4Z2WA

Factor inhibiting hif in complex with fe, and alpha-ketoglutarate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Substrate Promotes Productive Gas Binding in the alpha-Ketoglutarate-Dependent Oxygenase FIH.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 108
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4z2wA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z2wA01
1YCIA 1IZ3A 1MZFA 2ILMA 1H2NA 4JAAA 2YDEA 2YC0A 3P3NA 2Y0IA 3KCYA 1MZEA 2CGNA 4B7EA 3OD4A 4Z2WA 4B7KA 4QU2A 1H2MA 3P3PA 2CGOA 3D8CA 3KCXA 4Z1VA 2WA4A 5JWPA 1H2KA 4AI8A 1H2LA 2WA3A 4NR1A 2XUMA 4BIOA 2W0XA
chains in the Genus database with same CATH superfamily
2CH7B 3T2OA 2HYXA 1D0HA 4CEYA 1GMGA 5T3NA 1BK0A 3AFGA 3HKDA 3O1TA 1F5FA 4UVBA 1GP4A 4MLOA 2V4VA 1D2QA 5LL6Y 1FAYA 2PHLA 1YFYA 5AVAA 4TLGA 1Z7S3 2L6LA 1S0BA 2CDOA 2RS33 4J25A 2FL4A 5GTHZ 4CEYC 1DYKA 1VPHA 3PUAA 2ZXQA 1UOGA 3OCPA 2PHFA 4YG3A 3MIBA 4QX3A 1UXZA 1UY3A 1DIWA 2HWF2 2OA2A 2WO1A 2C6SA 3VBUB 1VIWB 2Y6HA 4DY3A 3VQYA 2NLJC 2C9AA 5DDJ3 1ZZ8A 2ZPXA 1NT0A 2QNKA 2IZWA 2QKCA 2UWBA 4IIJA 1I5ZA 4FZ1A 1V9U2 1Q90D 4DR3B 3AMMA 3GWOA 5AG2A 1RUJ1 2BCCH 1SLLA 4FTSA 2CU5A 5J98B 5KX5B 3BOWA 4COWA 1ZZCA 3VQXA 1BE3H 2TUNA 3X2QB 4A45A 1OKOA 4B3SB 3ETQA 5LA0A 3APOA 5E89A 4GAZA 2DUQA 4NHYA 2CAZC 3PVNA 2CAUA 4QHOA 1SRYA 3POSA 3ZYHA 2RS52 3OTOO 3KCXA 3NR7A 1Z7S1 4JTNA 4X20B 1NKGA 1XSRA 4E2GA 2RS31 5CAZA 4D6RA 3T08A 4QX5A 4CU9A 3WQ1A 3G6JB 2EJRA 3IMNA 3BA9A 4E4SA 1KKDA 4KBZA 4L99A 1Y76A 1FMD3 3V56A 1CWPA 3LNMB 5CFCA 3RZJA 5DDJ1 1D5NA 1J58A 3NAPB 1IG0A 4MVRA 4FPCA 4AEDA 3JCUZ 2HEVF 3BVCA 4L8QA 2JDHA 3KGZA 5IVFA 4WVMB 2GNDA 5A7WA 4KGQA 3WUCA 1M90W 5A3NA 5B3SC 3HMYA 2Q6AA 4AEDC 2YDEA 4NJ4A 4WZCA 1KP2A 5JXGA 1H2SB 3F5WC 3ZXJA 4QHBA 1RUH3 2NYYA 3SEEA 4NHLA 2XB6C 4XQWA 2EIBA 1UU4A 2ERFA 2XXZA 2ZGLA 4XXAA 3C3VA 3L9DA 5C33A 3GJBA 4GZ9A 4R4ZA 4CYDA 3P1IA 3M8LA 2P37A 1W8OA 2GSMB 2AH2A 4QWNA 1XMQO 4BYYA 3S5AA 1PIV2 1F8VA 5C4WB 5J37A 4UB8Z 4CP0A 1HW7A 1T6BX 1FMD1 4AOCA 4FM2A 4B3MB 1CJPA 2VMFA 3QVNA 2JS3A 4B1MA 1EV12 3GJAA 3ZXGA 4FFIA 1H1MA 1NR1A 2UUCB 3PTYA 3BUCA 1A8MA 4PLMA 1AROP 1HKDA 4K8ZA 3W9AA 4P02B 5FUPA 3OUSA 3FYIB 2NLRA 2OIEA 1GV9A 1HJGA 4QPJA 1RUF3 2WLLB 4ZOLA 2A3WA 2IW5A 2D93A 4QKFA 5BUVA 2HKXA 3B9IA 4ZKTB 4RFRB 5H9SA 2D6NA 4HN0A 4CP9A 5A3UA 2XHBA 1RUH1 3H7YA 2JS5A 3AB0A 3O1OA 1EPWA 4MGKE 5CIRA 5KHJA 5B66Z 4P9YA 4NUBA 2IJIA 3CIHA 4PD4F 2ADEA 5LBCA 3SYCA 2UWAA 1MSDA 4UW3A 4CEYB 1H2MA 1HQLA 3ZMSA 3HKDB 3NSTA 5DUUA 3KVAA 2BVBA 2QE7G 4UI9L 3WZ1A 4YXWG 1OI6A 2Q1ZB 3MUZ1 2VMEA 1IS6A 1O7FA 1AL22 4RGAA 3TEYA 5GLTA 5KXBA 1CZVA 1SEFA 3WDXA 1FPN1 2QDRA 1QGLA 2VBBA 3MHZA 3J7HA 1JZ3A 2P4VA 1XMOO 2OS2A 2EIDA 2XOMA 2DQ3A 2PHDA 4H33A 1ENVA 4LO6B 1MVEA 2EIJC 4TXWA 1MEC2 1UX6A 4IIJB 1QEXA 4CTEA 4Q4W1 5H6RA 1RUF1 4AHZA 1K42A 4BIOA 1PM7A 5LCWL 1COV2 1JYVA 2WC2A 1DQ0A 1O5LA 1YXWA 3ZHUA 3JU9A 4Q1RA 3PVBB 5IAXA 4QGNA 1OCCB 3OFNG 1NH2B 3J26N 4DV1O 3P30A 3H8OA 4XFCA 1X8EA 4QXCA 2W68A 3SC7X 1THZA 3A2FA 5GALA 2J1UA 1GH6A 2WABA 4Q4V2 1U97A 1TUBA 4AYUA 2CWSA 4MHRA 3F7VC 3IAQA 1JOPA 2XAGA 3QCWA 2RR12 5GW7A 1DZTA 1HXS2 2DVBA 3MHHC 4YZ3A 2X5IA 4NIIA 1QQCA 2QQMA 3I49A 1FXZA 3I2FA 1AR62 1LGCA 1Y76B 1GKFA 4LUMA 5FYZA 4FK5C 2XVLA 2X5IC 5CFCB 1P4RA 2HLEA 4AEDB 3ZXAC 2GC0A 3M3IA 4JTDB 3O1PA 4OZOA 4XCAA 3LSDA 2P22C 3TN92 2D6MA 2WLNA 1GRJA 4KWKA 5A7WB 5H9CA 2ID4A 3BB6A 1R1A3 1IPJA 5K7PA 4GYCB 1CX1A 1Q56A 3MF9A 1NCQA 1PMJX 4NIGA 1EBOA 1TNFA 5JQGA 1SHWB 1NQTA 5T55A 3UKNA 4CC6A 3CQOA 2HG5C 1DQ4A 5BNPB 4J7KA 2WLIA 3WNOA 3T0BA 2GC3A 3OGSA 1BXHA 5FXWA 2IVIB 4X88A 1PP9H 4A5UB 2P3YA 1LR5A 2VG9A 3K9SA 2D44A 1UIJA 4ZBMA 4RQFA 3MDSA 4H7MA 4TLFA 4W6XA 5EIBD 2BWCA 2VCCA 1WLEA 4LBLA 4U2AA 2VAUA 3CPWU 3WT3A 2OKXA 4HN1A 4ONUA 5EC1C 3T4ZA 1L3JA 4X1YA 3UJQA 3FHQA 5F9TA 5A70A 1HJFA 3KKYA 1FKAO 2DVFA 1R1A1 3JB8A 5BYNA 1N33O 4EWAA 4ZOLB 4H55A 1DF5A 2OX0A 4LCUC 1YFWA 3RVZA 3LKJA 1WNSA 3AXEA 4BAYA 2XLAA 2QE3A 4XAEA 3N7JA 2Q4SA 2WZR1 1J1TA 4CDXB 3FX7A 4Y24A 1SESA 2O8OA 2YIAA 3PJYA 1AXZA 4EKWA 3RYIA 5CBGA 4DR2O 1I08A 2G38A 4HT1T 5F3GA 2RJ2A 4J1WA 2OCCB 2AHZA 1XMQB 4FCAA 1BVVA 1YO8A 2OZJA 4WVZA 2VTFA 4X8NA 1O3TA 1XREA 2GSYA 2GDFA 1O3QA 4EFBA 1E5SA 4FAHA 4MTFA 3OR6C 1IHMA 2BV4A 3FN9A 5JOXA 4HG6B 3J4UH 2EIJB 1R64A 2A06H 2B8MA 5A3OA 4UT5A 4BQ3A 4B3RB 1CQ9A 4CP2A 1W8UA 2Y6JA 2LW1A 2XJQA 2YG0A 1QJEA 3ZM8A 2R9RB 1R3IC 4UFHA 3SQOA 1K4CC 4J7ZA 2GDSA 1SFPA 3R4UA 2RDNA 2I45A 5IJRA 1GZCA 2AUYA 1K33A 4QU1A 3AKSA 3QACA 3UM7A 2W1UA 3AMPA 4EN6B 4Y4YA 3RYRA 4YM3A 4UVAA 4JI2O 3DL3A 1L0LH 4D7SA 1ZRIA 1VQ8V 3ZRWA 1AX0A 5GKAC 2VO5A 1ST8A 2A6YA 2VZUA 4XIOA 5KAIZ 2HBUA 1TUBB 2KSDA 3RWKX 3RZGA 2P34A 4AL9A 2W52A 5I0UA 1TVKA 3SDLA 3UJOA 1BMV2 1FS0G 4C91A 5JIAA 3N9MA 2PAMA 1BVP1 2QWRB 3IDAA 5IK7A 1KFXL 3OGJA 4LORA 5HI0A 5JWPA 3KVBA 1XMOB 3HQRA 3B09A 1XNDA 2DYSC 3E8FA 1MABG 4TWKA 4FVMA 4AG4A 2B9ZA 2QCSB 2PAEA 1D0GA 1IBMO 2ZTNA 5J2TB 2H6BA 4FLWA 2YC0A 2JX9A 3ZFEB 4QKBA 2EZPA 3CJHB 1NLQA 2XJTA 3A0BZ 1X9PA 5FUIA 1NCQB 3MV11 4DV1B 3I2OA 2EIMB 1EN6A 3V0AA 1YTFD 5JQGB 2AACA 4CCKA 1WPXA 