4Z2WA

Factor inhibiting hif in complex with fe, and alpha-ketoglutarate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Substrate Promotes Productive Gas Binding in the alpha-Ketoglutarate-Dependent Oxygenase FIH.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4z2wA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z2wA01
5JWPA 3P3PA 4B7EA 1H2NA 2CGNA 4BIOA 3D8CA 2WA3A 1H2MA 1MZEA 1YCIA 1IZ3A 4AI8A 1H2KA 3KCXA 3P3NA 4B7KA 1MZFA 4NR1A 4QU2A 2XUMA 2W0XA 4JAAA 2WA4A 1H2LA 2YC0A 2ILMA 4Z2WA 4Z1VA 2CGOA 3OD4A 3KCYA 2YDEA 2Y0IA
chains in the Genus database with same CATH superfamily
2W52A 2HWF2 1KS4A 1L3JA 3VDBA 2HYXA 3OTOB 4JAVA 3VKMA 3ZRWB 3VV1A 1NXD1 2CWMA 3QACA 3PLQA 3K77A 5IWFA 2VOTA 3OUJA 3OT7A 2YB7A 1AR62 3CRAA 4CVUA 3L72H 4CC6A 3MHZA 1U5IA 1Z5VA 5FP8A 4C8DA 1S5JA 4TV8A 1Q7YW 1Q8IA 3RWKX 5D8AC 1LNSA 1TVKA 4H3WA 1WN7A 1DQ0A 1AI7A 2BP6A 1SDWA 2D5FA 3RDIA 1OD5A 5KAFZ 2XTAA 5C9AA 1A6CA 1QNYA 1IDSA 3BALA 2Q4PA 1GU3A 3AK0A 4OUMA 5D5PA 4WVZA 1CAWB 2IU0A 3C7HA 3PJQA 3JALA 3MW3A 4PA3A 5IT9N 1DYKA 1BSMA 4DR5B 5IYCO 1IVSA 1OD3A 1F4MA 4I5SA 2B9ZA 1WPBA 1RM1C 4MGQA 2WQ4A 1UJWB 1VF6A 3B40A 1KFXL 3K5LA 3SPGA 4QT6A 1SZTA 3KMHA 1JU4A 2DVDA 2QQJA 4N53C 1XEQA 3LKJA 5A32A 5FUNA 2ZGOA 2R043 1US2A 1OH4A 1ND3C 2WFF1 5DZEA 2WLKA 1LKNA 1NU1H 3E8HA 3H8OA 1ZUQA 1OCCC 2F4LA 2UUAB 1VQ7V 5BNOB 1IPSA 3AMNA 2VTXA 5GLTA 1HRV2 5FY0A 4TYSA 4CP9B 1JS9A 1O6UA 3UGGA 4DR5O 2ITCC 1BQ0A 2R1DA 1R3LC 1QQP1 1F2NA 2R70A 3G6BA 1LRHA 3OEHG 3CYOA 4MADA 1NVPB 3W7UA 2RMU3 2BTQB 3GZUC 3GBGA 3H1YA 2VQ0A 4ZKIA 4Q0UA 1GKBA 4I02A 4PLNA 3RNSA 5BXXA 1CZVA 1AX2A 2RCVA 4NHKA 2UXCB 2XJSA 4QPIB 1O3SA 4R9DA 1HQLA 2DVFA 1SQXH 3ZX6A 4EN8B 3L9JT 5FY5A 1RUC2 1UOGA 3UT5B 3R4UA 4BM8A 1AXKA 2DDUA 1N32O 4TUYB 3KVBA 1NKGA 4JI2O 2E75B 1SLAA 1ZZ6A 2CL2A 2WAOA 1D0HA 3KV9A 3OGCC 5FZKA 1QR9A 4PDRA 4JDOA 4FFFA 3MF6A 2UUCO 5LP6A 3ZN6A 5EJZB 2FL4A 3ZYPA 1ZYBA 5L9BA 1JZ8A 4NPRA 5K7PA 1Z0HA 3X29B 4OVEA 1HN0A 3RZJA 2RS51 1WLDA 1W9WA 5H2FZ 5BUVA 5IK7A 4KGGA 1I5XA 2UXCO 5A3PA 2KXLA 4HPKA 2EVXA 4RAIA 1W59A 5CBFA 3ZSEA 1W03A 3B3QE 3ZKUA 2C24A 5C8CB 1SBEA 1VBE1 1KDKA 2GAUA 5KHIA 4YG6A 5A1AA 1EPZA 3C3TA 4Q4Y2 1V9U2 3EB7A 1F51A 1R1A1 2LALA 1CAXA 2XJRA 4DY3A 3A0HZ 4OXSA 5JIAA 1UNBA 4R4ZA 4JI5O 3N35A 1CQ9A 4Z1VA 1FV3A 1GN3A 1YFWA 1YYNA 4YJ3B 4HSJA 4O4JB 2E9QA 1M4UA 4DV2O 2BNOA 1OKQA 2BBAA 4CDUC 3POBA 4MGTA 3HQXA 2WS93 3ZDVA 5IJRA 2Y69B 3LOBA 1JCHA 1K8AW 4ISQA 2F43G 4KGQA 5J2UB 1WB7A 3M3CA 1W3XA 3VL8A 2QWPB 4GUNA 4XDLA 4BQWA 2BOJA 4JV5B 2LGQA 1OH3A 4FPKA 1LENA 3F7VC 1VAKA 3S7IA 2R063 4R50A 3JQWA 5BNOC 3M7AA 3OYWA 5GALA 1GOHA 4P00B 1H8VA 2XHKA 3SDLA 2VW2A 1XPWA 4Q0SA 4XC9A 4DY5A 2C9AA 4YGBA 1ROPA 1MS1A 5FZFA 2B46X 4JGSA 4H44B 3JCZA 1N47A 5H9CA 3CMAV 3I59A 1WW6A 1XOUA 5FMOS 2CTQA 5GLWA 1S5HC 3H42B 2ET1A 1H2MA 3D6EA 2XJQA 1MZ5A 3W5NA 5FO7B 2IJKA 3J80N 1KP3A 4O4HB 3VDDC 1NZ6A 2C2AA 2VBDA 1ZBA1 4PD4F 4XTPA 1I6XA 3BAAA 1W05A 1R081 4QPIC 4GX5A 1W39A 4R4XA 5EV7A 1WW4A 1R64A 3I3DA 3J8F1 3JAWA 5G04L 5FPUA 4OHVA 3Q8EA 1KP2A 5KUMA 3ORJA 5KC6A 4CPBA 2CTVA 1W9TA 3THDA 4Q1PA 1XHXA 3THCA 3IDEA 3POEA 4H13B 1XDCA 5DG1A 4LHNA 4I55A 1HWYA 4FLZA 4R52A 4NXNO 2W3JA 1COWG 2GN7A 1NUKA 4J25A 3T3YA 4HKLA 3ZPYA 4Q4V3 2WLMA 3WQ7A 5A7SA 3KQ4B 4BOWA 2W92A 1HNWB 1CD3G 4S2DA 1N4CA 4OGQB 1FI2A 1OBNA 2PHTA 2YFUA 3E8FA 4IETA 3O1OA 3S3WA 5DG2A 2EIGA 2F17A 5C8CC 5J96B 1G8MA 3RZGA 4FSJA 2J42A 1Q8VA 1C8M1 1YZBA 1XRUA 4LBNA 4D94A 1MEC2 1FNZA 3HPLC 2A7WA 2JK5C 4L97A 2C9KA 2CYFA 4MXWA 4AYUA 1XMQO 5FIXA 3VZKA 2DURA 1C5HA 5T5JA 3SHRA 1H4GA 4CDWB 1Z7S3 4HSLA 4A6OA 4DV1B 1LODA 2AZ5A 4G9SB 1K12A 2CY6A 1A8MA 4AK3A 3B9CA 1QBZA 1LEDA 2GNMA 3ZIXA 2Y69C 4CZZA 3IIIA 1L7RA 2H3OA 3DYMA 2WNVA 3PL0A 4YW3A 5FMBA 4YPJA 1UIKA 5ACA2 5BMVB 2PHRA 3E5QA 4EB6A 3ZR5A 3VD4A 5FYTA 5FQ0A 1XILA 2E3CA 3LDEA 2XHNA 5ERLA 3HNMA 1DHKB 2BSKA 1W8HA 2JDHA 4FM2A 1YNAA 1JHJA 5IYZA 4JZ2A 2Z5WA 5FZDA 4HNAA 2RS33 1TME2 3M3QA 5CBLA 1AJNA 1LNQA 2NR5A 4JYYA 1WP7A 1CIYA 5FKBA 2JXAA 4W6XA 4ONUA 3O0WA 1GZWB 4JQRA 3OM3B 1COV1 4LA3A 5E6HA 5LBEA 4RHV3 2JGUA 3V0AA 5FLHA 1L8DA 3IIAA 2E32A 3ICXA 5DMYA 4NTXA 3ZRVA 3VBHB 4K0KB 3FUOA 3HR9A 4CU6A 2WRAA 5FXVA 1DK1A 2HJIA 4JC1A 1JX9A 2DWEC 4C7UA 2ZR2A 5HCFA 4DRRA 1BQZA 4LC1A 3W58A 4CCDA 4I0WB 2R071 4Q8KA 4DUZB 1QJX3 4HVOA 4AZZA 4P30A 1Q81W 1R6TA 2DN9A 3AJYA 3UV9A 1WLCA 1NLSA 2PAMA 4B29A 2X6BA 1AR91 1XJAA 4NUBA 3ZLIA 4K40A 3HJRA 5FZOA 2V1DA 5KBFA 1LOAA 4EFBA 3BRCA 4MHRA 4D3WA 4GH4A 4JKKA 4IE5A 4ASLA 2OX0A 5HBAA 4COWA 2HWE3 4RGAA 1YIFA 5LEJA 4DFSA 3LSDA 4K3AA 1XYOA 4PQQA 2IXJA 3ABLC 4GMP3 2XBO1 1YFXA 1RUNA 1XC6A 3G67A 4OHWA 4DIQA 1YJNV 4OYUA 3DECA 1SFPA 1GTOA 1OJHA 4X1KB 5A3OA 1B06A 4LWSB 4PHZA 2RM22 3UM7A 3S57A 3PUQA 5FPXA 2WT1A 4XUTA 4G3YC 2P2KA 4FVMA 1DF5A 4Q4X1 1K4CC 3MAQA 3A21A 4YJ2B 1QU7A 4H0LB 1UY3A 1UO9A 3FWEA 4I0BA 4DV5B 3SJAC 4PLMA 4OQ9A 3J7NA 1VE0A 2JG8A 4CDWC 2IW5A 4BIUA 1H9PA 1L7LA 1RGSA 4UCRA 1BBT1 2G19A 1PZ7A 1WWYA 4XDQA 3AX4A 4DRVA 4QX2A 3JD73 3PVNA 3OSDA 4KHPO 4QKNA 2JS5A 1J5EO 4RQPB 4XVHA 1VBC1 1PK6B 4LFCB 3ZR6A 2WKKA 