4JI8O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji8O00
1DK1A 4NXMO 4DR5O 1AILA 1HR0O 2LW7A 1X59A 5H5NA 1XNRO 4DR7O 2DOSA 3T1HO 4B3MO 1A32A 5LMUO 4B3TO 2Z0AA 1N34O 2UUAO 4X62O 3J81N 2FKXA 1FJGO 1HNZO 4DV0O 2VQEO 1YZBA 1XMOO 4KHPO 4NXNO 2UXDO 5BY1A 4OPAA 2UUBO 1NS1A 2UXBO 4JI3O 2UUCO 5FLXN 5A2QN 4OPHA 3F5TA 4GKKO 1XEQA 3RT3C 4JI4O 4LFCO 1R1BA 2E5LO 5LL6Y 2UU9O 5BR8O 2DJVA 4X64O 3O65A 1G1XB 2JRIA 4X66O 1IBKO 4JI5O 4LFAO 4DV5O 2UXCO 4LFBO 4YHHO 5LMNO 4A5UB 4JI1O 4GKJO 4JI7O 3J7AU 1D2DA 1XMQO 1IBMO 3J80N 4DV6O 4JI0O 1IBLO 2F4VO 1J5EO 1KUQA 1FKAO 4LF8O 1I94O 4YY3O 5BXZA 1N36O 1XNQO 4DR1O 1HNWO 2AGAA 3T1YO 2ZKOA 1F7YA 4X65O 1R6TA 4DUZO 4LF6O 4K0KO 3OTOO 4DR3O 4LF5O 4JI2O 4DV3O 4AQYO 4JI6O 5IT9N 2HHHO 4OX9O 1HNXO 1N32O 4LF4O 1AB3A 4DV2O 1N33O 4LF7O 4DV7O 2N74A 3R66A 4B3SO 2VQFO 4DR2O 5IWAO 2ZM6O 4JI8O 3SDLA 4LF9O 4B3RO 4DV1O 4DV4O 4DR4O 3M8AA 4JYAO 1FYJA 4DR6O 4DUYO 3JAMN 4JV5O
chains in the Genus database with same CATH superfamily
2Y48A 5IYBO 4TWKA 4IT5A 4ZI7A 3I5DA 2F23A 5KHKA 1AR1B 4MTXA 4DYLA 1SERA 4PA4A 5KA5A 1EZVH 1QR8A 4NXNO 1VQ9V 1AP6A 1Q3EA 4F6RB 2ZT9B 1RSOA 2M7WA 4PV1B 4O4HA 3RVZA 4DR6B 2Q7GA 4TV8A 2F66C 1WJZA 3AG2C 3CRQA 4I5SA 1HR0B 1GMGA 2FYUH 5D5PA 5CB4B 2D3OW 2CGOA 2JK5C 2UUAB 3OMAB 1JA8A 2ZINA 3ML0A 5L3BA 4DV6O 1PP9H 4KHPB 2X6BA 2E76B 4DW1A 5C8YA 3JATA 1RPRA 1F4NA 4DV6B 1FXHA 3CYOA 2AGAA 5KUMA 3OTOO 3SYQA 4MVQA 3OW2U 1XL4A 2XAHA 4DV3O 1N4CA 1XBLA 1COWG 3L72H 2HHHO 3OTOB 4G27B 3PJSK 3K79A 1PPJH 1YJ9V 4DV3B 1K8AW 1EN4A 3M7MX 3DXRA 2HHHB 5H9CA 1N33O 4PI2A 2ZIMA 1RM1B 1S5LZ 1S5HC 5DN6G 3FB8C 5JVDA 4QPJA 1H38A 5IY5C 5KA6A 4KFMA 4ZHQB 1BE3H 4X20A 1FYJA 4UVCA 2W0FC 4O4JB 1MSDA 3BPZA 2LW7A 3IFXA 1XNRO 4O2AA 1K9MW 4YIOA 1D5NA 1XNRB 2RCVA 4UFZA 1EN6A 2A9HA 1AI4A 3SJBC 4JTAB 4NKGB 1AI7A 1ZWIC 5AG2A 3RYHA 1IXMA 3B2EE 3F5TA 3MHSC 3DTUB 1GAXA 5L3DA 5BR8O 5KHIA 4BW9A 4JV5B 2JDIG 3SJAC 4P30A 3ZIAG 1NU1H 2EJRA 1WP7A 4D7TA 4EFBA 4DV5O 1VQ6V 5BR8B 3ETEA 4YJ3B 4O4LB 5LMNO 3AG1C 2ADQB 3KCYA 4I7ZB 4DV5B 1D2DA 3WB2A 3E86A 1XILA 4Z1MG 2E75B 5FNVA 1IBMO 2XHBA 1WP8A 3T2MA 3QG5A 3CCSV 4PDMA 3RYCA 3JASA 1IBMB 1XQ8A 4B7KA 3EHBB 3RFRA 4JI4B 5K1PA 5TISZ 3CCMV 2WWWA 3ZS8C 2ZKOA 3FYIB 3CC7V 2Z5UA 5ITZA 4MVRA 3B8NA 2PI5A 5IT9N 2V1DA 4LNUA 3KG2A 2K1EA 1AB3A 1M56B 1DF4A 2OCCC 4O2BB 3S3WA 1XMQB 3E8GA 4H33A 3JCZA 5KHJA 2HJDA 3G80A 3STZC 4UCRA 4DV1O 3W7XA 1H8EG 1KKCA 4DRXA 2ZE5A 3T1YB 1VQ5V 2Q67A 5D5QA 1K5QA 4UCUA 3ZMVA 4DR5O 1TUEB 2NNUA 5BZBA 1Y76B 4B3MO 1BCCH 2Y0PA 4Z1VA 2Z0AA 4F4LA 2Q7HA 4EB6A 3J81N 5KX5A 1I08A 3IC7A 4O4IB 1HNZO 4JYYA 1RFYA 3N2KB 3K5OA 5EBWC 5BY1A 2UXBO 1CEZA 1NH2D 3RT3C 4FFBA 1FXKA 1BS3A 2Y69C 3FKSG 5EZYA 5LL6Y 2UXBB 2HG5C 4J10A 1Q7YW 1UJWB 2HJFC 2E74B 3GB7C 1SESA 4LFBO 1UFIA 5B1AB 1RPOA 1W59A 1EZJA 5LP6B 1Q82W 4DK1A 1YVWA 1KBHA 4LFBB 2ZR2A 2KB1A 4X88A 4NTYA 1M9NA 4W4LA 4IIJB 5JQGB 5LYJA 3TXSA 5FPOA 1RM1C 3CMAV 3CCJV 1EM1A 1P84F 1WA8B 3JAWA 1GN4A 3JD2A 4JI6O 2Q9LA 4WFHA 4LFAB 2YXYA 1ZSPA 4OX9O 1HNXO 1F23A 5JWPA 5L3CA 4OXSA 4K8ZA 1OCOB 4GKJB 3ZHVA 1HNXB 5GONA 4DV7O 2HVJC 1MABG 3BAAA 1KU9A 1Y67A 2EBOA 2IJKA 1AR5A 5B3SB 4JYCA 3CRCA 3HKEA 4DV7B 5LHGA 2OIGA 1Q81W 3K5LA 4RO2A 4I55A 2IJIA 2HP8A 3THOA 4YJ2A 4X65B 3I55V 3RYIA 1E1QG 2KQXA 4LWSB 4MVSA 1PL0A 2WSSG 5IDJA 4WBNB 1ZL8B 1A32A 5IYZB 1VQLV 2QJ1A 3W7WA 1LUWA 3FFQA 1NI8A 4E4EA 2DYRB 1MG1A 1LUVA 5E1AC 2BCCH 2AZ0A 3N2GA 5KLVH 3ICXA 1QBZA 1YHQV 2HFEC 5J2TA 2JS3A 3ABMB 3B8MA 1L1FA 4H13B 2DN9A 1K92A 4MVZA 4RUFA 5LOVA 2PTMA 2FB5A 2WLLB 4DUYB 2WLHA 5JCOA 2XNDG 3HKBA 4R7CA 2IU3A 3JD4A 2P7TC 1XHXA 3C3TA 1Y74B 3ASNB 3W7UA 1WPBA 2ITCC 2B1IA 3C90A 2M6YA 2CUGA 1VQMV 1HNWO 2WLIB 1SQXH 4YXWG 1I5XA 5H2FZ 4DUZO 4JYBA 4BIZA 1YSCA 3KZIZ 1NTZH 3FB7C 4JF3A 4WFBV 2QM4A 4JI2O 2EIJC 2WLMA 3WG7B 4DUZB 5IJ0B 1R73A 3HPLC 1XDCA 2P4VA 1PNKA 2B5UA 3UT5A 1NBMG 3K0GA 1BL8A 3BA8A 3AG2B 4R6ZA 5KMGA 1GN2A 1OCZC 5FL7G 4B7EA 2W6JG 4EFEA 4WFAV 4CS4A 5EYPB 1CPYA 4DR4O 2P06A 1YCIA 5KUKA 3JAMN 2FTKA 4NXMO 4DR4B 4DK0A 3G71V 1FXKC 1R3IC 5J9PC 3MAQA 4LBEC 3Q4HB 3H1LH 3AK3A 1WAZA 2OTLV 1SC5B 1VF6A 1YJNV 1GM9A 1XMOO 1SS3A 3L9DA 1PD3A 4JI3O 4BWAA 4RQEA 3H1IH 3ABUA 4GKKO 3DGEA 5LP6C 5LXTA 3UM7A 1FFXB 2DJVA 4UB6Z 4GKKB 2LGWA 2MW2B 1Q6HA 