4JI8O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji8O00
2FKXA 2LW7A 4GKKO 2UUAO 2ZM6O 4DR6O 4JI3O 3M8AA 4JV5O 3JAMN 4DV2O 1HNWO 2Z0AA 1N36O 2VQFO 1F7YA 4DR2O 2HHHO 2UXDO 4LFAO 5BXZA 4LF9O 1HNZO 4DV7O 3SDLA 4JI6O 3J7AU 1XEQA 4K0KO 4X65O 4DV1O 5FLXN 4LFCO 5IWAO 4DV3O 1DK1A 5BY1A 4JI8O 4DR3O 4DUZO 1HR0O 2F4VO 4JI5O 4LFBO 4JI7O 1XMOO 1KUQA 1XNRO 2AGAA 4DR4O 4X66O 4LF8O 3R66A 5LMUO 2UXCO 4DV5O 1D2DA 1R1BA 4YY3O 4DR5O 1N32O 1R6TA 1IBLO 5LL6Y 1FJGO 4B3RO 4KHPO 2DJVA 4DR1O 4X62O 1G1XB 2N74A 3T1YO 4AQYO 3O65A 4OPHA 4YHHO 1N34O 4B3MO 4LF4O 4B3SO 1J5EO 4B3TO 1N33O 1FKAO 5IT9N 4NXMO 4DUYO 4JYAO 4JI1O 4X64O 1NS1A 4LF5O 2ZKOA 4LF6O 4GKJO 2UU9O 1FYJA 2JRIA 3J81N 2UUBO 5H5NA 3F5TA 3T1HO 1AILA 3J80N 1I94O 4LF7O 4DV0O 4OX9O 5LMNO 1AB3A 4JI4O 2UUCO 2E5LO 4A5UB 2DOSA 1IBKO 3OTOO 1YZBA 4JI0O 2VQEO 5BR8O 1XNQO 1X59A 4JI2O 5A2QN 1IBMO 1HNXO 4DV6O 2UXBO 4NXNO 4DR7O 4DV4O 3RT3C 4OPAA 1A32A 1XMQO
chains in the Genus database with same CATH superfamily
5J2TA 2NN4A 3IGAC 4WBNB 2F4VB 1IDSA 2GV9A 1JFFA 1Z2GA 5LOVB 2XAFA 1MSWD 3IAYA 2JS5A 1XQ8A 1GK9A 5DEDA 4E4EA 4NVPA 1IXBA 2C2AA 5JCOC 3CB2A 5JJJB 1EN5A 4MVOA 3B4SA 4LFAO 4D7TA 3E8BA 4EB6A 3E89A 4HYOA 3I5DA 4JI6O 1QR8A 5J2UB 3ZMTA 4G2KA 3G6EV 5EIBC 1BZKA 4DUZO 2FYUH 2Q0AA 2JS3A 2R9AA 2HFEC 3BABA 5IY5B 1VQOV 1K5SA 1I94B 2P22C 4J10A 4UVCA 4QNHB 1R6TA 1CEZA 3D8CA 2CTRA 1R6KA 1FAFA 2YDEA 1Y74A 5JVDA 4OPHA 1VF7A 2LJ2A 1IVSA 4MVUA 4WFFA 5KMGB 1P49A 1L1FA 2B5UA 3QVNA 4IT5A 2CUGA 2DQ0A 2WAMA 5EK0A 3G6BA 2ILMA 2CAZC 4GT1A 3CD6V 1DGSA 3HKBA 1AB3A 1K34A 2IJKA 1VF6C 4HAMA 1IBMB 4EFBA 1ZL8A 1MSDA 4BW5A 4IHJA 2X7RB 3RBZA 1HNZB 3UT5B 2JEXA 5EIBD 1VQ8V 1WLEA 1M57B 4DR7O 5D5PA 1J95A 1E1RG 4CH5A 1GM8A 1O9HA 4GLXA 5FPOA 1RM1C 4YIPA 3H1KH 1MA1A 1IX9A 2ZIMA 2HJFC 5DM6V 1BQZA 4J7ZA 3TJTA 1QNMA 2IW5A 1GMGA 4JAVA 1GO3F 1U97A 2DYSB 1F7YA 5LA6A 1NVPD 1FJGB 3D36A 3TCUA 2XHBA 3GWOA 3RYCA 1VQ7V 2BOBC 2WLLB 4DV7O 4KP4A 3ASNC 3IJ4A 4PDLA 5C8YA 1M56B 4U3JA 3M99B 2ZCEA 1QVGU 4GZRB 4DW1A 4DRXB 1V54C 2P90A 4O4HA 5LMUB 4FLTA 3SYAA 5L3CA 1H2SB 5BMVB 4FLWA 2Y0IA 3F7YC 1K4DC 4NKGB 2EX3A 3CE2A 3H1LH 5GONA 4F6RB 5CA0A 3CJHB 5JJEB 2PGGA 2ZDIA 1FPOA 3U0ZA 1KKCA 2IU3A 1DF5A 3BA8A 3B09A 3CEIA 3CCEV 2WA4A 3UO2A 2BTQA 2ZIOA 1DLBA 3CWBH 4K8XA 2F93B 2UUBO 1HNWB 2JK5C 4R50A 3ZRWA 3ZRSA 3WG7B 4G27B 4JI0O 1VIBA 1NH2D 2OTLV 3X2QC 2UXDB 1JMKC 2HJDA 2WWWA 2VWJA 1JR9A 3K06A 1TVKB 1NQTA 3FB7C 3RT3C 1V55C 2WLNA 2JDIG 1OJHA 2Y4UA 4TOIA 3PN1A 2R72A 5CBFA 4O4IA 3OT7A 4X1YB 1KECA 1Q81W 3FX7A 2IM9A 3VOUA 2QSAA 1Y76A 3CCMV 1N32B 4I5SA 4W4KA 4WFEA 4KHPB 4DR1B 4AQYB 2NR5A 3AG4B 4UXNA 4UFZA 1N34B 2Z5UA 4DV1O 1OCZB 4B3TB 4N23A 4GCZA 1I0HA 4TV8A 4X1KB 4H13B 3JAKA 3P3PA 3MDSA 4YIOA 2UXNA 2ZE6A 2ZNJA 2JVDA 5LP6C 4WCEV 3L9DA 3R66A 4DV5O 1ORQC 2GHYA 3G67A 2JJ1G 1SQQH 1VP7A 1GM9A 4JTDB 2DJVA 2ZE7A 4DUYO 1PNKA 4JI1O 4B08A 1NS1A 2ITDC 4ZBMA 2BTOA 4JI3B 1XOUA 3J81N 2OCCC 3F5WC 3OMIB 4DV0O 2K1EA 3OFNG 1B04A 1XI1A 1WNSA 4A5UB 3FFQA 5IYZA 1XILA 1Y6XA 1MZEA 3HR0A 5B1OA 5BR8O 1AP6A 1XNQO 3JD2A 2LGQA 3BEHA 4NXNO 1R3IC 3CSXA 4BW9A 4DV4O 3OUSA 4H44B 1GH6A 5CB4A 4BWAA 1WPXA 2WLIB 1JPXA 4TQDA 3LUTB 1ZSPA 3LDEA 4MSWC 4TWKA 2VS0A 4C7UA 2IH3C 1SA0A 3N2KB 3IC9A 2DYRB 4IL6Z 4FLZA 5CA1B 2LFSA 2RCVA 2VQFO 5KUMA 1YIJV 3CS5A 4I4TB 2YC0A 4IIJB 3RN4A 1EZJA 1ENVA 1KQSU 2CK3G 2W0XA 4DR2O 3Q4HA 4Q20A 1THZA 3K58A 3VQXA 4LFCB 1NR7A 4LF9O 3OGCC 2JGDA 4PA3A 3APQA 1F51A 1HR0B 4F6EA 3BHPA 1YITV 3CP1A 1XNRB 5JQGA 3EHBB 4JI5O 4LFBO 1AJPA 1AI6A 4D6TH 4X1IB 5B1AB 4I7ZB 4WFHA 4FLXA 4AI8A 2R9IA 4LCUC 4QJFB 4X62O 3K03A 1QLEC 4WFGA 4J41A 5CA3A 3ZJZA 3SJBC 3ZHRA 4LF4O 2QWQB 3AG1B 2RDCA 2X6CA 5H6QA 1SQPH 1E1QG 2UUAB 2ZM6B 4X9QA 2QE7G 1XL6A 3NR7A 1EM1A 1Y4MA 2XTAA 3K5NA 5EYPB 1VMGA 2F43G 3T4ZA 1KYOF 1UFIA 2YIBD 3L72H 4YXWG 1IBKO 1OHHG 1WA8A 2EIMC 2YICA 3ZX6A 4EKWA 1HNXO 4Z2WA 4X65B 5K1XA 2IU0A 1NH2B 2EULA 3LSUA 3OMNB 4JV5O 4ZOLA 4JYCA 5CN0A 4MTGA 4W4LA 2WLMA 3T1CA 4ZHQB 4J7JA 2D2CB 3ZRXA 1DTOA 3FAVB 3OGIB 3TGUH 2RN9A 3BVOA 3JATA 2FTKA 2W0FC 4CC5A 5K1PA 3D36C 4I0XB 4H33A 4JZ2A 1RP3B 3E86A 4FLVA 2QM7A 4X20B 1B6QA 1YTFD 4GKJB 2ITCC 1H2LA 3SPIA 4UV9A 1N8RW 3JCUZ 1FFXA 1ZUQA 3E8FA 4CS4A 1R1BA 5JH7B 4I9WA 4O2BA 5B3SB 2Q0OC 5LL6Y 