1QU7A

Four helical-bundle structure of the cytoplasmic domain of a serine chemotaxis receptor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
227
structure length
227
Chain Sequence
RTEQQAASLEQTAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEQSAAAAAALEEQASRLTEAVAVFRIQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
publication title Four-helical-bundle structure of the cytoplasmic domain of a serine chemotaxis receptor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 95
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00015 MCPsignal Methyl-accepting chemotaxis protein (MCP) signalling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.950 Mainly Alpha Orthogonal Bundle Helix Hairpins Methyl-accepting chemotaxis protein 1qu7A00
3ZX6A 2CH7A 3G67A 3G6BA 2CH7B 1QU7A
chains in the Genus database with same CATH superfamily
1QR8A 3W7SA 2P90A 1GN4A 5EBLC 3DC5A 1GH6A 3JYCA 1AI4A 2UUBO 1Q81W 2AZ2A 1NTZH 2EINC 1EZVH 5E1AC 4Z1MG 3CCVV 4LR3A 3ZHQA 1VIBA 2R72A 2NNUA 1YITV 3FAVB 1WP8A 3P3NA 4X62O 2XASA 3JD3A 2A9HA 3GVMA 4DO2A 5LXTB 5LGUA 3I55V 3BY6A 4E2LA 3K58A 3ZN0A 4I55B 4MTFA 4TOIA 5EZYB 1SESA 3OEHG 4KP4A 4B3RO 3CCEV 3SYPA 5A9GA 1IBLB 2ZINA 3KZIZ 3ABTA 4D7TA 4BIOA 5IYCO 1M93A 4ZOLA 3JATB 4FFBB 2BSKB 1ZLZA 2JK5C 4WFGA 3BA8A 4ASUG 4MTGA 4DR5B 2LGWA 2JS5A 4EB6B 2XT9A 1MNGA 3H9VA 4DUYB 2WPDG 1OCRB 2LW7A 1OV9A 1SQPH 1MSWD 4PD4F 3HR0A 2BTQB 2WLNA 4CH3A 3FAVA 4IT5A 4X8AA 3JD4A 1SF9A 3ZHUA 3ETGA 5LXTA 4DYLA 3F7YC 4F4LA 4ZHQB 1RM1B 2UXBO 2A06H 2NN4A 1OCOC 4I55A 1WNSA 1COWG 5EZYA 4FLZA 3ASNB 5GONB 4K8XA 4LF9B 3OMIB 3STZC 3T1HB 3OD4A 2AHYA 3ZRVA 1SZXA 2W6JG 4JI4B 4BW5A 3B09A 3E35A 4JI6B 3SYAA 3D3IA 1X4TA 3JATA 4FFBA 1M5IA 2BSKA 4CH6A 4P9OA 4BW9A 1M57B 4OX9B 5ITZB 1H8EG 4EB6A 1SKVA 3L72H 3EVKA 4QPKA 2ZM6O 2PUSA 1YZBA 4L8JA 5LOVB 2YS8A 2BTQA 1AJQA 2LP7A 5JCOC 3U11A 5IYBO 2DYRB 4PDMA 4IHJB 3QNEA 2CGOA 4DR1B 3ZN1A 1Y66A 4ZHQA 2EIJC 4MVQA 4U7OA 4RAIA 2Q73A 2H94A 3ABMC 5LP6C 1NH2B 1L0LH 3FB5C 5GONA 4GT1A 1XMQB 4LP8A 2EILB 5EC1C 1GK9A 5GW7A 1F7YA 4FM0A 4LF7B 1TA8A 2E76B 3CRMA 1IBKB 3JAKB 2IJJA 5DECA 1NR1A 5LA6B 5IWAO 3E22B 4B3SO 5B1NA 5B1AB 4DR4O 1JPXA 2Q9LA 1VP7A 3ABKB 5ITZA 2YXYA 1XNQB 3BA9A 4UCVA 3L75H 3STLC 2GUZA 4BR6A 1BE3H 5LOVA 2ADQB 2HLDG 2R9IA 1Z2GA 4CC6A 3AK2A 2E3CA 2N04A 4IHJA 2X0LA 3F5WC 4NTYA 4RUEA 1NVPB 4HAMA 4FMTA 3G71V 4DV1O 3ZRSA 1HR0B 1I5XA 4B3MB 4CS2A 3ASOB 1HP8A 4JPRA 2XUMA 5IYZB 1ZL8B 1MOFA 1V54B 1XI1A 4UCRA 3VBBA 1YI2V 4J9YB 4GYCB 2IM9A 3JAKA 1VF5B 2EIMB 4NTXA 5LA6A 3CRAA 1F51A 3E22A 3ZRXA 2R9RB 1L1FA 1R73A 5JJJB 1QR9A 2YXLA 5KHHA 4LF4O 1YXBA 1OHHG 3GWKC 1B6QA 3K04A 1Y74B 4K0KB 5KHJA 3BAAA 2GTSA 1SQBH 1N8RW 4DR6B 2OCHA 1HNXO 4LCUC 1QU7A 1JFFB 2ZT9B 1VQNV 4YIPA 2KB1A 3SPJA 4DUZO 2G38A 3O9OA 4ICGA 3CXCU 4JI8O 3B2EE 4DV6B 2QWNB 1QLEC 2UUCB 2HKOA 2ZE5A 5JJNB 3CRRA 3TXQA 1QNMA 1SQFA 1J5EB 4IYIA 5IYZA 4LFAO 1ZL8A 3ML0A 5KA5A 2UUBB 5B3SC 1J95A 1K8AW 4W4LA 4JAAA 2ZE6A 3CMEV 1R3IC 3OW2U 1AP6A 3RYIB 3ZHRA 4K35A 3HPLC 3CCLV 1D5AA 1GM7A 4KHPB 1S5HC 1K92A 1JVMA 4UXNA 2QJ1A 1Y74A 4ZI7B 3A8TA 1MA1A 2OCCC 2L35A 4MT8A 4PA7A 2RCVA 4DV3B 3K5OA 4TV9B 2XAGA 4JZ2A 1JFFA 1BMFG 1GN2A 1XREA 1UFIA 3VOUA 3LSQA 3OR7C 4LF8O 3CCSV 3PJSK 3OGCC 2A79B 2DWDC 3CCRV 3O65A 1TAEA 4FPPA 5KUMA 1YTFD 2YIBA 2YEVB 2UXDO 1ZUQA 5GTHZ 2HHHB 4WFHA 2ZXWC 1PD3A 3T1YB 3AG2C 4L87A 4O4IB 4E4EA 3RYIA 1P49A 2B5UA 2IH3C 5KAFZ 3LSSA 3RT3C 4EEQA 3G67A 4ABMA 4YY3O 4D7SA 4ZI7A 2ZDIA 4YJ3B 1EN5A 4LH7A 1XNRO 2UXBB 4FFKA 1GRJA 2BTOA 4TV9A 2X6CA 3H01A 4QNHB 1XILA 1PNKA 1BSMA 4MW3A 3LSUA 1NT2B 1HWYA 3CC2V 3WFVA 5DM6V 2K9PA 1S77D 4EKWA 1AP5A 1G8MA 3WU2Z 2A0LA 3AG1B 2OIGA 3A2FA 2EIKB 3OAAG 5IE9A 1FXKC 1N0NA 3GB7C 2YEVA 4JI5B 1DF5A 2CTQA 1R3KC 2C2AA 4UFZA 5EC2C 4UV9A 5HFLA 1GO3F 2ZM6B 