4JI5O 4I4TA 1AJQA 3L71H 2UXCO 2Q68A 3OUFA 2XOKG 4KP4A 4BAYA 1N0JA 2LJ2A 4IL6Z 2B1GA 1XHZA 2UXCB 3A8TA 2YDEA 5GTHZ 2OTJV 4LF8O 2WA4A 1G4YB 1OCOC 5HFLA 2CTQA 1BGYH 1WNSA 1ZAUA 2Q4PA 4LH6A 2GHYA 2EZPA 3ZRVA 4LF8B 5J2UB 5A9GA 1QLEC 3CSXA 4MTOA 1VQPV 1SA0B 4I50A 2VS0A 1VARA 1PNMA 4ABMA 3E83A 4J9ZB 1KB9F 1K4DC 4J80A 3LDEA 2XAGA 2HKOA 3CS5A 1M4UA 2Y0IA 3RBZA 4TQDA 3QTCA 2EZOA 5EBLC 1AI6A 4PDRA 3R66A 2VQFO 4RUEA 2WLKA 5IWAO 3B40A 5IJ9A 2F4VB 4B3RO 3AG1B 4DV4O 2VQFB 2BTQB 4K3AA 3SYOA 1JQ0A 4JYAO 2GUZB 4XDKA 2MK3A 4K0KB 1ZLZA 3K06A 2FL4A 5KHHA 4DR7O 2Q73A 3T1HO 4JYAB 3ZJZA 4EKWA 3K03A 3E8FA 4N21A 2QR4A 4DR7B 4P2ZA 3L70H 1HDJA 5L3GA 3T1HB 5CA0A 4FLZA 4U3JA 3O9OA 2KG7B 3RVYA 3KKYA 1IXBA 2JEXA 3OEEG 4FLXA 5LGNA 1SQGA 5B1OA 1BMFG 2W0XA 5DECA 2EINB 4JAAA 2QM8A 4PELA 2OCCB 2XAQA 4H37A 3B09A 2LP7A 3JAKA 4ZI7B 4Q20A 2ZDIA 4FVMA 3JD1A 4CH5A 1GKFA 2GDSA 2UXNA 3VOUA 3K5MA 4ZBMA 3WG7C 4PA6A 4NTWA 1RSOB 4NXNB 2BE3A 1GO3F 4G2KA 3OM3B 3JD0A 4X1IB 4O4HB 3OGIB 4HNAA 1XNQO 5JH7A 3ZHTA 4TV8B 4NR1A 1F7YA 2R70A 1H2MA 1K73W 1YXBA 2HLDG 3BHPA 5EC2C 3CE2A 1GK9A 4CH4A 4AQYO 3EVKA 1QQCA 3VQXA 2Y69B 4TQFA 3OAAG 3WU2Z 3GWKC 4AQYB 4UVAA 2ZIOA 2ZE6A 2Q0OC 1R6KA 1F51A 1SZTA 5C8YB 2EIMB 3JATB 2IU0A 5K1XA 5L3EA 4FPPA 3QO7A 3A2FA 4LF9O 4I0XA 3OR7C 1VF6C 4CC6A 4LF9B 2YEVA 3CX5F 3QO5A 1EFRG 1ZX3A 3LDCA 2IJJA 3DXRB 4J42A 4E2LA 1HP8A 4IHJA 5JVDB 1N33B 2JGDA 4GX2A 2ZD9A 1SQVH 2D2CB 4PI0A 2UUBO 2V7QG 4F6EA 5IE9A 4X20B 1NZ6A 4UCVA 1R1BA 2UUBB 1MOFA 4JASA 4NB5A 3CCLV 4O2AB 2CE4A 2LQTA 4FZ1A 1SRYA 4FMTA 1E79G 4MSWC 3CC2V 4K8XA 2YS8A 1OZ0A 1M57B 1VIBA 2YSUB 4UCTA 3RYHB 3D3QA 2EJ7A 3JALA 1XOUA 3SPCA 1BQZA 1EN5A 2JEUA 1FKAO 1N8RW 4U7OA 2F93B 2HR3A 1VF7A 2QTSA 2PI4A 1PM9A 3B77A 1R6TA 1K4CC 4UCOA 1JOYA 4TUYA 1K97A 2QKCA 4TV9A 1KQSU 3CCVV 3F7VC 3RYFA 2XUMA 3QNEA 5FNVB 5LMNB 4DV2O 2O57A 4CS3A 3JSNA 2XT9A 3JSLA 2X0LA 3JASB 4DV2B 1XL6A 2ZNIA 1P7GA 1PNLA 1TVKA 5KAIZ 4JTCB 5ITZB 3HB3B 1Z5VA 1YIJV 1THZA 4LNUB 2EINC 2CTWA 4B3TO 3IAYA 2P4KA 4X62O 1H2LA 4H0LB 1X4TA 2XTAA 2QA4V 1FJGO 3M99B 1TUBA 4HZ3A 3TETA 4ZOLA 3UO3A 1L8DA 2EX3A 2EIJB 4DRXB 3OTFA 1BT8A 2YIDA 4DV1B 1NH2B 3WFVA 3ETDA 1QHTA 1Q6IA 1OCZB 3N27A 4DR5B 4EB6B 1MZFA 5KX5B 4B3MB 3RN4A 2JJ1G 3FAVA 1GH6A 5B1BC 2DQ3A 4H44B 1HNZB 1MNGA 1Q43A 2DE0X 1G6UA 3BEHA 5JJJB 1IURA 1US6A 4FFBB 1FXKB 4C7UA 4ASUG 5EZYB 2KKWA 4G28B 2WA3A 2QKAA 1JPXA 1O9HA 2EIMC 3LSSA 1SQFA 1S5JA 1RP3B 4WCEV 4DW0A 2GTAA 1W0JG 5JJEB 1R3KC 2PF4E 1VMGA 3K9AA 1VQKV 3HKDA 3E22A 4WFGA 3ZRXA 4B3SO 2YIBA 2F1MA 1QLNA 1PL4A 1URFA 5LYJB 3FX7A 2Q5ZA 2V4DA 3M8AA 2P5OA 5CA1A 4CBCA 2RQ6A 3JAWB 3NXSA 3CRMA 1L0LH 4ICGA 3LUTB 3TK1A 4JI6B 4OX9B 1P7BA 3CB2A 3JARA 5GONB 1XREA 3BABA 1LNQA 1QLEB 1AI5A 3ZMSA 1H2NA 4UV9A 2QE7G 3HKEB 1AJNA 2ATKC 4RQFA 1FD9A 2BSKA 3ZHSA 4I55B 4OPHA 1M57C 4YJ2B 2RJZA 3SPIA 4LFCO 3RYIB 4NTXA 2Z3YA 5B66Z 1H2SB 4FIPC 2A0LA 1IBKO 1M93A 3T1CA 2Q6AA 4YHHO 3ZRWA 4AHCA 5J2TB 2R9IA 2H8PC 4FJCC 4YHHB 2R72A 1IBLO 1ORQC 3ZEDA 3SPHA 1J5EO 1WLEA 5LOVB 4X89A 1N36O 1H8HG 1U96A 2Y4TA 2OT5A 5C93A 2DMXA 1IBLB 1J5EB 3HKBB 2DWEC 2KSDA 4BR6A 1KYOF 4AILC 5BMVA 2PUSA 1VQ8V 3A0HZ 2WLLA 3ZN0A 1MSWD 1WPXA 2P90A 3OMNB 2CH7A 2AHYA 2GSMB 4JI8O 1TGOA 2CTRA 3SR2C 3CXHF 2IW5A 1HWYA 1HNWB 2ZE7A 3HR0A 1Y6XA 3AG3C 5GW7A 1M90W 4MVUA 5IYCO 4JI2B 2A7WA 3UT5B 2F95B 4TT3G 4WFEA 4CH6A 1MZEA 4LP8A 1K33A 1IX9A 1WB8A 5KMGB 2ZXWB 1VF5B 4R50A 4OGQB 3FYEB 3OMIB 5IJ0A 1P49A 5DEDA 3OD4A 4UB8Z 3UQ8A 5LBQA 3ETGA 2ILMA 2LFSA 4W4KA 4FLVA 3ZMUA 2QWNB 2X6CA 1G1XB 1O9GA 4NXMB 4X66O 3F5WC 5DM6V 1H2GA 4JZ2A 4X1KA 3BRCA 1S0VA 1L0NH 1V9PA 4JI1O 1NTKH 4PHZA 4Q6GA 4JI7O 3VBBA 2PGGA 3K08A 3SYCA 1B6QA 2QWPB 2CK3G 5LA6A 4LR3A 1XMOB 4JI0O 4JI7B 5LXTB 2QWRB 4CH3A 4JI3B 4N23A 4IYHA 2X6AA 1OV9A 3ABTA 4DR1O 4JI0B 3SYAA 4I4TB 3MDSA 2ADPA 4DR1B 3SPJA 1SF9A 4JI5B 2RN9A 1BHBA 1W2BU 3CCUV 1LR1A 2ITDC 1UPGA 4CZZA 3L75H 3CCRV 1VEWA 4XBFA 2Q7EA 3L74H 4LF7O 1YI2V 1Z2GA 2GBOA 3G6EV 5CBHA 1Q5OA 1S3JA 1JMKC 3DC6A 4BIOA 4LF7B 2NR5A 4JZGA 4GUNA 4I50B 4QE9A 2AHZA 5F2VO 3X2QB 3C3SA 1V54B 1YJWV 3P3NA 1KP3A 2ZE8A 5B1NA 1X59A 4IGGA 1JFFA 1B04A 2DYSC 1E1RG 3CJHA 3CRAA 5EBMC 3MD0A 4CS2A 1W0KG 2XASA 4MVMA 4X1YA 5IJ9B 3ABKB 4FZ0A 2EIKB 5IWAB 3SJCC 2H3OA 4B3RB 4BW5A 3VQYA 