2WLQA 4A42A 1BEV3 1T5EA 4GJZA 3UK9A 2UUBB 5JZGA 3KV5A 3G6JB 4X62B 4QPGB 3ZMSA 3AZWA 2ERFA 1VBB2 3MZHA 3JASA 4N43B 4DR1B 3VBOB 4Y26A 2V09A 1CAUA 1NLQA 4B3RB 4N9IA 1BT8A 4UW5A 3ZMNA 3E22A 1H38A 3USUB 4AHZA 2QKDA 1FYJA 2EIJB 2XASA 4CBCA 2YY1A 3AL5A 4W6YA 2BVVA 1RPRA 2UY9A 5A33A 2CHHA 1VF5B 2BTOA 3VBHC 3LEIA 2YFZA 4EYUA 4XW3A 1ASJ2 2UUBO 4IUGA 1HJGA 4DR4B 1M4WA 1WCKA 3A0KA 4FCAA 4CUAA 5JXGA 1HRI3 4IE6A 5DXDA 4DO0A 2ARHA 4DR1O 1O3TA 3E35A 1BQPA 4B3RO 3ZN0A 3B01A 3T4VA 3WG4A 4CA9A 1NTMH 1NT2B 4NIIA 1J3QA 1GN4A 2XL7A 3C3VA 4ZU5A 1WLTA 3FX3A 2GV9A 2W68A 4KWUA 3WG7B 3ZS8C 2CV6A 2UXDO 5E89A 3ZFGB 1NYWA 4C0HA 4DR3B 4UW3A 3NJZA 3ZOIA 1NCQC 4EN7B 4AILC 3SNMA 3A0RA 5BXZA 1I1EA 1O9HA 3LA7A 4EFEA 3V65A 2UXBO 4XF9A 1PKXA 3K0GA 3DKQA 4AOCA 4GJYA 1Y9MA 4P14A 3AVSA 4Y1ZA 2VZRA 2UURA 2DYRC 5JVDA 1QNWA 4CP2A 1EAH1 1UKGA 4QPWA 4DR2B 4CDXA 5ITZA 1JHNA 2JDAA 3L2HA 4ZOLA 1TNFA 1FAFA 2R72A 4UBHA 4ET7A 4CDQA 4AI0A 2HWC3 4LT5A 1B35C 4DR3O 3FAVB 4YW4A 2VZUA 1Y9GA 2DJVA 3A22A 1NE6A 4K6BA 1RUD3 2Q7GA 3I3BA 4ZHQA 1PK6C 3O5SA 3EYPA 2VUDA 5FYZA 3U75A 2DBNA 2ZDIA 5LL6Y 4C90A 3CL1A 4QPJA 1MQTA 1R6NA 4UFHA 1PM4A 3JBG1 3F5WC 4XF1A 2WFF2 3WQBA 2AW9A 4N43C 3TNPB 2NPIA 1CWPA 1VLNA 2XAFA 3CS5A 3ACHA 2W87A 1IX9A 4HANA 2O8QA 2EIJC 2VZTA 1N3OA 1WA8B 2YUEA 2XOMA 3LSUA 2HWF3 2VU9A 1K45A 5LMNB 2VW1A 3FUQA 4ARXA 2LFRA 4CRQA 4BW9A 1H1IA 1QQP2 4MGIE 3ST7A 1AR63 4H33A 4FPFA 3WP5A 4B7KA 4LOSA 4D6TH 2UXXA 4JI0O 2B39A 3G80A 4YIPA 4YZ2A 1DLLA 3IN9A 3GDBA 4YW5A 5FPBA 5A6ZA 2VOXA 2ES3A 3IB3A 2PHXA 4TTGA 2C6SA 3HBKA 2Q30A 4QB1A 1AP5A 3DKWA 4M4PA 2YICA 1KKCA 1NH2B 1P4RA 3U4XA 3FLPA 4CH3A 5C3OA 2QKAA 2OCCB 4O2AB 3DV8A 4BQ3A 3L74H 3NV4A 3H1KH 4FPPA 3ZFGC 4J11A 3NV3A 4FTEA 4B3SB 4O2BA 1NH2D 1JYXA 2K1EA 2RS52 1AL0G 4LNUB 2VCCA 2ETEA 2DQ3A 5L73A 1GANA 3B9IA 3L70H 4GKYA 3K48A 4IXLA 1RUF1 3I2HA 1Y66A 1VQ6V 3RYFB 2WN3A 3WNPA 5F8PA 4DV6B 4DUYO 2Q8EA 1Y76B 3OR7C 1CESA 2EIEA 3ZMUA 3LUTB 3QCWA 4M3CB 1N0NA 3IPVB 3WNOA 2ZABA 4IQPA 1Q56A 1R1A2 4LF6O 3DSQA 5B66Z 3KZ4C 1GWLA 2HJDA 5B3SB 1IQDC 4W4ZA 4DR6B 1QKQA 4DRXA 4ICGA 5AC91 3NKGA 4YY3O 3I3MA 5DECA 2GSYA 3OPTA 2VBBA 1VEWA 1DIWA 3WG3A 5C3SA 2CDYA 5FLXN 4BAYA 4BQXA 1QHDA 4DOUA 3BI3A 2EZPA 2VBPA 1N1VA 4COZA 4MYEA 5A2QN 2BZDA 1O91A 1QOOA 3IAQA 3T0AA 4FXGB 3ZFEC 4L87A 5IWAO 3T0DA 1RUC3 5APAA 3F7YC 3USSA 5LOVA 5JJEB 2VMHA 5BR8O 4GYCB 4UI9L 3K3WA 3MDSA 4DEVA 2WQ8A 2HVKC 1N36B 5FY4A 5IVYA 3MHHC 3IT8A 4LF7B 2VQEB 3POIA 3BUCA 1E5HA 3HR0A 4IT5A 4O9GA 3ZMTA 3AL6A 1K92A 5GLZA 5FYUA 4GKXA 4AVBA 2VOKA 4TZDA 1M5IA 2H0VA 1LOFC 2BW8A 3Q8BA 2WWSA 3NAPB 1NA1A 3WP4A 2NMOA 4AL9A 1AR81 1H2SB 2R1BA 3AKTA 3EQEA 3ZXFA 1GZTA 3PVBB 2A3YA 2J1UA 3BIWE 3ABUA 5C8YB 5E8AA 1ZBA2 3ZYGA 2WFPA 1N34O 1M93A 1R082 5M0TA 4N21A 2GDSA 2WNOA 3UGFA 1E5SA 1DGSA 3LSQA 4DB5A 1WNSA 4YYOA 4GIQA 4Q4Y3 2ILMA 4Q20A 1WUVA 3J7AU 3O14A 1V9U3 1VQ9V 3J8F2 1LHWA 1W2TA 2QTOA 1AI6A 2VQEO 2DMXA 3ZPOA 2DCZA 3CJIC 3ASOB 2OCCC 2QUOA 3RFRA 2WABA 4UXNA 5JH7A 5F39A 3BTXA 4FOYA 3VD7A 2UWCA 4IGOA 1J59A 1SPPA 2I07B 5F5QA 3OE7G 4BYYA 4QDRA 3GWKC 3UESA 3BA9A 1IHMA 1C3HA 4X66B 4NKGB 1Y74B 5H5NA 1K5MA 2W9XA 5CKQA 1DQ1A 3CKHA 2XG3A 3IAYA 2QBXA 3KVAA 5J1XA 3MUZ1 4FPGA 3AG7A 5HCHA 3ETEA 1HQNA 3LA2A 2QFEA 5FPOA 2ZE7A 4OMDA 5K0UA 1OFSA 2ADDA 5D2AA 5JR2A 1C8M2 1NR1A 1D7PM 5TSWA 3SITA 5FR3A 1AROP 3J4UH 2GZWA 2RNBA 1SERA 5KHJA 1TG7A 2BOBC 5C4WA 2XWBB 3FB6C 1VQKV 1YC61 4YVWA 2XOKG 5B3SC 3GGLA 3E83A 3I8TA 3MLJA 2QSAA 3AP7A 2LW1A 1US3A 1UWWA 2B8MA 2Y6JA 3OW2U 2JG9C 2DWDC 4K20A 4LKSA 4MV2A 3RN4A 5JVVA 4MZUA 4KMQA 4GQ7A 4Z07A 4UXAA 1R1ZA 3QH6A 3DPRC 3R66A 2FCVA 1AJOA 4I9WA 4EROA 4DR7B 2GHYA 2QM8A 3R4SA 3B4SA 1CX1A 2W2IA 3N3HA 2JJ6A 2XUMA 5DAWA 4BU2A 3LFMA 1JZ4A 1GRJA 2OPKA 2H6BA 5E88A 4YW2A 1NAEA 5C70A 1RJ7A 3ES4A 2X5IC 2JGDA 3PU3A 4IL7A 3RYCA 4QE7A 4UCSA 3NL1A 4AEJA 4DUVA 4JDMA 4FJCC 4JRLA 1YXWA 3DN7A 1C57A 1LCLA 4X1YA 1GM8A 4LF5O 3I3QA 3CX5F 3NAPC 4F83A 1JYIA 1COV2 1MZFA 1XNDA 2DFBA 5F3IA 3WDVA 4OZXA 3KKYA 3UJOA 1AILA 2QGNA 5B1OA 3SJBC 2W1SA 1W8FA 1ACCA 1A78A 2W0FC 4J10A 5B5EZ 1MEC3 2VAUA 2IU3A 2B5UA 1FAYA 2R072 4XFFA 3VD5A 1Y4WA 1SQBH 3VBUA 3RSJA 2QTSA 5CBHA 3OPWA 1YTFB 3BTYA 1AR92 4B4QA 4PF5A 4TLGA 1ZNPA 2A3WA 1F23A 3GM8A 2YEVA 5FLIA 2HLEA 2MW2B 1GQHA 3W59A 5LXTB 3VLBB 4AHYA 4V1PA 4JI1O 1YSCA 2L6LA 3C7GA 3KSCA 3ES1A 1FD9A 2XBO2 1YTFD 2ODMA 2OWOA 4IL6Z 5LW9A 5ACA3 2VUCA 5F7UA 1RINA 4W4LA 2WUHA 2ZZJA 2Y4TA 2OQ7A 4R9BA 4JZRA 1LGCA 3MIBA 4R8CA 1T6GC 4DZGA 2PTMA 2RE9A 4B4RA 3TEZA 3ABKB 4IGGA 2R0FA 1TME3 2VXJA 1KBHA 1RSOA 1FXKC 3IFXA 4UUJC 4WM8B 4UCTA 1ZZ8A 4XETA 2RR11 2EIKB 3CXHF 5F6LB 1YF2A 5FBZA 1LGBA 4Y20A 2PYTA 1RHI2 3PN1A 3WHUA 2DYCA 3T2MA 2VCMA 1DF4A 1O4YA 1GP4A 1UF2C 1XU2A 1K3IA 4ZI7A 3ROUA 4A45A 3MBWA 4LQRA 1NCRB 4UF0A 4HOOA 4CXWA 3MIFA 3MIDA 3NR7A 1VBD2 1IPJA 2VR4A 1QVGU 1VBC2 4KBZA 1S0IA 3C8XA 2A6XA 4AHCA 2BUKA 2QJVA 5EHDA 5DUWA 2FDHA 1N1YA 2GMMA 2GH8A 5B4XA 1ZLZA 1W9YA 1XNCA 2L9LA 4J41A 2ZEWA 4JI7B 4X8AA 1EZJA 4Y5TA 4WZCA 1GQPA 3D36A 1N3QA 1JJOA 3VGIA 1YHQV 4GKKB 3E97A 1ENRA 3ZN5A 4W50A 1RJ8A 2ZJCA 1IKPA 