1VQ8V

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq8V00
1QVGU 1N8RW 1VQOV 2OTJV 3CCQV 3CC4V 1Q81W 1Q86W 3G71V 1W2BU 1VQ5V 1YHQV 1YJWV 1KQSU 1QVFU 1YI2V 3I55V 1M1KW 3CCRV 3OW2U 1VQMV 3CCVV 1VQNV 1YITV 4WCEV 1YJ9V 1R73A 1K73W 1KD1W 1VQLV 1VQ6V 3G4SV 1K8AW 4WFAV 4WF9V 3CCUV 3CCMV 1VQ7V 5DM6V 3CC7V 3CMEV 1JJ2U 2D3OW 2QEXV 3CXCU 1YIJV 2OTLV 3G6EV 1Q7YW 3CC2V 4WFBV 1S72V 1M90W 3CCLV 3CCEV 1VQKV 1K9MW 3CMAV 1VQ4V 1VQ9V 1VQPV 3CD6V 1KC8W 1VQ8V 1NJIW 1Q82W 3CPWU 2QA4V 3I56V 3CCJV 1YJNV 3CCSV
chains in the Genus database with same CATH superfamily
4JF3A 1S0VA 2PI5A 2WLLB 2Q0AA 1N4CA 2Z5UA 2QJ1A 4FLWA 1L0NH 4EEQA 1IXBA 3WB0A 5ITZA 5LXTA 2WPDG 3JASA 1T5EA 4EKWA 1S72V 1XL6A 2IU0A 4JZ2A 1XMOB 4H0LB 4J10A 3QNEA 3TCUA 1L0LH 4NYKA 1ZX3A 1H2MA 3N2KA 1KUQA 3P32A 3ABLC 4WF9V 1XBLA 3CCMV 2GSMB 2KQXA 1WA8A 5LP6A 1P84F 1R3JC 5AG2A 3ABMB 4B7KA 3WB1A 1FAFA 2ZR3A 4DV0O 2BOCC 4UCSA 3SYPA 3SYQA 4AQYB 4I50A 4IYIA 1OCCB 1ROPA 1V55C 1Q5OA 3OMIB 4DRXB 2JDIG 3HPLC 4YIPA 1XMQO 1NTZH 3J81N 2LO1A 3CRRA 1SQXH 3AEIA 4DV3B 4X65B 3SJBC 3H9VA 3L74H 2DJVA 3ZS8C 2EIMB 3I56V 2YI9A 3K5LA 4NXMB 2BTQA 1V54C 1H38A 1FD9A 3IJ4A 2GHYA 4FFBB 2CH7B 1N36B 1HNWB 5JCOA 4O4IB 3CRQA 4FLVA 4JI0B 4KHPO 2A7WA 1FKAO 4X1KA 4JGSA 4DV7B 3CRCA 2A79B 5L3FA 4LF7O 4XBFA 1TVKA 2ZR2A 3T1HB 2AGAA 4DW1A 4L8JA 3E35A 4ICGA 1IBKO 2IJKA 3GVMA 4FLXA 1IX9A 2F4VO 2UXNA 4F6RB 4X1IA 1WJZA 3FAVB 3F7YC 3F5TA 3S3WA 1S3JA 3SJAC 3ZBHA 2XHBA 1Q86W 4K0KB 3BAAA 5L3DA 3LDDA 3JAKA 1WNSA 3PJSK 3C3SA 2QTSA 4GUNA 4LF5O 3ASOB 2BOBC 5JWPA 2UUBO 3T4ZA 1NR1A 1PD3A 2WWWA 3E86A 1M90W 4DR6B 1PPJH 3HKEA 4J41A 2NLJC 3JD3A 4PI0A 2EJ7A 3CCQV 1AJQA 2ITCC 4YJ2A 4BR6A 3AG4B 4JTCB 1SZXA 1ENVA 1K8AW 5KUMA 2WLKA 4R8CA 1ZAUA 3RVZA 4PHZA 1GAXA 3MDSA 1OCZC 4B3SO 1QLEC 3H1HH 1FXKC 5LMNO 5HFLA 1TA8A 5BY1A 3AG1C 2ZXWC 3OT7A 1UFIA 2PF4E 1YZBA 5B1BC 4BIOA 1VIBA 1VF6A 1WPBA 2FB5A 5LOVB 4DV6B 1XOUA 3L75H 3P30A 5EBWC 2QTOA 3RW0A 5H5NA 1AVMA 1RM1B 4WFGA 3W7SA 5J2UB 1NTMH 1BZKA 5EBMC 1CP9A 4UXNA 3BRCA 4LH7A 1S77D 3SYCA 4DR7O 4QPKA 2Q4PA 3SPCA 4PV1B 2F43G 5IYBO 4NXNO 4J7JA 2ZT9B 2O57A 1UJWB 4ZHQB 1E1QG 5DECA 2DQ0A 2PYLA 3GWKC 1SESA 4KL1A 2EINC 3MD0A 2UXDB 5JVDB 1SQGA 3RWRD 4JI5B 4CS3A 3ZIAG 4CS4A 3P3NA 2DOSA 4FLTA 2QKAA 4U7OA 4UVBA 4EFBA 5KMGA 4MVRA 1KBHA 4LNUB 5J9PC 2EIKC 2Q8VA 2LP7A 3H1LH 3RYCB 1B3QA 1N33B 4FLYA 2B1GA 2Q7GA 4CH5A 1QVGU 1J5EB 3BVOA 2IJHA 3E8FA 2ZE6A 2Q68A 3UQ8A 1IXMA 4DR1B 3Q4HB 4FLZA 2CK3G 2XASA 3ZRWB 1YCIA 3WU2Z 4EFEA 1VQ9V 3OUFA 4JASA 5IYCO 2FMLA 5KAIZ 1XILA 2IJIA 4AQYO 4GX2A 3ICXA 4MSWC 2CTWA 1OCZB 4ZIBA 4H33A 1OV9A 4XDLA 3JAWA 2IW5A 2E5LB 1RPRA 2XOKG 1VQMV 4YY3B 2QWPB 3X2QC 1PKXA 3D8CA 4DV3O 4X65O 2Q7HA 2YDEA 1D5AA 4X88A 1SC5B 1BL8A 2DYSB 1BGYH 4Q20A 2N04A 4JYCA 1QCEA 2E74B 3ZRVA 1NTKH 3W7TA 2YEVB 5K1PA 3K03A 4YJ3A 3CRAA 1HNWO 2JGDB 1FXVA 4JI0O 5GONB 2VRZA 1FFTB 1S76D 4GX1A 4LFBO 2QM4A 2AHZA 4TV8A 4IGGA 4CH3A 1BHAA 3B2EE 1SETA 1H2NA 2P90A 4C7UA 1VQOV 4LWSB 2X0LA 3OTFA 4B08A 1A32A 3T1HO 3RGBA 4DYLA 2WLMA 3DC6A 3E89A 1BQ0A 1MSDA 2QKCA 1IURA 1I08A 4JI7O 2D2CB 2DWEC 4X20A 2OWOA 1JQ0A 5B1NA 4JI3B 3CC7V 1Q6HA 2OCHA 4DV2O 3E8HA 2X6CA 2XNDG 1M4UA 4K0KO 1M56B 1HP8A 2YICA 2YS8A 4I4TA 4KXRA 2EIKB 5EZYB 2PI4A 1OZ0A 2R72A 2P6JA 4F6EA 2P7TC 2GUZA 4DV0B 4LH6A 3CHXA 3HKBB 4MVQA 4ASUG 3CSXA 2V7QG 4QE9A 3UT5A 4TSFG 1XMQB 4IIJB 1JJ2U 4DR6O 4YXWG 3KZIZ 5FNVB 4DR3B 4U3FH 4ZI7B 3T1CA 4AHCA 3RYHA 4U3JA 5H6RA 3JATA 3CP1A 4WBNB 1RFYA 4EB6A 5BMVA 1FXKA 2ZIOA 3N2GA 1TGOA 1Y4MA 5EBLC 4P9PA 2HG5C 3ZHVA 3AG7A 3B8NA 3ZJZA 2L35A 3AG2C 4UB6Z 1K73W 3FKSG 2EILC 1HNZB 5JCOC 4LF7B 4UUJC 1GN6A 3O9OA 5EC1C 4AILC 1GN4A 2ZE8A 4W4KA 1WB7A 4MVZA 2F4VB 4UCTA 4JTAB 4X8AA 3RYIB 3APQA 4Z1VA 1N8RW 1JCHA 1R3LC 5J2TB 1ZSPA 2NR5A 2ILMA 4DR2B 4E4EA 1QBZA 2JJ1G 5B3SB 2FKXA 4LF5B 2Z0AA 2JRIA 4RQEA 3JASB 1AR1B 1K92A 2ZQMA 5JQGA 2UXDO 2IH1C 3LSQA 4JI5O 1JPXA 4LFCB 1PP9H 2CTQA 1FFXB 1KD1W 4CZZA 4LF8O 1XHZA 3NXSA 3QG5A 5KX5A 1Y76B 1WA8B 5LP6B 1N33O 2Q0OC 1NU1H 3HB3B 4X64B 1J5EO 2JJ2G 1Q82W 4B3SB 4PI2A 3EHBB 2YXLA 3JALA 2LJ2A 3STLC 5KHGA 5LMNB 2ETNA 3ABKC 1DGSA 3G4SV 2CE4A 4LF4O 3D36C 1JR9A 4I9QA 1PL0A 4DV1B 4B3RO 2QR4A 2QWRB 1M57C 3SPGA 3W7WA 3L71H 3CXHF 3ZHQA 5LYJA 3VOUA 1K33A 3CCSV 2N05A 2YIBD 3JSNA 2RMKB 2JS3A 5EYPA 1Y6XA 1AP6A 2Y69B 3K3WA 4YY3O 3SYOA 1I0HA 2ATKC 1SQQH 2A0LA 4DR7B 2AW9A 4FM0A 2Y0IA 2HFEC 4NXNB 4HYOA 4UV8A 3SPJA 1P4RA 5DEDA 3SGIA 4X1KB 3LSUA 2OCCB 4I0XA 2UXBO 5KAFZ 3TETA 1TVKB 1KB9F 1MZFA 2ADQB 2XAQA 2P4VA 4FZ1A 3KG2A 2FL4A 4NTYA 1AI5A 3K5NA 4WFBV 4X1IB 3MAQA 3OGCC 3UKMA 4AI8A 4LFAB 2K9PA 4H37A 1KYOF 4QGPA 3AG3C 2X7RB 1XNRB 3IGAC 1VMGA 2HLDG 3BFRA 4BWAA 1K4CC 3JAKB 1BMFG 4JI3O 4DW0A 4PA3A 2AHYA 3CEIA 4TT3G 2ARHA 1SZTA 1GTOA 1YXBA 1YDXA 1OCOB 2W6IG 4TOIA 3HKEB 2KG7B 2ZNIA 3ZN1A 5B1AB 4YJ2B 2VQFO 1NVPB 1EFRG 2GTAA 3M8AA 2OIGA 4FIPC 1XL4A 3EVKA 1QR9A 2RCVA 4DR3O 5EIBD 1SQFA 5H2FZ 4RAIA 1I5YA 3ETQA 3KCYA 3M99B 4P9OA 2E75B 3TXSA 3OTOB 3MHSC 3RFRA 4TUYB 1U97A 4GX5A 5LGUA 2DWDC 3JD4A 1VEWA 2PTMA 3CWBH 4UVCA 5JJNB 5IYDO 1HDJA 2CGNA 1H2KA 3AK3A 2ZD9A 4X1YA 4WCEV 3ABTA 2L6LA 4K35A 2KKWA 1O9HA 2WAMA 3GWOA 4UB8Z 5C8YB 4LFBB 2B1IA 1VQ4V 3OMAB 3LUTB 1KP2A 1HNZO 2HR3A 3SDLA 4LCUC 2DE0X 5K1XA 3H1JH 1YI2V 3BA9A 3CJHA 2WLIA 3K58A 4LR3A 3WG7C 2FYUH 4PA7A 4JI7B 3DXRA 4UVAA 