4JI8O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 33
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4ji8O00
1YZBA 1XMOO 1XEQA 2UXDO 4DR7O 2AGAA 1HR0O 4YY3O 3OTOO 2ZM6O 4DR3O 1J5EO 1X59A 2UXBO 2VQEO 4JYAO 4LFAO 5LMNO 4DR6O 2UU9O 2N74A 2UUAO 4LFBO 1D2DA 1N34O 3F5TA 5BR8O 1N32O 4LF9O 1AB3A 1I94O 2HHHO 1NS1A 3O65A 1AILA 3M8AA 1N33O 4LF5O 4X62O 4JI2O 3SDLA 1HNWO 4X66O 4DV2O 2UUBO 4NXMO 2FKXA 5FLXN 4DV7O 1IBLO 4DR4O 2ZKOA 1FJGO 5IT9N 2UXCO 1G1XB 4A5UB 4DV3O 5BY1A 2VQFO 4YHHO 2DOSA 2Z0AA 3J81N 4JI1O 4NXNO 4GKJO 4KHPO 4DR5O 3RT3C 4DUYO 4JI6O 4LF7O 1F7YA 4B3RO 4DV1O 4LF8O 1R1BA 3T1YO 1A32A 4JI4O 1XNRO 4B3SO 3J80N 1XMQO 5H5NA 1HNZO 1HNXO 2E5LO 1XNQO 1KUQA 4K0KO 3T1HO 4DR2O 5LMUO 4B3TO 4DV6O 1IBMO 4DUZO 4LF6O 4DV0O 1DK1A 2JRIA 5LL6Y 2DJVA 4DV4O 3R66A 2F4VO 3JAMN 4AQYO 2LW7A 5A2QN 4JV5O 4B3MO 4LFCO 4X65O 1R6TA 4JI0O 1FKAO 4OPAA 4LF4O 1FYJA 1N36O 5BXZA 3J7AU 4JI3O 4X64O 4OX9O 4GKKO 1IBKO 4OPHA 5IWAO 4DR1O 4JI8O 2UUCO 4JI5O 4DV5O 4JI7O
chains in the Genus database with same CATH superfamily
2GDSA 1QLNA 4YJ3B 3OTOO 4PDLA 3W7UA 2LW1A 1NJIW 3FAVB 2CTWA 1BZKA 1QVGU 1SA0A 4LFBO 3BFRA 4O4JB 3QTCA 3ZHSA 2A79B 5JQGB 1VQ4V 1M56B 1QLEB 2ZIOA 4MVMA 2WLIB 3OGIB 2HHHB 1Q81W 1VQOV 3OT7A 2Q7GA 2YDEA 4FFBB 2ADQB 4NTWA 1HR0B 5IT9N 2OTLV 2CK3G 3TCUA 3L9DA 2HVJC 2A9HA 2G38A 2VQFO 4UFZA 4B3MB 3T1HB 1S0VA 4NXNO 4D7TA 3RT3C 2YXHA 1XBLA 1R1BA 2UXDB 3SJBC 4B3SO 4FVMA 1I5YA 4R8CA 2CGNA 3NR7A 2EILB 2DMXA 1DF4A 3ZRSA 1XHXA 2KKWA 1KUQA 1S76D 5L3BA 1U96A 3E86A 3CS5A 3ZRVA 1Y67A 1WN7A 4QNHB 4JTCB 3G67A 3OM3B 4AQYO 1VF6A 3ML0A 2JGDA 1KQSU 5A2QN 2V4DA 1Q82W 4QPJA 3KCYA 4J42A 1JJ2U 2ZE7A 1S3JA 3ETDA 2P7TC 2HLDG 3OAAG 2PTMA 3SYQA 3OW2U 5IJ0B 4IYHA 5LMUB 1IBKB 4BIZA 2AXTZ 4PDVA 4DRXB 2Q0OC 1K4CC 4QIWF 1SESA 2DYRC 3N2KB 3ABMB 1S72V 3LNNA 1SQXH 2P4KA 3X2QB 2WLLA 4N21A 3OFNG 4DR6O 2JS5A 3T4DA 2ZDIC 2B9ZA 4R7CA 1PP9H 2JEXA 1W2BU 4JI0B 3AG3B 3E89A 2H3OA 4X65B 2LJ2A 2QSAA 2RJZA 1SQBH 3OR7C 4DV2O 1Y4MA 2WLKA 4F6EA 5B1AC 3CCRV 4BWAA 1ZTEA 4HAMA 1FJGO 1PD3A 3LUTB 2LO1A 4JI1B 3CYOA 4PA4A 5EYPB 1K34A 5H6QA 1EZJA 4QE9A 1Q6IA 4J7KA 4JAVA 3RGBA 3W7WA 4DR5O 4MVRA 4H0LB 1US6A 2E75B 4KXRA 2RCVA 2AW9A 1AI4A 5B5EZ 4PA3A 3KG2A 2MK3A 1KU9A 3HKCB 4KL1A 3APOA 2ZINA 5KMGB 4Z2WA 3SPHA 4FLYA 1Z2GA 3AG3C 2EIKB 4DXWA 4LF6O 1ZAUA 1K5SA 3OUSA 5B1OA 4JAUA 3HKBA 2X7RB 3JAMN 2F66C 3TXQA 1FFTB 1RP3B 2WWWA 1SQGA 1L1FA 3CC4V 1YF2A 1R73A 3B8MA 3TXSA 1LNQA 2ZE8A 4ZOLB 5BR8B 3CCMV 3A0BZ 1Z5WA 2QWOB 2E3CA 2Q6AA 4MSWC 3W7SA 1RSOB 3ZRWB 1BQ0A 2ITDC 4JI8O 1COWG 1GAXA 3NXSA 1JOYA 4NB5A 1NR1A 3ZX6A 4X1IA 3AK3A 2YEVA 3H1KH 2LP7A 2YICA 2M6YA 3IGAC 4RQFA 2UU9O 3Q4HB 1LUWA 1NH2D 3CRCA 3L70H 4FM0A 2P6JA 1N0JA 3B4SA 1IDSA 2RNBA 1YEWA 1GK9A 1V55B 4YY3B 4LC1A 3SYOA 1AI6A 2A3QA 2BSKA 3BHPA 1GN3A 1V54C 4DV1B 5FL7G 2ILMA 4O2BB 5HFMA 2DYSC 4YHHO 2AZ0A 3ZHRA 2RN9A 3E8HA 3VBBA 3VQYA 4DV4B 2E74B 1EN4A 2WSSG 4DV1O 3HKEB 4JV5B 5CBFA 5J2TB 4E4EA 3FAVA 3BCCH 4FLVA 2FB5A 4UB8Z 1AR5A 3E83A 1V9PA 1RM1C 4ZBMA 4WFGA 1TUBB 1SQVH 2EJ7A 1MNGA 4PA9A 4GCZA 1I7FA 2ZXWC 4EKWA 2W6IG 2HVKC 1S5LZ 1OCCC 4OX9O 5LA6B 2OTJV 3JASA 3C90A 1K7DA 4ICGA 3SPJA 2FL4A 2YIBA 4X66B 4HYOA 4YIPA 5KMGA 2JIZG 3TETA 5F2VO 1JA8A 1XOUA 2AGAA 3LDEA 2EZPA 3H1HH 1J5EO 5CB4A 1IBMB 4U7OA 1XNQB 4LFAO 5D5PA 2VWJA 3P32A 1PL0A 2EJRA 1N32O 2PYJA 4MVSA 1I94O 4BW5A 1VQPV 2A0LA 3T2MA 3JARA 2ZXWB 3HR0A 4BW9A 5K1PA 1M9NA 4UCSA 1X4TA 4NXMO 1IBLO 3IFXA 5B3SB 1I94B 4LCUC 1JFFA 3FB6C 3I55V 3P30A 1FPOA 3RN4A 4DV5B 3SJQC 2Z0AA 2GUZB 3AG4B 5EBMC 2GBOA 5JH7A 3JCZA 1MOFA 3JD2A 5E1AC 1NQTA 5J2UA 4LF8O 2XASA 3DXRA 2XTAA 4J41A 4FM2A 1M93A 2XAGA 1HDJA 4FMTA 1HNZO 2QDOA 2P5OA 1TAEA 3CHXA 3RYFB 1QR9A 1CEZA 2UUCB 4N23A 2OCCC 3ASNC 1GTOA 4DR6B 4B08A 2Z3YA 1MG1A 3K03A 4JASA 4PV1B 5FPRA 1K73W 1O9HA 5LGTA 4HNAA 3UO3A 1EN6A 4X65O 1KKCA 1O9GA 3BAAA 1OCOC 1WPXA 1E1RG 2BTQA 2YSUB 3L73H 4XDLA 2P67A 3ASOB 1Q6HA 3GB7C 2IJJA 3K06A 4I5SA 4LH7A 1JR9A 4I9WA 2E76B 3WFVA 4EFBA 3SGIA 2A7WA 3ZMTA 1H2GA 5LHHA 1JCHA 4DR3O 1M4UA 2F95B 1VQMV 3EXAA 1TGOA 3B2EE 3FFQA 1HP8A 1B06A 1JPXA 3JD3A 2Y4TA 5BR8O 5B1AB 2BOCC 2IBZH 5LGUA 2PZSA 4LF5O 1VQKV 1HNWO 3ZN0A 1GN2A 3W7TA 2KSDA 1K5QA 4FFBA 2RMKB 1IXBA 3BABA 4DR4O 3CPWU 1GN6A 1GM9A 1OCRB 