1VQ8V

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq8V00
1YJNV 1M90W 1VQMV 1YI2V 1YJWV 3CXCU 3CCVV 1VQLV 1Q7YW 2OTLV 1YITV 1VQ5V 1W2BU 2OTJV 1S72V 2D3OW 1VQ9V 3CMEV 1R73A 1VQOV 1NJIW 1K9MW 4WFAV 3CCJV 1VQ7V 3G71V 2QEXV 3CPWU 1YHQV 2QA4V 4WFBV 1Q86W 1VQ6V 3CCQV 3G6EV 3CC2V 1Q82W 1QVGU 1KD1W 3CCLV 1N8RW 3CCUV 3CC7V 1VQPV 3CMAV 3CCSV 1VQNV 4WCEV 1KC8W 3OW2U 5DM6V 3CC4V 3CD6V 3G4SV 1K73W 1M1KW 1VQ8V 1VQ4V 3I56V 3CCMV 1JJ2U 1VQKV 1K8AW 1YJ9V 1KQSU 1QVFU 1Q81W 3I55V 3CCEV 1YIJV 3CCRV 4WF9V
chains in the Genus database with same CATH superfamily
3QO5A 4NXMB 2KG7B 2QE7G 2ATKC 5B1NA 2QM4A 2OTJV 1AI7A 1XHZA 1AP6A 5A9GA 1OCOC 4X88A 4FLUA 3QF7A 4DRXB 4C7UA 2D2CB 2LGQA 3LSSA 1OCZB 4JZ2A 2UUCO 3N2KB 1THZA 3KZIZ 5IYCO 1R3JC 3ETDA 1UPGA 2JGDB 3CMEV 3PN1A 3ASOB 5EYPB 2ZM6B 1R6KA 4RWUA 4DUZO 3UT5A 1CPYA 5LBQA 4IYHA 1GN3A 4DR3B 1VQ8V 4XBFA 4JYAB 4WFFA 3JAMN 1GMGA 3HKEA 1H2LA 4L8JA 5JH7A 1RPOA 3MHHC 1A32A 2W0XA 4E2LA 1NT2B 5B1BB 4X66O 4DO2A 2Q7EA 2EZPA 3QTCA 4MTFA 4LFBB 1U96A 2UXDO 1K97A 3UO2A 4TSFG 5JVDA 3KKYA 2RN9A 2YEVA 2P67A 1BCCH 5H9CA 3O9OA 4X89A 3BHPA 4LF7O 5KHGA 2QA4V 5LMUO 4FLWA 3CCUV 3C3SA 4LH7A 4MVQA 2ZDIC 3ABTA 1FXHA 3MD0A 2RNBA 4JGSA 4JYCA 1NVPD 5E1AC 4JI5O 1YVWA 1VP7A 2OCHA 4X64O 1MNGA 1X59A 1OCZC 5JCOC 5KHJA 3G6BA 1EN5A 2BTOA 3NR7A 2ZNJA 4X65B 1NVPB 4YIPA 1HNZO 1TGOA 5JJEB 1IBMB 1FXKA 3ASOC 1PM9A 1Q6HA 4MVRA 1JA8A 1TVKB 3I5DA 1X4TA 4OXSA 5IYZA 1K5QA 3G6EV 1S0VA 2JK5C 1S76D 2GSMB 1B06A 3CCSV 2F43G 4BIZA 2WLLA 4JI3B 3RT3C 4DUYO 4EFBA 1Y67A 1YJWV 1I5XA 5J2TA 3L9DA 1N36O 5B5EZ 1GN6A 4LBEC 3ETQA 1K92A 2UXNA 3L71H 5L3FA 5LOVA 1IBLO 3EXAA 3F5TA 4FM0A 5E79Z 3MHSC 5JJNB 5HFLA 1SA0A 4NXMO 2XTAA 4J9ZB 2X6BA 4UCRA 3ETGA 2QTSA 4DV5B 2XAHA 3CRRA 1TAEA 4DR2B 2EILB 2ADQB 4ZHQB 1VQOV 3RYFB 2B1GA 3L70H 3JALA 3K5LA 3CCLV 3KCYA 3RYHA 1OV9A 2VQEB 3DXRB 4I4TB 5J2UB 2MK3A 1JJOA 1V55C 3ZN0A 2ZM6O 3FAVA 1YCIA 1B04A 5IT9N 3JD1A 5D5PA 5L3CA 4BW5A 1HW7A 4B3MB 4DR3O 2CGNA 4JI0B 2P7TC 2WSSG 4JI4B 4JYAO 1BS3A 3CWBH 1NTMH 5IYBO 3CJHB 1B6QA 2BTQA 1LR1A 3U10A 4A5UB 4FFBA 1BHBA 4LFBO 3W7UA 1S5JA 4DK1A 3OM3B 4L87A 2FKXA 3GWKC 2WLIB 2Y0IA 3OEHG 1WP8A 2DQ3A 1R6TA 4DR7B 5GTHZ 2QDOA 4XDLA 3DTUB 4O4IA 3GWOA 4Q20A 5B1AB 5IE9A 4NVPA 4EB6B 1S5LZ 4JZGA 3AG7A 4DR1B 2WLMA 5IDJA 2B9ZA 3A0BZ 3A0HZ 1IVSA 2YS8A 5EBWC 4F6EA 5LA6A 3WB2A 3THOA 3X2QC 1L1FA 1M4UA 4X65O 4DR6B 2W0FC 3RFRA 1KKCA 3SJCC 2EINB 2HG5C 1IBMO 4O2BA 1GAXA 1G1XB 1RP3B 2D3OW 3K03A 2RDCA 3FB5C 3BY6A 2X6AA 3AG3C 2HJFC 2YC0A 3E8HA 1SRYA 3K58A 5GTIZ 3OFNG 4JF3A 4PA4A 3Q4HB 4MTOA 4KFMA 4LF4B 2QM7A 3JARA 5C8YA 4LFAO 4P9OA 4AQYB 1WJZA 3OD4A 2C2AA 3HKDA 2JDIG 3ABMC 4PDMA 3P3PA 3ZHRA 1RM1B 3FB7C 4PDVA 3A2FA 5KX5A 1GKFA 3JCUZ 2VWJA 4FLTA 2Q4PA 4JI3O 5EZYB 4AILC 2CH7B 3QNEA 3ZMUA 1J5EB 1VEWA 4DV2B 4MT8A 2H94A 1D5AA 2K9PA 4U7OA 5J9PC 1J95A 1OJHA 1H2KA 1QQCA 4GYCB 3G67A 1PKXA 4AHCA 1PL4A 4QGPA 3APOA 4DV5O 5JWPA 2K1EA 3CSXA 2GUZB 5B1AC 4DR2O 4GT1A 4MVUA 3T1YO 4F4LA 1FFXB 2GHYA 4I9QA 3SPJA 1O9GA 2ZT9B 2VQEO 5JQGA 2BSKB 1VQ5V 5CA1B 4PA3A 2JS3A 1FJGB 4YHHB 4U3JA 2Q7GA 1T5EA 1CXZB 2IU0A 5CBFA 4IL6Z 3RN4A 5ITZB 4B3MO 4JI0O 4H13B 3T4ZA 1Y76A 4J41A 1US6A 4JI4O 5CB4B 1PL0A 4D7SA 5KHHA 1BSMA 2F95B 5H2FZ 5L3GA 5GONB 3JSLA 1M93A 5LP6A 1V9PA 1I94B 1SQFA 5JJJB 1RM1C 2Q0OC 5CA0A 3JAWA 3ASNB 4KUMA 2ZNIA 4LF6B 4WFHA 3ZRWB 1VQKV 5KAIZ 1F51A 2KSDA 4FZ0A 4G28B 4DR7O 1IZ3A 2GTAA 4DV0B 2IH3C 2EJRA 3JCZA 4J11A 2YUAA 2JJ2G 3UT5B 5EBLC 1K3EA 2ITDC 1NU1H 2DQ0A 4DR1O 1GRJA 1YEWA 2ILMA 1VQ9V 4DW1A 1Q3EA 2R9IA 3HKEB 1XREA 2UXBB 4FM1A 5C93A 3TK1A 5JH7B 1CP9A 4N21A 4DR6O 1NH2D 1Q8IA 1KP3A 1VF6C 4LNUA 3H1HH 1SQXH 2ZE6A 5LGUA 4AI8A 3L75H 1IX9A 1NH2B 1QVFU 2UXCB 1F7YA 4GCZA 1OCOB 3FX7A 4MVZA 1YTFB 1K34A 4LF4O 3L74H 1WLEA 4AQYO 3P30A 2EX3A 4UB6Z 3GVMA 2GBOA 1WA8A 2CTPA 3K3WA 2PI5A 3OMNB 3E22A 3LNNA 1Q6IA 3IC7A 2X6CA 3OEEG 1ENVA 3E8GA 3CE2A 3WG7C 5IJ9A 1DF4A 4CC6A 4UCVA 3MDSA 1G6UA 4PJ0Z 5LXTA 5FNVA 4DV2O 3ASNC 3NXSA 4TV8B 3B4SA 2BCCH 3DC5A 3CX5F 1VQ6V 1XMOB 2DYSC 4I0XB 4J7ZA 4QPJA 3LDCA 3TXQA 3SGIA 2HP8A 2QWRB 5KMGA 1BQ0A 1XMQB 1R3LC 2PUSA 1EN6A 1ZLZA 2OIGA 1FS0G 3SYAA 2LFRA 2DW4A 4NKGB 3UCSC 2YI9A 4KHPB 2LW7A 1SC5B 3C90A 3D3QA 3LSQA 2ZIOA 2ZD9A 3W7TA 3CCQV 1Y74A 5IYZB 4BW9A 2ZE8A 3OTFA 4QE7A 1N8RW 3T4DA 2KQXA 5K1XA 4OGQB 2QKAA 2E74B 1FJGO 1MZFA 1XHXA 4UFZA 2BOCC 4YHHO 4R50A 3CCMV 1XNQB 2MW2B 1G4YB 4XDJA 1JOYA 3RVZA 2P5OA 1HNXB 2F93B 1U97A 1YITV 4Z1VA 1PPJH 5GW7A 1NJIW 5LOVB 4HBNA 2M7WA 5CA3A 2Q67A 1MABG 5KA5A 1Z5WA 3ZHTA 4I50A 2NN4A 1JCHA 3OE7G 1I94O 2YSUB 4FZ1A 4IGGA 4GX1A 5IY5B 3J7AU 3JAKA 3UO3A 1BGYH 4FFKA 3RGBA 4LF6O 1H38A 3BCCH 1R1BA 5FPRA 4YJ2B 4FM2A 4OPHA 4DV7B 2Y0PA 3RYHB 2AGAA 4TOIA 3SJQC 4DV0O 1M1KW 3S3WA 2HHHB 3FAVB 3JATA 5LYJA 2EULA 3C3TA 1FXKC 2NNUA 1KYOF 1XL4A 1P7BA 5FPOA 1H2NA 2GDSA 3CB2A 3ZHVA 1AR1B 2UXBO 1VQ4V 2KKWA 1EN4A 3BA8A 1K7DA 2ZR2A 4BWAA 4ZI7A 1M90W 3E8BA 4HAMA 1XILA 2P22C 1GM8A 2UXCO 2ETNA 3ZMTA 2KB1A 1S5HC 4TV9A 4RUFA 3AG2C 2E3CA 3EFFK 1PD3A 3SPCA 2AZ2A 3ABLC 3VBBA 5H6QA 2PYLA 4O4IB 4PA9A 3RYIA 1K33A 3HKBB 3CP1A 3B2EE 1OCCC 1IDSA 1V55B 5KHKA 5IY5C 1AVMA 3WFVA 3B8MA 4EFEA 2A0LA 4DV4B 3ZS8C 1HP8A 3I55V 2HLDG 2XNDG 2WA4A 3DSQA 2YIBD 4O2BB 3OUFA 1S72V 4R8CA 1XMQO 3HB3B 3ZMZA 1KECA 1W0KG 5H5NA 1KP2A 5KA6A 4KHPO 3OMIB 2WAMA 2DMXA 