3AG2B

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ag2B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ag2B02
2UX6A 2N0MA 3UADA 4A68A 2R7EB 1OE1A 4UANA 2HX9A 1BXVA 1NICA 4WTQA 3QJQB 3X1NA 1X9RA 1EHKB 4UF7C 3WNJA 1PLBA 3CDZB 1URIA 3FPYA 2XWZA 1HAUA 2HX8A 1XMEB 1PZBA 1CC3A 2IH8A 1GS8A 2FNWA 2YQBA 1PNCA 4F2FA 4M3HA 1OF0A 2IH9A 3CZUB 5B1KA 2RACA 2X88A 4YSAA 2E86A 1RZPA 2J55A 3WI9A 5I6MA 3HEIB 1QNIA 1IBZA 3QJVB 1BXUA 9PCYA 4BK5C 4FAAB 4DP1X 1JOIA 1N68A 4DPAX 8PAZA 5I5JA 1PNDA 1J9SA 4A67A 2YXWA 3BQVA 1ZV2A 1NTDA 2CBPA 3WIAA 1A4CA 1FA4A 1L9TA 3TASA 5D4JA 1JVLA 2BW5A 1KCWA 1AZRA 1XB6A 4E9XA 3SBRA 4DP2X 1JZEA 5I5MA 4Q8BA 4Q89A 3T6ZA 3RYMA 2OV0A 1PCSA 2FT6A 2BP0A 2FWLB 3H4FA 4CSPA 1AS8A 1OCZB 4K9JA 4NAJA 2YAPA 2GC7C 2PPAA 1QHQA 4YSOA 1XB3A 1KDJA 2XV2A 1JZJA 3PAVA 5AZUA 1A8ZA 2XV0A 3MX0B 2PPEA 1J5DA 1NWOA 4DP5X 2CAKA 2HXAA 3N2JA 3L45A 4E9VA 5I6LA 3NJLA 4DP6X 2XX1A 3ZBMA 4M4RB 4N4YB 2VMJA 1GS7A 1MG2C 2FQDA 3X1GA 3OMNB 3N55A 1MZYA 4P5RA 4W1TA 3FQ1A 5E9NA 2MTAA 3FSVA 3NJNA 4AKQA 2IDSA 2WSDA 3FU7A 4HALA 3ZIYA 2EIMB 1A4AA 2IDTA 1IUZA 3IN2A 2P80A 2DYRB 1MDAA 1SHXA 5F7AA 2IWFA 4F7KA 1BQRA 1TU2A 1W6LA 1MZZA 3NP4A 4DP9X 2YAEA 1ILSA 3IBOA 1WA1X 2PCFA 4BWUA 1GY1A 1W6WA 3T71A 1GSKA 1RZQA 1XB8A 1AOZA 2IAAC 3IE9A 1KBWA 6PCYA 4PAZA 3S3BB 3GXUB 5D4IA 2VW6A 4KO9A 3SBQA 2VW4A 1ASOA 2YARA 3NSYA 3NJHA 2AZUA 2GI0A 2PLTA 5ANHA 2PPDA 1SJMA 2TSBA 1M9WA 3FYIB 3KW8A 3AZUA 1IBYA 1JZHA 3AG1B 1CUOA 4G71B 5I5IA 5FC9A 1ZDQA 4DP0X 2GIMA 1L9RA 2JKWA 3QPKA 3ZDWA 1SFHA 1KCBA 2CUAA 3QJUB 4YVUA 3NJKA 3OM3B 2QDVA 3EHBB 4A2FA 4ENZA 3FU9A 3IN0A 4DP8X 4UAHA 2DYSB 1TEFA 1DZ0A 2B08A 1AZNA 4G7SB 2FQFA 1ET5A 4HCGA 1T5KA 2XU9A 1SF5A 6PAZA 2YAOA 4NERA 1R1CA 1BXAA 1SHWA 1ZPUA 4N8UA 2FQGA 2H3XC 3X2QB 2CALA 3T6VA 4YSSA 1PZAA 1JZFA 3AY2A 3CG8A 4KO5A 2BZ7A 1AAJA 1OCCB 1AACA 2I7OA 2ZWNA 1I53A 2IWKA 2WO3B 3NSDA 5B1BB 3CVCA 1IC0A 3QJRB 1PAZA 2Q5BA 4A2HA 1TKWA 3CVDA 2AVFA 1AQ8A 1GS6X 3FU8A 3TU6A 1ID2A 1ASQA 3FQYA 3NJIA 2XVBA 2GHZA 3OQRA 1F56A 1OOWA 2BWIA 2J5WA 4QKTA 3GDCA 4DPBX 1WA0X 2VM4A 2YAMA 2B3IA 3ABMB 2Y1AA 2HRGA 2ZXWB 1ADWA 4DP4X 4DP7X 3UAEA 4EF3A 1KDIA 5I28A 1PF3A 4YVNA 3T6XA 2GBAA 2Q9OA 3AG4B 7PAZA 1CYWA 1SDDA 3FYEB 3FS9A 2HZHA 1ET8A 2PPCA 3UABA 2FT7A 3G5WA 1AZCA 1B3IA 2TSAA 4KNTA 3ASOB 1OCOB 1PLAA 4HHWA 1KV7A 5TK4A 3TA4D 4GP5B 2VM3A 3U25A 3JTBA 3DKHA 2BP0B 2HX7A 1JXFA 2P80D 1SDDB 1BYPA 1BEXA 1UATA 1GR7A 3DTUB 4BXVA 1ET7A 4YSRA 2W8CA 2J57A 3PAUA 1ZDSA 2XXGA 1OV8A 1ETJA 1AS6A 4KO7A 1QLEB 1AR1B 5F7BA 5D4HA 2XYBA 1KYAA 4CSZA 1V54B 1OE3A 5I6PA 2W88A 1A4BA 3PPSA 1BQKA 1FFTB 1L9QA 1OCRB 2VW7A 1NPNA 3OMIB 2GB2A 1J9TA 2XUWA 1M57B 1MG3C 5B1AB 2GC4C 4W9ZA 1HFUA 1ILUA 2DY2A 2YAQA 2IDQA 5EHFA 3FU7B 2QT6A 2H5UA 3NSCA 4GP4B 1BQ5A 4HAKA 1X9UA 3NYKA 4GYBA 4AX3A 2FTAA 2FQEA 3S8FB 5I6OA 1GYCA 2DWSA 3NSFA 5AFAA 5I6KA 2YXVA 4PCYA 4KOCA 2FT8A 3H4HA 1L9OA 3TBBA 3AG3B 1J5CA 1PLCA 3UAAA 1KBVA 2UXVA 1CURA 1GW0A 2I85A 2UX7A 2EIJB 4AZUA 2NRDA 2JXMA 2XLLA 2VSKB 4JHUA 1PMYA 1ZIBA 3OD3A 4GY4A 2EINB 1FWXA 4AKPA 2FJSA 3JT2A 4A66A 1CYXA 2I7SA 3PCYA 3OMAB 3X1EA 1J9RA 1NIEA 2YAHA 2BO0A 2HLEB 4QLWA 1E5ZA 3FSWA 2R7EA 3MBWB 3WKQA 1AS7A 2X87A 3X1BA 1NIBA 1SFDA 3S3DB 3ABKB 4HIPA 4G72B 3S3CB 3QQXA 4E9RA 1JXDA 4HCFA 4GP8B 3ZX1A 2Y69B 1BYOA 3V9EA 2WO2B 1AZBA 1NIAA 1WA2X 3WKPA 2DWTA 1PZCA 3FSZA 1JERA 3EH3B 4G7QB 2YEVB 2HRHA 3PXLA 2CJ3A 4YSDA 3C75A 5I6NA 4JKNA 1KGYE 1NINA 2VSMB 3NJJA 4YSPA 1WAEA 3FQ2A 4NB7A 3UACA 1RKRA 2OJ1A 1OE2A 2DV6A 1ASPA 1N70A 1M56B 4E9TA 4KNSA 4YSTA 1HAWA 5I26A 3FSAA 4L0PB 4TXVB 1AANA 3NJFA 4E9WA 2AZAA 3WNIA 4BDVA 3GYRA 3EH5B 2PP9A 2IWEA 3ERXA 1VLXA 3NJGA 1WS8A 3IEAA 4RH4A 5TK2A 3T6WA 1JXGA 4BWWA 5B7MA 4HCIA 4YSQA 3S8GB 1JZIA 1A65A 1SF3A 1AG6A 2ZOOA 4DPCX 4BDVB 5B1JA 4HZ1A 2AFNA 1IKOP 5A7EA 1E65A 1NIFA 1E30A 1NDTA 2EIKB 1V55B 2MRYA 4YSEA 1TEGA 3X1FA 3PAZA 2YAFA 4E9QA 5LDUA 2H47C 3V9CA 2BZCA 2OCCB 2QDWA 3HB3B 3WG7B 4E9YA 3QJSB 4HHGA 3AW5A 5B1JC 4F2EA 2IDUA 1NWPA 4JHVA 2ZONA 2BW4A 1BAWA 4AKOA 1RCYA 3UGEA 4A2EA 4MFHA 2BWDA 5PCYA 2PPFA 5AKRA 2QPDB 1J9QA 2BHFA 1AZUA 3TBCA 4BWTA 1W8EA 3NJMA 3PLYA 4BXSV 2EILB 1V10A 4YSUA 3BVDB 3KW7A 2PP8A 1WS7A 3QJTB 3DIVA 1JVOA 1NZRA 4G7RB 3T9WA 3EH4B 5B7EA 5IY5B 1PY0A 2UXFA 2JFCA 3H56A 2PP7A 2QPEB 1GY2A 3SBPA 3ABLB 4A2GA 4X4KA 3NT0A 3SQRA 2XV3A 3ABGA 4KO6A 1DYZA 1YLBB 2CCWA 4G70B 3D12B 1E67A 1E5YA 4YSCA 2AANA 4ZK8A 1AIZA 2VN3A 4P5SA 4WKXA 2BP8A 5PAZA 1A3ZA 2XX0A 4A2DA 3AG2B 1JZGA 3ASNB 1L9SA 1NPJA 4KNUA 3FT0A 4E9SA 3CVBA 4YL4A 1SNRA 2A3TA 1L9PA 2IDFA 1AG0A 2GSMB 7PCYA 5B7FA 3NP3A 4GXFA 1ZIAA 2BP8B 2LLNA 3EF4A 4AI7A 5B3SB 3FPXA 2UXGA 1NIDA 2PCYA 2J56A 4KOBA 2UXTA 3CDZA 2XXFA 1EZLA 4FA7B
chains in the Genus database with same CATH superfamily
