2WA3A

Factor inhibiting hif-1 alpha with 2-(3-hydroxyphenyl)-2-oxoacetic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
335
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 335
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2wa3A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wa3A01
4B7KA 4Z1VA 2ILMA 2CGOA 2YC0A 4BIOA 4B7EA 2W0XA 3P3PA 3KCXA 2WA4A 1H2KA 4NR1A 1YCIA 2Y0IA 3D8CA 4AI8A 3P3NA 1MZFA 1H2MA 1MZEA 5JWPA 4QU2A 3KCYA 2WA3A 2XUMA 4Z2WA 2YDEA 1H2NA 1H2LA 2CGNA 1IZ3A 4JAAA 3OD4A
chains in the Genus database with same CATH superfamily
1JVMA 1VE0A 4RAIA 4D94A 4WFEA 4BW5A 3C90A 5A3WA 1R1ZA 3OY8A 3Q8EA 4GIQA 1EAH2 3VBUA 2LW8A 3NNMA 4KL1A 3WW4A 2OCHA 1BVP1 3ACHA 1MA1A 1H8HG 2WN2A 1CAVB 4BR6A 1EN6A 1WD4A 4P00B 4DXZA 4E2QA 3MV11 4WVMA 3BIEA 1EN4A 1N1TA 3RWRD 1DGSA 1ZA4A 1ND2C 2C5DA 1R64A 5K9YA 3VZNA 2FB5A 1OFSA 3CKHA 3ABMB 5LASA 2R9RB 2WNVA 1JFFA 4WM7A 3PIJA 4IEYA 1OA2A 2OT7A 1W0PA 4KBZA 2RM21 3G7DA 2HWC3 1CGPA 2P6CA 2R72A 2Y0OA 3VZJA 5C71A 4R8HA 5T5OA 2Z3YA 3VBOA 3K46A 4B3MO 3UKTA 3ZRWA 4J1WA 1RPOA 1UPSA 4NRPA 2VO5A 3DC6A 4Z2WA 2YDEA 2A71A 5LGTA 1F4NA 1AR63 2XVKA 5DUXA 5A7NA 2WNUA 2PHLA 4YSFA 3MGUA 1K4DC 4AFBA 3LDCA 4YNIA 2PAEA 2EIDA 1MQTA 3ZBHA 1Y7BA 3INAA 2B45X 2JDZA 3OCPA 2X6BA 1D2DA 4D6RA 3ASOB 3D82A 2HWF2 1FPN1 3SJQC 1RUG2 4JTAB 3JQXA 2GTAA 5B1BB 4X88A 4P9GA 4E4DX 1OUSA 4BIUA 4M4RA 2LQTA 1Q5OA 4ZHQA 4K8RB 3MDSA 1AVMA 1GMMA 3VKLA 1BSMA 4LT5A 2PTMA 2QQUA 4NHKA 5A70A 4AEMA 1FKAO 3BCWA 2HP8A 4JGZA 1QQP2 3GZUC 3AG2B 3QD6A 2LJ2A 1QNMA 3PDQA 3OE7G 2ZHKA 2LUWA 2XQRA 3BI3A 1W2UA 1IZ3A 2Z4FA 1YFWA 3E22B 4DINB 4MW8A 1XHZA 5H5NA 5C5UA 1DLCA 2ZTNA 5FO7B 4AZZA 5A6XA 3CCSV 2W52A 1Y9GA 1JYTA 4RL7A 2VL4A 1RC6A 3MLLA 1QQCA 3ZDVA 4C7UA 3H9VA 1QGLA 2DUQA 4IV1B 3OEEG 1WGPA 4FTBA 1X36A 4LBMA 1UYPA 1NS1A 1VB4A 2GMEA 4XJWA 2RDNA 1GP6A 2FMDA 2KQXA 1W0NA 1EN5A 4JYYA 2W91A 3NNJA 4PV1B 3A8TA 3MYXA 4I01A 4IT5A 4ATFA 2YPJA 4WFGA 1WA8B 4LBOA 5BNNA 1YQ8A 2FZ1A 5EQUA 2E6VA 5FY4A 1VBA1 2A3QA 3C7FA 2HWC2 2WZ8A 4YG0A 4P9JA 4P5YA 2RMU2 4CCOA 3KM5A 4XBFA 4WFFA 3LFMA 2Y0IA 2EF6A 4WFBV 4CE8A 4FFKA 2A70A 1YJWV 4E4EA 2R061 1RXGA 2Y6LA 3ABUA 1RMU3 3LEKA 2WS91 4HETA 4M01A 1T6BX 5HXMA 3IN9A 2QTSA 5J96B 4M3CF 3DL3A 5IVYA 3BB6A 1MS5A 2YZ4A 5JVDA 3GBGA 2WLMA 3JAKA 4OHXA 4OUMA 3BYWA 4TUYA 2ZAAA 4RHV3 2WWSA 3PLQA 1L0NH 1YWKA 1DQ1A 2VOTA 1F35A 5FDBA 3I54A 2EICA 3DKWA 4ZOLB 4N43A 1DP0A 2QQMA 1FOD1 5SV8A 2KD7A 3W7UA 5C8YB 4LNUB 2Q8EA 1SLLA 1OA3A 1VQ7V 4R50A 2JG8C 1CZTA 1ZZ6A 1DTOA 2ADQB 3M2MA 2W39A 1PGL2 5DMYA 4Q5OA 1X4TA 2UXDB 1R3JC 1Y67A 1G4YB 2H0VA 4XAEA 4FLXA 3PN1A 3UV9A 4ZS2A 1XPWA 4CC6A 3F5TA 1RVF2 3L70H 3FBYA 1RP3B 1XB9A 4LBQD 1N1SA 4O4LA 4FFIA 1DGWX 4LIUA 2JDAA 5JXJA 2JB4A 1I9RA 5FR3A 1ZBA2 4PDMA 1KRIA 1YQCA 5FPVA 4EZ4A 5CFCB 3KVAA 3B40A 4CEYC 5FQ0A 1R083 4NB5A 5JZGB 5FMCA 3D36C 4DW1A 4O2AB 3D0SA 5D8AC 2GBOA 1DHKB 3CX5F 5BY5A 5DAWA 4J11A 4GWNA 5B66Z 1X9TA 4MVTA 2QFEA 1PNFA 4JTDB 1OCRC 4FVMA 3BRCA 4WVWA 2YBSA 2DCZA 4EV0A 3TEXA 2R6QA 3ZYFA 4P9IA 2B39A 3IDEA 1GWLA 2DV9A 3OGRA 4NIGA 5FV3A 1YDXA 4XF9A 1XNAA 3C7HA 3STLC 3PVEA 4MVOA 3FWEA 1NCRA 1L0LH 4JI0B 2WO3A 2XG3A 1U5ZA 4GCZA 3SGIA 3OBRA 4AWDA 3V0AB 3W20A 1RMU2 3K0DA 2PI4A 4MVUA 1ENRA 4ZS3A 1LKNA 1H2LA 4K0KO 1VAMA 2WFF1 1GNHA 4AGGA 1MEC1 2DQ3A 1G9FA 3IC7A 4R6ZA 1AL22 2DWDC 2PHFA 3RYIA 2BOBC 3ES4A 2J7MA 5LK7B 5CB4B 4JGYB 3LD8A 1BKZA 1AR82 2ET1A 4FQZA 3RYHB 4ISRA 1UZVA 3VD7A 4NRQA 4AQYB 2AC1A 3WB1A 2P67A 4QQPA 4DV6B 5CG8A 1JPXA 1YJNV 3H1IH 1ZZ9A 4JV4A 3EQEA 4JZRA 2UXXA 2C26A 2UWAA 1OV9A 1AJKA 1MOFA 4NTWA 3IJ4A 3NVCA 3WFVA 2J1EA 4NTXA 3ZIAG 1V6KA 3P30A 4AAPA 3KS7A 5C4WA 2TEPA 4BQYA 3WG4A 1VBC3 2ZHMA 4OGQB 1VQ6V 1KS5A 1OCCC 4AI1A 5LYJB 1N0JA 5KAIZ 3MLKA 1KITA 2HEPA 1FXVA 3Q8CA 3RG0A 5IK7A 1RIRA 2ARHA 2JKBA 4NPMA 4JASA 3LSUA 1D4M3 3OM3B 4A5UB 1J1LA 3LA3A 4LULA 1Q82W 1PGSA 4KFMA 4J25A 5J7MA 1R082 1KD7A 2G4IA 4XUOA 4LTAA 2YICA 3QG5A 5BNPC 5C5TA 4FPPA 3JCIA 4G28B 2P4EA 1BHGA 1YRZA 2D6KA 1RHI1 4GXLA 1KS4A 2WLQA 2WQ8A 4OPHA 2Q4SA 5EYPB 1JU4A 2ZQMA 3VKNA 3DYPA 1ZTEA 4QPGC 3HBZA 1XXNA 3D6EA 5AVAA 1WLDA 2ZINA 3MW4A 3CIHA 2Y8KA 1CR7A 3N3HA 3G71V 1SACA 5EIBD 5LHGA 3RYKA 1MSWD 2W1QA 1IBKB 3BODA 4IEQA 3N9LA 3AJZA 3M8LA 1THZA 1WA6X 3M1HA 3AMHA 1EAH1 2D3SA 2OZ6A 2CDOA 3ZXKA 1COV2 4WVZA 5APAA 1L3JA 2DYRB 5KUMA 4UAPA 3DTUB 4JV5O 3H1JH 4R9DA 5DECA 1HQLA 4P9WA 5J98B 4CU6A 2WBKA 1YF2A 1ZRRA 1NG0A 1R093 3VZLA 1VBB1 1S2BA 1S5HC 5K1PA 4DR6O 4CPBD 4PDWB 1UZWA 4OX9B 4OI2A 4CUGA 2MW2B 3VBRB 3B01A 3OTOO 1OVSA 1XBLA 2B5UA 2VBDA 4DV3O 4IUGA 3BPSA 2L35A 4PQ9A 2UWBA 5CFDC 4DUVA 4YG3A 5FIXA 3RYFB 2ES3A 1HP8A 2XT9A 3JQWA 5IK8A 2ETNA 4OMCA 2Q7HA 1S0IA 3TJTA 1GP4A 4CVUA 1XMOO 2EINC 2QQVA 5FFOC 4DV7O 2Y69C 4L87A 3ST7A 1K4CC 3UM7A 4LBQB 3AG1B 5EPAA 3K79A 2PMWB 4RQPC 4N9IA 5JVVA 4P9OA 4NMIA 3E8FA 2YI8A 1ND3A 1AR4A 1ONAA 1X7NA 3N9MA 1GOGA 1LGNA 5H6QA 4AVAA 3QNEA 4A3XA 3FLPA 3I2GA 3OAAG 4I9WA 4EN6B 2PI5A 2HWF1 2ZXWB 3NAPB 4XUPA 2LGQA 4NPRA 2GUZB 4DV0O 2WT1A 5CA1A 1AVBA 4RGGA 5FBZA 3AB0A 2JRIA 3IDAA 5J48A 3LEGA 5DPNA 