4ZIBA 4DV4B 5LGUA 3O65A 2YI9A 2N04A 4J7ZA 1KC8W 2L35A 3SJQC 5CA0B 5JCOC 3I56V 4U3JB 4LCUC 2K9PA 2ZR3A 4I9QA 2ZQMA 3APQA 4MTFA 1BQ0A 1FXVA 3K59A 4X9QA 3HKCA 3FD9A 4PD4F 3AG4B 3U11A 1NTMH 2YUAA 4YY3O 5BXZA 3K5NA 3T4DA 1SQQH 3JAKB 4GX5A 3BCCH 2ZNJA 5LGTA 1CP9A 4QJFB 1NQTA 1MA1A 1M5IA 4LF6O 4YY3B 4GX1A 1OJHA 4LH7A 2IH3C 1Q8IA 2GTSA 3K9SA 4LF6B 4B08A 3E89A 3CCQV 5CBFA 3G4SV 1BSMA 5KHGA 2L6LA 2JS5A 3D8CA 4HNAB 3AG7A 5JH7B 3U10A 3CXCU 2JJ2G 1G8MA 2ZXWC 3ZHQA 4F6RA 4QGPA 3ZX6A 1XNQB 3D36A 2A79B 1OCRC 5B1BB 3CRRA 1SKVA 2XAJA 4DR6O 1KKDA 1HR0O 4X1IA 4D6TH 3H1KH 5FPRA 4FFKA 2UUAO 1QCEA 1PKXA 4GLXA 3QVNA 5CB4A 2BOCC 1SQPH 4KUMA 3CCEV 1NT2B 2PYLA 4KHPO 4I0XB 2UXDO 1ENVA 4D7SA 2JVDA 4FK5C 2VWJA 4KL1A 1NKDA 2LW1A 2OIEA 3LSQA 2VRZA 3G6BA 2YEVB 2UXDB 2E3CA 1NR1A 3H01A 3JD3A 4JAUA 5HFMA 1B3QA 5CN0A 3GWOA 4P9OA 4MTGA 4CC5A 4A5UB 4IHJB 3RGBA 1R3LC 2PZSA 2JGDB 3IC9A 1HW7A 2IJHA 1D5AA 1Q6UA 1GM7A 1YTFB 2JIZG 1YDXA 3S3XA 4J11A 1JR9A 4ZHQA 3VQVA 2WLJA 1FAFA 4O4JA 4QIWF 3BY6A 4LF4O 3X2QC 1QVGU 1V54C 1V55C 4FLYA 1YTFD 3JALB 5L3FA 3H1HH 4LF4B 1Y4MA 3E8HA 2OWOA 2ETNA 2CTPA 1ROPA 4UCSA 4TUYB 3ABKC 3ZHRA 3K0DA 4GX0A 4JTDB 4JV5O 2EIKC 1QNMA 3E8BA 1DK1A 4TV9B 2EILB 2QTOA 5H6QA 1DF5A 5H6RA 3RYFB 2DOSA 3UCSC 1QVFU 1GN6A 2FKXA 4UUJC 2PY5A 3RYCB 1FS0G 4YJ3A 4O4LA 1ZUQA 4XDJA 3UKMA 1JJOA 1NS1A 1TVKB 4JI4O 2DW4A 3E2EA 2WLNA 2P67A 2R9AA 3H1JH 3AG4C 2JRIA 4J41A 3OT7A 2WPDG 3AK2A 1YEWA 1AROP 2ZDIC 2OYQA 4BIUA 1TUBB 4B3TB 3TJTA 2QM7A 1DTOA 3WB1A 4X62B 1AJPA 4J7JA 4ZOLB 3AG3B 1FJGB 1OCCB 2IM9A 1I5YA 1XMQO 4QE7A 4O2BA 4MW8A 1AR4A 1JX9A 4FLWA 2NLJC 4TOIA 1KUQA 4PA7A 1VP7A 1I94O 3STLC 2PYJA 1BHAA 3T1YO 5CBGA 5LHHA 1I94B 1U97A 4UV8A 4DR3O 1FPOA 4TSFG 3TXQA 3B4SA 2X7RB 4KXRA 2YXLA 1YITV 1WB7A 3APOA 3D36C 3FAVB 2H94A 3E35A 4DR3B 1F4MA 4ZKIA 1Y76A 3TCUA 1YF2A 4O4IA 3N2KA 4U3FH 4L8JA 2CDYA 5E79Z 2R9RB 3A0BZ 2CAZC 2QWQB 2RDCA 1GRJA 2HVKC 5EC1C 1IZ3A 3BVOA 2W6IG 1AILA 5B5EZ 1SZXA 1QR9A 2P22C 1KECA 4YIPA 1NJIW 3LNMB 4U7NA 3HKDB 3E22B 5KAFZ 4DV0O 1YZBA 4MT8A 1M1KW 4IYIA 2QDOA 3GVMA 3ZN1A 5LP6A 4B3SB 3RW0A 4DV0B 2UUCO 5CA1B 2DWDC 2HEPA 2XAFA 3IJ4A 4UVBA 1XEQA 1OHHG 3AEIA 2ZCEA 2UUCB 3JYCA 4IIJA 5JQGA 3CMEV 3R65A 3OUSA 1DLBA 2Q8VA 5EIBD 2YIBD 4HYOA 3L73H 3ZBHA 4J7KA 4LFAO 3JARB 1MMMA 1WA8A 4GKJO 1Q86W 2BTOA 2BSKB 3PN1A 5CMUA 2QWOB 1TAEA 4JAVA 2DYSB 3P32A 2RNBA 3P3PA 1I0HA 4NYKA 1R3JC 2ODMA 4LFCB 4X65O 3U0ZA 4FM0A 2G38A 4J9YB 3K04A 4LF5O 2CGNA 3N2GB 1IBKB 1N0NA 4QPKA 3G67A 2QGNA 3ZRWB 4LWSA 3ZHUA 4WBNA 1ZL8A 4FM1A 4LF5B 5IYZA 2EILC 2IH1C 3F7YC 3ASOB 4MVOA 1FFTB 3CP1A 4L87A 3OR6C 4DR2O 3A0RA 3ZCCA 1K5SA 1NVPB 1N36B 2LFRA 4DR2B 1GM8A 4FM2A 4GCZA 4DUYO 3RWRD 5BMVB 1VQNV 1ZTEA 3KCXA 3CD6V 3FB6C 2Q0AA 2FMLA 2YI8A 1IDSA 1Z5WA 1SETA 2CH7B 1NVPD 3ABLB 3ZMTA 4PJ0Z 2LGQA 1Y74A 4OPAA 2UXXA 5FLXN 4JI8B 5A2QN 3NR7A 1OCCC 2P6JA 2YXHA 2YIAA 2IBZH 4PDVA 2E5LO 4Z2WA 5IYDO 1M56C 2UU9O 3TGUH 3AK1A 1VQOV 5LHIA 4MS2A 1K7DA 2WLIA 2QEXV 3OGCC 4PA3A 2E5LB 2UU9B 4NVPA 5JJNB 4GT1A 1VQ4V 2B9ZA 3EXAA 4JPRA 4WF9V 1BZKA 1OCRB 4PA9A 2DQ0A 1GTOA 4MW3A 1WN7A 3SYPA 2YICA 1S76D 2OCHA 2EULA 4AI8A 3K57A 2C2AA 3EFFK 3D3IA 3MHHC 1QU7A 1PV0A 4UXNA 2RMKB 4HAMA 1R6NA 5EYPA 4X8AA 4GZRB 2BOBC 4X1KB 4X66B 3LDDA 3DC5A 1XUQA 1EBOA 1J95A 4RAIA 2F43G 5EK0A 5LA6B 4JI1B 3WB0A 3Q4HA 3BFRA 2A3QA 1IVSA 4JGSA 3VQWA 3QO8A 2ZM6O 3W7SA 3BA9A 1DGSA 3W7TA 3H9VA 5EIBC 2ARHA 3ZMZA 1K34A 5B1AC 3OFNG 3FB5C 3CPWU 3CC4V 2ZM6B 1H2KA 1AVMA 3K3WA 1FFXA 2A06H 5H5NA 4QNHB 5CA3A 5LMUO 1B06A 1XI1A 1N34O 5GTIZ 5IY5B 3JCUZ 2VQEO 5LMUB 2YC0A 1N34B 1I7FA 1JJ2U 2GV9A 1AP5A 3K58A 3LNNA 2VQEB 2AXTZ 2VWKA 2AW9A 1V55B 3CHXA 4I9WA 4FLTA 4X64O 1JFFB 4DXWA 1KD1W 3CJHB 4XDLA 5J2UA 1SA0A 4EEQA 4X64B 5B3SC 4K35A 3QF7A 4X1YB 3IGAC 3J7AU 3T4ZA 2N05A 3J80N 3DSQA 4HBNA 1P4RA 1KP2A 1TA8A 4RWUA 2F4VO 1GN3A 3LSUA 3UO2A 2Y4UA 1Y66A 1JCHA 1T5EA 3ASOC 1CXZB 2LO1A 2NN4A 1K3EA 4LC1A 2DYRC 4FLUA 3P30A 3CWBH 4K0KO 2BTQA 1Q90D 2GUZA 2QSAA 4PDLA 3ABMC 1N32O 3CEIA 2QKSA 1VQ7V 2WAMA 3ETQA 1S72V 2AZ2A 3HKCB 1NR7A 4R8CA 1N32B 2N74A 2Q69A 4P9PA 4WFFA 2KG7A 3ZRSA 3OE7G 3SDLA 4DO2A 3SGIA 1JVMA 3SPGA 2JGUA 3ABLC 1S77D 3OEHG 4GYCB 1KMIZ 1SQBH 3ASNC
chains in the Genus database with same CATH topology
