3WU2Z

Crystal structure analysis of photosystem ii complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
total genus 24
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3wu2Z00
5KAFZ 4UB6Z 2AXTZ 5H2FZ 4PJ0Z 5B5EZ 3KZIZ 5E79Z 5TISZ 1S5LZ 3A0BZ 3WU2Z 5GTHZ 3A0HZ 4UB8Z 5B66Z 5GTIZ 5KAIZ 4IL6Z 3JCUZ
chains in the Genus database with same CATH superfamily
3BCCH 2Y69B 2UXCO 2R70A 1COWG 3IGAC 2DYRB 2HFEC 1GKFA 3A0BZ 1JQ0A 4DV3O 5IE9A 3RYCB 1KD1W 2DOSA 4X65B 4P9PA 4YJ3A 5EIBD 2PF4E 1N32B 2B9ZA 3CRMA 4WFBV 2ZNJA 5IWAO 4O2AB 1L1FA 1GN4A 1TUEB 2GDSA 1V54B 2UXCB 1YIJV 5LBQA 1KMIZ 2AHYA 2E5LO 4YIOA 5GTHZ 4FM2A 2BTOA 4NKGB 4DV3B 3ZHRA 4KUMA 3W7SA 3OUSA 3TCUA 5IJ0A 3RVYA 1SERA 5JQGB 4GLXA 3JCUZ 2KB1A 3L74H 2HKOA 3K0DA 5IWAB 3B77A 4U7OA 1VMGA 3E8FA 3FAVB 4J10A 4TT3G 2LW7A 4ASUG 1HW7A 4YHHB 2E5LB 2UUAB 1Z5VA 2OCCC 2Q8VA 4X1KA 1NKDA 4RQFA 1NBMG 4CBCA 1SQFA 3P3NA 5B1OA 4FLUA 2OCHA 1RFYA 2QA4V 5EYPB 2VRZA 4OX9B 3CCSV 4YJ2B 2F4VO 4FLXA 3G6BA 3WB0A 3KG2A 4FJCC 1JOYA 1WA8B 5IJ9B 2LJ2A 4PHZA 4LFAB 1PD3A 1VIBA 3JASA 1XBLA 3VQWA 4U3JB 4EFEA 2PTMA 3CPWU 1AILA 3ZN1A 4B3RB 1JR9A 2DE0X 4O4LA 4DW1A 1S76D 4Q6GA 1HR0O 2ETNA 5LHIA 2NNUA 4YXWG 1M57C 5LGNA 2DJVA 5JJJB 4HYOA 1GTOA 4OPAA 3J80N 2F4VB 1LUWA 3ZBHA 2ZKOA 3UCSC 5BMVA 5BR8B 4PDRA 4MW3A 3FKSG 1N34O 1S72V 3D3QA 1GRJA 1M56B 1K73W 3ZMUA 4FLYA 2M6YA 2ZXWB 2Y4TA 1HR0B 2QR4A 3CD6V 1QHTA 4IIJB 2VWJA 2IM9A 3K0GA 3HKCA 4X64O 3J81N 4H0LB 4HNAB 3LSQA 4FFKA 1S0VA 1ZSPA 1Y76B 4LF7B 3JD4A 2RDCA 4KHPO 1N34B 2PI5A 3FB6C 1H2NA 4BR6A 1H2MA 2G38A 2DN9A 4X8AA 1AI6A 1GN6A 4CC6A 4O4IB 1NVPD 2AW9A 3VBBA 1Q5OA 5HFLA 1YXBA 5B1BC 5LOVA 4PDLA 1BHBA 5L3CA 2JIZG 4KHPB 1WN7A 2ODMA 1JFFA 4BWAA 1S5LZ 4DV4O 5EBWC 1LR1A 1IX9A 4FMTA 1V9PA 3QVNA 1SA0B 3TJTA 5LHHA 4J80A 4WFEA 4DRXB 5KHGA 1L0NH 1FKAO 4MTFA 4CS4A 1F23A 4JAAA 4QPKA 5CN0A 5C8YB 5FPOA 1AVMA 4CH4A 1XOUA 2CTWA 5AG2A 2PYJA 3UM7A 4DV4B 1TVKA 4LF4O 1PPJH 4EEQA 4MVQA 5KAIZ 1SETA 1WB7A 3CJHA 1SC5B 4H37A 2DYSB 4IYIA 5JQGA 5IY5C 2GUZA 1NTKH 2BTQB 1ZLZA 2W6JG 3LNNA 3G6EV 3HPLC 1FFXA 2XASA 3BY6A 4CH3A 5LP6A 3B4SA 4D7TA 1WJZA 4L87A 4P2ZA 3VQVA 2QM4A 3STLC 4TSFG 1PL0A 3JARA 4PV1B 3OD4A 4JAVA 1OHHG 1EM1A 4UCOA 3SR2C 3ZRWB 2ZNIA 3I56V 4E4EA 1P4RA 4PI0A 5CB4A 3AG1C 3TK1A 5IJ9A 3IC7A 5B1NA 1VQOV 4U3JA 1ROPA 3N2GB 1VQ4V 2QE7G 1BGYH 2WLHA 2D3OW 1QR8A 3C90A 1IXMA 2EILC 3BRCA 4LF6O 1VF6C 2WLKA 1I94B 2ZT9B 3SPCA 3RVZA 3OMIB 2P4KA 4X89A 2EX3A 4ZKIA 2EIKB 3Q4HA 4LFBB 2CTPA 4WBNB 1QVGU 1HNXO 1YTFB 1OCOC 5FPRA 2MK3A 2QWNB 5B3SB 1N33B 2A9HA 1J5EO 4NTXA 2R9RB 4IIJA 5KHJA 3SDLA 4LF6B 4X88A 4MVRA 3N27A 4D6TH 2QGNA 3AG3C 5J2TA 1YDXA 1BMFG 1SKVA 4MVUA 2MW2B 3W7XA 3A0HZ 1VQ7V 4NB5A 1QLEB 3RGBA 3FX7A 2JGDB 4GT1A 4X1IA 1M90W 3AK1A 1J5EB 1VEWA 2ZQMA 1GN2A 2XNDG 4LF5B 4I7ZB 5LGUA 4PELA 2KKWA 4HAMA 4DYLA 2CGOA 3W7TA 1Q6IA 2QSAA 3RT3C 2WLJA 2A06H 2YXHA 1VARA 3LDEA 1XL6A 1AJQA 3ETDA 4FFBB 3GB7C 4I9WA 2F23A 4B7EA 3OTOB 4DR3O 3W7UA 1B3QA 1OCCB 2RCVA 5JH7A 1NH2D 3K5OA 3OEHG 4XDLA 1EN6A 4GX1A 3OT7A 5D5PA 1R3JC 1ZTEA 2H94A 4UV9A 4LP8A 2HJDA 1MG1A 3H1JH 3S3WA 4DO2A 4PA6A 5KMGA 4GKJO 2ITCC 5F2VO 1PL4A 4PDVA 3K79A 2N74A 1NJIW 4ZHQA 3JATB 4O4HA 3X2QB 1HNWO 2XAGA 3SGIA 4ZI7A 4JI8O 1YEWA 5LXTA 1X4TA 1Q82W 5CA0A 1I7FA 2E75B 1TUBB 3QNEA 1K8AW 5JCOA 4DV6B 2P90A 3CRQA 3E22A 2Y69C 1DGSA 5FLXN 4U7NA 1S5JA 4DR7O 1OCZB 1XNRO 1LNQA 1MSDA 1F7YA 1K5SA 4DR4O 1N0JA 4FLVA 2HHHB 5IYBO 1HNWB 3H01A 1RP3B 4MVZA 4PA7A 4PA4A 2DW4A 2GTSA 2EIJB 4G27B 4O2BB 1M93A 1IDSA 2YICA 4WFAV 4GX2A 3K04A 1SQBH 3E86A 2X0LA 5DM6V 3HKBA 3CCUV 1AB3A 3CB2A 3ZRWA 2ARHA 2UU9B 4DR7B 1XNRB 2CK3G 4C7UA 1P7GA 1YJ9V 4ICGA 1NR7A 3K5LA 3K9SA 2W0XA 4ZOLB 5ITZB 4P9OA 1O9GA 3H1HH 3BA8A 2X6BA 2IU3A 1GM7A 4IT5A 3HB3B 3DXRA 5JJNB 3G80A 2LQTA 3GWOA 4RQEA 1XREA 1V55B 