2WA3A

Factor inhibiting hif-1 alpha with 2-(3-hydroxyphenyl)-2-oxoacetic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
335
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 106
structure length 335
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2wa3A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wa3A01
1H2KA 2CGNA 3P3PA 3P3NA 2CGOA 4QU2A 2YDEA 2W0XA 1IZ3A 1YCIA 4JAAA 4B7EA 4AI8A 1MZFA 2WA3A 1H2MA 2YC0A 2XUMA 1H2NA 3D8CA 4Z1VA 3KCYA 4BIOA 2WA4A 3OD4A 1H2LA 4Z2WA 3KCXA 4NR1A 2Y0IA 5JWPA 2ILMA 4B7KA 1MZEA
chains in the Genus database with same CATH superfamily
3ZMTA 3E89A 3IB3A 3AG3B 2DTWA 4YM1A 1UNBA 5A6ZA 3L71H 3OEEG 2UUCO 1UU5A 3ZR6A 4ISQA 5TISZ 1HNZO 1LEDA 3OEAA 1E5RA 3RYFA 5LY1A 4TSFG 2W68A 4I01A 1GM9A 1W3XA 4CP2A 1WA8B 4Y26A 1ZZBA 5FZHA 4Z1MG 3VLBB 2B9VA 3I2KA 2FYUH 3E35A 1RIRA 2DBNA 3VD9A 2KG7A 4F6RB 5CISA 1YRZA 2IVJA 3FUOA 2Q7EA 2KM2A 5LASA 5FKBA 2FDFA 2HKOA 2E9QA 2OCCB 1LCLA 1GR3A 2GC3A 3UCSC 2EILC 4PELA 1QMJA 1XNDA 4NJ4A 5E6HA 1NY71 2N05A 4GZRB 1DZTA 4M3CF 3B02A 2DCZA 5JJJB 3P6BA 1LENA 2ZXQA 4QX1A 2RS51 4YZ3A 4ARXA 2VL4A 1M1KW 3WU2Z 3T0DA 1SBDA 2QZ2A 1YO8A 1CAXB 3LSSA 4H33A 4MT8A 2XXZA 4DXZA 1AR4A 2J22A 1FFXA 4JF3A 3CB2A 2OYZA 5F6LB 2CDYA 1K3IA 2RS53 3LDCA 4J80A 5L36A 5AFBA 5FZDA 4IQPA 4DV4B 1J5EB 2J42A 2R062 4WVWA 1XDCA 4UFZA 1PNMA 3HNBM 3ZFEA 4PD4F 2RDCA 4UI9L 2LM3A 4Q4V1 2GN7A 3M99B 4LTAA 2CYFA 4I09A 3WVJA 1W2TA 2JGUA 1VRBA 5ACA3 3VBUA 2VNVA 5A33A 5AC92 2DDUA 1BQZA 3WDWA 2PAEA 1Q5OA 2ATKC 2W46A 1RUE2 1QJEA 2WC2A 2IFRA 3I2HA 4FOYA 4FLYA 3PL0A 5LBEA 2V7QG 3LB9A 4WM7A 1SACA 5DXDA 2PF4E 4XHBA 3MF9A 1SZXA 3BU0A 3ILFA 1CAWA 5E8AA 1IZ3A 2YGMA 2Q68A 1N3PA 1XU1A 1EP0A 2BYVE 4BU2A 3VDDB 1YJKA 2DVBA 2QNKA 2HWB1 4ABMA 3D8CA 3ZHSA 4FXKB 3U10A 1Q8PA 4N43A 5FYUA 3N9PA 5FMDA 1OI6A 4DR6B 1VBC1 4OFGA 4I9QA 2BSKA 3ABUA 4XILA 5FOBB 4JI8B 5D8AA 3CYOA 1VIWB 3S6PA 1AYN3 1GNYA 1WMXA 4GWIA 5HXVA 4AAPA 3OYWB 5KXBA 5LHIA 5SV5A 3VBHB 4CDQC 1TNFA 2N7GA 3BCWA 2NNUA 1NYWA 4AGGA 3T2QA 4DS0A 1RP3B 1ASJ2 2ZGOA 4XUOA 5JVDB 4JI5O 3TK1A 4PDLA 1KDKA 3U1XA 4LF9O 2YU1A 5JR7B 1AR92 1Z0HA 4QDSA 1UZ0A 4X1KB 4IE4A 5GZDA 4CH3A 2VQFB 1FD9A 1QU7A 3T3YA 4XZPA 3AMHA 2PHRA 3O5SA 1JYCA 2GSMB 1QHTA 4GJZA 4CBCA 4LF8B 2VR4A 4Q4X3 4AVCA 4NTYA 4PDRA 3SH4A 1G8WA 1NKGA 1FXKA 3ZPOA 2PI4A 1N8RW 2EZOA 4YJ3B 4HT1T 2GUZA 5DEDA 4HBNA 2RE9A 3U37A 1XNQO 1AJOA 4IEOA 3VDCA 3CXCU 2JG9A 1S4CA 3H7JA 4IL7A 4NROA 2VUJA 2JK5C 2LTNA 5J36A 3MZHA 3BAAA 3ITQA 4E4ZA 4AQTA 4AVAA 3IN9A 5J3UA 2W87A 4NHKA 5I8YA 1B6QA 5EBWC 3E8BA 4XF3A 3WB1A 2H6CA 1V6KA 4LFCB 1WW4A 1NCRA 5L3GA 3AP9A 4JI0O 2YIBA 2VVDA 4Q8LA 