5LZ6A 2M7WA 4K21A 2DDUA 4BR6A 4PDLA 2VQAA 1UY2A 4N53A 2GC1A 1OJHA 3JATA 2KD7A 2B5UA 3ON7A 1VBC1 3GHMA 5K8SA 5GZEA 4Y1ZA 4LFBO 1QXPA 4XOGA 3M3EA 5M0TA 5DPNA 3LWCA 3EO6A 4DIQA 2VZVA 4XFAA 4MTXA 4KU8A 1KBHA 4BHPA 2QQLA 3USSA 1S76D 4I0WB 5CG8A 4LLFA 2O8QA 1YHFA 2ZKNA 2QWNB 3NV2A 1XL4A 3RYCB 2X7RB 2ZR3A 5IWAO 1XU1A 4TV8A 2JG9C 2JDUA 2ZHKA 4X1YB 3D8CA 4DUVA 1GU3A 5I8SA 3E22B 2Q30A 4FQZA 4QT6A 1SACA 2EVXA 3KS7A 1ZNPA 3AG1C 1RPOA 3K0DA 3OAAG 1HV0A 3O1VA 4K3UA 1TQ5A 2GU9A 2ZAHA 3OPZA 1Q6IA 3CRMA 4XPVA 1L1FA 1ASJ2 4NB5A 4PELA 1ND3A 4XUTA 3OG2A 3WW4A 3ZCCA 1AP6A 1SS3A 1JOJA 2XNDG 3ILFA 1LJ7A 2ZGKA 1ND3C 1HNWO 1BKZA 3RS6A 1LOEA 2YU1A 3LA7A 3RYIB 5H9PA 4OUEA 3QH7A 4Q0SA 1YHQV 1UZWA 1NTKH 4YW3A 4J6GA 3B3QE 2YSUB 2K0GA 2BFUS 3EHKA 1BGYH 4HSJA 2RM22 2WYFA 3NNMA 2DJVA 4X1KB 4GIQA 3WY6A 3JCIA 2J7MA 4AVTA 3PL0A 1QMJA 2CHHA 1ULCA 1VQMV 2GUZA 1JZ8A 1FNZA 1SZXA 3OMIB 4GKKO 1ZL8B 1AYM2 3L9JT 1K4DC 3ABZA 1GOFA 1PGW2 4DV6O 5BY5A 1O4TA 4NROA 1GZ9A 3QTCA 1UYPA 4K1ZA 4S2FA 2B9VA 2LGWA 4BE3A 2UU8A 3T30A 1O3RA 1N33B 4O4LA 2JEXA 2IFRA 4CU7A 2JJ1G 3ZX7A 3SGIA 3UT5A 1CVNA 4XQDA 3N7KA 4GWIA 2GNMA 3KWVA 5D21A 4LF4O 4CXXA 1Q6UA 3FFQA 3USUA 4BPZA 2W6JG 1QJY3 2EIKC 2BW8A 3DPRA 3M2MA 3MLJA 3ZRWB 5EWSA 4CU8A 5D5QA 1AL0G 2R043 2ZGQA 5LBBA 2ILMA 2VTXA 1C8M2 3K4DA 2ZS6B 1TVKB 1OUXA 4X89A 3DPRC 1M57C 1XEQA 1OOPC 4J7JA 3WUDA 2DYSB 1LNQA 2IXCA 2VMGA 1A8DA 4BMBA 4OQ8A 4B3TO 3W7UA 3VZLA 4J80A 3HPLC 1RUD2 4LFCO 2VCMA 3KF5A 4XCBA 1IURA 4RGGA 3IZOA 4BLIA 5KA6A 1LEDA 4RHV2 2G9ZA 3TXSA 3AYCA 4DR6B 4LWSA 2E5LO 3B8MA 3ZSJA 2FQPA 2DBNA 4BQ5A 2CDPA 3WQ7A 3NO8A 3R6SA 1GN6A 4YW1A 2JDPA 1IS3A 4XF3A 2HWD2 4YM0A 3POWA 2JD9A 5EJ1B 3UKVA 1H8TA 5H9RA 1HR0O 4HNAA 2OZ6A 4JI2B 4NPMA 1O4YA 2QM4A 3LE0A 4P2ZA 4PHZA 1VMFA 1QJY1 4P14A 1RGSA 5FXVA 3RW0A 3V0AB 3CO2A 1ZA7A 2XL9A 4YRDA 2AZ5A 1H8TC 2WLQA 2R041 2PHTA 1JZ7A 4N53B 3G4SV 3U07A 5B2GB 3T1HO 3JATB 3UGHA 4CH4A 4WBBA 4W6YA 4Y33A 1W2TA 3NW4A 2VOXA 1LULA 1Q43A 4ARXA 2AXTZ 5JLVA 5SV5A 1YCIA 4UFZA 4Y20A 2IXIA 4BH9A 3C7OA 4OZXA 2DYRB 5A33A 3AG1B 3OD4A 3SISA 3WG7C 2D3PA 1TVGA 1U5YA 4WFEA 1IBMB 2VPVA 5BNOA 1J1LA 1KJLA 4QIWF 5JPNB 4C0BA 2HH9A 1WLCA 4I0XA 4PF5A 4D7YA 1VF6A 1JXNA 1YZBA 3EFFK 2BWAA 4LMFA 1DQ1A 4R4XA 3I2JA 3OGVA 4UFLA 3ETDA 5BNOC 1ND3B 1XE0A 2WYSA 3TBDA 1FXHA 3BAAA 4K1YA 4I9WA 1RUG2 5IFPA 3FLPA 3RI9A 3ZN5A 5ISLA 1DG6A 1WPBA 3ZN6A 5JZGA 5DABA 1BBT2 2ZM6O 3AZYA 2BGOA 4I2OA 4UCRA 4CDWA 4YYOA 1OA4A 5FY9A 2PHXA 4GWJA 2FZ2A 4HL0A 1VQ5V 2ZABA 4DXTA 3VZJA 1OC1A 1UPIA 4QQLA 4LXLA 4R9CA 3L2HA 1ZREA 2P6CA 5JZGC 1AHSA 4X6QB 1FT9A 4LFBB 4OHWA 1EFRG 1VB2A 1ZTEA 5FMOL 3Q8FA 2GC2A 1K45A 3ZYPA 1NQJA 1J83A 2ZE5A 3BOPA 4XZPA 4IE5A 3WD5A 3QBQA 4N43B 3JB4C 2GUZB 1KMIZ 4QJFB 5JMOA 4DUWA 1SQPH 4W4KA 1Z0HA 4UW4A 2ZKOA 4LK7A 3N9PA 5KR7A 3AYEA 1IBKB 4DV0O 1UOFA 4Q0PA 1KUQA 2R073 5KBFA 1IS4A 4IGPA 4XIKA 4LT5A 2B5HA 3KGLA 4U7OA 3R65A 2GHYA 4TYSA 4O4LB 5I0SA 2X6BA 5IHRA 3N27A 4I02A 1P7BA 1N36O 4KL1A 3IC9A 3UT5B 3E8BA 3N9NA 3FFZA 2HWF3 3ITQA 2ZE7A 4NXNO 3SITA 4YFZA 1HNWB 4XHXA 2ITDC 5GZDA 5IYBO 4BLJA 4GJYA 1JH5A 3MZHA 3USUB 1GTOA 4CXWA 3WVJA 4DV5O 3OMAB 1V9U3 4MGSA 2CY6A 1OQDA 5KHGA 2GALA 4OGQB 3RGBA 4YZ1A 4FT8A 2AENA 1I1EA 4CUAA 1NQDA 2ZINA 2W9XA 3HOBA 4KWJA 4HZ3A 4DUZO 3HR0A 5LHGA 4LO8A 2EINB 3J7LA 3FHAA 3SYOA 2JIGA 4EWEA 4DV6B 2R70A 4WCEV 1XOYA 1WA8A 2J1EA 3R05A 4X8PA 3HEIA 3U14A 2VBDA 1W8NA 2FDHA 1G6NA 5F3EA 3U1XA 2IC1A 3RJ2X 2RS53 1MA1A 1IVSA 3CD6V 2BOJA 2HJIA 4NKGB 3CCUV 4LWSB 1JOYA 1H2GA 3SPJA 4GA9A 2DE0X 2PQSA 4CP1A 2QQKA 4YLZA 3VZNA 3RZHA 2OPKA 1MNGA 1ZZ7A 3Q4HA 2HWF1 3RMYA 1H8TB 4IEZA 3ZXDA 1IQDC 4HNAB 4CH5A 2Y8KA 4PQ9A 2XAJA 2WT1A 1S0JA 4V1PA 2RDSA 4YGDA 2GP5A 4UW5A 4Y1UA 5JOYA 3TCUA 3T0AA 4ES8A 3ZMUA 2W92A 2R061 1F23A 3S57A 2B7YA 3K48A 1WW5A 4UCSA 3WLUA 2WWJA 5FY0A 1OCZC 4O2BA 4I55A 3LDEA 3ZMVA 2ORZA 1QKQA 1YFUA 4JI0O 4MVMA 3MW3A 4X65O 1JYWA 2UUAO 1ULGA 4JGZC 3WG7B 4LFCB 3AG4C 1PZ7A 4GLXA 2EAAA 1W2NA 3NJXA 2IH3C 4YW2A 3ZXFA 5FPUA 5A33B 5JUVA 4PJ0Z 4PA9A 3CP1A 4NWVA 1Y4MA 2BGPA 5BNOB 3RVYA 2ADPA 1B35A 4I0XB 2JE7A 2D97A 4H2AA 1XNKA 5A7SA 1C4RA 3VD4A 1PIV3 4DUYO 1SFNA 4MVTA 1SETA 1JYCA 1HR0B 3WF2A 2CV6A 1QJU2 3BTYA 4UFMA 4UBGA 1EV13 4QDSA 5C71A 5JZGB 3ABUA 2JE9A 4IEOA 3T1MA 1DLCA 5JMCA 4CDWB 5F5IA 3O0VA 4FP3A 2VNGA 4DR7O 1AI5A 4JV5O 4QGLA 3ORJA 1SLBA 4MVSA 4B8EA 4MVUA 4XTMA 5A80A 1FAFA 4W65A 4ZS3A 1YIPA 3A8TA 3AG3C 1DGWA 4ASKA 3DTUB 2A5ZA 4LHKA 3POGA 2EXHA 2ZJCA 2VY0A 1GN4A 3QD6A 1W39A 4XDQA 4IT5A 4QD2A 3D4KA 1LU1A 1Q8IA 1LU2A 1SDWA 1AR71 3BI3A 3CSXA 1W2UA 3VBFC 4EWDA 3IFXA 1AR5A 1VARA 2RDRA 2ATKC 3NNLA 1WLDA 5IVVA 1PIV1 4XFFA 3ZFGC 1HB4A 3BPZA 2DCYA 1AL23 4FLUA 3V0BA 2MEV2 2VWKA 4IDZA 1AYN2 2YC4A 4DZGA 4JAVA 4LHSA 4XDKA 4M0HA 1LGNA 3PHMA 1N1VA 1F4HA 4GKYA 3ZYRA 5FDBA 1K92A 4XJUA 1J3PA 1JHJA 3LOBA 1G1XB 4Z07A 1RB8G 2BGCA 1MEC3 1HNXO 2DF7A 3LEIA 4N23A 3DCQA 1S0GA 4AI0A 1N34B 1COV3 4A3ZA 4V2WA 3OPTA 4GUNA 1AR82 3IT8A 1OCOC 4QXBA 3P32A 4XUPA 1AX1A 3H1KH 3NL1A 1Y6XA 3WDUA 2E33A 3MLLA 2IFWA 3X29B 1JA8A 3ZR6A 3JD72 3PUQA 4BM8A 1QOSA 3RZLA 3E6BA 1WA8B 2VOWA 