2WA3A

Factor inhibiting hif-1 alpha with 2-(3-hydroxyphenyl)-2-oxoacetic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
335
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 106
structure length 335
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2wa3A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wa3A01
1MZEA 2CGOA 2WA4A 2XUMA 1MZFA 2YDEA 2W0XA 5JWPA 2CGNA 2YC0A 1H2KA 3P3PA 4NR1A 2ILMA 1H2LA 4B7EA 4B7KA 3OD4A 3P3NA 4QU2A 4JAAA 4AI8A 4Z2WA 4BIOA 2WA3A 2Y0IA 1H2NA 1IZ3A 1H2MA 3D8CA 3KCXA 4Z1VA 3KCYA 1YCIA
chains in the Genus database with same CATH superfamily
2BWCA 4PELA 4JQTA 1GKFA 3WG7B 1G9BA 1GV9A 3ILFA 2ZGUA 1XL6A 2YXSA 4GMP3 2AXTZ 3BOWA 3VDDB 5JDBA 5EJ1B 2YY1A 1NQDA 5LEJA 1K7DA 3WVJA 2WZR1 3ZMNA 1PK6C 2EINC 3H1YA 3UL2A 1S2BA 1ND3B 2X29A 5EQUA 2HHHO 5B1AB 1RUC2 5CU1A 3H1KH 1RUI1 4QKDA 4AEDA 1YXWA 2XBO3 2SBAA 3B00A 5KXDA 4RA0A 4ES9A 2QQUA 4UFMA 2FD8A 3L73H 3EXUA 2R061 1KMIZ 2D5HA 4HOOA 4LWSB 2VUCA 4JHZA 5LA2A 4MTXA 4EV0A 3VDDC 1VMJA 2VWJA 3WQ0A 2VZ3A 3AB0A 5C8YA 5T5LA 3EMRA 4YW5A 5FMBA 4DR2O 5FQ0B 1UYXA 4LNUB 5EBMC 2XVKA 4UWDA 5FP3A 1WA8A 1G4YB 4AR2A 3JSNA 3ZFFA 1TG7A 2XAJA 4QKBA 5B2GB 1DTOA 4YW2A 1XI1A 1MS9A 5A7NA 3STLC 3T2OA 3ACFA 1FYJA 2ZTNA 4PIXA 3M3CA 1QY4A 4YJ3B 1XU1A 5IUQA 4QGPA 1OCRC 2ZS6B 4DXSA 4DXRA 1BQ0A 4LO4B 1JFFA 4K35A 1EBOA 3TCUA 1UW8A 4R52A 1W0JG 1IG3A 5TSWA 2VM9A 4N53C 3DPRA 1R1A3 2PGGA 2DVFA 2I07B 2VZOA 5E88A 1ZBA2 1NR7A 1XNCA 1UIKA 2O14A 1UOGA 4A3ZA 3LOBA 1QKQA 3S7EA 1ZA4A 4UCUA 3E86A 2PMWB 1PNGA 3FX3A 4Z07A 1MSDA 5CB4B 1JFFB 3D3AA 1XNQO 1YC61 2XAFA 3T4VA 2RE9A 5I91A 3I59B 4IEZA 2YHJA 4NVPA 1NU1H 1KQRA 1H1MA 3JATB 1YHFA 2ARCA 1IX9A 4JF3A 2Y6HA 1BCXA 4NIGA 1W3VA 3E8BA 1IS6A 3LE0A 2D40A 4MVUA 2AC1A 2JWPA 1PIV2 2Y0IA 2B45X 4B8EA 2BUKA 4LHSA 3KZIZ 2QTWB 4A42A 3K75B 2OUJA 3WW1A 4Q4Y2 4AEMA 3N9OA 1HDJA 1V6NA 5FLJA 1SF9A 1ENVA 1ULDA 2VU9A 3DKWA 5CNAA 3ATGA 2LM3A 2DCTA 1VQ7V 1JZ2A 2R6QA 1QU7A 3F7YC 1XU2A 4A7YA 4LFCB 2FL4A 5FLXN 2Y69B 4DR3O 2GH8A 3CCSV 5JCOA 5FPUA 4IERA 1LOCA 4CBCA 1QJX3 2WSVA 5FZIA 5C8CC 1RUG2 2RMU3 4CCCA 4O4HB 1MVQA 2P22C 1O3RA 1RHI3 4FPJA 1YJ9V 3RWRD 2H6CA 2RJKA 3J7AU 5EJZB 4ATEA 4FLVA 2OS2A 3JSLA 2VW2A 4PI0A 2JKXA 2WLJA 1AR92 5D8AC 2Y34A 1Z2GA 3FFQA 4CH4A 3VKNA 1CPMA 4GWIA 2AYHA 1WPXA 1VJ2A 1NQTA 1O9HA 1FPN3 5H2FZ 4D7SA 5E1RA 5EJ3A 1SLBA 5KHJA 5IVYA 1U5XA 4UW3A 5BMVB 3KWVA 3FZ3A 4TV9A 4FPKA 2G9ZA 5C4WA 5IJ9A 2OZJA 4DV1B 1QXJA 3LDCA 2J22A 1ZREA 2D44A 1L0NH 4CDQA 3SH4A 5D8AB 1I5ZA 1JX9A 2WWJA 1VF5B 2P7TC 4I5SA 1EN4A 2HWB2 2QQLA 5I8YA 4FQZA 3DF0A 1W2BU 1S5LZ 4BWAA 4DV5B 2Y64A 3K59A 1RPRA 2UUBO 3AKRA 2KXLA 4DR7B 4K20A 1P4RA 2WR9A 3LSUA 3ZR5A 3WR0A 4R8HA 5IJ0A 1HWYA 1G8WA 2XJVA 1EAH3 4IE5A 4FAGA 1JMKC 4O2AA 3EYPA 3MV11 1ZL8B 3CZJA 4CC5A 1MEC1 1ND3A 5FRAA 2VZ1A 1QOTA 1CGPA 3M8AA 3W7SA 1SLIA 4AQYB 4DUZO 1E5HA 2HP8A 2G9FA 5FOBB 2KR2A 4I9WA 4QX2A 2VS0A 1PMJX 3IPVA 2YU1A 1DLLA 3CSXA 4MS2A 4OMDA 4O61A 3WNNA 2ZNIA 3S30A 2QTOA 2V09A 2RMU1 1H4HA 3G6EV 1ZL8A 2PHLA 2GC2A 5JMOA 1I1EA 3ZHSA 2VOXA 1LNQA 5K1XA 1VBD2 4XFGA 3F2ZA 5FLHA 5IK7A 3JQXA 4JTCB 1BBT1 5LA1A 1RXFA 4RQPB 2PHXA 2DYCA 3OUFA 1RUC1 1SQBH 1JYIA 1SBEA 1UYYA 5KUKA 1NCQA 1R1A2 3ZO0B 4CDXC 5L3EA 2YMZA 1UL9A 5J2UA 2FMDA 2F93B 3VBFB 4GMP1 4LUKA 1XNDA 1GOGA 1D2QA 1QGLA 1B06A 3IDCB 3CRMA 4A44A 2Y0OA 4PA7A 1WA4A 3HNYM 4JASA 5A7QA 2R041 4OI0A 2GU9A 2BNOA 1LOAA 3OBTA 1UY3A 3RW0A 4XXPA 2LGQA 4DQAA 2XQXA 1SACA 2ZHKA 1BCCH 5K7PA 4PIZA 1W03A 4Q0VA 1PO21 4MGQA 4WCEV 2C9KA 4XOGA 2QKSA 2YXLA 4ASLA 2WBKA 1XUQA 4JRAA 3FB5C 1OOPA 4WM8C 3OT7A 2PFWA 2AUYA 3H0OA 4NB5A 4FPHA 3ZN6B 4CU8A 3N9MA 3ZYRA 4LBNA 3VBHB 3KCCA 1XOYA 2KSDA 1AYM3 3M4FA 5DUVA 3NNJA 2D6MA 4XURA 3AG7A 1RTVA 1N47A 4XACA 2BE3A 4FLWA 4DEVA 1RUF3 5L3FA 4WM7A 5JVDA 4FFKA 2XKOA 4NHYA 3LDBA 1H8TB 1N1YA 2YFZA 3M1HA 1NS1A 4LWSA 1S0GA 4JI7B 2ETEA 4RGKA 1X82A 1JOPA 3ZHVA 2XGXA 3AYEA 1IGOA 4XZPA 2DJVA 3VQWA 1V00A 1VBA1 3OGGA 4UFIA 1K3IA 2CL2A 4BIZA 1FAYA 2B1IA 2J1EA 3VD4A 2O1QA 5T5PA 3J7NA 1NT2B 4IV3B 2WQ4A 1PK6B 2RS53 4HVRA 2PELA 5H9QA 1SESA 2X10A 1SETA 5FZ6A 5CYYA 3O5SA 1MG1A 1RUC3 3ZYIB 5LMNB 2ZX2A 4CRQA 2XVGA 1PV0A 3KQ4B 3WDVA 1JTZX 1OVSA 5F2WA 5L36A 1C8M1 5C3QA 3UO3A 3U10A 1DIWA 2JXAA 3RSJA 4DR3B 4ZI7B 2BRTA 1WA6X 4W4KA 4O2AB 1X4TA 2ADQB 4QPGC 3CC7V 4J42A 3IBMA 3PUAA 1H8VA 1VF6A 1OXCA 4I02A 4LO6B 2OYZA 3ZHQA 4MGYE 4CH5A 1OLMA 4L9BA 1RB8G 5HCFA 2DFBA 3TBDA 3TOJA 5DDJ1 2JKBA 1WCQA 3AG2B 1VRH1 2W1QA 4TSFG 5A7PA 3JD1A 3QH6A 1AJPA 4UAPA 3AK1A 2EXHA 1EPWA 3RZLA 1MQTB 4FXKB 2GALA 2B1GA 2R9RB 3SEPA 4FVVA 1QJX1 5CBHA 4CDXB 3ZYBA 4Z1VA 1XYNA 2IXCA 1EV13 1POV0 4A2UA 4IGGA 5A70A 4NKGB 4CP9A 1I94O 3QBQA 5FCCA 4MVTA 4JI7O 1FOD3 3LAGA 1H6XA 1O9GA 3L2YA 3JYCA 1VAKA 1XC6A 1OCZB 2ZX1A 1SBDA 1AUYA 5GZFA 4AE2A 5AC91 1OQDA 1R64A 4BISA 3WF2A 5L73A 2E53A 4M3CF 1ACCA 1Q8IA 2QJ1A 2R9IA 4AWDA 1Z7S3 4AFCA 2C0ZA 4URTA 5E79Z 4CCEA 4HXCA 4MVMA 5LBQA 3VV1A 1J1LA 1SBFA 4OX9O 2VMDA 1S0FA 3AM2A 4IL6Z 4XFBA 3X2QC 5TISZ 1M9NA 5EZYB 3MI8A 4XF1A 5JH7B 1FFXA 3MIHA 2JG9A 4Q0UA 1DGRN 4LO7A 4RSUA 4W6WA 3AP9A 