4CCLA 4E8DA 3MIDA 1V9U2 2R9RB 2OVUA 3A4UA 3N9QA 3W7UA 1GWLA 4GX5A 3CCEV 4EWDA 1XSQA 5EK0A 4JI7O 1C5IA 4BXSV 3WP6A 5DDJ3 2D7FA 4GKKO 2VGDA 3B8MA 3HKBB 1GZTA 2JG9B 3KM5A 4PLMA 1SQFA 4O2BA 2MHFA 1XPWA 5G05L 1R73A 5IY5C 2ZAHA 2AXTZ 1PNGA 1WCUA 3LCPA 2QVSB 1Q8SA 2P1BA 2GNBA 3WDXA 2DTYA 4FAHA 1CX4A 1QDCA 1GBGA 1W6MA 4FLXA 5IYBO 2F17A 5DAWA 2YXSA 1AXZA 4M4PA 3PUAA 3J8F3 4LT5A 5FYCA 4YW2A 1RUF2 4FQZA 1MVEA 2DUOA 2YPDA 2WQ8A 3G6BA 4KMQA 4AR2A 3I3EA 5J1XA 3Q8CA 3MF6A 1K4CC 2DYSB 5FY1A 3UGHA 5CG9A 1EFRG 2IXCA 5LWBA 1UZZA 4NIGA 2VZOA 3T1CA 2XBO2 2XHNA 5F39A 3CRAA 2BEOA 1ENSA 4HSJA 4K3AA 1WLTA 4B29A 2G9FA 4YW5A 1GM8A 1I94O 4AL9A 2CTPA 4XDOA 1RHI3 2Q69A 2PLV1 3WNPA 1JZ3A 3SKJE 2AZ0A 1N1VA 5B1AC 5E79Z 2A6XA 1MZ6A 3WB2A 2JEXA 4JGSA 3JASB 5FZ9A 1ZREA 3ZIAG 3JD1A 3ZPYA 2LROA 1VQNV 1HXS1 1RFYA 4QB2A 4CU8A 1JH5A 1URXA 4NAOA 1XUQA 4V1PA 2WQ4A 3DXRA 1W8HA 3U07A 2DVDA 3K03A 4JRLA 1GKBA 3KT4A 3UO2A 2BGPA 1S0BA 1D7PM 3AFKA 4QM9A 5D2AA 2IJJA 4XF0A 4S2DA 3KZIZ 3AG4C 2R6QA 4ZIBA 4BK4A 1W0KG 3KCCA 3TOJA 4FLVA 4YIOA 1BGYH 4YW7A 1PM7A 4TXWA 1G4YB 1TMF2 3QG5A 1SESA 2W91A 3WW2A 3VHPA 1COV1 3QO5A 4QAWA 2DOSA 4P2ZA 3BEHA 1VIBA 1X82A 1M57C 2QKAA 1FNYA 4JYAB 3O0WA 1W03A 1FMD1 2OWOA 1UOBA 2C0ZA 4LF5B 5L3FA 4KH9A 3QO7A 1H8HG 2PXJA 2ZKLA 4Z92B 5C8CB 1R1A3 2RS52 5GLVA 3RSJA 3AG1B 2P17A 4BDVB 3RZMA 5LBCA 2VBBA 4V2WA 4A3XA 1NTZH 3ASOC 2AUYA 1K5SA 3FBYA 4I0WB 1IS4A 5IJRA 1ZBE1 1S2BA 4QPIC 4X9QA 4Q4Y1 1CGPA 1KMIZ 4JI3B 4LKFA 3WW3A 1LU1A 3GBWA 4BQ3A 1LOCA 4Q4Y3 2G1MA 4AVBA 3OT7A 4AEDA 1M56B 3OPWA 3PVEA 4K1YA 4OVEA 4XQWA 3C90A 2JX9A 4KHPB 4YG3A 2Y48A 2UU9B 3RYIA 3OFNG 2GP5A 2QGNA 5CN0A 3J26N 3ZHVA 2W6JG 4BW9A 3DTUB 2VNGA 1K3EA 3ENRA 4XYXA 3OEHG 5A3TA 4CUCA 2VTXA 3R4SA 4QQHA 3GZAA 4N7IA 5DAXA 4ZHQB 1LESA 3QLQA 2AHYA 3SPJA 4J41A 1XNTA 2HYXA 1XSRA 1NY72 1XMOO 4FOQA 4CDXC 2GBOA 4NPMA 5BNOB 2D3OW 4QU1A 5A3LA 3VKMA 1VJ2A 4I5SA 3WP3A 3LEKA 5L3DA 2EX3A 2O8OA 1AR82 2R72A 2ARCA 2C2AA 2LRPA 4GH4B 5FPLA 4YXWG 1WLWA 3E8FA 3IFXA 3CC4V 2JD9A 1OCRC 3U11A 4WV8A 2DYRC 5CA0B 4CDUC 2ZIMA 3MV01 4IGPA 5D5QA 4JKLA 4JAVA 2XH6A 2BFUL 3NAPB 4BCUA 3K5OA 1AF9A 2PN5A 4JC1A 2IXJA 4XBQA 1R083 2BGOA 4M00A 5LEKA 5IAXA 4BB3A 1VF7A 3LDKA 2ID4A 3G80A 3H01A 2VVEA 3M8AA 2ZEWA 3AG3C 1QR9A 2W9XA 1S2KA 4J7JA 1K5JA 1N32O 2ZZJA 3W5MA 2Y6LA 1ZM1A 2UUBB 1W6PB 5IW0A 2RCVA 4Q4W3 5T3NA 2E51A 4D8MA 4I0BA 1AR72 2C1FA 1NUKA 4BIOA 4E2LA 4LUKA 1Q8OA 3HQUA 3M3OA 3GHMA 4JI1O 1GICA 1CZSA 3MDSA 2B46X 5JI7A 1QJU3 2PHUA 2AENA 3ILNA 1V55B 3O1VA 4CCOA 1V6OA 5JOYA 2J7MA 5A3NA 1NH2D 2JEMA 1AL22 4A5UB 1WD3A 2PHWA 5C93A 3JAMN 3HR0A 4K40A 1YIPA 3D0JA 2VRZA 1DFQA 1J84A 