1VQ8V

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq8V00
2OTJV 1M1KW 1VQ4V 3CCEV 1VQ8V 1VQKV 3CCQV 1Q86W 3CC2V 1VQ9V 3CCMV 1VQ5V 1VQLV 1VQ7V 1S72V 1YJ9V 3CCLV 3CCJV 3G6EV 1YHQV 1Q7YW 1KC8W 3CXCU 3CCSV 4WCEV 3G71V 1YI2V 1QVFU 3G4SV 3CC7V 1YJWV 1K73W 4WFBV 1K8AW 1KD1W 1VQ6V 3CPWU 2QA4V 1KQSU 1K9MW 4WF9V 2D3OW 1VQMV 1NJIW 2QEXV 3I55V 3CCRV 1JJ2U 4WFAV 1QVGU 1Q81W 1VQPV 2OTLV 1VQOV 1R73A 3CMAV 1YIJV 1M90W 1YITV 1YJNV 1W2BU 3CMEV 3CC4V 3CD6V 3I56V 1Q82W 1N8RW 3CCUV 1VQNV 3OW2U 3CCVV 5DM6V
chains in the Genus database with same CATH superfamily
1VQKV 2WAMA 3OMNB 1HR0O 4DV1O 3TXSA 5IYBO 2P6JA 2DYRB 5B3SB 3AG1B 2UXCB 1K33A 2EJ7A 1PP9H 1IBKO 4R8CA 2HJDA 2N74A 1EN4A 1R3JC 2P22C 1HP8A 3WB1A 3HR0A 3ABLC 3H1LH 3SJCC 4K0KB 1N32O 1E1QG 1Y4MA 1U96A 2XOKG 1R3IC 4GLXA 4MT8A 4DR2B 5KHHA 3CXCU 1FJGO 1K5QA 3RVZA 5K1XA 4XBFA 2D3OW 2PUSA 3OMAB 4PA6A 2Y69C 2VRZA 3ZRXA 4EFEA 4DR6B 2HEPA 4I9QA 1OZ0A 1VQNV 1DTOA 2DQ0A 2JS5A 1PNLA 4FLTA 4ZHQB 2P7TC 3K57A 2HHHB 1VQLV 4JYBA 1Z2GA 5LGTA 3OE7G 4GX2A 3N2KB 4UB6Z 1SA0B 4E4EA 3E22A 3ABMC 4FK5C 4MTXA 5JWPA 2QDOA 3JALA 2DMXA 4UVBA 4H0LB 1WN7A 2OCCB 1BHBA 5IE9A 3FFQA 3GWKC 4MW8A 1G4YB 5LA6B 2LO1A 2JEUA 3P32A 4LF5O 2CTWA 1VQ9V 4QGPA 1SETA 3IC7A 2H94A 4FMTA 3D8CA 1W0JG 5H9CA 5LOVA 5L3BA 2BTOA 4PD4F 3JATA 1S5HC 1WPXA 2DWDC 3ABLB 2ZR3A 3OGIB 1IXMA 1US6A 4LR3A 1BQZA 2ATKC 3ZRVA 5D5QA 1SQBH 3WFVA 1YCIA 5KHJA 1CP9A 2L35A 3FAVB 3ML0A 5EYPA 1G8MA 3FKSG 2AW9A 3GWOA 4FM1A 4O4LB 2DWEC 3B8MA 1YITV 3G67A 3UCSC 4DV7O 5DN6G 5L3FA 1NKDA 2V1DA 2CH7A 2ODMA 3B09A 4IIJA 1FXKC 2WLLA 3OUFA 5KAIZ 2FMLA 3LNMB 1NI8A 4JAVA 3K06A 3EFFK 2JK5C 4JI4B 4YJ3A 1VMGA 2HR3A 2YXYA 4X62O 5LXTB 2Q4PA 1SA0A 3K59A 1WB8A 4LF8B 2IM9A 2M6YA 5JCOC 1XHXA 1H2SB 1M56B 3CCMV 3B8NA 5IJ9B 2RDCA 1VQ7V 2HJFC 2XAGA 4BW9A 2X0LA 3ZHQA 3SPGA 3EVKA 2ZD9A 1SC5B 1XMQO 2OIGA 4I0XA 5LP6B 3QG5A 4GCZA 5JCOA 4K3AA 3CMEV 1QLEC 2B1GA 1NQTA 5JVDA 3QF7A 4OPAA 4JTCB 2EBOA 1RP3B 3P3PA 1FXHA 1ZUQA 2DN9A 4BAYA 3T1HO 1GM8A 3R66A 5KUMA 4O4HA 3ZCCA 4FFBA 4X66O 3AG3C 4TUYB 3FB5C 2P67A 3DC5A 2UU9O 1W59A 2XT9A 4PA7A 1N0NA 4DRXB 3K0DA 1BCCH 4I55B 2OIEA 2QM8A 2UUAO 3ABMB 3HKCA 5D5PA 4JTAB 2LQTA 2H3OA 3HKBA 4HYOA 4XDJA 4JI4O 2Q67A 3ASNB 4B3SO 4RUEA 1SZXA 2MW2B 4CH6A 4X20A 1YXBA 1M1KW 4I0XB 4WFFA 4LF7B 1HNXB 1L0LH 2KQXA 5DEDA 2KG7B 4BIOA 2UXBO 1KP3A 1NTZH 5DECA 4PDRA 3N2GA 2YSUB 4JAUA 1AP5A 2PTMA 3CCVV 1FFXA 3RYIA 2A06H 2QE7G 2DJVA 4FPPA 4OX9B 5FPRA 2PY5A 4MTFA 5HFLA 5JJNB 2LGQA 5JH7A 4LF4O 1XMOO 1N0JA 1F7YA 2WLKA 1XNRB 4WBNA 5KUKA 1K34A 3UO3A 5KX5A 4MSWC 1HNZO 2XAFA 3N2KA 2ADQB 3QO7A 1XNQB 4AQYB 4O4HB 5EC2C 1AI6A 2YDEA 4JYAO 1YVWA 3JAWA 1JPXA 1XDCA 4B3TB 3RFRA 4JI3O 2AZ2A 4K8XA 2FKXA 3J81N 4NXMB 4I55A 3M8AA 2CTQA 2W0FC 4LFBO 2RJZA 3CSXA 2OCHA 2YUAA 4X65O 2EZOA 1S77D 4NVPA 1SQFA 2ZE8A 4FJCC 1VF6A 5LOVB 4O2BA 3CJHB 5EBLC 3JD2A 4JI6O 4I50A 3LSQA 3G71V 2GBOA 4MTGA 1TAEA 4H13B 3SYQA 2X6BA 1DF4A 1R6TA 2WLNA 5IT9N 3T4DA 1R73A 1N33O 1AR4A 3LSUA 3I56V 4LF9B 5B66Z 4NTXA 1TA8A 1PNKA 5JJEB 1E79G 2ZE7A 3CRMA 3AK2A 1JA8A 3H1IH 3DSQA 4DUZO 4J9ZB 4RQEA 3A0BZ 4QJFB 1XBLA 1KP2A 4IYIA 2R70A 2ITDC 5B1AC 2Q9LA 2YEVB 1MMMA 4OX9O 1S0VA 5ITZA 2HLDG 2KB1A 3CP1A 2ZDIC 5E1AC 5KHKA 2LJ2A 3X2QC 1GTOA 1MOFA 3AG2B 1VQ8V 1H8HG 1KECA 3CCLV 3JARB 3WB0A 1K97A 2ZXWB 5H5NA 4NB5A 2W0XA 3JSNA 1F4MA 4EFBA 2CGNA 3A2FA 4X1YB 5J2TB 3RYCA 1UJWB 2P4KA 3CJHA 2ZCEA 1FS0G 3ZMSA 4LF6B 3J7AU 1YZBA 3JAWB 1S5LZ 1AR1B 5B1BB 5C8YA 2N04A 4W4LA 5IYZA 4U3FH 2DOSA 3ZMVA 2WA4A 2RMKB 4CS2A 5LP6A 3AK3A 2JIZG 3B40A 1YTFD 1VF6C 4CC5A 4DV4B 1R6NA 3D3IA 2QTSA 1PM9A 1VEWA 1AJQA 1IX9A 5LHHA 2LGWA 4JI5B 2OTLV 2IU0A 1R3LC 4X64B 1M93A 1WPBA 2YI8A 1NT2B 2VQEO 2M7WA 1VQ4V 5IY5C 2IJJA 2Q73A 3K79A 2E76B 4IT5A 1QVFU 3DTUB 1THZA 4P30A 4JI6B 3CS5A 3BFRA 1JMKC 2FYUH 5LMUB 2Q7HA 2Y0PA 4FM0A 4KHPO 3KCYA 3HKBB 4DR7B 4FIPC 3ZS8C 5J9PC 4ZOLA 4CS4A 4DUYO 2CTPA 3OM3B 2ZKOA 4JAAA 1CXZB 4IHJB 3W7XA 1JX9A 3AG3B 4OGQB 5JJJB 1B04A 2QKCA 4F6RA 2UU9B 2EIKB 4LWSA 2HVJC 4LFBB 4LF6O 3G6BA 1EN5A 4UB8Z 3CCSV 1V55B 3G4SV 2CUGA 4TSFG 4DV2B 2QM7A 4LF7O 4OPHA 2CAZC 5A9GA 4FZ0A 1YDXA 1VF5B 5JH7B 1TVKB 3O9OA 1WLEA 5IJ0B 3JD3A 4TQDA 5CN0A 1IBLB 3OTOO 4X89A 1M56C 5F2VO 2CE4A 1O9GA 4MVQA 3CXHF 1KUQA 2EILC 1RSOB 4I4TA 4DR2O 3OT7A 4ZI7A 2Q68A 3B77A 4YIPA 1SERA 1I94O 4P9PA 3JASA 4BWAA 4B3RB 1TUEB 4UCTA 1IVSA 2WLJA 5EBMC 5H6QA 3E35A 2E75B 4ICGA 5CA0B 1ZAUA 1ORQC 4MVSA 3THOA 1NTMH 2Y4TA 3CC4V 1J5EB 1G6UA 4X65B 4LH6A 1QBZA 3CC2V 5LGUA 2WLIB 1V54B 4P2ZA 2G38A 1V55C 4IHJA 2Q7EA 2VS0A 3UO2A 2WSSG 2IJIA 1TVKA 4B3TO 3GVMA 3T1HB 2RN9A 3AEIA 4JYAB 3MDSA 1H2KA 1P84F 4HAMA 4B08A 2PGGA 1MZFA 1SKVA 2EZPA 3OEEG 2FTKA 4EEQA 4DV0O 4PA9A 3ABKC 3ETEA 2Q8VA 3IGAC 1EM1A 3N27A 2R9RB 1I08A 1FD9A 3A0HZ 3SYCA 3JASB 3T1YO 1YIJV 4PDVA 3P30A 3H9VA 5FNVA 3BEHA 4PELA 1K7DA 3E22B 1PL4A 1ZWIC 4W4KA 3JALB 3OFNG 3OTFA 5C8YB 1GK9A 2DW4A 5LL6Y 5IYDO 2FB5A 2GUZB 3JSLA 4XDKA 3SJAC 2KKWA 5CMUA 2O57A 2GTSA 3PJSK 4JYYA 4GT1A 5KA5A 2JVDA 5J2UB 1PD3A 2K1EA 2EIJC 1X4TA 5H6RA 1B06A 1N4CA 3J80N 4LFAB 1BE3H 1L8DA 1UFIA 3N2GB 2XAQA 4ZKIA 3VQVA 5GONB 3DGEA 4JI0B 1KKDA 1OCRC 2B9ZA 1BQ0A 4MVZA 4LH7A 3L9DA 3VQXA 3HKEA 1S76D 1AR5A 2BOBC 3L72H 5H2FZ 1N36O 4JASA 4WFGA 1JQ0A 4UCOA 5JQGA 3JAMN 4LC1A 5EZYA 1VQ6V 4A5UB 1LUVA 1EBOA 3EHBB 2CH7B 4AILC 