ 4AYEC 2XACC 1FVCA 1NBVL 4XHJD 3BH8B 2NTFA 3FU7A 1ZLDA 4DR6B 2F1MA 2YAOA 4XVSL 2DTSA 1TTAA 4HU8A 2LGWA 4PGDB 4DV2B 1QFWI 2GTAA 4X1KB 4JI1O 1O7DE 1OSPL 3QORA 4GMSL 4KTDH 4MD0A 4AQ1A 4N90D 1GOHA 1OAYH 1TJMA 5EMYA 5AVUB 4OGZA 3GTTA 5ABZA 3IDMA 4P2CG 2KLRA 4NQXA 3UOAB 3WFVA 4HK0A 1O6SA 2XRAL 3VFSB 1UXSA 1A8ZA 3N1MC 1C5BH 3TZVA 3D09A 1R73A 3B9VA 3LNIA 5E6RB 3IETB 5AVRB 1GZPB 3DJZA 3QJQB 2VXUL 1KUMA 1BGYH 4L8SA 4ELME 4XMTA 1J0JA 4UQ3B 3OAAG 1SUJA 2NX5B 4AKPA 4JHWL 2AK4E 3QZWB 2B0SH 1ZT1B 3PL6A 3F12A 2XJKA 4HETA 2APVA 2ATAA 1GRJA 4AYSA 3HZKB 4P23D 1KFAH 3AWEA 4BE5A 1T2JA 4JZJB 1RZ7L 1ZLWH 2X9WA 4LVOC 2PP7A 4F7TB 2OJZL 4IL6Z 1E5AA 3U1SL 2MOGA 3LH9A 2QWOB 4YZFF 1ZTXL 4L1LA 4B53A 4OLZL 4RH4A 4EPSA 1Y18B 5CR8A 3GS7A 1SOKA 1S78D 4XXDA 5L0QC 1MH5A 3KWXA 4OM1H 1KLGA 2QL1A 1OP3H 3CC7V 3C6LC 4KNUA 2Y07L 1BXVA 3O6FB 2MQGA 2X41A 5CWSB 1KB5A 4J7KA 3T6ZA 3V8OA 2EXWD 3AITA 2VDPL 3AXIA 1BAFH 2ITDA 2CE6A 1X5IA 5ISZB 2IALB 3ZRWA 4KO9A 1TVKB 2BZDA 4QRQA 2ZNXA 4D7SA 3NH7H 4Y9CA 4YDNA 4EDWL 1OANA 2WSPA 3S37H 5T5FA 1MPAH 3Q9QA 1G7LA 1NUNB 5TQ0H 4HMCA 2EVFA 2AEWA 4PB9L 1THZA 1MABG 1L8DA 2CIIB 3I6LD 2E7CA 4B9PA 3HAEB 4TUYB 4R7LA 3LKSA 3TBBA 1MQKL 4LCUC 1QWUA 5D6CB 3FT1A 2GJPA 4JAMA 1Q4NX 2CO2A 2PR9A 4R26L 2A4EA 3LDBB 5IJCC 1MKFA 1DVFC 1XV8A 5C0AD 2FD6L 1UATA 4U6VH 3T4YA 2W38A 5D9SA 2VLRB 2AV1B 3Q9PA 5A2AA 4J3OD 1T04A 2VTFA 3BUIA 3FK3A 4L8DB 4XODA 4JANB 3T8VA 2KSDA 3D3IA 5FM5O 4GX0A 4ETQA 5DR5H 1D6VL 3BY6A 4F9LC 4RQEA 2IPUG 1S3KH 5FPOA 3JSLA 1I8KB 4H1LH 5E4EB 2R15A 1XTMA 4B9CA 1KIUB 4LF7B 4MA7L 1HCFX 4ODUB 4GUCA 3H54A 3QJVB 5F7UA 4LVNC 3MC0A 5E1HB 5EWIL 1RIVH 4FFYH 5KG9A 4QHUA 4U1MB 4JKMA 4B7EA 4OCXL 4F15B 4RIRB 4P3DB 4I0PA 1TQCB 2A3QA 5C71A 4G8FA 1I08A 1L9PA 1YPZF 4M5ZH 3CVBA 4WW2B 2LP7A 3BAIA 3RTQC 4DHLA 2ILLA 5DQJA 1UA6L 4W9EC 5AENA 3DETD 1VPOL 4HWBL 4KJPD 1KULA 3US1A 1E4HA 2QQNH 4JFUA 1MVFA 3V4LA 1AQDB 5ILTH 3WUZA 5JJEB 1ETJA 1GW0A 4GPVA 1FYHB 4YXLH 3WXWH 1BA9A 4O4YH 1N70A 1KXTA 5HGAB 1VADA 3EJYD 3OG4B 2B08A 5T1KB 5BJTB 5BRZD 1TJIL 3W37A 4RX4D 3X2QC 15C8L 1B0GB 3B2XA 5K59F 1JHTB 5DUBA 5T5NF 5EYPA 3NFNA 2OTUA 5EDSA 4GIOA 1LP9A 4NO0B 1RZIA 2A74A 4MS8C 4OZFH 4PJ5A 4EXPX 1A7NL 2QBWA 3CC4V 1S7XA 2DQDH 3NCBB 4ODVH 3RGHA 4ZNEE 5J2UB 4QHNA 5SX5K 3T1WA 2X6BA 3BJ91 5I17B 1NS1A 3I02A 5CBFA 1FYTD 4C4KT 3JAWA 1NCHA 1C8QA 1FZMA 1Z5LB 3L54A 2X42A 3SDDC 2UWEA 3MSPA 3UTSE 1V3MA 5EBLC 3BLKA 5D5QA 2FJFB 3PCYA 1JGIA 1YSCA 4PWIA 3F6LA 3WLBB 2FR4B 2FEDD 2DQMA 1CYWA 3B5HA 1UACH 3BW9A 1B4TA 1U9KA 3DDGA 3L17A 3D0VA 2YXLA 5CN0A 3L73H 4M93B 4PA3A 3MZTA 3T2MA 4OX9O 3O3AA 3DURB 4W6WB 3WB1A 1BLNA 2GJZA 2GY7B 4NM8L 4OZ4A 3KWVA 2Z31A 1LO5B 5LMNB 4PTTA 4LPXA 3DIDA 2VAJA 4KRMB 4Z3TA 4ODVL 1A7NH 3ARGC 1W72H 2IPKB 5BV7H 3D3VB 5D8JH 3E8BA 2I07B 3LKQB 3T3PF 2V5TA 5CZXD 4MCZB 5KYXA 3LN4A 4Y2DA 4PGZA 1TJIH 1NIDA 3LYRA 4LXFA 4GIPD 4NZRH 3BFWA 5JZ7D 5E5LA 4YXLL 3S5LB 1PD1A 4LF6O 2O5ZH 1P1VA 2VDOH 4GOSA 3LSSA 4PA9A 1ML0A 4J8RB 5HDQL 3KVQA 3D7PA 1JA8A 2DB8A 1PLCA 4NO2A 4HWBH 1RZ8B 4L37A 2YFNA 1H8NA 5JPNA 5FDYA 1A1NB 2BP0B 3AVEA 4FKKA 5F0LB 3A0RA 3S37X 2A3TA 3TU6A 4B97A 4D2NA 4F1SA 2MKLC 2NNRA 4OCXH 4MZRA 4MMYA 4QXGH 4FFYL 1XBDA 4JRFA 4UINL 3TCLB 3DX7A 3WKPA 1LWJA 1HSBB 3O3DB 3GMPB 3RX9A 4R7VA 5ESVB 1J8HB 3OKLB 4ANUA 5HJGA 3O6FA 1E5BA 1S3KL 4HBQA 5F9WC 