4HETA 1DU3D 3S5QA 5F3GA 2A5ZA 3AG4B 5A3PA 1W2TA 5JMCA 4OUEA 4B3MB 2RJLA 5K0UB 2IJHA 3PMEA 4K8FA 1AJKA 1Q6IA 3IMNA 3H7YA 2H94A 3QG5A 3U78A 1SA0B 2ETNA 2A3WA 2AHYA 5JJJB 1WLTA 4N43A 4CEWA 2A6YA 4QAWA 1JZ3A 3HMYA 1FKAO 4JDNA 4I50B 2F6BA 3QOPA 3FBYA 3GB7C 3CLPA 3FFZA 5BZBA 4YW7A 3JUUA 4H2AA 1Z7S2 4EN0A 2O57A 2OPWA 1THZA 3P6BA 3VHOA 1L0LH 2KD7A 1NTZH 4DUXA 2A06H 4YGDA 3EHBB 4EYUA 3VZNA 2UUCB 1UYPA 3QO5A 3SPIA 2IUWA 1OH3A 4XFFA 1XQ8A 5FKCA 3HQUA 4SLIA 3FLRA 1V6LA 1F4NA 2B9VA 5ITZA 3KGLA 4NPLA 4HN0A 2P67A 2JDMA 5JIAA 4QXCA 3A22A 4J41A 1X59A 3OY8A 4A6SA 2ZZQA 1SZBA 3VB9A 2P37A 3MBWA 5CISA 1TE1B 4IV3A 4L8QA 5CFCA 5LHIA 1Z7S1 3T0DA 4QPWA 1E57A 2DQ3A 3H1IH 3LB9A 4JI4B 1YCIA 4OX9B 2A71A 4LH7A 4D7YA 3CC4V 5C3OA 4CS3A 1S55A 2O8OA 1NCQB 2WNVA 1FATA 2CAUA 4P9OA 1VBB2 4BHPA 2XJTA 3S5AA 3HN3A 5T50A 2RN9A 2QVSB 3H3ZA 4YLZA 1QF3A 1PVC2 3N27A 2EILB 4BDVB 2W46A 3OGIB 1IQDC 5FZ0A 2RQ6A 1PO23 2WQ8A 3NV3A 1H2LA 5FY0A 4GX5A 1YFWA 3CC2V 5IVJA 4TUYB 2W94A 1VIWB 4LF6B 5GM0A 4X1KB 1T6GC 2ZXQA 3VZJA 1L3JA 1ZZ6A 1QJU2 5J2UB 3ZFEA 1GP6A 3VKMA 4DUYB 3PVEA 3BTAA 1QWRA 4BH9A 5FP7A 1R3IC 2NN4A 1YQCA 1LUWA 2C26A 3UNPA 3ZXKA 4UCSA 3PURA 4OHVA 2M6YA 5IDJA 4DV1O 3RDIA 1A8MA 4Q4V3 1OCZC 2CTRA 2UXBB 3BHPA 2QQMA 3C2UA 1SPPA 2WZEA 1VMGA 3ECQA 3MIDA 4G4FA 2BTVC 5BNNB 4M01A 3S0MA 4META 3D36C 3HKBB 5JOZA 1CAVB 1LHNA 3MHSC 2GUZA 3ZXLA 4UFZA 1M4WA 2QGNA 1AJOA 1PGW2 2WWSA 4IQPA 4JGYC 2PI4A 4LE3A 2GP5A 2ZGRA 3MAQA 1CZSA 4JKMA 5IVFA 4QQ2A 1OCRB 5GZEA 2W92A 4A41A 3C7EA 1AR4A 3SKVA 2EINB 1XE0A 3C8XA 3RGBA 5K1PA 2RM22 1PL0A 2FDFA 1BQPA 2WLHA 4KI5M 4C0BA 1S2EA 1QLEB 1Q8VA 4C1WA 1YJKA 3JD71 5C7GA 3WXPA 3RS6A 5LBEA 4C0HA 2XNDG 4GA9A 4DV6B 1YVWA 2H0VA 4JZRA 2ZAHA 5I8SA 4X20B 4PA9A 4Q0QA 3ABTA 4IUGA 1WLEA 1RUJ2 2B5UA 2UU8A 5DAVA 4IE6A 1HXS2 1Q56A 3AXDA 1PKXA 3AYDA 4DV7B 3E22B 4TOIA 3E83A 1XNRO 1OT5A 2R49A 4UW5A 4XE9A 1UU4A 3WDTA 1QLEC 2ZEYA 5LP6C 1ALYA 3ABZA 2JEXA 4CXWA 4QX8A 4UF0A 3OGRA 1F4HA 2RV9A 3KG2A 2PYLA 1S1AA 3LNMB 1XSRA 1D5NA 5A32A 5JPNB 3AP5A 3EJKA 3CCRV 2LW8A 4Z8BA 2OCHA 4AHCA 3SPJA 3CO2A 2QQOA 1VMHA 1QDCA 1F8VA 1RHI1 4Y1XA 3WQ1A 5JZGB 3FYEB 4UBGA 2JENA 3PVOA 4X66B 1KP2A 4IHJA 1JPXA 5T5JA 2YS8A 1HR0B 1R73A 3ZIAG 4PBPA 1YF2A 3AXEA 1IBMB 1IBMO 4TV8A 2QSAA 4P9YA 2NMNA 4I50A 1FAFA 3FBMA 2UUAB 1NXD1 3S6PA 1WB7A 1OFNA 2JE7A 1X9PA 1LB2A 2XLGA 2W1UA 4C1XA 1NQJA 3N9LA 1ZZBA 3WP3A 3UKMA 2PLV3 1S77D 3MF6A 1O8PA 2UY9A 3ETDA 1N8RW 5JSPA 3B8MA 2ZGKA 2QE7G 4A6OA 4A5UB 1JU4A 1H8TA 3IZOA 5LOVB 3LQCA 2E3CA 4AHZA 1FXKB 5JQGB 1H8HG 4CPBA 3U4SA 2PYJA 3CCVV 4HZ3A 1UCXA 1C4RA 3AK3A 3ML0A 5LBFA 4BMEA 3A8TA 2ZM6O 1K5JA 3VBBA 5FZ3A 1NLQA 2P6CA 1LOGA 2ET7A 3VBHC 3CCLV 1S0IA 3JBG1 3K57A 2R072 2OT5A 1ZAUA 3SCFA 3JZVA 1X50A 1PIV1 4LA2A 2PYTA 3P1IA 2OW4A 3OUIA 3TJTA 3N7KA 1XREA 3IAYA 3RN4A 4RYDA 1AHSA 4EJRA 2UUCO 2IJKA 4CCMA 2FDHA 1U0AA 1GZTA 3C90A 3AKQA 3DXTA 4I30A 4P9PA 1K5MC 5C9AB 5KHIA 2FDIA 4I2OA 3VBUC 4QKFA 3POFA 3AL6A 3D3IA 4RR3C 3F5TA 4W50A 4XMIA 5FR3A 2ZPXA 1N32B 4LCUC 3CJXA 4FZ0A 2Y6GA 1RUOA 2P3YA 3AZXA 4JI0B 2BNNA 4DR4O 3WUCA 2XVLA 2SLIA 4XFIA 1VQ6V 2P2KA 4KGQA 1AR81 4XUQA 2G4IA 1OF4A 1W8HA 4BQ1A 5H6RA 1V54C 2NNUA 3NL1A 1ULFA 2QNKA 4E8DA 4R9DA 5FZMA 2OQ6A 2YC0A 3AG1B 4YW6A 1XOUA 2KG7B 4KWKA 3SITA 5LYJA 3K5OA 3STZC 4QB6A 5EIBD 4J9ZB 1YIJV 5IVVA 2DURA 5CKQA 1QOOA 1NTKH 2K9ZA 4B1MA 2HWE2 3AX4A 1RINA 2JGDA 4LFBB 2X5IB 1OLME 4CS4A 4QU2A 4HONA 4EZ4A 4FM0A 1V9PA 4LNVA 2VMHA 1CAVA 3ZSKA 4CVUA 4R9CA 3CCJV 4EEQA 5J1XA 4HAMA 2GDFA 3CB2A 3AZVA 3B01A 2MNGA 5IT9N 4FFIA 4K0KO 4HG6B 5JAXA 2TBVA 1RM1C 2AR6A 5DZGA 2J1AA 2Q8CA 1PNKA 2OCCB 5F3CA 3W7WA 2ORXA 4LF7B 1FPN1 4EZHA 3NAPA 4Q5OA 1SFPA 3WQBA 4DR5B 3ZYGA 1W2UA 1W0PA 2VUJA 1LOBA 2OKXA 3HT1A 2VQ0A 1WP7A 5FJKA 3VBSA 1OUSA 4IGQA 4H13B 3CJHA 3ZM8A 1W9SA 2Q1MA 4YM0A 4XUTA 3FE5A 3IDBB 4Z1MG 2RHPA 3T0BA 1QBZA 4JI5O 3W59A 3MDPA 2DUOA 3OGCC 4OI4A 2YPDA 5LK7B 3IDAA 1WMFA 1XDCA 2J1SA 3GZUC 3ZXAC 4Q8KA 4BU2A 1VPHA 4EB6B 1DQ5A 5C8CB 4GT1A 2VVEA 5JXIA 3I3QA 5L9VA 4FPFA 5IT6A 5ANQA 5IYYA 1W99A 5DUXA 2E31A 3ZSMA 5CMUA 4F8AA 2QWPB 4O4IA 4GLXA 1VARA 2VNRA 2WLMA 4ZXEA 1VQOV 2YXHA 1NLSA 2ZEXA 1UFIA 3OMIB 3USUB 2HJDA 3CKHA 1GN3A 2IXLA 4X64O 1RUE2 1BHBA 4EROA 3OEEG 1FXHA 2VBPA 2LTNA 4BQ4A 4LHLA 2WN2A 4HKLA 4M0HA 4PI2A 5HCAA 5FZFA 1T5EA 1GRJA 1O5LA 3CQOA 3OG2A 2W6IG 3K4ZA 4QX5A 1RUD3 2VZTA 3KHBA 3BVCA 4AXOA 2VQEO 1K12A 2W2IA 2VTXA 2BPA2 1OKOA 4O4JA 3ZFFB 3W7UA 4LOSA 4FFGA 5DAQA 2QWQB 3OJBA 2ARAA 4UOJA 4JYBA 5FPOA 2GN3A 2QJVA 4KGGA 4COWA 1MS8A 1HLCA 3PHMA 3K4AA 1DZRA 3AG4C 1FXKA 2E33A 3OMAB 2ADEA 2DCZA 4TWKA 4Z82A 2YBPA 3OSDA 1XMQO 2NP0A 1AR71 2AEYA 1JYWA 1BK0A 2HWD3 1KYOF 2R043 3GBFA 3QO7A 4FIPC 2J1TA 3CHXA 1ND2A 3D8CA 1S0JA 4BQ5A 3FD9A 1K33A 3NNLA 4H7MA 4EN9B 3HAGA 2UWAA 2OYQA 5KHGA 3ZIXA 4ZOLA 4QT6A 5JOWA 3QVNA 2QWRB 4BJ0A 1DQ4A 1RITA 4LT5A 4MHUA 1K4DC 4KXRA 3ZMOA 5LZ6A 2V1DA 2X5IC 1FV2A 5IAVA 4IGOA 3UM7A 3RYFB 4DK0A 4WBNB 5JZGA 1TA8A 4JDOA 3JAMN 2Q4PA 4FO9A 1SS3A 3P3NA 4CCJA 4DRXB 3AZYA 2ZCWA 2QFEA 5T52A 3O1OA 2WYSA 1I5PA 2Y38A 4JGZC 4E4ZA 5LCWL 4JYYA 2ZEWA 