3NJXA 4HWBA 4XGZB 4YE4H 2XT1B 1JUFA 3P3YA 1MRDL 4OLZL 2R72A 2Z31C 4FQQA 2G3ZA 2EH7H 1DBKL 5CNHA 2KDYA 5D71L 4HWBL 4JY5L 5AB2A 3L1FA 5CHNB 3KS0J 4Z78A 1V7MH 2F8VA 3C2AL 5CJQL 5DQ9B 1HAUA 1G4RA 3T2LA 3GXMA 4MZ3A 4GX2A 4HIXL 2M1KA 5T33L 3GPSA 1P84K 3HB3D 4PJHE 1W8OA 2F19L 1F86A 5JOPE 4Z7UE 4AUYA 3U2SA 3MMEB 1RV6X 1Y74B 1XR8B 2ADFL 4K3EL 4MSWC 5I66A 5DVKA 2PUQT 1NGYA 4ERSH 4YSAA 1ZHNB 2J55A 3HHSA 4UZSA 2Q5ZA 5DWPA 5F6HJ 1J5EO 4LF5O 1IBZA 4NHCH 3DIFB 2E5EA 4NQQA 5FR3A 1ZK5A 3EOTH 5A2AA 4DP1X 4JAUA 4LCWD 2N01B 2XPZA 1TJXA 4MGXA 4FNUA 5I5JA 3SDAD 2TAAA 4PA7A 2IANB 4G2KA 4P2ZA 2YQGA 2R27A 2NXYB 2X89D 3CH1A 3NTCL 3IMRA 1JQ0A 5GGTL 4E36A 2NY1D 3CFCL 5GJTH 2DWYA 5KVDL 1I82A 3P54A 5CGMA 3VTTA 2IPKB 5FECB 1NA8A 1SZNA 3ARGC 3IRCA 1F4XH 2CIKA 2LLLA 3MHHC 3S5LB 2OV0A 2JGUA 4AMWA 4AMXA 1J7VR 3LEXA 4RA3A 3TYGL 5L3CA 1OAZH 3I6LD 3HPLC 1DQMH 2KLTA 1HYSD 2E4FA 2NW2B 5KHKA 3MROB 4MNHB 4Z7VF 5FNVA 5BO1L 4BHUA 3NIGF 4TOYH 1F4YL 1TLMA 4NZTH 1IGIH 3OKDA 2WAHA 4X50A 3H9SE 1RU9H 4KROB 12E8H 2CE6A 2H2SC 4JI3B 3KBFA 4KQ3L 4X6EB 5F7KC 1JGIA 1N9PA 1FVCB 3VGHA 2AV1A 1OSZA 1EA9C 3CC5B 4PGEA 3B9KB 2FL5A 5C92A 4LSUH 2X4NB 3ATBA 3SJBC 4WW1B 1G6RB 1ZSDA 4MXWH 4DGUA 2CRYA 3I6KB 3KXFE 4YJ3B 2R9RB 1PL3A 1ZXKA 3QGVA 3JVFC 4W4OA 1EV2E 3QEQA 2AQQA 3LVEA 2QADC 5DUPH 4LL1A 1I1CA 2F6AA 4H25A 3WY4A 4U1JB 2YGNA 3EDFA 4QUOA 3JWDC 1CLOH 1NCWL 2YSSA 4OD3H 2Z3FA 5SX5K 5LN4A 1SLXA 4WNQA 4HETA 2WXFA 2J1WA 1XMQB 1R46A 3FZUD 4ZXBA 3MV8A 3T0EC 2P80A 3KH4A 5KVEH 2OTJV 1VPOL 3GBNH 4FFWD 4EBQH 1S9VB 4D3CL 3QVAA 4QRQA 3E6FB 5BQDA 5JA9A 3IPBA 3L5XL 2ALAA 2YAEA 5EZPA 2ZUQC 1SEBA 5DHYA 1GCFA 2BY3A 1FBIH 3CFJB 3NFNA 1ZS8A 1KBWA 4P3DB 1K7DA 2D2CC 2NNXA 5M95B 2YMTA 3SBQA 4APXA 3JD2A 1E3ZA 5JXEA 4DR1O 2QWQB 3WN6A 4FKKA 1H15A 1JWSA 2ZYIA 5EC2C 3BMVA 5D7IA 3AG1B 1SOXA 5C09B 2UY6A 3F62A 5A43C 3VXRB 5IMKB 2F53E 1NGPH 2AJZB 5ILTH 3H01A 3QUXB 2VZ3A 2Y1ZA 3OM3B 3RYFB 1WA8A 3EHBB 2VQ1B 5JIIA 3MLSH 3MFGB 2VIRB 4XZUA 1J0HA 3B3IB 1NOAA 1IEAB 1QUNB 3MVSA 3NESA 4WKZB 3ZMRA 4LVEA 4YHIA 4IS6A 5HYIA 2C4FT 2D7PA 3HC4L 5CBEA 1KC5H 3F7YA 4YIOA 4PJ8A 4Y1AD 4IEFB 1XH3A 4BA0A 1RUAH 5CLWA 1BXAA 1HE8A 1N64L 3M8OL 3MV11 3V0JA 4OGAD 4JDZA 5DF0A 4I5BA 2O57A 4Q74A 3CN2A 4UQ3A 5JDJA 3DC0A 5T5NG 1M05A 4GUCA 2OMZA 4NQED 5C9KA 1JZFA 3KBPA 5C93A 1MCBA 1EEQA 3RTQB 4XE0A 2G5RA 4AE0A 2PYEB 4AEFA 4XPAH 3RWEA 4L23A 3OHXA 4JHBA 4PGBA 3D36A 1AKJA 4MLSA 4HWEH 4NQSA 3BAEL 3S4SA 2ZNJA 3CRCA 5CJOH 4OD1H 2RAMA 4DV7B 1ID2A 4FYSA 5EU4B 2GJJA 2HT4D 5CP3A 4PGCA 4HUNB 3BCFA 5I1GH 4ZFZA 1K4DB 1KP3A 1I31A 2A74B 2R9HD 4ONOA 3RHWK 4IRSA 5DS2A 4H1LG 4DEUA 2H2PD 4NKIL 2QTVA 4JDVB 1LO3H 4M1GH 4N2DA 1IT9L 1WFNA 2B3IA 3MLRH 2WBJA 2B8OT 3ARDC 5FA3A 1ZLUH 3L3KB 1FE8L 5TQ0L 4PRNB 5LWYL 2OMNA 4GG6A 3DXRB 2GHWB 5LN8A 4YN3A 4RBPK 3MRJA 2XYCA 4JO4H 3AROA 4LCIL 3IE4A 3MLVH 1JPEA 5JQHC 3BP6A 5IHWA 2ICWA 3S35H 3V5HB 1U3HC 2PPCA 3S34L 3H2QA 3KBEA 3MXVL 3O6LH 4HT1H 2Q2EB 1AZCA 3CLEL 4JM4L 4L9LA 3WE6A 3VCLA 1THCA 1S5HC 3NSXA 2WLYA 1OCOB 4NOFA 3GB7B 4KMLB 1WGOA 5F88B 2PF6A 3SYPA 2ATPB 4LMQE 1SLWA 1BEXA 1PEZA 2DTSA 1MLCB 2GBTA 3I50L 2C4XA 1UOWA 5CLZA 3FRUA 1LXMA 5A6LA 5HHXH 4DR6O 1BQZA 3N43B 5AB9A 4X6FB 3AK1A 4Q58C 3RFRA 5D4HA 4NN6B 4DV3B 3GIVB 1NBVH 2OCJA 5IG7B 1V54B 3I75B 4BSVB 1HL9A 4FQLL 1DQDH 1LMIA 4JO8A 1GPOH 3KJ6L 4N0FB 1DN0B 1I1AA 4I0XA 1TO5A 1GMGA 3Q8EA 5I0XA 1YECH 4QYAA 3SKMA 2EAEA 3RFZA 3D0AA 2E3CA 2K7QA 3H2WA 1JI2A 5EWIL 3RWCB 3EBGA 3K9SA 4BQ6A 5KSAA 4PB9L 3OKMB 3K5MA 4JUSA 2W9DH 5DRXB 1DJGA 1Z66A 5K9KB 1FAKT 3DGGB 4DETA 5JHMA 1YJWV 2EXYC 4FP8H 4PJEB 4AQYB 1QA9B 5IHHA 4DRXB 4OJFL 3NEOA 1VQLV 1UXWB 3AT9A 5FWQA 3MDJA 1CZ8L 3GZKA 3WLWC 3KWUA 1YUHB 2ZXGA 5DR5L 1G6RH 3D0LA 3HNVL 4ZOEA 1JNLL 1FCGA 4M7LL 4MASA 4XBEL 5LDSA 1XF2A 3PV6A 4M93C 3RAJH 2XOTA 2NY7L 4IBYA 3GSQA 2IFGA 1BJ1J 2JXMA 3FXIC 3NZUA 5D2LF 2IXQA 5JHDD 4G6JH 1IGCL 3CCEV 4L2LA 1ZT4B 2FEDC 4WWID 3VBBA 1N8RW 4M6ML 2I9LA 4BFIB 1JCKA 5HGAA 3MUGB 4Z7AA 1CBVL 2I7SA 2JJVA 1IVTA 3H9HA 4OGYH 3T3PF 4R97C 4UM9A 4EVNB 4Y5YB 2B39A 4U2ZA 1FDLL 3RQ3A 4MAUH 5I8CA 5DYFA 3KNBA 1VARA 3A4DA 5E4AA 4ZX5A 5BNXD 4L3EA 2NNAA 4C4KT 1QKZL 4DOHB 2XAJA 3B2VH 3F7VB 3LN5A 3U4KA 5KMGB 1SN0A 4S0HA 4FJYA 3UC0L 5FUZH 2WLNA 1LO2L 3SPVA 4KY1L 3RT3C 1AZBA 3RUGA 3BN9C 1EVTC 4K7PL 1MNUH 3RW0A 1UG9A 2GAZA 3LX9A 3QFJE 3MOBL 3VXSD 5IJ9A 3NCWA 4X65O 1NMBH 2JCCA 4NFDA 1NJ9B 3ZW3A 4GCZA 2IAMC 2WVUA 1QNZH 4ZUSA 1UWEH 4DV2B 5EEWA 5G4NA 2DYPA 5FK9B 4I2XE 3W7SA 2A9ML 5EC1C 5T3ZL 1TJGL 2YUZA 3BWZA 5C0CA 4GMSH 1SS3A 2NQ3A 4FQPA 4FYRA 2WLIA 1QFUL 1UT2A 1Q6UA 3JQOB 3L2NA 3ZKND 4E9TA 4NP4L 1HAWA 4XAKD 1YYML 4OFPA 2AEPL 1J11A 3DRTB 3MUY1 1JOYA 1ZLWK 1J0JA 1AXSB 1HX0A 4WU7B 1NTMH 2ESVA 5LLIC 2XAHA 4OZIA 1OPGL 3OJDA 2PP9A 1AVMA 2OJEA 1CVRA 4AIZB 1CFBA 1WCBA 1XDTT 2CGNA 5D5ME 4ABUA 5DUBA 1FFRA 2NY4D 2X09A 5LQBH 1GMEA 2AJXH 2ILMA 4I18A 1U58B 1VENA 5E56A 5L2KB 3D1MC 4XI5C 1PKQE 4BK4A 2P7TA 3ZHLA 4N8VB 4IOFD 3SCMD 2UZXB 3L6FB 1MI5E 3ELAT 5FW8A 2CHZA 3V4PL 1D5IL 1U8PA 3LNNA 2Z9TA 2ODMA 2YD6A 3RWIB 4GAYB 4LCWA 1T6BX 3KLHD 3ML0A 3OLDA 2J71A 1T4KA 1FFOB 2P5WD 5ESVA 2X89A 5BOZG 1YAZA 3E1F1 4L37A 5I74B 3SDDC 1KTCA 4JI1B 4FLXA 2JB5H 4ZW5A 3JWOH 2DQDH 3WY1A 1F6LL 2ICES 4G7VL 4RIRA 1B88A 1FCCA 1S7XA 1MHCB 2H26B 3E2EA 1MVYA 3TP4A 3JSLA 4TVSa 1DLHB 3ATDA 1MLBA 2QPDB 4NQDA 1XF5B 1TETH 