3JARB 1E1RG 3FFQA 3J80N 1ZX3A 2NLJC 2ZKOA 1XEQA 1XNRO 1D5NA 2PYJA 3TJTA 2EIMC 5BR8B 2HKOA 4R7CA 4R6ZA 5KX5B 1XNQO 1JFFA 4DV3O 4X8AA 3TGUH 1K4CC 2CDYA 3JYCA 2ZXWC 4IIJA 3S3XA 1SZXA 1I7FA 5BMVB 4JAVA 4P30A 3JD3A 3D36A 1JMKC 1P49A 3TXSA 2IJJA 4J10A 1NQTA 1Q6UA 4O4LB 3UKMA 1IXMA 3JASA 3RWRD 5DEDA 4WBNB 5CBGA 3K79A 4LWSA 2V4DA 4NR1A 4PI0A 2NR5A 4O4HB 3X2QB 3LDDA 5IYDO 1EM1A 1SERA 2IW5A 4LC1A 4DRXA 3OW2U 2H8PC 3T2MA 1NKDA 1WB7A 2BE3A 2XAQA 3LSUA 3AG1C 3N2KA 4UVCA 2FB5A 1N0JA 4X62B 3AG3B 4DV7O 1D2DA 4B3SB 4J80A 1AR5A 4JI8B 5EYPA 5B3SC 3T1CA 2HHHO 1DF5A 2N74A 1VQ7V 4YJ3A 2QGNA 1QVGU 4IHJB 3ABMB 5HFMA 1UJWB 1VF7A 1Y76B 2CTRA 1TUBA 1SS3A 4X1YB 3K5OA 1K8AW 2UUAB 3SYOA 1M56C 3CCVV 4GZRB 2YICA 4F6RB 3K5NA 4BIUA 3STZC 3L72H 3F5WC 3PJSK 1GM7A 4P9PA 4GLXA 2Q8VA 2EIKC 4JI6B 4J7JA 1F4NA 1FPOA 1VQLV 2IU3A 2IM9A 4HYOA 1QHTA 5CBHA 2XAGA 1IURA 2QTOA 4JI7B 1KUQA 5DECA 4TT3G 3H1LH 4GX0A 4CH6A 1KC8W 2LJ2A 3CRAA 5DM6V 1ZL8A 3H01A 1SESA 4CBCA 2P4KA 2Q9LA 2CGOA 4GUNA 3AK3A 1N4CA 1Q5OA 2A79B 3K06A 2IJKA 3ZCCA 2XAFA 3OUSA 3K9AA 1NBMG 4K3AA 4O4JB 4ASUG 3ZBHA 2EJ7A 1NI8A 1Y6XA 1YJ9V 3K08A 1FYJA 4UVBA 4WF9V 1YJNV 1QNMA 1BZKA 4P2ZA 5TISZ 1UFIA 2JEXA 1BT8A 3MAQA 4ZOLB 1AP5A 5BR8O 1WA8B 3CC7V 3WB1A 4JTAB 2OT5A 5LP6C 3DGEA 5B66Z 3AK1A 1HR0B 2QKSA 3OMAB 2LGWA 2Y4UA 5LXTB 2JVDA 2F4VB 1QCEA 4MW3A 2XHBA 4WFAV 3H1IH 1E1QG 2E5LB 2QEXV 1SQQH 2Q6AA 1ZWIC 3N2GB 1FD9A 2JEUA 1L0NH 5B1OA 4FLYA 3IC9A 4PDRA 3G4SV 1S3JA 4JI2B 3K04A 2LFSA 1EZVH 3SJAC 1S77D 3UQ8A 3QG5A 3JD0A 1W2BU 4LCUC 2H3OA 3HPLC 3RYFA 2W6JG 3ZRVA 4QNHB 2W6IG 1Q86W 2PI4A 2DE0X 4MS2A 4B3SO 1EBOA 3DXRA 3K5MA 4JI8O 3AG4C 4JTCB 5J2UA 4O2AB 2OCCB 1SF9A 1LUVA 1V54C 1VIBA 3BRCA 1CEZA 4U7NA 1Q7YW 1RSOA 4HNAA 4CS2A 4YY3B 4EEQA 1NR7A 2UUAO 3WG7B 2VQFB 3CJHA 4NTWA 2PF4E 4PA6A 1AI5A 3LNMB 4I50B 4TQDA 1KQSU 3OGIB 2CK3G 5EK0A 3OR6C 2DYSB 3SJBC 2IJHA 3STLC 2UUCB 4U3FH 4IT5A 4JI6O 2WLIA 5LHIA 1P84F 1SETA 2B5UA 3CC4V 3VQWA 4D7TA 4J9YB 3EVKA 4UXNA 4JI7O 2DYRB 4NYKA 1MSDA 5LL6Y 4K0KB 1QLNA 4PHZA 1M57C 1ROPA 3HKCA 4ZKIA 4X20A 1XOUA 2R72A 4Z1MG 1PNKA 2FL4A 4B08A 3ZHSA 4NXNB 3G80A 1W59A 3CRCA 3J81N 3ZN1A 1YF2A 1YTFD 3ZHUA 4EKWA 4FVMA 3ZX6A 5CMUA 4DR4B 1BMFG 4WFGA 4DR5B 1BHAA 2BOBC 5EIBC 5JVDB 1VARA 5H6RA 4ZI7B 2YDEA 2AXTZ 2YEVB 4IYIA 4X9QA 2OCCC 3IAYA 1KB9F 1PP9H 4JASA 1OCRB 4GKJB 3E83A 4DYLA 3Q4HA 5KUKA 5L3EA 4OPAA 4ZIBA 3CMAV 1NR1A 5D5QA 4TV9B 1DLBA 2DWDC 5BXZA 1TA8A 5IWAB 1DGSA 1GN2A 1GO3F 1IXBA 1J5EO 1GM9A 3RYIB 1K4DC 4TWKA 1SQBH 5EZYA 4QE9A 4B7EA 1YHQV 2CAZC 2LW1A 1HR0O 4WFBV 4X1IA 4LH6A 2PY5A 2CH7A 1IBKB 2F1MA 5LGNA 3JD2A 2F4VO 4MVOA 3WB0A 1XI1A 1QLEC 1BL8A 4D6TH 1FXKB 2R9AA 2E5LO 2FYUH 2Q5ZA 3OAAG 4KL1A 3EHBB 2RJZA 1Q90D 3CCRV 1WNSA 2CUGA 1M5IA 4RUEA 1FFTB 3M7MX 2DYRC 1AILA 4JI2O 3CCJV 3SDLA 2QR4A 4Q6GA 2GUZA 3H1KH 4UCUA 4CH3A 2QWOB 4B3TB 1FFXA 3RYCA 4ICGA 2R9RB 3FYIB 3B77A 4CZZA 2WLLB 5J2TB 2OTLV 4JI1B 4FIPC 4RQFA 1N34B 3AG2B 2Y69C 2YXHA 1Q82W 3ABLB 4MVSA 4WFEA 1SA0B 5CB4A 5LGTA 1OCRC 2WWWA 4YY3O 1JJ2U 2N04A 5KUMA 3ZMVA 1OCCB 2JIZG 3ICXA 2VQFO 3VQVA 5L3DA 5GONA 5FL7G 3JASB 4I5SA 4LWSB 1K9MW 2RMKB 2ADPA 1AJQA 2UU9B 1AJNA 1KD1W 5CN0A 2ZINA 2JRIA 1TUEB 3JALB 2QWQB 2ZIMA 1LNQA 1NTKH 3ZRWA 4K8ZA 5F2VO 2X7RB 3UM7A 2EZOA 2YIDA 3OTOB 4H33A 5IJ0A 4TUYA 2IJIA 1BE3H 3QO8A 2E75B 1BQZA 3T1HB 3ABKB 4RQEA 1XL6A 4LR3A 3CPWU 1SKVA 4YJ3B 4KP4A 4YXWG 4K0KO 3E35A 3IFXA 1KKDA 2VS0A 3U0ZA 2UXXA 2OYQA 2EIMB 1PNLA 1L0LH 4JAAA 1K5SA 1ZUQA 1F23A 3FB8C 1TUBB 4I7ZB 4NXNO 2BTQB 1JVMA 1VQMV 1JR9A 4FFBB 2ZXWB 4NTYA 3BVOA 4DR4O 4DR5O 4K35A 3OT7A 1EZJA 3FKSG 2JJ1G 4RAIA 4GKJO 2X0LA 1AI6A 1AR4A 2Q7HA 2JGUA 4OX9B 2P6JA 4CS4A 1R73A 1N0NA 3D36C 4MTGA 3CRMA 1I5YA 2HJDA 4ABMA 5IWAO 3AG1B 4X1KA 1MZEA 5A2QN 3M99B 1JX9A 4MSWC 1QR9A 5LA6B 1ZL8B 3QVNA 2OWOA 1SQPH 5B3SB 1WPXA 2E76B 2WLKA 3K0DA 2ZE7A 3CEIA 1IBKO 1XMOO 2CTQA 4TV8A 4DW0A 2WLHA 2QKCA 4UV8A 3ABUA 2QJ1A 2YI8A 3TETA 4I0XA 1WB8A 5K1PA 2IBZH 2HEPA 1HWYA 2P4VA 2LP7A 3ABKC 1YSCA 3D3IA 2YXYA 3CD6V 4GX2A 1M56B 1SQVH 1NZ6A 5C8YB 3K0GA 3I56V 3F7VC 4I9WA 3CCEV 4B3TO 1AJPA 4BR6A 3HKDB 5L3BA 2UUBB 5EBMC 4LFAB 2WA3A 4UCSA 4N23A 3LDEA 2F66C 2EIKB 3JSNA 1HNXO 3AK2A 4JI1O 1HDJA 4I55A 2GTSA 1RPRA 5B1BC 2A7WA 1N34O 4MVMA 2A06H 2R70A 1KU9A 1JPXA 1NTZH 1Y66A 2KG7A 2DN9A 4LP8A 1H2MA 2RCVA 2ZDIA 4H44B 1ZSPA 1AB3A 1FAFA 4LFCB 3OR7C 3FD9A 1M9NA 5JCOA 1FKAO 2ZR3A 3ZHQA 2GV9A 2UU9O 4J42A 1SZTA 3T1YB 2JGDA 5LMNB 4MW8A 5JQGB 1N33B 2ODMA 3OTOO 2QSAA 4YJ2A 1RFYA 3ZRXA 2ZQMA 4U3JB 1P7GA 3K57A 2Q68A 3T1HO 3W7WA 4UCOA 1N32B 1YXBA 4H0LB 3ZRSA 3SYPA 4TQFA 1HNWB 2G38A 2QWNB 2VRZA 1QR8A 2XASA 2CE4A 2DOSA 1W0JG 3CHXA 2DWEC 1RSOB 4HNAB 1DK1A 4UB8Z 1JQ0A 2QM8A 5LP6B 2WPDG 3ZEDA 3B09A 2L35A 4RO2A 5KLVH 5CA0B 3B8NA 5KAFZ 4G2KA 3JAWB 2Q0AA 5EC1C 3CXCU 3SYQA 1VF5B 1OZ0A 1XDCA 4LF8B 2XUMA 3IJ4A 3OGCC 4GKKB 2B1IA 3P3NA 4DV1B 2XOKG 3GB7C 4OX9O 4PA7A 3K59A 3B40A 2Y48A 1WAZA 3D8CA 3RBZA 1Q81W 1YIJV 2JS5A 1YZBA 3HKBA 5AG2A 3KCXA 3H1JH 2HR3A 2HVKC 4DV4O 1ORQC 3HKCB 1SQGA 1GTOA 3AG4B 4X20B 3ZIAG 3SPIA 2FMLA 1V54B 2EILC 4JPRA 2P06A 4FK5C 2FTKA 2O57A 1XBLA 3BPZA 3A0RA 1AI4A 4LNUB 4QPKA 3ZJZA 4DXWA 4E4EA 2A3QA 1AROP 3L73H 3RW0A 2QWPB 1ZTEA 4LF5B 1H8HG 5DN6G 1TVKA 3F7YC 5LHHA 3ZMSA 4QJFB 1B3QA 3BFRA 3A8TA 2YIBA 4CC5A 2UUBO 4UVAA 4W4LA 4XDKA 5KHIA 3AEIA 3E22B 