2PI5A 4XHBA 4N90A 4DV0B 2OUHA 1W8FA 3U4XA 3AYDA 2GNBA 5DQ0A 4Q4V3 4CS2A 1W8TA 3CF6E 1RPRA 4PIXA 3TNPB 5L9VA 2DQ0A 2K9PA 5CFDB 1W6PA 3GGLA 5LOVA 1OPOA 3SH5A 2RR13 3K79A 4QQOA 1PZ8A 4EFEA 1HXS3 4MXWA 2FKXA 3NJVA 1N36B 1XB9A 2DCKA 1AL21 4NIAA 4LE4A 3LF7A 4Q4W2 4I5SA 4PV1B 5L9BA 3VBSC 2GH2A 3Q4HB 2YEVA 1KS5A 4NXNB 1AR63 1GBGA 4YW6A 3F95A 1UCXA 3OBRA 2DTYA 2CGNA 1CIWA 4MXVA 4WM7A 2YUEA 1CPMA 5CA1A 1Y43B 1MEC1 3OM3B 2B42B 4ZI7A 2QSAA 3C3TA 2FCVA 3A4UA 3QLQA 2QQIA 1TEIA 2J22A 3TN93 1COV1 4WM7C 1YIFA 2NQYA 4OHZA 3AG4B 3K06A 4NHMA 4DUZB 2YBKA 1QJFA 5DN6G 4O2BB 4I55B 4KH9A 5LP6A 4BIZA 3LEMA 3SJAC 3CS5A 4PA4A 1AUYA 2ZQMA 5I8YA 3E5UA 1AR4A 5LP6C 5APAA 2G4IA 4FP2A 2WS92 4HYOA 4L0PA 3NNJA 4C8DA 5FPBA 1BQ0A 1WMXA 3K04A 2RR11 1WB7A 1EUUA 1ZA4A 5FQ0A 2Y38A 1F4MA 1F5JA 1B35B 3CXHF 1DQ5A 4XUNA 4MYEA 3M3QA 5H5NA 4H44B 3H1IH 4OPHA 1AR61 2JD4A 1KB9F 1AI6A 3H50A 2XVGA 1DGSA 5EJ3A 3TJTA 2X10A 1DCSA 2PA7A 5KUKA 1ZWIC 4JHTA 5FO7B 4DR5O 1Q8OA 3TN91 1HQWA 2V4AA 3AG3B 5D5PA 1NCRA 1OHFA 3KV6A 5CADA 3VBOC 4JI0B 5K0UB 2DBIA 4X65B 4LK6A 3AZZA 2JWPA 2Z69A 5FBJA 1NCRC 3DKWA 1W03A 4XUQA 1K3IA 3KB5A 4HVQA 4LOSA 3GM8A 3MAQA 2O14A 2A3XA 2D3SA 4X64O 2WT2A 1EM1A 1V70A 1UAIA 1JN2P 1AILA 5DZFA 1L0NH 2IWGB 4JZGA 4DUYB 3WDTA 1Q8SA 2VW0A 2IU0A 4O9EA 3IWZA 4TWTA 3IMMA 4GD4A 2NNUA 4AQYO 4JTCB 3V0BB 2Z4FA 1S3JA 5SV8A 2Q73A 3ZSMA 1T2XA 4TTGA 1MPXA 1Y7BA 4I4TA 1QWRA 2XJSA 1YDXA 2YI8A 4DR7B 1KITA 5FUNA 4OXSA 3PN1A 2BTVC 1CXZB 3PUHA 3APQA 1MS5A 2WZR2 4DS0A 1LOFC 2Q5ZA 5JOZA 2PMWB 2R6QA 3OB8A 5HV4A 3ZDSA 3LUTB 1U5XA 5F2WA 1J95A 2RMU2 3I2IA 4H13B 3LPFA 4XF1A 1S2EA 4IEXA 1S77D 5FYYA 3HB3B 4Y1YA 5H2FZ 2WN3A 3CU7A 4TN7A 1SERA 2XBO2 4GH4C 4EV0A 2E74B 1C5IA 2W95A 2G9GA 1UZYA 3JARA 2RG4A 4HANA 1QBZA 3ABTA 2P3KA 3E35A 2A73B 3SJCC 5JI9A 5IW0A 1W6PB 4JTOA 4K7JA 1QQP2 2Q8VA 5LOVB 1IBLO 2JEUA 1HNZO 3BALA 4MXWB 2IXJA 1VQ6V 2YMZA 2J1AA 3ZYBA 4FIPC 5FLXN 2V5DA 2BNOA 2YEVB 4IE7A 3NNFA 3HD8B 1B6QA 1FV2A 1GKBA 3ABLC 4LQRA 4WM7B 1UW8A 4QHZA 3J81N 4G4FA 2E63A 4E8CA 1VB4A 4ZI7B 4ISRA 3SYQA 3P3NA 3IAYA 1VALA 4LF7O 5C8YB 2N05A 4YVWA 1URXA 1UY0A 2ZEYA 1S2KA 5D8AA 1A32A 4XDLA 3LDKA 5A7QA 4WFFA 5LP6B 3S3WA 2N7GA 1YJNV 3KG2A 2J1RA 1W3VA 3H1MA 3SYPA 2CTQA 5FTTC 3G6EV 5JXJA 4ATEA 1H8HG 4RGKA 2SBAA 5C3RA 2HR3A 1SQVH 3B4SA 4XQ4A 4WFHA 4ICGA 4N7UA 2CWMA 2HP8A 1NI8A 1BMV1 1YJWV 2D7FA 4PF1A 4LA3A 4LR3A 2WZ8A 1XOUA 2CK3G 1NZ6A 4Z8BA 4A42A 4JTAB 3I3QA 2VZPA 1VBA2 1MACA 1DF0A 1LTEA 1BHGA 3WG4A 2JDZA 2ZAAA 1OQ1A 1S5JA 1NG0A 2CTVA 5C9AB 4DV7O 4YZ2A 1Z5VA 3E97A 2VZOA 4F3JA 4YSFA 2L35A 3OPWA 5JVVA 4B7EA 1C5HA 4CCJA 2GH8A 2RCVA 1V00A 3MF6A 1D4VB 1ASJ3 1OF4A 3O0WA 4AHWA 3OBZA 5EQUA 1OLQA 5B1NA 2ZCEA 4NHXA 3EYPA 3PVOA 4TSVA 3RYHA 1V55B 3OJBA 3BTAA 2XH6A 2RMKB 2YGLA 1ALYA 4PDRA 1XC6A 2I07B 5FY7A 3WW2A 5JIUA 1FXKA 3ASOC 3AZVA 3I7DA 3N2GA 4DW1A 4GCZA 4FJCC 5CA6A 4JRLA 4AI2A 2RM23 2YGMA 1O3SA 1UX7A 2B39A 1L8DA 1JZ2A 1QDCA 3CRRA 4BK4A 4FTBA 3BY6A 4HZFA 4IGGA 4Q0QA 3DGEA 1JJ2U 1AYM3 4NXMO 2EILC 5KA5A 3PVEA 2ZX2A 4I4TB 1FYJA 1LKNA 4DR5B 4CUGA 2A9HA 2YFUA 4QB6A 2A79B 1RC6A 1PD3A 1RFYA 1FJGO 3T4HB 2WNEA 2EICA 4B3NA 4LF8O 3J7AU 2ZMNA 2A7AA 4IV3A 1H2LA 1VEWA 5BPXA 4LPLA 3AMQA 1U12A 3IIIA 2QVSB 3U0ZA 2W3JA 2JDIG 4DW0A 1HN1A 4FVVA 4PIZA 5BMVA 4KMQA 4PLNA 4X64B 4IV3C 5J96B 4IGOA 3JARB 4IGQA 2VTXJ 3UKTA 1QU7A 1NY72 1E1RG 4XJZA 4MTGA 1C8M3 1DGWX 1I5PA 4EE2A 5DMYA 4QU2A 5FMDA 1R3JC 2Y4TA 3KD4A 4FMTA 3MIHA 3OUIA 4CDQC 4UV8A 1AYM1 1O4ZA 2YYOA 3BFRA 3OE7G 1H8EG 1PGW1 2PYJA 4JI6O 3WNXA 1RUD3 5EBLC 3VD9A 4CE8A 1KQRA 4RHV3 5LHHA 1D7PM 2QQVA 2UU9B 2VZ3A 3OEEG 3ABMB 1WW4A 2NN8A 2W5FA 1VLNA 5J3UA 4OI2A 1R6TA 3I3BA 4YVWB 2ENRA 1OKQA 2HWD3 1S1AA 5D8AB 3FKSG 1K5JA 3DXRA 1N3QA 3JD3A 1UMIA 1OVPA 1QNYA 2D5FA 3BEHA 3LCPA 1E1QG 1QOOA 3ZFFC 4R9AA 3FMGA 1N1SA 3MI8A 5FAXA 2VXRA 2QQOA 4OI1A 3F2ZA 2V72A 3DEMA 4XC9A 2JRIA 2H6CA 3I97A 1NTZH 2XUMA 3S3XA 1MS1A 1WCKA 3S5QA 4WVWA 3WP3A 1C8M1 4AFBA 3QH6A 2Y0IA 1IBLB 3K03A 1K73W 1R6NA 1YRZA 2FMDA 3WDVA 5IYYA 5FZ7A 3EXAA 1COWG 4JQTA 2HVJC 3TYJA 3KZ4C 1RUD1 1FFTB 4L8JA 2UXDO 3D0SA 2YXHA 4DQAA 1QIQA 1V54B 4RHV1 5GLWA 4R9BA 3KV5A 3RMXA 1FD9A 4IEYA 4LF5O 4B4QA 3E5QA 1ZYBA 4JKLA 4CCMA 1K5SA 3TGUH 3WOGA 1UYXA 3BCCH 2ARAA 4XILA 4K35A 4LC1A 1NLSA 1VBB2 1WWYA 2OYQA 2RE9A 1EUTA 2HWD1 2JXAA 1U0AA 1US3A 5KX5A 1OD3A 1NVPB 4KHPO 2Y33A 1H6XA 1RUG3 3FLRA 4KXRA 1YNAA 4BQ4A 2QQJA 3RYHB 4ZKIA 1BBT3 2YXYA 4OQ9A 1V6OA 1VQNV 4CS4A 5E16A 2C1FA 4CRQA 3CCVV 3L2YA 3SKVA 2WAAA 1O5UA 2EXJA 1GQPA 2R72A 1FXKB 1ORQC 1RINA 1W6NB 3X2QC 4OX9O 4JGSA 4GZRB 2UUBO 4Q8KA 3U75A 3MV01 3WF4A 3OEBA 1QOTA 3STLC 4M3CF 1CN1A 4Y5TA 4URTA 1VRH2 2EILB 4H7LA 2XJVA 4Q8LA 3RFRA 2DUPA 3HQUA 4OMCA 5F1RA 1G9BA 4LBKA 2YIBA 3SH3A 5K9YA 5FYUA 4DV4O 2RNBA 1W6MA 3OY8B 1NVPD 2ZX3A 4BQ2A 1NBMG 2NZ9A 1UD1A 4CZSA 4FLYA 1J3QA 3PMEA 4WM8A 1Y9MA 4HONA 1VQKV 5FK8A 3ACFA 3ZYFA 5FZMA 4FPKA 5IE9A 2LTNA 5J7MA 1LNSA 4UV9A 3NAPC 4BQ1A 1RUG1 4WM8C 4O4JA 2UWCA 3M4FA 2PHWA 3WX5A 3UL2A 3K77A 1QY4A 4U3JA 4JPRA 3I3DA 2WIIB 3JD2A 3HT2A 2FZ1A 4LUKA 5BMVB 2UY9A 2OQ6A 3N2KA 4CBCA 1GP5A 