3WFEL 1N32O 3ECVA 1Y76A 1V9PA 1E28B 2BWQA 1EZVH 1H2GA 3ZYZA 2IBZX 1ZOXA 3CDYA 4UB6Z 4GRMB 2CKBH 1O7DC 2WIIA 1DQIA 3MOQA 2MW2B 1MWAA 1TEYA 4DN4H 1ED3A 1USQA 3QQNA 5DMGC 1S7TB 2F7RA 4P5TD 3V52L 2UXFA 4MWFA 3VH8G 4ZMXA 1YY8A 1GRWA 3QG6A 2E8YA 5H6RA 3CWBH 15C8H 4O4HA 4B3RO 2DTML 1WLHA 4C83A 3ZL2A 3ULVH 1N59A 1V05A 2X4UB 2ZG2A 2QV4A 4U1NB 3BUYA 1DYZA 4L3CB 2NNUA 1U8QA 1YY9D 5EZOL 3CS5A 1A6WH 5AWNH 1HEJC 2VWEC 1OTTC 4Y16D 1KBHA 1N67A 3P3SA 4R4FH 3KL0A 3QDGB 3IM1A 3FMGH 1QWHA 3ZTNL 4KXZH 3SE8L 5IQNA 2W1NA 4LT7A 3S2AA 1M2VB 2O4EA 1NI8A 2P90A 1J05A 1P7BA 4D9LL 4E9SA 3NEEA 4YL4A 4G6AC 5CU9A 3GTTA 1PX8A 4AEEA 4F92B 3P11L 2FSEB 1UM4L 4PJ9C 4DUWA 1ZLSL 1VF5B 1HU8A 4TUOB 1LK3H 1MHHB 3VFVA 3JAWA 3CFNA 4I50A 3QZWG 1XHXA 3VFOB 3ZN6A 1KULA 5KN5A 4AC2A 2E56A 1RZ7L 1BX2A 4KOBA 2UXTA 2NYZA 4L4TB 3UYRH 1AJNA 4DK6A 2GK2A 3FL7A 5F1KC 1F3JB 4N2EA 4DSYA 5BVJB 1NSNL 4JKWA 4RMTA 4FYTA 1S9YB 2G75A 4Z7NF 1MNGA 5I18L 1BQHB 3FU3A 1I8KA 1S7UB 4R7NA 4G82A 1HXYA 4TUKH 3W0WA 3UBXG 2ICEA 5GQBA 4M1CC 4J23A 4PJHF 4FFYA 4WFGD 4IHOB 1AY1H 3V10A 4Z7WB 3D5OF 3KPRD 2AHIA 1GS8A 2GUYA 3TO2B 3SE6A 5I23A 1YQVL 4GXUN 4KZEL 3ZO0A 3GSRB 1BFVH 4FTVB 4M3HA 1QEWA 4LVHB 4ZQKA 1PD3A 2HJFB 4YIQB 3MYZA 3QG5A 4X62B 1WG3A 2J8UE 1KOAA 3BJ91 2G4EA 4Y1AA 3QIUD 5D1XE 2AJUH 5I6MA 3A6BH 2IV8A 1UCBL 3SQBB 4ABWA 4E42A 2BIQA 4JZOA 4FAAB 3NZHH 4M8UA 2L3BA 3MRHB 2ADIB 4FQ2H 3GXFA 1Q6HA 2CTPA 3BEHA 1JOIA 3VI4B 4NQEA 4OLUL 2A5UA 3BESR 2NXYC 3L5JA 4JGMA 4HIIA 2BTOA 5JO5A 2NCEA 1A6ZA 4NLHA 2ZPKH 3RVVD 3NZ8B 5B4MC 4YHKH 1P7KB 5KTEL 2YPVH 3SGEH 4OIIL 4TVUA 3UGUA 1BD2D 1A8JH 4YC2C 3CN3A 1UD3A 3ARVA 3MRNB 4JO1L 1JZEA 1UB6A 3L3OA 2GSGA 3NFPB 3MNWB 3EJSA 5DQ9A 2YRPA 4R4ND 3FFQA 4YDKH 5MHSE 3BXNB 1HQRA 2QM8A 3MXWL 4HV8B 4MBOA 2YAPA 5DO8A 4EZMA 1LEKB 4JJOA 3F64A 3ULVF 4IGBD 3AS0A 4FQJL 4KROC 5FF6A 5F9JA 4DPRA 3EJZD 3N43F 5IVXB 2WWMC 3RKDC 3C5JB 5LGNA 2E7DA 3EJYC 1RSOA 1WICA 1KV3A 3INUL 3V5KA 2HXAA 5GGRA 4LCUA 4UFZA 2B16A 2DWDB 4DP6X 5ICXB 5FDWA 3GSWA 3BJLA 1G1YA 1IBFA 3QCVL 4WLCA 5I8EA 4EEQA 4ZFOB 5I30L 5IKCB 3CCSV 1VGKB 3FO2A 2MEJB 3TO4B 3KPNA 4UT6H 5SV4A 1JIBA 4CDGC 2ZCKH 3G6JE 5BOJA 5DEGA 1YO4A 3FRPA 1I8UA 3FSVA 4XNMA 2WSDA 4PJEF 3RBGA 1WAZA 3UBFA 3VRLE 4NZUL 3IN2A 1VFOA 3D9AH 1RXLA 1S9WB 1MFBL 1DJZA 2BSBA 2IWFA 3FOMA 4AHCA 2ZXDA 2YFOA 2EEFA 3TH2T 2N1TE 4HEME 5KSBA 2UZIH 5TH2B 3ZRCC 1ZTMA 3L72H 3CZSA 4WDIA 3ZDXE 4P46D 1MWOA 1IKNC 2IAAC 3RZCD 6PCYA 4FNSA 1XGQA 2ZM6O 2CLRB 3P9WB 1HKLL 1K5NA 4LIQE 1JTOA 5GRZA 3B2MA 1ZHLB 1A3RH 4PY7A 1GM9A 4L05A 4HFWA 1PNMA 3CEIA 5GSRA 3VXPA 5BVPL 4X64O 2KLRA 4ODXA 4WHYH 5HYQA 3AG1C 3FAXA 2H8PA 1G7LA 1G7MA 3C5ZD 4KK5C 4OZGB 3T77A 4MHHG 4Z3JA 5FC9A 2AQTA 1JPTL 1J8SA 4KRNA 1X5GA 4IOIA 1KCBA 2VDNB 5LMNB 4WGKA 3K04A 4IIQB 5D8JH 2OSWA 4YHPA 4NDMB 2X4OB 2R56H 2D3LA 2DL2A 2HJKB 3MKGA 4UAHA 2ZE0A 3DIDA 1CFTB 3GO1L 4FJZA 2ADGB 3KEDA 3ZE2E 4DF9A 3FB6A 4XNZB 1IX2A 4ZW7A 1VFBA 1PG7W 1U2YA 1VQOV 6PAZA 3TS8A 1G9NL 5LA6B 3G5YB 1YEJH 4HGWA 4ABMA 3QISA 1M4KA 1VEWA 4X5WA 4RWYH 3CCRV 4GKKB 2FB4L 2HVJA 1VSCA 1NC4D 2JK5B 4PBXA 1R3LA 3OEHG 3DECA 3TIDA 3L7EB 4JI7B 3RTQC 3I9GL 4M43L 5FYLD 4KO5A 3CFKA 4Y19B 2XFXA 4R96B 2IMNA 1ACXA 1KCVL 4QPJA 3UBXI 4JB9L 5ADOL 1VFAA 1R6KA 2YGQA 3CVDA 4HJ1A 1RPQA 4JFVA 5ETUA 3RL2A 2J73A 3D3VB 1XD1A 4HBCL 4UZGA 5IFHH 2GT9A 2HMIC 4K94C 4MYPA 4XBMA 1K4DC 4YEEA 2A74C 5JHBA 5IB1A 4CW1A 3SOBL 2RIKA 2W0KA 2CG9X 4RO2A 1RL1A 2ZZUT 4N22A 4QRTB 4B9JA 4ZD3L 2XN9D 4MJIA 1JF1B 3ARFB 3LN4B 3SZ6A 4DP4X 4EB6B 3TOPA 1EEZA 5C07A 4GMTL 4JG5A 2BFGA 3DVGB 3IETA 3NJVA 1L3WA 4KC3B 4EF3A 1KDIA 1EQWA 2FBRA 5SX5H 1Q9KB 1ZTXH 3BFQG 1CFQA 5L4FA 2Z64C 1BJMA 3AXIA 1DN2A 3F5TA 2FIKB 1KTKE 1PJ9A 4KDVA 4JY6A 4B3TO 3WS3A 4PCKA 4ACPA 4MA3B 4YZFE 5BJTA 4X9QA 3UO3A 1U8IA 4X7TA 1MJUL 4X5QA 1OCOC 1NVPB 3ASOB 5MENB 4FM0A 4LNUB 5TK4A 3GB7C 1ZRUA 3HZMB 2GQHA 3TA4D 3RIFK 4Z7OB 1Q0XL 1FFNA 1OIOA 1QATA 2FLBT 5FM5O 1WSST 3ZE0E 4BXVA 3D4CA 4XBGB 1UXSB 3QHTC 4OLEA 2CLVB 3GHBL 3KD4A 2APXA 5ICYB 2XXGA 2ZG3A 3JTTA 4U1LB 3MJ8A 2A6KB 4KZ0A 3C87A 5E6ID 1OQOA 4NN6C 4W4KA 4HZAA 2EEDA 1P84F 1TF4A 1V54C 2DQTH 2E5LB 3O3DB 2I60L 4NT6B 4FM2A 2W88A 4I8DA 4K2UL 1R3JA 4MB3A 4UV4L 5CM1A 5CIPH 3SCMA 4NP9A 2CGRL 4DUVA 4GFXA 1OCRB 3K06A 4L87A 4KPHH 4ZG1A 5E2TH 1M1XA 4CILA 3G6JB 3TEXA 3V0VB 4RQQA 1JJ2U 1RJZA 3KYNB 1EAQA 1HCVA 1S78D 2OIGA 1RZKH 1JGVL 1UT9A 2JKLA 2Y72A 3HOGA 4GRWB 4MDRA 4WO4B 4X5RA 5D1ZI 2Q6AA 4GAGH 1JPGA 2XWDA 4B7EA 3F04A 3H55A 2EBOA 4ANXA 5I76A 2P5WA 3JT0A 4XCYB 2B5UA 1V7NH 1ZT7B 1GZQA 1FYTB 2XAFA 4OGXL 4R6UA 5CEYB 1IE4A 1HNFA 1EVUA 3AU1A 3EJCA 4AQ1A 4ZMPA 4DEPC 1FGVL 4WK0B 3ZDXB 1H3TA 3ILQC 4WV1A 4NQCB 1BE3H 1MF2H 1MFDH 2GJPA 2PCFB 1ONQA 3UAAA 2A73B 2BOBA 1XCTA 1Q82W 4E41A 2I85A 1P69B 2EACA 4LF8O 2EIJB 4PJDA 4XO4A 2MJWA 4NQXB 3OW2U 2XLLA 4M1DH 3VXQA 1UZ8B 1YN6A 2JRIA 3OKOA 3P2BA 2F08A 4GY4A 4TUUA 2Y6SD 4WU5B 1YSOA 4Z0XB 2ED7A 5H2BA 3HKBB 4X7SH 2BIPA 2FJSA 3JT2A 4HGMA 5EOCJ 4P5TA 4BR6A 3MR9B 3VFRB 3WEOA 4QWWC 3MRQB 4QLWA 1OTUC 4NQUA 4ADJA 2LU5A 5HPMA 5E2WL 3DJSA 4EXPX 