4JI8O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji8O00
1HNZO 4YY3O 4DUYO 5IT9N 5A2QN 2UXDO 3OTOO 4LF9O 4YHHO 3R66A 4X62O 4JI2O 1FYJA 2LW7A 1IBMO 1XNQO 5LL6Y 2JRIA 1N33O 1AB3A 4DR3O 2VQEO 2HHHO 4GKJO 1R1BA 3SDLA 4JI4O 1N34O 4NXMO 4DR2O 1AILA 1XMQO 2AGAA 4A5UB 2UUCO 4DV5O 1XEQA 2Z0AA 3M8AA 3T1HO 4JI7O 2FKXA 2UXBO 4LF4O 4X64O 1FKAO 1R6TA 2VQFO 1HR0O 1F7YA 4DV2O 3F5TA 4DR6O 4B3SO 2E5LO 4JI3O 2F4VO 4JI8O 1N32O 4DV3O 4JV5O 4DR4O 1HNXO 4DUZO 4DR1O 4B3TO 4LFCO 3JAMN 5BY1A 4AQYO 5BXZA 5LMNO 2UUBO 4OX9O 5FLXN 4DV6O 4LF8O 4LFAO 4NXNO 2N74A 3O65A 4JI5O 3J80N 4LF5O 1HNWO 4X65O 2DOSA 1G1XB 4K0KO 3J7AU 1J5EO 4DR7O 5H5NA 1XMOO 2UUAO 4OPAA 4JYAO 1NS1A 4JI6O 1A32A 4JI1O 5BR8O 4B3RO 4KHPO 4OPHA 3RT3C 4X66O 1XNRO 4GKKO 4DV4O 4DV0O 1FJGO 1N36O 1I94O 2UU9O 1IBLO 4LF6O 2ZKOA 4LF7O 4LFBO 1IBKO 5LMUO 1YZBA 1DK1A 4DR5O 2UXCO 1KUQA 1X59A 2DJVA 4B3MO 4JI0O 3J81N 2ZM6O 4DV1O 4DV7O 1D2DA 5IWAO 3T1YO
chains in the Genus database with same CATH superfamily
2JGDA 3K5LA 3DSQA 4GYCB 3W7WA 4Z1MG 4DR6B 2YIDA 1R6KA 4Q20A 3JCUZ 3E8GA 3MHHC 2X0LA 4U3FH 2BE3A 1YJWV 4JV5B 1QNMA 4CS4A 4OX9B 4WFBV 1BQZA 5E1AC 1N8RW 1E1RG 1GMGA 2H8PC 4LF5B 2GTAA 2QE7G 3K5NA 4X65B 2UUCO 5H6RA 4IT5A 4IL6Z 1Q90D 4UVAA 4JI1B 1PL0A 4X64O 1F23A 5EBWC 1WP7A 1JQ0A 4AI8A 3ABKB 4TOIA 2NR5A 3BABA 1WA8B 2G38A 1FXKC 3JAMN 2EJRA 2ADPA 5BXZA 2EIKC 1JOYA 4JI0B 1QR9A 3JAKA 5D5PA 3N2KB 1OJHA 2E75B 4ASUG 3L75H 3GB7C 2FL4A 3TGUH 1YTFD 3OFNG 3CE2A 3J7AU 4JZ2A 4PI2A 1GN3A 3HKDB 4JYAO 2CGOA 4J7JA 3RYIA 4LF9B 1TVKB 1V54B 1U96A 5DEDA 2HJFC 1IVSA 1YF2A 4XDLA 5HFMA 4H44B 1R3KC 4JZGA 4ICGA 4DV4O 3E2EA 1I94O 3NXSA 3VQYA 4YXWG 1FD9A 5KX5A 1J95A 1KB9F 1DK1A 3ZX6A 5JVDA 1F4MA 1K34A 3H1IH 4DV1O 2PGGA 3CRQA 3QO7A 4YJ2A 1B6QA 4YY3O 1ZAUA 2JS3A 1YJNV 2D3OW 1M57B 4N21A 3SJCC 1HDJA 4JI4B 3JD0A 5LGNA 1GRJA 1K4DC 1Q6IA 4IYHA 4KUMA 2F23A 2R70A 5IJ0A 2Z3YA 1PP9H 4U7OA 4F6RA 2AZ0A 1MZEA 3UT5B 3JARB 1QVGU 2UXBB 2DQ3A 5L3BA 2QWPB 3CYOA 1VF7A 3EFFK 4X1KA 1FXHA 4UXNA 4B3SB 3JALB 2AXTZ 3VOUA 3AG2C 2HJDA 4DK0A 3CXCU 3LSSA 3PN1A 2EIJB 3H1KH 4MSWC 4JI3O 5ITZA 5EYPB 4JI8O 3D36C 4LF6B 3K0DA 3D8CA 5DN6G 3ASNB 5FNVB 1EFRG 4MTXA 5FLXN 1ZTEA 4PA4A 2R9IA 3K9AA 5J2UB 3RW0A 1G1XB 2IU0A 1AP5A 2DE0X 1VIBA 4DUYB 1J5EO 3E83A 5KHJA 4TSFG 4JYBA 1FJGB 1OCRC 4DRXB 3B77A 1RFYA 4JI2B 4FM1A 2Y4TA 4PELA 2JJ1G 1NTMH 1VQ7V 4I4TA 3TXQA 3CCLV 5IYCO 3KCXA 2DN9A 1FXKA 2K9PA 3HKBA 1H2SB 4BIOA 4NXMB 1RSOB 4FFKA 1P49A 3HPLC 2LFSA 1TUEB 1XBLA 2JDIG 3CD6V 2FYUH 4K3AA 1N0NA 3LNNA 3STZC 3RWRD 3OTFA 1XHZA 4LF4B 1P4RA 2PY5A 4XDKA 4WBNB 2VRZA 3VQVA 1VQNV 2P90A 1US6A 4D7TA 3L71H 3ZRXA 3CCJV 4WFEA 1RM1B 2JS5A 2GTSA 2H94A 1FYJA 2JRIA 3N27A 1HNXB 2GHYA 4I0XA 2WLJA 1AB3A 2BTQA 1VQLV 2UUBB 4DXWA 3APOA 2YC0A 2WLNA 4JI5B 1MABG 3F7YC 2DYRB 1BQ0A 4X1YA 1Q3EA 4KP4A 3AG1B 2WAMA 4FFBB 3AG7A 3JD2A 3G71V 1W2BU 2E3CA 4PV1B 4KHPB 5H2FZ 1GH6A 4ZOLB 3SYPA 1EN6A 4PI0A 4DV2O 4NR1A 4PDMA 3KG2A 2E5LO 1AR4A 2A79B 3E22A 4DV0B 2JEUA 2PYLA 2YIAA 4LF7B 4J9YB 4AHCA 1SS3A 2HEPA 1SA0B 2CTPA 3SJAC 5GTHZ 2YIBD 3RN4A 4JPRA 2OCCB 5JQGA 3T1YB 3ZRWA 4LWSA 4UCOA 4B7EA 2H3OA 1IZ3A 2WPDG 5LYJA 2ITDC 4D6TH 3HKCB 4UB8Z 4IYIA 2E74B 2MW2B 2UXXA 4GKKO 3BVOA 1Z5VA 3E86A 3W7TA 3D36A 5KX5B 1N36O 3WG7B 2X6BA 2WWWA 4FM2A 2ZKOA 2OIEA 1S72V 5LOVB 1H8EG 2DJVA 3CCSV 4KFMA 2CH7A 4K8ZA 2EILB 2B1GA 2Q69A 4YJ2B 1WP8A 2Q8VA 3MDSA 5KMGA 1VQKV 1VQMV 3RGBA 3BAAA 4TWKA 1MSWD 2XAGA 4ZBMA 5H9CA 5K1PA 1YTFB 2WSSG 4CS3A 2UXDO 3CMAV 4BW5A 2IH1C 2ZIMA 1W0JG 5LL6Y 4F6RB 1NH2B 2EULA 4DV6B 2GUZA 4JI4O 1XILA 2XUMA 1N34O 1K97A 1HNWB 1XMQO 3OEEG 4Q6GA 3AG3B 4J41A 2FTKA 4CC6A 4QPKA 2LGQA 1KKCA 4EKWA 5BR8B 4JTAB 1BS3A 2UXBO 1Q81W 1FKAO 3E8HA 4LP8A 4J80A 3NR7A 1K92A 2NNUA 2QGNA 4B3SO 1MMMA 1KQSU 1NVPD 1TGOA 4UCSA 3S3WA 2QWNB 4YIPA 1N32O 1YITV 4LFCO 4AQYO 4G28B 1YI2V 3K08A 1QLEB 4J42A 3CRCA 5J9PC 1SKVA 5KHKA 2N74A 4ZHQB 3JAWA 4HNAA 1W0KG 4UV8A 1Y4MA 3CS5A 4PD4F 4K0KO 2GBOA 3JD3A 3S3XA 4P2ZA 1XL6A 2P06A 4FLYA 1XDCA 3CB2A 1L1FA 5KAFZ 3DGEA 5DECA 3FX7A 2XAQA 1NBMG 4O4HB 1FJGO 4MW8A 2EIKB 2FB5A 3D3QA 5LMUO 1NR7A 3UQ8A 3Q4HA 2M7WA 1D2DA 2FMLA 4BR6A 5CMUA 4LH7A 2YS8A 1G8MA 2QDOA 5B1NA 1M56C 1P7BA 2ZIOA 2R72A 4TV9B 2JJ2G 4RQEA 4MVSA 4PDLA 1OHHG 3T4ZA 4FLZA 