2HWC2 2C24A 1WA6X 4CEWA 1O59A 1XDCA 5DZEA 2WLKA 4FM1A 1N3OA 5EZYB 4DR1O 1PHMA 5FLHA 1FXVA 3MW2A 3KM5A 5FZ8A 4F8AA 3VHNA 3WG1A 4OYUA 4TV9B 3UCSC 2ARBA 4KQ7A 5JJJB 1V6IA 4CEWC 4NXMB 3E8GA 3BGAA 1LGBA 3OBAA 2V09A 4CUBA 4YFWA 1W9WA 3VKLA 3SCFA 2XKOA 3TWIA 1FJGB 1N32O 4LO7A 5A1FA 3VBRA 1GWLA 3CC4V 1PVXA 4KG8A 4QGMA 4LF8B 4P9PA 4JI7O 3GBWA 3W5MA 2QJ1A 4IYHA 1YQ2A 5JPMB 1S0CA 3AP9A 1D2SA 3DXTA 3SKJE 5ANNA 2C5DA 1TMF2 5FOJB 3VBRC 3DXRB 2E6VA 4YJ3A 5C5UA 4CC5A 3RJRA 2Y48A 3O65A 1NZIA 1F35A 4EYUA 1F4AA 3ALQA 5H9QA 4X66B 2CAVA 2OYZA 4AWDA 2ETNA 1WA4A 3CRAA 2GN3A 1IOAA 5FPZA 1RVF1 2YFZA 5IVYA 4L9BA 5T5LA 2DOSA 5F2VO 1XHXA 2W1QA 3TK1A 5GZFA 3AYAA 1F51A 5CBHA 1ND2A 4IEUA 5B1OA 5ACA1 2TBVA 2D6OX 1A78A 2QFEA 4QGPA 1LOCA 2HJDA 4KFMA 3VHOA 1ND2C 4BDVB 4LBOA 3KZIZ 1HRI2 4DRRA 1D5AA 4G28B 3CCEV 4FSJA 2LS6A 4A41A 2ZBJA 1GWMA 4LO5B 1Y9QA 3VL8A 4FPYA 5HXMA 5BNQA 1GAXA 3T4VA 1UPGA 4IXLA 3I55V 3H9AA 1AVMA 5LEJA 1GOHA 4ZU7A 1BQZA 4JDMA 2Q4PA 2R062 3ZLIA 4BW5A 2MK3A 2R30A 1IZ3A 3NKGA 4J42A 1GQGA 4FBFA 1QJU3 2ZMLA 3RRDA 2VMCA 1QJX2 5ITZA 1QHDA 4OUSA 4L2NA 3N9OA 2F6BA 3QG5A 5C8CA 1JU4A 3ZR5A 1WAZA 4BIUA 1JFFA 3NKTA 2WO3A 2PZSA 5F6LB 3QO8A 2JB4A 3RYPA 3AK0A 3LGRA 3ZXEA 1O8PA 3O0XA 1XILA 2B4KA 1OCCC 4JI1B 1HDKA 3ES4A 3GALA 5G05L 2D6KA 2VOKA 3WINE 2UXDB 1VF5B 4FPOB 3DXUA 3CYOA 5FP8A 3F5TA 4QPWA 5AFBA 3AG2B 1PO12 5F39A 1TZOA 2WNOA 4Q1PA 4XACA 4AHXA 3I5DA 1W6MB 5AC92 4XJ8A 1LHNA 3I2HA 5E1RA 5A1AA 2A75A 1DYOA 2YPDA 5JJEB 3MO4A 5FKCA 2VOVA 4WM8B 3GBGA 2ARXA 2A0LA 3N9LA 4JVAA 1W9YA 5I0TA 2X05A 3CZJA 4KHPB 2YPJA 4GXLA 3BHPA 5CFCC 1V0AA 2Y26A 4ARYA 4RUEA 3MICA 1QJU1 4DR4O 4OFGA 2BVVA 3DSQA 3H1HH 2CTRA 2MEV3 4M0NA 4O4JB 3SYAA 3SPCA 5DAPA 1VMGA 2F95B 2OWOA 4JI4O 5A3WA 3AK3A 2QR4A 3GZUC 3VZKA 4U3JB 1YQ6A 2BSKB 2VQEO 5LWBA 2UUBB 2QWQB 1SKVA 5BNPA 3N2KB 2QGNA 4DYLA 2UXCB 1AR72 1V6MA 4O4HA 3MIEA 2ZA9A 2YIBD 1N8RW 4NYKA 4CEWB 1AR83 3G7DA 1M1KW 5FZ3A 4AEMA 5BNPC 2D6LX 3IIAA 3DKQA 5A7OA 4P9JA 1B06A 4PDMA 3D3QA 2AZ2A 1S0EA 5KAFZ 5E88A 2Q1MA 3JD73 2QWOB 3DUIA 3KHBA 1YWKA 1UL9A 5EJZB 3VLBB 4OULA 4HBNA 3URFA 3L71H 1FPN3 2XKPA 3VDBA 3WU2Z 2OUJA 3FB5C 1URFA 2YXLA 2WR9A 3KT7A 2BU9A 3VBRB 4AHCA 5FMCA 4OI4A 5FZBA 1UNBA 1QCEA 4UBHA 4LBMA 2F23A 2MEV1 4Q4W3 3WB0A 3OYWA 5L3EA 1AF9A 1XBLA 1PL4A 1AYN1 3N9QA 3B02A 1WP8A 1XSQA 2NPIA 3AG7A 4YJ3B 2ZT9B 5JOWA 4UCVA 1V9PA 4RR3B 4QPIA 2C9KA 4FFKA 4Y22A 3Q8CA 1RHI2 2QZ2A 4CDXA 1I6XA 1H6YA 4FO9A 3UKMA 2PQQA 2FHRA 2UXBO 4LKDA 2BOIA 4D69A 5CU1A 1AR81 5DEDA 1MS8A 3D82A 4CDXC 2ZIMA 2F4PA 2X53S 3B8NA 3DYOA 1ND2B 2DWEC 5FP9A 5FLJA 2WDBA 1E5RA 1CAXA 3LSUA 1IPSA 3A0NA 3FHIB 1X59A 1Q7YW 2OCCC 3JD71 2H0BA 4A7YA 1N1YA 4Z1VA 2DCZA 4OLLA 1RMU2 2FDGA 3IDEA 4TT3G 2TNFA 1HX6A 4CCOA 5A7PA 4DMIA 2LFRA 4JI7B 1HB1A 3D3IA 3LSSA 4P08A 2WT0A 3HN3A 4IV1A 3T1CA 3CBNA 1W0PA 2WZPP 1MOFA 1JJOA 3FAVA 2A6XA 4TZDA 2WLHA 1RXGA 1SLIA 2PHRA 5IJ0B 1H2NA 1RUE1 3FL7A 4HAMA 2JG8A 5IJ9B 4MW8A 5GJ6A 1YSCA 4NPRA 3FYEB 5ITZB 4LLOA 1DP0A 4MO3M 4NIDA 3V64A 1QNMA 5C8CB 1N0JA 2JG8C 2WWWA 3H8RA 1JFFB 3POBA 2ZX0A 2F1MA 5FV3A 3VGIA 4B1LA 3VD7A 4G9SB 2A3YA 2OW4A 3T2TA 3TAYA 3A7QA 5LBEA 1LR1A 4W4LA 4M3CB 4NVPA 1KKCA 4MVQA 3ZIAG 2Z3YA 4X1IA 4K3AA 3OEAA 1IG3A 5I0DA 2BZDA 5F3CA 2BOCC 2XL7A 4IE4A 3JD0A 4LNVA 2WS91 3OUJA 1LENA 3MGUA 1CEZA 4RN5A 1J84A 1W9SA 4O61A 1GM7A 1CZSA 1FFXB 1DQ2A 1Q6HA 2WJSA 1FV3A 4XAAA 5J2TA 2C2AA 2EIGA 5FWEA 1NH2D 4QPYA 3GZEA 3ZFEA 3EXUA 5FY5A 3CJHA 3POIA 5LYJB 3A23A 4QMAA 2OIIA 1MQTA 1UWWA 2Q8EA 4QDQA 4BA6A 5CN0A 1QVGU 1R1BA 1Z2GA 3U37A 1XNQO 1QU0A 3M1HA 3ZFEC 2PI4A 5FZFA 5IK4A 3CRCA 1NR7A 3GDBA 4QQPA 3VDDA 4GMP0 2WZR3 3K08A 4R7CA 1MQTC 2BPA2 1LOBA 2UYBA 1E57A 1NCQC 1LESA 3OTOB 5KHIA 1GOGA 2EIMC 1C3HA 2PLV2 4O4HB 2Y69C 5G04L 3K0GA 2W47A 2ZNIA 5JI7A 2XPJA 4ORFA 3B2EE 4GKJO 1MR5A 1RSOA 1YIJV 2XBO3 2L9LA 2XQRA 2NP0A 4JYAO 2LROA 4O9GA 2CNAA 4WFAV 4P9XA 1PV0A 4C7UA 4WFBV 3JAWA 1YF2A 1TME2 3ZN0A 2MNGA 4MG2A 3RYCA 3HR9A 1PPJH 3A21A 4ZZ8A 4PDWB 2IXKA 5IT9N 4EB6A 4UXNA 1R082 3E22A 4NRMA 4AFCA 1QQP3 1DDLA 3A0KA 5LRSA 2ZD9A 3CMEV 1ZZBA 5DAQA 2W87A 3M7MX 3U4SA 1W8HA 5FZ6A 1PZ9A 1PNKA 3OYWB 3BIEA 4JI4B 2OIGA 4IETA 1Y4WA 3OTFA 2Z0AA 4FAGA 3RZKA 1DZRA 1ZX5A 2VQEB 4QPIB 4Y22B 5IVJA 2Y64A 3ABKB 4BU2A 4AQ6A 3UO3A 4UAPA 2WSSG 2WKKA 3KV9A 4L97A 5DG2A 2RMU1 1MVQA 1DGRA 3T1YO 3CRQA 4QDRA 5FO9B 5GM0A 5L3CA 3C8XA 1YVWA 2LGQA 4X1KA 3BIWE 2XBO1 3ES1A 4O2AA 2CGPA 4ZY9A 3E6CC 1OFSA 3BCWA 3V65A 2FDJA 2Q8CA 1CAXB 2AGAA 1ZL8A 4ET7A 1YLLA 3I2DA 1PMIA 5CB4A 1MZEA 3P5BA 4QX0A 1TGOA 2O0OA 3DC5A 4RQEA 1QQP1 3JXSA 3ZPYA 2BNMA 3CMAV 4YJ2A 2WUHA 4IV1B 2D3RA 2XJPA 3POYA 3K3NA 2DYCA 3VQVA 3FAVB 3ILNA 1N3PA 5A3PA 1POV0 3O1UA 1JTZX 2FMLA 4E9KA 2JG8B 4G3YC 1HB3A 1N47A 1VBA3 3KHCA 2R49A 3EBRA 5A1LA 5BXZA 4P5YA 2ZE8A 5A32A 1DFQA 2GV9A 4DPNA 3D0JA 1PNGA 2BOBC 4JDNA 4OCTA 3OEHG 4D3WA 1AVBA 3OUFA 3LFMA 1OMIA 2JE8A 2E51A 4CH3A 2BDRA 5HCHA 1VBC3 1DU3D 1FNYA 1B09A 3LDCA 3DECA 4X1IB 2GTSA 1GUIA 1AZDA 4NOTA 1ULPA 5L3GA 3PMSA 2E75B 4INDA 4B3SO 1H9PA 3THTA 2WPDG 2VQFO 1UYYA 2VUDA 4Z92B 1OFNA 4QKDA 5FYCA 4K20A 4K8RB 