1QU7A

Four helical-bundle structure of the cytoplasmic domain of a serine chemotaxis receptor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
227
structure length
227
Chain Sequence
b'RTEQQAASLEQTAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEQSAAAAAALEEQASRLTEAVAVFRIQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
publication title Four-helical-bundle structure of the cytoplasmic domain of a serine chemotaxis receptor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 95
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00015 MCPsignal Methyl-accepting chemotaxis protein (MCP) signalling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.950 Mainly Alpha Orthogonal Bundle Helix Hairpins Methyl-accepting chemotaxis protein 1qu7A00
3G6BA 2CH7A 1QU7A 3ZX6A 3G67A 2CH7B
chains in the Genus database with same CATH superfamily
1G8MA 2QWRB 3H1LH 3TJTA 5IWAO 1KKDA 1VQPV 4I50A 4B7KA 3ASOB 2PGGA 4I0XA 4K8ZA 1WP7A 3AG4C 3N27A 1FXKC 3RVYA 2DYRB 3MHHC 2GV9A 3R65A 1K7DA 4JV5O 1CPYA 1H8EG 4R8CA 3TCUA 3K08A 3QO5A 1D5NA 1PKXA 5FNVA 4OX9B 4AQYB 1AR5A 3RT3C 4EKWA 4FFBA 3SYQA 2JDIG 2N05A 2B5UA 5LHHA 3FFQA 4K3AA 4EFBA 3OR6C 2HG5C 1RM1B 3SYCA 3E83A 5LMNO 1K8AW 4O4IB 5JCOC 3H1JH 5EIBC 1QU7A 2A06H 4JI7B 3RYIA 2QR4A 1W59A 3AG2C 1ZUQA 2Y69C 4PA3A 1XNRO 4X66B 3KCXA 5B1BB 3E8HA 2KSDA 4WBNB 4O2AA 1U96A 5IY5B 1IBMO 3J7AU 4LF5O 5KA6A 4BW9A 1AI7A 4TQDA 4JI1B 1R6TA 2UUBO 4DK0A 1WA8A 1H38A 4BIUA 4UCTA 5CA1A 3RVZA 1O9GA 2X6BA 5IJ9B 4C7UA 4FJCC 1HR0O 1L8DA 1XILA 3L71H 2PY5A 1Y74A 1AP5A 4GX0A 2VS0A 1SS3A 2L35A 2QA4V 3LUTB 1DGSA 3H1HH 1TVKA 4DV5B 3D3QA 3HKEB 4GX2A 2HVKC 2QTSA 2FMLA 1HNWB 4HAMA 4DR1B 3MAQA 4LNUA 3BPZA 2RDCA 4PDVA 3CCSV 1G6UA 4E4EA 2ZE7A 1R3LC 1E1QG 1Q43A 1SKVA 4RO2A 3RYCB 4O4LA 4CS2A 2UXBO 3ZRVA 2P22C 1X4TA 1BCCH 4JAUA 1XNQB 4X1IA 2Y0IA 2IU0A 4UXNA 3P32A 4JAAA 2E5LO 2MW2B 4FIPC 1Q86W 1VEWA 3K57A 4DV4B 5IJ0B 2YXYA 4U3JA 4NTYA 1KBHA 5KX5B 2R9RB 2XAHA 1BQ0A 2ITCC 4U7NA 1NKDA 4X1YA 1D2DA 4LWSA 3OR7C 2RNBA 1SA0B 3FAVA 3BRCA 1KP2A 1NVPB 5FPOA 3B8MA 1PNMA 1TUBA 3ZN0A 1E1RG 2VRZA 2X7RB 2Q67A 1KECA 2C2AA 1FJGO 2QKCA 3KZIZ 1K3EA 5F2VO 3HKDB 4DR3O 3X2QB 2VQEO 4DR7B 4R7CA 4UVAA 4TV9B 3W7UA 2UXCO 4NTWA 2KG7A 2WA3A 3HPLC 1GMGA 4DV6B 5LP6B 3AG1C 4DUZB 3E8BA 1Z2GA 3CRRA 2IBZH 3BA9A 2GUZB 4FM2A 2Q68A 1I94O 2CUGA 1EN5A 1S77D 2JGUA 3D36A 1SESA 3APQA 3RYHA 5A9GA 4O4HA 1YJWV 2D2CB 3H01A 2D3OW 1SQBH 4YY3O 4GKJB 2HJDA 1XHXA 3P3NA 5EK0A 4WFEA 2ZINA 3K0DA 3UKMA 1QQCA 2AHYA 2JK5C 2PUSA 3RN4A 1R6KA 2P7TC 2WLIB 2R70A 3ZX6A 1DTOA 1BHAA 2BCCH 3QTCA 1S76D 4YJ3A 1OJHA 4FLWA 2E75B 4PJ0Z 2CGNA 4D6TH 4DW0A 3OMNB 2X0LA 2UUAB 3AK2A 4J9YB 1N33B 3PJSK 2KKWA 4MVMA 1V55B 4L87A 5C8YA 5KHIA 4CBCA 1PPJH 2RCVA 2QM4A 2B9ZA 3JAMN 2XASA 3JD2A 2FKXA 2DW4A 5LMUB 3CPWU 1JJ2U 2N74A 2EZPA 4XDKA 4OPHA 3W7WA 1MG1A 1FXKB 1AP6A 2BTQB 4WFHA 2PZSA 1LUVA 1W0JG 2ZD9A 1US6A 3IFXA 4YIPA 1NJIW 1VQOV 2EULA 1ZAUA 4JF3A 4GKKO 2H3OA 3F5TA 5IJ9A 3QO7A 3C3SA 1IBKB 2UUCB 2EZOA 3G71V 4MVUA 5D5PA 2HLDG 3EHBB 4GT1A 4MVZA 3EXAA 3N2KB 3K5LA 3WB1A 1EN4A 3HKEA 4ZHQA 3AG2B 2Y69B 1P49A 1JQ0A 1YSCA 4IT5A 1L1FA 2ADQB 4LF6B 3ML0A 3PN1A 3P30A 3CJHB 5L3FA 3E2EA 4JI3B 1N32O 1VQ8V 1R1BA 1OCOC 1NTKH 4B3TO 4X20B 4WFBV 1I7FA 2ZXWC 2ZR2A 5BMVA 5EBMC 2E3CA 4LBEC 2X6CA 3K06A 2R9IA 3W7SA 5B3SC 3LNMB 2AW9A 1AB3A 1EBOA 1Q81W 1H8HG 2EINC 1KC8W 4RUEA 4W4LA 3OEEG 1F23A 1NR1A 1WJZA 1XOUA 5E1AC 4LH7A 5DN6G 4DV1O 3ABKC 2ZM6O 1S5LZ 1PL4A 3AG3C 4UCUA 1HNXO 2QWNB 4RQFA 2QWQB 1XQ8A 2ZE8A 1Y76A 4QE7A 1GM7A 3T1HO 2QWOB 4DR5O 4PELA 2F93B 3UT5B 3OMAB 5LP6A 4JYBA 1JOYA 3UO2A 3HR0A 4UCVA 4PA4A 1K4DC 2W6JG 2UXXA 1THZA 3CMEV 3AK1A 3JD4A 4UCOA 1B3QA 3CX5F 4DUYB 1OCRC 4YJ2A 2HFEC 3E8GA 1R3JC 2IH1C 2OCCC 3N2GB 5H5NA 1MZFA 1HWYA 5JH7B 4GX1A 4LP8A 