4XAWL 5JORA 4N9GB 1WC7B 4P2OB 5HI5C 4G72B 3F7VC 3QQXA 3N2KB 3GDBA 4Q0XL 4HCFA 1OK8A 4RBPH 1A9EA 1OWWA 4OI7A 2AABL 3PF2A 5CEZH 2DWEA 3HR0A 4X0KB 5AOJA 3V95A 1N8ZB 2RQ8A 2VXQL 3GXDA 1LP9E 2K6YA 3C6LB 3BI9X 3PWVA 4L5FL 4ZO8A 2YMXH 1FL5A 2HFFB 4P2RE 3G6BA 3RDTB 5C0GB 3OAAG 3AABA 1VERA 1LYQA 4FXLA 1HQ4A 1WAAE 1E2WA 5DA0B 3WY2A 1UOKA 1F4WH 4QHUB 2VDNH 3KWVA 3KGRA 5EZYB 5GONA 5BW7A 4CNIB 4FFKA 3GJEA 4NENA 1LEIB 1I8MA 4YH6A 4P48A 4XN4A 2IWGA 4HLZG 2VJ0A 3CLFL 1GN6A 4X9GA 3X11A 3NAAL 5HYEA 3BQUB 4JFDE 1RKRA 1W72H 4F8PA 2B1HH 3MDSA 4RRPM 1R24B 3W7UA 1NFDA 2Q0AA 2A1WL 1QO3A 4WCYL 2P24A 2DJVA 1RUKH 3QXDB 4FHKA 2QTEA 1Q8IA 4M56A 2XKUA 4QXTB 3RA7H 2O61A 3QRGH 4UDUB 1PQZA 1K6QH 3FH5A 2ZKWA 4WI4A 3KWTA 1YN7B 1RAMA 4XCNA 4XWOC 1CLCA 4EN3B 1GC1H 4UNTA 5D5MF 2DI9A 3VE0A 1BMWA 1Y6KR 2X6AA 4WFGA 5KUMA 4XXCA 3C8DA 1EBAA 3BP7B 3F84A 5C0FB 1DF5A 2F66C 1QOKA 4FXKC 3BZFB 1AHWA 1JXGA 3KPRA 5DJDA 1R3KA 4KXRA 1A65A 3GHEH 3ZGHA 4MS2A 1WBYA 3PHOA 4LQFH 4MQ7B 4ICGA 4I9QA 2N7AA 5B1JA 2AFNA 1FL3A 4ICWA 3BABA 2OZNA 5IVXF 1Y18B 3PWLB 4G43B 1MA1A 1CPYA 4JFPB 5C08E 5DK0A 3ZEDA 5HJBA 5SWZD 1U4FA 4HHGA 2IALB 4ZW8A 4F2EA 1DVYA 1CDIA 3GJFK 1D7FA 5IQ9A 1NWPA 4YBLC 1MREL 5I74C 3I2CH 3RLSA 4PLNC 3WTXA 3ZMSA 3CD6V 1Z3RA 1NGXB 2WQVA 1WQVT 3TV3H 3UAJC 3ZUCA 4A2MA 2P5OA 4I4WB 1QSFB 1BD2A 1C5DA 3K71B 3QUYD 2J5LB 1BQLL 3L3GB 2BS71 4BXSV 4NIKB 5C3IA 3QEGH 3TA3D 4ODHL 4PREB 1PEWA 3NCJL 1PD1A 2HLFC 2PP8A 2QHRH 3B9EA 2QLVB 4C47A 2XV6B 4LOUD 5FKAA 4U3JB 2ZSVA 3RHWF 2J44A 2B1AH 4NSKA 5LGJA 2OMTA 4IGBA 4B3MO 1XF3B 3AVEA 4KJQD 4F2MA 3VFPA 3IGKA 4HW6A 4P9MH 1FRGH 2DYRC 2IGFL 4HQQL 4Z3TA 1CBJA 1T66C 2Y4TA 3FF8A 1KCLA 1NEZG 1HH9A 4B5EA 4IQHA 1W9XA 1XCQA 4ZHQA 2VQFB 2R1YB 1MQKH 3IGUA 4G9FE 2K4AA 4UV9A 1E67A 3CXFA 3TWYA 1P4UA 2FHBA 4DGVL 1JZ3A 1DQJA 4Y1TA 4OZGF 1QRNB 4JKPL 1TZIA 3CH8A 3KPSE 2LFGA 3LAFA 2ZF9A 1H19A 3ZMEA 2Q67A 3CV5A 5J5EA 3SO3B 2YIDA 3EUUA 5IJVB 1JP5A 3P0VL 4GRWH 5C0RL 5L2JB 2HKFL 1VF5C 2MCMA 1IFHL 4ZW3A 2Z8SA 4AI7A 3AACA 5B3SB 3FPXA 1NIDA 3SDXE 1ZLWH 3RZCA 3D3IA 5JOPD 1ZV9A 2ID5A 5C2BL 1IIKA 1TSHA 3L3HB 3P30A 3MGAA 5CSZB 4AQEB 1OP3K 3OTOB 2OYPA 3VSVA 2L7UA 4EI5C 1KIUA 4WTQA 1KCKA 4N23A 4JKMA 3KZIZ 2GVYA 4RNRB 5CR8A 3P30L 4RAUA 5IYCO 4C56E 4Q14A 2Z92B 1C16B 3C5ZA 1UKSA 3EH1A 4TSBL 3UBGA 1EHLH 2AK4E 3DJZA 4RFEA 2JJUA 4YLBA 3QF7A 1MRFL 1KXVA 1Q6IA 1NOFA 3L95B 5K59E 43CAA 2E76B 3S3PA 5IW6A 4N2FA 5JW5B 4LGPB 2ZQKA 1EJ8A 3QG7H 1SOQA 4N2GA 2ZCLH 5CP7B 1KB5L 1OF0A 2J8UF 2HJFC 1UQSA 2HFGL 4PRDB 1VEMA 1QRKA 3VXUE 3FCSA 4HOXA 2QPFA 3Q5YA 3OUFA 1E5BA 2YUXA 1HHKA 2P8PB 2BNUA 5FKPB 5CCKL 3QUMA 3TT3H 1KGIA 2A7BA 3I85A 3UTZA 3D3QA 1NC4A 2YPLE 2BIMA 4IBQA 3QT2A 4F1ZA 5F6IB 1C1EH 1EFXD 1N68A 1TNNA 2ZDIC 3NQKA 3P4OA 3QUML 5AVTB 5L7XL 1JRHI 5J56B 4KKAD 3KCPB 5IUCA 1BQ0A 2CR0A 1MCPH 3BSZH 3GD1C 4ALAC 1B6QA 1I9JH 2ZKHH 3UOAB 4OI8A 3D05A 4DW1A 2BW5A 5FYLL 2XWJB 2DBJA 1MFAL 3ZBHA 2AAVA 1P5UA 2BSRA 4Q89A 4PV9A 2AJVH 4CMMA 5A2JH 3DVIA 3US9A 2QSQA 2NY3D 1NCHA 3E3QC 4TQFA 4AYFB 3LEVH 3IXTA 3P9LA 4Y4KB 3GBDA 1NCNA 1RZKC 3BPLC 3S88H 1WD9A 35C8L 3GXIA 3MGOA 3QCTL 3K5RA 2XN9A 4GQQA 4N25A 1HL8A 4UQEA 3MCYA 4W9CC 1E4KC 4JVWA 5EO0B 3WXVL 1IAIH 2PPEA 3NCYS 4CJ0A 3CPWU 3VWKB 1L6ZA 3N9GH 2WPGA 2F2HA 4JMNA 3PWUB 2UUDK 3ZHQA 5AUMA 4A6YA 4ZS7H 3BZEB 3GSNA 1T5WA 2Z35B 4LDCA 2EEXA 5SWSB 2OL3A 4HZLB 4JZJA 5CN1A 2Q8BL 3G6JF 4E2LA 2CRZA 2LAGB 3TO4C 3JSSA 2FH8A 1XSOA 2VQ4A 4F93B 2GTWB 3LDBB 4GRWF 5DLMH 5KYWA 4NUGL 5KVFE 4LHUB 1VA9A 3F83A 3VRLF 3V0FA 1Y07A 2MTAA 4AH2A 1YZBA 4UQAA 3VXMA 4KDWA 1LO5B 4NLAA 4KKCC 4NJAL 1IBLB 2UXCO 3KYMB 3QUKB 1GGTA 4KTEH 2FECI 1E8WA 6TAAA 1AI1L 1CDCA 2A9NL 4A55A 4JUTA 5F7AA 5T1LD 3AGVA 5D1QA 4CGUB 2O5YL 3ZDXF 2L7JA 1TU2A 2A6IB 4G80A 2XWTB 4PRAA 2F53D 4BINA 3QARA 1HDJA 4O9HL 4LRIA 3LKRA 1GY1A 5E6IA 3V4VA 1XB8A 3AADB 2C9UA 3P32A 4X4XB 3EDKA 3PRZA 2QA4V 4X80H 1LR1A 3EBHA 5KA5A 4G9DB 2VXUL 3V4VL 2Q10A 4LSRL 3QQDA 4IJ3B 4M8QB 1NLDH 3BHBB 3DUHA 3MRCB 3ECBB 4HFUL 4J6RL 4YHMH 3QEHB 3MV7A 1LUWA 4KFMA 1IQWL 4DN3H 3FYIB 1DEEA 3AZUA 1VCAA 3GTNA 3AM8C 2PWGA 3TK1A 4MVBC 2QSAA 1ZA6A 1TVKA 2C1OB 4IIQC 2ZKMX 1WLEA 3VJ6A 5KOVC 1FFPB 3IU3B 3WXWL 1V8HA 4IMKC 5CSGA 3ZE2F 1F8TH 1DTUA 3O2VH 1TEFA 5I0WA 1OVZA 3QULA 1WHPA 1EGJH 4DV5O 4UCVA 2HN7B 3DC5A 1V5JA 2G0KA 3DX9B 3SDCD 3IVKA 2K8QA 4Z77A 4ELME 3MA7B 1XEQA 3E7JA 4KUCF 2APVA 3VDAA 3T0WA 1ULVA 1DL7H 2XG4B 4TVPD 4DTGH 4XMUA 2H3XC 3LVTA 4JPRA 4Z9KB 1GC1C 4GKJO 3GK8L 2G3NA 5GRVK 5EN2B 1BVKA 3ES6A 3ZT5A 3IFXA 2EDJA 2NR6A 3DLQR 1AAJA 3OGIB 4DR1B 4PBDA 2VS0A 3ME0B 4UIKH 2CDFB 2UYLB 3LS4H 1RIVL 3RB5A 5CJXC 1YEDA 3WFVA 3HN5A 1AQ8A 2D7NA 1FFQA 4I88A 4IHJA 1C08B 2ZUSA 4JR9H 4XMWA 4BCXA 1NGZA 3D2TA 1QWUA 1SMOA 1D7BA 2B1IA 1FORL 2BXZA 3L9YA 2DPKA 4HSAC 3EYUL 2C3GA 2VDOL 2YAMA 5GISH 3DWTA 5E00B 3ARFC 2ZXWB 5C0IA 3QUZB 5LBSA 3QR0A 1J1XL 4BZYA 5E5MA 1JGDA 3MCKA 5D7SL 4Z7NB 4QHNA 4JCWA 5F70A 3FB5C 1MFNA 5JHLA 4ZUWA 3E1ZA 1F11A 2X1QA 2AHZA 2CTRA 3LXUX 2VH5H 4JM2F 3QYCA 5IWLA 4Y4HB 2K1EA 2XIIA 1WO2A 4PJFA 2IQAA 2VRAA 3HE7B 3J2PA 