4Z2WA

Factor inhibiting hif in complex with fe, and alpha-ketoglutarate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
341
structure length
341
Chain Sequence
b'VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Substrate Promotes Productive Gas Binding in the alpha-Ketoglutarate-Dependent Oxygenase FIH.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 108
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4z2wA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z2wA01
3OD4A 2YDEA 4B7EA 4B7KA 2WA3A 4NR1A 3KCYA 2YC0A 2CGNA 3P3NA 1MZFA 5JWPA 1H2LA 4Z2WA 1YCIA 2ILMA 4QU2A 2Y0IA 2WA4A 2W0XA 1IZ3A 1MZEA 1H2NA 2CGOA 3D8CA 3P3PA 4BIOA 4AI8A 1H2MA 2XUMA 3KCXA 1H2KA 4Z1VA 4JAAA
chains in the Genus database with same CATH superfamily
5GM0A 2F23A 4XZUG 3F5TA 1F23A 2X7RB 3ZN0A 2ARAA 2B39A 2HWD1 3LQCA 3FBYA 5CFCA 2XUEA 3IN9A 1TZOA 4Y26A 2JDKA 4CH4A 1WPXA 1ND2A 4PLNA 4B4QA 3WNOA 4F7ZA 4LBNA 2JGUA 3A0RA 5CB4A 1UOFA 5ANNA 4WCEV 2FCVA 4K3AA 4J1WA 3RI9A 4DR1B 1FXKA 1PZ8A 3MDSA 4LCUC 3CWBH 4CS2A 1CZTA 4AQSA 2JDIG 2QDNA 5EYXA 1FYJA 5LHGA 3V0BA 4YVSC 1GKBA 4XXAA 5LBFA 2DUQA 4XABA 4GALA 4FP2A 5KA5A 3TN92 3I3BA 2CAUA 3VQYA 4AAXA 1ZZCA 2Q73A 3AVSA 2A6YA 4A42A 1S2EA 3PVBB 2E5LB 1EYBA 4A44A 1XL6A 3VN4A 1NH2D 1AR63 5FZDA 2K9ZA 1K3IA 1HKDA 2G4IA 4RR3B 1QOSA 4XZPA 1NX9A 1KQRA 5FV3A 4BIUA 2XGXA 2CTPA 2GMEA 5CMUA 1YI7A 5CA0B 4W4KA 3LEKA 1TME3 4R4XA 2VR4A 4AQ2A 1X9TA 1X9PA 3BVCA 4D94A 2R0HA 2CH7A 4JAUA 3WP6A 1YQ2A 1OH3A 2QVSB 5HFLA 5JMCA 1NS1A 1VAVA 4XDKA 1FKAO 1GZTA 2LFRA 5ITZB 3QF7A 2VQFO 1RUH3 2PN5A 2BW8A 4UBGA 1JN2P 4JRLA 2ZXWB 3RPQA 2XR4A 4KU7A 2VW1A 2QEXV 4XJ8A 2NMOA 3KV6A 2WKKA 3N2GB 4QU2A 1VLNA 4DUXA 4YJ2A 4RWUA 3ZYGA 4FCAA 3WNKA 2WFPA 2QKDA 2GH2A 4TQDA 2JEUA 3FHQA 4DRXB 1W6NA 5EQUA 2Y4TA 4EZ4A 4K3UA 2XHKA 2LTNA 4CYDA 4O9GA 3D3AA 3ZRXA 5FMDA 4JGYB 3ZN4A 3ABKB 4MGYE 4FVMA 2JDNA 3S30A 3CMEV 1QVGU 4JGZA 3SH4A 5F37A 5CZKA 4XFBA 5C33A 4RS5C 4MVSA 5F5QA 1GOFA 1V9U2 3I56V 5F1RA 3PVEA 3L9JT 3FLRA 3ZOIA 1YRZA 3KGLA 1KYOF 2ZX1A 3VL8A 4HVQA 5B3SC 3DPRC 2D6PA 4XYXA 2QQJA 3K77A 4MO3M 4ZXKA 1X50A 1TUEB 2F95B 1RXFA 1XU1A 1SETA 3G80A 3VD5A 1O5LA 3VBBA 3WG2A 3ZDSA 2OT5A 1J59A 5EIYB 1F31A 3OJBA 4GULA 1SBDA 1T5EA 2DWEC 2YFZA 3OGRA 3JB8A 1HRI1 4J6GA 3OPZA 3DC5A 3E22A 3POIA 5H9RA 5FZCA 2UUBO 3UM7A 4NPMA 4Y5SA 1C28A 1OUSA 3U11A 2OCCB 3OOXA 1POV3 3O1VA 1AB3A 5A7WB 4OFGA 4CS4A 1G9DA 1HDKA 2LGQA 1NKGA 2BDRA 5CU1A 1RMU1 2LW8A 4NMIA 5L9VA 2QCSB 3LB9A 3ASOB 1JZ7A 2IU0A 3FN9A 3ABLC 2O0OA 3LIHA 4KL1A 4OHYA 4KWJA 2D97A 4WVZA 4BR6A 5BV6A 4PIXA 2RDSA 3AKTA 4UXAA 1SLAA 3FB6C 1N1VA 4W6XA 4WFAV 4ZS2A 1PP9H 2ZGPA 2PGGA 4LKFA 3IDAA 5DN6G 3H1JH 4RO2A 4Q4V2 1S3JA 3NJVA 4IV1B 1ASJ3 2RS52 1ZZ8A 3UO3A 1F4AA 4XF3A 3NNMA 5IJ0A 3EHBB 4CH6A 4CBCA 1WB7A 1KUQA 2M6YA 5B2GB 5EZYB 1MACA 4L9BA 2WZEA 1HNXO 1PO11 2G1MA 3VKLA 2Q67A 4QD2A 4L2NA 5BNQA 1QQP2 3EHKA 4Q8LA 3Q8BA 4XFAA 1V9PA 3RYRA 3AL5A 4IGOA 3IDEA 2YGMA 4J9YB 4CDQC 2Y0OA 3SPJA 2DOSA 1WMFA 1EV12 1CEZA 4OMDA 4QX3A 2UUBB 5LOVA 4O4IA 5LP6B 1H6YA 4GKXA 5FUIA 2ZEWA 1H1IA 4B3RO 3WNXA 5IFPA 2WZR1 1HW5A 3B93A 3J7AU 3HKBA 4G9SB 5BZBA 3V0AB 3DXUA 2X5IA 4DZGA 4P14A 1RUG1 3MEPA 4JI7O 1LCLA 4XHBA 3JCUZ 4LXLA 1K5SA 5DUXA 1ZVFA 3RYHB 1GN3A 5IVCA 1RITA 3QTCA 4AF9A 1X59A 3VB9A 1PMIA 3ACLA 2VNRA 1GMGA 2YBKA 1GAXA 3SH5A 5IJ9B 2OIIA 3VLBB 5DZEA 1RUE3 3W5MA 5A3MA 4W50A 1CXZB 1V9U1 1YITV 3K48A 4Z07A 2DMXA 4JRAA 2VWKA 2OIGA 5A3WA 1ZSPA 3N27A 3K9AA 1KD1W 1HNXB 5JQGB 2E31A 4ARYA 1TUBA 3VBOC 5B1BB 3AKRA 5GZCA 1OOPB 1NJIW 5BMVA 4RL7A 3OPTA 2XDVA 3UETA 1XB9A 2IXLA 2XOMA 2HKXA 4LULA 4GH4B 1R093 3ZYRA 5HV0A 1RUI3 2Q5TA 4WBNA 2XB6C 3WG7C 4Q4X1 4B3RB 1ACCA 1WCUA 4C90A 2K1EA 4I50B 5TSWA 4Q4W2 1BYHA 3HQXA 4NHLA 1U5ZA 4JI7B 1K5MA 2DF7A 1OI6A 2OZJA 2YBPA 2W6IG 3HEIA 3EB7A 3C7OA 1NTMH 1LEDA 1HP8A 2TNFA 4META 3JD4A 2VUCA 3HKCA 4XACA 5FMOL 2ARHA 2H3OA 1UZZA 4LITA 2LQTA 1VMHA 1NQDA 5JAXA 1SS3A 3TXQA 3NNFA 4UV8A 5T52A 3J8F3 2E6VA 1Y9QA 4Q4V1 4MVZA 3CO2A 3EXUA 5C3SA 2RS51 1DU3D 3AMPA 4LOTA 4DY3A 2XJPA 4K8RB 4KBBA 2DUOA 3FUOA 4QE9A 4N90A 4H37A 2ADDA 3AKQA 4JTOA 2D3PA 5K0UC 4ISQA 4UT5A 3WOGA 1NBMG 3T2TA 3ZXEA 4CCOA 3AG7A 4MYEA 3POSA 5FP9A 4NIGA 3LFMA 3O1PA 4WZFA 2EAKA 2VZVA 1CX4A 4FXKB 3VBUA 1AJQA 2PAEA 5J48A 3CCVV 4BIZA 3M4FA 3R4UA 2ES3A 1EV11 1YLLA 2N7GA 4QHBA 4WM8C 5AC93 2ZAAA 3ZIAG 5IYBO 5CKQA 5BXXA 3E8FA 2NR5A 2QQPA 2AZ2A 4X88A 3Q8CA 4Y20B 1JCHA 2OYQA 5FMCA 5FZ1A 1RHI2 5C5UA 3RN4A 4I9WA 1HJFA 5C7GA 4Y4YA 2BOCC 2TEPA 5J3UA 1GNHA 3MF9A 3AL6A 3MLJA 3AZXA 5FZ7A 4IV3B 2HWB2 5L3EA 5J37A 2XBO2 1NI8A 1PGW1 5FOJB 4TXWA 2J1VA 3KSCA 1ULEA 4OLLA 1GOHA 3L70H 1RP3B 1FOD1 4FLZA 2EXJA 4CDXB 2BPA2 1JZ3A 1VBC3 3HN1A 4S2FA 4GLXA 1IKQA 5F3IA 3POJA 3BUCA 4HVRA 2ATKC 2YV8A 4YFWA 3N2KB 2ZZQA 1CAUB 3KKYA 5KMGB 2KG7A 1CJDA 1BHGA 2WLKA 1GLHA 4MTXA 5CFCC 2ZX3A 2R32A 2EA7A 4B3TO 1CZSA 4QQOA 4BQWA 3C3TA 4LFAO 4PDLA 3D6EA 5D2AA 1XOYA 4A5UB 3RWNA 4JI6O 4JHZA 4G4FA 5GONA 1MABG 2R30A 2ZM6O 4JI5O 4X89A 1WLWA 3OAAG 3ABUA 3EMRA 1FXKC 2JDPA 3I3DA 4RGGA 1W3XA 4FPYA 4HFSA 2W39A 1Q82W 3OEBA 1W06A 1H30A 