4MT8A 3ZHVA 5LGNA 2DWEC 5ITZB 1BGYH 3F7VC 4DV3B 4DV2O 4K0KO 2WLLB 4JYYA 1FFXA 4UB8Z 1JPXA 4FZ0A 1YHQV 1L0NH 1P7GA 3ZMUA 1OV9A 2P4KA 2ETNA 4X65B 1RPOA 2P90A 5TISZ 2DYSC 4PV1B 3IC9A 1IVSA 1NTZH 3OTOB 3AG7A 2YUAA 3F5WC 1MOFA 2DE0X 3O65A 1XBLA 4MTFA 4ZKIA 3K5OA 1NR7A 3CXHF 2Q8VA 5KMGB 5EC1C 2JGDB 2HKOA 4ZI7B 5BR8B 4CH4A 4JI6B 1GH6A 1GRJA 1FAFA 2XOKG 3B77A 2XHBA 3FX7A 2W6IG 2LFSA 3QF7A 2QWPB 4CS4A 3OUSA 4H13B 2Q9LA 1YF2A 2UXDO 3A0HZ 4JV5B 4EB6A 2ATKC 5GONB 3ZHTA 3ETGA 1K4CC 3N2KA 3CHXA 3DTUB 1OHHG 2YIBA 1OZ0A 3TXQA 3S3XA 3KKYA 3FB5C 4QPKA 4GLXA 4FLVA 2YIAA 2UU9O 1SZXA 5CA0A 3D3IA 5IYZB 5LMNB 2CH7B 2Z0AA 2OT5A 5CA3A 1R3IC 3CJHA 1I5XA 1YXBA 1N36O 3ZEDA 1XNRB 2IJKA 3B40A 3ZBHA 4I4TB 3HKCB 1GKFA 1XUQA 5IE9A 2DQ0A 2ZNJA 5IDJA 1IBMB 1YCIA 4LR3A 4LF5B 4B08A 2Q6AA 4J42A 1P84F 1ZTEA 4P9OA 2UUBB 2LP7A 4LFAO 1K33A 5IT9N 3E22B 5LGTA 4UVBA 2OYQA 4IYHA 3T1YO 1S0VA 5IYCO 2L6LA 1SQVH 4L8JA 2LW1A 1HR0B 3K5NA 4CZZA 2JEXA 4MVQA 3QG5A 2Q69A 2YEVB 1PNLA 3CCVV 1K5SA 1P4RA 3ZS8C 2VQFO 2ODMA 4X88A 2N04A 1ZSPA 1Y67A 2A79B 1UJWB 4N21A 1EN6A 2JRIA 4JI5B 1KUQA 3J81N 5JVDA 4IHJA 1M90W 4I7ZB 1YVWA 4X9QA 2MK3A 1AI5A 1K9MW 4IIJB 3THOA 1JA8A 3VQWA 1BQZA 2JJ1G 2QDOA 2ZE5A 1OCOB 2UXBB 4IL6Z 3T4DA 1E79G 1S3JA 3UM7A 4JI8B 3CCLV 1PNKA 1VF5B 3KG2A 4MW8A 4NB5A 4CC5A 1F7YA 1D5AA 2ZXWB 3K0GA 5J2UB 4PHZA 2E5LB 3CCMV 1PD3A 3A8TA 2G38A 5B3SB 2YC0A 1RSOA 4JYAO 4TV8B 2BSKA 2EINB 3IAYA 3BHPA 4TOIA 1IX9A 4KHPO 3CC2V 3QNEA 3SPGA 4PD4F 3N2GA 3WFVA 4CC6A 1LNQA 5JH7A 5L3GA 2F95B 3DC6A 5B1AC 3ABKB 1FD9A 3JSNA 3AG3B 1EFRG 1Y6XA 2UXNA 4FLYA 4JZ2A 2P06A 1WPXA 1FPOA 2ADPA 3VQXA 1BSMA 4EFEA 5CB4A 2LJ2A 2IW5A 4GX5A 2KB1A 4MVOA 3BY6A 2VQEB 2WLLA 1TGOA 3LSSA 2UXCB 3CE2A 3G6BA 3CMAV 3JAWA 2EILC 1M9NA 5EYPB 4K35A 4JI7O 2LGQA 5LOVB 3OAAG 4ASUG 4RAIA 5EZYB 2BOCC 4NXNB 1OCRB 1EZJA 4B3MO 1M56C 1I94B 1WAZA 3AK3A 4X66O 3Q4HB 4YHHO 2OCCB 5KMGA 2GDSA 2JGDA 3CP1A 4I55B 4DV7B 1MNGA 4BIZA 1SC5B 5KHKA 1W0KG 4YY3B 1H2MA 3OGCC 3JALA 3ZHUA 5D5QA 1N8RW 5LA6B 3CRAA 2IJHA 4J7KA 5KAIZ 2LW7A 2P5OA 4WFGA 5JJEB 2XNDG 3ZRWA 2WLJA 2Q5ZA 3IGAC 1VF6A 1XL6A 2ZIOA 3W7XA 2YIDA 4PI2A 1YIJV 3U0ZA 2EIKC 2DJVA 2QSAA 4DXWA 4LFCB 1KU9A 1VQ6V 2HJFC 4A5UB 4DV5O 4J11A 3GVMA 3CB2A 1N0NA 3K03A 1AR1B 3JCZA 3CCEV 4DR1O 2CGOA 4JI2B 1VQNV 2PYLA 4AILC 2VWKA 5AG2A 4UCSA 2BOBC 2PTMA 1YJ9V 4LH6A 4F6EA 4HNAB 1Z5WA 4AHCA 1MSDA 3CEIA 1MA1A 4CH3A 3VQVA 3DXRB 1XNQO 2XAFA 2XAJA 1BT8A 5B66Z 4LF7B 4O4JA 2F23A 2HHHB 2OIEA 3FYEB 4DRXB 1BE3H 3LSUA 2V1DA 1GTOA 2CAZC 3JD1A 4I4TA 4X64B 3K9SA 1ZL8B 1JFFB 4OPAA 1GO3F 2W0XA 1NI8A 3BAAA 1H2SB 1SF9A 4TSFG 1W2BU 5FPRA 1ENVA 4WCEV 4GKKB 4GZRB 2ZR3A 2PYJA 4WF9V 4GCZA 3OTFA 1VP7A 2YSUB 4X1KB 1QBZA 1AR4A 2OWOA 5BY1A 3MDSA 4O4IA 1MSWD 4X89A 4FLXA 1NZ6A 2JVDA 3ZRSA 4FM1A 4LF4O 5CMUA 2QEXV 4F6RB 5LXTB 4TWKA 2NNUA 4BIOA 3AG4B 1MZEA 4WBNA 1GN6A 1RPRA 3H1IH 3RYFB 4O2BB 5H9CA 2PI4A 1N32B 2CDYA 4GUNA 3J80N 1VQ7V 3IJ4A 4MW3A 5JQGB 2DOSA 5GW7A 4DK1A 3D36C 4F4LA 1S72V 4B3TB 4X62O 1VMGA 3JATB 4DR4B 1SQPH 4YXWG 4J80A 1H2NA 1Y66A 2EJRA 2DQ3A 4PI0A 1R73A 2B1GA 3FB6C 1KYOF 1U97A 3JAKB 1YTFD 2PI5A 5DM6V 4DV1B 3LNNA 2ZM6B 1BMFG 4ICGA 1B6QA 2UUAO 1QNMA 3HKBB 1N33O 4TUYB 3RYCA 4QNHB 2CTRA 4BWAA 3T1HB 4B7EA 5LGUA 4DR5B 4UFZA 1FXVA 4P9PA 3TETA 3JARB 1R6NA 3SPIA 4ZIBA 4KP4A 5LYJB 4NXMB 3JASB 1Z5VA 2HEPA 5H6QA 5IJ0A 1J5EO 3ABLC 1XEQA 5KX5A 1WB7A 1TA8A 4I50B 4FZ1A 4EEQA 2NLJC 2YI9A 4FMTA 3ABMC 2RMKB 5B1AB 2ZNIA 1Q5OA 2DWDC 1SA0A 3ZRXA 2YXLA 3K3WA 3CC7V 1FKAO 2F43G 4DV0B 2UUCO 1V54C 1JR9A 4LC1A 3HKDA 5FNVB 3L74H 3NR7A 4K8XA 2CTPA 3IC7A 2ZIMA 5JJJB 2Y0PA 2F4VO 4H33A 4TV9A 4FFBB 5LHIA 2QM8A 4DV2B 3SDLA 2EILB 4K0KB 4JZGA 2CTQA 1M56B 1WN7A 1B04A 2GUZA 1URFA 4J10A 4QIWF 4B3SO 3RYIB 1IZ3A 5KHGA 2ZDIA 3ABTA 4N23A 1QR8A 5J2TB 4DR6B 4JI4B 1HW7A 2A7WA 4Q6GA 2IJIA 