1GMMA 3SJBC 2Q7EA 1MMMA 1OT5A 2Q69A 3S6PA 2O1QA 1QF3A 1JVMA 2DFBA 5FP3A 1QJZA 3LEKA 1ULOA 4K40A 5EP9A 2OT5A 3O7OA 1MZFA 1AJQA 1G9FA 4C90A 1JUHA 1DQ6A 3JASA 3ZKUA 1YJKA 1VBA1 2DWDC 4AAPA 3CDZB 2PY5A 2Y6GA 3I2KA 1MQTB 1W28A 4AILC 2Y69B 5CBFA 4JKMA 5IATA 3DGTA 4FPPA 2WFF2 4ZHNA 3VDDB 3AKRA 1RP3B 2RJKA 3CHXA 2PUSA 2RDCA 4FOVA 1JR9A 1DYPA 3AJZA 1XNCA 3ACLA 2XWJB 3ZXKA 4UXAA 1S0VA 2W0XA 5LXTB 1VMJA 4CS3A 4QB1A 4FPHA 1SQFA 1WCQA 2JK5C 1RUOA 5I0RA 5KXDA 4N53C 3CCQV 1OUSA 1RSOB 4YWAA 1AR92 4KG0A 1X7NA 3G67A 2VUAA 2LUWA 1RM1B 5T50A 4A2UA 4Q0VA 4K0KO 3JAWB 4KNCA 1OLMA 5KMGA 4N7IA 5B4NA 4XW3A 5F3IA 3Q8AA 4EB6B 3FBYA 3WF0A 3WP4A 4CDUA 2DYRC 1SPPA 3W7XA 3ZSEA 2Q7HA 1R73A 5KHKA 4AW7A 4DNYA 3S7EA 1M5IA 3DYMA 4LA2A 1BZWA 1NS1A 2YHJA 5T54A 4YHHO 3MPPG 1VAKA 3I56V 1Y74A 1MG1A 1PNMA 2KM2A 4CDUC 4ZHQA 3UETA 1ROPA 3OGRA 2VS0A 5C93A 1YFXA 3W7SA 3GWKC 5E79Z 2WWUA 5FMBA 3T0DA 1QH6A 1QLNA 2ARCA 1OH3A 4I50A 4NRPA 1P49A 1K8AW 5LMUO 3APBA 2EIEA 2VQTA 4AQ2A 3OR7C 1WMEA 2XG3A 3BVOA 5FP4A 2WBKA 1C28A 1S0DA 4HPKA 4RSUA 1X8MA 4JYAB 4O2AB 4JC1A 4N43A 1UY4A 1HIXA 5I91A 4GWNA 1FYUA 1GO3F 2VD7A 1XNAA 1EP0A 1AI7A 1S0FA 3I3MA 3JQXA 2PYTA 1OBNA 5FYSA 1NY71 3ZMOA 2XWBB 4N43C 2WLMA 4MSWC 5D2AA 5CB4B 4COZA 3POJA 4YJ2B 3NNGA 1P7GA 5FY8A 1IXBA 4PI2A 1ZRFA 2XHNA 3HNBM 1IKPA 4PIYA 3STZC 2W94A 4Q5OA 3VKFC 3UQ8A 4Z1MG 2IXLA 4EROA 1C8NA 1UMHA 4U7NA 3JZVA 3LA2A 1XHZA 4LO4B 1SLTA 5EIYB 1KXGA 2XOKG 4DR2B 2BQPA 4XBNA 4XDJA 4CPBA 3NV3A 1UFIA 4UFIA 5A32B 2IUWA 2XJUA 2D6PA 3H42B 3GB7C 2WFPA 5HCFA 1LOGA 4N9HA 1LRHA 2BJSA 5FO8B 2B45X 1DF4A 2V5YA 3TOJA 1MSWD 4QXKA 1GNYA 3AVSA 1YJLA 2H94A 2R0HA 2ES3A 4YW5A 5FKBA 1QVFU 2D98A 2WLJA 3VZMA 2ZIOA 4DEVA 3N4MA 3AKQA 4QB2A 4N8MA 2VVEA 1SQXH 2DCJA 1C1LA 4BXSV 2E32A 4H14A 4UWDA 2QQNA 1Q8QA 1EZJA 3ZDVA 1NOVA 2ZGMA 3M8AA 4DUXA 2EINC 4EN0A 3GCXA 3OMNB 4CZZA 3THCA 2IJJA 3JD4A 2LFSA 1LHVA 4S2DA 4JYYA 4FQ4A 4IESA 1NXD1 1W6QA 2R072 2VGDA 4YZ5A 1VRH3 1WD3A 4HKOA 1WBFA 1R3LC 4MGIE 4WVVA 4AI9A 2VMDA 1SMVA 3ZKYA 5HCAA 4GQ7A 4XABA 5LA9A 5FMOS 3JASB 5BV6A 3I59A 3ZO0B 3AXDA 1Q5OA 1PNLA 4Z2AA 3FBMA 2VUCA 2IJKA 3K51A 4K8FA 5FYBA 4P9LA 2W91A 4IEVA 1VBB1 4ZU5A 4F7ZA 3S7IA 1Y9GA 1XYPA 4MVZA 3ML0A 2WSVA 1M93A 3GZTB 3BU0A 2F17A 4XF0A 4LTAA 5IVBA 5FRAA 4LOTA 4F6EA 1YI9A 5HXVA 3CXCU 2ARHA 3OGCC 1GWKA 3M7AA 1SA0A 3PDQA 1T5EA 4NRQA 2A71A 1FX5A 2VQFB 1OHHG 3K5NA 4AR2A 3Q8BA 4I0AA 1OA2A 1KEXA 2VMHA 4JAAA 5C3OA 1VBD2 2ET7A 4V2VA 5T5PA 2HWC3 1NA1B 3BTZA 5FYMA 1S2BA 5KMGB 3OGIB 1VRH1 4LULA 5IYZA 2EULA 3ZSKA 2A1XA 4CDUB 1SPPB 2YICA 4DB5A 4FM0A 4J9ZB 3UT0A 4ZONA 1XYNA 1LHUA 3K2OA 1REEA 4AQSA 1HB2A 5DG1A 1GN2A 1AXYA 3WXPA 1Y74B 1VF6C 2QM7A 4ZHQB 2YC2A 1RUC2 3WDYA 4P9WA 2RV9A 4I0BA 5IYDO 3DN7A 3LD8A 1CESA 2X09A 3B9CA 1M4WA 2QDNA 1O9GA 4AI3A 5JVDA 3N7MA 2RS12 4JHZA 2RJZA 5LHIA 2R9AA 3WDWA 2EAKA 3ELNA 4I50B 3AZXA 2R32A 4CDWC 5EIBC 4KGGA 4QX7A 1TMF3 3BABA 5L19A 1UZZA 5EZWA 3UO2A 2LQTA 1ZX3A 1YXBA 2DVDA 3WW3A 3ZMNA 4GX5A 4HPKB 3B5LB 2XVKA 1J3RA 4XE9A 5CG9A 4WBNB 3ETPA 4XJAA 4K0KB 4XBFA 2UXXA 3A0RA 5FZ4A 5IWAB 2HWC1 2ZDIA 4R6ZA 2ETEA 1NE6A 3MUY1 2A6WA 3WR0A 3JBG2 1LCLA 3FZ3A 2EJ7A 5CNAA 4FFBA 3H8UA 2ZDIC 3OSDA 3T09A 5DAWA 4QQHA 2KXLA 4YHHB 4LEJA 4XF4A 4I9QA 4RQPA 3B93A 5F32A 2QKSA 1S0IA 1VP6A 4CVUA 2SLIA 2BTQA 1PL0A 1CAVA 1HRI3 2EX3A 2A6VA 2VBPA 1G8MA 3NQHA 1VR3A 4RQPC 2ZOEB 1YEWA 4H0LB 4NN0A 4B3RO 2P2KA 4YGCA 1C1FA 2F66C 4QX8A 4JZ2A 2XR4A 5LASA 1RVF2 4X6RB 3AK1A 5LMUB 3VBHA 2R063 1TMF1 4NWWA 4A3XA 4Z82A 3NJZA 1QJX3 4MGZE 3H8XA 4BOWA 4XF9A 5ACA2 2LALA 4WFGA 5FZAA 4GKKB 1CZTA 3VBHC 5CYYA 1F9KA 4A44A 5C5TA 2KKWA 4RUFA 3BA8A 2Q0OC 3RNSA 1Y3TA 1ZBA2 3IPVA 2DU0A 1VAMA 1DLLA 2P7TC 4D0QA 1JZ4A 5CFDA 1IXMA 3FB7C 2E3CA 2V73A 1W6QB 1W0NA 3SH4A 5A3MA 4P5HA 4XBQA 3CWBH 3KSCA 2ORXA 2EALA 2D2CB 5FZ1A 4CPBD 4Q26A 2QUOA 1JYNA 4N9IA 3LIHA 5CFDC 1HRI1 1ULFA 2IBZH 2ZCWA 1HRV2 1PO13 2J42A 3I59B 4AVAA 2KB1A 4LF4B 5AC93 1FATA 1BT8A 4FPLA 1GP6A 1GANA 2P3JA 2ZX1A 3FLTA 1NTMH 1M9NA 2N04A 4EJRA 1I5YA 1A3KA 1UMZA 2J1SA 3WSOA 3K46A 1BCCH 3THOA 2K9ZA 1QJX1 2WO2A 5LRRA 4BQWA 3HVDA 1H38A 1SA0B 4B3TB 4LIUA 1EPZA 4NPLA 2VZSA 4JX0A 2Y6LA 2BBVA 4OHXA 5A3TA 3RWNA 2DV9A 4XFBA 1AR73 5L73A 2E5LB 2Z42A 1XBFA 4F4LA 3C7FA 3K3WA 1BCXA 1ENXA 2VCBA 1WLTA 2ADDA 5IYZB 4HETA 1S5LZ 2VVDA 1WMDA 1PO11 3HT1A 1NE4A 5LA2A 3SCHA 5ABJA 1GQHA 5AC91 1B35C 4P9OA 3ENRA 2XJRA 3PLQA 4ASMB 2Y60A 3H3ZA 2QZ3A 5B3SB 4UCTA 1W0KG 2W1WA 3EHBB 5ABJC 4DK1A 2NM1A 2HJFC 1W2BU 1V6NA 3T1HB 3LAGA 1OCRC 5JVDB 2X29A 4FFFA 4ASLA 2Q8OA 4Q4Y2 5LGUA 1PO22 2BTOA 2Q68A 5K0UA 3VD3A 3SXWA 3DF0A 4MS2A 5A9GA 3E6DA 3AFKA 4AVVA 5FZKA 1W90A 1V6KA 4GMP3 4AHYA 3ZHQA 2C26A 2XGXA 1XXNA 4UCOA 5CISA 5CEHA 1RHI3 1K5QA 4NHKA 2D40A 5K0UC 4YIOA 3M70A 4PT6A 4Y1XA 5LA1A 4FI9A 1CAUA 5C8WA 1QXRA 1YJ9V 3WFVA 5L3DA 2RN9A 1JODA 2Q5TA 5LMNO 1NJIW 4M3CE 2FTKA 5HFLA 2JDNA 3B40A 1NX9A 4FFBB 4W50A 3MIDA 2HEWF 4NAMA 4LJHA 1RJ7A 2QQPA 2BRTA 3WV6A 4RQPB 1XI1A 2BTQB 2ZM6B 5DZGA 2ZEZA 1CAVB 1RMU3 3JSLA 3W7TA 3KCYA 3LA3A 3KCCA 4DK0A 4CCDA 1HWYA 2X6CA 2GMEA 1JOBA 1V6JA 2P6HA 4A7ZA 3GZAA 4LR4A 