2WA3A

Factor inhibiting hif-1 alpha with 2-(3-hydroxyphenyl)-2-oxoacetic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
335
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 106
structure length 335
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2wa3A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wa3A01
1MZFA 4B7KA 3P3PA 3P3NA 1H2MA 1MZEA 2YC0A 2YDEA 1H2NA 5JWPA 4Z1VA 4BIOA 1IZ3A 3KCXA 4JAAA 1H2KA 2W0XA 2WA4A 1H2LA 3OD4A 2CGOA 2ILMA 4AI8A 3KCYA 3D8CA 4NR1A 2CGNA 2WA3A 2Y0IA 2XUMA 4QU2A 4B7EA 4Z2WA 1YCIA
chains in the Genus database with same CATH superfamily
3J8F2 4XVHA 3OBAA 3GYDA 1GV9A 5FZKA 4OX9O 1QNMA 1ZWIC 3GHNA 3JCUZ 5FQ0A 3IPVB 3WP4A 1MOFA 1J3QA 3GCWA 4URTA 3ZYFA 3EHBB 1H9PA 2HWB2 4MS2A 3HKEB 4Q8KA 5FWEA 4S2HA 5FJHA 1VQ4V 1IG0A 4H0LB 2TEPA 4QPIB 2CH7A 3B02A 4RQPC 5C33A 4X66O 1K8AW 1YNAA 3AP6A 4I30A 1FMD2 4XUOA 3HD8B 3ZYHA 1HRV2 1UY2A 4JYBA 4OI1A 1VBE1 2GNMA 4DEVA 1K5QA 3SCHA 2G9ZA 5JVDB 3HKEA 3PHMA 1O8SA 4MXWA 3TCUA 5JPNB 2ARHA 4EFBA 4DRXB 4CS2A 3FHIB 1XOUA 3QH7A 2VWJA 1W3VA 1RUF2 2EZPA 4DY5A 1HJFA 4NN0A 4KFMA 3CJIB 3IDCB 4QHBA 4D3WA 1QNYA 3ZMUA 2PUSA 1LU1A 3IMNA 3OE7G 4IV1C 4LF8B 1JOBA 2ODMA 1S0BA 2BPA2 2K9PA 4F6RB 2F4PA 4QX7A 1LHWA 1S4CA 1CIWA 1M90W 1YQ5A 1Y4MA 2YU1A 5EK0A 1XSQA 1RHI2 3X2QB 3PJYA 1US2A 1WKYA 2GNTA 3AG4C 3STLC 4NXNB 5LBQA 1LENA 1UIKA 3OM3B 4AOCA 5KUMA 1K92A 4IT5A 5JUVA 4JX0A 3VL8A 1CPNA 1TEIA 4IYIA 4IE0A 2YI8A 4YG3A 1OCOB 4WZFA 4IE6A 3B3QE 3JATB 1B3QA 2GP5A 3T4VA 3ZMOA 4UW4A 1C5IA 2P17A 3RYHB 1VMGA 2V73A 4CDXB 4EN6B 1JN2P 2RE9A 2EIMC 1SQQH 2Z42A 1MACA 3K5LA 1JZ7A 3KMHA 2XHNA 2XJSA 2YYOA 3A0BZ 3ZR6A 3THTA 3WF0A 5C9AB 3DYPA 4ZKTB 1PP9H 4AEMA 2XHBA 1ZLZA 2WZR3 2ZR2A 1CAWB 4TV8A 2C0ZA 4R8CA 1YQ2A 1BCXA 5F1RA 5JOYA 4Y4RA 2I74A 1OZ0A 5H5NA 3UCSC 4Y20B 3C7GA 2EXKA 2R042 4F4LA 1FOD3 2ERFA 3JCZA 4ISRA 1YIFA 4Y4YA 1NY72 5FJKA 2IM9A 4TTGA 1RFYA 4ZU4A 2LQTA 2ARBA 4Q4V2 2WFPA 1XU2A 3VV1A 3RYCA 4E2SA 1W8OA 4PIYA 2JWPA 2WJSA 1Q5OA 5DAVA 1R081 3SDLA 2NM1A 1IXBA 3V0AB 1W2UA 4A3XA 3VBSC 4XACA 4JGYC 1E57A 1RVF3 2ZX3A 4CA9A 1LOEA 2VMDA 1G8MA 4O2AA 4AE2A 3AZYA 1VBD2 4Y1YA 1W9SA 3RSJA 4GJZA 4MYEA 4PA9A 4DK1A 3ZMSA 1COWG 4WVVA 5DABA 2DDUA 5ACA1 4PF5A 2VNOA 2R9IA 4KGQA 4DV2O 5KR7A 4IW3A 2HWB1 3WP3A 1A34A 3GZUC 3VBSA 4DO2A 2HWF1 5GZGA 1I3HA 5FMCA 3J7NA 4CZZA 3FX7A 3ATGA 4KU7A 3O0VA 2VZQA 3VDBA 3U0ZA 5DAWA 4COVA 3PUHA 4C90A 3J8F1 2Z2SB 4B1LA 1XNAA 4AVSA 2GDFA 2PTMA 2ZHLA 2E7QA 3MAQA 1ZREA 4G27B 3IZOA 2UXCO 5GLUA 5E8AA 1BQ0A 5C8YA 1K5MC 1WBLA 4CEWC 2YROA 5BNOB 3PJQA 2XTAA 4QDSA 4RYDA 3POGA 5A80A 4JI8O 3JD1A 5FMOL 4BDVB 3OEHG 1AVBA 4E9KA 4P9PA 4I50A 4KHPB 1NI8A 4WF9V 1SACA 4QM9A 4Y5SA 3WDYA 2UU8A 3LEKA 2ZTNA 1I7FA 3ZJZA 2Q68A 3T4HB 3D6EA 4XF4A 4QX3A 1SQ4A 3ABLC 1JYNA 1CAVA 4OULA 3CMAV 3WG1A 1SA0B 2LW8A 5FYMA 1XNQB 2UU9B 5C93A 1YJKA 4NXNO 2R49A 5FYUA 3KT7A 1F5JA 4LOTA 1AI4A 3WB1A 4U7NA 3RVZA 4LF6O 3OPTA 4P9IA 1SQBH 3HPLC 4FP2A 1J84A 2PGGA 4OMDA 4C8DA 4XZPA 3VBSB 5JDBA 5FRAA 4J80A 4GWNA 5F6KA 3MV11 5EYXA 2KG7B 5IWFA 5FP7A 1IXMA 4TOIA 3C7EA 2QUOA 4CU8A 4U2AA 3F5WC 1LHVA 5EJZB 2LGQA 4F83A 1QJY2 3L71H 3APOA 2R32A 4X1KA 1RXFA 1ULCA 2GC0A 3W7UA 1ZRRA 4O7XA 2E75B 3TNPB 4XBFA 3MIEA 3O1TA 3TB0A 5L3DA 4Y3OA 4PIZA 2W68A 4FM1A 4IHJA 5LGTA 1GZWA 3A0HZ 2O1QA 3G6JB 4RSUA 3SKJE 4EN8B 4D6SA 1HXS3 1E5IA 3O1VA 2ZJCA 4YY3O 3VBRB 1PMHX 1MR5A 4K8RB 2XHKA 1EZJA 4X6RB 3O1UA 4FP3A 1DGSA 4MHUA 1NX9A 1PVC2 5LRRA 4DXRA 1EYBA 1S0GA 1JZ4A 4FZ1A 3I2KA 5LBFA 2PA7A 4L11A 4AVVA 2GALA 1G86A 3ZXEA 4Q4V1 4XW3A 5ABJC 5IVYA 1VF6C 3ZIXA 1KP3A 1W90A 1KMIZ 3D3AA 1AI7A 1DF4A 3SPCA 2QQLA 3PVEA 1QXJA 4YW3A 3CDZB 2A6XA 5CN0A 4MXVA 1K42A 4O4IA 1PHMA 4LF7B 4NXMO 5LP6B 3TEZA 4HG6B 3MHHC 2O8OA 4MX3A 1OOPB 1GBGA 1OUSA 4FTSA 3ACHA 3VBHA 4LF9O 3OGVA 1IKQA 1FMD3 5EZYB 3WEZA 2IC1A 4WVZA 4DUZB 3PJSK 2VBBA 1V9PA 4DR5O 3SEEA 4CPBD 4CE8A 5FZ8A 4QHOA 1Y9GA 2P06A 3JD73 4DUZO 4L99A 1F51A 3RW0A 3FLPA 3EYPA 3FJSA 3WUCA 2DQ0A 3E86A 1K45A 1V6IA 2YXYA 1MS3A 4GKJB 5FZ9A 1UZZA 5A3LA 4H2AA 1W8FA 3M99B 1W9WA 2W92A 5CVRA 3CCRV 3K75B 1V9U2 1QH6A 1WW6A 1OXCA 1IBLB 1CPMA 2VR4A 3FC0A 1WCUA 1W6OA 3OEBA 2DWDC 1DQ6A 2W5FA 1OA2A 1DDLA 2FZ1A 2Q8CA 2JE7A 1DFQA 2OYQA 1RHI1 4LBQA 5LEJA 1FKAO 3T0AA 2JIJA 4AI8A 3Q4HA 3UT5B 4O4JA 2GUZB 5FTTC 2EINC 2V5YA 2JDPA 3O14A 3FL7A 3WU2Z 1GN6A 1HX6A 5C4WB 3QNEA 2C6SA 1UKGA 2R70A 1W2TA 3ZN6B 2XQRA 5FBZA 4HN0A 3CRMA 1W99A 5C6CA 4JI5B 1MA1A 4XMIA 2XQXA 4LBMA 1RJ7A 2WSSG 1KDMA 3LAGA 1REFA 3NNGA 1QKQA 3DGEA 4RGKA 4QQ2A 4RD7A 4E2GA 4O4LB 3ZYRA 3EFFK 4LO7A 3H1IH 3CWBH 1N32B 5CFDB 2VCCA 1B04A 3KKYA 4ZHQB 1UQXA 3M1HA 3ZKUA 1C5HA 3GCXA 5JSRA 3A0KA 2VGDA 1U0AA 1WA8B 3AX4A 3MUZ1 2DE0X 4J7KA 1JXNA 2WLIA 2BCCH 4DV6O 3AP7A 3WW1A 5A3NA 1ULOA 4DR7O 1S0IA 4Q8LA 2X5IB 1VMJA 2AXTZ 5A3PA 3VDCA 3O1OA 1VBB1 5L36A 4UCRA 3NRUA 3UYJA 4RGAA 3G80A 4Q4X2 3BTYA 4OHZA 3SKVA 4DQAA 3WCRA 4I9QA 4QGLA 3HNYM 5BR8B 4YYOA 4UFMA 3CCVV 3T3YA 3ELNA 3WR0A 3IB3A 3CBNA 4OPHA 4XUPA 5HCAA 2ZX1A 1BBT3 2VH9A 4QU1A 4BH9A 4OHXA 2W52A 2UWAA 1UU6A 3AKSA 1W6PA 4GH4C 1R6KA 4X64O 2ZBJA 