3TCUA 4O4LA 2BTQB 2ITCC 2KG7A 1N33O 1P7GA 1GN2A 4HAMA 4DR2B 2VQEO 4GX5A 2DW4A 5JJJB 1R1BA 5CA0A 4UCRA 1WLEA 5GTIZ 4I9QA 1ORQC 3KZIZ 4QNHB 1AR5A 4O4IA 1KU9A 4DV5O 1FS0G 3RYHA 1EZJA 2P6JA 5IY5B 4ZI7A 2FKXA 1S5JA 3RYFB 2Q5ZA 1HR0O 2V7QG 1JJOA 1AI5A 4P9PA 3OGIB 1M4UA 1Y76A 2ZE6A 3CSXA 5LBQA 1ZUQA 2OTLV 1FFXA 1SESA 4JASA 1S5HC 3VQXA 2Q68A 1AROP 5C8YA 2Y69C 2QKAA 1EN4A 1PKXA 1HW7A 5JQGB 1JFFB 3J80N 4I50A 2WLLB 2OYQA 1B3QA 3AG2B 4UVCA 5EZYA 2ZDIC 3CJHB 2LQTA 2AHYA 3K79A 4JI6O 3LUTB 4B7KA 1YCIA 3E89A 4RAIA 3OAAG 4XDJA 4CH5A 4X20A 3CC2V 1K8AW 1H8HG 1VEWA 5EK0A 2HHHB 4NVPA 2XAFA 3G6EV 4DR5O 1KUQA 3RYCA 2XOKG 1TUBB 3SJBC 3ZN1A 2QR4A 3C3TA 2QEXV 3C90A 2F95B 4UB6Z 5KHIA 1Z5WA 3T1HB 4JI7B 3WU2Z 1OCRB 1CPYA 2ODMA 4P30A 4P9OA 1F4NA 3SPJA 3R66A 2M6YA 2LGWA 4DR1B 3UO3A 2UXNA 4HZ3A 4LFAB 3THOA 5IDJA 3ABMC 2AZ2A 1YSCA 1Q43A 2KSDA 3SYQA 4DR7B 2VWKA 2IH3C 3QF7A 1XEQA 2Q67A 4GCZA 3FB5C 4BWAA 2Y0IA 4X9QA 2KB1A 2VQFO 3BFRA 3ABLB 1U97A 4FZ1A 1SC5B 3LSUA 5LGUA 4JTDB 1I5YA 4DUZO 3QG5A 2A06H 3ETGA 1UJWB 2IU3A 1HP8A 2PZSA 3P3NA 1Y74A 2L6LA 3T1CA 3JYCA 4B3RB 5LHGA 4E4EA 3G80A 1VQ9V 4WFFA 3IC7A 2UUAO 1XNRB 1QBZA 1OV9A 3CCVV 2QA4V 2DYSC 1IX9A 5KUKA 4LR3A 5LP6A 1SZTA 4U3JA 3LDCA 1SQGA 3QO8A 3CP1A 3ZS8C 1OCCB 3ETDA 2O57A 1BHBA 2Q4PA 4PJ0Z 1NVPB 1IBKO 3BPZA 1SF9A 4KXRA 3CCEV 1OCOC 2ZM6O 2OTJV 1GN6A 2EZOA 1VP7A 2DMXA 5IWAO 2ZDIA 1PPJH 1LR1A 5IT9N 5A2QN 3B8NA 3LSQA 1UPGA 4TT3G 1NTZH 2HR3A 4DR3B 3D3IA 1DF4A 3TETA 2K1EA 3ZJZA 5BMVB 2C2AA 1JPXA 4UFZA 4MVZA 4B3TB 2PF4E 4GZRB 5LMNB 4UCUA 3G67A 3SPIA 4DW0A 4LF8B 3SPCA 1VARA 4UCVA 5IYDO 4DR2O 4UV9A 4MTOA 5B3SC 2AGAA 4LC1A 3K0GA 1COWG 2Z0AA 4UVBA 4X1IB 2CGNA 4I55A 2YICA 3HB3B 4TUYB 3UO2A 5CA1A 4FLTA 5EIBC 3K06A 1R6TA 3HKEA 1VF6C 4X66B 1YDXA 3K58A 2YI9A 5L3CA 3JD4A 4FLVA 2ZXWC 3O9OA 4PA9A 4I5SA 4DR4O 1Q82W 5LXTA 2WLKA 2EJ7A 4NXNO 5B66Z 3B4SA 5CA3A 4K8XA 1AJQA 2HG5C 3H1HH 1MA1A 3WB2A 4FVMA 1PNLA 4NB5A 1HNZB 4GX2A 3W7UA 3U10A 1XMOO 4OPAA 3OTOB 4FMTA 3B09A 4YHHB 4X20B 1JMKC 2Q6AA 2AHZA 1NJIW 2YXLA 1XNQB 2E76B 2QM4A 4X88A 3AK3A 3JD1A 3SPHA 1SZXA 1NT2B 2ATKC 4O2BB 1FXVA 3TJTA 3ZN0A 4D7SA 1BE3H 4EEQA 3DC5A 2LW7A 2L35A 1YVWA 4OGQB 1Y66A 2PTMA 4N23A 2ZNJA 4X62O 4J10A 2A0LA 5CBGA 4WCEV 1HWYA 1WJZA 5LA6B 3MAQA 1M90W 4GT1A 1Q86W 2MK3A 2JGDB 5TISZ 2F43G 4FJCC 1AILA 5KA6A 5B1AB 4UCTA 5EIBD 5KLVH 2HP8A 4IIJA 3ZIAG 4TV8A 2IJIA 1K5SA 5D5QA 2F4VB 1ZX3A 2RDCA 2WA3A 3AG4B 4O2AA 2ZNIA 4DR6O 3CRAA 3MHSC 5J2TA 4I9WA 5JH7A 2EINB 2CE4A 1EZVH 5JJNB 4JV5O 2EIMC 5BY1A 1NU1H 2IJJA 3E8BA 1Y74B 2B9ZA 4OX9O 1NQTA 1PNKA 4CH6A 4LF5O 5IYZA 4LH6A 4CBCA 4X65O 2CDYA 5CB4A 3OT7A 4J9ZB 2Z5UA 2ZE8A 1AI6A 4JI1O 1L0LH 1VF6A 1XUQA 1URFA 2RJZA 3K04A 4B3RO 4WF9V 3OGCC 3RT3C 2D2CB 2LW1A 5E79Z 1XNRO 1XOUA 2BSKA 3JAKB 1ENVA 2JGUA 3JASA 1MG1A 1ROPA 3CCQV 4GKJB 5IJ9A 4QJFB 4MTFA 4LNUA 1BHAA 3ZMUA 1R3JC 3RYIB 4JI0O 1B04A 2P67A 3ZMZA 3ZHRA 4PDRA 4RWUA 2EBOA 2ZE7A 2IBZH 3W7SA 3X2QC 4LF9O 2OIGA 4IHJA 5JVDB 2P4KA 2LO1A 1VQ8V 2PI4A 3M99B 5LHHA 4DR3O 2ZR3A 2RCVA 1PM9A 3A0RA 1MNGA 3U0ZA 2ILMA 4I55B 4R7CA 5CA1B 2LP7A 1BMFG 2RQ6A 4DK1A 3B2EE 2PYJA 1YJ9V 2WLIA 4MS2A 4O4JA 1KD1W 4CH3A 1GM9A 3QVNA 5IJ0B 2UU9B 1XQ8A 5LXTB 1DGSA 1IBLB 2NLJC 3ABMB 2GSMB 2UXCB 4YJ3A 3UM7A 4B3MB 4X1KB 4OXSA 3BEHA 1OZ0A 2YEVA 2A3QA 5KUMA 1WN7A 3SGIA 4CC5A 1B06A 5ITZB 1WPXA 1PV0A 1NKDA 1AJNA 3HR0A 2EX3A 1EBOA 1R3IC 3WFVA 4LFBB 4EFEA 4RUFA 4MT8A 3JATA 3ZCCA 1WB7A 3FB7C 3C3SA 1YXBA 3ZRVA 4LF6O 5IYBO 3GVMA 2EIJC 1ZL8A 2UUCB 4B08A 1TA8A 1S76D 4PA3A 1W59A 4QPJA 2QM7A 3ZMVA 3H1LH 4DUYO 4X64B 1Y6XA 4I4TB 4BAYA 2DQ0A 1IBMB 3ZEDA 1NI8A 1FXKB 4FPPA 3HKBB 4FLUA 3H1JH 3EVKA 4JAUA 4JI2O 1AI4A 1QHTA 3K03A 1OCOB 1I0HA 4NTXA 4NXMO 3JSLA 4GX0A 1WA8A 3AEIA 3F7VC 4LCUC 3ASOC 3DTUB 3BRCA 4JYAB 1SQXH 4RUEA 4O2AB 1BSMA 5HFLA 4I0XB 4LF4O 2ZINA 3TXSA 1IXMA 2F93B 4DV4B 1DF5A 1LNQA 1I94B 2F4VO 1NTKH 1VQOV 2Q9LA 1TVKA 1PNMA 4X1YB 3I55V 3BY6A 1HNXO 1MSDA 1RPOA 2HVJC 3STLC 4DYLA 2UUBO 1RP3B 4DV1B 4JI5O 4U7NA 3ABUA 4UUJC 5KA5A 1QQCA 2BTOA 2DOSA 2QWQB 4YY3B 3E22B 1GM7A 1NR1A 3K3WA 1K7DA 5LP6C 1IURA 1A32A 2DYRC 3CEIA 3K9SA 1D5AA 4KHPO 1CP9A 1N4CA 2ZXWB 3FB8C 3AG1C 2Q0AA 2Y48A 1V55C 5JJEB 2XTAA 2W6JG 4DV0O 2BCCH 4MVQA 3ZRWB 5C93A 1QU7A 4RQFA 4LF7O 4LWSB 