2P4VA 1IBLO 1YDXA 3GWOA 4NVPA 3I55V 2WLNA 5CA1B 2WPDG 4E2LA 1KMIZ 2IJJA 2WLIA 4JPRA 1JFFA 3VBBA 2GHYA 1L0LH 3T4ZA 1Y74B 2EIKB 1MABG 1VARA 2VWJA 2E74B 2JJ2G 1PV0A 3K58A 3AG1B 3L70H 1T5EA 2EIJC 4UV8A 1AJNA 4H44B 2LFRA 3CD6V 4MVSA 4JAVA 3ZMTA 2AZ0A 5J9PC 3CCJV 1SZTA 3BABA 2FYUH 4G28B 4LNUB 1XHZA 3AEIA 3L72H 3LDCA 2IU3A 1DLBA 4YIOA 1R3KC 2UU9B 1OCZC 4QPJA 4JGSA 1M57C 3K59A 4X1IB 5LP6C 5L3CA 4B3RO 5IWAB 2YS8A 2ZT9B 1FXKA 3CCQV 4MTGA 2BTQA 4U3JB 4DUYO 3C3TA 3RWRD 4XDJA 3RYFA 2OTLV 2EJ7A 4W4KA 4H0LB 1XL4A 3B09A 3HB3B 4WFFA 4LF8O 3ETEA 1GN3A 5LBQA 4X1YB 1JX9A 4LF9O 5JQGA 4LWSB 3APOA 3FAVB 4LFAB 1SRYA 1K34A 4Z2WA 5B1NA 4D7SA 3L9DA 3T1YB 1WLEA 3WU2Z 1XMOO 3SPCA 3CXCU 4DR2O 4X8AA 1G1XB 1AILA 1HNZO 1XDCA 2ZCEA 4CS3A 1QR9A 4DV3O 4CH5A 5JCOA 2XAGA 3L73H 3GB7C 1GN4A 4FM0A 2VQFB 3UQ8A 2ARHA 1SQQH 4X65O 2W0FC 3R66A 1XMQO 2YIBD 3LDDA 3OGIB 2YI8A 4KUMA 3OMIB 2XUMA 4HBNA 2Q4PA 4DW1A 3H1KH 4I5SA 1V55C 2WA4A 5LYJA 4X20A 3D8CA 3EVKA 4NTXA 4LCUC 3SJQC 3ZMSA 4LFBO 2O57A 5CBHA 1A32A 4JYAB 1CEZA 2Q0OC 4KHPB 1N34O 1XI1A 4P2ZA 1JVMA 5KHHA 1S5HC 1NBMG 4YJ3B 4JI0O 5A2QN 2F1MA 5K1XA 5EBWC 1Q3EA 3ZHQA 3E8FA 1EM1A 4PA7A 3L75H 3ZIAG 4DYLA 4IGGA 1FS0G 2V7QG 2EIMC 5LL6Y 2YXHA 3DGEA 3OFNG 1F51A 5H2FZ 2Q7HA 3UT5A 4QE9A 1DF5A 1PM9A 5C8YB 3SYAA 4AI8A 1M5IA 3ABLB 2A0LA 3P3PA 2WLKA 3WG7C 4BAYA 1H2GA 4PDRA 4XDLA 2Q7GA 4B3MB 1VQLV 4PDLA 3ABMB 1AROP 4YHHB 2CTWA 3M99B 5J2TA 5EC2C 3U10A 3CS5A 1YI2V 2AZ2A 2P67A 2Q73A 1Q8IA 3OM3B 2HVJC 2BTOA 5B5EZ 1YEWA 3F7YC 1V54B 1HDJA 2NN4A 1QHTA 5L3DA 5DECA 1IXMA 4ZBMA 1KB9F 3ETQA 3TGUH 4OX9O 3B2EE 5JJNB 4AQYO 1FJGB 2QKSA 3WB2A 5ITZA 1YTFB 5GTHZ 1KP3A 4DR3B 1X59A 1PL0A 3O9OA 2QKAA 5KUMA 1P7BA 5IYBO 1SQXH 3CYOA 3K5MA 2JS5A 3SJCC 2FTKA 4JI5O 3JD3A 1AJQA 3A2FA 1IXBA 4WFAV 4ZHQB 1ROPA 2WLHA 2WAMA 3WB0A 3RW0A 4U3FH 1YJNV 2A9HA 1YZBA 3OE7G 1NS1A 2DMXA 1NQTA 4OXSA 1M4UA 4JI8O 1RFYA 4ZI7A 2CE4A 1Q6HA 4JI1O 1B06A 3SJAC 4G2KA 3OT7A 3CRCA 3SJBC 5KHJA 3EFFK 3CSXA 4RWUA 3BVOA 1LR1A 5H6RA 1Q82W 2ITDC 2P6JA 2JIZG 3OD4A 5BMVB 4J7ZA 5KA5A 5FLXN 5CBGA 4JTCB 4QJFB 2GSMB 2QE7G 3CWBH 2K9PA 3UCSC 2EIJB 1SETA 4RQEA 3CRMA 3JSLA 4U7OA 3E89A 1VQMV 3SPJA 2DYSB 2AHZA 3JYCA 3MD0A 5GONA 1HNWO 2EBOA 5BXZA 4J41A 5L3EA 1RP3B 1DF4A 1BHBA 4XBFA 3ZMVA 1Y76B 1OCZB 4H37A 4FLZA 2ZE6A 1NH2D 2IM9A 4Z1MG 1M57B 3CRQA 3SYPA 2ILMA 2X6AA 5IYZA 3SPHA 2CH7A 1OCCC 1QLEC 4TT3G 3ASNC 4LF4B 4PA6A 1ZWIC 2M7WA 4Q20A 4DV4O 4NXNO 1Y4MA 3B8NA 3JCUZ 1GM8A 1FXHA 2RQ6A 1M93A 3HKCA 2OCHA 3M8AA 3GWKC 4YJ2B 4DV7O 4R50A 4HZ3A 4GYCB 2GTSA 3E22A 4I9WA 3QO8A 1CXZB 4X62B 4J7JA 5C93A 5BR8O 4MSWC 1GN2A 1TUEB 2YEVA 3ZCCA 2FL4A 3JD0A 4I9QA 4DR7O 3FYIB 2LGWA 3G80A 2QGNA 1K5QA 3TK1A 4KXRA 3ZN1A 1VQ5V 1FFXB 4LFCO 1TAEA 2M6YA 4DV6O 1ZLZA 1VF6C 4DUZO 3VOUA 1VQ4V 2GBOA 1JCHA 3A0RA 3I56V 3STLC 4JI2O 4IIJA 5BZBA 3RGBA 3QVNA 3W7TA 2EX3A 1SQGA 2KQXA 1XREA 2RJZA 5LHGA 1O9HA 4ABMA 4UUJC 4FK5C 4LF7O 1QLNA 3BA8A 3OW2U 4GKJO 5J2UA 4R6ZA 2HHHO 4J9ZB 2Y48A 1N0JA 1J5EB 1Q90D 1NT2B 3ETDA 2XT9A 4FLUA 2FB5A 4TV8A 4QGPA 2OIGA 1AI4A 1H2KA 4X64O 2WSSG 5CN0A 1K73W 2Z5UA 3H9VA 1GK9A 2R72A 3ASOC 1JMKC 3NXSA 1VQ9V 1SQFA 3K9AA 3ZJZA 5B1OA 1BL8A 2DYRC 1WPBA 3STZC 1VIBA 3E35A 4EB6B 2EIMB 1GM9A 3SYOA 2QTOA 1HNXB 1KKCA 4KL1A 1EZVH 2R9AA 4KFMA 4ZOLB 1K92A 2F4VB 1AVMA 3WG7B 3RBZA 3LSQA 4UV9A 1H2LA 5FL7G 2Z3YA 5EYPA 1IDSA 5CA0B 1Q6IA 5LOVA 5LMUO 5KLVH 1K97A 1RM1C 5EZYA 1KQSU 1ORQC 4B3SB 2IH3C 4NR1A 3Q4HA 1CP9A 1UFIA 3LDEA 4RUFA 4I55A 1HP8A 5HFLA 5DEDA 1J95A 1Q6UA 4I0XB 5B1BC 3K79A 3BCCH 1IBLB 2JS3A 3TXSA 5IY5C 4BR6A 1MMMA 5LA6A 2Y4TA 4DR4O 1VF7A 1AJPA 4UVCA 1IBKO 2HR3A 2YICA 1VQKV 2E76B 3ZMZA 1ZX3A 3T1CA 1NVPD 3G67A 3S3WA 2YDEA 5CBFA 2HP8A 3CC4V 4P30A 1F4MA 3MHSC 3DC5A 3ICXA 1QVGU 3CCUV 5JVDB 4IHJB 4LF6O 3ZHSA 4CH6A 2XTAA 3I5DA 3ZHRA 1WNSA 2OTJV 1QVFU 4HNAA 