1OFNA 1V6OA 3I8TA 3CCUV 5EZYA 4K35A 4UCTA 3SPHA 1POV0 3M3OA 5GLTA 4X9QA 2BGCA 1Z5WA 2DV9A 3JALA 4N53B 3LSDA 4BW5A 3VUOA 5B1NA 2YBPA 2JKXA 1FPN3 5FZBA 1O9HA 5FO7B 2P3IA 4C0BA 3DUIA 4D7SA 5B4XA 4DV1O 3KWVA 3J9SA 4I0AA 4XIKA 2LTNA 3OJBA 4AYUA 1D2SA 2RS33 5B4NA 1IURA 2H94A 3JAWB 4O9GA 4P9OA 1QR8A 1MQTA 1EPZA 4ZHNA 3RDIA 4GX1A 1O7FA 1XE7A 3EXUA 1I1EA 3RWRD 5FY5A 1H8VA 2Z0AA 3FBYA 1R3LC 1SETA 3ASIA 2DURA 1U5ZA 4Y1ZA 3IN9A 5K1PA 4IEVA 4N7IA 5KA5A 3SXWA 3RZMA 1IPJA 5ITZA 3E5XA 2IW5A 4NTXA 1CJPA 2QJ1A 1U5YA 5IAXA 3I3BA 1W8UA 1FFXA 1FFTB 4I50B 3E22A 4Q0SA 3H1HH 4V2VA 3BTZA 1K5MA 3FKSG 3MEPA 5J37A 1QJX3 1SZXA 1HW5A 1L7QA 2CY6A 2WN2A 1OA4A 4QPIA 3S57A 4A45A 1UZYA 2GU9A 3RBZA 3L72H 2W1QA 2RS53 1Q86W 4NRPA 3WHUA 2EIGA 1R6TA 4G3YC 2R9AA 2ZDIA 2A3QA 3P6BA 2F95B 5J2UA 4DO0A 3U4SA 5C8WA 1S2BA 2FB5A 1XNCA 4N8MA 5E1RA 1K5JA 5LWBA 1GAXA 1K3EA 2RHPA 4B4RA 3QLQA 1JU4A 3WG3A 2Q8EA 3TRSB 4Q4Y3 4B3RB 3ACFA 4EWDA 4ZPIA 5LMUB 3GNEA 4MW8A 3HQXA 3RPQA 1CX1A 1GNHA 4ZI7A 3AXDA 2VZSA 4JTNA 1VPHA 1N3QA 4QPJA 3ZSLA 1THZA 1LKNA 2WO2A 4IUGA 4A41A 2G9FA 1Q8IA 1FMD1 2GMEA 1F15A 4CCLA 3DC5A 3PUIA 1J5EO 4JGYA 4WBNA 3OB8A 4PI0A 5JXGA 4XETA 3Q8CA 2Q30A 3KV4A 1ND2C 4KBZA 4JGZC 2PYTA 2JB4A 1QJX2 5FYVA 1KRIA 1HRI1 2JEXA 1FAYA 5J7MA 1CIYA 2ZINA 2IXCA 3AFKA 3ZSJA 1E5HA 1AR5A 2PELA 1XNRB 1PO21 1JODA 5CBFA 2VQEO 4FFBA 5CA1B 3UGFA 1NLQA 2WIIB 3OG2A 2YIBD 1WB8A 4JTDB 3H1MA 4HAMA 4GULA 5DECA 3B9CA 3AYAA 3OUSA 3SJQC 1AX1A 3HKBA 4NB5A 3OUIA 4TLFA 1AYN2 5L3GA 1H2LA 5H6RA 2ARCA 4BHPA 1SS3A 2BEOA 4AW7A 4NJ4A 1WJZA 4IHJB 4FOYA 3LDCA 2JE8A 5T5JA 4M4PA 2R1DA 3K58A 4DRXA 1G9CA 3IWZA 3SC7X 3UT0A 4YZ2A 1UPGA 1SQGA 4CRQA 1GN4A 1GQGA 5DXDA 2UYAA 1GWKA 4TQDA 3U07A 4I3PA 2YEVA 3IIAA 2V72A 5GONB 4E2QA 2R9RB 5FPRA 4QQPA 1Q56A 2YGLA 3CLPA 3OAAG 3CZJA 3ZKYA 1QJEA 4OHWA 5IJ0B 1XSRA 2DJVA 4F7ZA 5IVCA 2WSUA 3PVNA 5FZOB 5IHRA 2VBDA 1TE1B 4M01A 2GC1A 3OMAB 4H33A 3GGLA 1O9GA 2R30A 4XFCA 1JUIA 5EXOA 1W9TA 4CCOA 1U12A 3JARA 5HCBA 3CEIA 5C8CA 1M5IA 5DQ0A 2BVVA 2P6CA 2P90A 3AYDA 4FPOB 3LDDA 4XJ8A 3ABUA 4B3RO 1HB4A 3ZHRA 1TNFA 3OOXA 5IVEA 2BVBA 4AK3A 1XE0A 4ZI7B 4DR1B 5FY1A 4FFHA 1G9DA 1X8EA 1VB4A 1LESA 3VZOA 2JD9A 4FFFA 3CIHA 5T5PA 3JD2A 2WSVA 1ZZ6A 2GMPA 4FPFA 5IVFA 5T50A 1ND3A 5LRSA 4ARYA 4WBNB 5FYBA 5AVAA 1R6NA 2XJUA 4RQPA 2IXHA 3CMEV 5CBHA 3DYOA 2MNGA 1Y76B 2VM9A 3RZKA 1GRJA 1RM1B 4FVVA 5ABJB 3AZWA 2P3KA 2IVJA 3BCWA 1UD1A 3BA8A 4GT1A 3VD5A 2YXLA 4PQ9A 5IYDO 2QEXV 3IIIA 1ZNPA 4CDQA 5EYPB 3OSDA 3ABMC 3J8F3 3V0AA 1RP3B 3VBFA 2P67A 4G9SB 4AEKA 1S72V 1C3HA 5LP6C 3TAYA 3BIEA 2QQMA 5CKNA 2EXIA 3VKFC 1UU4A 5BNOA 1PL0A 1LNSA 3E89A 3PUQA 4XFGA 2Q69A 4JAVA 5FK7A 1K4DC 1NYWA 4TT3G 3BEHA 2NZ9A 2WNUB 2WABA 2OKXA 2BU9A 1BSMA 2YIBA 2JDKA 4GWJA 2JECA 1HRV3 1DYKA 2WL1A 2PHLA 4NROA 4GX0A 1YEWA 3BGAA 1CAUA 4INDA 1LOAA 1VLNA 1B35C 3N3HA 3W59A 1QHDA 3ZXGA 1L1FA 1S0CA 1W04A 4AZZA 2EJ7A 1L7RA 3H9AA 1FJGB 4FXGB 3ZFFB 3NJVA 3CCEV 5M0TA 1GM7A 4FLTA 2R16A 1SEFA 1JYCA 4DZGA 1UCXA 4AQ2A 4JGZA 1MVQA 4CDXC 1POQA 1VF7A 2R071 1K4CC 2N7GA 1LOCA 1QDOA 3HN3A 2BP6A 4B4PA 3WVJA 2CTQA 3B09A 1J83A 2EBOA 2GHYA 1R1A1 4BAYA 4HLTA 3VBRA 2HWE1 4E4HA 2QSAA 5H9CA 4AVAA 4DR3O 5LMUO 3CX5F 1FXHA 4PA7A 1YIJV 5DPNA 4W4KA 1QR9A 4L92A 1AR61 4JDMA 4FFGA 2QE3A 4DR3B 5JOXA 5LHIA 4B29A 1CESA 1VQ5V 2RS32 3AK1A 2CL2A 3LZZA 1N32O 2BWAA 1Z0HA 2WZR1 5CA6A 2E5LB 5B3SC 1YRZA 2WNOA 4RUEA 4AI2A 1J58A 1AILA 3L73H 1ACCA 3J26N 5ERLA 1L3JA 4QXCA 4HZ3A 2PHUA 4A44A 5C9AA 1H1IA 4XAEA 2DVBA 5J3UA 4V2WA 2XJTA 3KQ4B 2YICA 2WAMA 3SJBC 1N33B 1OPOA 2XLFA 3LEIA 1YF2A 1O6UA 5LASA 4F6EA 1YJWV 1MS9A 4Q5OA 5FYIA 4C91A 5DZFA 2XXZA 1YI7A 2A75A 1B06A 2K9ZA 4P08A 1R082 1R092 2V1DA 4H7LA 4K0KB 3VBOB 2KB1A 3JSLA 4UF0A 3O9OA 1Y76A 4Q4Y2 4BIUA 3S0MA 4RQEA 1MVEA 3OGRA 1D0GA 4AFAA 5ACA3 4MSVA 3JASA 2BTQA 4META 5I93A 5FUIA 1WP8A 1VRH1 1OH3A 3H9VA 4GUNA 1ZBA1 5FZEA 4JYYA 2JVDA 1WGPA 1W6NA 5I0UA 2JD4A 1W2OA 2V7QG 4K40A 3OBZA 4DRRA 1PGW2 2P4EA 1XILA 4PDWA 3R4SA 4FPJA 4J1XA 1HP8A 3H1JH 2VCBA 3ORJA 5DAPA 2UXDO 4NHXA 3T2MA 1ZZ8A 3HQRA 5FOJB 3AVRA 5CKQA 3W7SA 2QA4V 1BK0A 5A1AA 3OYWA 4EJRA 2Z69A 4Y24A 2W0FC 1JZ3A 2Y34A 1NZIA 4QPYA 2E33A 4RL7A 2QWQB 3B69A 3OTOO 3PLQA 5D21A 1S0EA 2G9GA 1UFIA 1RUD1 4HSLA 4IV3A 1AJKA 3H42B 3WG4A 1R1ZA 1Y67A 3O0WA 3VKLA 4K7JA 1SERA 4I55B 3ZM8A 2L9LA 3MIBA 3QCWA 1DLBA 3RZZA 4BQXA 4YM1A 3MF9A 4YG0A 3K2OA 2WLJA 5FZMA 4U3FH 2ZMNA 2UUCB 1RUJ3 1D0HA 5JWPA 3MUY1 3CB2A 2JIGA 2RJZA 2XPJA 5HBAA 1KXGA 4TSFG 4CS3A 4NHLA 2VUAA 3U11A 4JASA 3N7MA 3FN9A 5FZ7A 3SISA 4YY3B 1Y3TA 2EIMB 1VE0A 4RS5A 5FLHA 2WLLB 3ABTA 1PZ8A 1H2GA 4AQYO 4YG6A 5L7OB 2UUAB 4J11A 3ZX6A 5A6YA 2JDUA 1VRBA 5HI0A 4I0XB 1CAVB 3R0RA 2JG9A 1WMFA 3X29B 2VQFO 1S5JA 3JXSA 4YZ5A 1BXHA 4IGGA 4PELA 3VBBA 1NE4A 1ZL8B 1XQ8A 3VKNA 3GXUA 3MHSC 3VZNA 3BABA 5FZAA 1G7YA 3VZMA 4R8HA 2D5FA 1AZDA 1COV1 2ZKOA 4OZXA 3ZN5A 3DV8A 3K5MA 3SCGA 1BMV1 3OGCC 5KX5B 1UPSA 1R1A2 2R063 1XMOO 1UWWA 3OT7A 5FYSA 3MPBA 4Q1RA 1GYKA 3SEPA 3CNAA 5J48A 4B7KA 4CXXA 1F4AA 4GKKO 2QCSB 1PMJX 2X53S 2VMHA 2Q5TA 1VQ9V 1LULA 4RO2A 1VBC3 1WCSA 2YEVB 