4Z2WA

Factor inhibiting hif in complex with fe, and alpha-ketoglutarate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Promotes Productive Gas Binding in the alpha-Ketoglutarate-Dependent Oxygenase FIH.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 108
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4z2wA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z2wA01
2XUMA 3KCYA 4B7EA 1IZ3A 1H2KA 4QU2A 4AI8A 4Z1VA 1H2LA 1YCIA 2CGOA 5JWPA 1H2NA 1MZFA 1MZEA 4NR1A 4Z2WA 2W0XA 4B7KA 1H2MA 2ILMA 2CGNA 3P3PA 3D8CA 3OD4A 3P3NA 2WA3A 4JAAA 2YC0A 2WA4A 4BIOA 2YDEA 2Y0IA 3KCXA
chains in the Genus database with same CATH superfamily
1VIBA 3CRRA 4RR3A 3WNKA 4CCCA 2HEWF 1IPKA 3TRSB 4UXAA 1JZ6A 4B4QA 4CDXB 5J9PC 3QD6A 5J2TB 4JI7O 3WG7C 5FZAA 4YW3A 4LFAO 2ZEWA 5CFDA 1HQNA 5LYJB 2Z5UA 1PVXA 4UFZA 1FX5A 2VQFB 4MX3A 1MZ6A 1NAEA 5K0UB 2JGUA 3CD6V 1W8UA 4CDWA 5BZBA 2HYKA 1DQ0A 4KQ7A 2RM21 2AW9A 2VTXA 3QO7A 2PA7A 4CEYC 4ZIBA 1O3SA 5LA6A 1OH3A 1C8M2 3FFZA 2FCVA 5ACA3 1SBDA 1PO21 4LO4B 1HB4A 4BW5A 4DV1B 4YXWG 2YUEA 2FYUH 1S77D 1L8DA 1W04A 3H1WA 3CCEV 2VBPA 1JYNA 1GQGA 5GALA 1FPN2 2GSYA 4Y1VA 5JVDB 2YXHA 4DRXB 5FP3A 3CLPA 1AR1B 5KLVH 1Y9QA 4Q4W3 3ACFA 2HWF1 3WF4A 4Q8KA 3VBUB 1QNYA 1QEXA 3W5NA 1GQHA 4O65A 5LGUA 1VIWB 4ZHQB 5JCTA 3APBA 5L7OC 1GFF2 5LP6A 4QQLA 3RVZA 3WF1A 2P1BA 1VQ5V 3S7EA 3RZLA 2P4KA 4F4LA 2ARHA 4BH9A 4TLGA 3H1LH 4RHV3 3VDBA 3OUSA 1EUTA 3DYMA 3LDDA 5CBHA 5B3SC 5B5EZ 3BYWA 5ACA1 2V1DA 4MHRA 4YPJA 2CL2A 2ZM6O 1D2DA 2C5DA 3D3IA 3CJIA 3OSDA 3B69A 4JKLA 2XJVA 3U37A 5IK7A 2EIJB 1QWRA 2AHYA 4BIZA 4MYEA 1Y9GA 1WLCA 4PIYA 3MO4A 4I01A 1RUNA 1UCXA 4TV8A 3PMEA 2JDNA 1VMHA 3B9CA 4CP9A 5DM6V 3BUCA 2UURA 4RYDA 1R3KC 2O14A 1X7NA 4RD7A 4EN8B 5AC92 4X64O 2ZINA 3ZFFA 4MVQA 3NNFA 1LHOA 5F2SA 4AFMA 3R65A 4PF5A 2K0GA 2WAAA 1UKRA 3CHXA 1I5ZA 2EIMC 2FCUA 3RGBA 1T6BX 3LEGA 4ABMA 4QU2A 3UETA 3HT1A 2WQZC 1OA4A 2YSUB 1IURA 4MVZA 5IUQA 2E7QA 2A73B 2Z3YA 4YM0A 4I0AA 1UN1A 4Y22A 2VAUA 1MNGA 4GWMA 4HVRA 1J95A 4WZFA 4XEZA 2EXJA 5L9BA 2FD8A 5F5AA 1WMDA 2QKAA 2BERA 3IKWA 2WS91 1AXZA 2I74A 3ZXGA 5DUXA 1WCQA 3KGLA 5ISLA 3RYCA 5L3DA 4FSJA 3L9DA 5ERLA 1ORQC 1DQ5A 1O4ZA 1LU2A 3VBHA 4XF4A 1I08A 4WZCA 3F7VC 2CAVA 2RR12 1U5ZA 2DUPA 2XVGA 4I02A 3NMBA 4CDXA 1BQPA 3ILFA 1OBNA 5F39A 3S30A 2F66C 4E4DX 2DUOA 5LYJA 2UWCA 1ZZ9A 1QIQA 3CZJA 5BY5A 5LEKA 2PMWB 2WLPA 2XJTA 2ET1A 1JOPA 4LR4A 5FZ9A 2BSKB 2PAMA 2HBUA 5CKNA 1ACCA 3VBRC 4GIQA 2Q7HA 2Y34A 3BVOA 2VS0A 2ZPXA 1JZ3A 1GNYA 1W9YA 2GNDA 3FD9A 1ZBE3 3T1YO 2XHBA 1TEIA 4YM3A 2CNAA 4LUKA 5A7OA 4EFBA 4X89A 2JG9C 1EAH3 5FPUA 3VZMA 1K5QA 1GRJA 1S2EA 2IFRA 2A7AA 3QVNA 4W50A 1SPPA 2X6AA 4ARXA 3VDDC 3V56A 3ETPA 1OCZC 3LIGA 2JDAA 1WLTA 2KR2A 2Q8DA 4KL1A 2KB1A 4LKFA 2RDSA 3KM5A 1W8OA 4FTEA 1D0HA 2EAAA 3B93A 1CWPA 3ZFEC 1QQP2 4TYSA 1YWKA 3J4UH 3QTCA 2BFUL 1R3LC 2GNBA 1OSGA 3RJRA 2VULA 1PIV2 3ABKB 1VPHA 1ENQA 4LNUA 2JB8A 1K33A 4WFGA 4H44B 1RVF3 3T4HB 5C4WA 5EPAA 3OY8B 3ZYBA 2DURA 1W6PA 2FKXA 4LO7A 3BEHA 2R16A 2P3KA 5AFBA 3B01A 4W6XA 2Y6LA 1ASJ1 1BQZA 1XB9A 2AEYA 4UFMA 2QTSA 5HCAA 2EIMB 5HFMA 4DW0A 2LS6A 2CE4A 1DFQA 3P6BA 2J1SA 1K3EA 4FXGB 3WDXA 1NQJA 4YW5A 5BNPA 4PIXA 4LR3A 5LBBA 1NT0A 2WO7A 5ANQA 3F5WC 1YYNA 4CCOA 3GWKC 5EQUA 2BTQB 2CTVA 3VDAA 1TMF2 2UUCB 3LPGA 4LXLA 5FWJA 3U14A 4ZI7A 1AR92 4ASLA 1PM4A 3RYIB 4YJ3A 3G4SV 2ZGUA 3ML0A 1UPIA 1QJU3 1NXMA 1LESA 3AL5A 1UOJA 3SCHA 3SH3A 2P4VA 5LASA 2YIAA 3QNEA 3F95A 3VD4A 5GLTA 4PA9A 1M56B 2W92A 3CJIC 5LEJA 1DZTA 4PBPA 1HNXO 1UYXA 3O7OA 2YC0A 1UKGA 3MIEA 4QPGC 2D97A 1GANA 3OGSA 1MEC1 5FPLA 4J7ZA 1DU3D 2EXKA 2ZKNA 4XUTA 1OUSA 4ZU7A 5IY5C 1C8M3 4PDWB 3WR0A 3N9LA 3HD8B 3OTFA 1LEDA 4XW3A 2RV9A 5F3IA 4M3CB 3RI9A 2KG7A 3WV6A 4M00A 4I55B 4Q1PA 1H2LA 4Z82A 4KWJA 1PK6C 4H33A 1J1TA 2GC2A 4LBLA 1AB3A 1AXKA 3RG0A 3K4ZA 4RS5C 3WNMA 4YWAA 4DY3A 4ET7A 4KG0A 1M06G 2YG0A 5FYBA 2E7TA 2WNEA 1QR8A 2ZHLA 1SQFA 1YSCA 2JG9A 1RB8G 5KA6A 3GDBA 1OHHG 3W20A 4RQFA 3NNGA 3PJYA 4UXNA 3U1XA 4AK3A 1GOHA 1Y67A 2QQJA 3SYAA 1BXHA 4FK5C 1UYPA 4CH4A 3SH5A 1LENA 1R6NA 3T4VA 1BBT1 3GBFA 4Z8BA 3RZKA 3NR7A 1D7PM 2B42B 2VMDA 1NT2B 1EBOA 1VALA 3H42B 2R1BA 5JDBA 3CX5F 3KLSA 1ZX5A 1OF4A 4K8ZA 4HK9A 4NUBA 3UGGA 3VD5A 2AHZA 2Y4UA 1JYCA 2X53S 2ZGQA 4BMEA 5LA6B 2R70A 2RVAA 3NKGA 1IDSA 2A6WA 2Q1MA 2WLJA 1Q8QA 3GJAA 5IJ0A 1TUEB 5CKMA 2PZSA 2G9FA 3WXPA 1Y9MA 1OOPA 1K4DC 4I9QA 1O3QA 3SJBC 3A0BZ 1FT9A 3T3YA 3JZVA 5IVBA 1DLLA 4ITCA 1VQ8V 1AILA 2VMFA 5FZ3A 4O4IB 1VJ2A 3M3QA 4IGPA 2V5YA 1WA4A 2RM23 3F2ZA 2BNNA 5DZEA 1QXJA 4JI1O 4P9WA 1AR62 3ZRSA 4LQRA 4XDLA 4TOIA 2D3SA 2TUNA 5D8AB 4XTPA 4MGQA 4EN7B 3RN4A 3I2JA 1LRHA 4RS5B 1S0JA 4YJ2A 1KB9F 1RTVA 1HX6A 4TV9B 5C9AB 3RMXA 2NN4A 3MICA 3M1HA 3JAMN 2K9ZA 4LTAA 4CCDA 4H37A 1ST8A 4RGGA 4UI9L 5FR3A 2XASA 1WMFA 1PVC3 3AKPA 3J8F1 2VPVA 1R083 4R8CA 5DN2A 4H13B 1F51A 2XH6A 1W3VA 2E76B 1C28A 5CA0A 2VM9A 3WCRA 5FP8A 3VBSA 1SZXA 2P3JA 1YTFD 4X20A 4CP9B 1OCCC 3TB0A 1OC1A 4LMFA 5ANNA 4NHMA 1GNZA 2XJUA 2P2KA 2DVFA 1V54C 4GJZA 4DW1A 3V0BA 1L3JA 4A7YA 5IVJA 2W5FA 1XQ8A 5J96B 5K0UA 5JQGB 1YJNV 3PL0A 3WW3A 