2Y4TA 4DV5O 1K9MW 4DV2B 3CYOA 2WLLA 2F66C 3K04A 4DR2O 1YHQV 1NH2B 5CB4B 4GKJO 5IYZB 2PY5A 1VQNV 4JI2B 5GTHZ 1Z5VA 5FPRA 4O4HB 4BW5A 2PYJA 5KHHA 2QM7A 1F7YA 5KMGB 4YHHB 3OEEG 3NR7A 3ABLB 1F23A 3IFXA 1G6UA 5C93A 1RPOA 3JSLA 2JS5A 1E1RG 4LFCO 3BHPA 1URFA 4P30A 3C90A 4O4JA 3OUSA 4K3AA 1ZWIC 1V55B 2VQEO 5CBFA 1D2DA 1AR4A 5LL6Y 4X64O 3D36A 3ZHUA 3H1IH 5IY5C 1KC8W 5CBHA 1D5NA 3JAWB 4O2BA 5A2QN 3AK2A 4D6TH 2YIDA 3OMNB 1GM7A 1V54B 4DV1O 3K9AA 1SS3A 2KSDA 4JI8O 2RNBA 1RSOB 2R9RB 1NI8A 4TV9A 3D3QA 1MSWD 1YTFB 5LBQA 1NT2B 3OR7C 2YXHA 1PL4A 1ZL8B 2IJJA 2P5OA 1VF7A 1COWG 3BA8A 4YJ3B 2CH7A 2B9ZA 2ZNJA 1VQ6V 1VQLV 1G4YB 1H2GA 4DUYB 3F7VC 4LBEC 3BABA 5BZBA 2DYRC 3ETDA 3O65A 1B6QA 3VBBA 3ASNC 1NVPD 4BW9A 4RUFA 3IC7A 1TAEA 3K06A 4DV4B 1AJPA 3OE7G 1Y74A 4K8XA 1NZ6A 3HKDB 3DGEA 5CA1B 4CH4A 1WP8A 4GZRB 3RYFA 1DF4A 3G80A 5L3BA 1W59A 4LF8B 4LFAO 1TUBA 2DQ3A 3FB7C 4NR1A 1DK1A 3E22A 3CMAV 2YIAA 3CB2A 3ZHRA 3SJQC 4JPRA 3CPWU 1XNRO 5KHJA 3T1YO 5B5EZ 4I4TB 4W4LA 4MW3A 5A9GA 2RDCA 3LNMB 4RWUA 2GUZB 2AXTZ 2ZKOA 1PNLA 1XREA 5HFMA 1M9NA 3BPZA 3UT5B 4FZ0A 4LF4B 3TXQA 2GV9A 1MA1A 3BEHA 1PM9A 1FPOA 4ZBMA 4B3RB 3OM3B 1Q8IA 1BS3A 4PDRA 1GO3F 2HHHB 1S5LZ 1QLEB 4K8ZA 3JATB 1SA0A 3ML0A 4EB6B 4TQFA 5BMVB 1FXKB 4CBCA 3N2GB 4J80A 3AG1B 2F95B 2ZXWB 4HNAA 1VF5B 1IZ3A 1NQTA 1Q3EA 3ZX6A 4H44B 3OTOO 5B1BB 1NH2D 4UV9A 2IU3A 2MK3A 2HP8A 1NJIW 3ETGA 1K5QA 4B3MB 3K08A 1YEWA 4I9WA 2UXBB 2OT5A 2JK5C 4OPHA 5LGTA 3A2FA 3WFVA 3CCUV 4B3TB 2UUCB 1R3IC 5IJ9B 4JYYA 2K1EA 5LHGA 2JGUA 3UM7A 4MT8A 2YUAA 2VS0A 3JD1A 4PDMA 1W0KG 4DO2A 2EZOA 3EFFK 4BIUA 2EINB 2P06A 4IL6Z 4D7SA 3JARB 2VWJA 5E1AC 1NBMG 3G67A 1AP5A 2F23A 3MHHC 1K3EA 2CDYA 5JQGB 5JVDA 3SPHA 1H8EG 4JI2O 1Q90D 4GX0A 4QE7A 2UU9O 1YTFD 2E3CA 2QWQB 2V1DA 2VQFB 3OD4A 4LNUA 4YHHO 2UUAB 4QIWF 4O4LA 2XTAA 5KX5B 3RYCA 2RJZA 4N21A 4DUZB 4QNHB 3DTUB 1GRJA 2Z3YA 5IJ0B 4X62O 4YIOA 2LW1A 1M5IA 5LHHA 3LSSA 3Q4HA 4R6ZA 2EIJC 3KKYA 3QF7A 2CGOA 1QNMA 2BSKB 3X2QB 3QO7A 1HR0O 2W0FC 4PDVA 5LYJB 2ZDIC 4GKKB 5LMUO 4O2AA 4RUEA 4JAUA 1XHXA 4FJCC 1HNXB 2Y4UA 4CS2A 4HZ3A 3ZEDA 2WLHA 4N23A 1Q6IA 5L3EA 1JX9A 5GW7A 1G8MA 1LNQA 2ZE7A 3S3XA 4JI6O 2EULA 2WA4A 3D3IA 3FB8C 3T2MA 3BCCH 4DV5B 2YEVA 5L3GA 2PZSA 2ZIMA 4I0XB 2OIEA 4BIZA 1E79G 1PV0A 2NN4A 3FB6C 5LA6A 4MTGA 4DUYO 5GONA 4GKJB 3ZHSA 1XUQA 5KHIA 4UCOA 4DXWA 2KB1A 3G6EV 1YSCA 4GCZA 5ITZB 5LXTB 3QO5A 4J42A 5F2VO 4DV4O 1AB3A 3U0ZA 1EN4A 2HVJC 3JCZA 2LW7A 3U10A 2LGWA 2VWKA 4Z2WA 3FX7A 3J80N 2DW4A 2JIZG 1R1BA 3N27A 3N2KB 2YIBA 1AROP 4MVUA 2P4KA 2A06H 1B06A 2QWNB 4H13B 4JAAA 2HKOA 3HKCA 2VQEB 1JA8A 1VQPV 1AR5A 1P49A 5H6QA 4I50B 5IE9A 3QO8A 1EM1A 1EZJA 1IVSA 1ZLZA 3ABMC 2PUSA 5KUKA 5BXZA 4J7KA 4DR5B 3G6BA 4JI8B 4ZI7A 4UCVA 1OCCC 5CA0A 1L1FA 4X9QA 1I94B 2HHHO 1GN2A 5KA6A 1J95A 4QJFB 1MMMA 2BTQB 3FB5C 4L87A 3K5OA 4JAVA 3A0RA 4JYAO 4PJ0Z 3UO3A 3AG2B 2R70A 2AZ0A 1OCRC 5B66Z 2EILB 2EBOA 3KCXA 2EIMC 1AI6A 4PDLA 1SRYA 1WP7A 1Y66A 2QWOB 1PNMA 1R6NA 4JTDB 1BCCH 1JVMA 4J7ZA 3CCVV 3TGUH 4B3MO 1QVFU 2UXXA 4RO2A 3CJHB 4B3TO 2UUCO 5DN6G 4ZKIA 1HW7A 2X6AA 2V4DA 1MZEA 4J9ZB 3LDCA 4G27B 4PELA 5DM6V 3CXCU 3DXRB 1CXZB 1DLBA 4NTWA 4BAYA 3E83A 3RYIA 4HBNA 2Y0PA 1TUEB 3ZRSA 3JAMN 5J2TA 3F5WC 2W0XA 1KP3A 3IC9A 3T1YB 1YJWV 2XT9A 3J7AU 1R73A 5CMUA 1YVWA 2Q5ZA 2M7WA 4IHJA 1KECA 1R3KC 3FD9A 4E2LA 2A9HA 2D3OW 1WAZA 1UPGA 4HAMA 3P3PA 3ASOC 4MTOA 4MVOA 3CE2A 3DSQA 2W6JG 2H94A 1FFXA 4OX9O 2BCCH 2UXCO 5H9CA 2ZM6O 1O9GA 1JFFA 4O4JB 2UUAO 1LUVA 3K79A 2QE7G 1Y76A 4X66B 3ZHTA 3ABKB 4I55A 1Q7YW 1KU9A 1I7FA 4DUZO 1WPXA 3AG4C 1BT8A 1EBOA 1M57B 4CC5A 2WSSG 3OR6C 1W2BU 4O2BB 2B5UA 3IAYA 4ABMA 1GK9A 2F93B 1FJGO 4FK5C 2ZDIA 4ZOLA 2EZPA 3R65A 3JD0A 4R7CA 1OCRB 1GN3A 2G38A 4TV9B 3JD2A 1WLEA 4A5UB 5JH7A 4JV5O 3A8TA 1GM9A 4GKKO 1XQ8A 3APOA 4Q6GA 1HNXO 1RM1C 3QTCA 4WFHA 2WLJA 1BQZA 1H2LA 2CAZC 4IT5A 2JVDA 5IWAB 3OAAG 3FYIB 4NTXA 3ZMZA 3B8MA 4MVMA 1K4DC 1Y74B 3G71V 2RQ6A 3ZMVA 3AG3B 2GBOA 3CX5F 3CCRV 4JI1B 5B1OA 3RYFB 2UU9B 2CUGA 1F51A 1IBMO 4UCRA 1QHTA 1H2SB 1TUBB 1SF9A 3E22B 2QM8A 2Q67A 1ORQC 2HJDA 2LGQA 3U11A 1QLNA 5JJJB 2ITDC 3ZMSA 1X59A 3ABUA 4X62B 4G2KA 1AJNA 1NS1A 3EXAA 4LF9O 4OGQB 1Q43A 3K5MA 1N0NA 3RT3C 3B4SA 1VQ8V 4LF6B 2KG7A 2LQTA 1HR0B 2MW2B 1QU7A 1SA0B 4DRXA 5LMUB 3ETEA 2ADPA 5BR8O 2CTPA 4DR5O 1CPYA 1KMIZ 1WN7A 3CS5A 4HNAB 1I94O 2ODMA 1XEQA 4JI4B 1R6TA 4TUYA 1SERA 1Z5WA 4JI6B 1R6KA 1L8DA 1SKVA 4KUMA 2HJFC 3SR2C 4NVPA 3W7UA 5EC2C 3SPIA 4I7ZB 1XNQB 2ZINA 4U7NA 3I55V 5EK0A 1BSMA 4FFBA 3VQYA 2P67A 2DYSC 4O4IA 3FFQA 2WLNA 1N32O 5C8YA 5CA3A 3CMEV 1OJHA 2DMXA 4GYCB 2XAGA 3K57A 4TV8B 1SQPH 4B7EA 3WG7B 3CRMA 3A0BZ 1KKCA 1IBLO 4DR4B 4MTXA 1FYJA 4FVMA 1YF2A 2HVKC 5FL7G 4P2ZA 1P7GA 1THZA 1I5XA 3JCUZ 4TWKA 2RN9A 3ZCCA 4G28B 4WFFA 4X20B 4F6RA 5LHIA 1WB8A 1W0JG 2BE3A 3FAVA 4KP4A 2NNUA 3AK1A 3LNNA 1P7BA 3QVNA 3T4DA 3UCSC 5CB4A 3CC4V 3VQVA 5IYZA 2GTSA 3TK1A 1Y67A 2C2AA 1VARA 4O4HA 1FXHA 1GM8A 2OYQA 5GTIZ 1Z2GA 2QEXV 1M56C 4F4LA 1XMOO 4O4LB 2XUMA 3THOA 5D5PA 1AI4A 4Z1MG 2DN9A 4I5SA 3RYHB 4U3JB 3L72H 5IY5B 3H01A 2E76B 1YITV 3OEHG 4JYAB 1JJOA 2Q7EA 4X66O 1MABG 2N74A 3K9SA 2F1MA 2IH3C 2Y48A 4FPPA 4XDJA 3E8GA 2Q6AA 3OGIB 3R66A 2XAFA 5CBGA 1EZVH 2R9IA 4O2AB 4FM2A 3RN4A 4FFKA 5LOVA 4R50A 3STZC 1RSOA 4OPAA 2PGGA 2EX3A 2OTLV 5J2UA 3JYCA 3CCLV 1M93A 1N34B 3UO2A 4NXMO 1ZL8A 