3N2GA 4B3MO 1BS3A 5DUVA 3CKHA 3S6PA 1H8TB 1FPOA 4OHVA 5JQGA 1TG7A 1VIWB 1GMMA 5A6ZA 1OOPC 4LFCB 4KP4A 4EROA 2W3JA 2QTOA 4PJ0Z 3C8XA 2IH3C 3H3UA 2DBIA 4KHPO 1KJLA 1P7GA 2OQ6A 2DWRA 4I4TA 3KT4A 1EFRG 4LF9B 1XYOA 1PX3A 2RS12 1N1TA 3O1RA 4UT5A 3AG2B 1QCEA 3TXSA 2LW1A 4MVSA 1YCIA 3LDRA 4U3JA 3M8AA 3OTOB 3I2OA 4XJAA 4J41A 4FIPC 5C8CB 2W6JG 4AI1A 1XMQB 1Y9QA 3CF6E 4BLJA 2WLPA 3MF6A 1ZL8A 1M56B 3RZHA 3ZSKA 4M0HA 1JZ5A 1NCRA 4K3UA 1MS4A 5EJ3A 4TQFA 1JYTA 1JBCA 3FB6C 4QXKA 5A3OA 4XURA 4DXTA 1COV3 2VWKA 4HVRA 4CXWA 1JX9A 2DU1A 4QX8A 5C7GA 2Q6AA 5EQUA 1VR3A 1NS1A 2QQNA 3FAVA 2YUEA 2W94A 5A7PA 2AZ5A 4ZOLA 4OXSA 1ZAUA 2QWOB 2AEZA 1CAWA 4DV5B 4GWIA 2PI4A 2RS13 5LHGA 2QWNB 1QWRA 1AR83 3ZYJB 2X05A 1IBMO 1ENRA 1VEWA 3VDAA 5DM6V 1ZA7A 5FXXA 3IPVA 1J1LA 3WNLA 2NP0A 2F4VB 1SLTA 4JKKA 3NNLA 3VBUC 1VRH2 2YHJA 3POJA 4YVWC 2R073 3ZYGA 4MVMA 2H8PC 5E16A 2WAAA 2YGMA 2ZGKA 1ZBE2 1R1BA 1WB7A 1AB3A 3JD3A 5CFDC 4IETA 4OFGA 4CCDA 3OBRA 4P9WA 1XDCA 4XOGA 2D40A 4FO9A 3A0RA 4JHTA 3F7VC 4QE7A 3PDQA 1YTFB 1EZVH 2WC2A 1YJLA 1MMMA 1W6QB 3ZMVA 4BQ2A 3OUJA 3Q4HB 1W9YA 4JI2O 1AROP 2DVAA 4FFIA 2BOBC 1LGNA 4CEYA 1IOAA 5IK8A 2A7AA 4X8NA 4QGPA 3QO5A 1LECA 1AR92 5FAXA 1K73W 5FKCA 2R072 3FBMA 3EHKA 1SFNA 2VZ3A 1ZZ9A 2VULA 4IV3C 5CAZA 2FKXA 4U3JB 3GHMA 1SG3A 4LF5O 5GLVA 4B1MA 1STMA 5C3PA 2RV9A 2ZIMA 3K46A 5FXZA 2JK5C 1Q3EA 3CPWU 1UY4A 2GC2A 2DQ3A 2HP8A 3RJ2X 2C5DA 2HKXA 2JS5A 4W4ZA 4UUJC 3H8UA 3T1YB 1IQAA 4DB5A 2VVEA 2WPDG 4DUXA 2ZNJA 5H6QA 4QD2A 1YITV 1Z2GA 1NVPB 3E6BA 1EV13 4DV0B 3WW2A 3GB7C 5DUUA 1WLWA 2WZPP 1GFF2 2CDOA 1XHZA 1BMFG 2E63A 3RWKX 3BA9A 5LMNO 4YW1A 4NPLA 3LIHA 1RUF1 5L9BA 1QHTA 3IBMA 2GDSA 3H7YA 1RGSA 2EIKB 2PYJA 4Y1VA 4BPZA 4N90A 4JI5O 1VBB2 1XMOB 2PY5A 4G2KA 5FCCA 2BRTA 4JV5O 4QKFA 1P49A 3DTUB 4DV3O 1AYM3 4GB32 4JHZA 3KCCA 2O0OA 1CD3G 2WLKA 3L70H 2D3OW 3VL9A 3RYRA 2PAMA 3N9QA 1TNRA 1W0KG 2UWCA 2IJHA 4GWMA 4DV0O 2DOSA 2NN4A 4AHCA 2HH9A 5KC5A 1DQ4A 3ALQA 5FK8A 4IV3B 1JHJA 1NR7A 3S7IA 1JYXA 2Q5ZA 4NKGB 3T1YO 1W6NB 2EINB 2A0LA 2YMZA 5BNNC 1VP7A 3ZN4A 4EWEA 3LDBA 2RJKA 2PLV1 1VP6A 1V6KA 4IIJB 1E1QG 4DYLA 2EZOA 3B01A 1QMJA 4FT8A 4NO4A 2CDPA 2G19A 4Y33A 4L2NA 1TVKB 1PD3A 1IPSA 2VMIA 3ZXJA 4BOWA 3DKWA 1GZCA 5CA1A 1N3PA 4X8PA 1EBOA 4LH6A 1LODA 4ZIBA 3CC7V 4M3CA 3QO8A 1AYM2 2CGNA 4GB33 4W65A 5CNAA 2YUAA 1ULPA 1JZ8A 5D5PA 1RJ8A 1POV3 4FZ0A 3BALA 3GBWA 3BTXA 4GYCB 3KVBA 4WFBV 4JI6B 2QZ3A 2P4KA 4UCVA 1TUBB 1PIV2 5B1AB 4A7KA 3UL2A 5A32B 2EIKC 4CP2A 4Y20A 3VKOA 1ZBE1 2UUBB 2OQ7A 2HYXA 3QD6A 1CVNA 5JCOA 3HT2A 4DRVA 4LKFA 3LGRA 5LBEA 1N34O 4M4RA 2OT7A 2BGPA 2DCTA 1SLCA 3T0DA 1BT8A 4H14A 4E8CA 3MDSA 4CZSA 1WLTA 3ZFEC 1R083 4NR1A 1K3IA 1GZTA 2HHHB 1DYOA 3OGSA 2D44A 2YBKA 2FMDA 1H8HG 4BWOA 3RYIA 4R50A 1SFYA 4WM7A 1QBZA 3BRCA 2AC1A 4HBNA 3JU9A 4XFIA 1T5EA 2PHTA 4QHZA 1KS4A 5ACA2 5E88A 3VBOA 3WF4A 5IT6A 4JI3B 2H3OA 5IDJA 3H01A 1VMFA 2VQUA 3WD5A 1YQ6A 2PYLA 1O91A 3E5UA 1VBE2 4O2AB 1W8TA 3C90A 2IXJA 3G6BA 4DUYO 4CDQC 2HHHO 4JTCB 2ZKLA 2GNDA 1C1LA 4OVEA 4FVMA 3JATA 3DXRB 2D3SA 1KQSU 1YHQV 1TMF2 1XXNA 4HZFA 2NR5A 3CCJV 5E79Z 3JBG3 1UYXA 1ND3C 1OVPA 4XYXA 1PV0A 2HWC2 4YW5A 4UFHA 2ZX0A 3C2UA 2P6JA 3N7KA 4CH3A 2N05A 2AR6A 4QU2A 4Y22A 1ROPA 3WXPA 2M6YA 1A78A 2WINB 5FY8A 1FOD1 4CH4A 1NY71 3ZN0A 2VU9A 4IESA 5C4WA 2XOMA 2YS8A 4AGGA 4PDVA 4H13B 4QGNA 4YW4A 5IW0A 4JCKA 5CISA 3P30A 5CADA 1SDDB 2BE3A 4CDWA 5A3TA 5IK5A 5A6XA 4DUYB 3N7LA 1UZWA 2XAGA 1WLDA 3ZRVA 1DZTA 2UXCB 4XZUG 2BW8A 2VZUA 3AZXA 5A33B 5GJ6A 2X7RB 1V55C 5KXCA 4GKXA 3OUHA 2YBSA 3JBG2 5A70A 5HCFA 4BLIA 5FL7G 1MS1A 3SCFA 4EN9B 1Y7BA 2R0FA 2D93A 1AJQA 3M3CA 5JR7B 3UM7A 4FPGA 2ZMLA 5DG1A 5EC1C 1OQ1A 5CA0B 1JU3A 2IH1C 3GWOA 3D0JA 2VOKA 1NAEA 3MI8A 5KXDA 2Y48A 2N74A 4I0XA 1UZVA 1KD1W 1APNA 2DFCA 1CN1A 1ENQA 1OKOA 3CO2A 1JUHA 3FB8C 3NNJA 2PMWB 1NZCA 3VHOA 1IBLO 4P14A 3O1MA 1WAZA 4NAMA 3CJHA 1WP7A 2B5UA 3U14A 3WQ0A 1SF9A 4JYCA 2B46X 2LO1A 2OXBA 3ML0A 1AL21 3B00A 3MHZA 5F5AA 4O4HB 4ASMB 2YDEA 2E7AA 2HKOA 1WUVA 4BK4A 1XNDA 3IMMA 1BLZA 1D5NA 2F4LA 4BK5A 1OQEA 1JJ2U 3OR6C 1MEC3 2OWOA 1DGLA 3UJOA 4COYA 4XJUA 4P5YA 4KG0A 1JCHA 3ROUA 4CC6A 4XDKA 1ZX5A 3KD4A 2CE4A 1AHSA 1C8NA 5FPOA 2XUEA 1CEZA 5IYBO 4YJ2B 3T4DA 2ZIOA 2Y4UA 5EBLC 2WS93 3P1IA 3UKVA 1VAKA 2WLIB 3I54A 1PNLA 2RM22 5FWJA 5FO8B 4RUFA 4Y26A 2K1EA 1WMDA 1HV1A 3ZRXA 4D6TH 3RRDA 1NH2D 3WQ1A 2CH7B 3I2DA 3ZPOA 2I2SA 2G4IA 1F8VA 1F4HA 1OF4A 4AHYA 2IJKA 1MZEA 5JH7A 4CCKA 2WNVC 3HBKA 1COV2 4FLWA 4Z2AA 4LOSA 5K0UB 1NUKA 1GZWB 1IZ3A 3PVOA 2VG9A 1QDCA 3X2QC 1R091 5BYNA 3RNSA 3AG3B 1BKZA 2BWCA 2AACA 3MIFA 3AG4B 4CSWA 1EAH1 1IG3A 2Q67A 2BZDA 5JH7B 2P3YA 3EVKA 2AYHA 3INAA 1Q8SA 4JGSA 4UFKA 3ZFGA 3MD0A 1AR82 2FYUH 3M2MA 1UNBA 1QNWA 3RYPA 3HR9A 1S0JA 3IDEA 3F5TA 1ZA4A 3UKMA 4MZUA 4EB6A 3U37A 1VQLV 4QXBA 4PBOA 4XBLA 2W47A 2WWUA 3K59A 3AL6A 4OQ8A 2GP3A 3KM5A 1JA8A 2ZXQA 3WDUA 1XNTA 3PMSA 4AAPA 2HEPA 5LA1A 1S3JA 1SQXH 1XOYA 1SPPA 1Q8QA 1I5XA 2ZT9B 3VB9A 5KXEA 2VQEB 4IERA 1JHNA 3AK3A 1PO13 1NG0A 2IUWA 4Q29A 4O2BB 2JEUA 2ZCWA 3CS5A 3TYJA 4IGQA 1NTKH 3A22A 5H9SA 5BMVB 4YGEA 1IBMB 2ZX4A 