2VQFB 1IBMO 1QLEB 4GX0A 1GN4A 3RYHA 2QKAA 4Q20A 5CB4A 2JGDB 3A0RA 4JF3A 1OCCB 2OT5A 3ZMTA 4YJ3B 4UUJC 3ZRWA 1AI4A 4PI2A 1B3QA 2X6CA 1COWG 5B3SC 3K03A 4G28B 3SPIA 1NS1A 4TV9A 3ZRSA 4DV5B 4UXNA 5B1AB 3TJTA 5BR8O 2QM4A 2P06A 1V54C 2GV9A 2XASA 3OUSA 3K5OA 3K5MA 1F23A 4E2LA 3B4SA 1NVPD 1D5NA 4O4JB 3SPJA 5IJ0A 5L3EA 1BT8A 3E8GA 3K58A 4FLWA 1MABG 4U3JB 3ASOC 3OTOB 1SQPH 3FB8C 4JYCA 2YICA 2EIKC 3ABKB 1Q6UA 1L0NH 3CX5F 2WWWA 3G6EV 1YI2V 1HW7A 4DRXA 1HR0B 2OYQA 2C2AA 3JAKA 3JD0A 2W6JG 1N34O 4LFCO 1QR9A 5JQGB 4GX5A 1W2BU 4DK1A 3JYCA 1JOYA 3RYFA 4AHCA 2DYSC 4PA3A 4O2AB 4KP4A 4QE9A 3BY6A 2RNBA 2ILMA 1LNQA 2NNUA 3HKDA 4C7UA 1ENVA 1ROPA 5EIBD 1KQSU 3MHSC 2Y4UA 3ZIAG 1VQPV 3ZRWB 4FLXA 2YXHA 3BA9A 2KG7A 4CBCA 4O4JA 2MK3A 1GMGA 3W7TA 1P7GA 3AK1A 1KKCA 4WCEV 3IC9A 2ZNJA 2ZT9B 3QTCA 3ZHVA 4XDLA 2EIMC 3Q4HA 4FM2A 3BVOA 1OCRB 4IGGA 4PA4A 3STLC 4UV8A 2EULA 4YHHO 1XNRO 3VQWA 2N05A 1BGYH 1URFA 3FAVA 4GX1A 1Y74A 2X7RB 4YHHB 4LF4B 4QNHB 4JGSA 1IBMB 1OJHA 2A3QA 1A32A 4B3MB 4YIOA 2ZQMA 3CPWU 3ZMZA 4DYLA 4D7TA 4JZGA 4K35A 3U10A 3E2EA 4H44B 5IJ9A 1FYJA 2DYSB 4RO2A 4X88A 1FXKA 2OCCC 4JI3B 4HNAB 3R65A 4LFCB 2AZ0A 3AG4B 2UUCO 5CBGA 1YJ9V 1YHQV 1DLBA 3RYFB 4F6RB 2P5OA 1XHZA 2EILB 1J95A 3L73H 5EK0A 2BTQA 4DR3B 2HG5C 3W7UA 4KFMA 2YI9A 3HKDB 4YY3O 2YS8A 5TISZ 3ZHUA 4DV5O 5CA1A 4L8JA 3ICXA 3K04A 2UXDO 5JVDB 4NXNB 2YIAA 2B5UA 4PDMA 1I7FA 4FLZA 4X66B 1SESA 2R9AA 3SDLA 2QWPB 1RSOA 4I4TB 2UUAB 2YEVA 3ZMUA 1KC8W 4JI2B 1FXKB 4UV9A 3CC7V 2YIDA 4YXWG 1QHTA 4GZRB 1RM1B 1K92A 3SR2C 3JARA 1GRJA 3HB3B 4JI1B 3ASNC 1J5EO 1GN3A 1Y76B 4GYCB 1XEQA 4J80A 3WG7B 4MS2A 2VQFO 3JATB 2F4VB 3K9AA 1GM9A 4UCSA 1I0HA 5L3CA 3RGBA 4GKKO 1FFXB 1OCOC 3A8TA 4F4LA 3HPLC 4LNUA 4X62B 1X59A 2LFSA 1M57B 1EFRG 3ETQA 2WPDG 4KL1A 1GH6A 2A9HA 4DR4O 4TV8A 4EB6A 2Q5ZA 1QLNA 1M9NA 2AHYA 1MSWD 1AB3A 2L6LA 3BABA 2ZNIA 3C3SA 4GKJB 4PHZA 5KA6A 4R6ZA 2EIJB 2IH3C 1KB9F 4LBEC 5CBHA 4JI2O 2EINC 2IU3A 1AJNA 2JS3A 1FFTB 3S3WA 4FLUA 3LDCA 3TCUA 1AP6A 3KZIZ 1Q6HA 3QO5A 3CE2A 1RM1C 4O4IA 1XILA 1WB7A 1KBHA 1H38A 2YIBD 1NH2B 3TK1A 2WLLB 4IL6Z 2IJHA 3O65A 5EIBC 4RWUA 3ZJZA 3IJ4A 4PI0A 1CPYA 4KXRA 1Y67A 4GKKB 2CGOA 1G1XB 3UM7A 1HNWO 4LP8A 3T1YB 1JFFA 4J42A 1AI5A 4Z2WA 4DV3O 1Q8IA 4ZBMA 4DV2O 1XREA 1NU1H 3SJQC 1ZL8B 4G27B 3F5WC 4ASUG 1B6QA 4AI8A 5AG2A 3L71H 3TGUH 3FYEB 2A0LA 4J7ZA 3D36A 3L75H 4J10A 3T1CA 1UPGA 3OR6C 5LYJA 3JCUZ 4DV7B 2F23A 3ZN0A 3OD4A 4CH5A 2P4VA 3SPHA 1R1BA 2LP7A 1FPOA 2AHZA 3GB7C 2CTRA 2ITCC 2JDIG 4TV8B 2QGNA 1FAFA 3UT5B 2EINB 2VQEB 1GKFA 1FJGB 1NR1A 2WLMA 4ZI7B 1P49A 3F5TA 5IYZB 2PF4E 1E1RG 4DV6B 3K9SA 1SZTA 1GM7A 2CDYA 1TGOA 2H8PC 3CRCA 2F4VO 3UKMA 3RW0A 3WU2Z 1BMFG 4JI5O 3T2MA 3OGCC 1N32B 5LMNO 1SF9A 1Y66A 1OCOB 1K73W 4WFBV 4CS3A 1EN6A 4IYHA 1K9MW 3NXSA 1JFFB 1M57C 4Q6GA 1SQVH 2F93B 3L74H 1XL6A 2QWOB 3F7YC 4NXNO 5IWAO 2XHBA 1DK1A 5EYPB 5CA3A 4DV1B 3F7VC 2R9IA 1ZL8A 3CCEV 2ZIOA 1CEZA 2NLJC 1XMOB 2KSDA 1OHHG 2QA4V 2DYRC 2XNDG 1VQMV 5FL7G 3RYIB 4DV0B 5GTIZ 1VQOV 4JI8B 2XTAA 5C93A 4CH4A 1AILA 2JRIA 5EBWC 4RAIA 1MG1A 2BSKA 1F4NA 4MVRA 4JI7B 2IBZH 1SRYA 5LXTA 5KX5B 1O9HA 3U11A 2E5LO 2WLHA 4I7ZB 4MVUA 3QNEA 3UT5A 2QWRB 3G80A 1KD1W 1Y76A 4LWSB 4DR1B 2B1IA 5B5EZ 2X6AA 3BHPA 4DK0A 4CZZA 1QVGU 4Z1MG 2JJ2G 4I50B 3CHXA 4FFKA 3L70H 1PNMA 1PL0A 1MA1A 3SYOA 5KAFZ 5KMGB 4KUMA 4LNUB 1FKAO 4OXSA 3E86A 3JD4A 2LFRA 5BR8B 3KCXA 4UCUA 2BCCH 4UFZA 2EX3A 4B3MO 4EB6B 3MD0A 1JCHA 1QU7A 5HFMA 4PJ0Z 4JV5B 5KHGA 4NR1A 2OTJV 4TWKA 2ZR2A 1Q90D 4TUYA 5ITZB 3AG4C 3APQA 3FB6C 4DV4O 2RQ6A 2ZM6O 5B1NA 1YEWA 5LBQA 3W7WA 1LR1A 1XUQA 2Q0OC 3CYOA 4UCRA 3TETA 4FVMA 1AI7A 3ZBHA 1F51A 3FD9A 3CCUV 2A7WA 4ABMA 1NBMG 1VIBA 1WP7A 1OCZC 4YY3B 1Q7YW 4LFAO 2A79B 3JD1A 1YJWV 2R72A 3C90A 5KMGA 3I5DA 2ZINA 2F43G 2E3CA 5LHIA 2UXCO 3ASOB 2Y69B 3D3QA 1XNQO 1Y6XA 2YIBA 3HKCB 1H8EG 1ZX3A 1N8RW 2QWQB 3RYCB 1N33B 1Q86W 2Q7GA 2ZDIA 2QJ1A 3M99B 5IDJA 2ZM6B 2UXBB 1NH2D 1HNXO 2JGUA 1KU9A 4X20B 1KYOF 2Z3YA 5LMNB 1AROP 5CA1B 4J41A 3SJBC 1L1FA 5LYJB 3KG2A 3T4ZA 2P90A 3ZHRA 2F95B 5BMVB 1NTKH 4JTDB 3U0ZA 1Q3EA 1H2NA 3WG7C 2GTAA 3BAAA 4U3JA 4R50A 2VWJA 1K8AW 1WJZA 4DR5B 1XL4A 3K08A 2QEXV 3CCRV 1RPRA 4WFAV 4DR4B 4X1KB 4WFEA 4IIJB 1S3JA 3X2QB 4MTOA 3AG2C 1QR8A 2IH1C 4QE7A 4X9QA 4JI8O 4I9WA 4CC6A 2ZXWC 1YTFB 1WP8A 1N36B 1XI1A 5FNVB 1LUWA 2HKOA 3D36C 1QCEA 4O2AA 3ETDA 1D2DA 3MHHC 1W0KG 4PV1B 1Z5VA 3RT3C 2V7QG 2QTOA 1VP7A 2V4DA 3E83A 5FLXN 4B3RO 1R6KA 2PYJA 4JZ2A 3CRQA 2FL4A 4G2KA 1MSDA 2CK3G 3ZEDA 3QVNA 4JI7O 1JJOA 3K5LA 2EJRA 1VARA 3OEHG 2LW1A 2XUMA 2HHHO 1Q81W 4F6EA 1H2LA 1ZTEA 4Z1VA 4N23A 5IY5B 3NR7A 3BPZA 1IBLO 1IZ3A 1PKXA 4MW3A 3ZHSA 3RYHB 3IFXA 3E8FA 3HKEB 1U97A 2JGDA 3DC6A 2RCVA 1Y74B 3CEIA 4BW5A 1M5IA 1NJIW 1QNMA 3AG7A 5LGNA 1TUBA 2UUBB 4LF8O 5EZYB 5LP6C 3RBZA 3FB7C 5CA0A 4O4IB 5DM6V 5E79Z 2ARHA 2WA3A 3CCQV 1DF5A 1EZVH 1VQ5V 4FLVA 2Z5UA 4QPKA 3H1KH 1P7BA 1IBKB 1K3EA 4LCUC 5CB4B 1IURA 1PPJH 1EZJA 3CB2A 4FLYA 3BRCA 1RPOA 2UUCB 5CBFA 4B3SB 1D5AA 5J2TA 4GKJO 4J7JA 2ZIMA 4QIWF 1Q5OA 4TV9B 1SQGA 1ZLZA 2E5LB 2VWKA 1WA8B 3TXQA 4H37A 1IDSA 3RN4A 3DXRA 4GUNA 1JJ2U 2UUBO 3CD6V 1R3KC 2Q6AA 3W7SA 2PI5A 4RQFA 4WFHA 4WBNB 4O4LA 5GTHZ 3OMIB 2JJ1G 3ABTA 3FX7A 3RWRD 3ETGA 4K8ZA 4QPJA 2Y0IA 4UVAA 4DV3B 3H01A 2BE3A 4R7CA 3STZC 2UXXA 4K0KO 2HVKC 3K5NA 2GUZA 2GDSA 1GN2A 3VBBA 4DR3O 4DW0A 