1QRNB 1D6VH 3WN5B 4R2GB 4Z7NE 4BSWB 5A16B 5K1XA 2QM8A 2GJ6D 2PXYA 1OHZA 1N33O 2AQTA 3P73A 2V9QA 2VOTA 4U6VL 2FD6H 1BS3A 1KBPA 2EE6A 3EH4B 4KAQH 4LLYA 5EOTA 4R26H 4PREB 4H0GA 5MEQB 3V0DA 3N50A 1O6VA 3ARVA 5EPMA 1F3JA 4HGMA 4JS7A 5JLZB 3OZLA 2VIRB 5KYUA 3RVWC 2VWJA 1X5KA 4EN3A 3B2PA 4NWUL 3ZJZA 3BAXA 5TQ0L 4UILH 1PTZA 1MPAL 3EGXB 2PPCA 2Z93B 3JD4A 2H26A 1FV1A 2HLAA 1W2BU 4MVSA 3ZKQD 5DJAB 4EDWH 3RVZA 1BAFL 4A2HA 5BOJA 5T3ZD 5L2JB 1L9RA 1F42A 2BSDA 1FG2A 4DUYB 1RP9A 1WA0X 4Q6YA 2FRGP 4I1PA 3IFXA 1VZIA 4OM1L 1BJ8A 3QUYB 3TASA 3BEVB 4NDMA 3KDMB 4ENEC 3L75H 2BIQA 3ZO9A 3J2PA 3K9AA 2FWOA 2F7QA 3BH9B 1LDSA 3B9AA 4MB3A 4OLZH 1OWRM 1YRKA 2OM5A 5JHDD 4QNPF 1AVMA 3U1SH 1ACYH 3MO1A 2OJZH 2FNWA 3O3BB 3UZEC 5C9JB 1G5GA 2ZSWA 1RZ7H 2AQSA 3O4LD 3BVXA 3S96B 1KFAL 3GB7B 3T0AA 1SQ2N 3EO9L 5DJAA 1ILUA 4PY8I 3QRLA 4ZT1A 1RZJH 1P5UB 4JHWH 3ZYJA 5IHWA 4M48H 4MHHI 3ZHFA 3F85A 3PREA 1U8NA 3QJRB 2O6FA 5C07B 1S77D 1HXYA 1DP0A 5ECGA 3FUHA 3CFBA 2XRAH 1MCBA 1IM3B 4GRMB 1HNWB 4HH9B 4PWEA 1ZANH 2FDBP 4IOSA 4MJ6B 3QXDB 3DC6A 3K5RA 3O45A 3CMOL 3V0EA 3I3DA 5IQ7L 4IGBC 5EH1A 3Q8BA 4R4BA 5BQ7B 2JKRM 3UMTA 3FO2B 4GMSH 4KTDL 3TM6A 3GJEA 2VWEE 3C08L 3N2KB 1AZRA 3BGMA 4Q89A 1N0XH 5IKCA 2UXXA 4DRXA 5JJNB 2XBTA 3C6LD 1NBVH 2Q9OA 3IGAB 3QCUH 4M61B 1A4JA 3M1OA 5T1MA 4LVHC 3VRIA 3MNWB 3S2AA 3U7YH 4GB9A 4EI0A 1PKQB 1Y7VA 4ANKA 4BXVA 1L4IA 4NQEE 3ES6A 3E83A 4JREB 5F3HB 5GTHZ 1O9HA 4Q9BA 3ZZLA 3F5WA 2PCXA 1II4E 1TT6A 5JZ7C 4ODBD 2VLRA 5J0BA 4A63A 3D05A 4ZSOA 2VXQA 5FYKD 4ZX5A 3UIZA 4HZ1A 5D4HA 4LOFA 3VJ6A 1QVGU 2H0JA 2X4OA 3H3KA 5KSBB 2E9IA 4DGIH 4BRVA 4RBPH 1GIGH 5JHDE 3BN9D 1F3RB 1RHHA 1CUOA 2A9ML 3QWQB 4OFPA 2YARA 5F7DA 5L2JA 1PP9H 2R59A 3A8TA 4A37A 2XQYG 4NO0D 5FGBA 3UAEA 1IC7H 1GZQA 3HE7B 4N6RB 5FIEA 4XB8A 3V6OC 3CVHA 1XCQA 3KW8A 1BBDH 4LPCA 4MNQB 4EO5A 5JMRA 3RU8H 2ZCLH 1M7IB 2UXBB 4MJ5A 3CCEV 3AK2A 12E8L 2BSSA 2ZE7A 3HR0A 1TETL 2RQ8A 3GLZA 2WVTA 3MRJB 4JX0A 4OLVH 5FKPB 4DW2H 1HH9A 5K1PA 3WY2A 4UQBA 4G2AA 3HNTH 3LNHA 5ISZE 3KM2A 4ODHH 1AHWA 4BRJA 1ZTXE 2XAFA 1D5IH 2APXA 1Q0YL 2VDML 5GS0C 2J2ZA 4PJGB 1J88A 1FUNA 2FO8A 2OBGA 1Z2KA 4GEJA 3RWJB 3X3FH 1ZPLA 1AP6A 1XCTB 2WTRA 2OPCA 2WWNA 3H1ZA 4YK4B 4QPJA 5D7KD 3TA3A 3VI4F 3FT3A 3DRQA 4FQQB 4JFEA 4UIMB 5C0IB 3BVTA 2XQBL 1AO7A 1AXTL 3HG2A 5D7EA 3U36B 3EJUA 2YRBA 2L7QA 3VGAC 3VXOB 4F2ME 1DDHB 1YHPA 4O4HB 3P11H 4G9DA 2VR6A 1KBKA 4ZQKA 4Z8FH 2ZUSA 2XBDA 5J9PB 1KJMB 3PGFL 5F96H 1XD1A 2E7BA 2Q0ZX 5FX3A 1S7WB 4Z7NB 1UURA 2LTQC 5EU4A 1K5NA 1L1FA 2K4WA 2YWZA 3SY0B 4MTGA 1TZHB 4JHZA 1M1SA 5T1LD 5E2WH 5KVDE 5IOKA 1Y6NR 5CEZD 3G4SV 2LT9A 4HEPA 5HJ3B 2VLRD 1LXMA 3D18A 4AYFB 2V2TB 1HDMA 2OR9H 3WYRA 4DNLA 4F9PA 2CO6B 3LQAL 2VW4A 2IXQB 3MV7B 3NDZE 1NC4A 4K94C 5FKPA 4ICGA 1IZKA 1QQDA 1K85A 5DK2B 1JPXA 4TL5A 2OJEB 2XQ0A 3VTMA 1DJSA 3HS0A 3ILDA 4OCMC 1JK9B 2DTML 3DTXA 5DC4B 1FNSL 2CH8A 1LJMA 5FFOA 5GS2H 3VXRB 1FRGH 2O6PA 3KBPA 4JY4A 5AVQB 3KPMA 3BFQG 4NKQB 5IQ9A 2O30A 2DYSC 4PV8A 1KLFA 1BVLB 1RHHB 1Y6XA 5SWSD 4LC1A 4FXLA 4YHML 4LEEA 5JORA 5AAPA 4I55B 1XF4A 4Y7MA 2W0FA 4K71B 4X2UA 1E6JH 1HI6A 5FA4A 5K93A 4ZW8A 3RDJA 4I89A 1ZS8B 3WJLA 1E9PB 2P5WE 4M6NL 5IMLB 5IOPA 1O7VA 3G71V 1SXSA 2R51A 4QPEA 3ASOC 1TEGA 1H8HG 3BAEH 3QFJE 4ZPVB 2D9CA 2EDDA 2NY1C 5KSAD 3G5VA 5DJ8A 2XT1B 3WY3A 1Z5WA 2LABA 4RA3A 4D7BA 1PNMA 