1K33A 1N1VA 2E31A 4A2UA 3THPA 4JTAB 3Q9OA 4LMFA 3L9DA 4FPCA 2WNVB 1MG1A 3GJAA 4MG2A 4NUBA 2X29A 1TMF1 1R73A 1Y9MA 4XDOA 3TEXA 3T1LA 4QX2A 4YVWA 4XJ9A 3DECA 2Q73A 3CHXA 1S0DA 2ZNIA 1V6MA 4AHWA 3BUCA 4XHBA 4MXWB 3AG3C 4UB8Z 5JMOA 2HJIA 1B35B 4JGYB 4FFBB 2B9ZA 2R6QA 5T5LA 4AL9A 4Q20A 4GALA 5FZ6A 2P5BA 2R043 2WN3A 1IS3A 1UMIA 2G1MA 2R7EB 5FZIA 3E35A 2OCCB 3W7XA 1H1MA 4Q4W1 4GA9A 4NIDA 1FFXB 1BZWA 1HIXA 3CRAA 2ZHMA 4MTXA 1GMGA 1ASJ2 1RUJ1 4G28B 3SH5A 3KCYA 1CZSA 5AG2A 5FDBA 4A3ZA 4PA6A 2QVSB 5EIBC 2D6OX 3I3DA 3JD71 1TVGA 1BEV1 2JS3A 4DV2B 4FTEA 3E83A 5CFCB 1M9NA 4DUVA 1FJGO 1VBE3 3HKBB 2JENA 4X8AA 1AL0G 1AJNA 2MW2B 1NCRC 2DCJA 2QQPA 1UO9A 2RJLA 1VAVA 2F1MA 5C3SA 1NZ6A 3WQ7A 1F4NA 2HJFC 2Q7GA 2VQTA 5BXXA 2JG9B 3KV5A 1XBLA 1TMF3 1KB9F 1RUG3 2BBVA 1VQNV 1DZRA 4D0QA 4QPGB 4DR6O 4DUWA 2RVAA 1JW6A 4D69A 3LKJA 4FFKA 3UKTA 1OFSA 2ZR3A 4D8MA 3AKPA 3RGBA 2QM7A 3THCA 3FWEA 3DC6A 3CD6V 3N36A 1I5ZA 1ENXA 3I49A 5F8PA 5HPOA 1AR91 2XG3A 2A06H 1WZXA 3M8LA 2DCZA 5C3OA 3ZSEA 1TAEA 2B9UA 2PZSA 1HNZO 4YLZA 2W9XA 2VCAA 2I07B 1AR81 4IGPA 3POWA 4DPNA 1V6JA 2HJDA 1FI2A 3POBA 1EN5A 3IKWA 3BCCH 1EM1A 2JE9A 3RMXA 1CZVA 5JZGC 1R1A3 1HQWA 3K4AA 4KBBA 1FXKB 3WW3A 2D43A 3AVSA 3OF1A 1AXZA 4U36A 5BMVA 1GO3F 4K8ZA 4YPJA 4NTWA 4ZOLB 1HQNA 1CQ9A 1GOGA 1PGL2 4Q1PA 3CL1A 1VIBA 2E9QA 1BL8A 1FPN2 5CZKA 1W2BU 2Y0OA 4AXOA 3K03A 2KA3A 3VQXA 3T1HB 3SYAA 2ENRA 4YHHB 1J59A 2PI5A 4YGBA 2WLLA 2A6VA 2UY8A 1GN3A 4YVSB 3SPJA 4Q2FA 1NCRB 3GALA 3K5OA 5DUXA 5B5EZ 4FLYA 1RC6A 4BCUA 3WUDA 4AFMA 3ZPYA 3I97A 4QDQA 2YIDA 4MGQA 4PI2A 3V0BB 3ZO0B 3L74H 4UVBA 5F5QA 1HJGA 1J3PA 2VOWA 2BTOA 4JGZB 3KF3A 2RDRA 4LXLA 4CDQB 1YFXA 3C3VA 4M3CF 4LKEA 3KB5A 5FYYA 5LW9A 4ZZ5A 4QJFB 2CV6A 3J4UH 4CBCA 3SPIA 1V6LA 2LRPA 1NA1B 1RPRA 5ABJA 3GDBA 3ACGA 1W8HA 3I2IA 3SPGA 2Y0PA 3WDVA 2BOCC 3BU0A 3L2YA 1F7YA 5I91A 5A7WA 5L19A 1SBFA 5DN6G 2GN3A 2HFEC 1V00A 5FY9A 3WNXA 2C4XA 2DWEC 3F2ZA 4YFWA 4AEJA 2UYBA 1LGCA 1MZ5A 1F23A 4JTOA 4AHXA 1C8M3 2XASA 5E1AC 1NQTA 2VXJA 1GP5A 2ILMA 1D2QA 3GBFA 4BMEA 1PZ9A 1DG6A 2RM23 4ASKA 2XVKA 2IBZH 4HVOA 2MK3A 1WMEA 5JCOC 4P9LA 2EXHA 1U5IA 4E4DX 2DW4A 3H3LA 4DS0A 3I2FA 1OC1A 2XGXA 3V64A 1FYJA 3AP5A 4YZ1A 2Y60A 1KFXL 2C1FA 2OTLV 5DMYA 1QVGU 5FMBA 3WW4A 1HNWB 3F7YC 1QF3A 2AZ2A 1ZBE3 2QBXA 4FPYA 4FPKA 1QU0A 4Q0VA 1FYUA 3PIJA 2XL9A 4QKDA 2WWSA 3RYHA 2GH2A 1V6NA 2VMGA 2FD8A 2IU0A 3E8FA 2D97A 4BQ3A 5L9RA 2L35A 2HEVF 2X5IA 2LFSA 5L3BA 1C8M2 1AX2A 1KITA 2D5HA 3RFRA 1LHUA 1NXD1 1QJU1 1S2EA 3D4KA 3OBTA 4I09A 1EN6A 1OCRB 1OCCB 3OMIB 4MVZA 5CG9A 4QMAA 3PUSA 2GNBA 4FM0A 4Q4Y1 2QJVA 4DR1O 3AZZA 3LB9A 1J3RA 1V9U3 3BIWE 2DUQA 3BY6A 2J1UA 4P2ZA 1H8TC 4MVQA 2DYRC 4JDOA 5GM0A 4AVBA 2QQVA 3ABKC 1H4GA 2KSDA 2JEMA 2JGDA 2XMLA 3HPNA 1PO12 4YW6A 3FHAA 4MO3M 2VW2A 2PAEA 3OYWB 4JI2B 4NWWA 5IYZB 3JASB 1CP9A 2CK3G 3ZMZA 1PGW1 1VQMV 2J1AA 5E89A 2OVUA 2EIJB 2G38A 3U78A 3VBFB 5L3FA 4CU7A 2ZPXA 5FPAA 5A7OA 3E5QA 1XUQA 2WUHA 4MGZE 4Q0PA 4RN5A 3ZMTA 3T1CA 2D7FA 1MPXA 1FD9A 1O5UA 2XVGA 1BVP1 3VHNA 3NO8A 2NNUA 4LBNA 5F9TA 4B3TO 2ZAHA 3I55V 3B4SA 2ZEWA 4LNVA 4DY3A 4XFHA 5FLIA 4CEYB 1PK6B 4KUMA 1Z7S2 2VOXA 2B8MA 4NIIA 1W6MB 3BVCA 2ZXWC 2BV4A 3LSUA 5JXJA 4SLIA 5KAFZ 3FZ3A 2R72A 1OCRC 3AC0A 4XF9A 1NE6A 2XJVA 2XDVA 4L8JA 5L3EA 1RITA 3R4UA 1CAUB 3VQVA 4J6GA 2RS11 4TXWA 4TWTA 1RUH2 3JB4C 3HKCB 2DF7A 5FPXA 3K77A 4NPRA 3NNFA 5FZLA 1Y74A 4M00A 5FREA 2VC9A 2ATFA 3FAVB 4DXZA 3QACA 1KYOF 2JJ1G 4KXRA 4JQRA 4H37A 4RA0A 1VAMA 4GD4A 1UN1A 3LWCA 5LXTB 3B7MA 1CPYA 2JJ6A 1SPPB 1HXS1 4LP8A 3SYQA 4LUMA 2XBO2 5APAA 1W0JG 5LY2A 4XJWA 1BQZA 2PF4E 5AC92 4NAOA 3VBFC 2OCHA 1R3IC 1ONAA 4FTBA 1RUG2 1TME2 5B66Z 3WY6A 4Z1VA 3BPZA 1DGWA 4ATEA 1RUG1 3HAGA 3ETDA 4O61A 4Z92B 1ALYA 1X50A 2EIBA 1MQTB 4Q4V3 3FB5C 3K9SA 4AVCA 3FLRA 1GUIA 4L87A 3JZVA 4JI8B 1K97A 1ZRFA 1UZ0A 3EXAA 1OD5A 4N43C 1ST8A 4DR2B 3P5BA 4JVAA 1KD7A 3ZS8C 3DGTA 1QXPA 3IAPA 2E53A 2P7TC 4MW3A 3NL1A 1GN2A 3E22B 5KMGA 3P3NA 1VBD3 1ZUQA 2VL4A 4J10A 2K2SA 2VPVA 1ASJ1 1IBKB 1RUJ2 1SQFA 4QPKA 3CQOA 2VUDA 4MOAA 4A4AA 5JSPA 1OH4A 4A7YA 2PFWA 2PHWA 1O59A 5CEHA 5LOVB 1Y43B 2VMEA 5KMGB 4LCUC 1KQRA 5I8YA 3HKDB 4WZCA 1O5LA 4I55A 4GLXA 3ZYIB 1BK1A 3QO7A 3I3QA 1PM7A 1UY3A 4IEXA 1EY2A 2XR4A 3NSTA 1NXMA 2ZEYA 1XYPA 2W6IG 5HFLA 3Q8FA 4HT1T 1N34B 3G7DA 4DNYA 4NIGA 4X6QB 4O9EA 2P22C 4LFBO 4S2DA 3ASNB 4YM2A 3BB6A 1N36O 1WLCA 1U97A 2ZE5A 1G9BA 4CC5A 5F3GA 3B8MA 3NKGA 4DV5O 4HETA 3R65A 5AFBA 2CTVA 2RM21 4S2GA 3RYIB 2LM3A 4F8AA 2VZTA 4IE5A 1UMHA 2OUJA 2F43G 3E6DA 2D6NA 1HKDA 4UCSA 4JI7B 3UO2A 3D3QA 1O3SA 4QT6A 3S5AA 1I94O 4OX9B 4D6RA 4XEZA 4RGGA 4W6WA 3K3WA 3I59A 4LORA 4B08A 1R093 4NHMA 2YFZA 2DYSB 1RVF1 3N2KB 3EO6A 3IJ4A 2VZRA 3UNPA 3I56V 2HWC3 2E3CA 4YJ3B 1VMHA 1QIQA 1K5SA 4EFEA 3ZEDA 4BWAA 1WW4A 4KWJA 3GM8A 5JZGA 2GSYA 3B8NA 2E74B 4QM8A 3LOBA 4LF4O 4DW0A 3B94A 4JRAA 4IEUA 4YIPA 3UETA 1ZBA3 5KXBA 3USSA 3TEWA 3B2EE 4YNIA 5FZOA 3LFMA 1NKGA 1W9FA 3BI3A 4HNAA 3APQA 1QJX1 4CDUC 1UMZA 1S55A 3ZOIA 3CEWA 3KS7A 1NLSA 3ZRWB 1RMU1 4EN7B 2Y6LA 4Z8BA 5A2QN 4OCTA 2BTVC 2GMMA 1REDA 5EJ1B 1Q8OA 2H0VA 3R4DB 