3L75H 1BZKA 3E8HA 2WLLA 3M7MX 3ZHSA 5J2UA 4X20B 3BEHA 1YCIA 5CMUA 3QO8A 5LA6B 4IL6Z 5DECA 1E1RG 1F4MA 2IJJA 4WF9V 1VQPV 4JI5B 3JAMN 2P7TC 1P7BA 2EIMC 3JAWB 1XUQA 5L3GA 3P32A 1Q43A 4DV5O 1Y6XA 4O4JA 5C93A 1M1KW 3H1KH 5LYJB 1D2DA 1I08A 4JI2O 1M9NA 3ABTA 4JYCA 3VQYA 2ZR2A 2ZD9A 3C3SA 1DK1A 4UV8A 2JGDA 3LUTB 5B1AB 3O9OA 1GK9A 5EZYB 1VQ8V 3OAAG 3K59A 1GH6A 4Z1MG 2AGAA 4DV5B 2F93B 1NR1A 1M56C 3EVKA 2ZXWC 1W59A 4BW5A 5CBFA 1Q7YW 2YC0A 1HP8A 2ZDIC 4KFMA 4JI2B 2H3OA 3UT5B 3AG4B 3RWRD 5FNVA 1SZTA 3HR0A 3STZC 2WSSG 1YI2V 1AROP 1QVFU 3CYOA 1B04A 4LFCO 1W0JG 4LNUB 3OFNG 1H2KA 1Q81W 2IW5A 4QIWF 4J9YB 1VQ9V 1WAZA 3ML0A 4I50A 1FFTB 4FLWA 4TQFA 3JAKB 3ZHTA 3OW2U 1VF5B 3QF7A 3JD2A 4F6RA 1VF6A 1NQTA 3TGUH 3F7YC 4BIZA 4AHCA 4KXRA 4J7ZA 1AJPA 4R50A 5H6RA 4WFHA 3CXCU 2CGNA 1IVSA 3CCJV 4LFCB 4JYAO 3E83A 4K0KO 5K1PA 1XI1A 2Q0AA 2O57A 1Q90D 1K97A 3ZEDA 1WPBA 3H1LH 2LGQA 2OTLV 3TETA 5CA1B 1F4NA 4AILC 1R6TA 2Z0AA 1SS3A 4X66O 4DUZO 2KG7B 4QPJA 2Q68A 1AP5A 5IT9N 4ABMA 2Y0IA 3WB2A 1KKDA 2B5UA 1R3LC 3ASOB 4WFFA 1KB9F 3P30A 4FK5C 4J7KA 4TV9B 1G6UA 3WFVA 4DUZB 4BAYA 1DLBA 1RM1B 1FXHA 3T2MA 2PGGA 3AEIA 4IHJB 4LR3A 4EFBA 2DYSC 1K33A 3E8BA 5JCOC 2B1IA 2EJRA 1JJ2U 4MT8A 1KUQA 3HKEA 3FFQA 4IYHA 4LWSA 4F4LA 3G67A 1OJHA 1NTMH 4MTOA 2Q9LA 4QJFB 2LFRA 2Q7HA 2W0FC 4NTWA 1SQPH 5KUMA 3OEEG 5KA6A 4JTDB 3IAYA 3FB5C 1IBLO 4DXWA 1XEQA 2C2AA 3JALA 4H13B 4TQDA 3MHSC 5GONA 3JSNA 4X64B 1D5AA 5L3BA 1PNKA 1LUVA 2ZE7A 2UUCO 2BSKB 2XAHA 2UXDO 4J41A 3CEIA 3BPZA 4UCTA 4N23A 2FMLA 3QTCA 4TUYB 1S77D 4I4TA 1XNQO 2JEXA 3N2KB 1NT2B 1YZBA 3U0ZA 4L8JA 3LDCA 1S3JA 3D3IA 3ZJZA 3SYAA 4X9QA 4J11A 2XOKG 2YEVB 2XAJA 2UUCB 2EIKC 1OCRC 1XILA 4BIOA 3HKDB 4GKKO 4JI6O 2UXDB 3RYCA 2WWWA 2E74B 1FJGO 3ZMTA 3PN1A 1EBOA 3UQ8A 4DV2O 3ABLC 1XNQB 4O2AA 4LF9O 1H8EG 1RSOB 1N8RW 2HVKC 3FB7C 3LSUA 4K3AA 3A8TA 1IURA 2ZR3A 2AXTZ 4JYYA 5IDJA 3OR7C 3CRCA 4J7JA 3CWBH 2YI9A 3QO5A 1JPXA 3RYHB 5TISZ 4GKKB 5A2QN 1FJGB 2Z3YA 4X62O 5KLVH 4B3TO 3U11A 3ETQA 3MD0A 3L71H 4DV2B 1RPOA 1BQZA 1WLEA 1KBHA 4Z1VA 1JX9A 3ASNC 3FAVA 2PZSA 4LF4B 4LF9B 3OMAB 2X7RB 4I55B 1TAEA 1XQ8A 4K8ZA 2P06A 3K5NA 3EHBB 5FL7G 2OIGA 3I5DA 4JI0O 1IBKO 3OE7G 1FXKB 4NTYA 1XMQO 4JASA 1Y67A 1A32A 3UO3A 4XBFA 2GV9A 5EYPA 4LH6A 3AK2A 4B3TB 4DV1O 4YJ2A 1MA1A 2KSDA 3AG2C 4W4KA 2WLIB 1WA8A 4FZ1A 2QKAA 1UFIA 3B09A 3OM3B 2F66C 5E79Z 1YF2A 3FD9A 3SYQA 3IC9A 4I5SA 4JI0B 1IBKB 2IJKA 2QWRB 1URFA 2RQ6A 3ZHUA 1MSWD 2Q5ZA 2OWOA 4R6ZA 1WB8A 1KYOF 2A3QA 4DV1B 2Q0OC 1H2LA 4OGQB 5B1BB 4B7KA 4QGPA 4MVOA 4NR1A 2IU0A 2DWEC 3WB1A 2GHYA 3ZRVA 2P67A 1MOFA 4RUEA 2Y0PA 2A79B 1AI7A 2YDEA 3ZN0A 4IHJA 2NN4A 2XHBA 4NXMO 2CH7B 2DQ0A 3MHHC 4N21A 2ILMA 2ZDIA 2R9IA 3ABMC 4GUNA 3F7VC 3RYIB 3M8AA 2FB5A 4LF8O 3J7AU 1OCZC 1SESA 3EXAA 3M99B 4HNAA 1K9MW 3CMAV 2NR5A 1Y76A 3CHXA 1SF9A 3LDDA 4P30A 1DTOA 3FYEB 1BT8A 2EIJC 3T4ZA 1HNXB 2V4DA 1JA8A 2P22C 4H44B 4DR6O 1NVPB 3SYPA 3H1IH 3ABUA 1BCCH 5A9GA 2P6JA 4I0XB 3THOA 5KA5A 2F43G 2LFSA 2EULA 3APOA 4O4IA 3SYOA 2PI4A 1NS1A 1GN3A 2BOCC 3JYCA 3OMNB 1MNGA 3CS5A 4UVAA 3H9VA 3SJAC 4PA9A 4GX5A 2RN9A 3RFRA 1XDCA 1Q86W 4UCSA 4ZBMA 1WP8A 1SQVH 1HNZO 1ZUQA 3SYCA 4UUJC 4DR6B 1YJNV 4FM0A 4DV0O 4AQYO 1R6NA 3P3PA 2B1GA 1VQKV 1SA0A 2UXXA 1NTZH 1EFRG 2HR3A 4YJ3B 2VS0A 4DRXA 3E35A 1V55C 3MAQA 2LP7A 5J9PC 2WA4A 2FKXA 3LSSA 4DK1A 4D7SA 1IBMO 4DR3B 5C8YA 2QTSA 2ZE5A 4CS2A 4JZ2A 3SJQC 4CZZA 1MMMA 1QU7A 1SQXH 4K35A 2Y4UA 4EB6B 4DV0B 5IJ0B 4AQYB 1KU9A 5DN6G 4UVCA 2A0LA 4UFZA 2EILB 2XAFA 2YXLA 1DF4A 1ORQC 2JGUA 2QKCA 4J42A 2LGWA 3BVOA 4GKJB 2BTQA 5L3EA 1B06A 1PNLA 1UPGA 2ZE6A 1G4YB 2DYRC 4X1KB 5B1AC 3VQXA 4DR1O 2OT5A 3F5TA 3CCEV 4KP4A 1N0NA 1OCOB 4GYCB 1GM8A 1P49A 2CTRA 4JI8B 2QTOA 4QNHB 1I5YA 1YVWA 1YJWV 3R65A 2OTJV 1FXKA 3L72H 5EC2C 2Z5UA 4DUYO 3JASB 4JI3O 4KL1A 3CCRV 