5FZOA 2GTSA 5J2TB 1AJNA 1XBFA 5D21A 1EZJA 2JDAA 4AI8A 2B9ZA 1REDA 1XRUA 1L8DA 1NBMG 3B5LB 2YSUB 3VKFC 4L11A 2L6LA 1VBA3 3TNPB 1XE8A 1B35C 3HKDA 4ITCA 5KAIZ 2E75B 4QGLA 4Q1PA 4N53A 4A7ZA 1S2KA 1FOD1 3FHQA 2TUNA 1HNXB 4Y1YA 4P9XA 3SCHA 2DOSA 3UGFA 3I2OA 4NJ4A 5JWPA 3KSCA 2BYVE 4XF9A 1JCHA 4Y5SA 3BPZA 5FYTA 2BW8A 2VMEA 2W9XA 4XUPA 1AX1A 2IC1A 1MS4A 2WLLA 5F5IA 4E8CA 3LEKA 2BTQA 3R4UA 3G6JB 4H33A 4HBNA 1YI2V 4HN1A 3RVYA 1VBB1 1SFNA 1KEXA 4YYOA 2QWOB 3NXSA 1N36O 3SJAC 4CH3A 3FB8C 2F1MA 3AP7A 5JSRA 4EN8B 4L92A 1UQXA 2E32A 4CP2A 1H2GA 4O4HA 2XJSA 2UU9O 5L9RA 4MYEA 1OKQA 1XHXA 5A32B 1GLHA 4MVZA 3TN93 2MEV1 5A7OA 4LF4O 1XYOA 2P17A 3AKPA 4DR1O 1SFYA 4YG3A 1YYNA 1JH5A 4MTGA 1JYVA 4DYLA 3JCZA 5CADA 4XIKA 2WLQA 2EIJB 2VNGA 5ABJB 3TEZA 5A3WA 5C8CA 2WIIB 5KX5B 4K8RB 3E8HA 1OD3A 5T3NA 4AVAA 3DUIA 3ZHTA 1UZWA 5EYPA 2Q5TA 3H1LH 4B7KA 5AFEA 2WZPP 2HEPA 5M0TA 3FB6C 1J84A 1CJDA 3JALA 5ABJA 4A3XA 5C9AC 3I3BA 4JV5O 1XBLA 4JV5B 1UAIA 4AGVA 3ASNB 2E5LO 3BIWE 2PQQA 1GAXA 2ARHA 4B7EA 4TV8B 4GKYA 1W8FA 1JUIA 3AG3B 4X62O 4X62B 3SYAA 3OTOO 1WBLA 2A70A 4GMP0 2XLFA 5JOYA 5JVDB 1W05A 5FJHA 1UX7A 3N36A 5CKMA 1LU1A 1VRBA 1NI8A 3L74H 4OULA 2ZHLA 2NYYA 4YGEA 5FYCA 1IQAA 2C6SA 2V5YA 2VW0A 4QGNA 3L9DA 1VALA 4AFBA 2VL4A 2JDNA 1REEA 3W9AA 3AMQA 2CDPA 2QEXV 4E2QA 5BNPC 1EV12 2JJ6A 1IBLO 3RJ2X 2JS5A 2LW7A 4X66O 3OY8B 3VHNA 5DUUA 4FMTA 1WLDA 2JIZG 4FCAA 2YB7A 2LROA 1AX2A 1QR8A 1W0OA 1ZBE1 2VQUA 3C7HA 2BCCH 1GNZA 1UOFA 3AL5A 4R50A 1NCRA 4NTXA 5LRSA 3AVRA 4BQXA 1Y66A 2VCBA 3NAPB 3ZRXA 2QDRA 3OPWA 4QM8A 3SXWA 3GM8A 2LQTA 3BIEA 2FDGA 4UCRA 2Z2SB 4ZY9A 1QHTA 4DO2A 4M3CB 2WZR2 5B4NA 5DG2A 3RT3C 2EX3A 2JDPA 4AVBA 3WZ1A 1SZTA 3BTZA 1QQCA 1UNBA 5DZEA 2HWB3 4E2SA 5IK5A 3PUSA 4BQ2A 1K97A 1QU0A 2LW1A 1CWPA 2JIGA 4CSWA 5L7OC 4YW1A 5EYPB 1R1ZA 4WFBV 1VB2A 2ZGMA 3ZXDA 5FBJA 5IHRA 4BMBA 3LPGA 2C9AA 2DBIA 1LTEA 4V1PA 2NLRA 2DYRB 4RHV1 1YJLA 1SQPH 2YV8A 3ZS8C 4QPKA 1UKGA 4INDA 3APQA 3LCPA 2P34A 5FY1A 1BEV1 1SPPB 2EBOA 4K8ZA 4LHNA 3VKLA 2GTAA 4O4IB 1DF5A 2OA2A 4ZZ8A 3ABLB 3IWZA 3I2KA 4K3AA 1TMF2 1XE7A 3ALQA 1REFA 4ZHNA 2ZE6A 1W6NB 1YQ2A 2WWWA 1NX9A 3ES4A 3DC5A 4L87A 4XBLA 3B93A 1RC6A 2KQXA 3NJXA 1AI6A 4MXVA 2V73A 4GXLA 5CZKA 2WZ8A 4CEYB 4D69A 3NSTA 4K6BA 5E8AA 1KECA 4G28B 2OQ7A 4URAA 3ZRSA 1WA8B 4CDQB 1AL22 4MSVA 3B3QE 4WVZA 3CL1A 3WY6A 2H3OA 3D0SA 3S3XA 1PGL2 1U5ZA 5C4WB 3VD9A 1GU3A 3KQRA 2UURA 4BE3A 3H8OA 2BDRA 5A7WA 1WJZA 1S0CA 4BR6A 3UGHA 2JIJA 4Q4X2 4I3GA 1BJQA 3BTXA 3GHMA 1V6IA 4LF5O 1K3EA 2FZ1A 3VD3A 5ACA2 2V7QG 1AVBA 2P6JA 3R65A 1BVVA 2BVVA 4I4TB 5JI9A 2BJSA 2CWSA 4R4ZA 2Q4SA 3GNEA 3Q8BA 3R0RA 3WF4A 3RI9A 5FK7A 1YHQV 3BPSA 3K4DA 3ETGA 4OHZA 3J8F2 2WLKA 5FZ9A 4LHKA 4IHJB 4WFEA 2WT2A 1RM1B 2FMYA 2J1RA 2DCYA 2ZGPA 3UJQA 2N05A 2YBKA 3VZLA 3PVBB 3V65A 1AR93 5GLUA 2QKCA 4Y1VA 2BERA 3I3DA 2ZXWB 3EBRA 2LJ2A 5LOVA 3MLLA 5CA0B 3ASIA 1B3QA 2ZAAA 4OVEA 5LEKA 3SEEA 1AZDA 5DAPA 3S3WA 1KKCA 2HFEC 4Y24A 5BNOA 4GYCB 3A2FA 5F5CA 1A78A 3WCSA 4CCKA 5GZDA 3LSDA 1Y4MA 4FLZA 5F7UA 1IS4A 3M7MX 4R8CA 2AENA 3E8FA 2UY8A 3M7AA 3O0XA 2BTQB 2W87A 5JJNB 1W6OB 2H6BA 4QXBA 2J42A 1EP0A 1XB9A 3SHRA 1KFXL 4QE7A 1DQ1A 2XG3A 3J7LA 2KKWA 2IVIB 3ZXEA 1US6A 1ZWIC 3WG4A 4LJHA 5B1BB 3DXRA 1RUE3 4JGZB 3M3IA 5IE9A 2J1UA 1NH2B 3J9SA 1KS5A 3HQXA 4WFAV 3ZOIA 3CJIB 4P9IA 5J7MA 2OIGA 5HPOA 5BPXA 5F32A 2GHYA 1EAH2 1L1FA 3MW3A 2WLIA 5EZYA 1D0HA 1VBD1 1IURA 2DYSB 2EIEA 3CEIA 4AVTA 1VMFA 2JG8A 3OUJA 1I5YA 2JG9B 1IS3A 4OFGA 2IBZH 4PIYA 1UZ0A 1OZ0A 2ZE7A 4CYDA 4SBVA 1WW5A 4MOAA 3E35A 2W5FA 5LASA 1NG0A 3P5BA 5C71A 4K8XA 2N7GA 1W2AX 1DGSA 3HKCA 1GQHA 4FP3A 3J4UH 1PM9A 1YI9A 2I45A 1GZ9A 5DXDA 3ZPOA 4GX2A 3HJRA 3GYDA 1EN5A 4QKNA 1MEC2 3ABLC 3UKNA 1VRH2 2VMIA 2Z69A 5D8AA 3RBZA 2C1FA 2E9QA 4UCOA 2H0BA 1CVNA 1HRI2 1LOFC 1VIBA 2GMMA 1V6KA 4WFGA 5F9TA 1GTOA 3BGAA 1BHGA 2QQJA 5FZLA 2RR13 4JTAB 2ORZA 3H3UA 3KF3A 3P32A 2HWB1 2RJZA 1XMOB 4DR6O 1UZVA 3ZRWB 4MGKE 1E1QG 2IZWA 4J7ZA 2DE0X 5LYJB 1W39A 2QQKA 2VXRA 2D6PA 2RDSA 4M4RA 4CZZA 4KBZA 1NVPB 2ZR2A 3G4SV 1ENSA 3JCIA 4RR3B 2ATFA 5GTHZ 5CA1A 1HRI1 4PDRA 5C93A 1MS1A 4AL9A 2IH3C 3WDYA 4IESA 1X9TA 4MH0E 3VBSB 4OHYA 4JX0A 4P5YA 4IDZA 1MZ5A 2DVGA 3BYWA 1ROPA 4CEWC 2VVFA 4GJZA 2WZR3 5L3DA 4QM9A 2EZOA 5EIYB 2MHFA 4HMZA 3NRUA 3A0HZ 2E5LB 1IXMA 2JICA 1TME3 5F5QA 4Q4Y3 5FO8B 2VMGA 4CDUA 2WLIB 3BFRA 1M57C 3NW4A 2CH7B 4IW3A 2Q1FA 1R3KC 3ZXJA 2UYAA 2D3OW 2XR4A 2RDNA 4FOQA 2ZGNA 1CX1A 4MG2A 1VQ8V 5FK8A 4H44B 3T1HO 1FNZA 4YVSA 5DAWA 1IBKB 2VZRA 1VBE2 1Q6UA 4YVWC 1KFUL 1W06A 2P6HA 1GMGA 4J80A 4IEPA 3VZMA 3D3QA 1NZCA 4LC1A 3JAKA 3VN4A 1ZZ8A 3PUIA 1H1AA 1FV3A 5LA0A 1DCSA 4CTEA 1NUKA 2GH2A 3ZVXA 1K92A 5EXOA 1L7QA 3ZN6A 1US3A 3ACIA 5J09A 4XFAA 1W59A 1HQNA 3VHPA 3T0AA 1F51A 3PJQA 1Y4WA 4MZUA 2HWC3 4YPJA 5B3SB 5KC6A 3A0KA 3HKBA 4CP1A 2ZGLA 4XTMA 1N4CA 4WV8A 2Q1ZB 2CWMA 1XYPA 3B9CA 3T1MA 2QQIA 3WNXA 1M4UA 3ETQA 2IU3A 3ZX7A 2YUEA 4TN7A 1CESA 3CXHF 3VD5A 3I8TA 2IWGB 3LA3A 2HWF2 4RGGA 1N1VA 2ZKLA 1V6MA 4YJ3A 1HRI3 5EWSA 1YI7A 4TLFA 3OD4A 2YIDA 3OMNB 1RJ8A 3CBNA 4QPIB 4XAAA 3WINE 1PMIA 4PLNA 4B3SB 4FFFA 