3EJKA 3VBFC 1VRH3 4FP2A 1K12A 1AYN1 4FFGA 1V0AA 4AHCA 1JX9A 4EB6B 2XLGA 1W6QA 5D1IA 4QDSA 1PL4A 4I50A 3MW3A 1TME2 5F9TA 3WDVA 4DV0O 5H6QA 3ZFEB 1GM7A 4LNVA 4G2KA 4OI1A 3OGVA 4RSUA 5C3RA 2JRIA 2GTSA 3RYCB 2WNUC 4MTOA 1XE7A 4Y26A 5DAWA 4FPPA 4JTNA 2UXDO 4PQ9A 4JAAA 4DXWA 1FMD2 3MFCA 2ARCA 4QQPA 1VQ6V 4HK8A 4LEJA 3J81N 2UU8A 1SMVA 1IZ3A 2FB5A 5IVCA 2A9HA 1XE8A 4Y1UA 1J3RA 5A1AA 4FO9A 5T5LA 3TYJA 1SLLA 1US3A 2XTAA 1Z7S1 2EXIA 3HEIA 2FZ1A 3OTOO 1BHAA 4WBBA 5C8CA 1YQ2A 4Q0SA 1XNKA 2EICA 2JE7A 2E33A 2F4VO 3K59A 2QWRB 2Z4FA 1RHI2 4YW1A 4EQVA 4DR1B 3ZJZA 4GH4B 4UFJA 2R0HA 5C71A 5L3BA 1NY71 4Y5Z0 3AK3A 2IJHA 2YBPA 4FPKA 3SJCC 5J2UA 2F23A 1DBNA 1YFYA 3CKHA 5C3SA 1N1SA 3O1SA 2Q69A 4OI0A 3CDZB 2L6LA 1NR7A 5APAA 3O0XA 1UIKA 2XQRA 1QOTA 3KZIZ 4E2QA 5BNOC 1G9FA 2QA4V 3QACA 2JDKA 4QWNA 4DV7B 5T5OA 4MXWB 3RFRA 4YVWB 1IOAA 1PO13 2QFEA 2XLFA 1EPZA 3B7MA 3KV4A 3I3QA 1R3JC 1UX6A 4IV1B 4AVTA 2DVGA 5LMNO 5FZ6A 4A5UB 4GZRB 5H9RA 2XKPA 2R9RB 1VBB1 5DEDA 4AHYA 3G6EV 1E5SA 3OAAG 2EIDA 5C33A 1AP6A 5FCCA 2AZ0A 1NXD1 2OPWA 4QXBA 4D94A 4IEXA 4AI2A 1R081 4QJFB 4GLXA 3HBKA 4G28B 5JQGA 1AF9A 5T52A 2WLLA 2GUZA 3JB8A 3HN1A 4AEDB 5AG2A 3ZCCA 1J1LA 5FLIA 3ZXDA 4XJZA 3NL1A 4F83A 3IC7A 3AG7A 4N23A 1PO11 1LOFC 2LP7A 4Q6GA 4JTAB 3OEBA 3INAA 2R061 1AYM1 3M3OA 5HCBA 4AGVA 4JQRA 1POQA 3K9AA 1WLEA 3QO5A 2ZGLA 3AFKA 3M4FA 2ADDA 1AJNA 4JI2B 5GZGA 4NXNO 2JWPA 4ZZ5A 3LSUA 5H9SA 1OCCB 5FPZA 1N32B 3NQHA 3J9SA 1Q7YW 1MS5A 4EN9B 2W3JA 3HKCA 4C91A 4Q1RA 1OA3A 5DG2A 1OLME 1TG7A 1WP7A 2ZR3A 4HKLA 1HR0O 2E75B 2XAJA 3J8F3 4AHXA 3FC0A 3K9SA 4BIOA 4FM2A 4JI4B 2NN8A 4MTXA 3M3IA 2EIKB 4X6RB 3OUFA 3JYCA 2CTPA 3VBFA 1EP0A 4H7LA 1OCRC 2VXRA 4KWUA 4FTSA 4WFBV 2QDOA 4W4LA 1ULEA 1RUE1 4UW5A 3FN9A 5FY7A 5F37A 1WW6A 3OCPA 3UKTA 4DO0A 1W0KG 3T08A 1ULPA 1BS3A 2W95A 2XXZA 2Q4SA 2WL1A 2WN3A 4IL6Z 3KV9A 3KV6A 4L92A 4O9GA 1SQ4A 1XEQA 4BXSV 2LFRA 4EZHA 5LRSA 1WGPA 3RMYA 3MDPA 3VBUC 4NTXA 4QB6A 1EUUA 4DV5B 1HWYA 5BR8O 3ENRA 1FJGO 4Q4W1 3W7SA 4YZ3A 3AG4C 1VAVA 4B3SB 5A7NA 3ST7A 3VN4A 4DR2O 3ETEA 3RPQA 2QR4A 5JXIA 3RYPA 1LJ7A 1CAVA 1SQQH 2HJIA 4FP3A 1BMFG 2BJSA 3BRCA 3BY6A 1CR7A 3MV11 3CIHA 1I1EA 3QOPA 4MGTA 2DFBA 3VBBA 3ZX6A 4FOWA 3JBG3 5B1BC 3CCSV 5A7WA 5F1RA 1EV13 3ME2A 4D3WA 2P5BA 1FV2A 2GHYA 1S4CA 1AR91 3W7WA 2XJPA 1RUD2 3IDAA 3E2EA 4LBJA 1VARA 2P4EA 3ABTA 3ZHRA 2VOXA 1UNBA 4CC6A 3N7KA 2RE9A 4UOJA 4X66O 3CCVV 3AXEA 3SPIA 2IH1C 2UUAO 3A7QA 2YXYA 4DXZA 4HNAB 1EAH2 4AEDA 1LHUA 1TZOA 1PPJH 3B9IA 1GZTA 1UPSA 1J5EB 4PI2A 1UW8A 4UB6Z 4COUA 5G04L 1JMUB 4BDVB 3MW2A 3AZZA 5I91A 5DZFA 3CC2V 1C8M1 3KT7A 5L7OA 3HQXA 3OYWB 2QKCA 2OTJV 3H1KH 4EROA 3AJYA 1ZRRA 1YRZA 3I56V 1MACA 3LD8A 4AXOA 3E22A 3DN7A 1Z2GA 4XYXA 1F23A 4YVSC 2VD7A 1E5HA 1P7GA 1FPN1 5F3EA 4DUWA 3KHCA 2N7GA 2VQFO 3E6BA 4CPBA 1SEFA 2QSAA 4QD2A 5LGTA 2VQEO 5FOBB 3H3ZA 3GJBA 4LA3A 3RNSA 2QM4A 4LIVA 1K4CC 5LK5A 1VF6A 3WW4A 2YU1A 1X59A 4LUMA 2VOKA 2A75A 1G9BA 2RG4A 3R4SA 1HQLA 4E4ZA 1O5UA 5DAPA 4QDQA 4NTWA 2ZX3A 2J22A 3VD7A 1Q82W 3C7EA 3K77A 5FY8A 2JG8A 1JJ2U 4RFT0 3S3WA 1JYVA 4LKSA 3L74H 4LIUA 2ZZJA 5FO8B 2XR4A 2R043 1W9WA 4IETA 5GLVA 3KS7A 4UBGA 3B40A 5LBCA 1H8TA 3EXUA 4X8AA 3NAPA 2YI8A 4MSWC 1L7LA 1ULGA 1X8MA 3JAKA 4ZHNA 4F7ZA 4CDQB 3LKJA 1BEV2 4N53C 1AUYA 4LBQD 2VCMA 1NLQA 3I2FA 4FZ1A 3EHBB 2VECA 3LEMA 4I0WB 4Y1XA 2RS53 1S0BA 3SPHA 3ZSEA 5C8YA 3J7MA 4UF0B 2ZXWB 1POV3 3UGFA 1LHNA 2WWWA 1M56C 3VBHC 4A41A 3OB8A 3ZOIA 3CQOA 2ATFA 3H8OA 5KHGA 5EWSA 1FXKB 4XFCA 3ZYRA 2NZ9A 5A70A 4X1YB 2UXCB 2WT1A 3N9MA 1I5YA 5BNNA 1UQXA 2VE1A 4LOSA 2ID4A 1AVMA 2MEV2 2A6YA 1Q81W 5KC5A 5GLUA 3VZLA 1S72V 3K3WA 4FFKA 1F31A 4XQ4A 3ABUA 2F6BA 1MVQA 1F9KA 4BQWA 5L36A 2Y0OA 5A7SA 4M3CE 4QQOA 4WV8A 4WVMA 2WYFA 2DWRA 3SNMA 3RYKA 4DR7B 3HQRA 3O1MA 2LO1A 4A45A 1HRV1 5F5CA 4CEWA 1HLCA 3KZ4C 1XNTA 5CA3A 1FFTB 3IM0A 1JU4A 1K3IA 4JI5O 4CS2A 3JARA 2ARXA 5T5JA 1D0GA 2WZEA 3AX4A 4FAGA 2DTYA 4ES8A 4DR5B 3LDBA 4MGKE 3HKBB 4IL7A 4IQPA 5EIBC 3ZMTA 5DUUA 4DR3O 3JCIA 5B1AB 2RDRA 2R041 2VQEB 4R6ZA 1FOD2 1CAXB 1W9TA 2E6VA 4XQDA 4MXVA 1H0BA 3PIGA 3UYJA 3OFNG 2Q8OA 2R071 1PGL1 1E5IA 3C3VA 3NNLA 4B3MB 5FOJB 4XFGA 3BN6A 3NRUA 1MSDA 4CDQC 2NLJC 2QGNA 1TME1 2BYVE 5FIXA 1X36A 2PHFA 5CBFA 1COV2 1PMHX 3NXSA 4CZZA 4GX5A 2FDKA 1SZBA 1DP0A 2ES3A 2P6JA 2KKWA 3K5NA 2FHRA 2HJDA 3AP5A 3U0ZA 3FB5C 4GX2A 3V64A 4XUQA 4AAXA 4E4SA 2V09A 1OUXA 2D3PA 1PV0A 2E5LO 4LE4A 4AGGA 5J2TA 4P00B 3POBA 3IN9A 2JKXA 1GQPA 5CB4A 4DQAA 4BQ2A 4AVVA 5F5IA 1UD1A 1S0EA 4XQWA 4AVAA 4IYHA 1T6GC 4Q0VA 5JVDA 5E1RA 1M90W 4MVOA 5KHJA 1CJPA 3LPFA 4NXMB 2MK3A 4LO6B 2XAFA 1UXZA 3AKRA 3MLLA 4BCUA 3T2TA 4P9GA 1WAZA 4P9PA 3N2KB 2UUBB 1Q5OA 1WP8A 1LODA 1R1A2 2CHHA 3U10A 1IKPA 2X29A 2HHHB 5HFLA 2XHKA 4BLIA 4CYDA 4OVEA 2AYHA 1XNRO 1BGYH 2PY5A 3ZEDA 4AZZA 3T09A 5CIRA 5FMDA 1GWLA 2ZGMA 3HKCB 5C8YB 3PTYA 4LOTA 2ZABA 1SZTA 1URXA 5C3PA 3NJZA 2A0LA 3I49A 4X65O 1XNQO 3KKYA 2LW1A 4O4IA 3ZDSA 3CYOA 1V6IA 3UKNA 2JE9A 5FV3A 1A8MA 5L9VA 1K8AW 3E5XA 4X1YA 3LEIA 3H1JH 4SBVA 1RUOA 4XHBA 2YGMA 4OFGA 1P8JA 4YG6A 4HG6B 1AR81 4C90A 1VBB2 4XXAA 3UO3A 2P6CA 1RL3A 