3L73H 3FAVA 5KHHA 2W6IG 4CZZA 1JVMA 1THZA 3B40A 5LYJB 3L9DA 2GDSA 3RFRA 3ZMSA 3T1YO 3BHPA 1QVFU 1BZKA 2ZCEA 1FAFA 3UT5A 3JARA 4KL1A 4WFGA 2QWRB 1BL8A 4JI3B 2XASA 4JI8B 2CH7B 3JALA 5FPRA 4J7KA 3QNEA 5DM6V 1Q8IA 5KMGB 1WAZA 3CWBH 3SPGA 2XAJA 2YSUB 5EYPA 2ADQB 2RN9A 3WG7C 2ZE5A 3RVYA 1J5EB 3RVZA 1AR1B 1TAEA 2CTRA 3QTCA 1OCZC 1AP6A 2EILC 3UKMA 3GWKC 5FL7G 2GUZB 4J11A 3F5TA 4G27B 2OCHA 2W0FC 3JSNA 4PA7A 4YJ3B 1M1KW 3AK1A 3ZHSA 4DRXA 4FLXA 4CH4A 4DV6O 3O65A 3BA8A 2IJKA 1HNWO 1M9NA 4R8CA 1DLBA 2V1DA 2CK3G 1RSOA 1SQFA 3FFQA 1I08A 1NS1A 1PL4A 1WPBA 3PJSK 5BR8O 4JGSA 3AG3C 3JATB 4JTCB 2EIMB 1M93A 1G6UA 2XNDG 1K73W 3JAWB 2BOCC 4WBNA 4HNAB 1L0NH 4DV7B 1KC8W 4LFBO 4BW9A 1JA8A 3W7XA 1ZL8B 1ZLZA 2P4VA 1X59A 1AJPA 2V4DA 1YIJV 1VMGA 1QLEC 3L74H 2QSAA 5L3FA 1YEWA 4DV2B 2E5LB 4FFBA 3H01A 4GX1A 1IBMO 3RBZA 2P7TC 2JIZG 3Q4HB 4MVMA 1KBHA 2A7WA 4ZOLA 3SDLA 3UCSC 4HBNA 4A5UB 1VQ5V 3P32A 3CCMV 3OW2U 1SA0A 4NTWA 1GO3F 1RPRA 1Y67A 4O4LB 3X2QB 2ARHA 2KG7B 4LBEC 1LUWA 2QKCA 3FKSG 5CBFA 1T5EA 2PUSA 5CA0B 4R6ZA 4GKKB 5A9GA 1N36B 3CXHF 4QE9A 3ZHQA 4O4IB 3HKCA 1NH2D 1JX9A 3RYHB 5F2VO 3CRMA 4ZI7B 1KP2A 3IC9A 2YXYA 4W4KA 1BGYH 1SERA 1BCCH 1Y76B 3ZBHA 1E1QG 5LOVA 1FFTB 3K57A 2UXDB 3ZMTA 1FFXB 1XI1A 3FYEB 3IFXA 1QR8A 5C8YB 4OPHA 2YXHA 2IJHA 1JCHA 4MVRA 5LGTA 5JWPA 4I50B 5IY5C 3FAVB 2OT5A 3VQWA 3T2MA 3CC4V 4PHZA 1N34B 5EZYB 4PDVA 1Q6UA 2WLHA 1I5XA 1XMQB 3FYIB 2W0XA 4BIZA 3CC7V 2HKOA 4H33A 1IDSA 1O9GA 2LFRA 3A0HZ 5GONA 3OUSA 2YI8A 3CRRA 3OMNB 1K5QA 3RYCB 5L3EA 4H13B 4X89A 5EC1C 1N32B 1ZSPA 2Q7HA 4LFCB 4ZIBA 4AQYB 2HHHO 4I7ZB 1MOFA 4EB6A 1EM1A 2IW5A 4ZKIA 1E79G 5EC2C 2XHBA 1M5IA 4AILC 5B1BC 4EFBA 2B5UA 4QE7A 4K0KB 4XBFA 4FIPC 2P5OA 5GW7A 2KKWA 3T1HO 2JVDA 4JI7O 4ZHQA 4DV3B 1SQQH 4QIWF 1QLNA 1LUVA 3EHBB 5LMUB 4MTGA 1H2GA 2IM9A 4DR1O 2RMKB 3OR6C 1M56B 3KCYA 4LFAO 4Z2WA 4O4HA 3ASOB 1L8DA 5EBMC 4JAAA 4NKGB 2P22C 3APQA 3H9VA 4DR7O 2N05A 4J7ZA 1KP3A 3IJ4A 4BIUA 2JEXA 1O9HA 2AW9A 1R6NA 1N33B 1UFIA 1EN5A 2VQEB 3T4DA 4TV9A 1H38A 4NYKA 2Y4UA 4L87A 4MVOA 3ML0A 3ABLC 1SQPH 3ICXA 3IAYA 1F51A 3OUFA 4E2LA 3LDEA 1S77D 4DV7O 2CAZC 4DV5B 1D5NA 1NZ6A 5KAIZ 1VF5B 5LP6B 4U3JB 3K5MA 2R9RB 2PI5A 2YDEA 1BT8A 3ABTA 3U11A 1HR0B 1V9PA 1GM8A 3CPWU 1V55B 2Y69B 2ZT9B 2NN4A 1GK9A 4GUNA 3SJQC 3ETQA 4FLWA 3RYFA 3ABKC 3FB6C 3DXRA 1H2LA 4JYCA 2ZR2A 1OCCC 2VS0A 3SYCA 3E35A 4IGGA 4JI6B 1JFFA 1K33A 2WLLA 3CHXA 5L3GA 1KYOF 1F7YA 2QTSA 4JAVA 1JR9A 5B1OA 3L72H 1V54C 3ZHUA 4Z1VA 3CJHA 2Q7GA 2WA4A 5KHGA 3BA9A 2N04A 4B3TO 3K5OA 4DR5B 1XL4A 5LMNO 3ETEA 4R50A 1H2NA 1MZFA 3OMAB 2QKSA 4LF8O 1VQ6V 3SYAA 3HKEB 5JCOC 3E8FA 1N0JA 1K4CC 2F66C 2F1MA 3CCRV 1OCZB 3L70H 3I56V 5EBLC 2EZPA 1TUBA 2YIBA 1S0VA 3I5DA 4W4LA 1Q6HA 3WB1A 3LDDA 4X66O 5IE9A 1WB8A 2Q0OC 1FPOA 1M57C 3N2GA 2B1IA 4X8AA 1XREA 1VQ4V 1KMIZ 4ABMA 1G4YB 1R73A 1X4TA 2GV9A 3J81N 4TQDA 3OD4A 2DWEC 5GONB 4GLXA 2VWJA 2CTQA 3KKYA 3G6BA 1HNZO 2VQFB 1XHXA 4C7UA 3OTOO 1AI7A 4H0LB 4YHHO 1ZWIC 3QO5A 3ZHVA 4YIOA 1XNQO 4EB6B 4PA6A 3A2FA 4DUZB 3A8TA 2BOBC 4H37A 2HVKC 4FM0A 4RO2A 3ASNC 1S5LZ 3OEHG 4G2KA 1VQPV 2DYSB 3AK2A 2X6AA 2QJ1A 2CUGA 1R3LC 2UUAB 3OMIB 2X7RB 4DW1A 3OE7G 4FK5C 1K9MW 3CX5F 5AG2A 2A9HA 2WLMA 4F4LA 1QCEA 3OM3B 4IIJB 4DV3O 3SYOA 1I7FA 4TV8B 1IBKB 1K3EA 3WB0A 4F6EA 2KQXA 2R9AA 2QTOA 2ZM6B 1WNSA 1AVMA 5H6QA 1SRYA 4WFHA 5CBHA 5IWAB 3BCCH 3N2KA 5J2TB 5BZBA 5JH7B 5H5NA 2YUAA 1CXZB 2QWOB 3K59A 1GTOA 5B1AC 3HKDA 2X6CA 2ZQMA 4FZ0A 3MD0A 2JK5C 2Q7EA 5IYZB 5B3SB 2RNBA 1RM1C 3AG4C 2XAHA 3EXAA 5CB4B 1YHQV 5CN0A 5BMVA 1H2KA 4L8JA 3LNMB 2QM8A 2EINC 5JCOA 1JJ2U 2HFEC 2XT9A 4K35A 5FPOA 3TK1A 2BSKB 4HYOA 1KECA 1Q5OA 3JASB 5IJ9B 1KKDA 3F5WC 5LHIA 1GN4A 2OWOA 1Q7YW 4LNUB 4JYYA 3VBBA 4X1IA 4TUYA 4DR4B 3DXRB 1GKFA 3SR2C 3R65A 4GKJO 5L3DA 3FD9A 4NXNB 1SQVH 1SETA 3P3PA 1GAXA 4JF3A 3P30A 2HLDG 2OCCC 4IHJB 4TQFA 3G4SV 1XMOB 4WFAV 3M8AA 1PD3A 2Y0PA 2Q73A 2LJ2A 1P84F 2CTWA 4MVUA 1H2MA 3GWOA 4MW3A 5B1BB 3JCZA 4CS2A 1IXBA 2WLIB 3A0BZ 5FNVA 3ZRSA 4O4JB 1S3JA 1DTOA 4NTYA 3CMEV 5J2UA 5K1XA 4O2BA 2ETNA 4X62B 2DWDC 1CEZA 3N2GB 3M7MX 4QGPA 4DO2A 2YEVB 2UU9O 2ZD9A 1IBLO 3CCUV 1YZBA 2UXCO 3ZHTA 3IGAC 5B5EZ 4B3MO 3B8MA 3OR7C 1SQBH 1Z2GA 5LA6A 3DC6A
chains in the Genus database with same CATH topology