2HHHB 4MW8A 5A70A 1IBMB 1D0GA 1EN4A 1GKFA 4OHYA 1KQSU 1QLNA 3U4SA 4Y4RA 5BNPC 5HI0A 3WFVA 2RM23 2K9PA 5DUVA 5EIYB 1R3IC 3AG3B 4OHZA 1DDLA 2X53S 4MTXA 1AI5A 5D1IA 1RL3A 1S0DA 3FFQA 4TV8B 4LBQB 4QQLA 4PJ0Z 1TVKB 5KHHA 4JI7O 2Z4FA 3V64A 2JJ2G 4R6ZA 3WCRA 5LEKA 5C9AB 4AQYB 5C5TA 2XLGA 3LPGA 1D2SA 4QXBA 3JALB 2EIBA 3J7LA 5FO8B 2MK3A 1PZ9A 1VMHA 2HHHO 2BNNA 1PM7A 2D3RA 1MR5A 4LBKA 5EJ3A 2Z42A 2Q7HA 2J1VA 4TN7A 3MDPA 2FDGA 1ZWIC 1PO21 2J7MA 3VBFA 3SKVA 5A32B 1B04A 1BGYH 4IYIA 2JWPA 4RR3A 3ETDA 4AGVA 4PDWA 5EC2C 3EHKA 3ABKC 2ETNA 1JYWA 1XI1A 5FPRA 3E5XA 1X9PA 5GZGA 2VZQA 3H1JH 1ODMA 3I55V 1XYNA 3LFIA 4WM8C 3KS7A 4AQYO 1EAH2 1BS3A 1EPWA 2QE3A 5E16A 4UFZA 4V2VA 4XF4A 3I2DA 2NQYA 3MICA 1S0CA 1DLCA 2PN5A 5FYBA 1Q3EA 5FKCA 5DDJ1 1V6LA 1Q5OA 4MT8A 4Q4W1 2VZPA 4U7NA 2HWB3 3OF1A 3APQA 4PIXA 1ASJ3 3GWOA 5A7PA 3L73H 4KL1A 1ALYA 2X6AA 3KLSA 1G9FA 1BK0A 1XREA 1DGRA 4FZ0A 5B2GB 5FAXA 3POWA 4ATEA 3JBG2 2FZ1A 3POGA 2RDQA 4YZ1A 3ZCCA 3LOIA 3GZEA 1SF9A 4QM9A 3EFFK 4UVBA 5LP6B 2V7QG 3EHBB 3ZN6B 1L7QA 4JPRA 1W0PA 5CZKA 2K0GA 3SYQA 4NIAA 1P84F 2W47A 4X89A 1IBLB 1MVQA 1E1QG 1D2QA 4LO8A 1QWRA 4LFAO 4HN1A 1TNRA 2AZ0A 2X09A 1XOYA 1HNZB 4AVCA 3LZZA 3BU0A 3AG3C 4HPKB 3VDAA 3SR2C 4LK6A 4AVSA 4AI2A 4DUXA 3H0OA 2E7QA 1ZZ9A 3ZYFA 1RUI1 5BV6A 1QY4A 4A7YA 2QTWB 3ZYBA 2EILB 4QD2A 1FJGB 2P34A 1WZXA 4WVVA 4QX5A 5C9AC 1CAXB 5A6XA 4YGCA 2O1QA 4E8DA 2DUOA 1FKAO 1W6OA 3JXSA 4NHLA 2B5HA 5LA9A 4FTBA 3VUOA 4F6RA 1Y7BA 1HB4A 3L75H 1VQPV 5CIRA 1IBLO 1CPMA 4BDVB 1N33B 5LMUB 4QX8A 3WINE 2YS8A 5C3RA 4ABMA 4PDVA 1QU0A 3SEPA 4BJ0A 4BH9A 3VBRA 2FDJA 4EQVA 5IVCA 1VF6C 1HNZO 2VH9A 2WZPP 4A7ZA 3LQCA 2Q8DA 4MVUA 1VIBA 2AEYA 1DZRA 4C1XA 2WAAA 3BN6A 3FC0A 1PNKA 4AAXA 1GOFA 2JIJA 1G86A 3U0ZA 3HKDA 1RUF2 1GZCA 2J1TA 2WFF3 1QLEB 2WLLA 1LB2A 2QDNA 1XMOO 1IXMA 4GKJO 3OYWB 4JTDB 4XURA 3LA3A 1BXHA 1QHTA 2VL4A 2JICA 3ZSJA 1EN5A 4YM1A 1HQWA 1W6MA 4R7CA 3W5MA 4TOIA 3I59B 2VZOA 5F2VO 4H7LA 1WD4A 5JJNB 1QQP3 2N04A 4AFMA 1BZWA 3SPCA 4NIGA 2XKPA 5AC92 4TT3G 3T1LA 2QM7A 2FB5A 2P6HA 3FLTA 5KMGA 4MX3A 2QWQB 4OLLA 2ARBA 2IWGB 2JRIA 4NPLA 1SETA 4XXAA 3JB4C 5H9PA 1UPIA 3MV11 1RXGA 4UCVA 1F8VA 5LA2A 1LR5A 3JAWB 4IV1C 3HEIA 1QJZA 1FMD1 1K7DA 4LHKA 5CA1A 3FYEB 4Z82A 2QKCA 4O9EA 2EIMB 2FTKA 5LP6C 4INDA 4I55B 1Y43B 3RI9A 3VKNA 1OQ1A 4MOAA 1R6KA 3HD8B 2Y0PA 4K8FA 4AI8A 1SQQH 4LORA 2ZGNA 3CD6V 3AKQA 2AH2A 2CTPA 2ZGTA 4CPBD 5CA6A 4JGYB 3LDBA 3I49A 2RS53 4HAMA 4LH7A 3IDBB 4XIKA 2IH3C 4CS4A 1AR82 1QDOA 1X36A 3DXRA 4LF9B 4ATFA 5FZ1A 3RYIA 3WQ1A 2OT5A 4BZ4A 3HB3B 3FHIB 3J81N 4XF3A 3K5MA 3CMGA 4RS5A 3OY8A 3KCCA 4FPLA 3CCUV 1VBE3 2ZM6O 4QKFA 1D5NA 4MXWB 1JFFA 1X33A 3LAGA 2GDFA 3FLRA 4G27B 3LE0A 1R1A3 3RMXA 4N7UA 1UZ0A 3WVJA 2BQPA 2OPWA 3B8MA 3RZMA 2FQPA 2XVKA 2LP7A 4A5UB 5AG2A 1J3PA 1ZX5A 1TUEB 1H6XA 3MYXA 3K4AA 3IMMA 3MIHA 3VL9A 4C0BA 4S2FA 3PUSA 3DL3A 1V6KA 3LDCA 2ZX0A 2WNVB 3K58A 3KGZA 3IGAC 5LHIA 1POV1 4JTAB 5J3UA 1NT0A 3NWKA 5FYIA 5GTHZ 3QNEA 4L2NA 4UFIA 5B1NA 4XAEA 2AEZA 4EB6B 1MOFA 4LITA 5FQ0B 3CCJV 5EZWA 1QLEC 3LNNA 2F23A 2VWJA 1VQ8V 2JIZG 1E5IA 5IYZB 4MH0E 2LROA 2YHJA 1QJU1 4Y5SA 4HNAB 1NQTA 4XDOA 4I50A 5A3LA 1HV0A 3IJ4A 1TMF1 2HWD1 1JZ5A 5FZ7A 4E2LA 5GZDA 2VMDA 4TSVA 2TBVA 1PNLA 3CB2A 1QOSA 3V0AB 4ZBMA 1XBFA 3AZVA 4FLTA 3WX5A 1NS1A 1NQDA 4DV0B 1YQ6A 1RP3B 2HYKA 2CGPA 3ZIAG 2VVEA 1YJKA 3U37A 2ZX3A 1ZBA3 5KC5A 2YC2A 4AWDA 1R083 1UX7A 3A0NA 5BNNC 5LYJA 2JDUA 1XNQB 5LGTA 2IBZH 4WM7B 2TEPA 3BA8A 4KH9A 2R32A 1QDCA 3AKSA 2AHZA 4OMCA 1DQ2A 2KG7A 3TGUH 2EIMC 3RYHA 1AJQA 1PGSA 1BJQA 4CDUA 5FZOB 2QM4A 1CPYA 2UU9O 3RS6A 2Q5ZA 1SG3A 5JQGA 1JA8A 2ZOEB 4Q1RA 4LFBB 3LB9A 3TXSA 1EN6A 3BFRA 4JI6O 4JGYC 1URFA 5EXOA 5IFPA 4PA9A 3E6BA 5BYNA 1W06A 5J48A 2YXHA 3ELNA 4CP1A 4AFAA 4BQ2A 3APBA 3S6PA 3ACFA 4P9YA 2QR4A 1APNA 1MS3A 5BY5A 3K04A 3HKCA 2DQ0A 5FZGA 1RUH1 2N74A 2GUZA 5BNOA 4PA4A 4FFIA 4CCLA 3RVYA 1C8M3 2UXNA 4KP4A 1M9NA 2A73B 2FMLA 2UYBA 4LUMA 1MG1A 5FRAA 1FS0G 4NIHA 4KI5M 4XF0A 4FO9A 1PVXA 2W94A 3BVCA 4KWLA 1UY2A 3M3OA 4IEQA 1EM1A 3HKEA 1PGW1 2RDCA 2CGNA 5IVVA 3CIHA 4XFBA 5H9QA 4NWWA 1REDA 1G6UA 4LFBO 4QX0A 2OTJV 3VDDA 2VMGA 1JOYA 2AACA 3AKPA 3LSEA 3ASNB 1G9AA 2ZGQA 4QPIA 2WNVC 1DG6A 3NJYA 1HNXO 1I94O 4KU7A 5JJJB 3LWCA 1LU1A 1GYKA 4TUYA 1F7YA 4BWAA 4XABA 5JZGB 1PIV1 2EINC 2WJSA 2EJ7A 4WVMB 5IE9A 1LGNA 4W65A 1GH6A 4TV9A 4FOVA 3LEGA 4HLTA 3JASB 2YIBA 1VMFA 3O1PA 1CAUB 4QGMA 4LF8B 3E22B 4QGNA 2RR12 1W6QB 5F9TA 2NNUA 1NZIA 4UBGA 1COV3 5CBGA 3J7HA 3PHMA 5FK7A 3MF9A 1D2DA 3K08A 5FNVA 1IURA 1WW7A 5A33B 4DV3B 2ZMNA 4O4IA 1OFNA 3DGEA 3E86A 3OMIB 3JUUA 1OCRB 2VCBA 3ZM8A 3WDTA 5KWRA 4XXPA 5FJKA 4WM7C 2R073 1KJLA 4JF3A 2WA3A 2Q0AA 1X9TA 4D8MA 2ZEZA 4LF8O 2BTVC 2EZOA 2PI5A 4HKWA 4GZ9A 2V72A 4D6QA 4JHTA 4Q6GA 4X88A 2EA7A 4LF4O 3UO3A 2OQ6A 5A3TA 2DU0A 4ES8A 3HOBA 4H37A 1W6NA 1QXRA 4DW0A 3AFKA 3MLLA 5I0TA 4XCAA 2JVDA 2XBO3 4P9LA 4OI2A 5A3UA 3H1IH 1OZ0A 4MO3M 4AAPA 4D7SA 4FLVA 5JOYA 4NRMA 5FUIA 2VVFA 1WPXA 5LASA 1IZ3A 4HBNA 2LM3A 4Q4X3 1DU3D 2BDRA 1O59A 2HEVF 5JVDB 2DCKA 1SQPH 4CDXB 3ON7A 4MVRA 2ZE8A 1X59A 5T55A 4X65B 5L3BA 