3WDXA 1NY71 4Q4V1 4HSJA 3K51A 5GJ6A 1V55C 5CA6A 5DN6G 5AVAA 2E76B 5I93A 1A3KA 2XKPA 3M99B 1UMIA 4FAHA 2F17A 5A7WB 4XF0A 1CZTA 4UVCA 4NXMO 1IPJA 1PNLA 5JCTA 1VQ4V 4BPZA 4DUVA 4EFBA 1GN6A 1ZX3A 2HBUA 3HNMA 4MLOA 2PI5A 3EQEA 2DVAA 3KVBA 2XB6C 4W65A 2XASA 3O0VA 4N23A 5E16A 4L99A 4X1YA 2LS6A 3BCCH 4QPIC 4L0PA 1H30A 4E2GA 1G8MA 1WLCA 4G3YC 3POJA 3OEBA 2K46A 2PHDA 3TEWA 4IL7A 2VW1A 1RUH2 4DV7O 1W3XA 4ONUA 1R092 1W9YA 2WNEA 2Z4FA 4Q4X1 4KHPO 3J7HA 2R062 3AVSA 5FYIA 3FC0A 4COVA 1GO3F 3POGA 3CF6E 2WKKA 3KF5A 3MD0A 4RN5A 3MF9A 3DTUB 3ZFGA 1AP5A 5DN2A 1UY0A 5F6LB 4YGCA 2P3JA 5FY4A 4IYIA 2JGDB 4LF6O 1W28A 3HNBM 1JXNA 2JD9A 1EUTA 3OEAA 1NA1C 1POQA 1YFXA 4XEZA 4C91A 1FT9A 2HG5C 3AMHA 4LQRA 1O3QA 1POV1 4WF9V 3U75A 2WA3A 4GX1A 1GM7A 5LGTA 1ZYBA 5I0RA 5LP6A 5GLWA 1ZUQA 3POEA 3Q4HB 2QQNA 1UWWA 4EE2A 4LF9O 1Y3TA 4KMQA 3JARA 4IIJB 4LH6A 4LIVA 2EVXA 1ZA7A 4LFAB 1JOBA 1V70A 1E5SA 2DBNA 3AG2C 3I3EA 1CAXB 3GDBA 4N90A 4HSLA 3CD6V 1D7PM 4DV5O 4QPJA 4M4PA 5FZEA 4DO0A 1FMD3 3TEXA 4J7KA 1QMJA 4R4XA 2KM2A 3FLTA 1ONAA 1F31A 4X6RB 2PHFA 2B8MA 4JI0O 2JDKA 2HEYF 4GULA 5G05L 3MPBA 3MPPG 5IY5C 1LAJA 1ZZCA 1M06G 2RS33 4TV9B 2UXCB 1CAWB 2D43A 3O7OA 5B3SC 5EZWA 5IW0A 5DMYA 2EA7A 4UXAA 3BU7A 2DWDC 3THTA 4BW9A 1XL4A 1ULEA 2RS51 4JTDB 4DOUA 4XYXA 3B7MA 4FLUA 5KHHA 5FLIA 1X7NA 3JD2A 2JB8A 1DZQA 4ZI7A 5FP9A 1COV1 3DYPA 3V64A 4AI9A 5ERLA 1D4M1 5E6HA 4ZS2A 3RYIB 3SPCA 1W0KG 4P30A 2Q8VA 2ZGSA 1MNGA 4WZCA 4XZUG 4KU7A 5F3EA 5JVVA 2N04A 5C4WC 5D5PA 3QD6A 1H8EG 5A33A 4GB32 4G2KA 4I01A 5IYCO 2VCMA 1R6TA 4B4RA 1OPOA 1GICA 3LWCA 1P7GA 1PM7A 3FLPA 3CMEV 4CEYC 4CCNA 3RYCB 4N53B 1JZ6A 2G38A 1OCCC 4FPOB 5H9PA 3VBRC 1JUHA 3UK9A 5APAA 2HBTA 1HX6A 5JR2A 3WHTA 3USSA 1LNSA 4FFBB 3J26N 3ZPYA 2WS93 4N9HA 4GUNA 1X36A 1ZX5A 4OZOA 2PN5A 5LATA 1F4MA 1RHI2 1RSOA 5LY2A 2HJIA 3RYPA 3W20A 2EIGA 1YZBA 1VBA2 5ACA1 1S76D 1U97A 1NXMA 2ZIOA 2HEWF 4XTPA 2WNVB 2Q67A 2X0LA 5FZHA 2ZINA 4BLIA 4X1IB 2VQFB 2ADPA 5LHGA 3AKSA 3H1JH 4Q0SA 2RDCA 3PVNA 1U5YA 4JRLA 1WUVA 4RHV3 4UFLA 1ZBA3 2QDNA 1NZIA 1DGWX 2OPKA 2E6VA 4MADA 1KBHA 5FYVA 4CZSA 1AP6A 4ZONA 3IJ4A 1T6BX 1Y74B 4X1IA 3D5OA 1YO8A 3V56A 2YXYA 3THCA 4QWNA 3LPFA 1AI5A 4IV3C 1Q6HA 3JD4A 1XHZA 1HW7A 1NAEA 2JDHA 1K34A 4P14A 3BTYA 4GWMA 4U7NA 3HR9A 5GKAC 1GM9A 2TEPA 1UXXX 4D7TA 1LULA 5B4XA 3ILRA 4CDXA 3CCUV 1R093 1AR5A 4CEWB 3WF1A 5J37A 1JOYA 4AHYA 2HR3A 2R042 4NHMA 1WCKA 4J1XA 2CTPA 3HKDB 4LPLA 2R1BA 1D0GA 1JR9A 5FY9A 2ZA9A 2QTSA 3DGEA 3CE2A 2AGSA 1MZEA 4ISQA 4XJAA 1RGSA 4FM2A 4I0WB 2TNFA 4BLJA 4MGTA 5C3RA 2Z5UA 2PA7A 2R30A 1OHFA 2XBO2 2JK5C 4E2LA 4MW8A 1OOPB 3T4ZA 1QXRA 3OD0A 3WP4A 4S2FA 5KWRA 3L72H 2D6KA 3SH3A 3KMHA 3ZN1A 1WMDA 3RZZA 4BQ3A 4S2DA 1LHUA 1S3JA 5BMVA 1LKNA 4O9GA 1W8TA 4GH4A 2XBO1 1QH6A 3I56V 1WCUA 5JH7A 1H2SB 5AC93 4O65A 3UKVA 4LXLA 4XF3A 5FUNA 2HVKC 1F7YA 1F5JA 1J58A 4M0NA 3D36A 2OVUA 1I08A 1IKQA 4BQYA 1NR1A 4NTYA 3N7LA 2YC4A 4XBFA 5FUIA 2F4VB 1IPSA 4JGYA 5HCBA 5BNNC 1J3RA 1SLAA 2X53S 3UJOA 1BHAA 5A3TA 1QJU3 5K4LA 1QXPA 4EWAA 5FMCA 1FD9A 2YC2A 5A1AA 1RUD1 2AREA 3U37A 1GQPA 3AC0A 5HXMA 2WABA 4X64B 4AAXA 3ZHUA 1CAUA 1DYPA 4CUBA 1JZ4A 4IEWA 1WW6A 1CP9A 4O2BB 1QQP1 5IYZB 5T5OA 2D5FA 4QHZA 4FBFA 2EXKA 3E6DA 3WLUA 4DXWA 1GWKA 1Z0HA 3OEHG 2WNUB 4IV1C 4A45A 3H3LA 3WQ7A 2P3KA 5A3NA 3SDLA 3AFKA 4NN0A 2FCVA 3W21A 2QDOA 1D2SA 3DSQA 4MTOA 5LA9A 1E5RA 2HJFC 4LITA 2VOTA 2PXJA 1UOJA 2WJSA 4EWEA 1MZ6A 3H1WA 1N0NA 2Q68A 4IEUA 3OUSA 4ICGA 3MEPA 5H9RA 4QPGA 4ZPIA 1QQP2 5E1AC 4GALA 1ND2C 2VOWA 3VBOA 2L35A 5EFUA 3KKYA 1I7FA 1QJY1 4D6QA 3VQVA 1TME2 1O4TA 4XDOA 4RS5A 1FFTB 3U4XA 1N3PA 3KHCA 1N36B 4LLOA 1YQ6A 4ET7A 2X5IA 1OBNA 3DXUA 3NV2A 3T4DA 5FMOS 5JZGC 2WQZC 4GQ7A 3ELNA 2HKOA 1AL0G 2R32A 5IYBO 3LFMA 4BCUA 3JASB 4MVQA 2CSGA 4BWOA 1OMIA 3VQXA 1STMA 4JDMA 3R05A 1IOAA 4DS0A 3RI8A 1CAXA 1TVGA 1BMV2 3OTFA 2WFPA 1LR1A 1PZ8A 4HPKB 1R6KA 4QB2A 3QO8A 1YIPA 4WZFA 1OPMA 1M56C 4GKKB 1HB2A 4PBOA 1KUQA 2P1BA 4DK1A 4BM8A 3ROUA 1H8TC 3PU8A 2EICA 4U2AA 2WL1A 4PJYA 3RRDA 1Y9GA 1PO11 4YJ2A 4CH6A 4LULA 3DN7A 1KDMA 4U7OA 1HN0A 1N32O 2OIEA 4K9SA 2MPFA 4YW3A 1WWYA 4IE7A 1V55B 3IIIA 1VP7A 1WGPA 1VBE1 4F83A 4JKKA 3POSA 4FI9A 1NTMH 2K0GA 2R0FA 4MVSA 1PZ9A 4LF8B 4W6YA 5CFDA 2LFSA 4CDQC 1GMMA 5A3UA 4COYA 4RGAA 1MPXA 1GOHA 1J5EO 1NKGA 3ZBHA 2AHZA 4GKJO 3D4KA 4Z2AA 1BE3H 1SQVH 3MO4A 1ZM1A 1PPJH 3B4SA 2D93A 3A0NA 1HB4A 5FO9B 3T1CA 3J7MA 4G27B 4XDPA 1ENXA 5LW9A 4XDJA 4JCKA 3X2QB 2XQRA 1GNYA 1UIJA 3MIBA 4PA3A 4U3FH 3ZMUA 3UYJA 5KXBA 1FOD2 1AXYA 4I0AA 3FAVB 1RUH1 2GN7A 2FQPA 3I55V 3T1YO 4QQPA 3X29B 1N3QA 4NR1A 5FXZA 2VZVA 4AZZA 1NZ6A 2UXDB 3OFNG 2ZM6B 1LGNA 2BFUS 2MK3A 1AR82 1W9FA 1P8JA 3JD73 1DK1A 2WNUC 5FYZA 3DYMA 3IDEA 5BNQA 1EY2A 1ZRDA 1HP8A 3QTCA 4PQQA 4Q4W1 4FOYA 1GBGA 5K8SA 4MUVA 2DF7A 4RUEA 4Y4YA 3W58A 1I0HA 4ZU7A 4AI0A 3LNNA 3RYFA 1TNFA 1XPWA 5FY5A 5A1FA 1UU6A 3TK1A 4YIPA 2BZDA 3ZSEA 1RP3B 4K21A 3WG1A 3DC6A 2BP6A 1NJIW 4NHXA 1CONA 1OLRA 2DV9A 5L7OB 4D94A 4JI8B 4OHXA 4QHBA 3K3WA 1R091 5GZGA 3F5WC 2EAKA 1ND2B 4ZOLB 4GKJB 1PIV3 3GJBA 4JV4A 2UXXA 3NQHA 1EM1A 1IVSA 1AYN1 2WO3A 