2WA3A

Factor inhibiting hif-1 alpha with 2-(3-hydroxyphenyl)-2-oxoacetic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
335
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 335
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2wa3A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wa3A01
1H2LA 2CGNA 2WA4A 2ILMA 4B7KA 2W0XA 3KCYA 4JAAA 4B7EA 3D8CA 1H2MA 2XUMA 1MZFA 3KCXA 4Z2WA 5JWPA 1H2KA 3P3PA 2YC0A 1YCIA 4NR1A 2YDEA 4Z1VA 3P3NA 1H2NA 1MZEA 3OD4A 2CGOA 4BIOA 4QU2A 2Y0IA 4AI8A 2WA3A 1IZ3A
chains in the Genus database with same CATH superfamily
4FPLA 2FB5A 3RYHB 2OYZA 1J3RA 4P08A 4Q6GA 5A3PA 3POEA 3U11A 4UCOA 1ZVFA 1NCRB 2EIBA 3DPRB 4J11A 5BNOC 2A3YA 4RAIA 3CJHB 4QPWA 1W6QB 1W8HA 3ZYJB 4B3MB 5A3UA 4K0KO 2VMIA 3GZAA 3L9JT 1R3LC 2JB4A 2Y64A 4KH9A 5LZ6A 5L3EA 1IS3A 2QKDA 4L2NA 4M00A 4B4PA 3JCIA 1GMMA 1J59A 3THCA 4CVUA 2XBO2 4LF8O 2YBSA 3H9VA 4E4SA 4HZ3A 3SKVA 2P17A 2A79B 2BRTA 1YDXA 2HWD3 3H1YA 5LB6A 1J83A 3KMHA 4NRMA 4CCLA 2GNTA 4WVMB 1S2KA 3U10A 4FK5C 5IYCO 3ELNA 1NH2B 1RP3B 2NMOA 1PO23 4K3UA 2ZEYA 3E6BA 4GMP0 2QKSA 4TSVA 5FYHA 3PJYA 4YZ5A 2D3SA 2Z5WA 2JKBA 2ZX3A 4RWUA 4I3PA 2R041 4FLXA 3BTYA 3AG2C 5EZYA 2ZOEB 1ZAUA 1Y9GA 4BLJA 3IGAC 1A6CA 1H8VA 3WG3A 4LBQA 2P6CA 2DOSA 2LS6A 2X6BA 3RWRD 5IY5C 4L99A 3NAPC 1DYOA 4NOTA 1R3JC 4IE5A 4CH3A 2JEUA 3K9SA 2XNDG 2VMCA 4X64B 1DYPA 3I2FA 3SPIA 4FPHA 5FKCA 1OD5A 3ZBHA 1HB2A 1XYNA 5FY4A 5CB4A 2P06A 1W04A 4Q4V1 1HQWA 2LRPA 2W1SA 2WS93 4TYSA 2IUWA 3ZJZA 4W4ZA 4LBOA 2W52A 2CGPA 3GBWA 3NNMA 3WW4A 2E7QA 3K0GA 1YXWA 2VCCA 3HN3A 3JQWA 4IGQA 3CEIA 5DN6G 5BNOA 3KM5A 3N3HA 4EE2A 3ZHVA 2Q30A 4N90A 3SCFA 4AVCA 3JAKA 2XG3A 4M4PA 1TNFA 1EN4A 2RV9A 3KF5A 1IX9A 4R6ZA 4NHLA 4XFGA 1JBCA 4QXHA 4GIQA 2W92A 3ZCCA 4IE4A 4W8JA 4QB2A 1UIJA 5APAA 1MNGA 2DVAA 2AEZA 2H3OA 4XBNA 4CXXA 2Z69A 1M4WA 4D8MA 5JSPA 4AVSA 4TUYA 4OI4A 3T4DA 1B04A 4K1ZA 4BWAA 3SGIA 3HB3B 1WMFA 2OCCB 3B09A 5FY9A 1XYPA 3MYXA 4YZ3A 4Y4RA 3ZN5A 3JARB 5IYZB 1LR5A 5LK5A 1OF4A 2HEYF 3WQ7A 3MDSA 3DF0A 4XUOA 4PA9A 1EAH1 4Q1PA 1H1AA 4BW9A 2CGNA 2BOIA 4JQRA 3R0RA 2VOVA 1ND2C 1MQTB 4O4JA 4W6WA 2NPIA 5FPLA 1ZBA1 2AGSA 4YZ1A 3L73H 4N9IA 3M7AA 2WA3A 4F83A 2F1MA 5FWJA 4LWSA 2EXKA 1QNMA 2GP3A 1N32B 4G2KA 3S0MA 3BRCA 1BHAA 4B29A 1RITA 2EIJC 2D97A 4LOSA 3A0NA 2HWF2 4EFBA 1CZTA 5FY0A 3NAPA 1L0LH 1YQ8A 2EIMC 5EP9A 2D6MA 2YV8A 5F2WA 3T3YA 2VRZA 2ZT9B 2R9IA 3RN4A 3OY8B 2R16A 3CCEV 3T1MA 4HT1T 2VOTA 4HKWA 2IW5A 1VPHA 2WR9A 3PTRB 4AQ6A 4UFJA 1P49A 3FN9A 5JXHA 1VMJA 4P9OA 2Q6AA 4NIHA 1W6PB 5GLTA 4B3TB 1WMXA 4YG3A 1FXKC 4QGPA 4P14A 3VBRB 3LPFA 3O1SA 1O7FA 1S0DA 3POWA 4X65O 1AL0G 4MSWC 3SH3A 1VQ9V 3GHMA 4HYOA 5L3BA 2UUBB 2Z79A 1GOGA 5FZLA 2XTAA 1H8EG 2WAMA 1V54C 5CN0A 5F3GA 1JVMA 1LUVA 3OBTA 1ZZBA 2A70A 5JXJA 1BBT2 4Y22B 1HB3A 1HRI2 4UCVA 3LEMA 2P5OA 1AJPA 3WXPA 5JQGA 1QJX1 4HETA 2GMMA 2ZIOA 4RQPC 4ZXKA 3EHKA 4I55B 4DV6B 2BPA2 2B45X 1PMHX 5SV8A 3A23A 4AEDC 4JC1A 4CDQC 4HL0A 3H50A 5JR7B 3T30A 1PX4A 1E5SA 3VLBB 1ND2A 4MGTA 1HJGA 3NNJA 5CA6A 1POV3 3JD1A 1Q6IA 2NR5A 2AYHA 1P84F 1REEA 5EC2C 4R4XA 5KA6A 3H01A 2B1GA 1RTVA 1YFWA 4BCUA 4RSUA 4RHV3 2BNMA 4R4ZA 5FZ0A 1LEMA 3JAMN 1QDOA 1OC1A 2UXCO 1RHI1 3JATB 1A34A 4LF6B 1H38A 3T1HO 5FMCA 4PD4F 3D8CA 2NZ9A 1Z7S1 2BBAA 5J37A 4X88A 1WKYA 3O12A 4PI2A 5DAPA 3ZVXA 1Y9MA 5FZCA 1D4M2 5J9PC 2FDHA 2IFWA 3SLIA 5B4NA 3H3UA 4XABA 4JI4O 2BSKB 2WLNA 2G1MA 2GTAA 2QE3A 3G67A 1RUNA 5DDJ2 1SLBA 1OVPA 2W0FC 4C7UA 2Z2SB 4YM2A 4N43C 1FXKA 4DV0B 1EPWA 5EBLC 2V1DA 5JIUA 1SBFA 2IH3C 2QM4A 4DR4O 4FCAA 2W08A 2VZOA 2IM9A 5JDBA 3G6BA 4Y1VA 1I5ZA 1WA8A 1RXGA 1IQAA 4O2BA 4NIDA 3ZMOA 2X6AA 5C33A 1L1FA 5ABJB 3BCWA 3HR0A 4XF9A 2HWE2 4ASMB 3WG7C 4DXTA 3I7DA 5FYIA 3ZX7A 4PDWC 3FB7C 5H9RA 4MTGA 4EQVA 3O65A 5FP8A 3TAYA 1J1LA 4IEXA 2XQRA 2Q7GA 3AK1A 1KP2A 4YNIA 3N2GB 1QOOA 4AEDA 1B3QA 4ARXA 5C71A 1TVGA 1S1AA 1AR92 5JH7A 4JRLA 1JZ2A 2RMU1 1SPPA 1IBMB 1Q8IA 2NN8A 4NN0A 4WM8C 3K57A 2EIKC 1VAKA 4Z92B 4Q4V3 2RVAA 3TXSA 3LIHA 2VWKA 2ZINA 3M4FA 1FPOA 4OQ9A 2ZAHA 4PA3A 2ZDIC 3H1HH 4GKKB 3GYDA 3VQWA 2EX3A 2F4VO 1GN4A 3KVAA 2I74A 5FY5A 5A7SA 5KHGA 2E9QA 1PKXA 4IV3C 3QOPA 5CFCB 4QDQA 4LF7O 1RUI3 2NLJC 2BFUL 3HT1A 4Y20A 4DRRA 1ZL8A 4BQ2A 1DBNA 3FD9A 3ZN0A 1IBLO 3AP4A 3HOBA 1FV2A 2VQAA 2JKXA 3B00A 2ARAA 4N43A 1ASJ2 1XU2A 2MHFA 4PLNA 4JQTA 5A7WB 2P3JA 5J96B 3S5QA 4OUEA 1AX2A 1WMDA 3D3QA 2FTKA 3WQ1A 4LNVA 3A0RA 2ES3A 3PURA 3H8XA 4JI2O 3SYAA 2WN3A 1JFFB 4QM9A 3I2KA 1RUJ1 1RMU3 2DU0A 1V6KA 2AHYA 3WVJA 1EAH3 3RI9A 3QO8A 4A6OA 3ETDA 1AR1B 2UXBO 1ZLZA 3ZIAG 4PDWA 3IFXA 1Z0HA 3OEHG 5C8WA 1ZBA3 1KRIA 1NA1C 1SFPA 1OJHA 3AG3C 1OV9A 1GOFA 1OH3A 2WLMA 1AR63 1BEV2 3GGLA 2QJVA 3WT3A 1GWLA 4ASLA 4NUBA 5FUNA 1W3VA 1TNRA 4BJ0A 3AMNA 2QBXA 4YSFA 5DQ0A 4GCZA 5F3IA 1LNQA 3PIJA 1OFNA 1XOYA 4WM8A 5K0UB 1WLCA 1NR1A 1VBB2 4IYIA 5T5LA 3J7AU 4TV8B 2XAJA 5T54A 2BZDA 4CP9A 4NHXA 4HANA 2ZDIA 2H6CA 3ABKC 3ZN1A 2A75A 2W1WA 2CWMA 3K79A 2QCSB 1MABG 3ZRVA 4IV3A 3CRRA 3WB2A 1KD1W 1RUE3 2DYRB 2P22C 1ROPA 3GXUA 4HKOA 5LCWL 1JUIA 5JUVA 3FL7A 1X4TA 4IYHA 2DBIA 1AJQA 4FBFA 1J5EB 2HJFC 