4Z2WA

Factor inhibiting hif in complex with fe, and alpha-ketoglutarate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
341
structure length
341
Chain Sequence
b'VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Substrate Promotes Productive Gas Binding in the alpha-Ketoglutarate-Dependent Oxygenase FIH.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 108
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4z2wA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z2wA01
2W0XA 2Y0IA 1MZEA 3P3PA 1H2NA 2YDEA 1IZ3A 3KCXA 4AI8A 1H2MA 4Z1VA 2WA4A 4QU2A 1H2LA 4BIOA 2CGNA 1YCIA 4B7EA 4Z2WA 3P3NA 4B7KA 2CGOA 5JWPA 4JAAA 1H2KA 2WA3A 3D8CA 3KCYA 4NR1A 2YC0A 3OD4A 2ILMA 2XUMA 1MZFA
chains in the Genus database with same CATH superfamily
2W3JA 4WV8A 3WNLA 5IVEA 3BVOA 1WCUA 3UKNA 1RUI3 1XREA 4LBQD 5JJEB 3HEIA 2IJHA 2Y6JA 2YBSA 1OT5A 5GALA 2F95B 4O4IA 2E53A 1OVSA 1GYKA 1JR9A 2CV6A 1LKNA 4RUFA 3WNOA 3FB7C 4U2AA 5DZGA 3PU8A 1HB4A 1PVC1 2VQFB 3IM0A 4JDOA 4EN7B 4YG6A 5T5PA 2ZPXA 4FZ0A 3L2YA 4NIAA 1IX9A 3VHNA 4Q6GA 1X7NA 4NIGA 3AP4A 2JE7A 3BTAA 4BJ0A 3NKGA 2VUCA 2WSSG 2BWCA 2BRTA 5IYDO 2LW7A 3ZMZA 1SQPH 1W0OA 5I8SA 3ST7A 2ZR3A 4NVPA 3VBFB 5FNVA 2P22C 2Z0AA 1RHI2 2XAGA 3L9JT 5FOBB 4LWSB 2PHUA 4Q5OA 2HWC3 3LOBA 1V9PA 1Y66A 4DV4B 4DUZB 3DTUB 4WVWA 1E57A 1X33A 3ABLC 3DC6A 3MPBA 4UT5A 1NT2B 2VW0A 1O4ZA 4CDWB 2VWKA 4IEVA 1REDA 1BVP1 3Q9OA 4K20A 2UWCA 2RG4A 3LA2A 1SF9A 3NL1A 4DUXA 5JPMB 4I55B 4FQZA 1XDCA 4LNUA 3AKRA 3MEPA 2DOSA 1A78A 5A1FA 3AM2A 3IT8A 3EXUA 1LULA 3FFZA 2LGQA 2IFRA 3ZLIA 3KVAA 3ZXDA 3FKSG 2LRPA 1RL3A 5CADA 4XFBA 2N74A 5JOWA 5AVAA 1NZCA 5B5EZ 1ND2C 2W52A 5EP9A 4WFHA 1N47A 4BCUA 2W9XA 4QPGB 1OLME 5L7OB 1H6XA 2OUHA 2W1WA 4MW3A 3CPWU 1LNQA 4BR6A 1K5MC 2Q67A 5JIUA 2DTYA 4Q4Y1 2DUQA 1XOYA 4BQ2A 3M7AA 4CEYA 1VBD1 2EINB 2VO5A 5D8AC 1ZBA1 2JEUA 1JX9A 1G6UA 5K0UC 5JCOA 1AR91 4WM8C 4IDZA 5LP6C 4WZCA 2CTQA 3N27A 2F17A 1XILA 1BBT3 3ZYBA 4RR3A 4Q4V1 2GMMA 3GBWA 2DVBA 1GNHA 4L8QA 2A71A 4ZOLA 1PM9A 3S7IA 4PIXA 3QNEA 2UUCO 3AP7A 2EIJC 4RGKA 5CFCB 3LFIA 4DV6O 5JXJA 5LBBA 3DXUA 4GULA 1WMDA 3M3QA 2V4AA 1XNBA 2ID4A 4UYBA 2WLPA 1D5NA 3WNXA 4MTOA 4AWDA 3H9AA 1VF6C 1I94B 4UB6Z 3AK3A 3MZHA 4A6OA 5KX5B 4ISQA 2FYUH 3HIFA 5KUKA 1JPXA 2WQZC 1B04A 2X7RB 3MPPG 3VBRC 2H0VA 1VMJA 3T30A 1VBB1 5J96B 3U10A 4FPGA 2IXJA 3MIDA 4AEDB 5LBQA 3LNMB 4QJFB 2ZX4A 4CC5A 5TISZ 2EIMC 4YGCA 3JAKA 4DMIA 1XPWA 1TVKA 3NAPB 3ZHRA 4I0XB 3JASA 4TYSA 4Y24A 1PV0A 3WDUA 1COWG 4U7NA 5EC1C 3ETDA 4AQ6A 5KR7A 5I8TA 3DXTA 2Y0IA 4OQ9A 3FX7A 1QJY1 5DXDA 1NR7A 2D6OX 3GJBA 1UYYA 1ZVFA 4A5UB 4BU2A 5LATA 2QGNA 2J7MA 5IWAB 1HV0A 4DV0B 2UXDO 2JDAA 2V72A 3K5LA 1N32O 1OFNA 1C5IA 4X89A 4GAZA 3LDBA 2Y60A 1QQP2 4I3GA 2PLV3 4AHYA 4Q29A 2XTAA 4Q0UA 2QWRB 1NTKH 3FB8C 2C5DA 4ZKIA 4TV9B 3O65A 2HG5C 3PVNA 2XVLA 4FT8A 4IIJB 1KUQA 4JZRA 5EJ3A 1BEV2 3AYAA 2DW4A 4DRVA 3ZFEC 3AZZA 1V00A 3PL0A 1DQ4A 5FPRA 3OB8A 4P9IA 1LUVA 4WCEV 3VBUC 4LIUA 4E8DA 4BIUA 3QLQA 3SCHA 4RS5C 5ERLA 1ZM1A 1PNLA 1RUJ1 3LOIA 4QAWA 4NRPA 3THPA 3SH5A 2K0GA 4JI6O 2P4EA 1OQDA 4PA6A 1BXHA 5FZ6A 2C4XA 2X6CA 5J2TA 3HN3A 5FYCA 2QTSA 3CCLV 1QJU2 4A2UA 4DV3B 3FL7A 1WBLA 4PD4F 4N9HA 3ES4A 4AOCA 3LE0A 2ZGPA 3BCWA 2D6LX 3VL9A 1B06A 1W8FA 4AHXA 1AXKA 3KV9A 3ZX6A 2QEXV 2ZXQA 3ZMSA 2DYSC 2O0OA 2GTAA 2ARHA 4UFJA 1BQ0A 4DUYO 1NBMG 2JG8B 3H3UA 3ASIA 4L87A 3ZR6A 5JJNB 3FFQA 4PV1B 2RDNA 4NB5A 3FAVA 5KMGB 1OKQA 1UXXX 3AFGA 5K9YA 1LJ7A 1RUC2 1OCRB 1SLBA 4NWWA 4TLGA 2JIGA 1CJDA 1Y43B 5F3EA 1YRZA 2EILC 1Y9GA 4BQ1A 2F93B 5DDJ3 4WFEA 3T1LA 1R1BA 4PDWB 2IH3C 1V70A 2YBPA 4A4AA 3NXSA 2XJRA 4GMP0 4K8FA 3BTYA 4XCAA 2CAVA 2DYCA 1GR3A 2VNGA 1OCZC 1HRV3 3IAYA 4H44B 2WFF1 1NA1B 1ZA4A 4YW2A 3L74H 4ZZ5A 4CS3A 2Q69A 5I93A 2FMYA 1NKDA 4FAGA 1AR71 2RS33 2DCTA 2GU9A 2JDKA 1YC61 3VL8A 3H1KH 3RW0A 2ZDIA 3G80A 2V5YA 2BCCH 1C1LA 4O4IB 5CBGA 1FOD2 1EY2A 4YY3B 4CH5A 3USSA 3K2OA 2JRIA 2CNAA 4J1XA 4YSFA 3CCSV 2VE1A 5FYSA 4YJ3A 2FDGA 2QUOA 1BCCH 2VD7A 4M3CE 5EC2C 1QNWA 1IS5A 2J1TA 2ET1A 2OA2A 3N2KA 1BK0A 1IBLB 4OGQB 4QGPA 5C4WB 4RUEA 3ABMB 2HWB3 1CONA 4XUTA 1PZ9A 3AG4C 5JQGA 3O1OA 3OTOB 1KFXL 4JGZC 1BJQA 1VIBA 5LA2A 2Y4UA 3O9OA 5FNVB 3J26N 2ZM6B 4LEJA 1NI8A 3LIGA 2WRAA 5CG9A 4IE0A 1RMU1 3A2FA 1HXS3 3G7DA 2JIJA 1OF3A 2R071 4MO3M 1W6NB 4LF7O 4YLZA 1DK1A 2F6BA 1H4GA 5J1XA 2ZGQA 4RQPB 4LFCO 4FOWA 2IJJA 4LO5B 3N7MA 1OV9A 4JCKA 4O61A 2WS92 4F4LA 1SG3A 4Z92B 1UCXA 2C9KA 4D8MA 5FMOL 1AL22 3K59A 3AKSA 2E63A 3DCQA 4LNUB 3LWCA 1EN5A 1K45A 1NCRC 1H38A 4GB33 4M00A 1FYUA 4HVQA 5J3UA 2D6KA 3I2JA 4UF0B 3EFFK 4AAPA 3W59A 4YZ5A 4W6YA 1UY4A 4MVSA 2IM9A 2YMZA 4OPHA 3MV01 5H9CA 4JTDB 4ZU4A 2D3SA 2I74A 3J9SA 5FUPA 3KWVA 3NJZA 3AG1C 3WD5A 5CN0A 1VQOV 2WBKA 4IE4A 4JI5O 4E4HA 1REEA 4FLVA 2B8MA 1J1TA 1TQ5A 3UYJA 1POV1 1LEMA 5LK5A 4CH6A 3SQOA 1PL4A 3B00A 3F7VC 3UO3A 4XDLA 2QE7G 3POYA 3ZMUA 5CFCC 1IBMB 1JUHA 3CLPA 4UVCA 3OR6C 4KMQA 4XQWA 5LY2A 4PCRA 3WDWA 5KAIZ 1EFRG 3SKJE 3ZIXA 4DW1A 4WVVA 4ZOLB 3F2ZA 4NTXA 4NXNB 4PLMA 4JTOA 5KHJA 3GZAA 2OCHA 3B9IA 1ST8A 4XTMA 5FZ0A 2JG9C 2W87A 4P5HA 2QQLA 2VBPA 2WDBA 2WLIA 