2ZE5A 3JATB 4YJ3B 3JALB 2EIKB 3RWRD 2ZDIC 2EZPA 3CXHF 4B3SO 1J5EO 4PJ0Z 4GX1A 5IT9N 4X64O 3W7SA 2XUMA 1N4CA 2WLHA 5FNVB 1L0NH 3CC7V 3OR6C 2HVJC 5H5NA 4FM2A 4LF7O 3JD3A 2CDYA 1SRYA 3JAWA 4R8CA 4AHCA 1YJ9V 4JI4O 1MOFA 1WB8A 2B1GA 4TV9A 4LP8A 1K92A 4DXWA 1BE3H 1VQNV 1YCIA 3FYIB 1N0NA 1YHQV 1ZTEA 1Y66A 5IYDO 4CBCA 5EZYA 1FXKB 1AI7A 1KKDA 1XMQO 2YEVB 3ZMSA 4WBNA 2KQXA 4BIUA 2P67A 5LOVA 1QLNA 4LNUB 2ZT9B 2LGWA 3ZHUA 4FFBB 4FZ1A 1I08A 4FLUA 3CRAA 2VWKA 5LGTA 3A2FA 4LC1A 2BE3A 3IFXA 4YHHB 2L6LA 5J2UA 1NJIW 5FLXN 3ABMB 4NXMB 4CS3A 2Y69B 4DR3O 1K33A 4CZZA 4QGPA 4MS2A 4YY3B 1KUQA 2HEPA 1RSOB 2CTQA 4PI2A 2CGOA 2OIGA 1U96A 1PL4A 1US6A 4DR5O 4NTYA 4J11A 4FM0A 3T1YO 2MK3A 1GN3A 1AROP 3JSLA 5KMGA 2DWEC 4JTAB 4E2LA 2UU9B 4EFEA 3ZHQA 2PTMA 3E35A 1Q82W 1M90W 1F4NA 4L8JA 2RJZA 1OCCB 3JSNA 2LQTA 2GSMB 1PL0A 2JGUA 4UVBA 2Q73A 5CBHA 2V7QG 3UT5A 2AW9A 3WB0A 3ZMVA 2EIJC 1OCRC 1FXVA 1WJZA 1IBMO 1QR9A 1SZXA 2UXBO 4JI6B 3QO8A 1SF9A 4IGGA 3SYOA 3DSQA 3ETDA 2P4VA 3CXCU 2YSUB 1Q3EA 1ZLZA 2EILC 3AK2A 1YJNV 1EFRG 2E74B 2ETNA 3G71V 1GRJA 3LDDA 4BIOA 2IJHA 4QPJA 1NZ6A 4B7EA 3M8AA 4I50B 3JAMN 3W7XA 1VQLV 5H2FZ 2EJ7A 4H0LB 1UPGA 3K9SA 1JOYA 4XBFA 1KBHA 2WLLA 5GTIZ 1YDXA 1OCOB 4WFAV 2EINC 3ZHTA 4OXSA 1Z5VA 5LYJA 3KCXA 3L71H 2B1IA 2O57A 4DRXA 3K0DA 1M1KW 3U10A 1ZAUA 1I5YA 3RYHB 4DR4B 3HKCB 1F23A 1HW7A 1PPJH 4JI7O 5BMVA 4PA9A 2DN9A 1NTZH 5LMUO 1OZ0A 5J9PC 2UXCO 4UUJC 4F6RA 3CJHA 3AG2B 2ZINA 1YTFB 1EBOA 4B3RO 3H9VA 1G1XB 3SPGA 5LYJB 1BGYH 3I56V 4B3MO 1PD3A 1W59A 4KXRA 3U11A 2CH7A 3ZN0A 2Q6AA 2D3OW 3K3WA 1R3LC 1SQXH 2XAHA 2HR3A 1EZVH 3F5TA 5ITZB 2Q7EA 4PD4F 4MVZA 3HKDB 1PNMA 2HVKC 2IBZH 2QGNA 4GX2A 1Q8IA 2XAJA 2BOCC 2FB5A 2OT5A 1SQGA 2XOKG 4JI2O 3K57A 1TVKA 4DV7B 2G38A 3A0RA 3TK1A 4GKKB 2JEUA 4J9ZB 2CH7B 2RMKB 5F2VO 4J80A 4ICGA 1BL8A 2Q68A 2LW7A 2XASA 2QTOA 4X1YA 3ZMZA 2PI5A 2A3QA 3OEHG 1XBLA 5KX5B 4PA6A 4OGQB 2PYLA 2N05A 2GDSA 3FKSG 3RFRA 3NXSA 3VQYA 4UB8Z 5H9CA 5KHGA 1R6NA 3JD4A 4Q6GA 1WP8A 2HHHO 1VEWA 3K04A 4ABMA 1K97A 1SC5B 1BT8A 4JI8B 4K0KO 5EBLC 4X1KA 1W2BU 1BCCH 5IWAO 4DV3O 1DK1A 1R73A 2DMXA 4MW3A 3VQVA 4NTXA 1H2GA 2IJJA 3CRQA 4UCSA 3DXRB 2UUBB 3UCSC 4UCOA 1I7FA 3G80A 4AILC 4JI0B 2L35A 4PDMA 1S76D 5LHGA 4BR6A 4O2AB 4JYAO 2ZQMA 1BQ0A 5BZBA 3CC4V 1WAZA 3K5MA 4HNAB 3ETGA 2W6JG 4X89A 3SYCA 5FL7G 1RPOA 1VQMV 3T1HO 1O9GA 2VQEB 3ABLB 5KA5A 2UUCO 2ZXWB 4FM1A 3OTOO 4FFKA 1H2NA 2F1MA 3A8TA 1F4MA 3HB3B 1NI8A 4MVSA 3L70H 3N27A 2F66C 3FB5C 1MG1A 1HWYA 2H8PC 2WLIA 3ABKC 4ASUG 2DE0X 1S77D 4XDJA 3SGIA 5AG2A 3E8HA 4RQFA 1CP9A 3QTCA 2W6IG 2GUZB 2FKXA 3N2KA 1Q86W 2M6YA 5CA1A 2Y0PA 2LO1A 1BS3A 3SYQA 5LXTB 3LSSA 4GUNA 4NR1A 5L3BA 4I4TA 4DV5B 4IIJA 4PDVA 5KHKA 3VQWA 4K8ZA 2K9PA 3ZEDA 2P5OA 3JD1A 5KUKA 1KMIZ 4JAUA 1FD9A 2HG5C 2B9ZA 3JASB 1D5AA 1SETA 1YVWA 4UV8A 1KP3A 2GBOA 1QBZA 1AJQA 4LFCO 4DUYB 1KD1W 1HR0O 1VQ4V 3GB7C 4K35A 4X1IA 3N2GB 1XMOO 4YJ2B 1G8MA 5IY5C 3OMAB 1XNRO 2ARHA 4O4LB 1I5XA 5IJ9B 1G4YB 2EBOA 3A0BZ 4PV1B 2XNDG 3ZRVA 2QWOB 5BR8B 4QE7A 5GW7A 2DWDC 3S3XA 1NKDA 1M93A 1SQFA 3L75H 2DW4A 4NXNB 4DV4B 1NVPB 3P3NA 4MW8A 2X0LA 1L0LH 2ZD9A 4JYYA 3KKYA 5HFMA 1GN6A 1GAXA 3LDCA 4N21A 1LUWA 3FYEB 5EYPA 5KHIA 5L3FA 5CBGA 2VQFB 4CS2A 4FIPC 2QWNB 1FFTB 3CX5F 2E5LO 5DN6G 5KHJA 4DR2B 3QG5A 1HP8A 4LH6A 4LF9B 3JCZA 3DC5A 1M57C 1TAEA 3JARB 4OPAA 4WF9V 1GN4A 3FB6C 4UCVA 1RM1B 3FB8C 5IJ0B 4RO2A 3CMAV 1R3JC 4JI5B 4LFBB 2P7TC 3RGBA 4DR6O 3CCUV 2M7WA 4ZHQA 2ZR2A 3FAVA 3D3IA 1N36O 2DYSC 4FZ0A 3B77A 1BSMA 2Q67A 2A7WA 4MT8A 2UXXA 1TGOA 5BXZA 1FS0G 2FL4A 1TUBB 3SDLA 2FMLA 4I0XA 4O4JB 3W7UA 3ASNB 2YXLA 4LF4B 1M4UA 4X20A 4K3AA 4TUYB 1M5IA 2CTPA 1M56C 3E22B 1B06A 1V54B 2EZOA 4UB6Z 1IZ3A 3AG7A 1SQVH 1K5QA 2R9RB 2KSDA 3MAQA 3OW2U 2AGAA 4X66O 1GKFA 4LF8O 4L87A 5JH7A 1WN7A 1AR1B 2YXYA 2Y4TA 1G6UA 4YJ3A 3JALA 3KG2A 1IBLO 4ZKIA 1GN2A 4FLYA 1H8HG 4I55B 1YEWA 4FK5C 4D7SA 3APOA 1HNXB 2Q9LA 1NU1H 1N0JA 4QE9A 2HKOA 4LF5B 1N33O 3UO3A 5FNVA 5TISZ 3F7VC 3R65A 2ZKOA 4LF6O 2ZE8A 4H37A 3CCVV 4JV5B 2OCHA 4LR3A 5IYBO 2QR4A 2YIDA 4OX9O 5KAIZ 5LMNO 3WG7C 4KL1A 3ASOB 3X2QB 3ML0A 3CCQV 3SPJA 4DV6O 1FXKA 1PM9A 2YEVA 3P30A 1V55B 1YF2A 1VQPV 1A32A 1PV0A 3EFFK 3BPZA 4LNUA 1JQ0A 1WB7A 3QO5A 3OR7C 4HZ3A 4P30A 1AJNA 4FFBA 4I9QA 3CCLV 3A0HZ 4RAIA 