4NHKA 2IXKA 2QM4A 1YIFA 4GKXA 5LL6Y 4LF8O 1ZLZA 2F4PA 2CYFA 2VG9A 4D6RA 1BZWA 3RWKX 4DFSA 1TQ5A 2XONA 4AAPA 1AI4A 1CPYA 2FMLA 2Z42A 1GYKA 2FB5A 1SLCA 3ABMB 3LUTB 3VOUA 4FOWA 3I4IA 3BKZA 1H2NA 1W8NA 2CTVA 5CEHA 4K7JA 1OV9A 1RUG1 4LF4B 3SC7X 4R7CA 3SJCC 2E7TA 3EB7A 4QNHB 1ZZ7A 1EAH1 1W8UA 4NPMA 2VD7A 3QLQA 1QVGU 4BB3A 3SGIA 2F23A 4J6GA 4MTFA 1BK1A 3RWNA 4X65B 4JGSA 5C33A 5J2TA 5LGUA 2VCCA 1C1FA 3N2GA 2D3SA 3ZX6A 3SJBC 1TVKA 2CDOA 3CS5A 2WAOA 1SQGA 1W8OA 3LFIA 1V9U3 5JUVA 4X89A 3CIHA 2Q0AA 1URXA 5D2AA 2GBOA 3R6SA 4QIWF 2AZ2A 1S5HC 2WWUA 2HWE3 4Y5Z0 3OM3B 4E9KA 4YNIA 1BQZA 2B4KA 2Q8OA 2Q73A 4JC1A 3GCXA 2ITDC 3E5UA 3OTOB 1W9TA 3T2QA 1XMQB 3OR7C 1BBT3 1R3JC 5JI7A 3MLKA 3U11A 1EZVH 5EBWC 4KG8A 1H2KA 1FPN2 4BK5A 4AVSA 1SRYA 3FX7A 3WHUA 2EJ7A 5BR8O 3T30A 4ZZ5A 1R1A1 4K1ZA 4LMFA 4W8JA 2F66C 3ZMVA 2Y0PA 2HLDG 2GNTA 3GWOA 4K0KB 1V9U2 4CDWA 4EN7B 1CX4A 4JYAB 3L75H 4I7ZB 2KA3A 2VJXA 3WB1A 1Y9QA 4UV9A 4N43B 4I0XB 4Y26A 1ASJ2 2YIBA 4EB6A 1IBKO 1XQNA 2KG7A 4YZ2A 2GC3A 4UB8Z 1N33B 1OI6A 1YNAA 3VKOA 5JJEB 1XNKA 1EYBA 4DV6O 1SQQH 4J7JA 5L3BA 1G6NA 1JZ8A 1GQGA 1FS0G 4YWAA 3WCRA 5FP8A 4ZXKA 3FWEA 1S4CA 2W95A 1QJY3 2XWJB 1SA0A 3HIFA 1SC5B 4H55A 2GC1A 2ZMLA 1RVF1 5F8PA 2AEZA 3T2TA 2RS12 3VDDA 3RZGA 5KBFA 4AEKA 4ZHQB 1HNWO 1PMHX 4IT5A 2VNVA 5KC5A 3JATA 5CFCB 1PGL1 1RUD2 2JE8A 2XHKA 4PDMA 5ITZB 3ZFGB 2DFCA 1J1TA 4COZA 5A3MA 4NWVA 1AL21 2LUWA 1RJ7A 1I94B 1WLWA 3ZYPA 1WPBA 2BSKA 4D8MA 3M3OA 2LGWA 2DVDA 2W91A 1BZKA 2A79B 2VY0A 4IEOA 5C5TA 3CEWA 5FAXA 2A73B 1RVF2 5JXGA 3CJIC 4TXWA 2DUPA 1ORQC 1CIWA 4R6ZA 4ZKIA 5IWFA 2Q69A 4DR2B 1WCSA 2P5OA 5FPBA 4GAZA 2IFRA 4AFDA 2LRPA 4JI2O 3VBFC 5T54A 1YDXA 2DYSC 4LEJA 1BXHA 3FJSA 4FFHA 4XIOA 1CPNA 3OYWB 3B94A 5BR8B 1CAWA 3AP4A 4I55B 2ZZJA 3DPRC 3MYXA 1XSQA 2ZBJA 1WD4A 5L3GA 1ZZ9A 4DV0O 4PDWB 3E89A 2VQEB 1AR91 2UXBO 5LB6A 4XJWA 2YZ4A 2RDQA 2ZGTA 4UVAA 1LHWA 4U3JA 1K5QA 2AACA 5KUMA 5IJ9B 1KB9F 5DAXA 1LCLA 4UCVA 4X9QA 3JBG2 1VLNA 4M3CA 1WN7A 5BNOC 5B1NA 3A4UA 5B1BC 1Y67A 3U14A 2IXHA 2DYRC 2XLAA 3CRRA 2XT9A 3KGZA 4MSWC 4Q29A 1CZVA 4YZ1A 4ZBMA 4YG6A 2VMCA 4PJ0Z 3WDWA 3NV4A 5T55A 3WW4A 2FDKA 3NJYA 3SKJE 3BALA 3TWIA 2E74B 1CJPA 5ACA3 4LR4A 2R063 3Q8EA 5FIXA 1BL8A 2PAMA 1RXGA 3VHRA 3THDA 3ZIWA 2CNAA 4LF9B 5JIUA 1VBC2 1QEXA 5C3PA 3O1TA 4YJ2B 5GONB 2VZQA 2RG4A 2Z3YA 4XJZA 2VWKA 3BY6A 1YRZA 1UY1A 5C5UA 3QH7A 2ARBA 1UOBA 5E89A 3G80A 1QVFU 1O7FA 3ZRWA 4AVVA 4UBHA 1RMU1 1B09A 3PJYA 2XHBA 3MHHC 3NMBA 3RYCA 2PHTA 4DR4B 3RFRA 1X8MA 4Y5TA 1W90A 4OPAA 3C7FA 4OXSA 1W2OA 4F7ZA 3TXQA 5F6KA 5C8YB 1PX4A 1Y7BA 4YGBA 4JI6O 4YY3B 2GP3A 3H8UA 4YRDA 1KQSU 4MGIE 1ZNPA 3AP6A 1LEMA 3ZLIA 2HLEA 2ZHMA 5I0SA 4FVMA 1MOFA 2VO5A 3HT2A 1ZBA1 2FYUH 4QDQA 2Y4UA 1AYN3 3RZMA 2W3JA 2W68A 4H14A 4B08A 1Q8OA 1FMD2 4B3TO 5LMUB 1L7LA 4RFT0 4UF0B 2JRIA 1LGBA 2K1EA 1O4ZA 5A80A 1GANA 2GNDA 2G1MA 3HPNA 3ZDSA 2HWC2 1VBB3 2RMKB 4UYBA 4NWWA 3VBSC 1QIQA 3WFVA 1RUG3 4XF4A 1UKRA 3KV9A 4NAOA 2W0FC 2RM21 1SCSA 5GLVA 3SYCA 3ABKC 5F2SA 4HT1T 4MVRA 5LXTA 2OTLV 4MW3A 2MEV2 1M93A 1K9MW 4D0QA 4PHZA 5GLTA 3T4HB 5F37A 3WF3A 1DDLA 4X1KA 5H9CA 3JAWB 1WAZA 3UQ8A 1CN1A 1KD1W 2YGLA 4JZ2A 2IJJA 1YQ5A 2WS91 2RDRA 4IGPA 1KJLA 1AYM1 3MW2A 5JR7B 4KWLA 4DRRA 4X8PA 2EJRA 1GOFA 4N7UA 5A3LA 4CC6A 3LOIA 1KGYA 1QOSA 4B3SO 1QJX2 2P3IA 4A7KA 2W0XA 3M3QA 1W8WA 1O3TA 4PDWA 2YIBD 1PX3A 5FL7G 2X6AA 5CA0A 3M3EA 3CP1A 1W6NA 4FPEA 2WO7A 1TUBA 3ENRA 2NZ9A 4FZ1A 4OQ8A 2GC0A 1OSGA 3IC7A 3JXSA 3R4DB 3HBKA 2ZOEB 2ZACA 4OCTA 4P5HA 4RL7A 3EVKA 5J9PC 1JYXA 1O3SA 3CRAA 5CAZA 1WB8A 1UXZA 4J10A 1MMMA 5CBFA 1A6CA 1AYM2 2EAAA 4BA6A 1BMV1 5CG8A 5IK8A 2BWAA 5IJRA 1K42A 3IT8A 4OUMA 3KT7A 1K5SA 3V0AA 3ON7A 2HWC1 1AILA 1C8M2 3JB4C 2VRZA 1SLLA 3VDCA 3DXRB 1W2NA 1JHJA 3H9VA 1YLLA 4FLYA 4E4SA 2YGMA 3ZMSA 2W1WA 4JI6B 1PK6A 4M00A 1SLTA 2X6BA 4O2BA 1UN1A 1AR1B 4LBOA 1DHKB 4MO3M 2JG8B 4GX0A 1F9KA 1OOPC 4AEDC 3VD7A 5FYMA 2PUSA 3GBWA 5L9BA 2Y6LA 1URFA 4FT8A 3OBRA 2HWF3 1LODA 2ET1A 1YFYA 2EIKB 3E6BA 3HQRA 4Y3OA 4LORA 3WNMA 4BZ4A 1NOVA 3LZZA 2BBAA 3EFFK 1OVPA 2PLV1 4AF9A 5EIBC 2X7RB 4KU8A 4WM7C 3PTYA 1ZSPA 1RMU2 3U07A 1RMU3 3H9AA 3OF1A 1H1IA 4N8MA 1GN4A 1GWLA 1TME1 2QQPA 1GM8A 1H2MA 2VUDA 2VZUA 1J95A 1L7RA 4PV1B 2BNMA 1U12A 4BXSV 2Y26A 2ZE8A 3BVOA 1E5IA 4GWJA 2FBEA 5C8WA 1P7BA 3LEGA 2NMOA 4Z2WA 4AVCA 5BNPB 3LSSA 1O91A 4NXMB 4YSFA 2BVBA 3T08A 1VQ9V 1HRV2 2NR5A 2BFUL 4OPHA 2VTXJ 3SR2C 3K2OA 5FPZA 1YFUA 5A6YA 3RYKA 3AZWA 2GNBA 4Q4V2 1SERA 1LHOA 4JAAA 4Q26A 1T2XA 3C3SA 1VBE3 3OGSA 4AHWA 1KP3A 1VF7A 4RUFA 4M3CE 2C4XA 4Q1RA 4PA4A 1CXZB 1OQEA 1J3QA 2E7QA 1RUF2 3ZKUA 3HKEB 4AG4A 3RYHB 5DM6V 3AG3C 5LWBA 4XQWA 5AC92 3MZHA 1GSLA 4C7UA 4KHPB 1UMHA 2ZDIA 4BW5A 1MABG 4Q8LA 1D4M2 5FZ1A 3LSQA 1ZBE3 3K5MA 4XETA 5KR7A 2QQVA 4FTEA 3BODA 1MR5A 4CXXA 1PGW1 3K08A 4DV2B 1PO22 1HKDA 1MQTC 4YVSB 2VOKA 5FYHA 2P90A 3OYWA 5IYZA 3TN92 2A7AA 3WW2A 5IVEA 3ICXA 2QQWA 3H1HH 5A2QN 3ACHA 5K0UA 4NIIA 1W6MA 4X8NA 5FBZA 3I59A 4O4LA 2UXDO 5KA6A 1VEWA 3BCWA 2GUZB 3C3VA 3LEIA 3UETA 4Y20A 2UUAO 2ZMNA 2AZ5A 5CKNA 1FJGB 3IKWA 4H3WA 4QXKA 3ORJA 3BUCA 4RAIA 3MDSA 