1HNZO 4YY3O 4DUYO 5IT9N 5A2QN 2UXDO 3OTOO 4LF9O 4YHHO 3R66A 4X62O 4JI2O 1FYJA 2LW7A 1IBMO 1XNQO 5LL6Y 2JRIA 1N33O 1AB3A 4DR3O 2VQEO 2HHHO 4GKJO 1R1BA 3SDLA 4JI4O 1N34O 4NXMO 4DR2O 1AILA 1XMQO 2AGAA 4A5UB 2UUCO 4DV5O 1XEQA 2Z0AA 3M8AA 3T1HO 4JI7O 2FKXA 2UXBO 4LF4O 4X64O 1FKAO 1R6TA 2VQFO 1HR0O 1F7YA 4DV2O 3F5TA 4DR6O 4B3SO 2E5LO 4JI3O 2F4VO 4JI8O 1N32O 4DV3O 4JV5O 4DR4O 1HNXO 4DUZO 4DR1O 4B3TO 4LFCO 3JAMN 5BY1A 4AQYO 5BXZA 5LMNO 2UUBO 4OX9O 5FLXN 4DV6O 4LF8O 4LFAO 4NXNO 2N74A 3O65A 4JI5O 3J80N 4LF5O 1HNWO 4X65O 2DOSA 1G1XB 4K0KO 3J7AU 1J5EO 4DR7O 5H5NA 1XMOO 2UUAO 4OPAA 4JYAO 1NS1A 4JI6O 1A32A 4JI1O 5BR8O 4B3RO 4KHPO 4OPHA 3RT3C 4X66O 1XNRO 4GKKO 4DV4O 4DV0O 1FJGO 1N36O 1I94O 2UU9O 1IBLO 4LF6O 2ZKOA 4LF7O 4LFBO 1IBKO 5LMUO 1YZBA 1DK1A 4DR5O 2UXCO 1KUQA 1X59A 2DJVA 4B3MO 4JI0O 3J81N 2ZM6O 4DV1O 4DV7O 1D2DA 5IWAO 3T1YO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ O;  4YY3 O;  4DUY O;  5IT9 N;  5A2Q N;  2UXD O;  3OTO O;  4LF9 O;  4YHH O;  3R66 A;  4X62 O;  4JI2 O;  1FYJ A;  2LW7 A;  1IBM O;  1XNQ O;  5LL6 Y;  2JRI A;  1N33 O;  1AB3 A;  4DR3 O;  2VQE O;  2HHH O;  4GKJ O;  1R1B A;  3SDL A;  4JI4 O;  1N34 O;  4NXM O;  4DR2 O;  1AIL A;  1XMQ O;  2AGA A;  4A5U B;  2UUC O;  4DV5 O;  1XEQ A;  2Z0A A;  3M8A A;  3T1H O;  4JI7 O;  2FKX A;  2UXB O;  4LF4 O;  4X64 O;  1FKA O;  1R6T A;  2VQF O;  1HR0 O;  1F7Y A;  4DV2 O;  3F5T A;  4DR6 O;  4B3S O;  2E5L O;  4JI3 O;  2F4V O;  4JI8 O;  1N32 O;  4DV3 O;  4JV5 O;  4DR4 O;  1HNX O;  4DUZ O;  4DR1 O;  4B3T O;  4LFC O;  3JAM N;  5BY1 A;  4AQY O;  5BXZ A;  5LMN O;  2UUB O;  4OX9 O;  5FLX N;  4DV6 O;  4LF8 O;  4LFA O;  4NXN O;  2N74 A;  3O65 A;  4JI5 O;  3J80 N;  4LF5 O;  1HNW O;  4X65 O;  2DOS A;  1G1X B;  4K0K O;  3J7A U;  1J5E O;  4DR7 O;  5H5N A;  1XMO O;  2UUA O;  4OPA A;  4JYA O;  1NS1 A;  4JI6 O;  1A32 A;  4JI1 O;  5BR8 O;  4B3R O;  4KHP O;  4OPH A;  3RT3 C;  4X66 O;  1XNR O;  4GKK O;  4DV4 O;  4DV0 O;  1FJG O;  1N36 O;  1I94 O;  2UU9 O;  1IBL O;  4LF6 O;  2ZKO A;  4LF7 O;  4LFB O;  1IBK O;  5LMU O;  1YZB A;  1DK1 A;  4DR5 O;  2UXC O;  1KUQ A;  1X59 A;  2DJV A;  4B3M O;  4JI0 O;  3J81 N;  2ZM6 O;  4DV1 O;  4DV7 O;  1D2D A;  5IWA O;  3T1Y O; 
#chains in the Genus database with same CATH topology
 2JGD A;  3K5L A;  3DSQ A;  4GYC B;  3W7W A;  4Z1M G;  4DR6 B;  2YID A;  1R6K A;  4Q20 A;  3JCU Z;  3E8G A;  3MHH C;  2X0L A;  4U3F H;  2BE3 A;  1YJW V;  4JV5 B;  1QNM A;  4CS4 A;  4OX9 B;  4WFB V;  1BQZ A;  5E1A C;  1N8R W;  1E1R G;  1GMG A;  2H8P C;  4LF5 B;  2GTA A;  2QE7 G;  3K5N A;  4X65 B;  2UUC O;  5H6R A;  4IT5 A;  4IL6 Z;  1Q90 D;  4UVA A;  4JI1 B;  1PL0 A;  4X64 O;  1F23 A;  5EBW C;  1WP7 A;  1JQ0 A;  4AI8 A;  3ABK B;  4TOI A;  2NR5 A;  3BAB A;  1WA8 B;  2G38 A;  1FXK C;  3JAM N;  2EJR A;  2ADP A;  5BXZ A;  2EIK C;  1JOY A;  4JI0 B;  1QR9 A;  3JAK A;  5D5P A;  3N2K B;  1OJH A;  2E75 B;  4ASU G;  3L75 H;  3GB7 C;  2FL4 A;  3TGU H;  1YTF D;  3OFN G;  3CE2 A;  3J7A U;  4JZ2 A;  4PI2 A;  1GN3 A;  3HKD B;  4JYA O;  2CGO A;  4J7J A;  3RYI A;  4LF9 B;  1TVK B;  1V54 B;  1U96 A;  5DED A;  2HJF C;  1IVS A;  1YF2 A;  4XDL A;  5HFM A;  4H44 B;  1R3K C;  4JZG A;  4ICG A;  4DV4 O;  3E2E A;  1I94 O;  3NXS A;  3VQY A;  4YXW G;  1FD9 A;  5KX5 A;  1J95 A;  1KB9 F;  1DK1 A;  3ZX6 A;  5JVD A;  1F4M A;  1K34 A;  3H1I H;  4DV1 O;  2PGG A;  3CRQ A;  3QO7 A;  4YJ2 A;  1B6Q A;  4YY3 O;  1ZAU A;  2JS3 A;  1YJN V;  2D3O W;  1M57 B;  4N21 A;  3SJC C;  1HDJ A;  4JI4 B;  3JD0 A;  5LGN A;  1GRJ A;  1K4D C;  1Q6I A;  4IYH A;  4KUM A;  2F23 A;  2R70 A;  5IJ0 A;  2Z3Y A;  1PP9 H;  4U7O A;  4F6R A;  2AZ0 A;  1MZE A;  3UT5 B;  3JAR B;  1QVG U;  2UXB B;  2DQ3 A;  5L3B A;  2QWP B;  3CYO A;  1VF7 A;  3EFF K;  4X1K A;  1FXH A;  4UXN A;  4B3S B;  3JAL B;  2AXT Z;  3VOU A;  3AG2 C;  2HJD A;  4DK0 A;  3CXC U;  3LSS A;  3PN1 A;  2EIJ B;  3H1K H;  4MSW C;  4JI3 O;  5ITZ A;  5EYP B;  4JI8 O;  3D36 C;  4LF6 B;  3K0D A;  3D8C A;  5DN6 G;  3ASN B;  5FNV B;  1EFR G;  4MTX A;  5FLX N;  1ZTE A;  4PA4 A;  2R9I A;  3K9A A;  5J2U B;  3RW0 A;  1G1X B;  2IU0 A;  1AP5 A;  2DE0 X;  1VIB A;  4DUY B;  1J5E O;  3E83 A;  5KHJ A;  4TSF G;  4JYB A;  1FJG B;  1OCR C;  