1EY2A 2QQPA 1TVGA 3LQCA 4LP8A 3G67A 2CH7A 1DQ4A 5LB6A 2YPJA 3W7WA 4DR5B 5LL6Y 1E79G 2H94A 2Z79A 1W0JG 3ZYHA 1L8DA 3CLPA 3JD4A 2UWCA 4HFSA 4QX2A 5JJNB 3ZXDA 4XJUA 1JMKC 1XMQB 2ZR2A 1JI6A 1IBLO 4Q5OA 1NQTA 4F6EA 4HKOA 3X2QB 3K2OA 1UY0A 2QQMA 5FUPA 3K59A 3SQOA 3ABLB 1V6IA 4JI4O 2ZGKA 4OHXA 5FZGA 4XDPA 4JV5O 2JWPA 1V6MA 4J7KA 4P9GA 5I8SA 2WJSA 5FLXN 1OSGA 1RUH3 2MW2B 1X9PA 3O14A 1B04A 2VBPA 1AZDA 5JQGA 4BQ1A 1JCHA 1YIFA 1FPOA 3M7AA 1W0PA 5IAVA 4I0AA 5LMNB 3MUZ1 1RUG3 4JYYA 5FZ6A 5DN6G 2AGAA 4OHWA 2PAMA 3TETA 2R073 4HN1A 2JE7A 5FZLA 3VDDC 3SLIA 2K1EA 3DEMA 5KXEA 1S5JA 2EILB 3WG7C 4P9OA 4DUWA 2D5HA 1IHMA 2WZR3 4AQ2A 1QLEC 3HKCB 4K8RB 1QEXA 2WNVA 3RG0A 1CZVA 4NTWA 3KQ4B 2DVFA 2B45X 4O2AB 3PU3A 4BZ4A 3IJ4A 3KVAA 3M70A 3TBDA 1AR93 3UGFA 1QIQA 3DYMA 2OPWA 3MIHA 2UYAA 4MV2A 4JHTA 1FOD2 4LNUA 4HANA 4RUEA 4RSUA 5JLVA 1W3VA 2RS33 3GZTB 5KHKA 2ZGLA 4O4LA 3AG2C 1IPJA 3LSDA 3DL3A 3IDBB 3ETPA 2WLNA 4XVHA 1IS6A 2WABA 5DG2A 2A71A 3K5LA 2X8KA 3TYJA 4YY3B 4LF7O 2VO5A 2PFWA 1UY1A 3V0AA 3MLKA 3SH3A 1Y74A 3HT1A 2YB7A 2Q30A 2IJIA 4ZU7A 3ALQA 3ACLA 1MS3A 5SV8A 4LKEA 1NCQB 4FM0A 2RMU1 1W2BU 4JI2O 2GNDA 1KECA 2Z69A 2BNMA 5F8PA 4WFGA 1US6A 1KS4A 2ORZA 3VDDA 1UL9A 3ZYIB 3QO8A 4IUGA 1HW5A 4Y24A 1H2MA 2DCYA 3SPGA 1SFPA 1O4TA 1UD1A 4BLIA 5KHHA 3O0VA 3O65A 4GLXA 1V0AA 1MS5A 3KLSA 3HBZA 3V0AB 3WD5A 2JEUA 2WYSA 3POSA 1TMF1 2WS93 5IJ0B 4FPLA 4JZRA 3VBRA 1XE8A 1QXRA 3NKTA 1W2AX 4Q4Y2 5T50A 5EHDA 5A32B 5IHRA 3N9MA 2QQKA 4RGAA 5EC2C 3APBA 5FMBA 1V9PA 4MUVA 5I0SA 1JODA 1IS5A 1FV2A 2Y60A 3BKZA 1DP0A 2ARBA 2ITDC 3IKWA 3I97A 3K4AA 5JZGB 4DRVA 4BWOA 5JWPA 1AL0G 5EQUA 2JG9C 4UFJA 1ND3C 4R52A 3ZEDA 3D4KA 4E8CA 3USSA 3SITA 4N53C 3BHPA 3WV6A 2ZX1A 2WA3A 4IE0A 4WVZA 3OMNB 1CAXA 4XW3A 2GAUA 4YW1A 3L75H 1Y9QA 4IDZA 1ND2A 3AYAA 3NJVA 3CCQV 2X0LA 3FB8C 2VW2A 1JHNA 5GLZA 5C8CA 5J96B 1XE0A 4XDLA 5HV0A 2P5OA 3MIEA 2GC0A 5LA6B 3OE7G 3E22A 2DYSC 2AREA 1X8EA 2ZM6B 3QVNA 1N47A 5FUNA 4YLZA 4DV1B 1TUBB 4TOIA 4PCRA 4MTXA 3ZMZA 1PK6C 2AW9A 2XVKA 3E6CC 3CS5A 1EV12 4CEYB 4L8QA 3K4DA 2ZHLA 3NV1A 2XAQA 3AZZA 4YZ1A 4OI0A 1LR1A 2UUCB 3OOXA 2VMHA 1AVMA 5FZCA 2P3IA 5AC93 1Q82W 3BU7A 4PA6A 3VBFA 1KJRA 2WLQA 4LO8A 1C1LA 1HRI2 3GBFA 5EIYB 1W9SA 4LBMA 3C2UA 4SBVA 4IETA 3ABKB 3STLC 4KL1A 1O9GA 5FY8A 4L0PA 3T30A 3GF6A 3MUY1 1LOAA 5J09A 4DRXA 3ZDSA 1FT9A 1YXBA 4MTOA 3NV4A 2HWF3 5DUXA 3K51A 3LE0A 5ANNA 1H30A 2XMLA 3JU9A 1IXMA 2WLJA 1MQTC 1GZ9A 1RUI3 1AILA 1KJLA 5T5OA 5KXCA 2D6PA 5A70A 3UT5B 1AYN2 3M3CA 3H3UA 1QJFA 5IYDO 3T0AA 4UFKA 5T55A 1NA1B 4XHXA 3ZSKA 5ITZB 3WY6A 2FMLA 1NA1A 4DV4O 2VZSA 1OD5A 4EN9B 4MS2A 5C70A 2F95B 1BCXA 4LH6A 3O0XA 