1DK1A 4NXMO 4DR5O 1AILA 1HR0O 2LW7A 1X59A 5H5NA 1XNRO 4DR7O 2DOSA 3T1HO 4B3MO 1A32A 5LMUO 4B3TO 2Z0AA 1N34O 2UUAO 4X62O 3J81N 2FKXA 1FJGO 1HNZO 4DV0O 2VQEO 1YZBA 1XMOO 4KHPO 4NXNO 2UXDO 5BY1A 4OPAA 2UUBO 1NS1A 2UXBO 4JI3O 2UUCO 5FLXN 5A2QN 4OPHA 3F5TA 4GKKO 1XEQA 3RT3C 4JI4O 4LFCO 1R1BA 2E5LO 5LL6Y 2UU9O 5BR8O 2DJVA 4X64O 3O65A 1G1XB 2JRIA 4X66O 1IBKO 4JI5O 4LFAO 4DV5O 2UXCO 4LFBO 4YHHO 5LMNO 4A5UB 4JI1O 4GKJO 4JI7O 3J7AU 1D2DA 1XMQO 1IBMO 3J80N 4DV6O 4JI0O 1IBLO 2F4VO 1J5EO 1KUQA 1FKAO 4LF8O 1I94O 4YY3O 5BXZA 1N36O 1XNQO 4DR1O 1HNWO 2AGAA 3T1YO 2ZKOA 1F7YA 4X65O 1R6TA 4DUZO 4LF6O 4K0KO 3OTOO 4DR3O 4LF5O 4JI2O 4DV3O 4AQYO 4JI6O 5IT9N 2HHHO 4OX9O 1HNXO 1N32O 4LF4O 1AB3A 4DV2O 1N33O 4LF7O 4DV7O 2N74A 3R66A 4B3SO 2VQFO 4DR2O 5IWAO 2ZM6O 4JI8O 3SDLA 4LF9O 4B3RO 4DV1O 4DV4O 4DR4O 3M8AA 4JYAO 1FYJA 4DR6O 4DUYO 3JAMN 4JV5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DK1 A;  4NXM O;  4DR5 O;  1AIL A;  1HR0 O;  2LW7 A;  1X59 A;  5H5N A;  1XNR O;  4DR7 O;  2DOS A;  3T1H O;  4B3M O;  1A32 A;  5LMU O;  4B3T O;  2Z0A A;  1N34 O;  2UUA O;  4X62 O;  3J81 N;  2FKX A;  1FJG O;  1HNZ O;  4DV0 O;  2VQE O;  1YZB A;  1XMO O;  4KHP O;  4NXN O;  2UXD O;  5BY1 A;  4OPA A;  2UUB O;  1NS1 A;  2UXB O;  4JI3 O;  2UUC O;  5FLX N;  5A2Q N;  4OPH A;  3F5T A;  4GKK O;  1XEQ A;  3RT3 C;  4JI4 O;  4LFC O;  1R1B A;  2E5L O;  5LL6 Y;  2UU9 O;  5BR8 O;  2DJV A;  4X64 O;  3O65 A;  1G1X B;  2JRI A;  4X66 O;  1IBK O;  4JI5 O;  4LFA O;  4DV5 O;  2UXC O;  4LFB O;  4YHH O;  5LMN O;  4A5U B;  4JI1 O;  4GKJ O;  4JI7 O;  3J7A U;  1D2D A;  1XMQ O;  1IBM O;  3J80 N;  4DV6 O;  4JI0 O;  1IBL O;  2F4V O;  1J5E O;  1KUQ A;  1FKA O;  4LF8 O;  1I94 O;  4YY3 O;  5BXZ A;  1N36 O;  1XNQ O;  4DR1 O;  1HNW O;  2AGA A;  3T1Y O;  2ZKO A;  1F7Y A;  4X65 O;  1R6T A;  4DUZ O;  4LF6 O;  4K0K O;  3OTO O;  4DR3 O;  4LF5 O;  4JI2 O;  4DV3 O;  4AQY O;  4JI6 O;  5IT9 N;  2HHH O;  4OX9 O;  1HNX O;  1N32 O;  4LF4 O;  1AB3 A;  4DV2 O;  1N33 O;  4LF7 O;  4DV7 O;  2N74 A;  3R66 A;  4B3S O;  2VQF O;  4DR2 O;  5IWA O;  2ZM6 O;  4JI8 O;  3SDL A;  4LF9 O;  4B3R O;  4DV1 O;  4DV4 O;  4DR4 O;  3M8A A;  4JYA O;  1FYJ A;  4DR6 O;  4DUY O;  3JAM N;  4JV5 O; 
#chains in the Genus database with same CATH topology
 2Y48 A;  5IYB O;  4TWK A;  4IT5 A;  4ZI7 A;  3I5D A;  2F23 A;  5KHK A;  1AR1 B;  4MTX A;  4DYL A;  1SER A;  4PA4 A;  5KA5 A;  1EZV H;  1QR8 A;  4NXN O;  1VQ9 V;  1AP6 A;  1Q3E A;  4F6R B;  2ZT9 B;  1RSO A;  2M7W A;  4PV1 B;  4O4H A;  3RVZ A;  4DR6 B;  2Q7G A;  4TV8 A;  2F66 C;  1WJZ A;  3AG2 C;  3CRQ A;  4I5S A;  1HR0 B;  1GMG A;  2FYU H;  5D5P A;  5CB4 B;  2D3O W;  2CGO A;  2JK5 C;  2UUA B;  3OMA B;  1JA8 A;  2ZIN A;  3ML0 A;  5L3B A;  4DV6 O;  1PP9 H;  4KHP B;  2X6B A;  2E76 B;  4DW1 A;  5C8Y A;  3JAT A;  1RPR A;  1F4N A;  4DV6 B;  1FXH A;  3CYO A;  2AGA A;  5KUM A;  3OTO O;  3SYQ A;  4MVQ A;  3OW2 U;  1XL4 A;  2XAH A;  4DV3 O;  1N4C A;  1XBL A;  1COW G;  3L72 H;  2HHH O;  3OTO B;  4G27 B;  3PJS K;  3K79 A;  1PPJ H;  1YJ9 V;  4DV3 B;  1K8A W;  1EN4 A;  3M7M X;  3DXR A;  2HHH B;  5H9C A;  1N33 O;  4PI2 A;  2ZIM A;  1RM1 B;  1S5L Z;  1S5H C;  5DN6 G;  3FB8 C;  5JVD A;  4QPJ A;  1H38 A;  5IY5 C;  5KA6 A;  4KFM A;  4ZHQ B;  1BE3 H;  4X20 A;  1FYJ A;  4UVC A;  2W0F C;  4O4J B;  1MSD A;  3BPZ A;  2LW7 A;  3IFX A;  1XNR O;  4O2A A;  1K9M W;  4YIO A;  1D5N A;  1XNR B;  2RCV A;  4UFZ A;  1EN6 A;  2A9H A;  1AI4 A;  3SJB C;  4JTA B;  4NKG B;  1AI7 A;  1ZWI C;  5AG2 A;  3RYH A;  1IXM A;  3B2E E;  3F5T A;  3MHS C;  3DTU B;  1GAX A;  5L3D A;  5BR8 O;  5KHI A;  4BW9 A;  4JV5 B;  2JDI G;  3SJA C;  4P30 A;  3ZIA G;  1NU1 H;  2EJR A;  1WP7 A;  4D7T A;  4EFB A;  4DV5 O;  1VQ6 V;  5BR8 B;  3ETE A;  4YJ3 B;  4O4L B;  5LMN O;  3AG1 C;  2ADQ B;  3KCY A;  4I7Z B;  4DV5 B;  1D2D A;  3WB2 A;  3E86 A;  1XIL A;  4Z1M G;  2E75 B;  5FNV A;  1IBM O;  2XHB A;  1WP8 A;  3T2M A;  3QG5 A;  3CCS V;  4PDM A;  3RYC A;  3JAS A;  1IBM B;  1XQ8 A;  4B7K A;  3EHB B;  3RFR A;  4JI4 B;  5K1P A;  5TIS Z;  3CCM V;  2WWW A;  3ZS8 C;  2ZKO A;  3FYI B;  3CC7 V;  2Z5U A;  5ITZ A;  4MVR A;  3B8N A;  2PI5 A;  5IT9 N;  2V1D A;  4LNU A;  3KG2 A;  2K1E A;  1AB3 