3HKEA 3SJAC 1SEFA 1YQ8A 2QUOA 3UJQA 4LKEA 3D82A 1WKYA 5TISZ 4Q4W1 2UYAA 1V55B 1Q5OA 1LOEA 1OHHG 2P6CA 1EPZA 3A4UA 1AR92 1W04A 5D5PA 3ZRWA 4CZSA 4EV0A 4CU6A 4NAOA 4JTNA 1OQDA 2FYUH 2P34A 3G6JB 2JDZA 1UMZA 1QNWA 3WDYA 5JH7B 5C4WA 1E57A 2BGCA 3CJIA 1KFUL 1UWWA 3IAQA 4MGKE 5FY7A 3S6PA 5BXZA 5LWBA 2IUWA 4LF5O 1RJ8A 4GMP3 2H8PC 1RUJ1 5CBHA 4Y1VA 4K9SA 4B3TB 3IKWA 3EO6A 4BQ5A 4NYKA 4AAPA 2B1IA 4LFAB 2WA3A 1F15A 4XUTA 4IEVA 3M3OA 4JI6B 2M7WA 3L9DA 3T0AA 2IZWA 1XYNA 2ZM6B 4JI5B 3POWA 4XW3A 1KECA 3DYMA 3BODA 5EYYA 3A23A 4HSLA 1PGSA 1EAH2 2CY6A 4N23A 5B1AC 1R3KC 1QHTA 3KCCA 5DECA 2PI5A 2KXLA 4JGSA 2QBXA 3I2FA 5KX5A 1XXNA 4MV2A 5GZFA 4DV7O 3J26N 2QJVA 1XHZA 5HXMA 4TOIA 4HBNA 1RUC2 4HL0A 1URXA 4PA6A 4PA4A 1LHUA 5J09A 4LO6B 4GB32 1PM7A 4ATFA 4BPZA 5FMBA 1IQDC 2WLJA 4TSFG 3MDPA 4X62O 5JIUA 4JGZC 4O2BB 2XONA 2K9PA 1PK6A 3IAYA 5HCAA 2E75B 3T3YA 3GZUC 1K34A 3SCGA 3OY8A 2B5HA 3UNPA 3LDBA 4H7MA 4LF5B 2WUHA 4LBLA 1UKGA 3CXCU 4UWDA 3N9OA 4BWAA 4Q0VA 4J11A 5LGUA 1BZWA 3C3SA 3BYWA 4MVQA 3CKHA 2E7AA 1KP2A 1W90A 1BCCH 4LNUB 1WGPA 4LO5B 4Y1ZA 3QH6A 3EXAA 4LF6O 1XREA 5FREA 2EIGA 1R1A2 3RSJA 3JALB 3HVDA 3TGUH 4XQWA 4NN0A 2HWC2 4YJ3B 2EAAA 2JG9A 4H0LB 1ENQA 1JU4A 2ITCC 4O4JB 2ATFA 1WW6A 3F7YC 4HVOA 5B66Z 3E5UA 3IC9A 2OS2A 3ZMTA 1P4RA 1GMMA 3MV01 2YXSA 4R50A 2V4VA 4QX2A 1YVWA 4DV7B 2QFEA 4PBPA 5F9TA 1VF7A 1US3A 4NO4A 4TQFA 3T0BA 5C9AA 3G71V 1DQ0A 3GVMA 1ZZ7A 1FPN3 3CEIA 5FY9A 2PYLA 1AR91 2W68A 2R063 4X62B 4UW3A 2VMEA 1FS0G 2HJIA 4BQ3A 1XNDA 2Q1ZB 1S0DA 2AHZA 4W6WA 4QGNA 4X8AA 1N3OA 3ZHTA 2Q4PA 1O3TA 4WFHA 5FY4A 3P3NA 2QQNA 1R3JC 3U75A 5DG1A 3RYCA 1IS4A 4FPGA 4NPLA 4AQ6A 3DC6A 4DV1O 1AHSA 5IYYA 4F4LA 1GOGA 2WPDG 1DZTA 3BAAA 2ZHMA 4N9HA 4QGPA 2D6KA 3USUB 5F7UA 4LF6B 2JE8A 4UXNA 3F95A 1GK9A 2ID4A 2JIZG 3GZEA 3TEWA 1CPMA 3H3ZA 4UCSA 1QR8A 3P3PA 4DXSA 4IERA 1JYNA 1S0BA 2W95A 3M99B 3TRSB 1NZ6A 2JKBA 2Y6KA 3GDBA 4YVSB 3OGVA 1EAH1 1JBCA 1F8VA 2X5IC 4KH9A 1MSDA 4QKDA 1XU2A 4E2GA 2YIAA 1JOJA 1OV9A 4DV0O 3OCPA 2OTJV 2Y6LA 3KMHA 2BFUS 1AXZA 4TWTA 3CJHB 4MW3A 1W9TA 4XBNA 1UJWB 3T1LA 2R042 2E9QA 1HN1A 2DE0X 4RD7A 3DKQA 2ZE7A 1OUXA 3O1UA 2K0GA 4J25A 4FLVA 5EYPB 4LF4O 3HNYM 4WV8A 2HWE2 1VARA 2KQXA 4EB6A 2E3CA 4HNAB 4GXLA 1JH5A 1Z7S2 4JYAO 1AL23 3JD72 2FMLA 5CA0A 2XTAA 2O1QA 2YPJA 4FLWA 3AG1C 4IEWA 4B1MA 1CJPA 4DV1B 3ZIWA 2PQSA 3E8BA 2DYSC 3IPVB 3LA2A 5FL7G 1UY3A 2JD9A 1DF4A 5C3QA 1J84A 1N0NA 2G19A 3CC7V 2OIEA 3FYEB 4LK6A 2WWUA 4PF5A 1L0LH 2FMYA 4NHYA 1I08A 1TAEA 3K5OA 2QKCA 3B01A 4XF0A 2Q4SA 1BGYH 2WZ8A 1AR73 1N47A 3RZHA 2D5FA 4CS3A 1OLQA 4DV0B 3AG3C 2YXYA 1K5MC 4PCRA 1BCXA 2ADQB 1KS5A 4HK8A 1VRH3 1Y7BA 3FZ3A 1LOCA 3O0WA 3SJCC 4DRXA 2J7MA 5GLZA 2NN8A 3RNSA 4ES8A 4RA0A 2EZOA 3H8RA 1POQA 3L72H 3MIEA 2RN9A 3WW2A 3W7TA 4GKYA 4JGYA 4KMQA 1UMIA 1N0JA 5FR3A 1W8WA 3CCEV 3LSDA 4JI4O 4H55A 4JI8O 1VEWA 1CIYA 1W9SA 3OUSA 4LF4B 1GFF2 5JOWA 1OF4A 2WFF1 5DZFA 3DPRB 5A6XA 5IVFA 2IJKA 3IMMA 3A2FA 5HV4A 2WYSA 4JYAB 1OHFA 2QQOA 1SERA 1Y67A 3APOA 1NR7A 3BKZA 3CCJV 2CAZC 4DXRA 2GC3A 4ZOLA 1W2NA 2HH9A 3BIWE 4X6QB 3FYIB 4RSUA 4YRDA 1PHMA 5C8CA 3VBUC 1BHBA 5LA2A 4FQZA 4XQDA 1JQ0A 5CAZA 3TEYA 4MTOA 2F93B 2RMU2 1YDXA 4UYBA 2D40A 4PDWB 3JAKA 2Q8VA 3SPHA 3T4ZA 4DIQA 3BPSA 5A7WA 4AFAA 4HZFA 4M01A 1OCRC 4XILA 2ZD9A 5LYJB 3OUIA 2F43G 5T5PA 2C24A 2P1BA 3E8GA 4QT6A 1CZVA 1JYCA 5FOBB 1FX5A 2GP3A 4OUEA 4JI4B 4JI8B 5F3EA 4ITCA 5IK4A 2ZINA 3ZSJA 2Z5UA 1FJGO 1W3VA 2GSMB 3RZZA 3F2ZA 1ND3B 1T2XA 3FFZA 5LGNA 4LWSA 2IVJA 4IV1A 4HK9A 1N1SA 2D3SA 2YROA 4CP9B 3CCMV 3JD71 3BU7A 5A32B 2EIMC 4D7SA 2RQ6A 4D6SA 1W2OA 3TN93 4CDQB 5FZMA 5F2SA 3MD0A 5FLIA 3A21A 3EFFK 5AG2A 3I2DA 3LSSA 4AVAA 2B9UA 2VNGA 1MS5A 4DFSA 4AHZA 4K8FA 3OBAA 3R4SA 2BTQB 5KUKA 1KITA 3SISA 4NE9A 2BSKB 4UI9L 1S2BA 3FL7A 2VOWA 2FDFA 4J7JA 1MR5A 3B4SA 2VJXA 1CAVB 5EXOA 4UCUA 3N9NA 2ZMNA 1LECA 5FYBA 3CEWA 4QX5A 2HJFC 3LSUA 4QHOA 3H01A 2EIDA 4J1XA 4X20B 2VTFA 2C6SA 4IEPA 2C9KA 3J7MA 5A3PA 3SYOA 1AX0A 1ZZ6A 3CJIC 1NY72 2BU9A 2QQVA 4CUBA 2VVDA 1FJGB 1XQ8A 1Y3TA 3WP5A 4CH3A 2V09A 3MHZA 2E51A 2PUSA 3NV3A 3RQ0A 3DGTA 2PHWA 1H2GA 5FWJA 4YHHO 2LP7A 5JZGB 1YJNV 3SC7X 2W52A 3CPWU 3MFAA 2VZQA 2GHYA 5FPOA 2A3WA 4DOUA 5ANQA 4HETA 1VB4A 1X8EA 1EN4A 1HV1A 1OOPA 1O6UA 3RZLA 2KD7A 1BBT1 2NPIA 2MK3A 2HEYF 4FOYA 2QZ2A 1H9PA 1V9U3 3HR9A 2R49A 4MXWB 3CX5F 4CEWA 1N34O 2ZHNA 4GH4A 1KJRA 1WA8B 3MIBA 4MGQA 5E8AA 4CE8A 3CRMA 1HLCA 1AR4A 3DXTA 3LPFA 5JSRA 1YCIA 4LLOA 5CISA 5FZHA 5C70A 3ES4A 2CWSA 4IEZA 3NAPA 3OB8A 2ZTNA 4K6BA 4NR1A 2AYHA 4YGEA 4OHXA 1YZBA 4EEQA 3FMGA 4FPCA 2W6JG 4YM0A 3PIJA 1R1BA 1VP7A 4QX1A 3J80N 4UV9A 3ME2A 1JOBA 1PK6C 3VHOA 1W6QA 2EINC 1LEMA 1YUDA 3NWKA 5A3UA 4N43A 3ORJA 3BCCH 3BTZA 3ZBHA 4W4LA 1S5JA 3LF7A 2WLLB 1BQ0A 4KU8A 5A7QA 5JVVA 2ZDIA 1PL4A 2N05A 4BW9A 5F6LB 4YHHB 1SBEA 3SLIA 3M3QA 3C7HA 4CCEA 4AYUA 4AVVA 4P08A 5LEKA 4F6RB 2DVDA 1DLBA 1Q8PA 2KKWA 4WM8B 1G9AA 4R8CA 3G7DA 2JG9C 3OD4A 3WX5A 5D5QA 4LT5A 4Q4V3 1W6MB 2PLV2 4JKLA 1VBE2 2W3JA 1W0PA 3RI8A 2RS53 5T55A 2RDNA 5K7PA 2JXAA 3QOPA 1BMFG 2JS5A 2PZSA 1IZ3A 1W0JG 4DEVA 5ABJB 1E5SA 4P9YA 4FZ0A 4NIAA 1ZZBA 4XBLA 