4P3WA 4FNUA 4PJ6A 1EFXB 4PRPB 5F88B 1P7GA 4PYGA 4YHHB 1UXWA 3ARUA 1U8JA 3JV6A 4PJGE 2J1YA 1BF5A 4JI6O 3UPRA 2HP4A 3NIDB 4Z7VB 1AOHA 3P9WB 4ZMOA 4HIIB 4NBYB 1SUHA 3U0TA 1B9ZA 4JFSA 1A4CA 1DQJA 1RSFA 4HOXA 1LP9B 1TJHH 3KPQB 1Z9MA 2E59A 1W0WA 1A7OH 2NY0C 1NLBL 4L9LB 1C5CH 3AB0C 1AANA 2BXYA 4JPRA 3TJPA 2Q86B 5AAMA 4OZGE 5TF1L 2GCYA 4GAJL 2N7AA 1M7XA 1YO4A 4H5SA 2PTUA 3DO4A 1UJ3C 5JOEA 3T6QC 5LL6Y 5C6PB 3TNNA 4FTDA 4UQ2A 2GITA 3HUJA 5KVEH 2KT6A 3EAKA 1KLUA 2LFEA 1KCKA 2APFA 2XXMB 4PY8J 8FABA 5DCCA 2ZUWA 2RACA 4Y4HB 4EN3D 1ZKAA 4HJ1A 3QUXC 1YIJV 4D8PB 4NQUA 5I6XC 5IGXL 2CBPA 4LP4A 2R7EA 4NXKA 3E2HB 1NAMA 2VLLA 3OR7A 3SZKC 1A7RH 2PZSA 1GSMA 3ARBB 2EUWA 2XN9D 3Q6FB 4MXVF 4OCYH 5DD1L 2ZYHA 5CJBA 1MY7A 1G6RL 3QDJD 4DTGH 2PWEA 1AI5A 2YIDA 3T0BA 3V6ZA 2EO9A 3DARA 1XF2A 4P5KB 3MTXA 5K9KA 2WBWB 1ZAGA 4G80B 5ACLA 4JKLA 4K5PA 1QFHA 2BCCH 2Y0IA 1H6UA 4QGYA 3MROB 2IO5A 1NVPD 1U36A 4LCCB 4B5ZA 2XSKA 1ZGLM 3HPJB 5IFHL 4XN4A 4TUKL 1P4LB 1XGUA 5GZOA 5DHYA 1JZ3A 3II3A 3DV4B 4I2XE 1IURA 2WXPA 1U91A 43CAA 2MMXA 5ESQA 4G43B 2A6KA 2ZQMA 1K7DA 3ILPB 3OLEA 4DOHB 4FLWA 3K57A 3JBG7 4J1UB 4KROD 4LFHG 5CEXB 1UB5B 4LHUD 1UEMA 3NIDF 2WTRB 2R69A 5DZVA 1DLHB 5IMOA 4RNRB 5H94A 3KPOB 3SBWA 3CFJB 2QMKA 4QXUL 1S9WB 3HKCB 2PYLA 2IWGA 5IV2A 5B7FA 2XFGB 3K46A 1E4WH 1YVWA 1RFDL 3O2VH 1PIFA 3U9UA 1RM1C 1MHHB 4ISVB 2VDKB 4HG4J 5I1EH 1NFKA 2WAHA 1FGVL 2G75B 4B3RO 3IFLL 3MLVL 1H3GA 5F71A 2VR8A 2W6IG 5GZND 3CHRA 5MENE 1FP5A 3IKKA 1KCRH 3DX7B 5B38G 1YEKH 4H0HB 4HKZB 2ENSA 4F8LA 2QVIA 2MEJB 4CADA 1E2WA 3KPSD 2OSLB 5EZLA 2DMHA 4MMXC 2J56A 1A25A 3BDXA 3RNKB 3AZUA 3HOGA 2PF4E 3TH2T 4LFHD 3PAUA 3O0RL 4Y4FA 1XGRA 4N0RA 2XZCL 4OVVA 3DVGB 3GSNL 4KHXL 5EFIA 5HGHB 1SFDA 5FUOL 5MEPB 4ZSOB 4ZOLB 1M53A 3RIAF 1T6BX 1KT2B 1A6WL 4ZUWB 3ZE1B 1FF5A 2VZVA 5I1AB 3IETA 4ENZA 2W88A 3SOBL 3ZMNA 4DPCX 1SQQH 4XH2B 3FPXA 2UWEF 3MNZA 4CUCA 1H3WM 1PKQA 5JPNC 1BHGA 4K8RH 2DYRB 5DJYB 3JWNE 2ADFH 2ZUVA 5EBMB 4JQXA 1UENA 5FHBL 2DD8L 2EVIA 4X9FA 2QEJA 3GSXB 1MFCH 3GXMA 3CVCA 4P5TD 1AD9B 1QLNA 1TZOA 1E9PA 1U0QA 4K07A 3SDAA 1BE3H 1CFSA 1N2RA 3CPWU 1UH4A 2YN5A 3DX1A 4B9JA 1R24B 3AS1A 3BD5A 3AXHA 5E24E 2MCPL 4YZWA 1K72A 4HS8H 1SC5B 5T33H 4GLXA 3L1OH 4QKXB 2V1DA 3WTUA 1UZ6F 4MQXD 1HXYB 1S7RA 4EZKA 5AD0A 3A3YB 5FNVB 3ESVF 2PWHA 1C1EH 1EGJH 4PRIE 4Z0BH 1DQVA 4L4TD 1AXSA 2JH2A 1GGUA 4U1HA 3BFRA 1JVKA 2OCCB 1XSKA 3QEQD 4FADA 3HC2A 4RBPK 3OKEB 3LPOA 3VXUB 4NN5C 4NZUL 1U30A 1MLCB 1ZEAH 3JALB 1VCBC 3LS4H 4JG1L 3OKYA 1GS8A 4PB0H 2NLJB 4YXKH 4BDVB 4DK5A 2MPVA 4ZUTA 3H4HA 3OX8B 4M5YL 2ISDA 5C0EA 1YMMA 3KHOA 3KVPA 1H19A 3PWUB 5IEKB 1Z2GA 5KSBE 1TYJA 4Z7VA 1WBYA 2YKLL 3NSFA 5TE6L 2VAAA 3TBTA 5JXAL 2OSYA 4LPVA 5CBEB 2APBA 3ABUA 4XNDA 5F7EH 4WIQA 5EULV 2OW6A 4PGEA 2PW1A 4MVRA 2DN9A 4PG2C 4HCRL 1R24A 1MOFA 4PSPA 4XT1C 4A67A 1YDPA 2YBRB 4JO2H 4ZAKB 3N27A 2ITDC 3ZMUA 1QZNA 4HAMA 1KEML 2W0PA 4HHGA 5A6MA 5I1HL 4KK5D 4UT7H 2PWGA 3D6GA 3TURA 1A14L 3PWPA 2GHYA 4OD2B 4TSBH 1KBGH 3F84A 2GEEA 5FF6A 3QFJD 1IVTA 3EFOA 1S9KC 4G83A 3HNVL 1DTUA 3AWFA 2WKOA 3NABL 3KYKL 3TIDB 3RI5F 1JXFA 3SCMA 3EYQC 4UAHA 5D4IA 3OKLA 3HW7A 4PV1B 5E9DD 4N4YB 4ZOAA 5DJXA 3X11A 2P24A 3CDYA 4XNQA 4JGJA 5DURB 1S7UA 2WAQA 4L8DA 1NAML 2DIAA 1X5LA 2JCCF 2IH1A 1AQKH 4O4IA 1MFAL 1T4KB 5KTEL 2QWRB 2MKWA 1PZBA 4WEUD 3D0LA 5FLXN 