4DRX B;  3B77 A;  1RFY A;  4JI2 B;  4FM1 A;  2Y4T A;  4PEL A;  2JJ1 G;  1NTM H;  1VQ7 V;  4I4T A;  3TXQ A;  3CCL V;  5IYC O;  3KCX A;  2DN9 A;  1FXK A;  2K9P A;  3HKB A;  1H2S B;  4BIO A;  4NXM B;  1RSO B;  4FFK A;  1P49 A;  3HPL C;  2LFS A;  1TUE B;  1XBL A;  2JDI G;  3CD6 V;  2FYU H;  4K3A A;  1N0N A;  3LNN A;  3STZ C;  3RWR D;  3OTF A;  1XHZ A;  4LF4 B;  1P4R A;  2PY5 A;  4XDK A;  4WBN B;  2VRZ A;  3VQV A;  1VQN V;  2P90 A;  1US6 A;  4D7T A;  3L71 H;  3ZRX A;  3CCJ V;  4WFE A;  1RM1 B;  2JS5 A;  2GTS A;  2H94 A;  1FYJ A;  2JRI A;  3N27 A;  1HNX B;  2GHY A;  4I0X A;  2WLJ A;  1AB3 A;  2BTQ A;  1VQL V;  2UUB B;  4DXW A;  3APO A;  2YC0 A;  2WLN A;  4JI5 B;  1MAB G;  3F7Y C;  2DYR B;  1BQ0 A;  4X1Y A;  1Q3E A;  4KP4 A;  3AG1 B;  2WAM A;  4FFB B;  3AG7 A;  3JD2 A;  3G71 V;  1W2B U;  2E3C A;  4PV1 B;  4KHP B;  5H2F Z;  1GH6 A;  4ZOL B;  3SYP A;  1EN6 A;  4PI0 A;  4DV2 O;  4NR1 A;  4PDM A;  3KG2 A;  2E5L O;  1AR4 A;  2A79 B;  3E22 A;  4DV0 B;  2JEU A;  2PYL A;  2YIA A;  4LF7 B;  4J9Y B;  4AHC A;  1SS3 A;  2HEP A;  1SA0 B;  2CTP A;  3SJA C;  5GTH Z;  2YIB D;  3RN4 A;  4JPR A;  2OCC B;  5JQG A;  3T1Y B;  3ZRW A;  4LWS A;  4UCO A;  4B7E A;  2H3O A;  1IZ3 A;  2WPD G;  5LYJ A;  2ITD C;  4D6T H;  3HKC B;  4UB8 Z;  4IYI A;  2E74 B;  2MW2 B;  2UXX A;  4GKK O;  3BVO A;  1Z5V A;  3E86 A;  3W7T A;  3D36 A;  5KX5 B;  1N36 O;  3WG7 B;  2X6B A;  2WWW A;  4FM2 A;  2ZKO A;  2OIE A;  1S72 V;  5LOV B;  1H8E G;  2DJV A;  3CCS V;  4KFM A;  2CH7 A;  4K8Z A;  2EIL B;  2B1G A;  2Q69 A;  4YJ2 B;  1WP8 A;  2Q8V A;  3MDS A;  5KMG A;  1VQK V;  1VQM V;  3RGB A;  3BAA A;  4TWK A;  1MSW D;  2XAG A;  4ZBM A;  5H9C A;  5K1P A;  1YTF B;  2WSS G;  4CS3 A;  2UXD O;  3CMA V;  4BW5 A;  2IH1 C;  2ZIM A;  1W0J G;  5LL6 Y;  4F6R B;  1NH2 B;  2EUL A;  4DV6 B;  2GUZ A;  4JI4 O;  1XIL A;  2XUM A;  1N34 O;  1K97 A;  1HNW B;  1XMQ O;  3OEE G;  4Q6G A;  3AG3 B;  4J41 A;  2FTK A;  4CC6 A;  4QPK A;  2LGQ A;  1KKC A;  4EKW A;  5BR8 B;  4JTA B;  1BS3 A;  2UXB O;  1Q81 W;  1FKA O;  3E8H A;  4LP8 A;  4J80 A;  3NR7 A;  1K92 A;  2NNU A;  2QGN A;  4B3S O;  1MMM A;  1KQS U;  1NVP D;  1TGO A;  4UCS A;  3S3W A;  2QWN B;  4YIP A;  1N32 O;  1YIT V;  4LFC O;  4AQY O;  4G28 B;  1YI2 V;  3K08 A;  1QLE B;  4J42 A;  3CRC A;  5J9P C;  1SKV A;  5KHK A;  2N74 A;  4ZHQ B;  3JAW A;  4HNA A;  1W0K G;  4UV8 A;  1Y4M A;  3CS5 A;  4PD4 F;  4K0K O;  2GBO A;  3JD3 A;  3S3X A;  4P2Z A;  1XL6 A;  2P06 A;  4FLY A;  1XDC A;  3CB2 A;  1L1F A;  5KAF Z;  3DGE A;  5DEC A;  3FX7 A;  2XAQ A;  1NBM G;  4O4H B;  1FJG O;  4MW8 A;  2EIK B;  2FB5 A;  3D3Q A;  5LMU O;  1NR7 A;  3UQ8 A;  3Q4H A;  2M7W A;  1D2D A;  2FML A;  4BR6 A;  5CMU A;  4LH7 A;  2YS8 A;  1G8M A;  2QDO A;  5B1N A;  1M56 C;  1P7B A;  2ZIO A;  2R72 A;  4TV9 B;  2JJ2 G;  4RQE A;  4MVS A;  4PDL A;  1OHH G;  3T4Z A;  4FLZ A;  3TCU A;  4O4L A;  2BTQ B;  2ITC C;  2KG7 A;  1N33 O;  1P7G A;  1GN2 A;  4HAM A;  4DR2 B;  2VQE O;  4GX5 A;  2DW4 A;  5JJJ B;  1R1B A;  5CA0 A;  4UCR A;  1WLE A;  5GTI Z;  4I9Q A;  1ORQ C;  3KZI Z;  4QNH B;  1AR5 A;  4O4I A;  1KU9 A;  4DV5 O;  1FS0 G;  3RYH A;  1EZJ A;  2P6J A;  5IY5 B;  4ZI7 A;  2FKX A;  1S5J A;  3RYF B;  2Q5Z A;  1HR0 O;  2V7Q G;  1JJO A;  1AI5 A;  4P9P A;  3OGI B;  1M4U A;  1Y76 A;  2ZE6 A;  3CSX A;  5LBQ A;  1ZUQ A;  2OTL V;  1FFX A;  1SES A;  4JAS A;  1S5H C;  3VQX A;  2Q68 A;  1ARO P;  5C8Y A;  2Y69 C;  2QKA A;  1EN4 A;  1PKX A;  1HW7 A;  5JQG B;  1JFF B;  3J80 N;  4I50 A;  2WLL B;  2OYQ A;  1B3Q A;  3AG2 B;  4UVC A;  5EZY A;  2ZDI C;  3CJH B;  2LQT A;  2AHY A;  3K79 A;  4JI6 O;  3LUT B;  4B7K A;  1YCI A;  3E89 A;  4RAI A;  3OAA G;  4XDJ A;  4CH5 A;  4X20 A;  3CC2 V;  1K8A W;  1H8H G;  1VEW A;  5EK0 A;  2HHH B;  4NVP A;  2XAF A;  3G6E V;  4DR5 O;  1KUQ A;  3RYC A;  2XOK G;  1TUB B;  3SJB C;  3ZN1 A;  2QR4 A;  3C3T A;  2QEX V;  3C90 A;  2F95 B;  4UB6 Z;  5KHI A;  1Z5W A;  3T1H B;  4JI7 B;  3WU2 Z;  1OCR B;  1CPY A;  2ODM A;  4P30 A;  4P9O A;  1F4N A;  3SPJ A;  3R66 A;  2M6Y A;  2LGW A;  4DR1 B;  3UO3 A;  2UXN A;  4HZ3 A;  4LFA B;  3THO A;  5IDJ A;  3ABM C;  2AZ2 A;  1YSC A;  1Q43 A;  2KSD A;  3SYQ A;  4DR7 B;  2VWK A;  2IH3 