3AG3B 4LBEC 3ASNC 1DGLA 3VQVA 1K73W 3FHAA 4AQTA 5KHGA 5GLTA 2OCCB 3KGLA 4QKDA 1N3QA 4D7YA 2CGPA 3RYRA 1W03A 1R73A 4EWAA 2P6JA 2QQIA 2FD8A 3POWA 5IVCA 3E8GA 1KD1W 5LA6B 1US3A 1AYM2 3GCWA 4QGNA 3BTAA 1ZNPA 1JYCA 2WSUA 1AROP 2ZKLA 4UXAA 3I2FA 4R7CA 5F3IA 1TMF3 4MG2A 2GU9A 1GICA 2PQSA 1K42A 3LGRA 5B1AB 1V70A 4OQ9A 4COZA 3OEHG 4BE3A 2IJIA 2QE7G 2RS31 2HYKA 2ET7A 4GJYA 1JOJA 1S3JA 1NCQB 2J1AA 4AHXA 1AI5A 3ZX6A 1FMD2 5FPLA 5FZAA 1EUTA 1OHHG 3MFCA 3B9CA 2J1UA 4LHNA 4UVAA 3ETPA 4Q4V3 4PA4A 4QX7A 1HW5A 5C8CB 4N7UA 2W6JG 1NJIW 2P4KA 1H2MA 2LP7A 2GMMA 4MOAA 5GONA 4FP3A 3B02A 1DIWA 2FDJA 2H6BA 2GTSA 3V0BA 1XC6A 2VW0A 1AYN3 1IGOA 1C5HA 5FO9B 3PIGA 3WHTA 2RMU1 3BEHA 1MZ5A 4Y20A 1VQKV 5F1RA 3VDDB 2A3YA 5DXDA 1ZM1A 1H1MA 3B8NA 3T4HB 2JVDA 4CCCA 1SZTA 4TV9A 2XH6A 2P3KA 1Q86W 1ZRCA 1Q8QA 5C3QA 3AP9A 2R70A 1OOPA 4I02A 3ZKYA 1Q90D 3PJYA 3KQRA 1MS0A 1YLLA 5FPAA 3K08A 4J9YB 2V4AA 4DR4O 4FM1A 2ZE7A 4URAA 1OQEA 5C93A 1ZREA 1R3KC 4QXBA 3FHIB 4CSWA 1RUJ3 2UXBO 4QPJA 3CRRA 1ALYA 3C3VA 2ZJCA 5LL6Y 2V72A 4YW3A 4FLUA 3G67A 4AEDC 1Z7S3 4LITA 4WZCA 3GWKC 4X20B 1PD3A 4Q0QA 3UO3A 4YHHO 2WAOA 2BOIA 3T4DA 3SYOA 2YGLA 2EXJA 3ZHVA 2DURA 5J2TB 1VRBA 2D7FA 3EFFK 3JASB 4GX0A 5DDJ3 3FBMA 2YIBA 2PF4E 3BU0A 3AKTA 5A3MA 1XOYA 5ACA2 2Z2SB 1VQNV 5I91A 2YC4A 3KT4A 1NR7A 4CCKA 2PLV3 3VBFC 5I8TA 5GZDA 2XGXA 2HEYF 2IWGB 1ZAUA 3P3PA 4I4TA 3ETEA 3ZCCA 1RVF1 2TNFA 3CEWA 3OBTA 4UB6Z 3KCYA 4HMZA 1OSGA 1QOTA 5FYTA 2W1SA 2ZNIA 3EB7A 4IV3C 3JATA 4Y5SA 4Q4W3 1HJFA 4CCMA 4XCBA 3NKTA 2X7RB 1BZWA 4BQWA 3WW1A 3AEIA 1QWRA 1ZBA1 4JI1B 4G3YC 1LGBA 2EZPA 5LEKA 4EKWA 2FMYA 4A4AA 4UW3A 2ZCWA 3EYPA 2F66C 1NX9A 1H8TC 1S2KA 5A6ZA 3A0BZ 2Y38A 2DTWA 3E6BA 2RDQA 4YPJA 1UU5A 3WSOA 3CMAV 3CPWU 4KWUA 3PTYA 4DV2B 4LKSA 1HX6A 3NJVA 5H2FZ 4N53A 4U36A 5CA0B 2I07B 5K8SA 1HQNA 2YV8A 3UYJA 4NYKA 3KWVA 5HXVA 2B9ZA 2VNVA 2JDHA 5GLUA 3UT5A 3MF9A 1XUQA 4BAYA 4DK1A 1DGRA 2LFRA 4BIOA 3KB5A 3JSLA 4HG6B 1AX1A 1ZBE2 4A6SA 4I3PA 5LK5A 3RZJA 3CCMV 4ZKTB 4FQ4A 4WM8B 1AR93 2EA7A 4F3JA 2DWEC 5DG1A 2WC2A 3UO2A 1BQ0A 1AL21 4HN0A 4OI4A 1S0CA 3UQ8A 3N2KB 4FFBB 3ZLIA 1MS1A 2A06H 2YROA 1AR81 5IAXA 2IZWA 3K4DA 3CC4V 3OFNG 4NXNO 2CV6A 4LNUA 2DVDA 2VECA 1KBHA 3AZVA 1VMFA 3A23A 1H1AA 3FKSG 3K04A 4UFKA 4CP9B 5L3EA 4JI4O 1W9YA 1DQ5A 4BB3A 3WQ7A 2IXLA 3I8TA 5A33A 1PK6C 5JUVA 2ZABA 2JIZG 1SA0A 5BY1A 2ZA9A 3ITQA 1SQFA 3HN1A 4KH9A 4LFAB 2D97A 2XQXA 5A6QA 3H50A 4MZUA 2VS0A 4DXWA 4LO8A 4I7ZB 4XEZA 3VL8A 4F7ZA 3HIFA 1GANA 2ZX2A 5FYZA 3GALA 1G8WA 1HDJA 3WP3A 3JARB 2ZGQA 1MNGA 4NIHA 5H9QA 4IDZA 4GB33 5EBLC 2B9VA 4XIKA 4ASLA 1CAXB 4F8AA 3UGFA 1YXBA 1WD3A 1NA1B 2HJIA 5CFCA 3O0XA 4ET7A 1IXMA 2Y6FA 3FL7A 1Y4WA 2YIAA 5F8PA 3CCLV 2NN8A 1OCOC 3RMYA 3SCHA 2ZGUA 4QB1A 2K9PA 4YM0A 1XNCA 5SV5A 2XPJA 1FS0G 1PVC2 4NTYA 1IXBA 4P9XA 3QTCA 3NW4A 1SZXA 4JI6O 5FLJA 1PL0A 4MTGA 5E88A 1FV2A 4QD2A 1N32B 3LQCA 4MT8A 4DUZO 5B1BC 5LXTA 4CDQB 2GN7A 3POSA 1D4VB 1P8JA 4FPKA 3EXAA 5G05L 4JF3A 4KP4A 4YVWB 1YI2V 1QLNA 1UFIA 4YARA 1RUE3 2XOMA 1HWYA 3ZXDA 3F5WC 2QZ2A 1J58A 2ERFA 4B8EA 4X8NA 2DJVA 5A32B 3RWKX 2ZM6B 5BMVB 3O1SA 3IAQA 4HPKB 3L72H 1W0OA 4UV8A 3PMEA 1UU6A 2CSGA 3U14A 1BGYH 1PM4A 2WIIB 3SHRA 4I5SA 3AP4A 5CB4A 2VR4A 1CZSA 3SJAC 5A7OA 5LGNA 5EIYB 4X9QA 4XBQA 1COV1 4FK5C 2GSMB 2MPFA 2ZKOA 2Q7GA 2BFUS 4LKEA 3IFXA 1NVPD 1F51A 2ZX0A 4RR3C 4B7EA 3AG4B 1F8VA 3OR6C 1JU3A 4N90A 3UKMA 3WHUA 2WZR3 4N21A 3MIGA 3CRMA 4I50A 2VZUA 3WW3A 5JXHA 3SJCC 2QQJA 3VBUC 4DR3O 2R49A 4P30A 1PZ7A 3SEPA 3RFRA 4NUBA 2ETEA 4X8AA 4UYBA 1R3LC 1SBEA 1I08A 1C5IA 3PUAA 2YHJA 4P9PA 1WW5A 3K48A 4JI5O 1L7RA 2YC0A 3HT2A 1D0HA 2DCJA 3AP6A 4UCVA 4J7JA 1V9U3 4JYBA 4DV0B 4JTOA 3ZFFB 3NV3A 1Y9MA 1HNXO 1N34B 1HNZB 3WUDA 1UCXA 4ZZ8A 3K03A 1ZYBA 3O1PA 1J84A 2VZTA 1KP3A 2A73B 3S30A 3L75H 4LJHA 4XTPA 4CU7A 3EXUA 1DU3D 5B3SC 1DYPA 2CWSA 1JOBA 3VBOC 5FOJB 4MADA 4MTXA 1JYVA 2PYJA 4OI1A 2AEYA 1JS9A 2NMNA 3K5LA 3U0ZA 1AX2A 1M06G 3TOJA 4RA0A 3GJAA 1W6QB 1MQTC 2Y60A 4DZGA 4CDWB 1X8MA 3T2MA 1W6NB 2OA2A 4FLYA 2B46X 4IIJB 1NLRA 1W9SA 2ENRA 2AW9A 4FCAA 1M5IA 4LF8B 5J2UB 4O4HA 1ZA7A 3ZMUA 2X0LA 2YMZA 1W0KG 2A6WA 1GNZA 1TUEB 1AYM1 1V9PA 4IHJB 3R4UA 4I09A 3HR0A 1AJOA 2Q0OC 5LOVA 1ASJ2 3AXDA 2ZGKA 1W2AX 5KC5A 1UW8A 4NOTA 4LFBB 4JGZC 1J5EO 2YFUA 3ACLA 5LMNO 1GZWA 1OUXA 2WLIB 2XJUA 4AF9A 2P6HA 1CJDA 3BALA 1H0BA 4X1KA 1FMD1 2Q8VA 3H8RA 4HFSA 2WUHA 2GHYA 5E8AA 2IU0A 1HRI2 5C8WA 1REDA 1UOGA 2WZR2 2DW4A 1RITA 2B9UA 2A6YA 2NZ9A 1WCKA 1ND2B 3IM0A 3EHBB 3H0OA 4PD4F 2Q1ZB 5IYZA 5JJJB 5ABJA 2W68A 2UY8A 3TXSA 3W5NA 4XDQA 5AC92 1SQGA 2D3PA 1VIBA 4HKLA 2R072 4Y1UA 5T55A 1CEZA 5IWAO 3C8XA 1AXYA 1WKYA 3WQ0A 5FZ3A 5FZKA 1UX6A 3CC7V 4Z07A 2W5FA 4Q4X3 1V9U2 2RS52 2BPA2 2VOVA 1W2NA 3AX4A 5JXGA 3CB2A 5DEDA 2VC9A 1I5YA 4XW3A 3D3AA 2YUAA 2WINB 5K4LA 5BNNC 5L7OB 3I3QA 4JDMA 3ZHRA 1JZ6A 4YW7A 4E27A 2UUCO 1B3QA 1JBCA 5F2SA 4Y1VA 1VQ5V 2Q6AA 2P5OA 4KG0A 4KHPO 1O6UA 4JKKA 1SQ4A 5GTHZ 1FXKC 3VQXA 2YXYA 4FLVA 5HPOA 4W8JA 4YRDA 2X5IC 4XDPA 4ZU5A 4ORFA 1WAZA 4O61A 3T4VA 1H8EG 4IE5A 4UF0A 3JD73 5CBFA 3I59A 1UMZA 4LUMA 5FPUA 3EVKA 3GDBA 1REEA 