2WLHA 4O2AB 4O4IA 2QR4A 3RFRA 4NTWA 1JX9A 3TETA 2KQXA 5H2FZ 5DN6G 3ZMSA 1BCCH 4J7JA 4YJ3A 3SDLA 1KUQA 2ZD9A 1YJNV 3SPHA 3B77A 1P4RA 5B1BB 4DV2B 2YI9A 1H2LA 1K3EA 3AG4C 5IT9N 3OTOO 1YF2A 3MHSC 3N2KB 4WFAV 5EIBC 1L8DA 2ETNA 1QBZA 4J7ZA 2YIBD 3L70H 4JV5B 1H2MA 1Q7YW 4DV7O 2CDYA 2GBOA 4GX1A 4B3SB 2QWPB 1JA8A 4DR4B 4UUJC 5HFMA 5FPOA 3HB3B 4I0XB 1FD9A 3H1LH 5F2VO 4O2AA 2QTSA 1XBLA 3TGUH 4JAUA 5K1PA 2YC0A 2EJ7A 4C7UA 1DK1A 1AJPA 1FFXB 3OEEG 1HNZB 4FLYA 1SZTA 2Z5UA 5LGTA 2Z0AA 1UJWB 1NU1H 1VF6A 1Y4MA 3SR2C 2JGUA 5CBHA 3HKEB 1M56C 2HFEC 5LGNA 1JQ0A 2Y69C 4J11A 4DV1B 1Q6HA 3FYEB 1BZKA 2VWKA 4JYAO 2KSDA 1GM9A 2WWWA 4O4JB 2DW4A 4KFMA 1JJOA 3ICXA 4JYBA 4GCZA 4NYKA 3T4DA 5BR8O 1KYOF 5LBQA 1TUEB 3CB2A 1EM1A 4I0XA 1H2NA 2JEXA 4DK0A 3QO5A 2QKCA 3H1HH 4KXRA 4DR3O 1AI6A 3NXSA 5KHGA 2HVKC 3CJHB 5FNVB 4K3AA 1HNXB 5A2QN 1FFXA 2CUGA 4AILC 4UCOA 5IDJA 4JI8B 3HKEA 4WCEV 3QO8A 1R6KA 3G4SV 5D5PA 4DK1A 4PA6A 2DN9A 2ZCEA 3B40A 2DYSB 4LFAB 4O4JA 1H2KA 4DV0B 3RW0A 3E89A 4DW0A 4J7KA 3ZMVA 3L73H 2Q67A 1KKCA 1IXBA 1IXMA 5BY1A 3GWOA 3D3QA 3X2QC 4CZZA 1RPRA 4YXWG 3LNNA 4RO2A 2EZOA 1ZTEA 4X1YB 2WLIB 3CJHA 5FNVA 2IW5A 1K97A 4MVZA 4JYCA 1QQCA 2ZKOA 4LF8B 2W6IG 3CMAV 2Y0PA 1WB7A 5LMNO 5FPRA 2E5LB 2P4VA 3ASNC 3UKMA 4GKKB 1VF7A 1AJNA 2WLMA 3H1IH 1HNWB 1A32A 2JS3A 2E75B 4MVRA 3DXRB 2H8PC 4JGSA 3ZMUA 2PYJA 3B8NA 1MZFA 2R70A 1JR9A 4BIZA 2JVDA 3JD0A 4UB8Z 2BOCC 2HP8A 4YY3B 3FX7A 4X1KB 5LMUB 2EINB 2QWOB 4X1YA 3QG5A 4J42A 4F6RB 3K5NA 2WLIA 3UO2A 1EBOA 4GX2A 4LC1A 2OTLV 1URFA 1YDXA 3U10A 3C3TA 3K79A 1I94O 1XQ8A 2YIAA 4O2BB 4MVUA 2DYRC 3RWRD 2P06A 4ZIBA 1NJIW 3NR7A 2V4DA 5B1OA 1ENVA 3W7WA 1B04A 1LUVA 1MABG 4MVOA 4YHHO 4J9ZB 2EILC 2HG5C 1W0JG 2B1GA 2F93B 3DXRA 1OCCC 5BXZA 3SJBC 1I0HA 2Z3YA 1S5LZ 2ZNIA 3P30A 2RJZA 4X1KA 4X66O 2RDCA 3ABKC 2WLKA 3SJCC 4F6RA 4FZ0A 5KA6A 2F4VO 3VQYA 4TV8B 1NBMG 3OTOB 4JAVA 2XAFA 5E79Z 2YIDA 1Y6XA 2VQFO 3QF7A 4O2BA 2YICA 2FL4A 1THZA 1OCOB 3CXHF 2Q7EA 5KAIZ 4DV7B 1YTFB 4P9PA 1CPYA 2CTPA 2XTAA 1WP7A 3ASOC 4Q6GA 2N74A 5IJ9B 1E1RG 1NR7A 1TVKB 3LDDA 3P3PA 1IBMO 3CWBH 1V55C 4B3TO 2XOKG 1U97A 1IURA 3BPZA 3H1JH 4FLTA 1VQ8V 2DQ0A 2A7WA 2F23A 2OIEA 4X64O 4X65O 4DV4B 3ZS8C 3FB8C 5IJ0B 1R1BA 2PI5A 1ZAUA 1N32O 4TV8A 3CE2A 4PELA 3JSLA 1KC8W 1VARA 1ORQC 2ADPA 2CAZC 4MTXA 3J7AU 2EIJB 4P2ZA 2WLJA 3MAQA 4O4LB 1MMMA 1YHQV 1PNMA 2NLJC 3ABMB 1TGOA 4H37A 2CK3G 3OM3B 3JARB 2M6YA 1BHAA 3VQVA 2RNBA 3KKYA 2DMXA 4DRXB 4UCSA 5CA0B 5IJ9A 2ITDC 1VQPV 5LHIA 2ILMA 4RWUA 4NXNB 1I5YA 1AROP 4U3JB 3ZBHA 2NR5A 4MTOA 3FKSG 1VQ5V 2PYLA 5KX5B 5BZBA 2RMKB 1I7FA 1RSOB 1HDJA 2ZDIC 1ZSPA 3T4ZA 2ZR3A 4J10A 3JD1A 2JGDB 5JCOA 4N21A 4PA3A 2Y4UA 1H2GA 4AQYO 2CGNA 1EN4A 4DR2O 4JI7O 4GX0A 4O4LA 4UV8A 3EFFK 5CA1B 4XDLA 1GM8A 2B1IA 3JARA 5FL7G 3BCCH 3UCSC 2P22C 3CP1A 4DRXA 1FPOA 1GMGA 2ODMA 3OFNG 2UU9O 2D2CB 4U7NA 2FYUH 4RQEA 4FM2A 1S5JA 3FB7C 3MD0A 4LNUB 5LL6Y 1K4CC 4X62B 2ZR2A 2PI4A 4U3JA 3ZMZA 1VQ9V 4JI2O 1GN6A 2LGQA 1VQ6V 3RYHB 3W7XA 5KX5A 3JAMN 1AR4A 1N33O 1N0JA 3PN1A 4MVSA 3A0BZ 4B3RB 1RSOA 2R9AA 2FTKA 2QSAA 4I9QA 2ZE8A 2JGDA 1G1XB 1Q8IA 5LMNB 2P67A 4X1IB 3ZJZA 3JCZA 1QLEB 2HVJC 2W0FC 3JALB 5H5NA 3I5DA 3W7TA 3DTUB 3VQWA 1XOUA 5CA1A 4H44B 4ZKIA 3AG1C 2A3QA 1US6A 5B3SB 1IBLO 4PDVA 2Q5ZA 4PDRA 1OZ0A 1GTOA 4LNUA 1PL0A 5CA3A 4JZGA 3HKCB 2WA4A 1MZEA 4JI3O 4JI1O 3R65A 1V9PA 1Q86W 1Q90D 3RYHA 1DGSA 3JASB 4DR5O 1XL4A 5L3DA 3SPIA 4DW1A 5JH7B 1K73W 2JJ1G 2N05A 4DUYO 3CRQA 1LNQA 2QM7A 1VF6C 1N34O 3CCUV 1FXHA 3F5TA 4TSFG 1H2SB 5IY5C 2Y48A 1SA0B 5B1BC 3OMNB 5KLVH 2DE0X 2LFSA 2QKSA 4WFBV 3K0GA 1OCZC 4YHHB 1NZ6A 3JALA 1SRYA 3Q4HB 4PA9A 1PM9A 4FVMA 2IJIA 3BABA 1WA8B 3OMAB 5LYJB 3AEIA 3U0ZA 3T1CA 1YIJV 1RPOA 3TK1A 1MSDA 4LF9O 5B5EZ 2O57A 3T1HO 2CTRA 4NVPA 2ZXWB 3IJ4A 1SC5B 3JAWB 1AB3A 3AG2B 3OGIB 4KUMA 3UT5B 1VQOV 1PL4A 