4LE3A 3FHAA 1KFUL 4UFIA 3I3MA 4DO2A 1LULA 1RUG1 4PDMA 5HFMA 5LEKA 5LMUO 5I8TA 3O5SA 5FY7A 3IDBB 5L9VA 1BK0A 4NXNO 3TB0A 5C8CC 3QG5A 2VUDA 2VG9A 2C0ZA 4YVSC 4JI7O 1QDCA 1W0JG 5FZIA 3M3EA 4QU1A 3N2KB 4ZZ5A 3HT2A 2Q4SA 5FLHA 1PZ8A 4JZRA 5FTTC 3MFCA 1MMMA 4N53C 2Q4PA 4NJ4A 3EVKA 2Y8KA 4P2ZA 4LO6B 3NQHA 4S2DA 3MUZ1 4JHTA 4PA7A 5AG2A 1CAWB 2KG7A 1DQ1A 1IOAA 1QJEA 1NA1A 4RUFA 3ZFEB 3RZJA 1AJKA 1TMF1 4LMFA 5J3UA 5AC92 4C0HA 2OW4A 4UW6A 5TSWA 3QNEA 4KGQA 2HWB3 3MW4A 3CCSV 1TGOA 3THPA 3JASB 3AZXA 1YFXA 4NTYA 4UFZA 4TSFG 4DPNA 1CWPA 1P7BA 1OT5A 1EV11 1RHI3 5G05L 3IPVA 4L8QA 2FL4A 3K03A 5C8YB 1NR7A 1XHZA 2FMYA 1NY72 2WLQA 4PCRA 5GM0A 5FY8A 5GZDA 1D4VB 2KM2A 4QWNA 1NCRC 1Z7S3 3NV3A 1T5EA 2ZCWA 3DPRC 1K4DC 3LD8A 3POJA 1DF4A 4ZIBA 1PZ7A 4IUGA 5I0TA 2AW9A 4HG6B 5HPOA 1Z5WA 3GF6A 1UF2C 2J1UA 4Z07A 2X7RB 3H9AA 2X29A 5ERLA 3VZKA 1ZTEA 4LF5B 4WZFA 4XMAA 3IB3A 1COV1 2A7AA 2VCBA 2FBEA 3JB4C 4PT6A 2JG9B 4KWLA 4HK8A 2VE1A 1W9YA 5FAXA 2E7AA 4UAPA 4AFAA 5LA6B 4WVVA 3VKMA 5DMYA 1YFUA 3BVOA 1TG7A 4ZI7A 4LHLA 4D6RA 4MVSA 2ORZA 3OF1A 1SCRA 1WGPA 4R9CA 5FPOA 3DGEA 3O0WA 3H1KH 1MVEA 3WG4A 2W68A 5C8CA 3KB5A 2JJ2G 5F6LB 3CCUV 4QAWA 4YVSA 1E1QG 5JVDA 3ZOIA 5FUIA 1LHNA 4Y24A 1GZWA 3VUOA 4Y5Z0 1Y76B 3JALB 4PF1A 3ILRA 3ENRA 1QJU1 4ABMA 4QXBA 3MHSC 2JXAA 2HEPA 5KXDA 1I6XA 4LBJA 4N53A 4O61A 4XUNA 4ZONA 4UV9A 1O8SA 2E75B 4NWVA 2VR4A 4XPVA 3AG1B 2AH2A 3TETA 4LLFA 4LNUB 3PUIA 2YEVB 3CCQV 5IFTA 4GUNA 3EYPA 1F15A 2ZTNA 3OE7G 3DGTA 1W2UA 5LL6Y 5JJNB 3DXRB 4AVBA 5C3PA 5J2TA 1LOCA 1HNXB 4KL1A 4O2AA 1RJ8A 5C5TA 3CRCA 3H3LA 1DLBA 3CL1A 2R071 1F4AA 4FQ4A 3E8BA 1OXCA 3EQEA 1R73A 2PQSA 2WLPA 4S2FA 4AQSA 4UB6Z 2CE4A 3RYCB 3B40A 2E51A 3RZGA 4CUBA 5F3CA 3RYHA 2WS92 4MZUA 3JBG1 2JX9A 5A3MA 1H30A 1NCRA 2QQWA 4I4TB 3DPRA 3UJQA 1LGBA 3KV9A 3CJHA 4ASUG 1KUQA 2JJ6A 4LO4B 1W6QA 3AVRA 1DGSA 5F9TA 2AHZA 4NTXA 4E9KA 5H6RA 2Y6LA 3U78A 3LFIA 4AFDA 1OFSA 3SYCA 2VTXJ 3SXWA 2WDBA 3APOA 4J9ZB 3WP3A 1KDMA 5FL7G 5KUMA 4KQ7A 4W6YA 3CIHA 4Y4YA 5FYVA 5LBBA 4Q29A 2N74A 2Q8OA 5FZAA 1RUJ3 2WO2A 4L0PA 4BK5A 2L35A 2OCCC 3WX5A 5B3SB 1WB8A 3EJKA 5ISLA 3WW3A 4WVMA 5LEJA 4K3AA 4QU2A 5LBQA 1V6MA 1ZYBA 2QZ2A 1BHBA 1WPBA 3FLRA 1HXS2 4X64O 1HNZO 4UUJC 3DXUA 1IPJA 5KR7A 4J9YB 3UO2A 1SDDB 1ZZ7A 2XUMA 4DUYO 4XQ4A 2JDPA 1MQTC 1S0EA 1ZRIA 4TWKA 3EBRA 2HBTA 4Q4Y3 2X53S 4DY3A 1SHWB 3S57A 4UCUA 3KD4A 4IEUA 4MOAA 4I5SA 3CXHF 3CJIB 2IJIA 2P90A 1AI7A 1F23A 3ZM8A 4JGYB 1V00A 5BNQA 3I3BA 1KGYA 4URAA 1QY4A 4XHXA 3KT7A 2UXNA 5GJ6A 2ZXWB 4NHYA 4FP2A 4XDJA 2JGUA 4AI8A 3STLC 3M1HA 4XOGA 3POGA 4FPJA 4ZZ8A 2YI9A 3KLSA 2GC2A 2KD7A 3MIHA 5BMVA 1QOSA 4AI9A 3K9AA 3VBRC 1RINA 5H2FZ 3C7GA 3PMEA 3WHTA 1RUG3 2HKXA 4Q8KA 5LOVB 2P67A 1S0JA 4I0XB 3WU2Z 4EZ4A 2GMPA 5IK4A 2KKWA 2WC2A 2VQEB 2ZNIA 2I45A 1JJ2U 2BWAA 3CNAA 1I1EA 2P37A 3OSDA 5EIBD 5FLIA 4YG0A 2K9PA 3AX4A 3IIAA 5A1FA 1CPYA 4FAHA 1GQPA 2BVVA 3QCWA 4HPKB 4RQEA 3GJBA 4NAMA 1N32O 3AZZA 2FZ2A 3MI8A 3JARA 5IYZA 3RI8A 4DV3B 3OBRA 1FYUA 3AMPA 1LU1A 1DLLA 3ZDVA 3IAQA 1TMF3 4CPBD 2WO3A 2QUOA 1MQTA 2VQFB 2VBBA 2BU9A 2WNOA 1PNLA 3KQRA 4XE9A 4UB8Z 1SQPH 2BYVE 3O1UA 1EV13 4XJUA 3VL8A 1VBE3 2O1QA 2D44A 4B3TO 5BZBA 2ADQB 4JI0O 5IVFA 3ZS8C 5FYCA 4R9AA 1H4GA 2WT1A 3RMYA 3VZOA 4QQ2A 3U07A 3OY8A 1KJRA 2UUBO 3H8UA 4DUXA 3HN1A 1XMOO 4H14A 2YPDA 2PLV1 3J7NA 1BSMA 1MVQA 3ZXDA 5IWFA 1W6NA 1COV3 4FOYA 4P5YA 2BGOA 2ARXA 1UOGA 2A6XA 1W6PA 1ENSA 5I91A 3ZKYA 4LK7A 1W6MB 5FMDA 3E83A 5F6KA 3VBRA 2A6ZA 3WDTA 1ZBE1 4XJWA 2H8PC 4XILA 3R05A 1O5UA 4SBVA 5C9AB 4CU6A 1CAVB 2XMLA 4DV6O 3KT1A 4RS5B 5IFPA 1QJFA 3GHNA 2YDEA 2BBVA 3G6JB 1W05A 4AE2A 2P2KA 1W6OB 5I93A 1VBA3 1FKAO 3ON7A 2JWPA 4CDXB 4JRAA 2JGDB 4LFCB 1A8DA 5ABJC 3Q8FA 5LHHA 1CONA 2VMFA 4XJ8A 1PNKA 3FX7A 1G9BA 2FZ1A 1OQEA 4QPKA 1XEQA 4HN1A 4Y22A 2A0LA 3JD3A 1R081 1ZRDA 2HFEC 5T5JA 5C4WB 4CCDA 4I55A 2KB1A 4EB6B 4RFRB 1AX1A 1DFQA 3THTA 1STMA 4EWAA 3WY6A 5CA0B 3AJZA 3LFMA 1EZVH 1OA3A 2Y69B 5L3GA 4Y5SA 1XL4A 1JW6A 1LCLA 2R073 2XONA 1DK1A 2RQ6A 1FYJA 1RUD1 2FHRA 4C0BA 1PMJX 2JIZG 1TUBB 5KHKA 3H1WA 1S0GA 1WW4A 2D5FA 4YJ2B 4Z2WA 3AYDA 3E1F1 2LALA 2XAFA 4Q4V2 5A6ZA 5FZHA 3FHIB 3JATA 3JBG3 1ZUQA 4KP4A 3VDBA 2XOMA 4DV0O 2A73B 5L3DA 2MW2B 3E8GA 5HXMA 2M6YA 5KHJA 1M06G 5FPAA 4R9DA 5CFCC 4FPPA 3RVZA 1WBFA 3VV1A 3SR2C 2Y34A 4GXLA 2E53A 1Q8SA 2RG4A 1W2BU 1NTMH 1HR0O 1Q56A 1YZBA 4QPJA 2BSKA 4NPLA 1N1YA 3H42B 2IXLA 1RUI2 2P34A 4DUZB 1AROP 2W87A 3A22A 3I3DA 5BXXA 2VBDA 3M8LA 5LA9A 4QX8A 1S0VA 2E33A 4YJ3B 1O9GA 4LA3A 3FJSA 5LP6B 3AP9A 1UU4A 2CTVA 2B5HA 3LSQA 4N23A 1XE7A 2JD9A 4DXSA 2N04A 3THOA 2XL9A 1GN3A 1JYIA 1K5QA 3ZYBA 2O8OA 4M3CE 1IBMO 5GLVA 3ACLA 3P6BA 2JRIA 4OHZA 3ETGA 5FLXN 1KS4A 1SCSA 5ABJA 3HIFA 1OUSA 1WPXA 3CRMA 1O4TA 1V9PA 1KFXL 3ORJA 1AJNA 2ZM6O 2ZX2A 2EJRA 1EFRG 4DV7B 2RJKA 4B7EA 1AYM1 1EAH2 1QGLA 2F17A 3RSJA 1QQCA 4GYCB 1BXHA 1WLEA 4I09A 2HR3A 3N2GA 2J1AA 4BQ3A 1B06A 1ZX3A 2JE8A 3OPTA 3L70H 4TT3G 4GWMA 5F37A 5E16A 3IDAA 4U2AA 1ZBA2 3RVHA 4CH4A 5CIRA 1CESA 1PGSA 3WF4A 1AR62 4JASA 5K0UC 4DV5B 3MHZA 4YHHB 3AEIA 3FX3A 1UY0A 1NUKA 2A3QA 3O9OA 4H44B 5HCAA 