4DV6B 5IJ9B 1XUQA 1H2SB 4UV9A 4FLXA 3APQA 1I08A 4Z2WA 5FNVB 4JV5B 2OIEA 1YDXA 3W7SA 2LO1A 4NTXA 4B3RB 4X1IB 1MA1A 3W7XA 3SR2C 4PD4F 2YIAA 5BMVA 4FMTA 1GH6A 4W4KA 1M57B 1E79G 1R3IC 5KMGB 4LFCO 1Z5VA 4GX5A 3TCUA 1ZAUA 4O4LA 2AW9A 4NB5A 4WBNA 4B7KA 4CS3A 5EIBD 3VOUA 4ZHQA 1R3KC 4O4HA 2P90A 4PI2A 4HZ3A 2A9HA 3O65A 1OHHG 4X62O 1Y74B 5LMNO 4I4TA 1VQNV 4CH5A 3RYCB 1N33O 1MOFA 5BZBA 2Q73A 2HVJC 1WPBA 2AHYA 3E8FA 2ITCC 1R6NA 4PV1B 1N32O 2EIJB 1G8MA 4LF9B 3BABA 5FLXN 1PNMA 3R66A 1FXVA 1HNWO 2EINC 2WLJA 3FB6C 2F23A 3CRQA 1H8EG 4IHJA 1L8DA 2XAJA 3E2EA 4JYYA 4J7KA 2IH1C 4JTDB 1O9HA 1Z2GA 2YXLA 2Z3YA 3RVYA 3JD4A 4X1YA 2Q69A 4UUJC 4BAYA 2PGGA 3K9SA 4JAUA 4ZBMA 3P32A 1EFRG 3JAKB 4F6RA 3VQYA 2CTWA 1QLEB 3FYEB 4QIWF 1MMMA 1KBHA 2RQ6A 3BAAA 4LF8O 1NS1A 1K73W 3LUTB 1DTOA 4GKKO 2PZSA 2LQTA 2ARHA 1H2GA 4DV1O 5IJ0B 1I0HA 2AHZA 3JATB 4FLVA 1YI2V 3U11A 5LYJB 4TUYB 3QO7A 4DUZB 4EB6A 4PELA 4FJCC 3KG2A 3G71V 1COWG 1VMGA 3E89A 3CC2V 1VQPV 2HFEC 2N05A 3CS5A 3M8AA 3BEHA 2XT9A 3SPGA 2L6LA 1MSWD 4DK0A 4X66B 2Y4TA 2Y69B 1LUWA 2V1DA 2UXDB 1P4RA 1QU7A 1WP7A 3H9VA 3ML0A 1QBZA 5BY1A 2EIJC 4LF5O 2DJVA 4O4JA 4WCEV 4PDLA 4H37A 2Z0AA 4K8XA 4LF7B 3HR0A 5LMUB 5EC2C 3SYCA 2ZCEA 4DV6O 4ZOLA 4JI5B 3CXHF 4X1KB 4X64B 4JV5O 1PV0A 2EBOA 4MTXA 4YIOA 4B3RO 1HNZB 2WLNA 1KMIZ 3N2GA 2M6YA 1F4MA 4FLZA 1Q43A 3BA9A 4CH4A 3CYOA 1Y4MA 3WU2Z 2Z5UA 4G27B 1URFA 2VWKA 3R65A 4UCTA 3IGAC 3SPHA 3E86A 3N27A 2ZE5A 2BSKA 1WN7A 3DC6A 5CA1A 4KXRA 1VF6A 2PTMA 3ETEA 1GN4A 1XQ8A 4JYBA 2AZ0A 1JFFB 4BIOA 4DUYB 1XNRB 5ITZA 1GK9A 2V7QG 4LF9O 4O2AA 1N36B 4IIJB 5LHGA 4I55B 3VQXA 1IBLB 4DV3B 1MG1A 4FPPA
chains in the Genus database with same CATH topology
1F51A 1AJPA 3QO5A 2QE7G 5L3BA 4G28B 2ATKC 5B1NA 2OTJV 5EBMC 1AI7A 2A79B 2IH3C 3K06A 2EJRA 2IJKA 1OCOC 3ZCCA 3JCZA 4X88A 4N23A 2XAFA 3LDEA 3OUSA 2EIKB 3K9AA 1NBMG 2JJ2G 1RPRA 3LSSA 5EBLC 1K3EA 4ASUG 2ITDC 5B1BC 1OCZB 2DQ0A 4MVMA 1YJ9V 3K08A 1VQ9V 1JPXA 1Y66A 4UVBA 4WF9V 1YJNV 1THZA 4LP8A 5IYCO 1R3JC 4P2ZA 3ETDA 2R9IA 3CMEV 2ZDIA 5C93A 3TK1A 3ASOB 1CP9A 2JEXA 4N21A 1R6KA 3OR7C 1NH2D 1CPYA 3CC7V 1KP3A 1M9NA 4JTAB 5LBQA 2OT5A 2ZR3A 1VQ8V 3DGEA 4XBFA 5LGUA 1NH2B 1QVFU 2QKSA 3OMAB 4WFFA 4GCZA 1OCOB 1GMGA 4MVZA 1SZTA 1YTFB 1K34A 4MW8A 1QCEA 1WLEA 1RPOA 3MHHC 3P30A 4MW3A 4WFAV 4E2LA 1E1QG 2QEXV 5B1BB 3ZRXA 2ZQMA 2Q6AA 1ZWIC 4DO2A 3K3WA 2EZPA 2JEUA 2Q68A 3W7WA 4MTFA 5B1OA 4PDRA 1K97A 3OMNB 3ZRSA 3G4SV 4TSFG 2PI5A 3SYPA 1S3JA 3IC7A 2X6CA 3OEEG 1ENVA 3E8GA 3K04A 3WG7C 1DF4A 2LFSA 1QR8A 2XASA 2YEVA 1S77D 3ASNC 3NXSA 1W0JG 2P67A 3JD0A 1W2BU 4LCUC 5H9CA 3HPLC 4X89A 2DWEC 2W6JG 3ZRVA 4QNHB 2W6IG 2QA4V 1Q86W 1VQ6V 2PI4A 1JQ0A 2QM8A 4MS2A 2WPDG 2DYSC 1EBOA 3CCUV 4MVQA 4QPJA 3LDCA 3AG4C 4JTCB 4RO2A 2ZDIC 3ABTA 1FXHA 3B8NA 3MD0A 4G2KA 2OCCB 4JGSA 4JYCA 1R3LC 1V54C 1NVPD 5E1AC 1FS0G 3SYAA 1CEZA 4U7NA 5EC1C 3CXCU 3SYQA 1Q7YW 2LFRA 1OZ0A 1OCZC 2DW4A 1NVPB 3OGCC 3LSQA 2ZD9A 3W7TA 3CCQV 2B1IA 1NR7A 2XOKG 3WG7B 3GB7C 4QE7A 1N8RW 4PA7A 3T4DA 1FXKA 3ASOC 2Y48A 4PA6A 2BOCC 1AI5A 3LNMB 4R50A 3CCMV 1G4YB 3RBZA 4XDJA 1KQSU 1JOYA 1Q81W 3RVZA 1YIJV 4MVRA 2CK3G 5EK0A 2HR3A 2HVKC 3OR6C 2DYSB 1YITV 1ORQC 5GW7A 2IJHA 1NJIW 1GTOA 3AG4B 3STLC 2M7WA 3ZIAG 4OXSA 2WLIA 3SPIA 5LHIA 1K5QA 3G6EV 1V54B 2EILC 4JPRA 5CA3A 1S0VA 4FK5C 2JK5C 1S76D 2GSMB 2Q67A 3CCSV 1SETA 2B5UA 3CC4V 2FTKA 2F43G 1MABG 5KA5A 4J9YB 4BIZA 3A0RA 1AI4A 1JCHA 4QPKA 4UXNA 3ZJZA 4DXWA 2DYRB 2WLLA 3OE7G 2YSUB 4GX1A 1YJWV 1I5XA 1AROP 3RW0A 1QLNA 5IY5B 1M57C 4LBEC 1H8HG 5DN6G 1K92A 1ROPA 3F7YC 4ZKIA 5LHHA 2UXNA 3ZMSA 4QJFB 5L3FA 4Z1MG 1H38A 3MHSC 1PNKA 5HFLA 4J9ZB 4UVAA 2X6BA 4XDKA 3ZN1A 3SJQC 1YTFD 3ETGA 4EKWA 1M1KW 3AEIA 5CMUA 1BMFG 4WFGA 1BHAA 2BOBC 2XAHA 5H6RA 4UV9A 1FXKC 2YEVB 2NNUA 2OCCC 1XL4A 2EILB 1P7BA 1VQOV 2B1GA 3W7SA 4JASA 1OCRB 3E83A 5KUKA 3W7XA 5L3EA 3CCLV 4FMTA 1AR1B 3CMAV 1NR1A 1DLBA 2MK3A 3ZN0A 1V55C 1M57B 1E79G 1R3IC 1VQ4V 2DWDC 4GX5A 1K7DA 2ZR2A 3TCUA 3JD1A 1M90W 1GO3F 3E8BA 5L3CA 4BW5A 1GM9A 4HAMA 3VOUA 1K4DC 1R3KC 4TWKA 2P90A 2P7TC 4HZ3A 1GM8A 2WSSG 2A9HA 4QE9A 1YHQV 4WFBV 1OHHG 3ZMTA 5LGNA 2KB1A 1S5HC 3JD2A 4MVOA 5IYBO 1VQNV 4RUFA 3AG2C 1QLEC 1MOFA 1BL8A 5BZBA 1FXKB 2HVJC 3EFFK 1B6QA 1PD3A 2AHYA 3ABLC 3SPCA 3VBBA 3OAAG 3EHBB 5H6QA 3E8FA 3CCRV 2ITCC 1R6NA 1BHBA 4PA9A 4RUEA 2EIJB 3W7UA 1G8MA 1FFTB 1K33A 1PNMA 1FXVA 2DYRC 3CP1A 3CCJV 2EINC 1OCCC 3OM3B 4L87A 2WLJA 1V55B 3FB6C 1H8EG 5IY5C 2WLIB 3WFVA 3OEHG 3B8MA 2DQ3A 2XAJA 3E2EA 2A0LA 2IH1C 4JTDB 2Z3YA 3RVYA 2R9RB 3JD4A 4XDLA 3FYIB 3B77A 4CZZA 2Q69A 2WLLB 2HLDG 3DTUB 4UUJC 4BAYA 2XNDG 3GWOA 4Q20A 3I55V 2OTLV 4JAUA 4ZBMA 5B1AB 3P32A 3OUFA 1S72V 1EFRG 4R8CA 4FIPC 3HB3B 4RQFA 3AG2B 1QLEB 3ZMZA 1KECA 1W0KG 3FYEB 2Y69C 4QIWF 2WLMA 5IDJA 1KP2A 1Q82W 3ABLB 4MVSA 5KA6A 4WFEA 5EBWC 3X2QC 3OMIB 1L1FA 1K73W 2WAMA 3LUTB 1DTOA 1E1RG 5LGTA 1OCRC 2WWWA 1JJ2U 2W0FC 1H2GA 5KUMA 3ZMVA 2NLJC 2EINB 1OCCB 2AHZA 2JIZG 2HG5C 1YI2V 3QO7A 5L3DA 2EIMC 2HKOA 4R7CA 5FL7G 4PELA 2D3OW 3K03A 4FJCC 4I5SA 3KG2A 4R6ZA 3FB5C 1K9MW 3BY6A 3G71V 2X6AA 1COWG 3AG3C 3E89A 4X8AA 2HJFC 1AJQA 1K4CC 3E8HA 1SRYA 3JYCA 1AJNA 3CC2V 2ZXWC 3OFNG 5CN0A 1KD1W 4JF3A 4PA4A 4MTOA 1TUEB 1VQPV 2HFEC 1LNQA 4JAVA 2QM7A 4KFMA 3ZRWA 3BEHA 3SPGA 4P9OA 4P30A 2X7RB 3UM7A 2EZOA 3D36A 3JD3A 4H33A 2IJJA 1MSWD 2C2AA 2JDIG 3ABMC 