4ZOLB 2QWRB 2ORXA 2RDNA 5SV8A 4CH6A 3HN3A 1I3HA 3NV2A 4O4HA 2HEYF 1BBT3 4CDQB 2WO3A 3CEWA 2EALA 4XFGA 1C28A 3ASNC 4FM1A 4EV0A 4AEDB 3IKWA 1AVMA 3RZLA 5EBLC 1W9SA 3PUIA 2NM1A 2L35A 1HXS1 5C3PA 4NXMB 2PHWA 4AQ6A 4ZHQB 2WZEA 2MHFA 4BXFA 1WMFA 2WL1A 1VBC3 2VWKA 4QNHB 4UCOA 1PO11 4P5HA 1PO22 2DFCA 2DYSC 1MQTB 4QIWF 3OBAA 1FV2A 5DABA 3DUIA 5L19A 2FYUH 4LBEC 3W9AA 3ZXLA 1MACA 2AGAA 3K03A 3ILRA 4DV7B 3JU9A 4K1YA 1K5QA 2CTWA 2DVBA 4CCNA 3N2KA 2B45X 1JXNA 1SZXA 2NYYA 1YUDA 2A75A 4B8EA 5FUPA 1H4HA 1RMU1 3CQOA 2P6JA 5A9GA 3J26N 5GONB 4I3PA 4BQ5A 1XNRO 1SHWB 3T1MA 2QQMA 1J3RA 4HONA 5DDJ2 5EBMC 4Q4W2 2R7EB 5AFBA 4JYAO 4IIJA 3OUSA 1OCRC 1DF0A 5J2TA 3AK1A 1KKDA 5JXIA 5KXDA 1S77D 4V2WA 2RV9A 2GN3A 1ZVFA 2ZAAA 3IMNA 1UKRA 1UN1A 1HKDA 2P90A 5EFUA 3G4SV 5K9YA 5FZAA 5JUVA 2HWC2 4P9WA 4DV4B 3VHPA 1RIRA 4U3JA 4XUQA 4CSWA 2LUWA 5I8SA 1RUD2 4UWDA 3VHRA 3VZJA 4U36A 4QDQA 5LY2A 2M6YA 1Q8OA 4GLXA 4FLXA 1UIJA 2ZX1A 3W7SA 4DXSA 5BMVA 2VNVA 4EN0A 5C3QA 5B1AB 4Z2AA 4JI4O 3KT7A 2Q68A 1AX0A 3PUHA 4FVVA 2YXYA 5L3CA 5J7MA 1RB8G 2RMKB 3CJHA 2Y60A 4YHHB 1H1AA 3ALQA 2GC1A 3ZSMA 1AB3A 1ZA7A 3TOJA 2YBPA 1RUI2 1JN2P 4CDXC 1JODA 2Q69A 2P4EA 1EAH3 5JIUA 4WBNB 2F95B 5L9VA 4JTOA 5FP7A 4BIZA 1U96A 2CSGA 1FFTB 3JQXA 3KHBA 4A2UA 3CCVV 2ZACA 4X64B 1DGWA 4X8PA 4BHPA 4LOTA 4FPHA 3N7KA 4AEDC 4HMZA 2JKBA 2ZZQA 3QTCA 2ZX2A 4DRXB 3ZSKA 1XBLA 1UYYA 1V55B 3H01A 4JGZC 2E63A 5SV5A 2Y6GA 3K5NA 5JXJA 3GF6A 2CH7A 4ASUG 4F3JA 1VB2A 2VZVA 5K1PA 4YHHO 2VS0A 1ZRIA 1MQTC 4FPYA 4UFLA 3TRSB 5JLVA 3MD0A 2JDKA 4LIUA 3I56V 1QMJA 1AXYA 1FXHA 5LOVB 3JBG3 5HV4A 3OTOO 4LO5B 2Q73A 1US6A 1KYOF 2QNKA 4XZUG 3ZHRA 1X82A 4CCKA 4M0HA 2IC1A 4YW7A 1GLHA 4LO7A 3QG5A 4JI3B 3N9MA 1NCQA 3MW4A 3H50A 5JPMB 4M01A 4XBQA 3AMPA 1SCSA 2DE0X 3TWIA 3I2GA 5CADA 1L1FA 5EYPA 2QCSB 1NA1B 5KHGA 4A7KA 4CCOA 4IESA 1PX3A 4R9AA 2ZTNA 3RZZA 3INAA 1FOD1 3AYAA 4NROA 1ZX3A 1WLWA 3WW3A 3ZX7A 1JOJA 4EWDA 1U5YA 4IE4A 3BCWA 4JVAA 1DLBA 3CE2A 1JYCA 3ZMZA 3JAKA 1SBDA 3K3OA 2O57A 5HXMA 3AZXA 3KCYA 1JOPA 2BOIA 3CRRA 5FYHA 4URAA 1IS5A 1FMD2 1B35A 1C8NA 5IUQA 4K35A 1HX6A 3AEIA 3ZYRA 1MZEA 4L0PA 2Q5TA 1KECA 3OEEG 1FFXA 5JH7B 3VHNA 1UPGA 2FHRA 5FMDA 1AVBA 1ZRDA 1WA6X 4E2QA 1ENSA 3WLUA 1VF7A 5JCOC 1CZTA 3BOPA 2UUAO 5B1AC 3CCMV 5JSOA 3WHTA 3TB0A 4K8RB 3N9LA 2Y26A 4AFCA 1G9DA 2QDOA 2DCYA 4MSWC 1JU3A 3WW2A 4TLFA 1AXZA 1RUF3 3C7FA 4WF9V 2R16A 5K0UB 4GMP0 1C1LA 1MABG 5IJ9B 1LTEA 2JEMA 4FFKA 1XNTA 2D3OW 1IOAA 2WO1A 5CA0A 2ZHLA 2QQLA 1QQCA 3ITQA 1OV9A 5C4WB 2BBVA 1XNBA 1K5JA 4YVWB 5BZBA 2IJHA 1LOBA 4AGGA 1DGWX 4QGPA 1Q86W 1A34A 1J1LA 4ES9A 4MUVA 2KB1A 1RVF1 1OURA 1V55C 1OVPA 1ENXA 1S3JA 3I3EA 1HDJA 3WSOA 2Q7EA 5AC93 2R49A 2ZE6A 2ZT9B 1X7NA 1ZRRA 2V4DA 4IE7A 5GZEA 2JE8A 4GWNA 1KDMA 3B7MA 1HJFA 2SBAA 2XGXA 4Q0VA 2P4VA 4A4AA 1W3VA 2NLJC 4E2SA 3RYPA 4PCRA 2WIIB 4DK1A 2UU8A 1TAEA 1JUHA 1G9CA 2A1XA 5FTTC 3X2QB 3NJXA 2RQ6A 4KWJA 1H8EG 4BCUA 4MSVA 1OF4A 3D82A 3P5BA 4R8HA 1PMIA 2JGDB 2GNBA 4UYBA 2CAVA 2LW8A 3ZFGA 1QJU2 1UOBA 3SJQC 1RPOA 3NNMA 3RYCB 2P5OA 4XJ8A 3VZNA 3N9NA 1UQXA 3K0DA 4IEYA 3TBDA 4TWTA 4WVWA 1TUBA 5FYYA 1IBKB 4FIPC 1MA1A 5L36A 5JMOA 3VKFC 1QEXA 1NA1C 2R9AA 1SACA 3O1MA 2QQIA 3EVKA 1YRZA 1IKQA 4QJFB 3WDYA 4NHMA 4XEZA 5IT6A 3OG2A 1AR83 4LEJA 4Z1MG 2G9ZA 3ZEDA 2ZINA 1GNHA 1URXA 3ZHVA 4XTMA 3EMRA 1JUIA 5KXEA 2OS2A 4OFGA 3STZC 1PM9A 3SYCA 1H8TA 3UYJA 3VBUB 1KU9A 3B93A 1V6JA 5EJ1B 1IBKO 4JV5O 1F9KA 3VHOA 1JZ2A 2QWNB 3RJ2X 4WFFA 4PDMA 2GTAA 5HPOA 1X8EA 4J6GA 1YIJV 2JDNA 4HN0A 1JBCA 2FKXA 1QR8A 3ZFEA 3NNLA 4ZPIA 3CC2V 1ONAA 2HBUA 3K46A 3O12A 3WD5A 5KA6A 2BGCA 5K0UC 2WO7A 5FL7G 4AVVA 1XL6A 1GN6A 1Y4MA 4OI0A 1RSOB 1D4M1 2BFUS 1LOFA 4YVWC 2ZX4A 3R05A 5LBQA 3THTA 3ACGA 1MS5A 2X05A 1VRH1 4XZPA 1PGW2 4Y20B 2EIDA 4Y1YA 3S5QA 2ZGPA 3F95A 2GNDA 3FYIB 1ULPA 2VVDA 4N9HA 1ZRCA 2XWJB 5IK5A 1I5YA 3VQWA 1K33A 3ZDSA 4P9PA 4ZI7B 2YI9A 4DS0A 2NMNA 4YM2A 1STMA 4UF0B 1QCEA 1RYYA 4L92A 2LS6A 3MI8A 3VZMA 4RL7A 1OOPA 4LKFA 4B3NA 3CJIA 3X2QC 4XDJA 1WMDA 4RQEA 1YO8A 1PIV2 1WP8A 1NOVA 4GT1A 3ECQA 4I0AA 3HKBB 3MGUA 1BKZA 1HNWO 3UQ8A 2WZ8A 2XQRA 5BNQA 3ETPA 4MGYE 4AVTA 2HP8A 4LR3A 1M57B 4LNUA 4LPLA 3LDDA 2QQVA 4CU7A 3MV01 3NNJA 1IS4A 3RYFA 5L3FA 3U1XA 4GX1A 4MGZE 2J1EA 1BL8A 4RWUA 2YZ4A 2A9HA 2ARCA 4DUWA 4F4LA 4DV1O 2VCAA 2ZGSA 1G1XB 5BPXA 3WF4A 3KZIZ 1L0LH 3WUCA 5A6QA 3NRUA 3WEZA 5FJHA 3THPA 3S3XA 4HG6B 3ABZA 4N8MA 2P3KA 4FQZA 3VBUC 2FMDA 4NN0A 5GW7A 2JG9A 2BWAA 3C7OA 3N7JA 2F4VB 3T1YB 1QJEA 4FZ1A 3DPRA 4B1LA 1S0VA 3O0VA 4I9QA 5FPLA 3BY6A 3TN91 1SQFA 3VKOA 1G8WA 5KHKA 2QWOB 1SLBA 3MIEA 5KUKA 2VG9A 1JOBA 3VBFB 1UOFA 4RGGA 2RHPA 2X5IA 1MZ6A 2EXKA 4RR3B 2CTRA 5LBCA 4PDWB 2VD7A 3BU7A 3IAPA 5JWPA 1OKOA 4MVZA 1FXVA 4K0KO 5FLJA 4FLWA 2ZKLA 3T1YO 1P49A 3IWZA 2ADPA 4O4LA 2RR13 1GWKA 3SPHA 5CG8A 4DUZO 2ZGRA 1EUTA 4AR2A 3AKRA 5JOZA 5FY8A 3SEEA 5D21A 2W6JG 4BR6A 3FBYA 2QKSA 3A2FA 3DTUB 2JB4A 2WSUA 2ZAHA 3DC5A 4Y22A 1LHVA 4C1WA 3SJCC 1HXS2 2P3YA 3IZOA 1F4AA 1MSDA 2ARAA 2P3JA 2VQAA 1XE0A 1PO12 4NB5A 1RUE1 5HCAA 2OIIA 2DUQA 5LZ6A 4JAUA 1WGPA 3ZHTA 5FWEA 1MNGA 1SA0A 3CRMA 3OMNB 