1Q3EA 3AG4C 2P4VA 3AG3B 1V54C 2WPDG 4O4LB 4UXNA 1B6QA 3E89A 4DR1B 1J95A 4DR4B 1EZJA 2YXYA 2JRIA 1ZX3A 4QE9A 2PYLA 2QDOA 3N2GA 3T4DA 1VP7A 1YITV 3B8NA 4RAIA 2WAMA 1WPXA 4BW9A 1ZWIC 1QBZA 5BMVB 2UXBO 1US6A 1KQSU 4JI3B 3RBZA 1PV0A 3EFFK 2VQFO 2EZOA 4LCUC 4TV8B 4NYKA 2UUBO 1DF5A 4CH6A 1E79G 4UB8Z 4FLZA 3K06A 4B3SO 3HKCB 4WBNA 4IGGA 1FD9A 4G2KA 2HVJC 2WA3A 3T1HO 5K1XA 1Q6HA 1WNSA 1HWYA 1PNMA 1O9HA 3PJSK 3CMEV 1K92A 4R7CA 2UXBB 1YHQV 3K9AA 3NXSA 2ZE8A 2VQFB 1VF7A 2UUBB 2JK5C 3K3WA 4NVPA 1Y4MA 5HFMA 3K57A 1K34A 1Z5WA 4JGSA 4B3SB 3T1HB 5GW7A 4JYBA 1RPRA 5L3DA 2YIDA 5LOVB 1NZ6A 1EN4A 1TA8A 1D5NA 4X65O 4MVMA 4LC1A 3OGIB 4LBEC 3CSXA 1QLNA 2IJHA 3E2EA 1N32O 5KUKA 1JFFB 1JMKC 3ABKB 1RM1C 4JAUA 1NH2B 5JJEB 2RMKB 2CTQA 4MSWC 4FFBA 1Q8IA 2YI8A 1ZL8B 3APQA 5JVDB 3MDSA 4XDKA 2F1MA 3FYIB 4DR2O 2CDYA 1VQMV 1W0KG 2XUMA 1QNMA 2R72A 1H38A 1XHZA 1VQ6V 5LL6Y 1Y74B 1TVKB 4K8XA 2EINB 3WG7B 3ZRXA 5EBMC 4YHHO 2WLMA 2BCCH 3OR6C 2UUAO 4BIUA 3DC6A 4ZIBA 2EJ7A 3CJHB 4DR2B 3JATA 4R8CA 2ITDC 1WP7A 4EB6A 2HP8A 3LNMB 1BHAA 3ETGA 2GUZB 4OX9O 1R1BA 3CX5F 4JV5O 2AZ0A 4G28B 3RN4A 4U3FH 2LO1A 3ZS8C 1I0HA 1TUBA 1FFXB 3SPJA 1K4DC 5KX5B 2YS8A 3VOUA 4LFAO 5LP6B 2BE3A 3K08A 2XTAA 3KCXA 4B3RO 3C3TA 2L35A 4DR5O 3JARB 4WCEV 5EIBC 5LGTA 3S3XA 4JYAB 4K0KB 2ZIMA 4Z2WA 2PY5A 1SRYA 2BOBC 4JV5B 3ZMVA 2V1DA 1JCHA 3SPHA 5CB4B 4O2BA 2YIBA 2CUGA 2EIMB 2EZPA 5BR8O 1GM9A 2QKSA 4X66B 2N05A 3ZRSA 1H8HG 1X59A 1XL4A 3CCVV 4GCZA 3JD1A 4DR5B 1CPYA 3BA9A 4JF3A 2JS5A 3O65A 3DTUB 4OXSA 4PJ0Z 3D36A 3ZCCA 4ZOLA 5ITZA 4LF7O 3JD3A 3BAAA 3KCYA 3Q4HB 3BHPA 1ZAUA 3CCMV 3RYFB 1QCEA 4TV8A 2FTKA 2PUSA 1R6KA 1JVMA 1SQGA 1AR4A 1U96A 4X20A 1YTFD 1BL8A 1FXKC 2V7QG 5KHHA 1KP3A 3WU2Z 5LA6A 1AI5A 4MTGA 1CEZA 3ICXA 5KHKA 1L0LH 2QWQB 2QWPB 5J2TB 4TWKA 5LMNO 3TXSA 2CE4A 3NR7A 3JAWA 1FPOA 3UO2A 1FS0G 2GSMB 4AI8A 5LHGA 1PKXA 4WFGA 3L73H 4X1IB 2OYQA 5B5EZ 1N36O 3AG7A 4FVMA 2A7WA 4UCVA 4I9QA 5LYJA 2ZCEA 1I5XA 4NXNO 2DQ3A 2OCCB 1IBLB 3CCQV 5KHIA 5LMNB 5EZYA 2QM8A 4Q20A 5JH7B 3ZHQA 5D5QA 2JEUA 1L8DA 2ADPA 3CC4V 5H9CA 1N36B 1VQNV 2RJZA 5B3SC 4JI4O 1ZL8A 4JTAB 3B8MA 2JVDA 3A0RA 4H33A 5JVDA 1BE3H 4OPHA 3UT5A 5GTIZ 4NXNB 4XDJA 3QG5A 5EC1C 4B08A 5KMGB 2Q73A 5IYZB 4JI7O 1CP9A 4LNUA 1M57B 3K03A 3T1CA 4YIPA 4JI6B 1AR1B 1VQLV 4CC5A 1Y74A 2GTAA 2WLNA 4O4HB 4ZHQB 3F5WC 3ZX6A 3JAKA 1QLEC 3JCZA 4X1YB 4JI4B 1MABG 2E3CA 4ZI7B 2QEXV 5LXTB 1VQ5V 5CA0B 3K5MA 1K5QA 1FYJA 1Z2GA 4UB6Z 2IBZH 4MVSA 4MS2A 5LMUO 4EKWA 4JI7B 3E22B 2HJFC 4MTXA 3CRAA 5JWPA 1OCCC 1H2SB 3SJCC 2DMXA 4X62B 5KX5A 3FB8C 3ZMSA 5CA1A 1U97A 2ZINA 2AHZA 4A5UB 3B2EE 2KQXA 2KG7A 2H8PC 1E1QG 3ZIAG 5H2FZ 1FXVA 3CE2A 1KP2A 5LMUB 5CBHA 1I94O 2X6CA 3HKBB 4TOIA 2YIBD 2JS3A 2K1EA 1XMQB 1QQCA 4YY3O 3G4SV 1PM9A 2QWOB 2M7WA 2Y48A 3BABA 2HG5C 2HEPA 2GBOA 1OV9A 4LFBO 1K3EA 4TV9A 2DWDC 3X2QC 5DEDA 2ATKC 1AI4A 1TGOA 4FZ0A 1S5HC 3DGEA 1N33O 3DC5A 4PDMA 4F6EA 1AR5A 1Y66A 2IH3C 5BXZA 2VQEO 2P5OA 4UVBA 3DXRB 2F95B 4CS3A 5EBLC 4YY3B 1THZA 1W2BU 2Q6AA 2WLLB 5J2UB 1OCRB 1R73A 2CAZC 1QR9A 2UXNA 3KKYA 2E76B 3ZMZA 1KKCA 1BQ0A 3RYFA 1H2GA 1R3KC 2EBOA 2ZM6O 2OIEA 2HLDG 4FPPA 3ABLB 4B3MO 5IYDO 2XAQA 1FAFA 1GMGA 1CXZB 1JJOA 4LF5O 4NXMB 1ENVA 2VQEB 4PI2A 3K58A 1PP9H 4O4JB 4LF8B 3JSLA 4HBNA 1EN5A 5H6QA 5IYCO 1BSMA 3OTOO 2Q67A 1KC8W 1NI8A 5IY5B 2BSKA 1UJWB 2YUAA 2YIAA 2NLJC 4FM1A 3DSQA 2YSUB 2ZM6B 3IFXA 2Q7EA 1IXBA 1BS3A 1IZ3A 3D36C 4B3MB 4DK0A 3ASNB 4TUYA 1M5IA 2N04A 3R66A 3N2KA 2W6IG 4CH5A 1XMOO 1EZVH 2IJIA 3CC7V 2FYUH 2X6AA 1G8MA 1SQQH 3UKMA 2YEVA 3B40A 3I55V 2XT9A 1MZEA 3HKDA 3RW0A 5FNVB 4JZGA 4FIPC 3AG1B 4GX0A 1HNZB 3AG2B 4E2LA 3W7WA 1XHXA 1Q6UA 1AP6A 1RSOA 3CP1A 1G1XB 2K9PA 1XMOB 1YSCA 3CCLV 4I50B 4DV7O 4LH7A 1F51A 4FLTA 3U10A 4DV6O 5IYZA 4F6RB 3IJ4A 3OUFA 3RYHA 4GZRB 1P84F 3JD0A 1IBMB 2L6LA 5H5NA 