4XP1H 3TWCL 5I1HH 2RCSH 1L0PA 3K2IA 1A3QA 2HZHA 3T1FB 3AJ7A 1G7QA 2Y7OA 4D9RE 1E2VA 4I87A 4KK9D 3ASOC 1ORSB 3MLYH 1EHAA 1LE5B 4KKZA 1RPRA 3ZE0F 5A6MA 3U79A 1HT6A 2BP0B 4H1LA 1JXFA 2KKWA 1DDHB 1R5IB 1TQCB 1DSFL 3A67H 4K3JL 4R83A 3L9RA 4K5LA 4RSVA 3CRAA 1ET7A 2BOCA 1LO0L 3CHPA 4MA8L 3STLA 3UX9B 3IF1B 4KX9A 1KIPA 4XNXH 4WWOA 4CKQA 3V4PB 3G5XB 1O6SA 4BZ2A 5F71A 3JAMN 1FJGO 2FE0A 3EO1A 4MS6A 4JYBA 4P4RA 5MEOA 5C8JB 2PR4L 2Y5QA 3TCLB 4RQEA 3LZOA 2CO1A 4K7FB 4IKJA 2EQDA 4U7MA 4WWKD 1AH1A 4S1DC 3BO8A 1MCFA 5E7BA 3U6RB 1G7IA 5AW6B 1OCRC 2OI9B 1EZUA 4J4PD 4KUZL 4ZAKC 2WUBL 5SWZA 1VF7A 5B1AB 2XQ0A 4WO4C 5EFIA 1GZPB 3ESMA 5F0MB 2JI3A 3SGDI 3LJ3A 4P9OA 5I8OL 4PMFA 1JNHB 5IMMB 1EAJA 4OLWH 1U8OA 4FQHB 5HVHC 4R2GB 2V9UA 3O3EA 3SN6N 4KNQA 3LNDA 5I6KA 3Q0HA 1NL0L 3MNVA 1RK1B 1OP5K 4FZ8L 2KH2B 4W9FC 1HXMA 1PL4A 5AW0B 3QUYA 1KG0A 5J6GB 2WYHA 1DBBH 3CQPA 5AQ0A 4ODVH 1ZVSB 5GGQH 2MOVA 1NMAH 3VFNA 2EIJC 1YNKL 5AKTA 3TA3A 3MRPB 2EVGA 2NRDA 3B40A 1WAPA 3U0PA 3CXDL 1F4AA 4J5VA 4DCQB 3SGJA 2O6FA 1OEZW 5I19L 2Q7YA 4WIQA 3CVHA 3FU5A 4S1RL 3SGIA 3VDBA 1T1ZA 4BRJA 2GSIB 1A9BB 4KRPB 3QFJD 4MMXB 2HG5A 4FG0A 4O2FA 1W0VB 4XVJH 5EG6C 5DJ2B 1BM3L 1FNSL 4MKTA 4PJ7B 5CN3A 1HCFX 1BAFH 1GGYA 2VABA 3THML 3WIFA 3VI3B 2KQMA 1UA6H 3GJFB 4YXKH 3E22B 1H8LA 2AKRB 4O51A 3LQZA 4P2OC 4OJAA 1FC1A 3GUFA 4HH9B 3A0BZ 2H1XA 2QVKA 4U6VL 3WS6A 2BNRE 1CWVA 2VE6B 4ABVA 2RCVA 1A6PA 3QAZB 1CFNA 2OQJA 1I94B 1Y6MR 4GP8B 1BF2A 2Y69B 1ES0A 1F3DH 1LP9F 1BYOA 3C8KB 2WO2B 5EEVA 4MVMA 1J10A 4JQXC 2QKIA 4WJ5B 3C6LC 1UZGA 1EIBA 3L1EA 3RDTC 1DTOA 1WAAF 3PXLA 3POCA 5J1AB 2NY0B 2CJ3A 3EYQC 4XP5H 2YKKA 5F9AC 1HVXA 1AQDB 4TULL 4S0TD 1H3VA 2CLZB 1F2QA 4N0YH 1NINA 2B9AA 3D39A 2QQKH 2FL4A 1WAEA 2YXLA 2Z8WC 2VDKB 3BQUC 3FQ2A 4GSDH 7CGTA 4Z7UA 3D25A 3HMXL 3IJYB 2DM4A 5CEXA 2DV6A 4AQAB 2R8SL 2Z93A 1TQVA 9CGTA 3OTFA 2ZYSA 3DVNA 2XZAL 4KHTL 3FQWB 1TENA 4XP9L 2R0ZH 1XZ0A 5EU7C 1MI5D 3K4AA 3S9DB 3WJMA 4LBEA 4KVNL 3SDYL 4PTTB 3WJJA 5EO1B 4J2XA 2BHZA 1KMGA 5HY9B 4ODTL 1T89A 2UVFA 4N2CA 2XETA 3V0HA 1D5ZB 3O3AB 4OTXH 4JQIH 2D3VA 5CJ8A 1EDHA 3GEFA 4OQ1A 3L3IB 5IBTH 1KN4L 3IFPA 4Q9BA 1TTAA 4O5LH 3PJSK 2X12A 4K8RH 1M6OB 1P4LB 3MBED 4BQ9A 2ZCZA 4HZ1A 1K8AW 5KYYA 1PY9A 5ESAB 1CDYA 3WEMA 2SODB 4F58H 1ZEAH 4I0KA 4F33B 4Z76B 3KLDA 3QWQB 4I55A 1B9ZA 3CK0L 2BZCA 1EJOL 1CICA 3WG7B 4JI4B 2PYFA 2NDGA 4UV7H 1AGCB 5IT9N 1NH2B 1LWRA 5FLUA 3O0RL 1EFXA 4NCDA 4RMQA 3ULSA 2VMFA 1NAKH 4HJGB 3A23A 2YBRB 4B9CA 2EC9U 4H4NA 4UYPA 4W9LC 3U11A 1A4KA 4WUUB 5C0DB 1CE1H 2BWDA 5EYPA 3U46A 5TD4A 3HG1B 4HKBB 3TJEL 1Z5LA 1IEBB 1HK6A 2WXNA 4L1DA 5EORL 5E2UL 1KBBA 1I9RH 2APTA 1XZWA 3PLYA 4JFWA 4AT6B 5KUKA 3SSGA 3BMWA 1YVWA 1WS7A 3H7BA 2X6UA 4FNLH 4ZTOH 3DIVA 3VYOA 4QHKI 2Y9RT 1YYLL 1HEZB 5DRZA 2W0FB 4L4VB 3T2PA 5K9QG 3S0PA 4PJ5A 3MJ6A 1SEQL 4QTFA 3SBPA 1QYGH 2DQEH 3KPTA 1NR1A 3IJHB 4X0NA 1SJHB 5HGGS 4Q9RH 3TL5A 2A83B 3NT0A 2VAAB 3HTLX 3NCXA 1XGYH 3L4TA 4G8IB 4K71B 5ANME 3DETD 4DR5O 3OHMB 2M8XA 3NIFE 2QWRB 1OAQH 1RUPL 1V3MA 3EGDB 3M07A 5EIVA 3B43A 4XP6L 4PLJD 2NTFB 1UH2A 2J1XA 4QNHB 2X1WL 4P5SA 3V0WL 4Y89A 5F8RC 5EIBD 5PAZA 1I8IB 2OMYB 4A2DA 2D31B 2XX0A 1UPGA 3G6DL 5EULV 4TUYA 1P6WA 4CN6A 1B6DA 1OAKH 5I16A 2CDGA 3FJTA 4OBSA 3SO3C 4OM1L 5F89B 5F9DC 5GS0D 4N5EC 4N85A 1FJ1A 3RIFF 2DL9A 2FATH 2Z7WA 5T1LA 1GIGL 3JBG7 2X53A 3CFBA 4NJ9H 2OM5A 2Y36L 2F53A 4RGNB 3VH8A 2LLNA 3EF4A 5KZCD 5B3SC 1TTFA 4LSVH 3DSFL 5DD1H 4G6ML 1GYUA 3QI9B 2FZ3A 2ZTBA 2JKTM 1VACA 1ZGLB 3CFEB 3UTSE 3WB2A 4UBDC 3QJZA 1CK0H 3UP1A 2L35A 5D1XD 4NXMO 1OF2A 2OKMA 1CGTA 3K2MC 4WSJA 2NY5L 3GT6A 3H3PL 3QJHA 5EOQL 1BVNP 4PW3A 5KBMA 3WNJA 4OCWL 3DPDA 5E94A 5K59F 1MFUA 3M1BB 1W0YT 2WVTA 2X2YA 5LG6A 1KGCE 2X9XA 2M2DA 4X1IB 2Z8VC 5INDA 4Z6AT 1Y6XA 2J8OA 5T5FA 1R0AH 1CFSB 2C1PA 1JVKA 4LLYB 2QVIA 3A47A 1CL7H 3QZWA 3AXLB 3VVWA 2WNGA 4ONHB 3GJFH 2C8NA 4B50A 2VR7A 3SDCA 1NDMB 1TVBA 3CFIC 1YPZE 3II3A 4B9YA 4HXBH 3OKEA 1IIIA 1RSFA 2B0SL 2V8MA 2XPYA 5HHMB 1OSPH 2HH0H 2FWOB 3LRGA 4GW4A 3R7RA 5F6IC 1AR5A 1TUBA 3CX5J 4U6HB 4X4YB 4UT7H 5DMIH 4EDWL 5MHSD 3TEUA 4NZ8A 4H8PA 3BVTA 3JD4A 1K85A 4YQXH 1HNXO 4TVPL 4PGJA 4GSRA 4XPBL 2Q86B 4PRPE 4MMZB 3PDGA 3GKWH 2P1YA 2MQ0A 3SR2C 3UBXA 3W37A 2G60L 1KPUB 4F9PC 2PW1A 2LW1A 1I7ZA 1JV2B 2J2ZB 3O6KH 2OYMA 5EZIH 4JG0H 1A3LH 4NYLA 1HIMH 2YPKA 3KLKA 3SBRA 5DUML 1DR9A 4N0UB 2VDKH 5I5MA 4Q8BA 1JG9A 4MJ5A 3RGVB 1EEYA 4JY4A 2VRKA 3G5ZA 1FG2A 3RYMA 1HWHB 2CIIA 3WE1A 1ZL8A 3MACL 4Y4KC 4UINL 4UQ2B 5MP6H 4IRZH 3F00A 1OCZB 3ILEA 4K9JA 3H54A 1MEXH 2L7EA 1WHOA 5DRWA 4YOKA 3K6SB 2LGWA 3TBSB 2BJML 1TJMA 2FJGA 2ZE7A 1NLBH 1X7QB 1JMKC 4OZFG 1HOEA 5EIIB 3VWKC 4X2UA 2J20A 4PHXA 1N8OE 3BPNB 3PGDA 1CP9A 1A4JA 1DVUA 4ONFL 3MRMB 5IYZA 2X1OA 1YJDH 5JIQA 4M5YL 1ITCA 1GM8A 3MCLH 3ZBMA 5KAQF 2HG0A 4ZFFA 4RQFA 2VMJA 5CLTA 1T2QL 4GXVH 5AAWA 2I32A 3CHRA 3RBZA 2BDNL 4IOSD 4F57H 2EXWC 1A7QH 1EXUA 2MH4A 3LS5H 3WHE0 3PAYA 2X44D 3T0VA 3X1GA 4UUJB 4HBNA 2X4TB 2NUPA 2XVKA 4AKQA 3FU7A 2YD1A 3PG2A 4XBPB 4H20L 2D7OA 4UOW0 3DGCR 4YAQB 5CB4A 4JPWL 2NMSA 1OP3H 4DEWA 