2XHBA 1M57B 3RNSA 4J25A 2DTWA 4AOCA 1EUUA 1QU7A 3OMIB 1VBC1 3PUQA 5KMGB 1LHVA 4XCBA 1ZSPA 4CSWA 1Q86W 1HNWB 2PGGA 2BOJA 1TAEA 2XJPA 2XJVA 3SPGA 1AL21 1X33A 1OBNA 2GN3A 4DEQA 3EO6A 3HVDA 1QR9A 5CFCA 2DYRC 1FATA 4F8AA 3FC0A 3NJZA 5IT6A 3Q8EA 1XE0A 3ZXAC 1YTFD 3WW2A 4AGRA 3N9NA 5JJJB 2OTJV 3OUHA 1N4CA 3SDLA 4QKFA 1HW7A 3QF7A 3AG4B 2UXDO 1BMFG 1G9FA 4IEYA 3S30A 3S3WA 4PDRA 3LB9A 1RIRA 4FPKA 4YM0A 1JZ7A 4YGCA 5A7WA 2HG5C 5H6QA 2D6OX 4QKNA 3I2GA 3QACA 4IW3A 4FAGA 1AF9A 4JYYA 4BB3A 3POSA 4YM3A 1VRBA 1RM1B 5KAFZ 2RS13 1JFFA 1IXBA 2P6JA 1AR71 4HONA 1HJFA 2XJRA 1QJX2 1CX4A 4QM8A 4XUPA 3P30A 3RS6A 4BW5A 1LOEA 3EFFK 1LENA 4DR1O 4LO7A 3ZFEC 5FIXA 4LF8B 1KJLA 1W8UA 4YLZA 3WEZA 2D93A 2WZPP 3O1MA 4LH7A 4AVTA 2VAUA 4NPRA 3VDAA 4H7MA 4QHOA 2W46A 4BPZA 1MS9A 5K0UA 4IXLA 1SQBH 5F8PA 3BHPA 2HWB2 5IK8A 1J5EO 2EIDA 4OCTA 4A3ZA 3VD9A 2XASA 1RHI2 5CFDB 4TV8A 2DYCA 2EZOA 4XCAA 2RN9A 5DAXA 5FZ7A 2PZSA 4HKLA 2PLV3 4JI3B 5FR3A 1W2AX 3FHQA 3IAYA 3FWEA 3PTYA 3BA9A 3X2QB 1VAVA 2X05A 1Z7S2 2Y60A 2NMNA 2HEWF 4IGPA 4FIPC 1QNYA 2Q5TA 1TVKB 1JOJA 5JOZA 5IWAB 2JG9C 3OFNG 5FYMA 1MS1A 4XVHA 3E5UA 4JDMA 1G9DA 4WFBV 2UURA 3H1MA 2JEMA 3IDCB 2DFCA 4HAMA 2VULA 1WCKA 5FMOS 5K7PA 3K08A 4CEWB 1K92A 4B08A 4BQXA 4YZ2A 3H7YA 4QPYA 1ZREA 1R083 3FUQA 3PMSA 3B5LB 3N2KA 4FFBB 3C7HA 4RFT0 3CEWA 2BTVC 2DQ0A 4ZS2A 4GWNA 2ZEWA 3MUY1 4E27A 4B8EA 1CAWA 4K8RB 3K75B 4GWJA 3T08A 1WWYA 1NLSA 1TZOA 2J7MA 3AG1C 1ALYA 3ZR5A 1JI6A 5FQ0B 3J26N 2VZ3A 2GNBA 1UQXA 3ZFEA 4EN8B 1BGYH 1KKCA 2CTQA 4N7IA 2EAAA 1VMHA 1X8EA 1PNGA 3JASA 3T2MA 2RR11 1GICA 1WN7A 3BUCA 2EAKA 4JAAA 1PVXA 1ZRFA 4DK1A 5KBFA 1ODNA 1OF3A 4FVMA 1WCUA 5C8YA 5D8AB 2LP7A 4RGKA 1PO11 1V9U1 3VKNA 4G3YC 2H94A 1S5HC 1KS5A 2PAMA 5BPXA 3FYEB 4XFFA 3BCCH 2UWBA 1G9CA 4BQ5A 1QLEB 3E97A 3SPHA 3ES1A 4CU9A 2Y6GA 2UWAA 1LAJA 2DE0X 1PVC1 1WP7A 5KWRA 1LODA 1XHXA 2FKXA 5BY1A 5EPAA 4LO8A 2XWJB 1CXZB 1GO3F 2JG9A 1AR5A 2P4VA 1ZZ6A 2ZQMA 2LW8A 4OX9B 5LA6A 3LNNA 5CBHA 1HQNA 1SF9A 1OURA 1HV0A 1Q3EA 4UXNA 4ARYA 2BOBC 2WNUB 1OHFA 1HN0A 1TQ5A 2WABA 2J1VA 2CWSA 4IGGA 3B69A 1O8PA 1VP7A 2FCVA 5B3SC 3WF3A 3UV9A 2IWGB 4LBMA 5EYYA 4FM0A 5FYZA 3VBHB 3RZMA 1NVPB 1HNXO 2UU8A 5GLUA 5IDJA 1RUJ2 1N34B 3OD0A 4GKYA 2EXJA 2PHUA 1Y76A 1CPMA 1VIWB 3JALA 1AYM3 1UL9A 3JXSA 3FFQA 1YI9A 2ZE8A 4Y1UA 2E26A 1XYOA 2JK5C 4DY5A 4X65B 2R6QA 5L7OB 5KC6A 1QQP1 2ET1A 4LHNA 3EHBB 3W5MA 5C6CA 5CMUA 3AK0A 4LNUA 2ARHA 4KWKA 2P1BA 4QGLA 3AKPA 2YEVA 3CJIC 1R6KA 5E6HA 5IVBA 3D0SA 5FWEA 1L3JA 3DXRA 4JGYC 1QKQA 4QDSA 4LHKA 3K5MA 2XJSA 3FAVB 2YC2A 3NKTA 1W59A 2YXHA 3SPCA 2C6SA 2C24A 1WW6A 2OT5A 1PM7A 4JTNA 3PLQA 2LTNA 3ZSKA 1H2GA 3LF7A 4BQYA 3SJQC 2ZXWC 5J98B 4SLIA 3RYCA 1AL23 1CD3G 3ABLB 4R7CA 2OPWA 5F32A 3TN91 1E5IA 2XKOA 5B1AB 3OEEG 3KHCA 3USSA 4I4TA 3LNMB 4D7YA 1Y9QA 4AQYB 4MH0E 1K3IA 2QQPA 4XJAA 5CEHA 5D1IA 3T4ZA 1X8MA 3OBZA 4LKDA 4MVMA 2ZKLA 4YYOA 1FXVA 1YVWA 3WD5A 4Z1VA 1MS5A 4ZU5A 1DGRA 2YIBA 5E79Z 4YZ4A 4PIZA 2PFWA 3K3OA 4WFEA 1UY4A 3OD4A 3WSOA 1RUG2 4TLGA 1X9PA 4FLYA 3GCXA 2UXCB 2HWC1 4FLZA 3UGFA 3HAGA 5BNPB 5CYYA 2CYFA 1FMD1 1NTZH 2WNEA 1DQ5A 1ULGA 3AB0A 2LM3A 2XJQA 5IHRA 1AR73 1UOFA 1VF5B 3D6EA 2DCTA 5EHDA 2KXLA 4JI4B 3N7LA 5FPXA 1WA4A 4QE7A 4KXRA 2BTOA 2P7TC 3NKGA 3K4ZA 3BABA 1H0BA 4JYBA 5L3FA 1EP0A 2OTLV 1OKOA 5BXZA 4DV4B 1TMF2 4TZDA 4GJYA 3CJIA 4CXWA 3HPNA 4MGKE 1LOFC 4QX2A 2YY1A 4JGYA 5A1AA 1EV12 2ZMNA 3WCRA 1N1SA 1HLCA 4OUMA 2UUAO 1MS0A 4AEJA 1XQNA 3BGAA 4M0HA 1K8AW 2VQEO 1YIJV 3VQXA 1H8HG 5FZ3A 3A2FA 4W6XA 2E7TA 4OPAA 4EN0A 4GMP1 1UNBA 1KB9F 2Q5ZA 2EVXA 4QX7A 3NRUA 1DTOA 4MVRA 2VMGA 3OTOO 2FCTA 5FFOC 2Q1MA 1COV2 5DDJ3 2Z3YA 5C9AC 2WWSA 4XDPA 1V6NA 4LKEA 3GJAA 5LOVA 2HHHB 2GHYA 1C28A 2VZQA 4FPYA 4BQWA 3BAAA 2ZEZA 4I0XA 4RS5C 3NV1A 1NXMA 5JR2A 2WN2A 1YLLA 4DV3O 1ZZ9A 3B77A 4COWA 1RXFA 1YJWV 2OVUA 2Y38A 4X9QA 3ETEA 2F4VB 1NX9A 4MTFA 4GAZA 3KVBA 5FCCA 4CDXC 2H0VA 1DQ0A 1LJ7A 1L7QA 1OQ1A 2VQFO 1D0GA 1FI2A 1JTZX 1WW7A 3IMMA 1UY3A 1BQZA 3BA8A 4AVVA 4LBEC 3HKEB 3BU7A 4LF7B 3KCCA 5C4WC 4HPKA 4AVAA 3JD71 3B93A 3HEIA 4FTSA 1QJU2 4B1LA 3BOPA 3WB0A 2PA7A 2ITDC 3TYJA 2EULA 1B6QA 4HFSA 4NHKA 4FSJA 2WKKA 3WOGA 4BMEA 2Y69C 1AR93 2BJSA 4R8CA 5H5NA 2ZZJA 4FTEA 1QXPA 4ONUA 2RR13 3LA2A 5I8YA 1CEZA 5LW9A 5IK5A 4EZHA 5HBAA 4ZPIA 1F35A 5FO8B 3PUHA 2VJXA 1YYNA 4OULA 4JI2B 4XEZA 3BN6A 1PO13 2R072 1GP4A 4DEVA 3P32A 3MPBA 3LZZA 1V9U3 1LOFA 2VNRA 3A4UA 1GQHA 2HVJC 3ME2A 4OPHA 3SISA 2IVIB 3URFA 2MEV1 4JPRA 1GFF2 3DL3A 4D6TH 3HWJA 4P9PA 2PI5A 1N1VA 3QH6A 3RYKA 3JBG2 5TISZ 2Q8DA 2YIBD 5EIYB 1Q81W 1PVC3 1CAXB 4YW4A 1XREA 1V70A 3T1LA 5C93A 3ABTA 1Y7BA 3P3NA 4LFCO 4J1WA 3FLPA 4AFCA 3CCJV 4JVAA 5FKBA 3LCPA 4JZ2A 2DWRA 4ZBMA 4LXLA 4LFAB 1W6MA 4ISQA 2B9VA 5FO7B 1O3TA 3USUB 5C9AA 2UXXA 2YXSA 2HJIA 1CAVA 4URTA 4X1KB 5LP6C 3RPQA 5A2QN 2RM21 4KNCA 4AEMA 2RDQA 3HKCB 4RS5A 1LHWA 1BCCH 1W8NA 3CPWU 1RSOB 5IUQA 1MSWD 1ZA4A 1YF2A 4A41A 4MLOA 1KD7A 3WFVA 2UUCO 4WFGA 1ZWIC 4D94A 4CDXA 3S5AA 2JGDA 1AVBA 4OYUA 4MW3A 1XB9A 2XBO1 3WNPA 3AP5A 4E4HA 4O9GA 4IL7A 2RS51 3CZUA 3ZXJA 1LEDA 1YHFA 5C4WA 4X1IB 4FOVA 