2DYRB 2H3OA 1DF5A 4DK1A 3ASNB 1HWYA 1MOFA 1N36O 4XDKA 1M1KW 3ZMTA 1YJ9V 5LA6B 3FYEB 1FS0G 1G1XB 1US6A 3ZRXA 4ZHQA 3H1KH 4DV7O 4GT1A 2ZE5A 1S5HC 5EIBC 2CTRA 1B04A 5IWAO 1AI7A 1EN5A 1JMKC 3VQXA 5KA5A 1YJNV 2P22C 1LUWA 3HKDA 5B3SC 5CA1A 1Q81W 4JI1O 3TJTA 1F4NA 4J9YB 2WA3A 4WFAV 4OX9B 2UXCB 2ZM6B 2Q69A 2HEPA 3LDEA 3HKCB 1SQBH 4UCUA 2QDOA 1RP3B 3K59A 2XAJA 1EN6A 3SJCC 4PD4F 1AILA 2AZ2A 3JALB 4X89A 1V9PA 1NR7A 5LP6C 1JOYA 3RBZA 1FJGB 1QR8A 1Q6UA 3BY6A 3SYAA 1H8HG 3ZRWA 3CC2V 3PN1A 2JEUA 4LF6O 2ZCEA 5CA0B 3L70H 3CCJV 4UFZA 4JV5B 5E79Z 1OHHG 1K97A 5EYPB 3ZMUA 4LC1A 4TQDA 5IDJA 4FMTA 5CN0A 4JYBA 1N0JA 4MW8A 3L73H 1XDCA 4JI4O 1NKDA 4J11A 4KHPB 2Y69C 2BTOA 4MS2A 3RVYA 1XNQO 1VP7A 4OXSA 2YC0A 3B09A 4DV6O 1DTOA 2QGNA 2YSUB 3K0GA 3W7XA 2X6BA 3A0HZ 2JGDA 2YXYA 2OCCC 5IJ9A 1IBKB 3ZN0A 3L9DA 4RQFA 1VQKV 1IBMB 2R9AA 4DR4O 4D7TA 4LWSA 1X4TA 2QA4V 1YIJV 4GLXA 4FLUA 2OTJV 4CH6A 2QKSA 2LFSA 1ZTEA 3JARA 4IHJB 2XAHA 4PA6A 5D5QA 4MVSA 2Q73A 2UUBB 1K7DA 1KKDA 3CD6V 1BHBA 4LF9B 3VQWA 1ZUQA 5EZYA 2GDSA 5FLXN 5FPOA 2JEXA 1VQ5V 1KQSU 4KFMA 1GH6A 3GB7C 3I5DA 3OW2U 2H8PC 3HKBA 1K34A 1OCOC 1JFFB 3HR0A 3WB2A 1CEZA 1U96A 4WFEA 4IIJA 1QQCA 1BE3H 1GKFA 2QSAA 5BR8B 5FNVA 4I55B 3C3TA 3CCEV 4PA4A 5B1AC 2EIJB 4JZGA 1S5JA 4LP8A 3B77A 5KHKA 5IJ0A 5L3CA 4WBNA 3E8BA 4IYHA 5JJEB 2YI8A 4CC6A 4DR1O 3M7MX 5LGNA 2EJRA 4X1YB 4ZOLB 1SQVH 3B40A 1LR1A 3K0DA 1VQ7V 1IDSA 2BSKA 4FM1A 1N32B 5KLVH 3DC5A 2LFRA 1XI1A 5JH7B 1GMGA 2M6YA 2E5LO 1VF6C 4MTFA 3OFNG 4QPJA 5TISZ 1IBLB 4NKGB 2IM9A 2WLIB 4NB5A 4DK0A 5IT9N 1MG1A 1K5SA 2FTKA 1N34O 4PA9A 2IBZH 3E2EA 1F4MA 1PNKA 2Q9LA 1MNGA 2A3QA
chains in the Genus database with same CATH topology
3FKSG 4JF3A 1S0VA 2PI5A 2WLLB 1QLEB 2EILC 1QLNA 3ML0A 4UUJC 2ITDC 2Z5UA 5EC1C 3ZMSA 3ABUA 1FXKB 4CBCA 4G2KA 1AJNA 3AG1B 2ZXWB 2WPDG 1NQTA 4EKWA 5B1BB 1S72V 1XL6A 4MVZA 2IU0A 1NH2D 4UV9A 1VQ8V 2IU3A 2MK3A 3QNEA 4JTAB 4X8AA 1NJIW 3TCUA 3ETGA 1N8RW 1JCHA 1R3LC 1K5QA 3P32A 3K08A 4I9WA 3ETEA 2OT5A 1QBZA 2JJ1G 2JK5C 5LGTA 5B3SB 3ABLC 4WF9V 3WFVA 3CCUV 3CCMV 2GSMB 1CPYA 1R3IC 4RQEA 1R3JC 2K1EA 5LHGA 3ABMB 1AR1B 1K92A 2ZQMA 2ZR3A 3UM7A 1SERA 4MT8A 1R6KA 2IH1C 2BOCC 3LSQA 3SYPA 3SYQA 4KUMA 2HJFC 3W7UA 1OCCB 3JD1A 5EC2C 1ROPA 3SPIA 1V55C 1JPXA 3I55V 4U7NA 3OMIB 4PDMA 2JDIG 1W0KG 3HPLC 5EK0A 4DO2A 2P67A 2EZOA 3EFFK 4BIUA 4CZZA 2EINB 2DYSC 1KD1W 2WLNA 5CA3A 3CMEV 3AEIA 3NXSA 2XAGA 5E1AC 1NBMG 3WG7B 3HB3B 3MHHC 1K3EA 2JJ2G 1Q82W 2EIMB 3I56V 4MTXA 1V54C 3EHBB 3SPHA 1H8EG 3STLC 1H38A 2HVKC 2GHYA 4GX0A 4QE7A 3ABKC 5FL7G 1YTFD 4P2ZA 2V1DA 3G4SV 1THZA 1I5XA 4TWKA 3ZCCA 4G28B 4WFFA 1PL0A 4QIWF 5LHIA 1W0JG 1M57C 4KP4A 2NNUA 3SPGA 3W7WA 4JGSA 2A79B 5L3FA 1P7BA 4N21A 3VOUA 1K33A 3CCSV 4XBFA 3DTUB 3T4DA 4QNHB 3CC4V 2ZR2A 2Y69B 2Z3YA 3K3WA 3SYOA 2ATKC 2A0LA 3TK1A 5LHHA 3E35A 2C2AA 3LSSA 4R6ZA 1FXHA 2EIJC 1GM8A 2IJKA 2HFEC 2QEXV 1M56C 4F4LA 2UXNA 4HYOA 4UV8A 3SPJA 1P4RA 3F7YC 3QO7A 3X2QB 2W0FC 1AI4A 1S3JA 2OCCB 4PDVA 4Z1MG 1Q86W 2ZDIC 4I5SA 4RUEA 3TETA 5L3DA 4JAUA 3H01A 3LDDA 5IY5B 2XAQA 4FJCC 3PJSK 1YITV 3OEHG 4HZ3A 3ASOB 2BOBC 2WLHA 3KG2A 1MABG 4N23A 3T4ZA 1NR1A 1AI5A 5L3EA 1PD3A 1JX9A 2WWWA 3E86A 5GW7A 1G8MA 1LNQA 2IH3C 4WFBV 2Y48A 4FPPA 1M90W 3OGCC 3UKMA 4XDJA 3D3IA 3FB8C 4H37A 3E8GA 2Q6AA 3T2MA 3AG3C 2X7RB 2YEVA 2NLJC 2XAFA 3JD3A 5L3GA 5CBGA 2R9IA 3CCQV 1AJQA 2ITCC 3IGAC 2HLDG 4BIZA 1E79G 3AG4B 4JTCB 1K4CC 3FB6C 4MTGA 1BMFG 1ENVA 1K8AW 4R50A 5KUMA 4PA3A 2AHYA 3STZC 2WLKA 4TT3G 4R8CA 1SZTA 3RVZA 2KB1A 1GTOA 4DXWA 2OTLV 3G6EV 1YSCA 4GCZA 1OCZC 3JYCA 3QO5A 3CCLV 1QLEC 1OCOB 2W6IG 3JCZA 2HVJC 2DYRB 1FXKC 3ZN1A 1DF5A 5HFLA 3ASNB 1HWYA 5B1AB 1MOFA 4XDKA 3AG1C 2ZXWC 1NVPB 1EFRG 2DW4A 3ZMTA 2JIZG 1M1KW 1YJ9V 5B1BC 1AROP 4FIPC 3FYEB 1FS0G 1XL4A 3P30A 1QR9A 4MVUA 5EBWC 2QTOA 3ZRXA 3RW0A 1RM1B 4GT1A 4WFGA 1S5HC 3W7SA 4RAIA 2HKOA 1I5YA 1AI7A 3M99B 1VQPV 4P9OA 5KA5A 3MHSC 4GX5A 5EBMC 5LGUA 1CP9A 1YJNV 2DWDC 4UXNA 3JD4A 5B3SC 4UVCA 5H6QA 5IYDO 1Q81W 1S77D 3SYCA 4QPKA 2ZD9A 3QO8A 3SPCA 4WCEV 3ABTA 1EZJA 2F43G 1F4NA 4J9YB 5IYBO 4WFAV 3ABMC 1UJWB 5KUKA 2WAMA 2Q69A 3GWOA 1E1QG 3LDEA 2B1IA 1OCCC 2DQ0A 1L1FA 3OMAB 3LUTB 1VQ4V 1KP2A 1SESA 5KA6A 1J95A 2HR3A 2XAJA 2EINC 4QJFB 3MD0A 4LCUC 3FB5C 4L87A 4JAVA 3A0RA 1YI2V 4X89A 3AG2B 1NR7A 3ZIAG 1OCRC 2WLIA 1JOYA 3WG7C 3RBZA 2EILB 1QR8A 2EBOA 4U7OA 3BY6A 4PA7A 4UVBA 1H8HG 2EIMC 1AI6A 3SYAA 3ZRWA 4UVAA 4MVRA 4PDLA 5J9PC 3CC2V 1SRYA 2JEUA 2EIKC 1K9MW 2LP7A 1Y66A 1PNMA 1R6NA 2B1GA 4JTDB 3CYOA 1JVMA 3CCJV 3CCVV 2WLLA 1QVGU 1OHHG 1K97A 3K04A 3ZMUA 4LC1A 1YHQV 1NH2B 2IJHA 2UXXA 4RO2A 5IDJA 1QVFU 3E8FA 1VQNV 4FMTA 5DN6G 5CN0A 2Q68A 4ZKIA 4JYBA 2X6AA 1IXMA 4BW5A 4MW8A 2CK3G 4J9ZB 4PELA 3LDCA 4G27B 5DM6V 2XASA 2QM7A 3CXCU 3ZRWB 1NKDA 3OEEG 1DLBA 2Y69C 4BAYA 3ABLB 3E83A 1VQ9V 1F23A 3IFXA 3OUFA 4JASA 5IYCO 4MS2A 2IJIA 5C93A 4GX2A 3RVYA 4MSWC 1RPOA 1OCZB 1TUEB 3ZRSA 4H33A 1E1RG 4XDLA 4OXSA 3F5WC 2IW5A 1KP3A 1YJWV 1RPRA 1DTOA 2XOKG 4P30A 1VQMV 2YSUB 3K0GA 3W7XA 1R73A 2X6BA 5CMUA 3X2QC 2M7WA 1KECA 1PKXA 1R3KC 3OUSA 1ZWIC 2OCCC 1V55B 5CBFA 4E2LA 2A9HA 2D3OW 3ZN0A 4X88A 4RQFA 1BL8A 4HAMA 2DYSB 1VQKV 3D36A 4Q20A 5IY5C 1KC8W 4JYCA 1QCEA 2QA4V 3ZRVA 1YIJV 5CBHA 3ASOC 4MTOA 3W7TA 2YEVB 2OTJV 4MVOA 2QKSA 2W6JG 3K03A 2H94A 5H9CA 2LFSA 3OMNB 1GM7A 1V54B 1FXVA 3K79A 2XAHA 