4UB6Z 3M8AA 4PJ0Z 4IL6Z 4H13B 1ROPA 3HKCA 2VQEO 1WJZA 2WAMA 2E74B 2ZNJA 1P7GA 2AGAA 2VQFB 3JASA 4OX9O 1CP9A 2AW9A 4BWAA 5EK0A 5JH7A 2YUAA 1KECA 4H33A 3BHPA 1N36O 3OUSA 4I4TB 3G6BA 3RVYA 1PV0A 1SA0A 1YEWA 3LDEA 3DC6A 3F7VC 3S3WA 2HJFC 1P84F 2GTAA 4X20B 3OT7A 4YJ2B 5IWAB 1EZJA 1R6NA 4J80A 3L9DA 4NB5A 1KP2A 3AG3C 3CCMV 3Q4HA 1IBMB 3KCYA 3L74H 1FXKB 2BOBC 5H9CA 1VEWA 3LDCA 4H0LB 4B3TB 3WB2A 2CE4A 1K5SA 2QWQB 1XMQO 1Y76B 5CB4B 4NKGB 4DXWA 5J2TB 3ZX6A 3UT5A 4D6TH 1VMGA 2IBZH 1BS3A 4X88A 4X64B 4X65B 1IBKO 4GKJO 3WG7C 3UO3A 3CRCA 3JCUZ 1N32B 5IYDO 2PY5A 4FM1A 2ITCC 4DV5O 4I7ZB 4CH5A 1L0NH 1Q6IA 2P7TC 2GV9A 3AG4B 1LR1A 5C93A 1BGYH 4I4TA 3N2KA 4GLXA 2IU3A 3B4SA 4U3FH 3EHBB 1JOYA 1AVMA 5GTIZ 3IC9A 1E79G 4X20A 4YJ2A 2HR3A 4PA4A 4I5SA 2DYSC 2JRIA 2LW1A 1FXKA 1WLEA 4LF4B 4NXMO 2GSMB 4G27B 2OTJV 2H3OA 3RN4A 4B3MO 2P4KA 3K9SA 3FFQA 1Y76A 5EYPB 5CB4A 3ABLB 5J2TA 3DGEA 1LUWA 3KCXA 1VQLV 4FLUA 3B8MA 4TQDA 1NKDA 1WN7A 4DUZB 1Q82W 1JCHA 1K5QA 2WLLB 1G4YB 1UPGA 4W4KA 3FB6C 4QGPA 1T5EA 4HBNA 3K03A 4AQYB 5LHHA 4JTCB 4DR2B 5D5QA 3ZCCA 3ETQA 4JI7B 2Y69B 3QO7A 1M90W 3IC7A 4BAYA 3ZHTA 4JI0O 3EXAA 3ETDA 3H1KH 2IJHA 4FZ1A 3ZEDA 4Z1VA 3CEIA 4LF5O 2QM4A 2WA3A 2VS0A 2UU9B 1SQXH 4K8ZA 2Q4PA 1I08A 4XDJA 4JI2B 2YXHA 3K5LA 5EYPA 3SYQA 5J9PC 3SPGA 1J5EO 4AI8A 1OCRC 1ZWIC 1M1KW 5KMGB 1N33B 4WFEA 5BMVB 4PI0A 1W2BU 2OWOA 2JJ2G 2WLLA 4LF6O 1YVWA 3CHXA 3A0RA 1F4NA 2UUAO 2EJRA 4KHPO 1BHBA 3IFXA 1AILA 1YSCA 3MDSA 1RM1C 3RYCB 2L6LA 3JD2A 2UXDB 3K06A 1FYJA 1R3JC 4LFCO 1WAZA 4DV3O 2F1MA 4PDLA 1KKDA 3K9AA 3SYCA 1PNLA 4QE9A 1FAFA 3VQXA 1YCIA 1D5NA 2DOSA 4PI2A 3CPWU 4AHCA 3BEHA 2B9ZA 4JI3B 4JI1B 3D36A 3X2QB 1M57C 1RP3B 2FMLA 3MHHC 4EFEA 1XNRB 4IGGA 1QLNA 5KMGA 2HHHO 1M9NA 5BMVA 2OYQA 3HKBB 4F6EA 1N34B 1G6UA 3T1YO 2ZIMA 1JMKC 1ZX3A 1K9MW 1S0VA 4HZ3A 2ATKC 5KUKA 1S76D 1IDSA 4EFBA 4GX5A 3WB0A 2ARHA 2RN9A 3RYCA 1PP9H 4Q20A 3W7UA 5EIBD 4UVBA 2ZQMA 1YJ9V 1E1QG 4UCUA 4MSWC 5KHIA 3T2MA 3CD6V 5J2UB 5JWPA 4G28B 2MK3A 5LHGA 1GAXA 1Q3EA 1KB9F 2UXXA 3APOA 3WB1A 1JJ2U 2EX3A 4A5UB 1R6TA 5B1AC 2VQEB 1IZ3A 3L71H 3OTFA 5L3CA 1AR5A 1IVSA 1KQSU 5JVDB 1XMOO 4JI5O 3K57A 2V7QG 4Z2WA 5H6QA 2K1EA 3SPCA 2F95B 1Z5WA 2WSSG 3HKBA 2FB5A 2QA4V 1QCEA 1N36B 4ZBMA 4LFBO 1Y67A 3AK3A 2P6JA 2GUZB 4QIWF 2KG7B 4R7CA 4LWSB 4UCTA 4KL1A 3BRCA 1RFYA 1NTMH 5JJEB 1BL8A 2W0XA 3E2EA 2AXTZ 4DV2O 5EBWC 2Q6AA 1AI5A 2YI8A 1Z5VA 4IIJB 4TWKA 1KBHA 3APQA 4OGQB 4I9WA 1V54C 3N2GB 3TXSA 1NS1A 4JTDB 5J2UA 3CC7V 2VRZA 2EIMC 4RQFA 3KG2A 1OCCB 5KHKA 4GKJB 2FKXA 4JV5O 2JEUA 1GN3A 2PGGA 5JVDA 2LO1A 1U96A 4DV5B 2CH7B 1R3LC 2Q69A 4JYAB 1XDCA 2XAJA 3E86A 1DF4A 2KG7A 5LP6B 2GHYA 2QTOA 4LWSA 3BVOA 1HNZO 4LH6A 5BR8B 2Q0AA 3ZHVA 4UVCA 4QJFB 2XHBA 1XL6A 4CC5A 4NXMB 3J81N 2X6AA 4FIPC 4DR3B 4IIJA 1TVKA 2LQTA 3N2GA 1EFRG 1KP3A 3G6EV 2XAHA 1Q6UA 4OPAA 4GUNA 2P5OA 1BQ0A 1V55B 1VQ4V 4FLXA 1O9HA 5IJ0A 2M7WA 4DR7O 2CH7A 1IX9A 2ZE7A 2X6BA 1B06A 1W0KG 2OT5A 2QEXV 4JI0B 1NI8A 4MS2A 3JSNA 2UXCO 1FJGO 2Y0IA 3P32A 3FD9A 1DTOA 2BE3A 5LP6A 4LF5B 2LFRA 2Q0OC 3K3WA 3TCUA 3SYOA 2Q68A 2PTMA 3CSXA 5CA0A 3THOA 1AI7A 2BCCH 2VWJA 3CCJV 3RVZA 3K59A 3BFRA 1SERA 3CCQV 2DQ3A 3E8GA 4DV0O 5CBGA 5C8YB 2RQ6A 4X89A 4N23A 4LF6B 5L3EA 2UUAB 3LUTB 3HKDB 3RGBA 2QKAA 3N27A 2X7RB 1B3QA 2XAQA 1WB8A 3FYIB 4LBEC 5TISZ 1FKAO 1AR1B 4R6ZA 3D8CA 3M7MX 4LFCB 2DJVA 1EN6A 2Q8VA 1XHXA 3E83A 3J80N 1SETA 2KKWA 1NH2D 2QE7G 2EIKC 4HYOA 1FS0G 2QDOA 4WFFA 3OUFA 3ABUA 2YSUB 3AG7A 3E8FA 2V1DA 4PHZA 4I50B 1M4UA 2E5LO 1NTKH 4GKKO 1K4DC 2ZIOA 4MVMA 1HNWO 1CXZB 3IAYA 5C8YA 3R66A 1W59A 4R8CA 1I94B 2OCCB 1KMIZ 3HKDA 4FK5C 2UXNA 4JASA 4QE7A 3TJTA 3ZIAG 2CTWA 3UM7A 4UVAA 1VQMV 3G80A 5LMUO 1H38A 4X1IA 4CBCA 3OE7G 2Y4TA 1YJWV 1QVGU 2PF4E 5B66Z 1PPJH 1NVPD 3C3SA 5CBFA 4WBNB 3CS5A 5L3GA 2DWEC 1Q43A 4TQFA 3M99B 4PV1B 2Q7GA 2XNDG 