4KG8A 1M06G 3D36C 5FZEA 3BVOA 5FP3A 1RUOA 2Q67A 1RMU2 3H8XA 5CFCA 3ACLA 3F2ZA 1H0BA 1UMHA 4DV5O 4AE2A 3LEMA 2VW0A 3LF7A 3WDUA 2SLIA 2ZNJA 2D6PA 2R9IA 4NR1A 2TNFA 5FO9B 2PHDA 2C0ZA 3OBTA 2OZJA 3T2TA 1ST8A 2OYQA 5EC1C 3DXTA 1FXKA 1ZZ7A 4KNCA 1UY4A 3P30A 4X20A 1KITA 4CTEA 3RZKA 2Z2SB 3KB5A 1PD3A 1GBGA 2XKOA 1AR5A 3FB5C 4LFCO 2HWB2 3P32A 1W6OB 2Q4SA 4AF9A 5FYSA 2XXZA 4U3FH 2DVGA 4B3MB 4F6RB 4X62O 4K8XA 1CZSA 1TVGA 1WCDJ 4LLOA 5KR7A 5I93A 2A7AA 1Q43A 3NV1A 3ZXKA 2PYLA 3TEYA 1F4HA 3OBRA 2V5DA 2ZKNA 4B08A 3VBRB 2CDPA 4FOWA 5F2SA 5LA6B 2VNOA 4FFHA 4XUNA 4LO6B 4L9BA 3VBFC 5DEDA 1PO23 3CCSV 4RR3C 1UX6A 3ZN4A 3HKDB 4PDWC 2F4PA 3LIHA 4AGRA 3DEMA 4ZU4A 3JB8A 3V0BA 2WLLB 2G38A 4NHXA 4KQ7A 2IM9A 3M1HA 4K8ZA 3KCXA 3NSTA 2A71A 4UB8Z 3AB0A 5DPNA 3WCSA 3ZYHA 2OVUA 5F6KA 4LNVA 2E51A 4DR4O 2R0HA 2KR2A 1EUUA 3JARA 5T5PA 3ZXAC 3VBSA 1UOJA 1VQNV 5BNPA 2DCTA 5DDJ3 1QVFU 3RYKA 3P6BA 4LTAA 4Q4W3 1YHFA 5B4NA 4UVAA 3T1HB 2W91A 3BYWA 1NTKH 4FMTA 2YGLA 5KMGB 4HKOA 3ZHQA 2ZHMA 2UWBA 2KM2A 3OPZA 1PVC1 5EQUA 4Y24A 4U2AA 4XBFA 1YI2V 2XL9A 4E4SA 3AMMA 2AENA 3ZFFB 1SLTA 1AJKA 4JYCA 3O1SA 5FYVA 2NN4A 4XJZA 4RO2A 5CA1B 4RQPC 3SQOA 4JASA 3MPPG 4W4KA 4NHYA 3RWRD 1ND2A 1OUSA 3N36A 1DP0A 1CXZB 4I30A 2BFUL 4YM3A 1BVVA 4QPGC 4DK0A 1GMGA 1GP6A 1NZCA 3H7YA 2VUAA 2R6QA 3E2EA 4FPOB 4QQOA 1SEFA 4DR2O 1WCUA 3R4DB 2WA4A 2P7TC 1VBB1 4TWKA 1VMJA 3VBOC 2D93A 3RW0A 1OPMA 3DXRB 3M3EA 2V4AA 3WP3A 2B1IA 1O5LA 1WKYA 3RYIB 1OCCB 1OCZB 2Y64A 5IAXA 4OPAA 1WBLA 1FOD2 4RS5B 3OY8B 2D6KA 1RUI3 5JI9A 1JZ3A 5DAQA 3CRCA 4EE2A 4OX9B 2C5DA 2H6CA 1QNMA 3T2QA 2WPDG 1JFFB 5LRRA 3RQ0A 4DXTA 3OGSA 4E4ZA 1O9GA 1CX4A 3N7LA 1P7GA 1W6PA 1G6NA 1X50A 1I5ZA 4DPNA 3B8NA 3FFZA 4AVAA 1AR71 3B09A 1O7FA 3LCPA 3I97A 3FL7A 1OLMA 1LJ7A 2ADEA 2YC0A 4ZONA 5LK5A 4BK5A 4YVSA 3Q9OA 4LXLA 3UKNA 3WG7C 1NI8A 5LMNO 4XHBA 4XHXA 3TAYA 2UY8A 1G4YB 2YIDA 1W04A 2VY0A 4MLOA 1U97A 5CB4A 2E53A 5L7OA 5CNAA 2VMCA 3PTYA 1OI6A 1JYVA 2EJRA 2WQZC 4I50B 3W21A 5JDBA 2VM9A 4YM0A 4E4EA 3OCPA 4O61A 2FDIA 4RD7A 1O8PA 1YQ8A 5IYDO 3D3AA 3ZYIB 1W0OA 1XB9A 4AQ2A 2IUWA 3ZO0B 1VP7A 1RVF2 2N05A 1RUJ1 1W8TA 2P67A 1VBE2 1J83A 3T0BA 2XUEA 1QJY1 2VZSA 1LOEA 4LBQA 5IDJA 1DBNA 4FPJA 3UNPA 1BZKA 5LYJB 3ZFFC 1I0HA 1KC8W 4BE3A 4HL0A 3LEKA 4B3SO 1OT5A 4O65A 2ATKC 1R1BA 2WINB 4BMEA 2KG7B 1IQAA 1FMD3 1ZSPA 3RYHB 3WB0A 4CDUB 1V9PA 3WNLA 3RWNA 1JVMA 3ZXGA 4I0XA 3ZHSA 4YRDA 4CEYA 4DV6O 3AFGA 5JQGB 3K51A 5FP4A 1W90A 3BKZA 5JSRA 4CCEA 2VQUA 1KD7A 4XDPA 3R6SA 2A3XA 3BOWA 1OCZC 3HKCB 1W2UA 2GUZB 4MGKE 2ZMKA 4KXRA 3JAMN 3T1CA 4RS5C 1N32B 1QF3A 4HYOA 4DR6O 2G9GA 5I8TA 1XNAA 2ZQMA 2Z69A 4YGEA 1GN2A 1BVP1 4JI2B 4YIOA 2VMIA 1NY71 3HT1A 2ZS6B 3H1HH 1KXGA 4MVMA 2UUCB 1IG3A 1TEIA 1KRIA 5JOXA 1KB9F 4GD4A 2H94A 1AR1B 1SC5B 3HKEB 3E8BA 5IAVA 5CFDA 1SESA 3MO4A 1EYBA 3QLQA 2E33A 2NLRA 2BYVE 3VDDB 2H8PC 2WNUA 4LKDA 1EY2A 4UT5A 3ZRSA 5FZ8A 3C2UA 1N36O 4LF7O 1NVPD 4NTYA 1UL9A 2JX9A 1VQOV 4IEWA 3OEBA 5LBFA 4IV1A 4SBVA 1POV3 1SFYA 1OHHG 3BHPA 3KD4A 3DYOA 1H1MA 1LOGA 3RI8A 1FPOA 2WWUA 4Y33A 4TV9B 3QO7A 3ILFA 4JI5B 1GM9A 3WR0A 3G71V 3QO8A 1MSWD 2IVIB 3T2OA 4I4TA 3FJSA 1QJU3 3WV6A 2VNRA 4DV2B 1WCQA 1D4M2 2G4IA 1UD1A 3HIFA 1TMF3 2HWD3 5C71A 4G28B 1VRH2 4QDSA 3E6CC 4F6EA 2ARXA 4HT1T 4ORFA 5D5QA 4DW1A 2ZXWB 5FNVB 4UW6A 2YIBD 3ZKYA 4O4IB 1Z5WA 4AQTA 2PAEA 2ZEYA 3ABTA 1SBFA 1W9FA 3CCEV 1VQLV 2QQNA 2HLDG 1E57A 4GX2A 1K5SA 5C8WA 3MW2A 1VIWB 1ZZCA 4CS2A 3SXWA 4HVQA 1I7FA 2JD4A 4RUEA 3N2GA 1X4TA 5IVEA 3PVEA 4CEWB 4X66O 4YNIA 2VUJA 3H9AA 3PDQA 4J42A 2J1SA 4ZS3A 1Q6UA 4ASMB 3AJZA 3E89A 2GSMB 1BMV1 5FZ6A 3NKTA 1SQ4A 1V6MA 5HV0A 2XH6A 2VNGA 4XMIA 4OUSA 1O4ZA 3ASIA 1W6NB 2BERA 4FM0A 2D3PA 2NZ9A 1M1KW 3OEAA 3GJAA 3HNBM 2EAKA 3D5OA 4FT8A 1LU2A 4SLIA 1GV9A 1PNFA 5T52A 5FP9A 3W7WA 4WBBA 5I0SA 5C93A 2X8KA 2Y38A 4K3UA 3AMHA 5FV3A 4QB2A 4PA7A 1V0AA 1RUH3 2CUGA 1NLRA 2OT7A 4EKWA 1Y67A 4ZZ8A 4J7KA 1ULGA 4LBJA 4FPCA 5I0DA 2BU9A 1NG0A 4QQHA 4NTWA 2QEXV 4NXNB 4LHSA 4DR7O 5CG9A 3LDRA 1K9MW 2MEV1 3AG2B 1AR4A 4Q8LA 5K4LA 4GXLA 1DTOA 1UZVA 2FD8A 2I2SA 1UU5A 3H9VA 4P5YA 1OF3A 2XAJA 2GMPA 4XAAA 1V00A 3VDCA 4ZS2A 2LJ2A 4NOTA 3TN92 5BNNA 1JW6A 4CYDA 4C91A 3ASOC 3PTRB 5ABJB 2BE3A 4META 5F5AA 2Q6AA 4UFKA 5FYCA 2CGOA 2ATFA 1CJDA 2W46A 1XMQB 3H7JA 2VQTA 1HR0B 2WWJA 4E4HA 4EEQA 1PIV3 4J80A 1YVWA 5EP9A 1CGPA 2KD7A 4NO4A 4ZHNA 1EV11 3ZSLA 4BMBA 5CKNA 5GKAC 2MNGA 2D3SA 2VTFA 3N2KB 2Y6HA 2OZ6A 1IGOA 3ILNA 1JI6A 2I74A 3ABLB 4JGYA 5T50A 1ZBE1 2XVGA 3FB8C 3WDXA 2ORZA 3TEXA 4L8QA 1YIPA 2ZXWC 1OA2A 1AYM1 2GH2A 2ZIOA 2Q0OC 2YGMA 2XJPA 3N9OA 1O8SA 3NVCA 4Q4X2 4FAGA 4MVOA 3PJSK 1O3QA 1PGL1 4IIJB 4A6SA 5A1FA 4NJ4A 5J2TB 2F6BA 1W2NA 1UYPA 1LOCA 1HR0O 2FDKA 1MS0A 5EYXA 1FYUA 1S76D 2ZBJA 1BBT2 1PHMA 4CEWC 2WYSA 4N23A 4U3JB 2D5HA 2IXIA 4XYXA 2DBIA 2PHUA 2FDFA 1SMVA 2PLV1 1RUE2 3OGIB 4Q26A 4XFAA 1I08A 1VAMA 1L0NH 2XJVA 3BCCH 2EF6A 4P02B 4YZ5A 1W8ZA 2IJIA 3A4UA 5FBJA 3D0JA 5H6RA 1CAVA 4LE3A 4J1WA 3ZYJB 3TJTA 5IYBO 4K21A 3ZXEA 1YWKA 1WD3A 2DTYA 4WCEV 5FZ0A 3SH3A 3JATA 4JHZA 3WOGA 4XFCA 5BY1A 1A32A 3CJHB 1XE8A 1S4CA 3RPQA 2PELA 