3K9AA 4PA6A 1FFTB 1S76D 2QE7G 4GX1A 4MVSA 2AHZA 2R9RB 3ABKB 1Q7YW 1K7DA 1MSWD 1YTFB 5LBQA 1KKDA 3CD6V 1BHBA 1BHAA 1WPXA 3AG4C 3OR7C 1SETA 2P90A 1VQOV 2X0LA 1EBOA 1M57B 2JEXA 2IJJA 2WSSG 3OR6C 1W2BU 1VQ5V 2WLMA 1KQSU 4KFMA 2B5UA 3GB7C 1COWG 1GK9A 3OW2U 3E89A 2H8PC 4FK5C 2ZDIA 1VQ6V 1VQLV 1K34A 1OCOC 2EZPA 3R65A 2DWEC 3JD0A 1G4YB 1JQ0A 1CEZA 1H2GA 4WFEA 5B1NA 4R7CA 3F7VC 4LBEC 3CC7V 1GKFA 1OCRB 5BZBA 2DYRC 3ETDA 1B6QA 3CCEV 3VBBA 3E8HA 1WLEA 3ASNC 3JD2A 2X6CA 4PA4A 5B1AC 2XNDG 1NVPD 2EIJB 1GM9A 4LP8A 1M56B 3IC7A 3B77A 3K06A 4RUFA 1AJPA 2PI4A 2EIKB 1OZ0A 3OE7G 2P6JA 5L3CA 2P7TC 3DGEA 3E8BA 1RM1C 5LGNA 2EJRA 4MVQA 4ASUG 1DF4A 4WFHA 3K0DA 1VQ7V 5L3BA 2V7QG 4QE9A 2WLJA 4TSFG 1JJ2U 3FB7C 2DQ3A 4YXWG 3CMAV 2LFRA 3T1CA 3SJQC 4JPRA 1GMGA 3CPWU 3OAAG 3FYIB 3ZMZA 3B8MA 4MW3A 4MTFA 1K4DC 3OFNG 3LNMB 4MVMA 5H6RA 3G71V 4QPJA 3ZMVA 3CP1A 3AG3B 3CCRV 1PNLA 5B1OA 1FXKA 5HFMA 1M9NA 2WLIB 1Y4MA 1F51A 1MG1A 5EBLC 4P9PA 1K5SA 2FTKA 2HG5C 3BEHA 4PA9A 3E2EA 1F4MA 1PNKA 3B8NA 4ZBMA 3ZJZA 3OM3B 2QM8A 2Q67A 3AG2C 4PDRA 1ORQC 1GO3F 1K73W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG U;  1N8R W;  1VQO V;  2OTJ V;  3CCQ V;  3CC4 V;  1Q81 W;  1Q86 W;  3G71 V;  1W2B U;  1VQ5 V;  1YHQ V;  1YJW V;  1KQS U;  1QVF U;  1YI2 V;  3I55 V;  1M1K W;  3CCR V;  3OW2 U;  1VQM V;  3CCV V;  1VQN V;  1YIT V;  4WCE V;  1YJ9 V;  1R73 A;  1K73 W;  1KD1 W;  1VQL V;  1VQ6 V;  3G4S V;  1K8A W;  4WFA V;  4WF9 V;  3CCU V;  3CCM V;  1VQ7 V;  5DM6 V;  3CC7 V;  3CME V;  1JJ2 U;  2D3O W;  2QEX V;  3CXC U;  1YIJ V;  2OTL V;  3G6E V;  1Q7Y W;  3CC2 V;  4WFB V;  1S72 V;  1M90 W;  3CCL V;  3CCE V;  1VQK V;  1K9M W;  3CMA V;  1VQ4 V;  1VQ9 V;  1VQP V;  3CD6 V;  1KC8 W;  1VQ8 V;  1NJI W;  1Q82 W;  3CPW U;  2QA4 V;  3I56 V;  3CCJ V;  1YJN V;  3CCS V; 
#chains in the Genus database with same CATH topology
 4JF3 A;  1S0V A;  2PI5 A;  2WLL B;  2Q0A A;  1N4C A;  2Z5U A;  2QJ1 A;  4FLW A;  1L0N H;  4EEQ A;  1IXB A;  3WB0 A;  5ITZ A;  5LXT A;  2WPD G;  3JAS A;  1T5E A;  4EKW A;  1S72 V;  1XL6 A;  2IU0 A;  4JZ2 A;  1XMO B;  4H0L B;  4J10 A;  3QNE A;  3TCU A;  1L0L H;  4NYK A;  1ZX3 A;  1H2M A;  3N2K A;  1KUQ A;  3P32 A;  3ABL C;  4WF9 V;  1XBL A;  3CCM V;  2GSM B;  2KQX A;  1WA8 A;  5LP6 A;  1P84 F;  1R3J C;  5AG2 A;  3ABM B;  4B7K A;  3WB1 A;  1FAF A;  2ZR3 A;  4DV0 O;  2BOC C;  4UCS A;  3SYP A;  3SYQ A;  4AQY B;  4I50 A;  4IYI A;  1OCC B;  1ROP A;  1V55 C;  1Q5O A;  3OMI B;  4DRX B;  2JDI G;  3HPL C;  4YIP A;  1XMQ O;  1NTZ H;  3J81 N;  2LO1 A;  3CRR A;  1SQX H;  3AEI A;  4DV3 B;  4X65 B;  3SJB C;  3H9V A;  3L74 H;  2DJV A;  3ZS8 C;  2EIM B;  3I56 V;  2YI9 A;  3K5L A;  4NXM B;  2BTQ A;  1V54 C;  1H38 A;  1FD9 A;  3IJ4 A;  2GHY A;  4FFB B;  2CH7 B;  1N36 B;  1HNW B;  5JCO A;  4O4I B;  3CRQ A;  4FLV A;  4JI0 B;  4KHP O;  2A7W A;  1FKA O;  4X1K A;  4JGS A;  4DV7 B;  3CRC A;  2A79 B;  5L3F A;  4LF7 O;  4XBF A;  1TVK A;  2ZR2 A;  3T1H B;  2AGA A;  4DW1 A;  4L8J A;  3E35 A;  4ICG A;  1IBK O;  2IJK A;  3GVM A;  4FLX A;  1IX9 A;  2F4V O;  2UXN A;  4F6R B;  4X1I A;  1WJZ A;  3FAV B;  3F7Y C;  3F5T A;  3S3W A;  1S3J A;  3SJA C;  3ZBH A;  2XHB A;  1Q86 W;  4K0K B;  3BAA A;  5L3D A;  3LDD A;  3JAK A;  1WNS A;  3PJS K;  3C3S A;  2QTS A;  4GUN A;  4LF5 O;  3ASO B;  2BOB C;  5JWP A;  2UUB O;  3T4Z A;  1NR1 A;  1PD3 A;  2WWW A;  3E86 A;  1M90 W;  4DR6 B;  1PPJ H;  3HKE A;  4J41 A;  2NLJ C;  3JD3 A;  4PI0 A;  2EJ7 A;  3CCQ V;  1AJQ A;  2ITC C;  4YJ2 A;  4BR6 A;  3AG4 B;  4JTC B;  1SZX A;  1ENV A;  1K8A W;  5KUM A;  2WLK A;  4R8C A;  1ZAU A;  3RVZ A;  4PHZ A;  1GAX A;  3MDS A;  1OCZ C;  4B3S O;  1QLE C;  3H1H H;  1FXK C;  5LMN O;  5HFL A;  1TA8 A;  5BY1 A;  3AG1 C;  2ZXW C;  3OT7 A;  1UFI A;  2PF4 E;  1YZB A;  5B1B C;  4BIO A;  1VIB A;  1VF6 A;  1WPB A;  2FB5 A;  5LOV B;  4DV6 B;  1XOU A;  3L75 H;  3P30 A;  5EBW C;  2QTO A;  3RW0 A;  5H5N A;  1AVM A;  1RM1 B;  4WFG A;  3W7S A;  5J2U B;  1NTM H;  1BZK A;  5EBM C;  1CP9 A;  4UXN A;  3BRC A;  4LH7 A;  1S77 D;  3SYC A;  4DR7 O;  4QPK A;  2Q4P A;  3SPC A;  4PV1 B;  2F43 G;  5IYB O;  4NXN O;  4J7J A;  2ZT9 B;  2O57 A;  1UJW B;  4ZHQ B;  1E1Q G;  5DEC A;  2DQ0 A;  2PYL A;  3GWK C;  1SES A;  4KL1 A;  2EIN C;  3MD0 A;  2UXD B;  5JVD B;  1SQG A;  3RWR D;  4JI5 B;  4CS3 A;  3ZIA G;  4CS4 A;  3P3N A;  2DOS A;  4FLT A;  2QKA A;  4U7O A;  4UVB A;  4EFB A;  5KMG A;  4MVR A;  1KBH A;  4LNU B;  5J9P C;  2EIK C;  2Q8V A;  2LP7 A;  3H1L H;  3RYC B;  1B3Q A;  1N33 B;  4FLY A;  2B1G A;  2Q7G A;  4CH5 A;  1QVG U;  1J5E B;  3BVO A;  2IJH A;  3E8F A;  2ZE6 A;  2Q68 A;  3UQ8 A;  1IXM A;  4DR1 B;  3Q4H B;  4FLZ A;  2CK3 G;  2XAS A;  3ZRW B;  1YCI A;  3WU2 Z;  4EFE A;  1VQ9 V;  3OUF A;  4JAS A;  5IYC O;  2FML A;  5KAI Z;  1XIL A;  2IJI A;  4AQY O;  4GX2 A;  3ICX A;  4MSW C;  2CTW A;  1OCZ B;  4ZIB A;  4H33 A;  1OV9 A;  4XDL A;  3JAW A;  2IW5 A;  2E5L B;  1RPR A;  2XOK G;  1VQM V;  4YY3 B;  2QWP B;  3X2Q C;  1PKX A;  3D8C A;  4DV3 O;  4X65 O;  2Q7H A;  2YDE A;  1D5A A;  4X88 A;  1SC5 B;  1BL8 A;  2DYS B;  1BGY H;  4Q20 A;  2N04 A;  4JYC A;  1QCE A;  2E74 B;  3ZRV A;  1NTK H;  3W7T A;  2YEV B;  5K1P A;  3K03 A;  4YJ3 A;  3CRA A;  1HNW O;  2JGD B;  1FXV A;  4JI0 O;  5GON B;  2VRZ A;  