4DIQA 5BNOA 3KG2A 3EJKA 2OS2A 4QDQA 2XKOA 3RWNA 5LA6A 1V6MA 1DCSA 3M7AA 1AJPA 1PP9H 5ACA1 4YZ4A 3T1YB 1W8HA 4N43C 4P02B 3BIWE 1M1KW 2QQNA 5K0UA 2VE1A 3AKRA 4X64O 3N35A 2C24A 2P17A 3AP5A 5HBAA 1SFNA 1EBOA 3CD6V 2DBIA 4FFGA 3E6CC 1SLBA 3ZHUA 2X10A 3AMQA 1NVPB 3QH6A 4BMEA 1M90W 3JD4A 2ZGMA 2W08A 4XMIA 2ARCA 2GN3A 5IJRA 1WWYA 2B1IA 5GKAC 3TN93 4GX5A 4GH4A 2WWWA 1F4MA 3B09A 3L71H 1V00A 1IQDC 3PTRB 4Z1VA 2P3YA 3QOPA 4HSLA 4X1IA 1YC61 1LUVA 2VMEA 1QLEB 2RJKA 4LE4A 3A0HZ 3ZYIB 1C4RA 1YQ2A 5F6LB 5CBGA 5I0SA 1GBGA 4YW1A 3APOA 1V6JA 2C9AA 2R043 4G2KA 2XXZA 3BGAA 1LHUA 1W6OA 4HK9A 1GV9A 1Z0HA 2BNOA 2J1TA 4UFHA 5JLVA 1PNLA 4WFHA 4PI2A 1W04A 5AVPA 3WINE 4MVSA 1PMHX 1HW7A 2GV9A 2E5LB 4ICGA 4G9SB 4FI9A 4YZ1A 1JZ8A 3ZJZA 3WDUA 1ZBE1 4TZDA 3OG2A 3S7EA 4LO6B 2G9ZA 1SF9A 4MW3A 2EIEA 1CIYA 4PBOA 1NCRC 1MS4A 2JE7A 2EAAA 4A6OA 2AZ2A 3IPVA 5A7WA 4X20A 1TZOA 1H6XA 4FVVA 3VQYA 4MVMA 1ENSA 4OUEA 1D2QA 1UOBA 5T52A 4DR7O 4XJ8A 1GQHA 1H9WA 3AZWA 3SYCA 1XU2A 3SKJE 1SLIA 2P1BA 4XZPA 2D5FA 2JG8B 2XLAA 4NVPA 1O5LA 5KX5A 4BWOA 5KLVH 5LMUB 3ZXGA 1UOJA 1W9FA 4QU2A 1HN1A 1A6CA 5LP6A 2J1VA 3K9SA 5K7PA 5JSPA 5B2GB 1KU9A 4UCUA 1N47A 2WO2A 4GKJB 1JOYA 2EALA 5FWJA 2Q8CA 3VDAA 4A7ZA 4JX0A 1LAJA 1PMJX 1N33O 3NRUA 2VBBA 2QA4V 3V64A 4IE0A 4HNAA 2UXCB 2IJHA 2IVIB 3AZYA 2VZRA 5I0TA 1BQZA 1ULDA 1WCUA 5C4WC 2QEXV 5E16A 2OIGA 4YG6A 5EZWA 4LCUC 4TXWA 4CEYB 2DVAA 2VZVA 2HWE2 5D8AB 4LR3A 3WLUA 4P2ZA 1SDDB 2WO1A 3N2GA 3ZYJB 3LA7A 5JQGB 3GJBA 1PVC1 1SZBA 3W21A 5FPOA 1S0FA 1OCRB 5CA0A 1HB3A 1S77D 1FPN3 2Z5WA 4HKOA 2UURA 5F7UA 5JAXA 5IY5C 1POV0 3BVOA 2R0FA 2AZ0A 2WJSA 3PUHA 4BCUA 2F4VB 4DV4O 2YG0A 4FOYA 3ETGA 2ZCEA 4RS5A 4DOUA 4LORA 1N36O 4LF6B 5FMOL 2UU9B 2WLJA 3IC9A 5FZLA 5F3CA 4CBCA 4JZ2A 4BXSV 2W87A 5IJ0B 1QNYA 5LA9A 1RPRA 3RVZA 2RJLA 1KGYA 1FXHA 1WN7A 2R7EB 4KMQA 4ZZ5A 1CAUB 2XHNA 3CRCA 4IXLA 2H0BA 2XJPA 4O4JA 1K9MW 2Q5ZA 1E5IA 4Z92B 4K1YA 3RZZA 1XHXA 4GT1A 1H1IA 2V7QG 1CX1A 2JJ1G 2AREA 4DRRA 2XUEA 4MX3A 1GZCA 4AILC 1UKGA 1O4YA 1OH4A 1D5NA 3G6JB 2DFCA 2QVSB 1SKVA 1US6A 3B3QE 2QWNB 1GOHA 2R9AA 1XRUA 1LNSA 1UZ0A 4TYSA 2BBAA 2G9FA 1H38A 4PQQA 5LRSA 1TE1B 1SPPB 4M0NA 1CESA 3KCXA 4DXRA 1A8DA 2UUAO 5FYUA 4NE9A 1UL9A 3GBFA 2BGPA 4V2WA 1K5MC 3VDBA 5C8CC 5DM6V 2Y6JA 3POIA 4DS0A 5IJ9B 3B4SA 2D98A 1U12A 4JHTA 2XONA 5A3NA 4O4IA 2JDNA 3HQRA 1OURA 1NKDA 5IYYA 3ASIA 3HKDB 1OCCB 5CNAA 4EB6A 2Q9LA 2O14A 4OYUA 4JAUA 3JARA 2QM7A 1YIJV 1VBA3 4LOTA 4Q4Y2 1QY4A 1W2TA 3ACGA 3T1LA 3WUCA 3L74H 2BP6A 5B5EZ 5JSRA 2D93A 2ZMKA 1V6OA 3H01A 3WDVA 1CAXA 1NZIA 4FMTA 4K3UA 3VZMA 4BDVB 4H2AA 1PL4A 3E8HA 3RNSA 1Q43A 2FHRA 4QX0A 4J80A 3QH7A 2R063 4QQLA 1W2OA 2CU5A 2A6VA 4XFCA 2WS93 4F83A 1B06A 5FYCA 5A7QA 5BNPB 4RWUA 5HCHA 1V55C 3AJYA 1EP0A 4QPKA 2WLNA 5C7GA 1PVXA 2ZXQA 1NH2D 3E6DA 3DYOA 4D0QA 1Y76B 3W59A 5CZKA 1OQDA 3RZKA 1MR5A 1DQ0A 3LSSA 1LR1A 2BTQB 4EWDA 1ND3C 1N1VA 4Y33A 2JX9A 4XC9A 3MW2A 3MV01 4XOGA 1RUD3 5B1OA 4QPGB 2EAKA 1FOD3 1DF0A 4NO4A 3ZRXA 4D6QA 3K5MA 2CE4A 5A32A 1DG6A 1ULGA 1UNBA 2XB6C 3WDXA 1DDLA 1XSQA 4AQ6A 1XJAA 4O7XA 5C70A 1SQXH 3L2YA 5IK4A 1UU4A 4Y5Z0 4L2NA 1ASJ1 1WMFA 4YJ2B 4X62B 1XE8A 2WNEA 3CJHA 3A4UA 4L9BA 3N9PA 1MZEA 4DR1B 3JD2A 3GHMA 4ZHNA 1JQ0A 4LH7A 1YFXA 3NSTA 5EZYA 1CQ9A 3FUQA 4LKFA 4OQ8A 1Y3TA 1OD3A 2N05A 4YVSA 2JD9A 1HRI1 1W8ZA 2WZR1 5KR7A 3A2FA 1ULCA 3T1HB 2XJQA 1S4CA 1AZDA 4HVQA 1B35A 2ZAHA 3WF3A 4JI2B 4IERA 4Q8LA 3ZX7A 2DUOA 3O12A 2QJ1A 4WCEV 1R1A2 1FI2A 1L7LA 3J7NA 2B1GA 1UQXA 3U75A 5AC91 4AHZA 1QH7A 4FO9A 2R071 3ZFEA 1TVKB 1WJZA 4XMAA 3TETA 5DZEA 4A7KA 3D0JA 4TSFG 1RUC2 3OGCC 3I2JA 2EINB 5FZ1A 3HEIA 4RUFA 1F23A 2Y69B 2RS51 5KHJA 2YXLA 4RQPB 4WV8A 1QR8A 3A0NA 5FMBA 5LA2A 1A34A 4PIYA 3T3YA 1FV3A 4W4LA 2ZHLA 2QSAA 1WCQA 3ACIA 3OYWB 3GXUA 1V54C 5KXEA 1FFXB 1F15A 4P14A 4C91A 1ZZBA 1ENVA 4CRQA 1ZSPA 1TUBA 1D7PM 1GWMA 2WFF3 1OPOA 3KHCA 2BSKB 1MEC3 1NY72 2P34A 4IESA 3USUB 3LDEA 1W8FA 4YW5A 1OOPC 4LWSA 2HYXA 1NOVA 1IURA 2RDSA 3LKJA 5JH7B 3WDYA 4EYUA 1K5QA 4X64B 4RGAA 4UFMA 1CPYA 3GGLA 4YM2A 2ARXA 3MIDA 3ASNB 4N7IA 2JGDA 3ZSLA 4LEJA 1RUD2 2JEMA 5JMCA 2LFSA 3I56V 5FBJA 4BA6A 3M3IA 3SH3A 4R9BA 5IT6A 2JWPA 2W92A 1B6QA 1QU0A 3HQXA 4ZIBA 4AI3A 5J2UA 3VBHC 1OFNA 2XBO3 4B4PA 5ITZB 3RYCB 1HXS1 2BTVC 4CH4A 4WF9V 3D5OA 2ILMA 3NV2A 2N04A 3HKEA 2OYZA 3IDBB 2DVBA 2YSUB 3VKOA 4DB5A 4MGSA 4H55A 2J1SA 2GP5A 1H2NA 2CGNA 2Q5TA 5FZGA 4I0WB 2QWPB 1OHFA 3L73H 2BUKA 5FK7A 4DNYA 3B5LB 3DKQA 1BMV2 1X50A 5A1AA 1LOAA 3THCA 3DGEA 1YVWA 5FZOA 2CTQA 4QM9A 1BMFG 1JODA 2YB7A 4M3CB 2JIGA 3GZTB 1G7YA 2E9QA 5CEHA 2BGOA 3IIAA 4CYDA 2EIMC 1RUF2 1HB1A 2D6PA 2WAMA 3IWZA 4MGTA 3WNLA 2UXDO 3NJYA 4Q1PA 4JYAB 3M99B 5LZ6A 4HVOA 4B29A 2IVJA 2KSDA 5LCWL 3AC0A 5KMGB 2W2IA 3JALA 2IH3C 3LF7A 1FNYA 1RHI3 2ZPXA 2EJ7A 5CA3A 2VTXA 2DQ0A 2F1MA 5FXVA 4QU1A 4QXKA 3KD4A 2O1QA 1QDOA 2ZD9A 4CXXA 5FPZA 3J7AU 2N7GA 1GQPA 5HFLA 4XURA 3FMGA 1YFUA 4YVWC 1Q7YW 2P90A 5GZGA 4CCLA 4N53C 3L9JT 3J8F1 4NJ4A 1AJQA 1GTOA 2VZ1A 2ZGPA 1GRJA 4IL6Z 1Y74B 1TME2 2WSVA 3SITA 5CBLA 3FJSA 4CCEA 1NI8A 2WLLB 3R05A 3K2OA 4WBBA 3P3NA 1KB9F 2GNTA 