3NNFA 1AJPA 1MS4A 1SQGA 1QGLA 1ODNA 4JRAA 4BWOA 1AL21 5C7GA 4NVPA 4DYLA 1XHZA 2JEUA 1H2GA 1R093 3AG2C 4X6RB 2YXSA 4IERA 1YFYA 2XJTA 3HVDA 5HFMA 3QBQA 4BLJA 2RG4A 5LB6A 2XAQA 3K9SA 2X29A 4MG2A 1S2KA 2AZ2A 3JD0A 3JD1A 4I01A 3UO2A 4M00A 1VQ4V 3AP4A 4AXOA 2J1RA 4Z92B 3LGRA 4XACA 5ABJC 3H8UA 2YROA 3V56A 4WM7A 2CH7B 1W0NA 1HXS3 3GNEA 3L9DA 3WG1A 3M70A 1N1SA 4FFBA 3DCQA 3SCGA 2JJ1G 2A06H 3I54A 1GUIA 4MGSA 4GKKO 2IZWA 4PELA 2AHYA 1PO13 1MPXA 2IJJA 1AUYA 2HBTA 5CU1A 1YJWV 1IBMO 1QH7A 2CWSA 2V5YA 2EICA 3A8TA 1W2AX 3GJBA 4AW7A 1KJRA 1VAVA 1Q6HA 3CCRV 3Q4HA 2OUJA 4TQFA 1ENQA 1NCQB 1RMU3 1DQ4A 4KHPB 1J5EB 1S55A 3MPBA 3KT4A 3Q8AA 2VPVA 5EYPB 2LRPA 4A44A 1PNGA 3GHMA 1S1AA 2LGWA 3OGRA 2EIKC 3JCUZ 2GU9A 3JSLA 1PZ8A 2E26A 2DYRB 1IS6A 5IJ0A 1VJ2A 2IXKA 3GCXA 1PVC2 3JAKB 4D6RA 2YUAA 1RHI1 3CJXA 5EPAA 1BK1A 4UV8A 1AYN1 4G2KA 1ZL8A 1M90W 1HDKA 1YI9A 3OGGA 4KUMA 4XFHA 4MW3A 1V54B 2VE1A 1B35B 3O1VA 1NCRC 3UL2A 5EBWC 4IW3A 5EZYA 1RC6A 3SKJE 1FPN1 2GNTA 1FFXB 3AK3A 2K9ZA 3GYDA 5DAVA 1VBD1 2XQXA 2W08A 4IV3A 5GZCA 3GVMA 2ZPXA 3I7DA 5KXBA 3H8RA 3QH7A 4HK9A 3RG0A 4PIZA 3PNAA 3H3UA 3N9PA 4WVMA 2JENA 4OULA 3PIJA 4GB31 2W1WA 3KQRA 3CZUA 3SC7X 4EZHA 3CO2A 1RUG1 1YQCA 5KX5A 4WFBV 1M56B 3J9SA 3OB8A 1CEZA 2WLIA 2RS11 1YLLA 3GCWA 4LO4B 5JSPA 2QA4V 2WN2A 3CC4V 3WF1A 1W6QA 3OUIA 4DINB 1ULEA 5CA0B 3AG1B 4CUBA 1R3JC 1VBA1 2E7TA 2ZXQA 5EWSA 2UXDB 5ANQA 3WNKA 1S0GA 1YJLA 1XSRA 1SRYA 1UY1A 3H3LA 5FOBB 1G7YA 5DZGA 4IHJA 1YCIA 3AXDA 4CCJA 1PL4A 3K79A 4JYBA 2UXBB 4KBBA 1VPHA 4CCMA 5FY9A 5K8SA 2Y0IA 4LCUC 1AR72 1N3PA 3FHQA 3UETA 2X7RB 1CVNA 1OQDA 2PMWB 1YJ9V 1VR3A 3AZZA 3C90A 5FXWA 1GMMA 2GTSA 1IG0A 3LNMB 3CLPA 1FT9A 3AYDA 2Y6KA 5LATA 4E9KA 1A3KA 1UU4A 1GR3A 2D7FA 1H6YA 1KFUL 4HZFA 3M99B 5FFOC 3POFA 4J9YB 2JECA 3RMYA 5IATA 2WZR1 1VQ5V 2WBKA 3AM2A 3B00A 3FKSG 5FMOL 5A3MA 2JDIG 1ULCA 3K4DA 5LHGA 3NMBA 3RT3C 1TUBB 3STLC 4QMAA 5ANNA 3RRDA 2ZCEA 1KQRA 3BB6A 3HPNA 1RFYA 1FJGO 2YSUB 1HB1A 3AP9A 4M0NA 2VOWA 1RUJ2 4QKDA 1PMHX 3FB7C 3ML0A 3BIEA 2D6MA 4K9SA 2Z5UA 3RJRA 4JTCB 1QJY2 5KAIZ 1FOD3 3RYRA 4GULA 3FMGA 1N33O 5LMUO 3CBNA 3PURA 4OI1A 1YXBA 2VXRA 5EIBD 2B7YA 3MIGA 1V54C 1H8TB 4AEDA 3ZMOA 1V70A 2WLNA 1IPKA 2ITDC 4QKBA 1J1TA 3FN9A 4B1MA 2ZHNA 2XR4A 3S5AA 1H2KA 2W5FA 3UKTA 4COUA 2VMFA 2YBSA 5D8AA 4JGZA 5FZLA 2Y4UA 4J1XA 4AQSA 2MPFA 4XBNA 4PA6A 1GZ9A 4RGKA 4OHXA 4FBFA 2DU1A 4Q2FA 2DCJA 3ETQA 4NRPA 4JI0B 2O14A 4ASKA 4FFGA 4CU9A 3QO5A 3PIGA 2VO5A 3THOA 1DYOA 3NW4A 3PUAA 3ZFEB 2HH9A 3KG2A 3E6DA 4EWEA 1K97A 4D6SA 2WLJA 1M56C 1GAXA 2A6VA 5IYYA 2LW7A 1K4DC 4EN6B 3S0MA 2D2CB 3U07A 1FX5A 2YI8A 3R65A 4Y1UA 3AYCA 2R041 5GONA 2W1QA 2OUHA 3AG1C 1O5UA 4N53A 3T2PA 1OC1A 2E31A 1NY72 1ZREA 4CU8A 3WY6A 1ND3A 4OZOA 4UAPA 1NTZH 1UPSA 1HW5A 4NIDA 4D0QA 2YPDA 3SLIA 4NPMA 2YPJA 4CCCA 5GZFA 3K59A 2IFWA 3KV4A 2X10A 2J1AA 4DNYA 3HMYA 2EILC 2V73A 1RVF3 2BGOA 2XDVA 3BEHA 3I4IA 5CB7A 3ZXJA 2ZKOA 3FX7A 1C4RA 3E1F1 4X6QB 2BNMA 1KS5A 2ZGKA 4M4RA 4XJWA 4DUYB 5H9SA 2RMU1 4IGQA 2XHBA 5CVRA 5J98B 5FZHA 1JZ7A 3HT2A 1VARA 2UWAA 3JD4A 1DFQA 1OOPB 3CJIB 2CK3G 4YZ4A 4NRQA 3VD9A 4LF6B 4H14A 3OUFA 2PFWA 3NXSA 2VULA 1JQ0A 5JPNB 4GALA 2P22C 2P3IA 2PQQA 2AGSA 4X1IA 4LF9O 4BISA 4CH5A 4Q0PA 5I0RA 5JCOA 5A7OA 4S2HA 1SCRA 5LRSA 4ZZ5A 4PF1A 1GSLA 4YY3B 3WDWA 1WW5A 1HV1A 2C4XA 4GZRB 1W8UA 4RFT0 5A7WA 1CP9A 1PL0A 1BHAA 2BSKB 4AEMA 5EIBC 2WYFA 3IDCB 1CPNA 5LHHA 1G9BA 2EAAA 3MUY1 1S5LZ 3MFCA 5CN0A 5IWAB 4QAWA 4KWKA 4IEVA 4WBNA 2JDZA 3ZRWA 5GTIZ 1HRV3 5BR8B 1HN1A 4XMAA 1DGLA 2A3QA 3CEIA 3CF6E 1YEWA 4EWAA 3I5DA 2H0BA 3HAGA 1H8TC 1POQA 2HEWF 2GALA 3Q8FA 2QQWA 4J9ZB 5LK7B 2Q8VA 2JG9B 1W28A 1EZVH 3BTAA 1GP5A 1F5JA 2PY5A 2IVJA 1BMV2 3TK1A 2GP5A 3DPRB 4J7JA 3L2YA 3EJKA 3G7DA 3JZVA 1E1RG 3VZLA 1CAWA 3POYA 1K42A 4FLYA 1LHUA 2W0XA 1N34B 2WO2A 1ULDA 2WT0A 4AI3A 2WS91 3H1LH 1H9WA 2NN8A 3M2MA 3ZJZA 1JTZX 1UCXA 2AXTZ 2DWRA 2LO1A 5KA5A 4X9QA 3T4DA 2X5IB 4GH4B 2ADQB 1LEMA 2JIGA 1GQGA 1WB8A 3M7MX 3W7XA 1Q90D 4DV0O 4CXXA 1PV0A 1D4M3 1OXCA 2R061 1H30A 4O4LB 3EXUA 1OA3A 4GA9A 2MEV2 3JSNA 4GAZA 1VRH3 1XNQO 4JKMA 4MS2A 4Q29A 4XCBA 3OGVA 4A3ZA 1UZYA 3D8CA 5CMUA 4MVTA 1ZA4A 4AI9A 4CP9A 3OMAB 4H2AA 5JR7B 1DGRN 4F8AA 3LDKA 2B4KA 3E8GA 4IYHA 2PF4E 4Y22B 2FZ2A 2JG8B 5F3GA 1MS9A 2VECA 1J84A 4P9XA 1K3EA 2BTQA 4OI4A 5IK8A 3O1UA 1PPJH 1OOPC 4LA2A 1F4NA 1UFIA 1GNYA 1NBMG 4AI1A 3SMHA 5J37A 1O3RA 2XB6C 4ITCA 1EV12 3WP6A 2KKWA 4QQPA 3WF2A 5LA1A 5HXVA 2PZSA 1SA0B 4AG4A 3GXUA 4GWMA 3UT5A 5FZCA 5A80A 3NNGA 3ZBHA 1WCSA 1OCOB 4IEZA 2W95A 2TUNA 1UW8A 1W8WA 4JX0A 2XAGA 1ZBE2 4AHWA 4BQ1A 5CFCB 1C5IA 4QXKA 2P4KA 2JKXA 1AYM2 5FPAA 4LKEA 4MTFA 2EULA 2JS3A 4Q4V1 1PP9H 3CXCU 5IJ9A 1PGL2 3OJBA 4LR4A 4MTOA 2UYAA 4NWVA 2ZNIA 3IBMA 2A5ZA 4XE9A 1FXKB 2WLPA 4XDKA 2D40A 4EN9B 3I2JA 5IVJA 5LBBA 4X20B 4Y5Z0 2IXCA 1ZTEA 5C8CA 4JDNA 2PLV2 3AXEA 4LF5B 4YLZA 1DQ5A 4CXYA 1V6IA 4UVCA 1E79G 2W1UA 3CZJA 1W8NA 3Q8CA 3K2OA 2Q8OA 2EXIA 3POJA 1Z7S1 1YDXA 4FK5C 1XUQA 4Q27A 3QOPA 1PMJX 2ZIMA 3TN93 3APOA 4YJ3A 4O4JA 2EX3A 4HFSA 3EXAA 3PVOA 4R9CA 1E5RA 2A70A 3VN4A 4GH4C 5DN2A 5J2UA 1QXJA 