4N9IA 2Y69C 3ZN5A 1C8M3 1XXNA 3DECA 3N9NA 1FYUA 3SYOA 1AXKA 4CU7A 4XBNA 4XFCA 2P5BA 1LESA 4UFHA 2ADDA 1HNZB 3DGTA 4FK5C 1JJ2U 1A32A 1JBCA 2CTQA 3K03A 3HD8B 2BOCC 1MS0A 2XDVA 5I0DA 4F6RA 1Q8SA 3OCPA 3APBA 2IXJA 4LOTA 3KV5A 5IVCA 1SQ4A 3TEYA 2RMU2 3GZTB 4RFRB 3ZXFA 1J5EB 1G9CA 1HR0O 1JVMA 1Q7YW 4PLMA 1W6QA 1XNTA 2CAVA 4AQ2A 4J25A 3JCUZ 2Z0AA 4I09A 2VC9A 2QM8A 2RNBA 1PVC3 5FYBA 4JHTA 2QKAA 3K04A 3SISA 3ETPA 4Y22B 4EKWA 5LMNO 3IGAC 2WYFA 3PUQA 5GZCA 4Q4W3 1W6QB 1H4GA 3KZ4C 1OCCB 3E97A 4E4HA 2WDBA 3B69A 3VBRB 2WLNA 4LA3A 4MGSA 2DU1A 3RJRA 3NR7A 4AQ6A 2PAEA 4BQWA 1NE6A 1MA1A 1J3PA 2ZD9A 2RS32 2VBDA 1WBFA 3ZKYA 4TYSA 3APOA 1PP9H 3TGUH 2PZSA 5FWJA 2DU0A 3OGJA 2WO1A 2FCTA 3S57A 1V9U1 2LP7A 5EC1C 4QDRA 1J83A 4PT6A 1IS5A 4WVWA 1VBD3 2XMLA 1DF0A 1HNZO 4OYUA 4LBLA 2ZIMA 1DGWA 1ULPA 4UV8A 2IM9A 4NYKA 3ZDVA 4NRPA 4DIQA 1MS3A 4AI2A 1S0BA 3GGLA 4PF1A 5EPAA 1GZCA 4FPYA 4DXZA 3GVMA 1ULOA 4CE8A 1TVKB 4MXWA 1IDSA 4OMCA 2YDEA 1AR72 1JZ7A 3K5LA 1G86A 2V4DA 1AB3A 1R3LC 2CTWA 5CBGA 5LHHA 5BY1A 1TAEA 2HWF1 5FYUA 4QU1A 3JARB 4GKKO 1XNAA 4FQ4A 5FFOC 2CAZC 5JLVA 3HN1A 5J98B 4HK9A 4YY3O 3L9JT 1VAMA 3POIA 1GH6A 4OHWA 1COV2 4AFMA 5FZ4A 4CP0A 1KDKA 5SV5A 3VDAA 1WCDJ 5DUWA 2Z79A 2BBVA 2OWOA 2HWD1 2FHRA 1Q90D 4PD4F 1SCRA 3PNAA 4FPGA 3WEZA 4AI1A 2WPDG 4JKLA 2DDUA 5FXXA 1S5JA 4E4DX 3QNEA 3QCWA 1HQWA 2WFF2 2VQFO 4PF5A 2QR4A 4LF7O 2DQ0A 2GZWA 3GZEA 5A6ZA 1UY4A 4IETA 4S2HA 4Q27A 2XUMA 3V0AB 1TUEB 1FXKC 2F4VO 4XBQA 3OGVA 1EFRG 3FHIB 3SYQA 5KMGA 3B8NA 4F6EA 2ZNJA 5EP9A 2NLJC 4WM8A 2ZCEA 1UMZA 5B66Z 2YUAA 2WS92 4ES8A 4B4QA 1ZTEA 2EIMB 1F23A 3Q8FA 3ME2A 2XJQA 4DPNA 3J81N 5FZAA 1DP0A 3NV1A 2QWNB 4X1YB 5IJ0B 1DYKA 3PTRB 1HNWB 3W5NA 5I0UA 2RS11 2XTAA 1LEDA 4ARYA 4P2ZA 1PZ7A 5B1OA 4LK6A 1SDDB 3ITQA 1I9RA 1G6UA 3SMHA 3P3PA 3K5NA 3KLSA 2Y48A 3FKSG 5AG2A 4BIOA 2ATKC 3ZSJA 4JAVA 3OBAA 2Q5ZA 3PU3A 4Y22A 5FOJB 2FCUA 2ZEZA 1F2NA 1HXS1 1AL23 1F15A 3I97A 1BVP1 2ZKNA 4ORFA 3JD3A 3LIGA 5BUVA 3ETEA 4KL1A 1QJEA 2UXNA 4WVMB 4YVWB 4QDSA 4RQPC 2A9HA 1VP6A 3POBA 3WB2A 1NE4A 3Q8AA 2XAHA 2HYXA 4L97A 1W0NA 4I3PA 4MHRA 3E1F1 3ZYFA 2YU2A 2A3XA 4XCAA 1W6PB 3ZRVA 1QDOA 1B35A 3FUOA 1PL4A 3ZFGC 1DQ2A 2GAUA 4IV1A 3GJAA 2JVDA 2D6OX 5A7SA 3EXAA 4OUSA 4LO5B 2EULA 2ODMA 4W4LA 4TT3G 2B46X 3JBG3 4DW1A 3WUDA 4LE4A 1NA1A 4FJCC 5IWAO 1W6PA 1SHWB 1QNMA 3PJSK 2ZE5A 4PCRA 5F39A 4H7LA 1VF6C 3T2PA 2CGOA 3CDZB 4FOVA 4YZ4A 3PIJA 3ABKB 4DV2O 1EN6A 4QXHA 3RVZA 5A1LA 5BYNA 1FNYA 4HPKA 3B40A 1C5HA 1IZ3A 2Y4TA 2B39A 3ST7A 3DV8A 2E7AA 3KV4A 4YXWG 1AXZA 1BLZA 4GJYA 4GD4A 4GIQA 3RYHA 4K1YA 4RS5C 4UFJA 2QBXA 4E27A 1YWKA 1RUNA 5FO7B 4LKFA 4HLTA 2EALA 2CUGA 3KB5A 1M1KW 2RCVA 1VQ5V 4QX1A 5A33B 1JMUB 2J1VA 3LF7A 3N9QA 4JI3B 1JI6A 3VLBB 4EWDA 4QQOA 2PF4E 3O1RA 4B3RO 1UY2A 2Q8EA 4HVQA 4JI1O 5FYYA 3VZOA 2WFF1 3PDQA 1MVEA 4D6SA 3LEMA 2BGCA 2DTYA 2OX0A 1FX5A 2CK3G 4NIDA 3NVCA 3H7JA 1HB3A 4J9YB 5FTTC 5KA5A 5LMUO 4P9GA 1DFQA 5FXVA 5C6CA 1RUJ3 4XDLA 2YPJA 4DR7O 2JD4A 3RNSA 3J8F1 1SG3A 4UW6A 4XHXA 3F95A 5ABJC 2IJIA 1BBT2 3RVHA 4LF5B 2C24A 1LOFA 2VZPA 2XOMA 1QLNA 3KCYA 1BKZA 1COWG 4LKDA 4FLTA 3I2IA 2IW5A 1NH2D 4NHLA 3H01A 3CU7A 5GLZA 2RM23 2ZT9B 1I5XA 1BEV3 1W6OA 1TGOA 4BAYA 2XL7A 2HKXA 1WD3A 1GKBA 1FXZA 2Q0OC 3LDKA 3O65A 3RZHA 4ABMA 5KHKA 2YI8A 1K5MA 4X20A 3ASNC 3OPTA 4JGYB 3E8GA 4CEYA 3AG1C 1X33A 2ZXWC 1AYN2 4QHOA 2Q7HA 3LD8A 5KAFZ 2FTKA 4YHHO 2C5DA 3PUHA 1Q5OA 1QR9A 1AR83 3KVAA 3JD72 3IB3A 1SQXH 1CAUB 2BGPA 3OOXA 1BMFG 4GZRB 5J48A 4XDQA 3M70A 2ZX3A 3FN9A 4DRXA 3ASOC 4AEJA 1LR5A 3PIGA 3FL7A 1A8DA 1FFXB 4ASMB 1M90W 2QCSB 2HHHB 1O4YA 1KRIA 5IATA 2XHNA 5FPXA 3WG3A 2D3PA 1PGSA 3ZEDA 2LO1A 2P4KA 5HFMA 1CQ9A 2J7MA 4XMAA 1K4CC 4LBKA 1QJZA 1OJHA 1Z5WA 4NPRA 2M7WA 5B5EZ 4CPBD 2RS31 4C8DA 1H38A 1FXVA 4JPRA 5FREA 4X65O 5DG1A 4HNAA 3CNAA 1KS4A 1ASJ1 4LFCO 2G9GA 5LY1A 5BY5A 2VZSA 2PQSA 3AZZA 1OLQA 2K2SA 3E5QA 3PMSA 4TQDA 3IMMA 2OZ6A 4UFKA 4XDKA 2DUQA 1GK9A 2B42B 2O0OA 1H6YA 3MUY1 1DLBA 2GMEA 1K73W 1TMF1 5EBLC 4ZHQA 1MACA 2XWBB 4CP9B 3NAPC 3TB0A 2WAMA 1ZVFA 4ASKA 4QB1A 2D2CB 3FMGA 3RMYA 1NCQC 1AR61 2JB4A 1N0JA 2R72A 2BGOA 4AGRA 4XFHA 4JYCA 2WINB 4UW4A 4Y1UA 3JQWA 2VVDA 2JX9A 3ABMC 5BNOB 1YJWV 2IXIA 3C3TA 5IFTA 5HFLA 4DUYO 5EV7A 1YTFB 3GBGA 5FMDA 1F4AA 3SQOA 4B29A 1EUUA 1XJAA 5D1IA 3O1PA 2IH1C 4O4JB 1G7YA 3LDDA 1S0VA 2VCAA 2A3YA 4LR3A 3ZMTA 5HV0A 4AGGA 2W47A 4N7IA 5DQ0A 1GUIA 4KNCA 2YBSA 2CH7A 3T1YB 4XUNA 4YZ3A 3VZKA 4QQLA 1OURA 1VE0A 4QX0A 4YIOA 4MV2A 1RL3A 2AW9A 5GTIZ 4DEQA 2BQPA 1ODMA 2MW2B 4Y33A 4JI1B 4DR1B 4FP2A 3CRCA 1WMEA 3RYRA 3M2MA 2EF6A 5L3CA 2RJ2A 1GN2A 2WFF3 5FPLA 2Q30A 2VE1A 4UVBA 4LBJA 4QQHA 3ZFFC 1LGCA 1M56B 1H9WA 5FPRA 1ENQA 5I8TA 3D82A 5JXHA 1EV11 3OPZA 5DPNA 4Q0PA 3C7GA 1C57A 1GR3A 4XQDA 4NO4A 4IEXA 2B7YA 3I3MA 4MVOA 4CUAA 3RZJA 1VAVA 4XQ4A 3N2KB 2JDIG 3PLQA 1XILA 5JOXA 3LIHA 4ISRA 4NXNB 5FKBA 5FDBA 1X8EA 4P9WA 2ITCC 1Q81W 2Y6FA 1HN1A 4KQ7A 5G04L 1QJY2 5DZFA 1DGLA 4QPGB 3DL3A 3L71H 4YARA 1YXBA 3CRQA 4AQYO 1BGYH 1AR73 3E5XA 4K3UA 4CDUB 4IV1B 3N35A 3NKGA 3FUQA 1V54B 3I2DA 3A7QA 4B3MO 3OBZA 2QZ3A 1NA1B 3G7DA 3Q8CA 