1S3JA 3I56V 4X66B 1WPXA 5L3BA 4JI4O 1XMOB 3QTCA 4I50A 4JI6O 2F4VB 4NR1A 2LJ2A 4P30A 3CC4V 3CYOA 1S72V 1Q5OA 4LFBB 4TUYB 2QM8A 5JQGB 4GZRB 1HW7A 3QVNA 3E8HA 3ETEA 1MG1A 2HJDA 1P7BA 3RYFB 4B7EA 5IY5B 2F66C 1K7DA 3RBZA 3IGAC 4QPJA 3C90A 1K34A 2JIZG 4DR1O 4CH4A 5H6RA 1OCZB 1WA8A 5LYJA 1F4MA 4FLWA 1FFTB 1QHTA 3K08A 4WBNA 1N4CA 4OXSA 1PKXA 2EBOA 2JDIG 2F43G 4CS4A 5CMUA 4WF9V 1K33A 4RUFA 3JAWA 2AZ0A 4LF7O 1KU9A 1TUBB 2EULA 4CS3A 3S3XA 3K5MA 4MW8A 4JF3A 1X59A 1DLBA 4J41A 3ABLC 1FXVA 4HNAB 4TUYA 4JTAB 5JQGA 3OR6C 4IYHA 4O4HB 1SS3A 4B7KA 2QGNA 1XNQO 2EZPA 1XHZA 4XDKA 1SQQH 2PZSA 4B08A 3RYFA 3ZMTA 1D2DA 3ZRWB 2YDEA 4DV4O 1XEQA 5DEDA 1KD1W 2IJKA 4TT3G 1SQGA 3CX5F 2Q7HA 3AG3B 3LNMB 1F23A 2IH1C 2QWRB 1HR0O 5EBMC 1GKFA 2MW2B 3SJAC 1VQKV 3E8BA 1VQ7V 3A0HZ 1SQVH 4YIOA 1CEZA 2HEPA 1TUBA 1WPBA 3D36C 2D3OW 5AG2A 4DR7B 2AHZA 3WG7B 1H8HG 1XUQA 4OPHA 1NQTA 5K1XA 4JYYA 4X9QA 4HNAA 4G2KA 4FJCC 1M56B 4NXNO 3AK1A 5L3FA 2UXCB 1FJGB 4K0KO 4O4HA 1O9GA 4XBFA 4BIUA 4DR6O 3K0DA 3SGIA 4FLVA 3ZRWA 4R50A 1OJHA 3SJQC 4DV6O 2IU0A 1BT8A 5CN0A 2UUCO 1QVFU 2GDSA 3UQ8A 5FLXN 1BQZA 3ZHSA 4ZOLB 3DSQA
chains in the Genus database with same CATH topology
3ZX6A 2CH7A 3G67A 3G6BA 2CH7B 1QU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZX6 A;  2CH7 A;  3G67 A;  3G6B A;  2CH7 B;  1QU7 A; 
#chains in the Genus database with same CATH topology
 1QR8 A;  3W7S A;  2P90 A;  1GN4 A;  5EBL C;  3DC5 A;  1GH6 A;  3JYC A;  1AI4 A;  2UUB O;  1Q81 W;  2AZ2 A;  1NTZ H;  2EIN C;  1EZV H;  5E1A C;  4Z1M G;  3CCV V;  4LR3 A;  3ZHQ A;  1VIB A;  2R72 A;  2NNU A;  1YIT V;  3FAV B;  1WP8 A;  3P3N A;  4X62 O;  2XAS A;  3JD3 A;  2A9H A;  3GVM A;  4DO2 A;  5LXT B;  5LGU A;  3I55 V;  3BY6 A;  4E2L A;  3K58 A;  3ZN0 A;  4I55 B;  4MTF A;  4TOI A;  5EZY B;  1SES A;  3OEH G;  4KP4 A;  4B3R O;  3CCE V;  3SYP A;  5A9G A;  1IBL B;  2ZIN A;  3KZI Z;  3ABT A;  4D7T A;  4BIO A;  5IYC O;  1M93 A;  4ZOL A;  3JAT B;  4FFB B;  2BSK B;  1ZLZ A;  2JK5 C;  4WFG A;  3BA8 A;  4ASU G;  4MTG A;  4DR5 B;  2LGW A;  2JS5 A;  4EB6 B;  2XT9 A;  1MNG A;  3H9V A;  4DUY B;  2WPD G;  1OCR B;  2LW7 A;  1OV9 A;  1SQP H;  1MSW D;  4PD4 F;  3HR0 A;  2BTQ B;  2WLN A;  4CH3 A;  3FAV A;  4IT5 A;  4X8A A;  3JD4 A;  1SF9 A;  3ZHU A;  3ETG A;  5LXT A;  4DYL A;  3F7Y C;  4F4L A;  4ZHQ B;  1RM1 B;  2UXB O;  2A06 H;  2NN4 A;  1OCO C;  4I55 A;  1WNS A;  1COW G;  5EZY A;  4FLZ A;  3ASN B;  5GON B;  4K8X A;  4LF9 B;  3OMI B;  3STZ C;  3T1H B;  3OD4 A;  2AHY A;  3ZRV A;  1SZX A;  2W6J G;  4JI4 B;  4BW5 A;  3B09 A;  3E35 A;  4JI6 B;  3SYA A;  3D3I A;  1X4T A;  3JAT A;  4FFB A;  1M5I A;  2BSK A;  4CH6 A;  4P9O A;  4BW9 A;  1M57 B;  4OX9 B;  5ITZ B;  1H8E G;  4EB6 A;  1SKV A;  3L72 H;  3EVK A;  4QPK A;  2ZM6 O;  2PUS A;  1YZB A;  4L8J A;  5LOV B;  2YS8 A;  2BTQ A;  1AJQ A;  2LP7 A;  5JCO C;  3U11 A;  5IYB O;  2DYR B;  4PDM A;  4IHJ B;  3QNE A;  2CGO A;  4DR1 B;  3ZN1 A;  1Y66 A;  4ZHQ A;  2EIJ C;  4MVQ A;  4U7O A;  4RAI A;  2Q73 A;  2H94 A;  3ABM C;  5LP6 C;  1NH2 B;  1L0L H;  3FB5 C;  5GON A;  4GT1 A;  1XMQ B;  4LP8 A;  2EIL B;  5EC1 C;  1GK9 A;  5GW7 A;  1F7Y A;  4FM0 A;  4LF7 B;  1TA8 A;  2E76 B;  3CRM A;  1IBK B;  3JAK B;  2IJJ A;  5DEC A;  1NR1 A;  5LA6 B;  5IWA O;  3E22 B;  4B3S O;  5B1N A;  5B1A B;  4DR4 O;  1JPX A;  2Q9L A;  1VP7 A;  3ABK B;  5ITZ A;  2YXY A;  1XNQ B;  3BA9 A;  4UCV A;  3L75 H;  3STL C;  2GUZ A;  4BR6 A;  1BE3 H;  5LOV A;  2ADQ B;  2HLD G;  2R9I A;  1Z2G A;  4CC6 A;  3AK2 A;  2E3C A;  2N04 A;  4IHJ A;  2X0L A;  3F5W C;  4NTY A;  4RUE A;  1NVP B;  4HAM A;  4FMT A;  3G71 V;  4DV1 O;  3ZRS A;  1HR0 B;  1I5X A;  4B3M B;  4CS2 A;  3ASO B;  1HP8 A;  4JPR A;  2XUM A;  5IYZ B;  1ZL8 B;  1MOF A;  1V54 B;  1XI1 A;  4UCR A;  3VBB A;  1YI2 