1MEC2 3M7MX 4CBCA 2GP3A 4MVUA 3PJQA 1BMV2 5F2SA 4TOIA 4LFAB 1C28A 4NRMA 1EV11 5J9PC 1OUXA 4B3SO 3R4SA 4I9WA 1IZ3A 3I4IA 4QKBA 2BVVA 5F7UA 3Q4HA 1JOJA 3CXHF 4I5SA 3JAKB 4OVEA 2OVUA 5A3TA 5C6CA 1Y76A 2JGDA 3JASB 1JZ3A 1IPJA 2NN8A 1UY3A 3O1VA 2QWNB 1X9PA 4NYKA 1AYN1 1BHBA 2ADDA 5FZDA 3FBMA 5K8SA 2ZHMA 4ZS3A 4E2LA 3AYEA 2VGDA 3ETQA 4CZSA 3FLRA 1ORQC 4HBNA 4NAOA 1J5EO 3MYXA 1GN4A 4O2AA 3JU9A 1KFUL 2FCVA 2OX0A 1ZRIA 3TOJA 1REFA 2J1VA 3JD0A 4P00B 1URFA 1GSLA 4XZUG 4GKKO 2OTJV 2IVJA 2R042 5C5UA 3WY6A 3OF1A 1HWYA 1SACA 3MIFA 2JIZG 2MEV3 4FTEA 2ATKC 3CRCA 3THDA 4AL9A 5DZEA 4CDUA 1S0EA 3VGIA 2NYYA 3ACIA 1LU2A 1D2SA 2GZWA 4FVMA 5FLXN 1YTFB 4QIWF 1XNKA 4OUMA 3ABTA 4EWEA 3HBZA 3A23A 1VBC3 4CZZA 3BOWA 5HCFA 2VWJA 3IPVA 1KU9A 4H0LB 2PHFA 3RT3C 4YM3A 2CSGA 4LA3A 1ZRFA 1RM1B 3K3WA 2FDKA 5BXXA 4CCJA 3M2MA 1HQWA 5J2TB 4R4ZA 1CIYA 3P30A 3EQEA 2Q8DA 2AW9A 2I45A 3KHCA 4G3YC 1WUVA 2OQ7A 5A6YA 4JZ2A 1JZ4A 3JAMN 1DLCA 4UCVA 4LHLA 1HN0A 5D5QA 4IEPA 4MTFA 1YJWV 2XJTA 5JSPA 4LR4A 4Y1UA 1TGOA 4EN6B 5LBEA 2A5ZA 2R30A 4FTBA 2UU9O 4D7SA 1AR83 1VALA 4AVSA 2QKAA 4X9QA 4URAA 4GJYA 2XPJA 2QDNA 1XNRO 3FAVB 3KV5A 3ZHSA 1AL0G 2WA3A 1NJIW 3CYOA 4K1ZA 2CH7A 4W4ZA 2HEYF 4B1LA 1Q56A 1QNYA 3NNFA 1CGPA 2MK3A 1R6NA 3E6CC 1UMZA 2PLV1 5FPOA 3ZRVA 4NXMO 2IBZH 5FZOB 3OYWA 1G9BA 5FZCA 2GNTA 4QXHA 1MG1A 4AZZA 5I0SA 5FWJA 2YROA 2WNUA 4MT8A 1L0NH 2HFEC 3EVKA 3E5UA 2F4VO 3SYOA 4PHZA 1DZQA 1AR5A 1JU4A 3MF9A 5LW9A 3WW3A 2XUMA 4JI1B 4Y1ZA 4EQVA 3NQHA 5A3UA 1HNZB 4PIYA 3OPTA 4CCKA 5JXHA 4U3JA 3SEPA 3SJCC 4UFIA 5BPXA 4EYUA 3RYHA 3VV1A 4AGVA 2HWC2 2LQTA 1O3SA 3DYOA 1M57B 4UW3A 1F31A 1XNQB 3AZVA 2NZ9A 1HDJA 4DZGA 4OZOA 3RJ2X 5JMCA 3OMNB 1ENQA 3O1SA 2WZR3 5EYXA 4YHHB 4IERA 4RL7A 1AI4A 3GDBA 4META 4GD4A 1WP8A 4WZFA 3OEEG 1ZRDA 4MS2A 1VRH1 4HN1A 3OUHA 2VG9A 1PO13 1AJKA 3VDDA 1I5PA 5JH7A 1ND3B 1QEXA 3DECA 4RHV2 1RIRA 4CU8A 1QXJA 3MV11 3VZLA 3PVBB 2L35A 4CEWB 1JMKC 5FP9A 1YI7A 2GMPA 4XAEA 3R0RA 3UKVA 1ZSPA 1RVF3 1PO22 2RNBA 5FZEA 5FZHA 2VH9A 4FPCA 1YI9A 2Q7EA 1LTEA 5EBWC 4I9QA 1PGL1 3OMAB 3IGAC 2F43G 1DGLA 4RN5A 4D7TA 1S5LZ 5L3FA 3WF3A 2D5HA 3PHMA 1BSMA 5JDBA 4INDA 3HR0A 1QQP1 3T1YO 5FXVA 4YZ1A 4QQPA 4UVBA 3B09A 5JVVA 1YDXA 5K1PA 3IFXA 3OBTA 4CDXA 2O57A 1B09A 1BBT2 4AHWA 3WP4A 4CH3A 5HCAA 2AYHA 3SJBC 1M56B 4BH9A 4CEYC 4FLUA 4NIDA 3VOUA 1T6GC 1IKQA 4IEQA 5FBZA 2EAKA 1BEV1 3NJYA 5JCOC 1SQQH 4NIIA 1WCQA 2WFPA 2CU5A 1AROP 4RR3C 4OHVA 4Q0PA 4J9YB 4MVQA 5FOJB 1PK6A 2WZ8A 4GWJA 1Q8QA 1CXZB 1N3OA 2A1XA 2XBO3 2D6PA 1HB3A 1TAEA 5IVCA 4I7ZB 4FPLA 4WVZA 4LPLA 1W2OA 2NMOA 3M8AA 4PT6A 4GXLA 2QQWA 3JD2A 3WT3A 3RVHA 2W91A 2IXKA 4N23A 5FKBA 4AGGA 5DG1A 2HWB1 2HVJC 2JD9A 4CCEA 4DO2A 3P6BA 1JI6A 1OURA 4M01A 3NNLA 5A7PA 4DRXA 5CBHA 1Z0HA 4IV3B 5H6QA 3BPSA 5FK7A 1CJPA 3VKFC 3AKPA 2UUCB 3AX4A 4O7XA 2GSYA 1TA8A 1HXS1 2P2KA 4FM1A 1H1IA 4H13B 3CS5A 1SHWB 2PI4A 3ZMVA 2WWJA 4DQAA 2WO7A 3JQWA 5D2AA 2Y6FA 3JD73 5IT6A 3UCSC 1SLIA 5JLVA 3IMMA 4UWDA 4XFCA 1Y76B 2JGDB 1KBHA 1UZYA 1V54C 1U0AA 2A6VA 1RUOA 4GB31 3POEA 5HXMA 2YU1A 1XE0A 3ZHTA 3RGBA 4JZGA 4QPIA 4DEVA 4EE2A 4XIOA 2R1BA 1XI1A 1DGRA 2YXYA 1N3QA 3JCUZ 5IWFA 3LSUA 1U97A 2P06A 1ZBE2 1IBKB 4O2AB 1QJZA 5B3SB 2WLMA 3ZYIB 2LJ2A 2DQ0A 1W6MA 3SEEA 5F5QA 3T0BA 2HWE2 4BMBA 4JI4O 3WSOA 1FOD1 3OGCC 5F3CA 1DQ0A 5IATA 1NUKA 5EYPB 1FNYA 4JRLA 1K92A 1Q43A 2QJVA 1KECA 2ETEA 4DR3O 2YIBA 2L6LA 1MVEA 4BE3A 1O3TA 1XMOO 3ES1A 2B5HA 5JJJB 1V6IA 4R9AA 1V9U3 2A73B 4RQFA 3WG1A 4C0BA 3IPVB 3AMMA 3ACHA 4E8CA 1GP4A 4JI2O 3ACGA 2VQEO 4B1MA 4OHXA 3S3XA 2ZAAA 2YXLA 4AVVA 3POJA 5JZGC 4QX1A 2OYQA 5DZFA 3TEWA 2ZX1A 2VBBA 5F1RA 5DDJ2 4N43C 1FMD2 2WS91 3RFRA 4DR7B 3E83A 2IJIA 4K7JA 4LHSA 1HRV2 4DYLA 1AL21 4BK4A 4PA7A 3CCEV 4B3TB 5JUVA 1X8MA 3HWJA 2ET7A 1YIFA 5F5AA 4ET7A 2ZE5A 2LFSA 2A70A 4F8AA 2ZE8A 3O1UA 2ADEA 2XLFA 2G38A 3LDRA 2RS32 2FDHA 4DXWA 5KXDA 2UXCO 1VBE3 2OPKA 4G28B 2B39A 3S0MA 4LF4O 2CH7B 2QQOA 2ZGSA 2A3QA 5CU1A 5JVDA 4B3MO 3DSQA 4FQ4A 3STLC 2ZGKA 2LROA 4GH4C 1YNAA 3ZXJA 4Q4W3 4PDRA 3LD8A 1POV0 1W6QB 4NJ4A 2PQQA 3KT7A 3OYWB 4JI8B 4PA4A 3UV9A 2QTWB 1JFFB 2WNUB 4XJWA 2GMEA 5AFEA 2E7TA 1IKPA 2GH8A 5GKAC 3N9QA 3GALA 3X2QB 3MLJA 3TN91 4N53C 2WLHA 3BPZA 2BBAA 5FBJA 5FREA 3NWKA 1RGSA 1JOBA 1JODA 1APNA 1Q8VA 2OW4A 5GM0A 4COYA 3RYHB 3IWZA 3M70A 2UYAA 3ZRSA 1QH6A 4LH6A 1MZ5A 4JV4A 3SYCA 1LR1A 4M4RA 4C90A 4I4TA 2CTWA 1K5SA 5FPUA 1FXHA 1E1QG 5L3DA 4IQPA 2OIEA 2WSVA 4LOSA 4FZ1A 4IL7A 1W2AX 2B9UA 3FLPA 3PJSK 2XQRA 4G9SB 1FPN3 2P4KA 1QCEA 3TJTA 3KHBA 1W04A 4UVAA 5C3RA 1B35A 3HNYM 2VMEA 3TEXA 2JDHA 3VDCA 5JH7B 1XMQB 2XJVA 2UUAB 2QQUA 3W7TA 4FTSA 4FMTA 2JENA 3ZO0B 1LHOA 3J80N 4DR5B 2P5BA 2QCSB 2PA7A 2XXZA 2RM22 4W4KA 3W5MA 1BQZA 2V4VA 1VQ7V 4ZIBA 5LA6B 1AR61 2ES3A 4IYIA 4OX9O 2P67A 1RXGA 2EVXA 3T4DA 2WA4A 4WM7A 3J7AU 3VHOA 1Q8PA 1WCDJ 1N3PA 1CAUB 3WLUA 1OCCB 3FUOA 3SKVA 2XJSA 3WDXA 4LMFA 4D7YA 4CDXB 4JAVA 3VD3A 5BNPC 1XQNA 4RAIA 4XOGA 2VTFA 3T1HO 4O2BA 4FI9A 2BBVA 1SMVA 1RJ7A 3VBBA 3IDBB 4EROA 5B1AB 3ETGA 4XJAA 5SV8A 5FJHA 2AEZA 2W6JG 4QQ2A 3ZSEA 5DUXA 4FAHA 4D6QA 3BU7A 2BNOA 1EM1A 3WNKA 4LBMA 4PI0A 3O12A 4DR4B 