4RWUA 1GAXA 1MZFA 2HHHO 3CC2V 3OTFA 4X1YA 2VWKA 4JI1O 4W4LA 4UCRA 4I55A 3SPGA 2QJ1A 3CRRA 4DV7B 1M4UA 3QO7A 3ABKC 1HDJA 2JJ1G 3ABMB 3ZHVA 2R9AA 5BZBA 2UU9O 3D8CA 3ETEA 3T1YO 4JI1B 2QM7A 2WLIA 2Q69A 5B66Z 2JJ2G 3G71V 2AZ2A 3L70H 3E8GA 2EINC 3WG7C 5KAFZ 4DUYB 3CXHF 2ZIOA 1OZ0A 3L9DA 5CBGA 4J9ZB 2Q4PA 3A2FA 4RO2A 4HZ3A 1R3IC 4QE7A 3T1YB 1GO3F 4JPRA 4JTCB 3AK3A 1NU1H 3TXQA 2Q7GA 1N4CA 5L3FA 4JI5O 3HKEB 4LWSB 2CH7A 5EK0A 4RUFA 2FL4A 2LW1A 5LP6C 1K7DA 1SZXA 1KECA 5E1AC 3GWKC 3RYIA 3SJBC 1K4CC 3SPIA 2IH1C 4MW8A 4DW0A 1T5EA 3BFRA 2ADQB 2D2CB 3ASOC 3JALB 3GVMA 5GONB 4UCUA 4PD4F 3KZIZ 1AJNA 4I0XA 2RNBA 5CA3A 5BY1A 4PA3A 2JDIG 3OGCC 4I4TB
chains in the Genus database with same CATH topology
5KAFZ 4UB6Z 2AXTZ 5H2FZ 4PJ0Z 5B5EZ 3KZIZ 5E79Z 5TISZ 1S5LZ 3A0BZ 3WU2Z 5GTHZ 3A0HZ 4UB8Z 5B66Z 5GTIZ 5KAIZ 4IL6Z 3JCUZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF Z;  4UB6 Z;  2AXT Z;  5H2F Z;  4PJ0 Z;  5B5E Z;  3KZI Z;  5E79 Z;  5TIS Z;  1S5L Z;  3A0B Z;  3WU2 Z;  5GTH Z;  3A0H Z;  4UB8 Z;  5B66 Z;  5GTI Z;  5KAI Z;  4IL6 Z;  3JCU Z; 
#chains in the Genus database with same CATH topology
 3BCC H;  2Y69 B;  2UXC O;  2R70 A;  1COW G;  3IGA C;  2DYR B;  2HFE C;  1GKF A;  3A0B Z;  1JQ0 A;  4DV3 O;  5IE9 A;  3RYC B;  1KD1 W;  2DOS A;  4X65 B;  4P9P A;  4YJ3 A;  5EIB D;  2PF4 E;  1N32 B;  2B9Z A;  3CRM A;  4WFB V;  2ZNJ A;  5IWA O;  4O2A B;  1L1F A;  1GN4 A;  1TUE B;  2GDS A;  1V54 B;  2UXC B;  1YIJ V;  5LBQ A;  1KMI Z;  2AHY A;  2E5L O;  4YIO A;  5GTH Z;  4FM2 A;  2BTO A;  4NKG B;  4DV3 B;  3ZHR A;  4KUM A;  3W7S A;  3OUS A;  3TCU A;  5IJ0 A;  3RVY A;  1SER A;  5JQG B;  4GLX A;  3JCU Z;  2KB1 A;  3L74 H;  2HKO A;  3K0D A;  5IWA B;  3B77 A;  4U7O A;  1VMG A;  3E8F A;  3FAV B;  4J10 A;  4TT3 G;  2LW7 A;  4ASU G;  1HW7 A;  4YHH B;  2E5L B;  2UUA B;  1Z5V A;  2OCC C;  2Q8V A;  4X1K A;  1NKD A;  4RQF A;  1NBM G;  4CBC A;  1SQF A;  3P3N A;  5B1O A;  4FLU A;  2OCH A;  1RFY A;  2QA4 V;  5EYP B;  2VRZ A;  4OX9 B;  3CCS V;  4YJ2 B;  2F4V O;  4FLX A;  3G6B A;  3WB0 A;  3KG2 A;  4FJC C;  1JOY A;  1WA8 B;  5IJ9 B;  2LJ2 A;  4PHZ A;  4LFA B;  1PD3 A;  1VIB A;  3JAS A;  1XBL A;  3VQW A;  4U3J B;  4EFE A;  2PTM A;  3CPW U;  1AIL A;  3ZN1 A;  4B3R B;  1JR9 A;  2DE0 X;  4O4L A;  4DW1 A;  1S76 D;  4Q6G A;  1HR0 O;  2ETN A;  5LHI A;  2NNU A;  4YXW G;  1M57 C;  5LGN A;  2DJV A;  5JJJ B;  4HYO A;  1GTO A;  4OPA A;  3J80 N;  2F4V B;  1LUW A;  3ZBH A;  2ZKO A;  3UCS C;  5BMV A;  5BR8 B;  4PDR A;  4MW3 A;  3FKS G;  1N34 O;  1S72 V;  3D3Q A;  1GRJ A;  1M56 B;  1K73 W;  3ZMU A;  4FLY A;  2M6Y A;  2ZXW B;  2Y4T A;  1HR0 B;  2QR4 A;  3CD6 V;  1QHT A;  4IIJ B;  2VWJ A;  2IM9 A;  3K0G A;  3HKC A;  4X64 O;  3J81 N;  4H0L B;  4HNA B;  3LSQ A;  4FFK A;  1S0V A;  1ZSP A;  1Y76 B;  4LF7 B;  3JD4 A;  2RDC A;  4KHP O;  1N34 B;  2PI5 A;  3FB6 C;  1H2N A;  4BR6 A;  1H2M A;  2G38 A;  2DN9 A;  4X8A A;  1AI6 A;  1GN6 A;  4CC6 A;  4O4I B;  1NVP D;  2AW9 A;  3VBB A;  1Q5O A;  5HFL A;  1YXB A;  5B1B C;  5LOV A;  4PDL A;  1BHB A;  5L3C A;  2JIZ G;  4KHP B;  1WN7 A;  2ODM A;  1JFF A;  4BWA A;  1S5L Z;  4DV4 O;  5EBW C;  1LR1 A;  1IX9 A;  4FMT A;  1V9P A;  3QVN A;  1SA0 B;  3TJT A;  5LHH A;  4J80 A;  4WFE A;  4DRX B;  5KHG A;  1L0N H;  1FKA O;  4MTF A;  4CS4 A;  1F23 A;  4JAA A;  4QPK A;  5CN0 A;  5C8Y B;  5FPO A;  1AVM A;  4CH4 A;  1XOU A;  2CTW A;  5AG2 A;  2PYJ A;  3UM7 A;  4DV4 B;  1TVK A;  4LF4 O;  1PPJ H;  4EEQ A;  4MVQ A;  5KAI Z;  1SET A;  1WB7 A;  3CJH A;  1SC5 B;  4H37 A;  2DYS B;  4IYI A;  5JQG A;  5IY5 C;  2GUZ A;  1NTK H;  2BTQ B;  1ZLZ A;  2W6J G;  3LNN A;  3G6E V;  3HPL C;  1FFX A;  2XAS A;  3BY6 A;  4CH3 A;  5LP6 A;  3B4S A;  4D7T A;  1WJZ A;  4L87 A;  4P2Z A;  3VQV