2QTWB 4M4RA 3NXSA 3LB9A 3N3HA 3HBZA 2GTAA 3VBHB 4D8MA 4MADA 1BEV2 4XZUG 4UCUA 4URAA 1SQQH 3ACHA 2UURA 5TISZ 4GMP1 4A6SA 1GSLA 2PELA 3AL5A 4CP9B 3ZXLA 2DU1A 3QNEA 1HN0A 2Y4UA 1RHI1 2W46A 2WL1A 5C70A 3IN9A 3E89A 1LHOA 1UKGA 2FCTA 3K4ZA 4E8DA 1ULDA 1QHTA 3HKCA 3IGAC 3ZOIA 4DXRA 4N21A 4YARA 2ZGOA 4P00B 3IPVB 4P9GA 3RSJA 4AEKA 4IQPA 4X62O 1JMUB 4FPGA 4Q20A 3U10A 2WN2A 2LW7A 3POEA 3J8F2 3SMHA 3M3OA 4F6RA 3H1LH 4Q27A 1KQSU 3TEWA 5FYVA 5CBLA 3U11A 4AVSA 5F37A 3ZMTA 3CEIA 1OD5A 3ASIA 3VQWA 2FDKA 2DURA 1RUE2 1RMU1 1VF7A 1YUDA 3VHPA 1US2A 3SPHA 2VQ0A 5FZ0A 4HVRA 1GN3A 1KS4A 4DV5B 3H0OA 1JZ6A 3RWRD 2EXKA 3SJQC 5FLIA 4I09A 1DGRN 4CU6A 3HKEA 4ZXKA 2FYUH 4DR6O 5FREA 1POV3 3TEXA 5C8YA 5FCCA 3T2PA 1KU9A 5GLZA 3HJRA 1JZ5A 3L73H 1UYZA 1POQA 1OF3A 2OCHA 4BWAA 1XU2A 3HN1A 1JBCA 4JI5O 3ZSLA 1CGPA 3B01A 4QE7A 1VQ4V 1F2NA 4IUGA 1XPWA 4I7ZB 1ZLZA 1EAH2 3SCGA 2P06A 5IY5C 5J1XA 3O5SA 3RYKA 4M4PA 2PLV3 1LOAA 1YYNA 5EFUA 1W9FA 5EC2C 3DV8A 3IDBB 3G6BA 3TXQA 1YTFB 1K12A 3BN6A 3ETGA 2K1EA 3ZVXA 3UESA 1G86A 5LY2A 5EBWC 1R1ZA 1Y67A 2X5IB 5FZLA 1VBE2 5FZIA 3PJQA 2V4DA 4BB3A 5ABJB 2M6YA 1TME3 4BMEA 3ST7A 1OCRB 5A7NA 5C9AA 2ZXWC 3PTRB 4Y4RA 1R083 5JDBA 2KG7A 1POV1 4AGVA 4IEPA 4KP4A 1AXKA 4E4HA 4UFJA 3B94A 1NZCA 1R092 1CP9A 2JDAA 5FPLA 4QM9A 5KXCA 5C9AC 4YZ4A 3OT7A 2UUAB 4MV2A 1JQ0A 5CVRA 1VQLV 2HWB2 2VXJA 3H1JH 4GJZA 3WG3A 1Y66A 1FOD2 2VUJA 3VDCA 1OQEA 4U36A 3WCSA 4LF9O 5IFTA 3J80N 1ZRCA 1CPNA 1YC61 3O14A 3ECQA 3M3CA 1V55C 2PLV1 2YI9A 1GK9A 2WLIB 5DXDA 4FLXA 3OW2U 1CAUB 4QKNA 5F5CA 3ZPOA 4FXGB 5HPOA 4RYDA 5FYHA 4PLOA 3EMRA 1ZVFA 1H4HA 4Z2WA 3ZHSA 2VZ1A 1YI2V 2JG9A 1VQOV 1DBNA 5IT6A 3IC7A 2VCAA 2NR5A 2V1DA 1TME1 2WAOA 2QBXA 3KV4A 3RI8A 3B00A 1R081 1TG7A 2DWRA 1WJZA 2HKOA 2ZX4A 2QDOA 4JV5B 2YZ4A 5LW9A 1IBKO 3ZIWA 5FPRA 3HPNA 1H1IA 1BL8A 2K46A 3AMHA 1EYBA 3ICXA 2DUOA 3UGFA 1ACCA 4C0HA 4GB32 1BYHA 1WKYA 2A6ZA 2XTAA 1B3QA 1OLRA 1ZRDA 4JI3O 5A3LA 1I5XA 4JYCA 1DGLA 5FZGA 3HKCB 3ZHVA 3ZX6A 4D94A 3ATGA 1MS3A 1WUVA 5C3QA 5LMNB 4S2HA 3P6BA 2MHFA 4AE2A 3DYPA 3BKZA 1TE1B 1W3XA 3RT3C 1HDJA 1IS5A 3MBWA 3IAPA 4F6RB 2PFWA 3THPA 1JYXA 3PUSA 1WW6A 2XUEA 4X9QA 2H3OA 2QEXV 1RUI2 2LRPA 2LP7A 4IERA 2P3IA 3LPGA 1QLEC 4BXFA 2QTSA 3ZHTA 2WQ4A 2PF4E 5BNNA 1ZBE2 1M06G 4AGRA 1SBDA 2Y0PA 3JAMN 1HNXB 4KWLA 3HKEB 1AI4A 4HK8A 2YROA 2LJ2A 3ZYIB 3IBMA 3RVHA 5JCOA 4ZS2A 5BNNC 3VB9A 1RUNA 3ZYGA 3WF1A 2FCUA 5FOBB 1TA8A 1VQPV 2CYFA 2JJ6A 3ABMC 1LAJA 4AQTA 1I9RA 1UPSA 3H1YA 4DO2A 3CLPA 2E53A 3LQCA 5B5EZ 2Q0AA 2VNOA 4MW3A 4QNHB 5JCOC 3IM0A 5IY5B 4YVWC 5J2UA 5D8AC 1VJ2A 3JQWA 5J9PC 1WGPA 2WFF3 4X62B 1LODA 3H7JA 2Z2SB 3ZN1A 2VM9A 1OOPA 1GM8A 4XDPA 2CUGA 2IH1C 3G80A 2WSUA 3F7YC 3R66A 1JHNA 4LH6A 3ZRSA 2D5HA 3G71V 4JRAA 4OHYA 3ILRA 4Q4X2 2E31A 3CEWA 2LM3A 1AR93 5FYTA 4XURA 2ZXWB 2GMMA 4W4ZA 4CCNA 1CPYA 2QWPB 1H0BA 1FI2A 3FX3A 4BK5A 1XJAA 3NV1A 2OTLV 1NT2B 3IJ4A 4GT1A 2VULA 2VW2A 4UFKA 5JXIA 1D4M2 2BFUL 2EF6A 2Y34A 2KG7B 1V54C 3E1F1 1XQNA 4YW7A 4KBBA 3OBTA 4Q29A 4FPFA 4YW4A 3NMBA 2QTOA 5EXOA 1ZZ9A 3C3SA 4Y3OA 3I8TA 2QM8A 4FFGA 4XYXA 2VWJA 4JI5B 4XETA 4COUA 3D6EA 4W6WA 1F31A 4AFMA 2IXHA 4W8JA 4AAXA 2HWE2 2WFF1 2X0LA 1GICA 4XJ9A 5LBFA 5LK5A 1XNBA 4D6QA 2F43G 2CL2A 2JEMA 4NMIA 1W6NA 1PMHX 2WNVA 4DFSA 3BODA 5LA6A 5L36A 1KDKA 1SF9A 3KF3A 2JENA 2O57A 3GNEA 1QXJA 1FXKC 4JV4A 2WNVC 4OVEA 4NTWA 1AR91 4LKFA 4NR1A 2HLDG 2JG9B 1SCSA 1QDOA 2MPFA 1QR8A 3JAKA 4YG0A 3RZZA 2LW8A 2Q8DA 3OY8A 4I30A 4FXKB 1W2AX 5CKMA 2CGOA 2ZGSA 4TV8B 3FD9A 3MEPA 1O91A 4NTYA 1N0NA 3ZMZA 3NJYA 4UUJC 1VAVA 4HK9A 1KD7A 1KDMA 1Z5WA 4R8CA 2YUAA 2Q7GA 2HEYF 1PVC2 5KHHA 4LF9B 1QR9A 5ANQA 4EN8B 2OVUA 1UQXA 5BR8O 1HV1A 4M00A 1J5EO 3NV4A 1UKRA 2Q9LA 2AYHA 2VNVA 5HBAA 2NN4A 4J11A 1O8SA 4BZ4A 1XE8A 1ODNA 5FJKA 2BNNA 5EZYA 1QLEB 4LP8A 3EB7A 1N34O 2E26A 3RZMA 3MLKA 4AQYB 4TV9A 3WB1A 1W59A 4TOIA 3VOUA 3L75H 3BPSA 4P9IA 3L70H 2ZGPA 2ZE6A 4XVHA 1ENQA 4XXPA 1M56C 2F4VO 2BP6A 4CH6A 1X33A 1G8WA 4MT8A 1OLME 5BNNB 4LBJA 1WN7A 5EYYA 5F5AA 2R1DA 4BIFA 4JCKA 1C57A 2ZGNA 3FC0A 4JDOA 1JYIA 1TNRA 1PGL2 4O65A 2OTJV 2EIKB 4JGYA 4PI0A 4ITCA 4HFSA 3UYJA 1WP7A 4RD7A 1P8JA 1WCSA 4JI3B 4COVA 4BQXA 5EYPA 2XDVA 1BJQA 3TRSB 4LFAO 3K5OA 3I3EA 5J2UB 2FB5A 3PIGA 5C6CA 1PK6A 1AX2A 2DVAA 2ET1A 4QQ2A 3PURA 1NXMA 4E2LA 1REDA 4JGYC 3DPRB 1M57B 1NKDA 4C1WA 4K8XA 3Q9OA 2IJHA 1APNA 1OOPB 1PX3A 1JX9A 1RL3A 1S5HC 5FYIA 3CCMV 2XMLA 1PK6C 2GZWA 4HKWA 1HNZB 4YVSA 3RYFA 3WNPA 4EZ4A 4ABMA 1ENRA 1BHBA 5A6QA 2Q67A 4AXOA 4YGEA 5DUVA 2YB7A 5FZCA 2ZEXA 1JCHA 1GZTA 2FBEA 2ADQB 4MUVA 3VD5A 4JYBA 4Q0UA 4YVSC 3LDDA 1VBD3 1OURA 2JECA 4B7KA 4AK3A 1DZQA 1RIRA 3LDBA 2OT7A 4AI8A 2R071 2QKAA 5EPAA 1O6UA 4I01A 1WD4A 3K9AA 5FP7A 4LF7B 1H4GA 2AREA 1SLAA 3CCJV 2GMPA 4DINB 5BY1A 5IWFA 4BWOA 2RDQA 2P90A 2Z5UA 3AP4A 3SNMA 1X36A 1W06A 2AEZA 4UW6A 1RUJ2 3ASNC 1DTOA 3WNMA 4QPGA 1WCDJ 4LBNA 1RUC3 1XNRO 1ODMA 4CA9A 1ZM1A 5DAXA 4Q2FA 1IX9A 1UU6A 2ZZJA 1K5MA 1V9U1 2Q1FA 4RWUA 2RS13 2WNVB 4QPGC 2CDYA 4JGZA 5LA6B 1ZSPA 4CSWA 5KWRA 3RN4A 2TEPA 3A22A 2JDKA 3ZJZA 3K59A 1QH7A 1WB8A 3CNAA 1K5MC 4B08A 3WQ0A 1Z7S2 5J36A 