3EYQD 3LN5A 2K9UA 2YEZB 4ZI8A 3KKYA 4EVNA 2HHHB 1T21A 4AXWA 2NUPB 1B6DA 3HZ3A 1P53A 2FX9H 5I1KL 3JZYA 1A7QL 1PMYA 3K4AA 1ORQC 2UXDO 1JV5A 2C1PA 4U1SA 1IGTA 1XB3A 4OUUA 5A6LA 1P6WA 3W7UA 3V6FB 4NKDA 1G7IB 3QHZL 4B9ZA 4LARL 5JW4R 5IIEB 4LL1A 3VSUA 1J5OH 1HHJA 2KPNA 1LK2B 4Y9EA 2WYTA 4JFFB 3E3QC 3V0WH 1M57C 4O4HA 4FLSA 4G9DB 4G7QB 1KYAA 1AR1C 4Y4KD 4GKZA 3Q43A 4JDTH 3WL9B 4P9PA 3WNJA 3H8NA 2GSIB 4MXQC 3BZEA 2ADYA 3MRHA 3GMRA 4WW2C 3DRQB 5C0IA 3NP3A 1JI2A 4HXBL 4RNRA 5CA0B 1JGLL 2DQEH 4IDLA 5H94B 4A2LA 2JKJA 3BAJA 1CCZA 4YHNA 1K4DC 3E9UA 4UMGA 2H9GB 2XN9A 2M1KA 3RPIB 1WITA 2YPLA 1JNJA 2DM2A 1XZ0B 3F7YC 4Y9FA 4Y5VB 4KHPO 1E4JA 5DFVD 4L1DA 3B6SA 1QSVA 3I2CH 1R33A 4LKCB 4FZ8H 1WB7A 3NAAL 2B1HL 1SVBA 4KY1L 4OCSH 4Z3GA 2DQTH 2WQSA 4YK4C 3BRFA 4KHTH 1FZKA 2I9LA 1RY7B 3UBXB 1L6PA 1RZIB 2A74B 4AIXA 1U41A 3ARDC 5LG1A 1JERA 4X6BB 4FG0A 1I7RB 4JZGA 4N26A 1EEUA 1FKAO 2VH5L 1TGOA 3MJGX 2YD5A 3FQTB 3WFCH 4BSJA 3EJRA 4HD5A 3BPNC 2CNZA 2GT9A 4P2QE 2OT5A 1YUHB 3LNDA 3VW3L 2GUOB 4P4KC 1LTXA 1A6UH 2GBTA 1WZLA 2R0WL 3TO4C 4I50B 3US9A 4NAJA 1IBBA 1OKEA 2J1WA 2V9TA 5ALBH 4F80A 3EF7A 1BEYL 1GOGA 4IRZH 4MDJA 3VXMA 4UVBA 2ZCZA 1UKSA 5DJ6B 4DERA 1HYSD 3PGCA 2YQBA 3H9SE 4QO1B 1FDLH 2QKCA 1EXGA 2VKWA 4U1GB 5CMUA 3T2NH 4QIRA 5DO2D 4FNPA 1A7BA 1WTGT 1SYSA 2PP8A 4KKLD 1U8OB 4NHUB 2R8SL 2X44D 3F6IA 2BS9A 3NJNA 4NNYB 2Q68A 2XA8L 1EAPA 2CO4A 2HRLA 2PGGA 3ZW3A 1RJLB 5EN2A 5D96C 5FLUA 4FAAB 3QIUA 4OFDA 3MV8D 4YIOA 5BV7C 4EEEA 4FLHA 5DWUH 2ZCHL 4MVBC 4JQXC 3F3HA 1BVOA 2YEQA 4K8XA 3A0BZ 1EZUA 3VQMA 2IU3A 4JI5O 1RK1B 1OF0A 3Q8CA 4G8EA 3KM1A 4I48B 4B3SB 3S2CA 5I5RA 2ESVA 2YRZA 2IAMB 2JI1A 2XFXA 2X12A 3GHPA 3JCUZ 3F00A 2BHFA 3HVNA 2VS0A 1QO3A 3KCPB 3IMWA 2FUQA 5I75C 4U1IA 4XR8C 3U0TB 5KHIA 1FL6A 2P8MB 1T0NB 4HLEA 4A2GA 5LVEA 4E36A 3ISRA 2ATKC 3B2UD 4PBDA 1QACA 3P0YH 4YIQA 1GYAA 1E5YA 1Q9OA 4I4WB 1UWEL 3GKZA 4D3CL 2F54E 3G04A 2R69H 1U3JA 3NQIA 3S96A 3KS0J 2EC9U 4Z7WE 3G6JA 3MQIA 1F8TL 2WINB 3DX0A 4Y1TA 4NR1A 3FO1A 4FS0A 4FFBA 1G1OA 2Q3ZA 3BIAX 4K5NA 1DN2A 1CLYH 1AH1A 4P04A 1N7MH 4DYLA 2X7LA 2Y06L 4QGPA 2C1PB 4NSKA 5FXCH 3ME0A 3ETQA 2FQEA 2R29L 3ASNC 3OLGA 4TF4A 1UB6A 3E1ZA 2DLIA 3NBNA 1IEAA 2DQCH 4YHKH 2EYSB 5TE4L 4K9EL 3B1UA 4PLKC 5CD3B 2DI7A 3B9KD 1WK0A 2VM9A 4XAWL 1DQMH 2VN7A 3HKCA 3FT9A 1TYRA 5F9OL 1DBJH 5I0YA 4MMXA 2EEFA 2H26B 2HLAB 1Z9NA 1NFDF 4PWFA 4QRTB 3D2UD 3SJVD 4RMVA 4RMWA 3VUAA 2UUCO 2F54D 4MCZA 1GVIA 2VIRA 2WANA 4LGSB 5KYUB 1MJ7L 1AKJA 3TIDA 1YNTF 1MH5B 1NR1A 2XOKG 4B0MB 3DLQR 4O02H 3HZKA 2AEOA 3KE0A 1BMZA 2PNDA 5J9PC 3KPOA 3N6YA 2J21A 4ZKIA 3QGVA 3TXQA 4FN0A 5HYSG 1BPVA 3P54A 1NIFA 1CLZH 4PJCE 3IVKB 3ROOB 1DVUA 3MV01 1W0VA 4CKQA 5DVOA 1MHEA 3OFNG 4JRXA 1N5AB 4I0XA 3EYFA 3HZVB 3QXAA 5I1IL 1FC1A 2YA2A 3ZTJG 3D69B 3PQYB 4FCHA 1JZ6A 1H3PH 2FYUH 3D87B 1QLEC 5DJ0A 3VBBA 5I8OH 2CJTA 3QG6A 3WJJC 4PJ9A 3QNZB 5E5RB 3V5KA 4AM0Q 1U21A 1K5WA 4GX1A 3QULA 3QDME 1E28B 3ALWA 5HHVH 3HKBA 2OTWB 1IC1A 3ZIMA 2NX5E 5T3ZL 3TPKA 5DSCB 4TSCH 4N8PA 3T1YO 2R7EB 3WN5C 4MBRA 3HVDA 1ZSPA 4WZ9A 1PNCA 1MCKA 2VDLB 1J1XH 1M3JA 2G9KA 1I1AC 2VSDA 4FQ1L 5EF0A 1W0JG 1YC8A 5JHBA 3QUXB 3FNKA 2D9QB 3FXIC 5IJKA 3TJHD 3AQYA 1A9BA 2WZPA 3SE4C 3FTXA 5GRVK 3H2WA 2E86A 4FXTA 5D1XB 25C8H 4Z78A 2NLJC 2CZNA 2E7LC 1IC0A 2J43A 4N5ED 3Q8FA 4W9IC 3SHSA 5J1AB 2ZOLB 