A;  2QM4 A;  3STL C;  4TSF G;  1PL0 A;  3JAR A;  4PV1 B;  3OD4 A;  4JAV A;  1OHH G;  1EM1 A;  4UCO A;  3SR2 C;  3ZRW B;  2ZNI A;  3I56 V;  4E4E A;  1P4R A;  4PI0 A;  5CB4 A;  3AG1 C;  3TK1 A;  5IJ9 A;  3IC7 A;  5B1N A;  1VQO V;  4U3J A;  1ROP A;  3N2G B;  1VQ4 V;  2QE7 G;  1BGY H;  2WLH A;  2D3O W;  1QR8 A;  3C90 A;  1IXM A;  2EIL C;  3BRC A;  4LF6 O;  1VF6 C;  2WLK A;  1I94 B;  2ZT9 B;  3SPC A;  3RVZ A;  3OMI B;  2P4K A;  4X89 A;  2EX3 A;  4ZKI A;  2EIK B;  3Q4H A;  4LFB B;  2CTP A;  4WBN B;  1QVG U;  1HNX O;  1YTF B;  1OCO C;  5FPR A;  2MK3 A;  2QWN B;  5B3S B;  1N33 B;  2A9H A;  1J5E O;  4NTX A;  2R9R B;  4IIJ A;  5KHJ A;  3SDL A;  4LF6 B;  4X88 A;  4MVR A;  3N27 A;  4D6T H;  2QGN A;  3AG3 C;  5J2T A;  1YDX A;  1BMF G;  1SKV A;  4MVU A;  2MW2 B;  3W7X A;  3A0H Z;  1VQ7 V;  4NB5 A;  1QLE B;  3RGB A;  3FX7 A;  2JGD B;  4GT1 A;  4X1I A;  1M90 W;  3AK1 A;  1J5E B;  1VEW A;  2ZQM A;  1GN2 A;  2XND G;  4LF5 B;  4I7Z B;  5LGU A;  4PEL A;  2KKW A;  4HAM A;  4DYL A;  2CGO A;  3W7T A;  1Q6I A;  2QSA A;  3RT3 C;  2WLJ A;  2A06 H;  2YXH A;  1VAR A;  3LDE A;  1XL6 A;  1AJQ A;  3ETD A;  4FFB B;  3GB7 C;  4I9W A;  2F23 A;  4B7E A;  3OTO B;  4DR3 O;  3W7U A;  1B3Q A;  1OCC B;  2RCV A;  5JH7 A;  1NH2 D;  3K5O A;  3OEH G;  4XDL A;  1EN6 A;  4GX1 A;  3OT7 A;  5D5P A;  1R3J C;  1ZTE A;  2H94 A;  4UV9 A;  4LP8 A;  2HJD A;  1MG1 A;  3H1J H;  3S3W A;  4DO2 A;  4PA6 A;  5KMG A;  4GKJ O;  2ITC C;  5F2V O;  1PL4 A;  4PDV A;  3K79 A;  2N74 A;  1NJI W;  4ZHQ A;  3JAT B;  4O4H A;  3X2Q B;  1HNW O;  2XAG A;  3SGI A;  4ZI7 A;  4JI8 O;  1YEW A;  5LXT A;  1X4T A;  1Q82 W;  5CA0 A;  1I7F A;  2E75 B;  1TUB B;  3QNE A;  1K8A W;  5JCO A;  4DV6 B;  2P90 A;  3CRQ A;  3E22 A;  2Y69 C;  1DGS A;  5FLX N;  4U7N A;  1S5J A;  4DR7 O;  1OCZ B;  1XNR O;  1LNQ A;  1MSD A;  1F7Y A;  1K5S A;  4DR4 O;  1N0J A;  4FLV A;  2HHH B;  5IYB O;  1HNW B;  3H01 A;  1RP3 B;  4MVZ A;  4PA7 A;  4PA4 A;  2DW4 A;  2GTS A;  2EIJ B;  4G27 B;  4O2B B;  1M93 A;  1IDS A;  2YIC A;  4WFA V;  4GX2 A;  3K04 A;  1SQB H;  3E86 A;  2X0L A;  5DM6 V;  3HKB A;  3CCU V;  1AB3 A;  3CB2 A;  3ZRW A;  2ARH A;  2UU9 B;  4DR7 B;  1XNR B;  2CK3 G;  4C7U A;  1P7G A;  1YJ9 V;  4ICG A;  1NR7 A;  3K5L A;  3K9S A;  2W0X A;  4ZOL B;  5ITZ B;  4P9O A;  1O9G A;  3H1H H;  3BA8 A;  2X6B A;  2IU3 A;  1GM7 A;  4IT5 A;  3HB3 B;  3DXR A;  5JJN B;  3G80 A;  2LQT A;  3GWO A;  4RQE A;  1XRE A;  1V55 B;  3L75 H;  1BZK A;  3E8H A;  2WLL A;  3M7M X;  3ZHS A;  5J2U A;  4X20 B;  3BEH A;  1YCI A;  5CMU A;  3QO8 A;  5LA6 B;  4IL6 Z;  5DEC A;  1E1R G;  1F4M A;  2IJJ A;  4WF9 V;  1VQP V;  4JI5 B;  3JAM N;  2P7T C;  1P7B A;  2EIM C;  3JAW B;  1XUQ A;  5L3G A;  3P32 A;  1Q43 A;  4DV5 O;  1Y6X A;  4O4J A;  5C93 A;  1M1K W;  3H1K H;  5LYJ B;  1D2D A;  1I08 A;  4JI2 O;  1M9N A;  3ABT A;  4JYC A;  3VQY A;  2ZR2 A;  2ZD9 A;  3C3S A;  1DK1 A;  4UV8 A;  2JGD A;  3LUT B;  5B1A B;  3O9O A;  1GK9 A;  5EZY B;  1VQ8 V;  3OAA G;  3K59 A;  1GH6 A;  4Z1M G;  2AGA A;  4DV5 B;  2F93 B;  1NR1 A;  1M56 C;  3EVK A;  2ZXW C;  1W59 A;  4BW5 A;  5CBF A;  1Q7Y W;  2YC0 A;  1HP8 A;  2ZDI C;  4KFM A;  4JI2 B;  2H3O A;  3UT5 B;  3AG4 B;  3RWR D;  5FNV A;  1SZT A;  3HR0 A;  3STZ C;  2WSS G;  1YI2 V;  1ARO P;  1QVF U;  3CYO A;  1B04 A;  4LFC O;  1W0J G;  4LNU B;  3OFN G;  1H2K A;  1Q81 W;  2IW5 A;  4QIW F;  4J9Y B;  1VQ9 V;  1WAZ A;  3ML0 A;  4I50 A;  1FFT B;  4FLW A;  4TQF A;  3JAK B;  3ZHT A;  3OW2 U;  1VF5 B;  3QF7 A;  3JD2 A;  4F6R A;  1VF6 A;  1NQT A;  3TGU H;  3F7Y C;  4BIZ A;  4AHC A;  4KXR A;  4J7Z A;  1AJP A;  4R50 A;  5H6R A;  4WFH A;  3CXC U;  2CGN A;  1IVS A;  3CCJ V;  4LFC B;  4JYA O;  3E83 A;  4K0K O;  5K1P A;  1XI1 A;  2Q0A A;  2O57 A;  1Q90 D;  