3ZXFA 1AXKA 4R52A 1ENSA 1YYNA 2ZD9A 2NPIA 1OHFA 1BVVA 4ES9A 5FO9B 1HB1A 1F4MA 4HNAB 3WSOA 3JQWA 1YQ8A 3N2KA 4IGOA 1S5LZ 3RYFA 1FS0G 1RSOB 2AUYA 4XABA 4IL7A 1BBT1 2OPWA 1UOFA 3JUUA 4FBFA 5JIAA 1IKPA 3DKQA 1Q8VA 3AYEA 1YXWA 5HXVA 2EX3A 2OPKA 5FP4A 1VRH3 4PA4A 2O8QA 5EIBD 3PL0A 3JAMN 3D36A 4IEQA 1SRYA 3SGIA 3WB0A 5DG2A 1RXGA 3ME2A 3N9NA 4K1YA 4RHV3 3WX5A 4I0WB 4QKBA 3NJXA 4FM2A 1MZFA 1LGBA 5BY1A 4I2OA 1M93A 2Y38A 4DV7B 1HB2A 3JD72 1BZKA 4MVUA 2WBKA 1JMUB 2BNNA 2UXDB 4OMCA 1RUD2 3WOGA 4ZHQA 2EILB 5B1OA 2WNUC 3LSSA 1PM4A 3LA2A 2EIDA 4KGGA 1GP4A 5GTHZ 2TNFA 2XJPA 2V09A 1W2NA 1W39A 2RDNA 3J7LA 4GB31 2C2AA 1US3A 1N0JA 3W5MA 4UCUA 5EC2C 2UURA 3H1YA 3GF6A 4NOTA 4UVCA 4FLVA 4PV1B 3K57A 3KVAA 3C7OA 1ULEA 3U1XA 1X36A 1W06A 3HB3B 1VQ8V 1XPWA 3U75A 3EMRA 2A79B 3KZ4C 5BY5A 2DUOA 1OI6A 2B7YA 4UBHA 3BFRA 1REEA 1S77D 2UXBB 2BDRA 1S0FA 4P9GA 1AI5A 1P84F 5A1FA 1GU3A 3JAWA 1PGSA 1XNKA 1RUD3 5GZFA 2D6MA 2ZM6B 4TV9A 1HRI2 3OPZA 1FXZA 1GZ9A 3BPSA 4FPHA 1H8EG 1HLCA 4UF0B 1O4YA 1KEXA 3SNMA 1SCSA 3H1WA 1SQPH 1AR73 3JALB 4N53A 3O1SA 2VVFA 2CTWA 5LZ6A 4LBEC 2JDIG 4XBQA 5A7SA 1NTZH 1M57C 4NRMA 4BA6A 1ULDA 3VBUB 2B1IA 4LPLA 5C9AC 2J1RA 1XNBA 1JJOA 1ZTEA 4XFBA 3VD9A 1X4TA 2E5LO 4DR2O 4OUSA 1RSOA 1MNGA 1CJDA 4D7YA 2EILC 3M7AA 2AREA 4K20A 1WW7A 1DGRN 5IAVA 2VQ0A 4FOQA 3MZHA 4YM0A 4O4JB 1LHOA 2WNEA 3HEIA 1PIV1 2EIJC 5BPXA 2YB7A 4LHNA 2QGNA 3ZHUA 4QX5A 2WNVA 1ZSPA 3K3NA 2H6CA 4CCCA 3RT3C 3IAYA 5A1LA 4XDQA 1FXKA 1EAH2 2ZHKA 2FDIA 3H8XA 3JAKA 2UUBO 1AX0A 1DQ0A 3MIHA 4FMTA 3JSNA 2WLNA 4KWUA 3U4XA 1AR72 1QJZA 2ZQMA 3K5NA 4PDRA 2LJ2A 2OS2A 4YFZA 1W6OB 3HT1A 4KWKA 4J1WA 1UYPA 1NTMH 3D5OA 4FLZA 2RDSA 4IQPA 2OYZA 3SQOA 4N21A 3AZVA 2DN9A 3ZHTA 4KMQA 1WA8A 3TNQA 3U10A 1HB3A 5C3RA 1F5FA 3HWJA 4W8JA 4NE9A 1UAIA 3QH6A 1ZYBA 4WM7B 4XDJA 4QX1A 5C4WC 3MFAA 3C7HA 2XOKG 1HRV1 4CCNA 4BQ1A 1JYIA 4P02B 3G4SV 4Y1UA 4KL1A 3TXQA 5CBGA 4AR2A 3TN91 1RUOA 2HEYF 1RMU2 1URXA 2KKWA 5FZ4A 5A3WA 1UIJA 1QU7A 5FPUA 4EE2A 1PIV3 5JPMB 5F3IA 5BNOC 3KHBA 2DTWA 2Q1FA 5K0UC 1WBFA 5IT9N 1PZ7A 1UU5A 1N47A 1ZZCA 5FP3A 1DP0A 3KGLA 4FOVA 4OQ9A 4RFRB 2PAKA 3LPGA 2IXLA 3EQEA 1NH2B 3O12A 4FK5C 5D1IA 4DV3B 3AFGA 3HKDA 1I08A 1A8MA 2KM2A 1GNYA 4JV5B 5FY0A 3RI8A 2Y0IA 4TYSA 1QVFU 1A32A 5DZGA 5JJJB 1ULGA 3BOPA 2VMFA 2BBAA 1VF6A 5LBBA 1LUVA 2A3YA 5KHHA 2FTKA 1KECA 3SYPA 5JJNB 3HVDA 1JH5A 4JYAO 1ZRDA 3GZAA 1O3RA 2PLV3 1OPMA 2E51A 3SLIA 4RWUA 5J2UB 1NKDA 4CDWC 4OI0A 3QBQA 3DCQA 1SLAA 5HV4A 3SJCC 3NKTA 5F2SA 3LDEA 1RUI1 4ICGA 2Y64A 4WM8C 1DQ2A 2XJRA 2A6ZA 3KZIZ 3NV4A 1HW7A 3SYCA 5C8CC 3ZYPA 3BODA 5EWSA 1R64A 1RB8G 4J25A 4YWAA 1AI6A 4GCZA 3VDDC 2XWBB 2XBO3 4PDWB 3ST7A 1UYYA 2DYCA 5AC93 4X1KB 2ZZJA 3APBA 2WA3A 2EA7A 1NQJA 5J2TB 4LF6B 5JR2A 3TGUH 4KI5M 3DN7A 4JI1B 4X20A 4LF5B 3DPRC 4XQDA 5LATA 4TUYA 4NPMA 4BM8A 2WKKA 1F2NA 3GWKC 2J1SA 3K04A 3J7AU 2WLQA 1JZ6A 2VUJA 1QJU3 2ADPA 3MW3A 2VAUA 2W1WA 3ZBHA 3AG1B 1QQP3 3ASNC 1LR1A 5AVPA 1I94B 2HWC1 3NXSA 4PT6A 1LHNA 2VZOA 4I02A 1KU9A 2IWGB 4JC1A 4LHKA 3SH4A 4BIOA 4AI9A 4NTYA 2QFEA 1S1AA 1JOJA 3WP6A 5K0UA 4R9CA 4UBGA 2JDHA 3CRCA 1LOBA 2ZE6A 2AH2A 1PNFA 5F3EA 3K4ZA 5FZ3A 5IJ9B 3HMYA 4GKYA 4BQ4A 1BCCH 3M3QA 2R062 3JYCA 5T55A 3CZUA 1CX4A 3FUQA 2DUPA 4FXKB 5JLVA 1AVMA 1D5AA 1ZM1A 1FV3A 5D8AB 1HR0O 5LHHA 5JQGB 4E4SA 3AKQA 3C3SA 4LBQB 2Q9LA 2ADEA 3T30A 3H3ZA 3ZFEA 1Z5VA 4COWA 3D0SA 5F39A 1JTZX 5KUKA 1PNMA 5CFCC 2QDNA 2ETEA 5CU1A 5ISLA 1MS8A 2O57A 1QQP2 2EICA 3WG2A 3ITQA 2BYVE 1WW5A 4FJCC 4ITCA 4ZBMA 4X66B 1WD4A 4LKSA 3P32A 3KV6A 4XHXA 1N3OA 2PHDA 4JI3O 4L9BA 2SLIA 4HMZA 5IJRA 3OGJA 4OZOA 1DQ1A 3V56A 3SITA 3EJKA 2YPJA 1KFUL 3ZXAC 3O0XA 4COZA 3ES1A 2VY0A 4X1IA 1RUC2 1FXVA 4ZY9A 5LCWL 4OUEA 1Z7S1 3N9OA 2EIEA 2IJJA 4ONUA 1BMV2 2AZ0A 2DVDA 3ZRWA 4C0HA 2WR9A 4HK9A 4RAIA 2YV8A 2R061 5I8SA 1YFUA 4AFDA 2XJQA 4NWVA 3RG0A 1GP6A 1DBNA 3WNMA 5IE9A 2P3JA 2RR13 3IT8A 4FQ4A 5LK5A 1NQDA 4CP1A 4X65B 4YVWB 2WZEA 2DCKA 3LSQA 3WDTA 4JI0B 2MHFA 2GBOA 3SJAC 5HV0A 3I7DA 3K4DA 4MVRA 5L7OA 2ID4A 5BNNA 3C3TA 3TBDA 4QX0A 1OUXA 1MZ6A 1OLQA 5IYYA 3JARB 2BFUS 5FZ1A 1OA3A 2ARAA 1SLIA 1AR71 1H8TA 3MBWA 1EN4A 4UXNA 5LB6A 1QLNA 2CSGA 4YGDA 1YI2V 2VECA 1RUE3 3WP5A 1IGOA 4OLLA 1SA0A 2Z3YA 2HLDG 3WDXA 3H1KH 5DUWA 3OR7C 5IVBA 2JGUA 2ZGRA 3J7HA 3AMPA 2X5IC 3TJTA 1T6GC 1PM9A 1H2NA 2X6BA 4WFGA 2XAFA 3M7MX 4LIUA 4UB6Z 3WG7C 3R66A 1GM9A 1KKCA 2LS6A 2F17A 4XJZA 5J98B 4A42A 2JXAA 5BNPB 4KWLA 1YO8A 1OHHG 1QLEB 2Y33A 5SV5A 2QKDA 2WLMA 1XL6A 3OGIB 2P37A 5L9VA 2ADDA 5CFDA 4R4XA 4GH4A 1ZZ7A 1VBC1 3CRRA 4FPLA 2LFRA 1JYVA 1QXRA 1E79G 2ITCC 1S2KA 3EB7A 2XUMA 4Z82A 4XILA 2ET7A 3PIGA 3KF5A 1BJQA 2YPDA 1RUE2 1W8WA 4PLNA 1AR93 3MYXA 1LOGA 1LCLA 4LC1A 4RHV2 1NOVA 1R3JC 1W28A 2ZAAA 1W05A 3A0NA 4LK6A 3VLBB 3OEEG 2GSMB 4GKJO 1NCQB 2XAHA 3PNAA 1WCKA 4TV9B 1RM1C 4HANA 3MICA 4FAHA 1O4TA 3WF2A 3PUAA 4AEDA 4DOUA 4PF1A 1DIWA 3DL3A 4J9YB 4FPPA 2P2KA 3KSCA 2UUCO 4YARA 3TK1A 1EUUA 2ZGLA 2WWJA 2ET1A 4PIXA 5FPLA 1O8PA 3PURA 4LHSA 2W0XA 2W1SA 4Z1MG 1XRUA 3FFQA 1LTEA 4BW9A 1S5HC 1EV12 1V54B 2HG5C 3BHPA 5IUQA 2Y8KA 4MGTA 3UJQA 3MLKA 3AMNA 