1O5UA 2R9AA 4AHXA 1RUJ1 5C70A 3WNOA 1QNWA 1RYYA 5BXXA 4PDLA 2YI9A 4X6QB 4KWUA 3NNGA 1ULCA 4W4ZA 1HV1A 2ZHNA 5J36A 2EIBA 3IIAA 4CCOA 1GWMA 2WLPA 2RS52 1GP4A 3H8RA 2HYKA 2NQYA 4YFZA 4DV0B 3VBOC 1RSOB 1HJFA 1YUDA 4FXGB 3KM5A 2A6WA 1LOEA 1RUI2 4UUJC 1G1XB 2MEV3 2WA4A 1B6QA 4TQFA 2ZMKA 5ISLA 1YSCA 2QE3A 3RG0A 5JCOC 4IEVA 4LKEA 3HR0A 2QA4V 4JTNA 4JGZA 3E22A 3EO6A 2R1DA 1R6NA 4OI2A 3N4MA 2QKDA 4IE0A 2OCCC 3CJHB 5FWEA 5FZGA 1GZWB 4CA9A 2E26A 4ZU4A 4FPCA 3JAWA 3MGUA 3OE7G 4I0BA 3BI3A 4B3TB 2H8PC 3WT3A 1VR3A 2Y33A 3RPQA 1AR62 3SJQC 2OUHA 4YG0A 1CEZA 3HBZA 2YROA 1Y43B 1QQP3 4YM2A 3K48A 3AEIA 2VXJA 3GWKC 4HVOA 2ID4A 4YFWA 2OIIA 2BOIA 1C8NA 3VBHA 4PQ9A 4F6RB 4DY3A 4FPLA 2JGUA 4GH4B 4P02B 1QH7A 4ATFA 3E6CC 2JG9C 4XVHA 4W6XA 3ZYJB 3P30A 2GV9A 4O9EA 2V72A 1PVC1 4BIFA 3KT4A 4P9LA 2F4LA 1JYTA 2N74A 5CFDC 3I7DA 3NJVA 4A4AA 4E4EA 3S7IA 4F3JA 1RIRA 1V6JA 3H8XA 4RR3A 4XXAA 1ZRRA 2WSSG 1UF2C 4N43C 1J59A 2XL9A 1OC1A 4LBMA 1UX6A 2AZ0A 1ND3C 1NCRB 1LENA 2VR4A 1RPOA 5CN0A 2HEVF 1KJRA 1ZRCA 4XJ9A 3HKCB 3CX5F 3JD0A 4EQVA 1O8SA 4GZ9A 3VUOA 2VGDA 1NT0A 3UT0A 1Y76A 3D6EA 1ZBE2 1CIYA 2RR12 4CU6A 4B3RB 4HKWA 1ASJ3 1UPIA 4MGZE 4NAMA 1A34A 1NLRA 4CDUC 5HCHA 4DB5A 2IVJA 3NNMA 2YG0A 2JJ2G 1Y6XA 5LA6A 3G67A 2WT0A 4XCBA 5LXTB 3JB8A 1ZRIA 2FDJA 4XPVA 3R66A 5KMGB 2XJUA 3THOA 3H42B 3OAAG 2OTJV 5IVBA 4DZGA 3SPHA 4HK8A 2OXBA 4XABA 4DNYA 4LBEC 1WNSA 3I49A 2EXIA 3LDRA 2DVBA 2P4EA 4P08A 4MXWB 5A9GA 1LUVA 1Y74A 3CYOA 3VL8A 4WVMA 4YVWA 3O1VA 5LA6B 1JJOA 2QUOA 3WD5A 4HNAB 4NMIA 3ZMZA 4NRMA 5FZ7A 3ZN0A 2W1SA 3NWKA 2W52A 1XEQA 2WN3A 1PNFA 2KB1A 1FI2A 3AMPA 3C7OA 1FPOA 3JALB 4GB31 5ANNA 2EILC 1TUBB 4ASUG 3K46A 4BOWA 4F4LA 2RVAA 2WSUA 3OUHA 1S0EA 5IYDO 3TXSA 1JW6A 3ES1A 1VQNV 3K77A 3TYJA 3JASA 4ZU5A 1LHVA 1SMVA 3WNPA 2R071 3T09A 4CCDA 2IFWA 3AYAA 3K3NA 3SH5A 3ZJZA 3N2GB 3KS7A 1V0AA 3T2MA 3J80N 3ZFEC 4OLLA 3NO8A 1K5MB 1ULGA 2ZGOA 3Q4HA 3ACLA 2VAUA 2VQTA 3ABUA 3MFCA 1UYZA 3H50A 1LRHA 5F2VO 4RS5B 1VRH3 5FMOL 1CD3G 1DBNA 3Q9OA 1HQLA 1VBC1 3WSOA 5J3UA 1E1RG 1B35B 3LGRA 5FZBA 4ZS3A 3UKTA 3PN1A 2ARXA 3LSEA 4Q4Y1 1JQ0A 1ENRA 3D0JA 4Q4X3 1O6UA 1JZ5A 2JDZA 4UCTA 1SDWA 4XUOA 4GH4C 2DW4A 4LBQA 2YIAA 4HFSA 4LBQB 1UU5A 2DWRA 3RZKA 3G6BA 4G9SB 4CUGA 4IEYA 5L7OA 5JPMB 5GW7A 4PDWC 5L19A 2DN9A 5JSOA 3GF6A 1XMOO 4DR6B 4UI9L 4YW4A 3CMGA 1QHDA 4AFAA 1IXBA 4NUBA 1PHMA 2UWCA 2JDYA 4AK3A 4MX3A 3BOPA 1UZZA 4MT8A 4FPPA 4LLFA 1YEWA 4WFFA 3MW4A 3CWBH 4FTBA 5AFBA 2D6NA 1P84F 1SKVA 3T1HB 2GNMA 2UUBB 3WB0A 4AW7A 4KWJA 3OR6C 3TRSB 3BABA 4QD2A 1AROP 2A75A 3HEIA 4XC9A 4IXLA 4NXNO 2V5DA 3CPWU 1YJNV 5FYSA 1HXS3 2L9LA 1G9AA 3O9OA 1VQLV 1O59A 5LP6B 2WAAA 1RUI3 3E2EA 3AJYA 5F3IA 4GB33 4X8AA 1BYHA 4CDWC 4CS2A 3DEMA 2BEOA 1LU2A 2WC2A 4Y4RA 3TETA 2CY6A 3FAVA 1ZRFA 3WDUA 4DUZB 1RUH3 2EIKC 1I6XA 2EIMC 2HVJC 1VB4A 4LBQD 5SV8A 2X6CA 2JEMA 2LALA 2R0HA 1W9WA 4I55A 3M8LA 4JZGA 2UWBA 3GALA 3WG2A 2V4VA 4DRVA 1DGRA 2CGPA 1AJQA 3R4SA 1N3OA 2BU9A 4GWNA 3CCEV 2B9UA 1SQFA 4P9JA 2WUHA 4YM3A 4TWTA 2VBBA 2ZGQA 4WVVA 4HKOA 4JI4O 2C2AA 2D97A 3SPGA 4CUCA 1Y9MA 5KLVH 4CU9A 2I74A 1OD5A 3CJIA 5DEDA 2Y8KA 3J8F3 1HB1A 4AQTA 4PLOA 3K0DA 3MFAA 1HNXO 4FTSA 3WNKA 3V0BB 2XOKG 1DQ6A 5EC2C 2JS3A 1C1LA 1U5IA 2XAGA 2CHHA 2XAQA 4I0XA 3ZFEB 4UT5A 3AFGA 1WW7A 1D4VB 3BU0A 3DYOA 2HWD2 3KT1A 1HIXA 4O4LB 2WT1A 3H1MA 1TNRA 1JU3A 2JDUA 3G71V 5CA3A 3SCGA 3O1MA 5DABA 2Y60A 2W39A 3BA8A 2X8KA 1NY72 2VH9A 3MICA 1D2DA 5CBLA 1VQKV 1SZXA 2ILMA 3I2JA 1KKDA 4NIHA 3W5MA 5A6QA 4B4PA 3LDEA 4TLGA 3VBOB 4FM1A 1US2A 2JEUA 5H5NA 4HYOA 3UESA 2F43G 2ES3A 2LFRA 3QF7A 2ENRA 3B9IA 4B3NA 2D6LX 1OFSA 1WW4A 1RUE1 4C90A 2ZX0A 1N34B 1IG0A 3BB6A 3A21A 5H9SA 4H37A 5BV6A 4COUA 2O8QA 2Q8DA 3VBUB 1DLCA 2A1XA 2CDYA 5CA1B 4XW3A 1XNRB 1MS5A 3VBRA 4RQFA 4LO8A 2ZX4A 4BYYA 2ZQMA 2PY5A 3CMAV 3F7VC 4YHHB 4HL0A 2A7WA 1UJWB 5FXWA 2D98A 2JG8C 1NKDA 4R9BA 5LK5A 1YITV 3AMMA 2YFUA 4AOCA 2BOJA 3BEHA 3BAAA 4CCLA 3QACA 3EHKA 3HB3B 5FPVA 4JAUA 1DF4A 3W7XA 4LIUA 5D5QA 2Y6KA 3O0WA 1G9DA 5F1RA 2OT7A 4IEQA 5CB7A 4WBBA 3WF0A 4LKSA 1LJ7A 1CR7A 3VL9A 4JI3O 5FZCA 3RQ0A 1JS9A 1W8ZA 1VBC3 4KP4A 1N1TA 5IK4A 5C9AA 1OA4A 2WO2A 5CB4A 3WU2Z 2XJPA 2HH9A 2RR11 4Q6GA 5CFCC 4DY5A 2JE9A 4LP8A 1Q8QA 4Q2FA 5EK0A 4DR5O 4DW0A 1K45A 3MIGA 3AMNA 2XJRA 4QMAA 4PDVA 2HWE1 3B77A 4TTGA 3SLIA 2NPIA 5EYXA 2WNVC 4HZFA 5BXZA 3O1SA 3KV6A 1IBLB 2WRAA 2YICA 4Q4W2 1AI7A 2QZ2A 4P00B 1GP5A 4GCZA 3ZCCA 1EPZA 1SEFA 4RQEA 1BEV2 4K40A 3WX5A 4LFBO 4Z92B 1KU9A 5JQGA 2QM7A 1MEC3 2D3RA 3A23A 3OB8A 4Q20A 2NN8A 1LECA 4D3WA 1YTFD 4RHV2 1OHHG 5CVRA 1KXGA 3N2KA 1M57B 2CV6A 4AILC 4TZDA 2ERFA 3UO2A 3WG7C 4DV3B 2A3QA 4V2WA 4IIJA 2V4AA 5GALA 4LFAO 2PTMA 2NM1A 4IE4A 1KC8W 4U36A 2Q7GA 1WMXA 4QJFB 1RVF3 3UGGA 3AJZA 4WFHA 2I2SA 4KUMA 2CE4A 2CGNA 2DWEC 2CU5A 1APNA 2G19A 2BOBC 4EFEA 1NYWA 3ACGA 4IYHA 2EZPA 3O14A 1OA3A 5FY8A 4DUWA 3TN91 3N9PA 2DCJA 4H0LB 3CCMV 1TEIA 2PHUA 2BV4A 1AX0A 4WM8B 4WBNA 3CXCU 5F5AA 1UPGA 1HRV3 1PVXA 5BNNA 4TSVA 2X05A 3RYIA 3UT5B 3USUA 5A6XA 3B09A 2VTFA 1UO9A 1DZTA 4OI1A 2ZJCA 1QJU1 3INAA 2DTWA 2JJ1G 3KD4A 1ODNA 4QX7A 3AK2A 3VGIA 