2GY5A 2WWMD 1MWAL 5LHGA 2VITB 3QNFA 4P5TB 2AZAA 1NOLA 2W0KA 3BEWB 3DPBB 2B3IA 3HEIB 4FTVB 4NO5B 3D52A 2E76B 4NXNB 1X9QA 4LLQB 4FJYA 4WW2A 3O2WL 5F21B 3SZ6A 5I19H 1N6VA 1O7DC 5KYNA 4KJQC 4G2KA 2DWDC 3RUGA 2QA4V 4D9LL 1BF2A 5MHSE 1T1WA 4JGUA 1YJNV 1VSCA 1A6AA 3OAUH 2EIJB 3RI5K 1RIUL 1EEZA 4FA8A 1SLWA 1XGPA 3MR9A 1HE8A 3HI5H 1TQVA 1KBHA 1FPOA 1WZAA 2MQCA 4PJFA 3CX2A 3CE1A 1N59B 2AXFB 4ZW3A 4LNUA 4XMUA 2WN2A 1VF5B 1DQJB 2ZSVB 3V55A 2GAZB 1QOKA 1KCUL 3Q05A 4N22A 5EOQL 4DP2X 4QGTA 4U3SB 3OL2A 3QORC 3CXDH 4I18C 1MFEL 3O4LA 43C9B 5EU5A 4NWTL 4UWQB 3R66A 1DQIA 3N40F 4XVOA 4W9GC 5FYKH 1QWNA 2X10A 4HX1B 1HZHL 1GY1A 3T0DA 2VYRE 4LSVL 5JOPE 3GTNA 4TULL 4I9WA 2DQJL 1JFQL 4GQPH 1BWWA 3EYOA 2ALAA 4PDMA 5FS5A 2FECI 4I0CC 1F6AB 3BP4B 1JBJA 1WWBX 3P30A 2OL3B 2ZXQA 1FAKT 5EU7C 2W0FB 3KZIZ 4G8GB 2QTEA 4GSQA 4HV8A 1YAIA 3UJIL 2JXMB 4G8GD 1JI1A 1VEMA 3D34A 4GQRA 3HZMA 1NGPL 4KXCA 3QCTL 1H0DA 4ZPTB 4PBXA 1JNLH 4FYTA 2QSQA 3T4AC 4UAOB 3FBQA 3CC5B 4NQVB 4FZ1A 3OC5A 3ZDYB 1CFBA 3VFPB 3MUHL 5K1JA 4YC2C 2DYPD 2H4EA 3NACH 3DSQA 3R4DA 5D1XA 1XWVA 4Z78B 3FSAA 3CUPA 3LQAC 2H1PH 1FO0B 4JB9H 1D5MB 2X0LA 5KANI 4X1YB 2DWSA 1LQBC 3ML9A 1J9CT 2JCCE 2CO6A 3MV7A 4PRIB 2WVUA 4ZQKB 1E2ZA 3QDHA 5L9DL 1U3HB 3QG7H 4PRID 5DLLA 4UF7C 1MCCA 5DMKB 3UZEA 4JY5H 3L1GA 2CKBL 1W8NA 2FB4H 1QQCA 3PY9A 1EXHA 1BZDA 4UCUA 1NZRA 1J9RA 1F4XH 4IRJC 2IANA 1GTFA 3N40P 1RQ5A 2XQYA 2NX5D 2ZWNA 4JPQA 2XNAA 2QTOA 5KS9A 1OCCC 2YXHA 1UCBL 3C5ZB 5CJQH 4HP5A 3TO4D 2E4FA 2VLKA 2ZT9C 3LD8C 5JH7A 1Q5OA 4KTEL 4WFEE 3UJTH 5DUPH 3I9AA 2HMIC 2ID5A 3J7AU 2F61A 4ES8A 5K9KB 4DWHA 4JFOA 4F6RB 2DYRC 4AM0A 2P67A 1KN2H 3QA3A 1NBYA 4U6YA 1VERA 1WP8A 4N2HA 3OJDB 2P8LB 5E8EB 4NPYB 1GA2A 3R4RA 4PGDA 3DSNA 4RRPA 5BOZG 5CAYB 4FRWA 2V0AA 1F5WA 2BSSB 1YSOA 2PYFB 3RVVD 1IJ9A 4Y4KB 5BMFH 1CL7I 3QO0B 5T3XE 2IPTH 4JVUA 4RZCB 3MRHB 1I3UA 4BE6A 5EF1A 1I4FA 3TBSB 1CL7H 1QTPA 3P9MA 1HDJA 2XDHA 2BWDA 4MXWL 4EQ2A 3LEYL 5BXZA 2VDNL 3AREC 5GGTL 4AVIA 5HXMA 3LMJL 5IR1A 3L3KA 5C09E 3U1PA 1SVZA 5TE7H 3ETDA 1IQWL 3FQXB 1JHLL 1U33A 4QRRB 2JQAA 1IBKO 3I6LE 4OQ1A 3S5ZA 3KWTA 3RZWA 5HYJB 3RBSA 4ZFZB 2WV3A 3NIFB 4YIPA 2NY6B 3QUKA 1CFNB 1EUTA 2F54B 3OM3B 4W4OA 1G5AA 1S7QB 4FFWC 4GINA 1TU2A 3WEXA 4OLUH 4F33B 3H0TA 2OZNA 3WELA 5E0QA 2AJUL 2Q4PA 3STLC 3QZWA 4JNXA 3FSWA 4DR7B 3LRGA 5FO8B 3MZGB 2CHXA 5ICYB 1WISA 3TF7C 2BSKA 5T1DL 3BSZL 2OMUB 4MNGE 4XVTL 1W8OA 3G6JB 5D7IB 5AWNL 3TA3C 2Z91A 2YKKA 1Q3EA 1PQZB 3IGAA 4YDLB 3ZYZA 4XMPL 1OGPA 1XH3B 3UJJL 3P3NA 5E4OA 4S1DD 1HNGA 1UFGA 1ACCA 4NUJB 1T2QL 3AG4C 4WKZA 3KLAB 2ICWB 1R0AH 2YLKA 2XFXB 1DVYA 5BXFA 1AROP 1HNZB 3PAYA 1IC4L 3D0VB 3NSDA 4PS4H 4Q6IA 1TITA 4HK3J 4GAYA 4KBPA 4QKTA 2YPVL 4QRPD 4HEMA 2X38A 3BWUC 4A7GF 5D1QD 2XNDG 1Q9KA 4HCGA 4GQZA 2OXHB 1XXFC 2CGRH 2X53A 1AYOA 4DZ8A 1P4IL 2BVOA 4JM2B 2AJYH 4OFKA 4F7CA 3BSZA 1MCIA 4O4LB 4X7DC 3HBPA 5BRZB 2V9UA 3W0WE 4J41A 1WZKA 3ETGA 2WSKA 5IB3A 5I0VA 1WBXA 1DBBL 1JHTA 5DUBB 2GC7C 5JQ6L 1QTYT 1F6FB 3BLPX 5INDB 3IMRA 3DYMA 3GSNB 4NKIL 4XBEL 2B4CH 1YJWV 1F23A 1FVEB 4IW4C 2VXTL 2GBVA 2Z8WC 2ODIA 3UCSC 1CGVA 1OOWA 3SKOA 2CKBB 1YHQV 4GXUM 2XWEA 2VZUA 1F3DH 1I9IL 5J9PA 2X1QA 3ZRFC 1FXHA 3ULVL 1HL5A 1QBML 4A7VA 2P8PB 3S3DB 5EPMB 1JVMA 4PV9A 2YC0A 4F7TA 3TT3L 3NIGF 3NZ8B 5FLVA 5C7XL 4M62H 2LE9A 2P3YA 4HG4K 2ZIOA 5EZYA 4NTWA 