4D6QA 2BTOA 1YYNA 4IIJB 1WW7A 1PO22 3G6BA 5KAIZ 1HNWO 2WT0A 1V6IA 5FYYA 2G9FA 5IK5A 3VD3A 1QQP3 1HB2A 1VQ6V 4LE3A 5C9AC 5IWAO 1NLRA 3VBRB 3PUSA 2Q9LA 3OM3B 2FQPA 4X1YB 5FUPA 3LSQA 3MIFA 2WQZC 1QY4A 2GAUA 4A41A 1EV13 4LHKA 1UU6A 5BPXA 2WINB 1E1RG 3OEEG 3OMAB 1PMHX 4U2AA 2LO1A 3ZEDA 3ZYPA 2W47A 3K2OA 1LAJA 5CFCB 4XXPA 5J7MA 1OLRA 2LJ2A 3WB2A 1OPMA 1ND2B 4EWAA 5JPNB 5FYIA 4Y33A 3FFQA 5BY1A 2NMNA 4AW7A 1BT8A 4R9AA 1NZIA 2DTWA 5D8AA 2BOBC 4X8NA 5CB4B 3KZ4C 2DWDC 5A70A 3ZMNA 1JMUB 4ONUA 1OBNA 1JTZX 2GC1A 1WD3A 3HIFA 1E5HA 3KV5A 5DDJ2 3N9QA 1EM1A 5CBGA 3IIIA 2DQ3A 5L36A 2UWBA 4NOTA 4XF1A 1DYOA 4HOOA 5JR7B 1IURA 3D8CA 2BUKA 3OGIB 1EY2A 2X53S 3ACFA 5L19A 3A0BZ 4K1YA 4W65A 3OW2U 4JKMA 1BVP1 4E8DA 1URFA 2OWOA 2GDSA 4FLTA 3T2MA 4PF1A 1HNWB 2ILMA 4DR5O 3HAGA 1L7LA 5FPXA 3M8LA 1MQTA 1OFNA 1N36O 3UL2A 1H2KA 4H13B 4A6OA 4LO8A 2XNDG 1I3HA 2R7EB 3MF6A 5GALA 5IWAB 2CAVA 2X29A 1VQ7V 1FT9A 1JW6A 5IY5C 3ZFEA 3L2HA 2B42B 3POBA 4EQVA 1BJQA 3UYJA 2EXIA 1VQOV 4IXLA 3WB1A 4GA9A 4BZ4A 4CCJA 2BOJA 4D6TH 1V54B 1VPHA 4IE7A 4P5YA 5JH7A 3AP6A 2GN7A 3BOWA 1NAEA 3PU8A 4Q4W3 3VBHB 2YZ4A 1OURA 2ZE6A 4LF7O 1YO8A 2A9HA 1H4GA 3KG2A 4YG3A 5H6QA 1SQPH 1D4M2 5EK0A 2V4DA 4YW1A 2JGDB 1UZVA 4UVCA 4IE6A 4QB2A 4KNCA 1Q56A 5IAXA 1IPKA 1CAWA 2YC4A 1NVPD 3ZXJA 2WWWA 1VBA1 1DLLA 4YJ2B 1JI6A 3WG3A 4DRVA 2ZXWC 3FB7C 1SQ4A 2BZDA 3U07A 1N4CA 1XDCA 1SRYA 1YEWA 3FB5C 3UK9A 1LB2A 4QKNA 1JHJA 4MTFA 1W6NB 2GV9A 3MUY1 4EZHA 5FPZA 4AI8A 3UJOA 2C4XA 5FPVA 4DR5B 4CH5A 1P49A 3RYPA 4TLGA 1HV0A 5FYSA 1XSQA 1N36B 1GWLA 2V73A 1PO21 4JGZB 2JWPA 4Y5TA 4Q0UA 5D1IA 2HP8A 2DCTA 3ZYHA 4AVSA 4EN7B 4P5HA 3PTYA 4ZY9A 5A33A 1MMMA 1GUIA 4XUQA 4JGYC 1F5FA 2VY0A 2BE3A 3ABKC 1UL9A 2UXNA 4XJAA 2VTXJ 1W03A 2VZOA 3VL9A 2Y6HA 2I07B 1RHI3 2NP0A 4LF7B 3PDQA 4YM3A 4FAGA 1QJX1 5IVYA 4LC1A 4NPRA 1JUHA 4JI1O 1UCXA 4GCZA 2HWB3 3IC7A 1VQ8V 1OT5A 2UUCO 1RVF2 4S2DA 2H0BA 1NUKA 4LNUA 4OYUA 2Y6GA 2UYBA 5C8CC 1S4CA 1AI5A 1G1XB 4I9QA 5DEDA 4DS0A 1TQ5A 1J3PA 1CP9A 3JASB 5FMOS 4BXSV 3D5OA 3INAA 1HRV2 4D8MA 4AGGA 2RS11 3AZWA 3MIGA 1PVC2 1BE3H 3K0GA 2B9VA 2OCCC 4YXWG 4FOWA 4JDNA 2YU1A 2FDJA 1ODMA 4AFBA 3JD0A 1M4WA 3H1LH 1DLCA 4AI9A 3HPNA 3ROUA 2CDOA 3ASOC 2HHHB 1CGPA 2PA7A 4F3JA 4WFGA 5FXVA 2VBBA 3ZLIA 4QM9A 3TEXA 4TV8A 3WUCA 4U3FH 4BIFA 4NKGB 4PA3A 4E2QA 1GQHA 5IJ0B 4OXSA 4MX3A 5L9BA 4AEKA 3ZMOA 2YICA 3NRUA 4M4RA 4IV1C 1M4UA 1Z5VA 5FYCA 3NO8A 1OLME 1AP6A 3HNMA 3MUZ1 2W94A 2ZHKA 3X2QB 2HWF1 4K0KO 1DQ2A 3WNLA 4JI1B 2Q6AA 2C2AA 3EQEA 3UGHA 1OA2A 1AR93 2RDQA 5A7OA 1D4M1 2DCZA 2UUCB 4I5SA 3ZYJB 5I8SA 5LOVB 5CNAA 4O4IB 2WSVA 3I2GA 3USUA 4XQ4A 3V65A 3H1WA 3WF0A 3M70A 3HKBB 2AGSA 1GM8A 1UXXX 1PNMA 4FOVA 2X5IB 1C1FA 2WLPA 1JZ4A 2ADEA 3ETQA 4AEJA 3LE0A 1RSOA 1K8AW 5DUUA 3AG2C 1YI9A 3ZXGA 4IEOA 3ZIXA 5ERLA 3H50A 4J7KA 3UV9A 4DY5A 1US6A 1W0KG 3MO4A 2GP5A 4DR6O 4XFGA 2ZX0A 2WSSG 4I0XA 4GJYA 1VAKA 2ADPA 4LHNA 1ALYA 3NR7A 5L73A 4QX0A 2ZIMA 1K92A 3TBDA 1SQXH 1YWKA 3T30A 4YW3A 3KV4A 1EAH3 1AJPA 3PURA 5CN0A 4XC9A 3PUHA 1DP0A 4R9DA 3A0KA 3DUIA 1TUBB 5LBEA 1VQ9V 2DYSB 3M7MX 2MEV2 1GRJA 3PVOA 5B1NA 5FK8A 2PI4A 4K0KB 3ZMSA 1RUC3 2AR6A 2ZE5A 1ULFA 1OFSA 1N1TA 4GB33 1OJHA 3BB6A 1GNZA 4WBNB 2QKAA 1MEC2 2J42A 3CCLV 1OOPC 1ZRDA 4E2SA 2CHHA 1FD9A 1SMVA 4CEWC 1SG3A 4X1IB 4NXMO 3AG3B 2P3JA 1ROPA 1K5MB 4GH4C 4CU8A 1YJKA 4OUMA 2RV9A 1HRV1 3T1HO 1PVC1 4CU7A 3AK2A 3C2UA 1XNBA 2YHJA 4JZGA 2BOIA 4UFIA 4UAPA 3HKCB 4XCBA 2X10A 1UY0A 4DR6B 5LCWL 3OEHG 2XAHA 3ETDA 2P06A 1R1A3 3WB0A 2EIKC 3QO8A 2YU2A 4QKBA 5LBCA 2R0FA 2HWC3 2Y64A 4KUMA 4IGGA 1LGNA 2HR3A 3AK1A 3KGZA 4LFCO 1EP0A 2ZA9A 5A1LA 4K21A 1OKOA 2EILC 2HEWF 1SQGA 1YTFB 1FI2A 3UKVA 1K4DC 1K97A 2EULA 2QQKA 1QJEA 2ZDIC 3W7XA 1R73A 3GXUA 3H1MA 3IT8A 1H8TA 3O9OA 4KBZA 3ZHQA 3AB0A 4QXHA 3I7DA 3I59A 3ABMB 1C8M1 2JB4A 5C71A 2W5FA 4RGKA 3VD4A 2BVVA 5H9PA 4FOQA 5LGTA 1D0HA 1ZUQA 2QWQB 3RYFA 1LHWA 3E86A 1POV0 4UW6A 4MGSA 2QTOA 2F17A 3GJAA 4NXMB 2IJJA 4E27A 4DYLA 1Z0HA 1H1AA 4BQ1A 2V4AA 2DURA 1OCRB 3T1HB 1MPXA 4EFBA 2KM2A 1Y76A 2VOTA 4ICGA 1Q86W 2P17A 5DZGA 3B9IA 1FNYA 2HYKA 3UT0A 3VDCA 1QOTA 4EROA 4KWLA 3JD2A 4N7IA 1YFWA 5JSPA 3UGGA 1SZTA 4CP0A 4L87A 3SPGA 5LYJA 4FO9A 4YZ1A 4IV3C 4PT6A 5DAXA 1D2DA 3LEIA 1COV1 4D69A 1GICA 4LFCB 1CAXA 2KG7B 5J96B 2GDFA 1MS1A 1SESA 1O3RA 4COZA 4DXWA 2J1AA 2D6LX 4Q0QA 4EN9B 1IKPA 5FP3A 2EIMB 2BFUL 4HT1T 2XVKA 1U0AA 3JUUA 1W6OA 2ZOEB 2TUNA 1G6UA 2Y6FA 1ND3A 3CL1A 4Y1XA 5D8AC 3H8XA 2CGNA 5EJ3A 5GONB 1VF6A 2QTWB 1UPGA 1U5YA 2WN3A 1I5YA 1Q8QA 3O1MA 1W99A 2ZACA 3NNGA 5SV5A 3ZHVA 4EN0A 2R043 1MEC1 1F2NA 3HKEB 4OGQB 3ZXAC 1AP5A 3KM5A 1RFYA 2R9IA 2PQQA 2VTXA 4KI5M 1JUIA 1SLIA 5JXIA 2DCKA 3AKPA 4YARA 1C57A 2YS8A 5LY2A 2A6ZA 3JD73 3N35A 4QDRA 4P9XA 2ZHLA 3WF4A 5T54A 1H38A 1VP6A 1RUNA 3ZRWB 1GH6A 1MQTC 4P9LA 2CE4A 4JAVA 1PM9A 3APBA 2IFRA 3K46A 5J98B 4BQ4A 5C4WB 1L7QA 2A6XA 3ZFEC 1PGL1 3CJIB 2PFWA 3THOA 3ECQA 2PMWB 2VQAA 4YLZA 1F51A 1FV3A 1HWYA 4WBBA 1SFNA 3WDUA 2DVAA 3ZX6A 2HWD2 4TN7A 5GZDA 4PDMA 1XNCA 5GTHZ 3SCFA 1AJOA 3T2OA 2JG8A 2QWOB 4JDOA 5KHIA 4CP2A 5FXXA 1Z78A 4PQQA 3HB3B 3FWEA 3STLC 2LM3A 2ZR3A 