5FXVA 4LLFA 5EV7A 4D6QA 3NR7A 1UY0A 5KAIZ 4PDMA 5KA6A 1N1SA 3A4UA 2NN8A 5BNNB 3N7JA 1TME3 5DAXA 4BQ5A 1I5PA 5LK7B 4OHYA 2P4VA 5H2FZ 2ITDC 1HNWO 4J7JA 2A6WA 1YC61 1W03A 3ZFFC 3AK2A 5A7QA 1QQCA 4J9ZB 1HRI3 3LCPA 2PLV2 4X1IB 1W8ZA 3ZMNA 2VE1A 2DMXA 2JG8B 1G8WA 1AJOA 5L73A 3OCPA 2YU2A 3NV1A 1TA8A 4KH9A 4Q26A 1LNQA 4JF3A 1QEXA 1C8M1 3QG5A 4JPRA 2FCVA 5I0SA 3LUTB 5FNVB 1L0LH 1HDKA 2ZX2A 1MSDA 3UGGA 4E4ZA 5BNPA 4RQPB 3FLTA 5B1AC 3WQBA 3VHRA 2KD7A 2XLAA 4XXPA 3OY8B 5GW7A 1YXBA 4K0KO 2ZHNA 2LP7A 4MTOA 3E2EA 1OMIA 2ZM6O 5GTIZ 1YJ9V 1TGOA 4AFCA 5BXZA 3ZHVA 3WB2A 3ZFFA 4MSWC 4TN7A 4CH6A 3ZDSA 1H1AA 4FI9A 1OSGA 3GZTB 2XB6C 2Y69C 1XB9A 3THOA 4YGCA 1OVSA 4MADA 2RN9A 5CG8A 2Q7EA 1IDSA 3LEGA 4K6BA 4LFAO 1F35A 4AVTA 4AQ6A 1PO23 3I2HA 1VQOV 5FUNA 1JOPA 2OT5A 4ZONA 2QNKA 2FDGA 1XYNA 4P00B 1LOFA 2WYSA 5T52A 4L8QA 4X64B 2P5OA 4ZXKA 4XMAA 1AR63 1AL23 2WAOA 2XAJA 2YSUB 1D4VB 4XCBA 5D5QA 2JDYA 2IFRA 3MV01 1SMVA 2XBO1 3AG7A 4DR4O 2EVXA 1SFPA 5I0DA 2ATKC 2FCTA 2RS52 2QZ2A 1M06G 1GOHA 2OCCC 3SMHA 4JZ2A 4E8DA 5CB4B 4GMP1 4AEDC 2VJXA 5TISZ 4ASLA 2AEYA 3QTCA 4F6RA 4LBKA 2RMKB 1H6XA 2CNAA 5K4LA 3VZLA 1YFYA 4ZS3A 4LR4A 4COUA 2P6HA 2B4KA 4X65O 1OLMA 4DR7B 1AP6A 2WFF2 2LALA 3VQYA 3ETEA 4KQ7A 3DF0A 3KG2A 1GQPA 1QY4A 2GN7A 5KLVH 4PDWC 4QWNA 1W0PA 3ZXDA 4FLUA 1RUNA 1M1KW 1EPWA 1NCQA 2BSKA 4ZKIA 2JG9C 4MHRA 3FB7C 3L2HA 1RPOA 3VN4A 3IC7A 4TUYB 2ZGOA 2ZGQA 1UX7A 1GKFA 3K3OA 2WA4A 5FUPA 1YFWA 2LROA 4PDLA 5GONA 5JOZA 1W3XA 4TLGA 4RS5C 5G05L 4CUGA 2HVJC 1XREA 3R05A 2JDMA 3MLLA 3WF3A 2VMCA 4EN0A 1IX9A 2W1UA 4Y1XA 3AMMA 1POV1 1N8RW 3K51A 2K46A 2H6BA 2ZCEA 4MTGA 1VJ2A 1H2MA 2IJIA 4QNHB 2A7WA 4EZ4A 2XT9A 2Q1MA 5IVJA 1G6UA 3NJZA 4SBVA 4XDLA 5IYCO 2GZWA 5JZGB 4H7MA 3D8CA 3E97A 2J1TA 4DINB 4X62B 4FLXA 4GX5A 4X1YA 5FMDA 4IL6Z 4AEDB 1RUC1 3TEYA 4AQYB 3WFVA 1UKRA 2D6PA 4QIWF 3WCSA 1H6YA 2VTXA 4LO8A 5IK7A 5IYZA 1CGPA 4QB2A 2FQPA 4BE3A 3ZFGC 1JS9A 3VD4A 4UFLA 4LA3A 4PQQA 4CUAA 5IY5C 4B4QA 4YVSA 1K12A 1YTFD 4OI4A 2JGDB 5B1BC 4PJYA 3K9AA 2C26A 5I8TA 4JI6O 3BVOA 2M7WA 4CEWB 4F3JA 3JCIA 1OQDA 2VCMA 1VARA 4EQVA 2R041 3UT5A 5ANQA 3NAPC 3ILNA 3KQRA 5GLWA 1VBD1 2NLRA 1SKVA 2F6BA 1CONA 4QQLA 4B3MB 4JYAB 5CBLA 3VBRC 3N27A 3T2OA 2CAVA 2J42A 3BKZA 3ABLB 5FPBA 3N4MA 4UXAA 3OMNB 1RHI3 4MUVA 1ZZBA 2DYSC 1SC5B 4XPVA 3WNNA 4H44B 2QQIA 2A73B 4I7ZB 2WDBA 1BHBA 4UFJA 4ZXEA 4EB6B 5LYJA 4HVQA 1WNSA 5J96B 5JCTA 4HKOA 1RUI3 3WINE 3OTFA 4LIVA 1I9RA 1C1FA 3Q8AA 4JZGA 1S76D 4XXAA 3B77A 5FLJA 2RS51 3LSEA 1WCQA 5D2AA 5CFCA 2W87A 1OLME 2BNMA 2ZABA 4FPEA 1LAJA 2QKSA 5LBCA 3JD4A 2WQ4A 3AG2C 4Q0UA 3T2TA 1DGWX 1WPXA 4LWSB 1FPN1 1SHWB 2XVLA 1DHKB 2GAUA 5A32A 4KNCA 5F6LB 2XL7A 5BZBA 5DDJ3 4O65A 1X9PA 2BSKB 1A8DA 2VW1A 5C5TA 3FYIB 5CA3A 3W9AA 3ZVXA 5C5UA 1RUI2 5D8AA 3WV6A 1VB2A 2XH6A 2W08A 1PVXA 4CP0A 4P5HA 2WT2A 3W20A 4HKLA 2VUCA 1XJAA 5EP9A 3O1PA 1OCOC 2E76B 1G1XB 3EBRA 1RUH3 3LIGA 5IVVA 3A23A 4JI1O 1QLEC 3RN4A 2QTWB 4LBJA 1MEC1 2A3XA 2CDYA 4JQTA 4AQTA 2VOVA 1EAH3 3W21A 2J22A 1D2DA 2B42B 2O14A 2RMU1 2FDFA 3SYOA 5A7NA 3SH3A 1MABG 3OFNG 1W6QA 1SCRA 5B2GB 4LO6B 5J36A 3W7TA 3QVNA 4JI0O 4JRLA 3RYFB 4LWSA 2ZKNA 4AAXA 2V4VA 2J7MA 3E8HA 1KUQA 1XL4A 1P7BA 5CB7A 5IATA 1CWPA 3ZX7A 1L8DA 1H4HA 2HWB3 1Q82W 1FNYA 5LEKA 4X20B 1XU1A 2ZGUA 1D7PM 1VBB3 1H30A 4YXWG 5GZEA 2EF6A 2FCUA 3MIDA 1LR5A 4GQ7A 4OPAA 3LD8A 5K1XA 4B3NA 3ACLA 3D82A 3DXUA 1K9MW 1TME1 2XKOA 1NLRA 2Y6KA 3UO3A 5LY1A 1QQP1 5GZCA 4UFZA 3NVCA 4YW7A 4NHKA 2VZ1A 2AW9A 4K1ZA 1IS5A 3SR2C 3ZXKA 1U96A 1IQDC 1DF5A 4LE3A 2QQUA 2XONA 4X1YB 1RUF3 2QKCA 2Y6GA 3LNMB 2ORZA 2Z79A 4CCMA 1KDKA 1HV0A 2NQYA 3ZIAG 4WBBA 1X8MA 4HYOA 4YRDA 2ZZQA 5FKBA 4JZRA 1ZVFA 2B1GA 5JJEB 3LDKA 2X8KA 2Y26A 4XUTA 1I6XA 2AGSA 3I3EA 3J7MA 3FX3A 2HWE2 3CE2A 3OEAA 5LOVA 4UFIA 4HPKA 2GC3A 1AP5A 2PHXA 5EIYB 4WM8B 5L3CA 4AGVA 3NWKA 1YI9A 3WDWA 4AILC 4DR6B 3AYCA 4ES8A 1C28A 3GBGA 5C3QA 1OV9A 3WLUA 2EXJA 2Q7HA 3KLSA 2WLHA 4URAA 3LE0A 3CCSV 5ANNA 3AKTA 4XBNA 2JB8A 1OURA 4LITA 1CAXB 1Q81W 2P34A 3HIFA 1YWKA 1US6A 3A21A 1M57B 3USUB 1CZTA 3POEA 5C8YB 3CJXA 5FP8A 1SQVH 3DPRB 4D7TA 4WV8A 1Q6HA 2WO7A 4MGIE 5AC91 4JI4O 2WFF3 2RG4A 3E8BA 2GUZA 4W50A 1GTOA 4GMP0 4R9AA 3USUA 2VTFA 2RQ6A 3VZKA 1HWYA 1VQPV 2ES3A 5FZHA 1UY1A 3NQHA 1DTOA 1ND2A 2D6KA 3CC4V 3MO4A 2GV9A 1Z7S3 3A7QA 4ABMA 3BOWA 1E1RG 2BFUL 2W95A 5FYCA 1GNZA 3WNKA 5FNVA 2ZOEB 2X10A 1O4ZA 1UF2C 2JKBA 4RR3A 1FOD2 2CWMA 4MTFA 4LBLA 3K0DA 4CTEA 3DXTA 5T54A 1AJPA 3AP4A 1SDWA 3LEMA 1JVMA 5EBWC 4JI4B 1QJU2 5D8AC 3NJYA 2K0GA 2XLGA 2ORXA 4P9XA 4R4ZA 3ZXLA 5F5CA 1WCDJ 2CTPA 2OUHA 3AL5A 2YFUA 5K9YA 3E6CC 2EAKA 4UW6A 1DLCA 2P1BA 1KBHA 3ZHQA 1DK1A 2OA2A 1KJRA 3MLJA 1BEV3 2Q0OC 3LA3A 4B3SO 1W6MA 3THDA 2XNDG 3AMHA 3MGUA 2HLEA 4N53C 5T5OA 1IS4A 2NMOA 3N9PA 1RTVA 4L0PA 3JQXA 3FHQA 5A6QA 3N2GB 1TUBA 5LL6Y 4NYKA 4QE9A 4BISA 4UV9A 5IJ9A 2A71A 4LK7A 2PHRA 2UXBO 4ZZ8A 5F32A 5FYHA 2OTJV 3CU7A 1NA1C 3K06A 2Q4SA 4LULA 5K8SA 4DEQA 2VZVA 4CVUA 4PLOA 4UYBA 1YZBA 5FZCA 5JI7A 1GKBA 3V0BA 3CCMV 3CRQA 2OZJA 3KCXA 2TUNA 1WMXA 1X33A 3RYCB 1QGLA 4GXLA 3N35A 4A6OA 4B7EA 4B8EA 1J95A 