2Q0AA 3E8BA 5C8YB 5KX5B 3L72H 1PNLA 5IYDO 2VS0A 2QA4V 1KECA 5LHGA 4XDJA 3ABUA 1P4RA 2IW5A 2X6CA 3CP1A 4Q6GA 1OHHG 4K35A 4WBNB 3RYIB 4LWSA 1EBOA 4K0KB 3J80N 4LFBB 3JATB 1L0NH 2EINB 3T1YB 2ODMA 1KC8W 4R6ZA 3N2KA 4PELA 3C3TA 5B1NA 2QWQB 3ZHTA 2HP8A 2OIGA 3MD0A 1SQFA 5LYJA 4J9ZB 4ZKIA 4HBNA 1GM8A 3R65A 3STLC 5IY5B 2EILC 2DQ0A 4DUYB 2PY5A 2YI8A 3CJHA 4OXSA 4X20A 2IJIA 5ITZB 3VQVA 2QJ1A 4CC6A 3H9VA 4LWSB 4NXNB 3B8NA 5IDJA 1YTFB 4O2AB 4FM1A 4O2AA 2R72A 4I9QA 2ZNIA 2UXDO 2F1MA 3CC7V 2VWKA 2Q8VA 4NVPA 5J2TA 2Q73A 1Q3EA 1YCIA 5IJ9B 3HKEA 1D5AA 3K79A 3ZRXA 1D2DA 3L71H 3K57A 4LF9O 1AB3A 1XUQA 5JCOA 4ASUG 1WP8A 3ASOC 5H9CA 4OX9B 3ZCCA 4ZI7B 3RYCB 2ZR2A 5IE9A 1U97A 1AP6A 3HKBB 1M56C 1I5XA 3QF7A 4X66O 4PHZA 2FKXA 2DQ3A 1TVKB 2ZIMA 1AJPA 1K97A 2OCHA 2L35A 1G1XB 2WLIA 4O4LA 1Y74A 3FB8C 1NH2B 1MA1A 4X62B 3B40A 1N36B 1NT2B 4TT3G 2F43G 2CUGA 1A32A 4X1IB 1M5IA 5L3CA 3K9AA 4YJ3A 4B3TB 1BS3A 2IU0A 3L74H 1HNZB 5LMUO 2XT9A 2EULA 1VQ7V 3OEEG 3WG7C 1GRJA 3EFFK 1SF9A 1W0JG 3K59A 4CZZA 2ATKC 1XILA 2UXNA 2QM4A 3VQXA 2XAQA 3FYIB 4G27B 4GKKB 3E22A 1VP7A 4TUYA 5KAFZ 4TSFG 2EIMC 1FXVA 1VEWA 5H6RA 5LMNB 4UVAA 2UUCO 1HNXB 2XNDG 3FYEB 1Q8IA 4DV5O 4JI7O 4WFAV 1UFIA 1FAFA 2Q68A 4U7NA 2GV9A 1XEQA 4DR7O 2JS3A 1UJWB 4U3FH 4MTFA 1OCZC 4I7ZB 1KB9F 1H8HG 1BL8A 2VQEO 2N05A 5LMNO 3G80A 2N74A 5EBLC 3CRRA 2UXBB 4JI7B 4MW8A 1MSWD 4NTXA 5CN0A 4TV9A 3O65A 1DLBA 3SYPA 1S77D 2KB1A 4CH5A 1HNWB 3FX7A 4P9PA 3ZHUA 5FLXN 1L8DA 1SERA 4IL6Z 1CXZB 4B3RB 2BE3A 4J7ZA 3VOUA 4A5UB 5KHHA 2CH7A 4DV3O 3ZMSA 1NTZH 3CE2A 5BY1A 3T4ZA 4CS2A 3CCJV 1AR4A 1Q86W 1NKDA 5EBWC 2ZD9A 2GHYA 3ABKC 1AR1B 3G71V 1H38A 5DN6G 1BGYH 4B3RO 1XMQB 1QHTA 4H33A 4JPRA 1FXKB 2UU9B 3A8TA 1PNKA 4DR4B 1N4CA 3RYCA 4EFEA 4DR3B 2DYSB 3I5DA 2PUSA 5J9PC 1NVPD 1DK1A 5DM6V 5D5QA 4JI8B 4GLXA 2X6AA 2AHYA 4X88A 3CXCU 3B77A 4KFMA 4DK0A 4O4JA 5LP6A 4H13B 2UXXA 2B1IA 2BOBC 4GUNA 1EN5A 4RUEA 1YJWV 4MVZA 2P06A 4O4HB 3CX5F 1YZBA 4YY3O 1NU1H 3JYCA 4XDKA 3DSQA 4YIOA 4O2BA 3BRCA 4GX5A 4PJ0Z 5LP6C 5CBHA 3GWKC 3RYHA 1N34B 4I4TB 2FMLA 3EHBB 2V7QG 1FXKA 1N0NA 2KG7B 3T1CA 2FYUH 1K8AW 2K1EA 5E79Z 2HHHO 2QKAA 4B3SB 1KKDA 4U3JA 4DK1A 2KG7A 1M57B 2CTPA 4AILC 1LR1A 2ADPA 1VQ6V 5KAIZ 4FIPC 3L75H 1K3EA 5IWAB 2C2AA 3STZC 2XOKG 4MT8A 1H8EG 2NR5A 1F51A 4FLWA 1BSMA 4LF9B 4LF7O 3OMAB 2QR4A 1SA0B 4F6RB 2UUAB 2BCCH 3RW0A 4RUFA 2R9AA 3AK1A 1XL6A 1SZXA 3BPZA 2XUMA 3MHHC 3SPCA 3D36C 1I0HA 4WFEA 3ZMVA 5H2FZ 5LL6Y 3UKMA 3GWOA 2F4VB 1H2KA 3OE7G 4UB6Z 4MTGA 5JCOC 3JD4A 1R3JC 2JEUA 3AG1C 5LXTA 4JI0O 4W4KA 3F5WC 2YIAA 4GT1A 4XBFA 4DV2B 2IM9A 4GKKO 5LXTB 2Y69B 5C93A 1MSDA 1EFRG 2WLNA 1FJGB 5KUMA 2ETNA 5B1BC 1RFYA 4YXWG 1S5HC 4TOIA 1JFFB 2W0FC 1BE3H 4DV6B 5EYPA 4JYAO 4ZOLA 3BEHA 3LSSA 3K5NA 3JARB 3K3WA 1B6QA 1OV9A 1Q7YW 1SQPH 4MVOA 1AILA 3OMNB 2DWEC 1YSCA 3K5OA 2XAFA 3OMIB 1G8MA 1P7GA 1XI1A 5IYZA 3CRQA 2DYRB 3WB1A 3QNEA 3DC6A 4TQDA 4LNUB 4NYKA 4JGSA 3RVZA 2UXCO 4O4IB 5CA1B 3PN1A 4QPKA 1VQ5V 1Q43A 5EC2C 2DOSA 3CCQV 1Y6XA 4KHPO 1VQ8V 4JI6O 3H1JH 3ZIAG 1JQ0A 1XQ8A 1WA8A 2R9IA 1QCEA 3M99B 3MDSA 4X1KA 4X64B 3JCUZ 1TUBA 4QJFB 1GMGA 4ZIBA 2CTRA 3ETEA 2E5LO 4DR7B 2Q9LA 3P3PA 1UPGA 2QTSA 5CBGA 3ABLC 4TV9B 3D36A 3ZEDA 2EIJC 1R3KC 4O4HA 4JTAB 3DGEA 1AI5A 2LW7A 1ZL8B 4JYYA 5KHJA 4Z1MG 2P22C 1Y76A 1QQCA 2JK5C 1R6TA 1GM7A 1SS3A 3ABKB 5ITZA 1KBHA 3THOA 2RDCA 2PGGA 4JI3O 4Q20A 5CA3A 3N27A 4B7EA 4PD4F 1CPYA 4O4LB 3CEIA 5JJJB 1XMOO 4JI3B 4LFCB 2H8PC 2Q7HA 2K9PA 5BZBA 1QR8A 5K1XA 1MZEA 3QO5A 1N34O 5KLVH 4MVUA 2IU3A 3ASNB 1PPJH 5L3GA 4NR1A 4JI2B 1OCZB 4WFHA 4J10A 4PDRA 5JJEB 3K5MA 2XAJA 1YDXA 2QGNA 2QWRB 4JTDB 4DV7O 5EZYB 3I56V 1DF5A 4P30A 1B3QA 3TGUH 1YIJV 2CH7B 3FB7C 1JJOA 3APQA 2YC0A 2W0XA 1KP3A 3ABTA 5EZYA 3ZHQA 4B7KA 3M7MX 2QKCA 3UT5B 2VRZA 3ZN1A 2N04A 3UCSC 3ZRWA 3JALB 3E8GA 4CBCA 4D7SA 5FNVA 1E79G 5AG2A 2YIDA 1TVKA 5B3SC 5A9GA 3G4SV 4D6TH 3E8FA 2Z5UA 1MMMA 1WJZA 3AK2A 4C7UA 3H1IH 4ZI7A 1KP2A 2WA3A 4PI2A 4WFBV 4QE7A 1IBMO 3FB5C 4DV0O 2ZE6A 2F4VO 4CS4A 5LHIA 4UCUA 2QWNB 4TWKA 4B3MO 4DW0A 4MVQA 1T5EA 4EB6A 4TUYB 5L3EA 4AQYB 3U11A 3SPIA 1SETA 4GKJB 3J7AU 3TK1A 3OR6C 2ITCC 1YITV 4TV8A 5KHGA 3ZMZA 5IWAO 2W6JG 2Q7EA 4JI4B 4LH6A 3D8CA 3CJHB 1DTOA 1P7BA 2EBOA 1HWYA 4X89A 3AG2C 4X1KB 5JVDB 2UUAO 5LYJB 3WU2Z 3F5TA 