A;  1M56 B;  1DF4 A;  2OCC C;  4O2B B;  3S3W A;  1XMQ B;  3E8G A;  4H33 A;  3JCZ A;  5KHJ A;  2HJD A;  3G80 A;  3STZ C;  4UCR A;  4DV1 O;  3W7X A;  1H8E G;  1KKC A;  4DRX A;  2ZE5 A;  3T1Y B;  1VQ5 V;  2Q67 A;  5D5Q A;  1K5Q A;  4UCU A;  3ZMV A;  4DR5 O;  1TUE B;  2NNU A;  5BZB A;  1Y76 B;  4B3M O;  1BCC H;  2Y0P A;  4Z1V A;  2Z0A A;  4F4L A;  2Q7H A;  4EB6 A;  3J81 N;  5KX5 A;  1I08 A;  3IC7 A;  4O4I B;  1HNZ O;  4JYY A;  1RFY A;  3N2K B;  3K5O A;  5EBW C;  5BY1 A;  2UXB O;  1CEZ A;  1NH2 D;  3RT3 C;  4FFB A;  1FXK A;  1BS3 A;  2Y69 C;  3FKS G;  5EZY A;  5LL6 Y;  2UXB B;  2HG5 C;  4J10 A;  1Q7Y W;  1UJW B;  2HJF C;  2E74 B;  3GB7 C;  1SES A;  4LFB O;  1UFI A;  5B1A B;  1RPO A;  1W59 A;  1EZJ A;  5LP6 B;  1Q82 W;  4DK1 A;  1YVW A;  1KBH A;  4LFB B;  2ZR2 A;  2KB1 A;  4X88 A;  4NTY A;  1M9N A;  4W4L A;  4IIJ B;  5JQG B;  5LYJ A;  3TXS A;  5FPO A;  1RM1 C;  3CMA V;  3CCJ V;  1EM1 A;  1P84 F;  1WA8 B;  3JAW A;  1GN4 A;  3JD2 A;  4JI6 O;  2Q9L A;  4WFH A;  4LFA B;  2YXY A;  1ZSP A;  4OX9 O;  1HNX O;  1F23 A;  5JWP A;  5L3C A;  4OXS A;  4K8Z A;  1OCO B;  4GKJ B;  3ZHV A;  1HNX B;  5GON A;  4DV7 O;  2HVJ C;  1MAB G;  3BAA A;  1KU9 A;  1Y67 A;  2EBO A;  2IJK A;  1AR5 A;  5B3S B;  4JYC A;  3CRC A;  3HKE A;  4DV7 B;  5LHG A;  2OIG A;  1Q81 W;  3K5L A;  4RO2 A;  4I55 A;  2IJI A;  2HP8 A;  3THO A;  4YJ2 A;  4X65 B;  3I55 V;  3RYI A;  1E1Q G;  2KQX A;  4LWS B;  4MVS A;  1PL0 A;  2WSS G;  5IDJ A;  4WBN B;  1ZL8 B;  1A32 A;  5IYZ B;  1VQL V;  2QJ1 A;  3W7W A;  1LUW A;  3FFQ A;  1NI8 A;  4E4E A;  2DYR B;  1MG1 A;  1LUV A;  5E1A C;  2BCC H;  2AZ0 A;  3N2G A;  5KLV H;  3ICX A;  1QBZ A;  1YHQ V;  2HFE C;  5J2T A;  2JS3 A;  3ABM B;  3B8M A;  1L1F A;  4H13 B;  2DN9 A;  1K92 A;  4MVZ A;  4RUF A;  5LOV A;  2PTM A;  2FB5 A;  2WLL B;  4DUY B;  2WLH A;  5JCO A;  2XND G;  3HKB A;  4R7C A;  2IU3 A;  3JD4 A;  2P7T C;  1XHX A;  3C3T A;  1Y74 B;  3ASN B;  3W7U A;  1WPB A;  2ITC C;  2B1I A;  3C90 A;  2M6Y A;  2CUG A;  1VQM V;  1HNW O;  2WLI B;  1SQX H;  4YXW G;  1I5X A;  5H2F Z;  4DUZ O;  4JYB A;  4BIZ A;  1YSC A;  3KZI Z;  1NTZ H;  3FB7 C;  4JF3 A;  4WFB V;  2QM4 A;  4JI2 O;  2EIJ C;  2WLM A;  3WG7 B;  4DUZ B;  5IJ0 B;  1R73 A;  3HPL C;  1XDC A;  2P4V A;  1PNK A;  2B5U A;  3UT5 A;  1NBM G;  3K0G A;  1BL8 A;  3BA8 A;  3AG2 B;  4R6Z A;  5KMG A;  1GN2 A;  1OCZ C;  5FL7 G;  4B7E A;  2W6J G;  4EFE A;  4WFA V;  4CS4 A;  5EYP B;  1CPY A;  4DR4 O;  2P06 A;  1YCI A;  5KUK A;  3JAM N;  2FTK A;  4NXM O;  4DR4 B;  4DK0 A;  3G71 V;  1FXK C;  1R3I C;  5J9P C;  3MAQ A;  4LBE C;  3Q4H B;  3H1L H;  3AK3 A;  1WAZ A;  2OTL V;  1SC5 B;  1VF6 A;  1YJN V;  1GM9 A;  1XMO O;  1SS3 A;  3L9D A;  1PD3 A;  4JI3 O;  4BWA A;  4RQE A;  3H1I H;  3ABU A;  4GKK O;  3DGE A;  5LP6 C;  5LXT A;  3UM7 A;  1FFX B;  2DJV A;  4UB6 Z;  4GKK B;  2LGW A;  2MW2 B;  1Q6H A;  4JI5 O;  4I4T A;  1AJQ A;  3L71 H;  2UXC O;  2Q68 A;  3OUF A;  2XOK G;  4KP4 A;  4BAY A;  1N0J A;  2LJ2 A;  4IL6 Z;  2B1G A;  1XHZ A;  2UXC B;  3A8T A;  2YDE A;  5GTH Z;  2OTJ V;  4LF8 O;  2WA4 A;  1G4Y B;  1OCO C;  5HFL A;  2CTQ A;  1BGY H;  1WNS A;  1ZAU A;  2Q4P A;  4LH6 A;  2GHY A;  2EZP A;  3ZRV A;  4LF8 B;  5J2U B;  5A9G A;  1QLE C;  3CSX A;  4MTO A;  1VQP V;  1SA0 B;  4I50 A;  2VS0 A;  1VAR A;  1PNM A;  4ABM A;  3E83 A;  4J9Z B;  1KB9 F;  1K4D C;  4J80 A;  3LDE A;  2XAG A;  2HKO A;  3CS5 A;  1M4U A;  2Y0I A;  3RBZ A;  4TQD A;  3QTC A;  2EZO A;  5EBL C;  1AI6 A;  4PDR A;  3R66 A;  2VQF O;  4RUE A;  2WLK A;  5IWA O;  3B40 A;  5IJ9 A;  2F4V B;  4B3R O;  3AG1 B;  4DV4 O;  2VQF B;  2BTQ B;  4K3A A;  3SYO A;  1JQ0 A;  4JYA O;  2GUZ B;  4XDK A;  2MK3 A;  4K0K B;  1ZLZ A;  3K06 A;  2FL4 A;  5KHH A;  4DR7 O;  2Q73 A;  3T1H O;  4JYA B;  3ZJZ A;  4EKW A;  3K03 A;  3E8F A;  4N21 A;  2QR4 A;  4DR7 B;  4P2Z A;  3L70 H;  1HDJ A;  5L3G A;  3T1H B;  5CA0 A;  4FLZ A;  4U3J A;  3O9O A;  2KG7 B;  3RVY A;  3KKY A;  1IXB A;  2JEX A;  3OEE G;  4FLX A;  5LGN A;  1SQG A;  5B1O A;  1BMF G;  2W0X A;  5DEC A;  2EIN B;  4JAA A;  2QM8 A;  4PEL A;  2OCC B;  2XAQ A;  4H37 A;  3B09 A;  2LP7 A;  3JAK A;  4ZI7 B;  4Q20 A;  2ZDI A;  4FVM A;  3JD1 A;  4CH5 A;  1GKF A;  2GDS