1TUBB 1GN6A 1OV9A 1GAXA 1XOUA 4U7NA 1P4RA 3CRRA 3SYPA 5GW7A 2ZE5A 4O2BB 1SQQH 1T5EA 2GSMB 2PZSA 4BR6A 4DO2A 1IXBA 1YF2A 2HP8A 1N34B 5J2UA 2AXTZ 1OCZB 3KKYA 3E89A 1KMIZ 4B7KA 3LNNA 5LMUO 3LUTB 4JPRA 2W6IG 1JVMA 3BCCH 2E74B 1HDJA 5B1BC 1I5YA 2QR4A 2IW5A 1H2MA 1Z5WA 4MVMA 1PV0A 1SS3A 3Q4HB 5L3GA 1Q82W 1MZEA 1WA8A 2ADPA 3DXRB 4FFBB 2IJKA 3BA8A 3LDEA 4DXWA 1NZ6A 2AGAA 4H33A 4KHPB 2F1MA 2YC0A 3VQYA 4MVOA 5LHGA 4HNAA 4UCVA 4LF5B 2DE0X 4J9YB 4ZHQA 1HWYA 5KHIA 4NYKA 2PYLA 1M90W 4DW1A 4P9OA 4B7EA 4DR5O 1DGSA 4DR6O 3OAAG 3H1HH 3VOUA 4HBNA 3P3NA 4FZ1A 2QKSA 1S72V 1XMQB 2DQ3A 2YXLA 2ZE6A 3H1JH 5LA6A 3CWBH 4X64O 3FYIB 4YJ2A 3AG1C 3MAQA 1SQXH 2Z0AA 1HNWB 3LSSA 4JI1O 3K0GA 4L87A 3ZN1A 4TQFA 2Q0AA 4DR7O 5A2QN 3WB2A 4D7SA 2XAJA 2BTQB 1FXVA 3IAYA 4TT3G 1I94B 5L3DA 4AQYO 2UXDB 1V9PA 2Q69A 3ZX6A 1AJPA 2EIMB 1Q6IA 1WAZA 2HFEC 5BZBA 2WLIA 1BS3A 1K4CC 4TOIA 5BXZA 2OWOA 4DR1O 3UQ8A 3ZHTA 5B1OA 1NVPB 2NR5A 1YSCA 5KLVH 3RVYA 4X1IA 3S3XA 5FPOA 3SPCA 4NTWA 3SYAA 4JV5O 4BIZA 4JI0O 4EKWA 3CRAA 3M7MX 4NTYA 1ZSPA 1MNGA 2UXNA 4DUYB 1OCCC 3K3WA 4ZOLB 3JAKB 1S5JA 3E8HA 1BZKA 1RFYA 1BSMA 3CCJV 4ZIBA 2QSAA 4WF9V 1K5SA 2GHYA 5BY1A 3I55V 1NR7A 3SGIA 1JR9A 2XAHA 4CH3A 3CMAV 1Q43A 3JCZA 4DV6O 4NKGB 4YJ2B 4D6TH 2BOCC 2F66C 1XQ8A 2D2CB 5EC1C 3B2EE 2LW7A 1QQCA 4LF9O 3ABUA 2ETNA 1VF7A 1WNSA 1HNZB 1BHAA 1GO3F 5BMVA 4BIUA 3QO8A 4PDLA 2PI4A 4DUZB 1YJNV 5GONA 1M4UA 4UVCA 4X8AA 3C3TA 4HZ3A 4J11A 3APOA 4X1KA 3E8BA 3OR7C 4U7OA 5IWAB 2QWNB 4RUFA 1H2GA 3PN1A 2BSKB 1K4DC 2NN4A 4J7KA 2K9PA 4N21A 2JEXA 5IYCO 4X1IB 4I5SA 4NXMO 5K1PA 1AVMA 2Y48A 1I5XA 1BL8A 3LDDA 3EXAA 4X1YA 3OW2U
chains in the Genus database with same CATH topology
1VQ4V 5IY5C 3AG4B 4JTDB 1VQKV 2WAMA 2IJJA 3OMNB 5CBGA 1YJ9V 3WG7C 1YHQV 3K79A 1DLBA 5IYBO 1QVFU 2P6JA 4R50A 2DYRB 3DTUB 5B3SB 1THZA 1K8AW 3AG1B 4P30A 1XL4A 1K33A 3K08A 2QEXV 2EILB 1J95A 1RPRA 3CCRV 4R8CA 4WFAV 4WFEA 5EK0A 1S3JA 1R3JC 2HG5C 3W7UA 4KFMA 3X2QB 4MTOA 3ABLC 3AG2C 1QR8A 2IH1C 4QE7A 4I9WA 1E1QG 1Y4MA 2ZXWC 1YTFB 2XOKG 1R3IC 4MT8A 3CXCU 3K04A 4FIPC 1K5QA 3RVZA 5J9PC 2HKOA 4XBFA 2B5UA 1QCEA 3OM3B 4PDMA 2D3OW 3ETDA 3OMAB 4PA6A 2Y69C 3MHHC 1W0KG 3W7XA 1JX9A 3ZRXA 3AG3B 1SESA 1OZ0A 2EIKB 1VQNV 2V7QG 2QTOA 1DTOA 2HVJC 2DQ0A 3E83A 1PNLA 1R6KA 2P7TC 2YEVA 1VQLV 4JYBA 4G2KA 3ZMUA 5LGTA 3CCSV 1KC8W 2CK3G 1FXKB 1V55B 3OE7G 4GX2A 4UV9A 3G4SV 3CC7V 4TSFG 2QM7A 3ABMC 4FK5C 4MTXA 4YXWG 2EJRA 3OEHG 1RM1B 4UVBA 1K92A 1Q81W 2OCCB 1BHBA 3HB3B 4MW8A 1G4YB 1WLEA 2JEUA 3ASNC 4N23A 5IY5B 3P32A 3JD3A 3WG7B 4MS2A 1VQ9V 5CN0A 1PKXA 1SETA 3IC7A 4MW3A 2H94A 4FMTA 3K9AA 1GM9A 4X89A 1M56C 1W0JG 3IFXA 3E8FA 5L3CA 4MVQA 2EILC 4BW5A 5H9CA 1OCOC 1NJIW 5L3BA 4F4LA 3HPLC 5LGNA 2Q68A 1S5HC 1WPXA 2DWDC 2LFSA 3B77A 1M57B 1EFRG 3ABLB 1SERA 3RBZA 3FB7C 2ZR3A 1IXMA 2WPDG 2ATKC 5DM6V 4P9PA 3ZRVA 2A9HA 3WFVA 3CCQV 1DF5A 1VQ5V 2Z5UA 4QPKA 1TUEB 1P7BA 1K3EA 2WLJA 4LCUC 1CP9A 1QLNA 1M9NA 2AHYA 5EBMC 5H6QA 1MSWD 3E35A 3ML0A 1G8MA 1EZJA 1ORQC 3FKSG 4MVSA 1RPOA 3GWOA 2DWEC 3B8MA 5CBFA 3CC4V 1YITV 5KA6A 4R6ZA 2EIJB 2IH3C 4LBEC 5CBHA 5DN6G 5L3FA 1NKDA 2EINC 2IU3A 1AJNA 2V1DA 1QBZA 3CC2V 5LGUA 2WLIB 1FFTB 1V54B 4QIWF 4P2ZA 1FXKC 1V55C 2WLLA 3OUFA 3LDCA 3LNMB 2WSSG 4JAVA 2IJIA 3K06A 3TCUA 3EFFK 2JK5C 3QO5A 1RM1C 4H37A 1H38A 1JJ2U 3AEIA 1NH2B 3TK1A 2HR3A 2WLLB 2IJHA 3CD6V 3ZJZA 4HAMA 1R3KC 1CPYA 2Q6AA 3OEEG 2EZPA 3W7SA 2PI5A 4RQFA 3UM7A 4LP8A 2FTKA 4WFHA 4PA9A 1M56B 3ABKC 3B8NA 3CCMV 3OMIB 1VQ7V 2JJ1G 1AI5A 2HJFC 2XAGA 3ETEA 3ABTA 4ZBMA 3IGAC 2X0LA 3ETGA 4QPJA 3SPGA 2R9RB 4UVAA 2ZD9A 3SJQC 4G27B 3F5WC 3H01A 4ASUG 3SYCA 4GCZA 4R7CA 1B6QA 3STZC 1YIJV 2UXXA 4PDVA 3P30A 3CMEV 2HVKC 1QLEC 2B1GA 2A0LA 3FYEB 1NQTA 3BEHA 4PELA 3D36A 1K7DA 4JTCB 1ZWIC 2EBOA 3T1CA 3VBBA 3OFNG 3OR6C 1FXHA 1GK9A 3ZN0A 2DW4A 4BAYA 5IYDO 1GM8A 4XDKA 4U7NA 3SPHA 1P4RA 5KUMA 5CMUA 3SYPA 3ZCCA 2LP7A 5GW7A 2AHZA 3PJSK 4GT1A 3GB7C 5KA5A 2ITCC 3AG3C 3FB5C 1PD3A 2JDIG 2K1EA 2EIJC 5H6RA 2P67A 2GSMB 2EINB 4DO2A 1GKFA 4PA7A 3K0DA 1NR1A 2WLMA 2QM8A 1OCZB 2XAQA 1E1RG 4ZKIA 3ABMB 3E89A 3DGEA 4JTAB 1KKDA 3LUTB 1OCRC 4JPRA 4MVZA 2W6IG 1JVMA 1SZTA 4HYOA 4XDJA 1GM7A 5B1BC 2Q67A 1I5YA 3ASNB 2IW5A 2H8PC 4MVMA 1S76D 1Q82W 5L3GA 4RUEA 2BOBC 3UKMA 3RW0A 4JASA 1BMFG 4WFGA 1M1KW 1JQ0A 3T2MA 2IJKA 3OGCC 4WFFA 3LDEA 4DXWA 4LC1A 4H33A 1Y66A 1OCOB 4MVOA 5LHGA 4WFBV 1K73W 1KP3A 1VQ6V 1EBOA 1K9MW 3NXSA 3EHBB 1M57C 4PDRA 4J9YB 1QLEB 4GX0A 1HWYA 2YSUB 4JAUA 1M90W 1XL6A 4P9OA 3F7YC 4Q20A 3A0RA 4JF3A 3CCVV 1OCCB 3OAAG 3VOUA 2OT5A 5CA3A 3F7VC 2R9IA 3CCEV 3ZMTA 2QKSA 2QE7G 4FPPA 4UUJC 1S72V 2DQ3A 1CEZA 2NLJC 4MTFA 3ZRWA 5HFLA 1AI4A 3FYIB 1OHHG 2QA4V 2X6CA 2DYRC 1COWG 2XNDG 3K03A 5FL7G 3AG1C 5B3SC 1VQMV 2WLKA 4G28B 3SPIA 5KUKA 1K34A 1VQOV 3ZRSA 4MSWC 4UXNA 5B1AB 3LSSA 5C93A 2XAFA 3K0GA 4L87A 3QO7A 5EC2C 1AI6A 5EBWC 3ZN1A 4RAIA 1MG1A 1V54C 2XASA 1F4NA 3OUSA 4MVRA 1SRYA 2XAJA 1FXVA 1F23A 1JPXA 4E2LA 2WLHA 4MVUA 4TT3G 3QNEA 1NVPD 5L3DA 1KD1W 2Q69A 3SPJA 1AJPA 2B1IA 2EIMB 2W0FC 2X6AA 5L3EA 2HFEC 5BZBA 2WLIA 3E8GA 4CZZA 1QVGU 4Z1MG 2JJ2G 1K4CC 2EZOA 1MABG 1S77D 3ASOC 4FJCC 3FB8C 1PL0A 1PNMA 4JYCA 5B1OA 3SYOA 2EIKC 3ABKB 5EBLC 1NVPB 4KUMA 1YSCA 3RVYA 3JD2A 3SPCA 3G6EV 2WWWA 3LSQA 3G71V 1YI2V 3SYAA 4OXSA 4BIZA 3E86A 4EKWA 4MTGA 3SYQA 2X6BA 2LFRA 3JD4A 1DF4A 2C2AA 3JD0A 