1FFT B;  1S76 D;  4GX1 A;  4LFB O;  2QM4 A;  2AHZ A;  4TV8 A;  4IGG A;  4CH3 A;  1BHA A;  3B2E E;  1SET A;  1H2N A;  2P90 A;  4C7U A;  1VQO V;  4LWS B;  2X0L A;  3OTF A;  4B08 A;  1A32 A;  3T1H O;  3RGB A;  4DYL A;  2WLM A;  3DC6 A;  3E89 A;  1BQ0 A;  1MSD A;  2QKC A;  1IUR A;  1I08 A;  4JI7 O;  2D2C B;  2DWE C;  4X20 A;  2OWO A;  1JQ0 A;  5B1N A;  4JI3 B;  3CC7 V;  1Q6H A;  2OCH A;  4DV2 O;  3E8H A;  2X6C A;  2XND G;  1M4U A;  4K0K O;  1M56 B;  1HP8 A;  2YIC A;  2YS8 A;  4I4T A;  4KXR A;  2EIK B;  5EZY B;  2PI4 A;  1OZ0 A;  2R72 A;  2P6J A;  4F6E A;  2P7T C;  2GUZ A;  4DV0 B;  4LH6 A;  3CHX A;  3HKB B;  4MVQ A;  4ASU G;  3CSX A;  2V7Q G;  4QE9 A;  3UT5 A;  4TSF G;  1XMQ B;  4IIJ B;  1JJ2 U;  4DR6 O;  4YXW G;  3KZI Z;  5FNV B;  4DR3 B;  4U3F H;  4ZI7 B;  3T1C A;  4AHC A;  3RYH A;  4U3J A;  5H6R A;  3JAT A;  3CP1 A;  4WBN B;  1RFY A;  4EB6 A;  5BMV A;  1FXK A;  2ZIO A;  3N2G A;  1TGO A;  1Y4M A;  5EBL C;  4P9P A;  2HG5 C;  3ZHV A;  3AG7 A;  3B8N A;  3ZJZ A;  2L35 A;  3AG2 C;  4UB6 Z;  1K73 W;  3FKS G;  2EIL C;  1HNZ B;  5JCO C;  4LF7 B;  4UUJ C;  1GN6 A;  3O9O A;  5EC1 C;  4AIL C;  1GN4 A;  2ZE8 A;  4W4K A;  1WB7 A;  4MVZ A;  2F4V B;  4UCT A;  4JTA B;  4X8A A;  3RYI B;  3APQ A;  4Z1V A;  1N8R W;  1JCH A;  1R3L C;  5J2T B;  1ZSP A;  2NR5 A;  2ILM A;  4DR2 B;  4E4E A;  1QBZ A;  2JJ1 G;  5B3S B;  2FKX A;  4LF5 B;  2Z0A A;  2JRI A;  4RQE A;  3JAS B;  1AR1 B;  1K92 A;  2ZQM A;  5JQG A;  2UXD O;  2IH1 C;  3LSQ A;  4JI5 O;  1JPX A;  4LFC B;  1PP9 H;  2CTQ A;  1FFX B;  1KD1 W;  4CZZ A;  4LF8 O;  1XHZ A;  3NXS A;  3QG5 A;  5KX5 A;  1Y76 B;  1WA8 B;  5LP6 B;  1N33 O;  2Q0O C;  1NU1 H;  3HB3 B;  4X64 B;  1J5E O;  2JJ2 G;  1Q82 W;  4B3S B;  4PI2 A;  3EHB B;  2YXL A;  3JAL A;  2LJ2 A;  3STL C;  5KHG A;  5LMN B;  2ETN A;  3ABK C;  1DGS A;  3G4S V;  2CE4 A;  4LF4 O;  3D36 C;  1JR9 A;  4I9Q A;  1PL0 A;  4DV1 B;  4B3R O;  2QR4 A;  2QWR B;  1M57 C;  3SPG A;  3W7W A;  3L71 H;  3CXH F;  3ZHQ A;  5LYJ A;  3VOU A;  1K33 A;  3CCS V;  2N05 A;  2YIB D;  3JSN A;  2RMK B;  2JS3 A;  5EYP A;  1Y6X A;  1AP6 A;  2Y69 B;  3K3W A;  4YY3 O;  3SYO A;  1I0H A;  2ATK C;  1SQQ H;  2A0L A;  4DR7 B;  2AW9 A;  4FM0 A;  2Y0I A;  2HFE C;  4NXN B;  4HYO A;  4UV8 A;  3SPJ A;  1P4R A;  5DED A;  3SGI A;  4X1K B;  3LSU A;  2OCC B;  4I0X A;  2UXB O;  5KAF Z;  3TET A;  1TVK B;  1KB9 F;  1MZF A;  2ADQ B;  2XAQ A;  2P4V A;  4FZ1 A;  3KG2 A;  2FL4 A;  4NTY A;  1AI5 A;  3K5N A;  4WFB V;  4X1I B;  3MAQ A;  3OGC C;  3UKM A;  4AI8 A;  4LFA B;  2K9P A;  4H37 A;  1KYO F;  4QGP A;  3AG3 C;  2X7R B;  1XNR B;  3IGA C;  1VMG A;  2HLD G;  3BFR A;  4BWA A;  1K4C C;  3JAK B;  1BMF G;  4JI3 O;  4DW0 A;  4PA3 A;  2AHY A;  3CEI A;  4TT3 G;  2ARH A;  1SZT A;  1GTO A;  1YXB A;  1YDX A;  1OCO B;  2W6I G;  4TOI A;  3HKE B;  2KG7 B;  2ZNI A;  3ZN1 A;  5B1A B;  4YJ2 B;  2VQF O;  1NVP B;  1EFR G;  2GTA A;  3M8A A;  2OIG A;  4FIP C;  1XL4 A;  3EVK A;  1QR9 A;  2RCV A;  4DR3 O;  5EIB D;  1SQF A;  5H2F Z;  4RAI A;  1I5Y A;  3ETQ A;  3KCY A;  3M99 B;  4P9O A;  2E75 B;  3TXS A;  3OTO B;  3MHS C;  3RFR A;  4TUY B;  1U97 A;  4GX5 A;  5LGU A;  2DWD C;  3JD4 A;  1VEW A;  2PTM A;  3CWB H;  4UVC A;  5JJN B;  5IYD O;  1HDJ A;  2CGN A;  1H2K A;  3AK3 A;  2ZD9 A;  4X1Y A;  4WCE V;  3ABT A;  2L6L A;  4K35 A;  2KKW A;  1O9H A;  2WAM A;  3GWO A;  4UB8 Z;  5C8Y B;  4LFB B;  2B1I A;  1VQ4 V;  3OMA B;  3LUT B;  1KP2 A;  1HNZ O;  2HR3 A;  3SDL A;  4LCU C;  2DE0 X;  5K1X A;  3H1J H;  1YI2 V;  3BA9 A;  3CJH A;  2WLI A;  3K58 A;  4LR3 A;  3WG7 C;  2FYU H;  4PA7 A;  4JI7 B;  3DXR A;  4UVA A;  2Y4T A;  4DV5 O;  1K9M W;  4DV2 B;  3CYO A;  2WLL A;  2F66 C;  3K04 A;  4DR2 O;  1YHQ V;  1NH2 B;  5CB4 B;  4GKJ O;  5IYZ B;  2PY5 A;  1VQN V;  4JI2 B;  5GTH Z;  1Z5V A;  5FPR A;  4O4H B;  4BW5 A;  2PYJ A;  5KHH A;  2QM7 A;  1F7Y A;  5KMG B;  4YHH B;  3OEE G;  3NR7 A;  3ABL B;  1F23 A;  3IFX A;  1G6U A;  5C93 A;  1RPO A;  3JSL A;  2JS5 A;  1E1R G;  4LFC O;  3BHP A;  1URF A;  4P30 A;  3C90 A;  4O4J A;  3OUS A;  4K3A A;  1ZWI C;  1V55 B;  2VQE O;  5CBF A;  1D2D A;  1AR4 A;  5LL6 Y;  4X64 O;  3D36 A;  3ZHU A;  3H1I H;  5IY5 C;  1KC8 W;  5CBH A;  1D5N A;  3JAW B;  4O2B A;  5A2Q N;  3AK2 A;  4D6T H;  2YID A;  3OMN B;  1GM7 A;  1V54 B;  4DV1 O;  3K9A A;  1SS3 A;  2KSD A;  4JI8 O;  2RNB A;  1RSO B;  2R9R B;  1NI8 A;  4TV9 A;  3D3Q A;  1MSW D;  1YTF B;  5LBQ A;  1NT2 B;  3OR7 C;  2YXH A;  1PL4 A;  1ZL8 B;  2IJJ A;  2P5O A;  1VF7 A;  1COW G;  3BA8 A;  4YJ3 B;  2CH7 A;  2B9Z A;  2ZNJ A;  1VQ6 V;  1VQL V;  1G4Y B;  1H2G A;  4DUY B;  3F7V C;  4LBE C;  3BAB A;  5BZB A;  2DYR C;  3ETD A;  3O65 A;  1B6Q A;  3VBB A;  3ASN C;  1NVP D;  4BW9 A;  4RUF A;  3IC7 A;  1TAE A;  3K06 A;  4DV4 B;  1AJP A;  3OE7 G;  1Y74 A;  4K8X A;  1NZ6 A;  3HKD B;  3DGE A;  5CA1 B;  4CH4 A;  1WP8 A;  4GZR B;  3RYF A;  1DF4 A;  3G80 A;  5L3B A;  1W59 A;  4LF8 B;  4LFA O;  1TUB A;  2DQ3 A;  3FB7 C;  4NR1 A;  1DK1 A;  3E22 A;  3CMA V;  2YIA A;  3CB2 A;  3ZHR A;  3SJQ C;  4JPR A;  3CPW U;  1XNR O;  5KHJ A;  3T1Y O;  5B5E Z;  4I4T B;  4W4L A;  4MW3 A;  5A9G A;  2RDC A;  3LNM B;  4RWU A;  2GUZ B;  2AXT Z;  2ZKO A;  1PNL A;  1XRE A;  5HFM A;  1M9N A;  3BPZ A;  3UT5 B;  4FZ0 A;  4LF4 