4FOWA 1CIYA 2RS32 5IYCO 2GP3A 2UXNA 2ZZQA 2JGUA 2ZR2A 1VBD1 5LATA 4GULA 4MTOA 4Y20B 3JAKB 4YM2A 2RS51 1JYTA 4DV7B 3P3PA 4P30A 2VL4A 3IDCB 3OD0A 5LY1A 5DDJ2 1VQ7V 1G6UA 3I4IA 3AG2C 3C90A 3JBG3 5AFEA 3ZIXA 1KC8W 1X82A 5FPAA 2KA3A 4UYBA 1JI6A 2F93B 4PA7A 3CX5F 2EBOA 4SBVA 5JXHA 4AEJA 3L74H 1Z78A 2PXJA 1RUC1 2WINB 5T5JA 1OPMA 3ZN6B 1JU3A 2FDFA 2VJXA 4PBPA 1CONA 3HBKA 2BSKA 2BUKA 2RS11 3CL1A 2E76B 3ACGA 3O1MA 4F83A 1RVF3 4Y1VA 5DAVA 5DM6V 3AVRA 4GX2A 1HP8A 2JJ2G 3FUOA 2B1GA 2DN9A 1BSMA 1H30A 4I3GA 4RL7A 4O4IA 1XE7A 1M56B 2JDMA 5FFOC 3FE5A 4LHNA 4DXWA 2VH9A 3VBFA 5I8TA 5ACA3 1BK1A 4YPJA 5HV0A 1ZUQA 2Z79A 5L3FA 1WMFA 3R0RA 4COYA 1VQ9V 5IUQA 1ZBA3 3RQ0A 1FMD2 1NYWA 3ZFGA 3GVMA 3CJXA 5LK7B 1WBLA 5FXXA 3JBG1 3C2UA 3LNNA 1G9DA 3K75B 4IL7A 3A0HZ 3L72H 2E9QA 4IE0A 4ZIBA 2Y6KA 4KWUA 2DMXA 4RA0A 3T4DA 5A2QN 1VP7A 3WNKA 1P84F 4FPJA 2P67A 4D7TA 3KT4A 2JGDA 2Z5WA 1HRV3 2WQ8A 2ZHLA 1SQ4A 1EV11 4QM8A 4JGYB 1SG3A 4BCUA 4IYIA 2J1VA 2A70A 4RR3A 5BR8B 1RUH2 5EYPB 2JB8A 4AVCA 5IVCA 1J5EB 3HKBA 4CCCA 1PK6B 3HNMA 3D36A 2R0FA 3W7WA 2YS8A 4ATFA 1QNWA 1PNFA 5FL7G 3PU3A 4HSLA 5C3SA 1LB2A 1L7LA 4RR3C 2VMIA 3AMNA 4UF0A 4WZFA 4OUMA 1G9AA 5F2SA 5F7UA 3LOIA 2E7TA 1LEMA 5B1BC 4OHVA 5JH7A 5B1AC 1I94O 1W05A 4YVSB 3D36C 3RYFB 4JKKA 3LEGA 4C1XA 2XAQA 1PX4A 4AFAA 3N36A 4AVBA 3AP7A 2F4VB 1R3KC 3H3UA 4JI6B 4Q6GA 1ZBA1 2W39A 5LB6A 1RTVA 4YM1A 3AX4A 4R52A 1VE0A 3THDA 4YY3O 3ZBHA 4JQRA 1E5IA 4PDVA 1LUVA 1IKQA 1FPN2 1L7QA 3T2QA 3K3OA 2GNTA 4L87A 3VBSA 3PU8A 3ASNB 3CC2V 3AP5A 3TETA 2N74A 4LF6O 4BJ0A 5IVEA 4FOQA 2B46X 2EZOA 5IJ0A 2QA4V 1J59A 1HRV1 1RUF2 1LHWA 5IJ9A 4Y5SA 5CZKA 3LFIA 3POFA 3CZUA 4HXCA 5L3BA 5JR7B 1OZ0A 3JYCA 2P5OA 4LFAB 3IKWA 3GBFA 1K3EA 4QPKA 4QPGB 3B7MA 3I2GA 1PKXA 4D6SA 1Q8VA 1BLZA 1B04A 2AHYA 2UYAA 4DO0A 5CA0A 1OCZB 1X9TA 2WZEA 1K5MB 1MZ6A 3ME2A 3GHNA 4AF9A 2OQ7A 2PTMA 3C7GA 4JGZB 1Q3EA 4Q4Y3 1PO23 2WO7A 5CB7A 3PIJA 2OXBA 5C8CC 4XFGA 4M3CA 3M99B 3AC0A 3VL9A 5EK0A 1PM4A 5H6QA 4FZ0A 2UY8A 1W8WA 2ZGTA 5FZOA 5A6YA 4LF5B 3CKHA 1XNTA 4YIPA 4AI1A 5EV7A 1ENSA 4Q4V1 3S0MA 1X50A 4LITA 3BTXA 2X8KA 3WF3A 1FFXA 1IDSA 3WQBA 1UZVA 4LIVA 4DRXA 1HXS1 1KFUL 1W2OA 1WZXA 5CKNA 2FDIA 4IL6Z 1UU5A 1FPOA 1LUWA 5FIXA 2FD8A 5F5QA 4QAWA 4ISQA 3INAA 2AC1A 2VECA 5LYJA 3E8HA 2RQ6A 2D43A 3W20A 3ZN4A 5C7GA 1XNRB 2FMYA 1AYN3 4ES9A 4NAOA 4G2KA 2HFEC 1N4CA 4IW3A 4PBOA 4FTEA 2RHPA 3AK2A 3VBOA 3CMGA 3SLIA 5FY4A 1TAEA 4NTXA 4OX9B 1ONAA 5K1PA 2W0FC 3MIFA 1U96A 4I3PA 5KXEA 4OPAA 4OI0A 4Q4Y1 4E2SA 1PO21 1UIKA 3FB6C 3SHRA 3MFAA 1BEV3 2BEOA 1SQBH 3VN4A 1NAEA 4O4IB 1K9MW 1R6KA 2X6AA 2QQWA 4EN9B 1UXXX 5EHDA 2ZGUA 1AR1B 5FZHA 1K97A 3HAGA 4FFHA 3VBFB 3HWJA 5KUMA 3JD1A 1E79G 4DV4B 4WF9V 4RS5A 5JSRA 2LO1A 5FK7A 2WRAA 2ZEWA 3WHUA 1H2KA 4J10A 3ZFGB 2VZTA 4PDWA 4QX2A 3E5XA 4LKEA 4XTPA 1GM9A 4J41A 4E4EA 1RJ8A 1S55A 1RXFA 3JUUA 5B4XA 3W59A 2VW1A 4CCLA 2AW9A 1SLCA 5TSWA 2YV8A 4RS5C 4DXZA 4CCEA 3J8F3 5LEKA 4AZZA 4JZRA 4TSFG 3LSQA 4PDWC 3BRCA 3GYDA 1UF2C 2WA3A 3RPQA 4MZUA 2CTPA 3AZWA 1U5ZA 2JGDB 1R1A2 4A7KA 4JF3A 1RUE3 1LOFA 5A6ZA 1KRIA 4H37A 1GFF2 5ERLA 2IVJA 5F8PA 3FUQA 1XRUA 4LBQA 1IPKA 4B29A 3MW4A 4MGQA 1XQ8A 5FY1A 2HHHO 3W58A 1CR7A 3HKBB 1I0HA 5B1BB 4GWMA 1MZ5A 1OCOB 5B1AB 5LGNA 2UU9O 5T52A 4JI8O 4CUCA 3GCWA 4S2GA 3JSNA 2ZGRA 1BEV1 4GH4A 1F7YA 2ZMKA 1UOJA 4DR1B 2I2SA 4QPIC 4UF0B 2PN5A 3N35A 3ZHRA 1N1TA 2YBPA 2PGGA 3ABKC 3D3AA 5JH7B 1MS9A 5L7OA 5T5OA 4DV3O 1KYOF 5DUWA 3MHSC 5GZCA 2WWSA 1LECA 2RJLA 1EN5A 1AJOA 1KJRA 1KP3A 1Q81W 2ZACA 1JMKC 2WLPA 2W1SA 2AR6A 5L7OC 5I93A 4META 1EAH3 2OPWA 4LH7A 2GN7A 1N32B 3AKTA 3KMHA 2WS93 4IEWA 3ZYJB 3ACIA 3J8F1 3VBSB 3KQ4B 5D1IA 2ZKLA 3CJIA 3T3YA 1XYOA 1H8VA 3AP6A 2ODMA 3K57A 1OXCA 2XONA 1VIBA 1S72V 3H9VA 1T6GC 1ZRRA 3O12A 1VBE3 2ZHNA 2VOTA 2PAKA 4AGGA 1JW6A 4NE9A 3ROUA 3CJIC 5IAVA 3AKPA 5KC5A 3ZEDA 4IV1C 4KI5M 2HYKA 3KQRA 4KUMA 2XAFA 3UGGA 5CA1B 3EVKA 4NIHA 4TQDA 5CA0B 2JIJA 3VUOA 4NO4A 5LBQA 4B4PA 3SPIA 1R093 3K5LA 4FLTA 1UN1A 2VRZA 2ATFA 1I94B 4EQVA 1BHAA 1SC5B 1K34A 3VZOA 3SEPA 4IHJA 3W21A 1AP5A 4M01A 3SR2C 2HWB3 2NMOA 3CB2A 4TQFA 3UV9A 2JICA 1FOD3 2J1TA 3WP6A 1UY1A 4LNUA 2DW4A 2VNRA 4TUYA 4YY3B 1CX4A 2XHKA 5FZOB 4IEQA 3EJKA 1EAH1 2XASA 1GZWA 4U3FH 1OVSA 2VE1A 3WNNA 1Q8PA 2WQZC 3J7MA 3MDPA 2A7WA 5GLVA 5EYXA 3I54A 5BXXA 4LF6B 3W5NA 3TB0A 1UO9A 5FQ0B 4DRXB 5FR3A 1AJPA 1OA3A 1W6OA 3WP5A 3ZS8C 1VBE1 3OGGA 1W04A 5FBZA 2QQUA 4PQQA 3OF1A 3QO7A 1ZZ6A 4G27B 5CMUA 2C0ZA 4GX1A 3MIGA 4MHUA 3K4AA 3WEZA 1GNHA 3GF6A 1UOBA 5IDJA 4MOAA 3VBOB 1W0OA 1KECA 3QO5A 3PNAA 1E5HA 3B77A 1R091 4K6BA 4MSVA 4K9SA 2JDYA 1HW5A 1SCRA 2P1BA 3VKOA 4R50A 3OUHA 4YG6A 1NCRB 2RMU3 3WNLA 5LXTA 2ZHMA 2W08A 4DOUA 2HWB1 4CXYA 3VDDC 4PJYA 2R16A 1F4NA 1VBC2 1NU1H 1FOD1 2IU3A 2F4LA 4GB33 5CKQA 4XDOA 4MGTA 4DRVA 5JJNB 3UNPA 4RS5B 1GYKA 4MVOA 5FNVA 4PA3A 4UVCA 1SBEA 1WCUA 4XBLA 3R4DB 4XFIA 3VKMA 1RM1C 3ZRXA 2HEPA 3PUIA 5GONA 3U78A 4DR4B 2D3OW 4MX3A 4KU7A 4WV8A 1Q86W 4DXSA 1RUI3 3ETEA 2P6JA 2WAMA 3RDIA 1AJNA 3AM2A 3LSEA 1RYYA 4DV2O 2BERA 2H8PC 2XAHA 5FJHA 1ZBE3 4LHLA 2QJVA 1MS4A 3HQXA 4LBQB 3CCRV 4XMAA 3DC6A 