2W6JG 2WLNA 1QR9A 3T4DA 1R73A 4GX5A 1W2BU 2UXNA 3JYCA 1JOYA 3MD0A 3I56V 1JCHA 1OCCC 2DYSC 5HFMA 3K3WA 1PNKA 4PA3A 2OTJV 4TWKA 2ZR2A 4KP4A 4QE9A 3E8HA 3BY6A 1E79G 3AG4C 3CCJV 3FB6C 1LNQA 2NNUA 5B1NA 4J9ZB 1ENVA 1ROPA 4RQEA 1KQSU 4WF9V 1K5SA 2GHYA 4QJFB 5LBQA 3W7WA 3MHSC 3I55V 1KP2A 1NR7A 2ITDC 5B1AC 3ZIAG 2YEVB 3CYOA 2XAHA 1VQPV 1S0VA 2HLDG 2KB1A 3CMAV 3CP1A 3ZRWB 3TETA 2ZDIC 1AI7A 3JCZA 5E1AC 4CBCA 1F51A 3CCUV 3X2QC 2MK3A 1GTOA 1GMGA 1MOFA 3AG2B 3W7TA 2BOCC 1VQ8V 1NBMG 1H8HG 1KECA 1OCZC 3CCLV 1K97A 2ZXWB 1Q7YW 5EC1C 4WCEV 2A79B 1F4MA 3JD1A 4XDLA 3ABUA 2EIMC 1YJWV 1OCRB 1UJWB 1BHAA 1GO3F 1FS0G 3ZMSA 4BIUA 3QO8A 4PA4A 4PDLA 2F43G 4UV8A 5B1BB 3STLC 1AR1B 5LHIA 2PI4A 1YJNV 3ASOB 2Y69B 3ZMVA 4UVCA 1H8EG 4X8AA 4GX1A 1N8RW 2X7RB 4QNHB 4HZ3A 4JGSA 1Q86W 3E8BA 3OR7C 2ZDIA 2JIZG 4U7OA 3M99B 1YTFD 5IDJA 1R6NA 1NH2D 2ZQMA 3D3IA 3CPWU 3ZMZA 1H2GA 4RUFA 2Z3YA 1AROP 1K4DC 1AJQA 3E2EA 4N21A 2JEXA 5IYCO 1L1FA 3KG2A 5LHHA 2OTLV 4I5SA 2DYSB 4RO2A 3T4ZA 4X88A 2Y48A 2IU0A 1I5XA 1FXKA 1BL8A 2OCCC 2P90A 1R3LC 3LDDA 3OW2U 3R65A 2M7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ V;  1M1K W;  1VQ4 V;  3CCE V;  1VQ8 V;  1VQK V;  3CCQ V;  1Q86 W;  3CC2 V;  1VQ9 V;  3CCM V;  1VQ5 V;  1VQL V;  1VQ7 V;  1S72 V;  1YJ9 V;  3CCL V;  3CCJ V;  3G6E V;  1YHQ V;  1Q7Y W;  1KC8 W;  3CXC U;  3CCS V;  4WCE V;  3G71 V;  1YI2 V;  1QVF U;  3G4S V;  3CC7 V;  1YJW V;  1K73 W;  4WFB V;  1K8A W;  1KD1 W;  1VQ6 V;  3CPW U;  2QA4 V;  1KQS U;  1K9M W;  4WF9 V;  2D3O W;  1VQM V;  1NJI W;  2QEX V;  3I55 V;  3CCR V;  1JJ2 U;  4WFA V;  1QVG U;  1Q81 W;  1VQP V;  2OTL V;  1VQO V;  1R73 A;  3CMA V;  1YIJ V;  1M90 W;  1YIT V;  1YJN V;  1W2B U;  3CME V;  3CC4 V;  3CD6 V;  3I56 V;  1Q82 W;  1N8R W;  3CCU V;  1VQN V;  3OW2 U;  3CCV V;  5DM6 V; 
#chains in the Genus database with same CATH topology
 1VQK V;  2WAM A;  3OMN B;  1HR0 O;  4DV1 O;  3TXS A;  5IYB O;  2P6J A;  2DYR B;  5B3S B;  3AG1 B;  2UXC B;  1K33 A;  2EJ7 A;  1PP9 H;  1IBK O;  4R8C A;  2HJD A;  2N74 A;  1EN4 A;  1R3J C;  2P22 C;  1HP8 A;  3WB1 A;  3HR0 A;  3ABL C;  3H1L H;  3SJC C;  4K0K B;  1N32 O;  1E1Q G;  1Y4M A;  1U96 A;  2XOK G;  1R3I C;  4GLX A;  4MT8 A;  4DR2 B;  5KHH A;  3CXC U;  1FJG O;  1K5Q A;  3RVZ A;  5K1X A;  4XBF A;  2D3O W;  2PUS A;  3OMA B;  4PA6 A;  2Y69 C;  2VRZ A;  3ZRX A;  4EFE A;  4DR6 B;  2HEP A;  4I9Q A;  1OZ0 A;  1VQN V;  1DTO A;  2DQ0 A;  2JS5 A;  1PNL A;  4FLT A;  4ZHQ B;  2P7T C;  3K57 A;  2HHH B;  1VQL V;  4JYB A;  1Z2G A;  5LGT A;  3OE7 G;  4GX2 A;  3N2K B;  4UB6 Z;  1SA0 B;  4E4E A;  3E22 A;  3ABM C;  4FK5 C;  4MTX A;  5JWP A;  2QDO A;  3JAL A;  2DMX A;  4UVB A;  4H0L B;  1WN7 A;  2OCC B;  1BHB A;  5IE9 A;  3FFQ A;  3GWK C;  4MW8 A;  1G4Y B;  5LA6 B;  2LO1 A;  2JEU A;  3P32 A;  4LF5 O;  2CTW A;  1VQ9 V;  4QGP A;  1SET A;  3IC7 A;  2H94 A;  4FMT A;  3D8C A;  1W0J G;  5H9C A;  5LOV A;  5L3B A;  2BTO A;  4PD4 F;  3JAT A;  1S5H C;  1WPX A;  2DWD C;  3ABL B;  2ZR3 A;  3OGI B;  1IXM A;  1US6 A;  4LR3 A;  1BQZ A;  2ATK C;  3ZRV A;  5D5Q A;  1SQB H;  3WFV A;  1YCI A;  5KHJ A;  1CP9 A;  2L35 A;  3FAV B;  3ML0 A;  5EYP A;  1G8M A;  3FKS G;  2AW9 A;  3GWO A;  4FM1 A;  4O4L B;  2DWE C;  3B8M A;  1YIT V;  3G67 A;  3UCS C;  4DV7 O;  5DN6 G;  5L3F A;  1NKD A;  2V1D A;  2CH7 A;  2ODM A;  3B09 A;  4IIJ A;  1FXK C;  2WLL A;  3OUF A;  5KAI Z;  2FML A;  3LNM B;  1NI8 A;  4JAV A;  3K06 A;  3EFF K;  2JK5 C;  4JI4 B;  4YJ3 A;  1VMG A;  2HR3 A;  2YXY A;  4X62 O;  5LXT B;  2Q4P A;  1SA0 A;  3K59 A;  1WB8 A;  4LF8 B;  2IM9 A;  2M6Y A;  5JCO C;  1XHX A;  1H2S B;  1M56 B;  3CCM V;  3B8N A;  5IJ9 B;  2RDC A;  1VQ7 V;  2HJF C;  2XAG A;  4BW9 A;  2X0L A;  3ZHQ A;  3SPG A;  3EVK A;  2ZD9 A;  1SC5 B;  1XMQ O;  2OIG A;  4I0X A;  5LP6 B;  3QG5 A;  4GCZ A;  5JCO A;  4K3A A;  3CME V;  1QLE C;  2B1G A;  1NQT A;  5JVD A;  3QF7 A;  4OPA A;  4JTC B;  2EBO A;  1RP3 B;  3P3P A;  1FXH A;  1ZUQ A;  2DN9 A;  4BAY A;  3T1H O;  1GM8 A;  3R66 A;  5KUM A;  4O4H A;  3ZCC A;  4FFB A;  4X66 O;  3AG3 C;  4TUY B;  3FB5 C;  2P67 A;  3DC5 A;  2UU9 O;  1W59 A;  2XT9 A;  4PA7 A;  1N0N A;  4DRX B;  3K0D A;  1BCC H;  4I55 B;  2OIE A;  2QM8 A;  2UUA O;  3ABM B;  3HKC A;  5D5P A;  4JTA B;  2LQT A;  2H3O A;  3HKB A;  4HYO A;  4XDJ A;  4JI4 O;  2Q67 A;  3ASN B;  4B3S O;  4RUE A;  1SZX A;  2MW2 B;  4CH6 A;  4X20 A;  1YXB A;  1M1K W;  4I0X B;  4WFF A;  4LF7 B;  1HNX B;  1L0L H;  2KQX A;  5DED A;  2KG7 B;  4BIO A;  2UXB O;  1KP3 A;  1NTZ H;  5DEC A;  4PDR A;  3N2G A;  2YSU B;  4JAU A;  1AP5 A;  2PTM A;  3CCV V;  1FFX A;  3RYI A;  2A06 H;  2QE7 G;  2DJV A;  4FPP A;  4OX9 B;  5FPR A;  2PY5 A;  4MTF A;  5HFL A;  5JJN B;  2LGQ A;  5JH7 A;  4LF4 O;  1XMO O;  1N0J A;  1F7Y A;  2WLK A;  1XNR B;  4WBN A;  5KUK A;  1K34 A;  3UO3 A;  5KX5 A;  4MSW C;  1HNZ O;  2XAF A;  3N2K A;  2ADQ B;  3QO7 A;  1XNQ B;  4AQY B;  4O4H B;  5EC2 C;  1AI6 A;  2YDE A;  4JYA O;  1YVW A;  3JAW A;  1JPX A;  1XDC A;  4B3T B;  3RFR A;  4JI3 O;  2AZ2 A;  4K8X A;  2FKX A;  3J81 N;  4NXM B;  4I55 A;  3M8A A;  2CTQ A;  2W0F C;  4LFB O;  2RJZ A;  3CSX A;  2OCH A;  2YUA A;  4X65 O;  2EZO A;  1S77 D;  4NVP A;  1SQF A;  2ZE8 A;  4FJC C;  1VF6 A;  5LOV B;  4O2B A;  3CJH B;  5EBL C;  3JD2 A;  