A;  2UXN A;  3VOU A;  3K5M A;  4ZBM A;  3WG7 C;  4PA6 A;  4NTW A;  1RSO B;  4NXN B;  2BE3 A;  1GO3 F;  4G2K A;  3OM3 B;  3JD0 A;  4X1I B;  4O4H B;  3OGI B;  4HNA A;  1XNQ O;  5JH7 A;  3ZHT A;  4TV8 B;  4NR1 A;  1F7Y A;  2R70 A;  1H2M A;  1K73 W;  1YXB A;  2HLD G;  3BHP A;  5EC2 C;  3CE2 A;  1GK9 A;  4CH4 A;  4AQY O;  3EVK A;  1QQC A;  3VQX A;  2Y69 B;  4TQF A;  3OAA G;  3WU2 Z;  3GWK C;  4AQY B;  4UVA A;  2ZIO A;  2ZE6 A;  2Q0O C;  1R6K A;  1F51 A;  1SZT A;  5C8Y B;  2EIM B;  3JAT B;  2IU0 A;  5K1X A;  5L3E A;  4FPP A;  3QO7 A;  3A2F A;  4LF9 O;  4I0X A;  3OR7 C;  1VF6 C;  4CC6 A;  4LF9 B;  2YEV A;  3CX5 F;  3QO5 A;  1EFR G;  1ZX3 A;  3LDC A;  2IJJ A;  3DXR B;  4J42 A;  4E2L A;  1HP8 A;  4IHJ A;  5JVD B;  1N33 B;  2JGD A;  4GX2 A;  2ZD9 A;  1SQV H;  2D2C B;  4PI0 A;  2UUB O;  2V7Q G;  4F6E A;  5IE9 A;  4X20 B;  1NZ6 A;  4UCV A;  1R1B A;  2UUB B;  1MOF A;  4JAS A;  4NB5 A;  3CCL V;  4O2A B;  2CE4 A;  2LQT A;  4FZ1 A;  1SRY A;  4FMT A;  1E79 G;  4MSW C;  3CC2 V;  4K8X A;  2YS8 A;  1OZ0 A;  1M57 B;  1VIB A;  2YSU B;  4UCT A;  3RYH B;  3D3Q A;  2EJ7 A;  3JAL A;  1XOU A;  3SPC A;  1BQZ A;  1EN5 A;  2JEU A;  1FKA O;  1N8R W;  4U7O A;  2F93 B;  2HR3 A;  1VF7 A;  2QTS A;  2PI4 A;  1PM9 A;  3B77 A;  1R6T A;  1K4C C;  4UCO A;  1JOY A;  4TUY A;  1K97 A;  2QKC A;  4TV9 A;  1KQS U;  3CCV V;  3F7V C;  3RYF A;  2XUM A;  3QNE A;  5FNV B;  5LMN B;  4DV2 O;  2O57 A;  4CS3 A;  3JSN A;  2XT9 A;  3JSL A;  2X0L A;  3JAS B;  4DV2 B;  1XL6 A;  2ZNI A;  1P7G A;  1PNL A;  1TVK A;  5KAI Z;  4JTC B;  5ITZ B;  3HB3 B;  1Z5V A;  1YIJ V;  1THZ A;  4LNU B;  2EIN C;  2CTW A;  4B3T O;  3IAY A;  2P4K A;  4X62 O;  1H2L A;  4H0L B;  1X4T A;  2XTA A;  2QA4 V;  1FJG O;  3M99 B;  1TUB A;  4HZ3 A;  3TET A;  4ZOL A;  3UO3 A;  1L8D A;  2EX3 A;  2EIJ B;  4DRX B;  3OTF A;  1BT8 A;  2YID A;  4DV1 B;  1NH2 B;  3WFV A;  3ETD A;  1QHT A;  1Q6I A;  1OCZ B;  3N27 A;  4DR5 B;  4EB6 B;  1MZF A;  5KX5 B;  4B3M B;  3RN4 A;  2JJ1 G;  3FAV A;  1GH6 A;  5B1B C;  2DQ3 A;  4H44 B;  1HNZ B;  1MNG A;  1Q43 A;  2DE0 X;  1G6U A;  3BEH A;  5JJJ B;  1IUR A;  1US6 A;  4FFB B;  1FXK B;  4C7U A;  4ASU G;  5EZY B;  2KKW A;  4G28 B;  2WA3 A;  2QKA A;  1JPX A;  1O9H A;  2EIM C;  3LSS A;  1SQF A;  1S5J A;  1RP3 B;  4WCE V;  4DW0 A;  2GTA A;  1W0J G;  5JJE B;  1R3K C;  2PF4 E;  1VMG A;  3K9A A;  1VQK V;  3HKD A;  3E22 A;  4WFG A;  3ZRX A;  4B3S O;  2YIB A;  2F1M A;  1QLN A;  1PL4 A;  1URF A;  5LYJ B;  3FX7 A;  2Q5Z A;  2V4D A;  3M8A A;  2P5O A;  5CA1 A;  4CBC A;  2RQ6 A;  3JAW B;  3NXS A;  3CRM A;  1L0L H;  4ICG A;  3LUT B;  3TK1 A;  4JI6 B;  4OX9 B;  1P7B A;  3CB2 A;  3JAR A;  5GON B;  1XRE A;  3BAB A;  1LNQ A;  1QLE B;  1AI5 A;  3ZMS A;  1H2N A;  4UV9 A;  2QE7 G;  3HKE B;  1AJN A;  2ATK C;  4RQF A;  1FD9 A;  2BSK A;  3ZHS A;  4I55 B;  4OPH A;  1M57 C;  4YJ2 B;  2RJZ A;  3SPI A;  4LFC O;  3RYI B;  4NTX A;  2Z3Y A;  5B66 Z;  1H2S B;  4FIP C;  2A0L A;  1IBK O;  1M93 A;  3T1C A;  2Q6A A;  4YHH O;  3ZRW A;  4AHC A;  5J2T B;  2R9I A;  2H8P C;  4FJC C;  4YHH B;  2R72 A;  1IBL O;  1ORQ C;  3ZED A;  3SPH A;  1J5E O;  1WLE A;  5LOV B;  4X89 A;  1N36 O;  1H8H G;  1U96 A;  2Y4T A;  2OT5 A;  5C93 A;  2DMX A;  1IBL B;  1J5E B;  3HKB B;  2DWE C;  2KSD A;  4BR6 A;  1KYO F;  4AIL C;  5BMV A;  2PUS A;  1VQ8 V;  3A0H Z;  2WLL A;  3ZN0 A;  1MSW D;  1WPX A;  2P90 A;  3OMN B;  2CH7 A;  2AHY A;  2GSM B;  4JI8 O;  1TGO A;  2CTR A;  3SR2 C;  3CXH F;  2IW5 A;  1HWY A;  1HNW B;  2ZE7 A;  3HR0 A;  1Y6X A;  3AG3 C;  5GW7 A;  1M90 W;  4MVU A;  5IYC O;  4JI2 B;  2A7W A;  3UT5 B;  2F95 B;  4TT3 G;  4WFE A;  4CH6 A;  1MZE A;  4LP8 A;  1K33 A;  1IX9 A;  1WB8 A;  5KMG B;  2ZXW B;  1VF5 B;  4R50 A;  4OGQ B;  3FYE B;  3OMI B;  5IJ0 A;  1P49 A;  5DED A;  3OD4 A;  4UB8 Z;  3UQ8 A;  5LBQ A;  3ETG A;  2ILM A;  2LFS A;  4W4K A;  4FLV A;  3ZMU A;  2QWN B;  2X6C A;  1G1X B;  1O9G A;  4NXM B;  4X66 O;  3F5W C;  5DM6 V;  1H2G A;  4JZ2 A;  4X1K A;  3BRC A;  1S0V A;  1L0N H;  1V9P A;  4JI1 O;  1NTK H;  4PHZ A;  4Q6G A;  4JI7 O;  3VBB A;  2PGG A;  3K08 A;  3SYC A;  1B6Q A;  2QWP B;  2CK3 G;  5LA6 A;  4LR3 A;  1XMO B;  4JI0 O;  4JI7 B;  5LXT B;  2QWR B;  