1GR3A 4Y5Z0 1YQ5A 4GALA 3WCRA 3H3LA 1CJDA 1UZ0A 1AB3A 3KT1A 1ASJ1 4EEQA 4GH4B 3AJYA 3E2EA 3T2MA 2I74A 2K2SA 2WNUA 1S4CA 5L7OB 5K1XA 4GB31 5HCBA 5KLVH 2VR4A 5A6XA 1JPXA 3JALA 1YI7A 3D5OA 1NLRA 2VC9A 1CAWA 2WNUC 3H01A 4X66O 1PGSA 4DY5A 1DK1A 4HLTA 2CTWA 2KQXA 5HFMA 3KLSA 1UJWB 4CDQA 2RM21 2IM9A 1X4TA 1SQGA 4PA6A 3CJIB 1I7FA 1GLHA 5FXZA 4LBQD 1Q82W 1H9WA 3JCZA 1US6A 2VQUA 5CA3A 1RUI1 4Q4X3 3ABLB 1YQCA 1W99A 1K7DA 4E4ZA 3AL6A 4EZHA 5FZ9A 3VKNA 1ZBE1 3VV1A 3MFCA 2HHHB 5DN2A 2WA4A 2G9FA 3K58A 2YBSA 3LZZA 5JSPA 4LBEC 1D4M3 3ZRVA 2VVFA 4JI8B 4QXHA 1GNZA 1VMHA 4A4AA 3QF7A 1HQNA 1BZKA 2UXBB 3MD0A 4Y26A 1L7RA 5E8AA 2HBTA 3J7NA 3ZFFA 2EA7A 4D6TH 1A34A 2H0VA 4IE6A 3WHTA 4DV3B 4DR3O 1CD3G 2R1BA 3O1SA 4IHJB 4ZPIA 2E7AA 4RO2A 3EQEA 4UB6Z 1F15A 5KC6A 2AGSA 3AEIA 3S30A 2JIZG 2HWE3 4HOOA 3GXUA 4LNUB 2XT9A 1EY2A 4O7XA 4A6OA 4TUYB 1G9CA 3FJSA 4X8AA 2CH7A 2VZQA 5GZGA 1GZWB 5BZBA 2QKDA 4E4DX 1IQAA 5J48A 2JVDA 1I3HA 1SDDB 4BISA 3CCLV 2ITCC 4HVOA 2W6IG 3VBBA 1KD1W 4JI1O 4Q4X1 1W6OB 2GBOA 2YIDA 3HNYM 4J9YB 1H1AA 5DUXA 4QE9A 4XJWA 4MH0E 4MGYE 3N7LA 3E83A 2G1MA 3VDAA 1W9TA 1WW7A 4B4RA 1D4M1 3VBUA 1D2DA 4YNIA 3TEZA 1BMFG 1EZVH 1QJY2 1ULEA 2P5BA 1HLCA 2V7QG 1REFA 1BQPA 2DFCA 3FB8C 5FPXA 2B1IA 4XEZA 1OSGA 1SFYA 3VBUC 4OMDA 2R042 2P4EA 4BW9A 2Y0OA 3H1WA 1DLBA 1BS3A 1G4YB 2XLFA 2XQXA 1RITA 2PYLA 2DCTA 3RG0A 3ASOB 5F6KA 1OH4A 1IGOA 2HWE1 2DVGA 4ZZ5A 1PVC3 1ZAUA 3LDRA 4XUOA 3Q8EA 2PHUA 4L92A 5K4LA 1DHKB 4ZXEA 2A3QA 5IK8A 3FWEA 5FNVB 1VRBA 3C7EA 3K5MA 1NA1A 3WB2A 3N2GB 5E1AC 4GX0A 3MPBA 5FPVA 3PJSK 3C7HA 2UXCO 2DTWA 3WW1A 4X20A 3VHRA 4JASA 1G7YA 2RVAA 1PM9A 2P17A 5GONB 2AZ0A 4R8HA 2YU2A 3CE2A 3IB3A 4SLIA 1NA1C 3O9OA 2YXSA 3SPGA 4JAUA 1XNQB 4ZU4A 1O9HA 1AJKA 3CC7V 4E27A 4B3MO 3NAPA 4FLZA 2CE4A 2HVKC 5JSOA 2E7QA 2JKBA 4YGBA 5FPOA 1M4UA 2UUCO 2CSGA 5GLUA 4WVMA 1OV9A 5JCTA 2NMNA 4ASUG 5FWJA 4J1XA 3NWKA 4H3WA 3O1RA 4GKJB 5DECA 4FPEA 4FLVA 2WNUB 2YY1A 3LIGA 4IV3B 4EN7B 4E2QA 1YQ8A 1JUIA 1PVC1 1BBT1 5EBMC 3BYWA 5L9RA 5IK5A 2EXIA 3NVCA 3JALB 4WBNA 1STMA 4HMZA 1W0JG 1CAWB 4AFDA 5AVPA 3NRUA 1YITV 5FZEA 1SZTA 2C4XA 1KGYA 2BYVE 4CDQB 2P4KA 1XL6A 5JR2A 2VU9A 3QOPA 1A6CA 2BE3A 3T1LA 1JS9A 2GAUA 4FOYA 3CCSV 3UK9A 2B9UA 2G19A 5C4WA 4GKXA 4R9DA 4XFHA 2BBAA 4DV2B 1EN4A 2R9IA 1NUKA 1MS0A 2VZRA 3J9SA 4XMIA 2MW2B 4LE3A 5C4WC 1V6LA 2W2IA 1WLWA 3E86A 3B69A 3WG2A 3MYXA 3HIFA 3TNQA 2KR2A 2Y6FA 1TUEB 3T1YB 1VBB3 4UOJA 5LGTA 3OOXA 4DEQA 1PGL1 4RAIA 3ZFFB 2WLLA 4PCRA 2XLGA 3R4SA 1W8ZA 1RUJ3 2AEYA 3RBZA 2JKXA 5FZDA 1SBFA 4QX1A 4L11A 4BQYA 5GTIZ 3BU7A 1U5IA 1XUQA 4LKSA 5J09A 2R7EB 4HKLA 1SZBA 5JAXA 5E6HA 4RFT0 5C3PA 2ZNJA
chains in the Genus database with same CATH topology
1XQNA 4DZGA 1MR5A 1D0HA 4KBBA 3OBTA 4CEYA 2XBO3 4M0HA 4FPFA 4Q29A 1LGNA 5T3NA 3PHMA 4YW4A 1N1VA 3AFGA 4GKYA 5EXOA 2NP0A 1ZZ9A 3ZYRA 5FDBA 1F5FA 3I8TA 4MLOA 4XJUA 4O9GA 1J3PA 2CNAA 3LOBA 1D2QA 4P9XA 4Z07A 1RB8G 1FAYA 2BGCA 2PHLA 1YFYA 5AVAA 1MEC3 1TME2 1Z7S3 4XYXA 2MNGA 2DF7A 3HR9A 4XETA 1S0BA 4COUA 3D6EA 4W6WA 1F31A 2RS33 4AFMA 4CEYC 2IXHA 4PDWB 1S0GA 2IXKA 2HWE2 4AI0A 1DYKA 2WFF1 1COV3 1GICA 4XJ9A 3OCPA 5LK5A 1R082 2PHFA 4YG3A 1XNBA 1AR82 4AFCA 2CL2A 3IT8A 3MIBA 1QQP3 2JEMA 1DDLA 1W6NA 3A0KA 1DIWA 2WNVA 1AX1A 5LRSA 2HWF2 4M2FA 2OA2A 1ZZBA 4DFSA 3BODA 3VBUB 3NL1A 5L36A 1KDKA 3WDUA 1VIWB 4DY3A 1PZ9A 3MLLA 3OYWB 2JENA 2IFWA 3X29B 2C9AA 5DDJ3 1ZZ8A 2ZPXA 3JD72 3GNEA 4IETA 4BM8A 1QOSA 1QXJA 2QNKA 2IZWA 3E6BA 2UWBA 1I5ZA 3OTFA 4JV4A 2VOWA 4FAGA 4XHBA 2WNVC 4N90A 1V9U2 4OVEA 2OUHA 3U4XA 1AR91 3AYDA 2GNBA 3AMMA 1DZRA 1ZX5A 4Q4V3 1RUJ1 4NR1A 2JG9B 3CF6E 1SLLA 4QPIB 4FTSA 4Y22B 4PIXA 1SCSA 5J98B 3TNPB 5CFDB 1W6PA 1QDOA 1OPOA 3SH5A 3BOWA 2MPFA 2RR13 4COWA 1ZZCA 4YG0A 4QQOA 3RZZA 4AQ6A 1PZ8A 1HXS3 3OY8A 4I30A 4FXKB 2TUNA 4MXWA 2WKKA 4L97A 5DG2A 2RMU1 2DCKA 1AL21 1MVQA 4LE4A 1DGRA 2CGOA 2ZGSA 4Q4W2 5FO9B 3VBSC 3ETQA 3MEPA 5GM0A 1O91A 2GH2A 5E89A 2DUQA 2WBQA 1KS5A 1AR63 1GBGA 3BIWE 1OS7A 2XBO1 3ES1A 3PVNA 1UCXA 3OBRA 2CGPA 2CAUA 2DTYA 2CGNA 1CIWA 4MXVA 3E6CC 1OFSA 3BCWA 4WM7A 2YUEA 3POSA 3V65A 1CPMA 1VAVA 1CAXB 1KD7A 1Y43B 2RS52 4HK9A 3KCXA 1MEC1 1Z7S1 4JTNA 1KDMA 2B42B 1YLLA 3I2DA 4E2GA 1PMIA 2RS31 2HEYF 3A4UA 3QLQA 5CAZA 1TEIA 3TN93 1COV1 1PVC2 4QX5A 4WM7C 5KHHA 3WQ1A 1MZEA 2O0OA 1YIFA 3G6JB 3IMNA 2NQYA 4OHZA 1QQP1 4EN8B 2OVUA 4E4SA 3ZPYA 2BNMA 4NHMA 4L99A 1HV1A 4M00A 3NV4A 4IV1B 4KH9A 1DRTA 1UKRA 2D3RA 2XJPA 1FMD3 3POYA 3V56A 2AYHA 2DYCA 5HBAA 3ILNA 5CFCA 5DDJ1 1J58A 4BZ4A 1N3PA 1XE8A 3NAPB 1POV0 1AUYA 2BNNA 4FPCA 4AEDA 5I8YA 3E5UA 1JTZX 4E9KA 2JG8B 2HEVF 4G3YC 4L8QA 1N47A 1VBA3 3KGZA 1Y0ZA 2G4IA 3MLKA 4FP2A 2WS92 4WVMB 2GNDA 4KGQA 2R49A 3WUCA 3EBRA 4P9IA 1DRYA 2RR11 1ZA4A 3HMYA 2ZGPA 5FQ0A 1ENQA 4AEDC 2YDEA 2Y38A 4XXPA 5A32A 1DFQA 4WZCA 1F5JA 1B35B 1DQ5A 4DPNA 1X33A 1G8WA 4MYEA 3ZXJA 3M3QA 4QHBA 3D0JA 5BNNB 1PNGA 1RUH3 4LBJA 2NYYA 4JDNA 5EYYA 4D3WA 4NHLA 1AVBA 1AR61 2XB6C 4XQWA 1OMIA 2R1DA 2JD4A 4BIFA 2E51A 4JCKA 1C57A 2ZGNA 1UU4A 1VBC3 2ERFA 1DU3D 1FNYA 3H50A 2XVGA 2ZGLA 1B09A 4XXAA 5EJ3A 3C3VA 5C33A 3FC0A 4JDOA <