2JS3A 2BVBA 1UF2C 2RDNA 1FMD3 3CO2A 4IT5A 1W9SA 1O59A 4PLOA 1WCDJ 3FHAA 1HXS2 1RM1B 1O3TA 2HWE2 4LBOA 4P9IA 1MZFA 2VCCA 4DR2B 2DWDC 1K9MW 2GTAA 4NRQA 4KG8A 4LO8A 3OM3B 1YTFB 1Y76A 1CAXA 1PGW2 1GZWB 3HOBA 4XBNA 1RUF2 2MEV1 3VHNA 4P9YA 3MZHA 4JASA 4LFAB 1LNQA 4F6RB 1NCQA 1EFRG 4XFIA 5FZDA 2VOTA 1NCRA 2EIKC 1GWKA 4TZDA 3CMAV 1W05A 3ETQA 4JI8B 4RHV2 2F4LA 3GVMA 1HR0B 1IG0A 4LK7A 3POFA 3ZFFC 4TN7A 4TXWA 1IQDC 4WFFA 1KQSU 1ZZBA 2Q5TA 4BQ5A 5J7MA 3VBOB 1SC5B 3OEEG 1MR5A 4JTOA 3OJBA 1V70A 4UFIA 3ZXAC 2R9IA 3IIIA 4UWDA 4A4AA 4CXWA 1QJU2 2ZIMA 3E1F1 3Q9OA 4TSVA 4J41A 4J9YB 1JW6A 4IEWA 3TN91 4K1YA 3E97A 5K7PA 4YNIA 2PAKA 3WNLA 4RGKA 2VBDA 3OR6C 4QPGB 4N9HA 3ZN0A 3ZRXA 1QJY3 2JDPA 1C5HA 4M0HA 1NG0A 3KT4A 4E2LA 3WUCA 1PGL2 1BL8A 1FJGB 4W4KA 5H5NA 3TNQA 3MIBA 4NPRA 4DV5O 5GTHZ 5FZ0A 1B35B 2VXJA 1VP7A 3FZ3A 1VQ9V 3ZXFA 2BP6A 5FP7A 1UZYA 4JDMA 2QWQB 1KS4A 3K5OA 3A0NA 2WO2A 2ERFA 1VBB3 1SPPB 1F35A 1D4M1 5C7GA 3WQ1A 1VQMV 4MV2A 2GZWA 5LHIA 3GF6A 4E27A 3KCXA 3PTRB 3E6DA 3TNPB 4ZXEA 5A7QA 2I07B 2CUGA 4WM7C 2UUCO 4HSLA 3I2OA 5LA9A 1XXNA 3MIHA 1ODMA 3KWVA 4ISRA 1Y4MA 1ZYBA 4I0XB 2OT7A 3BTXA 3A0KA 4ZHQA 4TUYA 3I2KA 3KQRA 3VHPA 2NPIA 2V73A 2IBZH 3POYA 1W0PA 3EBRA 1GLHA 4PDRA 2A6ZA 5B2GB 4AFCA 2OIIA 5IK5A 1ZRIA 5EZYA 4AW7A 4YRDA 3OMNB 5KX5A 1JI6A 1OLQA 3U07A 3WB1A 3ZLIA 4Y24A 2ILMA 1VMGA 4QKBA 4BR6A 5DPNA 2SBAA 1URFA 2I45A 2DQ0A 5H2FZ 1UYZA 4RL7A 5IFTA 5BNPB 4QGLA 2MPFA 4BK4A 4NHXA 1EAH1 2QZ2A 3VBSC 1DGSA 5ACA2 4Z92B 4XJAA 2DBNA 4FFIA 1B35C 3M8LA 1GAXA 2GNTA 1GKFA 1UOGA 1KECA 3VD9A 5LMUO 2YXLA 4GYCB 3ES4A 4RFRB 3MF6A 1VBE3 3ZFGA 3CC7V 1FXKC 4PDVA 4AE2A 3JAWA 4MGIE 4CEWC 1G4YB 4JI4O 2W08A 2Y6GA 2K9PA 1Q3EA 4C7UA 4FM1A 3HKDA 1B04A 1OT5A 5AC91 1QLEB 4CS3A 4JI6B 2A5ZA 3UQ8A 4N43B 3WG3A 3BGAA 5KXEA 2EINB 4QT6A 1VBC1 4KGQA 1Z5WA 4PV1B 1JCHA 1AJKA 4IUGA 2YIBD 2VJXA 3FHQA 3VDDA 2IFWA 5KHIA 4UUJC 4HOOA 1G7YA 3SCFA 5A80A 3POGA 3N7JA 3I4IA 4B4PA 3VZKA 3DF0A 4YFZA 3SR2C 4BWAA 5IJ9B 2HWB1 3M7MX 5C8CC 1IBLO 1CQ9A 2YBSA 2WPDG 2ZGKA 2OCCB 3POIA 3WCSA 2ZGSA 4QGMA 4GX1A 3ZN6A 3T1MA 4Q4V1 3W7XA 3ILNA 3IC9A 2Y69C 2Z42A 4FOQA 2P6HA 4XUPA 4M4PA 4KBZA 4JAVA 4H3WA 1OCOB 4AYUA 1JXNA 2PTMA 1VF5B 2OCHA 1ZNPA 4A7ZA 2X5IB 2FMYA 5FZKA 4JI1B 3M99B 1KKDA 2DVBA 4H55A 1JN2P 2MW2B 1I3HA 5HCFA 3BCCH 3UNPA 1G1XB 3ZMVA 4HFSA 4F3JA 4ASUG 1YIPA 1MVEA 2W0XA 2Y60A 4BQ3A 1IXMA 2WWUA 4B3TO 5L9RA 1V9U2 2B5UA 1UZWA 1U96A 1QOSA 1NU1H 1DYPA 4XJWA 2RMU2 3ZXJA 1AR93 4K3AA 1A6CA 1W2UA 5CFCC 5I0DA 2LALA 3ACLA 3T1HO 4AL9A 3PVEA 3IAYA 3JQWA 1C3HA 1R1ZA 1WW5A 2VQUA 1QKQA 5FYVA 2IXIA 1CD3G 2ZZQA 1QOOA 3WLUA 1K7DA 5I8YA 5FUNA 3O12A 3KCCA 4RS5A 1GZ9A 4O7XA 2BOIA 1DQ1A 3ZO0B 5JZGC 2VZUA 4NXNB 2D3RA 5A1FA 5FY4A 1LR1A 1O5LA 1PNKA 4NE9A 5AC93 3EXAA 4XCAA 4GT1A 1GK9A 2LFSA 3AMQA 3G6BA 1ULDA 4FPFA 4AVSA 4Q20A 2YS8A 1ULOA 2CGPA 1NCQC 2YC4A 2DFCA 5E89A 1CP9A 1XRUA 3B2EE 3WG1A 3ACIA 4C0HA 1KKCA 2Q1ZB 2R042 3AM2A 3BU7A 4CE8A 4E4HA 2BU9A 4HPKA 4DK1A 1PO23 5BMVA 5ABJC 3RYRA 2BFUS 4GALA 1JYXA 1H2MA 1I94O 2JJ6A 5DDJ2 4JGYB 5GKAC 1H8HG 5K9YA 1RMU1 4NPMA 3E8HA 3ZPYA 2FZ2A 1M57B 3KQ4B 4DO2A 2E74B 2YBKA 4XMIA 2PYTA 4BQ1A 2GC1A 1SCRA 1QF3A 4R9DA 3PJSK 4ZI7B 3B94A 4YIOA 1OI6A 2C9KA 3JQXA 1K42A 2BV4A 3OW2U 3TEZA 5C3QA 4KUMA 2NNUA 3ZSJA 4AI3A 1ONAA 5EP9A 2QVSB 1XBLA 4CDWC 3IMMA 4QKDA 4DNYA 4LF6B 4CCKA 4YFWA 2BTVC 4LFCB 5GW7A 1XHXA 5A6ZA 5F6LB 1TQ5A 2OCCC 4PCRA 1N32O 2LM3A 5EYYA 4ZBMA 1FI2A 1UZ0A 1GOFA 3ZXLA 4R4ZA 5FBJA 4B8EA 3FYIB 4UCTA 4CDXC 1JZ2A 3UV9A 1XBFA 2B46X 2GDSA 3K06A 1UIJA 4MUVA 3DSQA 1Q8OA 3EQEA 3IJ4A 3WINE 4TWKA 1WN7A 3ZMSA 5EK0A 2ZGPA 5DQ0A 2VW1A 2GAUA 4ZU4A 2DMXA 1F7YA 4F6RA 4W6WA 2ZE5A 1YQCA 3AVRA 3B8NA 5DAXA 2AR6A 3BCWA 1COWG 2EF6A 1V55B 3QBQA 1GM9A 2EINC 2BGOA 1ZL8A 2R30A 3I3EA 3N9QA 2DF7A 4JI5B 3ILRA 1WW4A 4L0PA 2R1DA 3GYDA 3ZKYA 4ATFA 3AZYA 4M4RA 1OJHA 5FZMA 3ZRWA 2Y6FA 5L3FA 5FZCA 3UM7A 2HEPA 1CPNA 1JA8A 4DR7O 4QMAA 3RZZA 4NRMA 1VE0A 2CDOA 4FTBA 1RUI1 2HWE3 2HWB2 5A33A 2RN9A 2Y6HA 4UF0A 4CP1A 2F95B 2WZR2 2GNMA 2EIEA 3AZXA 1RVF1 1DF5A 1PZ7A 5JCOC 2DBIA 1J59A 2ZGTA 2B1GA 3D8CA 5FZOB 3T0BA 1SLIA 4LH7A 2CK3G 5EZWA 3WQBA 1HNZB 4NOTA 4M3CF 1SCSA 5KXBA 1VMJA 4UCVA 3B09A 3SJQC 4MXWA 1S5JA 2JG9B 1PX3A 2MHFA 2VZVA 3BA9A 5JSRA 5HPOA 3EVKA 1FFXB 3MW4A 5JZGA 2NLRA 2DU0A 3QO8A 1M1KW 1WWYA 3IAQA 3ZMNA 1YIFA 5CB7A 2WA3A 2ZIOA 2EZOA 1W3XA 4YZ1A 3PDQA 3Q8AA 1AI4A 1ND2B 1WKYA 1DGRN 1B6QA 2X09A 3WEZA 1G8WA 1YFXA 4LF5O 2TBVA 2D5FA 2Y6JA 3ACHA 4D6QA 2HWE1 3EB7A 1JFFA 2E7AA 5IYDO 1RUH3 1Z7S3 3E8FA 2VZPA 1TME3 5LY1A 2VY0A 1R093 2W6IG 3RJ2X 4DUXA 5LL6Y 5FZ8A 2EIGA 4MADA 1CZVA 5EIYB 2ZNJA 1XMOB 5D8AA 1ZAUA 2H94A 4X1KA 4JVAA 1ZRDA 2ZM6B 5IYYA 3J7HA 1SKVA 1KITA 4JKKA 3TEXA 3ZN4A 4OZOA 1SLAA 1V6NA 2IWGB 4FBFA 4DR4O 2VNRA 3CJHA 3U4SA 1MS1A 5BNQA 1XYPA 1US2A 1H2GA 4FFBB 2QWOB 1CEZA 4XFFA 1E5RA 5C93A 5CA0B 4I9WA 4OCTA 1UY2A 1I7FA 3FFQA 4MH0E 3SDLA 1CAWB 1DYOA 1UFIA 4LHNA 4ZS3A 2NMNA 4FMTA 1PVC2 3MIDA 4GB32 5FXXA 4GMP3 5LBQA 4CSWA 1JU3A 2JGDB 3W7UA 3OMAB 3TBDA 1C4RA 5A3LA 2WUHA 5A3UA 1WCSA 3HN3A 4QPWA 1W8FA 4IHJA 1MQTC 4QHBA 