3ZHTA 2IXCA 5DAQA 1MEC1 2WZ8A 1W9WA 4DZGA 3KV6A 4EB6A 1RUH3 1QQP3 4CS2A 3T09A 1VB2A 5LMUB 5CA0A 5FY1A 1UKRA 4U3JB 4NXNB 3BI3A 1HWYA 3JSLA 2BNNA 5GALA 4JI7B 4CDWB 2FDKA 3ALQA 4J7KA 1V6JA 1M57C 1TUBA 5FBJA 3ZRSA 1JZ4A 1VBB3 3WZ1A 4YJ2A 1GANA 1QBZA 5LWBA 2WLLB 4I50B 3WQ0A 4DUZO 4K40A 2Y33A 3TN93 3SEPA 2CL2A 3WHUA 4LOTA 3RFRA 5LA0A 4YPJA 3BVCA 2MNGA 1RVF1 5CISA 3CWBH 1HB4A 1DQ6A 3E5XA 4UVAA 3AL6A 1QEXA 1Q6HA 1EZJA 2X6CA 3PUAA 2GDSA 3FBYA 1W3XA 3IT8A 4K8ZA 2C2AA 2WYSA 1RYYA 2LFSA 2Q68A 2UYAA 1KDKA 3BYWA 1GOHA 3VQVA 2YG0A 3KWVA 3AG4C 3AFKA 1AXYA 4NO4A 3RVYA 2HWC3 3ZMSA 3KS7A 2Y0OA 4N7UA 1JU3A 2N7GA 4YJ3A 5H9SA 2GC0A 3AK2A 4DV7O 2ZD9A 1ORQC 3GVMA 3KZIZ 5LP6A 3MAQA 4K6BA 5BV6A 2MK3A 4GX0A 4OXSA 1QHDA 3N4MA 2CAZC 4LUKA 3K4AA 3A7QA 5LGUA 5IVJA 3W9AA 1RM1C 5JAXA 1YITV 2XOKG 2XLFA 5FPUA 4EFEA 1HW5A 2DJVA 4DV5O 2YSUB 4YHHO 2ZJCA 4CCEA 5T5PA 3SQOA 2LW7A 5LY2A 2DDUA 2JENA 3NO8A 1T2XA 3NVCA 4WFAV 3L75H 4WBNB 4X8NA 4UW5A 4QGMA 4BISA 4ZOLB 2B8MA 1ACCA 1HNWO 4AFMA 4GH4A 4Q0UA 2PHTA 5IYDO 1VBD1 1G1XB 1C8NA 2JECA 1EUTA 3I49A 5FP9A 1YJNV 3DYPA 2OUHA 3MF6A 1O4YA 5L9BA 3CYOA 5FOBB 3J81N 2WAAA 1D5NA 4F4LA 4IEQA 1QF3A 1Y74B 2V5YA 3LIGA 3SNMA 4MT8A 1OD3A 1OQDA 1FT9A 4KI5M 5GKAC 3AC0A 3BFRA 4DIQA 1POQA 1UXXX 5KMGA 3X2QC 4H2AA 2WWJA 4RA0A 5IT9N 4GMP3 4GULA 1WNSA 3I5DA 1X7NA 5EV7A 2RJLA 1L8DA 1W8ZA 3CF6E 1DCSA 2PLV2 2B39A 2V4DA 2L9LA 2Z0AA 2VVFA 1IG3A 4AHZA 4UFMA 2J22A 2F4LA 1ND3B 1CPNA 1JU4A 3FYIB 1O4ZA 1RUOA 5HI0A 4Z8BA 2QFEA 1VF6C 3W21A 1R091 4FXGB 4OZOA 3RWNA 3F5WC 4AW7A 1N3OA 4CEWC 1O9HA 1GAXA 1JOPA 5T5OA 4XFCA 1JR9A 4COUA 1W06A 2A06H 3I59B 2OUJA 2J42A 1G8WA 2XAGA 1LESA 1XSQA 3OT7A 2LJ2A 3JD73 4IEZA 3RDIA 2ETNA 3MO4A 1AHSA 4KU7A 1R082 1A32A 5IAVA 2EBOA 1I94B 2DCKA 1W8TA 2GALA 4I01A 4X1YB 1GV9A 5SV5A 2CK3G 5T50A 4CTEA 1OCOB 4J7JA 3APBA 3EB7A 1GZCA 2VZTA 5LMNB 3U75A 3O1RA 1HN1A 4JI3O 3OMAB 2AEYA 4JV4A 5JWPA 2D98A 3VD4A 4MVTA 4XDOA 3GWKC 3OGRA 2QNKA 1XXNA 4IDZA 3E8FA 5HFLA 5IWAO 5D8AC 2ZHNA 2OPKA 5IJ0B 5A32B 3ZYIB 2BTQB 1AR4A 1UMHA 2Q8CA 4GALA 1W0OA 1NT2B 1HNZB 5JJEB 3MW3A 5CFDA 3DN7A 1LB2A 2JJ1G 2MPFA 4DUYB 3P1IA 4XXAA 5LRRA 1QLEC 5FZ4A 3IAPA 4H37A 3MF9A 4MGIE 4EV0A 4WM7B 2YC4A 2CTRA 1SQXH 1O3SA 2G38A 4FM2A 4KUMA 3ZDSA 5JOWA 5I0DA 1TVKA 3DUIA 2IVJA 1PX3A 4WVWA 2RMKB 4K9SA 2TNFA 3BY6A 2ZGTA 1H9PA 5JPMB 2QSAA 5JMCA 3OUIA 3BPZA 2RM23 2NQYA 3RZLA 4AG4A 4IIJA 2WRAA 4ISRA 3BKZA 2WNUC 1VF6A 3OBAA 3ACIA 2VXRA 3JZVA 1GMGA 3PJSK 2VZ1A 4CEWA 4WFHA 4N21A 3A21A 4FPGA 4XDLA 2ETEA 5FZ6A 2A3XA 2K1EA 2Y6HA 3VBHC 3AM2A 1XNCA 2RS53 4PI0A 5LXTB 3A0BZ 2JS5A 1WZXA 1GUIA 5DZFA 4XC9A 4FFBA 1VQ8V 1YWKA 1REDA 1MEC3 3I56V 1HXS3 1Z5VA 1XU1A 3ILFA 2E5LO 5KC5A 1KEXA 5B4XA 4A42A 5L7OC 1BT8A 5CA1B 2C5DA 5IYYA 1AYM2 3FFZA 2OZJA 5FQ0A 2YXLA 1FOD1 3N36A 3MV11 1AYN1 5CU1A 1Q90D 1E57A 3BEHA 3NW4A 2JEXA 1YQ5A 3SYQA 3V56A 1EBOA 1A8MA 2UYBA 1MZ5A 3AP6A 4OI1A 4JI8O 2W0XA 1DGLA 1IURA 5D8AA 4NIGA 4A4AA 3ABLC 4OX9O 4J1XA 4YFWA 1L7LA 1C8M1 1RVF3 2VGDA 5B1AC 2Q69A 2YU1A 2QA4V 1DGWA 3HBKA 3JB8A 3NJXA 1NXD1 1AL22 4LR4A 4H33A 2WZR1 3MBWA 3VHPA 5HXVA 2A5ZA 4RD7A 1SZBA 1PMIA 1JYXA 1PHMA 4RGAA 1JYCA 1LTEA 2W3JA 5T55A 1W28A 1NJIW 1N36B 4G28B 4XMIA 4Q1RA 1N34O 3IM0A 3OOXA 2W94A 4O4HB 1CZSA 2L6LA 4JI0B 2O0OA 3EXAA 1LOAA 2IJKA 2SBAA 4BHPA 4XUTA 5LA1A 4ZHQB 3N35A 5BNPC 2WNUA 4A44A 1AILA 4FTBA 1HRV1 1N3QA 2PHFA 3TXQA 3ZMNA 4D6SA 1XMOB 1W8FA 5D2AA 3WNXA 1QMJA 3VZNA 2B46X 1W0PA 3ATGA 4MGZE 4DR6B 2IZWA 1S0IA 2JS3A 3P3PA 1FJGB 5JXIA 4COZA 1K5MB 1NLRA 3K77A 3VBHA 4JKLA 4V1PA 3PN1A 2RS31 1GN6A 1AR72 1DGRN 3CD6V 2BGPA 4BQ1A 3C2UA 4FFHA 4D0QA 3UQ8A 3H8RA 3SJAC 1SC5B 4R9BA 4LBQD 1Q6UA 4E2QA 3T4HB 5L7OA 1F51A 5FLJA 4J6GA 1UFIA 2H6BA 2R70A 1Q82W 4GKJB 1XC6A 2WQ8A 5FNVB 4KWJA 4AQYO 3UK9A 1R3IC 4LE4A 3D5OA 2P3IA 5E1AC 4RUEA 3K48A 2DBNA 2O57A 1QNWA 3FAVA 4F6RB 1H2LA 4XHBA 1VMGA 5GONB 1GQGA 4ZY9A 5DAVA 1SQVH 4AGGA 2Y6KA 4MX3A 4BH9A 1EN5A 2IXHA 2A6WA 1XBLA 3MPPG 1XNRO 4W50A 1FFTB 3K5LA 2VOKA 3ABMB 5C3SA 4K8FA 1VB4A 1NKGA 4PLMA 2A6YA 1Q8OA 3H7JA 5A33B 2EZPA 2BNOA 2NYYA 2JDYA 1RUF1 2ZGOA 1XNQB 1N1TA 3RT3C 1Q7YW 1R093 4P9IA 4TOIA 2CY6A 4K8XA 5FV3A 1OCZB 3GCWA 1UD1A 2E74B 4P9GA 2PYTA 4QKBA 4XURA 3ETQA 5HCHA 1D2DA 2QTWB 4DR2B 3UKNA 2ARBA 4BOWA 2RDCA 3GM8A 5BNPA 4Y5TA 4DV4O 1DZTA 1S3JA 2BE3A 1M56B 1H2MA 1PM9A 1AP5A 4Q4X1 1J58A 4PLOA 4QKDA 3OUJA 1HR0B 4INDA 4QD2A 4PDVA 3N9LA 4IEOA 4ORFA 5G04L 2R043 5GZFA 3E22B 1SZTA 1S4CA 3N9QA 2QKAA 1IVSA 4RQPA 4RQFA 4KGGA 4CH6A 3VDCA 3BTZA 2FD8A 1RL3A 4UW4A 4RGGA 3ZXEA 4CDQA 3NV4A 3AMQA 3TOJA 1OH4A 1VQLV 4XIOA 1WCDJ 2RR12 4EWDA 3CE2A 3NJYA 4TWTA 1RPRA 5C7GA 2WO1A 2ZPXA 4FJCC 3IZOA 4YFZA 2HHHO 1PO12 2WSUA 3J9SA 1V9U2 2ZM6B 2DTYA 1JYVA 3RJ2X 2DWEC 1I3HA 3S3XA 4XJZA 2IU0A 3WDYA 3GZEA 5GLZA 4YIPA 3HKBB 3WG1A 3VZMA 2X09A 1PVC2 4QXKA 4I02A 1MA1A 3PVBB 2EINB 4A5UB 1Y67A 3O1OA 4FZ0A 5B66Z 3ZRWB 3SH4A 3WP5A 5DM6V 3OM3B 3M99B 2ZGSA 3F2ZA 2QE7G 5IW0A 2VOWA 4HN0A 5LHIA 2DQ3A 2LFRA 2PUSA 4Q27A 2G9GA 4KBBA 4EEQA 3AL5A 2TBVA 5ANQA 3WDXA 3V0AB 5KXBA 4O4LB 3OCPA 3ES4A 1QXJA 4I0AA 1OLMA 3LA7A 