1I0HA 2DN9A 1COWG 4FPPA 4JI3O 2Q0AA 2XAQA 3DXRA 4O2AB 1KD1W 4OGQB 3G4SV 1JJOA 3OEHG 4JASA 4NXMO 1G4YB 1GAXA 4DRXA 1WA8B 4B3RB 3SGIA 1I5YA 4HYOA 4FFKA 1RSOB 2AXTZ 1YITV 1BS3A 3RFRA 2QM7A 3BFRA 1ZL8A 2BSKB 4DO2A 3OUFA 4LF8B 4LF9B 2RN9A 3B4SA 1NU1H 2V4DA 2UXDB 1SERA 2H8PC 4DV0O 3G6EV 3DSQA 3FD9A 1IURA 3M7MX 3FB7C 5KAFZ 2ZQMA 2K1EA 1TVKB 2BE3A 1LUWA 3C90A 5JWPA 1XMOB 4TQFA 3K04A 4DR2B 4X1KA 1HNZB 5CB4B 5K1PA 4BW5A 1FYJA 1PP9H 4PDMA 1OCCB 4MS2A 5E79Z 3SR2C 1QLEB 3ASNB 3A0BZ 4FVMA 4O4LB 3X2QC 1WB8A 1BZKA 5L3BA 4PA9A 2NR5A 1NTMH 3JAWB 4F6RA 1XMQB 5LXTA 2A3QA 4IYIA 2ZKOA 1S5JA 5IYDO 1Q7YW 2LQTA 5GTIZ 4NYKA 3T2MA 1N36B 4JYCA 2Y4UA 1UPGA 4O2BA 4DR6O 4JI4O 2ZDIC 4MVRA 1FFTB 4JTDB 3VQYA 4Z1VA 3FKSG 3KCYA 3JATA 5HFMA 3JALB 4NKGB 2F66C 1TUBB 4LFBB 3BEHA 1V9PA 4MTOA 4UCRA 3ZRWB 5EBLC 2WWWA 1N34B 4UB6Z 5KUKA 2H94A 2AGAA 2B1IA 4G27B 1F4NA 3FB8C 3JAKA 2KG7B 3E86A 4JI0B 2JEUA 2GTAA 1NH2B 3U11A 2WLMA 3HKBA 2LO1A 3OTOO 5EIBD 3CCRV 4TUYA 4ZOLA 2CK3G 4D7TA 4JTAB 1I08A 4MTXA 1N4CA 2Q7EA 3ABUA 1DK1A 4FLTA 2QJ1A 1M1KW 3JARA 1QCEA 1WP8A 3RYHB 4O4HB 3JASA 2PF4E 1AI6A 3UO3A 4O4JB 4JI6O
chains in the Genus database with same CATH topology
3G6BA 2CH7A 1QU7A 3ZX6A 3G67A 2CH7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6B A;  2CH7 A;  1QU7 A;  3ZX6 A;  3G67 A;  2CH7 B; 
#chains in the Genus database with same CATH topology
 1G8M A;  2QWR B;  3H1L H;  3TJT A;  5IWA O;  1KKD A;  1VQP V;  4I50 A;  4B7K A;  3ASO B;  2PGG A;  4I0X A;  4K8Z A;  1WP7 A;  3AG4 C;  3N27 A;  1FXK C;  3RVY A;  2DYR B;  3MHH C;  2GV9 A;  3R65 A;  1K7D A;  4JV5 O;  1CPY A;  1H8E G;  4R8C A;  3TCU A;  3K08 A;  3QO5 A;  1D5N A;  1PKX A;  5FNV A;  4OX9 B;  4AQY B;  1AR5 A;  3RT3 C;  4EKW A;  4FFB A;  3SYQ A;  2JDI G;  2N05 A;  2B5U A;  5LHH A;  3FFQ A;  4K3A A;  4EFB A;  3OR6 C;  2HG5 C;  1RM1 B;  3SYC A;  3E83 A;  5LMN O;  1K8A W;  4O4I B;  5JCO C;  3H1J H;  5EIB C;  1QU7 A;  2A06 H;  4JI7 B;  3RYI A;  2QR4 A;  1W59 A;  3AG2 C;  1ZUQ A;  2Y69 C;  4PA3 A;  1XNR O;  4X66 B;  3KCX A;  5B1B B;  3E8H A;  2KSD A;  4WBN B;  4O2A A;  1U96 A;  5IY5 B;  1IBM O;  3J7A U;  4LF5 O;  5KA6 A;  4BW9 A;  1AI7 A;  4TQD A;  4JI1 B;  1R6T A;  2UUB O;  4DK0 A;  1WA8 A;  1H38 A;  4BIU A;  4UCT A;  5CA1 A;  3RVZ A;  1O9G A;  2X6B A;  5IJ9 B;  4C7U A;  4FJC C;  1HR0 O;  1L8D A;  1XIL A;  3L71 H;  2PY5 A;  1Y74 A;  1AP5 A;  4GX0 A;  2VS0 A;  1SS3 A;  2L35 A;  2QA4 V;  3LUT B;  1DGS A;  3H1H H;  1TVK A;  4DV5 B;  3D3Q A;  3HKE B;  4GX2 A;  2HVK C;  2QTS A;  2FML A;  1HNW B;  4HAM A;  4DR1 B;  3MAQ A;  4LNU A;  3BPZ A;  2RDC A;  4PDV A;  3CCS V;  1G6U A;  4E4E A;  2ZE7 A;  1R3L C;  1E1Q G;  1Q43 A;  1SKV A;  4RO2 A;  3RYC B;  4O4L A;  4CS2 A;  2UXB O;  3ZRV A;  2P22 C;  1X4T A;  1BCC H;  4JAU A;  1XNQ B;  4X1I A;  2Y0I A;  2IU0 A;  4UXN A;  3P32 A;  4JAA A;  2E5L O;  2MW2 B;  4FIP C;  1Q86 W;  1VEW A;  3K57 A;  4DV4 B;  5IJ0 B;  2YXY A;  4U3J A;  4NTY A;  1KBH A;  5KX5 B;  2R9R B;  2XAH A;  1BQ0 A;  2ITC C;  4U7N A;  1NKD A;  4X1Y A;  1D2D A;  4LWS A;  3OR7 C;  2RNB A;  1SA0 B;  3FAV A;  3BRC A;  1KP2 A;  1NVP B;  5FPO A;  3B8M A;  1PNM A;  1TUB A;  3ZN0 A;  1E1R G;  2VRZ A;  2X7R B;  2Q67 A;  1KEC A;  2C2A A;  1FJG O;  2QKC A;  3KZI Z;  1K3E A;  5F2V O;  3HKD B;  4DR3 O;  3X2Q B;  2VQE O;  4DR7 B;  4R7C A;  4UVA A;  4TV9 B;  3W7U A;  2UXC O;  4NTW A;  2KG7 A;  2WA3 A;  3HPL C;  1GMG A;  4DV6 B;  5LP6 B;  3AG1 C;  4DUZ B;  3E8B A;  1Z2G A;  3CRR A;  2IBZ H;  3BA9 A;  2GUZ B;  4FM2 A;  2Q68 A;  1I94 O;  2CUG A;  1EN5 A;  1S77 D;  2JGU A;  3D36 A;  1SES A;  3APQ A;  3RYH A;  5A9G A;  4O4H A;  1YJW V;  2D2C B;  3H01 A;  2D3O W;  1SQB H;  4YY3 O;  4GKJ B;  2HJD A;  1XHX A;  3P3N A;  5EK0 A;  4WFE A;  2ZIN A;  3K0D A;  3UKM