1NJIW 1L7LA 5IK4A 1BEV2 1TVKA 1H9WA 2NLJC 3IDBB 3H1LH 3VD3A 4QDRA 4Y5TA 4CCEA 4WVMB 3NAPA 1N1YA 4KG8A 4JKMA 4FSJA 1AR1B 3ZYBA 1LEDA 1AR4A 3G6EV 4LLOA 2Q0AA 5KHJA 2NYYA 2JRIA 4U7OA 4EV0A 2CAUA 1QJY1 4IEPA 4YJ2A 4CDWB 2ZE8A 2ZDIC 1M4WA 2HBTA 1X7NA 2UWBA 5H9PA 4WVMA 1SZTA 1GR3A 1R3KC 2RDQA 3HQUA 4QPIC 1XQNA 4NXMB 1GM8A 4D94A 1J5EB 1J1TA 5A3UA 5DN2A 4DW1A 3O5SA 2JX9A 5FPVA 1H2KA 1OCZB 1QJY3 2RJ2A 3DXRA 5FZDA 4CYDA 3IDAA 4LF8O 2QDOA 3P3PA 1ODMA 3D36C 4HL0A 3J81N 4CXYA 2QKAA 1ND2B 4DMIA 1FT9A 2DTYA 4XF3A 3TN93 2B39A 1OCCC 3LOIA 3K08A 2ARXA 2QM4A 4CEYC 2VQFB 1XE8A 4QAWA 3K48A 4DV4B 2JG8A 2J1EA 4Q27A 2HWD2 2ETNA 2OIIA 2JDNA 3RMYA 4ET7A 4E2LA 2E7TA 3ACIA 1M4UA 4BXFA 1YJNV 4PHZA 3ABKB 3IAQA 1GWLA 2YC2A 2UY9A 3T08A 3ZLIA 3UESA 1HNXO 3ILFA 5KWRA 3POIA 4BMBA 5GKAC 1YIPA 1NCQC 4O4LA 2F23A 1XNRO 1D4M2 5JXIA 2LUWA 5I0TA 1GK9A 2HWF3 3VBUA 3FD9A 3TN92 3WHTA 4O2BA 4IDZA 2A3WA 2WWWA 4LBQD 1OBNA 3W58A 4PCRA 2RCVA 4BYYA 1BYHA 3MPPG 3JB8A 3WZ1A 3PU8A 3WNOA 2WYFA 4L97A 3JAKB 4DK0A 4Q6GA 2OIGA 4QPGA 4XFAA 3T1MA 1FNZA 3ABMB 2CYFA 2BGOA 2Q8OA 4RQFA 4X62O 2AGAA 1NVPD 1EUTA 3PN1A 1JI6A 2ADQB 4R6ZA 3PVBB 4R9DA 4LUKA 4DR4B 4A6SA 2E32A 3A2FA 4JI7O 1NU1H 2RMU3 1D4M3 1AUYA 2ZEXA 2EULA 1LOFC 1A3KA 4DXWA 2HYKA 5FR3A 1Y4WA 1AYN1 3UKNA 3ZSMA 2V4AA 2BUKA 3BYWA 4DV7O 1T6BX 2HWE3 1Y6XA 1Y74B 5FMOS 5T3NA 4EWAA 4GJYA 3E8GA 4FOWA 4EZHA 1D4M1 1W0NA 1NT2B 1BHGA 3I59B 4FCAA 3ASOC 3BN6A 4YZ4A 4Z2WA 4Q4W3 5LXTA 2J1VA 1PGL1 3HNMA 3VBHB 2OIEA 4AI3A 1H38A 1OLRA 4DIQA 5A7WB 1UOJA 1N0NA 5LA9A 2VRZA 1JFFA 1RMU3 2BERA 3E1F1 4RHV1 2MEV1 1E5RA 3POSA 1LJ7A 2Z5UA 3ZRSA 2B45X 4BU2A 5DAQA 1X59A 5JI9A 1GLHA 1LUWA 3N9LA 2F4VO 1HR0B 5KHKA 1FV2A 1RIRA 4IE4A 3ICXA 3O7OA 1P4RA 3UQ8A 5KHGA 3T4ZA 3HBZA 5KX5A 1Q8PA 2AHYA 2KXLA 1IBKO 1GSLA 4EKWA 2Y69B 4N43B 4IEOA 1UOBA 3T0BA 3AKRA 1OD3A 2HBUA 3C7FA 3L75H 5JSOA 4W4LA 1XNQO 4UW3A 5A3MA 3AP9A 1N4CA 3NMBA 2BOIA 1SLLA 5FY7A 1UW8A 4CU6A 2C9KA 1I0HA 4K8XA 4BQWA 1W2AX 4LO5B 2EALA 4N43A 5CIRA 1BHAA 1OF3A 1WD3A 2ZGTA 1SZBA 3W7WA 1LB2A 3ZFEB 2DFBA 4LQRA 3GJBA 5GALA 1TZOA 3RWNA 1W6PB 2Q8DA 4GZRB 1O3QA 5LA6A 1URFA 3VD7A 2KG7A 2FZ2A 4Q4X3 3PMEA 2QQOA 1JZ2A 2BQPA 3BU7A 4HXCA 3UV9A 4UWDA 2VW0A 1GH6A 2XKPA 4YW2A 4GIQA 3RZLA 1IPKA 4UVAA 5BV6A 4C1XA 4A7ZA 1PNGA 3T2PA 5IWAB 3B93A 5AFEA 3KV9A 2X09A 1Y66A 3RJRA 3ASOB 2RNBA 1G4YB 3VBOC 2SBAA 3K0GA 1JPXA 4DV6B 2D2CB 3CMGA 4AHZA 4N7UA 3N9MA 4ASUG 3B5LB 3TWIA 4I5SA 4MGKE 5FP9A 4H3WA 3T2QA 3RVYA 4WM7C 4K21A 3AXEA 4MVTA 2WT0A 3ILRA 3FMGA 1YHFA 4CDUB 2Y6FA 4LT5A 4ORFA 2QR4A 5BNQA 2IXIA 2MPFA 4BJ0A 3AK0A 1XI1A 4FQZA 1W59A 1WLEA 4CEWA 1RUE1 3NNMA 2OX0A 3ZIWA 4GZ9A 4LFAB 3LNNA 4AGRA 1Z78A 1V54C 3AB0A 3QF7A 3WF1A 5LA0A 1HN1A 3J80N 1PKXA 4LFBB 1CAXA 4Y22B 2ZGNA 2X0LA 3A8TA 1DQ5A 5LGUA 2GTAA 4UOJA 1PO11 1QOSA 2QWPB 1K34A 1FATA 3MW2A 4Q0QA 4CU9A 5EPAA 5EYPA 3JD0A 3ZN6A 3KT1A 1ZRCA 3RYKA 5J09A 2BOJA 4E27A 1UOGA 1IHMA 3LF7A 1VALA 2OW4A 1WA6X 2FDHA 4XE9A 4P30A 3I5DA 4ISQA 1PNKA 2YI9A 2C24A 5F3CA 3ETGA 1Q6IA 3GZEA 1CXZB 4B3SB 3B40A 4QXHA 1XEQA 3URFA 1NA1A 1UPIA 5GZDA 3OUFA 2ZGPA 5JAXA 5IY5B 2Z4FA 4CS4A 5LGNA 2QM8A 1DGRA 5B1BB 2PHFA 3G67A 1XHXA 3HNBM 2DU0A 5CMUA 2YXHA 3VZJA 1RL3A 4IXLA 3VDDB 4AQSA 4WFEA 1UJWB 4BIZA 1ZBA2 1UXXX 1F9KA 5LA2A 2Z5WA 3NAPB 4MLOA 1EV11 1KKDA 5L7OC 4EEQA 2CGPA 2BNOA 5ITZB 2W39A 5K7PA 2VNGA 2CWSA 1SESA 2UXNA 2VNVA 3H7JA 5CA0A 1K5MB 2BTQB 5KC6A 3IGAC 1QH7A 2RR12 5FBJA 4CPBA 4JDNA 2VXRA 3OGGA 2LW7A 1FAFA 3BTAA 1UYZA 2FHRA 3AJZA 4QKNA 4PLMA 5DDJ1 2F66C 2HR3A 5H9QA 1H2SB 4G4FA 3TOJA 4XIOA 4YHHO 3T1HO 2A9HA 4RR3C 5CYYA 1CR7A 2E26A 4W6YA 4TWKA 4I9WA 3MW4A 2HWF2 4LJHA 4MH0E 4ATFA 1TUEB 5SV8A 2CAZC 1VBA1 4LO4B 2Q4PA 1VQ6V 1AXYA 3I2GA 1N36B 5JIUA 3CJHB 4HOOA 3DYMA 4UV8A 4LTAA 4WFFA 2QE7G 4XC9A 4LNUA 1RUH1 4JAAA 2MEV3 1TQ5A 5LMNB 4QQOA 4IV1A 1KP2A 5EHDA 2KQXA 1PVC3 1DZQA 4NIHA 1LU2A 1Q90D 3GVMA 1B35A 1W0OA 5J2TA 1T2XA 3JBG1 4LBOA 2AHZA 4TZDA 5FV3A 4CP9A 2YIAA 2W91A 1M56C 1DU3D 1H0BA 4PBPA 5HFMA 4N23A 4TSVA 3AMQA 2NMNA 4X88A 5H9RA 4MGYE 4CUCA 1YDXA 4QPWA 3R6SA 2GTSA 3RZJA 4K3AA 1QOOA 3S30A 4MV2A 3G71V 5DDJ2 4RS5B 2ZMKA 1UX6A 2DBNA 4XCAA 5LP6A 2FDJA 2UU9O 2QQJA 2CUGA 2JDZA 2IVIB 1W8NA 3STZC 1AF9A 4Z07A 5KBFA 2QDRA 1YUDA 2YC4A 4M3CB 2WT1A 3Q8EA 5TSWA 3HR0A 4UI9L 1JYWA 4Q4W2 4GH4B 3POYA 2Y4TA 1G9FA 1WN7A 4AI0A 1WA4A 2YG0A 4HSJA 3F95A 2CTRA 4XQ4A 1MEC2 4BR6A 3UK9A 3DPRA 5EYYA 5GLZA 1FX5A 5HXMA 1IVSA 3RS6A 4CH5A 4V1PA 5FZ0A 5JXHA 1I5YA 1JR9A 3VDDA 2WS92 4GMP3 2ZE7A 3AEIA 3I3MA 3CXCU 5IFPA 4P9JA 4WM8A 4RFT0 4BQYA 2WZR2 1RUC3 4JAUA 4UAPA 1KS5A 1HNZB 3PU3A 4NHYA 4BXSV 4J42A 1OJHA 1BGYH 2A1XA 3MDPA 4HFSA 2UXXA 4LFCO 2PQSA 2H0BA 2XAQA 2A70A 1QOTA 1SLBA 3NV2A 1AYM1 1PL4A 2HWD3 5FOBB 4XUNA 1YLLA 4S2FA 4WFHA 5J1XA 3LFIA 3RZGA 3CXHF 1JFFB 1PMIA 5CKMA 2ZGSA 4BB3A 3ZHSA 1V70A 1DYPA 3OPWA 3FFZA 4UCOA 2CGOA 2F93B 5F7UA 5FFOC 1RVF2 3ECQA 4IYHA 1ENVA 4LHLA 4B3TB 2R0HA 2PN5A 3HKCA 2VTXJ 4N9IA 2DYRB 3NW4A 2VZPA 2E6VA 2HEWF 1VF5B 1E5SA 3CC2V 1ODNA 4O4IB 2JICA 5EZWA 1ZRIA 4I3GA 1C57A 4AF9A 5JMCA 3CCLV 3FE5A 4HPKB 4QQHA 3Q8BA 