5IVVA 1GZWB 4TYSA 2JDAA 4LWSB 1TVKA 4JPRA 4EFEA 4JQRA 4FO9A 1QJU1 1H2NA 2QE7G 1F4AA 1QQP1 3MHSC 5BNPC 3OTOO 4O4HA 3L2HA 2FZ1A 4YIPA 4URTA 3I3BA 3LKJA 4QPKA 1SLAA 1PNKA 3OJBA 4FSJA 4N53A 3OD0A 5GTIZ 1YYNA 1XL4A 3WHTA 2VZQA 1VQKV 2OCCC 2ZCEA 3O1MA 1WNSA 2Q67A 3NJXA 4LO7A 2QQJA 1COWG 1RYYA 4CRQA 2IH1C 4L11A 2QWRB 2K46A 5LXTB 3VUOA 4LBOA 1GV9A 3S7EA 1MEC2 3S3XA 1BHGA 4K0KB 2J1RA 2VE1A 2C24A 3GM8A 4CDXB 4WF9V 1TNRA 3GJBA 1R093 4Q8KA 4RQPA 4CCDA 2EZPA 2BVBA 3CJHB 2JRIA 4W65A 4FPKA 2YROA 3IPVA 5IVCA 3ICXA 3SMHA 3K75B 3DUIA 3ZXFA 1RMU3 4P08A 2VZ3A 3K4ZA 5DDJ1 2BTQA 3CC7V 1ZVFA 4EWEA 4PQ9A 3ZHUA 2QR4A 4GB32 1GK9A 4QU2A 3J7MA 4CDUB 4FTEA 2ZKNA 2B39A 3BFRA 3WXPA 1G1XB 1RUG1 3Q8FA 3SHRA 2YIBD 2OTJV 1NKDA 4LF8O 4QX5A 2BJSA 1AR73 4XMIA 4B4PA 4QD2A 1GU3A 2LW1A 1LTEA 3SJQC 1VEWA 2Y8KA 1YNAA 2DVGA 2OQ6A 3R4UA 1JS9A 5EFUA 2X7RB 4KNCA 1PZ7A 2OW4A 4I55A 1PP9H 4DR1O 1KB9F 2JE8A 2ADPA 1ZA4A 4CPBD 1N3OA 1REFA 4UW4A 5D1IA 2HR3A 4PHZA 2VCCA 4NWWA 1M90W 2QCSB 2OZJA 3VBSC 5GW7A 3FHAA 1A8MA 4IEQA 4LFCO 2Y0IA 4G2KA 3CJIA 3DCQA 5H9RA 3ZJZA 1V55C 5H5NA 2ZCWA 1GNZA 1MS9A 2PHTA 4RFT0 5A1LA 5L3EA 5F3CA 2WWUA 5FYIA 3Q8EA 5C3PA 5H9SA 4ZS2A 2ILMA 4GKJB 2HWC3 2IVIB 1RINA 4JI7B 3AG7A 3J7HA 4AHXA 5GZFA 2ODMA 1XNCA 4NXMO 3MLJA 4DK1A 1JX9A 3NR7A 2VULA 3OBRA 2WT2A 2QQIA 4CUBA 4LHKA 4MO3M 4EFBA 1VBB2 1YVWA 2YIAA 5E1AC 3AK0A 1ENVA 1DZRA 1FXZA 3J7LA 5IWAB 3ZM8A 4DNYA 5GONB 4Z8BA 1Y76B 5HBAA 1QWRA 3O1SA 1WN7A 1GNHA 2BNOA 1JZ6A 1VALA 1QKQA 4WBNA 5CA3A 3WG1A 1RVF1 1ACCA 2D5FA 1WP7A 2FD8A 4IV1C 5BV6A 2WS92 4TV8A 1KFUL 4EZ4A 5A7QA 2CNAA 1SPPA 2X6CA 4E2QA 5A3UA 1R1A1 4UCUA 4TLFA 1VB2A 3WNOA 3ZHQA 1W8OA 1QOTA 1BEV1 5KC5A 3RI8A 3CRMA 1ZBE3 3E5UA 4UW6A 1ULEA 1BK1A 2EVXA 5D8AC 5FNVB 3N9NA 5DN2A 4LORA 2NMNA 1I5PA 3AZXA 2K2SA 1N33O 1XILA 4RGKA 1DGWA 4B7EA 3CX5F 3CCUV 1XNBA 2RG4A 3OUHA 2V09A 3OUIA 4EZHA 1PGL1 2QWNB 4QIWF 3M1HA 5C8YA 4YHHO 5IY5B 4AI3A 3ETGA 1FATA 1UQXA 4HK9A 3PN1A 3RQ0A 1AX0A 4IERA 4IEXA 4LITA 4LNUB 1PMIA 1RUJ1 3MV11 3SXWA 1RUC3 1SHWB 1R3KC 4IV3C 3TN93 5FWEA 3AG2B 2JENA 2P6CA 2WAOA 4BISA 3FFZA 4I50A 1ASJ3 1UZYA 4ZOLA 4IEZA 1N1TA 3D3IA 1CONA 4UB8Z 2RM22 2YXYA 3IAYA 5CBHA 2UXBB 4CS3A 1M4WA 3EYPA 4DR2O 5T5PA 4OZOA 1D2SA 1WBFA 1JQ0A 4HZFA 4JCKA 3THPA 4YJ3A 5CEHA 2EIEA 3T1YO 2XJPA 3CCMV 5AC91 1HN0A 4XF9A 1S72V 3BIWE 5FO7B 3SYOA 1P7GA 3MBWA 3BY6A 4UT5A 2JGDB 3GVMA 5GLUA 2JB4A 1HJFA 1HIXA 4FLZA 3N2GA 4MVOA 3AZYA 2QKSA 2HVKC 2C26A 4QGLA 2QTWB 1RSOB 3JALA 4JTAB 1QLEB 5CVRA 4DXRA 5LZ6A 4XDJA 1UWWA 2WLKA 1GN3A 2YS8A 1N36O 3GZUC 5J2TA 1MVQA 1JZ4A 1IVSA 1QJY1 4ET7A 4E9KA 5L7OC 3ZCCA 2R0HA 1DTOA 2UU9O 1L7RA 3VBOC 