1VIWB 5F5QA 4BISA 2ATKC 3RJRA 1R6KA 1HB4A 3PUQA 1EAH3 1XYOA 1NH2B 4UV9A 2KXLA 3DN7A 4AEDB 5LA1A 2XWBB 4F6RA 4Y26A 4CH5A 4LQRA 4JI0O 2EIGA 3WNPA 3WB0A 3MIFA 5FLIA 1SS3A 1M4UA 1O9GA 3WQBA 4Q6GA 2J1RA 3BFRA 3F2ZA 2XBO2 1PKXA 5FPBA 4QGMA 1VBB3 2HEVF 4H37A 4CP2A 1R3IC 4O65A 4EQVA 3O1RA 4C8DA 5FKCA 2AGAA 3FD9A 4CU9A 2ZT9B 5FNVA 3VBFB 1IS3A 1H6YA 3WG1A 2IJJA 1IPJA 3ILRA 3S3XA 4AFMA 3LEIA 3WVJA 1H2KA 2DFBA 4BLIA 2HH9A 4AQYO 4FM0A 3HKCB 4IV3B 3IKWA 1QDCA 2EIJC 4DV6O 3J81N 4RFT0 4OI0A 1PIV2 3JUUA 2A79B 2JS3A 5JPMB 2OT5A 4HAMA 4QDRA 5E1AC 2G1MA 3SPIA 1BL8A 4OZXA 4QQHA 2KB1A 5FYHA 1N36B 1VBD2 3APBA 2HWE1 1H8TB 1PZ9A 1BBT2 1DQ2A 3FC0A 2BE3A 1EZJA 3VD3A 3HPLC 1JYNA 3JCUZ 1OI6A 1NZ6A 5LA0A 5LW9A 4XDLA 1N8RW 1N1YA 3VHPA 2HWF3 4FPYA 1RHI2 4TV8A 3T0DA 1K3EA 4CUAA 5ISLA 4J10A 2JICA 3WU2Z 3CLPA 3RI9A 4L11A 1VQ8V 1IG3A 4CDWC 1F2NA 2BEOA 1YUDA 4CC5A 2HWB2 5CYYA 3DXRB 1HKDA 2OVUA 1EZVH 2BWCA 1ULFA 4DUXA 3ZN5A 3D3QA 1KEXA 2GALA 2Y0PA 3PU8A 3OT7A 4CH3A 1RM1C 2BVBA 1F4HA 5BYNA 2YEVB 4KU7A 5F3GA 3SMHA 2ORZA 2RS33 2RR12 2QDNA 5A80A 3IBMA 2F4PA 5KAFZ 4BJ0A 2JG8A 4XF1A 2BV4A 2N74A 3VBSB 2VZOA 4PBPA 1IBKO 4JRLA 1VBB2 1PK6B 2P4VA 4QPIC 1OPMA 4CCJA 2WYSA 1VQ9V 1KJLA 2P22C 1MACA 3ZEDA 1QVGU 1SLCA 4CDXB 4XUNA 3OPTA 5J09A 4Q4Y1 1N4CA 4GMP0 2O8OA 2RMU3 3X2QC 5DN2A 3RGBA 4XF4A 3DPRA 3AYDA 1UPGA 4CEWA 2VXRA 2HWD3 5FRAA 3CCVV 5EC2C 2QKAA 2DOSA 3PNAA 4OX9O 3D36A 1RL3A 4QE7A 5L7OC 1OCOB 1PM7A 4XAAA 4HOOA 3K3WA 2KG7B 1N3PA 2FBEA 4QMAA 5C9AA 4B1MA 1WMXA 2YFZA 2HJFC 1LENA 4ZY9A 1FJGB 4HK8A 4D6SA 5JOWA 1KXGA 4YJ3A 4AFCA 1ZL8A 3DECA 2VY0A 4KBBA 3OGVA 2CH7B 1LESA 4QX2A 4R8CA 4E4SA 3JB8A 3K4AA 3ZYHA 1GSLA 3U37A 4WBNA 1S0GA 3RZMA 1EYBA 2MNGA 4NKGB 4K35A 2JJ6A 1JZ4A 3E86A 1AF9A 4OHZA 1CAUA 2VMCA 2GC2A 1JUHA 5DUVA 3THDA 1GN3A 4CDUC 2X6CA 4EJRA 5F3EA 4EWEA 3FAVB 1NLSA 3ZR5A 1OF4A 3ZN0A 3QCWA 3BTXA 3JBG3 3B93A 5L9RA 4H13B 1K5SA 1J83A 4MH0E 3QO7A 4CXWA 4JRAA 1XNQB 3WEZA 1RVF3 4XUQA 1STMA 1ZZCA 4MXWA 4GWIA 4FIPC 3ZFGA 2ZE8A 4PJ0Z 4PLMA 4RR3B 2RS32 4AI0A 1W6MA 4GKXA 4UW5A 1LOBA 5DG2A 3AP7A 1SPPA 1UXXX 2EILC 1MS3A 1ZBA3 4BQ5A 5L9BA 4K8FA 1C8M1 1GM7A 1CXZB 3OY8B 3WCSA 3VBUB 5DAPA 2BFUL 4M0HA 2PZSA 2CK3G 4UFZA 5FYIA 1XE0A 2D6NA 2WL1A 3LDKA 4KU8A 2HBTA 1NYWA 1R1A1 2EXIA 1OKOA 2DVFA 5BNQA 4H14A 1F31A 3TXQA 1VMHA 2DCTA 3KV6A 4XFAA 1QLEC 1RTVA 3M3EA 1QHDA 5FZ4A 1RUC1 3E89A 1HN0A 2GC3A 4FXKB 4NWWA 1QMJA 4COUA 3T2OA 5ABJC 1SFPA 1JFFB 1ROPA 2HWD2 4RO2A 1SQQH 4ISQA 1GYKA 3K59A 3B2EE 3T2PA 3SC7X 5I0RA 5B3SB 1X8EA 3I2DA 2RQ6A 5JOXA 4IE6A 5EWSA 2FL4A 3VBOB 3ZO0B 4IEOA 4INDA 1AI6A 1PX4A 3ZRWB 2A0LA 4FPLA 2JDKA 1NY71 3GWOA 3ZMTA 3Q4HA 1TVGA 3WP4A 1AL23 5BV6A 1CAWB 1YQ6A 4NIIA 2V4DA 3OBZA 5JI7A 1W28A 1AR83 2DCKA 5JWPA 4QPGA 1MQTB 2HHHO 1IBMB 1RUD1 2H6CA 5FY0A 3SPJA 2YPDA 2PXJA 4UFLA 2RS12 3FYEB 2CHHA 4ZHQB 1ENXA 3SQOA 4P5HA 3IDCB 3ZIWA 4MTFA 1CD3G 4TLFA 2GNDA 2VOKA 3VD9A 3WNXA 3JBG2 2JG9A 5BNOC 4JGZB 3WG7C 4L92A 2XLFA 4K3AA 1BMV1 2D5HA 1CWPA 2ZGRA 4R52A 4XFBA 4UWDA 2XMLA 4Y5TA 3ETDA 2ZACA 3P5BA 3H3LA 2D43A 3POFA 5K0UC 1YNAA 1S5JA 1V6IA 2GH8A 4HBNA 1RUF1 4R9CA 1APNA 4OHVA 5C33A 1W59A 2XKPA 1D0GA 4Q1RA 3CF6E 5CFDA 2P3IA 3WZ1A 2E26A 4BQXA 3G6EV 4W65A 1IKQA 3R6SA 1MVQA 4DO0A 1C28A 3ZMOA 1TVKA 4MS2A 3HBKA 1X59A 3HJRA 3ZXAC 3T08A 4X6QB 2WO7A 5J1XA 5FMOS 3TCUA 1DF5A 2DYSC 1L1FA 1US2A 4X89A 4U3JA 5DAVA 3D3IA 5AFBA 3OW2U 4BHPA 4PDRA 1JYWA 2VULA 4GH4C 5BR8B 4RD7A 2D2CB 5LHIA 4JI1O 3VGIA 4LK7A 3HD8B 4UVCA 1LOEA 5BNNB 2AHYA 1FFXA 5JOZA 2FYUH 1Y6XA 4I0XB 5DQ0A 1AR71 2DE0X 1LU2A 4DK0A 4R9AA 4M4PA 5AG2A 3I3EA 5IT9N 3AMNA 1TME1 4PA9A 3LE0A 3EBRA 2HEWF 2D44A 4BOWA 4DV2O 1FXKB 3CRAA 2W1WA 5EYYA 2OQ6A 1H9PA 2X5IB 3PMSA 2WZPP 5FY9A 2WRAA 1VMJA 1COV3 2VCCA 3H8UA 1XNRB 3ROUA 4YFZA 4ASMB 4A44A 2AACA 3QO5A 2RE9A 5CB7A 2LW1A 1H4GA 3FZ3A 3OGJA 1HV1A 5JVDB 3SCGA 3FYIB 1NR1A 2VPVA 1BEV1 2OYQA 3JAKB 2XBO1 1W8UA 1I1EA 1KKDA 3ABZA 5JIUA 4XCAA 4CA9A 2ZX4A 2DU0A 4N43B 1W6PA 2Q7EA 1D2SA 2XJTA 1DLLA 5EK0A 3ALQA 3OF1A 4ES9A 3ZHTA 4DUYB 4XABA 2WNOA 3ZOIA 4LF9B 2A75A 3TEYA 4GKKO 1VQ4V 4MGQA 4DV5B 5LP6C 4EFBA 2QQPA 1PIV1 2IUWA 5JMOA 1WLEA 3T30A 2BNMA 1MS8A 4O2BA 3DEMA 2CAZC 3SR2C 1POV1 1S0BA 1VBD1 3OMIB 4W6WA 4E4HA 1BBT1 1Z5VA 4LF7B 4O4LB 4XILA 1QU7A 4LFAO 5KA6A 1KKCA 4DXTA 4Z1MG 4V1PA 2D3RA 3M3QA 3HR9A 1DZRA 1QJY1 4ITCA 1AILA 4H33A 1W9WA 5FQ0B 3I2KA 4NRMA 2VWJA 2BRTA 3I3MA 1ODNA 2QJVA 1WMEA 1HNWB 3H42B 3I5DA 4OXSA 1WZXA 1WNSA 4AVVA 2R1BA 2FTKA 2PQQA 1OJHA 2ZOEB 3MIHA 2EIBA 4DW0A 3E5XA 4AI8A 1GZTA 2C0ZA 2HWB1 3WP6A 3KHBA 2M7WA 3R65A 5A6YA 1QXPA 1U5XA 2QM4A 5F32A 4ZI7A 1AYM3 1O3TA 1AXZA 2VWKA 1YQ5A 2XWJB 4B3SB 4RS5C 4URTA 2G38A 2OPWA 1NCRB 1K7DA 1N32O 1ZRIA 4BIZA 2QZ3A 2B5HA 2WA3A 4BW9A 4E8CA 2VQ0A 2ZGTA 5GJ6A 4EZHA 4AG4A 4X6RB 2ZKNA 2RR11 4K7JA 1I3HA 1K92A 1FMD3 3D4KA 4LBNA 1A78A 4MVRA 1RSOA 5I8YA 2QM8A 3M3CA 4GX2A 3E2EA 3ZN6A 4IW3A 4X66B 2ZM6O 2K0GA 3ZSEA 3RYIB 3HNBM 2O0OA 1I5XA 1M56C 2HLDG 3W7TA 3JSNA 4B3RO 2ADDA 2RVAA 5DUUA 2Y4UA 3VBFA 1WP8A 2ZBJA 3J80N 1W99A 3OPWA 2JXAA 5IYDO 3GZAA 1PHMA 4LF4B 3OEAA 1E79G 1Y43B 