1K97 A;  3ZED A;  1WPB A;  3H1L H;  2LGQ A;  2OTL V;  3TET A;  5CA1 B;  1F4N A;  4AIL C;  1R6T A;  2Z0A A;  1SS3 A;  4X66 O;  4DUZ O;  2KG7 B;  4QPJ A;  2Q68 A;  1AP5 A;  5IT9 N;  4ABM A;  2Y0I A;  3WB2 A;  1KKD A;  2B5U A;  1R3L C;  3ASO B;  4WFF A;  1KB9 F;  3P30 A;  4FK5 C;  4J7K A;  4TV9 B;  1G6U A;  3WFV A;  4DUZ B;  4BAY A;  1DLB A;  1RM1 B;  1FXH A;  3T2M A;  2PGG A;  3AEI A;  4IHJ B;  4LR3 A;  4EFB A;  2DYS C;  1K33 A;  3E8B A;  5JCO C;  2B1I A;  2EJR A;  1JJ2 U;  4MT8 A;  1KUQ A;  3HKE A;  3FFQ A;  4IYH A;  4LWS A;  4F4L A;  3G67 A;  1OJH A;  1NTM H;  4MTO A;  2Q9L A;  4QJF B;  2LFR A;  2Q7H A;  2W0F C;  4NTW A;  1SQP H;  5KUM A;  3OEE G;  5KA6 A;  4JTD B;  3IAY A;  3FB5 C;  1IBL O;  4DXW A;  1XEQ A;  2C2A A;  3JAL A;  4H13 B;  4TQD A;  3MHS C;  5GON A;  3JSN A;  4X64 B;  1D5A A;  5L3B A;  1PNK A;  1LUV A;  2ZE7 A;  2UUC O;  2BSK B;  2XAH A;  2UXD O;  4J41 A;  3CEI A;  3BPZ A;  4UCT A;  4N23 A;  2FML A;  3QTC A;  4TUY B;  1S77 D;  4I4T A;  1XNQ O;  2JEX A;  3N2K B;  1NT2 B;  1YZB A;  3U0Z A;  4L8J A;  3LDC A;  1S3J A;  3D3I A;  3ZJZ A;  3SYA A;  4X9Q A;  4J11 A;  2XOK G;  2YEV B;  2XAJ A;  2UUC B;  2EIK C;  1OCR C;  1XIL A;  4BIO A;  3HKD B;  4GKK O;  4JI6 O;  2UXD B;  3RYC A;  2WWW A;  2E74 B;  1FJG O;  3ZMT A;  3PN1 A;  1EBO A;  3UQ8 A;  4DV2 O;  3ABL C;  1XNQ B;  4O2A A;  4LF9 O;  1H8E G;  1RSO B;  1N8R W;  2HVK C;  3FB7 C;  3LSU A;  4K3A A;  3A8T A;  1IUR A;  2ZR3 A;  2AXT Z;  4JYY A;  5IDJ A;  3OR7 C;  3CRC A;  4J7J A;  3CWB H;  2YI9 A;  3QO5 A;  1JPX A;  3RYH B;  5TIS Z;  4GKK B;  5A2Q N;  1FJG B;  2Z3Y A;  4X62 O;  5KLV H;  4B3T O;  3U11 A;  3ETQ A;  3MD0 A;  3L71 H;  4DV2 B;  1RPO A;  1BQZ A;  1WLE A;  1KBH A;  4Z1V A;  1JX9 A;  3ASN C;  3FAV A;  2PZS A;  4LF4 B;  4LF9 B;  3OMA B;  2X7R B;  4I55 B;  1TAE A;  1XQ8 A;  4K8Z A;  2P06 A;  3K5N A;  3EHB B;  5FL7 G;  2OIG A;  3I5D A;  4JI0 O;  1IBK O;  3OE7 G;  1FXK B;  4NTY A;  1XMQ O;  4JAS A;  1Y67 A;  1A32 A;  3UO3 A;  4XBF A;  2GV9 A;  5EYP A;  4LH6 A;  3AK2 A;  4B3T B;  4DV1 O;  4YJ2 A;  1MA1 A;  2KSD A;  3AG2 C;  4W4K A;  2WLI B;  1WA8 A;  4FZ1 A;  2QKA A;  1UFI A;  3B09 A;  3OM3 B;  2F66 C;  5E79 Z;  1YF2 A;  3FD9 A;  3SYQ A;  3IC9 A;  4I5S A;  4JI0 B;  1IBK B;  2IJK A;  2QWR B;  1URF A;  2RQ6 A;  3ZHU A;  1MSW D;  2Q5Z A;  2OWO A;  4R6Z A;  1WB8 A;  1KYO F;  2A3Q A;  4DV1 B;  2Q0O C;  1H2L A;  4OGQ B;  5B1B B;  4B7K A;  4QGP A;  4MVO A;  4NR1 A;  2IU0 A;  2DWE C;  3WB1 A;  2GHY A;  3ZRV A;  2P67 A;  1MOF A;  4RUE A;  2Y0P A;  2A79 B;  1AI7 A;  2YDE A;  3ZN0 A;  4IHJ A;  2NN4 A;  2XHB A;  4NXM O;  2CH7 B;  2DQ0 A;  3MHH C;  4N21 A;  2ILM A;  2ZDI A;  2R9I A;  3ABM C;  4GUN A;  3F7V C;  3RYI B;  3M8A A;  2FB5 A;  4LF8 O;  3J7A U;  1OCZ C;  1SES A;  3EXA A;  3M99 B;  4HNA A;  1K9M W;  3CMA V;  2NR5 A;  1Y76 A;  3CHX A;  1SF9 A;  3LDD A;  4P30 A;  1DTO A;  3FYE B;  1BT8 A;  2EIJ C;  3T4Z A;  1HNX B;  2V4D A;  1JA8 A;  2P22 C;  4H44 B;  4DR6 O;  1NVP B;  3SYP A;  3H1I H;  3ABU A;  1BCC H;  5A9G A;  2P6J A;  4I0X B;  3THO A;  5KA5 A;  2F43 G;  2LFS A;  2EUL A;  3APO A;  4O4I A;  3SYO A;  2PI4 A;  1NS1 A;  1GN3 A;  2BOC C;  3JYC A;  3OMN B;  1MNG A;  3CS5 A;  4UVA A;  3H9V A;  3SJA C;  4PA9 A;  4GX5 A;  2RN9 A;  3RFR A;  1XDC A;  1Q86 W;  4UCS A;  4ZBM A;  1WP8 A;  1SQV H;  1HNZ O;  1ZUQ A;  3SYC A;  4UUJ C;  4DR6 B;  1YJN V;  4FM0 A;  4DV0 O;  4AQY O;  1R6N A;  3P3P A;  2B1G A;  1VQK V;  1SA0 A;  2UXX A;  1NTZ H;  1EFR G;  2HR3 A;  4YJ3 B;  2VS0 A;  4DRX A;  3E35 A;  1V55 C;  3MAQ A;  2LP7 A;  5J9P C;  2WA4 A;  2FKX A;  3LSS A;  4DK1 A;  4D7S A;  1IBM O;  4DR3 B;  5C8Y A;  2QTS A;  2ZE5 A;  4CS2 A;  4JZ2 A;  3SJQ C;  4CZZ A;  1MMM A;  1QU7 A;  1SQX H;  