4RAIA 5GW7A 2EIJB 3SYCA 1THZA 3BY6A 3KZIZ 1AP5A 4X62O 4L8JA 2PI4A 4O4IA 2EX3A 1VF5B 2X0LA 3HKCA 1GH6A 1VQLV 3K0DA 4LNUA 3UO2A 2PI5A 2AZ2A 2HKOA 4FLZA 1RPOA 1BHBA 2EIKC 3N2GA 1R3LC 5IY5C 4JI1O 3UQ8A 3TJTA 1XHZA 3D3IA 4IHJA 5BMVA 4J9YB 1P84F 3CCEV 4WCEV 2HFEC 1W0KG 2Y0PA 1VARA 2QM8A 1NR7A 1ZLZA 5IJ9A 1WP7A 5LBQA 1NTMH 2EINC 2X6BA 1SRYA 4DV6O 4JYAB 4DUZO 5JJNB 5GTHZ 1YHQV 4IIJB 3RVYA 3ZJZA 4BAYA 4X1YB 4JI6B 2D3OW 3LSQA 3CC2V 3JASB 5B66Z 2ARHA 1YJNV 3S3XA 3JD0A 4LF5B 4X1YA 4IIJA 3HB3B 3P3NA 2Y4UA 4X64O 4YJ2B 4DRXA 1GO3F 5KHIA 2GUZA 2UXCB 2NN4A 1NZ6A 4EEQA 4KP4A 2GSMB 1FD9A 4RQEA 3CCSV 1M57C 2AHZA 2QE7G 4CC5A 2PF4E 1P49A 3JALA 3K58A 2OYQA 4F6RA 2HEPA 4BIOA 4W4LA 4JYCA 4UCOA 1VIBA 1XL4A 1R3IC 2RQ6A 2DWDC 4JI2O 3F7YC 3JD1A 1YTFD 5L3DA 3AG1B 4LR3A 4P2ZA 4DW1A 2Y48A 2LFSA 2PYLA 4OGQB 3DXRB 5JH7B 2H94A 4U3JB 2EZOA 2NLJC 2B5UA 4DUYO 2F93B 1QNMA 5LA6A 4I4TA 1NVPB 1EZVH 4G2KA 1K33A 3T1YO 5JVDA 4F4LA 4UCVA 2JDIG 1VF6C 5DEDA 2R9RB 3T1HO 1PM9A 3W7XA 3S3WA 1IXMA 3CWBH 2BTOA 1IX9A 4TV8B 5LOVA 4K8ZA 1WB7A 3IAYA 2YI9A 1GN4A 5LP6B 3OEHG 4ABMA 2ZDIA 3G6EV 2YIBD 1TUEB 4ZHQA 1KD1W 4LF4O 5LGNA 1Q6UA 5DECA 5FPOA 5CMUA 1AJNA 3LDDA 4HNAB 1G6UA 1NBMG 1AI7A 2VQFB 2YXLA 4TQFA 3SJAC 5BMVB 4IT5A 1QVFU 4LF4B 3MAQA 4WF9V 4UV9A 1YVWA 4FPPA 2CAZC 2DE0X 1OCOB 2HR3A 3JSNA 4GZRB 3UM7A 4J7JA 4PDMA 1KYOF 1Q5OA 4QGPA 4X8AA 1WA8B 2YS8A 3SR2C 2KQXA 1HW7A 2LGQA 1J5EB 1AROP 2P90A 4LFAB 1CP9A 2OCCB 1N33O 2O57A 2MW2B 1M1KW 3QO8A 3E35A 3ZHVA 3OD4A 4X9QA 2HJDA 5JWPA 1FFXA 3K0GA 4IYIA 3ZMUA 2UUBO 4KUMA 1K4DC 1FXKC 4DV0B 1G4YB 5C8YA 2M7WA 4BR6A 5EIBC 3SYAA 4CH4A 1E1QG 4AI8A 1D5NA 3FKSG 1N8RW 3AG4C 3J81N 3QO7A 4UV8A 4GKJO 1RSOA 1WPBA 3AEIA 2CDYA 3WB0A 4UXNA 4FK5C 3CD6V 3MHSC 1PKXA 1RM1B 1J95A 1QBZA 3N2GB 1N32B 2WPDG 3DTUB 1XDCA 4JI4O 3HKDB 2HG5C 3RWRD 1S5JA 4NTYA 3JSLA 3A2FA 1HNXO 2Q4PA 3K08A 1F4NA 3JAKA 2L6LA 4DR2O 3A0RA 4GX2A 2VQEB 1KMIZ 2NNUA 2DJVA 1YI2V 1WB8A 2V1DA 2ZCEA 3Q4HA 4MTOA 4CH6A 3E22B 3KKYA 5HFLA 3GVMA 1FS0G 1FKAO 4JI5B 5IJ0A 3DC5A 1BQZA 2Q69A 1JX9A 3LDCA 1ZUQA 4UCRA 2ZM6B 1V54B 4GX0A 2ZE5A 1R6KA 5EC1C 1BCCH 2IJKA 1VMGA 3VQWA 4FZ1A 4JI5O 2B1GA 3CCUV 4G28B 1SKVA 4DUZB 1NTKH 4Z1VA 4RO2A 2ZM6O 1ORQC 1X59A 2UXBO 2XAHA 2E5LB 3PJSK 2WA4A 1EM1A 2ZT9B 4I0XA 1BMFG 3EVKA 3IC9A 3WG7B 1IURA 1V55C 3ABLB 4KHPB 4JZGA 4DV3B 1Y66A 4FFKA 4PA6A 3K5LA 3K9SA 3LNMB 4LBEC 1QU7A 5TISZ 2ZR3A 3ICXA 4AHCA 1SC5B 2IH1C 3BA8A 5B1BB 5CA0B 3CCVV 1F7YA 4UVBA 4I50B 3UT5A 2WLHA 4RWUA 3WB2A 4FZ0A 1H2NA 1DGSA 5IYBO 1L0LH 5H5NA 1NI8A 1ROPA 2JGDB 1K92A 2YEVB 4K0KO 1Z5VA 4YHHB 1W59A 3A0HZ 1Y76B 1FFXB 3OUFA 1ZL8A 3KCXA 1VQNV 3O9OA 4DV4O 4JF3A 4X20B 1JMKC 4JV5O 2QKSA 4LFCO 4EB6B 3F7VC 1FXHA 4LP8A 3H01A 4K8XA 2ZNJA 1WNSA 2DW4A 3ETQA 3B09A 1URFA 2CE4A 2LFRA 3JAWA 3JAWB 3SPGA 4DR1O 2Y69C 3C3SA 1YXBA 1PL4A 4FLXA 3OTOB 3JATA 1HR0O 5L3FA 4MS2A 3CMEV 4NKGB 5FNVB 3RYIA 4GYCB 2QEXV 2IJHA 3BVOA 4FJCC 4J11A 3CMAV 1OZ0A 2WLMA 4WBNA 1ENVA 3X2QC 5GTIZ 5JQGA 3M8AA 3ZBHA 3SDLA 4I0XB 2YXYA 2WLJA 2JGUA 3IJ4A 2P4VA 5KX5A 1B04A 2FTKA 3CRMA 1H2LA 3U10A 2ZKOA 1M90W 4I50A 5CA0A 2BSKB 4LF7B 4WFFA 4UVCA 2DN9A 3ABMC 4UCTA 4HZ3A 1RPRA 1Q90D 3IC7A 1F4MA 2HJFC 3U0ZA 1R6NA 1MZFA 4J80A 5KA6A 5CA1A 1I08A 1XNQO 2WLLB 2R70A 1BHAA 1MABG 4B3TO 3E2EA 3LSUA 4UUJC 4R50A 5IYZB 4JAAA 2JRIA 5KHKA 1OCRC 2Q67A 3BA9A 1XREA 3JAKB 1F23A 2QM7A 3QVNA 1SQQH 2ZQMA 4NXMB 1N33B 2BTQB 3HKDA 2CGOA 2YUAA 1IBLB 4JYBA 4OPAA 1FYJA 1N36O 3CB2A 1PV0A 2UUBB 2F23A 2JJ2G 1BT8A 1AVMA 1IBKO 1VQ9V 4OPHA 2QTOA 4BIUA 4MW3A 3CCLV 4DR2B 5EK0A 2Q5ZA 3AG2B 1H2SB 3ETGA 4LF8B 3RYFA 4YJ2A 5KA5A 4MTXA 2LGWA 3QG5A 3CSXA 5J2UB 2WAMA 4DR5B 1Y74B 4I55B 1NS1A 4I55A 1IZ3A 4PI0A 1QLEC 4PA7A 1TA8A 2JJ1G 4P9OA 1ZSPA 3CXHF 2OIEA 2Y0IA 1LUVA 3RYHB 1WAZA 1OCCB 4FLTA 1IVSA 3HPLC 1H2MA 5GONA 5GONB 2IH3C 4IHJB 2CTQA 3G6BA 5KUKA 1VF7A 4JZ2A 3AG7A 2GTAA 1GKFA 2EIMB 4DYLA 3H1LH 1WLEA 1XNRO 4ZHQB 5CB4B 1OJHA 1XMQO 2GTSA 4CH3A 1PNMA 5EIBD 3SJCC 4E2LA 4DO2A 5LOVB 4CS3A 2D2CB 4K3AA 4LF6B 2OT5A 5IYCO 2A06H 1XNRB 3R66A 1AJQA 1JVMA 3CRAA 3OGCC 3D3QA 1ZWIC 3RBZA 1YJ9V 3K04A 3FD9A 5BXZA 1SZTA 2LQTA 4GX1A 2QWPB 3RFRA 4H44B 2OWOA 2XHBA 4DV7B 4L87A 2JVDA 4FLUA 4IGGA 1XMOB 3ZS8C 3OTFA 1K9MW 4H37A 4DR1B 1ZX3A