4DKEL 1XGTB 3ARPA 3DX4A 2PCPA 5IOKA 1MCJA 3GS0A 1IGFL 1X6NA 4EDXA 5T1MA 4HXAH 3HR6A 3IE9A 4N5UA 1AOZA 5DJCB 1E4WL 1SMAA 1IBGH 3QIWB 2XZCL 4LRNH 4WWKA 3HHRB 1SESA 4IJ3C 3MRDA 4O2AA 1DSWA 1HH6A 1R47A 4MJ2A 5BZWB 3V9FA 3PQYB 2F54A 3DOHA 4HD5A 4QOKB 4LCCB 3QORB 4J4PA 4YHNA 3S36L 2VR3A 3DV6B 5HDBE 4YEFA 1KEMH 1OGTA 4M03A 1SRDA 4KUCD 1KXTB 2TSBA 4X98A 1XSKA 2YGOA 4PJ7F 4LE8A 4GQZA 1Z6JT 1E6OL 1MCWW 3O4LA 2F43G 1CJYA 3JD3A 3B37A 4LLQA 4OJEH 2YK1H 4UT9H 2R1WA 3GRWA 2SEBB 4Z7QB 4HF5L 4XNUH 1D6EB 1A7OL 1P1ZB 2FQFA 4RCAA 4ATTA 2XU9A 2EEAA 3D48R 2BTQB 3KPPA 3X13B 3EYFB 1S46A 3GRWL 3WY3A 5AKVA 2EABA 2RB8A 2EYSB 1UH3A 4PJCE 2W80C 1TG8A 2AI0L 2ZSWB 3FC8A 5JR1H 2VLRE 4HC1L 1AGBB 1UA7A 3CMOL 1K97A 1SXSA 3T6VA 1TYEB 3FU0A 3C09B 4YSSA 2ZD9A 1R3HA 4NX0A 4RFNB 2ZXQA 4P4KA 3UTQA 1YITV 2XHNA 1RZ8A 1WEJH 3BKJL 5TGBB 5E2VH 4GQRA 4H2AA 3QFJA 1TFPA 4NAMA 3OJVC 4RAIA 4POYA 3OKNA 3NSDA 1PSKH 3FW6A 4U1KA 4K8RC 4RMUA 1KTJA 1N34B 4LFCO 2Y4SA 4JFOB 2I9TB 3JASB 1QASA 4L3FA 1ZSPA 4J28A 3RWHB 3K7UA 1WYJA 2H2SD 3CFMA 4WI8A 2EULA 1F56A 1I1YA 2JH2A 2F23A 2XWBA 4N8CL 1GYWA 1P4IH 2UUDH 2J21A 1WA0X 4GG8B 2JSFA 3JWNE 2KS0A 4JFEE 1A6AB 2ZXWC 2MIZA 4B95C 1RZJL 5L4MA 2EIZB 4FNRA 4X4ME 2FKXA 1GM7A 1PF3A 3VGGA 4Y4HC 1RHHA 3VXNA 3HI5H 3BC9A 3AAZB 1I3RB 3HE7C 4WJG3 3L9DA 5B3JF 1HNWO 4LLWB 2V17H 2Z3YA 4I0PB 1PKQA 4A7VA 1F58H 1OL0A 1MI5A 3GSVA 1BDYA 2WTOA 1XCXA 2D7QA 1TQCC 5T1DL 3PHQA 3FCTA 2YC1B 2WWKT 5HVWA 2VXTH 4CVXB 5ITBH 2F68X 5LP6A 2K6ZA 3GSOA 3IJSA 3K3QA 1T20B 3MGTB 4PRHB 4TPRL 1AR1B 1FLTX 3ZRWB 3ZL4H 3N44F 3TZVB 3MLUL 2R29A 2WANA 1G9HA 5I6PA 1IJNA 2XQBL 3WD5H 3MBEA 4ZS6C 2GTZB 2OI9C 3LV3B 5DHEA 3EFOB 3OMIB 2GB2A 25C8L 2VLJB 3PIQA 3Q8BA 1ERNA 4UMSA 5F1NB 1B4JL 1M57B 4JL1A 3IDGA 5B1AC 1MG3C 2XAQA 4B3TB 4J80A 4NKOB 4O4YL 1NUDA 3FKSG 2HT3D 5TF1H 3W56A 1HINH 4M48H 4HJJH 1JK9A 2FUTA 5HHNB 2R0LH 1Q3EA 3NCEB 4LSTH 1TIUA 1BS3A 3FQRB 1JHKL 3L1OH 2V3EA 3ULUE 3HG2A 1PLCA 3IWUA 4AW4A 2NDFA 3EOBA 5BMFH 1OT4A 2EDYA 2H3NA 1A5FH 1CT8A 3WN5B 4JQVC 4CADB 1OZUA 2LQTA 5DVMA 1NANH 5IB3B 3PJSB 1PU0A 3QWOB 3AEIA 4PEEA 3NCFB 3SE4A 1KCSL 3GRGA 1BQUA 1QBML 2XASA 1PZ3A 4A66A 3FDWA 4MMXC 4P2RD 5T3XL 5DZPA 5IREA 3PCYA 5AALA 2YAHA 1RJYA 1WB8A 3I02A 5ID1B 3GUTB 3US0A 2DQJH 2R69H 3L4ZA 5E6UB 4KY2A 2QJ1A 2B7DT 1BJ1H 1T0NA 1O75A 1F90H 2H6OA 2LV4A 4JI2O 3JALB 1DUYB 5BQ7A 1A1NB 2Z8RA 3ARDD 1T03H 1WFJA 4L1LA 2PTMA 4JFDD 5D6DA 4DVRL 1CFVH 5DFVD 1K3EA 3GKZA 3QAZC 4LKCA 4HCRL 4QO1A 1KWKA 3DARA 2Y69C 3ZX1A 2AEWA 1A14H 1TJHH 1HE7A 1J8HB 4OZHB 2Q76A 3HUJB 1OB0A 4HMEA 4N8VG 1KKDA 5HGBA 3F7LA 2YEZA 1RK0B 1SQFA 4PRID 3EYVB 1X5HA 4KKQA 2N59A 2IDCA 3C75A 1DVFB 2A3QA 2CE4A 1MCKA 1D5BA 5A3ID 3P73A 4AGQA 2B14A 1U91A 3HN8A 2ZWKA 1A1MA 2EH8H 1ZHBA 2WBKA 3HMWL 4S11A 6CGTA 4DFHA 1RQ5A 1RLWA 3WTTA 2I5YL 3SBWC 3UACA 1LO4L 1UWXK 3N0AA 4C58B 2FYYB 2VLKE 1PPJH 1DP0A 2Y25A 2ILLA 1FZJA 3A4FA 3GMMA 3HS8A 3RPKA 1ASPA 1N70A 2UXBO 4HISA 3S36X 4D0BA 1ORQB 3QZPA 2EICA 2J4WH 4XP4H 5DJZB 4O2BB 5D1XA 4GX1A 3ELQA 3A6CH 1PFOA 4L8DB 4GRLD 3BE1H 3FCUB 4N2HA 1TZGL 2WNWA 1JYVA 2AXHA 3CN4A 3D4GA 2R4SH 2XTJB 5C9JB 4Y9GA 3TN0B 4KXZI 4QRPD 3UO1H 2J6EA 3OV6A 2GBUA 4PJXB 1YUKB 5B7MA 4AUUA 3SJQC 3MFFB 1FN4B 2OAAA 4YHZL 2IU0A 5AOLA 3MJ7A 5TFSH 3GXTA 3FUNA 4CN4A 1E30A 2MRYA 3JVGC 3MC0A 2YAFA 5TDNB 3RVUC 3V9CA 3WG7C 2D03H 5C7XH 2O5ZL 3S98A 1OP5H 1FPTH 3VGAB 5FB8B 2FX9L 3IGLA 3VD7A 2Q7HA 5FOBB 5A2QN 1J9CT 1VHPA 4MD0A 3V8CA 1FKAO 1LK2B 4NO2B 4CU8A 4ETQA 1NCBH 1OAUH 3BAXA 3UJIL 1JRHL 5HBBA 1JD9A 1SN2A 1LM8V 3T08A 1XGRB 3LNIA 5HFLA 1QR1A 3DRQB 1B3JA 2FEDD 3RIKA 4LKXB 4G9FD 5ESQB 1J9QA 3RP1A 3VW3H 2A2QT 3POHA 2DQUH 5FV2A 4H26A 1W8EA 3RWJA 5IEKB 4YSUA 2ICCA 4N2LA 3BVDB 3LKPA 4JFZH 2PTTA 3BW9A 4K3AA 3WEXA 1M1SA 4Z3EA 2W0FC 4JV5O 1OAYH 2DQ3A 3IDJA 4HUUB 1U0QA 1DBAH 2OYQA 4D9QE 4TV8A 1BF8A 1OHZA 3ILPA 4A1RA 5FO9A 3EGXA 2DLIA 2DIBA 3JARA 4PJAB 3FUKA 1BQHG 3SOTA 3O45B 2A77H 4K71C 3BN9D 4DJMA 5HD8C 1YYCA 3OZKA 3APNA 3F7PC 4G8GB 5TDPA 4U1SB 4RMBA 2MKLC 1UASA 4IOSA 3FO9B 4GKNA 5EU5A 1Q1JL 3RYHB 4MNQB 5DQDH 4A39A 3AREB 1S7WB 2MFNA 3D33A 3SGEI 4G27B 4MZIA 4KNUA 3JATA 3O6MH 4R26H 2BSKB 4RRPG 2IPUK 3DUSA 3P3PA 4B9ZA 1W59A 2ZUUA 2CBQA 2GSMB 2AK4D 2F4VO 1EZVY 4Z7QF 2DDQL 2FECL 3GZOA 4RGNC 3VFUB 2UUCB 3RYIA 4PBWD 3UYPB 3PWJB 3QI9C 4QY8B 1SHMA 1KJVB 4OAWA 5F72S 1CFMA 3ZKXB 4X4ZA 3CAFA 1Q94B 2Q4PA 4XPFH 5IGXH 5J9PB 1QI3A 3FB7C 1NEZA 4BSWA 4F5CE 1OGAE 4JJ5A 3WENA 3PHAA 4MX7A 2B3RA 5D6CA 4UANA 4LPUA 3VXUD 5H37A 3BZ5A 2IJJA 4NI3A 3QXAA 4HG4J 2CK2A 4Z95L 1YG9A 3JWNG 4GH7B 1MW3A 1WUZA 4IJTA 1S8DB 2HJLA 4IU3B 3V6ZB 3QIBB 4DZBB 2YPLD 3DJ9A 3CDZB 4H0IA 3MV9D 4U7KA 4MSWA 3MRLA 5F7EL 3U7WH 1A6UH 1G9NC 1PFCA 4CVZA 3R18A 5D4QA 3GI9L 2BRRH 1RY7B 1SDAB 1OTSD 1TTRA 3OTTA 4YWGL 2QGCA 4HKJB 4K0KO 2FYUH 3LQAH 3WB0A 3N06B 4KH2A 1MIEH 1XR9B 1A6TB 3GWOA 2ZUXA 3KDMB 4FNTA 4KHXH 2GK0B 1FNEA 3Q4HB 2EE6A 1PZSA 4LF6O 1EPFA 1RZPA 2FEJA 3QDJE 5K1JA 3SDDD 5GJSL 3QJVB 4FFZA 4ZUVA 5HDOA 9PCYA 4Y4FB 2P42B 4PW4A 3SQOL 1PBYA 4E4EA 4XMKH 5LGKA 1IL1B 4CU7A 