1BLZA 1JPXA 1R6NA 4XF4A 3UYJA 5CBFA 2VD7A 2NN4A 3L2YA 3HKEA 4DR5B 3RYPA 2D3RA 5FZ9A 2VZUA 1UX7A 2C1FA 2YHJA 2DYSB 4TXWA 2JE7A 2XWBB 2YUAA 5DZGA 1F4MA 4CE8A 3TNPB 4HXCA 2WT2A 1ENVA 3H8OA 4BXFA 1VQ4V 2HWD1 2BEOA 3ACGA 2UXDB 1NBMG 2OA2A 2K0GA 2DUPA 4ZHNA 1ZRCA 4QB1A 2ODMA 1RUH2 1DP0A 1QQP2 3DKWA 1K4CC 4YWAA 4CDWC 1PO21 4HZFA 4CUAA 2GAUA 4E8CA 4LCUC 4IESA 1XL6A 2F93B 1WLTA 4W4LA 4UYBA 3LUTB 4LFAO 3LAGA 5CNAA 1REFA 1I08A 3ZFFB 3HR9A 1XMQB 2YFZA 4X66B 2LUWA 5B5EZ 3NXSA 2ZR2A 3W7UA 2WZR3 4W4KA 4BDVB 4FLTA 3AXDA 4DR1B 3TN92 1VALA 1Z78A 3WG2A 3ZPYA 1CAXA 2HLEA 4CP1A 2ITCC 5ANNA 4A3XA 2VTXA 4OVEA 2C4XA 3ZMTA 2X0LA 5CKMA 4GT1A 4Q26A 5DPNA 3T0BA 2GU9A 4NXMB 5KXCA 5DUUA 4UVCA 2YYOA 4DR7B 4FLVA 2WWWA 3TJTA 1KQSU 1FNZA 1MG1A 3USUA 1H6XA 1W90A 4Q20A 2IXKA 4X1KA 5FZOB 4DK0A 3HKCA 4DR3B 2HWC2 5DN2A 1RSOA 4PDLA 3X29B 5FP7A 5K1XA 3IDEA 1T6BX 3RYIB 1UXZA 3E6CC 1QVGU 1UYYA 4CC5A 3I97A 2RS33 3MFAA 1OLQA 4MVOA 4I2OA 3Q8BA 3UESA 4CC6A 3T0DA 2WQZC 4WV8A 4DMIA 3MIEA 1QJX3 3J8F1 4X1IA 5LRSA 4YXWG 1K5SA 2OIGA 4BIFA 2Q0AA 5IVCA 1O3RA 4U3JA 3GBGA 3IBMA 5LYJB 4JGZB 1XSRA 3AVSA 2VH9A 1SQ4A 4CDWA 1IKPA 1MR5A 5T52A 1XE8A 1NCQB 4BR6A 2RDSA 2HLDG 2M7WA 2Q1FA 4XDQA 4AI3A 4FPCA 2XXZA 2P5BA 3PVEA 4B3NA 4EN6B 1BS3A 3F7YC 2VOXA 2WLLA 4I50A 4E2GA 1WLDA 2XHKA 1PL4A 5JI9A 3PHMA 4LHSA 1VQKV 5JVVA 3SEEA 3POBA 5HCFA 2K9ZA 4H0LB 4FZ1A 4JX0A 1OMIA 4YIOA 4U7NA 3H0OA 1G6NA 4IE6A 1THZA 4O7XA 4OHWA 1RUF3 4E4ZA 5KXEA 2WT0A 1ND3C 2QR4A 2ZAAA 4LBNA 4QPIB 4A7YA 3CXCU 2SLIA 2PMWB 1AP6A 1UN1A 3LDDA 3RZZA 2W1UA 3N9PA 5A6XA 4P5HA 4OHXA 2HYXA 5F39A 3ZX6A 3N27A 2V4VA 4A45A 1D2QA 4YW5A 2C9AA 3S7EA 4DO0A 4L8JA 5C70A 5L73A 2YFUA 1QU0A 2VQTA 3CCRV 2V4AA 4Q4X3 4NTWA 4CS4A 4NE9A 2HYKA 1ULDA 1D5AA 2VNGA 4UW3A 1GSLA 5A7PA 1ULFA 3JD72 1UIKA 3QH7A 1PP9H 4CCKA 4UVBA 1OCOC 3AZWA 5JVDB 4WBNA 4JAUA 4ZOLA 4QGNA 1GZWB 2C9KA 2HKOA 5E88A 3LSSA 3DEMA 2QQJA 4XQDA 2ZIMA 2RMU3 4DS0A 3RRDA 2K2SA 3MGUA 4PQ9A 3CC4V 5CVRA 2JIGA 5GW7A 5A7OA 1AJOA 2CAUA 4F6EA 1K12A 3F5TA 1K42A 1IQDC 4D3WA 2QDOA 4JTAB 1Y74A 3SKJE 2Y4TA 4PJ0Z 5E89A 2HJDA 4UFHA 1VP6A 4AHXA 4FVVA 3T2PA 3NV2A 4NRPA 4M01A 2MEV2 1WD4A 1JODA 3LDKA 1K45A 3T4VA 4K35A 1W9FA 4WM7C 3RGBA 1GH6A 4DINB 4XUQA 3ILNA 1HIXA 5KA5A 4JCKA 1SLIA 4RHV1 4AILC 5GTHZ 2QQOA 1ND3A 1UO9A 1NI8A 4YARA 3SH5A 2UU9O 4KG8A 1CZVA 1WMEA 2CSGA 1FX5A 1WP8A 3OAAG 3WQBA 3PUSA 4KU8A 5GZCA 1I94O 3F95A 1N0NA 5B1NA 5IVVA 4P30A 4OZXA 4EROA 2RM22 2D2CB 1GYKA 4HMZA 4Q8LA 2ENRA 2ZGUA 5LMNO 5FUPA 3I59A 2AENA 1MZEA 4B3SB 5HV0A 2QQMA 4XTMA 1VQPV 2CDYA 1K34A 2EILB 2BW8A 4Q2FA 4B7KA 3KCYA 2EJ7A 4AI0A 3ABZA 4DRXB 2RS52 4WBBA 4X20B 4CCNA 2DU1A 4H7LA 2KQXA 2YS8A 1X50A 3DCQA 1MEC2 4AWDA 1B35B 2P3YA 1IZ3A 1GZTA 2BWCA 4X1YA 2C26A 2Q67A 1TME1 1XRUA 3CMGA 4DXZA 4HNAB 3STZC 4JYAO 1UKGA 5J7MA 1JHJA 3FKSG 2Q9LA 4TN7A 5CB7A 2E63A 2AREA 2UWCA 3JD0A 3MLLA 3DYOA 1BK1A 3LDEA 1NKDA 1SKVA 1JYNA 1U5IA 3CS5A 2DUQA 1LOBA 4P00B 2PHWA 4LH6A 3A0HZ 2D3PA 4JKKA 2Y6JA 1DQ4A 1GKBA 5J36A 2A9HA 5IJ0A 5A32A 4X62B 3HQXA 2QGNA 2BTQA 1DHKB 2QQNA 1VQOV 4UI9L 4ES9A 2QQKA 4MHUA 5EQUA 1NTKH 2E6VA 2BOCC 1H1IA 3WB1A 5FZEA 5LASA 5EK0A 3GZTB 1RVF2 2R1BA 4WM7A 1M93A 2FDFA 4AFBA 4LKSA 1HKDA 1OVSA 2A1XA 4J80A 1AZDA 1C3HA 1IG0A 3L72H 3ZHRA 4X89A 1SFNA 4P9YA 1NG0A 1U12A 3QBQA 5IVEA 2VS0A 5FZFA 5LK7B 3V0BB 5B1BB 1ZA7A 2QQLA 2VO5A 3D3IA 3JUUA 1OPOA 4EN7B 4OHYA 5BMVB 4QDRA 4QPGB 4LEJA 1RPOA 2UUAB 2JVDA 2VMHA 4XFHA 1RUI1 4XBFA 4RR3B 3CB2A 1K9MW 2WBKA 2VY0A 2GBOA 1HDKA 2AUYA 1K5MC 2B9ZA 1COWG 1UZZA 4XDKA 5LXTA 4JKMA 3Q8CA 1VRH1 3J8F3 1LOGA 4DOUA 1JZ3A 4LKFA 2VMEA 3OTOB 4J7ZA 2XAQA 2YI8A 3VD7A 4MVUA 3J4UH 2VCAA 2D6NA 1W8OA 3E5QA 4FFGA 4B1MA 3AZVA 3N9OA 2QM8A 5H9PA 1ENRA 3A8TA 3IJ4A 4YGEA 5D5PA 5CA1A 1RGSA 1O5LA 1DU3D 3ZMZA 3ABUA 2WJSA 2DFBA 2FCUA 3GNEA 1WA6X 3CC2V 1WJZA 1W2TA 3CU7A 1MS3A 1RMU1 3I3EA 1VBD2 2IH1C 4R52A 2P3KA 4AZZA 2XT9A 4I9WA 3I2DA 5LBFA 2DUOA 4XXPA 1N36O 1WAZA 5B1OA 1BMV1 4MHRA 2XLGA 3K5NA 4LLOA 1KP3A 1AR61 4JZGA 4YY3O 2LO1A 3ZXFA 2VZVA 1F5FA 4LA2A 1PK6B 2YBKA 2Y48A 3UT5B 1XDCA 3ABMC 2IXJA 3CCVV 3VBSB 2B5UA 1ULCA 5CAZA 1AUYA 3SYOA 1UYPA 3CMEV 2R72A 3KV5A 4DR6O 2GUZB 2CHHA 1FJGO 1OCZC 4G27B 4RN5A 2LQTA 4CEYB 3MLKA 4N8MA 3TEYA 1SDWA 3LPGA 1KKDA 4CCMA 4O4HA 1R092 1W6NB 2QTOA 3JD2A 3R4DB 4PIYA 2LGQA 2R30A 4UBGA 1R1A1 4ICGA 4ZHQA 3DTUB 2ID4A 3U37A 4NMIA 3J7MA 4IQPA 1IKQA 4HVRA 1URFA 1VARA 1NH2D 1SMVA 1M56C 1RUE1 4MO3M 4IEWA 5D21A 4GKJO 1H9WA 4M4RA 2A71A 4YGBA 3IN9A 2JDAA 5EYPB 1OSGA 1SA0B 5F5CA 1K5MA 3ZR6A 4BAYA 3OUSA 3OR7C 1YTFB 1PNMA 1QJU3 2GDFA 2VW1A 4JTCB 2ZHLA 1DZRA 1UMIA 3WUDA 1XUQA 3K58A 1V55B 5LY1A 1OOPB 2YBPA 5FO9B 1BCXA 4ZXEA 1IDSA 5KAIZ 2IFRA 2CDOA 2YZ4A 5FZDA 2AR6A 2Q0OC 2R042 4DUWA 3VKOA 4JF3A 1DQ2A 2ADPA 1BJQA 5K8SA 5FNVA 2UUCB 4RYDA 2V5DA 4IHJB 4BK4A 4TV9B 3TRSB 3ZHSA 4I0BA 4NVPA 4LC1A 4ZKIA 2ZKOA 1H6YA 1XNQO 1U5XA 4F6RA 1MZFA 1PGL1 4JAVA 4GD4A 5GONA 3SITA 3UT0A 3QO5A 2FYUH 3I8TA 3ASOB 1D2SA 1O91A 1MACA 3G6EV 1QH6A 4DR2O 2JDUA 1Q8QA 4E4EA 4B4QA 5K4LA 3QO7A 1I0HA 4LFBO 1GKFA 2HWB1 3IMNA 2ZA9A 4HOOA 1XPWA 