5JZGA 3WG4A 1D0GA 1DGSA 2AUYA 3I2KA 4YSFA 3GBWA 4CEYA 3GWOA 1ZM1A 1CR7A 3DV8A 3DXRA 1ZBA1 1VBD1 4P9IA 2ZABA 4I09A 2VMFA 3AP5A 5FQ0B 1DQ6A 4XIOA 2XVLA 3K79A 2EZPA 5KXDA 1NKDA 2H0VA 3SMHA 1QJU1 4KWKA 4YG0A 3ES1A 5IATA 5B5EZ 5IVEA 2V1DA 5FP7A 1NXMA 2VCAA 1EPWA 3U78A 3CMAV 1QVFU 1BVVA 2R9AA 3JAMN 4NWWA 4INDA 1SC5B 1QJFA 5DAQA 2EINB 1IOAA 3THDA 1J95A 3OY8B 1HR0O 4ZHQA 3ALQA 2WT1A 4BXFA 4X6RB 4I02A 4QPIB 1XE0A 2WAAA 2BVBA 3ACIA 4YW4A 3JSLA 5CG9A 4FSJA 2YIBD 2O8OA 4DO2A 1FXHA 2R1BA 1AYN1 2Q7HA 2RMU3 4MGZE 1ZAUA 2YC2A 4LIVA 2DYRC 1R6KA 2VQEO 3VBSA 2JDUA 2DCJA 4UVBA 4EKWA 5T3NA 1B09A 2QQLA 2C1FA 3NJZA 3RVYA 1G9FA 1KP3A 2Y38A 3RZKA 1HJGA 1XNKA 2GNTA 2JG9B 3ZR5A 2YIDA 3IDBB 2PTMA 2ZX2A 4ZXEA 4MTGA 2VZTA 5KC5A 4MSWC 2QSAA 4TV9B 3CCSV 3ZN6A 2WAMA 1EN5A 1AYM2 3ON7A 4P00B 2ARBA 4RYDA 4QXBA 3WW3A 5E88A 4TLFA 4JI2O 1LHVA 4DQAA 2A79B 3GM8A 2ZJCA 1TNFA 5FPRA 2QE7G 5C9AB 2UURA 2RS32 3GALA 4XF9A 3AP7A 3R65A 1Z2GA 3AZZA 5FKBA 2Q8DA 3AJZA 4IUGA 4LORA 5A3OA 1D5NA 1SFPA 2ZMKA 2P22C 2QJ1A 5FYVA 1HR0B 1LRHA 2ZX4A 4OHWA 3WU2Z 4I0BA 4LBQA 3PJSK 3CQOA 2N74A 3BEHA 2VECA 2ZS6B 1JYXA 1HB4A 1GZCA 4JF3A 3RYCB 4B1LA 1AR82 2VE1A 4QAWA 4LPLA 3U4XA 5FAXA 3V56A 2VQEB 5K1XA 2CGPA 3EJKA 3QH7A 3ABTA 2RVAA 2VOXA 1S0CA 5GZGA 2YIBA 1QXJA 3BABA 3LPGA 2Q68A 2RMKB 4AR2A 3I54A 5IVJA 2VU9A 3VQWA 4E4EA 1W8FA 3MBWA 1VF5B 1HRI2 1N8RW 2ENRA 2DJVA 2X6CA 4TWKA 2Z0AA 4C7UA 4QU1A 1KDMA 4KP4A 2YY1A 2E32A 3C90A 3S0MA 4D6RA 4BB3A 4JI2B 1XHXA 2JE9A 4P9OA 2R16A 1RMU2 5IHRA 3AG4B 3K06A 1UYYA 5B4NA 5JCOA 2ETNA 5FNVA 4FAHA 3FHAA 2A3QA 3SJBC 2ZXQA 1BKZA 1K42A 5IY5B 4QGLA 2JK5C 2RR12 1JYIA 1CONA 3ATGA 3QG5A 1JZ5A 3N9MA 4B3SO 1A32A 4JV5O 4YNIA 3ABZA 2ZMLA 4NRMA 3WY6A 2WIIB 3JBG2 1ONAA 3CBNA 4EB6B 4Q29A 2YGLA 1W9WA 4QIWF 4GMP0 5GJ6A 4AQYO 2RE9A 1WP7A 1L3JA 2VZSA 2B5UA 1PZ7A 1ZBE2 4MVTA 4PDVA 1LNQA 1OLMA 2AH2A 3KHBA 3Q8AA 1TME1 5IDJA 2P37A 1JA8A 1LU2A 1PO12 4I0WB 1UY4A 3B3QE 4HXCA 3PU3A 3VBHA 2UY9A 5FY0A 1ZTEA 3DF0A 3POGA 2FCTA 2LROA 3DECA 1YI2V 4V2VA 2XJUA 1RUH1 1WNSA 3RBZA 4COVA 2JGDA 1W28A 1FPOA 4M3CA 4CC5A 2WZR2 1MA1A 4QPKA 5HCFA 1SA0A 1AYM1 5E1RA 2CTQA 3KVBA 2C5DA 3UKMA 4BMBA 1YNAA 1TVKB 1RUG2 4YIOA 4BHPA 4GJZA 3H42B 5E89A 1QDOA 4RAIA 4AHYA 2VMIA 5L3BA 4C1XA 2P3KA 5DG2A 1KXGA 3MIHA 4UBHA 2VUJA 1STMA 2DQ0A 1F7YA 3DKWA 2RS31 3THPA 5CKNA 4B3SB 1YXBA 1H2NA 4JV5B 2D93A 2J1EA 4R4ZA 5JIAA 2FMDA 1CD3G 2LALA 4DUZO 5H9SA 1AF9A 3PIGA 1W8ZA 4I2OA 1IG0A 2DFCA 2PLV3 1QCEA 1VBE3 2VD7A 4Q1PA 3IM0A 5FZAA 1SQVH 3VQXA 4R9BA 5FJKA 3WQ1A 3QO5A 1H8TC 1QR9A 1AR81 4I55B 3B2EE 4ZOLB 2XJTA 4JVAA 4FFKA 1PO23 2BP6A 1ZL8B 5C8CB 5C3RA 2VQFB 3VGIA 2AC1A 4LBMA 5FDBA 5C93A 1DQ1A 4P02B 4NRQA 2MHFA 5FZOA 1BHAA 1S1AA 3SDLA 4Q4X2 1SDDB 4G27B 3JB4C 1SF9A 3WW1A 3Q4HA 2E26A 3I2HA 2OCHA 1KU9A 2UUAO 3NMBA 2Q1MA 1D2SA 3JAKB 3JASA 2IXIA 2L35A 3WV6A 2YC0A 3VHNA 3BOPA 3OD0A 1ORQC 4PDWC 4XAEA 3GHMA 2RR11 4FZ1A 3G67A 4XAAA 3H8OA 2XLFA 1BL8A 1OQ1A 2WNVA 3GB7C 2JDYA 2E33A 5DDJ3 1O5UA 2JVDA 1R3LC 4DUZB 5I8YA 3JBG1 2VMDA 3R4DB 4LWSB 3WHUA 2EALA 1ASJ1 3B09A 4GD4A 5FYTA 1JJOA 1ZBE1 2W1QA 4CCDA 1ND3C 4KG0A 2QM7A 1Q8SA 1OC1A 1PNKA 2RCVA 2LUWA 1A78A 4XDQA 1VF6C 4JASA 1DG6A 2OZ6A 5A3LA 3ZSKA 3CLPA 5A3TA 3L71H 2HBTA 4C1WA 2JIGA 2JEXA 2DBNA 5H9QA 4K20A 3CCQV 3PMSA 4QPGA 2JRIA 3M1HA 3CRAA 4PDRA 5L7OA 4M00A 1XOUA 4I4TB 2UUAB 2QNKA 4UFZA 3NQHA 4Q20A 4UFHA 2GMPA 3GJBA 1CPYA 3AG2B 1IPSA 4J9ZB 1G8MA 4Y22B 4OPAA 2ZGUA 2ZGNA 1WCSA 1VIWB 3CRCA 2GH8A 1TMF2 1V00A 4B7EA 4QNHB 2GNDA 3PTRB 2VXRA 2RM22 1BK1A 3ZPOA 1D4M3 1PGW2 2UY8A 1R6TA 4O2AA 4Q6GA 3HKDB 1DQ4A 3MW3A 4A4AA 2VZ1A 3M2MA 1FOD2 1OQEA 1DBNA 3LFIA 5J1XA 5JOYA 1MOFA 2EVXA 4XMAA 2YI9A 2EICA 4NAMA 4B4PA 1GZWB 1YTFD 3N9PA 1RUE1 3W7UA 3CF6E 4YZ2A 2DVGA 4MLOA 3AZVA 1SZXA 3RZGA 4LKSA 2Q1FA 2XOKG 4GWIA 2FDHA 1I0HA 1OD5A 4P9GA 2JG8C 1MS3A 3AJYA 2BCCH 5JZGC 2PYJA 2WNOA 3JYCA 3KQ4B 4XJWA 3LEMA 4GZRB 2ZGOA 2AENA 1IG3A 1ENXA 4CEYC 4CEWB 3LKJA 1RUI1 5LA1A 5EBLC 4YG6A 4MHUA 2QTSA 4I30A 2ZGTA 2XHBA 2WR9A 3FJSA 4AFMA 4FIPC 2EXKA 5DM6V 3RZJA 3OYWA 1QWRA 2BTVC 2Y60A 3NAPB 5BNOA 3JATA 3RMXA 4X1IA 4PI2A 3E5QA 4AHXA 2EIKB 1OVPA 3LA3A 3NKTA 4Q0PA 3VDBA 1RJ7A 3O0XA 4ASLA 1OSGA 1RVF3 4IESA 5E79Z 3QNEA 1V6KA 3ZN5A 1FFTB 1W6QB 2VOVA 4JYBA 2EBOA 4R9CA 4N43B 2EILB 3B02A 2ZPXA 4Q27A 4HZ3A 1Y4MA 1SACA 3H7YA 3M3CA 1ZLZA 4AEDA 4NHKA 1HRV3 1OCOC 1JFFB 3CB2A 2XLGA 2R072 5FYMA 3ZM8A 4EWEA 1PVC3 4FFFA 1RUJ2 4ZZ5A 2A73B 4GX5A 1WBLA 5G04L 2GTSA 1QIQA 2D6NA 3VBSC 4Z2WA 5A6QA 3IAPA 3GCWA 4CCCA 5A6YA 2QWRB 4C0HA 3VDAA 1LOFA 1JX9A 4GYCB 5JOZA 3BTYA 4JQRA 4Z1MG 5LHHA 4BU2A 4AFDA 5FZ0A 4WFFA 3JXSA 1QH6A 3I97A 1PZ9A 1REFA 4Q2FA 4ZBMA 4ZKIA 3KQRA 1W2UA 1TNRA 3AYCA 5KBFA 5LW9A 5M0TA 5AC91 2B4KA 5L3GA 4XCAA 2YPDA 1FNZA 3SH3A 1L0NH 2RG4A 4QKFA 5LA9A 3I2JA 2EX3A 5I0SA 1T6GC 2QWPB 1Q90D 3LDCA 2WJSA 4Q26A 2WS92 5FFOC 3ZKUA 2QWNB 1TMF1 4ET7A 5ABJC 5FXWA 4O61A 2RM21 2AEYA 4LA2A 1UYZA 2IXKA 4IDZA 2VGDA 2PXJA 2QGNA 3AVRA 2DYCA 3H8UA 5DMYA 4N21A 3NXSA 3VBRC 2Y4UA 3ZN1A 4ZHNA 4AVCA 3CC2V 3K5MA 5A80A 4CU9A 4OMCA 1QLEB 4AEMA 4PBOA 3H9VA 4HSJA 2LGWA 4HMZA 5D8AB 