V;  4J9Y B;  4GYC B;  2IM9 A;  3JAK A;  1VF5 B;  2EIM B;  4NTX A;  5LA6 A;  3CRA A;  1F51 A;  3E22 A;  3ZRX A;  2R9R B;  1L1F A;  1R73 A;  5JJJ B;  1QR9 A;  2YXL A;  5KHH A;  4LF4 O;  1YXB A;  1OHH G;  3GWK C;  1B6Q A;  3K04 A;  1Y74 B;  4K0K B;  5KHJ A;  3BAA A;  2GTS A;  1SQB H;  1N8R W;  4DR6 B;  2OCH A;  1HNX O;  4LCU C;  1QU7 A;  1JFF B;  2ZT9 B;  1VQN V;  4YIP A;  2KB1 A;  3SPJ A;  4DUZ O;  2G38 A;  3O9O A;  4ICG A;  3CXC U;  4JI8 O;  3B2E E;  4DV6 B;  2QWN B;  1QLE C;  2UUC B;  2HKO A;  2ZE5 A;  5JJN B;  3CRR A;  3TXQ A;  1QNM A;  1SQF A;  1J5E B;  4IYI A;  5IYZ A;  4LFA O;  1ZL8 A;  3ML0 A;  5KA5 A;  2UUB B;  5B3S C;  1J95 A;  1K8A W;  4W4L A;  4JAA A;  2ZE6 A;  3CME V;  1R3I C;  3OW2 U;  1AP6 A;  3RYI B;  3ZHR A;  4K35 A;  3HPL C;  3CCL V;  1D5A A;  1GM7 A;  4KHP B;  1S5H C;  1K92 A;  1JVM A;  4UXN A;  2QJ1 A;  1Y74 A;  4ZI7 B;  3A8T A;  1MA1 A;  2OCC C;  2L35 A;  4MT8 A;  4PA7 A;  2RCV A;  4DV3 B;  3K5O A;  4TV9 B;  2XAG A;  4JZ2 A;  1JFF A;  1BMF G;  1GN2 A;  1XRE A;  1UFI A;  3VOU A;  3LSQ A;  3OR7 C;  4LF8 O;  3CCS V;  3PJS K;  3OGC C;  2A79 B;  2DWD C;  3CCR V;  3O65 A;  1TAE A;  4FPP A;  5KUM A;  1YTF D;  2YIB A;  2YEV B;  2UXD O;  1ZUQ A;  5GTH Z;  2HHH B;  4WFH A;  2ZXW C;  1PD3 A;  3T1Y B;  3AG2 C;  4L87 A;  4O4I B;  4E4E A;  3RYI A;  1P49 A;  2B5U A;  2IH3 C;  5KAF Z;  3LSS A;  3RT3 C;  4EEQ A;  3G67 A;  4ABM A;  4YY3 O;  4D7S A;  4ZI7 A;  2ZDI A;  4YJ3 B;  1EN5 A;  4LH7 A;  1XNR O;  2UXB B;  4FFK A;  1GRJ A;  2BTO A;  4TV9 A;  2X6C A;  3H01 A;  4QNH B;  1XIL A;  1PNK A;  1BSM A;  4MW3 A;  3LSU A;  1NT2 B;  1HWY A;  3CC2 V;  3WFV A;  5DM6 V;  2K9P A;  1S77 D;  4EKW A;  1AP5 A;  1G8M A;  3WU2 Z;  2A0L A;  3AG1 B;  2OIG A;  3A2F A;  2EIK B;  3OAA G;  5IE9 A;  1FXK C;  1N0N A;  3GB7 C;  2YEV A;  4JI5 B;  1DF5 A;  2CTQ A;  1R3K C;  2C2A A;  4UFZ A;  5EC2 C;  4UV9 A;  5HFL A;  1GO3 F;  2ZM6 B;  2WLH A;  4O2A B;  4O4I A;  2QR4 A;  3RFR A;  4NTW A;  1JX9 A;  3TET A;  2KQX A;  5H2F Z;  5DN6 G;  3ZMS A;  1BCC H;  4J7J A;  4YJ3 A;  3SDL A;  1KUQ A;  2ZD9 A;  1YJN V;  3SPH A;  3B77 A;  1P4R A;  5B1B B;  4DV2 B;  2YI9 A;  1H2L A;  1K3E A;  3AG4 C;  5IT9 N;  3OTO O;  1YF2 A;  3MHS C;  3N2K B;  4WFA V;  5EIB C;  1L8D A;  2ETN A;  1QBZ A;  4J7Z A;  2YIB D;  3L70 H;  4JV5 B;  1H2M A;  1Q7Y W;  4DV7 O;  2CDY A;  2GBO A;  4GX1 A;  4B3S B;  2QWP B;  1JA8 A;  4DR4 B;  4UUJ C;  5HFM A;  5FPO A;  3HB3 B;  4I0X B;  1FD9 A;  3H1L H;  5F2V O;  4O2A A;  2QTS A;  1XBL A;  3TGU H;  4JAU A;  5K1P A;  2YC0 A;  2EJ7 A;  4C7U A;  1DK1 A;  1AJP A;  1FFX B;  3OEE G;  1HNZ B;  4FLY A;  1SZT A;  2Z5U A;  5LGT A;  2Z0A A;  1UJW B;  1NU1 H;  1VF6 A;  1Y4M A;  3SR2 C;  2JGU A;  5CBH A;  3HKE B;  1M56 C;  2HFE C;  5LGN A;  1JQ0 A;  2Y69 C;  4J11 A;  4DV1 B;  1Q6H A;  3FYE B;  1BZK A;  2VWK A;  4JYA O;  2KSD A;  1GM9 A;  2WWW A;  4O4J B;  2DW4 A;  4KFM A;  1JJO A;  3ICX A;  4JYB A;  4GCZ A;  4NYK A;  3T4D A;  5BR8 O;  1KYO F;  5LBQ A;  1TUE B;  3CB2 A;  1EM1 A;  4I0X A;  1H2N A;  2JEX A;  4DK0 A;  3QO5 A;  2QKC A;  3H1H H;  4KXR A;  4DR3 O;  1AI6 A;  3NXS A;  5KHG A;  2HVK C;  3CJH B;  5FNV B;  4K3A A;  1HNX B;  5A2Q N;  1FFX A;  2CUG A;  4AIL C;  4UCO A;  5IDJ A;  4JI8 B;  3HKE A;  4WCE V;  3QO8 A;  1R6K A;  3G4S V;  5D5P A;  4DK1 A;  4PA6 A;  2DN9 A;  2ZCE A;  3B40 A;  2DYS B;  4LFA B;  4O4J A;  1H2K A;  4DV0 B;  3RW0 A;  3E89 A;  4DW0 A;  4J7K A;  3ZMV A;  3L73 H;  2Q67 A;  1KKC A;  1IXB A;  1IXM A;  5BY1 A;  3GWO A;  3D3Q A;  3X2Q C;  4CZZ A;  1RPR A;  4YXW G;  3LNN A;  4RO2 A;  2EZO A;  1ZTE A;  4X1Y B;  2WLI B;  3CJH A;  5FNV A;  2IW5 A;  1K97 A;  4MVZ A;  4JYC A;  1QQC A;  2ZKO A;  4LF8 B;  2W6I G;  3CMA V;  2Y0P A;  1WB7 A;  5LMN O;  5FPR A;  2E5L B;  