3IM0A 1W04A 3K08A 3T1MA 2PTMA 5L9BA 4EWAA 1EZVH 4XFGA 2ADDA 1LOBA 4DV5B 1FV3A 4O7XA 4ORFA 1WMEA 2FL4A 3IC9A 3R65A 1YFUA 2D44A 4COVA 3U0ZA 2A6YA 4XFHA 4DZGA 3R6SA 1QJU2 4CDXA 4QXKA 3IDEA 1W8WA 5KMGA 5CKNA 4KWUA 2Q73A 3WT3A 3NJZA 2Q1ZB 1GYKA 5LOVA 1SQ4A 1W99A 4CU6A 3HKEB 1ENRA 1Q7YW 2GC2A 4AI2A 1UYXA 3AG1C 5JOWA 1WCSA 2YEVB 2UURA 1SDDB 2DWEC 4QPIA 5T5JA 2JJ1G 4H14A 4M0NA 4WFAV 5FZFA 2WZ8A 1PGW2 4R8CA 3JD73 4B3MB 1K5QA 3J80N 3CHXA 1OVPA 1IS3A 4XBFA 1TME1 2EAKA 2FDJA 4KWJA 5GJ6A 2ZJCA 2IXIA 2GDSA 3ML0A 2BP6A 2EIGA 2HWD1 4HMZA 4FK5C 4ASKA 1JR9A 4CEYC 2DCJA 1L0LH 4DUXA 4LNVA 4CCJA 5KLVH 1O5UA 3CO2A 2IWGB 1QNMA 4A45A 1GZWA 1UYYA 5LXTA 2WINB 1Y4MA 1W6PA 4YM2A 3WDTA 2WNUB 3I3MA 3CEWA 1S0EA 5AG2A 4KU8A 5FP3A 4GD4A 2F43G 4XXAA 3NVCA 2IH3C 1YQ5A 3ABKC 2VXRA 2IU3A 3DV8A 3MFCA 3BB6A 2ZNJA 4BH9A 5KUKA 4N53B 4RS5C 1NLQA 5JPMB 5FIXA 2CGNA 1WW7A 1UF2C 1LAJA 2ZTNA 1NS1A 1UIJA 3KZ4C 5C5TA 3POBA 2WDBA 4BOWA 3AKPA 4F8AA 1HB3A 3M7MX 3PU8A 4XE9A 3WQBA 1DCSA 5FK8A 5A3MA 3B69A 4DR5O 4BIFA 1DF5A 5LGUA 2ZEXA 3UJOA 1XMQO 3T2OA 1B09A 4OUEA 4EQVA 3ZKYA 5FQ0B 4NRMA 3RVZA 4NIHA 2W3JA 4QPGA 4JI4B 4S2HA 1ZRFA 3JD3A 2OTLV 4AHYA 5FPBA 2JVDA 1U0AA 2HWC1 1NZ6A 4YVWB 1O9HA 1ONAA 3FAVA 1ENXA 2QEXV 3UK9A 1S3JA 3WF2A 2O57A 2P7TC 1WMFA 3N35A 3LOBA 2QSAA 4X65B 2JDMA 4E2GA 2V4DA 4DEVA 2A7WA 5EC1C 5FXXA 5CA1B 1DLLA 3VBFB 1OF4A 1RUD2 3WUCA 5C8WA 2WNOA 4CC5A 2NN8A 1YITV 5ABJB 4GYCB 2XWBB 4DW1A 1CAVA 3JB8A 1SF9A 2D43A 3HNYM 3THTA 4Q29A 5K4LA 1WW5A 2HWE3 3F5WC 1UY3A 3O1OA 4A44A 3J81N 2WWSA 4N43C 4HZ3A 4QXHA 4E4HA 4BQ5A 4QM8A 1PO11 1LEMA 4CH5A 1L7LA 3JQWA 3T0BA 4P5HA 3WP4A 3SJAC 5JOXA 1W8NA 2VOVA 2PYJA 5GZGA 3WZ1A 3ABLC 1OXCA 1OZ0A 1VBB1 2WN2A 4YYOA 4XUTA 1DF0A 1IX9A 2WFF3 2Z5UA 2YDEA 2WSUA 2RDNA 1UU6A 2G4IA 4YZ2A 2Q8VA 4MTFA 3SCFA 1V6JA 3USUA 1ZBE2 2XUMA 1G9DA 4J11A 1S0DA 4DR3B 1BXHA 4W4LA 1H8VA 1PGL2 2BWAA 3APQA 2W39A 3ZRWB 3EXUA 1MR5A 1OJHA 3JATA 4XF4A 3PVOA 2NP0A 1VBE2 2X09A 2A0LA 5FY5A 4O4LB 4CS2A 1CIWA 1QHDA 1WLDA 2B7YA 1E5IA 4G28B 2W94A 4XPVA 4Q4W2 4XOGA 2RDSA 1H6YA 4NIAA 1M9NA 5A7NA 4GUNA 1EV13 1NTKH 4V2VA 1K4DC 4CPBA 4B3SB 1CX1A 4RGGA 4RR3B 2P34A 4YM0A 1QR8A 2JG8A 1RPOA 4XDKA 4FFKA 4WFBV 4ITCA 4YG6A 3SH5A 1COV3 5F2VO 4EKWA 4CCNA 2EINB 1UKGA 3OUJA 4H3WA 1K34A 3C7HA 3NMBA 1SG3A 2OT7A 3PUIA 1XREA 2D6OX 4K9SA 1F9KA 4XZUG 3FL7A 2QQNA 1AJPA 2EF6A 1K5MB 2Q1FA 5CADA 1RM1C 2ZE6A 5BUVA 1TUEB 5FZKA 5BNNC 4C0BA 4LBLA 1OOPA 4U3JB 1DHKB 4DV7B 1NCQC 3F5TA 2BBVA 1Z7S3 1PX4A 1O3TA 3WINE 1V6NA 3WF3A 1NCRB 5C4WC 1D4M2 2KG7B 4QE7A 4JDMA 2ZE8A 3EXAA 4ICGA 2YEVA 4K8XA 5BNQA 3OY8B 4FPJA 4CXWA 4MZUA 4FZ0A 2ZR3A 1IPSA 1KBHA 2NR5A 