4AI9A 4OMDA 4I2OA 3ZFGB 3PN1A 3SYOA 1CPMA 2HFEC 4AVBA 2BTOA 1U12A 5FLJA 1NJIW 2CTWA 1C8NA 1GN4A 5BR8B 5DDJ1 1H2SB 5H9CA 3CSXA 1F8VA 4LF5B 1ZBA1 4LBQA 4N43A 4Y1YA 1RUC1 2DCJA 2HVKC 1G6NA 4LK6A 3AYAA 3NV4A 4ICGA 5IE9A 4UCRA 2DW4A 2XOKG 5B66Z 3PUAA 3HPNA 1W03A 1S0IA 3NV1A 5FYSA 2OIGA 5IDJA 4CEYB 3L72H 2WSSG 1MZEA 1BJQA 4JV4A 3NAPC 1MZ5A 2P37A 1HRI1 3O1VA 3X2QB 2ZX1A 4X65B 1D4M2 1UYYA 4LF6O 4AEMA 4X8PA 2XUMA 3A8TA 3AYDA 4LLFA 3GM8A 4UFLA 4L99A 2HWD1 5F3CA 3FWEA 3FL7A 4B29A 2Q68A 2G4IA 4OUMA 3UT0A 1XOUA 3M3CA 3POJA 4K21A 1LUVA 5BPXA 1OLMA 1SLCA 2R7EB 5CFCB 2Q6AA 3GBWA 4L87A 5J37A 2OPKA 1RUJ2 1N3QA 2Q73A 1FMD1 1GWMA 2BNOA 3BAAA 2N04A 5JXGA 4Z2WA 3DPRA 4XE9A 4HZFA 2CTQA 3MF9A 3POSA 4Q4Y1 5J98B 2JEMA 5TSWA 2WA4A 3V0AB 5EJ1B 2ZDIC 3CCJV 3AK2A 1G8MA 1W2TA 4TQDA 1HN1A 3JD71 3USUB 5ABJA 2EJ7A 4Q2FA 4DFSA 1S2KA 4HT1T 1RXFA 2E53A 1FATA 1PNMA 2XGXA 3ZS8C 2HKXA 4H14A 3OR7C 4D0QA 3MIFA 2A06H 1UY0A 4AQTA 4JI7B 3VB9A 4K20A 5LB6A 3UL2A 1QJY2 4JKMA 3OBTA 1NE4A 5SV8A 4DV6B 3BTYA 4UYBA 4XIKA 4DV2O 1VP6A 4KBBA 2FBEA 3FLTA 2OX0A 2VOWA 1KBHA 4XACA 3RDIA 3ZR5A 1LGCA 1VQOV 5FMCA 1BCCH 3AG1B 3AB0A 2VO5A 4XOGA 4AEDC 4PBOA 5JH7A 3LAGA 3QG5A 1BEV3 5FYUA 2VVEA 3OYWA 1Q8IA 1QHDA 2PHXA 1HJGA 2BPA2 2WZPP 4QX7A 2JECA 3VD3A 1AR83 4PDWC 1FD9A 1O7FA 2XHNA 2IU0A 3D0JA 3FAVA 4R4XA 3LSQA 1M4WA 3DGEA 2PQQA 3ASNB 2PI4A 4YZ2A 4B3TB 3L2YA 1VR3A 2YV8A 1KJRA 4FPEA 3K2OA 3H8RA 2G38A 1W2BU 1S5HC 3E5QA 2JVDA 1ROPA 1VF6C 3ZYHA 2P90A 1IPJA 2K46A 2YPDA 1H8VA 2Y8KA 5B4NA 2ITDC 4E2GA 2Q0OC 2UU9B 4E4EA 2RJZA 1Y3TA 1PK6B 3P30A 4ATEA 2HWC3 2XVLA 3D3QA 3C7OA 1RUD3 4B1LA 5IYCO 4OX9O 5EIBD 3NAPB 4YHHB 1XNAA 3CL1A 2IXCA 5D21A 1BBT2 2E9QA 3LFIA 3CCMV 3VUOA 3O1PA 4LORA 1OQDA 2FL4A 3BOWA 3F5TA 4DY5A 3LF7A 5LP6B 2WLNA 2BW8A 5FL7G 2BWAA 1H9PA 5EFUA 1OURA 1G9DA 1WB8A 4XF9A 4BM8A 5A3TA 2X5IC 3E8GA 3ETGA 3KVAA 1RSOA 3IFXA 5T5PA 1FOD1 5JR7B 1JHNA 3ITQA 3E35A 1N1YA 1Q56A 1HXS1 3SKJE 4JI8O 4AG4A 5C8WA 3WB2A 3P3PA 1GV9A 1TMF3 2C4XA 2YB7A 1XU1A 1ZL8B 2P3YA 1C57A 2PHRA 5EHDA 3LA7A 1AR71 1NH2B 2OIEA 3ZN5A 4IIJA 3J26N 1RUF1 1COV1 5A3OA 4GMP0 5T50A 3H7YA 4WFEA 5BUVA 5BNNB 2UU9O 5C5TA 4X88A 4MVMA 2XLAA 5L73A 1AR63 3N3HA 2DCKA 5LOVB 4CH6A 4CZSA 2VWJA 3POEA 4Y22B 4QDRA 1VAMA 4AF9A 5FAXA 1QH7A 2LW8A 5D2AA 1VRH2 3VQXA 3VL8A 2VMCA 3AG2B 1CAUB 4X6QB 1IG3A 1CPYA 1QVFU 1K92A 3RZJA 4Q4W2 1APNA 1RYYA 4Q4Y2 2IXHA 3VBHB 3MLJA 2RDQA 1ALYA 3EHKA 3JASA 2UXCO 4FI9A 2QDNA 1GU3A 5FK8A 2LROA 1F4NA 5DAVA 4UCSA 5C9AA 3CU7A 3RYHB 3WU2Z 1R1A1 1OMIA 4OZXA 5T55A 1UOBA 1YJLA 2JDHA 5FFOC 4HLTA 2ZE8A 3E5UA 3DECA 4QHZA 3ZMOA 1WA8A 5C4WB 2ENRA 3GGLA 4LF7O 4ZXKA 1MOFA 1NR1A 2ZACA 2DV9A 4KU7A 1TA8A 3H50A 2PI5A 2X6BA 3GHNA 2E3CA 1PGSA 4UW6A 4YY3B 4K7JA 1CX1A 3CJHB 5FNVA 1WBFA 1ZZ6A 5GM0A 5BY1A 2XUEA 4G4FA 4JI0B 4GKKB 4NIDA 2WO3A 3K75B 4QXHA 3OPTA 3NWKA 4EWDA 1TUBA 1G86A 2GBOA 2Y38A 1W90A 1BYHA 2QQIA 4O2AA 2RS51 3V65A 1IS5A 1N0NA 2BTQA 1GO3F 1ZUQA 5LZ6A 4KP4A 1HNZO 5CB4B 4O2BB 5JWPA 4RAIA 4TLFA 4LH6A 2XKOA 2YI9A 3D36C 4FFBA 5JJEB 3IIAA 4NPLA 4QPKA 4QPIC 1OH4A 1MQTA 1WJZA 3DKWA 3QF7A 4P5HA 1UOFA 1N1TA 2DDUA 2YGLA 4XIOA 5LHGA 4DEQA 4QNHB 1EN5A 3K58A 2BRTA 2WZR1 5I93A 4GKJB 1OQ1A 4ZY9A 1I94B 2HWC1 3LEKA 4XJUA 1DGWX 4J6GA 4JDOA 3WF0A 4B3RO 3C7GA 1XOYA 1GP5A 4YSFA 1YJKA 1OOPC 4DV3O 2WQ4A 1VBE2 1LHWA 4A6SA 1S1AA 3FKSG 4IE0A 3WY6A 1HIXA 4BAYA 1S76D 1WZXA 5FRAA 1VB2A 5AFEA 3F7YC 2XJSA 3OE7G 1UY3A 3R66A 4QHOA 1W6PB 3K0DA 4LFCO 4KHPO 3OBZA 5D5PA 4RA0A 3OGJA 4HKWA 1X50A 1AR5A 3RBZA 4I0BA 3AFGA 4CDQA 5LK7B 4KU8A 3E89A 4GWNA 1K5MC 5IK8A 4CDUA 3VBOC 3CXCU 2XAGA 4XVHA 4Q4X1 4DB5A 5JMCA 4IE4A 1N4CA 1TVKB 3Q4HA 4DS0A 1AI7A 5K0UC 5GONA 2YHJA 3IPVB 3RZGA 1NCQB 2RS31 2DTWA 2W1WA 1BK0A 4Z2AA 3CJIB 3UKVA 5GLWA 5DABA 2H6CA 4I09A 4BLJA 1UU4A 1CZSA 2ZX2A 2R32A 4IHJB 5FZ7A 1GICA 3PU3A 1O6UA 4L8QA 4JGZC 3AK0A 4FQ4A 3LA3A 3WDYA 5LA2A 1LECA 1OF3A 4QKNA 3ABLC 4CU6A 1I6XA 3JARB 4WM8A 1XE0A 1M9NA 5GJ6A 5L3CA 1PVC1 2DCYA 3D3AA 1WMEA 1S0CA 2WQ8A 2Y6KA 1DGWA 3RRDA 2E26A 2R062 2RS13 3AG3C 2VUAA 5FPAA 1NOVA 2VZOA 2PN5A 4UCUA 1R1A3 3G6JB 3H8XA 5LW9A 4ASKA 2KQXA 5IWAO 5FUIA 3IBMA 4NKGB 2V72A 2ZS6B 4NXMO 3AG4B 4F8AA 4OQ9A 4BPZA 3SPCA 4YW2A 2HWD3 3QCWA 1YLLA 3DEMA 5A1LA 3JD3A 2JEUA 2Z0AA 2HWB3 2KG7B 2XWBB 1O3RA 5IVYA 1CGPA 1TUBB 4FLZA 5JIAA 2WT0A 1FYJA 1RHI3 1KQRA 1QQCA 4PLMA 2QWPB 3SEEA 5L3GA 3H01A 5B1AC 3I3MA 2VMGA 2CH7B 2CGNA 2R072 2WSVA 2DCZA 3HKEA 3S5AA 2AC1A 4FT8A 2A71A 1F4AA 4UW4A 1R6KA 4LF8O 2UYAA 4LBKA 1D4VB 3DL3A 2X6CA 1TMF1 1YHQV 4EN0A 4XPVA 1D5NA 1F2NA 1RINA 3HR9A 5A3WA 2W9XA 4EWAA 4BQYA 1SHWB 4JF3A 2JDMA 3K48A 4DYLA 4LHSA 4U2AA 5IHRA 1FKAO 4RQPB 3VQWA 2PHDA 2WJSA 4DOUA 3H9AA 4D7TA 1YUDA 2BSKA 2PFWA 5A33B 4BISA 4IEUA 3UJOA 1AI5A 5EYPA 3T2OA 4AQYB 2QQVA 4I0XA 3GZEA 1W6OA 5A32B 4DR6O 2J1TA 1DZRA 1WPXA 4LBMA 3JB4C 3VKNA 4HL0A 5IWFA 2DVAA 3GZUC 1CIYA 3LUTB 3HNYM 4OHYA 3JATB 4BK5A 4NHLA 2BBVA 1O8SA 1HKDA 2ZEYA 4FCAA 4CC5A 4O61A 1LAJA 3I3BA 4CDUB 2WYSA 2BCCH 1FS0G 3S57A 1POV1 2ZHNA 4OI2A 2BBAA 5DUWA 1JJOA 4UB8Z 5GLZA 2PXJA 3VBSB 1BHGA 3CCLV 1OD3A 2HBTA 1GTOA 1R73A 