4JI6 O;  4I50 A;  3LSQ A;  3G71 V;  2GBO A;  4MTG A;  1TAE A;  4H13 B;  3SYQ A;  2X6B A;  1DF4 A;  1R6T A;  2WLN A;  5IT9 N;  3T4D A;  1R73 A;  1N33 O;  1AR4 A;  3LSU A;  3I56 V;  4LF9 B;  5B66 Z;  4NTX A;  1TA8 A;  1PNK A;  5JJE B;  1E79 G;  2ZE7 A;  3CRM A;  3AK2 A;  1JA8 A;  3H1I H;  3DSQ A;  4DUZ O;  4J9Z B;  4RQE A;  3A0B Z;  4QJF B;  1XBL A;  1KP2 A;  4IYI A;  2R70 A;  2ITD C;  5B1A C;  2Q9L A;  2YEV B;  1MMM A;  4OX9 O;  1S0V A;  5ITZ A;  2HLD G;  2KB1 A;  3CP1 A;  2ZDI C;  5E1A C;  5KHK A;  2LJ2 A;  3X2Q C;  1GTO A;  1MOF A;  3AG2 B;  1VQ8 V;  1H8H G;  1KEC A;  3CCL V;  3JAR B;  3WB0 A;  1K97 A;  2ZXW B;  5H5N A;  4NB5 A;  2W0X A;  3JSN A;  1F4M A;  4EFB A;  2CGN A;  3A2F A;  4X1Y B;  5J2T B;  3RYC A;  1UJW B;  2P4K A;  3CJH A;  2ZCE A;  1FS0 G;  3ZMS A;  4LF6 B;  3J7A U;  1YZB A;  3JAW B;  1S5L Z;  1AR1 B;  5B1B B;  5C8Y A;  2N04 A;  4W4L A;  5IYZ A;  4U3F H;  2DOS A;  3ZMV A;  2WA4 A;  2RMK B;  4CS2 A;  5LP6 A;  3AK3 A;  2JIZ G;  3B40 A;  1YTF D;  1VF6 C;  4CC5 A;  4DV4 B;  1R6N A;  3D3I A;  2QTS A;  1PM9 A;  1VEW A;  1AJQ A;  1IX9 A;  5LHH A;  2LGW A;  4JI5 B;  2OTL V;  2IU0 A;  1R3L C;  4X64 B;  1M93 A;  1WPB A;  2YI8 A;  1NT2 B;  2VQE O;  2M7W A;  1VQ4 V;  5IY5 C;  2IJJ A;  2Q73 A;  3K79 A;  2E76 B;  4IT5 A;  1QVF U;  3DTU B;  1THZ A;  4P30 A;  4JI6 B;  3CS5 A;  3BFR A;  1JMK C;  2FYU H;  5LMU B;  2Q7H A;  2Y0P A;  4FM0 A;  4KHP O;  3KCY A;  3HKB B;  4DR7 B;  4FIP C;  3ZS8 C;  5J9P C;  4ZOL A;  4CS4 A;  4DUY O;  2CTP A;  3OM3 B;  2ZKO A;  4JAA A;  1CXZ B;  4IHJ B;  3W7X A;  1JX9 A;  3AG3 B;  4OGQ B;  5JJJ B;  1B04 A;  2QKC A;  4F6R A;  2UU9 B;  2EIK B;  4LWS A;  2HVJ C;  4LFB B;  4LF6 O;  3G6B A;  1EN5 A;  4UB8 Z;  3CCS V;  1V55 B;  3G4S V;  2CUG A;  4TSF G;  4DV2 B;  2QM7 A;  4LF7 O;  4OPH A;  2CAZ C;  5A9G A;  4FZ0 A;  1YDX A;  1VF5 B;  5JH7 B;  1TVK B;  3O9O A;  1WLE A;  5IJ0 B;  3JD3 A;  4TQD A;  5CN0 A;  1IBL B;  3OTO O;  4X89 A;  1M56 C;  5F2V O;  2CE4 A;  1O9G A;  4MVQ A;  3CXH F;  1KUQ A;  2EIL C;  1RSO B;  4I4T A;  4DR2 O;  3OT7 A;  4ZI7 A;  2Q68 A;  3B77 A;  4YIP A;  1SER A;  1I94 O;  4P9P A;  3JAS A;  4BWA A;  4B3R B;  1TUE B;  4UCT A;  1IVS A;  2WLJ A;  5EBM C;  5H6Q A;  3E35 A;  2E75 B;  4ICG A;  5CA0 B;  1ZAU A;  1ORQ C;  4MVS A;  3THO A;  1NTM H;  2Y4T A;  3CC4 V;  1J5E B;  1G6U A;  4X65 B;  4LH6 A;  1QBZ A;  3CC2 V;  5LGU A;  2WLI B;  1V54 B;  4P2Z A;  2G38 A;  1V55 C;  4IHJ A;  2Q7E A;  2VS0 A;  3UO2 A;  2WSS G;  2IJI A;  1TVK A;  4B3T O;  3GVM A;  3T1H B;  2RN9 A;  3AEI A;  4JYA B;  3MDS A;  1H2K A;  1P84 F;  4HAM A;  4B08 A;  2PGG A;  1MZF A;  1SKV A;  2EZP A;  3OEE G;  2FTK A;  4EEQ A;  4DV0 O;  4PA9 A;  3ABK C;  3ETE A;  2Q8V A;  3IGA C;  1EM1 A;  3N27 A;  2R9R B;  1I08 A;  1FD9 A;  3A0H Z;  3SYC A;  3JAS B;  3T1Y O;  1YIJ V;  4PDV A;  3P30 A;  3H9V A;  5FNV A;  3BEH A;  4PEL A;  1K7D A;  3E22 B;  1PL4 A;  1ZWI C;  4W4K A;  3JAL B;  3OFN G;  3OTF A;  5C8Y B;  1GK9 A;  2DW4 A;  5LL6 Y;  5IYD O;  2FB5 A;  2GUZ B;  3JSL A;  4XDK A;  3SJA C;  2KKW A;  5CMU A;  2O57 A;  2GTS A;  3PJS K;  4JYY A;  4GT1 A;  5KA5 A;  2JVD A;  5J2U B;  1PD3 A;  2K1E A;  2EIJ C;  1X4T A;  5H6R A;  1B06 A;  1N4C A;  3J80 N;  4LFA B;  1BE3 H;  1L8D A;  1UFI A;  3N2G B;  2XAQ A;  4ZKI A;  3VQV A;  5GON B;  3DGE A;  4JI0 B;  1KKD A;  1OCR C;  2B9Z A;  1BQ0 A;  4MVZ A;  4LH7 A;  3L9D A;  3VQX A;  3HKE A;  1S76 D;  1AR5 A;  2BOB C;  3L72 H;  5H2F Z;  1N36 O;  4JAS A;  4WFG A;  1JQ0 A;  4UCO A;  5JQG A;  3JAM N;  4LC1 A;  5EZY A;  1VQ6 V;  4A5U B;  1LUV A;  1EBO A;  3EHB B;  2CH7 B;  4AIL C;  2VQF B;  1IBM O;  1QLE B;  4GX0 A;  1GN4 A;  3RYH A;  2QKA A;  4Q20 A;  5CB4 A;  2JGD B;  3A0R A;  4JF3 A;  1OCC B;  2OT5 A;  3ZMT A;  4YJ3 B;  4UUJ C;  3ZRW A;  1AI4 A;  4PI2 A;  1B3Q A;  2X6C A;  1COW G;  5B3S C;  3K03 A;  4G28 B;  3SPI A;  1NS1 A;  4TV9 A;  3ZRS A;  4DV5 B;  4UXN A;  5B1A B;  3TJT A;  5BR8 O;  2QM4 A;  2P06 A;  1V54 C;  2GV9 A;  2XAS A;  3OUS A;  3K5O A;  3K5M A;  1F23 A;  4E2L A;  3B4S A;  1NVP D;  1D5N A;  4O4J B;  3SPJ A;  5IJ0 A;  5L3E A;  1BT8 A;  3E8G A;  3K58 A;  4FLW A;  1MAB G;  4U3J B;  3ASO C;  3OTO B;  1SQP H;  3FB8 C;  4JYC A;  2YIC A;  2EIK C;  3ABK B;  1Q6U A;  1L0N H;  3CX5 F;  2WWW A;  3G6E V;  1YI2 V;  1HW7 A;  4DRX A;  1HR0 B;  2OYQ A;  2C2A A;  3JAK A;  3JD0 A;  2W6J G;  1N34 O;  4LFC O;  1QR9 A;  5JQG B;  4GX5 A;  1W2B U;  4DK1 A;  3JYC A;  1JOY A;  3RYF A;  4AHC A;  2DYS C;  4PA3 A;  4O2A B;  4KP4 A;  4QE9 A;  3BY6 A;  2RNB A;  2ILM A;  1LNQ A;  2NNU A;  3HKD A;  4C7U A;  1ENV A;  1ROP A;  5EIB D;  1KQS U;  3MHS C;  2Y4U A;  3ZIA G;  1VQP V;  3ZRW B;  4FLX A;  2YXH A;  3BA9 A;  2KG7 A;  4CBC A;  4O4J A;  2MK3 A;  1GMG A;  3W7T A;  1P7G A;  3AK1 A;  1KKC A;  4WCE V;  3IC9 A;  2ZNJ A;  2ZT9 B;  3QTC A;  3ZHV A;  4XDL A;  2EIM C;  3Q4H A;  4FM2 A;  3BVO A;  1OCR B;  4IGG A;  4PA4 A;  3STL C;  4UV8 A;  2EUL A;  4YHH O;  1XNR O;  3VQW A;  2N05 A;  1BGY H;  1URF A;  3FAV A;  4GX1 A;  1Y74 A;  2X7R B;  4YHH B;  4LF4 B;  4QNH B;  4JGS A;  1IBM B;  1OJH A;  2A3Q A;  1A32 A;  4B3M B;  4YIO A;  2ZQM A;  3CPW U;  3ZMZ A;  4DYL A;  4D7T A;  4JZG A;  4K35 A;  3U10 A;  3E2E A;  4H44 B;  5IJ9 A;  1FYJ A;  2DYS