2P4V A;  3ASN C;  3UKM A;  4GKK B;  1VF7 A;  1AJN A;  2WLM A;  3H1I H;  1HNW B;  1A32 A;  2JS3 A;  2E75 B;  4MVR A;  3DXR B;  2H8P C;  4JGS A;  3ZMU A;  2PYJ A;  3B8N A;  1MZF A;  2R70 A;  1JR9 A;  4BIZ A;  2JVD A;  3JD0 A;  4UB8 Z;  2BOC C;  2HP8 A;  4YY3 B;  3FX7 A;  4X1K B;  5LMU B;  2EIN B;  2QWO B;  4X1Y A;  3QG5 A;  4J42 A;  4F6R B;  3K5N A;  2WLI A;  3UO2 A;  1EBO A;  4GX2 A;  4LC1 A;  2OTL V;  1URF A;  1YDX A;  3U10 A;  3C3T A;  3K79 A;  1I94 O;  1XQ8 A;  2YIA A;  4O2B B;  4MVU A;  2DYR C;  3RWR D;  2P06 A;  4ZIB A;  1NJI W;  3NR7 A;  2V4D A;  5B1O A;  1ENV A;  3W7W A;  1B04 A;  1LUV A;  1MAB G;  4MVO A;  4YHH O;  4J9Z B;  2EIL C;  2HG5 C;  1W0J G;  2B1G A;  2F93 B;  3DXR A;  1OCC C;  5BXZ A;  3SJB C;  1I0H A;  2Z3Y A;  1S5L Z;  2ZNI A;  3P30 A;  2RJZ A;  4X1K A;  4X66 O;  2RDC A;  3ABK C;  2WLK A;  3SJC C;  4F6R A;  4FZ0 A;  5KA6 A;  2F4V O;  3VQY A;  4TV8 B;  1NBM G;  3OTO B;  4JAV A;  2XAF A;  5E79 Z;  2YID A;  1Y6X A;  2VQF O;  3QF7 A;  4O2B A;  2YIC A;  2FL4 A;  1THZ A;  1OCO B;  3CXH F;  2Q7E A;  5KAI Z;  4DV7 B;  1YTF B;  4P9P A;  1CPY A;  2CTP A;  2XTA A;  1WP7 A;  3ASO C;  4Q6G A;  2N74 A;  5IJ9 B;  1E1R G;  1NR7 A;  1TVK B;  3LDD A;  3P3P A;  1IBM O;  3CWB H;  1V55 C;  4B3T O;  2XOK G;  1U97 A;  1IUR A;  3BPZ A;  3H1J H;  4FLT A;  1VQ8 V;  2DQ0 A;  2A7W A;  2F23 A;  2OIE A;  4X64 O;  4X65 O;  4DV4 B;  3ZS8 C;  3FB8 C;  5IJ0 B;  1R1B A;  2PI5 A;  1ZAU A;  1N32 O;  4TV8 A;  3CE2 A;  4PEL A;  3JSL A;  1KC8 W;  1VAR A;  1ORQ C;  2ADP A;  2CAZ C;  4MTX A;  3J7A U;  2EIJ B;  4P2Z A;  2WLJ A;  3MAQ A;  4O4L B;  1MMM A;  1YHQ V;  1PNM A;  2NLJ C;  3ABM B;  1TGO A;  4H37 A;  2CK3 G;  3OM3 B;  3JAR B;  2M6Y A;  1BHA A;  3VQV A;  2RNB A;  3KKY A;  2DMX A;  4DRX B;  4UCS A;  5CA0 B;  5IJ9 A;  2ITD C;  1VQP V;  5LHI A;  2ILM A;  4RWU A;  4NXN B;  1I5Y A;  1ARO P;  4U3J B;  3ZBH A;  2NR5 A;  4MTO A;  3FKS G;  1VQ5 V;  2PYL A;  5KX5 B;  5BZB A;  2RMK B;  1I7F A;  1RSO B;  1HDJ A;  2ZDI C;  1ZSP A;  3T4Z A;  2ZR3 A;  4J10 A;  3JD1 A;  2JGD B;  5JCO A;  4N21 A;  4PA3 A;  2Y4U A;  1H2G A;  4AQY O;  2CGN A;  1EN4 A;  4DR2 O;  4JI7 O;  4GX0 A;  4O4L A;  4UV8 A;  3EFF K;  5CA1 B;  4XDL A;  1GM8 A;  2B1I A;  3JAR A;  5FL7 G;  3BCC H;  3UCS C;  2P22 C;  3CP1 A;  4DRX A;  1FPO A;  1GMG A;  2ODM A;  3OFN G;  2UU9 O;  2D2C B;  4U7N A;  2FYU H;  4RQE A;  4FM2 A;  1S5J A;  3FB7 C;  3MD0 A;  4LNU B;  5LL6 Y;  1K4C C;  4X62 B;  2ZR2 A;  2PI4 A;  4U3J A;  3ZMZ A;  1VQ9 V;  4JI2 O;  1GN6 A;  2LGQ A;  1VQ6 V;  3RYH B;  3W7X A;  5KX5 A;  3JAM N;  1AR4 A;  1N33 O;  1N0J A;  3PN1 A;  4MVS A;  3A0B Z;  4B3R B;  1RSO A;  2R9A A;  2FTK A;  2QSA A;  4I9Q A;  2ZE8 A;  2JGD A;  1G1X B;  1Q8I A;  5LMN B;  2P67 A;  4X1I B;  3ZJZ A;  3JCZ A;  1QLE B;  2HVJ C;  2W0F C;  3JAL B;  5H5N A;  3I5D A;  3W7T A;  3DTU B;  3VQW A;  1XOU A;  5CA1 A;  4H44 B;  4ZKI A;  3AG1 C;  2A3Q A;  1US6 A;  5B3S B;  1IBL O;  4PDV A;  2Q5Z A;  4PDR A;  1OZ0 A;  1GTO A;  4LNU A;  1PL0 A;  5CA3 A;  4JZG A;  3HKC B;  2WA4 A;  1MZE A;  4JI3 O;  4JI1 O;  3R65 A;  1V9P A;  1Q86 W;  1Q90 D;  3RYH A;  1DGS A;  3JAS B;  4DR5 O;  1XL4 A;  5L3D A;  3SPI A;  4DW1 A;  5JH7 B;  1K73 W;  2JJ1 G;  2N05 A;  4DUY O;  3CRQ A;  1LNQ A;  2QM7 A;  1VF6 C;  1N34 O;  3CCU V;  1FXH A;  3F5T A;  4TSF G;  1H2S B;  5IY5 C;  2Y48 A;  1SA0 B;  5B1B C;  3OMN B;  5KLV H;  2DE0 X;  2LFS A;  2QKS A;  4WFB V;  3K0G A;  1OCZ C;  4YHH B;  1NZ6 A;  3JAL A;  1SRY A;  3Q4H B;  4PA9 A;  1PM9 A;  4FVM A;  2IJI A;  3BAB A;  1WA8 B;  3OMA B;  5LYJ B;  3AEI A;  3U0Z A;  3T1C A;  1YIJ V;  1RPO A;  3TK1 A;  1MSD A;  4LF9 O;  5B5E Z;  2O57 A;  3T1H O;  2CTR A;  4NVP A;  2ZXW B;  3IJ4 A;  1SC5 B;  3JAW B;  1AB3 A;  3AG2 B;  3OGI B;  4KUM