4DEUA 5IHBA 3WIHH 4B08A 3DSNB 1Y74A 3OQ3B 4ZBJA 4KRPD 3TPUB 1DJYA 3CPLA 3UFIA 2W9DH 4OF5A 2JJVA 1SM3L 1F4NA 5M7QA 1OL0A 2GTWA 3D06A 3MJ6A 2FJHB 2V3DA 1UM4L 2P44B 4L29B 3NESA 5IF0B 2Z35A 3LHPH 3OTTA 1VQ6V 2X70B 5E5UB 1MCSA 4G7VL 5C1MB 4DT2A 2XNAB 3GJFB 4MMYB 4UDTA 4MNQA 3GMRB 3TCLA 3CU1A 3HA0A 2NYKA 1INDL 3PUUA 4ICWA 1J1OL 4GT0A 3PGDA 2A6DB 1KDJA 3NTCH 1HHKB 4J3OH 4KTGA 5JHLH 3T5WA 3AQXA 4BK5C 2JGDA 2VDKH 4ABUA 3NOIA 1H6FA 1CK0L 3CHQA 4O58H 1Z32X 1QLRA 4RQQB 5BW7C 3K2MC 3P0VH 2BTQB 2R4SH 3Q5OA 5CEYA 1A0QL 2DWEC 3BZ4A 4QRUB 3VNYA 3W2DL 3FYIB 1JK8B 4PCSA 4XGZB 4NFBA 4Z7UE 5B1JC 2UXCO 3T1HO 2VMDA 2VR9A 5F7NC 1G9NL 2NZ9C 3FHAA 2YOAA 4TVPL 3TEXA 2FIRT 2FJGB 2DRUA 3GSOB 4DFHA 3B40A 3RAJL 1RK0A 1OD9A 3K8KA 4X62B 4MHHG 4M56A 4YDKL 3QZOA 3ZT6A 2ZCKH 4OIIL 3D2UA 4GMTH 4UTCA 3M8OL 3S8WA 4MVZA 1YPZB 4XMLH 5DFWH 4LHUG 4KI5D 3L9RA 2HH0H 3M1BB 3VWJD 1S2EA 1E3ZA 3BGMB 1OCZC 3PXJA 5B4MC 4DOHE 2QQKH 3RL2B 3CXHK 1TTFA 1XMQO 5H6RA 4I18B 5AAWA 1AR5A 2WLHA 1S5HA 4PCKA 3RDTA 2APSA 2E27H 2JFCA 3H85A 4L3CA 3GMLA 2YSSB 4LCCC 5D70L 3UTSB 5EN3A 3VDAA 5ITFB 2QVFB 2B2XH 4HUNB 1XIWC 3F12B 2ADPA 2WBJB 5IROD 4X7EC 4P4RA 4Z1VA 3B8YA 4KX9A 1MRDL 1JOIA 1ZSDA 2CJSA 4HUMB 1BZQK 1CC3A 3TBTB 2EVJA 1NTZH 2V7QG 1FO0H 2G0KA 2ICEA 2ZE5A 1KJ3L 4XPHH 1J9QA 3KCXA 4MW3A 4U1KB 1NANI 2UVFA 3RYCA 3WTSA 4LSRH 4OGXL 4S1QH 2JCCB 1A6ZA 5DI8A 3IE9A 3JWOC 5DMKA 1WAZA 3ZR6A 3SYPA 1YZZA 3L3HB 1NGXA 4LSDA 5ICUA 4WAFA 5B8CB 1Z5LA 1FBIL 4JCLA 4M1DL 5IB2B 4OV5A 4BD4A 2ITFA 4QAWA 5T1KA 4N2GA 1T89A 3ZOAA 1OGAD 1SQMA 3RY5A 2Q2EB 2ZX8A 3G9VA 4HGWA 4ABWA 4IRSB 4WGKA 4M6MH 2VE6B 2IGFH 2NNAB 2I9TA 5DJCB 4FX5A 1KG0B 4JGNA 1SA0B 3QUZB 5EEUA 1BIIB 1JHKL 5DQJB 4XC3L 4MTFA 3C6EA 3WEMA 4HUUA 3T0EE 4X99A 4OZFA 1NUFA 2NY0B 1VF7A 4NKGB 4DZ8B 2DW4A 3MYJB 3KLAA 2EINC 4Q9QL 2Y5TA 4AQOA 5DECA 3L9YA 2XUMA 4B7KA 3CLEL 5FYKE 3MHHC 5JIQA 2XWJB 3BKJH 3OXSA 1G1YA 1GCYA 4AJVA 5EC1A 4DR5B 2G2RB 1KB9F 3VMOA 1EZJA 3T8MA 1OGAA 3A5VA 1K9MW 2GIYA 2I60L 3JVGA 4GP5B 4R8WH 2ZAGA 2CE4A 1KGIA 4DV4B 4G82A 3QDGA 1QHQA 3ZO0A 3IU3A 4KXDA 4Z7NF 2J5LC 3OKDB 2BP5M 2RQ6A 1IKOP 1A32A 1N8RW 1HHGA 2ED6A 3OAZH 4P2OB 4PJEE 4L8CB 1IAIL 5EUKB 4YJ3A 4XBMA 3II2A 1DVFB 7TAAA 1U8MB 3UZQB 5C0CD 4XHQA 1BM3L 3UYPA 4EE2A 1PSKL 1HSBA 4NJ9H 3QK0A 1N9PA 1J11A 3K4DA 3VX1A 4KVNH 4ZFZA 4M7JL 4XAKD 5I6PA 2Q76A 1WG3A 2IOMA 3SQOL 2K6ZA 2VQ1B 2VXSH 3GB7C 1W91A 3FQWA 3WSQL 4PGBA 4WUUB 3U6RA 5FW7A 5ICXA 1QPPA 3APOA 2AXTZ 2E7DA 4PJHF 3ZSSA 4K3HA 2ZJSH 5C9KA 3ELAT 5KAQG 3CCSV 1MJ8L 3GLDA 4LCWB 4KJYB 5HYSA 2AQPA 2ZPKH 1I7FA 4WUUE 1E5UI 4DV1O 2AP2A 3HN8A 5IE9A 1UOLA 4K23H 1WQVT 3TN0B 5DZAA 4UZSA 3CN0A 4IRJD 1DLHA 1ESOA 2BP3A 5GRUH 1IGMH 1XAUA 2EKSA 4JYBA 4DKDC 1VA9A 4XNYH 5G5DB 5FA3A 4IHOA 2ATPB 4IBQA 4JI2O 3DGGA 5LP6B 3D3VA 3OV6A 5IV2B 2Z7ZA 5GONA 4CU8A 4IBVA 2W9EL 1OTTD 2A6KB 5DYOB 5SWZE 3D4ZA 4X64O 4X0KB 4LVHB 1LL1A 2F8VA 1TZHA 4ZHQB 2H32B 2FT8A 2IU0A 1LO2H 2X7LB 4G1MA 4G6FD 3ET9F 3TV8A 5ESAA 5L3DA 1K5NB 1GW6A 2HFTA 3QHFH 4YL9A 2DL9A 1E28A 2JIXB 4XCNB 2ORBH 2J72A 5E95B 2DS4A 5E9AA 4FLXA 2R23A 1EERB 5KYYB 2J1KA 2YD6A 2CM5A 3NZUA 5AOZA 3WENA 4NQSA 4QD2E 2CTWA 4WKXA 3W11D 1Z3RA 2WIMA 1VF5C 4DKTA 4GUOA 5INCA 2V5MA 4X4ZA 2NTSP 1XGYH 2AITA 4EB6B 1FJGO 1HU8A 1VESA 2IBZX 1L0XA 1CG9B 1I8LA 3GHEL 1NMAL 1I85C 4JEGB 2J12B 1EDYA 