2YEVA 3JALB 1N0JA 4V2VA 1RUH1 1SQXH 2C1FA 4L2NA 3AJZA 3KV5A 3WG4A 2XG3A 4C0BA 5FZHA 5AVPA 3UT5B 1IKQA 2QBXA 1YJ9V 1OHFA 3DYOA 2BOJA 1LU1A 1QR9A 1VBE1 1NYWA 4FPOB 3G80A 2FQPA 2WSUA 1RJ8A 2WS93 2QE7G 4RN5A 1ODNA 1IS6A 1AR73 4EB6A 3ZHVA 4J1WA 1SFYA 4ZKTB 4IIJB 4KH9A 1U5YA 4K3UA 1Y7BA 4MGZE 1N34B 1BVVA 1W8WA 1N33B 4QXCA 2OKXA 2QJ1A 4FFHA 1F4HA 2YPJA 2WLQA 1Q6IA 2P7TC 4QM9A 3O9OA 3RT3C 2P67A 1JZ8A 4XBFA 5FPRA 3I7DA 2ADQB 2D7FA 1KUQA 5JPMB 2WAMA 4RQEA 3WW1A 5FKBA 4EKWA 1T2XA 3CCUV 2PHTA 3N2GB 3UJQA 4PJYA 4LP8A 1O4TA 2EBOA 3HR0A 1SACA 4FPLA 1LR5A 3J7AU 2ZDIA 2JGDA 1WCKA 2PQSA 4PDMA 1Q6HA 1AXYA 1NCRB 3JU9A 3KG2A 2IVJA 4JQTA 1RUI2 2FDJA 3D6EA 2LRPA 2QKDA 4B1MA 3ZSLA 3BKZA 3I97A 1SQBH 1YZBA 1RVF2 1W06A 1XYNA 1IQAA 4Q5OA 2XB6C 3IZOA 1UO9A 2RMKB 5KA5A 1KP3A 2F93B 1QDOA 2ATKC 4U36A 2X5IA 1Q43A 4GJYA 2VQAA 3U78A 4GH4A 2DUQA 1KDMA 5I0TA 2PF4E 3CWBH 2DYRC 3NW4A 2W2IA 2Z79A 2ZCWA 2XT9A 1BKZA 4UVCA 4ZPIA 2QQWA 2HH9A 4I55A 1BMV1 2ZE6A 2ETEA 4I3GA 4BQ4A 3O1TA 1ZA4A 2LUWA 3NJVA 2AGAA 1EV11 4HMZA 4QX5A 4RQPC 5CFCA 3CB2A 4GQ7A 2EAKA 4KWKA 1FNYA 1FV3A 5FQ0A 2QTOA 4E8DA 3H0OA 5B1OA 3SPGA 4QPYA 4DR5O 3BIWE 3NV2A 4MLOA 1TE1B 4NAMA 4XTMA 1FOD3 4C1WA 3ZMZA 2OZJA 4O2AB 4JI3O 2DYRB 2HKOA 4PIZA 3MPPG 4IV1A 4P08A 5FZIA 5KAFZ 1QXPA 2W94A 5D8AC 1RPRA 4AHZA 4RGAA 1H9WA 4SLIA 2PGGA 2YICA 3DXRB 1OCRB 3U75A 2W1UA 1NTZH 2VQTA 5C6CA 4QX2A 3SMHA 2KSDA 4S2FA 4GXLA 2ITCC 2NQYA 1E1QG 2XOMA 1HNWB 1H1IA 2PHUA 5E6HA 2LGQA 3R4UA 2VW0A 3CP1A 1VQNV 3URFA 1PIV1 5JR2A 4DEVA 1HJFA 5E88A 1PNFA 4FOYA 4J7KA 1YXBA 5CA6A 1DZQA 1Q6UA 4CH3A 2ORZA 4JI3B 5LATA 4QPIB 1V6MA 2M7WA 1YFWA 3R05A 4K8FA 4W8JA 4EN6B 3T0AA 4FLYA 3RWRD 1JODA 5KHKA 4PA7A 4W65A 1RUC2 2VUCA 4HPKB 5DZGA 3K5LA 4OPHA 2DN9A 1VBD1 2P5OA 2HJFC 4H0LB 1TVKA 4TV8B 1Y74A 4FPYA 3MHHC 3LCPA 3SGIA 3THTA 4FFFA 2DU1A 2B1IA 1R091 2JIGA 2F4VB 3ZYIB 4MVRA 4Q8LA 5FXZA 1RUH2 4PDLA 5EJZB 1NTMH 1PIV3 2JKBA 2IZWA 3BTZA 5GTIZ 4AFDA 5F2VO 2ZOEB 5FYCA 3ZYFA 3O1UA 3SH4A 2JJ1G 4WBNA 4JZGA 1W6MB 3B02A 2JEXA 3I8TA 5FPVA 1OA2A 3JBG2 4URAA 4H2AA 2ZA9A 1EPWA 3DKQA 3LWCA 1W2AX 4D6TH 3T2PA 4BXFA 5C3OA 4NWWA 4CP2A 1XNRB 3AL6A 4I5SA 1XNQB 1GP4A 1JS9A 4X8NA 4K8RB 4P9JA 4XC9A 4OYUA 3A22A 5FP9A 3THPA 1POV0 2VWKA 4CCNA 2QZ3A 5IVEA 1ND3A 1ZM1A 2EXHA 1GMGA 1XL6A 4CCJA 4KGGA 3MEPA 2VUJA 4EV0A 3OUHA 5A3PA 3JXSA 4L9BA 3PU8A 1JOJA 2VZSA 2JD4A 3MAQA 1BE3H 4HYOA 2Q5ZA 5HV4A 3TEYA 2VOVA 3G7DA 3C3TA 4L97A 1R082 3MV01 1J5EO 3LOBA 3ZBHA 1RIRA 3D36A 2EJRA 5I0UA 5IJ9A 4B7EA 3K3OA 2QQKA 3K4AA 1QU7A 5JI9A 3GB7C 2D3OW 4OLLA 1RFYA 2WNUB 5DECA 1NI8A 1W0OA 3WHTA 1OFNA 3ZX7A 3ZKUA 2XMLA 4CS4A 4EWEA 3APOA 2PLV2 2PELA 2V4VA 2ZAHA 5HI0A 3NV3A 5JIUA 1TNRA 3HKEB 4DV7O 4YARA 2JIZG 1GZCA 1XUQA 1KS5A 4LFBB 1CAVB 1LCLA 3ECQA 4CVUA 2H3OA 2HLDG 1RUG3 3OD0A 2D6KA 4AILC 5EYPB 5FJHA 3T2QA 4EZ4A 1KD7A 4DRRA 1MA1A 1VQPV 5IW0A 4DUZB 4OULA 4COVA 4DR6B 4FPCA 5F6KA 1HW5A 1PZ8A 1JVMA 3O1OA 2PUSA 3N35A 3ABKC 2ARAA 2W87A 1V9U1 2ZJCA 2P17A 2J1UA 4NIHA 1AR61 2WBKA 1RP3B 4JTDB 3K08A 1L1FA 4B3MO 1NUKA 1SERA 1W9FA 4N53A 3DUIA 1VQ7V 2GP3A 4WVVA 1KEXA 3ELNA 2VNOA 4HAMA 2Q8EA 1NKDA 4CXYA 1Q86W 4HNAA 5A2QN 3DGTA 4GUNA 2VUDA 2Y33A 3J7NA 4DZGA 3AP4A 4MS2A 2YY1A 4UW3A 4NHYA 2CH7A 1WD3A 5IK4A 3VKLA 2UXXA 5BMVB 4YJ3B 1I0HA 2Q67A 3ZIAG 4XF1A 3VDCA 3VBRB 4NAOA 3M8AA 4DV2B 1VQ4V 4FPJA 3AG2C 2G1MA 2X7RB 1CAWA 4XDJA 5FZGA 4YVSB 3OBRA 3K57A 4P30A 4MOAA 3OD4A 2UYBA 1S0GA 1AYN2 2B39A 4UFHA 3JCUZ 4MVUA 4K0KB 2PYJA 1ND3B 4Z1MG 5LA0A 2W1SA 4R8HA 2I2SA 1OCZB 2IU3A 2WLMA 1HB3A 2HWF3 2XL9A 1NLSA 5JPNB 3E86A 2E31A 4BE3A 1YIJV 3S0MA 3TGUH 2HYXA 2DE0X 1NVPD 1S55A 3KVBA 5L19A 3BFRA 5K1XA 2WIIB 3H8UA 5KMGB 2XQXA 3FBYA 1CIWA 3KF3A 2NR5A 3AMHA 4JCKA 1Z78A 3LNNA 3POWA 2RCVA 2DYSB 4UCOA 4FAHA 2XAHA 1RUG2 3WVJA 3PLQA 3R6SA 3H7JA 3B77A 4X1IB 2Y0PA 2A3QA 3JBG1 2KXLA 2Q4PA 1MS8A 1BT8A 1XC6A 1YITV 3O5SA 4A7KA 5ABJB 3H1YA 4TTGA 3SQOA 3UO2A 2VBBA 3C7HA 5F2WA 3Q8FA 3RYFA 1FYUA 5DMYA 1BHBA 1NZCA 2QQNA 2WFF3 5FPBA 4XF0A 1SS3A 3ZHTA 3MD0A 3DPRB 4PQQA 2WNUA 4Q29A 4MVTA 3ZDVA 2JICA 3CXHF 4V2WA 1X33A 1OD5A 4NWVA 5CZKA 1RHI1 3AYCA 4AFBA 2JB4A 3W9AA 3H3UA 4A3XA 1A32A 2UWBA 1Q8SA 2C26A 2OUJA 2KM2A 2R49A 4QU1A 5JXHA 1SBEA 3VHOA 4Q4V3 1STMA 4P02B 2H0BA 3FMGA 1G9AA 1HQWA 1GN2A 5CA1B 1S2BA 1YCIA 3DXRA 4DV3B 3WNPA 2GP5A 4PF1A 2C0ZA 3OMIB 1W28A 2VZTA 4QE9A 2WFF1 4NIGA 3BOPA 4CCMA 2VQ0A 1RITA 2RS52 3N4MA 2QJVA 4J10A 5EZYB 1YI9A 3ZN1A 4G9SB 2YZ4A 2ZBJA 1UZZA 4LPLA 2AH2A 4LF9B 1R64A 4LBNA 1QY4A 2VW2A 3AG3B 1X4TA 5LRRA 3ZYJB 2OT5A 2GMPA 5LXTB 1QQP3 1RUE3 2JS5A 1BBT3 3VBRA 4WFHA 2YXSA 4BOWA 4EYUA 2WNVB 5HV0A 4HANA 2A7WA 3T4DA 5M0TA 4CRQA 3KSCA 4Y4RA 2ZR2A 1WCUA 2QQMA 5KUMA 1CESA 2IM9A 2CTRA 4I4TA 5FO7B 3APQA 4DMIA 1K97A 4D69A 4YGDA 1RPOA 1VBC3 3FX7A 2B8MA 2Y69B 3N7LA 1JBCA 5FZLA 3BABA 4Q4V2 5F3GA 5CNAA 1JHJA 5CADA 5BXXA 1W6QB 4CCLA 5EV7A 4XF3A 5FYHA 3DPRC 3X2QC 1JR9A 2VZRA 2ZX4A 1OVPA 2OQ7A 1Y43B 4B3SO 1PO12 3QH7A 4CXXA 3ZFEA 2Q7EA 4WF9V 1BZKA 4K40A 2VMEA 1D2SA 2RMU3 3LDEA 1GZWA 3HMYA 3AKTA 4O4HA 4NVPA 2D2CB 1VB4A 4AFAA 3VOUA 2JG8B 4XFAA 1K45A 4CU7A 