B;  4RO2 A;  4X88 A;  1FXK A;  2OCC C;  4JI3 B;  4HNA B;  3R65 A;  4LFC B;  2AZ0 A;  3AG4 B;  2UUC O;  5CBG A;  1YJ9 V;  1YHQ V;  1DLB A;  3RYF B;  4F6R B;  2P5O A;  1XHZ A;  2EIL B;  1J95 A;  3L73 H;  5EK0 A;  2BTQ A;  4DR3 B;  2HG5 C;  3W7U A;  4KFM A;  2YI9 A;  3HKD B;  4YY3 O;  2YS8 A;  5TIS Z;  3ZHU A;  4DV5 O;  5CA1 A;  4L8J A;  3ICX A;  3K04 A;  2UXD O;  5JVD B;  4NXN B;  2YIA A;  2B5U A;  4PDM A;  1I7F A;  4FLZ A;  4X66 B;  1SES A;  2R9A A;  3SDL A;  2QWP B;  1RSO A;  4I4T B;  2UUA B;  2YEV A;  3ZMU A;  1KC8 W;  4JI2 B;  1FXK B;  4UV9 A;  3CC7 V;  2YID A;  4YXW G;  1QHT A;  4GZR B;  1RM1 B;  1K92 A;  3SR2 C;  3JAR A;  1GRJ A;  3HB3 B;  4JI1 B;  3ASN C;  1J5E O;  1GN3 A;  1Y76 B;  4GYC B;  1XEQ A;  4J80 A;  3WG7 B;  4MS2 A;  2VQF O;  3JAT B;  2F4V B;  3K9A A;  1GM9 A;  4UCS A;  1I0H A;  5L3C A;  3RGB A;  4GKK O;  1FFX B;  1OCO C;  3A8T A;  4F4L A;  3HPL C;  4LNU A;  4X62 B;  1X59 A;  2LFS A;  1M57 B;  1EFR G;  3ETQ A;  2WPD G;  4KL1 A;  1GH6 A;  2A9H A;  4DR4 O;  4TV8 A;  4EB6 A;  2Q5Z A;  1QLN A;  1M9N A;  2AHY A;  1MSW D;  1AB3 A;  2L6L A;  3BAB A;  2ZNI A;  3C3S A;  4GKJ B;  4PHZ A;  5KA6 A;  4R6Z A;  2EIJ B;  2IH3 C;  1KB9 F;  4LBE C;  5CBH A;  4JI2 O;  2EIN C;  2IU3 A;  1AJN A;  2JS3 A;  1FFT B;  3S3W A;  4FLU A;  3LDC A;  3TCU A;  1AP6 A;  3KZI Z;  1Q6H A;  3QO5 A;  3CE2 A;  1RM1 C;  4O4I A;  1XIL A;  1WB7 A;  1KBH A;  1H38 A;  2YIB D;  1NH2 B;  3TK1 A;  2WLL B;  4IL6 Z;  2IJH A;  3O65 A;  5EIB C;  4RWU A;  3ZJZ A;  3IJ4 A;  4PI0 A;  1CPY A;  4KXR A;  1Y67 A;  4GKK B;  2CGO A;  1G1X B;  3UM7 A;  1HNW O;  4LP8 A;  3T1Y B;  1JFF A;  4J42 A;  1AI5 A;  4Z2W A;  4DV3 O;  1Q8I A;  4ZBM A;  4DV2 O;  1XRE A;  1NU1 H;  3SJQ C;  1ZL8 B;  4G27 B;  3F5W C;  4ASU G;  1B6Q A;  4AI8 A;  5AG2 A;  3L71 H;  3TGU H;  3FYE B;  2A0L A;  4J7Z A;  3D36 A;  3L75 H;  4J10 A;  3T1C A;  1UPG A;  3OR6 C;  5LYJ A;  3JCU Z;  4DV7 B;  2F23 A;  3ZN0 A;  3OD4 A;  4CH5 A;  2P4V A;  3SPH A;  1R1B A;  2LP7 A;  1FPO A;  2AHZ A;  3GB7 C;  2CTR A;  2ITC C;  2JDI G;  4TV8 B;  2QGN A;  1FAF A;  3UT5 B;  2EIN B;  2VQE B;  1GKF A;  1FJG B;  1NR1 A;  2WLM A;  4ZI7 B;  1P49 A;  3F5T A;  5IYZ B;  2PF4 E;  1E1R G;  4DV6 B;  3K9S A;  1SZT A;  1GM7 A;  2CDY A;  1TGO A;  2H8P C;  3CRC A;  2F4V O;  3UKM A;  3RW0 A;  3WU2 Z;  1BMF G;  4JI5 O;  3T2M A;  3OGC C;  1N32 B;  5LMN O;  1SF9 A;  1Y66 A;  1OCO B;  1K73 W;  4WFB V;  4CS3 A;  1EN6 A;  4IYH A;  1K9M W;  3NXS A;  1JFF B;  1M57 C;  4Q6G A;  1SQV H;  2F93 B;  3L74 H;  1XL6 A;  2QWO B;  3F7Y C;  4NXN O;  5IWA O;  2XHB A;  1DK1 A;  5EYP B;  5CA3 A;  4DV1 B;  3F7V C;  2R9I A;  1ZL8 A;  3CCE V;  2ZIO A;  1CEZ A;  2NLJ C;  1XMO B;  2KSD A;  1OHH G;  2QA4 V;  2DYR C;  2XND G;  1VQM V;  5FL7 G;  3RYI B;  4DV0 B;  5GTI Z;  1VQO V;  4JI8 B;  2XTA A;  5C93 A;  4CH4 A;  1AIL A;  2JRI A;  5EBW C;  4RAI A;  1MG1 A;  2BSK A;  1F4N A;  4MVR A;  4JI7 B;  2IBZ H;  1SRY A;  5LXT A;  5KX5 B;  1O9H A;  3U11 A;  2E5L O;  2WLH A;  4I7Z B;  4MVU A;  3QNE A;  3UT5 A;  2QWR B;  3G80 A;  1KD1 W;  1Y76 A;  4LWS B;  4DR1 B;  2B1I A;  5B5E Z;  2X6A A;  3BHP A;  4DK0 A;  4CZZ A;  1QVG U;  4Z1M G;  2JJ2 G;  4I50 B;  3CHX A;  4FFK A;  3L70 H;  1PNM A;  1PL0 A;  1MA1 A;  3SYO A;  5KAF Z;  5KMG B;  4KUM A;  4LNU B;  1FKA O;  4OXS A;  3E86 A;  3JD4 A;  2LFR A;  5BR8 B;  3KCX A;  4UCU A;  2BCC H;  4UFZ A;  2EX3 A;  4B3M O;  4EB6 B;  3MD0 A;  1JCH A;  1QU7 A;  5HFM A;  4PJ0 Z;  4JV5 B;  5KHG A;  4NR1 A;  2OTJ V;  4TWK A;  2ZR2 A;  1Q90 D;  4TUY A;  5ITZ B;  3AG4 C;  3APQ A;  3FB6 C;  4DV4 O;  2RQ6 A;  2ZM6 O;  5B1N A;  1YEW A;  5LBQ A;  3W7W A;  1LR1 A;  1XUQ A;  2Q0O C;  3CYO A;  4UCR A;  3TET A;  4FVM A;  1AI7 A;  3ZBH A;  1F51 A;  3FD9 A;  3CCU V;  2A7W A;  4ABM A;  1NBM G;  1VIB A;  1WP7 A;  1OCZ C;  4YY3 B;  1Q7Y W;  4LFA O;  2A79 B;  3JD1 A;  1YJW V;  2R72 A;  3C90 A;  5KMG A;  3I5D A;  2ZIN A;  2F43 G;  2E3C A;  5LHI A;  2UXC O;  3ASO B;  2Y69 B;  3D3Q A;  1XNQ O;  1Y6X A;  2YIB A;  3HKC B;  1H8E G;  1ZX3 A;  1N8R W;  2QWQ B;  3RYC B;  1N33 B;  1Q86 W;  2Q7G A;  2ZDI A;  2QJ1 A;  3M99 B;  5IDJ A;  2ZM6 B;  2UXB B;  1NH2 D;  1HNX O;  2JGU A;  1KU9 A;  4X20 B;  1KYO F;  2Z3Y A;  5LMN B;  1ARO P;  5CA1 B;  4J41 A;  3SJB C;  1L1F A;  5LYJ B;  3KG2 A;  3T4Z A;  2P90 A;  3ZHR A;  2F95 B;  5BMV B;  1NTK H;  4JTD B;  3U0Z A;  1Q3E A;  1H2N A;  3WG7 C;  2GTA A;  3BAA A;  4U3J A;  4R50 A;  2VWJ A;  1K8A W;  1WJZ A;  4DR5 B;  1XL4 A;  3K08 A;  2QEX V;  3CCR V;  1RPR A;  4WFA V;  4DR4 B;  4X1K B;  4WFE A;  4IIJ B;  1S3J A;  3X2Q B;  4MTO A;  3AG2 C;  1QR8 A;  2IH1 C;  4QE7 A;  4X9Q A;  4JI8 O;  4I9W A;  4CC6 A;  2ZXW C;  1YTF B;  1WP8 A;  1N36 B;  1XI1 A;  5FNV B;  1LUW A;  2HKO A;  3D36 C;  1QCE A;  4O2A A;  3ETD A;  1D2D A;  3MHH C;  1W0K G;  4PV1 B;  1Z5V A;  3RT3 C;  2V7Q G;  2QTO A;  1VP7 A;  2V4D A;  3E83 A;  5FLX N;  4B3R O;  1R6K A;  2PYJ A;  4JZ2 A;  3CRQ A;  2FL4 A;  4G2K A;  1MSD A;  2CK3 G;  3ZED A;  3QVN A;  4JI7 O;  1JJO A;  3K5L A;  2EJR A;  1VAR A;  3OEH G;  2LW1 A;  2XUM A;  2HHH O;  1Q81 W;  4F6E A;  1H2L A;  1ZTE A;  4Z1V A;  4N23 A;  5IY5 B;  3NR7 A;  3BPZ A;  1IBL O;  1IZ3 A;  1PKX A;  4MW3 A;  3ZHS A;  3RYH B;  3IFX A;  3E8F A;  