chains in the Genus database with same CATH topology
1YZBA 1XMOO 1XEQA 2UXDO 4DR7O 2AGAA 1HR0O 4YY3O 3OTOO 2ZM6O 4DR3O 1J5EO 1X59A 2UXBO 2VQEO 4JYAO 4LFAO 5LMNO 4DR6O 2UU9O 2N74A 2UUAO 4LFBO 1D2DA 1N34O 3F5TA 5BR8O 1N32O 4LF9O 1AB3A 1I94O 2HHHO 1NS1A 3O65A 1AILA 3M8AA 1N33O 4LF5O 4X62O 4JI2O 3SDLA 1HNWO 4X66O 4DV2O 2UUBO 4NXMO 2FKXA 5FLXN 4DV7O 1IBLO 4DR4O 2ZKOA 1FJGO 5IT9N 2UXCO 1G1XB 4A5UB 4DV3O 5BY1A 2VQFO 4YHHO 2DOSA 2Z0AA 3J81N 4JI1O 4NXNO 4GKJO 4KHPO 4DR5O 3RT3C 4DUYO 4JI6O 4LF7O 1F7YA 4B3RO 4DV1O 4LF8O 1R1BA 3T1YO 1A32A 4JI4O 1XNRO 4B3SO 3J80N 1XMQO 5H5NA 1HNZO 1HNXO 2E5LO 1XNQO 1KUQA 4K0KO 3T1HO 4DR2O 5LMUO 4B3TO 4DV6O 1IBMO 4DUZO 4LF6O 4DV0O 1DK1A 2JRIA 5LL6Y 2DJVA 4DV4O 3R66A 2F4VO 3JAMN 4AQYO 2LW7A 5A2QN 4JV5O 4B3MO 4LFCO 4X65O 1R6TA 4JI0O 1FKAO 4OPAA 4LF4O 1FYJA 1N36O 5BXZA 3J7AU 4JI3O 4X64O 4OX9O 4GKKO 1IBKO 4OPHA 5IWAO 4DR1O 4JI8O 2UUCO 4JI5O 4DV5O 4JI7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZB A;  1XMO O;  1XEQ A;  2UXD O;  4DR7 O;  2AGA A;  1HR0 O;  4YY3 O;  3OTO O;  2ZM6 O;  4DR3 O;  1J5E O;  1X59 A;  2UXB O;  2VQE O;  4JYA O;  4LFA O;  5LMN O;  4DR6 O;  2UU9 O;  2N74 A;  2UUA O;  4LFB O;  1D2D A;  1N34 O;  3F5T A;  5BR8 O;  1N32 O;  4LF9 O;  1AB3 A;  1I94 O;  2HHH O;  1NS1 A;  3O65 A;  1AIL A;  3M8A A;  1N33 O;  4LF5 O;  4X62 O;  4JI2 O;  3SDL A;  1HNW O;  4X66 O;  4DV2 O;  2UUB O;  4NXM O;  2FKX A;  5FLX N;  4DV7 O;  1IBL O;  4DR4 O;  2ZKO A;  1FJG O;  5IT9 N;  2UXC O;  1G1X B;  4A5U B;  4DV3 O;  5BY1 A;  2VQF O;  4YHH O;  2DOS A;  2Z0A A;  3J81 N;  4JI1 O;  4NXN O;  4GKJ O;  4KHP O;  4DR5 O;  3RT3 C;  4DUY O;  4JI6 O;  4LF7 O;  1F7Y A;  4B3R O;  4DV1 O;  4LF8 O;  1R1B A;  3T1Y O;  1A32 A;  4JI4 O;  1XNR O;  4B3S O;  3J80 N;  1XMQ O;  5H5N A;  1HNZ O;  1HNX O;  2E5L O;  1XNQ O;  1KUQ A;  4K0K O;  3T1H O;  4DR2 O;  5LMU O;  4B3T O;  4DV6 O;  1IBM O;  4DUZ O;  4LF6 O;  4DV0 O;  1DK1 A;  2JRI A;  5LL6 Y;  2DJV A;  4DV4 O;  3R66 A;  2F4V O;  3JAM N;  4AQY O;  2LW7 A;  5A2Q N;  4JV5 O;  4B3M O;  4LFC O;  4X65 O;  1R6T A;  4JI0 O;  1FKA O;  4OPA A;  4LF4 O;  1FYJ A;  1N36 O;  5BXZ A;  3J7A U;  4JI3 O;  4X64 O;  4OX9 O;  4GKK O;  1IBK O;  4OPH A;  5IWA O;  4DR1 O;  4JI8 O;  2UUC O;  4JI5 O;  4DV5 O;  4JI7 O; 
#chains in the Genus database with same CATH topology
 2GDS A;  1QLN A;  4YJ3 B;  3OTO O;  4PDL A;  3W7U A;  2LW1 A;  1NJI W;  3FAV B;  2CTW A;  1BZK A;  1QVG U;  1SA0 A;  4LFB O;  3BFR A;  4O4J B;  3QTC A;  3ZHS A;  2A79 B;  5JQG B;  1VQ4 V;  1M56 B;  1QLE B;  2ZIO A;  4MVM A;  2WLI B;  3OGI B;  2HHH B;  1Q81 W;  1VQO V;  3OT7 A;  2Q7G A;  2YDE A;  4FFB B;  2ADQ B;  4NTW A;  1HR0 B;  5IT9 N;  2OTL V;  2CK3 G;  3TCU A;  3L9D A;  2HVJ C;  2A9H A;  2G38 A;  2VQF O;  4UFZ A;  4B3M B;  3T1H B;  1S0V A;  4NXN O;  4D7T A;  3RT3 C;  2YXH A;  1XBL A;  1R1B A;  2UXD B;  3SJB C;  4B3S O;  4FVM A;  1I5Y A;  4R8C A;  2CGN A;  3NR7 A;  2EIL B;  2DMX A;  1DF4 A;  3ZRS A;  1XHX A;  2KKW A;  1KUQ A;  1S76 D;  5L3B A;  1U96 A;  3E86 A;  3CS5 A;  3ZRV A;  1Y67 A;  1WN7 A;  4QNH B;  4JTC B;  3G67 A;  3OM3 B;  4AQY O;  1VF6 A;  3ML0 A;  2JGD A;  1KQS U;  5A2Q N;  2V4D A;  1Q82 W;  4QPJ A;  3KCY A;  4J42 A;  1JJ2 U;  2ZE7 A;  1S3J A;  3ETD A;  2P7T C;  2HLD G;  3OAA G;  2PTM A;  3SYQ A;  3OW2 U;  5IJ0 B;  4IYH A;  5LMU B;  1IBK B;  4BIZ A;  2AXT Z;  4PDV A;  4DRX B;  2Q0O C;  1K4C C;  4QIW F;  1SES A;  2DYR C;  3N2K B;  3ABM B;  1S72 V;  3LNN A;  1SQX H;  2P4K A;  3X2Q B;  2WLL A;  4N21 A;  3OFN G;  4DR6 O;  2JS5 A;  3T4D A;  2ZDI C;  2B9Z A;  4R7C A;  1PP9 H;  2JEX A;  1W2B U;  4JI0 B;  3AG3 B;  3E89 A;  2H3O A;  4X65 B;  2LJ2 A;  2QSA A;  2RJZ A;  1SQB H;  3OR7 C;  4DV2 O;  1Y4M A;  2WLK A;  4F6E A;  5B1A C;  3CCR V;  4BWA A;  1ZTE A;  4HAM A;  1FJG O;  1PD3 A;  3LUT B;  2LO1 A;  4JI1 B;  3CYO A;  4PA4 A;  5EYP B;  1K34 A;  5H6Q A;  1EZJ A;  4QE9 A;  1Q6I A;  4J7K A;  4JAV A;  3RGB A;  3W7W A;  4DR5 O;  4MVR A;  4H0L B;  1US6 A;  2E75 B;  4KXR A;  2RCV A;  2AW9 A;  1AI4 A;  5B5E Z;  4PA3 A;  3KG2 A;  2MK3 A;  1KU9 A;  3HKC B;  4KL1 A;  3APO A;  2ZIN A;  5KMG B;  4Z2W A;  3SPH A;  4FLY A;  1Z2G A;  3AG3 C;  2EIK B;  4DXW A;  4LF6 O;  1ZAU A;  1K5S A;  3OUS