C;  3QF7 A;  1XEQ A;  2Q67 A;  4GCZ A;  3FB5 C;  4BWA A;  2Y0I A;  4X9Q A;  2KB1 A;  2VQF O;  3BFR A;  3ABL B;  1U97 A;  4FZ1 A;  1SC5 B;  3LSU A;  5LGU A;  4JTD B;  1I5Y A;  4DUZ O;  3QG5 A;  2A06 H;  3ETG A;  1UJW B;  2IU3 A;  1HP8 A;  2PZS A;  3P3N A;  1Y74 A;  2L6L A;  3T1C A;  3JYC A;  4B3R B;  5LHG A;  4E4E A;  3G80 A;  1VQ9 V;  4WFF A;  3IC7 A;  2UUA O;  1XNR B;  1QBZ A;  1OV9 A;  3CCV V;  2QA4 V;  2DYS C;  1IX9 A;  5KUK A;  4LR3 A;  5LP6 A;  1SZT A;  4U3J A;  3LDC A;  1SQG A;  3QO8 A;  3CP1 A;  3ZS8 C;  1OCC B;  3ETD A;  2O57 A;  1BHB A;  2Q4P A;  4PJ0 Z;  1NVP B;  1IBK O;  3BPZ A;  1SF9 A;  4KXR A;  3CCE V;  1OCO C;  2ZM6 O;  2OTJ V;  1GN6 A;  2EZO A;  1VP7 A;  2DMX A;  5IWA O;  2ZDI A;  1PPJ H;  1LR1 A;  5IT9 N;  5A2Q N;  3B8N A;  3LSQ A;  1UPG A;  4TT3 G;  1NTZ H;  2HR3 A;  4DR3 B;  3D3I A;  1DF4 A;  3TET A;  2K1E A;  3ZJZ A;  5BMV B;  2C2A A;  1JPX A;  4UFZ A;  4MVZ A;  4B3T B;  2PF4 E;  4GZR B;  5LMN B;  4UCU A;  3G67 A;  3SPI A;  4DW0 A;  4LF8 B;  3SPC A;  1VAR A;  4UCV A;  5IYD O;  4DR2 O;  4UV9 A;  4MTO A;  5B3S C;  2AGA A;  4LC1 A;  3K0G A;  1COW G;  2Z0A A;  4UVB A;  4X1I B;  2CGN A;  4I55 A;  2YIC A;  3HB3 B;  4TUY B;  3UO2 A;  5CA1 A;  4FLT A;  5EIB C;  3K06 A;  1R6T A;  3HKE A;  1VF6 C;  4X66 B;  1YDX A;  3K58 A;  2YI9 A;  5L3C A;  3JD4 A;  4FLV A;  2ZXW C;  3O9O A;  4PA9 A;  4I5S A;  4DR4 O;  1Q82 W;  5LXT A;  2WLK A;  2EJ7 A;  4NXN O;  5B66 Z;  3B4S A;  5CA3 A;  4K8X A;  1AJQ A;  2HG5 C;  3H1H H;  1MA1 A;  3WB2 A;  4FVM A;  1PNL A;  4NB5 A;  1HNZ B;  4GX2 A;  3W7U A;  3U10 A;  1XMO O;  4OPA A;  3OTO B;  4FMT A;  3B09 A;  4YHH B;  4X20 B;  1JMK C;  2Q6A A;  2AHZ A;  1NJI W;  2YXL A;  1XNQ B;  2E76 B;  2QM4 A;  4X88 A;  3AK3 A;  3JD1 A;  3SPH A;  1SZX A;  1NT2 B;  2ATK C;  4O2B B;  1FXV A;  3TJT A;  3ZN0 A;  4D7S A;  1BE3 H;  4EEQ A;  3DC5 A;  2LW7 A;  2L35 A;  1YVW A;  4OGQ B;  1Y66 A;  2PTM A;  4N23 A;  2ZNJ A;  4X62 O;  4J10 A;  2A0L A;  5CBG A;  4WCE V;  1HWY A;  1WJZ A;  5LA6 B;  3MAQ A;  1M90 W;  4GT1 A;  1Q86 W;  2MK3 A;  2JGD B;  5TIS Z;  2F43 G;  4FJC C;  1AIL A;  5KA6 A;  5B1A B;  4UCT A;  5EIB D;  5KLV H;  2HP8 A;  4IIJ A;  3ZIA G;  4TV8 A;  2IJI A;  1K5S A;  5D5Q A;  2F4V B;  1ZX3 A;  2RDC A;  2WA3 A;  3AG4 B;  4O2A A;  2ZNI A;  4DR6 O;  3CRA A;  3MHS C;  5J2T A;  4I9W A;  5JH7 A;  2EIN B;  2CE4 A;  1EZV H;  5JJN B;  4JV5 O;  2EIM C;  5BY1 A;  1NU1 H;  2IJJ A;  3E8B A;  1Y74 B;  2B9Z A;  4OX9 O;  1NQT A;  1PNK A;  4CH6 A;  4LF5 O;  5IYZ A;  4LH6 A;  4CBC A;  4X65 O;  2CDY A;  5CB4 A;  3OT7 A;  4J9Z B;  2Z5U A;  2ZE8 A;  1AI6 A;  4JI1 O;  1L0L H;  1VF6 A;  1XUQ A;  1URF A;  2RJZ A;  3K04 A;  4B3R O;  4WF9 V;  3OGC C;  3RT3 C;  2D2C B;  2LW1 A;  5E79 Z;  1XNR O;  1XOU A;  2BSK A;  3JAK B;  1ENV A;  2JGU A;  3JAS A;  1MG1 A;  1ROP A;  3CCQ V;  4GKJ B;  5IJ9 A;  4QJF B;  4MTF A;  4LNU A;  1BHA A;  3ZMU A;  1R3J C;  3RYI B;  4JI0 O;  1B04 A;  2P67 A;  3ZMZ A;  3ZHR A;  4PDR A;  4RWU A;  2EBO A;  2ZE7 A;  2IBZ H;  3W7S A;  3X2Q C;  4LF9 O;  2OIG A;  4IHJ A;  5JVD B;  2P4K A;  2LO1 A;  1VQ8 V;  2PI4 A;  3M99 B;  5LHH A;  4DR3 O;  2ZR3 A;  2RCV A;  1PM9 A;  3A0R A;  1MNG A;  3U0Z A;  2ILM A;  4I55 B;  4R7C A;  5CA1 B;  2LP7 A;  1BMF G;  2RQ6 A;  4DK1 A;  3B2E E;  2PYJ A;  1YJ9 V;  2WLI A;  4MS2 A;  4O4J A;  1KD1 W;  4CH3 A;  1GM9 A;  3QVN A;  5IJ0 B;  2UU9 B;  1XQ8 A;  5LXT B;  1DGS A;  1IBL B;  2NLJ C;  3ABM B;  2GSM B;  2UXC B;  4YJ3 A;  3UM7 A;  4B3M B;  4X1K B;  4OXS A;  3BEH A;  1OZ0 A;  2YEV A;  2A3Q A;  5KUM A;  1WN7 A;  3SGI A;  4CC5 A;  1B06 A;  5ITZ B;  1WPX A;  1PV0 A;  1NKD A;  1AJN A;  3HR0 A;  2EX3 A;  1EBO A;  1R3I C;  3WFV A;  4LFB B;  4EFE A;  4RUF A;  4MT8 A;  3JAT A;  3ZCC A;  1WB7 A;  3FB7 C;  3C3S A;  1YXB A;  3ZRV A;  4LF6 O;  5IYB O;  3GVM A;  2EIJ C;  1ZL8 A;  2UUC B;  4B08 A;  1TA8 A;  1S76 D;  4PA3 A;  1W59 A;  4QPJ A;  2QM7 A;  3ZMV A;  3H1L H;  4DUY O;  4X64 B;  1Y6X A;  4I4T B;  4BAY A;  2DQ0 A;  1IBM B;  3ZED A;  1NI8 A;  1FXK B;  4FPP A;  3HKB B;  4FLU A;  3H1J H;  3EVK A;  4JAU A;  4JI2 O;  1AI4 A;  1QHT A;  3K03 A;  1OCO B;  1I0H A;  4NTX A;  4NXM O;  3JSL A;  4GX0 A;  1WA8 A;  3AEI