1XILA 4LP8A 3K5NA 3CXCU 4UW4A 1NXD1 3S5QA 1PNGA 3O0VA 3BVCA 3BUCA 1XREA 3HKCA 4AL9A 4LXLA 4AR2A 2OX0A 1QJU3 5E79Z 3VDCA 2Y26A 5KA5A 2AH2A 5EBWC 2CUGA 5IE9A 4IETA 1PM9A 4PT6A 3N9NA 4DRXB 2JGUA 5C4WB 5LBFA 3LPFA 3VKFC 4YW2A 3JZVA 3ZMNA 4S2HA 1IBLB 1H8TA 4PCRA 4NXMB 4YW4A 3KGZA 1DZQA 4CP0A 3C2UA 1JHJA 5A3OA 3OPZA 2PY5A 2DVGA 1YEWA 1SETA 3I3BA 4E8DA 1RUH2 5IY5B 5LBBA 3KKYA 2E51A 3NNGA 2SLIA 3ZM8A 5FUNA 2RHPA 1T2XA 3ICXA 4I30A 4IGGA 1N34O 4GZ9A 1HNZO 3LIGA 3LOIA 5CKMA 2MEV2 4HZ3A 4NN0A 3ETQA 2LTNA 3JAWA 2ZNJA 2JD4A 4X65B 3KF5A 1VBE2 4YWAA 3N4MA 1E5SA 5GLVA 1LEMA 3DXRA 2FDIA 2B7YA 5ACA3 4AGVA 4XJUA 3KZIZ 3HKBA 2OPKA 4Y22A 1K8AW 5L36A 4UW6A 1UMIA 3RPQA 5C3OA 5JR2A 4JHZA 2JJ2G 4PELA 4DYLA 2ZE5A 2V4VA 3RN4A 2YIBD 3BY6A 1VRH1 2EJRA 1GOFA 4HKWA 1HR0B 3H1YA 2FDFA 2WWUA 2I2SA 3USSA 1QCEA 1WCSA 2RDCA 3CU7A 4QPYA 5FK8A 1CAVA 1GZ9A 3MD0A 3M7MX 4LF5B 4Y1ZA 5FLHA 2XAJA 4AE2A 4LF8O 4L8JA 2J22A 2IXHA 2XHBA 3BAAA 4OMDA 1A32A 5IYBO 5A2QN 1MMMA 1K5MB 3AL5A 3DF0A 4FBFA 4JQRA 2OUHA 3H8OA 4EE2A 3NQHA 4ONUA 2WLKA 1SQBH 4BK4A 2NR5A 3WXPA 3CWBH 5F5AA 2W9XA 4YVSC 4LFBO 1KMIZ 2K9ZA 1IS6A 1MG1A 2OWOA 4YY3B 1YFYA 3FB8C 4HXCA 3L2HA 3PL0A 1QJU2 2HVJC 1B35C 1UZZA 4G4FA 2HWD1 1HRV2 1OD5A 4NHXA 5FP4A 2HHHB 2NNUA 2D6MA 4YGDA 5CU1A 1Y4MA 2ZZQA 3ZFEC 4GLXA 4YGBA 1F7YA 4DO2A 3SKVA 1Q56A 1RINA 3VHOA 1ZBE3 3X29B 1V55B 3DSQA 5H9RA 2VQAA 5FYYA 2A3WA 3HMYA 5J3UA 5IFTA 1R6TA 1LECA 1PNMA 2A7WA 5EFUA 1ND3B 1LNQA 4L0PA 3VHRA 3C3SA 3KSCA 3MUZ1 4MVQA 5CISA 5FCCA 1GM8A 3OUSA 1SLTA 4U7NA 3RZHA 4MSWC 3G4SV 1FFTB 1NBMG 3UKVA 4XJZA 1BS3A 3J9SA 2RS11 1SQPH 4YM3A 1DZTA 2YBKA 3TYJA 4GJZA 3IB3A 3FAVA 1YJKA 2C9KA 1PO21 1UXZA 3CJIC 3NO8A 3RW0A 3I49A 3E22A 1GFF2 1RUI2 1YXWA 3JBG1 2DF7A 1GQGA 5FJKA 3OR7C 2QDRA 2A6ZA 4JI7B 3R4SA 3GM8A 2XL9A 4Y4RA 5HCAA 3ZXLA 3W7XA 2VQFB 1WW7A 2BDRA 3CE2A 4IV1A 1URFA 1UX7A 4DFSA 3K9AA 2PYTA 4IEWA 1NTKH 4Q27A 2ZEWA 5C3SA 1W90A 3NJZA 3PUSA 5JJNB 4A42A 2XOKG 3T1YO 3JYCA 3E1F1 1XMQO 1KFXL 4UUJC 2NLJC 1S72V 3V65A 4DY5A 5D5QA 1S2EA 1C8NA 4NHYA 1WA8A 5DN6G 1PVC3 5TISZ 5KXCA 5EJ1B 2JDYA 2EBOA 4YXWG 5IHRA 3PJSK 5GONB 4ZU7A 1O3QA 2IXCA 3V0BB 4Q8KA 1I0HA 2DMXA 3ZYBA 1V54B 4TOIA 2LGWA 1V6LA 3K3NA 3TGUH 1BK0A 4Y20B 3ABTA 1DGRN 2V5YA 4CCDA 4AFAA 4JTNA 4TV9B 2XUMA 1VF6C 5A3TA 2K1EA 4H7MA 4D3WA 2UU8A 1CAWA 1OOPB 2WPDG 2JK5C 3A0RA 3SCFA 2LROA 5HV4A 3K77A 4ZOLA 1F5JA 1X9PA 3T09A 4MSVA 1WMDA 1QJX1 3LSEA 1LGCA 4E2GA 1YIFA 1EPZA 5C8YA 2E5LO 2VMDA 2UUBO 3VBHB 4GKKB 3AKSA 1O59A 2WSSG 3LA2A 4DR2O 2Y33A 4XHBA 3B7MA 1HIXA 3VBSC 4C1WA 5T5LA 3WOGA 2W94A 2EXHA 1C3HA 1XL6A 1UY0A 3JD3A 5H9PA 2JDUA 4FPOB 3P1IA 3ZSMA 2AZ5A 4CDXC 2NN4A 4OZOA 3UGGA 2RN9A 3URFA 4NIDA 2PA7A 5EC1C 1XU1A 4AEJA 2A6XA 3CXHF 3O1VA 5FL7G 4BYYA 3SH5A 5LMUO 3SDLA 4I4TB 1IQAA 1Q8VA 4AVCA 2I45A 2EIMB 2RDRA 4AHWA 5JZGA 3CZUA 4O2AA 3JD1A 3CDZB 2QTOA 3JATB 5GZEA 2WABA 5IVBA 1NT2B 3CCRV 4LC1A 4GKJO 2PAKA 5FP3A 2VAUA 4MO3M 2EVXA 4Q0VA 3TEWA 3CL1A 5GALA 3VZOA 2GMPA 4DR5B 1EPWA 2UXCO 1E1QG 3RMXA 1CIWA 2BQPA 3IGAC 1YTFD 2R32A 5F5IA 3DC5A 2Q68A 1VB2A 4LO4B 3BN6A 5FJHA 1LU1A 4I0XA 3V0AA 2BVVA 2XAFA 4N53B 2R9IA 1VF5B 3CSXA 2RJZA 1EV11 1H2GA 2YC2A 1Q8OA 4TQFA 1FXKA 4D7SA 2EZOA 1Y9QA 1QJFA 4B3RB 4HLTA 4XDKA 3N27A 1ASJ3 4RQFA 3T0AA 3UT5B 5LRRA 2X5IA 2DTYA 5FZ8A 1AR62 1T6GC 4KUMA 1S5LZ 1U97A 3ZPYA 5FZHA 4JGYA 2IXKA 4I55B 5JJEB 2F4VO 1UN1A 1HV0A 3RYHA 1I5ZA 1JW6A 3AVSA 5BUVA 4LF6O 2YIDA 5C3PA 2UU9O 3OUIA 3U4XA 4Q29A 1TA8A 2Q0AA 1G86A 1HRI3 5EYXA 2RNBA 4BLJA 3BKZA 2B42B 2LS6A 4NHLA 2VM9A 3BABA 3PHMA 4GMP1 2EULA 2G19A 4L99A 4GX1A 1O9HA 4XUTA 4GULA 3RVHA 5TSWA 5CADA 4QQOA 2D6OX 1XNBA 4FPHA 1NQDA 3GBWA 2FDHA 4JCKA 2JKXA 5AC93 4J9ZB 5LYJA 3KF3A 4BXFA 2R073 2OUJA 2GZWA 5KC6A 5IVJA 1PO11 2XASA 3FE5A 4NROA 4DPNA 3CCUV 3UKNA 3MBWA 4JI3B 1XDCA 2EIJB 5A33B 1JMKC 3NXSA 2RS53 4OLLA 1Q81W 4KXRA 2VQEB 2WNVC 1SA0B 3CJXA 2KKWA 2VTFA 4UT5A 4WM7C 4FFHA 4AXOA 5FPRA 2ZGOA 5T54A 1Q3EA 1XL4A 2BOCC 1UY1A 1RB8G 3PJQA 2HBUA 3ILNA 1YYNA 4UCSA 4IEXA 3HT1A 4B3TB 1I94B 1AX0A 4AFDA 3TNQA 3TEZA 3DPRC 4CEWC 2BOJA 4H7LA 4QM8A 3POEA 2Y34A 4B7KA 1RUH1 1XOUA 1K12A 1UMHA 2PN5A 5I8SA 1HJGA 4YZ3A 4Y1YA 1ORQC 5EYPA 3ML0A 1F5FA 1PZ8A 1VAVA 3FLRA 2X6AA 4FLZA 2Y48A 1P49A 2WNUC 4KQ7A 5FP9A 1LRHA 2MEV1 2VMFA 1IX9A 2F93B 2A5ZA 3WF1A 5C9AC 4META 4LLOA 1IHMA 2KR2A 1BYHA 3OSDA 2BJSA 3OUJA 1C1LA 3WDTA 5CN0A 1VBE1 2YUEA 1UJWB 1PGW2 3M3OA 5KBFA 4XF0A 2VZ3A 3Q8BA 5T50A 1HXS3 2GC1A 1Q6UA 2O8QA 5LXTB 2QQKA 5JPNB 5FYBA 4AVBA 3GB7C 4A41A 4GKYA 4PA7A 3SYQA 3DYMA 1CX4A 2E7AA 1RM1B 3I55V 2IBZH 3LOBA 4PA3A 3POBA 4XVHA 3N36A 4Z82A 5FXWA 4A2UA 3T1MA 1BT8A 1PPJH 2DYCA 3HWJA 3VHNA 3Q8FA 3AKPA 5GZFA 3SLIA 1M93A 4R4ZA 1J95A 4UCRA 4OULA 4TT3G 3AM2A 3UETA 1W2BU 4A7YA 5H9CA 1OMIA 2VW2A 2NPIA 2NYYA 5JXIA 1GMGA 4B4RA 2BERA 2ZMNA 3WW2A 1XNDA 3KQ4B 1B09A 1KYOF 4RHV2 2VOXA 5CVRA 4DV1B 3WNNA 2PHTA 4YIPA 4PDWA 4W6XA 3EHKA 3VBRA 3PURA 4QPIB 3ZFGC 4X62O 5F39A 3APQA 1WLWA 4DR1O 1BZKA 4I50B 1J3QA 3RYFA 2LRPA 4FFFA 1DLBA 3E8BA 5B1NA 4BU2A 4DXSA 3X2QB 2IW5A 1J3RA 2Z42A 4ASUG 2E32A 1QJU1 1SQVH 