A;  5B1O A;  4JAU A;  3HKB A;  2X7R B;  3JAM N;  2F66 C;  3TXQ A;  1FFT B;  1RP3 B;  2WWW A;  1SQG A;  1L1F A;  3CC4 V;  1YF2 A;  1R73 A;  3B8M A;  3TXS A;  1LNQ A;  2ZE8 A;  4ZOL B;  5BR8 B;  3CCM V;  3A0B Z;  1Z5W A;  2QWO B;  2E3C A;  2Q6A A;  4MSW C;  3W7S A;  1RSO B;  3ZRW B;  1BQ0 A;  2ITD C;  4JI8 O;  1COW G;  1GAX A;  3NXS A;  1JOY A;  4NB5 A;  1NR1 A;  3ZX6 A;  4X1I A;  3AK3 A;  2YEV A;  3H1K H;  2LP7 A;  2YIC A;  2M6Y A;  3IGA C;  4RQF A;  2UU9 O;  3Q4H B;  1LUW A;  1NH2 D;  3CRC A;  3L70 H;  4FM0 A;  2P6J A;  1N0J A;  3B4S A;  1IDS A;  2RNB A;  1YEW A;  1GK9 A;  1V55 B;  4YY3 B;  4LC1 A;  3SYO A;  1AI6 A;  2A3Q A;  2BSK A;  3BHP A;  1GN3 A;  1V54 C;  4DV1 B;  5FL7 G;  2ILM A;  4O2B B;  5HFM A;  2DYS C;  4YHH O;  2AZ0 A;  3ZHR A;  2RN9 A;  3E8H A;  3VBB A;  3VQY A;  4DV4 B;  2E74 B;  1EN4 A;  2WSS G;  4DV1 O;  3HKE B;  4JV5 B;  5CBF A;  5J2T B;  4E4E A;  3FAV A;  3BCC H;  4FLV A;  2FB5 A;  4UB8 Z;  1AR5 A;  3E83 A;  1V9P A;  1RM1 C;  4ZBM A;  4WFG A;  1TUB B;  1SQV H;  2EJ7 A;  1MNG A;  4PA9 A;  4GCZ A;  1I7F A;  2ZXW C;  4EKW A;  2W6I G;  2HVK C;  1S5L Z;  1OCC C;  4OX9 O;  5LA6 B;  2OTJ V;  3JAS A;  3C90 A;  1K7D A;  4ICG A;  3SPJ A;  2FL4 A;  2YIB A;  4X66 B;  4HYO A;  4YIP A;  5KMG A;  2JIZ G;  3TET A;  5F2V O;  1JA8 A;  1XOU A;  2AGA A;  3LDE A;  2EZP A;  3H1H H;  1J5E O;  5CB4 A;  1IBM B;  4U7O A;  1XNQ B;  4LFA O;  5D5P A;  2VWJ A;  3P32 A;  1PL0 A;  2EJR A;  1N32 O;  2PYJ A;  4MVS A;  1I94 O;  4BW5 A;  1VQP V;  2A0L A;  3T2M A;  3JAR A;  2ZXW B;  3HR0 A;  4BW9 A;  5K1P A;  1M9N A;  4UCS A;  1X4T A;  4NXM O;  1IBL O;  3IFX A;  5B3S B;  1I94 B;  4LCU C;  1JFF A;  3FB6 C;  3I55 V;  3P30 A;  1FPO A;  3RN4 A;  4DV5 B;  3SJQ C;  2Z0A A;  2GUZ B;  3AG4 B;  5EBM C;  2GBO A;  5JH7 A;  3JCZ A;  1MOF A;  3JD2 A;  5E1A C;  1NQT A;  5J2U A;  4LF8 O;  2XAS A;  3DXR A;  2XTA A;  4J41 A;  4FM2 A;  1M93 A;  2XAG A;  1HDJ A;  4FMT A;  1HNZ O;  2QDO A;  2P5O A;  1TAE A;  3CHX A;  3RYF B;  1QR9 A;  1CEZ A;  2UUC B;  4N23 A;  2OCC C;  3ASN C;  1GTO A;  4DR6 B;  4B08 A;  2Z3Y A;  1MG1 A;  3K03 A;  4JAS A;  4PV1 B;  5FPR A;  1K73 W;  1O9H A;  5LGT A;  4HNA A;  3UO3 A;  1EN6 A;  4X65 O;  1KKC A;  1O9G A;  3BAA A;  1OCO C;  1WPX A;  1E1R G;  2BTQ A;  2YSU B;  3L73 H;  4XDL A;  2P67 A;  3ASO B;  1Q6H A;  3GB7 C;  2IJJ A;  3K06 A;  4I5S A;  4LH7 A;  1JR9 A;  4I9W A;  2E76 B;  3WFV A;  4EFB A;  3SGI A;  2A7W A;  3ZMT A;  1H2G A;  5LHH A;  1JCH A;  4DR3 O;  1M4U A;  2F95 B;  1VQM V;  3EXA A;  1TGO A;  3B2E E;  3FFQ A;  1HP8 A;  1B06 A;  1JPX A;  3JD3 A;  2Y4T A;  5BR8 O;  5B1A B;  2BOC C;  2IBZ H;  5LGU A;  2PZS A;  4LF5 O;  1VQK V;  1HNW O;  3ZN0 A;  1GN2 A;  3W7T A;  2KSD A;  1K5Q A;  4FFB A;  2RMK B;  1IXB A;  3BAB A;  4DR4 O;  3CPW U;  1GN6 A;  1GM9 A;  1OCR B;  2Q0A A;  3E8B A;  5C8Y B;  5KX5 B;  3L72 H;  1PNL A;  5IYD O;  2VS0 A;  2QA4 V;  1KEC A;  5LHG A;  4XDJ A;  3ABU A;  1P4R A;  2IW5 A;  2X6C A;  3CP1 A;  4Q6G A;  1OHH G;  4K35 A;  4WBN B;  3RYI B;  4LWS A;  1EBO A;  4K0K B;  3J80 N;  4LFB B;  3JAT B;  1L0N H;  2EIN B;  3T1Y B;  2ODM A;  1KC8 W;  4R6Z A;  3N2K A;  4PEL A;  3C3T A;  5B1N A;  2QWQ B;  3ZHT A;  2HP8 A;  2OIG A;  3MD0 A;  1SQF A;  5LYJ A;  4J9Z B;  4ZKI A;  4HBN A;  1GM8 A;  3R65 A;  3STL C;  5IY5 B;  2EIL C;  2DQ0 A;  4DUY B;  2PY5 A;  2YI8 A;  3CJH A;  4OXS A;  4X20 A;  2IJI A;  5ITZ B;  3VQV A;  2QJ1 A;  4CC6 A;  3H9V A;  4LWS B;  4NXN B;  3B8N A;  5IDJ A;  1YTF B;  4O2A B;  4FM1 A;  4O2A A;  2R72 A;  4I9Q A;  2ZNI A;  2UXD O;  2F1M A;  3CC7 V;  2VWK A;  2Q8V A;  4NVP A;  5J2T A;  2Q73 A;  1Q3E A;  1YCI A;  5IJ9 B;  3HKE A;  1D5A A;  3K79 A;  3ZRX A;  1D2D A;  3L71 H;  3K57 A;  4LF9 O;  1AB3 A;  1XUQ A;  5JCO A;  4ASU G;  1WP8 A;  3ASO C;  5H9C A;  4OX9 B;  3ZCC A;  4ZI7 B;  3RYC B;  2ZR2 A;  5IE9 A;  1U97 A;  1AP6 A;  3HKB B;  1M56 C;  1I5X A;  3QF7 A;  4X66 O;  4PHZ A;  2FKX A;  2DQ3 A;  1TVK B;  2ZIM A;  1AJP A;  1K97 A;  2OCH A;  2L35 A;  1G1X B;  2WLI A;  4O4L A;  1Y74 A;  3FB8 C;  1NH2 B;  1MA1 A;  4X62 B;  3B40 A;  1N36 B;  1NT2 B;  4TT3 G;  2F43 G;  2CUG A;  1A32 A;  4X1I B;  1M5I A;  5L3C A;  3K9A A;  4YJ3 A;  4B3T B;  