4GAZA 3KHCA 3M4FA 4LKDA 1OOPA 4HONA 4LF4B 4H55A 5A9GA 3QOPA 3T09A 1WPBA 2D3PA 3POFA 4X89A 4OGQB 1RYYA 4J7ZA 3IM0A 4I01A 1XMQO 5FZGA 4QPGC 2OZ6A 1PK6A 5C70A 3CP1A 3RI9A 3CJIA 4FAGA 2HWD1 1OT5A 3B9IA 4Q4X1 4XF1A 2FL4A 2RDCA 2RR11 1A6CA 5JOWA 2WQZC 1PO22 4AWDA 1KGYA 2RMU2 4CCJA 2EAAA 1BBT2 4CUBA 1MS0A 2VOTA 5J9PC 3RVHA 3BAAA 5JVDA 5IFTA 4W6XA 1KC8W 2ZA9A 1GICA 3LPFA 2IXKA 3ZN1A 4ZS2A 2VO5A 3ABZA 2ZXWB 1HNXB 4HKWA 2VD7A 4GKKB 5IWAO 1BE3H 2IFWA 3ES4A 4DFSA 1SBDA 1FXKC 5FLXN 1VBC2 5FXWA 1MS5A 4XUQA 2PQQA 3V65A 2VNRA 2ZEZA 4MVOA 1Q7YW 1X9TA 2I45A 3DSQA 4LA2A 3L9JT 1ZX3A 4KU8A 2YC0A 2XWJB 2BJSA 1BQPA 3SHRA 4UW5A 3PTRB 1ASJ3 2B5HA 2JG8C 4WCEV 3RQ0A 3OD0A 2A6YA 3HN1A 3HJRA 4HK8A 4YVSC 4ZU7A 1QJFA 3DEMA 2AENA 3AJYA 1YVWA 2QWRB 2VVDA 4YM3A 4M0NA 2YY1A 3AG1C 1RINA 2FDKA 2WS91 3OY8A 2QQKA 4AFBA 3PTYA 2B9VA 1VBA3 1HN0A 4BIFA 2JIZG 4OYUA 3O65A 1NT0A 1GOFA 1HXS2 4CP9B 1JQ0A 2R1BA 4XTPA 4DV4O 3ZCCA 5JVVA 1MQTC 4C1WA 3M3EA 2QQWA 4Y5Z0 1LRHA 4DR5B 2Q1ZB 3UGHA 5LYJB 1PVC1 3LA7A 4MGSA 5DEDA 1N33O 1GWMA 5F5IA 2WZ8A 3S5QA 4A5UB 2Y6JA 4XFFA 4DV1B 4IEWA 5HCHA 2D3RA 1JMKC 2FBEA 4LF7O 4LE4A 1YSCA 5IJ0A 2FMLA 3LQCA 2W2IA 4R7CA 3MIGA 3MFCA 2KR2A 4XAAA 2X6AA 1XC6A 3ZDVA 3I4IA 4I4TB 1VQ7V 2YZ4A 2JDAA 5FYZA 5EBMC 3HOBA 2JJ2G 4EYUA 2VS0A 5DZEA 1VBA2 1OCZC 4IEYA 3NV3A 4M3CE 3IFXA 2PXJA 2V5DA 2MEV2 2WNUA 2HVKC 1V0AA 4QB1A 5BR8O 1IS6A 3H0OA 1S0VA 2CU5A 5CB4A 3FUOA 1U5XA 1DF0A 1NBMG 1UL9A 2GH8A 1PPJH 1YQCA 4GX2A 2YXSA 4YJ3A 2CHHA 1O3TA 4NIAA 1OKQA 4WVWA 5BUVA 3CCQV 5FZFA 4XF0A 2WRAA 1AYN3 5FQ0B 2ZACA 4BZ4A 2C9AA 4R9BA 4PD4F 4MT8A 1DCSA 4YIOA 1ULFA 4I0BA 5C71A 4IE7A 4QB6A 2IZWA 3CYOA 2IU3A 2WQ8A 3OW2U 1AR62 4WFAV 4XQWA 1AL22 1GANA 3VKMA 4OUMA 3FYEB 4QGMA 3S3XA 3W5NA 5FIXA 4E4EA 1XBFA 4LNUB 3H8RA 1Q6UA 3VOUA 4OI2A 3S7EA 2X6CA 1JOYA 5FY4A 4JV4A 5FPZA 3VQWA 1B6QA 4K9SA 4NMIA 4TV8B 3M3IA 2UUAO 2ZGMA 4C7UA 1HDJA 3ENRA 4YZ3A 1G6NA 3VGIA 3ZR5A 3ETQA 4LEJA 2N04A 1WWYA 1Q43A 2QTSA 2ZS6B 2D6LX 1P8JA 4CDUA 4RR3B 2A5ZA 1NR1A 2D98A 2WFF1 5E6HA 1C4RA 1B09A 3H50A 1X82A 3I2JA 4CDXA 2V4DA 4XTMA 4LH7A 3ETPA 3D3IA 4P9YA 3IC9A 1VQKV 1PX4A 1ORQC 5F2WA 1G9AA 1MSWD 2DVFA 3WG7B 3K79A 4PA3A 3AM2A 3ON7A 4JKLA 2TBVA 4K8FA 1GQHA 2WO3A 3H8OA 1V55B 4ZU5A 5BNPC 3VHPA 5B3SB 3WT3A 1K7DA 1DLLA 5LA6B 3TETA 3CJIC 1F31A 2WO1A 1PK6C 2VQAA 4N9HA 3ZFGB 5F2VO 4IV1B 2EJRA 3KGZA 3S3WA 2DVGA 2RS31 5A33A 4IIJA 2Q8VA 1V9U1 1L0NH 2FMYA 5EFUA 2VBPA 4HN1A 4AG4A 3WNPA 1ND3B 2Y6HA 3CSXA 4YSFA 4O4HA 1UXZA 5FYTA 2L6LA 5I0RA 3M70A 5G04L 1SBEA 4XDPA 1LEMA 4DXSA 5F37A 4IEZA 2LGWA 3OD4A 1EP0A 1HQLA 5KHIA 4NRQA 4LR3A 2DCYA 2W46A 4ARXA 4NVPA 3VBHC
chains in the Genus database with same CATH topology
3J8F2 1G9BA 2Z79A 1KDKA 3GYDA 4XJAA 1GV9A 1HV0A 2NQYA 5C8CB 3NKGA 4HETA 1X8MA 4WBBA 4AI1A 3GHNA 4YRDA 1Y9QA 2CTVA 3CF6E 3IPVB 5AFBA 3WP4A 5FQ0A 4BLJA 2RM21 2ZZQA 2WLPA 1J3QA 4S2GA 4URTA 3MF6A 2LM3A 4F8AA 1ZVFA 1H9PA 2OUJA 2X8KA 3ZSKA 2HWB2 2Y26A 3E6DA 1I6XA 4M0HA 2D6NA 1HKDA 1NCRA 2AGSA 4Q8KA 4S2HA 3FX3A 4M27A 4K3UA 1O3SA 4QT6A 1MS4A 2HWE2 5EJ3A 2R6SA 4XEZA 4HPKA 4RGGA 1JBCA 4QXKA 4W6WA 2TEPA 4QPIB 2GC3A 3B02A 1COV3 4HVRA 4RQPC 2PHXA 5C33A 1YNAA 3AP6A 4I30A 1FMD2 2DU1A 3I59A 4WM8B 4AGVA 3HD8B 3NWKA 1YI9A 1HRV2 3WDWA 4OI1A 1VBE1 3AYCA 4ES8A 1C28A 1R093 3GBGA 4NHMA 2GNMA 3WLUA 1VR3A 3SCHA 2EXJA 1RVF1 3KLSA 3EO6A 3PHMA 3AKTA 4XBNA 2YUEA 1CAXB 2AZ5A 4MXWA 2P34A 3HIFA 2HWC3 1YWKA 5JPNB 1CAWA 3USUB 3CJXA 3FHIB 2RS13 3DPRB 3QH7A 4M26A 1WW4A 4D7TA 4WV8A 4KWJA 5JZGA 1RUF2 2GSYA 1QWRA 1AR83 3ZYJB 4DY5A 4NN0A 3CJIB 4QM8A 3IDCB 4QHBA 4MGIE 1QNYA 4D3WA 1ENRA 3LOBA 1LU1A 3IMNA 5AC91 4IV1C 2WFF3 1S0BA 2BPA2 3B94A 4JRAA 4IEUA 3IPVA 4GMP0 4R9AA 3USUA 2F4PA 1J1LA 1LHWA 3VZKA 1CIWA 2NP0A 4FFAA 2ES3A 1ZBA3 5KXBA 3USSA 1RHI2 1SLTA 3PJYA 3VBUC 4YNIA 1VRH2 2YHJA 1ND2A 2D6KA 1DS1A 2GNTA 4YVWC 2R073 1Z7S3 1GQWA 3ZYGA 1QJX1 3BOWA 2BFUL 4CDUC 1UMZA 1S55A 3CEWA 3KS7A 5E16A 1LENA 1GNZA 1UIKA 1NLSA 2ZGKA 2YGMA 1ZBE2 1RMU1 5CFDC 4EN7B 2ZOEB 4IETA 3VL8A 4OFGA 4Z8BA 1CPNA 1O4ZA 1TEIA 1UF2C 2JKBA 3OBRA 4RR3A 4YG3A 4P9WA 2BTVC 4WZFA 2GMMA 1FOD2 1REDA 3B3QE 1Q8OA 4XOGA 2CWMA 2H0VA 2D40A 4FO9A 3R4DB 4LBLA 3ZXFA 4CTEA 1AXKA 4R52A 5T54A 1ENSA 3ZMOA 1YYNA 3AP4A 4BHGA 4UW4A 1C5IA 1SDWA 2NPIA 1OHFA 1BVVA 4ES9A 5FO9B 2P17A 1QJU2 1YJLA 2WC2A 3JQWA 1W6QB 2V73A 4CDXB 4EN6B 1JN2P 5D8AC 2RE9A 2K0GA 2XLGA 4P9XA 2AUYA 2Z42A 1MACA 4R4ZA 3ZXLA 4IL7A 1BBT1 1WCDJ 2DVAA 1VZ4A 3KMHA 2OUHA 2XJSA 2YYOA 3JUUA 5K9YA 3E6CC 1LGNA 2EAKA 4CEYA 3THTA 4FBFA 4UW6A 1IOAA 5C9AB 5IK8A 5JIAA 2OA2A 2A7AA 1IKPA 1KJRA 4X8NA 1Q8VA 3AYEA 3MLJA 1YXWA 4ZKTB 5HXVA 4AEMA 1BEV3 3LA3A 1W6MA 2OPKA 2WZR3 1VRH3 3AMHA 1CAWB 3MGUA 2O8QA 1LECA 1AR92 2C0ZA 5FAXA 1BCXA 5F1RA 4IEQA 2R072 5DG2A 5JOYA 3FBMA 4N53C 3EHKA 1SFNA 1ZZ9A 2I74A 3ME2A 1IS4A 2VULA 2NMOA 4IV3C 5T5OA 4K1YA 4Y20B 4RHV3 3WX5A 4I0WB 5CAZA 1RTVA 3JQXA 4M23A 2EXKA 1MZFA 3GHMA 2R042 1LGBA 5GLVA 4I2OA 2Y38A 1FOD3 2ERFA 4ISRA 3JD72 2A71A 1YIFA 4Y4YA 1NY72 2PHRA 4ZU4A 2BNNA 2ARBA 4BHFA 4Q4V2 3CU7A 2WFPA 1RUD2 1Q3EA 1NA1C 1XU2A 3WOGA 2Q4S