1NQTA 2IJIA 4PDMA 3QO8A 2Y69B 3UKMA 1RM1B 1IXMA 5CBGA 3FB7C 2V1DA 4PDVA 3ABKB 3K79A 4RQEA 1P4RA 1XL6A 1GKFA 3CPWU 3X2QB 3ML0A 3LDDA 1QBZA 4KP4A 5IYDO 4YXWG 3E35A 3IFXA 2EIJC 1SERA 1KKDA 2IW5A 4LC1A 3QNEA 3ZMUA 4MT8A 4WCEV 2H94A 3OW2U 2H8PC 2UXXA 4PDLA 3T2MA 4H37A 1NKDA 2EIMB 4U7OA 1PNLA 5J9PC 2XAQA 3AG1C 4UVCA 1K5SA 1F23A 3FB8C 3AG3B 5EC2C 3SYCA 1JVMA 1VQMV 1J95A 2ZXWB 5B3SC 3T1CA 1PKXA 1DF5A 1VQ7V 2K1EA 1QVGU 5B1AC 4GT1A 4MVUA 1EZJA 3FKSG 4F4LA 3ABMB 5HFMA 1UJWB 2JJ1G 2EBOA 2GHYA 4RAIA 4MTXA 3SPJA 2X0LA 1AI6A 1K8AW 3SYOA 1M56C 3CCVV 1VQ5V 2P6JA 4PA3A 2WLNA 1R73A 4MTGA 1I5YA 1F4MA 2IU0A 5CBFA 3AG1B 4BIUA 3STZC 3M99B 1JX9A 3F5WC 3PJSK 1GM7A 3CYOA 4MSWC 1QR9A 1Y4MA 4P9PA 2Z5UA 3T4ZA 4G27B 1PL0A 3R65A 5B3SB 2EIKC 1WPXA 3IGAC 2WLKA 3K0DA 3SPHA 1F4NA 3E86A 1VQLV 2IU3A 2WLHA 4HYOA 4UV8A 5L3GA 3ABUA 3ETEA 5CBHA 2XAGA 3TETA 2QTOA 4JYBA 1RM1C 1GK9A 4TT3G 2V7QG 1HWYA 4GX0A 2LP7A 3ABKC 1YSCA 3D3IA 1KC8W 5LHGA 3ASNB 4KUMA 5DM6V 3CD6V 4GX2A 1M56B 3H01A 4WFHA 3K0GA 3ZRWB 3I56V 1SESA 1VQKV 3F7VC 4CBCA 1MG1A 4I9WA 3CCEV 4FPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN V;  1M90 W;  1VQM V;  1YI2 V;  1YJW V;  3CXC U;  3CCV V;  1VQL V;  1Q7Y W;  2OTL V;  1YIT V;  1VQ5 V;  1W2B U;  2OTJ V;  1S72 V;  2D3O W;  1VQ9 V;  3CME V;  1R73 A;  1VQO V;  1NJI W;  1K9M W;  4WFA V;  3CCJ V;  1VQ7 V;  3G71 V;  2QEX V;  3CPW U;  1YHQ V;  2QA4 V;  4WFB V;  1Q86 W;  1VQ6 V;  3CCQ V;  3G6E V;  3CC2 V;  1Q82 W;  1QVG U;  1KD1 W;  3CCL V;  1N8R W;  3CCU V;  3CC7 V;  1VQP V;  3CMA V;  3CCS V;  1VQN V;  4WCE V;  1KC8 W;  3OW2 U;  5DM6 V;  3CC4 V;  3CD6 V;  3G4S V;  1K73 W;  1M1K W;  1VQ8 V;  1VQ4 V;  3I56 V;  3CCM V;  1JJ2 U;  1VQK V;  1K8A W;  1YJ9 V;  1KQS U;  1QVF U;  1Q81 W;  3I55 V;  3CCE V;  1YIJ V;  3CCR V;  4WF9 V; 
#chains in the Genus database with same CATH topology
 3QO5 A;  4NXM B;  2KG7 B;  2QE7 G;  2ATK C;  5B1N A;  2QM4 A;  2OTJ V;  1AI7 A;  1XHZ A;  1AP6 A;  5A9G A;  1OCO C;  4X88 A;  4FLU A;  3QF7 A;  4DRX B;  4C7U A;  2D2C B;  2LGQ A;  3LSS A;  1OCZ B;  4JZ2 A;  2UUC O;  3N2K B;  1THZ A;  3KZI Z;  5IYC O;  1R3J C;  3ETD A;  1UPG A;  2JGD B;  3CME V;  3PN1 A;  3ASO B;  5EYP B;  2ZM6 B;  1R6K A;  4RWU A;  4DUZ O;  3UT5 A;  1CPY A;  5LBQ A;  4IYH A;  1GN3 A;  4DR3 B;  1VQ8 V;  4XBF A;  4JYA B;  4WFF A;  3JAM N;  1GMG A;  3HKE A;  1H2L A;  4L8J A;  5JH7 A;  1RPO A;  3MHH C;  1A32 A;  2W0X A;  4E2L A;  1NT2 B;  5B1B B;  4X66 O;  4DO2 A;  2Q7E A;  2EZP A;  3QTC A;  4MTF A;  4LFB B;  1U96 A;  2UXD O;  1K97 A;  3UO2 A;  4TSF G;  5JVD A;  3KKY A;  2RN9 A;  2YEV A;  2P67 A;  1BCC H;  5H9C A;  3O9O A;  4X89 A;  3BHP A;  4LF7 O;  5KHG A;  2QA4 V;  5LMU O;  4FLW A;  3CCU V;  3C3S A;  4LH7 A;  4MVQ A;  2ZDI C;  3ABT A;  1FXH A;  3MD0 A;  2RNB A;  4JGS A;  4JYC A;  1NVP D;  5E1A C;  4JI5 O;  1YVW A;  1VP7 A;  2OCH A;  4X64 O;  1MNG A;  1X59 A;  1OCZ C;  5JCO C;  5KHJ A;  3G6B A;  1EN5 A;  2BTO A;  3NR7 A;  2ZNJ A;  4X65 B;  1NVP B;  4YIP A;  1HNZ O;  1TGO A;  5JJE B;  1IBM B;  1FXK A;  3ASO C;  1PM9 A;  1Q6H A;  4MVR A;  1JA8 A;  1TVK B;  3I5D A;  1X4T A;  4OXS A;  5IYZ A;  1K5Q A;  3G6E V;  1S0V A;  2JK5 C;  1S76 D;  2GSM B;  1B06 A;  3CCS V;  2F43 G;  4BIZ A;  2WLL A;  4JI3 B;  3RT3 C;  4DUY O;  4EFB A;  1Y67 A;  1YJW V;  1I5X A;  5J2T A;  3L9D A;  1N36 O;  5B5E Z;  1GN6 A;  4LBE C;  3ETQ A;  1K92 A;  2UXN A;  3L71 H;  5L3F A;  5LOV A;  1IBL O;  3EXA A;  3F5T A;  4FM0 A;  5E79 Z;  3MHS C;  5JJN B;  5HFL A;  1SA0 A;  4NXM O;  2XTA A;  4J9Z B;  2X6B A;  4UCR A;  3ETG A;  2QTS A;  4DV5 B;  2XAH A;  3CRR A;  1TAE A;  4DR2 B;  2EIL B;  2ADQ B;  4ZHQ B;  1VQO V;  3RYF B;  2B1G A;  3L70 H;  3JAL A;  3K5L A;  3CCL V;  3KCY A;  3RYH A;  1OV9 A;  2VQE B;  3DXR B;  4I4T B;  5J2U B;  2MK3 A;  1JJO A;  1V55 C;  3ZN0 A;  2ZM6 O;  3FAV A;  1YCI A;  1B04 A;  5IT9 N;  3JD1 A;  5D5P A;  5L3C A;  4BW5 A;  1HW7 A;  4B3M B;  4DR3 O;  2CGN A;  4JI0 B;  2P7T C;  2WSS G;  4JI4 B;  4JYA O;  1BS3 A;  3CWB H;  1NTM H;  5IYB O;  3CJH B;  1B6Q A;  2BTQ A;  1LR1 A;  3U10 A;  4A5U B;  4FFB A;  1BHB A;  4LFB O;  3W7U A;  1S5J A;  4DK1 A;  3OM3 B;  4L87 A;  2FKX A;  3GWK C;  2WLI B;  2Y0I A;  3OEH G;  1WP8 A;  2DQ3 A;  1R6T A;  4DR7 B;  5GTH Z;  2QDO A;  4XDL A;  3DTU B;  4O4I A;  3GWO A;  4Q20 A;  5B1A B;  5IE9 A;  4NVP A;  4EB6 B;  1S5L Z;  4JZG A;  3AG7 A;  4DR1 B;  2WLM A;  5IDJ A;  2B9Z A;  3A0B Z;  3A0H Z;  1IVS A;  2YS8 A;  5EBW C;  4F6E A;  5LA6 A;  3WB2 A;  3THO A;  3X2Q C;  1L1F A;  1M4U A;  4X65 O;  4DR6 B;  2W0F C;  3RFR A;  1KKC A;  3SJC C;  2EIN B;  2HG5 C;  1IBM O;  4O2B A;  1GAX A;  1G1X B;  1RP3 B;  2D3O W;  3K03 A;  2RDC A;  3FB5 C;  3BY6 A;  2X6A A;  3AG3 C;  2HJF C;  2YC0 A;  3E8H A;  1SRY A;  3K58 A;  5GTI Z;  3OFN G;  4JF3 A;  4PA4 A;  3Q4H B;  4MTO A;  4KFM A;  4LF4 B;  2QM7 A;  3JAR A;  5C8Y A;  4LFA O;  4P9O A;  4AQY B;  1WJZ A;  3OD4 A;  2C2A A;  3HKD A;  2JDI G;  3ABM C;  4PDM A;  3P3P A;  3ZHR A;  1RM1 B;  3FB7 C;  4PDV A;  3A2F A;  5KX5 A;  1GKF A;  3JCU Z;  2VWJ A;  4FLT A;  2Q4P A;  4JI3 O;  5EZY B;  4AIL C;  2CH7 B;  3QNE A;  3ZMU A;  1J5E B;  1VEW A;  4DV2 B;  4MT8 A;  2H94 A;  1D5A A;  2K9P A;  4U7O A;  5J9P C;  1J95 A;  1OJH A;  1H2K A;  1QQC A;  