A;  3F7V C;  4LCU C;  3ASO C;  3DTU B;  3BRC A;  4JYA B;  1SQX H;  4RUE A;  4O2A B;  1BSM A;  5HFL A;  4I0X B;  4LF4 O;  2ZIN A;  3TXS A;  1IXM A;  2F93 B;  4DV4 B;  1DF5 A;  1LNQ A;  1I94 B;  2F4V O;  1NTK H;  1VQO V;  2Q9L A;  1TVK A;  1PNM A;  4X1Y B;  3I55 V;  3BY6 A;  1HNX O;  1MSD A;  1RPO A;  2HVJ C;  3STL C;  4DYL A;  2UUB O;  1RP3 B;  4DV1 B;  4JI5 O;  4U7N A;  3ABU A;  4UUJ C;  5KA5 A;  1QQC A;  2BTO A;  2DOS A;  2QWQ B;  4YY3 B;  3E22 B;  1GM7 A;  1NR1 A;  3K3W A;  1K7D A;  5LP6 C;  1IUR A;  1A32 A;  2DYR C;  3CEI A;  3K9S A;  1D5A A;  4KHP O;  1CP9 A;  1N4C A;  2ZXW B;  3FB8 C;  3AG1 C;  2Q0A A;  2Y48 A;  1V55 C;  5JJE B;  2XTA A;  2W6J G;  4DV0 O;  2BCC H;  4MVQ A;  3ZRW B;  5C93 A;  1QU7 A;  4RQF A;  4LF7 O;  4LWS B;  3L73 H;  3FAV A;  5KHH A;  2W6I G;  4CZZ A;  1JVM A;  1THZ A;  3B40 A;  5LYJ B;  3L9D A;  2GDS A;  3RFR A;  3ZMS A;  3T1Y O;  3BHP A;  1QVF U;  1BZK A;  2ZCE A;  1FAF A;  3UT5 A;  3JAR A;  4KL1 A;  4WFG A;  2QWR B;  1BL8 A;  4JI3 B;  2XAS A;  4JI8 B;  2CH7 B;  3JAL A;  5FPR A;  4J7K A;  3QNE A;  5DM6 V;  1Q8I A;  5KMG B;  1WAZ A;  3CWB H;  3SPG A;  2XAJ A;  2YSU B;  5EYP A;  2ADQ B;  2RN9 A;  3WG7 C;  2ZE5 A;  3RVY A;  1J5E B;  3RVZ A;  1AR1 B;  1TAE A;  2CTR A;  3QTC A;  1OCZ C;  1AP6 A;  2EIL C;  3UKM A;  3GWK C;  5FL7 G;  2GUZ B;  4J11 A;  3F5T A;  4G27 B;  2OCH A;  2W0F C;  3JSN A;  4PA7 A;  4YJ3 B;  1M1K W;  3AK1 A;  3ZHS A;  4DRX A;  4FLX A;  4CH4 A;  4DV6 O;  3O65 A;  3BA8 A;  2IJK A;  1HNW O;  1M9N A;  4R8C A;  1DLB A;  2V1D A;  2CK3 G;  1RSO A;  1SQF A;  3FFQ A;  1I08 A;  1NS1 A;  1PL4 A;  1WPB A;  3PJS K;  5BR8 O;  4JGS A;  3AG3 C;  3JAT B;  4JTC B;  2EIM B;  1M93 A;  1G6U A;  2XND G;  1K73 W;  3JAW B;  2BOC C;  4WBN A;  4HNA B;  1L0N H;  4DV7 B;  1KC8 W;  4LFB O;  4BW9 A;  1JA8 A;  3W7X A;  1ZL8 B;  1ZLZ A;  2P4V A;  1X59 A;  1AJP A;  2V4D A;  1YIJ V;  1VMG A;  1QLE C;  3L74 H;  2QSA A;  5L3F A;  1YEW A;  4DV2 B;  2E5L B;  4FFB A;  3H01 A;  4GX1 A;  1IBM O;  3RBZ A;  2P7T C;  2JIZ G;  3Q4H B;  4MVM A;  1KBH A;  2A7W A;  4ZOL A;  3SDL A;  3UCS C;  4HBN A;  4A5U B;  1VQ5 V;  3P32 A;  3CCM V;  3OW2 U;  1SA0 A;  4NTW A;  1GO3 F;  1RPR A;  1Y67 A;  4O4L B;  3X2Q B;  2ARH A;  2KG7 B;  4LBE C;  1LUW A;  2QKC A;  3FKS G;  5CBF A;  1T5E A;  2PUS A;  5CA0 B;  4R6Z A;  4GKK B;  5A9G A;  1N36 B;  3CXH F;  4QE9 A;  3ZHQ A;  4O4I B;  3HKC A;  1NH2 D;  1JX9 A;  3RYH B;  5F2V O;  3CRM A;  4ZI7 B;  1KP2 A;  3IC9 A;  2YXY A;  4W4K A;  1BGY H;  1SER A;  1BCC H;  1Y76 B;  3ZBH A;  1E1Q G;  5LOV A;  1FFT B;  3K57 A;  2UXD B;  3ZMT A;  1FFX B;  1XI1 A;  3FYE B;  3IFX A;  1QR8 A;  5C8Y B;  4OPH A;  2YXH A;  2IJH A;  1JCH A;  4MVR A;  5LGT A;  5JWP A;  4I50 B;  5IY5 C;  3FAV B;  2OT5 A;  3VQW A;  3T2M A;  3CC4 V;  4PHZ A;  1N34 B;  5EZY B;  4PDV A;  1Q6U A;  2WLH A;  1I5X A;  1XMQ B;  3FYI B;  2W0X A;  4BIZ A;  3CC7 V;  2HKO A;  4H33 A;  1IDS A;  1O9G A;  2LFR A;  3A0H Z;  5GON A;  3OUS A;  2YI8 A;  3CRR A;  3OMN B;  1K5Q A;  3RYC B;  5L3E A;  4H13 B;  4X89 A;  5EC1 C;  1N32 B;  1ZSP A;  2Q7H A;  4LFC B;  4ZIB A;  4AQY B;  2HHH O;  4I7Z B;  1MOF A;  4EB6 A;  1EM1 A;  2IW5 A;  4ZKI A;  1E79 G;  5EC2 C;  2XHB A;  1M5I A;  4AIL C;  5B1B C;  4EFB A;  2B5U A;  4QE7 A;  4K0K B;  4XBF A;  4FIP C;  2P5O A;  5GW7 A;  2KKW A;  3T1H O;  2JVD A;  4JI7 O;  4ZHQ A;  4DV3 B;  1SQQ H;  4QIW F;  1QLN A;  1LUV A;  3EHB B;  5LMU B;  4MTG A;  1H2G A;  2IM9 A;  4DR1 O;  2RMK B;  3OR6 C;  1M56 B;  3KCY A;  4LFA O;  4Z2W A;  4O4H A;  3ASO B;  1L8D A;  5EBM C;  4JAA A;  4NKG B;  2P22 C;  3APQ A;  3H9V A;  4DR7 O;  2N05 A;  4J7Z A;  1KP3 A;  3IJ4 A;  4BIU A;  2JEX A;  1O9H A;  2AW9 A;  1R6N A;  1N33 B;  1UFI A;  1EN5 A;  2VQE B;  3T4D A;  4TV9 A;  1H38 A;  4NYK A;  2Y4U A;  4L87 A;  4MVO A;  3ML0 A;  3ABL C;  1SQP H;  3ICX A;  3IAY A;  1F51 A;  3OUF A;  4E2L A;  3LDE A;  1S77 D;  4DV7 O;  2CAZ C;  4DV5 B;  1D5N A;  1NZ6 A;  5KAI Z;  1VF5 B;  5LP6 B;  4U3J B;  3K5M A;  2R9R B;  2PI5 A;  2YDE A;  1BT8 A;  3ABT A;  3U11 A;  1HR0 B;  1V9P A;  1GM8 A;  3CPW U;  1V55 B;  2Y69 B;  2ZT9 B;  2NN4 A;  1GK9 A;  4GUN A;  3SJQ C;  3ETQ A;  4FLW A;  3RYF A;  