A;  1QQC A;  2AHY A;  2JK5 C;  2PUS A;  3RN4 A;  1R6K A;  2P7T C;  2WLI B;  2R70 A;  3ZX6 A;  1DTO A;  1BHA A;  2BCC H;  3QTC A;  1S76 D;  4YJ3 A;  1OJH A;  4FLW A;  2E75 B;  4PJ0 Z;  2CGN A;  4D6T H;  4DW0 A;  3OMN B;  2X0L A;  2UUA B;  3AK2 A;  4J9Y B;  1N33 B;  3PJS K;  2KKW A;  4MVM A;  1V55 B;  4L87 A;  5C8Y A;  5KHI A;  4CBC A;  1PPJ H;  2RCV A;  2QM4 A;  2B9Z A;  3JAM N;  2XAS A;  3JD2 A;  2FKX A;  2DW4 A;  5LMU B;  3CPW U;  1JJ2 U;  2N74 A;  2EZP A;  4XDK A;  4OPH A;  3W7W A;  1MG1 A;  1FXK B;  1AP6 A;  2BTQ B;  4WFH A;  2PZS A;  1LUV A;  1W0J G;  2ZD9 A;  1US6 A;  3IFX A;  4YIP A;  1NJI W;  1VQO V;  2EUL A;  1ZAU A;  4JF3 A;  4GKK O;  2H3O A;  3F5T A;  5IJ9 A;  3QO7 A;  3C3S A;  1IBK B;  2UUC B;  2EZO A;  3G71 V;  4MVU A;  5D5P A;  2HLD G;  3EHB B;  4GT1 A;  4MVZ A;  3EXA A;  3N2K B;  3K5L A;  3WB1 A;  1EN4 A;  3HKE A;  4ZHQ A;  3AG2 B;  2Y69 B;  1P49 A;  1JQ0 A;  1YSC A;  4IT5 A;  1L1F A;  2ADQ B;  4LF6 B;  3ML0 A;  3PN1 A;  3P30 A;  3CJH B;  5L3F A;  3E2E A;  4JI3 B;  1N32 O;  1VQ8 V;  1R1B A;  1OCO C;  1NTK H;  4B3T O;  4X20 B;  4WFB V;  1I7F A;  2ZXW C;  2ZR2 A;  5BMV A;  5EBM C;  2E3C A;  4LBE C;  2X6C A;  3K06 A;  2R9I A;  3W7S A;  5B3S C;  3LNM B;  2AW9 A;  1AB3 A;  1EBO A;  1Q81 W;  1H8H G;  2EIN C;  1KC8 W;  4RUE A;  4W4L A;  3OEE G;  1F23 A;  1NR1 A;  1WJZ A;  1XOU A;  5E1A C;  4LH7 A;  5DN6 G;  4DV1 O;  3ABK C;  2ZM6 O;  1S5L Z;  1PL4 A;  3AG3 C;  4UCU A;  1HNX O;  2QWN B;  4RQF A;  2QWQ B;  1XQ8 A;  2ZE8 A;  1Y76 A;  4QE7 A;  1GM7 A;  3T1H O;  2QWO B;  4DR5 O;  4PEL A;  2F93 B;  3UT5 B;  3OMA B;  5LP6 A;  4JYB A;  1JOY A;  3UO2 A;  3HR0 A;  4UCV A;  4PA4 A;  1K4D C;  2W6J G;  2UXX A;  1THZ A;  3CME V;  3AK1 A;  3JD4 A;  4UCO A;  1B3Q A;  3CX5 F;  4DUY B;  1OCR C;  4YJ2 A;  2HFE C;  3E8G A;  1R3J C;  2IH1 C;  2OCC C;  3N2G B;  5H5N A;  1MZF A;  1HWY A;  5JH7 B;  4GX1 A;  4LP8 A;  4MT8 A;  3ZHV A;  5LGN A;  2DWE C;  5ITZ B;  1BGY H;  3F7V C;  4DV3 B;  4DV2 O;  4K0K O;  2WLL B;  4JYY A;  1FFX A;  4UB8 Z;  1JPX A;  4FZ0 A;  1YHQ V;  1L0N H;  1P7G A;  3ZMU A;  1OV9 A;  2P4K A;  2ETN A;  4X65 B;  1RPO A;  2P90 A;  5TIS Z;  2DYS C;  4PV1 B;  3IC9 A;  1IVS A;  1NTZ H;  3OTO B;  3AG7 A;  2YUA A;  3F5W C;  1MOF A;  2DE0 X;  3O65 A;  1XBL A;  4MTF A;  4ZKI A;  3K5O A;  1NR7 A;  3CXH F;  2Q8V A;  5KMG B;  5EC1 C;  2JGD B;  2HKO A;  4ZI7 B;  5BR8 B;  4CH4 A;  4JI6 B;  1GH6 A;  1GRJ A;  1FAF A;  2XOK G;  3B77 A;  2XHB A;  3FX7 A;  2W6I G;  2LFS A;  3QF7 A;  2QWP B;  4CS4 A;  3OUS A;  4H13 B;  2Q9L A;  1YF2 A;  2UXD O;  3A0H Z;  4JV5 B;  4EB6 A;  2ATK C;  5GON B;  3ZHT A;  3ETG A;  1K4C C;  3N2K A;  3CHX A;  3DTU B;  1OHH G;  2YIB A;  1OZ0 A;  3TXQ A;  3S3X A;  3KKY A;  3FB5 C;  4QPK A;  4GLX A;  4FLV A;  2YIA A;  2UU9 O;  1SZX A;  5CA0 A;  3D3I A;  5IYZ B;  5LMN B;  2CH7 B;  2Z0A A;  2OT5 A;  5CA3 A;  1R3I C;  3CJH A;  1I5X A;  1YXB A;  1N36 O;  3ZED A;  1XNR B;  2IJK A;  3B40 A;  3ZBH A;  4I4T B;  3HKC B;  1GKF A;  1XUQ A;  5IE9 A;  2DQ0 A;  2ZNJ A;  5IDJ A;  1IBM B;  1YCI A;  4LR3 A;  4LF5 B;  4B08 A;  2Q6A A;  4J42 A;  1P84 F;  1ZTE A;  4P9O A;  2UUB B;  2LP7 A;  4LFA O;  1K33 A;  5IT9 N;  3E22 B;  5LGT A;  4UVB A;  2OYQ A;  4IYH A;  3T1Y O;  1S0V A;  5IYC O;  2L6L A;  1SQV H;  4L8J A;  2LW1 A;  1HR0 B;  3K5N A;  4CZZ A;  2JEX A;  4MVQ A;  3QG5 A;  2Q69 A;  2YEV B;  1PNL A;  3CCV V;  1K5S A;  1P4R A;  3ZS8 C;  2VQF O;  2ODM A;  4X88 A;  2N04 A;  1ZSP A;  1Y67 A;  2A79 B;  1UJW B;  4N21 A;  1EN6 A;  2JRI A;  4JI5 B;  1KUQ A;  3J81 N;  5JVD A;  4IHJ A;  1M90 W;  4I7Z B;  1YVW A;  4X9Q A;  2MK3 A;  1AI5 A;  1K9M W;  4IIJ B;  3THO A;  1JA8 A;  3VQW A;  1BQZ A;  2JJ1 G;  2QDO A;  2ZE5 A;  1OCO B;  2UXB B;  4IL6 Z;  3T4D A;  1E79 G;  