2ZGPA 1NZIA 3PURA 4UB6Z 1XEQA 2ZM6O 2KB1A 2F4PA 2VQEB 2JB8A 4DV1O 1B35B 4DR7O 3AMPA 3WG2A 1XB9A 4Y22A 1TUBA 2D40A 2HHHO 4MW3A 2D93A 4Q4V2 3KS7A 1ZX5A 5D8AB 2Z5WA 4URAA 4X66B 3CD6V 1BBT1 1UAIA 3WNMA 3LEMA 4ZU5A 3ABMC 3I59B 3MLLA 4XCBA 4LLFA 2FHRA 4NB5A 3AL6A 2F4VB 5DPNA 2BWCA 4RHV2 1PNLA 5BZBA 2WZR2 4O4IB 4FPYA 4HNAB 4NPLA 1WA6X 3UJQA 1W28A 1HNXO 1Q3EA 1J3RA 3TXSA 2L6LA 3FN9A 2XPJA 3B9IA 3BYWA 4LBEC 5T52A 1WBLA 2R70A 2RS32 1NT0A 3WR0A 3OEBA 1TME3 1H9PA 4OQ8A 1LUVA 2ZX4A 3RDIA 1IPKA 4HG6B 4FLWA 3OR7C 4TWKA 1FYJA 2X6BA 4LIUA 3ZMNA 1HP8A 2ARHA 1PK6B 2IBZH 4TV9A 2A3WA 2QE3A 3TXQA 5EIBC 1J58A 4XC9A 2QBXA 1SLCA 2VQAA 2JDHA 4FQ4A 2GH2A 2NMOA 4R6ZA 3MO4A 3AVSA 4GXLA 1NVPB 1H9WA 2JDPA 3ZSLA 4OHZA 2J1EA 2EIMC 4H2AA 2RS11 1HW7A 2EALA 4O4HB 2WZPP 5FPZA 1CJDA 1FNZA 2ZE5A 1XNRO 1Y9GA 3VBSA 1L1FA 1DQ2A 1I9RA 4AYUA 3TJTA 4HAMA 3MIBA 1DGLA 1BCCH 4CU9A 1W2UA 4LFAB 1MZ5A 3JARB 1OCCB 3N7MA 5B2GB 2FBEA 5JOZA 4K1ZA 4OGQB 1VPHA 3H1WA 5JXHA 4WZFA 4K0KO 5KBFA 1SPPB 4BIZA 4NHXA 2EIJC 5A3OA 3CCSV 1BHBA 2QJ1A 5IK7A 2VC9A 2ZGNA 5BR8B 1THZA 4KUMA 3SPCA 3SYQA 2Y6HA 3JD2A 5FYTA 4YJ2A 1Y9MA 4CZSA 4XFAA 4Q0PA 3IAQA 1CEZA 3FD9A 3G6EV 1HDJA 4GWMA 2D6KA 3LFMA 4XURA 5DABA 3VDBA 4ZI7B 1D5NA 1ZWIC 1JU4A 1JUIA 2PYLA 4MXVA 3HNMA 1TA8A 2B4KA 1J1TA 1W9TA 5FLHA 4TSVA 4B3NA 3VKOA 1ST8A 5EWSA 2VUDA 1NI8A 2D6NA 5IYYA 3K3WA 3B40A 2QDRA 2GH8A 4IE5A 4FM2A 2TEPA 2R043 3WNLA 1I0HA 4LHNA 3POEA 1YWKA 1IBMO 3ABTA 3CJHA 5L3CA 3KB5A 3RVHA 3L72H 5CZKA 1VBA1 4JZ2A 4CYDA 1N34O 4IGOA 5FQ0A 3S3WA 5JSRA 2ET7A 1U96A 1XHXA 3CEIA 2AGSA 1VARA 4DPNA 5K8SA 1XBLA 3K5MA 1VBA3 1A8DA 4DUZB 4GAZA 2PLV2 5FXZA 2GC1A 3UGGA 4ES9A 3ZMUA 3OTFA 4IEVA 1POV3 1VRH3 4XIKA 2YFUA 3OBZA 1JMUB 3ZFGB 4QXBA 3EVKA 2JKBA 1W9YA 1R082 4NXNO 5D21A 4ZBMA 5GM0A 1K97A 3A0KA 1LOEA 3IMMA 1R1BA 1ZRIA 1OKOA 4CDWA 4N21A 4W50A 1AUYA 3Q9OA 2QKCA 4UW3A 4OXSA 3VZJA 3MICA 3SR2C 4GMP0 1JJ2U 2LGQA 3C3TA 2GNTA 1J59A 2ADEA 2F23A 2ORXA 1RUJ3 2UXNA 4J6GA 1URFA 3AK2A 4HLTA 5FZ7A 5DMYA 4NAMA 3DGTA 3DPRC 1LRHA 3CIHA 4XMAA 4Q4W1 1Q6IA 4CP9A 5EP9A 4X62O 1PHMA 1JZ8A 3AJZA 1UO9A 3HMYA 4JGYC 2P6JA 5KX5A 5KX5B 2E7TA 2OYQA 1QLNA 4PDWB 4PJ0Z 3T08A 4UCTA 1GKFA 1ZZ6A 4QX3A 3RZKA 3VKFC 4TQDA 1EV11 3H3LA 4XFBA 2DU0A 1AX2A 1BL8A 3BTZA 5F7UA 3VBSB 3NAPA 3WCRA 4AZZA 4B3TB 3W7TA 4PIZA 5FYBA 2FMDA 4D7YA 3DSQA 1SMVA 1PZ8A 4BQWA 4ZU4A 1SLTA 3HBKA 1RVF3 1DK1A 5C6CA 4ZXKA 2DQ3A 1Z7S1 3ZN1A 4JTCB 5ABJC 2Z42A 4YVSA 1POQA 5GKAC 2LFRA 2Q5ZA 4QXCA 4I4TB 3LDRA 4PDMA 2NLRA 4K7JA 3KGLA 1XHZA 1JXNA 2JIGA 5K1XA 2ZDIA 2BW8A 1W6NB 3GNEA 4CH4A 3JUUA 4YNIA 2M7WA 2GMEA 4K35A 4QPJA 5KMGB 1KKDA 1ZRDA 1S2EA 3RZHA 