3ABK C;  3FB6 C;  3DXR A;  1H2L A;  4JYC A;  2ZR2 A;  1OCC C;  2VS0 A;  3SYC A;  3E35 A;  4IGG A;  4JI6 B;  1JFF A;  1K33 A;  2WLL A;  3CHX A;  5L3G A;  1KYO F;  1F7Y A;  2QTS A;  4JAV A;  1JR9 A;  5B1O A;  3L72 H;  1V54 C;  3ZHU A;  4Z1V A;  3CJH A;  2Q7G A;  2WA4 A;  5KHG A;  3BA9 A;  2N04 A;  4B3T O;  3K5O A;  4DR5 B;  1XL4 A;  5LMN O;  3ETE A;  4R50 A;  1H2N A;  1MZF A;  3OMA B;  2QKS A;  4LF8 O;  1VQ6 V;  3SYA A;  3HKE B;  5JCO C;  3E8F A;  1N0J A;  1K4C C;  2F66 C;  2F1M A;  3CCR V;  1OCZ B;  3L70 H;  3I56 V;  5EBL C;  2EZP A;  1TUB A;  2YIB A;  1S0V A;  3I5D A;  4W4L A;  1Q6H A;  3WB1 A;  3LDD A;  4X66 O;  5IE9 A;  1WB8 A;  2Q0O C;  1FPO A;  1M57 C;  3N2G A;  2B1I A;  4X8A A;  1XRE A;  1VQ4 V;  1KMI Z;  4ABM A;  1G4Y B;  1R73 A;  1X4T A;  2GV9 A;  3J81 N;  4TQD A;  3OD4 A;  2DWE C;  5GON B;  4GLX A;  2VWJ A;  2CTQ A;  3KKY A;  3G6B A;  1HNZ O;  2VQF B;  1XHX A;  4C7U A;  3OTO O;  1AI7 A;  4H0L B;  4YHH O;  1ZWI C;  3QO5 A;  3ZHV A;  4YIO A;  1XNQ O;  4EB6 B;  4PA6 A;  3A2F A;  4DUZ B;  3A8T A;  2BOB C;  4H37 A;  2HVK C;  4FM0 A;  4RO2 A;  3ASN C;  1S5L Z;  3OEH G;  4G2K A;  1VQP V;  2DYS B;  3AK2 A;  2X6A A;  2QJ1 A;  2CUG A;  1R3L C;  2UUA B;  3OMI B;  2X7R B;  4DW1 A;  3OE7 G;  4FK5 C;  1K9M W;  3CX5 F;  5AG2 A;  2A9H A;  2WLM A;  4F4L A;  1QCE A;  3OM3 B;  4IIJ B;  4DV3 O;  3SYO A;  1I7F A;  4TV8 B;  1IBK B;  1K3E A;  3WB0 A;  4F6E A;  2KQX A;  2R9A A;  2QTO A;  2ZM6 B;  1WNS A;  1AVM A;  5H6Q A;  1SRY A;  4WFH A;  5CBH A;  5IWA B;  3BCC H;  3N2K A;  5J2T B;  5BZB A;  5JH7 B;  5H5N A;  2YUA A;  1CXZ B;  2QWO B;  3K59 A;  1GTO A;  5B1A C;  3HKD A;  2X6C A;  2ZQM A;  4FZ0 A;  3MD0 A;  2JK5 C;  2Q7E A;  5IYZ B;  5B3S B;  2RNB A;  1RM1 C;  3AG4 C;  2XAH A;  3EXA A;  5CB4 B;  1YHQ V;  5CN0 A;  5BMV A;  1H2K A;  4L8J A;  3LNM B;  2QM8 A;  2EIN C;  5JCO A;  1JJ2 U;  2HFE C;  2XT9 A;  4K35 A;  5FPO A;  3TK1 A;  2BSK B;  4HYO A;  1KEC A;  1Q5O A;  3JAS B;  5IJ9 B;  1KKD A;  3F5W C;  5LHI A;  1GN4 A;  2OWO A;  1Q7Y W;  4LNU B;  4JYY A;  3VBB A;  4X1I A;  4TUY A;  4DR4 B;  3DXR B;  1GKF A;  3SR2 C;  3R65 A;  4GKJ O;  5L3D A;  3FD9 A;  4NXN B;  1SQV H;  1SET A;  3P3P A;  1GAX A;  4JF3 A;  3P30 A;  2HLD G;  2OCC C;  4IHJ B;  4TQF A;  3G4S V;  1XMO B;  4WFA V;  3M8A A;  1PD3 A;  2Y0P A;  2Q73 A;  2LJ2 A;  1P84 F;  2CTW A;  4MVU A;  1H2M A;  3GWO A;  4MW3 A;  5B1B B;  3JCZ A;  4CS2 A;  1IXB A;  2WLI B;  3A0B Z;  5FNV A;  3ZRS A;  4O4J B;  1S3J A;  1DTO A;  4NTY A;  3CME V;  5J2U A;  5K1X A;  4O2B A;  2ETN A;  4X62 B;  2DWD C;  1CEZ A;  3N2G B;  3M7M X;  4QGP A;  4DO2 A;  2YEV B;  2UU9 O;  2ZD9 A;  1IBL O;  3CCU V;  1YZB A;  2UXC O;  3ZHT A;  3IGA C;  5B5E Z;  4B3M O;  3B8M A;  3OR7 C;  1SQB H;  1Z2G A;  5LA6 A;  3DC6 A; 
#chains in the Genus database with same CATH homology
 1HNZ O;  4YY3 O;  4DUY O;  5IT9 N;  5A2Q N;  2UXD O;  3OTO O;  4LF9 O;  4YHH O;  3R66 A;  4X62 O;  4JI2 O;  1FYJ A;  2LW7 A;  1IBM O;  1XNQ O;  5LL6 Y;  2JRI A;  1N33 O;  1AB3 A;  4DR3 O;  2VQE O;  2HHH O;  4GKJ O;  1R1B A;  3SDL A;  4JI4 O;  1N34 O;  4NXM O;  4DR2 O;  1AIL A;  1XMQ O;  2AGA A;  4A5U B;  2UUC O;  4DV5 O;  1XEQ A;  2Z0A A;  3M8A A;  3T1H O;  4JI7 O;  2FKX A;  2UXB O;  4LF4 O;  4X64 O;  1FKA O;  1R6T A;  2VQF O;  1HR0 O;  1F7Y A;  4DV2 O;  3F5T A;  4DR6 O;  4B3S O;  2E5L O;  4JI3 O;  2F4V O;  4JI8 O;  1N32 O;  4DV3 O;  4JV5 O;  4DR4 O;  1HNX O;  4DUZ O;  4DR1 O;  4B3T O;  4LFC O;  3JAM N;  5BY1 A;  4AQY O;  5BXZ A;  5LMN O;  2UUB O;  4OX9 O;  5FLX N;  4DV6 O;  4LF8 O;  4LFA O;  4NXN O;  2N74 A;  3O65 A;  4JI5 O;  3J80 N;  4LF5 O;  1HNW O;  4X65 O;  2DOS A;  1G1X B;  4K0K O;  3J7A U;  1J5E O;  4DR7 O;  5H5N A;  1XMO O;  2UUA O;  4OPA A;  4JYA O;  1NS1 A;  4JI6 O;  1A32 A;  4JI1 O;  5BR8 O;  4B3R O;  4KHP O;  4OPH A;  3RT3 C;  4X66 O;  1XNR O;  4GKK O;  4DV4 O;  4DV0 O;  1FJG O;  1N36 O;  1I94 O;  2UU9 O;  1IBL O;  4LF6 O;  2ZKO A;  4LF7 O;  4LFB O;  1IBK O;  5LMU O;  1YZB A;  1DK1 A;  4DR5 O;  2UXC O;  1KUQ A;  1X59 A;  2DJV A;  4B3M O;  4JI0 O;  3J81 N;  2ZM6 O;  4DV1 O;  4DV7 O;  1D2D A;  5IWA O;  3T1Y O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...