4G7YH 1PNDA 1ODAA 1NBYA 4FFZL 1P4BL 4MMZC 5KVDE 2BVTA 4Q2ZA 4H8HA 1IGTA 1SJEA 3HPLA 1I7UA 2OTWB 4UOW1 1VZHA 1G1OA 1KCWA 4R0LA 1S5IH 1DBMH 1M71A 2ITCA 4UAOB 1DBJH 2IO5A 1WIOA 1ZLDA 3RGVC 5HPOA 2XZQL 4UDTA 5F1IA 3DPBA 1BA9A 3CB2A 1IV8A 4QHPA 3P4NA 1ZMYA 5K9JL 1SOSA 1QFHA 2EIEA 2HWZH 1OCZC 2VITB 3VQLA 3LKQB 1DZBA 3NFSL 5DHVH 2WKGA 1FFXB 1VGEH 2GC7C 3GF8A 2MCG1 1P49A 3TGUH 2ATKC 3DTDA 4GB9A 3C9NB 3IT8D 1XB3A 3H42L 1OTTD 1J8RA 4Z23A 2KBGA 2BERA 2BHYA 2Y06L 4H0GA 2R2HB 3BPNC 3VQMA 1QI4A 4DP5X 1NR7A 3MA9H 2EP6A 1S7SB 5H4ZA 3CVIL 3NEXA 5EU3A 5FGCB 1UCTA 5AOMA 2ZG1A 5DJXA 3FFDB 1AZZC 3IDNA 2MNJB 4NCC1 4X6CB 1ZK9A 3KGSA 1B4TA 3L17A 1USZA 5FYJU 5AKSA 2FJHB 5IR1A 4AIOA 3W2DL 1S5LZ 2XTLA 3MNZB 3QDMA 4C57C 4MTFA 3VFSB 5HVFB 4N8PA 1HWGB 2UUBO 3DTXB 2ADJA 1GW6A 4LLDB 4MS8C 1MZYA 4W1TA 5ALBH 2X0UA 3FQ1A 3VQXA 2Y7SA 4XMLH 3QH3A 2EDKA 1KP2A 4KRMB 4PW9A 1GTFA 2X28A 4OCXH 3LEYH 4J9ZB 5DZLA 2PY5A 5FYJH 1Y0LB 2CK0H 2FO8A 1BQRA 5K9OB 2ED6A 5HDQL 5FUCC 1IGYB 2DAVA 1AIFA 3VRIA 1UM5L 4DP9X 3IYLW 1HI6A 4O02B 1M7DA 1QSEB 5DO2D 1IM3A 2V2TB 3T65A 2QGEA 1MCOL 5D4IA 4M1CD 5EBMA 3V4UL 4ZYKB 2QMJA 2AQPA 1EJFA 5HDBF 1J5IA 5C0BD 4LCCC 2DQGH 3QORC 1NH6A 1ZT1B 1HNGA 2XJLA 3TCTA 1GYAA 4G1MB 1T1YB 3C6EA 5ANHA 5EIQA 3SJVB 3CSGA 3BVXA 4YNYB 1H5BB 2P4AB 1KJMA 4AXWA 5I2IB 4HPOL 2GIMA 4XOBA 2IU3A 3HZVA 1U8NB 3NSJA 5D7IE 5LGHL 5CGYC 3N6YA 1TCRA 1K8IA 3HBZA 3FT3A 4NM4L 3NK3A 3IN0A 3GNML 4HU8A 1JJUA 5K39A 4HUWB 1AZNA 3Q3GA 4AC4A 2OBGA 1ZANH 2IG2H 5MI0B 4OZHF 3HUJF 4LFAO 1FG9C 4I13B 1YNTA 5FCSH 5BXFB 4RMWA 5IVZB 2YEVA 1T1XB 3RJOA 5EN3A 4N8UA 3HCVA 5B4MD 3E8VA 2AGJL 3TBWA 4WFBV 3C09C 3CSXA 1JUFB 4RFNC 1XH2A 2C26A 1MVFA 4FQQB 4QDGA 4UTAH 3CG8A 1EXGA 2QSVA 2E7LC 4E0RA 4MBRA 3S37L 5E08L 1SHSA 4M7KH 4QE9A 1OCCB 1AACA 3N40P 4AMKL 4Q9QH 1I53A 2HUHA 2WO3B 1FGNH 4TQEL 1COWG 2ZE8A 1SQPH 2CAZC 2CXKA 2FWSA 3CVCA 4I0CC 1H0DB 2O93L 4OCSH 4GO6B 3QCUL 4ZNEE 4KROD 1SERA 2H0FA 4MB1A 4E5XB 1N6VA 4Z5RA 5CJBA 3ARDA 4OFKA 3ZY7A 4JFDA 2CJTA 3U2SB 3TBTA 1PS3A 1UADC 4HS6A 5L3BA 1RFYA 5L3EA 1SY6H 2BWIA 4M5ZH 4D9RD 4N68A 5I66B 1BHGA 1YMHA 3MRRA 2VUYA 1NGYB 4MVSA 2B5IB 2ITDB 5J12C 5J1TC 3CRMA 3L4YA 3HHSB 3N1QC 3DV4B 1NBZB 5IJ0A 1MJ7H 2HRGA 4PJXF 4EXKA 1ADWA 4PRIA 4RGMC 3DHJA 5IBUB 3UPRA 3V6OC 1UEMA 1KN2L 1RJLA 5FM4A 4ZMNA 3CH1B 2ZXBA 2F5BH 1HSBA 1IC5L 1XGUA 3F7QA 1DCLA 5H6QA 4G3YL 3BVNA 3UJTH 4AJ0A 3UEZA 4I0PC 1ETZB 1ET8A 4LARH 1CU4H 5AOIA 1UB5A 3KYAA 3TVMD 3VNZA 4YDJA 4AG4H 3DGDA 3UZQB 1KELL 5IB4B 4ZMTA 1KGXA 1VESA 4N86A 2EC9T 4BUGA 3REWA 3DSNA 3O2DL 5FNVB 3MLXL 4M8VA 4JFXB 4QTHA 4WTWA 1SM3H 4OUUA 4Z1MG 3PAUA 3OKDB 5JQGA 4QRPA 5H2FZ 1BF5A 4KITB 1AGDB 3WFZA 1WBXB 4KK5D 2FX7H 4Q20A 3OVUB 4PGEB 2FL5B 4NWTL 1LWJA 1FZMA 3CZFA 3PPSA 4YGVA 5DS8A 3X14A 3FQXA 1FFTB 4YGAB 1BZDA 1ZD6A 4FG6D 5JJJB 5CCHE 3SKUD 1F4HA 3QEQB 1M57C 3IWVA 4TTDC 3NOIA 4MAYC 3F6IA 3KHQA 2V6HA 1HHGA 2XFGB 3X1EA 3TT1L 3VGBA 3OZLA 4H25B 5JJNB 2CJSA 4F7CA 3FO0H 1F18A 1CF8H 1HDMA 4WNQB 2XJKA 2G2PA 3COOA 3L13A 3MV8B 4ZXBB 4YX2L 4OZ4A 4YE4L 4CC5A 5AZEH 2C3XA 5A6IA 3ULUF 1QTPA 3B7UX 2BVQA 3FH8A 3GMNA 1KFAH 2EH7L 5IK3A 4ZO7A 4FJ6A 4TQ8A 5DHYB 1G0XA 1NCIA 1ZS8B 1V7ML 3WN5C 3CFDB 4IDJH 2DD8H 1FZKB 1FJGB 2BNRD 3DX7A 3SHSA 3EXJA 3GS7A 3Q7JA 1SQMA 5F44A 2H1PH 5KBPA 1FS0G 4AEHL 2YKLH 1H15B 1JWSB 1UTDA 2IV9A 4PJIE 3PWPA 4P9HC 4QRSA 5E70A 5AVXB 3LQAC 3U6XS 4ERSL 2UY6B 4PGDA 3I3EA 2R7EA 4KHPO 3C6SB 1YNLL 4O02H 5C0NC 3BH9A 3Q1SH 5KAIZ 1WA8B 3SDXA 2G2RB 4HMDA 3EOTL 4XZUB 1IKFH 1CGSH 2IGLA 4X7CC 5EOCH 3RVTC 4QRBA 4E9RA 1UFUA 4F8TA 2E46A 2IAMA 4L3EE 4YHIB 4MB4A 4NYKA 3GMPB 1YDXA 5KVGE 1W16A 2J88H 2VDPB 5CBEB 4LWSA 3F7YB 5LXVA 4LPXA 5GJTL 5KYUA 1BZ7A 1XH3B 5EC1A 2Y7LA 3PE9A 3RUGE 3MHSC 5T1JA 1F3RB 4JDZB 1F4XL 3U4BH 2WXOA 1DVFC 4DR7O 1YVLA 2AK4A 1BOGA 4XHJC 4HAMA 2J25A 3INOA 3SKOA 5IZ7A 2OMZB 2BCKA 3PDOB 2JCCE 3NACH 5DDHA 5E1QA 5T3ZE 1OAZL 1LD9A 3U1PA 3H6AA 1S4IA 4PGBB 3CZNA 1BZEA 1RVFH 5DRNA 4NQSB 1ORQC 4NZTL 1IGIL 5G5DA 3QYMA 1RU9L 4JRXE 12E8L 5C0CE 3VXUA 1Z5WA 1NCTA 3P69A 3CRRA 4J3OC 1TSRA 3HNTH 4PGCB 2A9BA 4E9WA 4LSUL 1LILA 3WNIA 4BDVA 3JYBA 4JPIA 4MXWL 3MV9A 4GLRH 3BIKA 4IRSB 2XTJC 2BSSB 2ESVE 5AYQA 2B4CH 1H8OA 4MCNA 1KBPA 3BSGA 4RLDA 4UM8A 5DUPL 2QVFB 1XSIA 5I0DA 3FFCB 1OGPA 4GG6B 5E8OB 4MCMA 1CLOL 3IGAB 2X41A 4OD3L 5IB2A 3MRJB 2FLMA 4K3EH 1C8PA 2QPSA 2DLTA 1MCCA 2F1MA 4MDJA 4ZT1A 1HHJA 2Q68A 4K0OA 1AP5A 1VIBA 5KVEL 3SDDA 1JE6A 4E9QA 3GBNL 1NAMA 1FVEA 1RI8A 4EBQL 3T8XB 5I1EL 3VQ2C 5EEYA 1NBQA 4KDTA 5D70H 4MJHA 1RM1C 3VGAC 3S37X 2FGWH 3WE6B 3VCLB 3U6XA 4X6CF 4FULA 5HHVH 4YO0A 4AW7A 2ZKOA 2CM6A 3NTCH 3HR5A 1KU9A 4JKLA 4P9PA 3VGEA 3TTSA 5AKRA 1J1OH 1P1VA 3CZKA 3HZYB 3WDIA 2BHFA 3VD3A 1M5IA 5T1KD 4MCZA 1CDHA 1WZKA 4NQDE 4QWWD 2GITB 2EILB 1V10A 5CSBA 1H8SA 2R23A 3BAWA 5FL7G 4PS7A 2VDMB 1OTUD 1NGPL 2GJ6B 3QJTB 5ILTL 3TYGH 3BISA 4FABH 4DV1B 4AE1A 1I1AB 4I0XB 2R2CA 5BO1H 2LTQC 3MLSL 3L5HA 3EH4B 3CX5K 1DJXA 1W0KG 43C9A 3QR2A 5AW2B 5HI5D 4NHUA 5KSAB 1DUZB 1INDH 1WBZB 3GMQA 3W1ZA 2JKSA 3OF6D 3G71V 1MQ8A 4DR2B 1RUAL 