4COUA 4RGAA 1J83A 4GX0A 5BYNA 1LULA 3UGFA 2AW9A 2CU5A 1PD3A 2W1SA 4YWAA 4BQXA 3JD3A 1EUUA 2ZE8A 1ND2C 2HEPA 1WPBA 1ZX5A 3S7EA 2R9RB 4H33A 4HKOA 2DVFA 1CQ9A 3SKJE 1RM1C 2IVIB 1M1KW 4UFLA 3FX7A 3H3UA 3Q9OA 4X64O 1Y66A 1TGOA 2JJ6A 1I7FA 3AMHA 3AMQA 3HJRA 2YB7A 1MQTB 4XPVA 5JCOC 5BNPA 1SKVA 2MEV3 3CJXA 2OVUA 3ZHSA 4UW5A 4G3YC 3ZFEB 1XI1A 3AMMA 4LA3A 4JC1A 1UAIA 1LTEA 1MEC3 3T1YO 3SQOA 5L3DA 4PJYA 4RUEA 1RINA 4G2KA 1K45A 4UF0A 5FUNA 4QQHA 5IYZA 5IWFA 2Q8CA 1UQXA 2E74B 1RUF2 1ULPA 5JXHA 4YZ5A 4Y5Z0 2GNMA 5CB7A 3VDDB 3IMNA 3K3OA 3MICA 5FXZA 1AZDA 1V54C 2NM1A 1DIWA 4GMP1 3IDCB 1KGYA 5L3FA 2R071 5APAA 3VBHC 1LR1A 3J7LA 5C5TA 5C8YA 1XQNA 1CAWB 1FV2A 3H0OA 5I0DA 1WW4A 3RZMA 3SEPA 1IQAA 4FP3A 2XPJA 1QU0A 5EWSA 3RVHA 3PMEA 2BBVA 5CIRA 2LW7A 1K73W 3AYAA 2WQ4A 3VKMA 2FHRA 2GTAA 2FDIA 4X64B 3GBGA 1K12A 2JKXA 5ACA2 3VBFB 3FAVA 5FQ0A 3UO2A 3ZFGB 1ULOA 4HKWA 1MNGA 2PAKA 5LMNO 5CA3A 4FLUA 2ZT9B 2P2KA 2C0ZA 4K40A 4FPOB 2UXDO 2WS91 5HCBA 5KA6A 5LA6A 1SDWA 5KHKA 1AVMA 5A33B 1BLZA 3MZHA 1NTZH 3T1YB 4RQPB 3RJ2X 2EIEA 1NR1A 2QKSA 1AL0G 3H7JA 2DU0A 1ZRCA 2DYRB 4YGDA 2ZBJA 4W8JA 4FM1A 2ETEA 3MW4A 1YF2A 3ASNC 4QPIA 4QPYA 5EJZB 1IDSA 3D0SA 3AMNA 1G86A 1OCZB 4QWNA 2LFSA 5AFBA 1V6MA 1SFYA 1E1QG 2D7FA 4BLJA 4F6EA 3K57A 4IYIA 2VMGA 3LD8A 4GWNA 5JLVA 3ENRA 1O4TA 3UKTA 4K35A 1R082 3UESA 3MI8A 3OUJA 3ZVXA 4Q5OA 4J7ZA 3IZOA 2VNVA 3KT1A 4FT8A 1UMHA 4C0BA 3AXDA 1IS3A 4I7ZB 5FTTC 1NVPB 2VZPA 3LDKA 2QQUA 4TV9A 2YYOA 1WN7A 2VRZA 2AEZA 1A8DA 4BIOA 3KS7A 1M57C 3MFCA 3QLQA 4NIHA 5LMNB 4AFCA 1BEV2 1XNRO 1UNBA 3DEMA 2UXDB 3S3XA 3HNBM 3E2EA 3PUQA 3CRQA 1FPN1 4RN5A 4TV8B 3K5LA 4CCKA 4QB6A 1PIV2 1QU7A 3ETEA 2R061 3KWVA 2WNVC 2UXBO 4ZI7A 4IE5A 1EUTA 4K8XA 1XE7A 2WFF2 4IETA 2XAQA 3HN3A 1J3QA 3SPCA 4XFCA 1QH7A 2Q0OC 3JCIA 1RUF1 4JCKA 4LH7A 4DV2O 2X6BA 3QD6A 5I0UA 1QXPA 3BHPA 3RG0A 5IT6A 4UFMA 2VCBA 1K3EA 1KDKA 1VBB2 1NA1A 2JJ1G 1S77D 2ZQMA 3RVZA 2ZCWA 1HB3A 3WP3A 4AXOA 3E5XA 1H8HG 3X2QC 1UZ0A 1N33O 1YHQV 1TA8A 4AZZA 1B3QA 3J9SA 4JPRA 1V0AA 1M90W 4IEYA 4ATEA 3FUQA 5L7OC 2B46X 5GTIZ 1H2SB 5H6RA 4P9JA 1RSOB 4XJZA 3NJYA 1U12A 1SQBH 3SKVA 2VZRA 3WXPA 1NT2B 1WLDA 1R3IC 3ZX7A 4DR4O 2Z3YA 2OX0A 4CXWA 3HPLC 1D7PM 2R1DA 4Q4Y2 2HWD3 5BY5A 5K9YA 4D0QA 5EC1C 2UWCA 5LK5A 5ACA1 3ETGA 4URAA 1XNRB 1Z5WA 3GZAA 2PELA 4YZ4A 1V6NA 4I0XB 4Z1VA 2XT9A 3ASIA 4KXRA 1NQJA 2VMHA 2DFBA 2R72A 1M93A 1PVXA 5F5CA 2O57A 2PHDA 1AROP 2UXBB 1KJLA 1KS4A 4MHRA 4B3MO 1IS5A 2X0LA 4FFBA 4E4DX 4HYOA 4AI1A 1E5IA 3S57A 1JR9A 1JU3A 4IE4A 2J1SA 3R0RA 5BR8O 1FFXB 4DV2B 2ZGRA 1NG0A 3VHPA 4XDJA 1KD7A 1AL21 2W46A 3P32A 3LSEA 3I8TA 2PHXA 2LW1A 4QJFB 5FKCA 1UU4A 1Y4WA 4BK4A 3RS6A 2XAJA 1N33B 4Z8BA 1R081 3GWKC 4S2HA 3B00A 5F39A 3MPPG 4DV6O 1O8PA 1GR3A 4Y1YA 3OBZA 2CNAA 3O5SA 4V2WA 1W05A 4A3ZA 1QHDA 1C3HA 1UX6A 1I9RA 2A75A 2K46A 2WLHA 4DNYA 4DR4B 2XJVA 2NQYA 4ASMB 5FPUA 1AR71 3K4ZA 5CFDA 4ARXA 4M3CF 2GU9A 5BNOC 1B35A 3A7QA 2D5HA 4YZ3A 1TVKA 1BEV1 1PL0A 4F83A 3OGSA 1D2QA 1VRH1 3B94A 1XBLA 3SEEA 3U10A 4PJ0Z 4OHZA 3T0DA 4H2AA 4B3MB 4PV1B 4COWA 4ZPIA 1PIV1 4YM1A 2EJ7A 4NVPA 1AYM3 3VKNA 3I3QA 3E35A 2YMZA 1H8TB 4O4HB 4AEDC 2EF6A 5F5IA 5BR8B 2I74A 3I59B 4ES9A 4IGPA 1ZYBA 1PV0A 3ST7A 1RC6A 4LJHA 3AK3A 3DYOA 1AXKA 2D6MA 3UQ8A 3D4KA 3WSOA 3N9LA 2RNBA 1HW7A 2ET7A 2RS33 1LOFC 1UPIA 2XASA 1VBB1 4FK5C 3WUDA 3VZOA 1OA3A 3ABMC 4I55A 5G05L 3RYFB 1VQNV 1S76D 2BQPA 2DU1A 1BBT2 1RUD2 2I45A 4OPHA 3R66A 4DV6B 1ZL8A 3QO7A 1I5ZA 3R05A 1LESA 1QF3A 2ET1A 1QJY2 5KXBA 5I8TA 1BQPA 1Y76B 2W91A 1WWYA 2DDUA 4X8PA 5JUVA 5F6KA 1AR83 1VQMV 4DW1A 2ZNJA 3RYIA 2F6BA 4Q4Y1 4HN0A 4IL6Z 4CDUA 4MADA 4UCOA 3K03A 4LUMA 3CNAA 4JTAB 5FY8A 1SLBA 3MV11 1C5HA 5KWRA 3UT5A 3VHRA 1DDLA 4QGMA 5HCHA 4CCNA 1HRI3 1Y74A 1CAXB 2QQMA 1B06A 2XJSA 2VPVA 3RT3C 1LOBA 4QMAA 1TEIA 4XFFA 1DQ5A 4FBFA 4YIPA 2W1UA 4UB8Z 3KB5A 4DW0A 1VQPV 1W6OB 4AGRA 5EFUA 4FM2A 1AI7A 1RMU3 1VJ2A 1LR5A 1XEQA 4FTEA 5A7SA 1LU1A 1GP6A 2BNMA 4NHMA 3GCXA 2RR13 1W0NA 2UXXA 3TN91 4NIIA 2BWCA 4DPNA 5GKAC 1G9BA 4GIQA 4Z82A 1HX6A 4TUYA 3I4IA 2NYYA 5FYUA 2VO5A 3ZSMA 3JD1A 3JBG3 2FBEA 1LUWA 1NQTA 4LEJA 5FYHA 1VMJA 5EHDA 2W08A 5GLTA 3DYPA 5JVDA 1BS3A 1ZBE3 3BFRA 2WO1A 3U14A 4I4TA 3I3MA 1REEA 1ENSA 1OF3A 2WWSA 2P7TC 3LNNA 4K8ZA 1PO13 4JQTA 2GMMA 5BNPC 1GP5A 2PY5A 1SPPA 1NCQA 4Y22A 2F1MA 4UW4A 3R6SA 4E4SA 1XNTA 1UU5A 4J10A 4PA7A 1N32O 2W0FC 1ZRFA 2IJIA 3ZYBA 1FXVA 3EVKA 4IHJA 3HKDA 5GLUA 4LBOA 2JB8A 5C4WC 2WNUB 2FB5A 1UZWA 2WZR3 4P9PA 5JXJA 3PUAA 2ZKOA 1GZWA 3N4MA 2ZNIA 1QKQA 2D44A 1RUG3 1LUVA 4PQ9A 1X36A 2JG8B 3HWJA 4CXXA 1PMJX 3BTXA 2XAGA 1I6XA 4B3NA 4FMTA 2R6QA 4CEYB 2HLEA 3WDWA 5DUVA 4X1KA 1PNGA 5FBZA 3DXRB 1O8SA 1FYUA 2VC9A 3SYAA 4Q1RA 2L6LA 4MW8A 1RUD1 5FRAA 2BRTA 2WLIB 1HQLA 1W6PA 1WCKA 3CXHF 3E89A 1MZ6A 4J41A 4CRQA 2AZ5A 1JXNA 3E97A 1QJY1 1VMFA 4Y4RA 5FPBA 3HBKA 1XMOO 2QQWA 3DCQA 5CA1A 3AYEA 4L0PA 1UOGA 1KEXA 4BQYA 4JYYA 2VG9A 2A7AA 3AC0A 3ELNA 5E16A 1IVSA 3DN7A 5J36A 4FJCC 3KVAA 3JU9A 1OPOA 3O7OA 3IFXA 4ZHQB 1CWPA 3Q8EA 1N32B 3OMIB 3ETPA 4D3WA 4F8AA 5B4XA 4J42A 3TCUA 2EXHA 4JI3O 4Q4X3 2EIJB 1YFYA 1OCOB 1XYOA 1J1LA 2ARXA 4R8HA 