1DF4A 4Y5Z0 3JARB 3A0HZ 4D6TH 3WDTA 5FY4A 2XT9A 4F6RB 1R64A 3POFA 3UGFA 1DZTA 4JDNA 4AQ2A 4XDPA 1IS3A 3H3LA 4OYUA 4OHYA 2A79B 1J3PA 4JTCB 4QDQA 3TETA 5LOVB 5C8WA 1WBFA 1PIV3 4I3PA 5L9BA 1TE1B 1IG3A 3RN4A 2QM8A 1VQKV 3ZYHA 2QQPA 4I30A 1QR9A 3OMIB 2HYKA 1N34O 5L36A 4HZFA 3M4FA 2WL1A 1F2NA 2W1QA 1PNFA 4FK5C 2FD8A 4GWMA 1YIPA 1H8HG 1VQ5V 3TBDA 2WKKA 4ONUA 1NZ6A 5FMDA 3T2MA 1H2NA 2PXJA 1UQXA 5E89A 2VQTA 4FOQA 4I50A 5FUIA 1LCLA 2Q8EA 1VB2A 1RVF1 4UCSA 3AB0A 1RPOA 3ZSMA 1FXVA 5HBAA 4RSUA 1I7FA 2R1DA 4L99A 1M5IA 2VU9A 3E35A 3BEHA 5J7MA 4JI7O 3S5QA 3ICXA 4TWTA 4E2GA 1AP5A 3UT5B 3WCRA 4KGQA 1DCSA 3VBSA 5B3SC 1JZ2A 4Q27A 1S4CA 3BIWE 2E75B 3IDEA 3FUQA 4GMP3 5IYZA 1VB4A 2QDRA 1WLTA 2IVIB 2BQPA 1CQ9A 5A6ZA 4PJYA 3MLLA 2X09A 4Q20A 4JV5B 5FR3A 1VLNA 4Y33A 3N9PA 1UL9A 3B4SA 3CJXA 1SLCA 4TWKA 4MZUA 2VOKA 1NQJA 4HYOA 1VQMV 3X29B 2WZPP 5E79Z 4CDUC 2V73A 3H50A 3WR0A 2UYBA 1W8TA 1J1LA 5C3OA 3I49A 4AILC 3EMRA 2YS8A 4Z2WA 3K5MA 2LS6A 1QJEA 1W9SA 4CDQB 4LE3A 4XW3A 5FZAA 1PHMA 1UXZA 2OIGA 2HWD1 3VHRA 4H7MA 5FPLA 1O4TA 4GX1A 1IVSA 1DBNA 1U5YA 2VTXA 1JVMA 3RMYA 3GCXA 2HKXA 3CRAA 3T3YA 3WV6A 3VD4A 1JW6A 4COUA 4DR2B 1HQLA 5FV3A 4Z82A 1VF7A 5LYJB 1HJFA 3VBHA 2XLGA 5FO9B 5LMUO 2ZXWC 4RHV1 2DN9A 2QQKA 1VQNV 4B3RB 4ITCA 5A9GA 4BXSV 5CZKA 2RCVA 1TME3 3AG3B 3U11A 4JYAB 1NXMA 1Q82W 4NUBA 4KH9A 1VQ9V 1PO21 3WG3A 3VBOC 5C3PA 1XC6A 4HK9A 1F9KA 3RDIA 3JD71 5C71A 5C8YB 1KEXA 2B46X 3NW4A 4IGQA 3ZN4A 3WF0A 2HHHO 5IW0A 3S30A 3SITA 3RYCA 4TSVA 4PA3A 4UBHA 2AZ0A 2VULA 1JJOA 4CXXA 5FLHA 2DYRC 1HW5A 1M4UA 2GUZB 4K8XA 3O1MA 3GWKC 3WEZA 3GHMA 4LBNA 4PDVA 2CAZC 5D21A 3PUIA 3LKJA 3KQ4B 2YGMA 1VMHA 2DVFA 1L8DA 1D2DA 3VKNA 4HLTA 4JQRA 2QFEA 3MW3A 1D0HA 4LO6B 4RYDA 3TEZA 4AI9A 3CSXA 4YVWA 4E2SA 4JGYA 1R3IC 1HR0B 4K8ZA 2ARCA 3W5NA 2AGSA 1VP7A 5JVDB 5FUNA 2ZGOA 1UW8A 4MSWC 1UOGA 3QOPA 2D97A 1DF5A 4J7KA 1UPGA 3O1TA 2P6JA 1RUE3 1J83A 1GN2A 1YJLA 1EP0A 2K2SA 2WZR2 4QQLA 5K0UA 2OQ6A 2H0BA 1G7YA 2TNFA 4QX3A 5JOZA 3LEIA 3NJVA 4FPFA 1GLHA 5CISA 4V2VA 2D40A 4NXMB 4LFBB 1KS5A 1OA3A 3JXSA 3KCXA 4KXRA 2D6NA 4X66B 4HXCA 3QF7A 1N1YA 4GX5A 5JR7B 1XL6A 3MHSC 2QQNA 4DV2O 3WB1A 1O91A 1HLCA 1YEWA 2FDFA 4OHWA 3VD9A 3RQ0A 4DNYA 1SLAA 3OE7G 1GZ9A 4LTAA 4A45A 3C90A 5H9QA 1U5XA 4IEZA 4UFMA 3H7YA 2R7EB 4IUGA 2EJRA 3B5LB 4XJUA 2PY5A 1JBCA 1E1RG 1EBOA 4I4TB 3D36C 4DUVA 2F66C 4O4JA 4SLIA 4LHNA 5GTIZ 3W7WA 3VDDC 1PM7A 3GM8A 4R7CA 5E1AC 2BV4A 1J84A 2ZGNA 1Q6HA 5ACA3 1XE7A 3Q8EA 4FOYA 1U5ZA 2QKCA 2RS53 5LBFA 3L70H 5BR8O 4MXVA 1C8M1 4YGEA 5IJRA 2XHBA 2LP7A 1UN1A 1IXBA 3ZN6A 1JHNA 5KHGA 1B35B 3P3PA 5IJ9A 3ROUA 3BAAA 2ZZJA 4WVMA 1N8RW 5A1LA 3VUOA 4X6QB 4C1XA 3RWRD 2JICA 3LQCA 4TSFG 3NMBA 2GTSA 4LA2A 3DPRA 3K3NA 1XRUA 3WF1A 5IDJA 1J3RA 2Y4TA 1VBE1 2DUPA 3GVMA 1Y6XA 1OFSA 5A3MA 4KL1A 2VXRA 2BP6A 2Z5UA 1CZVA 4CDXC 4BIFA 5DN6G 3RVZA 3J7NA 3EHKA 2HWE1 5BNNB 2FZ1A 1PGSA 3SH3A 2JKBA 4MVMA 4J9ZB 2IZWA 1OOPC 5F39A 3AZWA 3PDQA 3U14A 4GKJO 2XBO2 3HB3B 3CF6E 3GBGA 1QR8A 2YEVB 1AVMA 4JTNA 1DP0A 3ZHVA 5C8CA 4H33A 5LB6A 1N36B 4O2BB 4F7ZA 3AK0A 5LA1A 1LRHA 3ZYFA 4QGNA 3LDDA 5GTHZ 4IGPA 3LCPA 3ZXKA 5FZMA 2YC0A 4CSWA 2PHRA 4JPRA 2KM2A 1F5FA 1PK6C 2ZJCA 5T3NA 3CCVV 2YXSA 1LOGA 4MVRA 4X8PA 3J8F2 3ZFEA 2Q8VA 5T5JA 5CA3A 4HG6B 4AVCA 4QKFA 1N1TA 4IGOA 3JQXA 2VAUA 1OPOA 1DF0A 4GQ7A 3QO8A 5LGTA 4AQTA 1SQGA 1M9NA 3D5OA 4CVUA 4BMEA 4P9YA 3RBZA 3TK1A 5IJ0A 1ULEA 2CTVA 1D7PM 5KC6A 1I5ZA 5CYYA 2A3XA 2PAKA 3MUZ1 1FMD1 2ZNJA 4MGQA 4CP9A 1CAVA 1AYM2 4JI0O 4NTYA 3AL6A 2JWPA 1QF3A 1XSRA 3ZRWA 2ZGUA 1GKBA 1YLLA 3N9MA 2EIKB 4HKOA 2FZ2A 3L72H 3F95A 4FLZA 3C8XA 4I50B 1UIJA 5AC93 4OPAA 4WBNA 5LRSA 1TUBA 3CRRA 2QE3A 1GU3A 2ZINA 5FYYA 4QPIC 5JMOA 4EB6A 1Q86W 3JCZA 3R4DB 1XU2A 2QTOA 1MVQA 5CKNA 3AL5A 4IESA 1C5HA 1NLSA 3N7KA 4LF6O 3VBSB 4GCZA 2CAUA 5A7WA 1LGBA 1RUH2 3G6BA 4X88A 5A3LA 4HOOA 2AREA 1VMFA 4Q4Y3 1MSWD 1UZVA 2RE9A 2CK3G 1BS3A 1VBD3 4X65B 1UX6A 1V9U2 1ZBA3 2Y33A 2ZT9B 1AX0A 1NXD1 3ZDSA 1WLEA 4RQEA 4ABMA 1P8JA 1AR93 2VW2A 2YC4A 5CKMA 1AB3A 3H1YA 1ZTEA 2W94A 4Q4V3 2ADPA 3K5OA 1MZ6A 4PJ0Z 1SBFA 5T52A 1GH6A 4XDJA 4FSJA 4X62O 4QB1A 4QM8A 2Z79A 3FHQA 1ZRRA 2UXNA 1OPMA 2XHKA 3D3IA 1FXZA 2HWF2 2Y8KA 5HFMA 1GMGA 3PUSA 2NP0A 2Y64A 3BYWA 2LFRA 3OBZA 2VCBA 3WQ1A 1PGW1 3BKZA 2ZGLA 3AFKA 1R3KC 4GWNA 4JGZA 1CD3G 1VBB3 3KVBA 2ZKLA 2IH1C 3FZ3A 3RMXA 3BA9A 2ODMA 3C3SA 2Q1ZB 1MS9A 5DAQA 4MHRA 3SGIA 4DR1B 1YQ8A 2JJ1G 1GN6A 5FYZA 1E79G 4LF5O 3POWA 2BSKA 3OEAA 5B2GB 3ABLB 4AQYB 2EXJA 3LFMA 2RM21 3FN9A 4CUAA 1YITV 1ZZ7A 5L3EA 3PNAA 2OTLV 1JZ5A 4Q4W2 1WW7A 3DYPA 1S0VA 2WINB 3RYCB 3MD0A 4H7LA 4PIZA 1P49A 4JAAA 4GA9A 4JRAA 4Y4YA 4XABA 5SV5A 1OHFA 2YIAA 1SZTA 2EAAA 4OMDA 1ND2B 4C91A 3M99B 1JU3A 2P3JA 2QJ1A 3AEIA 2Z42A 1SQFA 1S0CA 1BGYH 2NMNA 2VCCA 1PX4A 4MOAA 2XJUA 5LMNO 4QB6A 1DGRN 5FPBA 3CP1A 2UXCB 4P08A 3I2DA 4DO0A 3QVNA 3OGRA 3VD7A 2F4LA 4OZXA 5D8AB 4P9XA 2ZEXA 1OKOA 4GLXA 3E6DA 3GF6A 1XJAA 5K0UB 3ZEDA 1S2KA 3WW2A 1ZYBA 4DIQA 4WM8B 2YSUB 5LP6B 3AJYA 1EYBA 2CY6A 3ALQA 1DGWA 1LEDA 2JS5A 3T2TA 4TXWA 2UUBB 2GP5A 1GP6A 3OBAA 4LF9O 2EIJB 3JSLA 2R9RB 2ZX3A 3CBNA 4OUEA 5A7QA 