3HKE B;  1U97 A;  2JGD A;  3DC6 A;  2RCV A;  1Y74 B;  3CEI A;  4BW5 A;  1M5I A;  1NJI W;  1QNM A;  3AG7 A;  5LGN A;  1TUB A;  2UUB B;  4LF8 O;  5EZY B;  5LP6 C;  3RBZ A;  3FB7 C;  5CA0 A;  4O4I B;  5DM6 V;  5E79 Z;  2ARH A;  2WA3 A;  3CCQ V;  1DF5 A;  1EZV H;  1VQ5 V;  4FLV A;  2Z5U A;  4QPK A;  3H1K H;  1P7B A;  1IBK B;  1K3E A;  4LCU C;  5CB4 B;  1IUR A;  1PPJ H;  1EZJ A;  3CB2 A;  4FLY A;  3BRC A;  1RPO A;  2UUC B;  5CBF A;  4B3S B;  1D5A A;  5J2T A;  4GKJ O;  4J7J A;  2ZIM A;  4QIW F;  1Q5O A;  4TV9 B;  1SQG A;  1ZLZ A;  2E5L B;  2VWK A;  1WA8 B;  3TXQ A;  4H37 A;  1IDS A;  3RN4 A;  3DXR A;  4GUN A;  1JJ2 U;  2UUB O;  3CD6 V;  1R3K C;  2Q6A A;  3W7S A;  2PI5 A;  4RQF A;  4WFH A;  4WBN B;  4O4L A;  5GTH Z;  3OMI B;  2JJ1 G;  3ABT A;  3FX7 A;  3RWR D;  3ETG A;  4K8Z A;  4QPJ A;  2Y0I A;  4UVA A;  4DV3 B;  3H01 A;  2BE3 A;  4R7C A;  3STZ C;  2UXX A;  4K0K O;  2HVK C;  3K5N A;  2GUZ A;  2GDS A;  1GN2 A;  3VBB A;  4DR3 O;  4DW0 A;  1TUB B;  1GN6 A;  1OV9 A;  1GAX A;  1XOU A;  4U7N A;  1P4R A;  3CRR A;  3SYP A;  5GW7 A;  2ZE5 A;  4O2B B;  1SQQ H;  1T5E A;  2GSM B;  2PZS A;  4BR6 A;  4DO2 A;  1IXB A;  1YF2 A;  2HP8 A;  1N34 B;  5J2U A;  2AXT Z;  1OCZ B;  3KKY A;  3E89 A;  1KMI Z;  4B7K A;  3LNN A;  5LMU O;  3LUT B;  4JPR A;  2W6I G;  1JVM A;  3BCC H;  2E74 B;  1HDJ A;  5B1B C;  1I5Y A;  2QR4 A;  2IW5 A;  1H2M A;  1Z5W A;  4MVM A;  1PV0 A;  1SS3 A;  3Q4H B;  5L3G A;  1Q82 W;  1MZE A;  1WA8 A;  2ADP A;  3DXR B;  4FFB B;  2IJK A;  3BA8 A;  3LDE A;  4DXW A;  1NZ6 A;  2AGA A;  4H33 A;  4KHP B;  2F1M A;  2YC0 A;  3VQY A;  4MVO A;  5LHG A;  4HNA A;  4UCV A;  4LF5 B;  2DE0 X;  4J9Y B;  4ZHQ A;  1HWY A;  5KHI A;  4NYK A;  2PYL A;  1M90 W;  4DW1 A;  4P9O A;  4B7E A;  4DR5 O;  1DGS A;  4DR6 O;  3OAA G;  3H1H H;  3VOU A;  4HBN A;  3P3N A;  4FZ1 A;  2QKS A;  1S72 V;  1XMQ B;  2DQ3 A;  2YXL A;  2ZE6 A;  3H1J H;  5LA6 A;  3CWB H;  4X64 O;  3FYI B;  4YJ2 A;  3AG1 C;  3MAQ A;  1SQX H;  2Z0A A;  1HNW B;  3LSS A;  4JI1 O;  3K0G A;  4L87 A;  3ZN1 A;  4TQF A;  2Q0A A;  4DR7 O;  5A2Q N;  3WB2 A;  4D7S A;  2XAJ A;  2BTQ B;  1FXV A;  3IAY A;  4TT3 G;  1I94 B;  5L3D A;  4AQY O;  2UXD B;  1V9P A;  2Q69 A;  3ZX6 A;  1AJP A;  2EIM B;  1Q6I A;  1WAZ A;  2HFE C;  5BZB A;  2WLI A;  1BS3 A;  1K4C C;  4TOI A;  5BXZ A;  2OWO A;  4DR1 O;  3UQ8 A;  3ZHT A;  5B1O A;  1NVP B;  2NR5 A;  1YSC A;  5KLV H;  3RVY A;  4X1I A;  3S3X A;  5FPO A;  3SPC A;  4NTW A;  3SYA A;  4JV5 O;  4BIZ A;  4JI0 O;  4EKW A;  3CRA A;  3M7M X;  4NTY A;  1ZSP A;  1MNG A;  2UXN A;  4DUY B;  1OCC C;  3K3W A;  4ZOL B;  3JAK B;  1S5J A;  3E8H A;  1BZK A;  1RFY A;  1BSM A;  3CCJ V;  4ZIB A;  2QSA A;  4WF9 V;  1K5S A;  2GHY A;  5BY1 A;  3I55 V;  1NR7 A;  3SGI A;  1JR9 A;  2XAH A;  4CH3 A;  3CMA V;  1Q43 A;  3JCZ A;  4DV6 O;  4NKG B;  4YJ2 B;  4D6T H;  2BOC C;  2F66 C;  1XQ8 A;  2D2C B;  5EC1 C;  3B2E E;  2LW7 A;  1QQC A;  4LF9 O;  3ABU A;  2ETN A;  1VF7 A;  1WNS A;  1HNZ B;  1BHA A;  1GO3 F;  5BMV A;  4BIU A;  3QO8 A;  4PDL A;  2PI4 A;  4DUZ B;  1YJN V;  5GON A;  1M4U A;  4UVC A;  4X8A A;  3C3T A;  4HZ3 A;  4J11 A;  3APO A;  4X1K A;  3E8B A;  3OR7 C;  4U7O A;  5IWA B;  2QWN B;  4RUF A;  1H2G A;  3PN1 A;  2BSK B;  1K4D C;  2NN4 A;  4J7K A;  2K9P A;  4N21 A;  2JEX A;  5IYC O;  4X1I B;  4I5S A;  4NXM O;  5K1P A;  1AVM A;  2Y48 A;  1I5X A;  1BL8 A;  3LDD A;  3EXA A;  4X1Y A;  3OW2 U; 
#chains in the Genus database with same CATH homology
 1VQ4 V;  5IY5 C;  3AG4 B;  4JTD B;  1VQK V;  2WAM A;  2IJJ A;  3OMN B;  5CBG A;  1YJ9 V;  3WG7 C;  1YHQ V;  3K79 A;  1DLB A;  5IYB O;  1QVF U;  2P6J A;  4R50 A;  2DYR B;  3DTU B;  5B3S B;  1THZ A;  1K8A W;  3AG1 B;  4P30 A;  1XL4 A;  1K33 A;  3K08 A;  2QEX V;  2EIL B;  1J95 A;  1RPR A;  3CCR V;  4R8C A;  4WFA V;  4WFE A;  5EK0 A;  1S3J A;  1R3J C;  2HG5 C;  3W7U A;  4KFM A;  3X2Q B;  4MTO A;  3ABL C;  3AG2 C;  1QR8 A;  2IH1 C;  4QE7 A;  4I9W A;  1E1Q G;  1Y4M A;  2ZXW C;  1YTF B;  2XOK G;  1R3I C;  4MT8 A;  3CXC U;  3K04 A;  4FIP C;  1K5Q A;  3RVZ A;  5J9P C;  2HKO A;  4XBF A;  2B5U A;  1QCE A;  3OM3 B;  4PDM A;  2D3O W;  3ETD A;  3OMA B;  4PA6 A;  2Y69 C;  3MHH C;  1W0K G;  3W7X A;  1JX9 A;  3ZRX A;  3AG3 B;  1SES A;  1OZ0 A;  2EIK B;  1VQN V;  2V7Q G;  2QTO A;  1DTO A;  2HVJ C;  2DQ0 A;  3E83 A;  1PNL A;  1R6K A;  2P7T C;  2YEV A;  1VQL V;  4JYB A;  4G2K A;  3ZMU A;  5LGT A;  3CCS V;  1KC8 W;  2CK3 G;  1FXK B;  1V55 B;  3OE7 G;  4GX2 A;  4UV9 A;  3G4S V;  3CC7 V;  4TSF G;  2QM7 A;  3ABM C;  4FK5 C;  4MTX A;  4YXW G;  2EJR A;  3OEH G;  1RM1 B;  4UVB A;  1K92 A;  1Q81 W;  2OCC B;  1BHB A;  3HB3 B;  4MW8 A;  1G4Y B;  1WLE A;  2JEU A;  3ASN C;  4N23 A;  5IY5 B;  3P32 A;  3JD3 A;  3WG7 B;  4MS2 A;  1VQ9 V;  5CN0 A;  1PKX A;  1SET A;  3IC7 A;  4MW3 A;  2H94 A;  4FMT A;  3K9A A;  1GM9 A;  4X89 A;  1M56 C;  1W0J G;  3IFX A;  3E8F A;  5L3C A;  4MVQ A;  2EIL C;  4BW5 A;  5H9C A;  1OCO C;  1NJI W;  5L3B A;  4F4L A;  3HPL C;  5LGN A;  2Q68 A;  1S5H C;  1WPX A;  2DWD C;  2LFS A;  3B77 A;  1M57 B;  1EFR G;  3ABL B;  1SER A;  3RBZ A;  3FB7 C;  2ZR3 A;  1IXM A;  2WPD G;  2ATK C;  5DM6 V;  4P9P A;  3ZRV A;  2A9H A;  3WFV A;  3CCQ V;  1DF5 A;  1VQ5 V;  2Z5U A;  4QPK A;  1TUE B;  