1NTKH 4DV2O 3ZBHA 1NT2B 2ZNIA 2Z0AA 1UJWB 1SZTA 4ZI7B 4TT3G 3AG4C 1ZX3A 3J7AU 4B3SB 1J5EB 1OCZC 2E76B 3K79A 2AZ2A 4X64B 5BY1A 3SJAC 2HP8A 5KAFZ 1MABG 1RSOA 2F4VO 2WA3A 4LWSB 3CRMA 4UCUA 5LP6B 3EXAA 3L74H 2R70A 4LF7B 2GTSA 5LBQA 3D3QA 2KG7B 3QNEA 4MTOA 4PA4A 2AZ0A 4YY3O 3RYFB 3HKEB 2Z3YA 2YXHA 4QPKA 4XDLA 2N74A 3T4DA 3SR2C 2E3CA 2PY5A 3KZIZ 3MD0A 1XMQB 2E75B 1URFA 2QEXV 1MMMA 3B2EE 1Y67A 2UU9O 2ADPA 1FYJA 3SPHA 2OCCB 4UVAA 1Q7YW 2KKWA 1I94O 3CCSV 1ROPA 2PZSA 3AEIA 2LP7A 3G4SV 4J42A 4U7OA 2A06H 2DOSA 1XDCA 1YZBA 3OEEG 3RYIB 1GM7A 3C90A 5KLVH 3FD9A 3RVYA 2YIBA 4JYBA 5L3GA 5JWPA 3RVZA 4DR3B 4J7KA 4I50A 1KC8W 2VRZA 4GX0A 4RUEA 5J2TB 4UCRA 4DK0A 3LSQA 4P2ZA 2DYRC 3ABTA 3E8GA 5B66Z 1JFFB 2OTJV 4EEQA 1Q6IA 3MHSC 1VARA 2P06A 4Z1VA 4DR5B 1S72V 4LFAB 1M9NA 1EN4A 1Z5WA 3C3SA 3T1YB 1HNZO 3H1IH 4EB6B 4DUZB 3THOA 4PELA 1P7BA 4DYLA 3RYHA 3HKCA 2N04A 4CH3A 1VQKV 2BSKA 1Q5OA 4DR4O 1AR4A 5B1AC 4GX5A 2LW1A 2ATKC 3CMEV 3OUFA 1YJWV 1FJGO 4JAAA 1QLEB 1MZFA 2XAQA 3TXQA 2UXBB 1AR5A 1VQ6V 1Y74B 5JVDB 3AG1C 5JJNB 4KFMA 3LNNA 2BSKB 1XL4A 5ITZA 5C93A 1SERA 5EBMC 2F95B 3CCJV 3HKDA 3C3TA 1WP7A 3H01A 3E2EA 3HKBB 1PNLA 3AG3B 3SJCC 4DR7B 4UCTA 4MVQA 2EIMB 1ZL8B 3CHXA 1PKXA 3OE7G 4IHJB 4LBEC 4DO2A 2QKCA 2BCCH 2WLJA 1AI5A 5GTHZ 4GKKO 5KX5A 4JI7B 3K5OA 2Q4PA 1HNWO 2QM8A 4PA7A 5HFLA 1LUVA 3O9OA 1NR1A 2UXCB 3DGEA 4ZIBA 3JD0A 1H2KA 1KU9A 3KCYA 5D5QA 5E79Z 4B3RB 5L3DA 3ABUA 3T2MA 5LA6B 2UXDO 4MVMA 1P4RA 3RYCB 2EJRA 2KB1A 4B3MB 1EN6A 1XHZA 4CH6A 1PP9H 4FMTA 4CC6A 1XUQA 1KP2A 2IJIA 2V4DA 1BMFG 1K3EA 4JI8O 3DXRA 3H1HH 5CMUA 5C8YB 1LR1A 3BCCH 4U3JB 3P32A 5EBWC 4O4HB 4PDRA 3K0GA 5IYCO 2ADQB 1JJOA 4NB5A 1N32O 5FPRA 4RUFA 1QU7A 5B3SC 2AHZA 2JJ2G 4KHPO 4JI2B 4JF3A 5GONB 4DR1O 5CA0B 2EIKC 4O2AA 2QA4V 5LGNA 4AQYO 4MVRA 1N34O 2QTSA 3ASOC 3GWKC 3BFRA 4B3TO 2X6AA 1S5HC 2P4KA 1TA8A 4HNAA 3ZMUA 2BTQB 1JA8A 1X4TA 5B1NA 3E83A 2GTAA 1H8EG 3ZRWB 2Q8VA 1NTMH 2RNBA 3UKMA 3TETA 1W0KG 3CRRA 2HHHB 2VQEO 1Q90D 2RQ6A 2A0LA 5A2QN 1K9MW 3MHHC 1BHBA 3CRCA 3SPCA 4K0KB 2AXTZ 4PI0A 2GUZA 3WFVA 3M7MX 1FXKC 5IWAB 4DV3B 5B1BB 3HPLC 4JPRA 3IC7A 1JVMA 5LXTA 4JI3O 2Q69A 4MTFA 3K5LA 4O4IB 4U7NA 1K8AW 4XDKA 2PYJA 4LH7A 4IYIA 5JCOA 2QJ1A 1Y76B 3LNMB 1IURA 4U3FH 3ZCCA 4DV1B 1S3JA 3JASA 1AVMA 1D5NA 3ZS8C 4JYAB 1B3QA 3ABMC 4HBNA 1MNGA 3ZHSA 5KA6A 3ICXA 2Y69C 3N2GA 5DECA 4YJ2A 4TV8B 2CTWA 3OTFA 1CPYA 4O4LA 3JAKB 5IJ9A 1YI2V 3T1HB 2F23A 2PUSA 1D2DA 1FXHA 2UUCB 1YXBA 3L73H 1AI4A 1L8DA 3RW0A 2V1DA 3OTOB 3CCRV 5B5EZ 3SJQC 2CGNA 4JI1B 1QVFU 4JTCB 2YIAA 2QKAA 3BY6A 3DTUB 2CE4A 1DF4A 3B40A 2P6JA 2OYQA 1S5JA 3ETQA 2QWPB 4WFBV 4DV0B 1V9PA 2Q7GA 4KUMA 1OCCC 1AILA 1VF6A 3J80N 3STZC 1Q6UA 3I55V 1VQ5V 3QO7A 1RFYA 4CH4A 1XNQB 2MW2B 3WB1A 4DK1A 2IH1C 4FPPA 1K4CC 2EIJB 1OCRB 5IYZB 1X59A 3JARA 4P9OA 2YS8A 3B8NA 1HDJA 2H3OA 5IE9A 4MTXA 4R6ZA 1NBMG 2EILB 5IJ0A 3K59A 2H94A 5CB4B 3BRCA 2UUAO 3B8MA 4R7CA 2PF4E 2ZM6O 2QM4A 1OV9A 1TUEB 1XMOB 5KHHA 1SA0B 2A79B 1P7GA 3STLC 1XREA 2LFRA 1TUBA 1WPBA 1COWG 2OIEA 3AK3A 1SESA 2Y48A 3K08A 3OAAG 4O4JA 4P9PA 3WU2Z 4F4LA 2EINB 1OCOC 3Q4HB 4TUYA 1XEQA 1JCHA 4X65O 4NYKA 2JGDB 3E22A 1JX9A 1Q6HA 4DW0A 1QQCA 3QF7A 4BAYA 1R3KC 5JQGB 1VF5B 4Z1MG 4QIWF 4IYHA 4X62B 3TXSA 2E5LB 1RPRA 2NNUA 4I55A 1JJ2U 3AG2C 5EC1C 4NTWA 5EC2C 4B7KA 4BIZA 2QDOA 3AG3C 4X8AA 1S0VA 5H6RA 3SYPA 1H2MA 4LF5O 1SKVA 4JZGA 4GKJO 3OD4A 2JIZG 4DR6B 2JRIA 1IBKB 4J9YB 1H38A 1N36B 5LGUA 2YUAA 3UM7A 4GYCB 5L3EA 1WA8B 1Q43A 1W0JG 2Q5ZA 1BHAA 2X6BA 3UQ8A 3CC2V 2XT9A 3BA9A 3VBBA 2PI4A 3GVMA 2ODMA 1LNQA 2QKSA 1K7DA 2NLJC 2WPDG 4X66B 3CYOA 1VQ9V 4LF8B 3BAAA 4ZOLB 2Q7HA 4TSFG 1ZWIC 4ZI7A 1IBLB 2ZR3A 2HLDG 1SS3A 3OM3B 1GTOA 5LHHA 4G28B 1N33B 4JASA 2OWOA 4FVMA 3S3WA 4LWSA 3ZN1A 5LP6A 4PHZA 3ZIAG 4LF6B 1S5LZ 1QCEA 3ZHVA 4RQEA 2KG7A 2QWRB 1T5EA 3CPWU 3RYFA 3HKEA 4FJCC 4OX9B 3ETEA 5LMNB 1FFXB 5IDJA 1QHTA 3K9AA 4X88A 1SQBH 4O2BB 3EVKA 1KB9F 3O65A 5A9GA 4DV6B 4JGSA 4RWUA 4YHHO 1P84F 1FKAO 2YI9A 4NXMO 2A9HA 3H1JH 1IXMA 1XHXA 3AK1A 1AP5A 5B1BC 4DV2B 4JI4B 3PJSK 1CXZB 2WSSG 3JYCA 3ABLC 3W7WA 2YI8A 3RYIA 1YSCA 4TQFA 3JAWB 2ZXWC 3WB2A 2DQ3A 4TV9B 5LHIA 3DC6A 1K73W 3ABKB 2AHYA 3W7TA 2XAGA 1E79G 2WLKA 5E1AC 5EZYB
chains in the Genus database with same CATH topology