1M1KW 2JG9A 4A7ZA 2JB8A 2XH6A 2K1EA 5T5OA 2RJ2A 2R16A 4O4LA 2VQUA 2R0FA 1WW4A 3APOA 3CEIA 4O4JB 3VBRB 3DC5A 4K0KO 5T5LA 1XU1A 2A6ZA 1GQPA 2WLLA 1S0IA 3K57A 4FO9A 1EZJA 4FCAA 2EIMB 3QO5A 4Z2AA 4FFBA 3ZN6B 3BHPA 4GKYA 1XXNA 3BGAA 3HBKA 1OA2A 5IJ9B 1K73W 4WVMB 4XF1A 5JI7A 1GFF2 4C8DA 3TNQA 3MBWA 3OG2A 4DY5A 1GO3F 3JCIA 4WM7C 4FPJA 3DPRB 2RR12 3TWIA 5A1AA 3R4UA 3FHIB 1DLBA 1RFYA 5FY5A 1KB9F 1N4CA 4GT1A 2JDNA 5HFLA 4NHKA 2WFF3 4LBQB 2FKXA 1S72V 5FYVA 2R062 3H1HH 2X6AA 1O6UA 4ARXA 1WP7A 3LF7A 1ULPA 2WWSA 4MW8A 3MW2A 1SRYA 5IVJA 3CCRV 1AR73 4QNHB 3E89A 4XBQA 5IVBA 1WMFA 5C8CB 5B1NA 3MHZA 5J09A 1MS0A 1UYPA 3ACFA 4YZ3A 3IC7A 2RS12 3UM7A 2W2IA 3VZJA 4D0QA 1W6OA 2Q1FA 4K6BA 5FZLA 5KC5A 3EHBB 2V09A 4K1YA 1BE3H 3I3EA 3EO6A 4BM8A 4MUVA 4ZPIA 2Q8OA 4QX7A 1O3QA 3VDBA 3ZFEB 2P1BA 2AGAA 1MS8A 2W39A 3OY8A 2A6YA 2GC1A 1TMF2 3VBUB 2BOIA 1C8NA 3K4AA 4RS5B 3CRMA 1XHZA 4L9BA 4LKDA 4FXGB 4XIKA 1SLLA 1H2SB 5ITZA 1VBA1 4IV1A 4LO4B 2PAEA 3IBMA 5LL6Y 1IHMA 2FB5A 3NV2A 4XFIA 3AZYA 1GZTA 3ZMNA 2SBAA 1Q8SA 5IJ0B 2BFUS 4CP2A 1RMU3 2YB7A 2E5LB 5ACA1 3M3EA 4V2WA 2C26A 2R073 3TB0A 3A0RA 5J37A 3O14A 5FP8A 2RS51 2BPA2 1CAVB 3FMGA 2O8QA 3WG4A 5BUVA 2YI9A 2DYSB 2ERFA 2R9IA 4IEOA 1YFUA 4NTWA 4FM0A 5FPVA 3RZKA 1S55A 1N34B 5EBLC 3IJ4A 1ZZ9A 3CC4V 3B8NA 4P9WA 1P84F 3RYKA 5GONA 4LOTA 4AFBA 5KXBA 1Z5VA 3AG7A 3VBSC 2GBOA 4Q4X1 4X64B 1H6YA 4P9JA 2I07B 3I2GA 2EILB 1COV1 2AC1A 4EB6B 1R091 3AC0A 1KKCA 3MFCA 3FD9A 5J98B 1RINA 1GOHA 2Q1MA 3HKBB 1OCZB 3K46A 4R8HA 5A7WB 4IHJA 2RMU3 2IU0A 4CCNA 2VVEA 3EJKA 4FOVA 1POV3 5F6KA 5IVVA 2VOWA 5CA0A 3I2IA 3W20A 1QNMA 2PELA 1N33O 4IW3A 5K1XA 3VN4A 2JEXA 5L3BA 3WX5A 1OBNA 1XB9A 3LIHA 5LGNA 5FZ8A 1WB8A 1VP6A 2IXIA 2JGUA 4F6EA 4ASLA 4XFHA 2KXLA 3OGSA 4Y20A 3JBG2 5I0TA 5LWBA 1Z2GA 1TME2 1R6TA 4ZKTB 1NY72 5A32B 3E8HA 3ZFGC 3S6PA 3THOA 1BVVA 3WZ1A 4XMIA 1OVPA 4COVA 4UUJC 3E5QA 1R6KA 3VBHC 3OBRA 1SQVH 4MTGA 1QU0A 4KG0A 3AG4B 1AX2A 5IT9N 3ECQA 4JGZB 4XF3A 1EV13 4YGBA 4NR1A 2EX3A 1CZTA 4GX0A 4E4EA 2WR9A 1RUD1 1YSCA 2RV9A 2VQFO 4XBFA 2OKXA 4JF3A 3KT4A 2Y0PA 4JX0A 3B7MA 4X20A 1MNGA 2BSKB 3AKTA 1SPPA 1TNRA 3G6EV 1X9TA 5AC91 5B66Z 4EEQA 1YXWA 3ABZA 1WB7A 1AYN3 3V0BA 1QJX3 3N2GB 4UCRA 1W06A 1JZ8A 1XQ8A 1RUE2 3USUA 3VKMA 3AP9A 2IC1A 1W8ZA 1RYYA 5FL7G 3ZVXA 1Z7S1 3M1HA 5FY0A 3ZXLA 4MVZA 3K77A 2Y38A 1POQA 1NE6A 1NCRB 4N90A 2WO2A 5CAZA 2MHFA 1KQSU 2UWAA 3E8FA 1LOFC 2QNKA 4YVWC 4YFWA 4JGYC 4BWOA 3OAAG 4DV4O 3PURA 4DUZO 2MNGA 1D4M1 2DTWA 1G6NA 3UKMA 3VZNA 2XKPA 3TXQA 4DXZA 2BDRA 1SFPA 1S0DA 1MS1A 3AG1B 2RDRA 2V4DA 1K33A 3I3BA 4HNAA 1XE8A 1H8EG 1LU1A 3J8F1 5C3SA 3V0AB 4A3ZA 3PUAA 3KCYA 4FFIA 2V1DA 1HRI2 1S2EA 5IUQA 3P1IA 2HVKC 4XFGA 3O5SA 1WJZA 4TV8B 1R082 5FQ0B 5FYTA 1NLRA 4W65A 3BTZA 1RHI3 2JEMA 4RFRB 3DEMA 2GNBA 4Y4RA 1LOEA 1F4NA 3E2EA 1S0GA 3OR7C 2WJSA 1W3VA 4YRDA 4H55A 1AYM1 2BGPA 2JG9B 1ENSA 2XLAA 4YM0A 4OI1A 5IK5A 4HONA 1Q6IA 1NTMH 4O4LB 4RA0A 1XNDA 4DV1B 2G9FA 4X6RB 5EPAA 4J11A 2QQJA 2F1MA 4HSJA 2UXBB 1HIXA 4J7JA 1GMMA 3WP6A 1XNCA 3W9AA 2GAUA 4LUMA 1AJQA 5FYBA 1VE0A 4FFBB 5JOYA 1H8TA 3DPRC 4XCBA 1ENXA 5EZWA 4CU9A 2AEYA 1ONAA 1FFTB 1G9FA 4UV9A 1C57A 1RP3B 1VQ8V 3MGUA 3GZEA 1I94O 1EAH1 2EXKA 2DBNA 2WSUA 3DUIA 2VZ1A 3VQVA 1RUH1 5FO8B 4YW5A 4AHZA 2D43A 3ZSJA 1PD3A 4H37A 1PVC2 5G04L 3ASNC 4NO4A 1MABG 1CPMA 5CA1A 3HJRA 4IE6A 3SR2C 3K3OA 4AVTA 3T4HB 3K0DA 4U3FH 5C8CC 5IE9A 2JD4A 2Q9LA 4AFMA 1CAWA 1W90A 4DR6B 3AYCA 1ZL8B 3KZIZ 3M3IA 5I0RA 2V7QG 1WA6X 4OCTA 1MA1A 2ZEYA 4N7IA 5JOXA 3H42B 3AMNA 3D0JA 2CUGA 3I2HA 3LAGA 1C4RA 3DN7A 2Q0AA 1GP5A 3H8RA 5JXIA 4BZ4A 2XL9A 4EFEA 3B01A 5B4NA 1NKGA 5F9TA 4BIOA 5IWAO 1O5LA 1HV1A 5I0UA 1R1A2 4DV0O 2QWOB 1I6XA 4MH0E 4BDVB 1HNWO 1H30A 3D8CA 1TEIA 2OYZA 3TEYA 1YJNV 3RSJA 2QM7A 2VC9A 4KBZA 3I2FA 1WPXA 5IK8A 1AZDA 3U07A 1VRH3 2P5OA 4Y5TA 4D3WA 5JZGA 1GK9A 1DQ2A 5ITZB 1LHUA 4LJHA 4DEQA 1BK1A 2YPJA 4A44A 4OI0A 4QPKA 4N43A 2JDYA 1P7GA 4GJZA 3QACA 1AXYA 2VW1A 4YVSA 4I02A 1RPRA 4MSVA 1YZBA 4LC1A 1UZ0A 2DWEC 1W6PA 2DURA 5CFDA 1X50A 1GM8A 4KNCA 3N9OA 2BTQB 3J7LA 1JS9A 4Q4Y2 1GZCA 3CDZB 1DZRA 5FZ9A 4WFBV 2D44A 1ZBA2 2RDSA 2Q6AA 4YJ2A 3NNGA 5GONB 2PHWA 3NSTA 1NOVA 3CD6V 2WN2A 1QQP3 4QX2A 3KB5A 1FJGB 4DV3O 5FMBA 1UOFA 4B4QA 2VUJA 2A7WA 1BT8A 4L97A 1M93A 4W6XA 1PMJX 4IETA 3JALA 1OA4A 2Z69A 4GH4A 3I59B 4AI8A 2P3YA 1E5SA 2BJSA 4HAMA 3HOBA 1G8WA 1BQPA 4HMZA 4LF8B 4IHJB 3BTXA 1YJ9V 3ZHQA 1BEV3 5FYHA 1YVWA 1ASJ1 1PMHX 4LBEC 3U4XA 5CA0B 1CPYA 3ZXGA 2R6QA 3ZDVA 5J36A 2VL4A 1OZ0A 2A75A 5A3WA 4XEZA 2B45X 1LOBA 4FPHA 2N7GA 4JI3B 4R52A 1LESA 4N53A 1W39A 1VBB2 3DKQA 1US6A 3IKWA 4DV7B 4X1KA 5JCTA 3HT1A 2OZ6A 4O4HA 4FPEA 4CTEA 2XDVA 3ILFA 3OTFA 4UCUA 3N3HA 4WFGA 2DJVA 2WC2A 1X82A 1T6BX 2JDPA 1I9RA 4GWIA 3K4ZA 1WZXA 3HQUA 1BLZA 1C3HA 2DVAA 1F51A 4AGRA 4JASA 1GRJA 1QJY2 3BABA 1BZWA 3HKEA 1G4YB 3LNNA 1L1FA 3K0GA 4GZ9A 4M3CF 4NMIA 2ORXA 3ABKC 1H1MA 4YY3O 3KT1A 1Y4MA 5A33A 1JOPA 4GZRB 1RUC3 4JYBA 1G9AA 2WNVC 4U7OA 2C1FA 4XUOA 4X20B 3BVCA 2PQSA 1IBLO 2RR11 4ICGA 2GALA 2VUDA 3WW1A 2J22A 3V0BB 2RJLA 2AXTZ 3USUB 3JATA 1VR3A 5GLUA 3UT0A 4E4SA 1UY1A 4XJ9A 3OTOO 