4AYUA 3URFA 3PL0A 5I0TA 2ZKOA 2XPJA 2IU0A 1Z5VA 1OQ1A 1AR63 4EN6B 3N7MA 4XAEA 4HANA 3SNMA 4ZKTB 5FQ0A 2FKXA 5HV4A 1WP8A 4Y20B 4L2NA 3FHAA 1R083 4DV4O 1BT8A 3WP6A 1JYNA 2A0LA 2R16A 3BA9A 1C3HA 3MLJA 2W6JG 2PHWA 3ASOB 5FZDA 2DCKA 3ILNA 3A0RA 4LK7A 2PLV2 5CG9A 5IFPA 2UYBA 1RUF1 2VNOA 4OQ9A 4NROA 3MV01 4AEDB 1S72V 5LBCA 2F95B 3MIEA 3POWA 1Z78A 5DECA 4YM1A 3BN6A 2UU9B 3B02A 3I5DA 3O12A 1OH4A 3I2HA 3DKQA 3WV6A 2RS13 3IN9A 3B2EE 3HKEA 2Z5WA 4WM7B 2P06A 1IHMA 5KXCA 2UXCO 5HXVA 3K9SA 3K0GA 2XXZA 2Y6JA 4NIAA 3WP5A 3LA7A 1RFYA 1M5IA 3CCQV 3LKJA 4QPIA 3IAQA 2E63A 1TZOA 1Q86W 4FLXA 1PO13 1JN2P 1H0BA 1VQMV 4KFMA 5FPAA 3UV9A 3L70H 2Q6AA 1JHNA 1C28A 3WOGA 1AVMA 5KXEA 3HOBA 1DG6A 2XH6A 2W08A 4KG0A 2GDSA 2JECA 3VBFA 1Q43A 4JQRA 1Y76B 4RO2A 4O7XA 3AYCA 4XJUA 1MSWD 1N34O 4AI3A 5FY7A 4JI8O 1P49A 3LA2A 3DPRB 4XHBA 4OGQB 4RQPA 1E79G 4TUYA 3K3OA 4I9QA 5JXJA 4OZXA 5LBBA 1GZWA 4U3JB 4Y1ZA 1GFF2 1POV3 3FYIB 1W6MB 2AH2A 1B04A 2A6ZA 4QX3A 2ZDIC 2VUAA 5FNVB 2ZABA 5FNVA 5DDJ3 3W7TA 1AF9A 1V6OA 3GZAA 2DMXA 3NJZA 1W04A 3NNFA 1OCOC 4R9AA 4NOTA 3V0BA 3VQYA 3WNLA 1JYCA 4RD7A 3ZXGA 1MQTA 4NTWA 2VOVA 5IY5B 5HBAA 3WW3A 1PO12 1JODA 2A6VA 1WKYA 3TAYA 2A6XA 5LGNA 3VBUA 1S0DA 3IPVB 5K0UC 3ZN4A 3NKTA 1HW5A 3K06A 3I2GA 1F5FA 5FP4A 4B1LA 2EIJC 3K9AA 5FV3A 1XNQB 5C3SA 3IC9A 2BSKB 4DV4B 3T1LA 1UZYA 5FUPA 1JOJA 2VULA 5FZKA 3ZHRA 1R1BA 5IAXA 3K58A 3HPLC 1HJGA 2VMFA 2D7FA 5DDJ2 1Q3EA 2WLLB 1UPSA 1JA8A 2B5HA 4DINB 5B1AC 1DYOA 3AKTA 3U1XA 3CZUA 3MIFA 4N21A 2VPVA 4XJ8A 4QGMA 1COV3 1UD1A 4YZ5A 1KITA 1R082 2WNUA 3GXUA 1C5IA 3U0ZA 4LNUA 3KCXA 4JTOA 1BS3A 1OA2A 4KBBA 1FJGO 1WZXA 3VDBA 1FMD1 1HDKA 3N3HA 3TNQA 1U96A 4NE9A 4UB6Z 2K9PA 2VQAA 3OW2U 4DMIA 1K8AW 3L2HA 5FZOB 1GNHA 4CDWB 2GSMB 4ARXA 3AK0A 2VECA 3JU9A 3ZYHA 1N1SA 5CFDB 3GHNA 2ZR3A 3O1UA 1QNYA 3HVDA 4JI5B 2R7EB 1HRV1 2AGAA 5FZ8A 3DCQA 5BNPA 3THPA 4D6TH 1PNMA 3K79A 2YEVA 4QPYA 4QE9A 4JI2B 1OUXA 2FZ2A 3SYPA 2XUEA 4FSJA 4NRQA 3N7JA 2YYOA 3A0BZ 2GMPA 4XILA 3T3YA 4L8JA 1NCRC 4LTAA 3MHZA 2PAKA 1F35A 1PM4A 4X88A 2P4VA 3ZR6A 1YQ8A 4UXNA 5AVPA 1VQPV 4JYAO 1DQ0A 1IPKA 3I2FA 2GSYA 3IM0A 4JVAA 2R073 5IWAB 1R081 2YEVB 1QCEA 1G9FA 1H9PA 1OF3A 5K9YA 5HI0A 1N33O 3UCSC 3HWJA 4FFBA 1Q8PA 1ST8A 3GCWA 3I54A 3MUZ1 2Q9LA 3ZSLA 3FB7C 2X09A 1IKPA 4BK4A 5J96B 4ZIBA 3RMXA 4YVSC 4LUMA 4S2GA 1Q82W 2E51A 1MZFA 2PHRA 2EXJA 2Q7EA 4V2VA 5LRRA 1OCOB 4CXYA 3POYA 1KD7A 4J11A 1TMF3 3BRCA 2WNOA 3JAKB 1D4M3 4KH9A 4PA6A 1I3HA 5CIRA 3IAPA 5EHDA 4DV3O 3IFXA 1PD3A 2EIDA 2R70A 5H6QA 1BSMA 1HV0A 4RWUA 4J1WA 1D5AA 1QJFA 5EYYA 4DXTA 2BTOA 3UT5A 4BXFA 1XNBA 5A3OA 4AQSA 1NVPD 4I4TA 4BIUA 5KX5A 5GONA
chains in the Genus database with same CATH topology
4YW3A 5FPXA 2BWCA 3WG3A 2D3PA 5JZGA 1PGSA 1CQ9A 4JDOA 4XMAA 4LBKA 4FO9A 1QJZA 1WGPA 1G9BA 1GV9A 3ILFA 4NPRA 3P3NA 1VBE1 2ZGUA 4F83A 2RS31 3AZYA 2ZCWA 2QFEA 5T52A 3POSA 2YXSA 4GMP3 3BOWA 2K0GA 2R0FA 1PZ9A 3VDDB 5JDBA 4W6YA 5CFDA 5FREA 2Y38A 4CDQC 2YY1A 5DG1A 4COYA 1NQDA 4RGAA 4JGZC 4E4ZA 3CNAA 1KS4A 1ASJ1 5LEJA 2G9GA 3WVJA 2WZR1 5BY5A 3ZMNA 1PK6C 3AZZA 3D4KA 1OLQA 2K2SA 3H1YA 3E5QA 1ZM1A 3UL2A 3PMSA 1S2BA 2D93A 1ND3B 3A0NA 2X29A 2OZ6A 4AI8A 5FO9B 2DUQA 1REDA 2B42B 2O0OA 1XRUA 1RUC2 5CU1A 2GMEA 1ENXA 1TMF1 3B5LB 1RUI1 4AEDA 1YXWA 3VKFC 4JCKA 4L11A 1MACA 2XWBB 2XBO3 2SBAA 1VBA3 3NAPC 3B00A 3TNPB 3TB0A 5KXDA 1XE8A 4RA0A 1B35C 4ES9A 1ZVFA 1UIJA 4ITCA 3MIBA 4QGLA 3EXUA 2R061 3FMGA 4Q1PA 3RMYA 1FOD2 4N53A 1AXYA 1NCQC 2D5HA 5KXBA 4I0AA 4A7ZA 1S2KA 1FOD1 1AR61 4EV0A 3VDDC 2TUNA 1RUH1 4XFHA 4AGRA 4Y1YA 4P9XA 2GN7A 4MGIE 2FQPA 3SCHA 2WINB 4UW4A 3WQ0A 4QQPA 4Y1UA 3JQWA 2VVDA 2JX9A 3AB0A 5T5LA 5BNOB 5JWPA 2IXIA 3KSCA 4YW5A 2BYVE 5FQ0B 1N3QA 3X29B 4NR1A 4XF9A 5EV7A 3BPZA 2R6SA 3GBGA 2BW8A 2XVKA 1LGNA 1AX1A 2BFUS 2IC1A 1MS4A 3ZFFA 1AR82 3JD73 5B2GB 3R4UA 4YW2A 4M25A 2WNUC 3G6JB 1MS9A 4B29A 3IDEA 5D1IA 5BNQA 4HBNA 4HN1A 1EY2A 1ZRDA 1G7YA 2ZTNA 4PIXA 1GY9A 3M3CA 1QY4A 2A3YA 4Q4W1 4FOYA 1GBGA 1XU1A 1VBB1 1SFNA 5IUQA 4YYOA 5K8SA 4AGGA 4N7IA 2ZS6B 4MUVA 2DF7A 4Y4YA 3W58A 4LO4B 4KNCA 4ZU7A 4AI0A 3AP7A 5JSRA 1TNFA 4EN8B 1UU6A 4YZ3A 4L92A 1UW8A 3VZKA 4QQLA 3ZSEA 4CP2A 4R52A 4K21A 3WG1A 2XJSA 4CWDA 4MYEA 5TSWA 1OKQA 1CONA 4N53C 3DPRA 1R1A3 2DVFA 4MV2A 1GLHA 5A32B 1RL3A 2I07B 5E88A 1OLRA 1ZBA2 2BQPA 1XNCA 2DV9A 5L7OB 1UIKA 3TN93 2MEV1 4D94A 4OHXA 4QHBA 3R1JA 1R091 5GZGA 3LOBA 1QKQA 3S7EA 1GVGA 1XYOA 1ZA4A 2P17A 3AKPA 2EAKA 1SFYA 4FP2A 1WMEA 1PNGA 3FX3A 1ND2B 3M2MA 2EF6A 4Z07A 3RYRA 4JV4A 1PIV3 4YG3A 1YYNA 1JH5A 2WFF3 2Q30A 2RE9A 3I59B 4IEZA 5I91A 2YHJA 4NVPA 1AYN1 4LBJA 4NHKA 5CADA 4XIKA 2IXKA 2WLQA 4QQHA 3ZFFC 1KQRA 1YIFA 4GKXA 2VNGA 1LGCA 2F4PA 2CYFA 1H9WA 1H1MA 5ABJB 1YHFA 5C8CA 2VG9A 2WIIB 1ENQA 5I8TA 3D82A 5T3NA 1BZWA 4AVAA 4DFSA 1EV11 1TQ5A 3DUIA 1BCXA 3OPZA 1IS6A 2Q5TA 2D40A 4Q0PA 4B7KA 2Z42A 5AFEA 1C57A 1GYKA 4BHGA 1VZ4A 2WZPP 1PIV2 1SLCA 1GR3A 4XQDA 4FOWA 4NO4A 2Y0IA 2B45X 3I4IA 4IEXA 1H2NA 2CTVA 4B8EA 2BUKA 2B7YA 4K7JA 1CJDA 1RUG1 1VAVA 5ABJA 4XQ4A 2E7TA 4A3XA 2OUJA 3WW1A 4Q4Y2 4OJ8A 1ZZ7A 4AEMA 5C9AC 1EAH1 3PLQA 1UAIA 5JOX