2FKXA 2LW7A 4GKKO 2UUAO 2ZM6O 4DR6O 4JI3O 3M8AA 4JV5O 3JAMN 4DV2O 1HNWO 2Z0AA 1N36O 2VQFO 1F7YA 4DR2O 2HHHO 2UXDO 4LFAO 5BXZA 4LF9O 1HNZO 4DV7O 3SDLA 4JI6O 3J7AU 1XEQA 4K0KO 4X65O 4DV1O 5FLXN 4LFCO 5IWAO 4DV3O 1DK1A 5BY1A 4JI8O 4DR3O 4DUZO 1HR0O 2F4VO 4JI5O 4LFBO 4JI7O 1XMOO 1KUQA 1XNRO 2AGAA 4DR4O 4X66O 4LF8O 3R66A 5LMUO 2UXCO 4DV5O 1D2DA 1R1BA 4YY3O 4DR5O 1N32O 1R6TA 1IBLO 5LL6Y 1FJGO 4B3RO 4KHPO 2DJVA 4DR1O 4X62O 1G1XB 2N74A 3T1YO 4AQYO 3O65A 4OPHA 4YHHO 1N34O 4B3MO 4LF4O 4B3SO 1J5EO 4B3TO 1N33O 1FKAO 5IT9N 4NXMO 4DUYO 4JYAO 4JI1O 4X64O 1NS1A 4LF5O 2ZKOA 4LF6O 4GKJO 2UU9O 1FYJA 2JRIA 3J81N 2UUBO 5H5NA 3F5TA 3T1HO 1AILA 3J80N 1I94O 4LF7O 4DV0O 4OX9O 5LMNO 1AB3A 4JI4O 2UUCO 2E5LO 4A5UB 2DOSA 1IBKO 3OTOO 1YZBA 4JI0O 2VQEO 5BR8O 1XNQO 1X59A 4JI2O 5A2QN 1IBMO 1HNXO 4DV6O 2UXBO 4NXNO 4DR7O 4DV4O 3RT3C 4OPAA 1A32A 1XMQO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKX A;  2LW7 A;  4GKK O;  2UUA O;  2ZM6 O;  4DR6 O;  4JI3 O;  3M8A A;  4JV5 O;  3JAM N;  4DV2 O;  1HNW O;  2Z0A A;  1N36 O;  2VQF O;  1F7Y A;  4DR2 O;  2HHH O;  2UXD O;  4LFA O;  5BXZ A;  4LF9 O;  1HNZ O;  4DV7 O;  3SDL A;  4JI6 O;  3J7A U;  1XEQ A;  4K0K O;  4X65 O;  4DV1 O;  5FLX N;  4LFC O;  5IWA O;  4DV3 O;  1DK1 A;  5BY1 A;  4JI8 O;  4DR3 O;  4DUZ O;  1HR0 O;  2F4V O;  4JI5 O;  4LFB O;  4JI7 O;  1XMO O;  1KUQ A;  1XNR O;  2AGA A;  4DR4 O;  4X66 O;  4LF8 O;  3R66 A;  5LMU O;  2UXC O;  4DV5 O;  1D2D A;  1R1B A;  4YY3 O;  4DR5 O;  1N32 O;  1R6T A;  1IBL O;  5LL6 Y;  1FJG O;  4B3R O;  4KHP O;  2DJV A;  4DR1 O;  4X62 O;  1G1X B;  2N74 A;  3T1Y O;  4AQY O;  3O65 A;  4OPH A;  4YHH O;  1N34 O;  4B3M O;  4LF4 O;  4B3S O;  1J5E O;  4B3T O;  1N33 O;  1FKA O;  5IT9 N;  4NXM O;  4DUY O;  4JYA O;  4JI1 O;  4X64 O;  1NS1 A;  4LF5 O;  2ZKO A;  4LF6 O;  4GKJ O;  2UU9 O;  1FYJ A;  2JRI A;  3J81 N;  2UUB O;  5H5N A;  3F5T A;  3T1H O;  1AIL A;  3J80 N;  1I94 O;  4LF7 O;  4DV0 O;  4OX9 O;  5LMN O;  1AB3 A;  4JI4 O;  2UUC O;  2E5L O;  4A5U B;  2DOS A;  1IBK O;  3OTO O;  1YZB A;  4JI0 O;  2VQE O;  5BR8 O;  1XNQ O;  1X59 A;  4JI2 O;  5A2Q N;  1IBM O;  1HNX O;  4DV6 O;  2UXB O;  4NXN O;  4DR7 O;  4DV4 O;  3RT3 C;  4OPA A;  1A32 A;  1XMQ O; 
#chains in the Genus database with same CATH topology
 5J2T A;  2NN4 A;  3IGA C;  4WBN B;  2F4V B;  1IDS A;  2GV9 A;  1JFF A;  1Z2G A;  5LOV B;  2XAF A;  1MSW D;  3IAY A;  2JS5 A;  1XQ8 A;  1GK9 A;  5DED A;  4E4E A;  4NVP A;  1IXB A;  2C2A A;  5JCO C;  3CB2 A;  5JJJ B;  1EN5 A;  4MVO A;  3B4S A;  4LFA O;  4D7T A;  3E8B A;  4EB6 A;  3E89 A;  4HYO A;  3I5D A;  4JI6 O;  1QR8 A;  5J2U B;  3ZMT A;  4G2K A;  3G6E V;  5EIB C;  1BZK A;  4DUZ O;  2FYU H;  2Q0A A;  2JS3 A;  2R9A A;  2HFE C;  3BAB A;  5IY5 B;  1VQO V;  1K5S A;  1I94 B;  2P22 C;  4J10 A;  4UVC A;  4QNH B;  1R6T A;  1CEZ A;  3D8C A;  2CTR A;  1R6K A;  1FAF A;  2YDE A;  1Y74 A;  5JVD A;  4OPH A;  1VF7 A;  2LJ2 A;  1IVS A;  4MVU A;  4WFF A;  5KMG B;  1P49 A;  1L1F A;  2B5U A;  3QVN A;  4IT5 A;  2CUG A;  2DQ0 A;  2WAM A;  5EK0 A;  3G6B A;  2ILM A;  2CAZ C;  4GT1 A;  3CD6 V;  1DGS A;  3HKB A;  1AB3 A;  1K34 A;  2IJK A;  1VF6 C;  4HAM A;  1IBM B;  4EFB A;  1ZL8 A;  1MSD A;  4BW5 A;  4IHJ A;  2X7R B;  3RBZ A;  1HNZ B;  3UT5 B;  2JEX A;  5EIB D;  1VQ8 V;  1WLE A;  1M57 B;  4DR7 O;  5D5P A;  1J95 A;  1E1R G;  4CH5 A;  1GM8 A;  1O9H A;  4GLX A;  5FPO A;  1RM1 C;  4YIP A;  3H1K H;  1MA1 A;  1IX9 A;  2ZIM A;  2HJF C;  5DM6 V;  1BQZ A;  4J7Z A;  3TJT A;  1QNM A;  2IW5 A;  1GMG A;  4JAV A;  1GO3 F;  1U97 A;  2DYS B;  1F7Y A;  5LA6 A;  1NVP D;  1FJG B;  3D36 A;  3TCU A;  2XHB A;  3GWO A;  3RYC A;  1VQ7 V;  2BOB C;  2WLL B;  4DV7 O;  4KP4 A;  3ASN C;  3IJ4 A;  4PDL A;  5C8Y A;  1M56 B;  4U3J A;  3M99 B;  2ZCE A;  1QVG U;  4GZR B;  4DW1 A;  4DRX B;  1V54 C;  2P90 A;  4O4H A;  5LMU B;  4FLT A;  3SYA A;  5L3C A;  1H2S B;  5BMV B;  4FLW A;  2Y0I A;  3F7Y C;  1K4D C;  4NKG B;  2EX3 A;  3CE2 A;  3H1L H;  5GON A;  4F6R B;  5CA0 A;  3CJH B;  5JJE B;  2PGG A;  2ZDI A;  1FPO A;  3U0Z A;  1KKC A;  2IU3 A;  1DF5 A;  3BA8 A;  3B09 A;  3CEI A;  3CCE V;  2WA4 A;  3UO2 A;  2BTQ A;  2ZIO A;  1DLB A;  3CWB H;  4K8X A;  2F93 B;  2UUB O;  1HNW