5IFTA 3WOGA 2R061 1VIWB 2ZM6O 3OEBA 1H4HA 5H6RA 3CC2V 2E3CA 4X8NA 3K06A 4N7UA 2RMU1 4OQ8A 2WQ4A 5BNPA 3HD8B 3I2KA 1FX5A 4UXAA 1A8MA 1FOD3 3CU7A 4ZBMA 4CEYB 3FX3A 1RUJ2 3CMGA 2RS11 4DUWA 5LASA 1NH2D 4AFAA 2YDEA 3AXEA 3DGTA 3BODA 5T54A 3BN6A 4AK3A 2GV9A 4HNAB 2O8OA 2A3YA 5FP7A 4LUKA 3IDCB 2VMHA 4RR3B 1TMF1 4CDWA 2E76B 2V5DA 3Q8BA 1IPKA 3K58A 1R3JC 1VAVA 3IIIA 3L9DA 2W46A 3APQA 1J3QA 3WP3A 5A3NA 5EXOA 2BU9A 2K9PA 1OXCA 1OQEA 1US3A 1JYCA 5D1IA 2RDCA 4GKXA 4W6WA 4C1WA 4Q0VA 1UX7A 3CWBH 3NV4A 3J81N 4QPGA 5BV6A 3E8GA 4RWUA 1ZA7A 1OQ1A 1KD1W 2VPVA 2WS93 3PIJA 2NR5A 1RUF1 1F23A 3SJAC 5APAA 1O5UA 1TVKB 1IBMO 1HDKA 1ZNPA 3W7SA 4CUGA 2LALA 1AL23 1YXBA 2W95A 2RMKB 4AVAA 1UOBA 2ZKNA 4ZU7A 1CPNA 2P3IA 4JTAB 4CCDA 1QJX1 2KR2A 4QKDA 5GZCA 4MHUA 2BZDA 3WXPA 4NXNO 1GWLA 1KXGA 3D0SA 2KB1A 1V54B 4LIVA 3JYCA 1QOOA 2CTPA 3ASOC 4YM2A 2E31A 2EF6A 1WCKA 5A7SA 2WNOA 1D4VB 4D6RA 1BCXA 4R9BA 3QG5A 4LFAO 1XNTA 1M90W 1GV9A 2G9ZA 4D69A 5KX5A 3C7GA 1VJ2A 1AI6A 2Z5WA 4GALA 5FYIA 5EZYA 5ABJC 4P14A 3VZMA 1CAWB 4WBBA 2JDIG 5B1BB 3WDVA 4QB2A 3CX5F 3AVRA 1JYVA 3JBG1 1WWYA 4Y3OA 2XB6C 3TN93 3DF0A 3NAPA 2JK5C 1BL8A 3ZCCA 2NN4A 5ANNA 3W21A 4RGGA 3ML0A 2VECA 4IXLA 1NY71 5EJ1B 1UD1A 1RMU2 2XL7A 5LEJA 4YZ2A 4CUBA 2Y6HA 1RHI1 4EWAA 2EZOA 2P6CA 3MDSA 1H2MA 2ZX0A 1MEC3 4BYYA 2BFUL 2JX9A 3W58A 3RI8A 1TUEB 4BPZA 4IV1C 5LY1A 4BQ5A 1SZXA 1RUG2 2B9ZA 1OD5A 2ARXA 4CU7A 2D98A 2JVDA 4K9SA 5JZGB 1UAIA 1SCSA 3APBA 5L73A 3M3CA 1CZSA 3H7JA 1UKGA 3VBOA 4N43B 2EZPA 3ZFFC 2GN7A 2NNUA 3I3DA 1GKFA 3POGA 3D4KA 4XQDA 1RUI2 1QJFA 4KWLA 5BNQA 5CFDB 1GWMA 3WNMA 4ES9A 4H2AA 2DCYA 3PN1A 4N9IA 2IXLA 1W8UA 5BY1A 1AR63 2VZPA 1ROPA 2LGWA 2ZQMA 5A2QN 4XUPA 5JSOA 3GXUA 2R043 3T4ZA 1GNZA 5KHIA 1DIWA 2FTKA 3FB5C 3VZKA 2CDYA 3ZN5A 1PZ8A 3B77A 3JALB 1UZWA 4GH4B 1PX3A 5I91A 1R73A 1XUQA 5TSWA 1NYWA 3ZKYA 4QU1A 5FFOC 3J4UH 2Y69C 4UBGA 5IY5C 1HRI1 2BTVC 4NKGB 3PIGA 2ZS6B 2X53S 3CC7V 2DCZA 2VMFA 2DMXA 4LULA 2JG8A 4YJ3B 4I0BA 1R081 2CGOA 5JWPA 3SYAA 1W99A 1OLMA 3CJIC 4N53B 1NX9A 4LITA 5G05L 3H9VA 1EV12 2CHHA 2YYOA 3OUFA 3N2KB 4O4HB 1DQ6A 1FYJA 2BW8A 4NN0A 1L3JA 3ZSKA 3AG2C 2FMLA 5DAVA 1JTZX 5M0TA 5E8AA 1QOTA 1S0JA 2XGXA 3BI3A 1QH7A 1I5YA 3WG7C 5JQGB 2ZGMA 1GTOA 5LCWL 3D36A 5DQ0A 2ZE6A 3SMHA 4HKWA 1EN6A 3AK1A 1AYN2 2WT0A 3OUSA 4R9CA 5DUWA 4L8JA 2VQ0A 4IEUA 5LXTA 2YUEA 4JI1O 5FCCA 3HKEB 1VQ4V 3FHAA 5IAXA 4ARYA 4OULA 1RXFA 1AJOA 2DDUA 2PHTA 1HNZO 5ISLA 3AP6A 1E5IA 4HETA 3ZMOA 3NJXA 5A33B 2J1UA 4ASUG 4C0HA 1A3KA 1UO9A 2H6CA 1XNQO 3ZOIA 1YFWA 4XURA 4FPKA 2IXHA 4IGGA 5GZGA 1CESA 4S2DA 3K04A 4YHHO 2FQPA 1UOJA 3KF3A 4PLNA 1OMIA 3ZM8A 4QT6A 3FJSA 3JATB 3LSQA 5LBCA 2ZMLA 4H14A 5B4XA 5C4WA 2UXXA 1OOPA 3N35A 1V0AA 2O1QA 3Q8AA 1FXKC 4DK1A 3K4DA 3AJZA 3S57A 1RUNA 3CHXA 5CNAA 3ZX7A 1BHAA 5BNPB 1A34A 2LUWA 5HXVA 4BB3A 1SCRA 1K4CC 4AI0A 1K9MW 2P37A 5KUMA 5H9SA 3ZJZA 1S76D 3D3QA 5IK4A 4W8JA 1W6NA 1R1A1 5AFBA 1N1SA 1QKQA 4TUYA 4RQPA 3PU3A 4Y1XA 4I2OA 2BERA 5C5TA 4BXFA 1JZ6A 1PP9H 3POSA 2FDJA 2HWD3 4XHXA 4MG2A 4R8CA 1QJU1 2QSAA 4S2FA 3VDAA 1Y74A 2HP8A 2PTMA 2AZ5A 4AI2A 2IJKA 1AI7A 1YF2A 4GX2A 4V1PA 2VR4A 1TNFA 3U75A 5DAXA 4MGSA 4B3NA 1J95A 4UF0A 2WLIB 4DV6B 3CKHA 2BOJA 2YU2A 4RHV3 2ZGRA 1UU5A 3OGJA 4MGKE 1LHVA 3I3MA 4FLWA 2QA4V 2ZIOA 3ACLA 4K40A 1PO23 1Q81W 4BK5A 1RUC1 1ZX5A 1QGLA 3Q4HB 1K8AW 5BY5A 1UKRA 5H2FZ 2QQMA 1K3EA 2H94A 4XUQA 2XVKA 2PLV2 1H8TC 3VB9A 1OJHA 4CYDA 2KD7A 1V55C 2Q0OC 4Q1RA 1ZRCA 5GLVA 5C9AC 4Z07A 2JDUA 4UB8Z 3RZLA 4BHPA 2BOBC 2Q73A 3KG2A 4NPLA 3IMNA 3SLIA 1MQTC 5KWRA 4UFKA 1NCQA 4AAXA 2SLIA 4W4LA 2PYJA 1Z78A 5A3PA 1YWKA 1FT9A 2XR4A 3SXWA 3NVCA 5BMVA 1HNXO 4QX8A 4CCOA 2VZVA 2M7WA 3UETA 1Y9MA 3BUCA 2E9QA 4K3UA 3RZJA 4IEYA 1DLLA 1TG7A 3I2OA 1TZOA 4RD7A 1GN3A 4PI2A 2UXDB 3WHUA 5FY9A 2WQ8A 3T4VA 1BHGA 5B1BC 1Q5OA 4G2KA 3HQRA 1WCSA 4HFSA 1L7LA 1N32B 3CZUA 5A3OA 4KFMA 3C7OA 5CB7A 5EZYB 2PYLA 3PVOA 5A80A 5B1OA 3UL2A 2OIIA 4CDUB 4L2NA 4IT5A 1VRH2 3GB7C 1F4AA 1GM9A 3B02A 3BU0A 1S0BA 1DU3D 5BYNA 1NTZH 3ELNA 4A7KA 4BWAA 4B08A 1IBKO 5FPAA 1YQ2A 3IC9A 3ILRA 3S7EA 3I56V 4O9EA 1QDCA 1KKDA 3P3NA 1YJKA 4A42A 3C3TA 1PGL2 1HNWB 5LK7B 2WLQA 1IQAA 4MVTA 2IFWA 1CWPA 4JI6B 4MGIE 2ZXWB 3TAYA 4YVSC 3RJRA 1C8M3 4M3CA 1E5RA 3BY6A 3HKCA 1FV3A 5DG2A 2N05A 1L0LH 4E9KA 1Y3TA 5F5CA 3AVSA 1PVXA 5CFDC 3PMEA 1KDMA 4JDMA 3VBOB 2XAHA 5IVFA 5KLVH 3RG0A 3KV6A 4ZS2A 2VTXJ 3KM5A 4CCMA 2QZ3A 4JGSA 2E32A 4DUYB 2D2CB 2VOTA 1ZBE3 3H8OA 5EK0A 1SFYA 4LKSA 3H8UA 2WWWA 2DYRB 5DECA 1QLEC 4QM9A 2HWE3 4AW7A 5IHRA 1RTVA 5E16A 4YW3A 3G6JB 1HW7A 2WYSA 1F4MA 5HCHA 2XWBB 4PDMA 2KA3A 4EN0A 1EPWA 2RDQA 3T0DA 5KHHA 4DR7O 3O0XA 3RZGA 4PA9A 3CXCU 4PELA 2HWB2 2WYFA 5F3GA 4QD2A 5BZBA 2AHYA 4B3TO 4YXWG 2JXAA 3LSDA 3H1IH 1KDKA 5GJ6A 1W8OA 3W7XA 2AHZA 5E6HA 5J2UA 4U3JB 4XILA 3FE5A 2DWRA 1HXS2 3HNBM 5FYMA 4ISRA 1SQXH 5GLZA 1W03A 2IW5A 1JYXA 1HJGA 1MEC1 4G4FA 1QOSA 3H1JH 2UY9A 1BMV1 4J41A 5FY1A 5IYBO 5FZBA 3KGZA 3BRCA 3ZYJB 2DCKA 4FFFA 3N7JA 1FMD3 3SNMA 2GNMA 4DXTA 1QVGU 4JI8O 4GB32 3ZYGA 4UFHA 4I0AA 4KI5M 3VDDB 2DE0X 1LGCA 4XVHA 3QH6A 4BQYA 5FZOA 5LXTB 2N04A 3VLBB 3FC0A 4J7ZA 2AENA 