B;  3TXQ A;  2GV9 A;  1MA1 A;  3BEH A;  1PM9 A;  1FPO A;  4ZBM A;  4B3R B;  3OM3 B;  1Q8I A;  1BS3 A;  4PDR A;  1GO3 F;  2HHH B;  1S5L Z;  1QLE B;  4K8Z A;  3JAT B;  1SA0 A;  3ML0 A;  4EB6 B;  4TQF A;  5BMV B;  1FXK B;  4CBC A;  3N2G B;  4J80 A;  3AG1 B;  2F95 B;  2ZXW B;  4HNA A;  1VF5 B;  1IZ3 A;  1NQT A;  1Q3E A;  3ZX6 A;  4H44 B;  3OTO O;  5B1B B;  1NH2 D;  4UV9 A;  2IU3 A;  2MK3 A;  2HP8 A;  1NJI W;  3ETG A;  1K5Q A;  4B3M B;  3K08 A;  1YEW A;  4I9W A;  2UXB B;  2OT5 A;  2JK5 C;  4OPH A;  5LGT A;  3A2F A;  3WFV A;  3CCU V;  4B3T B;  2UUC B;  1R3I C;  5IJ9 B;  4JYY A;  2K1E A;  5LHG A;  2JGU A;  3UM7 A;  4MT8 A;  2YUA A;  2VS0 A;  3JD1 A;  4PDM A;  1W0K G;  4DO2 A;  2EZO A;  3EFF K;  4BIU A;  2EIN B;  2P06 A;  4IL6 Z;  4D7S A;  3JAR B;  2VWJ A;  5E1A C;  1NBM G;  3G67 A;  1AP5 A;  2F23 A;  3MHH C;  1K3E A;  2CDY A;  5JQG B;  5JVD A;  3SPH A;  1H8E G;  4JI2 O;  1Q90 D;  4GX0 A;  4QE7 A;  2UU9 O;  1YTF D;  2E3C A;  2QWQ B;  2V1D A;  2VQF B;  3OD4 A;  4LNU A;  4YHH O;  2UUA B;  4QIW F;  4O4L A;  2XTA A;  5KX5 B;  3RYC A;  2RJZ A;  4N21 A;  4DUZ B;  4QNH B;  3DTU B;  1GRJ A;  2Z3Y A;  5IJ0 B;  4X62 O;  4YIO A;  2LW1 A;  1M5I A;  5LHH A;  3LSS A;  3Q4H A;  4R6Z A;  2EIJ C;  3KKY A;  3QF7 A;  2CGO A;  1QNM A;  2BSK B;  3X2Q B;  3QO7 A;  1HR0 O;  2W0F C;  4PDV A;  5LYJ B;  2ZDI C;  4GKK B;  5LMU O;  4O2A A;  4RUE A;  4JAU A;  1XHX A;  4FJC C;  1HNX B;  2Y4U A;  4CS2 A;  4HZ3 A;  3ZED A;  2WLH A;  4N23 A;  1Q6I A;  5L3E A;  1JX9 A;  5GW7 A;  1G8M A;  1LNQ A;  2ZE7 A;  3S3X A;  4JI6 O;  2EUL A;  2WA4 A;  3D3I A;  3FB8 C;  3T2M A;  3BCC H;  4DV5 B;  2YEV A;  5L3G A;  2PZS A;  2ZIM A;  4I0X B;  2OIE A;  4BIZ A;  1E79 G;  1PV0 A;  2NN4 A;  3FB6 C;  5LA6 A;  4MTG A;  4DUY O;  5GON A;  4GKJ B;  3ZHS A;  1XUQ A;  5KHI A;  4UCO A;  4DXW A;  2KB1 A;  3G6E V;  1YSC A;  4GCZ A;  5ITZ B;  5LXT B;  3QO5 A;  4J42 A;  5F2V O;  4DV4 O;  1AB3 A;  3U0Z A;  1EN4 A;  2HVJ C;  3JCZ A;  2LW7 A;  3U10 A;  2LGW A;  2VWK A;  4Z2W A;  3FX7 A;  3J80 N;  2DW4 A;  2JIZ G;  1R1B A;  3N27 A;  3N2K B;  2YIB A;  1ARO P;  4MVU A;  2P4K A;  2A06 H;  1B06 A;  2QWN B;  4H13 B;  4JAA A;  2HKO A;  3HKC A;  2VQE B;  1JA8 A;  1VQP V;  1AR5 A;  1P49 A;  5H6Q A;  4I50 B;  5IE9 A;  3QO8 A;  1EM1 A;  1EZJ A;  1IVS A;  1ZLZ A;  3ABM C;  2PUS A;  5KUK A;  5BXZ A;  4J7K A;  4DR5 B;  3G6B A;  4JI8 B;  4ZI7 A;  4UCV A;  1OCC C;  5CA0 A;  1L1F A;  4X9Q A;  1I94 B;  2HHH O;  1GN2 A;  5KA6 A;  1J95 A;  4QJF B;  1MMM A;  2BTQ B;  3FB5 C;  4L87 A;  3K5O A;  4JAV A;  3A0R A;  4JYA O;  4PJ0 Z;  3UO3 A;  3AG2 B;  2R70 A;  2AZ0 A;  1OCR C;  5B66 Z;  2EIL B;  2EBO A;  3KCX A;  2EIM C;  1AI6 A;  4PDL A;  1SRY A;  1WP7 A;  1Y66 A;  2QWO B;  1PNM A;  1R6N A;  4JTD B;  1BCC H;  1JVM A;  4J7Z A;  3CCV V;  3TGU H;  4B3M O;  1QVF U;  2UXX A;  4RO2 A;  3CJH B;  4B3T O;  2UUC O;  5DN6 G;  4ZKI A;  1HW7 A;  2X6A A;  2V4D A;  1MZE A;  4J9Z B;  3LDC A;  4G27 B;  4PEL A;  5DM6 V;  3CXC U;  3DXR B;  1CXZ B;  1DLB A;  4NTW A;  4BAY A;  3E83 A;  3RYI A;  4HBN A;  2Y0P A;  1TUE B;  3ZRS A;  3JAM N;  5J2T A;  3F5W C;  2W0X A;  1KP3 A;  3IC9 A;  3T1Y B;  1YJW V;  2XT9 A;  3J7A U;  1R73 A;  5CMU A;  1YVW A;  2Q5Z A;  2M7W A;  4IHJ A;  1KEC A;  1R3K C;  3FD9 A;  4E2L A;  2A9H A;  2D3O W;  1WAZ A;  1UPG A;  4HAM A;  3P3P A;  3ASO C;  4MTO A;  4MVO A;  3CE2 A;  3DSQ A;  2W6J G;  2H94 A;  1FFX A;  4OX9 O;  2BCC H;  2UXC O;  5H9C A;  2ZM6 O;  1O9G A;  1JFF A;  4O4J B;  2UUA O;  1LUV A;  3K79 A;  2QE7 G;  1Y76 A;  4X66 B;  3ZHT A;  3ABK B;  4I55 A;  1Q7Y W;  1KU9 A;  1I7F A;  4DUZ O;  1WPX A;  3AG4 C;  1BT8 A;  1EBO A;  1M57 B;  4CC5 A;  2WSS G;  3OR6 C;  1W2B U;  4O2B B;  2B5U A;  3IAY A;  4ABM A;  1GK9 A;  2F93 B;  1FJG O;  4FK5 C;  2ZDI A;  4ZOL A;  2EZP A;  3R65 A;  3JD0 A;  4R7C A;  1OCR B;  1GN3 A;  2G38 A;  4TV9 B;  3JD2 A;  1WLE A;  4A5U B;  5JH7 A;  4JV5 O;  3A8T A;  1GM9 A;  4GKK O;  1XQ8 A;  3APO A;  4Q6G A;  1HNX O;  1RM1 C;  3QTC A;  4WFH A;  2WLJ A;  1BQZ A;  1H2L A;  2CAZ C;  4IT5 A;  2JVD A;  5IWA B;  3OAA G;  3FYI B;  4NTX A;  3ZMZ A;  3B8M A;  4MVM A;  1K4D C;  1Y74 B;  3G71 V;  2RQ6 A;  3ZMV A;  3AG3 B;  2GBO A;  3CX5 F;  3CCR V;  4JI1 B;  5B1O A;  3RYF B;  2UU9 B;  2CUG A;  1F51 A;  1IBM O;  4UCR A;  1QHT A;  1H2S B;  1TUB B;  1SF9 A;  3E22 B;  2QM8 A;  2Q67 A;  1ORQ C;  2HJD A;  2LGQ A;  3U11 A;  1QLN A;  5JJJ B;  2ITD C;  3ZMS A;  1X59 A;  3ABU A;  4X62 B;  4G2K A;  1AJN A;  1NS1 A;  3EXA A;  4LF9 O;  4OGQ B;  1Q43 A;  3K5M A;  1N0N A;  3RT3 C;  3B4S A;  1VQ8 V;  4LF6 B;  2KG7 A;  2LQT A;  1HR0 B;  2MW2 B;  1QU7 A;  1SA0 B;  4DRX A;  5LMU B;  3ETE A;  2ADP A;  5BR8 O;  2CTP A;  4DR5 O;  1CPY A;  1KMI Z;  1WN7 A;  3CS5 A;  4HNA B;  1I94 O;  2ODM A;  1XEQ A;  4JI4 B;  1R6T A;  4TUY A;  1SER A;  1Z5W A;  4JI6 B;  1R6K A;  1L8D A;  1SKV A;  4KUM A;  2HJF C;  3SR2 C;  4NVP A;  3W7U A;  5EC2 C;  3SPI A;  4I7Z B;  1XNQ B;  2ZIN A;  4U7N A;  3I55 V;  5EK0 A;  1BSM A;  4FFB A;  3VQY A;  2P67 A;  2DYS C;  4O4I A;  3FFQ A;  2WLN A;  1N32 O;  5C8Y A;  5CA3 A;  3CME V;  1OJH A;  2DMX A;  4GYC B;  2XAG A;  3K57 A;  4TV8 B;  1SQP H;  4B7E A;  3WG7 B;  3CRM A;  3A0B Z;  1KKC A;  1IBL O;  4DR4 B;  4MTX A;  