5FREA 4XQ4A 3V0BB 1HLCA 1UXXX 3AG4B 4DV3O 5FZ4A 2YIAA 4LULA 3ETGA 2PQSA 1Q8QA 1AL22 3VZOA 5FOJB 3KF3A 1Q82W 2OA2A 3U11A 4QX1A 5J09A 1UY0A 3ZRXA 4BXSV 4JI1B 2RS31 5FK8A 2Q1ZB 3JARB 1F35A 3B94A 3VBSB 1BHBA 4NYKA 5ISLA 5BNPB 4TSFG 5DUXA 3BGAA 4I3GA 3KF5A 3WXPA 5AVAA 4Z2WA 1NE4A 1R091 2JDYA 3D0SA 3FZ3A 2JG8C 5ITZB 4RHV1 3SH4A 1O4TA 3BTZA 1W99A 2WNEA 5F32A 2PHFA 2OXBA 2BV4A 3WZ1A 2BVBA 4H55A 5GM0A 2B42B 1EFRG 2D6OX 1FXZA 2OTLV 5IK4A 3CWBH 3FBMA 4B7EA 1RUE3 3WNMA 1ZRFA 3WNNA 1QJX1 1OSGA 2D44A 2QZ2A 3IC7A 4XQWA 2X6CA 3P3NA 1OCOC 4LJHA 1ND2B 2BGPA 1ZAUA 2PHLA 2YV8A 1GWMA 2BEOA 2BPA2 3AP6A 3KGLA 5CFCC 5JZGC 2FMYA 1H2NA 4XQDA 1S2BA 2P17A 1P8JA 3CCQV 2QDRA 3AVRA 4WFAV 4ZY9A 5CEHA 1HIXA 2DOSA 4LBOA 2HWE1 4X65O 4IE0A 5TISZ 4A41A 1UYXA 3FE5A 4GMP1 2E7AA 1QOTA 3OOXA 3RZHA 3IC9A 2ZGLA 3K75B 1YI7A 2GC2A 2K2SA 2R9RB 4BK4A 4EJRA 1JZ6A 1GK9A 3UKMA 5LY1A 1F5FA 4NXMO 1B09A 1VQMV 5KLVH 1AYN2 3ZHUA 3M8AA 2VTXJ 2O8OA 2PAKA 4D69A 3OFNG 1W6PB 1FPN2 3CRQA 2XLFA 2E74B 4YG3A 4CDWA 2I45A 4DV7O 3ZN1A 1TA8A 4IEXA 4YARA 2D6NA 4BQYA 3P1IA 4M3CE 4OUEA 3I2OA 4COVA 3JYCA 4YWAA 3OUHA 2PGGA 4FAHA 1Z78A 1UYZA 2RJZA 3JD71 1TZOA 1ORQC 3HKBA 4GB32 4YVSB 2OKXA 2HVJC 1XQ8A 2DF7A 5LGUA 1RUG2 4UOJA 4MTGA 4YG0A 4CC5A 5F3EA 3AG4C 3NJVA 1BEV1 3BPZA 3NQHA 2D6LX 2RS12 2E6VA 5CB4B 5L7OB 4L8JA 4QQ2A 4O2BB 4PBOA 4F7ZA 1VBA2 2PI4A 2Q1MA 3PU8A 3URFA 4QU1A 3MLKA 3VBSC 3OR6C 4IEOA 2P37A 3RVHA 2DW4A 1YITV 4DV4O 1S0FA 3AZYA 4Y1VA 3C3SA 4L99A 5LCWL 4RA0A 1GZWA 2BJSA 1FATA 4UCUA 1A8DA 2CU5A 3ZIWA 4PI0A 2XT9A 3WF0A 5C6CA 4MXVA 2AC1A 1XXNA 4I7ZB 3OTFA 4GX0A 4CDQC 1LUVA 3JD3A 1PVC3 4YFZA 3VBHA 1WBFA 1BLZA 3R0RA 1SFNA 3JD2A 4UB6Z 1WMXA 3OBZA 2G9FA 2VZ1A 5EK0A 1YQ5A 1PNMA 1EBOA 3CC7V 3CHXA 2PXJA 3DYPA 2XNDG 4QX3A 1HRI1 4QU2A 4LBQD 4XOGA 1VMGA 1MS8A 1ND2C 2RVAA 4E8CA 1UAIA 2WC2A 2HKOA 2ZDIC 1DYPA 4I0XB 2WZR2 4W6WA 5L3DA 5I91A 2V4VA 4CEYB 4JZGA 4I09A 2NP0A 2WAMA 1D4VB 4IEUA 5T5OA 2RDSA 3WF3A 3KHCA 3O7OA 1XYPA 5DAXA 5FPZA 1VBB3 2YU2A 1K73W 2B9UA 4K7JA 4X64O 1KEXA 4FOQA 5HCBA 3I2KA 3SYAA 1CIWA 3OAAG 1OVSA 2OYZA 4XBLA 2HJFC 3LD8A 4X1KA 3SPIA 4O7XA 2OCHA 1HB2A 4LP8A 3PJYA 4LWSA 3ACIA 1XQNA 3MEPA 2PYJA 5FY1A 5GJ6A 2KSDA 2VRZA 3BABA 4YJ2A 4YXWG 4DO2A 4FP2A 4CZSA 3EO6A 1KD1W 5CFDB 3OD4A 3U78A 3GB7C 4W8JA 4LFAB 1B3QA 2AUYA 3F5TA 2F66C 3K4ZA 2WNUB 4P2ZA 2Q8CA 3SCHA 1AR73 2XONA 2HWC1 1JPXA 4YVSC 4RSUA 1OA4A 4JI3O 5L3GA 1RUD1 2ZEXA 4IV1B 4WV8A 3T4ZA 4JI8B 1W2BU 4RQPA 5DN6G 1N1TA 5L9RA 1NQJA 4BB3A 1PK6A 1SPPB 1OLQA 1UMIA 5L7OC 4DXWA 4AFDA 4UV9A 2R042 4I4TB 1OMIA 4QPGA 1HW7A 1K5MB 3CU7A 2FCUA 4IGPA 1LUWA 2DV9A 4BIFA 2EXHA 5A1LA 4XJAA 4N43A 3VD3A 3VBOA 2HFEC 4PLOA 3VQXA 3USUA 3FD9A 1Y6XA 5IVFA 2Y0OA 1RUJ3 4D7TA 2HWF1 5CKMA 2CDOA 4JTNA 1QJY3 1YFUA 1WJZA 2JEXA 4JI8O 2W39A 1J58A 3WW1A 1XMOB 1H8HG 4K1ZA 2P6CA 4GKJB 2RMU2 4G4FA 1AR61 5AVPA 5F3CA 2WDBA 1JH5A 3N2GB 3NO8A 5CA3A 5FZ3A 4B3TB 4JAAA 1LHNA 3I2FA 2ZE5A 1OPOA 3O65A 1K34A 3P3PA 3TETA 4P9IA 1REEA 5LA6A 4ZU7A 3RVZA 5A6YA 4NE9A 4XFIA 4CEYC 2K46A 3QD6A 2JDMA 2ENRA 1EP0A 1NJIW 2JB8A 4FP3A 4D7YA 2BCCH 4GCZA 2IXHA 4QPKA 3L71H 2JDPA 3K3NA 2W6IG 4GWIA 1J95A 3U10A 5FZIA 4LBLA 5JCTA 3T09A 1R73A 4MVQA 4XPVA 2VC9A 1NXMA 1TMF2 1BCXA 2HWD2 3WG2A 4X1YB 4COYA 4B3TO 4JCKA 2YC4A 1JMKC 1AI4A 5LGNA 2RJLA 3TCUA 4P9JA 1Y3TA 3WQ0A 5CFDC 3M3IA 2VQFB 4AFBA 1XL4A 5LA0A 3O1TA 4FI9A 1CONA 1HRV1 4P9OA 3SYPA 4E2GA 4PDLA 3GALA 2WNUC 5G05L 2QQUA 4LH6A 1JJ2U 1Q6IA 5BNNB 4QPYA 3WB2A 3ZFFA 4PIYA 1IXBA 3FHAA 3PMEA 3FAVA 4M3CF 1C1FA 4QHOA 4LUKA 4FQ4A 4HVRA 5IFTA 4PJYA 5H6QA 2WS92 1VRBA 2XLAA 2ZM6B 1W0JG 4BW5A 4E27A 3W7TA 2WT2A 2YEVB 4GWJA 2Q9LA 3C7EA 1FNYA 3AC0A 3M4FA 2F93B 1GM7A 1S0BA 4XUOA 3TXQA 2YU1A 1K5MC 2ZA9A 5FZBA 1RUC1 1JYTA 2VQFO 5F5IA 1RITA 2Y6FA 2Y33A 3SISA 3D4KA 4UW4A 2R062 1QH6A 3WT3A 2IXLA 4HXCA 1OLME 3DXUA 3RBZA 5CYYA 1WAZA 1RUH2 3H3ZA 3RGBA 2DTWA 3K5OA 2VZ3A 3WU2Z 5A3NA 4NMIA 1WA8A 3S7EA 1R3KC 4YW1A 1BCCH 3KWVA 2G1MA 2CE4A 4CUGA 5C4WC 1QIQA 3VB9A 1LECA 5FY7A 2LTNA 2VMEA 3TEWA 4WFHA 2R30A 5T3NA 3VQYA 4HZ3A 5FCCA 2RN9A 2WSSG 5E1RA 3KT1A 4IDZA 1SKVA 3QVNA 1I9RA 1SZBA 4PBPA 1VALA 4OQ8A 5A7NA 2QQKA 3HBZA 2HEPA 1GFF2 5F2WA 4ZIBA 3UGHA 4Q4Y1 2B1GA 1V9U1 4KFMA 3QF7A 1QJFA 4KU8A 2ZHKA 5C5UA 1WMEA 1F15A 2JE7A 1CAVB 4PV1B 1UZWA 4O2AA 2D98A 1DZTA 3EBRA 3O9OA 2Y8KA 1UXZA 5FXZA 5CAZA 3CP1A 4QHBA 2EINB 1PX4A 3JATB 4FTSA 5DUUA 5B1BB 4P9GA 4Q4V2 4QB6A 1N0JA 3CCLV 5DQ0A 3GBFA 2A6ZA 4FPEA 1U12A 2WR9A 3WB1A 3ZXDA 4UFMA 2AREA 1TQ5A 3IDAA 3VOUA 5DZFA 5A3WA 4ISRA 2KA3A 1N8RW 1Q8PA 2OIEA 3TYJA 3WNXA 4BQ4A 4LMFA 1YQ2A 2UU9B 3GBWA 1ULOA 4JV4A 1LAJA 4J7ZA 2EBOA 2GP3A 3SH5A 3B02A 2MEV3 4PQ9A 1Y76A 2F1MA 5J9PC 1DQ6A 1I5PA 3DGTA 1JR9A 5K1XA 3N9QA 4JI6B 3O1RA 3W20A 4WZFA 4M3CA 1U5XA 3MFAA 3IPVA 1Y9QA 2DUPA 2HR3A 3K06A 1CN1A 2AR6A 4BIOA 1Z7S2 4ZXEA 4P08A 1XSQA 1S0EA 2VOVA 3UCSC 2JE9A 2DVAA 1T6BX 1UMZA 2VGDA 3B69A 2WSVA 1JYNA 3M8LA 1F31A 3J8F3 4CH4A 4FFBB 2RJ2A 4LK7A 2IH1C 3AK2A 4YZ3A 3WUDA 2N7GA 2BRTA 4YFWA 5IHRA 4Y1XA 2Y48A 3N27A 2P06A 4DXRA 2A6YA 2GBOA 5AFEA 4UFJA 1EV13 3IM0A 3ATGA 2ID4A 3B2EE 