4U36A 1J5EO 5KR7A 3NV1A 2QM8A 3VBSB 3T2PA 4QPIC 2C26A 3KLSA 4FFGA 3TB0A 2VW0A 3SGIA 3JAWA 4Q8KA 3TEZA 1K7DA 4GX2A 5IK8A 1ENVA 2X6AA 4AI0A 1JFFA 4BJ0A 3U4SA 2QA4V 2AGAA 1BSMA 1GM9A 4AI2A 1Y43B 3NJXA 2IH3C 1LGBA 1GSLA 1GNYA 4OVEA 1S0EA 4UOJA 2QDOA 4HPKA 1W8HA 3ZN6B 3JSNA 1NYWA 1B04A 4BE3A 1VBA2 2TBVA 3ZO0B 2W87A 4XF4A 1VB2A 1ODNA 3EBRA 1N34B 5AVPA 5J9PC 4HONA 1KRIA 4AI3A 1XMOB 5BNNA 1MZEA 4DRRA 4AWDA 3AFGA 1UYXA 3WZ1A 4GKKO 1X8MA 3VKOA 4WZCA 4E8CA 4OULA 1QQP1 4XIKA 3LDDA 1AI6A 3LUTB 1C8NA 1GWMA 1GO3F 1O4ZA 4O4LB 1BXHA 1DGRN 4LBQB 2A71A 2CWMA 3GYDA 4JI3B 1XYPA 4LIUA 4MGIE 3WHTA 3MAQA 4WVMA 1Q7YW 3UCSC 2FZ1A 3WF3A 2CL2A 4U7OA 1J5EB 3F7VC 4NTWA 3TK1A 2KA3A 4DB5A 2Q69A 5A6ZA 4N8MA 1QJX2 3PVNA 4LFBO 2VQTA 4B7KA 5EJ1B 1S72V 4NXNO 1S5HC 4AK3A 1TMF3 2VH9A 3C7GA 3L75H 1UIKA 1NZCA 1FMD2 2RM23 1W8UA 1NA1C 3ZMZA 3I2OA 5H9CA 1RXGA 5ISLA 5FZ3A 2ZR2A 3CS5A 2A06H 4D7YA 3WT3A 5LATA 5LBBA 1HQNA 3WEZA 1FOD3 2RJKA 1RM1B 3D3QA 2PHTA 3LEGA 2RHPA 2ITDC 2HBUA 5JR2A 4PIZA 4BOWA 3K58A 2RJLA 3ZFFB 2RS12 2D2CB 1KB9F 5A1FA 1ULDA 4TYSA 4CUAA 5FZFA 4XOGA 5FNVB 3ZXDA 3OTFA 1S2KA 5KHHA 3AP4A 5FY1A 5LB6A 1Q6IA 2GUZB 2OXBA 3HT1A 4A7YA 3ZRSA 4GKKB 2W2IA 1CVNA 3VQVA 3AG4C 2Y0IA 3RDIA 4E9KA 2VM9A 1Q8OA 1PX3A 4UFJA 4ZS3A 3LOIA 1UIJA 1GTOA 2VULA 1EZVH 5FLJA 4RHV2 3PL0A 1BZKA 3NV4A 2HLDG 1YIPA 1HDJA 2CGOA 3OGCC 2XKPA 1WAZA 4LLFA 4EJRA 1O9HA 4HAMA 2JICA 3B8NA 1LODA 1COWG 3ZYIB 3NNJA 4LFBB 1J1TA 4NXNB 3VDDA 3U37A 2ZEXA 2HWF2 3OR6C 4CUGA 2Q30A 3HT2A 1SLTA 1NCRB 2QZ3A 1FAYA 1YFXA 2IXCA 2CV6A 3K08A 1O3QA 2P5OA 1Y6XA 4M3CB 2WT2A 2ARCA 2YUEA 4E2LA 1SA0B 3RGBA 2F66C 4R6ZA 2B1GA 2W1WA 4B29A 4LR4A 1XPWA 4YY3O 5CEHA 5CBLA 3RRDA 2O14A 2R073 3GNEA 4C8DA 1Y9GA 5CFDC 3M3EA 3PLQA 1RUJ3 1XBFA 1B35C 5JCTA 2VAUA 3VBFA 1W2AX 2EIBA 1X33A 3ZFGA 3O1RA 1REDA 4QE7A 1Q81W 4OX9O 4QHZA 4QQPA 2N04A 3F5WC 3SJQC 3K59A 3WW4A 2ZKLA 2WLMA 3AEIA 4PIYA 4AE2A 4FTSA 5FZLA 1H8VA 1H0BA 3ASNB 1GBGA 5EV7A 2A7WA 1MVQA 3OPWA 4XHXA 4RQPA 4YM2A 5IVBA 1OVSA 2KB1A 1P7GA 3WP4A 3B77A 3RWRD 5A7NA 4U3JA 5HBAA 4AHCA 1ST8A 1RHI1 3E6CC 1F4MA 3AK0A 2KR2A 1JPXA 1H6XA 3POEA 4N53A 3POFA 4FM0A 3VZNA 2VMCA 2WS93 3VD9A 5J2TA 1HQWA 5FZOB 4XDOA 3KT4A 2HWB1 1FMD1 4FVVA 4QXCA 5LXTB 3UKNA 1K5JA 2XBO1 4YW2A 1J3RA 2WDBA 4YVWA 5T5JA 3Q4HB 2QM4A 3ZMVA 1JZ2A 3CRRA 4P9WA 2CYFA 3QVNA 2A0LA 3JARA 1M57B 5FZKA 3FX3A 4RFRB 2DUPA 4YY3B 4FLYA 1MZ5A 3BA8A 1W59A 2BJSA 2ZAHA 3K4DA 4L92A 2D3RA 2HJDA 1GM7A 2WL1A 4CDUC 3I3EA 1KC8W 1QNMA 1THZA 4MSVA 3P1IA 5FO7B 3HOBA 4BYYA 4OX9B 1QXRA 2WNVB 1FAFA 2XUMA 3KCXA 2ZGMA 3T4HB 2XWJB 1LHOA 3NNLA 5K8SA 2CSGA 3WNNA 5FZ9A 4RHV1 3W7WA 4A7ZA 5FZ4A 5K1PA 1GU3A 3FHIB 2XHNA 1YXWA 5C6CA 5GZEA 3THCA 3CU7A 4L8QA 4PHZA 5FZ8A 1JHNA 1W2TA 4LBJA 1L8DA 1OH4A 3AKSA 4A6SA 3K3NA 1G7YA 4ZU5A 1IXBA 2PHLA 1Q3EA 5JJNB 3WCRA 1UZYA 3H1HH 4WFEA 3ML0A 1A34A 2GN3A 2B8MA 4WM7A 1YJWV 1C8M2 2HEVF 4GAZA 4PD4F 1XSRA 3WVJA 1S0JA 4AOCA 3IIAA 4QPGB 3WQBA 4CDWA 5L7OB 2B7YA 4NUBA 4HG6B 4AGVA 2EJRA 4BCUA 5FYZA 3ZR6A 4AVBA 3WNPA 4X65O 1G6NA 3FBMA 4RQFA 3CDZB 1RUF3 3C7EA 1UF2C 4M3CE 1HIXA 4OI0A 4MVMA 1CIWA 1RPOA 5DN2A 5AVAA 5H2FZ 1VRBA 2Y69C 3TWIA 3S5QA 1DF0A 4W6YA 4NHXA 1OZ0A 1CN1A 2B45X 4J80A 4O2AB 4SBVA 4NWVA 1VQ4V 1JJ2U 4OCTA 1NCQC 5GLVA 2V7QG 1NT0A 5IT9N 1S55A 2V5DA 3K51A 2Q8OA 3VZMA 5I91A 1PM4A 1VQKV 2P6JA 3WDXA 2IH1C 1COV2 4HKLA 1O59A 4BWOA 4DR7O 4FPKA 5CADA 4H3WA 2YDEA 2UWAA 4X9QA 1XILA 4MVRA 1O4YA 2DW4A 4NROA 4LF8O 3HD8B 5FO8B 5T5LA 3NL1A 4BW5A 5ACA3 4IGQA 2VVFA 2JX9A 1LNSA 4LOSA 3ITQA 4S2GA 1FFXA 4QDSA 1M56C 4XTMA 4BLIA 5C3PA 1RUC1 4UUJC 2YG0A 4IE0A 1ENRA 3DL3A 4MT8A 4GB31 1JZ8A 3H3LA 4JTCB 3CCUV 5GLWA 4OI4A 2GC2A 2JENA 4X65B 1AXYA 1YIFA 5LZ6A 1QEXA 3OYWB 4MVOA 2YEVB 5BNOB 3JATB 2D3OW 4RR3A 1KQSU 3H9AA 1KBHA 2E63A 1Q8IA 4LHLA 2J1UA 3W5NA 5A3NA 5EIBD 5AFEA 4MS2A 2JDAA 2HFEC 2P90A 4FFHA 2YUAA 1GQGA 4XDPA 4RUFA 1ZREA 1TG7A 3OEAA 1HXS2 4L97A 3NAPC 5A9GA 4XMIA 2W9XA 5KLVH 1R083 3AFKA 2RJZA 1PGL2 2P3IA 1R1A1 4YFZA 5ITZA 2FCUA 4DR7B 1YC61 1W8NA 2HWC1 2P3YA 4AEDB 3N36A 2OW4A 1AJNA 4H7LA 4LF8B 4JX0A 2ZZJA 4N43C 2OTLV 3G6EV 4OQ9A 1WW5A 3A22A 3MW2A 1UYPA 3SCHA 3AP9A 5LL6Y 3N2GA 4O4HA 2JE7A 4JYCA 1BEV3 3M3IA 4L99A 2OUJA 1LOAA 1EZJA 4R7CA 4LO7A 5FZIA 1US2A 1X4TA 2HKOA 3I2IA 2ZEZA 4RS5B 1AILA 1WLEA 4PLOA 5DUWA 1PIV3 4UB6Z 1ZBA2 1VBD2 3H1KH 2D98A 3N7KA 4ISRA 2PHUA 3TAYA 2WFF3 5B3SB 4FPJA 4MUVA 1NOVA 3A0HZ 5DXDA 4ASUG 2IU3A 2Z4FA 1QJU2 1YQ5A 4FPEA 4IYHA 4DUVA 1DGWX 4X66O 3RMYA 3ACHA 5BNNC 4OI2A 3AZYA 3N7MA 3ILNA 4ZONA 1VBB3 2E53A 1M06G 3IWZA 4RQEA 3HMYA 1IBMO 3A8TA 3RFRA 1YHFA 4PLMA 1W9YA 3VKFC 5FZBA 2B9ZA 2DCYA 3JQWA 2HYXA 4GUNA 3J7NA 5J2UB 2VZUA 1AYN2 2H94A 3L74H 2JDHA 1C5IA 4QXKA 3ABLB 4Q4Y3 4DXZA 3OGGA 5JMOA 3OT7A 2NZ9A 1QLEC 1SZBA 5C8WA 3ZDVA 2P4KA 2ODMA 4GQ7A 2DV9A 3M7AA 2K2SA 1SLCA 2Q7GA 3PUIA 2O8QA 3E8HA 1NE4A 2WLNA 4AVTA 3N7LA 3FC0A 5FZGA 2PHRA 1LJ7A 2FDKA 1U5IA 1YJLA 4N7UA 5JI7A 3TJTA 3D0JA 1KKDA 5LBQA 4MVUA 4MZUA 3I55V 5JI9A 2R041 1NE6A 4UFKA 3B40A 2CDYA 2JECA 2DVBA 2Z69A 4DR2O 2QE3A 1VIBA 2HWE1 3V64A 4B08A 1F35A 5BNPB 2A6VA 4X66B 4L11A 1RUOA 