2DVFA 2EINC 1U97A 5A33A 2JDIG 2V09A 1F31A 4OMCA 3FB6C 5EJ1B 2F6BA 5M0TA 3APQA 3OW2U 2KR2A 3PIGA 3O1VA 3OJBA 3VL9A 4IE0A 4DUVA 5IYBO 3C8XA 1UPGA 4LT5A 4QNHB 1AR81 1K97A 2Y26A 3OEBA 1GN2A 3UGHA 4WVZA 4COYA 2VU9A 4Y26A 3FMGA 3DXTA 1A78A 4E2SA 3I55V 4DV2B 3V64A 3VD3A 2D6LX 2DYSC 2OYQA 3RYFB 2OZ6A 1POV0 2FDIA 4QQOA 1O3QA 3T1CA 1TME3 3M3CA 3LDCA 3ZHQA 4BLIA 5FPVA 2TUNA 1N33B 1N8RW 4U7OA 2F66C 3FLTA 4OI2A 3E22A 4QQPA 2WA4A 3AFGA 3ZEDA 2VVDA 1SS3A 1FOD2 4Y33A 1AYN2 2QWNB 1JHNA 1XNTA 3TEZA 3GBFA 1I5YA 1XNAA 2P6HA 5CKNA 3AYCA 3H3ZA 3AYAA 5E8AA 1L7RA 4ZU4A 4I0WB 5LBCA 1JYWA 3ZFFC 1QOTA 1NZCA 1YUDA 4CU7A 2Q7EA 3VBOB 4A2UA 3AZYA 3OYWB 4LIUA 2EALA 2OXBA 3AYEA 4E4DX 1BQ0A 3TNQA 4A7ZA 2OX0A 1C8M2 1IBKO 4IEVA 3CP1A 1H8TB 3AKSA 1IS4A 2WZR2 4MW8A 3G7DA 4ZU7A 3HKBA 4PJYA 2PYJA 5DECA 4DR5O 1QJY1 1CN1A 3BODA 5IJ9B 3ZRWA 3VOUA 4BXSV 1E1RG 1UOJA 4YW7A 3AMMA 2GC3A 5FMBA 1CAUB 3D4KA 3HJRA 2ADEA 3VBUB 3T2QA 3V0AA 1ST8A 1HRV2 2XR4A 4G4FA 4B3RB 1VRH3 4O4LA 4M3CF 1U5YA 5IJRA 4CXYA 1GR3A 5JI7A 2QZ3A 3IKWA 3ZO0B 1YHQV 4DV1B 3VB9A 3G80A 3DYMA 4DB5A 4OQ8A 3RG0A 2E3CA 3D0JA 4UV8A 4NHMA 3HD8B 4GKXA 2RS32 1GLHA 4BE3A 5IVYA 5H9CA 5LATA 1MZ6A 1BKZA 4E2LA 3M8AA 2W6IG 4JI5B 1XMQO 1BZKA 5FZ8A 2VZSA 2QQVA 2JG8B 4X66O 4PA4A 1F2NA 4XYXA 2VMDA 5T3NA 4GLXA 3K5OA 4JGZC 2G9ZA 1SLTA 3LGRA 4DRVA 1RUC1 2ZX1A 3EXUA 1YO8A 5CBGA 4XIKA 2XVLA 1NCQC 2ZGLA 5F3EA 3UJOA 4IERA 5KX5B 2R49A 4NXMO 5DUVA 1QHTA 1FNYA 2YGLA 1SETA 4DR7O 3J80N 3ZFFA 3B7MA 3TBDA 4Q4Y1 4XQWA 1NAEA 2OS2A 3CCLV 2W1QA 4ATFA 4DR3O 1VIBA 2PAEA 1VE0A 3TCUA 1L0NH 5A9GA 3Q9OA 1JZ8A 2HEVF 3ZRXA 1PM4A 4QPIC 3LEGA 4TTGA 2RHPA 1NU1H 1K73W 1YC61 2XJTA 2PN5A 4LF4B 3S7IA 1RUF2 2W91A 3ACHA 2GSMB 1QIQA 1ZBE3 5KHHA 2J1TA 4GX2A 1US6A 1R1A3 3AKRA 1PD3A 2BV4A 4YRDA 1S2EA 4XBLA 4GX5A 3ZMUA 5FZOA 1BVP1 2XL7A 4U3FH 5A3LA 5J2UB 2XQXA 1SEFA 3MHHC 5F1RA 4P9LA 4Y1ZA 5DG1A 1MPXA 3CO2A 2AZ0A 3HBZA 2Z4FA 3OPZA 3OGCC 5F5IA 3RYIA 3POFA 5JOYA 3V65A 3ZYFA 3RMXA 4XF3A 2I07B 1EN6A 2ZE7A 2AZ5A 3D82A 2AXTZ 4Q4X2 5DZEA 3N7KA 3WF1A 3KT4A 4ZS3A 4P9JA 3AK3A 5FREA 3KGLA 5L19A 4BQ4A 5FRAA 4F7ZA 4OGQB 4OFGA 5IAXA 3SYPA 5EIBC 3L2HA 1NOVA 3ZN6B 5LYJA 2RJ2A 4JGZA 4UFLA 5A6YA 2OKXA 4UXAA 3FB8C 4AAXA 1YSCA 3O7OA 1PNFA 1RUD3 2RMU2 1NCQA 3OTFA 5EYXA 1JQ0A 4FXKB 2A6VA 4H55A 3EMRA 3ST7A 3MIDA 4JV5B 5EBWC 2HP8A 1W0NA 3LSEA 2E5LB 1V6OA 1HP8A 2G19A 4META 3THDA 2JD4A 1SQFA 2HBUA 2VXJA 4CU8A 4ES8A 1VBE1 3JSNA 5JMOA 3ZPOA 4FPFA 4OHVA 2R1DA 3NL1A 2DVBA 1GNYA 4NIAA 2NP0A 4QPIA 1ENXA 1YNAA 4AQ2A 2ZABA 1CIWA 3CHXA 1IPSA 5BY5A 1GM7A 2R061 2WYFA 4EKWA 1UY2A 4MG2A 1SLCA 3UKVA 1GM8A 1JH5A 3TWIA 1OKQA 3CLPA 3JAWB 4JI8B 3CZJA 1FV3A 3FBMA 1AR83 2ORXA 3AKQA 1W03A 3OB8A 4HVOA 1J84A 2V7QG 5AVAA 4YM1A 4JI6O 2Q8VA 3K0DA 4FPEA 4BYYA 3GDBA 2F43G 3LEKA 1FPN1 2EILC 2VQUA 3MD0A 1EM1A 1G86A 1QXRA 1EPZA 3C7OA 2B9UA 1CVNA 2VTFA 3WP6A 1SQGA 4JI1O 3LWCA 1UWWA 5FOJB 3C3SA 2VZPA 5FXWA 1B35C 2D6PA 4DXWA 4I9QA 3K46A 4HSJA 5CA3A 1AB3A 2VW0A 2ZACA 1VBA1 2XB6C 1H1MA 2WSSG 1UCXA 3NR7A 3O1PA 1I7FA 4DYLA 2HWD2 2PELA 2XHNA 1AXZA 4FOQA 5KUKA 4AEKA 4K20A 1WCQA 1M4UA 3C3TA 2XVKA 1VMFA 2DCYA 4P9XA 1KBHA 4R50A 3B9IA 1PO22 3LDRA 5AFEA 5FZBA 3VBFB 1YIPA 1BE3H 1CJDA 4QIWF 1G4YB 3Q4HB 1Q43A 3K4DA 3VQYA 2B4KA 3AP7A 4YVWB 4LULA 1KMIZ 2GC1A 2PQQA 2XVGA 3ZLIA 1VBC3 4H3WA 4P02B 1Y66A 1SERA 3MEPA 5CZKA 4B3MO 2Q8EA 4MVZA 4XF0A 4QHZA 4MXWB 3K3WA 4CPBA 1KC8W 1BYHA 2D7FA 2JE9A 2W6JG 5FXZA 1Z2GA 1UZ0A 4B3SO 4KHPB 1QJY3 3VDDB 2VNOA 1ZX5A 4LORA 4AAPA 2ZGRA 1S77D 4ZKTB 3ZFGB 5FXVA 1LNSA 5B1BC 1GWMA 3W7XA 1VLNA 2ZGKA 1E5HA 1E5RA 2R32A 4PBPA 2X10A 4QPGC 2VNVA 4XAEA 1OA4A 1IS5A 4LP8A 3WNLA 2OQ7A 2X5IB 5LGNA 4MGYE 4MS2A 2OWOA 4RR3C 5J09A 1PIV1 5L3CA 5FP4A 1JA8A 3TGUH 1XNRB 1R1BA 1KU9A 5IK7A 1QVFU 1QH7A 3OG2A 1AX0A 1PGW1 2IXIA 1Q8VA 4IV1B 1VQNV 4JGSA 2AC1A 1JX9A 4DRXA 1UYXA 4PA6A 4X20A 3RZHA 1KYOF 3J8F2 3OR6C 4X62O 4NYKA 3DC5A 1YEWA 1B35A 3UETA 4Y1YA 3M3IA 1CX1A 1YI7A 1RUC3 4HNAA 2D43A 2D3OW 2E32A 3M3QA 3WDWA 2DN9A 3SMHA 1O6UA 2EIGA 4LK6A 3VKFC 1J95A 1BVVA 5A3TA 3B9CA 1US3A 1LHOA 5F2SA 3I3QA 4Q0VA 4G9SB 3H1IH 4XJ9A 3KHBA 4L97A 5FZKA 5H9QA 4CUCA 3G71V 2PHRA 3SCGA 4AF9A 2J1RA 1PK6C 2O8QA 3R65A 2ET7A 2WNVB 3HQUA 3J7HA 3VBSC 3RQ0A 2DV9A 5FJKA 4OMDA 4AGVA 1AXKA 3B8NA 4XZPA 2ZKNA 3POIA 2GH2A 5CBLA 2AZ2A 2YMZA 4CEYC 1UPIA 3JU9A 1IXMA 3IIIA 2R9RB 1JZ5A 4UBHA 2GNMA 2JDKA 4KWUA 3CDZB 3IC9A 3V0BA 3UGGA 2QEXV 1JN2P 5CADA 1FXZA 4QPGA 4JTDB 4LO5B 4RR3A 5C5UA 3NNFA 2N05A 1M5IA 2Y4UA 3ZXGA 4JHZA 4AI1A 3SHRA 3KCXA 4YW2A 3NJVA 3UCSC 1BHGA 3LA3A 4V2VA 3PJQA 4XW3A 2JDMA 1CP9A 4YW6A 1V55C 1OOPC 4A7KA 1GZ9A 1V6IA 1S0CA 1FAFA 4IGOA 2RS11 4GB31 5JZGB 3PL0A 5FK7A 3JQXA 5LGTA 5FXXA 4DNYA 5ITZB 3LKJA 3OEAA 1K7DA 5FP3A 3ZSLA 1EY2A 1OHHG 3HNMA 3JD4A 4NAOA 4QX1A 4CUGA 1UU5A 4MVQA 4RO2A 1S5LZ 3ASOC 4BZ4A 4S2HA 3CRAA 2VQ0A 3B8MA 1FFXB 2VC9A 4DQAA 2ZHMA 1K33A 2WLIB 3CJXA 4Q4W1 4ATEA 1PK6A 3UT5A 1DF5A 3DSQA 1NQJA 2WLHA 2AACA 2WFF1 1C1FA 5ACA1 3VBSA 1R1ZA 4MV2A 1S76D 2R063 1KECA 4RHV2 4CS3A 2GUZA 2HH9A 5FZ1A 3WNKA 2BQPA 5DUWA 4MUVA 4CEYA 1XJAA 1BL8A 