4GYC B;  3G67 A;  1PKX A;  4AHC A;  1PL4 A;  4QGP A;  3APO A;  4DV5 O;  5JWP A;  2K1E A;  3CSX A;  2GUZ B;  5B1A C;  4DR2 O;  4GT1 A;  4MVU A;  3T1Y O;  4F4L A;  1FFX B;  2GHY A;  4I9Q A;  3SPJ A;  1O9G A;  2ZT9 B;  2VQE O;  5JQG A;  2BSK B;  1VQ5 V;  5CA1 B;  4PA3 A;  2JS3 A;  1FJG B;  4YHH B;  4U3J A;  2Q7G A;  1T5E A;  1CXZ B;  2IU0 A;  5CBF A;  4IL6 Z;  3RN4 A;  5ITZ B;  4B3M O;  4JI0 O;  4H13 B;  3T4Z A;  1Y76 A;  4J41 A;  1US6 A;  4JI4 O;  5CB4 B;  1PL0 A;  4D7S A;  5KHH A;  1BSM A;  2F95 B;  5H2F Z;  5L3G A;  5GON B;  3JSL A;  1M93 A;  5LP6 A;  1V9P A;  1I94 B;  1SQF A;  5JJJ B;  1RM1 C;  2Q0O C;  5CA0 A;  3JAW A;  3ASN B;  4KUM A;  2ZNI A;  4LF6 B;  4WFH A;  3ZRW B;  1VQK V;  5KAI Z;  1F51 A;  2KSD A;  4FZ0 A;  4G28 B;  4DR7 O;  1IZ3 A;  2GTA A;  4DV0 B;  2IH3 C;  2EJR A;  3JCZ A;  4J11 A;  2YUA A;  2JJ2 G;  3UT5 B;  5EBL C;  1K3E A;  2ITD C;  1NU1 H;  2DQ0 A;  4DR1 O;  1GRJ A;  1YEW A;  2ILM A;  1VQ9 V;  4DW1 A;  1Q3E A;  2R9I A;  3HKE B;  1XRE A;  2UXB B;  4FM1 A;  5C93 A;  3TK1 A;  5JH7 B;  1CP9 A;  4N21 A;  4DR6 O;  1NH2 D;  1Q8I A;  1KP3 A;  1VF6 C;  4LNU A;  3H1H H;  1SQX H;  2ZE6 A;  5LGU A;  4AI8 A;  3L75 H;  1IX9 A;  1NH2 B;  1QVF U;  2UXC B;  1F7Y A;  4GCZ A;  1OCO B;  3FX7 A;  4MVZ A;  1YTF B;  1K34 A;  4LF4 O;  3L74 H;  1WLE A;  4AQY O;  3P30 A;  2EX3 A;  4UB6 Z;  3GVM A;  2GBO A;  1WA8 A;  2CTP A;  3K3W A;  2PI5 A;  3OMN B;  3E22 A;  3LNN A;  1Q6I A;  3IC7 A;  2X6C A;  3OEE G;  1ENV A;  3E8G A;  3CE2 A;  3WG7 C;  5IJ9 A;  1DF4 A;  4CC6 A;  4UCV A;  3MDS A;  1G6U A;  4PJ0 Z;  5LXT A;  5FNV A;  4DV2 O;  3ASN C;  3NXS A;  4TV8 B;  3B4S A;  2BCC H;  3DC5 A;  3CX5 F;  1VQ6 V;  1XMO B;  2DYS C;  4I0X B;  4J7Z A;  4QPJ A;  3LDC A;  3TXQ A;  3SGI A;  2HP8 A;  2QWR B;  5KMG A;  1BQ0 A;  1XMQ B;  1R3L C;  2PUS A;  1EN6 A;  1ZLZ A;  2OIG A;  1FS0 G;  3SYA A;  2LFR A;  2DW4 A;  4NKG B;  3UCS C;  2YI9 A;  4KHP B;  2LW7 A;  1SC5 B;  3C90 A;  3D3Q A;  3LSQ A;  2ZIO A;  2ZD9 A;  3W7T A;  3CCQ V;  1Y74 A;  5IYZ B;  4BW9 A;  2ZE8 A;  3OTF A;  4QE7 A;  1N8R W;  3T4D A;  2KQX A;  5K1X A;  4OGQ B;  2QKA A;  2E74 B;  1FJG O;  1MZF A;  1XHX A;  4UFZ A;  2BOC C;  4YHH O;  4R50 A;  3CCM V;  1XNQ B;  2MW2 B;  1G4Y B;  4XDJ A;  1JOY A;  3RVZ A;  2P5O A;  1HNX B;  2F93 B;  1U97 A;  1YIT V;  4Z1V A;  1PPJ H;  5GW7 A;  1NJI W;  5LOV B;  4HBN A;  2M7W A;  5CA3 A;  2Q67 A;  1MAB G;  5KA5 A;  1Z5W A;  3ZHT A;  4I50 A;  2NN4 A;  1JCH A;  3OE7 G;  1I94 O;  2YSU B;  4FZ1 A;  4IGG A;  4GX1 A;  5IY5 B;  3J7A U;  3JAK A;  3UO3 A;  1BGY H;  4FFK A;  3RGB A;  4LF6 O;  1H38 A;  3BCC H;  1R1B A;  5FPR A;  4YJ2 B;  4FM2 A;  4OPH A;  4DV7 B;  2Y0P A;  3RYH B;  2AGA A;  4TOI A;  3SJQ C;  4DV0 O;  1M1K W;  3S3W A;  2HHH B;  3FAV B;  3JAT A;  5LYJ A;  2EUL A;  3C3T A;  1FXK C;  2NNU A;  1KYO F;  1XL4 A;  1P7B A;  5FPO A;  1H2N A;  2GDS A;  3CB2 A;  3ZHV A;  1AR1 B;  2UXB O;  1VQ4 V;  2KKW A;  1EN4 A;  3BA8 A;  1K7D A;  2ZR2 A;  4BWA A;  4ZI7 A;  1M90 W;  3E8B A;  4HAM A;  1XIL A;  2P22 C;  1GM8 A;  2UXC O;  2ETN A;  3ZMT A;  2KB1 A;  1S5H C;  4TV9 A;  4RUF A;  3AG2 C;  2E3C A;  3EFF K;  1PD3 A;  3SPC A;  2AZ2 A;  3ABL C;  3VBB A;  5H6Q A;  2PYL A;  4O4I B;  4PA9 A;  3RYI A;  1K33 A;  3HKB B;  3CP1 A;  3B2E E;  1OCC C;  1IDS A;  1V55 B;  5KHK A;  5IY5 C;  1AVM A;  3WFV A;  3B8M A;  4EFE A;  2A0L A;  4DV4 B;  3ZS8 C;  1HP8 A;  3I55 V;  2HLD G;  2XND G;  2WA4 A;  3DSQ A;  2YIB D;  4O2B B;  3OUF A;  1S72 V;  4R8C A;  1XMQ O;  3HB3 B;  3ZMZ A;  1KEC A;  1W0K G;  5H5N A;  1KP2 A;  5KA6 A;  4KHP O;  3OMI B;  2WAM A;  2DMX A;  3JAR B;  1E1R G;  3FFQ A;  3J80 N;  1ZX3 A;  2NLJ C;  2ZKO A;  1XEQ A;  1XNR O;  1D5N A;  2PYJ A;  3TJT A;  2EIM C;  5BR8 B;  2HKO A;  4R7C A;  4R6Z A;  5KX5 B;  1XNQ O;  1JFF A;  4DV3 O;  4X8A A;  3TGU H;  1K4C C;  2CDY A;  3JYC A;  2ZXW C;  4IIJ A;  3S3X A;  1SZX A;  1I7F A;  5BMV B;  4JAV A;  4P30 A;  3JD3 A;  3D36 A;  1JMK C;  1P49 A;  3TXS A;  2IJJ A;  4J10 A;  1NQT A;  1Q6U A;  4O4L B;  3UKM A;  1IXM A;  3JAS A;  3RWR D;  5DED A;  4WBN B;  5CBG A;  3K79 A;  4LWS A;  2V4D A;  4NR1 A;  4PI0 A;  2NR5 A;  4O4H B;  3X2Q B;  3LDD A;  5IYD O;  1EM1 A;  1SER A;  2IW5 A;  4LC1 A;  4DRX A;  3OW2 U;  2H8P C;  3T2M A;  1NKD A;  1WB7 A;  2BE3 A;  2XAQ A;  3LSU A;  3AG1 C;  3N2K A;  4UVC A;  2FB5 A;  1N0J A;  4X62 B;  3AG3 B;  4DV7 O;  1D2D A;  4B3S B;  4J80 A;  1AR5 A;  4JI8 B;  5EYP A;  5B3S C;  3T1C A;  2HHH O;  1DF5 A;  2N74 A;  1VQ7 V;  4YJ3 A;  2QGN A;  1QVG U;  4IHJ B;  3ABM B;  5HFM A;  1UJW B;  1VF7 A;  1Y76 B;  2CTR A;  1TUB A;  1SS3 A;  4X1Y B;  3K5O A;  1K8A W;  2UUA B;  3SYO A;  1M56 C;  3CCV V;  4GZR B;  2YIC A;  4F6R B;  3K5N A;  4BIU A;  3STZ C;  3L72 H;  3F5W C;  3PJS K;  1GM7 A;  4P9P A;  4GLX A;  2Q8V A;  2EIK C;  4JI6 B;  4J7J A;  1F4N A;  1FPO A;  1VQL V;  2IU3 A;  2IM9 A;  4HYO A;  1QHT A;  5CBH A;  2XAG A;  1IUR A;  2QTO A;  4JI7 B;  1KUQ A;  5DEC A;  4TT3 G;  3H1L H;  4GX0 A;  4CH6 A;  1KC8 W;  2LJ2 A;  3CRA A;  5DM6 V;  1ZL8 A;  3H01 A;  1SES A;  4CBC A;  2P4K A;  2Q9L A;  2CGO A;  4GUN A;  3AK3 A;  1N4C A;  1Q5O A;  2A79 B;  3K06 A;  2IJK A;  3ZCC A;  2XAF A;  3OUS A;  3K9A A;  1NBM G;  4K3A A;  4O4J B;  4ASU G;  3ZBH