1S3J A;  3UM7 A;  4JI8 B;  3CCL V;  1PNK A;  1VF5 B;  3KG2 A;  4MW8 A;  4NB5 A;  4CC5 A;  1F7Y A;  1D5A A;  2ZXW B;  3K0G A;  5J2U B;  4PHZ A;  2E5L B;  3CCM V;  1PD3 A;  3A8T A;  2G38 A;  5B3S B;  2YC0 A;  1RSO A;  4JYA O;  4TV8 B;  2BSK A;  2EIN B;  3IAY A;  3BHP A;  4TOI A;  1IX9 A;  4KHP O;  3CC2 V;  3QNE A;  3SPG A;  4PD4 F;  3N2G A;  3WFV A;  4CC6 A;  1LNQ A;  5JH7 A;  5L3G A;  2F95 B;  3DC6 A;  5B1A C;  3ABK B;  1FD9 A;  3JSN A;  3AG3 B;  1EFR G;  1Y6X A;  2UXN A;  4FLY A;  4JZ2 A;  2P06 A;  1WPX A;  1FPO A;  2ADP A;  3VQX A;  1BSM A;  4EFE A;  5CB4 A;  2LJ2 A;  2IW5 A;  4GX5 A;  2KB1 A;  4MVO A;  3BY6 A;  2VQE B;  2WLL A;  1TGO A;  3LSS A;  2UXC B;  3CE2 A;  3G6B A;  3CMA V;  3JAW A;  2EIL C;  1M9N A;  5EYP B;  4K35 A;  4JI7 O;  2LGQ A;  5LOV B;  3OAA G;  4ASU G;  4RAI A;  5EZY B;  2BOC C;  4NXN B;  1OCR B;  1EZJ A;  4B3M O;  1M56 C;  1I94 B;  1WAZ A;  3AK3 A;  4X66 O;  3Q4H B;  4YHH O;  2OCC B;  5KMG A;  2GDS A;  2JGD A;  3CP1 A;  4I55 B;  4DV7 B;  1MNG A;  4BIZ A;  1SC5 B;  5KHK A;  1W0K G;  4YY3 B;  1H2M A;  3OGC C;  3JAL A;  3ZHU A;  5D5Q A;  1N8R W;  5LA6 B;  3CRA A;  2IJH A;  4J7K A;  5KAI Z;  2LW7 A;  2P5O A;  4WFG A;  5JJE B;  2XND G;  3ZRW A;  2WLJ A;  2Q5Z A;  3IGA C;  1VF6 A;  1XL6 A;  2ZIO A;  3W7X A;  2YID A;  4PI2 A;  1YIJ V;  3U0Z A;  2EIK C;  2DJV A;  2QSA A;  4DXW A;  4LFC B;  1KU9 A;  1VQ6 V;  2HJF C;  4A5U B;  4DV5 O;  4J11 A;  3GVM A;  3CB2 A;  1N0N A;  3K03 A;  1AR1 B;  3JCZ A;  3CCE V;  4DR1 O;  2CGO A;  4JI2 B;  1VQN V;  2PYL A;  4AIL C;  2VWK A;  5AG2 A;  4UCS A;  2BOB C;  2PTM A;  1YJ9 V;  4LH6 A;  4F6E A;  4HNA B;  1Z5W A;  4AHC A;  1MSD A;  3CEI A;  1MA1 A;  4CH3 A;  3VQV A;  3DXR B;  1XNQ O;  2XAF A;  2XAJ A;  1BT8 A;  5B66 Z;  4LF7 B;  4O4J A;  2F23 A;  2HHH B;  2OIE A;  3FYE B;  4DRX B;  1BE3 H;  3LSU A;  2V1D A;  1GTO A;  2CAZ C;  3JD1 A;  4I4T A;  4X64 B;  3K9S A;  1ZL8 B;  1JFF B;  4OPA A;  1GO3 F;  2W0X A;  1NI8 A;  3BAA A;  1H2S B;  1SF9 A;  4TSF G;  1W2B U;  5FPR A;  1ENV A;  4WCE V;  4GKK B;  4GZR B;  2ZR3 A;  2PYJ A;  4WF9 V;  4GCZ A;  3OTF A;  1VP7 A;  2YSU B;  4X1K B;  1QBZ A;  1AR4 A;  2OWO A;  5BY1 A;  3MDS A;  4O4I A;  1MSW D;  4X89 A;  4FLX A;  1NZ6 A;  2JVD A;  3ZRS A;  4FM1 A;  4LF4 O;  5CMU A;  2QEX V;  4F6R B;  5LXT B;  4TWK A;  2NNU A;  4BIO A;  3AG4 B;  1MZE A;  4WBN A;  1GN6 A;  1RPR A;  3H1I H;  3RYF B;  4O2B B;  5H9C A;  2PI4 A;  1N32 B;  2CDY A;  4GUN A;  3J80 N;  1VQ7 V;  3IJ4 A;  4MW3 A;  5JQG B;  2DOS A;  5GW7 A;  4DK1 A;  3D36 C;  4F4L A;  1S72 V;  4B3T B;  4X62 O;  1VMG A;  3JAT B;  4DR4 B;  1SQP H;  4YXW G;  4J80 A;  1H2N A;  1Y66 A;  2EJR A;  2DQ3 A;  4PI0 A;  1R73 A;  2B1G A;  3FB6 C;  1KYO F;  1U97 A;  3JAK B;  1YTF D;  2PI5 A;  5DM6 V;  4DV1 B;  3LNN A;  2ZM6 B;  1BMF G;  4ICG A;  1B6Q A;  2UUA O;  1QNM A;  3HKB B;  1N33 O;  4TUY B;  3RYC A;  4QNH B;  2CTR A;  4BWA A;  3T1H B;  4B7E A;  5LGU A;  4DR5 B;  4UFZ A;  1FXV A;  4P9P A;  3TET A;  3JAR B;  1R6N A;  3SPI A;  4ZIB A;  4KP4 A;  5LYJ B;  4NXM B;  3JAS B;  1Z5V A;  2HEP A;  5H6Q A;  5IJ0 A;  1J5E O;  3ABL C;  1XEQ A;  5KX5 A;  1WB7 A;  1TA8 A;  4I50 B;  4FZ1 A;  4EEQ A;  2NLJ C;  2YI9 A;  4FMT A;  3ABM C;  2RMK B;  5B1A B;  2ZNI A;  1Q5O A;  2DWD C;  1SA0 A;  3ZRX A;  2YXL A;  3K3W A;  3CC7 V;  1FKA O;  2F43 G;  4DV0 B;  2UUC O;  1V54 C;  1JR9 A;  4LC1 A;  3HKD A;  5FNV B;  3L74 H;  3NR7 A;  4K8X A;  2CTP A;  3IC7 A;  2ZIM A;  5JJJ B;  2Y0P A;  2F4V O;  4H33 A;  4TV9 A;  4FFB B;  5LHI A;  2QM8 A;  4DV2 B;  3SDL A;  2EIL B;  4K0K B;  4JZG A;  2CTQ A;  1M56 B;  1WN7 A;  1B04 A;  2GUZ A;  1URF A;  4J10 A;  4QIW F;  4B3S O;  3RYI B;  1IZ3 A;  5KHG A;  2ZDI A;  3ABT A;  4N23 A;  1QR8 A;  5J2T B;  4DR6 B;  4JI4 B;  1HW7 