1BS3 A;  2IU0 A;  3L74 H;  1HNZ B;  5LMU O;  2XT9 A;  2EUL A;  1VQ7 V;  3OEE G;  3WG7 C;  1GRJ A;  3EFF K;  1SF9 A;  1W0J G;  3K59 A;  4CZZ A;  2ATK C;  1XIL A;  2UXN A;  2QM4 A;  3VQX A;  2XAQ A;  3FYI B;  4G27 B;  4GKK B;  3E22 A;  1VP7 A;  4TUY A;  5KAF Z;  4TSF G;  2EIM C;  1FXV A;  1VEW A;  5H6R A;  5LMN B;  4UVA A;  2UUC O;  1HNX B;  2XND G;  3FYE B;  1Q8I A;  4DV5 O;  4JI7 O;  4WFA V;  1UFI A;  1FAF A;  2Q68 A;  4U7N A;  2GV9 A;  1XEQ A;  4DR7 O;  2JS3 A;  1UJW B;  4U3F H;  4MTF A;  1OCZ C;  4I7Z B;  1KB9 F;  1H8H G;  1BL8 A;  2VQE O;  2N05 A;  5LMN O;  3G80 A;  2N74 A;  5EBL C;  3CRR A;  2UXB B;  4JI7 B;  4MW8 A;  1MSW D;  4NTX A;  5CN0 A;  4TV9 A;  3O65 A;  1DLB A;  3SYP A;  1S77 D;  2KB1 A;  4CH5 A;  1HNW B;  3FX7 A;  4P9P A;  3ZHU A;  5FLX N;  1L8D A;  1SER A;  4IL6 Z;  1CXZ B;  4B3R B;  2BE3 A;  4J7Z A;  3VOU A;  4A5U B;  5KHH A;  2CH7 A;  4DV3 O;  3ZMS A;  1NTZ H;  3CE2 A;  5BY1 A;  3T4Z A;  4CS2 A;  3CCJ V;  1AR4 A;  1Q86 W;  1NKD A;  5EBW C;  2ZD9 A;  2GHY A;  3ABK C;  1AR1 B;  3G71 V;  1H38 A;  5DN6 G;  1BGY H;  4B3R O;  1XMQ B;  1QHT A;  4H33 A;  4JPR A;  1FXK B;  2UU9 B;  3A8T A;  1PNK A;  4DR4 B;  1N4C A;  3RYC A;  4EFE A;  4DR3 B;  2DYS B;  3I5D A;  2PUS A;  5J9P C;  1NVP D;  1DK1 A;  5DM6 V;  5D5Q A;  4JI8 B;  4GLX A;  2X6A A;  2AHY A;  4X88 A;  3CXC U;  3B77 A;  4KFM A;  4DK0 A;  4O4J A;  5LP6 A;  4H13 B;  2UXX A;  2B1I A;  2BOB C;  4GUN A;  1EN5 A;  4RUE A;  1YJW V;  4MVZ A;  2P06 A;  4O4H B;  3CX5 F;  1YZB A;  4YY3 O;  1NU1 H;  3JYC A;  4XDK A;  3DSQ A;  4YIO A;  4O2B A;  3BRC A;  4GX5 A;  4PJ0 Z;  5LP6 C;  5CBH A;  3GWK C;  3RYH A;  1N34 B;  4I4T B;  2FML A;  3EHB B;  2V7Q G;  1FXK A;  1N0N A;  2KG7 B;  3T1C A;  2FYU H;  1K8A W;  2K1E A;  5E79 Z;  2HHH O;  2QKA A;  4B3S B;  1KKD A;  4U3J A;  4DK1 A;  2KG7 A;  1M57 B;  2CTP A;  4AIL C;  1LR1 A;  2ADP A;  1VQ6 V;  5KAI Z;  4FIP C;  3L75 H;  1K3E A;  5IWA B;  2C2A A;  3STZ C;  2XOK G;  4MT8 A;  1H8E G;  2NR5 A;  1F51 A;  4FLW A;  1BSM A;  4LF9 B;  4LF7 O;  3OMA B;  2QR4 A;  1SA0 B;  4F6R B;  2UUA B;  2BCC H;  3RW0 A;  4RUF A;  2R9A A;  3AK1 A;  1XL6 A;  1SZX A;  3BPZ A;  2XUM A;  3MHH C;  3SPC A;  3D36 C;  1I0H A;  4WFE A;  3ZMV A;  5H2F Z;  5LL6 Y;  3UKM A;  3GWO A;  2F4V B;  1H2K A;  3OE7 G;  4UB6 Z;  4MTG A;  5JCO C;  3JD4 A;  1R3J C;  2JEU A;  3AG1 C;  5LXT A;  4JI0 O;  4W4K A;  3F5W C;  2YIA A;  4GT1 A;  4XBF A;  4DV2 B;  2IM9 A;  4GKK O;  5LXT B;  2Y69 B;  5C93 A;  1MSD A;  1EFR G;  2WLN A;  1FJG B;  5KUM A;  2ETN A;  5B1B C;  1RFY A;  4YXW G;  1S5H C;  4TOI A;  1JFF B;  2W0F C;  1BE3 H;  4DV6 B;  5EYP A;  4JYA O;  4ZOL A;  3BEH A;  3LSS A;  3K5N A;  3JAR B;  3K3W A;  1B6Q A;  1OV9 A;  1Q7Y W;  1SQP H;  4MVO A;  1AIL A;  3OMN B;  2DWE C;  1YSC A;  3K5O A;  2XAF A;  3OMI B;  1G8M A;  1P7G A;  1XI1 A;  5IYZ A;  3CRQ A;  2DYR B;  3WB1 A;  3QNE A;  3DC6 A;  4TQD A;  4LNU B;  4NYK A;  4JGS A;  3RVZ A;  2UXC O;  4O4I B;  5CA1 B;  3PN1 A;  4QPK A;  1VQ5 V;  1Q43 A;  5EC2 C;  2DOS A;  3CCQ V;  1Y6X A;  4KHP O;  1VQ8 V;  4JI6 O;  3H1J H;  3ZIA G;  1JQ0 A;  1XQ8 A;  1WA8 A;  2R9I A;  1QCE A;  3M99 B;  3MDS A;  4X1K A;  4X64 B;  3JCU Z;  1TUB A;  4QJF B;  1GMG A;  4ZIB A;  2CTR A;  3ETE A;  2E5L O;  4DR7 B;  2Q9L A;  3P3P A;  1UPG A;  2QTS A;  5CBG A;  3ABL C;  4TV9 B;  3D36 A;  3ZED A;  2EIJ C;  1R3K C;  4O4H A;  4JTA B;  3DGE A;  1AI5 A;  2LW7 A;  1ZL8 B;  4JYY A;  5KHJ A;  4Z1M G;  2P22 C;  1Y76 A;  1QQC A;  2JK5 C;  1R6T A;  1GM7 A;  1SS3 A;  3ABK B;  5ITZ A;  1KBH A;  3THO A;  2RDC A;  2PGG A;  4JI3 O;  4Q20 A;  5CA3 A;  3N27 A;  4B7E A;  4PD4 F;  1CPY A;  4O4L B;  3CEI A;  5JJJ B;  1XMO O;  4JI3 B;  4LFC B;  2H8P C;  2Q7H A;  2K9P A;  5BZB A;  1QR8 A;  5K1X A;  1MZE A;  3QO5 A;  1N34 O;  5KLV H;  4MVU A;  2IU3 A;  3ASN B;  1PPJ H;  5L3G A;  4NR1 A;  4JI2 B;  1OCZ B;  4WFH A;  4J10 A;  4PDR A;  5JJE B;  3K5M A;  2XAJ A;  1YDX A;  2QGN A;  2QWR B;  4JTD B;  4DV7 O;  5EZY B;  3I56 V;  1DF5 A;  4P30 A;  1B3Q A;  3TGU H;  1YIJ V;  2CH7 B;  3FB7 C;  1JJO A;  3APQ A;  2YC0 A;  2W0X A;  1KP3 A;  3ABT A;  5EZY A;  3ZHQ A;  4B7K A;  3M7M X;  2QKC A;  3UT5 B;  2VRZ A;  3ZN1 A;  2N04 