1RGSA 3FBMA 3SYCA 4ES9A 3THCA 4FPHA 5LMNB 1D2QA 4IERA 1AX0A 1NA1B 3EMRA 3N2KA 3LGRA 1NQTA 3LDCA 1V6JA 3ZN6B 4U7NA 1PNGA 5JSOA 1ENXA 4Q0PA 3WP5A 2BOCC 1PNLA 2R72A 4P2ZA 1SLTA 1DK1A 1GR3A 2W47A 4YVWC 4Z07A 2WR9A 1RSOB 1UX7A 1LEMA 1QU0A 1ZBA2 1BK1A 4AEKA 5BXZA 1HRV3 2RS32 4NB5A 4UT5A 4A42A 5FREA 2AZ5A 5EC1C 4XZUG 5LP6C 5C70A 3WOGA 4OPAA 4HVQA 4YYOA 3D4KA 3HJRA 3JATA 5LOVA 1SQGA 3NSTA 2CYFA 1MABG 2YIBA 1GUIA 4GKXA 3RWKX 1NLRA 5F7UA 1SETA 1S0DA 2D6LX 4CP0A 2RS12 3J8F2 4XZPA 1TNFA 2ZEXA 1XJAA 3ETDA 1V6LA 3GZAA 1UAIA 3SYPA 4OQ8A 1PMIA 2Q0AA 2J1EA 3HNBM 2YEVB 3JALA 4GX0A 5CA1A 2IXLA 2H0VA 3E6CC 5IFPA 3O14A 4MZUA 2B9UA 4AAPA 1IXBA 3CRAA 1K73W 4KFMA 4DR4B 4LO5B 3K4DA 4XETA 5FZBA 4W4ZA 3WSOA 1H6XA 1THZA 4BWOA 4INDA 1DQ6A 5BNOB 3ZIWA 3LNMB 1X82A 3I55V 5B1NA 2VVDA 2B9VA 1WUVA 2R6QA 3RI8A 4DR1O 1SA0B 4OX9B 4LKDA 5FYMA 2YFUA 3HVDA 3A21A 3RS6A 4JYYA 1C1FA 4D6SA 5BNNC 4MHUA 2IJKA 2DWEC 4OHXA 2B7YA 3KMHA 2HWC2 2QNKA 1ZBE1 4J42A 2IVIB 2JK5C 3OOXA 4XDKA 1WMXA 4FLVA 4IYIA 1KDKA 1QBZA 1VLNA 2B45X 3USSA 1E1RG 1RUD1 3AG1C 1KU9A 1UMZA 3KGZA 2BZDA 4JRLA 1W2NA 4IEYA 4M3CA 5FXVA 3BPZA 1HB1A 1LNSA 5JXJA 3UKMA 4HXCA 3R4DB 3M3EA 4WM7A 1M4UA 2LJ2A 2RNBA 1M57C 3AZVA 1V54B 4DV4B 1W8HA 1H8TC 3ZXKA 4N53B 3PUSA 4I4TB 4AI1A 4LULA 1J58A 1AR82 1Z7S2 3OUJA 3SLIA 3VQVA 1W99A 5EBMC 3SKVA 2ZGRA 4LC1A 2MEV3 2W52A 5FMOS 2JD9A 3N9PA 4N90A 3B4SA 5EYXA 1TGOA 4HONA 3DC6A 2W0FC 4M01A 1NZIA 1EY2A 3V0BB 1PK6A 2EALA 3BALA 1JMKC 5CG9A 4IGQA 3W59A 2PYLA 1HV1A 4Y20B 4IXLA 2DCTA 4ZZ8A 4D8MA 4JZRA 3AZWA 5JJNB 2R9AA 3RVYA 3IB3A 4YZ4A 4H7MA 3ICXA 4YVSA 3HT2A 4WFAV 4JGZB 1LKNA 1R1BA 3MIGA 4Y1ZA 3VBFB 4AR2A 2A70A 3AMNA 1J84A 4YLZA 1OOPB 1SQVH 1OXCA 4X64B 1UPGA 3I3DA 3FJSA 1BEV1 1NA1A 2DVDA 1SRYA 3NNMA 1AP5A 1VBA3 3OG2A 5B1BB 1XREA 1N36O 2EILB 1DG6A 5F5QA 1B3QA 4JPRA 3AYEA 3AC0A 4CUBA 4DV0B 3VGIA 4BYYA 3PMSA 4ORFA 1OPMA 3LOIA 1S3JA 3ASNC 3THOA 2VCBA 4JGYC 1W0JG 1XSQA 3IDEA 1K5MB 3VHRA 1ZRFA 4NROA 4JYAB 5DXDA 3UCSC 5T54A 3X29B 4K0KO 1VBA2 2ZEZA 4X66B 2C24A 1LOEA 5FYZA 2V7QG 2IC1A 2XDVA 4OXSA 5CYYA 5FP4A 3T4ZA 4PA3A 4QXKA 3S5QA 2R073 3WP6A 4X20B 2VGDA 1H4HA 1WPBA 4TT3G 2E5LB 4XABA 1O9HA 2PHWA 4KNCA 4XBLA 2CDYA 5B4XA 5C8CB 4JI6O 2RHPA 1YJWV 3ZVXA 4J11A 4YHHO 3E83A 2HLEA 1UMIA 2JDZA 4YGBA 5FZ4A 1C5IA 2SLIA 1W39A 2Q8CA 1PHMA 4GZ9A 2FDIA 2D6OX 5JAXA 4Q0QA 4D6RA 1YO8A 2M6YA 5JUVA 3ROUA 1XSRA 3CNAA 1XMQB 3I2IA 4AWDA 2EILC 1CX4A 3HB3B 2IXKA 2MNGA 4BU2A 2LTNA 1JOYA 4Y5SA 1EV12 4I30A 4BW9A 3VBOA 4Q0UA 2C2AA 2ZQMA 2A79B 1WA8B 4N43C 4OI4A 4Z1VA 5FPXA 3CCRV 5K1PA 5IVVA 2VCAA 2RJ2A 1OCOC 1JZ5A 4YVWA 2ADPA 4YG3A 4WCEV 4PA4A 3R0RA 2OWOA 4N9IA 3HWJA 5CFDB 1KGYA 3TETA 2JIJA 5FNVB 3TEWA 2HEVF 4FM0A 5L7OB 5K4LA 2CWMA 4XURA 2HWD2 1DTOA 4IESA 2WLLB 2PLV3 3ES1A 4J9ZB 3AK1A 1E79G 1IBKO 5H6RA 2UXBO 3M2MA 1MEC3 2O57A 5GZDA 3LA2A 4GA9A 2JDIG 5DG1A 4NJ4A 1ND3C 2R0FA 4OGQB 4FXKB 1QGLA 5IJRA 4WVWA 4GULA 1PO22 3ABMB 5A3NA 3AP6A 4P5YA 3GCXA 4LF9O 3CEIA 3HNMA 5H9QA 1H8TB 1XNBA 3SEPA 1M93A 3SXWA 3RVHA 2G19A 4Q27A 3BA8A 2ZAAA 3TK1A 1HXS3 4IW3A 3VL9A 3I59B 1B35A 4AEJA 1N34O 1SDDB 1MG1A 2QQPA 2QQLA 5A32A 4LJHA 2DYSC 3RSJA 1Z0HA 4JGZA 1REDA 2WLKA 3GZTB 5FJKA 1XMQO 4CUCA 3KB5A 4XDQA 2PAEA 4NIIA 5A7PA 1VBD2 4BIFA 4BQXA 5E16A 3PNAA 3VKOA 4LHLA 3H1HH 1JH5A 1O91A 3OGIB 5FO9B 1J3QA 3GALA 3U11A 4CBCA 1WW7A 1JZ7A 1WA6X 1P4RA 4G3YC 2B9ZA 1FXKA 3ZSMA 4CA9A 4GKYA 1SESA 5I0RA 2CU5A 2ZE7A 2QTWB 3GBGA 3P3NA 2OUHA 3PURA 2WN2A 1A78A 3AKQA 2A6VA 4CPBD 4HKOA 1PL0A 4URTA 1ULFA 3WF2A 2Y48A 1W0NA 1GP6A 3ZRWB 5DUVA 2OW4A 5CBLA 4WVMB 5J09A 3LDRA 2QUOA 1HP8A 4O9EA 2P06A 3MPBA 2GUZB 4MTGA 4ZU5A 4CEWB 3EYPA 1SBFA 4TWTA 1RXGA 1OPOA 4E8CA 3PIJA 1HB2A 1NTKH 2VTXJ 1QJX3 1P84F 2JENA 4LF4O 5FYYA 5GZFA 1BVP1 5IVFA 3H1MA 2W91A 3JD1A 4Y33A 2BE3A 2GMEA 1KJLA 1QH6A 2ARBA 1COV3 5FY1A 1Y4WA 3VZOA 5J1XA 4X62O 4MGSA 3C3SA 1HW7A 1VBD3 4DRVA 4ISQA 4I3PA 5C5UA 3A23A 4LFBO 1UY4A 1KD1W 2GSMB 1YDXA 5E79Z 1PGW1 1W8NA 2K2SA 2B4KA 4QM8A 2GV9A 1PM7A 4LF8B 4JDNA 1ULCA 2J42A 3VDDB 4CU8A 4XDPA 4XHXA 2RDCA 3AMMA 1XQNA 3CF6E 2VL4A 3FAVB 5FUPA 2Q8VA 1H6YA 1LHVA 4RO2A 2BWCA 4K35A 3OTOB 1DF4A 2YU2A 2VR4A 2CY6A 2QM7A 4J25A 1KYOF 4C8DA 1JYTA 1EZJA 1BSMA 3C90A 1QJX2 5JLVA 1XNDA 3WNXA 4J7JA 4WM7B 2A3YA 3C8XA 3NKTA 2TEPA 1NA1C 1AVBA 2Z5WA 3PUHA 3A0HZ 4XJ8A 1EN6A 1KFXL 2VMIA 3I54A 4AOCA 2XL7A 1A3KA 1JOBA 5FMOL 4LBEC 5HXMA 2JG8C 2CWSA 2CGOA 1G6UA 4A3ZA 4BZ4A 3BHPA 1ZZ7A 1WBLA 2ZKOA 1AR72 1K5JA 1QVGU 4JRAA 2NYYA 2G9GA 1LOAA 1PKXA 2UY8A 3FB8C 5H9PA 3N9OA 3ZM8A 2V5DA 5E1AC 2CDPA 3E22B 3O65A 1ENRA 3NO8A 3J7LA 3LB9A 1JFFB 5B3SB 2VZ1A 5FBZA 4UVAA 2QWNB 3SC7X 1TAEA 4AQSA 2CAZC 3B8MA 4DUYO 2GC3A 5JI7A 2P3IA 5G05L 1VRH1 1ND2A 3T2MA 1M5IA 1AR4A 5CN0A 3L70H 2N74A 3BODA 1AZDA 4JV5B 1OQEA 3KF5A 1IPSA 3MBWA 4YW7A 5J48A 5EBLC 1KRIA 3J80N 3RW0A 2ET7A 4AQ6A 2HVJC 1ENVA 4CEYA 1REFA 1UWWA 2IUWA 5KC6A 1VF7A 1QXRA 2O8OA 1SFNA 5EXOA 4QX0A 1VRBA 2EIJC 5LMUB 4UBHA 5KBFA 3IWZA 2XONA 3JSNA 3A2FA 2NMOA 1Y74B 3IAPA 1L0NH 3BPSA 4PHZA 1U97A 3SCGA 2R063 1LB2A 5FLHA 5D5QA 2YC2A 3Q8BA 5CKQA 3UT5A 3BIEA 5CBGA 