3GHBH 3T3ME 4NOFA 5GZOC 2YXWA 1RZPA 4U1GC 1X9LA 2Z8RA 3B8NA 4CRPA 5HFMA 1FIGH 4B41A 1NKDA 5FM8A 2BW4A 4FQIH 4U3XA 1MFBL 5G5DA 1J0IA 2Q5ZA 1ZT4A 4KV5F 1UH2A 4O2CB 4GBXC 3DI2B 4WCYL 3QNXA 4OFYA 5ANMB 4UM8B 4JYAB 5DEGA 4OZFB 4G1EB 2BNRA 5FPIA 2I7OA 1CGUA 1AJPA 1WBZA 1QFPA 5C0BA 1TQUA 2BRRL 3PJLA 3SO3B 3U6RB 3JAMN 3IE4A 3VQLA 3CJHA 1TJGL 1V3LA 3JWNH 2NY4C 4XCYA 5C0JA 2ZWSA 2VZ1A 3C5SB 5DJDA 1KTJA 5KHGA 4W1TA 2GBUA 4KFZC 5HGDB 1P84J 3BP4A 3U4AA 4GQQA 4AV0A 3U2JA 3MNVB 1NDGA 2HA1A 3BMWA 2FKXA 4RGND 3FO1B 4K3DH 3N85L 3QEQA 4WHYH 3X1GA 4D8OA 4DUXA 2Y7OA 3O8XC 1U4FA 2IG2L 3MNDA 1QSFA 1R3JC 4OJFH 1OK0A 4GSDL 5E8PA 3S3XA 1FZKB 2I9LB 5AB1A 2VSMB 4YPGA 2KDGA 3J27A 3U0ZA 4UVAA 1EEZB 4BZYA 2VQEO 4HW6A 3GI9L 5LCVA 5LGJB 5KMGB 4TQHA 4X5WA 1YJDH 4Q6KA 4AYBA 4FA7B 4LNUB 1SJHA 3E8UH 4LHJB 5LGTA 3SDAD 3QUKB 4HZ3A 5KVFH 4WGVB 3U9WA 1S5JA 1BEXA 4YXWG 2VW7A 1IAMA 5LBQA 4HJUA 4S1SH 3ZHQA 1OTUD 3ZBMA 4PGJA 5DHVH 3V6BR 2DOCA 4FERA 3VI3B 3BPLC 3D50A 4W70A 4BZ1A 1TLKA 3GI8H 2CAZC 1T7WA 1AFVH 1NBZB 4L5FH 5IBLD 3C60D 3CZLA 3WS6C 2PCPA 4OF3A 7PAZA 2EIKB 1FFOB 3CFEA 4PWHA 3ZYOA 5HD8C 1I3RA 1JJ2U 2ADQB 3V4UL 2WUBL 4N9GA 4ZUSB 2WGNB 3ARBD 4HFUL 2P06A 2BTOA 1LP9F 3D3VD 4HXAL 3MMEA 4JVWA 4MWFB 3SGEI 4PJBE 1ZHKA 2R0KH 2WUBH 1NCAH 3V4UH 5K9QG 3S4SB 2GT9B 1KCSH 5TDNB 4F2MB 1KY7A 3P77A 3U7AA 3ZL4L 4KO7A 5F7YC 4KJQD 1T20B 1L0NH 3AS2A 5J7CC 4HUVA 3RBZA 4L5FL 5DO2C 2Q8VA 1AFVL 3JCZA 3KPSA 4HMEA 3LN5B 2JVDA 3GI8L 1CB4A 3HE6D 3NP4A 5E9DE 3T04D 3ARGB 1QFUH 2GC4C 3ARXA 4LVOB 4PFEA 4U4BA 2Q6WB 1CDHA 2Z92B 3UGEA 4S1SL 4F7PA 2HKOA 5J4MA 2ZICA 2X4UB 3WE1A 3L9DA 2DMBA 1K3EA 4F7EA 4PBWD 2WOBA 4LKCA 4MJIA 2FJHA 5TH2A 4QTIL 1GC1C 5TD4A 3BE1L 3D2TA 3EG9B 1MCQA 3QQ3A 4I77H 3CSGA 3RFZB 3SPJA 3K03A 3EO0B 4BW5A 1S5HB 1KXQA 1NEZA 4MZ2A 2V4DA 2VQ4A 2EEAA 1LM8V 2W07A 3CUPB 4DP4X 1GAXA 3BEHA 2EIMB 1FNAA 4APXB 4AQ8C 4OBSA 1ZTMA 1SMOA 4PJFF 2BNQD 1Z5HA 3OKNA 4LNRA 2YRLA 3N85H 4Y2LA 4K3DL 4A66A 1JZ4A 3Q8AA 2HFGH 1IRAY 4KOCA 1E3XA 1I7UA 4BK5A 3VE0B 4WWKD 4ECNA 1DEEA 1UA7A 4X9IA 4YNYB 3OHXC 3HE7D 3H1JH 1UM6H 4U7KA 5I1JH 3L3OC 1MN4A 5F6HI 3TN0D 2OS7A 2YS8A 4OFIA 4JJ5B 1GAFH 2UV3A 1KKDA 3MRDA 4YX2H 5IESL 4G6JL 4Z7VF 2HPTA 1OAKL 3L5JA 4OJYA 4W68A 2AHYA 4N8VB 4CSZA 3QUMA 1KP2A 2A6DA 5EIQA 1WRFA 3P4NA 4LCUA 3C87A 4AIEA 3DUUB 3WCYA 2Q1EA 4P4KA 1UJWB 5HPOA 4FYSA 1NCUA 3AS3A 4FQIL 3T65B 4I3SL 5CGYC 2IC2A 4ERSL 4X88A 3ZK0A 4KZCA 3Q44A 3Q48A 1B04A 4HJGB 3AY4A 2RALA 3NEXA 3PHQB 5D1ZA 2C9SA 4JFEE 4PRAA 3LRKA 4M4PA 3WIIL 5I6MA 4OXSA 5KX5A 2R27A 2YEVA 4N3UA 1EXUB 4YL4A 1QLFA 2AK4D 3DOHA 4OCNC 4HJSA 4E9VA 2GTZA 5LP6C 1EZLA 4R50A 3RYHB 2K45A 1FYTB 1QNZL 3IN0A 3ARDD 1E4XH 1JWMA 1U8LB 3TBVA 3GB7A 2AXJA 1KLFB 3NCJH 5AAMC 4JUSA 5E6IB 5HDWA 3RKPA 3KMDA 2Y7LA 3EDKA 4M4RB 4TNWF 1F13A 3WLWD 3JAKA 2VZ3A 3AC0A 3KBEA 1CI5A 2BMKA 3WU2Z 1LO2L 1WBYB 2GYSA 4M3HA 4MGXA 3RDTD 4FMTA 4PIRF 1IAKA 5FDWA 3VI4E 4PJIF 1SDDB 3B2UC 7FABL 5KSAA 4K7FB 5EFIB 1BIIA 3RNQA 1BQ0A 4IGBD 1CYXA 4TNWK 4N0UA 1G7HA 4OD1L 5F9DC 1I53A 3Q5TA 2KZKA 4PHZA 4L8SC 4J3OC 4FD0A 1BVZA 2FEDC 5CCJA 1NANH 4NUQA 3CSYA 4DSYA 4E2OA 5K69A 5K1NA 3MGOA 5EU4B 1Z9SB 1OXYA 1CGYA 4UV7L 4DEPB 4DGYH 5B66Z 1MJ8H 5FM4A 3ATFA 1IBDA 3ZRXA 4PJ9B 3V5KB 4OZIB 2X4QA 4BKLA 4PVBA 3QXVA 3ORJA 1H9VA 2DMCA 2Y25A 3WSQH 3APQA 1QBAA 2BSTB 4NFDA 