A;  3UCS C;  3ZRW A;  3JAL B;  3E8G A;  4CBC A;  4D7S A;  5FNV A;  1E79 G;  5AG2 A;  2YID A;  1TVK A;  5B3S C;  5A9G A;  3G4S V;  4D6T H;  3E8F A;  2Z5U A;  1MMM A;  1WJZ A;  3AK2 A;  4C7U A;  3H1I H;  4ZI7 A;  1KP2 A;  2WA3 A;  4PI2 A;  4WFB V;  4QE7 A;  1IBM O;  3FB5 C;  4DV0 O;  2ZE6 A;  2F4V O;  4CS4 A;  5LHI A;  4UCU A;  2QWN B;  4TWK A;  4B3M O;  4DW0 A;  4MVQ A;  1T5E A;  4EB6 A;  4TUY B;  5L3E A;  4AQY B;  3U11 A;  3SPI A;  1SET A;  4GKJ B;  3J7A U;  3TK1 A;  3OR6 C;  2ITC C;  1YIT V;  4TV8 A;  5KHG A;  3ZMZ A;  5IWA O;  2W6J G;  2Q7E A;  4JI4 B;  4LH6 A;  3D8C A;  3CJH B;  1DTO A;  1P7B A;  2EBO A;  1HWY A;  4X89 A;  3AG2 C;  4X1K B;  5JVD B;  2UUA O;  5LYJ B;  3WU2 Z;  3F5T A;  4RAI A;  5GW7 A;  2EIJ B;  3SYC A;  1THZ A;  3BY6 A;  3KZI Z;  1AP5 A;  4X62 O;  4L8J A;  2PI4 A;  4O4I A;  2EX3 A;  1VF5 B;  2X0L A;  3HKC A;  1GH6 A;  1VQL V;  3K0D A;  4LNU A;  3UO2 A;  2PI5 A;  2AZ2 A;  2HKO A;  4FLZ A;  1RPO A;  1BHB A;  2EIK C;  3N2G A;  1R3L C;  5IY5 C;  4JI1 O;  3UQ8 A;  3TJT A;  1XHZ A;  3D3I A;  4IHJ A;  5BMV A;  4J9Y B;  1P84 F;  3CCE V;  4WCE V;  2HFE C;  1W0K G;  2Y0P A;  1VAR A;  2QM8 A;  1NR7 A;  1ZLZ A;  5IJ9 A;  1WP7 A;  5LBQ A;  1NTM H;  2EIN C;  2X6B A;  1SRY A;  4DV6 O;  4JYA B;  4DUZ O;  5JJN B;  5GTH Z;  1YHQ V;  4IIJ B;  3RVY A;  3ZJZ A;  4BAY A;  4X1Y B;  4JI6 B;  2D3O W;  3LSQ A;  3CC2 V;  3JAS B;  5B66 Z;  2ARH A;  1YJN V;  3S3X A;  3JD0 A;  4LF5 B;  4X1Y A;  4IIJ A;  3HB3 B;  3P3N A;  2Y4U A;  4X64 O;  4YJ2 B;  4DRX A;  1GO3 F;  5KHI A;  2GUZ A;  2UXC B;  2NN4 A;  1NZ6 A;  4EEQ A;  4KP4 A;  2GSM B;  1FD9 A;  4RQE A;  3CCS V;  1M57 C;  2AHZ A;  2QE7 G;  4CC5 A;  2PF4 E;  1P49 A;  3JAL A;  3K58 A;  2OYQ A;  4F6R A;  2HEP A;  4BIO A;  4W4L A;  4JYC A;  4UCO A;  1VIB A;  1XL4 A;  1R3I C;  2RQ6 A;  2DWD C;  4JI2 O;  3F7Y C;  3JD1 A;  1YTF D;  5L3D A;  3AG1 B;  4LR3 A;  4P2Z A;  4DW1 A;  2Y48 A;  2LFS A;  2PYL A;  4OGQ B;  3DXR B;  5JH7 B;  2H94 A;  4U3J B;  2EZO A;  2NLJ C;  2B5U A;  4DUY O;  2F93 B;  1QNM A;  5LA6 A;  4I4T A;  1NVP B;  1EZV H;  4G2K A;  1K33 A;  3T1Y O;  5JVD A;  4F4L A;  4UCV A;  2JDI G;  1VF6 C;  5DED A;  2R9R B;  3T1H O;  1PM9 A;  3W7X A;  3S3W A;  1IXM A;  3CWB H;  2BTO A;  1IX9 A;  4TV8 B;  5LOV A;  4K8Z A;  1WB7 A;  3IAY A;  2YI9 A;  1GN4 A;  5LP6 B;  3OEH G;  4ABM A;  2ZDI A;  3G6E V;  2YIB D;  1TUE B;  4ZHQ A;  1KD1 W;  4LF4 O;  5LGN A;  1Q6U A;  5DEC A;  5FPO A;  5CMU A;  1AJN A;  3LDD A;  4HNA B;  1G6U A;  1NBM G;  1AI7 A;  2VQF B;  2YXL A;  4TQF A;  3SJA C;  5BMV B;  4IT5 A;  1QVF U;  4LF4 B;  3MAQ A;  4WF9 V;  4UV9 A;  1YVW A;  4FPP A;  2CAZ C;  2DE0 X;  1OCO B;  2HR3 A;  3JSN A;  4GZR B;  3UM7 A;  4J7J A;  4PDM A;  1KYO F;  1Q5O A;  4QGP A;  4X8A A;  1WA8 B;  2YS8 A;  3SR2 C;  2KQX A;  1HW7 A;  2LGQ A;  1J5E B;  1ARO P;  2P90 A;  4LFA B;  1CP9 A;  2OCC B;  1N33 O;  2O57 A;  2MW2 B;  1M1K W;  3QO8 A;  3E35 A;  3ZHV A;  3OD4 A;  4X9Q A;  2HJD A;  5JWP A;  1FFX A;  3K0G A;  4IYI A;  3ZMU A;  2UUB O;  4KUM A;  1K4D C;  1FXK C;  4DV0 B;  1G4Y B;  5C8Y A;  2M7W A;  4BR6 A;  5EIB C;  3SYA A;  4CH4 A;  1E1Q G;  4AI8 A;  1D5N A;  3FKS G;  1N8R W;  3AG4 C;  3J81 N;  3QO7 A;  4UV8 A;  4GKJ O;  1RSO A;  1WPB A;  3AEI A;  2CDY A;  3WB0 A;  4UXN A;  4FK5 C;  3CD6 V;  3MHS C;  1PKX A;  1RM1 B;  1J95 A;  1QBZ A;  3N2G B;  1N32 B;  2WPD G;  3DTU B;  1XDC A;  4JI4 O;  3HKD B;  2HG5 C;  3RWR D;  1S5J A;  4NTY A;  3JSL A;  3A2F A;  1HNX O;  2Q4P A;  3K08 A;  1F4N A;  3JAK A;  2L6L A;  4DR2 O;  3A0R A;  4GX2 A;  2VQE B;  1KMI Z;  2NNU A;  2DJV A;  1YI2 V;  1WB8 A;  2V1D A;  2ZCE A;  3Q4H A;  4MTO A;  4CH6 A;  3E22 B;  3KKY A;  5HFL A;  3GVM A;  1FS0 G;  1FKA O;  4JI5 B;  5IJ0 A;  3DC5 A;  1BQZ A;  2Q69 A;  1JX9 A;  3LDC A;  1ZUQ A;  4UCR A;  2ZM6 B;  1V54 B;  4GX0 A;  2ZE5 A;  1R6K A;  5EC1 C;  1BCC H;  2IJK A;  1VMG A;  3VQW A;  4FZ1 A;  4JI5 O;  2B1G A;  3CCU V;  4G28 B;  1SKV A;  4DUZ B;  1NTK H;  4Z1V A;  4RO2 A;  2ZM6 O;  1ORQ C;  1X59 A;  2UXB O;  2XAH A;  2E5L B;  3PJS K;  2WA4 A;  1EM1 A;  2ZT9 B;  4I0X A;  1BMF G;  3EVK A;  3IC9 A;  3WG7 B;  1IUR A;  1V55 C;  3ABL B;  4KHP B;  4JZG A;  4DV3 B;  1Y66 A;  