4JPRA 3K06A 1UO9A 2W3JA 1ZUQA 4DRXA 2VCMA 4LBQA 4FJCC 4UCOA 2QTWB 3T1HO 1HRV1 4GAZA 2A9HA 3ZYPA 1P7BA 1FAFA 2AENA 1W05A 1JYXA 4JI2O 3AXEA 4FP2A 3CRQA 2ITDC 3J8F3 2XAQA 3EO6A 4DY3A 1LTEA 3O0WA 1R6NA 3HN3A 3J4UH 5DUWA 4JI8B 3NAPA 3NL1A 2VVDA 2E3CA 4LFCB 2GUZA 3RVYA 3O5SA 4FT8A 5FZBA 1BLZA 1O3RA 2CAVA 2GNBA 4RQEA 4RUEA 4HYOA 2RMKB 5KHKA 3B8MA 1QHTA 4EEQA 4LLFA 3B77A 4J6GA 4LPLA 3PVOA 3ZS8C 1YTFB 3J7HA 1PNKA 3OUFA 1UWWA 4YYOA 1TG7A 1HXS2 4CDUB 5L19A 2CGOA 2IFRA 1J59A 1RUI1 2PUSA 5HV0A 1UPIA 1XMQB 4FAHA 2OZJA 3SISA 1FYJA 3GYDA 2FCTA 3A21A 4NIAA 5CG9A 1DK1A 1VQMV 5JCOA 2BU9A 4QXHA 4HONA 1NTMH 1FT9A 1C1FA 1BCXA 1FX5A 4UVBA 4O4HB 2Y6GA 2XR4A 2JB8A 3ILFA 1NCQA 5E6HA 4F4LA 2EILB 1LOGA 5LOVB 5FO8B 3IIIA 3IAPA 4U3FH 1K5MA 5C8CA 2JG9C 5CA6A 3V56A 2OIIA 1GZWB 3WP5A 1WPBA 1KC8W 1JHNA 4NAMA 2HWE3 3HPNA 3IZOA 3SPHA 2UWCA 4LHKA 4X1KB 3FN9A 4MXVA 2PHXA 1FATA 3RZLA 4B3MB 4EN8B 3N7MA 4FZ0A 1GP5A 3AZXA 1UOFA 5IVFA 2Z79A 1XYPA 3ABLC 3UK9A 1T5EA 5IYZB 2V5DA 3VDDA 3JAMN 4FOWA 2PHWA 1OCZC 3ZPOA 5ABJB 1VBC2 1QXRA 1OF3A 3ORJA 1NU1H 3DV8A 1BXHA 1OT5A 4IEVA 3HOBA 2UY9A 4UFJA 2VVEA 4JYAO 2UUBB 5LEJA 1UYYA 4Y1XA 4QKBA 2NP0A 2PYLA 3J8F2 3KV9A 4DR2B 1IOAA 1K97A 2IU3A 1D4M2 1OZ0A 4CP1A 3SYAA 2DCYA 3WB2A 2V09A 1UF2C 4FPCA 2P5BA 3MHZA 4LMFA 2WLPA 2AEZA 4BZ4A 1WLCA 3ZN4A 2Q4PA 4KGGA 3C3TA 2KM2A 1VMGA 1O5UA 4E2LA 5LWBA 1NLQA 1YO8A 5F6KA 1F4AA 1MZFA 4QKFA 2IC1A 2Q30A 1CONA 5J2TA 1RUG1 1LULA 3H7YA 4XDOA 3ZR6A 3JASA 1I5PA 1ZX5A 4XHXA 2JDMA 1VJ2A 1QEXA 1M57C 5HCFA 1P4RA 4UF0B 4AK3A 4ZXEA 3I59B 1HLCA 5GLZA 1S76D 2UYAA 3WV6A 2AYHA 1QQP1 2WYFA 2JENA 1AP5A 5BNOB 5L3CA 3K75B 3WG7B 3I3DA 4QPWA 3AL6A 5FZ7A 4MGYE 4Q4Y3 1JX9A 1UIKA 5FZFA 1JOPA 2OW4A 5FKBA 2A1XA 3FLTA 1NKGA 1VPHA 2DUPA 1LCLA 2ZEYA 1JXNA 3WNKA 4LBJA 2BYVE 4UFIA 4YLZA 5K0UB 2VU9A 1BVVA 4GALA 3CO2A 1GN2A 4UOJA 2X29A 3BTYA 1OLQA 4FSJA 1VP6A 1GWKA 4J1XA 4PDLA 5KWRA 3PUIA 4ZONA 2Q8DA 4CPBA 3ME2A 1UY2A 3WF4A 1WCDJ 2ZEXA 4G27B 1F9KA 2UXNA 4KWKA 5FZMA 3I4IA 1YHQV 3MDPA 1JA8A 2DYSB 1R092 4P08A 4QIWF 1AL0G 4F6EA 2CTRA 2FDKA 1E5RA 1GKBA 3ECQA 2YU1A 4XPVA 3JCZA 3HQUA 4GH4B 2GDSA 5F5CA 3K3OA 3O1TA 3E83A 2NLRA 1KDKA 4X1IB 1GUIA 1KP2A 4FAGA 4Z8BA 3KT7A 1DF4A 2HWC1 2YS8A 1YITV 2Z5UA 5I0DA 5BXZA 1AUYA 2V1DA 3MAQA 4FM2A 2ARBA 2E33A 3T1CA 1K45A 4WM8A 1W6OB 5IUQA 3B69A 3UCSC 4J7KA 4Q0PA 3F7YC 4JZGA 1AR61 1V0AA 3LNNA 1Q8IA 3N2KA 2DBNA 4ARXA 1SCSA 4FFBA 2CWMA 3AFGA 4MHRA 3U10A 3QO8A 1GM9A 2JIJA 1S0DA 1YI7A 3H7JA 1VR3A 3VBHA 3ON7A 1W9TA 1SMVA 4COYA 3J26N 1C8M3 2WDBA 4CP9A 4ZBMA 2GP3A 3RS6A 3IPVB 5A7WB 5A1FA 4LO7A 5F2VO 2IJKA 3WT3A 3AMMA 4S2DA 3ABKC 4LUKA 3AYEA 3UNPA 1R1A3 4FLWA 5JI9A 1JJ2U 5T5PA 4PI0A 1BE3H 5DAXA 2GDFA 1H2SB 1W8WA 4KNCA 3IT8A 1GLHA 4ZU4A 5LBQA 1GK9A 1WW6A 5FTTC 5KX5B 1RUC3 1PGL1 2ZDIA 1H4HA 3LUTB 3O1UA 3OGSA 2HVKC 5LP6B 4H0LB 4HVRA 2ZIMA 1ZZ7A 3K5OA 4NR1A 4QDSA 1NA1A 4D8MA 3D8CA 3J7MA 1TMF2 2EIKC 2QDOA 2JDIG 2XNDG 2Z0AA 3SNMA 2DWRA 4COWA 5F9TA 3LEMA 1BJQA 2WT0A 4BQ3A 1K34A 3BTZA 4R4XA 3CYOA 4SBVA 2JE8A 1GKFA 2E74B 4HNAB 1TEIA 5FREA 1AR5A 4Q4V2 3W58A 5FMDA 3VB9A 2VOWA 4CCNA 3LDBA 3MUY1 5EBMC 1LODA 3WDWA 4AI9A 2GNMA 2DU1A 4CDQA 4BMBA 4K0KB 4L97A 3N2GB 4YVWA 2P2KA 2B4KA 1AYN2 1DFQA 1G9DA 1NXMA 3BA8A 1PGW1 5BMVA 3NV4A 5G04L 1UZYA 4HPKA 5CAZA 2W47A 3CP1A 1V6NA 5CMUA 1FJGO 3IAYA 4XQDA 1LOFA 4UBGA 2NMOA 5A7PA 4RS5B 3OD4A 4BPZA 3ZSJA 4O9EA 3ES1A 1LUWA 2VH9A 4QNHB 4I55A 1RJ8A 1RMU1 2W0XA 3SPGA 1OKQA 2CTWA 2XAHA 3RBZA 4QX5A 1X82A 1MABG 3B9IA 2OTJV 2VCAA 1VARA 2Q69A 1ULEA 5FZ9A 3ZSKA 3P6BA 1Q8SA 1RUJ2 4QHOA 4O4JB 1JI6A 5FWEA 5A9GA 4QWNA 2XVGA 2W95A 4YZ2A 3RYPA 1C8M2 1M56B 4RHV1 4QGLA 1RUF3 3H1LH 2CNAA 1Z7S2 4Y3OA 5GLWA 4B4QA 3MIBA 1OXCA 1S0EA 2XDVA 4AQ2A 3H1WA 4FXGB 1QIQA 4JKLA 1XNQO 2VUJA 1NQJA 1JZ3A 4PLNA 5EHDA 5DDJ2 3KV5A 5ANNA 3HVDA 5H6RA 2ZX1A 1CN1A 3ABMC 3CC2V 5FY8A 2PLV2 5FLXN 3ZFFA 4FOQA 1QXJA 4O4IB 4P9LA 5H9SA 2P06A 3E5UA 4EB6B 4OUSA 1WBLA 1WA4A 4QX1A 1AR73 2WAAA 4D7TA 5KUKA 3C7OA 2CTPA 4Q4W2 2XJVA 1ZZ8A 1TME3 2VNGA 5J37A 4YZ5A 4I0BA 1VEWA 4LH6A 5FAXA 1IG0A 2BGCA 3LSQA 1QJZA 5L9VA 5GM0A 4QB6A 2VGDA 4XACA 5L3BA 3CCEV 1CZVA 1R081 1WUVA 2QNKA 3J7LA 1RUOA 1LHOA 3NKGA 3M4FA 1W6QA 2WQ4A 4XXPA 4CDWA 3F7VC 3KMHA 1W6NA 5FP7A 3W9AA 4IIJA 1GH6A 2HKOA 3C7GA 3VV1A 1JR9A 4NPLA 5J9PC 3ASOC 1W8OA 1JUIA 1U5YA 2G9GA 1WLTA 2VMGA 3OJBA 1BEV3 4Q0UA 3WF0A 5IVVA 1QJEA 1RXFA 3CNAA 1HDKA 4IHJA 1URXA 4PLOA 4FOVA 4LK6A 4JV5B 3B94A 3CQOA 1KFUL 4HANA 4UXNA 3VN4A 4HT1T 3NNLA 2WLIA 3AG2C 1LHVA 2PFWA 4JYCA 1XE7A 1IBMO 4E4ZA 2JEUA 4YGCA 2QQLA 3KT1A 4GUNA 1AR92 4N8MA 4NWVA 4DR6B 3OTOB 1PIV3 5B4XA 4AW7A 2X09A 4DV3B 5IW0A 5FPXA 1ND2A 1DYKA 3CJHB 4CXYA 3GVMA 1E1RG 2VZPA 1POV3 5KXBA 1ULOA 1VBD3 4QPIA 4JQTA 2F6BA 1QKQA 1ZWIC 3KZ4C 1BBT3 5GZCA 3W7SA 5EZYB 3GF6A 4E9KA 4WZFA 4YVSB 1XMOB 1COWG 1ZRDA 4DV7B 3ZYRA 1IPKA 5IFPA 3ZKUA 3DUIA 4IV1C 2WKKA 3I2IA 4PF5A 3I2OA 3O65A 2QQOA 1QJY3 3CMEV 3ELNA 4IGOA 2WN3A 4C0BA 1KUQA 2YBPA 5K1XA 1B35B 3C7EA 4IE7A 4XQ4A 4LR4A 1GU3A 3S0MA 3ZXFA 1O91A 4RGKA 4LBLA 3VD4A 1VBC1 5EP9A 3N7LA 4CH6A 4IEPA 3UESA 1UYZA 