B;  2JK5 C;  4R50 A;  3ZRW A;  3ZRS A;  3WG7 B;  4G27 B;  4JI0 O;  1VIB A;  1NH2 D;  2OTL V;  3X2Q C;  2UXD B;  1JMK C;  2HJD A;  2WWW A;  2VWJ A;  1JR9 A;  3K06 A;  1TVK B;  1NQT A;  3FB7 C;  3RT3 C;  1V55 C;  2WLN A;  2JDI G;  1OJH A;  2Y4U A;  4TOI A;  3PN1 A;  2R72 A;  5CBF A;  4O4I A;  3OT7 A;  4X1Y B;  1KEC A;  1Q81 W;  3FX7 A;  2IM9 A;  3VOU A;  2QSA A;  1Y76 A;  3CCM V;  1N32 B;  4I5S A;  4W4K A;  4WFE A;  4KHP B;  4DR1 B;  4AQY B;  2NR5 A;  3AG4 B;  4UXN A;  4UFZ A;  1N34 B;  2Z5U A;  4DV1 O;  1OCZ B;  4B3T B;  4N23 A;  4GCZ A;  1I0H A;  4TV8 A;  4X1K B;  4H13 B;  3JAK A;  3P3P A;  3MDS A;  4YIO A;  2UXN A;  2ZE6 A;  2ZNJ A;  2JVD A;  5LP6 C;  4WCE V;  3L9D A;  3R66 A;  4DV5 O;  1ORQ C;  2GHY A;  3G67 A;  2JJ1 G;  1SQQ H;  1VP7 A;  1GM9 A;  4JTD B;  2DJV A;  2ZE7 A;  4DUY O;  1PNK A;  4JI1 O;  4B08 A;  1NS1 A;  2ITD C;  4ZBM A;  2BTO A;  4JI3 B;  1XOU A;  3J81 N;  2OCC C;  3F5W C;  3OMI B;  4DV0 O;  2K1E A;  3OFN G;  1B04 A;  1XI1 A;  1WNS A;  4A5U B;  3FFQ A;  5IYZ A;  1XIL A;  1Y6X A;  1MZE A;  3HR0 A;  5B1O A;  5BR8 O;  1AP6 A;  1XNQ O;  3JD2 A;  2LGQ A;  3BEH A;  4NXN O;  1R3I C;  3CSX A;  4BW9 A;  4DV4 O;  3OUS A;  4H44 B;  1GH6 A;  5CB4 A;  4BWA A;  1WPX A;  2WLI B;  1JPX A;  4TQD A;  3LUT B;  1ZSP A;  3LDE A;  4MSW C;  4TWK A;  2VS0 A;  4C7U A;  2IH3 C;  1SA0 A;  3N2K B;  3IC9 A;  2DYR B;  4IL6 Z;  4FLZ A;  5CA1 B;  2LFS A;  2RCV A;  2VQF O;  5KUM A;  1YIJ V;  3CS5 A;  4I4T B;  2YC0 A;  4IIJ B;  3RN4 A;  1EZJ A;  1ENV A;  1KQS U;  2CK3 G;  2W0X A;  4DR2 O;  3Q4H A;  4Q20 A;  1THZ A;  3K58 A;  3VQX A;  4LFC B;  1NR7 A;  4LF9 O;  3OGC C;  2JGD A;  4PA3 A;  3APQ A;  1F51 A;  1HR0 B;  4F6E A;  3BHP A;  1YIT V;  3CP1 A;  1XNR B;  5JQG A;  3EHB B;  4JI5 O;  4LFB O;  1AJP A;  1AI6 A;  4D6T H;  4X1I B;  5B1A B;  4I7Z B;  4WFH A;  4FLX A;  4AI8 A;  2R9I A;  4LCU C;  4QJF B;  4X62 O;  3K03 A;  1QLE C;  4WFG A;  4J41 A;  5CA3 A;  3ZJZ A;  3SJB C;  3ZHR A;  4LF4 O;  2QWQ B;  3AG1 B;  2RDC A;  2X6C A;  5H6Q A;  1SQP H;  1E1Q G;  2UUA B;  2ZM6 B;  4X9Q A;  2QE7 G;  1XL6 A;  3NR7 A;  1EM1 A;  1Y4M A;  2XTA A;  3K5N A;  5EYP B;  1VMG A;  2F43 G;  3T4Z A;  1KYO F;  1UFI A;  2YIB D;  3L72 H;  4YXW G;  1IBK O;  1OHH G;  1WA8 A;  2EIM C;  2YIC A;  3ZX6 A;  4EKW A;  1HNX O;  4Z2W A;  4X65 B;  5K1X A;  2IU0 A;  1NH2 B;  2EUL A;  3LSU A;  3OMN B;  4JV5 O;  4ZOL A;  4JYC A;  5CN0 A;  4MTG A;  4W4L A;  2WLM A;  3T1C A;  4ZHQ B;  4J7J A;  2D2C B;  3ZRX A;  1DTO A;  3FAV B;  3OGI B;  3TGU H;  2RN9 A;  3BVO A;  3JAT A;  2FTK A;  2W0F C;  4CC5 A;  5K1P A;  3D36 C;  4I0X B;  4H33 A;  4JZ2 A;  1RP3 B;  3E86 A;  4FLV A;  2QM7 A;  4X20 B;  1B6Q A;  1YTF D;  4GKJ B;  2ITC C;  1H2L A;  3SPI A;  4UV9 A;  1N8R W;  3JCU Z;  1FFX A;  1ZUQ A;  3E8F A;  4CS4 A;  1R1B A;  5JH7 B;  4I9W A;  4O2B A;  5B3S B;  2Q0O C;  5LL6 Y;  2ZE5 A;  3JAT B;  4YJ3 B;  3JAL B;  2EIK B;  3RWR D;  2ZDI C;  2EZP A;  3CXH F;  4B3S O;  1J5E O;  4PJ0 Z;  4GX1 A;  5IT9 N;  4X64 O;  3W7S A;  2XUM A;  1N4C A;  2WLH A;  5FNV B;  1L0N H;  3CC7 V;  3OR6 C;  2HVJ C;  5H5N A;  4FM2 A;  4LF7 O;  3JD3 A;  2CDY A;  1SRY A;  3JAW A;  4R8C A;  4AHC A;  1YJ9 V;  4JI4 O;  1MOF A;  1WB8 A;  2B1G A;  4TV9 A;  4LP8 A;  1K92 A;  4DXW A;  1BE3 H;  1VQN V;  1YCI A;  3FYI B;  1N0N A;  1YHQ V;  1ZTE A;  1Y66 A;  5IYD O;  4CBC A;  5EZY A;  1FXK B;  1AI7 A;  1KKD A;  1XMQ O;  2YEV B;  3ZMS A;  4WBN A;  2KQX A;  4BIU A;  2P67 A;  5LOV A;  1QLN A;  4LNU B;  2ZT9 B;  2LGW A;  3ZHU A;  4FFB B;  4FZ1 A;  1I08 A;  4FLU A;  3CRA A;  2VWK A;  5LGT A;  3A2F A;  4LC1 A;  2BE3 A;  3IFX A;  4YHH B;  2L6L A;  5J2U A;  1NJI W;  5FLX N;  3ABM B;  4NXM B;  4CS3 A;  2Y69 B;  4DR3 O;  1K33 A;  4CZZ A;  4QGP A;  4MS2 A;  4YY3 B;  1KUQ A;  2HEP A;  1RSO B;  2CTQ A;  4PI2 A;  2CGO A;  2OIG A;  1U96 A;  1PL4 A;  1US6 A;  4DR5 O;  4NTY A;  4J11 A;  4FM0 A;  3T1Y O;  2MK3 A;  1GN3 A;  1ARO P;  3JSL A;  5KMG A;  2DWE C;  4JTA B;  4E2L A;  2UU9 B;  4EFE A;  3ZHQ A;  2PTM A;  3E35 A;  1Q82 W;  1M90 W;  1F4N A;  4L8J A;  2RJZ A;  1OCC B;  3JSN A;  2LQT A;  2GSM B;  1PL0 A;  2JGU A;  4UVB A;  2Q73 A;  5CBH A;  2V7Q G;  3UT5 A;  2AW9 A;  3WB0 