4FFK A;  4PA6 A;  3K5L A;  3K9S A;  3LNM B;  4LBE C;  1QU7 A;  5TIS Z;  2ZR3 A;  3ICX A;  4AHC A;  1SC5 B;  2IH1 C;  3BA8 A;  5B1B B;  5CA0 B;  3CCV V;  1F7Y A;  4UVB A;  4I50 B;  3UT5 A;  2WLH A;  4RWU A;  3WB2 A;  4FZ0 A;  1H2N A;  1DGS A;  5IYB O;  1L0L H;  5H5N A;  1NI8 A;  1ROP A;  2JGD B;  1K92 A;  2YEV B;  4K0K O;  1Z5V A;  4YHH B;  1W59 A;  3A0H Z;  1Y76 B;  1FFX B;  3OUF A;  1ZL8 A;  3KCX A;  1VQN V;  3O9O A;  4DV4 O;  4JF3 A;  4X20 B;  1JMK C;  4JV5 O;  2QKS A;  4LFC O;  4EB6 B;  3F7V C;  1FXH A;  4LP8 A;  3H01 A;  4K8X A;  2ZNJ A;  1WNS A;  2DW4 A;  3ETQ A;  3B09 A;  1URF A;  2CE4 A;  2LFR A;  3JAW A;  3JAW B;  3SPG A;  4DR1 O;  2Y69 C;  3C3S A;  1YXB A;  1PL4 A;  4FLX A;  3OTO B;  3JAT A;  1HR0 O;  5L3F A;  4MS2 A;  3CME V;  4NKG B;  5FNV B;  3RYI A;  4GYC B;  2QEX V;  2IJH A;  3BVO A;  4FJC C;  4J11 A;  3CMA V;  1OZ0 A;  2WLM A;  4WBN A;  1ENV A;  3X2Q C;  5GTI Z;  5JQG A;  3M8A A;  3ZBH A;  3SDL A;  4I0X B;  2YXY A;  2WLJ A;  2JGU A;  3IJ4 A;  2P4V A;  5KX5 A;  1B04 A;  2FTK A;  3CRM A;  1H2L A;  3U10 A;  2ZKO A;  1M90 W;  4I50 A;  5CA0 A;  2BSK B;  4LF7 B;  4WFF A;  4UVC A;  2DN9 A;  3ABM C;  4UCT A;  4HZ3 A;  1RPR A;  1Q90 D;  3IC7 A;  1F4M A;  2HJF C;  3U0Z A;  1R6N A;  1MZF A;  4J80 A;  5KA6 A;  5CA1 A;  1I08 A;  1XNQ O;  2WLL B;  2R70 A;  1BHA A;  1MAB G;  4B3T O;  3E2E A;  3LSU A;  4UUJ C;  4R50 A;  5IYZ B;  4JAA A;  2JRI A;  5KHK A;  1OCR C;  2Q67 A;  3BA9 A;  1XRE A;  3JAK B;  1F23 A;  2QM7 A;  3QVN A;  1SQQ H;  2ZQM A;  4NXM B;  1N33 B;  2BTQ B;  3HKD A;  2CGO A;  2YUA A;  1IBL B;  4JYB A;  4OPA A;  1FYJ A;  1N36 O;  3CB2 A;  1PV0 A;  2UUB B;  2F23 A;  2JJ2 G;  1BT8 A;  1AVM A;  1IBK O;  1VQ9 V;  4OPH A;  2QTO A;  4BIU A;  4MW3 A;  3CCL V;  4DR2 B;  5EK0 A;  2Q5Z A;  3AG2 B;  1H2S B;  3ETG A;  4LF8 B;  3RYF A;  4YJ2 A;  5KA5 A;  4MTX A;  2LGW A;  3QG5 A;  3CSX A;  5J2U B;  2WAM A;  4DR5 B;  1Y74 B;  4I55 B;  1NS1 A;  4I55 A;  1IZ3 A;  4PI0 A;  1QLE C;  4PA7 A;  1TA8 A;  2JJ1 G;  4P9O A;  1ZSP A;  3CXH F;  2OIE A;  2Y0I A;  1LUV A;  3RYH B;  1WAZ A;  1OCC B;  4FLT A;  1IVS A;  3HPL C;  1H2M A;  5GON A;  5GON B;  2IH3 C;  4IHJ B;  2CTQ A;  3G6B A;  5KUK A;  1VF7 A;  4JZ2 A;  3AG7 A;  2GTA A;  1GKF A;  2EIM B;  4DYL A;  3H1L H;  1WLE A;  1XNR O;  4ZHQ B;  5CB4 B;  1OJH A;  1XMQ O;  2GTS A;  4CH3 A;  1PNM A;  5EIB D;  3SJC C;  4E2L A;  4DO2 A;  5LOV B;  4CS3 A;  2D2C B;  4K3A A;  4LF6 B;  2OT5 A;  5IYC O;  2A06 H;  1XNR B;  3R66 A;  1AJQ A;  1JVM A;  3CRA A;  3OGC C;  3D3Q A;  1ZWI C;  3RBZ A;  1YJ9 V;  3K04 A;  3FD9 A;  5BXZ A;  1SZT A;  2LQT A;  4GX1 A;  2QWP B;  3RFR A;  4H44 B;  2OWO A;  2XHB A;  4DV7 B;  4L87 A;  2JVD A;  4FLU A;  4IGG A;  1XMO B;  3ZS8 C;  3OTF A;  1K9M W;  4H37 A;  4DR1 B;  1ZX3 A; 
#chains in the Genus database with same CATH homology
 1YZB A;  1XMO O;  1XEQ A;  2UXD O;  4DR7 O;  2AGA A;  1HR0 O;  4YY3 O;  3OTO O;  2ZM6 O;  4DR3 O;  1J5E O;  1X59 A;  2UXB O;  2VQE O;  4JYA O;  4LFA O;  5LMN O;  4DR6 O;  2UU9 O;  2N74 A;  2UUA O;  4LFB O;  1D2D A;  1N34 O;  3F5T A;  5BR8 O;  1N32 O;  4LF9 O;  1AB3 A;  1I94 O;  2HHH O;  1NS1 A;  3O65 A;  1AIL A;  3M8A A;  1N33 O;  4LF5 O;  4X62 O;  4JI2 O;  3SDL A;  1HNW O;  4X66 O;  4DV2 O;  2UUB O;  4NXM O;  2FKX A;  5FLX N;  4DV7 O;  1IBL O;  4DR4 O;  2ZKO A;  1FJG O;  5IT9 N;  2UXC O;  1G1X B;  4A5U B;  4DV3 O;  5BY1 A;  2VQF O;  4YHH O;  2DOS A;  2Z0A A;  3J81 N;  4JI1 O;  4NXN O;  4GKJ O;  4KHP O;  4DR5 O;  3RT3 C;  4DUY O;  4JI6 O;  4LF7 O;  1F7Y A;  4B3R O;  4DV1 O;  4LF8 O;  1R1B A;  3T1Y O;  1A32 A;  4JI4 O;  1XNR O;  4B3S O;  3J80 N;  1XMQ O;  5H5N A;  1HNZ O;  1HNX O;  2E5L O;  1XNQ O;  1KUQ A;  4K0K O;  3T1H O;  4DR2 O;  5LMU O;  4B3T O;  4DV6 O;  1IBM O;  4DUZ O;  4LF6 O;  4DV0 O;  1DK1 A;  2JRI A;  5LL6 Y;  2DJV A;  4DV4 O;  3R66 A;  2F4V O;  3JAM N;  4AQY O;  2LW7 A;  5A2Q N;  4JV5 O;  4B3M O;  4LFC O;  4X65 O;  1R6T A;  4JI0 O;  1FKA O;  4OPA A;  4LF4 O;  1FYJ A;  1N36 O;  5BXZ A;  3J7A U;  4JI3 O;  4X64 O;  4OX9 O;  4GKK O;  1IBK O;  4OPH A;  5IWA O;  4DR1 O;  4JI8 O;  2UUC O;  4JI5 O;  4DV5 O;  4JI7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...