4AOCA 1JCHA 5L7OA 3N9QA 3ZFEB 4XFIA 1REFA 2HWB3 5HI0A 4K1ZA 4KI5M 4H44B 1O8SA 1AR72 4GB32 3MLJA 2E7TA 4XIOA 1D4M1 4GZRB 2AR6A 1W3XA 5GTIZ 2YXSA 3OD0A 3RQ0A 1YZBA 3AVRA 2BZDA 5C3RA 1S1AA 2VUCA 3HB3B 4QX3A 5BR8O 3FB6C 1VQPV 1S0VA 1UD1A 2ODMA 1PX3A 4XDJA 3GNEA 1IVSA 1JN2P 2ZR3A 1IS5A 4RFRB 2E76B 1G1XB 2RR13 4OHWA 2R16A 3TRSB 1TUBB 4K8XA 3SH4A 4W4ZA 2YY1A 2P37A 4D6TH 4XZUG 2ATFA 3NWKA 3WNOA 2CL2A 2H94A 4LWSB 4CDUA 1BEV2 3WQ1A 2ZGNA 2M6YA 4KWLA 2XAGA 2FKXA 3W7WA 1W06A 3PVNA 3CJIB 3TNPB 1AR1B 4W6YA 1KQSU 1O4TA 2LALA 3TB0A 2JGDB 2IXJA 4KGQA 1SDWA 2ORXA 2VUDA 1RUE2 4I2OA 3BOPA 1XNRO 3NV1A 1SESA 4ASKA 1SCRA 2Y4TA 2C1FA 1XQNA 3ZMVA 2AHZA 2ZIOA 1Z5WA 5D1IA 3HKEB 4H3WA 1MPXA 2WFPA 1SRYA 2R1DA 3MICA 2K46A 3H9AA 2OIEA 4M00A 5KXDA 4OFGA 4AAXA 4HN1A 5D2AA 4OHYA 2VZQA 2QE3A 1D5AA 5FZOB 4C0HA 4DUYO 3WD5A 5JCTA 1AJNA 3I97A 2H8PC 3U07A 1R091 4BH9A 4LF9O 4BIFA 1GN6A 1G8MA 5CFCC 2ADPA 1KQRA 2TUNA 4IQPA 1QJY2 2AGSA 4MUVA 1SHWB 3E35A 4DV5O 2KA3A 1VALA 1J3PA 5T3NA 5JZGC 2FMLA 4TQDA 3ZYGA 5FY5A 1AP6A 2QWQB 1R1BA 3UJOA 2WWJA 4DR4B 1NAEA 2O57A 4QHZA 4FLTA 5LY1A 3LWCA 3JALB 3A22A 4FTSA 1IS4A 4IGPA 2UXBB 3O7OA 2ZGLA 4PF1A 5AFEA 4LF7O 4FPFA 2OTLV 3LDDA 3BPZA 1NUKA 4FPEA 2JEXA 2QCSB 1YJ9V 3OTFA 1ZVFA 4YHHB 2BWAA 3N7KA 2OXBA 3S5AA 3G80A 4ARYA 2QBXA 1IDSA 3W5MA 1VRH3 2JS5A 4CUCA 1HNWO 4QX8A 2ZS6B 4Q20A 2E75B 4Y24A 4Q2FA 4FTEA 1VAKA 2PHDA 4XJAA 2BBVA 4BM8A 3BU7A 5EV7A 2D3OW 3BOWA 3OB8A 3FX7A 1P84F 1VQLV 4QQ2A 1CVNA 3UT0A 3AYCA 3S57A 2RCVA 4HZFA 2BCCH 2E31A 2X8KA 3RJ2X 4JGYC 2RJ2A 2RV9A 1AI4A 5LATA 4XFGA 4F6RB 3TWIA 4B3SO 2FQPA 3HNYM 3LZZA 4V2VA 3ZHQA 3FB7C 2GAUA 1QR9A 3FX3A 3ZXEA 4BQ2A 3SJBC 3KCCA 1LR5A 5JIAA 4CUBA 1SEFA 5LBCA 3JD0A 5LHHA 4XFFA 4Z2AA 3B00A 4U7OA 5CIRA 3PVBB 4X66O 2Z69A 5FNVB 5FY1A 1IKPA 1TMF1 2PELA 4S2FA 1TAEA 2C2AA 3IMNA 4CEYA 2E63A 5FZEA 3O14A 3QVNA 1AB3A 4QT6A 3AK1A 5T5JA 5D8AA 3K4ZA 4LF4O 3H8XA 4X1YB 3WCRA 4CS4A 1VP7A 3ACFA 5JQGA 4JAVA 2VD7A 4Q4V1 2HG5C 1SERA 2E7QA 2R0HA 2ADEA 5BXXA 1E57A 1OH3A 3TBDA 1WB8A 2GC0A 4L8QA 2ARAA 3DGTA 5FZCA 5F37A 5EJZB 1SC5B 2BTOA 3A0KA 1G9BA 4M3CE 1S55A 2XTAA 3ENRA 1XNKA 3M70A 5FZ0A 3GCXA 1ODMA 4YM1A 1K5JA 4LHSA 1AI7A 5A3UA 2X05A 1IBLO 1AYN1 1ZLZA 4NXMO 5IJ0A 2VRZA 2XJSA 3ZRSA 4K6BA 4TV8B 2FDGA 1U96A 2YGMA 2RS13 4XJ9A 1W3VA 3OUHA 4B08A 4FZ1A 4AVSA 4Q4X2 1SG3A 4RN5A 3MIEA 1PO23 1J1TA 4BQ1A 4ES8A 1B04A 3CMGA 5IK5A 5E1RA 2PGGA 3THTA 3CZJA 3IMMA 3OMAB 4NXNB 5FP8A 4CU8A 4QXCA 3FFQA 4UBHA 3WR0A 3POGA 3MHSC 1W0JG 1VRH2 5B4NA 2VW1A 2WLHA 3SXWA 4PHZA 2P7TC 2EXKA 3Q8AA 3NR7A 4JI4B 4X65O 2WR9A 4AQSA 1RUJ1 2R30A 4CZSA 2HFEC 1AXKA 3R4DB 2CDPA 3ZHSA 4LNVA 5IDJA 3QF7A 1Z7S1 3JD72 5IJ9A 4A3ZA 3AKQA 1JJOA 1A8MA 1CPMA 4IEUA 2DYRC 3Q9OA 4JAAA 5DZFA 4CZZA 5FYSA 3HKDA 4EN9B 1HR0O 3F95A 2BNNA 3CBNA 5DDJ1 4WVMB 3POYA 4QHBA 1YIPA 1E5HA 3WX5A 1DBNA 4LF5O 2VZSA 4PDWC 2Q73A 3VBRC 2PLV1 2PAMA 2QWOB 2WNVB 4MLOA 4WM7B 2YXHA 4XFHA 2RM23 4LA2A 4JTCB 3GZEA 3ATGA 3A7QA 5L3DA 2QWRB 1BQPA 2GSYA 4FPGA 1I7FA 2CY6A 3DCQA 4JI6B 5A1LA 3JXSA 5BNPA 2VBPA 1FYUA 4Q4W1 3DPRB 4W50A 3FUOA 4CEWB 3O1MA 1DYOA 2IH1C 1K33A 4DUZB 1BK1A 4UI9L 3AG1C 1GAXA 4YY3O 1M4WA 3OEBA 1QF3A 1Y76A 1L8DA 3H3ZA 3TN92 4RSUA 2BTQA 1HB2A 1UKRA 2FCVA 3T4ZA 2WNUB 3LIHA 2A7AA 2XHKA 5C9AB 1KECA 3HNMA 1EY2A 3T0BA 1QJX3 5CKNA 2E53A 3OMNB 2C6SA 2CAUA 1AHSA 5FXZA 3NAPC 2ZXWC 1RGSA 1OBNA 4TTGA 4YJ3B 2Q1FA 1ZL8B 3MEPA 2R042 3EMRA 1MZ6A 3KVBA 1W8NA 1BHAA 1K3IA 5FUIA 3JB4C 2LM3A 1I6XA 3KV4A 5EJ3A 3PU3A 1PO22 3LSDA 4DUWA 4IL7A 3AG3C 4YJ2A 2ZHNA 4TN7A 2ZMLA 1BHBA 5JSOA 4DMIA 4WBNB 2OCCC 2XL7A 4ZPIA 1OLRA 3LNMB 1C57A 4AI2A 4Q26A 3MFAA 4MYEA 3R0RA 5CKQA 4DR3B 1A3KA 1VQOV 1AR91 4AHCA 1O8PA 4EFEA 4MVZA 5IVEA 2LW7A 3OOXA 5IATA 4EROA 4IYHA 2NQYA 4ATEA 3DXUA 5JR7B 5HCBA 4Y4YA 1ST8A 2XLGA 3MI8A 4ABMA 1QOOA 5JCOC 3WG2A 1YJLA 3VBBA 2IXIA 4JI5B 5B1AC 4MXWB 2QQWA 4K40A 3T2QA 4JC1A 3ZFGB 3ZVXA 3BCCH 4GWJA 1NCQC 1W6MB 3THOA 1EUUA 2VCBA 2D40A 2TBVA 4JI7O 1RFYA 2C4XA 4GQ7A 3I7DA 1HNXB 3MPPG 1L7QA 3ZMSA 4CS2A 3THPA 4QJFB 2XVLA 2VQFO 3E97A 1ULPA 1N0NA 1LB2A 4AGRA 1W39A 4LE3A 1MSDA 4RQPA 4BQ4A 4EN0A 3BA9A 3I2HA 4N9HA 5I93A 2RM22 3VKMA 3OYWA 2QKCA 3NMBA 4OCTA 4YIOA 4GYCB 5A3LA 2VNOA 1EV13 2PHUA 4GB31 1X33A 3VDDC 2QUOA 1ZRFA 1POQA 1CPNA 2VUAA 5L73A 1NZCA 2BSKA 5BPXA 3USUA 1OC1A 1WP7A 1EM1A 1LEDA 5M0TA 4FPJA 2YYOA 4PJYA 4XQWA 1XQ8A 1XNTA 5JH7A 4JDNA 4TWTA 1NT0A 5ERLA 4DEVA 1WW4A 3LB9A 5IAVA 4TSVA 1CP9A 3ZXJA 1GN4A 2DN9A 1UY4A 1FD9A 3CEIA 4GD4A 1FXZA 5FYVA 4OVEA 1QJX2 4LO5B 1VF7A 1FPN2 5ANQA 4LIVA 3Q4HB 3CS5A 5ITZA 3RYCA 5L3GA 4K20A 4JKMA 1OA4A 4GMP3 4XBLA 3CHXA 4B1LA 1XYNA 4KG8A 3ZN1A 5EXOA 3K0GA 3E5QA 5BZBA 2ZGSA 1J5EB 4TUYB 2K2SA 5LMNB 2VMHA 2W0FC 2BW8A 4J42A 2ITCC 2CTVA 1P7GA 1O7FA 2HJDA 1HQWA 1RUE1 4XE9A 1YCIA 3VL9A 4AVTA 5DZGA 1N3OA 3UGHA 1JMUB 1PO13 5GW7A 1GNYA 2F4LA 4IEZA 1DQ6A 4MGKE 5JOYA 2FCUA 1XSRA 1YSCA 2HR3A 1OLME 2DDUA 4M3CA 2I74A 5EIBC 4AEKA 2JG9B 2FZ2A 3TAYA 5C6CA 1RJ7A 5IWAB 4XETA 3WNMA 3VLBB 5IYCO 2QKSA 5KMGA 4DQAA 4TLGA 1CJPA 3CCQV 1NTZH 1U0AA 3P32A 5KHIA 2D6LX 5J36A 1RUH3 