A;  3UT5 B;  1VQO V;  1PL4 A;  4UB6 Z;  3M8A A;  4PJ0 Z;  4IL6 Z;  4H13 B;  1ROP A;  3HKC A;  2VQE O;  1WJZ A;  2WAM A;  2E74 B;  2ZNJ A;  1P7G A;  2AGA A;  2VQF B;  3JAS A;  4OX9 O;  1CP9 A;  2AW9 A;  4BWA A;  5EK0 A;  5JH7 A;  2YUA A;  1KEC A;  4H33 A;  3BHP A;  1N36 O;  3OUS A;  4I4T B;  3G6B A;  3RVY A;  1PV0 A;  1SA0 A;  1YEW A;  3LDE A;  3DC6 A;  3F7V C;  3S3W A;  2HJF C;  1P84 F;  2GTA A;  4X20 B;  3OT7 A;  4YJ2 B;  5IWA B;  1EZJ A;  1R6N A;  4J80 A;  3L9D A;  4NB5 A;  1KP2 A;  3AG3 C;  3CCM V;  3Q4H A;  1IBM B;  3KCY A;  3L74 H;  1FXK B;  2BOB C;  5H9C A;  1VEW A;  3LDC A;  4H0L B;  4B3T B;  3WB2 A;  2CE4 A;  1K5S A;  2QWQ B;  1XMQ O;  1Y76 B;  5CB4 B;  4NKG B;  4DXW A;  5J2T B;  3ZX6 A;  3UT5 A;  4D6T H;  1VMG A;  2IBZ H;  1BS3 A;  4X88 A;  4X64 B;  4X65 B;  1IBK O;  4GKJ O;  3WG7 C;  3UO3 A;  3CRC A;  3JCU Z;  1N32 B;  5IYD O;  2PY5 A;  4FM1 A;  2ITC C;  4DV5 O;  4I7Z B;  4CH5 A;  1L0N H;  1Q6I A;  2P7T C;  2GV9 A;  3AG4 B;  1LR1 A;  5C93 A;  1BGY H;  4I4T A;  3N2K A;  4GLX A;  2IU3 A;  3B4S A;  4U3F H;  3EHB B;  1JOY A;  1AVM A;  5GTI Z;  3IC9 A;  1E79 G;  4X20 A;  4YJ2 A;  2HR3 A;  4PA4 A;  4I5S A;  2DYS C;  2JRI A;  2LW1 A;  1FXK A;  1WLE A;  4LF4 B;  4NXM O;  2GSM B;  4G27 B;  2OTJ V;  2H3O A;  3RN4 A;  4B3M O;  2P4K A;  3K9S A;  3FFQ A;  1Y76 A;  5EYP B;  5CB4 A;  3ABL B;  5J2T A;  3DGE A;  1LUW A;  3KCX A;  1VQL V;  4FLU A;  3B8M A;  4TQD A;  1NKD A;  1WN7 A;  4DUZ B;  1Q82 W;  1JCH A;  1K5Q A;  2WLL B;  1G4Y B;  1UPG A;  4W4K A;  3FB6 C;  4QGP A;  1T5E A;  4HBN A;  3K03 A;  4AQY B;  5LHH A;  4JTC B;  4DR2 B;  5D5Q A;  3ZCC A;  3ETQ A;  4JI7 B;  2Y69 B;  3QO7 A;  1M90 W;  3IC7 A;  4BAY A;  3ZHT A;  4JI0 O;  3EXA A;  3ETD A;  3H1K H;  2IJH A;  4FZ1 A;  3ZED A;  4Z1V A;  3CEI A;  4LF5 O;  2QM4 A;  2WA3 A;  2VS0 A;  2UU9 B;  1SQX H;  4K8Z A;  2Q4P A;  1I08 A;  4XDJ A;  4JI2 B;  2YXH A;  3K5L A;  5EYP A;  3SYQ A;  5J9P C;  3SPG A;  1J5E O;  4AI8 A;  1OCR C;  1ZWI C;  1M1K W;  5KMG B;  1N33 B;  4WFE A;  5BMV B;  4PI0 A;  1W2B U;  2OWO A;  2JJ2 G;  2WLL A;  4LF6 O;  1YVW A;  3CHX A;  3A0R A;  1F4N A;  2UUA O;  2EJR A;  4KHP O;  1BHB A;  3IFX A;  1AIL A;  1YSC A;  3MDS A;  1RM1 C;  3RYC B;  2L6L A;  3JD2 A;  2UXD B;  3K06 A;  1FYJ A;  1R3J C;  4LFC O;  1WAZ A;  4DV3 O;  2F1M A;  4PDL A;  1KKD A;  3K9A A;  3SYC A;  1PNL A;  4QE9 A;  1FAF A;  3VQX A;  1YCI A;  1D5N A;  2DOS A;  4PI2 A;  3CPW U;  4AHC A;  3BEH A;  2B9Z A;  4JI3 B;  4JI1 B;  3D36 A;  3X2Q B;  1M57 C;  1RP3 B;  2FML A;  3MHH C;  4EFE A;  1XNR B;  4IGG A;  1QLN A;  5KMG A;  2HHH O;  1M9N A;  5BMV A;  2OYQ A;  3HKB B;  4F6E A;  1N34 B;  1G6U A;  3T1Y O;  2ZIM A;  1JMK C;  1ZX3 A;  1K9M W;  1S0V A;  4HZ3 A;  2ATK C;  5KUK A;  1S76 D;  1IDS A;  4EFB A;  4GX5 A;  3WB0 A;  2ARH A;  2RN9 A;  3RYC A;  1PP9 H;  4Q20 A;  3W7U A;  5EIB D;  4UVB A;  2ZQM A;  1YJ9 V;  1E1Q G;  4UCU A;  4MSW C;  5KHI A;  3T2M A;  3CD6 V;  5J2U B;  5JWP A;  4G28 B;  2MK3 A;  5LHG A;  1GAX A;  1Q3E A;  1KB9 F;  2UXX A;  3APO A;  3WB1 A;  1JJ2 U;  2EX3 A;  4A5U B;  1R6T A;  5B1A C;  2VQE B;  1IZ3 A;  3L71 H;  3OTF A;  5L3C A;  1AR5 A;  1IVS A;  1KQS U;  5JVD B;  1XMO O;  4JI5 O;  3K57 A;  2V7Q G;  4Z2W A;  5H6Q A;  2K1E A;  3SPC A;  2F95 B;  1Z5W A;  2WSS G;  3HKB A;  2FB5 A;  2QA4 V;  1QCE A;  1N36 B;  4ZBM A;  4LFB O;  1Y67 A;  3AK3 A;  2P6J A;  2GUZ B;  4QIW F;  2KG7 B;  4R7C A;  4LWS B;  4UCT A;  4KL1 A;  3BRC A;  1RFY A;  1NTM H;  5JJE B;  1BL8 A;  2W0X A;  3E2E A;  2AXT Z;  4DV2 O;  5EBW C;  2Q6A A;  1AI5 A;  2YI8 A;  1Z5V A;  4IIJ B;  4TWK A;  1KBH A;  3APQ A;  4OGQ B;  4I9W A;  1V54 C;  3N2G B;  3TXS A;  1NS1 A;  4JTD B;  5J2U A;  3CC7 V;  2VRZ A;  2EIM C;  4RQF A;  3KG2 A;  1OCC B;  5KHK A;  