4M4PA 4XVHA 4CUCA 1GN4A 2BGOA 1Z7S1 5L9RA 5BUVA 5T5OA 4OZXA 4XETA 5EZYA 2FDGA 1DTOA 4O7XA 2ERFA 1IBMB 4A45A 1HXS1 3SPIA 3S7IA 2VZ3A 1MVEA 4DO0A 2XG3A 4UF0B 1WZXA 5IYZB 4AHWA 3NKGA 3G4SV 5CKMA 1GP4A 2HVKC 5GW7A 1JOPA 1W8OA 5LP6A 4LHSA 2WNUA 2VCCA 1AX2A 4YW5A 1I1EA 1JYTA 2ZGSA 2FTKA 5C8YB 1OXCA 3N7JA 3V0AA 3VDDC 1BK0A 4TTGA 4QX8A 1VQLV 3BCWA 4NJ4A 3J81N 4ZZ8A 3C8XA 3PJQA 3K5NA 2Q5ZA 4MH0E 3X29B 2RDCA 2BYVE 1GQPA 3RYHA 5H5NA 2MW2B 4KQ7A 1N1YA 1DGWA 3ZSLA 1CESA 3IGAC 1XL4A 1VALA 2V5YA 5A7PA 1I94O 3KF5A 3WQ7A 1IBKO 4RFT0 1D4VB 4DR2B 1QMJA 2XJRA 4JZ2A 3FAVB 5DAWA 5IJ9A 5F5AA 2XH6A 1WA6X 2WLIA 4L8JA 5D21A 1AVBA 3VBOB 1VE0A 5HXVA 2PAMA 5LA6B 1GZ9A 3O65A 4NB5A 1KMIZ 4YYOA 3LA7A 5IFTA 3BA9A 2WO2A 3A0NA 2A3YA 3VBFC 4G28B 4ORFA 4GZ9A 2UXCO 5LRSA 3ZFGC 5JQGA 4LBQD 1UKRA 3WG7B 1YFUA 1IXMA 4PELA 2XLAA 1MS8A 3JQXA 1BBT3 1NU1H 1RUD3 1XMQO 2YBSA 4TSVA 2WSUA 1ZZ9A 2IFWA 5L3CA 1AR62 1UO9A 5F3GA 2JEMA 1XRUA 2XQXA 2XWBB 3K0DA 3SYPA 1BMV2 1QJY3 4RQPC 3O1OA 1VAMA 3OUHA 4CCLA 1TME2 3O0VA 4IL7A 2RMU1 2D6OX 5IAVA 4CXYA 4I50A 1WMDA 3ZCCA 4N53C 1DYKA 3MGUA 2GZWA 1CX1A 2DTYA 1OCZC 3ZYFA 1A8MA 1RUH2 4XDLA 3WCSA 5KXCA 3NSTA 4YVWC 2G38A 2Q7EA 4HLTA 1WB8A 3MYXA 4ABMA 1I94B 3OE7G 3ZS8C 2BV4A 1IBKB 3OR7C 4XUNA 2Y34A 2ZGQA 4LR3A 1P7BA 1OMIA 3KZIZ 4M0NA 4LMFA 4QB1A 5K0UB 2P6HA 5IVVA 2W0XA 4LKDA 1QJZA 4NIDA 4YGBA 4BA6A 3VZLA 1UW8A 3OMNB 2NN4A 1IBLO 3USSA 4IEXA 1S5LZ 2UXCB 1MZFA 4ZI7B 1W8TA 4EWDA 4DUWA 5HI0A 5FCCA 4I3PA 2VQ0A 2WYFA 2V72A 1R1ZA 1XMQB 3W7SA 4BK5A 3KF3A 4DV3O 1H9WA 3OUFA 3GZTB 1OCCC 1HB1A 4O4LA 4QDQA 5DABA 1H2LA 4NTYA 1TVGA 1MG1A 5LRRA 2YI8A 3CD6V 3QACA 3SYCA 3PN1A 3RWKX 3BIEA 2F4PA 2DWRA 3QBQA 4Y20A 1IGOA 5FZ6A 1NA1B 1I5XA 3KHCA 3MHSC 4DV4O 2VXJA 2IBZH 1EFRG 4WM7C 4SLIA 3APQA 3KV9A 2F4LA 2X8KA 4BMEA 1XNQO 2UU9O 4LTAA 3WDTA 1VMGA 4IV3A 2IJHA 4BISA 2XMLA 4CDWC 2IC1A 1WUVA 2IW5A 4I01A 1W39A 4NTXA 4QM8A 2XAFA 5F32A 3O1TA 1H1MA 4EE2A 3I49A 4CDXA 1NY71 4OHVA 1OA4A 1SCSA 2OKXA 1O3SA 1LENA 4IW3A 2R70A 3B7MA 2KSDA 5FY5A 2OUHA 1ZWIC 3ZFFA 3N2KA 1CAUA 4DR3O 5KMGA 1UXZA 1IBLB 3D36A 2XL7A 3AM2A 1S0GA 2YFUA 3IBMA 5EC2C 1YSCA 2GUZA 2Y8KA 2GALA 2WQ8A 5FZEA 1FXKB 4FFBB 3TXSA 4EN8B 5HFMA 4FFIA 1IS6A 5CA6A 4DV3B 5IK7A 1S0FA 4AL9A 5DPNA 4DMIA 1F4HA 1AR61 4DV5O 1ASJ2 3V0BB 1PNLA 2P5BA 1W0OA 1ZRIA 1OKQA 3OG2A 2WBKA 3MPBA 1BMV1 1AR5A 1ULGA 1Q43A 4MGTA 1RL3A 2GNBA 1XE8A 4PI0A 3U1XA 3SNMA 4XFHA 4DV4B 2ZGKA 2JJ2G 2G9GA 4XBFA 4BM8A 2ZIOA 3TETA 3ACGA 4TT3G 1P8JA 1XNQB 2UU9B 2BWAA 4COYA 4JZRA 4DINB 4R52A 1TE1B 3W58A 1O7FA 1NCRA 4GKJO 5FK7A 1XC6A 2FL4A 3CIHA 2CTWA 5B1OA 2YXHA 3E83A 5CFDB 2CH7B 1MS9A 1IX9A 5SV8A 1UN1A 1B35B 1JYVA 4RR3C 3CSXA 3OSDA 1J58A 3FLTA 4YW7A 4DR3B 2VWJA 2OYZA 1O9GA 1WCQA 3L2YA 2IXHA 3O14A 4CSWA 4QPWA 1W9FA 3I5DA 3K75B 2SBAA 2LRPA 4LQRA 3J4UH 4XURA 4E4HA 3VZKA 2XJQA 3OBRA 5LHIA 2XVGA 5LEJA 3LIGA 5IYDO 5B1AB 1VBA3 5FLXN 3VD7A 1RUE2 1Q6UA 4DV5B 2XKOA 3OF1A 5I0RA 1QQCA 1HNZO 1F5JA 4AQYB 2PLV1 1VBE1 1JYWA 5IW0A 4JHTA 2Q8EA 2RJ2A 2Q0AA 1SQQH 2ZCEA 1WMXA 2CTRA 1DK1A 3BGAA 4FXGB 3OGJA 4WVVA 4WFBV 2Y26A 1AI4A 5FPAA 2FZ2A 5JOXA 3P30A 3JCZA 3HBZA 3WLUA 2HHHO 2GC0A 4CTEA 4DUYO 1NTKH 1WCDJ 4GKJB 4OUSA 1R092 5LXTA 1RUI2 3HQRA 2OA2A 3L73H 4FPLA 4O2BA 4LNVA 2F4VO 5FJHA 1NH2B 4TZDA 3RYIB 2J1TA 2NLRA 1POV1 4CDUB 2W92A 4AG4A 4A2UA 3QCWA 1QJX3 2JIJA 3WFVA 2WN2A 4KGGA 3B5LB 3RW0A 3MLKA 1RGSA 5CG8A 1JOYA 4B4RA 1QDCA 4AILC 2OPKA 2HVJC 3UT5B 4ASKA 1PKXA 5LA0A 3OFNG 4PA9A 5JJEB 1FMD3 2OQ6A 2WNEA 2QR4A 4UCTA 1Y74B 2XBO3 3BN6A 3BI3A 3E22B 1N3QA 4YW6A 3W9AA 5LMUO 2Z42A 1CPNA 4URTA 2P4VA 5EIBC 2Y48A 1M5IA 3ZRVA 5DDJ1 3JALA 3ZXFA 1XNAA 1LHNA 3J8F2 1Q8VA 2ZEYA 5LY1A 3FB8C 4H14A 4K1ZA 4IT5A 3IB3A 4GT1A 2WAOA 4YJ3A 1HNZB 1SCRA 4YPJA 2RS13 3WINE 4O4JA 1WP8A 4XBQA 3IJ4A 5FO9B 4LO4B 2FKXA 3THTA 1QNYA 4U7NA 3CZJA 2VNOA 5FP8A 3LGRA 1VQ5V 4TUYB 2AACA 4HANA 2BGPA 2X09A 1OD3A 4GWMA 2A70A 4JTDB 4DUYB 3HR0A 1PNFA 4RHV3 2VQUA 3WG1A 3GBFA 4CA9A 5JVDB 3VZJA 1L7RA 3WR0A 5AC92 4JI0O 2F4VB 2Z79A 2A6WA 5JJJB 5E1AC 2Y69B 2PF4E 1GANA 4LBKA 1SPPB 2Z2SB 1NCQB 1WA4A 2Y0PA 1FATA 5F8PA 1E5RA 4MXVA 4LH6A 3N3HA 2Y33A 2IM9A 2HWF3 2ZKNA 4C91A 3T4VA 2FD8A 4EYUA 4MOAA 1DGLA 3WQ0A 4JV4A 4IHJB 5A1AA 5LMUB 5KC6A 1ZRRA 1WMEA 3SHRA 1V6OA 1VBC2 1SQFA 1APNA 1MS0A 1NLQA 2VBPA 3CZUA 4XUOA 2JDMA 3JZVA 1GN2A 3MHHC 5LP6C 1NXD1 2Z5WA 3WDVA 2WNUC 1BQZA 4YVSA 5JPMB 3K9SA 2L9LA 1M56B 3CHXA 2QQIA 1ULCA 3LNMB 5A2QN 3BTAA 4X1KB 1N3PA 5E6HA 4CP1A 2P67A 1DFQA 2ZGLA 3BPZA 4GX1A 1R6NA 4CPBD 3HQUA 5FP4A 4YGCA 1LGCA 1W6PB 4D7TA 4Z92B 3CJHA 3TNPB 3ZKYA 4AQTA 2WWJA 4H44B 4XFIA 2GBOA 4JI0B 1R091 1PPJH 4BQ2A 2OT7A 5CA1B 3AG1B 3WF1A 3P6BA 5F3CA 5EYPA 3LCPA 3NVCA 4MG2A 3FD9A 4O9EA 3DTUB 2WABA 1GWKA 3ZXLA 2YEVA 5BMVB 4DK0A 1DGRA 4HNAA 2A5ZA 3P5BA 1GN6A 3POYA 3URFA 5FIXA 3E1F1 1S0VA 3NV2A 1K5QA 3DSQA 5KAFZ 1AX1A 4WVWA 3IPVA 5B1BC 3CE2A 1PX4A 2E7TA 1RVF1 1V6LA 2JD4A 2J22A 3LWCA 4OI1A 1X7NA 3VUOA 2WRAA 2VBDA 5DAVA 1L1FA 3J8F1 3OTOO 4KG8A 4LK7A 3JAWB 2EIJC 1XJAA 2CUGA 1YQCA 1UOJA 3T2QA 3STZC 4QX7A 3K04A 5DAPA 1DYPA 1DZQA 4HPKB 2IWGB 3E6BA 1GYKA 2VUAA 