A;  2EJ7 A;  1NI8 A;  1Y6X A;  1YJ9 V;  3K08 A;  1FYJ A;  4UVB A;  4WF9 V;  1YJN V;  1QNM A;  1BZK A;  4P2Z A;  5TIS Z;  1UFI A;  2JEX A;  1BT8 A;  3MAQ A;  4ZOL B;  1AP5 A;  5BR8 O;  1WA8 B;  3CC7 V;  3WB1 A;  4JTA B;  2OT5 A;  5LP6 C;  3DGE A;  5B66 Z;  3AK1 A;  1HR0 B;  2QKS A;  3OMA B;  2LGW A;  2Y4U A;  5LXT B;  2JVD A;  2F4V B;  1QCE A;  4MW3 A;  2XHB A;  4WFA V;  3H1I H;  1E1Q G;  2E5L B;  2QEX V;  1SQQ H;  2Q6A A;  1ZWI C;  3N2G B;  1FD9 A;  2JEU A;  1L0N H;  5B1O A;  4FLY A;  3IC9 A;  4PDR A;  3G4S V;  1S3J A;  4JI2 B;  3K04 A;  2LFS A;  1EZV H;  3SJA C;  1S77 D;  3UQ8 A;  3QG5 A;  3JD0 A;  1W2B U;  4LCU C;  2H3O A;  3HPL C;  3RYF A;  2W6J G;  3ZRV A;  4QNH B;  2W6I G;  1Q86 W;  2PI4 A;  2DE0 X;  4MS2 A;  4B3S O;  1EBO A;  3DXR A;  3K5M A;  4JI8 O;  3AG4 C;  4JTC B;  5J2U A;  4O2A B;  2OCC B;  1SF9 A;  1LUV A;  1V54 C;  1VIB A;  3BRC A;  1CEZ A;  4U7N A;  1Q7Y W;  1RSO A;  4HNA A;  4CS2 A;  4YY3 B;  4EEQ A;  1NR7 A;  2UUA O;  3WG7 B;  2VQF B;  3CJH A;  4NTW A;  2PF4 E;  4PA6 A;  1AI5 A;  3LNM B;  4I50 B;  4TQD A;  1KQS U;  3OGI B;  2CK3 G;  5EK0 A;  3OR6 C;  2DYS B;  3SJB C;  2IJH A;  3STL C;  2UUC B;  4U3F H;  4IT5 A;  4JI6 O;  2WLI A;  5LHI A;  1P84 F;  1SET A;  2B5U A;  3CC4 V;  3VQW A;  4D7T A;  4J9Y B;  3EVK A;  4UXN A;  4JI7 O;  2DYR B;  4NYK A;  1MSD A;  5LL6 Y;  4K0K B;  1QLN A;  4PHZ A;  1M57 C;  1ROP A;  3HKC A;  4ZKI A;  4X20 A;  1XOU A;  2R72 A;  4Z1M G;  1PNK A;  2FL4 A;  4B08 A;  3ZHS A;  4NXN B;  3G80 A;  1W59 A;  3CRC A;  3J81 N;  3ZN1 A;  1YF2 A;  1YTF D;  3ZHU A;  4EKW A;  4FVM A;  3ZX6 A;  5CMU A;  4DR4 B;  1BMF G;  4WFG A;  4DR5 B;  1BHA A;  2BOB C;  5EIB C;  5JVD B;  1VAR A;  5H6R A;  4ZI7 B;  2YDE A;  2AXT Z;  2YEV B;  4IYI A;  4X9Q A;  2OCC C;  3IAY A;  1KB9 F;  1PP9 H;  4JAS A;  1OCR B;  4GKJ B;  3E83 A;  4DYL A;  3Q4H A;  5KUK A;  5L3E A;  4OPA A;  4ZIB A;  3CMA V;  1NR1 A;  5D5Q A;  4TV9 B;  1DLB A;  2DWD C;  5BXZ A;  1TA8 A;  5IWA B;  1DGS A;  1GN2 A;  1GO3 F;  1IXB A;  1J5E O;  1GM9 A;  3RYI B;  1K4D C;  4TWK A;  1SQB H;  5EZY A;  4QE9 A;  4B7E A;  1YHQ V;  2CAZ C;  2LW1 A;  1HR0 O;  4WFB V;  4X1I A;  4LH6 A;  2PY5 A;  2CH7 A;  1IBK B;  2F1M A;  5LGN A;  3JD2 A;  2F4V O;  4MVO A;  3WB0 A;  1XI1 A;  1QLE C;  1BL8 A;  4D6T H;  1FXK B;  2R9A A;  2E5L O;  2FYU H;  2Q5Z A;  3OAA G;  4KL1 A;  3EHB B;  2RJZ A;  1Q90 D;  3CCR V;  1WNS A;  2CUG A;  1M5I A;  4RUE A;  1FFT B;  3M7M X;  2DYR C;  1AIL A;  4JI2 O;  3CCJ V;  3SDL A;  2QR4 A;  4Q6G A;  2GUZ A;  3H1K H;  4UCU A;  4CH3 A;  2QWO B;  4B3T B;  1FFX A;  3RYC A;  4ICG A;  2R9R B;  3FYI B;  3B77 A;  4CZZ A;  2WLL B;  5J2T B;  2OTL V;  4JI1 B;  4FIP C;  4RQF A;  1N34 B;  3AG2 B;  2Y69 C;  2YXH A;  1Q82 W;  3ABL B;  4MVS A;  4WFE A;  1SA0 B;  5CB4 A;  5LGT A;  1OCR C;  2WWW A;  4YY3 O;  1JJ2 U;  2N04 A;  5KUM A;  3ZMV A;  1OCC B;  2JIZ G;  3ICX A;  2VQF O;  3VQV A;  5L3D A;  5GON A;  5FL7 G;  3JAS B;  4I5S A;  4LWS B;  1K9M W;  2RMK B;  2ADP A;  1AJQ A;  2UU9 B;  1AJN A;  1KD1 W;  5CN0 A;  2ZIN A;  2JRI A;  1TUE B;  3JAL B;  2QWQ B;  2ZIM A;  1LNQ A;  1NTK H;  3ZRW A;  4K8Z A;  5F2V O;  2X7R B;  3UM7 A;  2EZO A;  2YID A;  3OTO B;  4H33 A;  5IJ0 A;  4TUY A;  2IJI A;  1BE3 H;  3QO8 A;  2E75 B;  1BQZ A;  3T1H B;  3ABK B;  4RQE A;  1XL6 A;  4LR3 A;  3CPW U;  1SKV A;  4YJ3 B;  4KP4 A;  4YXW G;  4K0K O;  3E35 A;  3IFX A;  1KKD A;  2VS0 A;  3U0Z A;  2UXX A;  2OYQ A;  2EIM B;  1PNL A;  1L0L H;  4JAA A;  1K5S A;  1ZUQ A;  1F23 A;  3FB8 C;  1TUB B;  4I7Z B;  4NXN O;  2BTQ B;  1JVM A;  1VQM V;  1JR9 A;  4FFB B;  2ZXW B;  4NTY A;  3BVO A;  4DR4 O;  4DR5 O;  4K35 A;  3OT7 A;  1EZJ A;  3FKS G;  2JJ1 G;  4RAI A;  4GKJ O;  2X0L A;  1AI6 A;  1AR4 A;  2Q7H A;  2JGU A;  4OX9 B;  2P6J A;  4CS4 A;  1R73 A;  1N0N A;  3D36 C;  4MTG A;  3CRM A;  1I5Y A;  2HJD A;  4ABM A;  5IWA O;  3AG1 B;  4X1K A;  1MZE A;  5A2Q N;  3M99 B;  1JX9 A;  4MSW C;  1QR9 A;  5LA6 B;  1ZL8 B;  3QVN A;  2OWO A;  1SQP H;  5B3S B;  1WPX A;  2E76 B;  2WLK A;  3K0D A;  2ZE7 A;  3CEI A;  1IBK O;  1XMO O;  2CTQ A;  4TV8 A;  4DW0 A;  2WLH A;  2QKC A;  4UV8 A;  3ABU A;  2QJ1 A;  2YI8 A;  3TET A;  4I0X A;  1WB8 A;  5K1P A;  2IBZ H;  2HEP A;  1HWY A;  2P4V A;  2LP7 A;  3ABK C;  1YSC A;  3D3I A;  2YXY A;  3CD6 V;  4GX2 A;  1M56 B;  1SQV H;  1NZ6 A;  5C8Y B;  3K0G A;  3I56 V;  3F7V C;  4I9W A;  3CCE V;  4B3T O;  1AJP A;  4BR6 A;  3HKD B;  5L3B A;  2UUB B;  5EBM C;  4LFA B;  2WA3 A;  4UCS A;  4N23 A;  3LDE A;  2F66 C;  2EIK B;  3JSN A;  1HNX O;  3AK2 A;  4JI1 O;  1HDJ A;  4I55 A;  2GTS A;  1RPR A;  5B1B C;  2A7W A;  1N34 O;  4MVM A;  2A06 H;  2R70 A;  1KU9 A;  1JPX A;  1NTZ H;  1Y66 A;  2KG7 A;  2DN9 A;  4LP8 A;  1H2M A;  2RCV A;  2ZDI A;  4H44 B;  1ZSP A;  1AB3 A;  1FAF A;  4LFC B;  3OR7 C;  3FD9 A;  1M9N A;  5JCO A;  1FKA O;  2ZR3 A;  3ZHQ A;  2GV9 A;  2UU9 O;  4J42 A;  1SZT A;  3T1Y B;  2JGD A;  5LMN B;  4MW8 A;  5JQG B;  1N33 B;  2ODM A;  3OTO O;  2QSA A;  4YJ2 A;  1RFY A;  3ZRX A;  2ZQM A;  4U3J B;  1P7G A;  3K57 A;  2Q68 A;  3T1H O;  3W7W A;  4UCO A;  1N32 B;  1YXB A;  4H0L B;  3ZRS A;  3SYP A;  4TQF A;  1HNW B;  2G38 A;  2QWN B;  2VRZ A;  1QR8 A;  2XAS A;  2CE4 A;  2DOS A;  1W0J G;  3CHX A;  2DWE C;  