1FYJ A;  4FVM A;  1YF2 A;  2HVK C;  5FL7 G;  4P2Z A;  1P7G A;  1THZ A;  1I5X A;  3JCU Z;  4TWK A;  2RN9 A;  3ZCC A;  4G28 B;  4WFF A;  4X20 B;  4F6R A;  5LHI A;  1WB8 A;  1W0J G;  2BE3 A;  3FAV A;  4KP4 A;  2NNU A;  3AK1 A;  3LNN A;  1P7B A;  3QVN A;  3T4D A;  3UCS C;  5CB4 A;  3CC4 V;  3VQV A;  5IYZ A;  2GTS A;  3TK1 A;  1Y67 A;  2C2A A;  1VAR A;  4O4H A;  1FXH A;  1GM8 A;  2OYQ A;  5GTI Z;  1Z2G A;  2QEX V;  1M56 C;  4F4L A;  1XMO O;  4O4L B;  2XUM A;  3THO A;  5D5P A;  1AI4 A;  4Z1M G;  2DN9 A;  4I5S A;  3RYH B;  4U3J B;  3L72 H;  5IY5 B;  3H01 A;  2E76 B;  1YIT V;  3OEH G;  4JYA B;  1JJO A;  2Q7E A;  4X66 O;  1MAB G;  2N74 A;  3K9S A;  2F1M A;  2IH3 C;  2Y48 A;  4FPP A;  4XDJ A;  3E8G A;  2Q6A A;  3OGI B;  3R66 A;  2XAF A;  5CBG A;  1EZV H;  2R9I A;  4O2A B;  4FM2 A;  3RN4 A;  4FFK A;  5LOV A;  4R50 A;  3STZ C;  1RSO A;  4OPA A;  2PGG A;  2EX3 A;  2OTL V;  5J2U A;  3JYC A;  3CCL V;  1M93 A;  1N34 B;  3UO2 A;  4NXM O;  1ZL8 A;  2DYR B;  2H3O A;  1DF5 A;  4DK1 A;  3ASN B;  1HWY A;  1MOF A;  1N36 O;  4XDK A;  1M1K W;  3ZMT A;  1YJ9 V;  5LA6 B;  3FYE B;  1FS0 G;  1G1X B;  1US6 A;  3ZRX A;  4ZHQ A;  3H1K H;  4DV7 O;  4GT1 A;  2ZE5 A;  1S5H C;  5EIB C;  2CTR A;  1B04 A;  5IWA O;  1AI7 A;  1EN5 A;  1JMK C;  3VQX A;  5KA5 A;  1YJN V;  2P22 C;  1LUW A;  3HKD A;  5B3S C;  5CA1 A;  1Q81 W;  4JI1 O;  3TJT A;  1F4N A;  4J9Y B;  2WA3 A;  4WFA V;  4OX9 B;  2UXC B;  2ZM6 B;  2Q69 A;  2HEP A;  3LDE A;  3HKC B;  1SQB H;  4UCU A;  2QDO A;  1RP3 B;  3K59 A;  2XAJ A;  1EN6 A;  3SJC C;  4PD4 F;  1AIL A;  2AZ2 A;  3JAL B;  4X89 A;  1V9P A;  1NR7 A;  5LP6 C;  1JOY A;  3RBZ A;  1FJG B;  1QR8 A;  1Q6U A;  3BY6 A;  3SYA A;  1H8H G;  3ZRW A;  3CC2 V;  3PN1 A;  2JEU A;  4LF6 O;  2ZCE A;  5CA0 B;  3L70 H;  3CCJ V;  4UFZ A;  4JV5 B;  5E79 Z;  1OHH G;  1K97 A;  5EYP B;  3ZMU A;  4LC1 A;  4TQD A;  5IDJ A;  4FMT A;  5CN0 A;  4JYB A;  1N0J A;  4MW8 A;  3L73 H;  1XDC A;  4JI4 O;  1NKD A;  4J11 A;  4KHP B;  2Y69 C;  2BTO A;  4MS2 A;  3RVY A;  1XNQ O;  1VP7 A;  4OXS A;  2YC0 A;  3B09 A;  4DV6 O;  1DTO A;  2QGN A;  2YSU B;  3K0G A;  3W7X A;  2X6B A;  3A0H Z;  2JGD A;  2YXY A;  2OCC C;  5IJ9 A;  1IBK B;  3ZN0 A;  3L9D A;  4RQF A;  1VQK V;  1IBM B;  2R9A A;  4DR4 O;  4D7T A;  4LWS A;  1X4T A;  2QA4 V;  1YIJ V;  4GLX A;  4FLU A;  2OTJ V;  4CH6 A;  2QKS A;  2LFS A;  1ZTE A;  3JAR A;  4IHJ B;  2XAH A;  4PA6 A;  5D5Q A;  4MVS A;  2Q73 A;  2UUB B;  1K7D A;  1KKD A;  3CD6 V;  1BHB A;  4LF9 B;  3VQW A;  1ZUQ A;  5EZY A;  2GDS A;  5FLX N;  5FPO A;  2JEX A;  1VQ5 V;  1KQS U;  4KFM A;  1GH6 A;  3GB7 C;  3I5D A;  3OW2 U;  2H8P C;  3HKB A;  1K34 A;  1OCO C;  1JFF B;  3HR0 A;  3WB2 A;  1CEZ A;  1U96 A;  4WFE A;  4IIJ A;  1QQC A;  1BE3 H;  1GKF A;  2QSA A;  5BR8 B;  5FNV A;  4I55 B;  3C3T A;  3CCE V;  4PA4 A;  5B1A C;  2EIJ B;  4JZG A;  1S5J A;  4LP8 A;  3B77 A;  5KHK A;  5IJ0 A;  5L3C A;  4WBN A;  3E8B A;  4IYH A;  5JJE B;  2YI8 A;  4CC6 A;  4DR1 O;  3M7M X;  5LGN A;  2EJR A;  4X1Y B;  4ZOL B;  1SQV H;  3B40 A;  1LR1 A;  3K0D A;  1VQ7 V;  1IDS A;  2BSK A;  4FM1 A;  1N32 B;  5KLV H;  3DC5 A;  2LFR A;  1XI1 A;  5JH7 B;  1GMG A;  2M6Y A;  2E5L O;  1VF6 C;  4MTF A;  3OFN G;  4QPJ A;  5TIS Z;  1IBL B;  4NKG B;  2IM9 A;  2WLI B;  4NB5 A;  4DK0 A;  5IT9 N;  1MG1 A;  1K5S A;  2FTK A;  1N34 O;  4PA9 A;  2IBZ H;  3E2E A;  1F4M A;  1PNK A;  2Q9L A;  1MNG A;  2A3Q A; 
#chains in the Genus database with same CATH homology
 3FKS G;  4JF3 A;  1S0V A;  2PI5 A;  2WLL B;  1QLE B;  2EIL C;  1QLN A;  3ML0 A;  4UUJ C;  2ITD C;  2Z5U A;  5EC1 C;  3ZMS A;  3ABU A;  1FXK B;  4CBC A;  4G2K A;  1AJN A;  3AG1 B;  2ZXW B;  2WPD G;  1NQT A;  4EKW A;  5B1B B;  1S72 V;  1XL6 A;  4MVZ A;  2IU0 A;  1NH2 D;  4UV9 A;  1VQ8 V;  2IU3 A;  2MK3 A;  3QNE A;  4JTA B;  4X8A A;  1NJI W;  3TCU A;  3ETG A;  1N8R W;  1JCH A;  1R3L C;  1K5Q A;  3P32 A;  3K08 A;  4I9W A;  3ETE A;  2OT5 A;  1QBZ A;  2JJ1 G;  2JK5 C;  5LGT A;  5B3S B;  3ABL C;  4WF9 V;  3WFV A;  3CCU V;  3CCM V;  2GSM B;  1CPY A;  1R3I C;  4RQE A;  1R3J C;  2K1E A;  5LHG A;  3ABM B;  1AR1 B;  1K92 A;  2ZQM A;  2ZR3 A;  3UM7 A;  1SER A;  4MT8 A;  1R6K A;  2IH1 C;  2BOC C;  3LSQ A;  3SYP A;  3SYQ A;  4KUM A;  2HJF C;  3W7U A;  1OCC B;  3JD1 A;  5EC2 C;  1ROP A;  3SPI A;  1V55 C;  1JPX A;  3I55 V;  4U7N A;  3OMI B;  4PDM A;  2JDI G;  1W0K G;  3HPL C;  5EK0 A;  4DO2 A;  2P67 A;  2EZO A;  3EFF K;  4BIU A;  4CZZ A;  2EIN B;  2DYS C;  1KD1 W;  2WLN A;  5CA3 A;  3CME V;  3AEI A;  3NXS A;  2XAG A;  5E1A C;  1NBM G;  3WG7 B;  3HB3 B;  3MHH C;  1K3E A;  2JJ2 G;  1Q82 W;  2EIM B;  3I56 V;  4MTX A;  1V54 C;  3EHB B;  3SPH A;  1H8E G;  3STL C;  1H38 A;  2HVK C;  2GHY A;  4GX0 A;  4QE7 A;  3ABK C;  5FL7 G;  1YTF D;  4P2Z A;  2V1D A;  3G4S V;  1THZ A;  1I5X A;  4TWK A;  3ZCC A;  4G28 B;  4WFF A;  1PL0 A;  4QIW F;  5LHI A;  1W0J G;  1M57 C;  4KP4 A;  2NNU A;  3SPG A;  3W7W A;  4JGS A;  2A79 B;  5L3F A;  1P7B A;  4N21 A;  3VOU A;  1K33 A;  3CCS V;  4XBF A;  3DTU B;  3T4D A;  4QNH B;  3CC4 V;  2ZR2 A;  2Y69 B;  2Z3Y A;  3K3W A;  3SYO A;  2ATK C;  2A0L A;  3TK1 A;  5LHH A;  3E35 A;  2C2A A;  3LSS A;  4R6Z A;  1FXH A;  2EIJ C;  1GM8 A;  2IJK A;  2HFE C;  2QEX V;  1M56 C;  4F4L