2Q30A 3ASIA 1LTEA 1EM1A 2LW7A 2DOSA 2CV6A 3TJTA 5LXTA 5A6XA 1LOBA 5GZEA 1GH6A 4DV1O 4DUZO 2WLIA 3M7AA 3T30A 1CONA 2Q7GA 5KWRA 1XNCA 2ZGOA 4FPGA 3KD4A 4O4JA 4LA2A 3K03A 4LWSA 4JYCA 1XU2A 1FAFA 3FLRA 3ORJA 1YFUA 1GN3A 3IMNA 3SYQA 4JC1A 4XFBA 1MEC2 2L35A 2A6XA 4BB3A 5L3EA 5JJJB 1QLEC 4YGCA 1YQ5A 1P7BA 1NX9A 2Y26A 2IJJA 3NVCA 4LBQB 3HKBA 4GCZA 3MUZ1 4G27B 2XPJA 2J7MA 3LSSA 1B06A 4QB2A 2XAQA 1U0AA 3K5MA 3VKFC 4QX3A 3LSDA 1AYM3 2D6NA 1BQ0A 2VZQA 3IDBB 3N2GA 2XBO2 4XJ9A 3FUQA 1QDCA 2IJIA 4FLTA 3ZMUA 4YIPA 3B5LB 3CRQA 4FLWA 2P22C 1JTZX 3CRMA 5ITZA 1N33O 2WNOA 1QNWA 3W58A 1LGNA 2XJRA 1P49A 3UK9A 3VZJA 5CMUA 2ZTNA 1Q8PA 2X8KA 2D5HA 3DV8A 3WZ1A 1UMHA 1W8TA 4CDUC 4K8XA 4U7OA 5J36A 2FTKA 4COZA 3TAYA 3HQUA 1F15A 1UU6A 3FE5A 2WAOA 5DDJ3 3L73H 4P9LA 3EO6A 2AENA 4NO4A 1ZLZA 4DIQA 3USUA 4QGPA 5E8AA 4KWLA 4PD4F 5IJ0B 1FXZA 1A34A 3PHMA 1X9PA 1QNMA 1QLNA 1MS4A 2P34A 1TVGA 3DC5A 3SPJA 3SJAC 4JI2O 3I2HA 2JDUA 4META 1GBGA 1YXWA 1AL23 2ZMKA 2DJVA 1XL4A 4IV3B 2BNMA 2OS2A 3JD2A 5HCHA 5KAIZ 5BNPC 3CRCA 2AUYA 2Y4TA 1VMFA 1OKQA 1ZZ8A 1XMOO 3FLPA 4MG2A 4AI0A 2D93A 4JHZA 1OV9A 2GH8A 4O4LA 1SLBA 4R9BA 4U3FH 1ENSA 1F5FA 4B3NA 3N36A 5BNOA 2NP0A 1IBMB 2HHHO 1EN4A 3I59A 1H8EG 4YW6A 3IGAC 1RUF3 2EX3A 1W6NB 5CISA 1MSWD 2ZHMA 4P9OA 2ZX0A 3OY8A 3K46A 4YW4A 3SITA 4D7SA 3RWNA 3H9VA 4A2UA 3W7TA 2WLIB 2NM1A 2RJKA 1QJU1 1V55C 3VZNA 1H1MA 2BQPA 2C6SA 1IBLB 4Y5TA 5HBAA 1D4M3 4LKEA 4HSJA 1RMU3 2OYQA 4NN0A 4ZOLB 2ZNIA 4COWA 3ZRVA 3DYPA 4QPJA 1WB7A 2IXJA 3TOJA 5LCWL 3ABZA 4K6BA 1I5PA 4HBNA 4OHVA 4OHZA 2YUAA 2E32A 5LA1A 2FMLA 5KXCA 1QCEA 1WLDA 2WFPA 2RS33 1JYWA 2X05A 4BMBA 2ODMA 5TISZ 5FTTC 5IAXA 2JJ2G 1E57A 1DYKA 4BA6A 3Q8CA 1DLCA 2BUKA 3DCQA 1H2KA 1DIWA 1QJY1 5LWBA 2V4DA 1LUWA 5FZEA 4AI8A 2FCTA 3ASOB 2VU9A 1R092 1W2OA 4KHPB 1LOGA 1AI6A 3WFVA 4HZ3A 4DPNA 4FZ0A 1DHKB 2EVXA 3NJYA 4CH5A 2RS11 4YG0A 1D5AA 1PD3A 1YI2V 3RQ0A 4K1ZA 3ACGA 4HETA 1W6MA 1RM1C 2F4PA 5KMGA 1ZA7A 3NNJA 4XAAA 1XPWA 2HR3A 1OLRA 4QB1A 3P5BA 4MW8A 3RYFB 1K34A 3WDUA 4LCUC 2BGCA 3OBAA 4XDOA 5DN6G 3I2GA 4NTYA 5JOZA 3DTUB 2H6BA 3OPWA 1OZ0A 2ZD9A 1L7QA 2WZ8A 1UL9A 5CVRA 2QQUA 3CMEV 3L9JT 4OHWA 3HAGA 2VTFA 1LULA 4QAWA 1NY72 3JUUA 4QIWF 4IEVA 4COYA 1SQPH 5CU1A 3O0WA 5J2UB 1S5LZ 1ZVFA 4CDWB 3OGCC 4DK0A 5KR7A 3WT3A 2QEXV 1WNSA 3MHZA 3BB6A 1K5MA 4PT6A 1PM9A 2IH3C 3D82A 1KP2A 3O1RA 3WQ0A 2XWJB 4N8MA 3VV1A 4FJCC 1AJPA 4MT8A 4PJ0Z 2IW5A 3GHMA 1S0FA 4XUOA 1PZ9A 2QQOA 1I9RA 1PX4A 2YMZA 4BIUA 2E63A 3CZUA 2ZXQA 5HXVA 3JSLA 2YROA 4DXTA 4F6EA 2BGPA 3N7MA 2JE8A 4DRXA 4FVMA 2K1EA 4FLXA 1AX2A 4P14A 4IV3A 5FYTA 3AKSA 1L0LH 4B08A 2PLV1 2W1QA 5FY9A 3VKMA 4V1PA 3JD73 1RUC3 3FUOA 5F8PA 3WUDA 1GMMA 2GC0A 1LOFA 1RC6A 1NZ6A 3D0SA 4QE7A 3E8BA 2KD7A 4AQYO 4GKJO 4O4LB 1ZSPA 4J80A 3PUQA 2WRAA 1SDWA 2VH9A 2EZPA 3WQ7A 2OQ6A 4XMAA 4XAEA 5EBWC 3UESA 5KUKA 2ADEA 1W6NA 4B7KA 5FMBA 4K9SA 1DQ2A 1O8PA 2YYOA 2WC2A 4JHTA 3T1LA 4TV9A 1L7RA 1QMJA 5SV5A 4I7ZB 2VG9A 5FLXN 2DYCA 5KX5B 5FWEA 2OVUA 2JDYA 2WZR3 4QPGA 5IAVA 4Y4YA 5JOXA 1GNHA 5K8SA 3ZSKA 1Q8VA 2O1QA 2OXBA 2AREA 1IHMA 1HRV2 3I5DA 1VEWA 3FYEB 1YQ6A 5GONB 2GN3A 2YDEA 2Y0IA 3CEWA 1JZ4A 3L75H 1CN1A 3GXUA 1CZTA 4O2BA 3WNOA 4JYBA 2WABA 5IY5B 4XXPA 4TSFG 3KT1A 5I0SA 2BDRA 2VMHA 1JUIA 5F32A 1PP9H 3N9NA 3ZPOA 1MQTB 3GNEA 4DUYB 3T0DA 3M70A 3KCYA 3ZXEA 5JCOA 1IBMO 3HKDB 4X62B 3KHBA 1ASJ2 4QX1A 4NYKA 2UXNA 1VBA1 3FB7C 1AHSA 5FDBA 2FDGA 2ETNA 3ZHQA 1T5EA 5I8SA 2X0LA 3OGGA 2L9LA 5IT6A 3K51A 3LE0A 1RUE2 1ZBE2 2HG5C 1MS9A 4FLUA 5GZCA 3ZYPA 3LSEA 4Q4Y3 2YIDA 3STLC 3AMPA 4DR3B 3MI8A 4YZ5A 3WDWA 2WDBA 4WVZA 2GN7A 2UY9A 4TUYB 1H38A 4P9XA 3CCQV 2QKSA 1AJQA 4DXRA 2C9AA 2WINB 1V6OA 1YHFA 3TXSA 4YY3O 2YFZA 1DGLA 4GH4C 4IEOA 1RUJ1 1H30A 4IE7A 2B5HA 2BOBC 4R52A 1ASJ3 1NBMG 4GWIA 1SF9A 3FX3A 2H8PC 1RJ7A 1YC61 3ZFGC 4U3JA 3P32A 4UV8A 3JD4A 3H1IH 4HVOA 3T1YB 4JX0A 1WD4A 1NS1A 2A3XA 1CVNA 3PVNA 4IV3C 1DDLA 1KC8W 4S2DA 4EJRA 3Q4HB 3PVBB 1RMU2 4ASMB 4GMP1 3U4XA 5FPOA 4O4JB 4OUEA 4DUVA 4LWSB 4HN1A 4RR3C 2FDFA 3OGRA 4UV9A 3C2UA 4CUAA 3WB0A 4J1XA 1B09A 1YEWA 3QLQA 3CJXA 1UZVA 2HWF2 5LGNA 2VC9A 2ZGNA 3JAWB 1V9U3 2W46A 2HEYF 4X9QA 4LNUB 4FVVA 1YQ8A 1NE6A 3L2HA 3HPLC 3ATGA 1REEA 1HN0A 3HBZA 5A9GA 5A7WB 2GU9A 5IYZB 2ZKLA 5BV6A 3AEIA 3T1CA 4ZKIA 2BEOA 1CAUA 3A0RA 1ZX3A 3FB6C 3OPZA 3OEHG 4QPIA 1AL21 2D40A 2ZMNA 3ZYGA 5FKCA 1N3PA 4RR3B 2GH2A 4NR1A 1DGRA 4QQHA 4X1KB 2O8QA 5T3NA 3W5MA 4UVBA 2D6PA 2WFF2 1KXGA 3PJQA 1FXHA 2GALA 4MVSA 4MO3M 5IT9N 1FNZA 1J3PA 3SHRA 4CUGA 1JUHA 1IS4A 3ZHUA 2Z69A 2EA7A 2WNVC 1VQLV 4Q4X2 2XBO1 2RJLA 4L11A 1ZREA 3TCUA 1MMMA 4C1XA 1BLZA 5BYNA 3S6PA 1R3IC 4WBNB 5FY5A 2WNVA 3TWIA 1HDKA 2UUAB 3OT7A 1AYN3 3ZFFB 4S2GA 4A6OA 3CE2A 2W39A 1XYOA 2LQTA 2WS92 1K5SA 4ZOLA 4RQPA 3BTAA 2WLHA 1IS3A 3TXQA 4JGYA 3RZHA 4KI5M 5C9AC 4E2SA 1W59A 2VVFA 4RHV1 3CMGA 1F5JA 2QE3A 2DQ3A 2Q9LA 2ZCEA 1W6OB 2RR11 1JYIA 1H1AA 1N47A 1NVPB 5A3MA 1MS0A 4YGEA 1F4MA 1Y6XA 4FQZA 1UJWB 2Q1FA 2CSGA 4JI0O 4GKKO 4NIAA 5FK7A 1NH2D 1DCSA 4IEPA 2VNVA 1U5XA 4UFKA 3PUIA 3JAKB 1AL0G 3ABMC 4O4HB 3WF3A 2VZ3A 2XVKA 1C1LA 1LGBA 4GAZA 2ZMLA 2J1AA 3VBUA 