4CH3 A;  4JI3 B;  4N23 A;  4IYH A;  2X6A A;  1OV9 A;  3ABT A;  4DR1 O;  4JI0 B;  3SYA A;  4I4T B;  3MDS A;  2ADP A;  4DR1 B;  3SPJ A;  1SF9 A;  4JI5 B;  2RN9 A;  1BHB A;  1W2B U;  3CCU V;  1LR1 A;  2ITD C;  1UPG A;  4CZZ A;  3L75 H;  3CCR V;  1VEW A;  4XBF A;  2Q7E A;  3L74 H;  4LF7 O;  1YI2 V;  1Z2G A;  2GBO A;  3G6E V;  5CBH A;  1Q5O A;  1S3J A;  1JMK C;  3DC6 A;  4BIO A;  4LF7 B;  2NR5 A;  4JZG A;  4GUN A;  4I50 B;  4QE9 A;  2AHZ A;  5F2V O;  3X2Q B;  3C3S A;  1V54 B;  1YJW V;  3P3N A;  1KP3 A;  2ZE8 A;  5B1N A;  1X59 A;  4IGG A;  1JFF A;  1B04 A;  2DYS C;  1E1R G;  3CJH A;  3CRA A;  5EBM C;  3MD0 A;  4CS2 A;  1W0K G;  2XAS A;  4MVM A;  4X1Y A;  5IJ9 B;  3ABK B;  4FZ0 A;  2EIK B;  5IWA B;  3SJC C;  2H3O A;  4B3R B;  4BW5 A;  3VQY A;  4ZIB A;  4DV4 B;  5LGU A;  3O65 A;  2YI9 A;  2N04 A;  4J7Z A;  1KC8 W;  2L35 A;  3SJQ C;  5CA0 B;  5JCO C;  3I56 V;  4U3J B;  4LCU C;  2K9P A;  2ZR3 A;  4I9Q A;  2ZQM A;  3APQ A;  4MTF A;  1BQ0 A;  1FXV A;  3K59 A;  4X9Q A;  3HKC A;  3FD9 A;  4PD4 F;  3AG4 B;  3U11 A;  1NTM H;  2YUA A;  4YY3 O;  5BXZ A;  3K5N A;  3T4D A;  1SQQ H;  3JAK B;  4GX5 A;  3BCC H;  2ZNJ A;  5LGT A;  1CP9 A;  4QJF B;  1NQT A;  1MA1 A;  1M5I A;  4LF6 O;  4YY3 B;  4GX1 A;  1OJH A;  4LH7 A;  2IH3 C;  1Q8I A;  2GTS A;  3K9S A;  4LF6 B;  4B08 A;  3E89 A;  3CCQ V;  5CBF A;  3G4S V;  1BSM A;  5KHG A;  2L6L A;  2JS5 A;  3D8C A;  4HNA B;  3AG7 A;  5JH7 B;  3U10 A;  3CXC U;  2JJ2 G;  1G8M A;  2ZXW C;  3ZHQ A;  4F6R A;  4QGP A;  3ZX6 A;  1XNQ B;  3D36 A;  2A79 B;  1OCR C;  5B1B B;  3CRR A;  1SKV A;  2XAJ A;  4DR6 O;  1KKD A;  1HR0 O;  4X1I A;  4D6T H;  3H1K H;  5FPR A;  4FFK A;  2UUA O;  1QCE A;  1PKX A;  4GLX A;  3QVN A;  5CB4 A;  2BOC C;  1SQP H;  4KUM A;  3CCE V;  1NT2 B;  2PYL A;  4KHP O;  4I0X B;  2UXD O;  1ENV A;  4D7S A;  2JVD A;  4FK5 C;  2VWJ A;  4KL1 A;  1NKD A;  2LW1 A;  2OIE A;  3LSQ A;  2VRZ A;  3G6B A;  2YEV B;  2UXD B;  2E3C A;  1NR1 A;  3H01 A;  3JD3 A;  4JAU A;  5HFM A;  1B3Q A;  5CN0 A;  3GWO A;  4P9O A;  4MTG A;  4CC5 A;  4A5U B;  4IHJ B;  3RGB A;  1R3L C;  2PZS A;  2JGD B;  3IC9 A;  1HW7 A;  2IJH A;  1D5A A;  1Q6U A;  1GM7 A;  1YTF B;  2JIZ G;  1YDX A;  3S3X A;  4J11 A;  1JR9 A;  4ZHQ A;  3VQV A;  2WLJ A;  1FAF A;  4O4J A;  4QIW F;  3BY6 A;  4LF4 O;  3X2Q C;  1QVG U;  1V54 C;  1V55 C;  4FLY A;  1YTF D;  3JAL B;  5L3F A;  3H1H H;  4LF4 B;  1Y4M A;  3E8H A;  2OWO A;  2ETN A;  2CTP A;  1ROP A;  4UCS A;  4TUY B;  3ABK C;  3ZHR A;  3K0D A;  4GX0 A;  4JTD B;  4JV5 O;  2EIK C;  1QNM A;  3E8B A;  1DK1 A;  4TV9 B;  2EIL B;  2QTO A;  5H6Q A;  1DF5 A;  5H6R A;  3RYF B;  2DOS A;  3UCS C;  1QVF U;  1GN6 A;  2FKX A;  4UUJ C;  2PY5 A;  3RYC B;  1FS0 G;  4YJ3 A;  4O4L A;  1ZUQ A;  4XDJ A;  3UKM A;  1JJO A;  1NS1 A;  1TVK B;  4JI4 O;  2DW4 A;  3E2E A;  2WLN A;  2P67 A;  2R9A A;  3H1J H;  3AG4 C;  2JRI A;  4J41 A;  3OT7 A;  2WPD G;  3AK2 A;  1YEW A;  1ARO P;  2ZDI C;  2OYQ A;  4BIU A;  1TUB B;  4B3T B;  3TJT A;  2QM7 A;  1DTO A;  3WB1 A;  4X62 B;  1AJP A;  4J7J A;  4ZOL B;  3AG3 B;  1FJG B;  1OCC B;  2IM9 A;  1I5Y A;  1XMQ O;  4QE7 A;  4O2B A;  4MW8 A;  1AR4 A;  1JX9 A;  4FLW A;  2NLJ C;  4TOI A;  1KUQ A;  4PA7 A;  1VP7 A;  1I94 O;  3STL C;  2PYJ A;  1BHA A;  3T1Y O;  5CBG A;  5LHH A;  1I94 B;  1U97 A;  4UV8 A;  4DR3 O;  1FPO A;  4TSF G;  3TXQ A;  3B4S A;  2X7R B;  4KXR A;  2YXL A;  1YIT V;  1WB7 A;  3APO A;  3D36 C;  3FAV B;  2H94 A;  3E35 A;  4DR3 B;  1F4M A;  4ZKI A;  1Y76 A;  3TCU A;  1YF2 A;  4O4I A;  3N2K A;  4U3F H;  4L8J A;  2CDY A;  5E79 Z;  2R9R B;  3A0B Z;  2CAZ C;  2QWQ B;  2RDC A;  1GRJ A;  2HVK C;  5EC1 C;  1IZ3 A;  3BVO A;  2W6I G;  1AIL A;  5B5E Z;  1SZX A;  1QR9 A;  2P22 C;  1KEC A;  4YIP A;  1NJI W;  3LNM B;  4U7N A;  3HKD B;  3E22 B;  5KAF Z;  4DV0 O;  1YZB A;  4MT8 A;  1M1K W;  4IYI A;  2QDO A;  3GVM A;  3ZN1 A;  5LP6 A;  4B3S B;  3RW0 A;  4DV0 B;  2UUC O;  5CA1 B;  2DWD C;  2HEP A;  2XAF A;  3IJ4 A;  4UVB A;  1XEQ A;  1OHH G;  3AEI A;  2ZCE A;  2UUC B;  3JYC A;  4IIJ A;  5JQG A;  3CME V;  3R65 A;  3OUS A;  1DLB A;  2Q8V A;  5EIB D;  2YIB D;  4HYO A;  3L73 H;  3ZBH A;  4J7K A;  4LFA O;  3JAR B;  1MMM A;  1WA8 A;  4GKJ O;  