2F23A 3UJQA 1GR3A 4QKNA 3ABLB 2JDPA 1M9NA 4BWAA 1PV0A 1YI9A 1OCZB 5FYMA 2MEV3 5CFDB 2UUCB 4DRVA 1DGWA 4SLIA 3POJA 4I9QA 2VTXJ 1ACCA 3SEEA 4GA9A 2W6IG 3M8AA 1UIJA 5L3FA 4MGZE 4KHPB 1VBA2 1VBE3 4QAWA 1Q8PA 4U3JB 3WG3A 4RYDA 1V9U1 1Y74A 4K9SA 3BHPA 1EV12 4JGSA 4U2AA 2QKDA 2W1UA 3FHQA 4LOSA 3CCJV 3RRDA 1SFYA 3U78A 4LKDA 1W8TA 2WLLA 2L6LA 3AG7A 1XEQA 3LAGA 4DR5O 2R062 5E89A 4QE9A 2J42A 2AXTZ 4AEDA 4MGIE 4ZXKA 4O9GA 2WS92 3AK0A 1WPXA 3U4SA 3SPCA 4K8ZA 1QOSA 2IFWA 4WM8C 1G9AA 5A3PA 2VQUA 5A7SA 2ZR2A 1JZ2A 1FAYA 2YU2A 4EN7B 2HKXA 4Q0SA 4LHLA 4WFAV 3WF2A 1QVFU 3K58A 5DABA 1M57B 3N9OA 3CJIA 3DXTA 3MZHA 2WT2A 1UYXA 4PA6A 3LDRA 1MS9A 3LPGA 1KJRA 1JTZX 3G6BA 1FOD2 3QBQA 5CBHA 1FNZA 5IWFA 4IE4A 3O1OA 3FFZA 4J7ZA 2WQZC 5LBEA 3HAGA 4S2GA 3U11A 3RI8A 1RUNA 4IYIA 4JVAA 4IV3A 1PO12 5HFMA 3O9OA 3VUOA 2RG4A 4I3GA 1YHFA 3H1KH 4MTOA 1W6PB 5KHHA 1SLAA 4CTEA 2VJXA 1NQTA 1HRV3 4HL0A 3VOUA 2ZZJA 4XXAA 1LHWA 2PHRA 4A45A 2B8MA 5D21A 2Q67A 1DQ4A 1LHNA 2IM9A 2VQTA 3K57A 2ZX3A 1GO3F 1NE4A 1O3SA 2HLEA 4XBNA 4QB2A 2JECA 3L9DA 2ZDIC 1WB7A 4PIXA 2AUYA 3H1MA 3AZZA 2WZEA 1Y66A 3H3UA 1NA1C 3JU9A 4O2BB 2Q1MA 3MF6A 2WA4A 3OGGA 4JI3O 4C90A 4I0AA 4D69A 3MPBA 5FUPA 2F95B 4OPAA 1XBFA 5FZIA 2VQEO 4DEQA 1JYIA 4AHYA 1Q6HA 2CDYA 3UL2A 1QBZA 4XTMA 1TNFA 4IGQA 2JE9A 4W4KA 1ENQA 4LBKA 1Z2GA 4B3TO 1I94O 2YI9A 3RT3C 2GH2A 4PDVA 3WY6A 3ZMZA 3VZKA 1MVEA 4Q4X1 4CDQC 1VF6A 3KLSA 1QH6A 3S7IA 1RUI3 3TK1A 4TWKA 4GWMA 5FOBB 4DR7B 5FY7A 1H8VA 3ZDSA 3VD5A 4ZKIA 4C1XA 4NAOA 2YEVA 4PIZA 3T2TA 5LY2A 3AK3A 4ZI7B 2F43G 2WFF2 4E2SA 3RZGA 1JH5A 1LOFC 2LO1A 3RDIA 1IPSA 1MEC2 4UB8Z 4BK5A 4COVA 1LOCA 3ZIXA 3AK2A 3VBSA 2VNRA 3FB5C 1RYYA 1XI1A 2MK3A 3JD71 1PK6A 3ABKB 4QGPA 3MW3A 2ID4A 5FXXA 1N33B 1VLNA 2ZE6A 1LJ7A 3AG4C 2SBAA 1RSOB 4CDXA 1G6UA 3ZN6B 3GHNA 3OGIB 4X8PA 4XYXA 3H1HH 4N23A 3AMPA 2OQ7A 5D5PA 4AYUA 1NE6A 4B3NA 4JDOA 1WBFA 3MHHC 3AFKA 3RSJA 3VQWA 1QNWA 1OQ1A 1G9CA 3QACA 5FZ6A 2X53S 3NJXA 4KWJA 4NHMA 2EIKB 4DV1O 4CS3A 2VVFA 2XJRA 2Y6HA 3ZRVA 1ZX3A 4X1YA 1KDMA 3S3WA 2KG7A 2UYBA 2L9LA 2V73A 2MHFA 3QLQA 3ZFFC 1SBFA 4DV4B 2VMIA 3STZC 5LGUA 4HSJA 1S0JA 3LFIA 3S6PA 2ZEZA 1U5IA 3TN91 5LB6A 2QR4A 2W46A 4J41A 2VXJA 2CH7A 1SBDA 3U1XA 2QGNA 1G6NA 1H30A 5DAQA 2H3OA 4LA3A 4MV2A 5JDBA 2F17A 1JZ5A 4UCTA 5F2WA 4K21A 2CYFA 1FPOA 4P9YA 1Z78A 1UAIA 4YW6A 1RUG3 1TQ5A 1EFRG 2Y6KA 1OLMA 4XF3A 1PMIA 2R041 4YFWA 4YGEA 5CA1B 3N7JA 4JI8O 3AYAA 3MO4A 3R66A 2Q8OA 4LFCO 5FZDA 3JAWB 1QQP3 2Y64A 1OVPA 2EX3A 1TNRA 3OBAA 3LCPA 1TGOA 1UY3A 1Q6IA 2UUAB 1BCCH 2NM1A 4WVVA 2OKXA 4MHUA 3SYPA 3K51A 4RR3A 1JZ7A 2A3XA 2VG9A 3NNFA 5I0UA 3HKBB 1O4ZA 4Y22B 2P3JA
chains in the Genus database with same CATH topology
5JIUA 2VOVA 4D94A 3AX4A 1LODA 3WDWA 2GNMA 2ZX4A 2DU0A 4N43B 2DU1A 1W6PA 1R1ZA 4CDQA 3OY8A 4XW3A 4GIQA 1EAH2 3VBUA 1D2SA 2WINB 4KL1A 2XJTA 5BNNC 1DLLA 4BMBA 5L7OB 3WW4A 4JDMA 1BVP1 3ALQA 3OF1A 4L97A 4ES9A 4YVWA 2P2KA 4E27A 1AYN2 1DFQA 1JBCA 1CAVB 4CWDA 1G9DA 4Y1VA 1WD4A 1NXMA 4DXZA 4E2QA 1PGW1 2A75A 4WVMA 3NV4A 4KG0A 1UZYA 1N1TA 4HPKA 5CAZA 1SQ4A 1ZA4A 1ND2C 2C5DA 1V6NA 5K9YA 3VZNA 2QQPA 1PIV1 2BNMA 1OFSA 4XQDA 1MS8A 1LOFA 4UBGA 2NMOA 4YRDA 2X5IC 4RS5B 3OD4A 4ZU5A 4BPZA 2WNVA 4ORFA 4M2GA 1POV1 1S0BA 3WW2A 3ZSJA 4O9EA 4WM7A 3ES1A 4BHFA 1VBD1 3JD73 2VH9A 4W6WA 1RJ8A 1RMU1 3I59A 2W0XA 4IEYA 1UMZA 4LUMA 1OKQA 1OA2A 1BBT1 1W0PA 4BGMA 2RM21 1VZ5A 3G7DA 2HWC3 1CGPA 4XILA 1REEA 2Y0OA 4QX5A 3VZJA 5BNOA 1X82A 4R8HA 5T5OA 2OG6A 3EJKA 3B9IA 4V1PA 2D3RA 2XKOA 1ULEA 3M3QA 3RWNA 3ZSKA 3HR9A 1DZRA 1Q8SA 1RUJ2 1V6MA 3VBOA 3M7AA 1QJY1 2XVGA 4ITCA 3UKTA 5ACA1 4YZ4A 4J1WA 5FQ0B 4YZ2A 1UPSA 4N43C 1C8M2 3RYPA 4RHV1 3BIWE 2A71A 4Z2WA 2YDEA 2QJVA 1WMEA 4QGLA 1AR63 1RUF3 2XVKA 2CNAA 1Z7S2 5DUXA 2WNUA 5GLWA 4AVVA 5K0UA 2PHLA 2R1BA 3AKRA 3MGUA 4YSFA 4B4QA 4AFBA 2PQQA 3MIBA 3N35A 4YNIA 2ZOEB 1S0EA 2P17A 2PAEA 3AP5A 4AQ2A 3H1WA 3MIHA 5HBAA 4BHGA 1MQTA 4FXGB 1SFNA 1Y7BA 3INAA 2B45X 4YLMX 3E5XA 4AI8A 2VUJA 3E6CC 1SLBA 1NQJA 2C0ZA 2HWB1 2JDZA 3OCPA 3WP6A 4PLNA 5DDJ2 1QXPA 1U5XA 3D82A 2HWF2 3AMQA 1FPN1 1AYM3 1O3TA 3QH6A 1AXZA 2ZX1A 4BMEA 1RUG2 3JQXA 1CN1A 4P9GA 2ZGMA 2XWJB 4E4DX 2W08A 4RS5C 4XMIA 4URTA 2GN3A 2PLV2 5GKAC 1Q5OA 3ZFFA 4FOQA 1NCRB 1QXJA 3TN93 1OIIA 2QZ3A 4P9LA 2B5HA 5H9SA 2WA3A 4GH4A 3VKLA 2VQ0A 2ZGTA 5GJ6A 4LT5A 4FFAA 2PTMA 1V00A 3E5UA 4OUSA 4NHKA 4AG4A 4AEMA 3BCWA 4Z1VA 4X6RB 2ZKNA 3QOPA 4HSLA 2RR11 4JGZA 4K7JA 1QQP2 1I3HA 1WBLA 1WA4A 3GZUC 1AR73 4D7TA 1FMD3 3QD6A 3D4KA 4LBNA 1A78A 2RJKA 4Q4W2 5I8YA 2ZHKA 2XJVA 3M3CA 4LE4A 1ZZ8A 3ZYIB 1C4RA 5I0SA 1TME3 2VNGA 5F6LB 2LUWA 3SWTA 4I0BA 3ZN6A 4YZ5A 1GBGA 5J37A 4YW1A 1V6JA 1W2UA 1IZ3A 2K0GA 2C9AA 2R043 5FAXA 1YFWA 3ZSEA 2BGCA 4DINB 1QJZA 2O0OA 1LHUA 5GM0A 2ZTNA 1W6OA 2VGDA 5FO7B 4HK9A 5DUUA 1GV9A 1R081 1WUVA 2QNKA 3VBFA 1RUOA 1Z0HA 2BNOA 1LHOA 2ZBJA 2W52A 3NKGA 5JLVA 3M4FA 4RL7A 5AVPA 2JXAA 3GZAA 3WINE 1PHMA 1W6QA 2WQ4A 4XXPA 1RC6A 1Y43B 4CDWA 4G9SB 3KMHA 1NXD1 1W6NA 3MLLA 4UW4A 3W9AA 1PNGA 3O0VA 4YZ1A 3WDUA 1ZBE1 4TZDA 3VV1A 2Q4AA 1JUIA 1U5YA 2G9GA 1WLTA 1QJU3 1QGLA 2VMGA 3OJBA