4NHKA 3BVCA 1IVSA 4U3JB 3HIFA 1KMIZ 4MW3A 1R6TA 3B00A 4KXRA 4IEZA 4FOVA 1GYKA 3V0AA 4Q4X3 3AXDA 5FYIA 3MLKA 3QH6A 1QJZA 4GB33 3S7IA 5IWAB 3EFFK 2D98A 1ZWIC 1O4YA 3GCWA 4EE2A 3LQCA 2RR13 3ZIXA 2J1VA 1EYBA 2RQ6A 4LLOA 2VRZA 1AX1A 4Y3OA 1HV0A 5EJ3A 4R50A 1V00A 3W21A 3WG2A 1ZRCA 4JZ2A 4JGSA 1N36B 3G71V 2WKKA 1FXVA 4AQ2A 2AZ2A 1AJOA 3MFAA 3ASOC 1A8DA 4XUNA 5FQ0B 4Q26A 1G9CA 1N8RW 4GB31 4CTEA 3LZZA 3H3LA 1QQP1 3BI3A 1AYM2 2QCSB 2QDRA 2UWAA 4ONUA 2KA3A 3VLBB 1NCRC 2AEZA 3IDCB 1HRI3 4AVCA 2CAUA 4JV5O 1SFPA 2N05A 3AVSA 4S2HA 1SA0A 1OVSA 4PA6A 4WM8B 3MUY1 2OZ6A 4IEQA 4N21A 3STZC 5LY2A 3JD0A 5LHHA 3IPVA 3S3XA 4XFHA 4PELA 1GOGA 5FZOA 4RUEA 3DXTA 1HDJA 4M0NA 5LBFA 5FZFA 5CEHA 4KMQA 4EFEA 2F1MA 3THDA 4YJ2B 2OYZA 1NQDA 5IYZA 5JZGB 4JYAO 3ABLB 1ZBA3 3WHUA 2OTLV 3D5OA 5JH7B 1XI1A 2V4AA 3BU0A 4QGNA 3G67A 1X9TA 2E51A 5JVVA 1JPXA 1PMJX 4TQFA 1HRI2 1W8ZA 3WG7B 3CC4V 2OA2A 3K04A 3RZMA 2LGWA 4JAUA 1XILA 1OKOA 5I8TA 2UUBO 3A4UA 2F43G 2EULA 2QM8A 1GSLA 2D43A 3K3NA 1UY1A 1BZWA 1RUG1 2VNGA 3WX5A 4AGRA 2RM22 1H4GA 1YI7A 4D7YA 4QX8A 1UU5A 1VQKV 2Z2SB 2BVVA 1AL22 4R9AA 5ITZB 4A44A 3OUIA 1VAKA 4B4RA 4DXSA 4XILA 1QHTA 4I50B 1ZTEA 5EC2C 3DXUA 3UGHA 3JD72 3LDKA 3OEAA 3RYIA 1FPOA 4Y20A 3CBNA 4QKFA 4MSVA 4OUSA 5CAZA 1VBC2 2ZXWC 2D44A 1FFXA 4L8JA 1UXXX 5DAQA 4BJ0A 3OF1A 1AROP 1S0VA 1QJEA 1QJFA 1YNAA 5A6QA 4LF7B 5IATA 1NKGA 2XNDG 2TNFA 2ZHKA 4RUFA 5FXWA 2A1XA 1GN6A 5C4WC 4YM2A 4DV6O 4PLNA 4HN0A 3ALQA 4X1IA 3Q8EA 4DV4O 4OMCA 3CPWU 1LOCA 4R9CA 4LF4B 5KHHA 3JCZA 1OFSA 5JOYA 4YM1A 3K0GA 4N7IA 4FIPC 3IT8A 4GWJA 1J83A 4PDWA 4AHWA 1MPXA 3I2DA 3WP3A 1HNXB 5FZ1A 4XBQA 1XDCA 3C7FA 2PHLA 3WP4A 1H2NA 4CCEA 4IGOA 3O0VA 3WNNA 4LE3A 3FHIB 2X10A 2JXAA 1X8EA 4GD4A 5A6YA 1SG3A 1FAYA 2G9ZA 1Y66A 5CFDC 4R7CA 4IV1C 5JSPA 3P1IA 1QJX1 1YF2A 3MDSA 1ZZCA 1WLWA 5J3UA 4E9KA 5JMOA 4BHPA 5LBEA 3LFMA 4QQ2A 1BMV2 4MTFA 1V9PA 2WWJA 1ND2C 2JX9A 3K79A 4XCBA 4EEQA 5AVAA 1Y76B 3TN93 2WWSA 3AP9A 4DINB 3ZHSA 5IYBO 2AGSA 2AACA 4LHKA 2XBO3 2HP8A 2RMU1 3AP7A 4ZONA 2XJQA 3JASB 4NRPA 2EIBA 1GM8A 2O0OA 2WT2A 1N1VA 2J1RA 1U5IA 3WW2A 5JOWA 4RWUA 2UXDB 2FMDA 4ZS2A 4JTCB 1Z5VA 1RUI3 2GDFA 3WD5A 4IGGA 4UAPA 5KXDA 1V6KA 4MGYE 5CG8A 4IDZA 4B3RB 3SISA 3N27A 3MGUA 4W6YA 1KFUL 3B3QE 3NJXA 3GWOA 1JQ0A 3PVOA 3MYXA 1CJDA 2GMMA 1XHZA 1CXZB 2A3WA 3TN92 4LITA 3RYHA 1RUJ3 1DQ4A 1IX9A 4LT5A 1EZVH 2AXTZ 1IBKB 2UXBB 3ZR6A 2D6MA 5FY0A 2ZT9B 2ORXA 3LIHA 2FDHA 1Q90D 1GKBA 1I5XA 1YVWA 4NMIA 1FPN3 4N7UA 1IGOA 3WDTA 1BCXA 4IE6A 4CU9A 3L71H 3VQYA 2Y64A 1DLBA 1US6A 1O9GA 3T1HB 2F17A 4ARYA 1HNWO 3MHSC 2W6JG 1MS3A 3ON7A 4WM8C 1N3OA 1DF0A 2WO1A 4PI0A 4IE5A 2W68A 3CS5A
chains in the Genus database with same CATH topology
4SBVA 4FT8A 2A71A 2QUOA 4RR3A 4O9EA 4UW4A 1RUOA 3MPBA 3SWTA 2HEWF 2UYAA 1IPKA 4XHBA 2YGMA 3TRSB 4UXAA 4LBKA 1D4VB 4OFGA 4ZU5A 3DL3A 4B4QA 4CEWB 1SBFA 4YG6A 1TMF1 4TWTA 1AR81 1OPOA 4CDXB 1VBB2 4C90A 4XXAA 3QD6A 4XPVA 4EN0A 1RL3A 1QJX3 2BVBA 1F2NA 1RINA 4YW3A 1UF2C 5CFDA 3HR9A 2JENA 1FMD3 1HQNA 3CO2A 5GZFA 2OG5A 4PLOA 4EWAA 1BVP1 1WCDJ 3H1MA 1HXS2 1PVXA 1O3TA 3K48A 1FX5A 4U2AA 2HWE2 4MX3A 4LBOA 2GMEA 1MZ6A 4P9IA 1KJLA 5K0UB 1MZFA 4RQPB 1QH6A 2ARBA 2PHDA 2WJSA 1COV3 4DOUA 4CDWA 3H9AA 4D7TA 2HYKA 1YUDA 2PFWA 1DQ0A 3VZOA 5A33B 4KG8A 4KQ7A 2RM21 4LO8A 1CAXA 4IEUA 1PGW2 2PA7A 1GZWB 1VBD3 4CEYC 3UJOA 4DRVA 1O3SA 4ISQA 4XBNA 3FFZA 1C8M2 1RUF2 4I3PA 5ACA3 2MEV1 1W6OA 4P9YA 3VHNA 3MZHA 2Q4AA 1SBDA 5A32B 1PO21 4LO4B 2YUEA 1NCQA 1DZRA 4XFIA 1PGW1 3H1WA 4LBMA 1NCRA 2K2SA 3JB4C 4QM8A 4TZDA 3VKNA 4HL0A 1PM7A 4JDNA 1ULCA 3ETQA 3VDDB 2DVAA 3GZUC 4RHV2 1GQGA 4XHXA 5GALA 1FPN2 2GSYA 1XQNA 3AMMA 4Y1VA 3CF6E 4OHYA 3ZFFC 3CLPA 4NHLA 2BBVA 1HKDA 4FCAA 1Y9QA 1LHVA 1ZZBA 4Q4W3 2Q5TA 2HWF1 5J7MA 5HSXA 3VBOB 2BWCA 4Q8KA 3VBUB 1QNYA 4CDUB 1NX8A 1MR5A 1GQHA 4JTOA 1VIWB 3OJBA 5JCTA 1V70A 3APBA 5L7OC 2CY6A 1GFF2 3ZXAC 1POV1 2ZHNA 4OI2A 1QJU2 5DUWA 4QQLA 3Q9OA 4TSVA 1QJX2 5GLZA 1JW6A 3S7EA 5JLVA 3VBSB 1XNDA 3WNXA 4IEWA 4BH9A 3TN91 4RHV3 4WM7B 2A3YA 4K1YA 3E97A 3NKTA 5K7PA 4YNIA 2PAKA 2TEPA 1NA1C 1RUH1 1AVBA 2Z5WA 2C1FA 4L2NA 3AJZA 5ACA1 3WG4A 4XJ8A 1KFXL 2XG3A 4C0BA 2VMIA 2CL2A 5AVPA 4QPGB 1IKQA 3I54A 4N9HA 2C5DA 2XL7A 1A3KA 5FMOL 1OHFA 3CJIA 1LU1A 4M2FA 2JG8C 1VBE1 2CWSA 2CGOA 4BZ4A 1QJY3 3B69A 1ZZ7A 2XJVA 1C5HA 5IK7A 4BHIA 1WBLA 1NG0A 1NYWA 1QWRA 4FPOB 3KT4A 4M0HA 2FQPA 4MYEA 3WUCA 2WSUA 1AR72 1RJ8A 2WS93 1PGL2 1WLCA 4PIYA 1RUNA 4OJ8A 4I01A 1UCXA 3TNQA 3MIBA 1IS6A 4JRAA 4NPRA 1AR73 3PMEA 3B9CA 2NYYA 1B35B 2G9GA 4J1WA 1SFYA 4ZKTB 1LOAA 2UURA 1U5YA 4KH9A 4K3UA 1Y7BA 3FZ3A 4MGZE 1BVVA 2UY8A 1X7NA 4RD7A 5H9PA 4EN8B 3ZXFA 5AC92 3ZFFA 1UZYA 2YPJA 2WLQA 4QM9A 1LHOA 4JDMA 4AFMA 1KS4A 3A0NA 4PF5A 2K0GA 1UKRA 3I7DA 1ENRA 3NO8A 1I5ZA 2D7FA 3LB9A 5JPMB 2ERFA 1VBB3 3MS5A 3WW1A 5FBZA 4QU2A 3HT1A 2WQZC 1OA4A 1D4M1 2PHTA 3WQ1A 3UJQA 5IUQA 4PJYA 2E7QA 1VZ5A 1O4TA 4AQSA 2A73B 4MV2A 1SACA 4FPLA 1LR5A 4YM0A 4I0AA 2GC3A 2GZWA 5JI7A 1WCKA 2P3IA 1UN1A 1VRH1 4Y22A 3GF6A 1AXYA 1ND2A 2OG7A 1NCRB 4E27A 3KCXA 3JU9A 3E6DA 3TNPB 4GWMA 4HVRA 3BODA 1AZDA 4WZFA 4XEZA 2EXJA