1IHMA 3BRCA 1GKFA 1UFIA 3VV1A 1JS9A 3RYKA 4RS5A 3J7HA 4BH9A 1K33A 2PYTA 2NLJC 1AUYA 1D5AA 3NW4A 5BNNB 4CPBA 2VUDA 3T09A 2CDPA 4FLXA 3DPRA 4I3GA 5HPOA 3PHMA 1C4RA 3ZHUA 5KHGA 1O91A 3O1SA 3ZHRA 2RDRA 1Q6HA 2ORXA 4QPJA 5LK7B 1C8M3 5I93A 5I0TA 4I0AA 3C7FA 3BU0A 1RPRA 1LOGA 2H6CA 4IEUA 2NNUA 3VBUB 1RIRA 3ZJZA 1GV9A 3Q8FA 2BBAA 2VCMA 4WVMB 2C9AA 2XQRA 1W2BU 2J1RA 5EZWA 5T50A 1V6JA 1VBC1 3OTOB 5KXEA 1YJ9V 3K3WA 3T1CA 2AXTZ 2AREA 2OQ7A 4FPHA 2BEOA 3U0ZA 4V1PA 3SXWA 3B9CA 5IE9A 4A7KA 1QLNA 5J2UA 3ILFA 5JSOA 1WJZA 4Y3OA 5CYYA 4PDWA 4WF9V 4XE9A 3TNQA 1ZA4A 5LASA 4QQ2A 3ZPYA 4KFMA 1F4NA 4BAYA 4JDMA 1A3KA 5IUQA 5C3OA 1S0IA 1WBFA 3MLLA 1RB8G 2SLIA 2A3XA 1COV3 2WLQA 4HN1A 5IJRA 1QBZA 2MNGA 1KKCA 1SBFA 2UU8A 4CDXC 3DGEA 3GF6A 1R64A 4CVUA 4N9IA 4KGQA 3CCRV 1ZX3A 3H1IH 3ZFFC 1A6CA 4A3XA 4FPFA 2MEV1 3C3VA 3D36C 2MPFA 3T08A 3W21A 4XUPA 1NLSA 2WO3A 4CP9A 1FPN2 5A32A 1K4CC 4Y24A 4KHPO 4FI9A 2AZ0A 2R062 4UVAA 4CDQA 1UY1A 3D3IA 3ZXKA 1RYYA 4LF9O 1H4HA 4EN6B 3M8AA 2GSYA 2X05A 4LUKA 2YSUB 3TOJA 2XXZA 1MS4A 3RJRA 2HWE3 1G8WA 1RTVA 2BTQA 5F2WA 1G9CA 3S5AA 5JXGA 2H6BA 1Z7S3 3SYQA 2HG5C 2BSKA 1UPSA 3SR2C 2DBIA 3EYPA 3KT7A 1QOOA 3AYDA 4CCMA 5EBWC 2DN9A 1FXZA 2CK3G 3CC4V 1V55C 5EBMC 2P4EA 1HXS3 1KFXL 1DCSA 1CAVA 3PNAA 1YQ6A 1U97A 5FPLA 1ZNPA 4P30A 1NCRC 4E4ZA 2QDRA 3FE5A 4Z2AA 4OZOA 1UY2A 4DXTA 4X20A 5KHJA 4P2ZA 1UD1A 1V70A 4DEQA 5EPAA 4Y1UA 3PJYA 4K7JA 1XUQA 1DHKB 4W4ZA 1SLLA 3VOUA 5K4LA 3ILRA 2XL9A 3W20A 1EBOA 2VW2A 1YIJV 3S3WA 4ZIBA 3WF2A 5FBJA 1JVMA 1U96A 2JS3A 3VBOA 3AX4A 3WD5A 1I5PA 3E6DA 3LDEA 4KHPB 4XEZA 3TYJA 2YXLA 2VOKA 3LAGA 3MIDA 5JWPA 1WLTA 2WO7A 2PHFA 1F9KA 4OQ8A 4LF9B 5KUMA 3WNMA 1ZBA3 1VBD3 1X82A 1H2MA 1EN6A 1JZ6A 3CMGA 1AR1B 4U3JB 3KD4A 4ZU4A 3KCYA 5KX5B 4B8EA 1AJKA 4LP8A 1QJU3 3LZZA 4N53B 4MXWA 1JMKC 1AL22 3BY6A 1WA8A 5J2TB 1C1LA 4UCVA 4KWUA 4IEQA 3ICXA 3ZMUA 2BERA 4FTBA 3B8MA 3O12A 4YVWB 3T1MA 2BNOA 4NRPA 3K4AA 1PK6B 1U5XA 4QQLA 4FQ4A 4XJ9A 1E79G 3T4DA 1WLCA 3FLPA 3JARB 4DK1A 2E7QA 5F2VO 1DF5A 2VVEA 3BVOA 4BDVB 4LE4A 3BALA 3ZSEA 5CBFA 4XTPA 1AYN3 5EP9A 4Q0SA 5CVRA 1MSWD 1AR72 3H1YA 2BNNA 4CC6A 3FKSG 2WC2A 1K9MW 2WLLA 4GWJA 2IXJA 4JKKA 5K0UA 2A1XA 1H8EG 1VRH2 1DZRA 1HN0A 2D43A 4CZZA 3OBTA 1Y9MA 3W59A 5FLHA 4F6RA 1JODA 1OCCB 2ORZA 2AHYA 1LKNA 1VR3A 4IQPA 1UOBA 1B6QA 2LS6A 5FWEA 4DR1O 4LBEC 1ZA7A 4WM8A 1T6BX 3B69A 1SHWB 1QGLA 1WD4A 3LDRA 1W6MA 4FPPA 4WM7B 4JAAA 2G9ZA 4ZKTB 2OPWA 1M9NA 3CP1A 5ABJA 2CTVA 4UCRA 3LOBA 5IYCO 3AXEA 4CDWB 3GGLA 4M0HA 1G4YB 4IIJA 2VL4A 2I2SA 5JDBA 5DQ0A 4ZU7A 2WZPP 2E5LO 1IPJA 1UX7A 3GHNA 3VBRA 4XJUA 2E76B 4EFEA 3CYOA 4X1YA 2Y6JA 4QPGC 2VS0A 3SITA 2WA4A 1P84F 4O65A
chains in the Genus database with same CATH topology
2JG9C 5GM0A 3OD4A 4Q0PA 3WX5A 4LT5A 1RJ7A 3O0XA 4Q4V3 1W6MB 4ASLA 1OSGA 4XTMA 1RVF3 4IESA 4BLIA 2PLV2 1RUC1 1V6KA 2B39A 3ZN5A 2HWD1 1W6QB 1VBE2 2VOVA 1W0PA 3RI8A 3FBYA 2RS53 5CFCA 4R9CA 4N43B 3B02A 4Q27A 2ZPXA 3IN9A 5T55A 5K7PA 2JXAA 1ENRA 3QOPA 4Y26A 1SACA 3DL3A 4GB31 3H7YA 1IZ3A 5ABJB 1ND2A 4PLNA 5GLWA 4OI4A 3M3CA 4P9YA 4M26A 1ZZBA 4B4QA 4AEDA 2GC2A 4XBLA 4NHKA 1HRV3 2JENA 4F7ZA 1YYNA 4LBNA 1WW7A 1PO22 2XLGA 2R072 1AXYA 2WT0A 1V6IA 1YIFA 4EWEA 1PVC3 2G9FA 1RUJ2 5IK5A 2A73B 1QQP3 1WBLA 3OYWB 4LE3A 5C9AC 2D6NA 3VBSC 4Z2WA 5BNOB 1NLRA 4J1WA 3RI9A 3VBRB 4RR3A 2FQPA 3H9AA 1PZ8A 4C0HA 1LOFA 2E63A 4LHLA 5JOZA 3MIFA 2WQZC 4AQSA 1QY4A 2GAUA 2QDNA 4JQRA 5EYXA 5AFEA 1EV13 4LHKA 1UU6A 4AFDA 5BPXA 2WINB 1GQGA 1QH6A 3V0BA 1ZREA 4U2AA 4YVSC 1GKBA 4XXAA 1HXS2 1PZ9A 4L97A 3NAPC 1REFA 3ZYPA 2DUQA 4Q2FA 4XMIA 5CFCB 1R083 4XXPA 4GALA 3AFKA 5J7MA 1PGL2 4FP2A 1OLRA 1W2UA 3KQRA 2P3IA 1R1A1 4YFZA 3TN92 1TNRA 3AYCA 5KBFA 2CAUA 5AC91 1OPMA 1ND2B 4EWAA 5JPNB 1FNZA 1ZZCA 4J5IA 3SH3A 3FFQA 2HWC1 4AEDB 2NMNA 2A6YA 3N36A 4AW7A 2OW4A 4R9AA 2DTWA 5D8AA 4H7LA 3PVBB 4Y0EA 4X8NA 1EYBA 3KZ4C 5I0SA 2ZZJA 1T6GC 3VN4A 4N43C 3ZMNA 2WJSA 4ONUA 4Q26A 3HIFA 1JTZX 2GC1A 1WD3A 1AR63 1WW5A 2WS92 5FFOC 2K9ZA 3MW2A 1HKDA 1TMF1 2G4IA 5ABJC 4RR3B 1QOSA 4XZPA 1KQRA 3SCHA 5DDJ2 3AP9A 2XGXA 2GMEA 2RM21 1YI7A 5L36A 2UWBA 4NOTA 4LA2A 4XF1A 2JE7A 1BEV3 3M3IA 1TME3 4R4XA 4L99A 2IXKA 2VGDA 4AQ2A 2OUJA 1LOAA 5JR7B 4D94A 2R0HA 3D8CA 2DYCA 2BUKA 3H8UA 1EY2A 4LO7A 3WP6A 2X53S 2QVSB 4RS5B 3VBRC 5JMCA 5L19A 4AVCA 1VAVA 4K1YA 4W65A 4PLOA 5DUWA 1BVP1 1PIV3 1VZ4A 4AEMA 4PBOA 1RUH3 2PN5A 1ZBA2 1VBD2 2BW8A 4UBGA 2D98A 2ILMA 4HSJA 3N7KA 4ISRA 2PHUA 3HAGA 4HMZA 3TAYA 5FPXA 2WFF3 3M8LA 1MQTA 1JN2P 4JRLA 1OFNA 4FPJA 5D8AB 3UL2A 1H2KA 3RPQA 4MUVA 4COUA 4LO8A 1I3HA 3MF6A 4RGAA 1NOVA 5GALA 5DXDA 2CAVA 2X29A 1FT9A 5BYNA 1QJU2 4KU7A 1OIJB 1LULA 4FPEA 2VW1A 1JW6A 3ZFEA 4C5WA 3L2HA 1DGWX 4XJ8A 2B42B 4YLMX 2NMOA 1BJQA 3RMYA 2WKKA 1ND2C 2EXIA 4IXLA 5BNNC 4OI2A 3AZYA 3N7MA 4GA9A 4BZ4A 4QU2A 1ZX5A 1VLNA 3ILNA 1VBB3 2E53A 3ZYGA 4FCAA 3S7EA 1M06G 3IWZA 2WFPA 2QKDA 3HMYA 2GH2A 3AP6A 4HKOA 2GN7A 3BOWA 1YHFA 1W6NA 3VBHB 2DVFA 4Q4W3 2YZ4A 4PLMA 1CQ9A 3VKFC 4K3UA 1YO8A 2XHKA 1H4GA 2LTNA 4CYDA 4YG3A 4O9GA 2DCYA 3H3UA 3Q9OA 4JGYB 3ZN4A 3JQWA 2JJ6A 3AMHA 3AMQA 4MGYE 1D4M2 3S30A 3SH4A 4JGZA 1MQTB