4GKJ B;  2FKX A;  4JV5 O;  2JEU A;  1GN3 A;  2PGG A;  5JVD A;  2LO1 A;  1U96 A;  4DV5 B;  2CH7 B;  1R3L C;  2Q69 A;  4JYA B;  1XDC A;  2XAJ A;  3E86 A;  1DF4 A;  2KG7 A;  5LP6 B;  2GHY A;  2QTO A;  4LWS A;  3BVO A;  1HNZ O;  4LH6 A;  5BR8 B;  2Q0A A;  3ZHV A;  4UVC A;  4QJF B;  2XHB A;  1XL6 A;  4CC5 A;  4NXM B;  3J81 N;  2X6A A;  4FIP C;  4DR3 B;  4IIJ A;  1TVK A;  2LQT A;  3N2G A;  1EFR G;  1KP3 A;  3G6E V;  2XAH A;  1Q6U A;  4OPA A;  4GUN A;  2P5O A;  1BQ0 A;  1V55 B;  1VQ4 V;  4FLX A;  1O9H A;  5IJ0 A;  2M7W A;  4DR7 O;  2CH7 A;  1IX9 A;  2ZE7 A;  2X6B A;  1B06 A;  1W0K G;  2OT5 A;  2QEX V;  4JI0 B;  1NI8 A;  4MS2 A;  3JSN A;  2UXC O;  1FJG O;  2Y0I A;  3P32 A;  3FD9 A;  1DTO A;  2BE3 A;  5LP6 A;  4LF5 B;  2LFR A;  2Q0O C;  3K3W A;  3TCU A;  3SYO A;  2Q68 A;  2PTM A;  3CSX A;  5CA0 A;  3THO A;  1AI7 A;  2BCC H;  2VWJ A;  3CCJ V;  3RVZ A;  3K59 A;  3BFR A;  1SER A;  3CCQ V;  2DQ3 A;  3E8G A;  4DV0 O;  5CBG A;  5C8Y B;  2RQ6 A;  4X89 A;  4N23 A;  4LF6 B;  5L3E A;  2UUA B;  3LUT B;  3HKD B;  3RGB A;  2QKA A;  3N27 A;  2X7R B;  1B3Q A;  2XAQ A;  1WB8 A;  3FYI B;  4LBE C;  5TIS Z;  1FKA O;  1AR1 B;  4R6Z A;  3D8C A;  3M7M X;  4LFC B;  2DJV A;  1EN6 A;  2Q8V A;  1XHX A;  3E83 A;  3J80 N;  1SET A;  2KKW A;  1NH2 D;  2QE7 G;  2EIK C;  4HYO A;  1FS0 G;  2QDO A;  4WFF A;  3OUF A;  3ABU A;  2YSU B;  3AG7 A;  3E8F A;  2V1D A;  4PHZ A;  4I50 B;  1M4U A;  2E5L O;  1NTK H;  4GKK O;  1K4D C;  2ZIO A;  4MVM A;  1HNW O;  1CXZ B;  3IAY A;  5C8Y A;  3R66 A;  1W59 A;  4R8C A;  1I94 B;  2OCC B;  1KMI Z;  3HKD A;  4FK5 C;  2UXN A;  4JAS A;  4QE7 A;  3TJT A;  3ZIA G;  2CTW A;  3UM7 A;  4UVA A;  1VQM V;  3G80 A;  5LMU O;  1H38 A;  4X1I A;  4CBC A;  3OE7 G;  2Y4T A;  1YJW V;  1QVG U;  2PF4 E;  5B66 Z;  1PPJ H;  1NVP D;  3C3S A;  5CBF A;  4WBN B;  3CS5 A;  5L3G A;  2DWE C;  1Q43 A;  4TQF A;  3M99 B;  4PV1 B;  2Q7G A;  2XND G;  1S3J A;  3I56 V;  4X66 B;  1WPX A;  5L3B A;  4JI4 O;  1XMO B;  3QTC A;  4I50 A;  4JI6 O;  2F4V B;  4NR1 A;  2LJ2 A;  4P30 A;  3CC4 V;  3CYO A;  1S72 V;  1Q5O A;  4LFB B;  4TUY B;  2QM8 A;  5JQG B;  4GZR B;  1HW7 A;  3QVN A;  3E8H A;  3ETE A;  1MG1 A;  2HJD A;  1P7B A;  3RYF B;  4B7E A;  5IY5 B;  2F66 C;  1K7D A;  3RBZ A;  3IGA C;  4QPJ A;  3C90 A;  1K34 A;  2JIZ G;  4DR1 O;  4CH4 A;  5H6R A;  1OCZ B;  1WA8 A;  5LYJ A;  1F4M A;  4FLW A;  1FFT B;  1QHT A;  3K08 A;  4WBN A;  1N4C A;  4OXS A;  1PKX A;  2EBO A;  2JDI G;  2F43 G;  4CS4 A;  5CMU A;  4WF9 V;  1K33 A;  4RUF A;  3JAW A;  2AZ0 A;  4LF7 O;  1KU9 A;  1TUB B;  2EUL A;  4CS3 A;  3S3X A;  3K5M A;  4MW8 A;  4JF3 A;  1X59 A;  1DLB A;  4J41 A;  3ABL C;  1FXV A;  4HNA B;  4TUY A;  4JTA B;  5JQG A;  3OR6 C;  4IYH A;  4O4H B;  1SS3 A;  4B7K A;  2QGN A;  1XNQ O;  2EZP A;  1XHZ A;  4XDK A;  1SQQ H;  2PZS A;  4B08 A;  3RYF A;  3ZMT A;  1D2D A;  3ZRW B;  2YDE A;  4DV4 O;  1XEQ A;  5DED A;  1KD1 W;  2IJK A;  4TT3 G;  1SQG A;  3CX5 F;  2Q7H A;  3AG3 B;  3LNM B;  1F23 A;  2IH1 C;  2QWR B;  1HR0 O;  5EBM C;  1GKF A;  2MW2 B;  3SJA C;  1VQK V;  3E8B A;  1VQ7 V;  3A0H Z;  1SQV H;  4YIO A;  1CEZ A;  2HEP A;  1TUB A;  1WPB A;  3D36 C;  2D3O W;  5AG2 A;  4DR7 B;  2AHZ A;  3WG7 B;  1H8H G;  1XUQ A;  4OPH A;  1NQT A;  5K1X A;  4JYY A;  4X9Q A;  4HNA A;  4G2K A;  4FJC C;  1M56 B;  4NXN O;  3AK1 A;  5L3F A;  2UXC B;  1FJG B;  4K0K O;  4O4H A;  1O9G A;  4XBF A;  4BIU A;  4DR6 O;  3K0D A;  3SGI A;  4FLV A;  3ZRW A;  4R50 A;  1OJH A;  3SJQ C;  4DV6 O;  2IU0 A;  1BT8 A;  5CN0 A;  2UUC O;  1QVF U;  2GDS A;  3UQ8 A;  5FLX N;  1BQZ A;  3ZHS A;  4ZOL B;  3DSQ A; 
#chains in the Genus database with same CATH homology
 3ZX6 A;  2CH7 A;  3G67 A;  3G6B A;  2CH7 B;  1QU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...