5AFBA 2QVSB 4L92A 1CJPA 1LGNA 4OLLA 5A70A 4IEPA 3MLJA 3CKHA 2WFPA 2GTSA 4Q0SA 3QLQA 1U96A 4BM8A 1FPN3 4CDUB 1OLME 3UO3A 2B7YA 5GZGA 1Q5OA 2Y0PA 4XFAA 4J41A 2DW4A 1W6OA 1NE4A 5J48A 1SLAA 1XBFA 1APNA 3Q8AA 1XNBA 5EYPA 1SA0A 1TUEB 4X6QB 1T6GC 1NZIA 4IL6Z 1EYBA 2Y0IA 3OGSA 2WSVA 3ETPA 1J3PA 1P8JA 3HPLC 1U0AA 4FPOB 2Z42A 3KKYA 3K04A 3ZKUA 1OOPA 4CP0A 4UF0B 1S0FA 2ZGQA 1TME2 3VHOA 2QDNA 2IJHA 3FZ3A 2FDJA 4NWWA 3E8HA 4M3CB 3ASNB 1OCCB 4AK3A 2VL4A 4LF6O 5BUVA 4IHJA 1SQQH 5BR8B 4TV9A 3FE5A 2BDRA 3N7MA 3VBOC 1RC6A 2CGOA 1JJOA 1DZQA 2R9AA 2ATFA 2FQPA 5KHIA 2VZRA 3IWZA 2P4EA 5EC1C 3NWKA 2ZCEA 2YXYA 3W7WA 1YRZA 1H8TC 5BNNB 2WZEA 2CH7B 1M9NA 1ZZ8A 2EIEA 1J1TA 2WLJA 1F4HA 3T2OA 2G9FA 4MSVA 4YW3A 2DCJA 2GZWA 1S2BA 3BOWA 3TEWA 4DV2O 5JLVA 3PVOA 2ZGNA 2ARCA 5A3NA 1N0JA 1YQ6A 2PYLA 5IE9A 1MS8A 4FFFA 3KG2A 1PIV3 3I54A 4LIVA 2A7WA 3JCZA 3HQRA 1URXA 2RJZA 3LSDA 2EXHA 1DF0A 1N33O 3VBUC 4A6SA 3CMAV 4EWEA 1X9TA 4YG6A 1B09A 3TK1A 1I5PA 4Q5OA 2VCMA 3ROUA 2CDPA 1FMD3 1QCEA 4XACA 1WLWA 2IC1A 4AHCA 3O1TA 5DG2A 5I8SA 1JZ6A 1VRH2 4UWDA 2BCCH 4RL7A 1FXHA 4BWOA 3RYFA 4O4IB 4LF9B 1JYTA 1VJ2A 3T1YB 1Y43B 4O9EA 5JXGA 2JG8C 3ECQA 1HB1A 3WR0A 2TEPA 1OCRB 3N9MA 1SFYA 3BU0A 2VPVA 5JCTA 3PVNA 3R6SA 5JSRA 1YJLA 1LGCA 5CKQA 4MTXA 2BFUS 2F4PA 1AI6A 2OIEA 4BIOA 4ITCA 3HNBM 4TLFA 1GBGA 2ZE5A 5JOXA 3CSXA 3C7FA 4C1WA 1RMU2 2BERA 1DYKA 2BVBA 3W58A 5A3OA 3CQOA 4GKKO 4CZZA 4Q0QA 2QDRA 4PQQA 2F95B 4F3JA 1FAYA 3H1JH 5EWSA 4GH4B 4QT6A 4UFKA 1BMV2 3OMNB 3VBOA 2AGAA 3HKDB 2P4KA 3NNLA 3OYWA 5JCOC 3I2HA 4UOJA 2Q7HA 2ZXQA 5FYSA 2ATKC 4MYEA 1LHUA 3SCHA 1NYWA 4FT8A 3AG7A 1H8TA 4MGQA 3WF0A 4B3RO 1ONAA 3VHRA 3CX5F 2HWF1 4GWIA 1TEIA 2VBPA 4AI2A 2W39A 1JUHA 3GWOA 2NLRA 4DV1O 2EXIA 4QX3A 1NQDA 5EXOA 3M70A 4P9WA 2JDZA 5J1XA 5IJ9A 4WFFA 1WCSA 3A0KA 4AHYA 4XTPA 1MS4A 2XAHA 1ZBE2 4JI5O 3ZHUA 3WF2A 1R1A2 5A3WA 1C57A 1CAUA 4XAAA 1AVMA 1HDJA 3AXEA 1GP5A 1K5JA 4XFIA 2F23A 2D6KA 3VBUA 4MTOA 1NS1A 1RUE2 1XQ8A 3UL2A 4QX0A 1CIYA 2QWOB 3ZSMA 3J7LA 1A3KA 3HNYM 1YJ9V 4QHBA 4D7TA 2QJ1A 5CG9A 4I7ZB 2YC0A 4LJHA 2UU9B 3KGZA 1RJ7A 2JG8A 1OLRA 5FJHA 4GB33 5K9YA 3MICA 5EFUA 3MIGA 4K0KB 1UPSA 1BBT1 1HRI1 4PIXA 1QR8A 2W9XA 5GTIZ 4B4RA 1V6LA 1LUWA 3UM7A 4LF4O 2YIDA 1UZVA 5KX5A 3DC6A 1RUD2 3RBZA 1PGL2 5EZYB 1VQMV 3OUFA 5C3OA 1OPMA 2JICA 1W9TA 4Q4W3 2MEV3 5KLVH 2VVEA 3CBNA 3CCMV 2PI4A 4CZSA 2WUHA 2PHDA 2WFF3 5ACA3 5FDBA 4LBQB 5JCOA 3ZYPA 1GRJA 3KQ4B 2PHXA 1R64A 4JYAB 3UNPA 3NSTA 3KV4A 4LPLA 2YICA 3IC7A 5A80A 5CB4B 2QQUA 3VD5A 4NRQA 3HMYA 3WLUA 1GWKA 3VHNA 1G6UA 2WPDG 3VKLA 2YB7A 2QQIA 3INAA 4CCOA 2J1EA 1ODMA 4BU2A 4HSLA 5C3RA 4QXCA 2DWDC 3R66A 3C7EA 1O59A 1PV0A 5BNOB 1E79G 5J2UA 1IS6A 2GSYA 1D4M1 2GP5A 1UYZA 1AR82 4XETA 4JDOA 1OA2A 3JAKB 3BB6A 3WDVA 4IIJB 5DDJ1 2JIJA 2B42B 4CBCA 3ZSEA 3LOIA 2XBO3 5FK8A 3T0AA 4I3GA 4MXVA 1D7PM 5DXDA 3FB5C 1TA8A 2RNBA 1UW8A 4J42A 4NIIA 4HVQA 1W99A 4JV5O 4GJZA 2VW2A 1NE6A 1UZWA 1IHMA 4TUYB 1UMZA 4KBZA 1DLCA 4M0NA 3ZN6A 2HWE1 4MADA 3VGIA 3B3QE 3VBFC 4AR2A 1HV1A 3LEIA 3WP4A 1XNKA 2ZE6A 4Z2AA 2GN7A 1ENQA 1X36A 2CTWA 4L9BA 4YVWC 5FPBA 3ZYGA 1ULPA 2YUEA 4O4JB 2PHLA 3BTXA 1AR91 3AG2B 4KFMA 3ZMVA 4AHWA 2ZBJA 4X8AA 4XFBA 2JDHA 4BIUA 3D3AA 2ZMLA 4LF5O 3NNGA 3K51A 3QVNA 1LKNA 2FDGA 4NR1A 4LWSB 1VBC2 3BPSA 3VDDC 2YPJA 4BMBA 5IY5B 3NAPB 2YGMA 3ZFGC 1YQCA 1SACA 3MIBA 4S2GA 3ZXLA 3JCUZ 2UY9A 2B1IA 5I0UA 1AI4A 3L9DA 2PAKA 3K06A 1QJY2 5B2GB 3O0VA 5FZMA 4DW0A 1S72V 4FI9A 1YJKA 2WLKA 2YROA 2CU5A 1C5IA 4FLWA 1SESA 2X5IC 3SPJA 3JAWA 2XLAA 3ZYHA 3UKTA 4NPMA 3PU3A 4K21A 1K3EA 4R8HA 1RFYA 2IJJA 4YY3B 1JCHA 1WB7A 3WDUA 4AL9A 1VQ5V 2QWPB 3JYCA 4IV1C 2K46A 4TQDA 4XF1A 2Z5UA 3ZSJA 1Y4MA 2DCZA 1P7GA 1H4HA 1PL0A 2XH6A 2OCHA 2RDRA 3QTCA 1ASJ1 4H13B 1V0AA 3KSCA 2EF6A 5FZGA 2R0FA 3K2OA 1NZ6A 5JSOA 2CUGA 3N7JA 5F5AA 3O0XA 2EA7A 3I4IA 3VZJA 3E86A 1SRYA 3PU8A 4Q0PA 3R4SA 3GB7C 1UX6A 4FQZA 2UY8A 2H0BA 1RUC2 5FYYA 4LTAA 1VBD3 4ET7A 1C1LA 1I5XA 2RCVA 5JQGB 4KHPO 3E6DA 4CP2A 4UCTA 3W7TA 5EJZB 1G9AA 3VBFA 1YXBA 5FPRA 5FBZA 3CC7V 4GZ9A 4PF5A 1RUH1 3AMHA 3RZKA 3BTAA 1H2KA 3PDQA 1JOBA 3Q4HA 1NLQA 1SG3A 5LBEA 3WINE 2CV6A 4YVWA 1ND2B 2WNVC 4Q4Y2 4N9HA 1BEV1 3TEXA 4D7SA 1WD3A 1W0KG 4D69A 1YQ2A 5DEDA 2ZGPA 2HWF3 4MXWA 1X82A 2EICA 5GLWA 2RE9A 2A3WA 1TE1B 1VBB1 2R7EB 3VDDA 1CR7A 3ZIXA 2EIJB 4D6QA 4MGSA 1SLLA 1XOUA 3ZFGA 2EIMB 5D5QA 2CAVA 3WCSA 5HCBA 1U5ZA 4CRQA 4U36A 4LBKA 1GU3A 3U14A 4QMAA 3ZN4A 3WV6A 2VUAA 1UU6A 3OGIB 1UOBA 2X5IA 3GZUC 3D36C 5IATA 2KA3A 1N3PA 4OI0A 3W5NA 4UCSA 1IGOA 1VQ7V 3I2JA 2PY5A 2W47A 2I2SA 1UZYA 4LFBB 3M7MX 2CTPA 4IV1A 1FXKB 3B4SA 1WW5A 1IPKA 4YGDA 1HX6A 3T1HB 2DURA 4BIZA 4C91A 3E35A 4PBOA 4AXOA 1WA8B 4QJFB 4O2BB 1BBT3 4FMTA 3SC7X 5FYTA 1HRI3 5JZGC 2VM9A 3WNNA 4JYCA 1V54B 1FD9A 3L71H 2GNDA 2ZZQA 5F5QA 5A7QA 2WINB 2ZX4A 4XZUG 1SBDA 1W8WA 1VEWA 2VUJA 4DFSA 4NROA 2Q73A 4K1YA 4RQPB 4E8DA 2PXJA 4I30A 4AEDB 1D0HA 4CDQB 4Z82A 3T2TA 4DR4B 2J1SA 1JMUB 3U4SA 5GZEA 4TQFA 5JH7B 5AC91 3VBBA 3ML0A 5C3QA 1SPPB 2WNVA 1LR1A 1FS0G 3OGJA 4WCEV 4LR3A 1VBE2 3E2EA 2QTSA 4COVA 1NY71 3SJCC 2R062 4NB5A 1GNHA 