4BQ4A 2UWBA 1W9YA 4DW0A 4Z8BA 2WN3A 2UY8A 5FZ7A 1UPSA 2G1MA 1O59A 1NS1A 3EYPA 3C7HA 3ZS8C 5EWSA 4LF7B 4CS2A 2LO1A 4AE2A 1DYKA 2ZCEA 2QBXA 2QR4A 3AKQA 2WAMA 4RGAA 4LFCB 4HKLA 5F2WA 1QVFU 2C24A 4A3XA 5JR2A 3D3AA 2L9LA 3GBFA 4EZ4A 1AILA 2GH2A 3PUQA 4HSLA 2R041 1QXPA 4XF9A 2VOVA 1DYOA 4TQDA 1I3HA 3SHRA 2XG3A 5EIYB 1K4DC 2HJFC 1QWRA 3VBFC 5FY7A 5AG2A 1OOPB 4P5YA 4XJ8A 2YV8A 3H0OA 2E6VA 4YPJA 2ZIMA 5FMCA 3BFRA 1J59A 4NWVA 4XACA 4TZDA 4L0PA 2UU8A 1XMQO 1QBZA 4FLXA 2G4IA 2UUAO 2QKDA 4CPBA 3RPQA 2NLJC 2Q4SA 3G71V 3AYDA 5J48A 3OCPA 4DR5O 1NZIA 3C7FA 1JOYA 1ND3A 4CDWC 4JI5B 3VHPA 2R49A 1PK6B 1FS0G 4CEWA 4J25A 3U1XA 4UFZA 3HMYA 5KAFZ 1FAYA 4TUYB 3RZMA 3WW4A 2XHNA 1MSDA 1WMEA 5KXEA 5EV7A 3ZIWA 3KKYA 4IEXA 2ZTNA 4YNIA 5T50A 1RUG1 1NU1H 4UCTA 1Y74B 5DEDA 4NE9A 3KD4A 4QPGC 3B3QE 1FD9A 4DRXB 5CG8A 5GZFA 5L7OC 1PPJH 3BA8A 4WFAV 4CU6A 3CCJV 2VVDA 2Q8CA 3MICA 4PBPA 1T5EA 3RYRA 1L7QA 3LEKA 1W2UA 4ZHQA 3MO4A 5H5NA 2EINC 4ZY9A 1CN1A 4YFZA 1RUI1 4DR4O 2HEWF 1IDSA 2RM23 3BCCH 2FBEA 3I7DA 2QWQB 2HBUA 2BNNA 1QLNA 4H3WA 1X8EA 4B3SB 1UYXA 1XBFA 3T1MA 4UCOA 4ZI7A 4DV5O 2EBOA 2WPDG 3K9AA 2MEV2 1FFXA 2ORZA 3ETEA 1RJ8A 1DFQA 5FIXA 1KRIA 4NHLA 4QPIB 3B2EE 2ZABA 1NCQB 1YQCA 2J1SA 2XVGA 4DOUA 3FYEB 3E5XA 1UY2A 5BMVB 4L92A 3AP5A 3TYJA 3TN92 2W08A 3FLTA 1LODA 1GAXA 4FFKA 4QWNA 1SZBA 1SERA 1VBC2 1W6MB 4BLJA 4P30A 5FY8A 2WLJA 4IV3A 1J5EB 4ES8A 2ZOEB 1YYNA 3SPCA 2VCAA 4GUNA 1NE4A 1XEQA 3A4UA 4AEDC 4ZZ8A 4OMCA 5L9RA 1F5JA 3I54A 2HWC1 4Y26A 4EN9B 3NRUA 3V64A 3NAPC 4AEKA 4XBNA 4GKKB 3LDCA 5DUVA 3AMPA 1N0JA 1YQ6A 3D6EA 1WD3A 1OSGA 2PUSA 2XAJA 3N7LA 1MS4A 1IGOA 2Y0OA 3ZIAG 1NQTA 1VAMA 3WB0A 3AMQA 4LQRA 4J80A 1GNYA 1OLRA 4OUSA 3ZFGA 2FL4A 5CBLA 2DU1A 3FWEA 1FV2A 3OFNG 2P7TC 2PMWB 4LKFA 2OXBA 4JV5O 2WAAA 3B40A 4TQFA 3AZXA 1AR82 2KKWA 1CEZA 1HKDA 1JH5A 5LZ6A 2WZEA 3QBQA 2X0LA 3OPZA 2H8PC 1V6MA 4BIZA 3WUCA 5GLTA 1THZA 3CCMV 2LW1A 1AR62 4P9LA 2R32A 4MTXA 4DPNA 1O8SA 1JYIA 3KS7A 1UWWA 2XAQA 4M3CB 3HKCB 4OI4A 2DCJA 2H3OA 3OD4A 4IEWA 3W7UA 5EYPA 2RQ6A 1ZZCA 1YO8A 3TCUA 4R4XA 1LENA 2FCUA 4QQHA 4TN7A 2VZOA 2H6BA 2VMGA 5LGUA 3UESA 1BBT1 3ETPA 4DR2O 5CIRA 4MV2A 4FM2A 4PDLA 2CDOA 2UU9B 3MDPA 1UPIA 1JYNA 2RN9A 3OSDA 2ZMNA 1LOFA 1XNRB 2CE4A 4QE7A 3VZOA 2YUAA 1IURA 4YM1A 4B3RO 1O7FA 5CA6A 1CAXA 1CIWA 2VZRA 4JYAO 2Y6GA 3GCWA 2QZ2A 3R6SA 4XDKA 2VNOA 1UMIA 5EJZB 1MACA 1BKZA 4CCLA 1ODMA 4JHTA 1EN4A 4DS0A 3P32A 5FZ4A 4G27B 2W5FA 3SISA 4YG0A 2JG8C 3B69A 4FPPA 3WF2A 4UAPA 1GWKA 3IIAA 1PO12 4LO8A 4BOWA 4COZA 4QDSA 5J2UB 2XJQA 1OCRC 2F4VB 2YY1A 4CXYA 2W0XA 2W47A 2YXHA 5HCBA 1Q7YW 1X4TA 1UMHA 1ZZ8A 2AH2A 4PDWC 1VF5B 1HR0O 2CGNA 1RVF2 3CNAA 1G1XB 1VBA3 3V56A 2J42A 4KHPO 4XDQA 1MZEA 4Y1YA 3WDYA 1SA0A 4QQOA 1NA1C 2CWSA 2YC2A 1M4WA 4PF5A 5EYYA 4LFBO 2GC0A 1W6QA 4X66O 3TGUH 3L75H 5CB4A 2VMDA 1PKXA 1JFFA 3ZBHA 1YUDA 1W0NA 1DQ1A 1JMUB 2XAFA 4JVAA 1NT0A 4E27A 2E7QA 4HANA 1ZBE1 3WNNA 4Q4X3 4QPYA 4HL0A 2F4PA 2HEVF 1P4RA 4Z1VA 3WQBA 1COV3 1VRBA 3LPFA 1YTFD 1R093 3LEMA 3CO2A 4P9GA 2GC2A 4WM7B 5C4WC 4MADA 1ZWIC 3ABMC 5FXZA 1I1EA 4YG3A 3CMAV 2A9HA 3GGLA 2M6YA 3UQ8A 1IOAA 1SFNA 3A21A 1SBDA 2WNEA 1YFXA 2XUEA 2VRZA 2NM1A 2ZZQA 2HWD2 3C3VA 3T1YB 3TNPB 2CWMA 2JJ2G 2XOMA 3CZJA 4Q26A 3T2OA 4NPRA 2PGGA 2FDIA 1U12A 4EWDA 4RQPC 1JUIA 1YCIA 1KD7A 3WFVA 1RB8G 5GLWA 3HAGA 3M8LA 4SBVA 4XDOA 3ILNA 2FCTA 3LSEA 4QMAA 2VZTA 2JB4A 2YHJA 4OHZA 1W0PA 4RO2A 1YQ5A 3KV4A 4DXSA 4X1YA 1H8VA 5FPXA 4UW4A 1XYOA 4BA6A 5F32A 3JD72 1QXRA 4HVRA 3INAA 3LB9A 5LA6A 2GDSA 5AVPA 4XF0A 5DDJ1 5FWEA 1Q90D 4I0WB 1CAUA 3SC7X 1N36O 4BQ3A 5T55A 1VMGA 1V6JA 3AK2A 1X59A 3OGIB 1HRV1 4JKMA 2A6WA 5KA5A 1RUD3 4LE4A 1ZAUA 4UW6A 1VEWA 4FJCC 4DXRA 4ZHQB 5GZDA 3WNPA 3B9CA 4N8MA 3OJBA 5BNOA 2RS31 3ABUA 1V6LA 2Y26A 5BXZA 5DPNA 2Q30A 4FFGA 5A7OA 2WUHA 1DGWX 3NNJA 1NCQC 3ATGA 1LECA 2C0ZA 3OEHG 2I2SA 1HX6A 1AP6A 3S5AA 1Z7S3 3JARA 1GQGA 4ZI7B 5LA0A 5A7NA 1XNAA 1FFXB 4F6RA 2XONA 5IYZB 5KHKA 4HZ3A 1D4M3 3KSCA 5LOVA 2J1AA 3WQ0A 1F7YA 3OGGA 1OUSA 3ZPYA 3LGRA 2JJ6A 2Q5ZA 4XF4A 1RSOA 1AVBA 1UY0A 5FJKA 2PAMA 1HNXB 1KITA 3EB7A 1UYZA 2B4KA 3OPWA 4QPWA 2LTNA 1ZLZA 2GNDA 3HPNA 3J8F3 1ZZBA 1AXZA 3GYDA 3FB6C 1KP3A 3ITQA 3LDKA 5FZ1A 4CPBD 4KU8A 1I5XA 1AHSA 2P34A 4CUCA 3QH7A 4KG8A 4JI4B 4LBOA 3FBYA 2GSMB 1WAZA 1KJLA 4S2GA 4XTPA 2WT1A 4O65A 1QDOA 1N1VA 3OUIA 1A8DA 1KP2A 2ZCWA 4LNVA 3GZUC 1UZZA 3UJOA 1C8M2 4NAMA 4U36A 1Y7BA 3VD5A 3RYFA 1VQLV 3THCA 4DR3B 4UI9L 3UT5A 3OW2U 2VJXA 3ZFGB 5CKQA 3N4MA 2KSDA 1AYM3 4IL6Z 2MW2B 1XMOB 3CIHA 1US2A 2X5IA 3ZYRA 2OCCB 4X65O 4AI3A 1H9PA 3VBHB 3B8MA 1IS4A 2A0LA 1W8WA 1LHNA 3D82A 3N36A 1VBE2 4JI2B 1K5QA 3K08A 2VQEB 1G86A 1FI2A 5CVRA 3NO8A 5FYUA 3T0AA 4CC6A 4AF9A 2WNVA 3WHTA 2VNRA 5GW7A 1S5HC 1WPBA 2ZACA 4LCUC 5JXGA 4HK8A 2NQYA 1JQ0A 2AZ2A 1EAH3 3STZC 1NG0A 4UOJA 5EFUA 1AI5A 3RYIA 4CDQA 2F23A 1ZZ6A 1XOUA 5LHIA 1RUH3 2DUOA 4YIPA 2HJDA 1OC1A 1FAFA 4B4RA 3DGEA 1MR5A 4J6GA 1LOCA 4Z1MG 2ZHLA 2W6IG 2HJIA 1RM1C 3K03A 1W05A 2WABA 4YVWB 1QHTA 4FVVA 4XXPA 4MLOA 2YFUA 4JGYB 2ILMA 4DR1O 4BQXA 3PTYA 1W3XA 3PJYA 5LYJA 2ZX2A 4E4ZA 4LF4B 4QKNA 4AQYO 5DAWA 1CAXB 2VZUA 