1P7B A;  1K3E A;  2WLJ A;  4LCU C;  1CP9 A;  1QLN A;  1M9N A;  2AHY A;  5EBM C;  5H6Q A;  1MSW D;  3E35 A;  3ML0 A;  1G8M A;  1EZJ A;  1ORQ C;  3FKS G;  4MVS A;  1RPO A;  3GWO A;  2DWE C;  3B8M A;  5CBF A;  3CC4 V;  1YIT V;  5KA6 A;  4R6Z A;  2EIJ B;  2IH3 C;  4LBE C;  5CBH A;  5DN6 G;  5L3F A;  1NKD A;  2EIN C;  2IU3 A;  1AJN A;  2V1D A;  1QBZ A;  3CC2 V;  5LGU A;  2WLI B;  1FFT B;  1V54 B;  4QIW F;  4P2Z A;  1FXK C;  1V55 C;  2WLL A;  3OUF A;  3LDC A;  3LNM B;  2WSS G;  4JAV A;  2IJI A;  3K06 A;  3TCU A;  3EFF K;  2JK5 C;  3QO5 A;  1RM1 C;  4H37 A;  1H38 A;  1JJ2 U;  3AEI A;  1NH2 B;  3TK1 A;  2HR3 A;  2WLL B;  2IJH A;  3CD6 V;  3ZJZ A;  4HAM A;  1R3K C;  1CPY A;  2Q6A A;  3OEE G;  2EZP A;  3W7S A;  2PI5 A;  4RQF A;  3UM7 A;  4LP8 A;  2FTK A;  4WFH A;  4PA9 A;  1M56 B;  3ABK C;  3B8N A;  3CCM V;  3OMI B;  1VQ7 V;  2JJ1 G;  1AI5 A;  2HJF C;  2XAG A;  3ETE A;  3ABT A;  4ZBM A;  3IGA C;  2X0L A;  3ETG A;  4QPJ A;  3SPG A;  2R9R B;  4UVA A;  2ZD9 A;  3SJQ C;  4G27 B;  3F5W C;  3H01 A;  4ASU G;  3SYC A;  4GCZ A;  4R7C A;  1B6Q A;  3STZ C;  1YIJ V;  2UXX A;  4PDV A;  3P30 A;  3CME V;  2HVK C;  1QLE C;  2B1G A;  2A0L A;  3FYE B;  1NQT A;  3BEH A;  4PEL A;  3D36 A;  1K7D A;  4JTC B;  1ZWI C;  2EBO A;  3T1C A;  3VBB A;  3OFN G;  3OR6 C;  1FXH A;  1GK9 A;  3ZN0 A;  2DW4 A;  4BAY A;  5IYD O;  1GM8 A;  4XDK A;  4U7N A;  3SPH A;  1P4R A;  5KUM A;  5CMU A;  3SYP A;  3ZCC A;  2LP7 A;  5GW7 A;  2AHZ A;  3PJS K;  4GT1 A;  3GB7 C;  5KA5 A;  2ITC C;  3AG3 C;  3FB5 C;  1PD3 A;  2JDI G;  2K1E A;  2EIJ C;  5H6R A;  2P67 A;  2GSM B;  2EIN B;  4DO2 A;  1GKF A;  4PA7 A;  3K0D A;  1NR1 A;  2WLM A;  2QM8 A;  1OCZ B;  2XAQ A;  1E1R G;  4ZKI A;  3ABM B;  3E89 A;  3DGE A;  4JTA B;  1KKD A;  3LUT B;  1OCR C;  4JPR A;  4MVZ A;  2W6I G;  1JVM A;  1SZT A;  4HYO A;  4XDJ A;  1GM7 A;  5B1B C;  2Q67 A;  1I5Y A;  3ASN B;  2IW5 A;  2H8P C;  4MVM A;  1S76 D;  1Q82 W;  5L3G A;  4RUE A;  2BOB C;  3UKM A;  3RW0 A;  4JAS A;  1BMF G;  4WFG A;  1M1K W;  1JQ0 A;  3T2M A;  2IJK A;  3OGC C;  4WFF A;  3LDE A;  4DXW A;  4LC1 A;  4H33 A;  1Y66 A;  1OCO B;  4MVO A;  5LHG A;  4WFB V;  1K73 W;  1KP3 A;  1VQ6 V;  1EBO A;  1K9M W;  3NXS A;  3EHB B;  1M57 C;  4PDR A;  4J9Y B;  1QLE B;  4GX0 A;  1HWY A;  2YSU B;  4JAU A;  1M90 W;  1XL6 A;  4P9O A;  3F7Y C;  4Q20 A;  3A0R A;  4JF3 A;  3CCV V;  1OCC B;  3OAA G;  3VOU A;  2OT5 A;  5CA3 A;  3F7V C;  2R9I A;  3CCE V;  3ZMT A;  2QKS A;  2QE7 G;  4FPP A;  4UUJ C;  1S72 V;  2DQ3 A;  1CEZ A;  2NLJ C;  4MTF A;  3ZRW A;  5HFL A;  1AI4 A;  3FYI B;  1OHH G;  2QA4 V;  2X6C A;  2DYR C;  1COW G;  2XND G;  3K03 A;  5FL7 G;  3AG1 C;  5B3S C;  1VQM V;  2WLK A;  4G28 B;  3SPI A;  5KUK A;  1K34 A;  1VQO V;  3ZRS A;  4MSW C;  4UXN A;  5B1A B;  3LSS A;  5C93 A;  2XAF A;  3K0G A;  4L87 A;  3QO7 A;  5EC2 C;  1AI6 A;  5EBW C;  3ZN1 A;  4RAI A;  1MG1 A;  1V54 C;  2XAS A;  1F4N A;  3OUS A;  4MVR A;  1SRY A;  2XAJ A;  1FXV A;  1F23 A;  1JPX A;  4E2L A;  2WLH A;  4MVU A;  4TT3 G;  3QNE A;  1NVP D;  5L3D A;  1KD1 W;  2Q69 A;  3SPJ A;  1AJP A;  2B1I A;  2EIM B;  2W0F C;  2X6A A;  5L3E A;  2HFE C;  5BZB A;  2WLI A;  3E8G A;  4CZZ A;  1QVG U;  4Z1M G;  2JJ2 G;  1K4C C;  2EZO A;  1MAB G;  1S77 D;  3ASO C;  4FJC C;  3FB8 C;  1PL0 A;  1PNM A;  4JYC A;  5B1O A;  3SYO A;  2EIK C;  3ABK B;  5EBL C;  1NVP B;  4KUM A;  1YSC A;  3RVY A;  3JD2 A;  3SPC A;  3G6E V;  2WWW A;  3LSQ A;  3G71 V;  1YI2 V;  3SYA A;  4OXS A;  4BIZ A;  3E86 A;  4EKW A;  4MTG A;  3SYQ A;  2X6B A;  2LFR A;  3JD4 A;  1DF4 A;  2C2A A;  3JD0 A;  2W6J G;  2WLN A;  1QR9 A;  3T4D A;  1R73 A;  4GX5 A;  1W2B U;  2UXN A;  3JYC A;  1JOY A;  3MD0 A;  3I56 V;  1JCH A;  1OCC C;  2DYS C;  5HFM A;  3K3W A;  1PNK A;  4PA3 A;  2OTJ V;  4TWK A;  2ZR2 A;  4KP4 A;  4QE9 A;  3E8H A;  3BY6 A;  1E79 G;  3AG4 C;  3CCJ V;  3FB6 C;  1LNQ A;  2NNU A;  5B1N A;  4J9Z B;  1ENV A;  1ROP A;  4RQE A;  1KQS U;  4WF9 V;  1K5S A;  2GHY A;  4QJF B;  5LBQ A;  3W7W A;  3MHS C;  3I55 V;  1KP2 A;  1NR7 A;  2ITD C;  5B1A C;  3ZIA G;  2YEV B;  3CYO A;  2XAH A;  1VQP V;  1S0V A;  2HLD G;  2KB1 A;  3CMA V;  3CP1 A;  3ZRW B;  3TET A;  2ZDI C;  1AI7 A;  3JCZ A;  5E1A C;  4CBC A;  1F51 A;  3CCU V;  3X2Q C;  2MK3 A;  1GTO A;  1GMG A;  1MOF A;  3AG2 B;  3W7T A;  2BOC C;  1VQ8 V;  1NBM G;  1H8H G;  1KEC A;  1OCZ C;  3CCL V;  1K97 A;  2ZXW B;  1Q7Y W;  5EC1 C;  4WCE V;  2A79 B;  1F4M A;  3JD1 A;  4XDL A;  3ABU A;  2EIM C;  1YJW V;  1OCR B;  1UJW B;  1BHA A;  1GO3 F;  1FS0 G;  3ZMS A;  4BIU A;  3QO8 A;  4PA4 A;  4PDL A;  2F43 G;  4UV8 A;  5B1B B;  3STL C;  1AR1 B;  5LHI A;  2PI4 A;  1YJN V;  3ASO B;  2Y69 B;  3ZMV A;  4UVC A;  1H8E G;  4X8A A;  4GX1 A;  1N8R W;  2X7R B;  4QNH B;  4HZ3 A;  4JGS A;  1Q86 W;  3E8B A;  3OR7 C;  2ZDI A;  2JIZ G;  4U7O A;  3M99 B;  1YTF D;  5IDJ A;  1R6N A;  1NH2 D;  2ZQM A;  3D3I A;  3CPW U;  3ZMZ A;  1H2G A;  4RUF A;  2Z3Y A;  1ARO P;  1K4D C;  1AJQ A;  3E2E A;  4N21 A;  2JEX A;  5IYC O;  1L1F A;  3KG2 A;  5LHH A;  2OTL V;  4I5S A;  2DYS B;  4RO2 A;  3T4Z A;  4X88 A;  2Y48 A;  2IU0 A;  1I5X A;  1FXK A;  1BL8 A;  2OCC C;  2P90 A;  1R3L C;  3LDD A;  3OW2 U;  3R65 A;  2M7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...