A;  2UXN A;  4HYO A;  4UV8 A;  3SPJ A;  1P4R A;  3F7Y C;  3QO7 A;  3X2Q B;  2W0F C;  1AI4 A;  1S3J A;  2OCC B;  4PDV A;  4Z1M G;  1Q86 W;  2ZDI C;  4I5S A;  4RUE A;  3TET A;  5L3D A;  4JAU A;  3H01 A;  3LDD A;  5IY5 B;  2XAQ A;  4FJC C;  3PJS K;  1YIT V;  3OEH G;  4HZ3 A;  3ASO B;  2BOB C;  2WLH A;  3KG2 A;  1MAB G;  4N23 A;  3T4Z A;  1NR1 A;  1AI5 A;  5L3E A;  1PD3 A;  1JX9 A;  2WWW A;  3E86 A;  5GW7 A;  1G8M A;  1LNQ A;  2IH3 C;  4WFB V;  2Y48 A;  4FPP A;  1M90 W;  3OGC C;  3UKM A;  4XDJ A;  3D3I A;  3FB8 C;  4H37 A;  3E8G A;  2Q6A A;  3T2M A;  3AG3 C;  2X7R B;  2YEV A;  2NLJ C;  2XAF A;  3JD3 A;  5L3G A;  5CBG A;  2R9I A;  3CCQ V;  1AJQ A;  2ITC C;  3IGA C;  2HLD G;  4BIZ A;  1E79 G;  3AG4 B;  4JTC B;  1K4C C;  3FB6 C;  4MTG A;  1BMF G;  1ENV A;  1K8A W;  4R50 A;  5KUM A;  4PA3 A;  2AHY A;  3STZ C;  2WLK A;  4TT3 G;  4R8C A;  1SZT A;  3RVZ A;  2KB1 A;  1GTO A;  4DXW A;  2OTL V;  3G6E V;  1YSC A;  4GCZ A;  1OCZ C;  3JYC A;  3QO5 A;  3CCL V;  1QLE C;  1OCO B;  2W6I G;  3JCZ A;  2HVJ C;  2DYR B;  1FXK C;  3ZN1 A;  1DF5 A;  5HFL A;  3ASN B;  1HWY A;  5B1A B;  1MOF A;  4XDK A;  3AG1 C;  2ZXW C;  1NVP B;  1EFR G;  2DW4 A;  3ZMT A;  2JIZ G;  1M1K W;  1YJ9 V;  5B1B C;  1ARO P;  4FIP C;  3FYE B;  1FS0 G;  1XL4 A;  3P30 A;  1QR9 A;  4MVU A;  5EBW C;  2QTO A;  3ZRX A;  3RW0 A;  1RM1 B;  4GT1 A;  4WFG A;  1S5H C;  3W7S A;  4RAI A;  2HKO A;  1I5Y A;  1AI7 A;  3M99 B;  1VQP V;  4P9O A;  5KA5 A;  3MHS C;  4GX5 A;  5EBM C;  5LGU A;  1CP9 A;  1YJN V;  2DWD C;  4UXN A;  3JD4 A;  5B3S C;  4UVC A;  5H6Q A;  5IYD O;  1Q81 W;  1S77 D;  3SYC A;  4QPK A;  2ZD9 A;  3QO8 A;  3SPC A;  4WCE V;  3ABT A;  1EZJ A;  2F43 G;  1F4N A;  4J9Y B;  5IYB O;  4WFA V;  3ABM C;  1UJW B;  5KUK A;  2WAM A;  2Q69 A;  3GWO A;  1E1Q G;  3LDE A;  2B1I A;  1OCC C;  2DQ0 A;  1L1F A;  3OMA B;  3LUT B;  1VQ4 V;  1KP2 A;  1SES A;  5KA6 A;  1J95 A;  2HR3 A;  2XAJ A;  2EIN C;  4QJF B;  3MD0 A;  4LCU C;  3FB5 C;  4L87 A;  4JAV A;  3A0R A;  1YI2 V;  4X89 A;  3AG2 B;  1NR7 A;  3ZIA G;  1OCR C;  2WLI A;  1JOY A;  3WG7 C;  3RBZ A;  2EIL B;  1QR8 A;  2EBO A;  4U7O A;  3BY6 A;  4PA7 A;  4UVB A;  1H8H G;  2EIM C;  1AI6 A;  3SYA A;  3ZRW A;  4UVA A;  4MVR A;  4PDL A;  5J9P C;  3CC2 V;  1SRY A;  2JEU A;  2EIK C;  1K9M W;  2LP7 A;  1Y66 A;  1PNM A;  1R6N A;  2B1G A;  4JTD B;  3CYO A;  1JVM A;  3CCJ V;  3CCV V;  2WLL A;  1QVG U;  1OHH G;  1K97 A;  3K04 A;  3ZMU A;  4LC1 A;  1YHQ V;  1NH2 B;  2IJH A;  2UXX A;  4RO2 A;  5IDJ A;  1QVF U;  3E8F A;  1VQN V;  4FMT A;  5DN6 G;  5CN0 A;  2Q68 A;  4ZKI A;  4JYB A;  2X6A A;  1IXM A;  4BW5 A;  4MW8 A;  2CK3 G;  4J9Z B;  4PEL A;  3LDC A;  4G27 B;  5DM6 V;  2XAS A;  2QM7 A;  3CXC U;  3ZRW B;  1NKD A;  3OEE G;  1DLB A;  2Y69 C;  4BAY A;  3ABL B;  3E83 A;  1VQ9 V;  1F23 A;  3IFX A;  3OUF A;  4JAS A;  5IYC O;  4MS2 A;  2IJI A;  5C93 A;  4GX2 A;  3RVY A;  4MSW C;  1RPO A;  1OCZ B;  1TUE B;  3ZRS A;  4H33 A;  1E1R G;  4XDL A;  4OXS A;  3F5W C;  2IW5 A;  1KP3 A;  1YJW V;  1RPR A;  1DTO A;  2XOK G;  4P30 A;  1VQM V;  2YSU B;  3K0G A;  3W7X A;  1R73 A;  2X6B A;  5CMU A;  3X2Q C;  2M7W A;  1KEC A;  1PKX A;  1R3K C;  3OUS A;  1ZWI C;  2OCC C;  1V55 B;  5CBF A;  4E2L A;  2A9H A;  2D3O W;  3ZN0 A;  4X88 A;  4RQF A;  1BL8 A;  4HAM A;  2DYS B;  1VQK V;  3D36 A;  4Q20 A;  5IY5 C;  1KC8 W;  4JYC A;  1QCE A;  2QA4 V;  3ZRV A;  1YIJ V;  5CBH A;  3ASO C;  4MTO A;  3W7T A;  2YEV B;  2OTJ V;  4MVO A;  2QKS A;  2W6J G;  3K03 A;  2H94 A;  5H9C A;  2LFS A;  3OMN B;  1GM7 A;  1V54 B;  1FXV A;  3K79 A;  2XAH A;  3K9A A;  4PA6 A;  1FFT B;  1S76 D;  2QE7 G;  4GX1 A;  4MVS A;  2AHZ A;  2R9R B;  3ABK B;  1Q7Y W;  1K7D A;  1MSW D;  1YTF B;  5LBQ A;  1KKD A;  3CD6 V;  1BHB A;  1BHA A;  1WPX A;  3AG4 C;  3OR7 C;  1SET A;  2P90 A;  1VQO V;  2X0L A;  1EBO A;  1M57 B;  2JEX A;  2IJJ A;  2WSS G;  3OR6 C;  1W2B U;  1VQ5 V;  2WLM A;  1KQS U;  4KFM A;  2B5U A;  3GB7 C;  1COW G;  1GK9 A;  3OW2 U;  3E89 A;  2H8P C;  4FK5 C;  2ZDI A;  1VQ6 V;  1VQL V;  1K34 A;  1OCO C;  2EZP A;  3R65 A;  2DWE C;  3JD0 A;  1G4Y B;  1JQ0 A;  1CEZ A;  1H2G A;  4WFE A;  5B1N A;  4R7C A;  3F7V C;  4LBE C;  3CC7 V;  1GKF A;  1OCR B;  5BZB A;  2DYR C;  3ETD A;  1B6Q A;  3CCE V;  3VBB A;  3E8H A;  1WLE A;  3ASN C;  3JD2 A;  2X6C A;  4PA4 A;  5B1A C;  2XND G;  1NVP D;  2EIJ B;  1GM9 A;  4LP8 A;  1M56 B;  3IC7 A;  3B77 A;  3K06 A;  4RUF A;  1AJP A;  2PI4 A;  2EIK B;  1OZ0 A;  3OE7 G;  2P6J A;  5L3C A;  2P7T C;  3DGE A;  3E8B A;  1RM1 C;  5LGN A;  2EJR A;  4MVQ A;  4ASU G;  1DF4 A;  4WFH A;  3K0D A;  1VQ7 V;  5L3B A;  2V7Q G;  4QE9 A;  2WLJ A;  4TSF G;  1JJ2 U;  3FB7 C;  2DQ3 A;  4YXW G;  3CMA V;  2LFR A;  3T1C A;  3SJQ C;  4JPR A;  1GMG A;  3CPW U;  3OAA G;  3FYI B;  3ZMZ A;  3B8M A;  4MW3 A;  4MTF A;  1K4D C;  3OFN G;  3LNM B;  4MVM A;  5H6R A;  3G71 V;  4QPJ A;  3ZMV A;  3CP1 A;  3AG3 B;  3CCR V;  1PNL A;  5B1O A;  1FXK A;  5HFM A;  1M9N A;  2WLI B;  1Y4M A;  1F51 A;  1MG1 A;  5EBL C;  4P9P A;  1K5S A;  2FTK A;  2HG5 C;  3BEH A;  4PA9 A;  3E2E A;  1F4M A;  1PNK A;  3B8N A;  4ZBM A;  3ZJZ A;  3OM3 B;  2QM8 A;  2Q67 A;  3AG2 C;  4PDR A;  1ORQ C;  1GO3 F;  1K73 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...