A;  2A7W A;  4Q6G A;  2IJI A;  2P4V A;  1IBL O;  1YDX A;  3GWO A;  4NVP A;  3I55 V;  2WLN A;  5CA1 B;  2WPD G;  4E2L A;  1KMI Z;  2IJJ A;  2WLI A;  4JPR A;  1JFF A;  3VBB A;  2GHY A;  1L0L H;  3T4Z A;  1Y74 B;  2EIK B;  1MAB G;  1VAR A;  2VWJ A;  2E74 B;  2JJ2 G;  1PV0 A;  3K58 A;  3AG1 B;  3L70 H;  1T5E A;  2EIJ C;  4UV8 A;  1AJN A;  4H44 B;  2LFR A;  3CD6 V;  4MVS A;  4JAV A;  3ZMT A;  2AZ0 A;  5J9P C;  3CCJ V;  1SZT A;  3BAB A;  2FYU H;  4G28 B;  4LNU B;  1XHZ A;  3AEI A;  3L72 H;  3LDC A;  2IU3 A;  1DLB A;  4YIO A;  1R3K C;  2UU9 B;  1OCZ C;  4QPJ A;  4JGS A;  1M57 C;  3K59 A;  4X1I B;  5LP6 C;  5L3C A;  4B3R O;  5IWA B;  2YS8 A;  2ZT9 B;  1FXK A;  3CCQ V;  4MTG A;  2BTQ A;  4U3J B;  4DUY O;  3C3T A;  3RWR D;  4XDJ A;  3RYF A;  2OTL V;  2EJ7 A;  4W4K A;  4H0L B;  1XL4 A;  3B09 A;  3HB3 B;  4WFF A;  4LF8 O;  3ETE A;  1GN3 A;  5LBQ A;  4X1Y B;  1JX9 A;  4LF9 O;  5JQG A;  4LWS B;  3APO A;  3FAV B;  4LFA B;  1SRY A;  1K34 A;  4Z2W A;  5B1N A;  4D7S A;  3L9D A;  3T1Y B;  1WLE A;  3WU2 Z;  1XMO O;  3SPC A;  3CXC U;  4DR2 O;  4X8A A;  1G1X B;  1AIL A;  1HNZ O;  1XDC A;  2ZCE A;  4CS3 A;  1QR9 A;  4DV3 O;  4CH5 A;  5JCO A;  2XAG A;  3L73 H;  3GB7 C;  1GN4 A;  4FM0 A;  2VQF B;  3UQ8 A;  2ARH A;  1SQQ H;  4X65 O;  2W0F C;  3R66 A;  1XMQ O;  2YIB D;  3LDD A;  3OGI B;  2YI8 A;  4KUM A;  3OMI B;  2XUM A;  4HBN A;  2Q4P A;  4DW1 A;  3H1K H;  4I5S A;  1V55 C;  2WA4 A;  5LYJ A;  4X20 A;  3D8C A;  3EVK A;  4NTX A;  4LCU C;  3SJQ C;  3ZMS A;  4LFB O;  2O57 A;  5CBH A;  1A32 A;  4JYA B;  1CEZ A;  2Q0O C;  4KHP B;  1N34 O;  1XI1 A;  4P2Z A;  1JVM A;  5KHH A;  1S5H C;  1NBM G;  4YJ3 B;  4JI0 O;  5A2Q N;  2F1M A;  5K1X A;  5EBW C;  1Q3E A;  3ZHQ A;  3E8F A;  1EM1 A;  4PA7 A;  3L75 H;  3ZIA G;  4DYL A;  4IGG A;  1FS0 G;  2V7Q G;  2EIM C;  5LL6 Y;  2YXH A;  3DGE A;  3OFN G;  1F51 A;  5H2F Z;  2Q7H A;  3UT5 A;  4QE9 A;  1DF5 A;  1PM9 A;  5C8Y B;  3SYA A;  4AI8 A;  1M5I A;  3ABL B;  2A0L A;  3P3P A;  2WLK A;  3WG7 C;  4BAY A;  1H2G A;  4PDR A;  4XDL A;  2Q7G A;  4B3M B;  1VQL V;  4PDL A;  3ABM B;  1ARO P;  4YHH B;  2CTW A;  3M99 B;  5J2T A;  5EC2 C;  3U10 A;  3CS5 A;  1YI2 V;  2AZ2 A;  2P67 A;  2Q73 A;  1Q8I A;  3OM3 B;  2HVJ C;  2BTO A;  5B5E Z;  1YEW A;  3F7Y C;  1V54 B;  1HDJ A;  2NN4 A;  1QHT A;  5L3D A;  5DEC A;  1IXM A;  4ZBM A;  1KB9 F;  3ETQ A;  3TGU H;  4OX9 O;  3B2E E;  5JJN B;  4AQY O;  1FJG B;  2QKS A;  3WB2 A;  5ITZ A;  1YTF B;  5GTH Z;  1KP3 A;  4DR3 B;  1X59 A;  1PL0 A;  3O9O A;  2QKA A;  5KUM A;  1P7B A;  5IYB O;  1SQX H;  3CYO A;  3K5M A;  2JS5 A;  3SJC C;  2FTK A;  4JI5 O;  3JD3 A;  1AJQ A;  3A2F A;  1IXB A;  4WFA V;  4ZHQ B;  1ROP A;  2WLH A;  2WAM A;  3WB0 A;  3RW0 A;  4U3F H;  1YJN V;  2A9H A;  1YZB A;  3OE7 G;  1NS1 A;  2DMX A;  1NQT A;  4OXS A;  1M4U A;  4JI8 O;  1RFY A;  4ZI7 A;  2CE4 A;  1Q6H A;  4JI1 O;  1B06 A;  3SJA C;  4G2K A;  3OT7 A;  3CRC A;  3SJB C;  5KHJ A;  3EFF K;  3CSX A;  4RWU A;  3BVO A;  1LR1 A;  5H6R A;  1Q82 W;  2ITD C;  2P6J A;  2JIZ G;  3OD4 A;  5BMV B;  4J7Z A;  5KA5 A;  5FLX N;  5CBG A;  4JTC B;  4QJF B;  2GSM B;  2QE7 G;  3CWB H;  2K9P A;  3UCS C;  2EIJ B;  1SET A;  4RQE A;  3CRM A;  3JSL A;  4U7O A;  3E89 A;  1VQM V;  3SPJ A;  2DYS B;  2AHZ A;  3JYC A;  3MD0 A;  5GON A;  1HNW O;  2EBO A;  5BXZ A;  4J41 A;  5L3E A;  1RP3 B;  1DF4 A;  1BHB A;  4XBF A;  3ZMV A;  1Y76 B;  1OCZ B;  4H37 A;  4FLZ A;  2ZE6 A;  1NH2 D;  2IM9 A;  4Z1M G;  1M57 B;  3CRQ A;  3SYP A;  2ILM A;  2X6A A;  5IYZ A;  3SPH A;  2CH7 A;  1OCC C;  1QLE C;  4TT3 G;  3ASN C;  4LF4 B;  4PA6 A;  1ZWI C;  2M7W A;  4Q20 A;  4DV4 O;  4NXN O;  1Y4M A;  3B8N A;  3JCU Z;  1GM8 A;  1FXH A;  2RQ6 A;  1M93 A;  3HKC A;  2OCH A;  3M8A A;  3GWK C;  4YJ2 B;  4DV7 O;  