3OF1A 5LATA 4X6RB 3E2EA 3K46A 5JSPA 4LE4A 2R072 1RUF3 4I30A 4UFMA 1EBOA 1AI6A 5BMVB 2Q9LA 1HB2A 4NN0A 2R063 4IV1B 3B94A 1W90A 2VAUA 2W2IA 4JV4A 4HVOA 2EIDA 4GB33 4D6QA 2WLLB 2OIEA 3PMSA 4JKKA 4Z07A 2WNVB 4FBFA 3HT2A 3IC7A 3E22B 3LWCA 2XAJA 3NXSA 4DY5A 1GWKA 1JYXA 1ZAUA 3WFVA 3TN91 4IGQA 2MPFA 3CF6E 1UW8A 2E75B 3IMNA 4XJZA 1YTFD 1VF6A 3TWIA 4BQ4A 1JZ7A 1ASJ1 3JCZA 5J9PC 2ZOEB 5LA1A 2WAMA 2E7AA 5JSOA 2AR6A 3N3HA 5FZ1A 4CEWB 3A8TA 3I59A 2OX0A 3HEIA 2E26A 3E6DA 3CRCA 1YFYA 4GA9A 2HYKA 2VECA 3AB0A 1NQJA 1MOFA 1RUI2 5A1AA 3B00A 2Q6AA 4Q1PA 1N36B 2XLAA 4JTDB 3ZN6B 3MIFA 1F31A 4AQYB 4ZZ8A 2RS12 2RNBA 3LSEA 1QY4A 4LA2A 4IHJA 2I74A 3AMQA 2Y33A 4FI9A 5BPXA 4AVSA 4N9IA 4DV5O 1BVP1 5FWJA 3BTXA 1K5MC 1MABG 2FCTA 1FXKB 1WPBA 2E5LO 5F5IA 4Z2AA 4FXGB 3BRCA 5FUIA 4P9PA 1IKPA 1NCRC 4Q0QA 1UY4A 3ES1A 5L3BA 1MZEA 2VCBA 3BVOA 1YQ6A 4E4SA 5DUUA 4B3MO 1UMZA 4EN6B 2BOBC 2LW7A 1FI2A 2BQPA 3CCLV 1OLQA 1VQ5V 2X29A 1DG6A 2N04A 5IK4A 4JI6O 3ZFEC 3CP1A 4CUGA 1V54B 2VOKA 1AYM1 3VQXA 2X53S 2YMZA 5L9RA 4I2OA 2KKWA 2JS3A 4X1IA 3Q8AA 4LBKA 3LDEA 1WP8A 5H2FZ 1UFIA 2VUAA 2AH2A 2RR13 4YM3A 3U4XA 3FBMA 3VBHC 5A7WB 5FMCA 1F8VA 4RR3C 4X1IB 5A7PA 1FMD3 3CSXA 1DQ6A 3ZXEA 1WLCA 3MW3A 5AVAA 1DGRN 1KD1W 4ONUA 1OQ1A 4EN8B 4FP3A 4AEJA 4F7ZA 1BEV3 1KC8W 1N3QA 4J25A 5JIUA 3GCWA 4XJ8A 1WB7A 3R05A 1PL0A 4EYUA 5H6QA 1JTZX 2JDYA 2V72A 5CA0A 1VMGA 5FTTC 2WFF2 2UXCB 2JICA 4OI4A 3OSDA 3ZRSA 1RB8G 1RM1B 2LGWA 4O4IA 3MFAA 1RHI1 1MS1A 3H8RA 3JBG1 1ZL8A 2CSGA 4D6RA 1RITA 4OHVA 3THDA 4MSWC 1HXS3 4BIUA 2BNNA 3AP7A 1DQ0A 2YG0A 5B1NA 1WAZA 3L9JT 4Y5Z0 3TGUH 5ISLA 5IDJA 4TT3G 3ZDVA 1MZFA 3ROUA 1PVXA 2W95A 3WQ7A 4X88A 4NE9A 1YEWA 2ZXWC 3C7FA 2VMEA 3POGA 1U5ZA 1WA8A 4J7ZA 5IJ9A 2D98A 1XE7A 3H1IH 1TG7A 1NU1H 2Y26A 2P5BA 2DCTA 1KRIA 1XL6A 5CYYA 1COV2 3ZFFC 2BFUS 3FKSG 2BPA2 1WKYA 4FLTA 3HJRA 1QOSA 1D2QA 1VB4A 4OUMA 5EBLC 2VOTA 2GMPA 2O1QA 1UX6A 1Q81W 5BYNA 3HOBA 3HIFA 3G4SV 3N4MA 3GZEA 4UFLA 3LFIA 1RUOA 1G9FA 3I54A 3ASNB 3I8TA 4IEYA 3TRSB 3O7OA 3ILRA 4RS5B 3ZBHA 3SISA 4XQDA 1JYNA 4X65O 2ZMKA 3BODA 5DUWA 4YJ2B 1OCCC 1VBC3 1GM7A 1I3HA 5FBZA 1UPSA 1U5IA 4DB5A 2WYFA 4LFBO 1JOJA 2YI9A 2D6MA 1AROP 2BTQB 1IKQA 5JMCA 1MSDA 5B1OA 4DUVA 3JQXA 4P9YA 3TEWA 4P9LA 2W92A 5FO8B 1JOBA 1S5LZ 4AVTA 5FOJB 4XUPA 1ZBA2 1QQP3 2C9AA 1YQ8A 5EIBD 1IDSA 4S2GA 1KP2A 1VMHA 4GULA 1BYHA 2D3SA 1NOVA 4BMBA 4I3GA 4CDQA 2QWPB 4MLOA 1QH6A 4TLGA 4XIOA 3BOWA 4Y5SA 1WW6A 1C5HA 1HNWB 1LKNA 2XJTA 1VP7A 1JOPA 4Q27A 1FAYA 5C5UA 4LPLA 1R3JC 1I5ZA 2DJVA 1NTMH 2EIMB 4AI8A 4D7TA 3CMGA 1XQNA 4Y1VA 3LPFA 1K8AW 4CXXA 2D3RA 3OPTA 2P90A 3SEPA 2GN3A 4A7YA 5A33B 4HSLA 3ZFGA 4UOJA 