2GH8A 5F2VO 4FLUA 2BGCA 1UAIA 4W65A 2VUCA 4LITA 1D4M3 1Y4WA 4CDUC 3B01A 3W20A 3LDBA 2ILMA 1US2A 2QWQB 3KZ4C 1QLNA 1F9KA 1NVPD 4LUMA 1PPJH 4Y20B 1H2SB 3D36A 1ZL8B 2ZMKA 1Y3TA 3VN4A 1IBKB 1FPN2 4Y3OA 2OT7A 2NM1A 3F7VC 2FMLA 3U0ZA 5A1LA 2DVGA 3SJBC 5L9RA 2V72A 5HV4A 2WQ4A 4HK9A 1J3QA 4N43B 5FPZA 4O65A 2WO7A 1CGPA 4AYUA 4C8DA 3W7SA 2IBZH 4GQ7A 1H2NA 1VBA2 5FYBA 4CA9A 1Q8PA 2ZNJA 1KQRA 1BZWA 2HWE3 3P5BA 2W2IA 4XBQA 1FOD3 3ZXKA 4J10A 3OPWA 1AYN3 3ASNC 1OCCC 1S0BA 5JZGA 3RWKX 4EYUA 1QJZA 2RDNA 1IBLB 2ZEXA 4GZRB 1XI1A 2D40A 3WG7B 5ITZA 3UKMA 1G8MA 3ACFA 4WF9V 2BP6A 5A7NA 4PDWB 1VAMA 4AQTA 1ZZCA 2R0HA 3ZYRA 3LSUA 2OIIA 3ZIWA 2XJUA 4JTOA 2E31A 4FO9A 1F5JA 1ZRRA 5FYUA 1YI2V 5BNNC 2GV9A 3S6PA 1FFXA 4FP3A 4JDNA 2LW1A 1C8M3 2X8KA 1RB8G 2WLIA 1DG6A 3WNOA 2W95A 2ZHKA 4PHZA 1XNDA 4L11A 1R6TA 2D5HA 4WM8B 1W2OA 4C90A 2EIKB 4Y1XA 3DKQA 4GX1A 2Y6FA 2E76B 2UXBB 1SBEA 2JB8A 4KG0A 1DDLA 3M2MA 2ZS6B 3FUOA 3QD6A 3R4UA 4CP9B 2WS91 3CRQA 2QM7A 4Z1MG 1OUXA 4L87A 4IT5A 2NNUA 5EZWA 5DAWA 1MSDA 3MV01 1PIV2 4IV3B 4CDUA 1HRV3 1ULOA 1ZM1A 3LE0A 5I0RA 4UCRA 4X6RB 4HLTA 2XUEA 2IU3A 2ZGMA 5CG8A 4PV1B 1YCIA 1OI6A 1DIWA 2WAOA 5I0SA 1P4RA 4FOWA 1F7YA 1PGW2 1ASJ3 1VQ6V 1FMD2 3B02A 3B2EE 1G7YA 1GK9A 2BUKA 4LQRA 3LOBA 5BR8O 3RW0A 3KF3A 1OCRC 4CYDA 4QX5A 1S55A 1M1KW 1ZNPA 2QWRB 4CH5A 4WZCA 3ICXA 1GNZA 4V2WA 3VZLA 3MW2A 5K1PA 3O14A 4UF0A 3K3NA 5E1RA 2XGXA 3G4SV 3AJYA 5A6QA 1KXGA 1YFYA 1I9RA 4M3CA 3PNAA 2DMXA 1HXS1 4QQLA 2ZX0A 2YU2A 3MDPA 1X59A 3RYRA 1F8VA 1JMKC 1C5HA 2KG7B 2LROA 4QQHA 1ULEA 2QKCA 4GH4C 2ADDA 2ERFA 1BEV3 2V73A 1LRHA 1YIFA 2ZR3A 2VECA 4IE7A 1NQTA 1NA1B 2PF4E 2YIAA 3AG3B 1R3KC 4NKGB 4IETA 5LA2A 1CQ9A 4FFIA 5BNNA 2CH7A 4YW1A 1XILA 3U1XA 5DUXA 3NMBA 5FMOL 5BYNA 3C3VA 3IPVB 1HQLA 3GALA 3POYA 4FFKA 3ASIA 1UJWB 3DECA 1M90W 4LF9O 3T1YO 4KMQA 2O14A 3W59A 1WUVA 1JOYA 3OGVA 2XPJA 2WWUA 3ABKB 2KSDA 2OQ6A 2JDNA 3MZHA 2LGWA 1Y6XA 2W5FA 3I2IA 5F7UA 5EJ3A 1S5JA 4UT5A 1LU2A 3ITQA 5L36A 2PTMA 4O4IA 4ZI7B 1AI5A 1QWRA 1W39A 1LECA 3U4XA 4BA6A 4LBLA 3MIFA 3OGGA 4DXRA 5DABA 4DW1A 4PELA 1JS9A 5EBMC 1W9SA 1GTOA 5C8CB 2XDVA 3BIWE 4GA9A 1F4NA 3BALA 1MOFA 3LQCA 2G4IA 3RJRA 3DV8A 4YVSB 3H1LH 2WL1A 3M3OA 4JI6B 2RS12 4K7JA 4GB32 4OUSA 2FMDA 3WW1A 2VWJA 4CCJA 1WBLA 3WUCA 4N53B 4FM1A 2Q1ZB 4HBNA 5LHGA 1PZ9A 1VF7A 1GP6A 3I2OA 3B94A 1SZXA 1N47A 4EN9B 4JI1B 1GM9A 3E89A 5AC93 5JIAA 2GMEA 1UY1A 4X8PA 3K59A 3AKTA 4QB6A 3HKDA 4EJRA 1BQPA 1NT0A 2XKPA 5JPNB 1KITA 2DVDA 4Q4W2 1OZ0A 5J2TB 4QE9A 1VR3A 2CNAA 4O2AB 1POV1 5CFDC 3WNMA 2WFF2 5ACA2 3C90A 2DF7A 4ASKA 4CCCA 1W2NA 1DGWX 1C4RA 2WIIB 5AVPA 3L74H 1JXNA 2HVKC 4C1XA 3BIEA
chains in the Genus database with same CATH topology
1CESA 4FPLA 5IK7A 4IEOA 1PGSA 1QH7A 1AR62 2OYZA 1AX0A 4ORFA 1J3RA 5K0UC 1PGW1 2IXIA 2R043 1Q8VA 4IV1B 3FX3A 3U11A 1ZVFA 5GZFA 1NCRB 3DPRB 5BNOC 2A3YA 5HCAA 4RQPA 4KGGA 3RNSA 1W6QB 2DTWA 1RL3A 4UW4A 4RGGA 3ZXEA 3ZYJB 4CDQA 3NV4A 3AMQA 3J8F2 3TOJA 4XIOA 2VMIA 2OG7A 1VBC1 3GZAA 1LHVA 1B35A 3L9JT 1WCDJ 4Y1YA 3M3IA 2RR12 4EWDA 4TWTA 4KH9A 1YI7A 1RUC3 2XJPA 2XJVA 1AL21 1X33A 2GN3A 2ZPXA 2D43A 3EO6A 3M3QA 1IS3A 2QKDA 4L2NA 4M00A 4B4PA 3JCIA 4YFZA 3WDWA 1J59A 3SMHA 5CFCA 1FATA 4F8AA 2XBO2 3FC0A 1PO12 3NJZA 1OIIA 2WSUA 2EIGA 4E4SA 3J9SA 5IT6A 1V9U2 2DTYA 3ZXAC 3WW2A 2P17A 3VKFC 1BVVA 4AGRA 3O2GA 3B9CA 3RJ2X 2HWD3 3H1YA 1LHOA 4Q0VA 1I3HA 3KMHA 4G9SB 4XJZA 3WDYA 4XJ9A 2GNTA 4L97A 5H9QA 5GLZA 1G9FA 4IEYA 3S30A 4WVMB 1S2KA 3WG1A 2PHRA 3U10A 3SCGA 3ELNA 3LB9A 1RIRA 4FPKA 4YM0A 3VZMA 4YGCA 2NMOA 1PO23 4K3UA 1PVC2 4AF9A 4QXKA 2D6OX 3E6BA 4I02A 1PK6C 3PVBB 2O8QA 3QACA 4GMP0 2ET7A 4FAGA 1AF9A 2WNVB 4TSVA 3POSA 3VBSC 3PJYA 4YZ5A 2D3SA 2Z5WA 2JKBA 2ZX3A 3RQ0A 3SH4A 2DV9A 3WP5A 4YM3A 4AGVA 2ZGSA 4I3PA 1AXKA 2R041 4XZPA 2VOWA 4HN0A 2ZKNA 4Q27A 2RS13 2GH2A 2G9GA 4KBBA 2ZOEB 5CBLA 2TBVA 2YMZA 4BLJA 4CEYC 1AR71 1UPIA 3JU9A 3WDXA 3V0AB 1A6CA 5KXBA 1H8VA 3WG3A 2XJRA 1QJX2 1CX4A 4QM8A 4UBHA 4LBQA 3OCPA 2GNMA 3ES4A 1QXJA 3RS6A 4I0AA 3V0BA 3LA7A 1LOEA 1JN2P 4L99A 4XF4A 3NAPC 4NOTA 1LENA 4LO7A 3L2YA 3ZFEC 1DYPA 5CADA 4FPHA 1OD5A 3RYPA 2D3RA 1KJLA 1FXZA 4YLZA 1XYNA 4QPGA 2C1FA 2YHJA 2JE7A 2XWBB 4Q4V1 5DZGA 1HQWA 2WS93 2D93A 4LO5B 4RR3A 2WZPP 4TYSA 3TNPB 4AVTA 4LBOA 2WT2A 4NPRA 3ZXGA 4H7MA 2W52A 2CGPA 3GBWA 4AI1A 4J5IA 3SHRA 2HWD1 2BEOA 3WW4A 4BPZA 3KCXA 1MS9A 3V15A 4YW2A 2OA2A 2E7QA 2K0GA 2DUPA 5K0UA 1ZRCA 1YXWA 4IXLA 3JQWA 4BGKA 2HWB2 3LA3A 5IK8A 1RUH2 1QQP2 3DKWA 5BNOA 3KM5A 3N3HA 3PJQA 4XW3A 4CDWC 1RHI2 2Q30A 5CFDB 2DYCA 4N90A 1PO21 3SCFA 4AVCA 4HZFA 1OOPC 2GAUA 2XG3A 1TNFA 4IESA 4A7KA 4HKLA 2PLV3 1GZ9A 3PTYA 3FWEA 1V6IA 1WLTA 4NHLA 1JBCA 4XFGA 4GIQA 1VAVA 1S0CA 1Z7S2 3LAGA 5CNAA 1REFA 1UIJA 2RS11 2NMNA 4GB31 3HR9A 3ZFFB 5JZGB 2HEWF 1QNYA 2LUWA 2DVAA 3JQXA 2Q5TA 1JOJA 5JOZA 2JG9C 4XBNA 2WZR3 4DNYA 2Z69A 3LKJA 1MS1A 1M4WA 1G9DA 3E5UA 4JDMA 3AXDA 3ZSLA 3TN92 2UURA 1VALA 5JSPA 1Z78A 1EY2A 3WG2A 3ZPYA 3H1MA 4AVSA 1CAXA 4CP1A 4OI4A 1UU5A 4A3XA 4OVEA 4K1ZA 2JEMA 4S2HA 4BZ4A 3IDCB 1WMFA 2DFCA 1XYPA 2VULA 3MYXA 1WCKA 4YZ3A 2VQ0A 5FMOS 5K7PA