2ATFA 1W0JG 2VY0A 3E22A 4B3MB 4PBOA 1V6KA 3CCUV 3ZXEA 1PL0A 2IWGB 3MLKA 2X6BA 1YHQV 3C2UA 1VQ6V 3Q8CA 3SH4A 2HWF3 2VM9A 5C8YA 1FPN2 1SC5B 5IAVA 4XPVA 4XC9A 1FKAO 1UF2C 1AJPA 1NVPB 5K7PA 3N9NA 5FP4A 2PFWA 4P9OA 4HVOA 2CTRA 1WGPA 4LR3A 3MW4A 5HV4A 3WVJA 3GHNA 1GBGA 3CQOA 2GUZA 1S1AA 3JUUA 2ZE7A 3OD0A 3RZZA 1WD4A 5EBMC 2DV9A 4M0NA 2E26A 3KLSA 3WP5A 1N0NA 2OWOA 2WLNA 4UFLA 1S77D 3T2QA 4Y5SA 3VQYA 1SA0B 1L7RA 1ODNA 1W9FA 4COWA 3SYQA 1RITA 4D6SA 1SKVA 3O1RA 1VAKA 4Y22A 2OT5A 2Q7HA 3UGHA 3A0BZ 1KMIZ 2OPWA 3I5DA 2RVAA 2JKXA 1MZFA 3R66A 4QDRA 2GHYA 2VZ3A 4MGZE 4Q8KA 1HQNA 1EUUA 3MF6A 1STMA 2ZDIC 1UU6A 2MEV1 5CB4B 2UUBO 1HB1A 2EXHA 2DBIA 3E1F1 4LO7A 1RC6A 2BOCC 2XOKG 4URTA 2YG0A 1M57C 2Q4PA 2J1RA 1AF9A 5EIBD 5HI0A 1DDLA 3WG2A 4LH7A 1FPOA 2R72A 1XSQA 2Z4FA 3UJQA 3NV1A 2ADQB 1VBC1 4B7KA 4R50A 1ULFA 3KGLA 4AFDA 2P90A 1OCOB 3ASNB 2CDPA 5F8PA 4AHCA 3WCSA 3DV8A 4OX9B 2VZQA 3K5NA 2K46A 3LSSA 3PTRB 1ASJ3 2LM3A 3ZXAC 3QO7A 5ABJA 2XJPA 4TTGA 3PUHA 5DAPA 1W8NA 1PIV2 4FPOB 4W50A 1CX1A 2QVSB 3R05A 4Y1VA 1ND3C 4CS4A 4P9PA 5LHGA 1PGW2 1K42A 1W59A 2HLEA 4AFCA 4CEWC 3T1HB 2W92A 2PHXA 1GANA 2JE8A 1JJ2U 4TT3G 3G67A 1PMIA 3O7OA 1IPSA 2JE9A 2OT7A 2R9AA 4LP8A 1NVPD 1IXMA 1DHKB 5FP3A 4ZHNA 4N21A 4P02B 1AR81 5D5PA 3HVDA 4ZXEA 2X05A 1WA8A 4X1YB 2G9GA 2Z2SB 3RS6A 2VNVA 3JD4A 2VBDA 5DUUA 5C33A 1G8MA 2A06H 5BNNA 4DRRA 1D5AA 1G9CA 3L2HA 1M56C 3IAPA 1UNBA 4CP9B 1PM4A 3PVEA 3DXRA 5A6XA 2YEVA 1H2KA 3CCQV 3ZRWB 4NROA 3DYMA 4Q1PA 4CE8A 1EZVH 3J7HA 1QIQA 3ZRXA 4LK6A 3ZFFA 2YBKA 2P3KA 1KQRA 3IDAA 4E2QA 4D94A 2QQVA 1F4HA 5BNOB 2RR13 4WBNB 1TUBB 4PQQA 1ULOA 2FMDA 1FNZA 3L73H 4QPJA 5JIAA 1MMMA 2PN5A 2B1IA 3BALA 4FFHA 2DFCA 2DVGA 1T2XA 2BEOA 1SS3A 2C2AA 1YIJV 4LBKA 3S3WA 3F7YC 2R063 1OHHG 4JI7B 1Q3EA 3GWOA 2ZBJA 5FZFA 2E5LO 2WZR1 2WO1A 4LBJA 4IV3C 1ZX3A 4UV8A 3JD1A 2ZEWA 5C93A 4DV5B 3VQXA 2RS13 3WF4A 1LR5A 2EXIA 5FK8A 2QWPB 1F35A 3HKDA 2ZA9A 1RSOB 1PO11 5KBFA 3IAQA 1JZ7A 3MIHA 4MXWA 4B4PA 1Q6UA 2C9AA 4Q0QA 1SETA 5H9PA 3KQRA 2DF7A 2HR3A 1TMF3 1ULGA 4B7EA 2JECA 4XMAA 4X64O 3CJIA 3U0ZA 4NHXA 1WLCA 1Q8OA 5EQUA 1YFYA 5FPZA 2EIDA 1GUIA 5DN2A 4CH4A 2OCCC 1VQPV 3RYPA 4KWUA 4EKWA 1KYOF 5L3GA 3RYFB 2VOXA 3LEGA 4ATEA 4DFSA 1VPHA 2X29A 4QGMA 4BW9A 1VARA 3NKTA 3T2PA 3E86A 2X5IB 1PNKA 1OF4A 1JYTA 1H1AA 1XYPA 4YYOA 1CP9A 3SPHA 4NPMA 4EZHA 1RUF3 1OLQA 2VCMA 4YW6A 1UU4A 1WLDA 1BZKA 3ABKB 2BWAA 1EPZA 3CRQA 3POIA 4FBFA 1G9DA 5LMUB 2QM4A 1Q8IA 3TXSA 3CJHA 2WNVB 5EIBC 3NR7A 4KWJA 4B29A 1QQCA 2ZNIA 3A7QA 1W2TA 4KBBA 1SBEA 1NLQA 5LEKA 1CR7A 5F37A 2DWDC 2XBO1 1KJRA 3CMEV 4XFAA 2KG7A 2CGPA 3RYIB 5FXXA 2OS2A 2DVDA 3KCCA 1U96A 2HHHB 4MX3A 3DL3A 1HB2A 2ZMKA 2R0HA 4OFGA 1D2QA 1FXKA 4K21A 1QHDA 4YWAA 3EBRA 3QD6A 4FPYA 2TBVA 3RRDA 4ATFA 1GOFA 3MI8A 4XJZA 5F5IA 3E22B 4KUMA 3JBG3 3NNMA 1VBA2 4MGYE 3RZHA 3MIGA 5I8YA 2HH9A 2K9ZA 5ACA2 2ZEZA 4XUNA 4PQ9A 4YW7A 2E74B 4JKLA 4KU7A 3ZYPA 2RS52 3ZN0A 2LW8A 4CRQA 3IB3A 1W28A 1W8HA 2PF4E 2YGLA 3RWKX 1O4YA 1OH4A 1H9WA 1GZWA 1UFIA 4QXBA 1A32A 1ENRA 2P17A 3MIEA 4MVOA 4DV2B 2BUKA 1ND2A 1LUWA 2Q7GA 2HYXA 1JYWA 3MFAA 4KQ7A 3JAWA 2B7YA 1WN7A 4Q4X2 4QHBA 1SEFA 5L9VA 3MAQA 5FO7B 2WLLB 1COV2 1GICA 1LNSA 2WT2A 5DMYA 1R092 1K5MA 2A7AA 1WNSA 4DINB 4Y22B 1SQBH 2WNUC 4I09A 3POBA 4KHPB 3OGVA 5D8AA 2BTOA 4BAYA 4LHKA 3X2QC 1WW6A 4LBLA 5C9AA 4QHOA 5BR8B 1C1FA 4JQTA 3ZXFA 2EALA 2ZD9A 1MQTA 1IQDC 3H8XA 4BISA 4WM8A 5LP6A 2Q5TA 1I08A 4FP2A 3MUY1 1AR4A 3RVYA 1D0GA 1OCOC 3WUDA 3HT2A 1DG6A 3ASOB 3ZSLA 5K4LA 1V9U1 3H1MA 1SDDB 4LORA 2YIBD 1QU7A 4DV1O 1LHWA 1P7BA 1VF6A 2R70A 2AR6A 1ALYA 4CP0A 4XXAA 2UXBO 4A6SA 2D3PA 1ULCA 2VUAA 1W0KG 3RNSA 3LUTB 1AX1A 3GJAA 1ACCA 1HRI3 3VBRA 4XYXA 4QX5A 4ASMB 4GKJB 2D3RA 5ABJB 5F2VO 3QCWA 4OI2A 1R3LC 3HNMA 3PMSA 5CMUA 1W9WA 4K35A 1W6OB 2HWF1 4CCCA 1R083 3JB8A 4LK7A 4Q0SA 1WMXA 3THTA 4NIHA 1Z5WA 3OY8B 3A0NA 2A6XA 1RUD2 5E1RA 2E33A 2W0FC 2ITDC 4JHZA 2E7AA 4BW5A 3KF5A 1E5HA 3MIBA 2EIEA 2KQXA 1HN1A 1KC8W 1WA8B 2YICA 5AC92 5H9RA 3O1PA 4QXCA 1OCCC 2DFBA 4HT1T 3G4SV 4IYHA 4DR6O 4IV1B 4AEMA 1AJNA 2VS0A 3H1LH 1W2BU 5FXWA 2PI5A 3A8TA 2AUYA 4QXKA 4LBQA 1K34A 1Z7S2 4ZXKA 3I3QA 5HPOA 3HQXA 3J7MA 3K75B 1Y9QA 3DXRB 4Q4W1 4EV0A 3AXDA 4JYYA 5B1AC 1W2NA 5BNOC 3OUJA 1K3IA 2PHDA 1XHXA 4CXWA 1D4M2 2WIIB 3ZFFB 5C70A 4JI0B 2ZHKA 2DU0A 4Q2FA 1VBD2 4XQ4A 4ASKA 3VKOA 3IZOA 3ZKUA 1PVC3 1PNGA 4AEJA 1AR92 4KWKA 2ETNA 3PLQA 4Q4V2 3VBUA 2Y48A 4FXKB 3RWNA 3WB2A 4BQWA 4RS5A 1J58A 4OLLA 4YGDA 1F8VA 3V65A 1DGSA 4QU2A 2QKSA 2W1SA 4R6ZA 2E51A 5FZIA 2TUNA 1NH2B 4HPKA 4LF6B 4I01A 1Y67A 3SPIA 2NPIA 3E6BA 2EIBA 2XNDG 1GOGA 1JCHA 5FTTC 5IYYA 3E8BA 2IU3A 3OOXA 2Y69B 2GC3A 2QQIA 4S2HA 1B3QA 3HKDB 2YI8A 1FPN1 5IY5B 1R1A3 1NQDA 4X1IA 3LA7A 5FDBA 3T1CA 4MXWB 4R9DA 1GM7A 4HN0A 4F83A 3SCFA 1LB2A 3P5BA 4Y20B 5ANQA 1FJGO 1LOAA 1QJU3 1CVNA 1MPXA 1WA4A 3CJIB 2Y6LA 1NR1A 3VKLA 4UXNA 4XAAA 5FZKA 1O9HA 3AG2B 2X5IC 4A7YA 1PZ7A 4X62B 2YZ4A 3DKWA 2QDOA 2VZSA 3T09A 1NAEA 4LF8O 4CA9A 5I0DA 4IE5A 4YW1A 3WG7B 2G19A 2Y34A 5FLIA 1EAH2 4NOTA 3LA3A 3LZZA 5LHHA 3HKBA 4UW5A 2PYTA 2WWUA 3CE2A 4JC1A 2ZGTA 1Y4WA 4EJRA 1R1ZA 4QGLA 