2M7WA 5C33A 2QQPA 3Q4HB 1KUQA 2XPJA 1ZBE3 1HNXB 1I94B 4NAOA 2RS32 5GLUA 4LHLA 1GNZA 1AYM3 3G6EV 4OPHA 1W8OA 1TE1B 1KGYA 5FDBA 2OIGA 4QE9A 3TNQA 5L3EA 1R092 2F4VO 4QXHA 2CAZC 3NAPA 4RHV2 4MVSA 5HFLA 2GMEA 1AF9A 2BOCC 2Z3YA 1UU6A 2ZGUA 2OW4A 5EYYA 5IJ0B 1W0KG 5JXHA 4LE4A 5F5CA 4ZKTB 4RQFA 1CJPA 3I2IA 2XJUA 4CUCA 5C8YA 2Y34A 5FYMA 4XILA 4X8NA 4B4PA 4E4DX 2CAUA 1ZL8B 1GOGA 1U5ZA 1MEC1 2PLV3 2ZCWA 1QJX2 3S30A 4NAMA 5EZYB 4PT6A 3KV6A 3AP5A 4AHXA 4IV3B 1BMFG 4Y3OA 1S72V 4Z8BA 2B9VA 2PUSA 4QXCA 4KG0A 1T2XA 1XE7A 3HN1A 2HKXA 5B1BC 3K9AA 2DYSB 3VQVA 3CMEV 2A0LA 3CNAA 3ABMB 3LSSA 2A6WA 1S2EA 1LR1A 2HWE2 4LBMA 5FZMA 3BPSA 4TXWA 1M57C 1DZQA 5KX5B 1Y74A 3VKLA 4IEPA 2WLIB 5ACA1 4FLUA 1W2OA 1VB4A 1AL23 4LF4B 3OGJA 5T5LA 1V6OA 4WFEA 4AEKA 2IFRA 4YSFA 4XIOA 2KQXA 4YW6A 1TME1 4QHZA 2LQTA 2ZR3A 4IHJB 3A7QA 1S0JA 5F37A 3ZMVA 3OD0A 3UJQA 2X0LA 4Y4YA 2FCTA 2QQOA 2GC3A 1LULA 1AX1A 1WA4A 4QWNA 4YGDA 4DQAA 1BHGA 1LHOA 1Q8SA 3ME2A 4FXKB 4DXZA 2ZGMA 4CEWA 2BWCA 2WWWA 1X8MA 1GO3F 3JD72 1D5AA 5IW0A 2QVSB 3ENRA 4EZ4A 2E5LB 2AYHA 1AR93 1MVEA 3PMSA 4H7MA 5JOWA 2VJXA 4RYDA 2Q1FA 2Y6LA 5F1RA 2RDRA 2LFSA 1BEV2 4DMIA 1OUXA 1ZZBA 5JAXA 2Z0AA 5KXCA 3B77A 1POV0 5T54A 3SPJA 3POSA 1THZA 3N7MA 5GLVA 5FZ9A 4JKLA 4HK8A 1B6QA 3GZTB 5IY5B 5J36A 3CSXA 2GC0A 2QZ3A 4BPZA 1HB3A 4URTA 2XMLA 3T08A 4CE8A 1SDDB 3O0XA 2E76B 5I0UA 4QGLA 3AMQA 1MMMA 4Q5OA 2YG0A 1SLIA 2E5LO 1XNKA 4TQDA 4B3MO 1UZZA 1GICA 4JQTA 1NX9A 2J22A 2XAHA 1OQEA 3SCFA 5DM6V 2RM21 1W6MB 1HP8A 1AZDA 4QM8A 5E79Z 1RHI3 5A7QA 3BODA 2YMZA 1AYN3 1CR7A 5JI7A 1XNRB 2YXLA 4LLFA 1HRI2 1SLLA 3CPWU 2C26A 4I2OA 2ZMLA 1FPN3 4IV3C 4JGZB 5D8AB 2Z79A 1TGOA 2QE7G 3K57A 5ABJA 3VBBA 1OLRA 1VBD3 1OHFA 4JYAB 3GHNA 4DEQA 5LWBA 3DF0A 3A23A 3ZVXA 2YYOA 2JD9A 1KMIZ 3ABMC 1ENVA 5LXTA 2O0OA 3WW4A 4XJ9A 2HG5C 4GB33 4QX7A 5CISA 1RUG3 1RM1B 5FMCA 3J7MA 1XU1A 4HETA 3H1WA 4S2GA 2RS13 2C1FA 1NKDA 2YBKA 1WLEA 5I8YA 5E1AC 5JMCA 4N7IA 4N53B 1NR7A 2A79B 3T1HO 4MHUA 4U7OA 1IS3A 2CNAA 2P1BA 3A0BZ 2D97A 3D3IA 1ND3B 2XVLA 1VBA3 3T4HB 2P5BA 3UT0A 3JCIA 4N90A 1Z2GA 3LIGA 4CP0A 4WM8A 1SQVH 4Q0QA 4RFRB 4JI4B 2WLHA 4L11A 3N4MA 2ET7A 3B5LB 2ZD9A 3GZAA 4RUFA 3AYEA 2QJ1A 1BYHA 3HWJA 1ULFA 5DAPA 3DC6A 3HQRA 1SS3A 3D3QA 1V6NA 4BLIA 5IVBA 4WFGA 2HWB1 3T30A 2PA7A 2RJKA 3U14A 1JMUB 1ASJ1 5FPVA 1RXFA 3CDZB 1NCRA 3KM5A 4RN5A 4BA6A 3VBRC 1VP6A 4XUPA 4OCTA 4ZXKA 4X1IB 2EXJA 3HNYM 1RTVA 1U0AA 1AHSA 1BE3H 1AP6A 4ARYA 1DCSA 3MHSC 1SLCA 2WZR3 1P7BA 5IY5C 3LPFA 4A3XA 1QXPA 1ZM1A 3SGIA 3SYOA 4CS3A 4OX9O 4XJUA 5A7WB 1REFA 4PI2A 2D43A 5FXXA 5FWJA 5H9RA 1H2LA 3H1MA 4LIVA 3HQUA 3E5UA 1LESA 2YDEA 3UKVA 2FBEA
chains in the Genus database with same CATH topology
1CPNA 2W52A 2HWF2 1G9BA 2EAAA 1KS4A 1L3JA 1IS4A 1IKPA 3MFCA 1D0GA 4MGZE 4OHYA 3SWTA 2YZ4A 4KWKA 4IEVA 3VKMA 3VV1A 1NXD1 2CWMA 2JDZA 3QACA 5BNPC 5HI0A 3PLQA 1HRV3 2RM23 4XMAA 2ZGSA 1DGLA 5BPXA 1AR62 5DUVA 4OHZA 3CF6E 3WUCA 1DDLA 2X53S 3THPA 4EWAA 1U5IA 2H0BA 4C8RA 2WBQA 3HAGA 1H8TC 2HEWF 2P3KA 5D1IA 1RL3A 1S0DA 4FQZA 3FFQA 2GALA 4LBQB 3VBUC 4QQLA 2FMDA 4NN0A 5LK7B 2JG9B 5KHHA 3BTAA 5D8AC 2JG9A 1F5JA 4H3WA 2BWAA 1DQ0A 4J5IA 3N7JA 3V64A 2D5FA 1SDWA 5LEKA 3WCRA 5C9AB 1BMV2 3RDIA 1OD5A 3DPRB 5C9AA 2XLGA 1A6CA 1QNYA 3L2YA 3BALA 3DPRA 3EJKA 3AK0A 1D2SA 4OUMA 4WVZA 3O0VA 1NX4A 1CAWB 3G7DA 3JZVA 3VZLA 1CAWA 3POYA 3TN91 5FO8B 3PJQA 1PZ9A 1LHUA 3MW3A 2BNNA 3VKOA 2W0XA 1G8WA 5KHKA 1DYKA 1PM7A 2D3RA 1ULDA 1MR5A 4LBKA 2WT0A 1SLBA 4AI3A 3MIEA 2WS91 5EJ3A 1H9WA 2Z42A 2OG7A 2NN8A 3M2MA 3MDPA 2WQ4A 1JTZX 1UCXA 2DWRA 1KFXL 2VG9A 4QT6A 1VZ5A 3VBFB 1PO21 2X5IB 3KMHA 4GH4B 4RGGA 1LEMA 3VBFA 2DVDA 1GQGA 2RHPA 5A32B 2X5IA 1MZ6A 2EXKA 4RR3B 4N53C 3LKJA 5A32A 2ZGOA 2R043 4PDWB 3BU7A 4RR3A 5JWPA 4AGVA 4PDWA 3EHKA 1ND3C 2WFF1 5DZEA 1LKNA 3E5XA 5GZGA 5FLJA 2ZKLA 1D4M3 2R061 1XYNA 1H30A 4WM8C 3IWZA 3KS7A 3EXUA 1OA3A 4GA9A 2MEV2 1EAH2 5BNOB 2RR13 3AMNA 1EPWA 1VRH3 2QE3A 5E16A 5GLTA 1HRV2 4XF4A 4TYSA 4Q29A 3I2DA 2NQYA 1UZYA 5CG8A 2ZGRA 3MICA 3D8CA 1S0CA 4MVTA 1ZA4A 3AKRA 5JOZA 2PN5A 1OIHA 5JR7B 1DGRN 4F8AA 1Q3EA 5DDJ1 5KEUA 2R1DA 1V6LA 1Q5OA 3FBYA 4Q4W1 1QQP1 1F2NA 4Y22B 2FZ2A 2ZAHA 2WSUA 2JG8B 1LRHA 4Y22A 1LHVA 1MS9A 2HWB3 2RMU3 3GZUC 3OF1A 4C1WA 2VECA 3GBGA 1HXS2 3H1YA 4PIXA 2VQ0A 4P9XA 1ASJ3 4OI4A 5IK8A 4Q0UA 1OOPC 4LA2A 1GKBA 1ALYA 4I02A 4KL1A 4PLNA 3KLSA 3RNSA 5BXXA 1G9FA 1DGRA 2P3JA 1AX2A 2VQAA 5B2GB 5FAXA 1PO12 4NHKA 3POWA 4AI1A 2XJSA 4QPIB 3SMHA 1O3SA 4R9DA 1RUE1 5J37A 1O3RA 5HCAA 1HQLA 2OIIA 4ATEA 2XB6C 2DVFA 4ITCA 1EV12 4EN8B 2DUQA 3L9JT 3WP6A 3JBG2 1RUC2 4QQPA 5HXVA 3R4UA 4YLMX 4AG4A 1WGPA 2FZ1A 4BM8A 1AXKA 4GWMA 4YZ1A 4KG8A 1WCSA 1M06G 4IEZA 3LOIA 2TUNA 1UW8A 3EATX 1SLAA 1ZBE2 1ZZ6A 2CL2A 4QM9A 4AHWA 1RUOA 1D0HA 4BQ1A 5CFCB 1C5IA 4JDOA 1RMU2 4QXKA 3ZN6B 5CFCA 3MF6A 3ACLA 3ZN6A 3ZYPA 1W0PA 1H0BA 2K0GA 1AYM2 1ZYBA 4AE2A 2VW0A 4NPRA 3WDUA 2SLIA 5K7PA 1Z0HA 3X29B 4OVEA 1MVQA 4Q4V1 2D6PA 1D2QA 1PGL2 4LO8A 4NR1A 1QWRA 2RS51 3OJBA 4HN1A 4LR4A 1TNRA 1WLDA 2TNFA 2UYAA 5FO9B 2PHDA 5BUVA 4NWVA 2C0ZA 3OBTA 5IK7A 2OZJA 4AVCA 3T2TA 3LZZA