5F1OB 3ABGA 1P84J 3AQYA 3AQXA 1EAPA 4I3GA 1BECA 1IBMB 3T4YB 2DKMA 4EIBA 1H6EA 4HS3A 2KC0A 3FUDA 2DQIL 3D0LB 3LY6A 3UZEA 3AREC 4HAFA 4JI6O 3O0LA 3MLTA 3PV6B 3G04B 4XPAL 1AI5A 2GJZA 4NNYA 3GSQB 1UWXH 4U7OA 5TE7H 5CJOL 5FFGA 5LYJA 4OD1L 4OKVA 1TTGA 4XGZA 2GKIA 3TXQA 5B66Z 2IXQB 2KI6A 2ZAIA 4LPWA 1WWCA 4Z0BL 4D3CH 3BYYA 1KGCD 1TZ8A 5I1GL 1HOCB 2I9LB 5HGAB 5J9PC 4NXNB 3LH9A 1I75A 4LP8A 5CHNA 1U4EA 3H9HB 3E9TA 5K1XA 2F9BT 3OX8A 5DEFA 2QFPA 1LO3L 4YIPA 4YHHO 1IAII 2OP4H 4FRWA 3MLRL 4KK8D 4M1GL 4ZDHA 4UM9B 4ONGL 3BH8A 3CGTA 2ZX6A 5FYKH 2NZ1A 2GDSA 5C0BA 4NKQB 5FCUH 5EF1A 3KNBB 2G0LA 4HBQA 4ELMA 4UTCA 3GRBA 3X1NA 1IB5A 2NNAB 3BAIA 4JO4L 5BRZB 3K8LA 3LN5B 1FLRH 1PLBA 2HVBA 4JFTA 3T1HB 3MLVL 3SPVB 1QLRA 4IRJD 4GI8A 3P0YH 3W0WE 1XMEB 3L3JA 3BGMB 3L08A 1FC2D 3S35L 2Z0AA 1IGJB 3KG5A 4FKEA 4U6XA 2GAZB 3O6LL 3BYTA 4JFFB 4F7PA 2IJIA 5HJGA 3MRGA 3MTRA 4JRYD 4FK5C 2WQWA 1LE9A 1AO7E 3KL5A 4ZUSB 3UIYA 2YN5A 1JDDA 2IANA 3B9VA 3LRLA 4M61B 2X88A 1ZJBA 3HC4H 1U8HB 1U3YA 1IU1A 2MTPA 4N0CD 5HI3D 4Y4FC 1TTCA 1D9KB 5C71A 2C34A 2IPKA 1AE6H 2VC2H 1KECA 4QKXB 4WENB 5HHXL 1XT5A 2VDPH 3D51A 3T3ME 1HHIB 4A67A 1ZX3A 1J9SA 1P53A 1NBVL 3CMEV 2NCMA 4LHUG 2GTAA 1NTDA 2CBPA 3BFOA 3EYOA 1DQDL 1L9TA 3H1HH 1GPOL 2A9CA 5FUOL 3GINA 2NW2A 4ZPVA 3MROA 2IJ0C 1CD1A 5D4JA 4OZIB 3OJDB 1YECL 2OJEB 2P4VA 1AZRA 2W07A 4UAOC 1WCBB 3U82B 5GRJH 1FXVA 1K33A 4OLVH 3T6QC 3FT2A 1YRKA 4X6EA 5H5NA 2W9DL 4I18B 2NN4A 3REVB 2WQ8A 3BRGC 1JFFA 3J07A 4WW1A 2X4NA 2FDBP 5D7JD 1G6RA 4NAJA 3K5NA 1T66D 3HN3A 1RSYA 1VZGA 5ID0A 3LZQA 5AVZB 1E5UI 2P7TB 2PPAA 2YD9A 4G8EA 5CP3H 3U1QA 4ZUTA 3B8SA 4FA6A 1G6RL 3K0GA 3MOAH 1U8PB 4RZCA 3VX1A 3ZN0A 2EDNA 1FE8H 3CSBA 4C4BA 2CAKA 4J3TA 1T1WA 5D7KE 4LCWB 5I6LA 3RAJL 2EYRA 3SDAB 4ILDA 1T4KB 5I1KH 5ESVB 2N0KA 1FXKB 4L37B 4EEEA 2NY1B 1I1FA 4FADA 1PG7X 1BMFG 3OWEA 4G6JL 1S7XB 3E6FA 2DQCH 4TLUA 3LIZA 2MCAA 2KT6A 1TXKA 2JELH 1W80A 1MLBB 1QX1A 3OUSA 1IKNA 1Y76B 4OGYL 4AVJA 1LNQA 2E9IA 1HJCA 5L0QB 4PWFA 3NQIA 3QNYA 3UP6A 4MAUL 4UILH 4EI5D 1ED3B 4OZFA 1XH0A 3IBOA 2VDQB 5KSBE 3CSFA 1YEIH 2IM9A 5CU5A 4FQ1H 1GSKA 1Z9PA 4MWFB 4Y7MA 1YY8B 4LEOA 5FUZL 4O4HB 1TPXB 5C09A 3ROLA 4C83B 4DO2A 1N59B 1JWUB 1MNUL 4FQLH 5HI4D 2G3MA 4MDIB 3FUEA 5CA0A 2V1DA 2ZXCA 4JF3A 4G28B 4LC1A 1I7RB 1U8QB 4XN9A 1XXFC 1NMBL 1MJJA 1QUNA 2VDMH 2PGGA 1WCQA 3L7FA 3HI6L 4WKZA 2WLJA 1UWEL 4JI0O 3EFDL 1M9WA 2VLRD 3PL6B 1H5BC 4QJFB 4LQ1A 1CUOA 4N6RA 5D7IF 4ZZFA 3CX2A 5HDWA 4ZX4A 2JKWA 3ZDWA 1S3RA 4IEFA 1CB4A 2VWKA 2CO4A 1J05B 2Y24A 3TJHC 5J11B 4GMSL 3U7YH 2WYTA 2PCXA 4OJFH 1DZ0A 1Y4MA 3Q05A 1CZ8H 4LR3A 3J27A 1UZ6E 4KH9A 1YEEH 3HNVH 5MI0C 3FONA 3RTQA 3VFVB 3JAWB 5IYBO 1XMOB 5KN5B 5E95B 1BX2B 4B3SB 2DJSA 1H6UA 2BNRA 2P5EE 4EOWH 1XI1A 3DMMD 4NN7B 5E1HB 3S5YA 3FN9A 1U8MB 4J41A 3QO5A 5LQBL 3ZYIA 5EU4A 2B4CC 3F01A 4JFED 3TPUA 4Y2LA 1FSKC 3IDYB 1OCCC 2HTLD 1S72V 1K4DA 4K3DH 4XN7A 1ENVA 1I8KB 2A74A 3BAKA 2IWKA 1H2SB 4R7NB 3WL9B 1IC0A 1EBOA 2ICEB 4PG9A 1GA2A 3CMGA 4UCSA 1U2HA 3FU8A 4RUEA 4WEEA 1ASQA 3FQYA 4CC6A 2CUMA 3MKKA 3VA2C 2ATAA 5JLZB 3ARRA 2R2EA 2DQHL 3IAPA 2CPUA 2UZYB 4NNXA 1BFSA 1UVQA 2HKHH 1JZ4A 4RZKA 1QEWB 4PDMA 2CO3A 4U1MA 1H8EG 1H2KA 1M7UA 2ITDC 2B5IC 5FS5A 4O2CB 4F9LC 1TKWB 1PCXA 2JB5L 4Y1AB 3VX0A 5DSCB 2DQDL 1P7HL 5LKNA 3VWJD 4ZMAT 3ZJAA 1KT2A 5GSVB 5KVGH 3ALXA 4E42B 2DEXX 3E80A 2I24N 4JZOB 3KEHA 1SYVB 3TO4D 4MJIE 4X66B 4GG6F 1MUJA 3MOBH 3UAEA 4IMLA 1N3NB 4X6DE 1TETL 1GGUA 4NQEB 2IPTH 3C08H 5FWRA 5C07E 3EO9H 3T6XA 4KKCD 4HIIB 3KPMA 1MRCH 1A6ZB 1MLCA 3CSYA 2FHCA 4DN4L 4XB8A 3IFNL 3RG1C 3OGCC 2APWA 4LFCB 2GSGB 2R1XA 15C8L 3B2UD 3L3OB 1OAXH 3BDYH 4NUJA 3U25A 3VD2A 3ULVL 3JTBA 4X9HA 1Z5YD 3IDMA 3DTUB 3SPJA 1HQRB 4N0FA 5AWNL 2DLHA 4F91B 1A6WL 5E99H 2ZOKA 2X3CA 2DW5A 3T2NH 2PXYD 3BUTA 4R4FL 4JASA 5FF6B 4GAAA 5LJYH 4PD4J 4OIBA 1SUJA 2AQNA 1G1KA 4GINA 3FMGL 1RSOB 1AB3A 2EDBA 4OQTA 3V5KB 5DRXA 2WOYA 5K9KA 1HCZA 1S7VB 4L3AA 3DGGA 4OBRA 4LCUB 5GGRB 3ULUD 2WIMA 2ZD0A 3NG5A 2JIZG 1IZJA 1QA9A 4DRXA 1EZSA 1Q90A 5D72H 5ICUA 1XTMA 2VW7A 5I8EB 2V7NA 1Z7JA 2CR6A 3CCHA 4B9PA 4LPTA 1LK3L 4LSSL 3LZFH 2PWFA 4G1EA 4TSCH 4LEEA 3FRPB 3ZSTA 5A2KH 2FBJH 3JV4B 4XNMB 3O81A 3UYRL 2Y0PA 4I1NB 5E4IA 2JJTA 3S8FB 1K72A 5DTFB 3FOMB 2DWSA 3OFNG 3NA9H 4BQBA 2XCMC 3WUWA 5AFAA 1ZT4A 3BAJA 1ZVHA 2Q7NA 1W0JG 5ANMA 4DFIA 3U36B 4BFIA 5JMRA 5T1KA 4AZ8A 1IC7H 3D8MA 5DHXB 3A4AA 1IARB 2DLGA 1XGQB 1UM6H 4GW5A 2MCPH 4E41E 5BS0E 1K5NB 2IH1B 3QO0A 4EVNA 4ZJ9A 4PJDE 4QRUA 1AY1L 3N85H 4LSDA 5AW5B 1JGUH 1DE4B 3VFMA 1BFVL 3ASNC 3F7VA 5GSRB 3VXPB 4ODXB 5HYQB 5KMGA 1MWAH 1G7MB 4Y9CA 3T77B 4MVQA 3U0TB 2AXFB 3OF6A 2V3FA 2AJUL 3A6BL 3DUUA 2VDQH 4IOIB 1AS7A 3GZPA 1IURA 4TV9A 2X87A 4XNQA 2GUOA 3ARFD 3X1BA 3FUIA 1CXIA 2P46B 3M86A 1BZ9A 4NNPH 4FQ2L 2F7OA 3MU3A 2VLKD 1NJ9A 1FV1A 4EI0A 2HJDA 3RGHA 2F7IA 2HTKC 4PV1B 3ZTNH 1OD9A 4L5FE 3RUGF 1CGXA 3FT9A 3CCQV 3NRQA 2ZPKL 4LDOB 4XT1C 5G55A 1OP9A 4H8WH 2HRHA 1EHXA 1MZFA 2YPVL 4X5WB 1B2WH 2HVJB 2YOCA 3IRZA 4YSDA 2JCCF 3LPGA 3DDFA 3EO0A 3FHQA 3PP4H 1KPRA 5IF0B 1XHZA 5JHDB 2EIDA