4K35 A;  2Y4U A;  4EB6 B;  4DV0 B;  5IJ0 B;  4AQY B;  1KU9 A;  5DN6 G;  4UVC A;  2A0L A;  4UFZ A;  2EIL B;  2XAF A;  2YXL A;  1DF4 A;  1ORQ C;  2JGU A;  2QKC A;  4J42 A;  2LGW A;  3BVO A;  4GKJ B;  2BTQ A;  5L3E A;  1B06 A;  1PNL A;  1UPG A;  2ZE6 A;  1G4Y B;  2DYR C;  4X1K B;  5B1A C;  3VQX A;  4DR1 O;  2OT5 A;  3F5T A;  3CCE V;  4KP4 A;  1N0N A;  1OCO B;  4GYC B;  1GM8 A;  1P49 A;  2CTR A;  4JI8 B;  2QTO A;  4QNH B;  1I5Y A;  1YVW A;  1YJW V;  3R65 A;  2OTJ V;  1FXK A;  3L72 H;  5EC2 C;  2Z5U A;  4DUY O;  3JAS B;  4JI3 O;  4KL1 A;  3CCR V;  1Q3E A;  3AG4 C;  2P4V A;  3AG3 B;  1V54 C;  2WPD G;  4O4L B;  4UXN A;  1B6Q A;  3E89 A;  4DR1 B;  1J95 A;  4DR4 B;  1EZJ A;  2YXY A;  2JRI A;  1ZX3 A;  4QE9 A;  2PYL A;  2QDO A;  3N2G A;  3T4D A;  1VP7 A;  1YIT V;  3B8N A;  4RAI A;  2WAM A;  1WPX A;  4BW9 A;  1ZWI C;  1QBZ A;  5BMV B;  2UXB O;  1US6 A;  1KQS U;  4JI3 B;  3RBZ A;  1PV0 A;  3EFF K;  2VQF O;  2EZO A;  4LCU C;  4TV8 B;  4NYK A;  2UUB O;  1DF5 A;  4CH6 A;  1E79 G;  4UB8 Z;  4FLZ A;  3K06 A;  4B3S O;  3HKC B;  4WBN A;  4IGG A;  1FD9 A;  4G2K A;  2HVJ C;  2WA3 A;  3T1H O;  5K1X A;  1Q6H A;  1WNS A;  1HWY A;  1PNM A;  1O9H A;  3PJS K;  3CME V;  1K92 A;  4R7C A;  2UXB B;  1YHQ V;  3K9A A;  3NXS A;  2ZE8 A;  2VQF B;  1VF7 A;  2UUB B;  2JK5 C;  3K3W A;  4NVP A;  1Y4M A;  5HFM A;  3K57 A;  1K34 A;  1Z5W A;  4JGS A;  4B3S B;  3T1H B;  5GW7 A;  4JYB A;  1RPR A;  5L3D A;  2YID A;  5LOV B;  1NZ6 A;  1EN4 A;  1TA8 A;  1D5N A;  4X65 O;  4MVM A;  4LC1 A;  3OGI B;  4LBE C;  3CSX A;  1QLN A;  2IJH A;  3E2E A;  1N32 O;  5KUK A;  1JFF B;  1JMK C;  3ABK B;  1RM1 C;  4JAU A;  1NH2 B;  5JJE B;  2RMK B;  2CTQ A;  4MSW C;  4FFB A;  1Q8I A;  2YI8 A;  1ZL8 B;  3APQ A;  5JVD B;  3MDS A;  4XDK A;  2F1M A;  3FYI B;  4DR2 O;  2CDY A;  1VQM V;  1W0K G;  2XUM A;  1QNM A;  2R72 A;  1H38 A;  1XHZ A;  1VQ6 V;  5LL6 Y;  1Y74 B;  1TVK B;  4K8X A;  2EIN B;  3WG7 B;  3ZRX A;  5EBM C;  4YHH O;  2WLM A;  2BCC H;  3OR6 C;  2UUA O;  4BIU A;  3DC6 A;  4ZIB A;  2EJ7 A;  3CJH B;  4DR2 B;  3JAT A;  4R8C A;  2ITD C;  1WP7 A;  4EB6 A;  2HP8 A;  3LNM B;  1BHA A;  3ETG A;  2GUZ B;  4OX9 O;  1R1B A;  3CX5 F;  4JV5 O;  2AZ0 A;  4G28 B;  3RN4 A;  4U3F H;  2LO1 A;  3ZS8 C;  1I0H A;  1TUB A;  1FFX B;  3SPJ A;  1K4D C;  5KX5 B;  2YS8 A;  3VOU A;  4LFA O;  5LP6 B;  2BE3 A;  3K08 A;  2XTA A;  3KCX A;  4B3R O;  3C3T A;  2L35 A;  4DR5 O;  3JAR B;  4WCE V;  5EIB C;  5LGT A;  3S3X A;  4JYA B;  4K0K B;  2ZIM A;  4Z2W A;  2PY5 A;  1SRY A;  2BOB C;  4JV5 B;  3ZMV A;  2V1D A;  1JCH A;  3SPH A;  5CB4 B;  4O2B A;  2YIB A;  2CUG A;  2EIM B;  2EZP A;  5BR8 O;  1GM9 A;  2QKS A;  4X66 B;  2N05 A;  3ZRS A;  1H8H G;  1X59 A;  1XL4 A;  3CCV V;  4GCZ A;  3JD1 A;  4DR5 B;  1CPY A;  3BA9 A;  4JF3 A;  2JS5 A;  3O65 A;  3DTU B;  4OXS A;  4PJ0 Z;  3D36 A;  3ZCC A;  4ZOL A;  5ITZ A;  4LF7 O;  3JD3 A;  3BAA A;  3KCY A;  3Q4H B;  3BHP A;  1ZAU A;  3CCM V;  3RYF B;  1QCE A;  4TV8 A;  2FTK A;  2PUS A;  1R6K A;  1JVM A;  1SQG A;  1AR4 A;  1U96 A;  4X20 A;  1YTF D;  1BL8 A;  1FXK C;  2V7Q G;  5KHH A;  1KP3 A;  3WU2 Z;  5LA6 A;  1AI5 A;  4MTG A;  1CEZ A;  3ICX A;  5KHK A;  1L0L H;  2QWQ B;  2QWP B;  5J2T B;  4TWK A;  5LMN O;  3TXS A;  2CE4 A;  3NR7 A;  3JAW A;  1FPO A;  3UO2 A;  1FS0 G;  2GSM B;  4AI8 A;  5LHG A;  1PKX A;  4WFG A;  3L73 H;  4X1I B;  2OYQ A;  5B5E Z;  1N36 O;  3AG7 A;  4FVM A;  2A7W A;  4UCV A;  4I9Q A;  5LYJ A;  2ZCE A;  1I5X A;  4NXN O;  2DQ3 A;  2OCC B;  1IBL B;  3CCQ V;  5KHI A;  5LMN B;  5EZY A;  2QM8 A;  4Q20 A;  5JH7 B;  3ZHQ A;  5D5Q A;  2JEU A;  1L8D A;  2ADP A;  3CC4 V;  5H9C A;  1N36 B;  1VQN V;  2RJZ A;  5B3S C;  4JI4 O;  1ZL8 A;  4JTA B;  3B8M A;  2JVD A;  3A0R A;  4H33 A;  5JVD