1RSO B;  4HNA B;  1DK1 A;  4UB8 Z;  1JQ0 A;  2QM8 A;  5LP6 B;  2WPD G;  3ZED A;  3B09 A;  2L35 A;  4RO2 A;  5KLV H;  5CA0 B;  3B8N A;  5KAF Z;  4G2K A;  3JAW B;  2Q0A A;  5EC1 C;  3CXC U;  3SYQ A;  1VF5 B;  1OZ0 A;  1XDC A;  4LF8 B;  2XUM A;  3IJ4 A;  3OGC C;  4GKK B;  2B1I A;  3P3N A;  4DV1 B;  2XOK G;  3GB7 C;  4OX9 O;  4PA7 A;  3K59 A;  3B40 A;  2Y48 A;  1WAZ A;  3D8C A;  3RBZ A;  1Q81 W;  1YIJ V;  2JS5 A;  1YZB A;  3HKB A;  5AG2 A;  3KCX A;  3H1J H;  2HR3 A;  2HVK C;  4DV4 O;  1ORQ C;  3HKC B;  1SQG A;  1GTO A;  3AG4 B;  4X20 B;  3ZIA G;  3SPI A;  2FML A;  1V54 B;  2EIL C;  4JPR A;  2P06 A;  4FK5 C;  2FTK A;  2O57 A;  1XBL A;  3BPZ A;  3A0R A;  1AI4 A;  4LNU B;  4QPK A;  3ZJZ A;  4DXW A;  4E4E A;  2A3Q A;  1ARO P;  3L73 H;  3RW0 A;  2QWP B;  1ZTE A;  4LF5 B;  1H8H G;  5DN6 G;  1TVK A;  3F7Y C;  5LHH A;  3ZMS A;  4QJF B;  1B3Q A;  3BFR A;  3A8T A;  2YIB A;  4CC5 A;  2UUB O;  4UVA A;  4W4L A;  4XDK A;  5KHI A;  3AEI A;  3E22 B;  4DV6 B;  5IJ9 B;  1XUQ A;  1H2S B;  4UV9 A;  4FLX A;  3APQ A;  1I08 A;  4Z2W A;  5FNV B;  4JV5 B;  2OIE A;  1YDX A;  3W7S A;  2LO1 A;  4NTX A;  4B3R B;  4X1I B;  1MA1 A;  3W7X A;  3SR2 C;  4PD4 F;  2YIA A;  5BMV A;  4FMT A;  1GH6 A;  4W4K A;  1M57 B;  1E79 G;  1R3I C;  5KMG B;  4LFC O;  1Z5V A;  4GX5 A;  3TCU A;  1ZAU A;  4O4L A;  2AW9 A;  4NB5 A;  4WBN A;  4B7K A;  4CS3 A;  5EIB D;  3VOU A;  4ZHQ A;  1R3K C;  4O4H A;  2P90 A;  4PI2 A;  4HZ3 A;  2A9H A;  3O65 A;  1OHH G;  4X62 O;  1Y74 B;  5LMN O;  4I4T A;  1VQN V;  4CH5 A;  3RYC B;  1N33 O;  1MOF A;  5BZB A;  2Q73 A;  2HVJ C;  1WPB A;  2AHY A;  3E8F A;  2ITC C;  1R6N A;  4PV1 B;  1N32 O;  2EIJ B;  1G8M A;  4LF9 B;  3BAB A;  5FLX N;  1PNM A;  3R66 A;  1FXV A;  1HNW O;  2EIN C;  2WLJ A;  3FB6 C;  2F23 A;  3CRQ A;  1H8E G;  4IHJ A;  1L8D A;  2XAJ A;  3E2E A;  4JYY A;  4J7K A;  2IH1 C;  4JTD B;  1O9H A;  1Z2G A;  2YXL A;  2Z3Y A;  3RVY A;  3JD4 A;  4X1Y A;  2Q69 A;  4UUJ C;  4BAY A;  2PGG A;  3K9S A;  4JAU A;  4ZBM A;  3P32 A;  1EFR G;  3JAK B;  4F6R A;  3VQY A;  2CTW A;  1QLE B;  3FYE B;  4QIW F;  1MMM A;  1KBH A;  2RQ6 A;  3BAA A;  4LF8 O;  1NS1 A;  1K73 W;  3LUT B;  1DTO A;  4GKK O;  2PZS A;  2LQT A;  2ARH A;  1H2G A;  4DV1 O;  5IJ0 B;  1I0H A;  2AHZ A;  3JAT B;  4FLV A;  1YI2 V;  3U11 A;  5LYJ B;  4TUY B;  3QO7 A;  4DUZ B;  4EB6 A;  4PEL A;  4FJC C;  3KG2 A;  3G71 V;  1COW G;  1VMG A;  3E89 A;  3CC2 V;  1VQP V;  2HFE C;  2N05 A;  3CS5 A;  3M8A A;  3BEH A;  2XT9 A;  3SPG A;  2L6L A;  1MSW D;  4DK0 A;  4X66 B;  2Y4T A;  2Y69 B;  1LUW A;  2V1D A;  2UXD B;  1P4R A;  1QU7 A;  1WP7 A;  3H9V A;  3ML0 A;  1QBZ A;  5BY1 A;  2EIJ C;  4LF5 O;  2DJV A;  4O4J A;  4WCE V;  4PDL A;  4H37 A;  2Z0A A;  4K8X A;  4LF7 B;  3HR0 A;  5LMU B;  5EC2 C;  3SYC A;  2ZCE A;  4DV6 O;  4ZOL A;  4JI5 B;  3CXH F;  4X1K B;  4X64 B;  4JV5 O;  1PV0 A;  2EBO A;  4MTX A;  4YIO A;  4B3R O;  1HNZ B;  2WLN A;  1KMI Z;  3N2G A;  2M6Y A;  1F4M A;  4FLZ A;  1Q43 A;  3BA9 A;  4CH4 A;  3CYO A;  1Y4M A;  3WU2 Z;  2Z5U A;  4G27 B;  1URF A;  2VWK A;  3R65 A;  4UCT A;  3IGA C;  3SPH A;  3E86 A;  3N27 A;  2ZE5 A;  2BSK A;  1WN7 A;  3DC6 A;  5CA1 A;  4KXR A;  1VF6 A;  2PTM A;  3ETE A;  1GN4 A;  1XQ8 A;  4JYB A;  2AZ0 A;  1JFF B;  4BIO A;  4DUY B;  1XNR B;  5ITZ A;  1GK9 A;  2V7Q G;  4LF9 O;  4O2A A;  1N36 B;  4IIJ B;  5LHG A;  4I55 B;  3VQX A;  1IBL B;  4DV3 B;  1MG1 A;  4FPP A; 
#chains in the Genus database with same CATH homology
 1F51 A;  1AJP A;  3QO5 A;  2QE7 G;  5L3B A;  4G28 B;  2ATK C;  5B1N A;  2OTJ V;  5EBM C;  1AI7 A;  2A79 B;  2IH3 C;  3K06 A;  2EJR A;  2IJK A;  1OCO C;  3ZCC A;  3JCZ A;  4X88 A;  4N23 A;  2XAF A;  3LDE A;  3OUS A;  2EIK B;  3K9A A;  1NBM G;  2JJ2 G;  1RPR A;  3LSS A;  5EBL C;  1K3E A;  4ASU G;  2ITD C;  5B1B C;  1OCZ B;  2DQ0 A;  4MVM A;  1YJ9 V;  3K08 A;  1VQ9 V;  1JPX A;  1Y66 A;  4UVB A;  4WF9 V;  1YJN V;  1THZ A;  4LP8 A;  5IYC O;  1R3J C;  4P2Z A;  3ETD A;  2R9I A;  3CME V;  2ZDI A;  5C93 A;  3TK1 A;  3ASO B;  1CP9 A;  2JEX A;  4N21 A;  1R6K A;  3OR7 C;  1NH2 D;  1CPY A;  3CC7 V;  1KP3 A;  1M9N A;  4JTA B;  5LBQ A;  2OT5 A;  2ZR3 A;  1VQ8 V;  3DGE A;  4XBF A;  5LGU A;  1NH2 B;  1QVF U;  2QKS A;  3OMA B;  4WFF A;  4GCZ A;  1OCO B;  1GMG A;  4MVZ A;  1SZT A;  1YTF B;  1K34 A;  4MW8 A;  1QCE A;  1WLE A;  1RPO A;  3MHH C;  3P30 A;  4MW3 A;  4WFA V;  4E2L A;  1E1Q G;  2QEX V;  5B1B B;  3ZRX A;  2ZQM A;  2Q6A A;  1ZWI C;  4DO2 A;  3K3W A;  2EZP A;  2JEU A;  2Q68 A;  3W7W A;  4MTF A;  5B1O A;  4PDR A;  1K97 A;  3OMN B;  3ZRS A;  3G4S V;  4TSF G;  2PI5 A;  3SYP A;  1S3J A;  3IC7 A;  2X6C A;  3OEE G;  1ENV A;  3E8G A;  3K04 A;  3WG7 C;  1DF4 A;  2LFS A;  1QR8 A;  2XAS A;  2YEV A;  1S77 D;  3ASN C;  3NXS A;  1W0J G;  2P67 A;  3JD0 A;  1W2B U;  4LCU C;  5H9C A;  3HPL C;  4X89 A;  2DWE C;  2W6J G;  3ZRV A;  4QNH B;  2W6I G;  2QA4 V;  1Q86 W;  1VQ6 V;  2PI4 A;  1JQ0 A;  2QM8 A;  4MS2 A;  2WPD G;  2DYS C;  1EBO A;  3CCU V;  4MVQ A;  4QPJ A;  3LDC A;  3AG4 C;  4JTC B;  4RO2 A;  2ZDI C;  3ABT A;  1FXH A;  3B8N A;  3MD0 A;  4G2K A;  2OCC B;  4JGS A;  4JYC A;  1R3L C;  1V54 C;  1NVP D;  5E1A C;  1FS0 G;  3SYA A;  1CEZ A;  4U7N A;  5EC1 C;  3CXC U;  3SYQ A;  1Q7Y W;  2LFR A;  