5FZGA 4JAUA 2X10A 4JI3O 3JSNA 3ON7A 3C7EA 2WLKA 4XFFA 1YI2V 5IYCO 3OT7A 3BIEA 4DV7O 1SPPB 2A3WA 1YHFA 4E4DX 5KXCA 4RFT0 2ARAA 2D6MA 1SESA 3SJQC 1WKYA 4LKEA 4CDQC 4L11A 3CJHB 4LF5B 2FHRA 3AMHA 1QMJA 4FLYA 5JPNB 1ULDA 1OH3A 1XBLA 3URFA 2KG7B 2ZR2A 1KS4A 5A32A 4JKKA 2B1GA 5CBFA 1H2LA 3ZMTA 3GZTB 3WU2Z 3VBFA 3L71H 3UK9A 4PLOA 1CX4A 1UJWB 1FATA 1PIV1 4AXOA 2RJZA 1S5JA 3M3OA 1FXKB 3BB6A 4LWSA 1ZREA 4WFFA 3NV3A 3ZHUA 2B9VA 4LT5A 1WW5A 4TLFA 3AG3C 3JD3A 2EICA 5CEHA 2X8KA 2PHLA 5JAXA 1QY4A 3UO2A 2BGCA 1PNMA 2J1EA 4F3JA 5LMNB 3I8TA 2EJ7A 2TEPA 2NLRA 3H01A 3R65A 5IFPA 5FZ3A 2HLDG 4I55A 4XZPA 2YFZA 3U37A 4O9GA 4QE9A 3U4SA 4AR2A 1BYHA 3Q8FA 3N2GA 4FLTA 2IUWA 1QJY3 3UGGA 4LLOA 2WO3A 4M0HA 4YZ4A 5HV0A 3JZVA 1K7DA 1BMFG 2IXCA 1NCRA 1DTOA 2AACA 5DM6V 3UNPA 5L7OA 5FMOS 1GZWB 4BLIA 4K8RB 4NHMA 5JI9A 1MS3A 3ME2A 2W68A 4GMP1 4LF9B 5EHDA 4NRQA 1F15A 3H1WA 1WLWA 1MS5A 2B5UA 2PZSA 1S2BA 3O0VA 4AG4A 3I55V 1S0FA 4XBLA 3JAWB 5E88A 2WAOA 3GNEA 2OUJA 4DB5A 1UIKA 4YW4A 1EUTA 5A70A 3A22A 2P4VA 2WFF2 2P6HA 5F3IA 4IE7A 1K5MB 1DYPA 2D3OW 1URXA 2VMIA 5A6QA 4K0KB 3V0AA 4YARA 5LA9A 2CYFA 1H8TB 1AR72 2VVFA 1JA8A 4WF9V 1V55B 4KP4A 1ASJ2 5C9AB 4FIPC 5CFCA 5FRAA 4EN8B 1MQTB 5FKCA 3BOPA 1B6QA 4AVBA 1AR1B 4TV8A 1AUYA 1O9GA 5FQ0A 4ORFA 3SCGA 4CP1A 1JHJA 1X36A 2GN3A 5L3CA 1RUJ3 2VQAA 5CA1B 1ZUQA 2YIDA 2ENRA 2DQ3A 2Y6KA 4LLFA 3K51A 3MHHC 2UURA 2RJKA 2XKOA 2ZHNA 1MOFA 2BNMA 4AYUA 2EIGA 4AEDA 1I0HA 2JS3A 1LAJA 2BE3A 4I0XA 1TME1 1B35C 2O14A 1O3RA 2MPFA 4ZONA 3A0KA 2BGOA 3U78A 3VQWA 2R072 2ZKOA 2D93A 2ITCC 4QHZA 3K9SA 3RI9A 4XETA 4M4PA 3EXAA 1K97A 3F5TA 5FAXA 2VMCA 4KGGA 2OZJA 2HEPA 3WINE 2XASA 1S3JA 3SPJA 3H3ZA 5KA6A 2W1UA 3ZN1A 5BNNC 5DABA 2Q68A 4PF1A 4J1WA 2CL2A 2GDFA 5GZEA 1IS6A 5FLJA 5L19A 1K5JA 3N9LA 5LRRA 3O0WA 2C6SA 3QTCA 2RHPA 3JB4C 3IN9A 3UKTA 4K3AA 4YVSB 1OD3A 2B42B 1H0BA 5C3QA 1ZL8A 1SQ4A 4EFBA 1RUE1 4XHBA 4YIOA 4TV9A 4XE9A 2HKOA 1W6PB 4IIJA 3K48A 2XWJB 2RMU2 3ENRA 3E97A 1HP8A 1IG0A 4OXSA 1U5IA 3ORJA 3B93A 4J10A 3SYPA 4YJ2B 4AQSA 2ARBA 1XL4A 4LXLA 1JXNA 3WQ7A 4NHYA 1XYNA 2EULA 1W9TA 1SLTA 4DY3A 1QLEB 1O8PA 2BYVE 5F6LB 3CEWA 1K12A 1OI6A 1H2GA 3SDLA 3FYIB 2D7FA 4FP3A 3T08A 4X8AA 3HPLC 4P2ZA 3TRSB 3OM3B 2D5FA 4A41A 4HPKB 3B94A 4MYEA 3HR9A 1JN2P 5IK7A 2JDMA 4GYCB 4MGTA 1SDWA 3SPGA 4B8EA 1A6CA 1GQHA 2EIKC 1LGNA 1ENVA 4QX0A 3F5WC 3I97A 3ZR5A 4AI1A 3KZ4C 1V6NA 4DK0A 4X1IB 3K79A 3CL1A 2VXJA 2JDZA 5KMGA 4X1KB 3ZPOA 2BTQA 5JSRA 3KMHA 1RUF2 5IVYA 1N33B 1V6OA 1KGYA 2ZAHA 1RUG3 4GIQA 5C7GA 2BVBA 4PDWA 2XQXA 4C7UA 1TVGA 2YPDA 3LPGA 1M06G 3CB2A 4Q8LA 2Z3YA 4ZU5A 1QJX2 4JYCA 1NA1A 4J42A 2XMLA 3LDEA 2EA7A 3HN1A 3I59A 1DQ5A 2HBTA
chains in the Genus database with same CATH topology
5DUXA 3HT1A 4WV8A 2OZ6A 5AVPA 4FAHA 4XF0A 4FPEA 3BU7A 3UKNA 2BNOA 5DDJ1 4CTEA 3ILFA 1RUI3 3OTFA 3N3HA 4LBMA 4LBQD 4I0WB 2WC2A 1CAUA 3O12A 1X82A 5T55A 4Y5Z0 1V6JA 5GALA 1HRV1 1I9RA 2E53A 1GYKA 2A6WA 3WDTA 1RUD3 2CV6A 1LKNA 4LE4A 1C3HA 2DVAA 1DZTA 4JDNA 4UW6A 4U2AA 4AGRA 5DZGA 4AQ2A 1PVC1 3IM0A 1QJY2 4JDOA 4EN7B 5GZDA 1IS3A 4OHYA 4YG6A 1J3PA 3B9CA 5C8WA 1BZWA 5T5PA 3OJBA 5BNOA 2RS31 2ZPXA 4M3CF 5SV8A 1V6LA 1WBFA 1PIV3 2Y26A 3L2YA 4I3PA 1TE1B 2Q30A 1H1MA 3VHNA 3KT1A 1X7NA 3AP4A 2JE7A 2QQPA 3BTAA 4I30A 5A33A 1DGWX 1NCQC 3NKGA 1RUC3 2HYKA 3ATGA 1LECA 2BWCA 5L36A 2C0ZA 4HZFA 3M4FA 1G9AA 2I2SA 1HX6A 2WL1A 1W0OA 1F2NA 1Z7S3 2WNVC 1PNFA 5I8SA 1GQGA 4GWMA 1YIPA 2C1FA 3TBDA 2WKKA 4ONUA 3ST7A 4NVPA 3VBFB 1H2NA 2RR11 1RHI2 5KHKA 2GALA 3L9JT 1OIHA 5FOBB 5E89A 3WW1A 4FOQA 3V0BB 2PHUA 1D4M3 3V17A 3KSCA 1LCLA 2HWC3 3LOBA 1VB2A 3WQ0A 1RVF1 3AB0A 2RJLA 3OGGA 3USUB 1VR3A 3ZPYA 4WVWA 3LGRA 1E57A 2JJ6A 3ZSMA 5GLUA 1X33A 4E4SA 5HBAA 4RSUA 4XF4A 4XJ9A 2R1DA 4L99A 2VU9A 3WOGA 5J7MA 1AVBA 2R061 3MPBA 1VIWB 2PAMA 1KITA 2VW0A 1O4ZA 4CDWB 2LTNA 4TWTA 1H4HA 4E2GA 4IEVA 2GNDA 1REDA 3J8F3 4X8NA 1BVP1 1ZZBA 1AXZA 2UWCA 3GYDA 3Q9OA 4K20A 4KGQA 3WCRA 4N7UA 2RMU1 2WQ4A 5BNPA 3LA2A 3HD8B 3NL1A 3VBSA 5JPMB 1FX5A 4Q27A 4UXAA 4KU8A 3BIWE 4FQZA 3IDEA 1AHSA 1A8MA 3AKRA 1FOD3 2P34A 3FUQA 3MEPA 3CU7A 4GMP3 3QH7A 4KG8A 4CEYB 3FX3A 1A78A 1RUJ2 3AM2A 4LBOA 1VB4A 2QDRA 2RS11 3EXUA 3IT8A 3FBYA 1WLTA 1LULA 3FFZA 2IFRA 2BQPA 1CQ9A 4AFAA 2YDEA 1KJLA 4PJYA 3ZXDA 3AXEA 3MLLA 1RL3A 4S2GA 3DGTA 4XTPA 2WT1A 5CADA 3BODA 1QDOA 1N1VA 4XFBA 1A8DA 5T54A 1Y0ZA 5JOWA 5AVAA 1NZCA 2ZCWA 4LNVA 4AK3A 1VLNA 1ND2C 2W52A 1UL9A 3GZUC 1UZZA 1N47A 2O8OA 3CJXA 3UJOA 4BCUA 4QPGB 1C8M2 1SLCA 4MZUA 2VOKA 2A3YA 4U36A 4LUKA 1Y7BA 3IDCB 1NQJA 2VMHA 2Q4AA 4RR3B 5L7OB 2OUHA 1TMF1 4CDWA 3X29B 2WZPP 4CDUC 1IPKA 2V73A 3H50A 3WR0A 2UYBA 1J1LA 1K5MC 3ZFGB 3N4MA 1AYM3 5JIUA 1VAVA 2DTYA 4Q4Y1 2DUQA 2OG5A 2X5IA 1J3QA 3WP3A 3ZYRA 4OJ8A 4Z2WA 3M7AA 4CEYA 4AI3A 5EXOA 1H9PA 3VBHB 1VBD1 1IS4A 1OQEA 1JYCA 5D1IA 5D8AC 4CDQB 1LHNA 3D82A 1ZBA1 3N36A 1VBE2 4GKXA 4LE3A 4W6WA 4XW3A 4C1WA 5K0UC 1PHMA 4Q0VA 1G86A 1FI2A 5CVRA 3NV4A 2HWD1 3VHRA 1AR91 3NO8A 4H7MA 4QPGA 4WM8C 5BV6A 4WZCA 1O4TA 1U5YA 1DBNA 1BBT3 4RR3A 4AF9A 3RMYA 4Q4V1 2GMMA 2HKXA 2WNVA 1OQ1A 3GBWA 2DVBA 1GNHA 3WHTA 3WV6A 1JW6A 2VNRA 4COUA 2VPVA