A;  1BE3 H;  4OPH A;  3UT5 A;  5GTI Z;  4NXN B;  4XDJ A;  3QG5 A;  5EC1 C;  4B08 A;  5KMG B;  2Q73 A;  5IYZ B;  4JI7 O;  1CP9 A;  4LNU A;  1M57 B;  3K03 A;  3T1C A;  4YIP A;  4JI6 B;  1AR1 B;  1VQL V;  4CC5 A;  1Y74 A;  2GTA A;  2WLN A;  4O4H B;  4ZHQ B;  3F5W C;  3ZX6 A;  3JAK A;  1QLE C;  3JCZ A;  4X1Y B;  4JI4 B;  1MAB G;  2E3C A;  4ZI7 B;  2QEX V;  5LXT B;  1VQ5 V;  5CA0 B;  3K5M A;  1K5Q A;  1FYJ A;  1Z2G A;  4UB6 Z;  2IBZ H;  4MVS A;  4MS2 A;  5LMU O;  4EKW A;  4JI7 B;  3E22 B;  2HJF C;  4MTX A;  3CRA A;  5JWP A;  1OCC C;  1H2S B;  3SJC C;  2DMX A;  4X62 B;  5KX5 A;  3FB8 C;  3ZMS A;  5CA1 A;  1U97 A;  2ZIN A;  2AHZ A;  4A5U B;  3B2E E;  2KQX A;  2KG7 A;  2H8P C;  1E1Q G;  3ZIA G;  5H2F Z;  1FXV A;  3CE2 A;  1KP2 A;  5LMU B;  5CBH A;  1I94 O;  2X6C A;  3HKB B;  4TOI A;  2YIB D;  2JS3 A;  2K1E A;  1XMQ B;  1QQC A;  4YY3 O;  3G4S V;  1PM9 A;  2QWO B;  2M7W A;  2Y48 A;  3BAB A;  2HG5 C;  2HEP A;  2GBO A;  1OV9 A;  4LFB O;  1K3E A;  4TV9 A;  2DWD C;  3X2Q C;  5DED A;  2ATK C;  1AI4 A;  1TGO A;  4FZ0 A;  1S5H C;  3DGE A;  1N33 O;  3DC5 A;  4PDM A;  4F6E A;  1AR5 A;  1Y66 A;  2IH3 C;  5BXZ A;  2VQE O;  2P5O A;  4UVB A;  3DXR B;  2F95 B;  4CS3 A;  5EBL C;  4YY3 B;  1THZ A;  1W2B U;  2Q6A A;  2WLL B;  5J2U B;  1OCR B;  1R73 A;  2CAZ C;  1QR9 A;  2UXN A;  3KKY A;  2E76 B;  3ZMZ A;  1KKC A;  1BQ0 A;  3RYF A;  1H2G A;  1R3K C;  2EBO A;  2ZM6 O;  2OIE A;  2HLD G;  4FPP A;  3ABL B;  4B3M O;  5IYD O;  2XAQ A;  1FAF A;  1GMG A;  1CXZ B;  1JJO A;  4LF5 O;  4NXM B;  1ENV A;  2VQE B;  4PI2 A;  3K58 A;  1PP9 H;  4O4J B;  4LF8 B;  3JSL A;  4HBN A;  1EN5 A;  5H6Q A;  5IYC O;  1BSM A;  3OTO O;  2Q67 A;  1KC8 W;  1NI8 A;  5IY5 B;  2BSK A;  1UJW B;  2YUA A;  2YIA A;  2NLJ C;  4FM1 A;  3DSQ A;  2YSU B;  2ZM6 B;  3IFX A;  2Q7E A;  1IXB A;  1BS3 A;  1IZ3 A;  3D36 C;  4B3M B;  4DK0 A;  3ASN B;  4TUY A;  1M5I A;  2N04 A;  3R66 A;  3N2K A;  2W6I G;  4CH5 A;  1XMO O;  1EZV H;  2IJI A;  3CC7 V;  2FYU H;  2X6A A;  1G8M A;  1SQQ H;  3UKM A;  2YEV A;  3B40 A;  3I55 V;  2XT9 A;  1MZE A;  3HKD A;  3RW0 A;  5FNV B;  4JZG A;  4FIP C;  3AG1 B;  4GX0 A;  1HNZ B;  3AG2 B;  4E2L A;  3W7W A;  1XHX A;  1Q6U A;  1AP6 A;  1RSO A;  3CP1 A;  1G1X B;  2K9P A;  1XMO B;  1YSC A;  3CCL V;  4I50 B;  4DV7 O;  4LH7 A;  1F51 A;  4FLT A;  3U10 A;  4DV6 O;  5IYZ A;  4F6R B;  3IJ4 A;  3OUF A;  3RYH A;  4GZR B;  1P84 F;  3JD0 A;  1IBM B;  2L6L A;  5H5N A;  4RWU A;  1GAX A;  1MZF A;  2HHH O;  3CC2 V;  3OTF A;  4X1Y A;  2VWK A;  4JI1 O;  4W4L A;  4UCR A;  4I55 A;  3SPG A;  2QJ1 A;  3CRR A;  4DV7 B;  1M4U A;  3QO7 A;  3ABK C;  1HDJ A;  2JJ1 G;  3ABM B;  3ZHV A;  2R9A A;  5BZB A;  2UU9 O;  3D8C A;  3ETE A;  3T1Y O;  4JI1 B;  2QM7 A;  2WLI A;  2Q69 A;  5B66 Z;  2JJ2 G;  3G71 V;  2AZ2 A;  3L70 H;  3E8G A;  2EIN C;  3WG7 C;  5KAF Z;  4DUY B;  3CXH F;  2ZIO A;  1OZ0 A;  3L9D A;  5CBG A;  4J9Z B;  2Q4P A;  3A2F A;  4RO2 A;  4HZ3 A;  1R3I C;  4QE7 A;  3T1Y B;  1GO3 F;  4JPR A;  4JTC B;  3AK3 A;  1NU1 H;  3TXQ A;  2Q7G A;  1N4C A;  5L3F A;  4JI5 O;  3HKE B;  4LWS B;  2CH7 A;  5EK0 A;  4RUF A;  2FL4 A;  2LW1 A;  5LP6 C;  1K7D A;  1SZX A;  1KEC A;  5E1A C;  3GWK C;  3RYI A;  3SJB C;  1K4C C;  3SPI A;  2IH1 C;  4MW8 A;  4DW0 A;  1T5E A;  3BFR A;  2ADQ B;  2D2C B;  3ASO C;  3JAL B;  3GVM A;  5GON B;  4UCU A;  4PD4 F;  3KZI Z;  1AJN A;  4I0X A;  2RNB A;  5CA3 A;  5BY1 A;  4PA3 A;  2JDI G;  3OGC C;  4I4T B; 
#chains in the Genus database with same CATH homology
 5KAF Z;  4UB6 Z;  2AXT Z;  5H2F Z;  4PJ0 Z;  5B5E Z;  3KZI Z;  5E79 Z;  5TIS Z;  1S5L Z;  3A0B Z;  3WU2 Z;  5GTH Z;  3A0H Z;  4UB8 Z;  5B66 Z;  5GTI Z;  5KAI Z;  4IL6 Z;  3JCU Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...