A;  3ZMV A;  2EIJ C;  1OCR C;  1FXV A;  1WJZ A;  1IBM O;  1QR9 A;  1SZX A;  2UXB O;  4JI6 B;  3QO8 A;  1SF9 A;  4IGG A;  3SYO A;  3DSQ A;  3ETD A;  2P4V A;  3CXC U;  2YSU B;  1Q3E A;  1ZLZ A;  2EIL C;  3AK2 A;  1YJN V;  1EFR G;  2E74 B;  2ETN A;  3G71 V;  1GRJ A;  3LDD A;  4BIO A;  2IJH A;  4QPJ A;  1NZ6 A;  4B7E A;  3M8A A;  4I50 B;  3JAM N;  3W7X A;  1VQL V;  5H2F Z;  2EJ7 A;  4H0L B;  1UPG A;  3K9S A;  1JOY A;  4XBF A;  1KBH A;  2WLL A;  5GTI Z;  1YDX A;  1OCO B;  4WFA V;  2EIN C;  3ZHT A;  4OXS A;  1Z5V A;  5LYJ A;  3KCX A;  3L71 H;  2B1I A;  2O57 A;  4DRX A;  3K0D A;  1M1K W;  3U10 A;  1ZAU A;  1I5Y A;  3RYH B;  4DR4 B;  3HKC B;  1F23 A;  1HW7 A;  1PPJ H;  4JI7 O;  5BMV A;  4PA9 A;  2DN9 A;  1NTZ H;  5LMU O;  1OZ0 A;  5J9P C;  2UXC O;  4UUJ C;  4F6R A;  3CJH A;  3AG2 B;  2ZIN A;  1YTF B;  1EBO A;  4B3R O;  3H9V A;  1G1X B;  3SPG A;  5LYJ B;  1BGY H;  3I56 V;  4B3M O;  1PD3 A;  1W59 A;  4KXR A;  3U11 A;  2CH7 A;  3ZN0 A;  2Q6A A;  2D3O W;  3K3W A;  1R3L C;  1SQX H;  2XAH A;  2HR3 A;  1EZV H;  3F5T A;  5ITZ B;  2Q7E A;  4PD4 F;  4MVZ A;  3HKD B;  1PNM A;  2HVK C;  2IBZ H;  2QGN A;  4GX2 A;  1Q8I A;  2XAJ A;  2BOC C;  2FB5 A;  2OT5 A;  1SQG A;  2XOK G;  4JI2 O;  3K57 A;  1TVK A;  4DV7 B;  2G38 A;  3A0R A;  3TK1 A;  4GKK B;  2JEU A;  4J9Z B;  2CH7 B;  2RMK B;  5F2V O;  4J80 A;  4ICG A;  1BL8 A;  2Q68 A;  2LW7 A;  2XAS A;  2QTO A;  4X1Y A;  3ZMZ A;  2PI5 A;  2A3Q A;  3OEH G;  1XBL A;  5KX5 B;  4PA6 A;  4OGQ B;  2PYL A;  2N05 A;  2GDS A;  3FKS G;  3RFR A;  3NXS A;  3VQY A;  4UB8 Z;  5H9C A;  5KHG A;  1R6N A;  3JD4 A;  4Q6G A;  1WP8 A;  2HHH O;  1VEW A;  3K04 A;  4ABM A;  1K97 A;  1SC5 B;  1BT8 A;  4JI8 B;  4K0K O;  5EBL C;  4X1K A;  1W2B U;  1BCC H;  5IWA O;  4DV3 O;  1DK1 A;  1R73 A;  2DMX A;  4MW3 A;  3VQV A;  4NTX A;  1H2G A;  2IJJ A;  3CRQ A;  4UCS A;  3DXR B;  2UUB B;  3UCS C;  4UCO A;  1I7F A;  3G80 A;  4AIL C;  4JI0 B;  2L35 A;  4PDM A;  1S76 D;  5LHG A;  4BR6 A;  4O2A B;  4JYA O;  2ZQM A;  1BQ0 A;  5BZB A;  3CC4 V;  1WAZ A;  3K5M A;  4HNA B;  3ETG A;  2W6J G;  4X89 A;  3SYC A;  5FL7 G;  1RPO A;  1VQM V;  3T1H O;  1O9G A;  2VQE B;  3ABL B;  5KA5 A;  2UUC O;  2ZXW B;  4FM1 A;  3OTO O;  4FFK A;  1H2N A;  2F1M A;  3A8T A;  1F4M A;  3HB3 B;  1NI8 A;  4MVS A;  3L70 H;  3N27 A;  2F66 C;  3FB5 C;  1MG1 A;  1HWY A;  2H8P C;  2WLI A;  3ABK C;  4ASU G;  2DE0 X;  1S77 D;  4XDJ A;  3SGI A;  5AG2 A;  3E8H A;  4RQF A;  1CP9 A;  3QTC A;  2W6I G;  2GUZ B;  2FKX A;  3N2K A;  1Q86 W;  2M6Y A;  5CA1 A;  2Y0P A;  2LO1 A;  1BS3 A;  3SYQ A;  5LXT B;  3LSS A;  4GUN A;  4NR1 A;  5L3B A;  4I4T A;  4DV5 B;  4IIJ A;  4PDV A;  5KHK A;  3VQW A;  4K8Z A;  2K9P A;  3ZED A;  2P5O A;  3JD1 A;  5KUK A;  1KMI Z;  4JAU A;  1FD9 A;  2HG5 C;  2B9Z A;  3JAS B;  1D5A A;  1SET A;  1YVW A;  4UV8 A;  1KP3 A;  2GBO A;  1QBZ A;  1AJQ A;  4LFC O;  4DUY B;  1KD1 W;  1HR0 O;  1VQ4 V;  3GB7 C;  4K35 A;  4X1I A;  3N2G B;  1XMO O;  4YJ2 B;  1G8M A;  5IY5 C;  3OMA B;  1XNR O;  2ARH A;  4O4L B;  1I5X A;  5IJ9 B;  1G4Y B;  2EBO A;  3A0B Z;  4PV1 B;  2XND G;  3ZRV A;  2QWO B;  5BR8 B;  4QE7 A;  5GW7 A;  2DWD C;  3S3X A;  1NKD A;  1M93 A;  1SQF A;  3L75 H;  2DW4 A;  4NXN B;  4DV4 B;  1NVP B;  3P3N A;  4MW8 A;  2X0L A;  1L0L H;  2ZD9 A;  4JYY A;  3KKY A;  5HFM A;  1GN6 A;  1GAX A;  3LDC A;  4N21 A;  1LUW A;  3FYE B;  5EYP A;  5KHI A;  5L3F A;  5CBG A;  2VQF B;  4CS2 A;  4FIP C;  2QWN B;  1FFT B;  3CX5 F;  2E5L O;  5DN6 G;  5KHJ A;  4DR2 B;  3QG5 A;  1HP8 A;  4LH6 A;  4LF9 B;  3JCZ A;  3DC5 A;  1M57 C;  1TAE A;  3JAR B;  4OPA A;  4WF9 V;  1GN4 A;  3FB6 C;  4UCV A;  1RM1 B;  3FB8 C;  5IJ0 B;  4RO2 A;  3CMA V;  1R3J C;  4JI5 B;  4LFB B;  2P7T C;  3RGB A;  4DR6 O;  3CCU V;  2M7W A;  4ZHQ A;  2ZR2 A;  3FAV A;  3D3I A;  1N36 O;  2DYS C;  4FZ0 A;  3B77 A;  1BSM A;  2Q67 A;  2A7W A;  4MT8 A;  2UXX A;  1TGO A;  5BXZ A;  1FS0 G;  2FL4 A;  1TUB B;  3SDL A;  2FML A;  4I0X A;  4O4J B;  3W7U A;  3ASN B;  2YXL A;  4LF4 B;  1M4U A;  4X20 A;  4K3A A;  4TUY B;  1M5I A;  2CTP A;  1M56 C;  3E22 B;  1B06 A;  1V54 B;  2EZO A;  4UB6 Z;  1IZ3 A;  3AG7 A;  1SQV H;  1K5Q A;  2R9R B;  2KSD A;  3MAQ A;  3OW2 U;  