4NBXB 3D30A 3D9AH 4FI7A 3RYCB 1D7DA 3EXLA 5HHPB 3CRRA 3K7UA 1S9WA 4N8UA 1IILE 3RJDA 4JRXB 1FAFA 4M7LH 2EJ7A 4ONHB 4DR5O 3EIFA 1NWOA 4RAHA 4FHKA 1UD3A 2K7QA 3GIZL 2UUDK 4GSXA 4HKBB 2X4NA 3J7HA 3ZLQC 3NCYP 3PHOB 3ROLA 1BCIA 4J1UA 1BM3H 1RJCA 4O00A 4UZGA 4X98B 3K2KA 5DVNA 1F3JB 1WZMA 1MQ8A 2GSIA 3KXFE 5HPMA 2EDBA 1IAIH 4YDVA 1X7QA 3WNOA 4TPRH 5FW6A 5EO9A 1MAML 2FJGA 2GW5A 3GSOA 4GCZA 3P40A 1YY8B 1FXVA 3F7LA 4R7DA 2QFPA 4K8RC 4R8WL 1ILSA 2I60H 5TDPB 4KRLB 3IJ7A 4JFDE 1G7IA 4LIQH 4QRTA 4DP9X 1O9WA 3DXAA 5DD3H 1QRNA 5JIKA 2GVYA 4FNSA 3C5XA 4MDIA 3WL9A 3BWAA 5IWLA 4YPJA 1RZKC 3FU6A 3QPKA 4F33A 5I6KA 4RGOH 3BKJL 3CV5A 2B16A 3P3SA 4N2OA 2J73A 5L3EA 4FKEA 4LASL 3CLEH 1HHHA 4PHXA 3WJJA 2WHVA 1DQDH 3BD4A 3QR1A 5IROC 4QRRE 1W80A 4JDEA 1D5MA 3L7EA 4Y5YB 3TFKC 5E51A 3IFOB 4G3YH 2C9AA 3FQNA 3IS1X 1R5VA 3D39D 4NRZA 3RGVD 5KHKA 2IH3C 1XMQB 3VFVB 4PD4J 3F5WB 2EDJA 1Z9OA 1JHKH 3V5DA 2JGDB 5IEHA 3VWJC 1BQ5A 2AI0H 2X4PA 5C7ZA 2HZHA 3MCG1 3JTBA 2IJJA 3CB2A 1DANT 4MDIB 4M6ML 3B9EA 1T4KA 5DMIL 1OT2A 1XHXA 1J1PH 2OULB 5IKCB 3HPLC 4Y16D 3SODB 4X64B 3BUPA 1WHOA 1KEGL 2X70A 2F93B 4IIQB 4MAUL 1QNMA 3ATAA 4M1DH 1TCRB 3LS5H 1N8ZB 5AW5B 3FT0A 4PJEF 3VX0A 2JQZA 4K3AA 2WXFA 3BUQA 3LDDA 1G7QB 2WPGA 5D7IE 3RGVC 1FJ1B 2Q7YA 3REVA 4WTQA 1NFAA 4L1SA 1EIBA 1F4AA 1TZIA 4YS4A 1ODAA 5DO8A 4OGXH 5CP3H 1FN4A 3UXFA 5D1QA 3BMVA 4XPHL 1KJ3H 5JW5B 1ROCA 1FE8H 2QMJA 2ERJC 1RERA 7PCYA 1OCRC 4I2XA 2WY3B 4QCIA 4Z7WF 5AW9B 4FLTA 3TTSA 1MRDH 3RYMA 1DVSA 3CFTA 3LN9A 3OJVC 1BZ7B 4OKVB 4MXVE 3NJJA 2HLEB 5C0EB 5D70H 5JW4Q 4JI4O 4XO3A 2WXOA 4G6AD 2VC2B 3VB9A 3EUUA 1A66A 2E27L 4WWID 2Z0AA 1ID2A 3MA7B 2L35A 4Y2OA 4AUYA 2NNAA 2C26A 2I9TB 1KPRA 3MO1B 3NSYA 5CBEA 4EXKA 2QQKL 3FB8C 3POCA 5LMUB 2Q87A 5B22A 2D2CB 1GKFA 4GX2A 4JI4B 3NJXA 3LSOB 2PTTA 2VN4A 1C5DA 4Y19A 4HOZA 2EVHA 4AZ8B 2YAQA 4XMLL 1KNOA 3EOBB 1AQDA 1CTMA 3ETBF 4WHTB 4KRPC 3VGBA 4C83A 3WEOA 3QSKB 4MKTA 2E5LO 3CJHB 1XMOB 4CC4A 1NGXB 3BAAA 5E00B 2QWNB 5B1BC 3FFCD 5I9QB 4TVPH 1J0YA 4KKRA 1G9NH 1F58H 1HXKA 1REIA 4IGBA 3UBXG 2MCAA 3CCHB 1HL8A 4LLWA 3W2DH 5IVOA 3ZHDA 4CL7A 2XWCA 4RIRA 1A0QH 2Q9LA 4OKDA 4JI0B 1I85A 4LPUA 3P0VL 1U92B 1IGFH 3ARFD 4O58L 4GFTB 3IK2A 4BR6A 5D2NB 5JW5A 1EV2E 2NPLX 5FK9B 3WUWB 2VDKL 1U8LA 3TBVB 2DLFH 4F24A 4F9LA 3DTUB 1DVTA 3NPSC 3HBQA 3NTCL 5BS0D 5JHLL 3PWNA 3IDXH 1SY6A 1NCDH 2EDKA 4CILA 5CLZA 3EJYC 3LPWA 5KG9B 3WG7B 4OCLC 4B3RB 4KHPB 1KJ2B 4ZFGL 2HFEC 1BDYA 1XF3A 3LHPL 1HKFA 4YDIH 1MCFA 4JV5B 2YZ8A 1AC0A 4UB6Z 3NRQA 4M3JA 1B0RB 2F1BA 5EUOA 1K5QA 5K39A 1QW9A 4N2NA 3MLUL 3BUTA 3RL1B 4AKOA 2W9DL 3QO8A 2NY0D 4HFWB 1RP8A 4NKOA 5DJ2B 4FYRA 1N5YH 3FKSG 1G9EA 1TZGH 4U1NB 1KT2A 1WAEA 2K78A 4OF0A 3CAFA 4F8QA 4ZHQA 1K34A 2PTVA 3L7EB 4MTMA 4UDUA 1FLTX 1XF4B 4A2MA 2XASA 3E2HC 4Y89A 2HFEA 3IDIA 2R4RL 3U2IA 1QBMH 3H6AA 3ULVH 3BIKB 1DGSA 2ZONA 1PJWA 2CK2A 3MOAL 2PP9A 5IB4A 1D6EB 4FFKA 1OT1A 3K6OA 3D85D 3BKML 5J3HC 4WNQA 1GTOA 2AQ3A 5TDPA 2IQAA 1KYOJ 2VSKB 2VXTH 3EO1A 2BOCC 4DR1B 3S34L 2NR5A 4TLUA 4Y4KA 2HN7B 3MRLA 1VQ9V 1E40A 2F1EA 4M43H 1XQ8A 3QUXA 5ECJE 4ZX6A 4X1IA 1DBBH 2XQYK 2H6PA 5JQ6H 3RFZA 1N32O 2EDWA 2Z34A 4LSQL 3UAAA 2OMTB 1ZV5A 2R1XB 1OAZH 3A0OA 1KB9J 5LAXB 1A2YA 2A6IA 4F6RA 5JO5A 3SPHA 4WF7A 5L88L 4HUKB 1J05B 3ZKND 1T0OA 2AJYL 1LO5A 1NH2D 4ZW6A 4KJWD 1W6LA 1QEWB 1WGVA 2CGR