4R50 A;  4HZ3 A;  4GYC B;  2GTS A;  3E22 A;  4I9W A;  3QO8 A;  1CXZ B;  4X62 B;  4J7J A;  5C93 A;  5BR8 O;  4MSW C;  1GN2 A;  1TUE B;  2YEV A;  3ZCC A;  2FL4 A;  3JD0 A;  4I9Q A;  4DR7 O;  3FYI B;  2LGW A;  3G80 A;  2QGN A;  1K5Q A;  3TK1 A;  4KXR A;  3ZN1 A;  1VQ5 V;  1FFX B;  4LFC O;  1TAE A;  2M6Y A;  4DV6 O;  1ZLZ A;  1VF6 C;  4DUZ O;  3VOU A;  1VQ4 V;  2GBO A;  1JCH A;  3A0R A;  3I56 V;  3STL C;  4JI2 O;  4IIJ A;  5BZB A;  3RGB A;  3QVN A;  3W7T A;  2EX3 A;  1SQG A;  2KQX A;  1XRE A;  2RJZ A;  5LHG A;  1O9H A;  4ABM A;  4UUJ C;  4FK5 C;  4LF7 O;  1QLN A;  3BA8 A;  3OW2 U;  4GKJ O;  5J2U A;  4R6Z A;  2HHH O;  4J9Z B;  2Y48 A;  1N0J A;  1J5E B;  1Q90 D;  1NT2 B;  3ETD A;  2XT9 A;  4FLU A;  2FB5 A;  4TV8 A;  4QGP A;  2OIG A;  1AI4 A;  1H2K A;  4X64 O;  2WSS G;  5CN0 A;  1K73 W;  2Z5U A;  3H9V A;  1GK9 A;  2R72 A;  3ASO C;  1JMK C;  3NXS A;  1VQ9 V;  1SQF A;  3K9A A;  3ZJZ A;  5B1O A;  1BL8 A;  2DYR C;  1WPB A;  3STZ C;  1VIB A;  3E35 A;  4EB6 B;  2EIM B;  1GM9 A;  3SYO A;  2QTO A;  1HNX B;  1KKC A;  4KL1 A;  1EZV H;  2R9A A;  4KFM A;  4ZOL B;  1K92 A;  2F4V B;  1AVM A;  3WG7 B;  3RBZ A;  3LSQ A;  4UV9 A;  1H2L A;  5FL7 G;  2Z3Y A;  5EYP A;  1IDS A;  5CA0 B;  1Q6I A;  5LOV A;  5LMU O;  5KLV H;  1K97 A;  1RM1 C;  5EZY A;  1KQS U;  1ORQ C;  4B3S B;  2IH3 C;  4NR1 A;  3Q4H A;  1CP9 A;  1UFI A;  3LDE A;  4RUF A;  4I55 A;  1HP8 A;  5HFL A;  5DED A;  1J95 A;  1Q6U A;  4I0X B;  5B1B C;  3K79 A;  3BCC H;  1IBL B;  2JS3 A;  3TXS A;  5IY5 C;  4BR6 A;  1MMM A;  5LA6 A;  2Y4T A;  4DR4 O;  1VF7 A;  1AJP A;  4UVC A;  1IBK O;  2HR3 A;  2YIC A;  1VQK V;  2E76 B;  3ZMZ A;  1ZX3 A;  3T1C A;  1NVP D;  3G67 A;  3S3W A;  2YDE A;  5CBF A;  2HP8 A;  3CC4 V;  4P30 A;  1F4M A;  3MHS C;  3DC5 A;  3ICX A;  1QVG U;  3CCU V;  5JVD B;  4IHJ B;  4LF6 O;  3ZHS A;  4CH6 A;  2XTA A;  3I5D A;  3ZHR A;  1WNS A;  2OTJ V;  1QVF U;  4HNA A;  1I0H A;  2DN9 A;  1COW G;  4FPP A;  4JI3 O;  2Q0A A;  2XAQ A;  3DXR A;  4O2A B;  1KD1 W;  4OGQ B;  3G4S V;  1JJO A;  3OEH G;  4JAS A;  4NXM O;  1G4Y B;  1GAX A;  4DRX A;  1WA8 B;  4B3R B;  3SGI A;  1I5Y A;  4HYO A;  4FFK A;  1RSO B;  2AXT Z;  1YIT V;  1BS3 A;  3RFR A;  2QM7 A;  3BFR A;  1ZL8 A;  2BSK B;  4DO2 A;  3OUF A;  4LF8 B;  4LF9 B;  2RN9 A;  3B4S A;  1NU1 H;  2V4D A;  2UXD B;  1SER A;  2H8P C;  4DV0 O;  3G6E V;  3DSQ A;  3FD9 A;  1IUR A;  3M7M X;  3FB7 C;  5KAF Z;  2ZQM A;  2K1E A;  1TVK B;  2BE3 A;  1LUW A;  3C90 A;  5JWP A;  1XMO B;  4TQF A;  3K04 A;  4DR2 B;  4X1K A;  1HNZ B;  5CB4 B;  5K1P A;  4BW5 A;  1FYJ A;  1PP9 H;  4PDM A;  1OCC B;  4MS2 A;  5E79 Z;  3SR2 C;  1QLE B;  3ASN B;  3A0B Z;  4FVM A;  4O4L B;  3X2Q C;  1WB8 A;  1BZK A;  5L3B A;  4PA9 A;  2NR5 A;  1NTM H;  3JAW B;  4F6R A;  1XMQ B;  5LXT A;  2A3Q A;  4IYI A;  2ZKO A;  1S5J A;  5IYD O;  1Q7Y W;  2LQT A;  5GTI Z;  4NYK A;  3T2M A;  1N36 B;  4JYC A;  2Y4U A;  1UPG A;  4O2B A;  4DR6 O;  4JI4 O;  2ZDI C;  4MVR A;  1FFT B;  4JTD B;  3VQY A;  4Z1V A;  3FKS G;  3KCY A;  3JAT A;  5HFM A;  3JAL B;  4NKG B;  2F66 C;  1TUB B;  4LFB B;  3BEH A;  1V9P A;  4MTO A;  4UCR A;  3ZRW B;  5EBL C;  2WWW A;  1N34 B;  4UB6 Z;  5KUK A;  2H94 A;  2AGA A;  2B1I A;  4G27 B;  1F4N A;  3FB8 C;  3JAK A;  2KG7 B;  3E86 A;  4JI0 B;  2JEU A;  2GTA A;  1NH2 B;  3U11 A;  2WLM A;  3HKB A;  2LO1 A;  3OTO O;  5EIB D;  3CCR V;  4TUY A;  4ZOL A;  2CK3 G;  4D7T A;  4JTA B;  1I08 A;  4MTX A;  1N4C A;  2Q7E A;  3ABU A;  1DK1 A;  4FLT A;  2QJ1 A;  1M1K W;  3JAR A;  1QCE A;  1WP8 A;  3RYH B;  4O4H B;  3JAS A;  2PF4 E;  1AI6 A;  3UO3 A;  4O4J B;  4JI6 O; 
#chains in the Genus database with same CATH homology
 3G6B A;  2CH7 A;  1QU7 A;  3ZX6 A;  3G67 A;  2CH7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...