1OZ0 A;  1OCZ C;  2DW4 A;  1NVP B;  3OGC C;  3LSQ A;  2ZD9 A;  3W7T A;  3CCQ V;  2B1I A;  1NR7 A;  2XOK G;  3WG7 B;  3GB7 C;  4QE7 A;  1N8R W;  4PA7 A;  3T4D A;  1FXK A;  3ASO C;  2Y48 A;  4PA6 A;  2BOC C;  1AI5 A;  3LNM B;  4R50 A;  3CCM V;  1G4Y B;  3RBZ A;  4XDJ A;  1KQS U;  1JOY A;  1Q81 W;  3RVZ A;  1YIJ V;  4MVR A;  2CK3 G;  5EK0 A;  2HR3 A;  2HVK C;  3OR6 C;  2DYS B;  1YIT V;  1ORQ C;  5GW7 A;  2IJH A;  1NJI W;  1GTO A;  3AG4 B;  3STL C;  2M7W A;  3ZIA G;  4OXS A;  2WLI A;  3SPI A;  5LHI A;  1K5Q A;  3G6E V;  1V54 B;  2EIL C;  4JPR A;  5CA3 A;  1S0V A;  4FK5 C;  2JK5 C;  1S76 D;  2GSM B;  2Q67 A;  3CCS V;  1SET A;  2B5U A;  3CC4 V;  2FTK A;  2F43 G;  1MAB G;  5KA5 A;  4J9Y B;  4BIZ A;  3A0R A;  1AI4 A;  1JCH A;  4QPK A;  4UXN A;  3ZJZ A;  4DXW A;  2DYR B;  2WLL A;  3OE7 G;  2YSU B;  4GX1 A;  1YJW V;  1I5X A;  1ARO P;  3RW0 A;  1QLN A;  5IY5 B;  1M57 C;  4LBE C;  1H8H G;  5DN6 G;  1K92 A;  1ROP A;  3F7Y C;  4ZKI A;  5LHH A;  2UXN A;  3ZMS A;  4QJF B;  5L3F A;  4Z1M G;  1H38 A;  3MHS C;  1PNK A;  5HFL A;  4J9Z B;  4UVA A;  2X6B A;  4XDK A;  3ZN1 A;  3SJQ C;  1YTF D;  3ETG A;  4EKW A;  1M1K W;  3AEI A;  5CMU A;  1BMF G;  4WFG A;  1BHA A;  2BOB C;  2XAH A;  5H6R A;  4UV9 A;  1FXK C;  2YEV B;  2NNU A;  2OCC C;  1XL4 A;  2EIL B;  1P7B A;  1VQO V;  2B1G A;  3W7S A;  4JAS A;  1OCR B;  3E83 A;  5KUK A;  3W7X A;  5L3E A;  3CCL V;  4FMT A;  1AR1 B;  3CMA V;  1NR1 A;  1DLB A;  2MK3 A;  3ZN0 A;  1V55 C;  1M57 B;  1E79 G;  1R3I C;  1VQ4 V;  2DWD C;  4GX5 A;  1K7D A;  2ZR2 A;  3TCU A;  3JD1 A;  1M90 W;  1GO3 F;  3E8B A;  5L3C A;  4BW5 A;  1GM9 A;  4HAM A;  3VOU A;  1K4D C;  1R3K C;  4TWK A;  2P90 A;  2P7T C;  4HZ3 A;  1GM8 A;  2WSS G;  2A9H A;  4QE9 A;  1YHQ V;  4WFB V;  1OHH G;  3ZMT A;  5LGN A;  2KB1 A;  1S5H C;  3JD2 A;  4MVO A;  5IYB O;  1VQN V;  4RUF A;  3AG2 C;  1QLE C;  1MOF A;  1BL8 A;  5BZB A;  1FXK B;  2HVJ C;  3EFF K;  1B6Q A;  1PD3 A;  2AHY A;  3ABL C;  3SPC A;  3VBB A;  3OAA G;  3EHB B;  5H6Q A;  3E8F A;  3CCR V;  2ITC C;  1R6N A;  1BHB A;  4PA9 A;  4RUE A;  2EIJ B;  3W7U A;  1G8M A;  1FFT B;  1K33 A;  1PNM A;  1FXV A;  2DYR C;  3CP1 A;  3CCJ V;  2EIN C;  1OCC C;  3OM3 B;  4L87 A;  2WLJ A;  1V55 B;  3FB6 C;  1H8E G;  5IY5 C;  2WLI B;  3WFV A;  3OEH G;  3B8M A;  2DQ3 A;  2XAJ A;  3E2E A;  2A0L A;  2IH1 C;  4JTD B;  2Z3Y A;  3RVY A;  2R9R B;  3JD4 A;  4XDL A;  3FYI B;  3B77 A;  4CZZ A;  2Q69 A;  2WLL B;  2HLD G;  3DTU B;  4UUJ C;  4BAY A;  2XND G;  3GWO A;  4Q20 A;  3I55 V;  2OTL V;  4JAU A;  4ZBM A;  5B1A B;  3P32 A;  3OUF A;  1S72 V;  1EFR G;  4R8C A;  4FIP C;  3HB3 B;  4RQF A;  3AG2 B;  1QLE B;  3ZMZ A;  1KEC A;  1W0K G;  3FYE B;  2Y69 C;  4QIW F;  2WLM A;  5IDJ A;  1KP2 A;  1Q82 W;  3ABL B;  4MVS A;  5KA6 A;  4WFE A;  5EBW C;  3X2Q C;  3OMI B;  1L1F A;  1K73 W;  2WAM A;  3LUT B;  1DTO A;  1E1R G;  5LGT A;  1OCR C;  2WWW A;  1JJ2 U;  2W0F C;  1H2G A;  5KUM A;  3ZMV A;  2NLJ C;  2EIN B;  1OCC B;  2AHZ A;  2JIZ G;  2HG5 C;  1YI2 V;  3QO7 A;  5L3D A;  2EIM C;  2HKO A;  4R7C A;  5FL7 G;  4PEL A;  2D3O W;  3K03 A;  4FJC C;  4I5S A;  3KG2 A;  4R6Z A;  3FB5 C;  1K9M W;  3BY6 A;  3G71 V;  2X6A A;  1COW G;  3AG3 C;  3E89 A;  4X8A A;  2HJF C;  1AJQ A;  1K4C C;  3E8H A;  1SRY A;  3JYC A;  1AJN A;  3CC2 V;  2ZXW C;  3OFN G;  5CN0 A;  1KD1 W;  4JF3 A;  4PA4 A;  4MTO A;  1TUE B;  1VQP V;  2HFE C;  1LNQ A;  4JAV A;  2QM7 A;  4KFM A;  3ZRW A;  3BEH A;  3SPG A;  4P9O A;  4P30 A;  2X7R B;  3UM7 A;  2EZO A;  3D36 A;  3JD3 A;  4H33 A;  2IJJ A;  1MSW D;  2C2A A;  2JDI G;  3ABM C;  1NQT A;  2IJI A;  4PDM A;  3QO8 A;  2Y69 B;  3UKM A;  1RM1 B;  1IXM A;  5CBG A;  3FB7 C;  2V1D A;  4PDV A;  3ABK B;  3K79 A;  4RQE A;  1P4R A;  1XL6 A;  1GKF A;  3CPW U;  3X2Q B;  3ML0 A;  3LDD A;  1QBZ A;  4KP4 A;  5IYD O;  4YXW G;  3E35 A;  3IFX A;  2EIJ C;  1SER A;  1KKD A;  2IW5 A;  4LC1 A;  3QNE A;  3ZMU A;  4MT8 A;  4WCE V;  2H94 A;  3OW2 U;  2H8P C;  2UXX A;  4PDL A;  3T2M A;  4H37 A;  1NKD A;  2EIM B;  4U7O A;  1PNL A;  5J9P C;  2XAQ A;  3AG1 C;  4UVC A;  1K5S A;  1F23 A;  3FB8 C;  3AG3 B;  5EC2 C;  3SYC A;  1JVM A;  1VQM V;  1J95 A;  2ZXW B;  5B3S C;  3T1C A;  1PKX A;  1DF5 A;  1VQ7 V;  2K1E A;  1QVG U;  5B1A C;  4GT1 A;  4MVU A;  1EZJ A;  3FKS G;  4F4L A;  3ABM B;  5HFM A;  1UJW B;  2JJ1 G;  2EBO A;  2GHY A;  4RAI A;  4MTX A;  3SPJ A;  2X0L A;  1AI6 A;  1K8A W;  3SYO A;  1M56 C;  3CCV V;  1VQ5 V;  2P6J A;  4PA3 A;  2WLN A;  1R73 A;  4MTG A;  1I5Y A;  1F4M A;  2IU0 A;  5CBF A;  3AG1 B;  4BIU A;  3STZ C;  3M99 B;  1JX9 A;  3F5W C;  3PJS K;  1GM7 A;  3CYO A;  4MSW C;  1QR9 A;  1Y4M A;  4P9P A;  2Z5U A;  3T4Z A;  4G27 B;  1PL0 A;  3R65 A;  5B3S B;  2EIK C;  1WPX A;  3IGA C;  2WLK A;  3K0D A;  3SPH A;  1F4N A;  3E86 A;  1VQL V;  2IU3 A;  2WLH A;  4HYO A;  4UV8 A;  5L3G A;  3ABU A;  3ETE A;  5CBH A;  2XAG A;  3TET A;  2QTO A;  4JYB A;  1RM1 C;  1GK9 A;  4TT3 G;  2V7Q G;  1HWY A;  4GX0 A;  2LP7 A;  3ABK C;  1YSC A;  3D3I A;  1KC8 W;  5LHG A;  3ASN B;  4KUM A;  5DM6 V;  3CD6 V;  4GX2 A;  1M56 B;  3H01 A;  4WFH A;  3K0G A;  3ZRW B;  3I56 V;  1SES A;  1VQK V;  3F7V C;  4CBC A;  1MG1 A;  4I9W A;  3CCE V;  4FPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...