2AGA A;  4X66 O;  1GKF A;  4LF8 O;  4L87 A;  5JH7 A;  1WN7 A;  1AR1 B;  2YXY A;  2Y4T A;  1G6U A;  4YJ3 A;  3JAL A;  3KG2 A;  1IBL O;  4ZKI A;  1GN2 A;  4FLY A;  1H8H G;  4I55 B;  1YEW A;  4FK5 C;  4D7S A;  3APO A;  1HNX B;  2Q9L A;  1NU1 H;  1N0J A;  4QE9 A;  2HKO A;  4LF5 B;  1N33 O;  3UO3 A;  5FNV A;  5TIS Z;  3F7V C;  3R65 A;  2ZKO A;  4LF6 O;  2ZE8 A;  4H37 A;  3CCV V;  4JV5 B;  2OCH A;  4LR3 A;  5IYB O;  2QR4 A;  2YID A;  4OX9 O;  5KAI Z;  5LMN O;  3WG7 C;  4KL1 A;  3ASO B;  3X2Q B;  3ML0 A;  3CCQ V;  3SPJ A;  4DV6 O;  1FXK A;  1PM9 A;  2YEV A;  3P30 A;  1V55 B;  1YF2 A;  1VQP V;  1A32 A;  1PV0 A;  3EFF K;  3BPZ A;  4LNU A;  1JQ0 A;  1WB7 A;  3QO5 A;  3OR7 C;  4HZ3 A;  4P30 A;  1AJN A;  4FFB A;  4I9Q A;  3CCL V;  3A0H Z;  4RAI A;  1NTK H;  4DV2 O;  3ZBH A;  1NT2 B;  2ZNI A;  2Z0A A;  1UJW B;  1SZT A;  4ZI7 B;  4TT3 G;  3AG4 C;  1ZX3 A;  3J7A U;  4B3S B;  1J5E B;  1OCZ C;  2E76 B;  3K79 A;  2AZ2 A;  4X64 B;  5BY1 A;  3SJA C;  2HP8 A;  5KAF Z;  1MAB G;  1RSO A;  2F4V O;  2WA3 A;  4LWS B;  3CRM A;  4UCU A;  5LP6 B;  3EXA A;  3L74 H;  2R70 A;  4LF7 B;  2GTS A;  5LBQ A;  3D3Q A;  2KG7 B;  3QNE A;  4MTO A;  4PA4 A;  2AZ0 A;  4YY3 O;  3RYF B;  3HKE B;  2Z3Y A;  2YXH A;  4QPK A;  4XDL A;  2N74 A;  3T4D A;  3SR2 C;  2E3C A;  2PY5 A;  3KZI Z;  3MD0 A;  1XMQ B;  2E75 B;  1URF A;  2QEX V;  1MMM A;  3B2E E;  1Y67 A;  2UU9 O;  2ADP A;  1FYJ A;  3SPH A;  2OCC B;  4UVA A;  1Q7Y W;  2KKW A;  1I94 O;  3CCS V;  1ROP A;  2PZS A;  3AEI A;  2LP7 A;  3G4S V;  4J42 A;  4U7O A;  2A06 H;  2DOS A;  1XDC A;  1YZB A;  3OEE G;  3RYI B;  1GM7 A;  3C90 A;  5KLV H;  3FD9 A;  3RVY A;  2YIB A;  4JYB A;  5L3G A;  5JWP A;  3RVZ A;  4DR3 B;  4J7K A;  4I50 A;  1KC8 W;  2VRZ A;  4GX0 A;  4RUE A;  5J2T B;  4UCR A;  4DK0 A;  3LSQ A;  4P2Z A;  2DYR C;  3ABT A;  3E8G A;  5B66 Z;  1JFF B;  2OTJ V;  4EEQ A;  1Q6I A;  3MHS C;  1VAR A;  2P06 A;  4Z1V A;  4DR5 B;  1S72 V;  4LFA B;  1M9N A;  1EN4 A;  1Z5W A;  3C3S A;  3T1Y B;  1HNZ O;  3H1I H;  4EB6 B;  4DUZ B;  3THO A;  4PEL A;  1P7B A;  4DYL A;  3RYH A;  3HKC A;  2N04 A;  4CH3 A;  1VQK V;  2BSK A;  1Q5O A;  4DR4 O;  1AR4 A;  5B1A C;  4GX5 A;  2LW1 A;  2ATK C;  3CME V;  3OUF A;  1YJW V;  1FJG O;  4JAA A;  1QLE B;  1MZF A;  2XAQ A;  3TXQ A;  2UXB B;  1AR5 A;  1VQ6 V;  1Y74 B;  5JVD B;  3AG1 C;  5JJN B;  4KFM A;  3LNN A;  2BSK B;  1XL4 A;  5ITZ A;  5C93 A;  1SER A;  5EBM C;  2F95 B;  3CCJ V;  3HKD A;  3C3T A;  1WP7 A;  3H01 A;  3E2E A;  3HKB B;  1PNL A;  3AG3 B;  3SJC C;  4DR7 B;  4UCT A;  4MVQ A;  2EIM B;  1ZL8 B;  3CHX A;  1PKX A;  3OE7 G;  4IHJ B;  4LBE C;  4DO2 A;  2QKC A;  2BCC H;  2WLJ A;  1AI5 A;  5GTH Z;  4GKK O;  5KX5 A;  4JI7 B;  3K5O A;  2Q4P A;  1HNW O;  2QM8 A;  4PA7 A;  5HFL A;  1LUV A;  3O9O A;  1NR1 A;  2UXC B;  3DGE A;  4ZIB A;  3JD0 A;  1H2K A;  1KU9 A;  3KCY A;  5D5Q A;  5E79 Z;  4B3R B;  5L3D A;  3ABU A;  3T2M A;  5LA6 B;  2UXD O;  4MVM A;  1P4R A;  3RYC B;  2EJR A;  2KB1 A;  4B3M B;  1EN6 A;  1XHZ A;  4CH6 A;  1PP9 H;  4FMT A;  4CC6 A;  1XUQ A;  1KP2 A;  2IJI A;  2V4D A;  1BMF G;  1K3E A;  4JI8 O;  3DXR A;  3H1H H;  5CMU A;  5C8Y B;  1LR1 A;  3BCC H;  4U3J B;  3P32 A;  5EBW C;  4O4H B;  4PDR A;  3K0G A;  5IYC O;  2ADQ B;  1JJO A;  4NB5 A;  1N32 O;  5FPR A;  4RUF A;  1QU7 A;  5B3S C;  2AHZ A;  2JJ2 G;  4KHP O;  4JI2 B;  4JF3 A;  5GON B;  4DR1 O;  5CA0 B;  2EIK C;  4O2A A;  2QA4 V;  5LGN A;  4AQY O;  4MVR A;  1N34 O;  2QTS A;  3ASO C;  3GWK C;  3BFR A;  4B3T O;  2X6A A;  1S5H C;  2P4K A;  1TA8 A;  4HNA A;  3ZMU A;  2BTQ B;  1JA8 A;  1X4T A;  5B1N A;  3E83 A;  2GTA A;  1H8E G;  3ZRW B;  2Q8V A;  1NTM H;  2RNB A;  3UKM A;  3TET A;  1W0K G;  3CRR A;  2HHH B;  2VQE O;  1Q90 D;  2RQ6 A;  2A0L A;  5A2Q N;  1K9M W;  3MHH C;  1BHB A;  3CRC A;  3SPC A;  4K0K B;  2AXT Z;  4PI0 A;  2GUZ A;  3WFV A;  3M7M X;  1FXK C;  5IWA B;  4DV3 B;  5B1B B;  3HPL C;  4JPR A;  3IC7 A;  1JVM A;  5LXT A;  4JI3 O;  2Q69 A;  4MTF A;  3K5L A;  4O4I B;  4U7N A;  1K8A W;  4XDK A;  2PYJ A;  4LH7 A;  4IYI A;  5JCO A;  2QJ1 A;  1Y76 B;  3LNM B;  1IUR A;  4U3F H;  3ZCC A;  4DV1 B;  1S3J A;  3JAS A;  1AVM A;  1D5N A;  3ZS8 C;  4JYA B;  1B3Q A;  3ABM C;  