1Q86 W;  2BTO A;  2BSK B;  3PN1 A;  5CMU A;  2QWO B;  1TAE A;  4JAV A;  2DYS B;  3P32 A;  2RNB A;  3P3P A;  1I0H A;  4NYK A;  1R3J C;  2ODM A;  4LFC B;  4X65 O;  3U0Z A;  4FM0 A;  2G38 A;  4J9Y B;  3K04 A;  4LF5 O;  2CGN A;  3N2G B;  1IBK B;  1N0N A;  4QPK A;  3G67 A;  2QGN A;  3ZRW B;  4LWS A;  3ZHU A;  4WBN A;  1ZL8 A;  4FM1 A;  4LF5 B;  5IYZ A;  2EIL C;  2IH1 C;  3F7Y C;  3ASO B;  4MVO A;  1FFT B;  3CP1 A;  4L87 A;  3OR6 C;  4DR2 O;  3A0R A;  3ZCC A;  1K5S A;  1NVP B;  1N36 B;  2LFR A;  4DR2 B;  1GM8 A;  4FM2 A;  4GCZ A;  4DUY O;  3RWR D;  5BMV B;  1VQN V;  1ZTE A;  3KCX A;  3CD6 V;  3FB6 C;  2Q0A A;  2FML A;  2YI8 A;  1IDS A;  1Z5W A;  1SET A;  2CH7 B;  1NVP D;  3ABL B;  3ZMT A;  4PJ0 Z;  2LGQ A;  1Y74 A;  4OPA A;  2UXX A;  5FLX N;  4JI8 B;  5A2Q N;  3NR7 A;  1OCC C;  2P6J A;  2YXH A;  2YIA A;  2IBZ H;  4PDV A;  2E5L O;  4Z2W A;  5IYD O;  1M56 C;  2UU9 O;  3TGU H;  3AK1 A;  1VQO V;  5LHI A;  4MS2 A;  1K7D A;  2WLI A;  2QEX V;  3OGC C;  4PA3 A;  2E5L B;  2UU9 B;  4NVP A;  5JJN B;  4GT1 A;  1VQ4 V;  2B9Z A;  3EXA A;  4JPR A;  4WF9 V;  1BZK A;  1OCR B;  4PA9 A;  2DQ0 A;  1GTO A;  4MW3 A;  1WN7 A;  3SYP A;  2YIC A;  1S76 D;  2OCH A;  2EUL A;  4AI8 A;  3K57 A;  2C2A A;  3EFF K;  3D3I A;  3MHH C;  1QU7 A;  1PV0 A;  4UXN A;  2RMK B;  4HAM A;  1R6N A;  5EYP A;  4X8A A;  4GZR B;  2BOB C;  4X1K B;  4X66 B;  3LDD A;  3DC5 A;  1XUQ A;  1EBO A;  1J95 A;  4RAI A;  2F43 G;  5EK0 A;  5LA6 B;  4JI1 B;  3WB0 A;  3Q4H A;  3BFR A;  2A3Q A;  1IVS A;  4JGS A;  3VQW A;  3QO8 A;  2ZM6 O;  3W7S A;  3BA9 A;  1DGS A;  3W7T A;  3H9V A;  5EIB C;  2ARH A;  3ZMZ A;  1K34 A;  5B1A C;  3OFN G;  3FB5 C;  3CPW U;  3CC4 V;  2ZM6 B;  1H2K A;  1AVM A;  3K3W A;  1FFX A;  2A06 H;  5H5N A;  4QNH B;  5CA3 A;  5LMU O;  1B06 A;  1XI1 A;  1N34 O;  5GTI Z;  5IY5 B;  3JCU Z;  2VQE O;  5LMU B;  2YC0 A;  1N34 B;  1I7F A;  1JJ2 U;  2GV9 A;  1AP5 A;  3K58 A;  3LNN A;  2VQE B;  2AXT Z;  2VWK A;  2AW9 A;  1V55 B;  3CHX A;  4I9W A;  4FLT A;  4X64 O;  1JFF B;  4DXW A;  1KD1 W;  3CJH B;  4XDL A;  5J2U A;  1SA0 A;  4EEQ A;  4X64 B;  5B3S C;  4K35 A;  3QF7 A;  4X1Y B;  3IGA C;  3J7A U;  3T4Z A;  2N05 A;  3J80 N;  3DSQ A;  4HBN A;  1P4R A;  1KP2 A;  1TA8 A;  4RWU A;  2F4V O;  1GN3 A;  3LSU A;  3UO2 A;  2Y4U A;  1Y66 A;  1JCH A;  1T5E A;  3ASO C;  1CXZ B;  2LO1 A;  2NN4 A;  1K3E A;  4LC1 A;  2DYR C;  4FLU A;  3P30 A;  3CWB H;  4K0K O;  2BTQ A;  1Q90 D;  2GUZ A;  2QSA A;  4PDL A;  3ABM C;  1N32 O;  3CEI A;  2QKS A;  1VQ7 V;  2WAM A;  3ETQ A;  1S72 V;  2AZ2 A;  3HKC B;  1NR7 A;  4R8C A;  1N32 B;  2N74 A;  2Q69 A;  4P9P A;  4WFF A;  2KG7 A;  3ZRS A;  3OE7 G;  3SDL A;  4DO2 A;  3SGI A;  1JVM A;  3SPG A;  2JGU A;  3ABL C;  1S77 D;  3OEH G;  4GYC B;  1KMI Z;  1SQB H;  3ASN C; 
#chains in the Genus database with same CATH homology
 1DK1 A;  4NXM O;  4DR5 O;  1AIL A;  1HR0 O;  2LW7 A;  1X59 A;  5H5N A;  1XNR O;  4DR7 O;  2DOS A;  3T1H O;  4B3M O;  1A32 A;  5LMU O;  4B3T O;  2Z0A A;  1N34 O;  2UUA O;  4X62 O;  3J81 N;  2FKX A;  1FJG O;  1HNZ O;  4DV0 O;  2VQE O;  1YZB A;  1XMO O;  4KHP O;  4NXN O;  2UXD O;  5BY1 A;  4OPA A;  2UUB O;  1NS1 A;  2UXB O;  4JI3 O;  2UUC O;  5FLX N;  5A2Q N;  4OPH A;  3F5T A;  4GKK O;  1XEQ A;  3RT3 C;  4JI4 O;  4LFC O;  1R1B A;  2E5L O;  5LL6 Y;  2UU9 O;  5BR8 O;  2DJV A;  4X64 O;  3O65 A;  1G1X B;  2JRI A;  4X66 O;  1IBK O;  4JI5 O;  4LFA O;  4DV5 O;  2UXC O;  4LFB O;  4YHH O;  5LMN O;  4A5U B;  4JI1 O;  4GKJ O;  4JI7 O;  3J7A U;  1D2D A;  1XMQ O;  1IBM O;  3J80 N;  4DV6 O;  4JI0 O;  1IBL O;  2F4V O;  1J5E O;  1KUQ A;  1FKA O;  4LF8 O;  1I94 O;  4YY3 O;  5BXZ A;  1N36 O;  1XNQ O;  4DR1 O;  1HNW O;  2AGA A;  3T1Y O;  2ZKO A;  1F7Y A;  4X65 O;  1R6T A;  4DUZ O;  4LF6 O;  4K0K O;  3OTO O;  4DR3 O;  4LF5 O;  4JI2 O;  4DV3 O;  4AQY O;  4JI6 O;  5IT9 N;  2HHH O;  4OX9 O;  1HNX O;  1N32 O;  4LF4 O;  1AB3 A;  4DV2 O;  1N33 O;  4LF7 O;  4DV7 O;  2N74 A;  3R66 A;  4B3S O;  2VQF O;  4DR2 O;  5IWA O;  2ZM6 O;  4JI8 O;  3SDL A;  4LF9 O;  4B3R O;  4DV1 O;  4DV4 O;  4DR4 O;  3M8A A;  4JYA O;  1FYJ A;  4DR6 O;  4DUY O;  3JAM N;  4JV5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...