4HBN A;  1MNG A;  3ZHS A;  5KA6 A;  3ICX A;  2Y69 C;  3N2G A;  5DEC A;  4YJ2 A;  4TV8 B;  2CTW A;  3OTF A;  1CPY A;  4O4L A;  3JAK B;  5IJ9 A;  1YI2 V;  3T1H B;  2F23 A;  2PUS A;  1D2D A;  1FXH A;  2UUC B;  1YXB A;  3L73 H;  1AI4 A;  1L8D A;  3RW0 A;  2V1D A;  3OTO B;  3CCR V;  5B5E Z;  3SJQ C;  2CGN A;  4JI1 B;  1QVF U;  4JTC B;  2YIA A;  2QKA A;  3BY6 A;  3DTU B;  2CE4 A;  1DF4 A;  3B40 A;  2P6J A;  2OYQ A;  1S5J A;  3ETQ A;  2QWP B;  4WFB V;  4DV0 B;  1V9P A;  2Q7G A;  4KUM A;  1OCC C;  1AIL A;  1VF6 A;  3J80 N;  3STZ C;  1Q6U A;  3I55 V;  1VQ5 V;  3QO7 A;  1RFY A;  4CH4 A;  1XNQ B;  2MW2 B;  3WB1 A;  4DK1 A;  2IH1 C;  4FPP A;  1K4C C;  2EIJ B;  1OCR B;  5IYZ B;  1X59 A;  3JAR A;  4P9O A;  2YS8 A;  3B8N A;  1HDJ A;  2H3O A;  5IE9 A;  4MTX A;  4R6Z A;  1NBM G;  2EIL B;  5IJ0 A;  3K59 A;  2H94 A;  5CB4 B;  3BRC A;  2UUA O;  3B8M A;  4R7C A;  2PF4 E;  2ZM6 O;  2QM4 A;  1OV9 A;  1TUE B;  1XMO B;  5KHH A;  1SA0 B;  2A79 B;  1P7G A;  3STL C;  1XRE A;  2LFR A;  1TUB A;  1WPB A;  1COW G;  2OIE A;  3AK3 A;  1SES A;  2Y48 A;  3K08 A;  3OAA G;  4O4J A;  4P9P A;  3WU2 Z;  4F4L A;  2EIN B;  1OCO C;  3Q4H B;  4TUY A;  1XEQ A;  1JCH A;  4X65 O;  4NYK A;  2JGD B;  3E22 A;  1JX9 A;  1Q6H A;  4DW0 A;  1QQC A;  3QF7 A;  4BAY A;  1R3K C;  5JQG B;  1VF5 B;  4Z1M G;  4QIW F;  4IYH A;  4X62 B;  3TXS A;  2E5L B;  1RPR A;  2NNU A;  4I55 A;  1JJ2 U;  3AG2 C;  5EC1 C;  4NTW A;  5EC2 C;  4B7K A;  4BIZ A;  2QDO A;  3AG3 C;  4X8A A;  1S0V A;  5H6R A;  3SYP A;  1H2M A;  4LF5 O;  1SKV A;  4JZG A;  4GKJ O;  3OD4 A;  2JIZ G;  4DR6 B;  2JRI A;  1IBK B;  4J9Y B;  1H38 A;  1N36 B;  5LGU A;  2YUA A;  3UM7 A;  4GYC B;  5L3E A;  1WA8 B;  1Q43 A;  1W0J G;  2Q5Z A;  1BHA A;  2X6B A;  3UQ8 A;  3CC2 V;  2XT9 A;  3BA9 A;  3VBB A;  2PI4 A;  3GVM A;  2ODM A;  1LNQ A;  2QKS A;  1K7D A;  2NLJ C;  2WPD G;  4X66 B;  3CYO A;  1VQ9 V;  4LF8 B;  3BAA A;  4ZOL B;  2Q7H A;  4TSF G;  1ZWI C;  4ZI7 A;  1IBL B;  2ZR3 A;  2HLD G;  1SS3 A;  3OM3 B;  1GTO A;  5LHH A;  4G28 B;  1N33 B;  4JAS A;  2OWO A;  4FVM A;  3S3W A;  4LWS A;  3ZN1 A;  5LP6 A;  4PHZ A;  3ZIA G;  4LF6 B;  1S5L Z;  1QCE A;  3ZHV A;  4RQE A;  2KG7 A;  2QWR B;  1T5E A;  3CPW U;  3RYF A;  3HKE A;  4FJC C;  4OX9 B;  3ETE A;  5LMN B;  1FFX B;  5IDJ A;  1QHT A;  3K9A A;  4X88 A;  1SQB H;  4O2B B;  3EVK A;  1KB9 F;  3O65 A;  5A9G A;  4DV6 B;  4JGS A;  4RWU A;  4YHH O;  1P84 F;  1FKA O;  2YI9 A;  4NXM O;  2A9H A;  3H1J H;  1IXM A;  1XHX A;  3AK1 A;  1AP5 A;  5B1B C;  4DV2 B;  4JI4 B;  3PJS K;  1CXZ B;  2WSS G;  3JYC A;  3ABL C;  3W7W A;  2YI8 A;  3RYI A;  1YSC A;  4TQF A;  3JAW B;  2ZXW C;  3WB2 A;  2DQ3 A;  4TV9 B;  5LHI A;  3DC6 A;  1K73 W;  3ABK B;  2AHY A;  3W7T A;  2XAG A;  1E79 G;  2WLK A;  5E1A C;  5EZY B; 
#chains in the Genus database with same CATH homology
 2FKX A;  2LW7 A;  4GKK O;  2UUA O;  2ZM6 O;  4DR6 O;  4JI3 O;  3M8A A;  4JV5 O;  3JAM N;  4DV2 O;  1HNW O;  2Z0A A;  1N36 O;  2VQF O;  1F7Y A;  4DR2 O;  2HHH O;  2UXD O;  4LFA O;  5BXZ A;  4LF9 O;  1HNZ O;  4DV7 O;  3SDL A;  4JI6 O;  3J7A U;  1XEQ A;  4K0K O;  4X65 O;  4DV1 O;  5FLX N;  4LFC O;  5IWA O;  4DV3 O;  1DK1 A;  5BY1 A;  4JI8 O;  4DR3 O;  4DUZ O;  1HR0 O;  2F4V O;  4JI5 O;  4LFB O;  4JI7 O;  1XMO O;  1KUQ A;  1XNR O;  2AGA A;  4DR4 O;  4X66 O;  4LF8 O;  3R66 A;  5LMU O;  2UXC O;  4DV5 O;  1D2D A;  1R1B A;  4YY3 O;  4DR5 O;  1N32 O;  1R6T A;  1IBL O;  5LL6 Y;  1FJG O;  4B3R O;  4KHP O;  2DJV A;  4DR1 O;  4X62 O;  1G1X B;  2N74 A;  3T1Y O;  4AQY O;  3O65 A;  4OPH A;  4YHH O;  1N34 O;  4B3M O;  4LF4 O;  4B3S O;  1J5E O;  4B3T O;  1N33 O;  1FKA O;  5IT9 N;  4NXM O;  4DUY O;  4JYA O;  4JI1 O;  4X64 O;  1NS1 A;  4LF5 O;  2ZKO A;  4LF6 O;  4GKJ O;  2UU9 O;  1FYJ A;  2JRI A;  3J81 N;  2UUB O;  5H5N A;  3F5T A;  3T1H O;  1AIL A;  3J80 N;  1I94 O;  4LF7 O;  4DV0 O;  4OX9 O;  5LMN O;  1AB3 A;  4JI4 O;  2UUC O;  2E5L O;  4A5U B;  2DOS A;  1IBK O;  3OTO O;  1YZB A;  4JI0 O;  2VQE O;  5BR8 O;  1XNQ O;  1X59 A;  4JI2 O;  5A2Q N;  1IBM O;  1HNX O;  4DV6 O;  2UXB O;  4NXN O;  4DR7 O;  4DV4 O;  3RT3 C;  4OPA A;  1A32 A;  1XMQ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...