3LOIA 2B9UA 1ULDA 3AG4B 4Q2FA 2UY8A 4OULA 2ARXA 4AILC 4HPKB 2HFEC 2JE9A 2J1VA 3TN92 1DF4A 1BMV2 2QQWA 4E2SA 3ZLIA 3ZYBA 1W6OA 4D6SA 1KD7A 2OPKA 4YGDA 5HCFA 5G04L 3P32A 4R9AA 4GKYA 1FX5A 1HRI3 1DYKA 2R061 2ZGTA 1W8UA 3W5NA 1PO23 1EN5A 3DPRA 5CBLA 4FIPC 5LBQA 1ND2C 1CP9A 4DV3B 2VQ0A 3VV1A 4L2NA 4C8DA 4LF9B 2PMWB 4Y20B 1G9CA 5DM6V 1VMFA 4AQ6A 2LW8A 2PI5A 2Z2SB 2XL7A 2R49A 4QPIB 1FYUA 5FZ4A 1BT8A 2VXJA 1JYTA 2CAZC 3IDAA 2Q7GA 2W1QA 4WCEV 3KVBA 3C7OA 4LJHA 4W6XA 2XAHA 2KSDA 4HYOA 2GTAA 4MGQA 1IG0A 1W0OA 3I2GA 4BLJA 2YUAA 4FOWA 2R071 5FZ0A 1Y7BA 3WOGA 4OI1A 5F3EA 4YGCA 5DAVA 2BV4A 1YUDA 2VZVA 5FZIA 4AI9A 2FCUA 2WFPA 1N1YA 1TME2 3DXUA 4IW3A 1LU2A 4XBLA 1AL21 1L3JA 2HWD2 3RPQA 3I4IA 2ZZQA 2R0FA 4I3PA 4BPZA 3DKQA 3IIAA 3J9SA 3OAAG 3A0RA 1BHAA 2QQLA 1AL23 4ZHQA 4DR7B 1OA3A 5IJ9B 2LQTA 4IE7A 2XAGA 5C8YB 3JCUZ 3DYOA 5BNNA 1GUIA 2HHHB 1O3RA 5LGTA 1Q56A 1KDMA 1TQ5A 1HB1A 5LBBA 1JPXA 1REEA 3PVBB 1K92A 3WDVA 3E1F1 1HV0A 2XASA 4LO6B 2F66C 3T4ZA 3ORJA 3ECQA 3ZFGC 4KGGA 2ZEZA 1QBZA 4U3JA 4H44B 4U2AA 3DC5A 3F7VC 4JTOA 4RUFA 2VW0A 1Y6XA 3I56V 3T1HO 4META 2CWMA 2YBKA 3HVDA 3KV5A 1OCRB 2OXBA 3JASA 4DFSA 5F32A 1W05A 4UW5A 5KWRA 1XRUA 4H7LA 4B4QA 1EPWA 5A6YA 3UQ8A 1T2XA 5KR7A 1C28A 3B93A 2Q8EA 1BBT3 4R8HA 1XYNA 4R4ZA 3VZOA 3PUSA 4BQXA 3CPWU 3EFFK 3C3VA 1R092 1PK6A 3VBHA 1MACA 1GANA 4LHSA 4QQOA 5DQ0A 2ZEYA 1C4RA 4TZDA 4NRPA 4RN5A 2ENRA 3EHBB 3NO8A 3ACGA 2A3QA 4HPKA 4OX9B 1W06A 1B35C 2Y64A 2WNVC 2OKXA 2NLJC 3BVCA 1KQSU 1Q8IA 4FPCA 5IFTA 4YVSC 3POFA 1YI7A 1UOJA 5LW9A 4DXSA 1LHNA 1GQGA 3H1YA 3WW4A 2JDUA 3VL9A 3FYIB 2G9GA 1V00A 3K79A 4AFMA 1FAFA 2M6YA 3ABMB 4XJAA 1FOD3 3MW4A 2QM7A 2R1BA 2AEYA 3K9AA 1H8EG 1S5HC 3DXTA 2ZX0A 5LMUO 1W6QA 1VQ9V 1IG3A 1EN4A 3OW2U 5LCWL 2HVJC 3RZGA 1B3QA 2XHBA 5BY1A 1PM9A 4UBHA 1XNAA 2V4VA 4PJYA 3LF7A 4W4KA 3T1LA 1Z78A 4MXWA 4RQFA 2XB6C 5JR2A 2A6VA 3VL8A 4IXLA 3MDPA 3O1RA 3JAKB 4OYUA 3PJSK 3VHNA 4LFAO 1ODMA 3PNAA 4KG0A 1HR0B 1X7NA 2GP3A 1IOAA 3FB7C 1BK0A 4IEUA 2ZA9A 4ZPIA 4BAYA 3LA7A 4YGBA 1H0BA 3X2QC 2BTOA 4IHJB 4GJYA 3HKDA 3JBG2 1A34A 4LF5O 2AZ5A 5FZAA 3RNSA 2GDFA 2WT1A 1RL3A 4LO5B 3VBUC 3W59A 3ZMVA 3AP4A 1VQMV 2Y6JA 4SLIA 1K12A 1AI7A 1YJWV 4LQRA 3J7AU 1W6MB 2RJKA 4NHLA 4Y5TA 5L9VA 4QE9A 4JI3O 5F2WA 5BMVA 4CEWA 2VWJA 5FV3A 4BK5A 1D2DA 4G27B 4CEWC 2DVAA 5CA6A 1NBMG 2QWQB 2ZMLA 2Y69B 2Q0AA 5B4XA 4UCVA 3K48A 3BCCH 4TQFA 5JCTA 1ULFA 2QZ3A 1EAH2 3ZHTA 4KHPO 2E6VA 3N7JA 4FJCC 3RYPA 3MPBA 1KQRA 1OF3A 3E6BA 2GALA 2JG8B 3ZN6A 3OY8A 2CGPA 3OM3B 1KP3A 3VD7A 1I1EA 1ZBA1 1GWMA 2B5HA 2ZHKA 3H1HH 4NVPA 2IXLA 2HP8A 1R1A2 1N34B 2E63A 3JD72 1YF2A 4LH7A 5JCOA 3U4SA 2WWWA 4ATEA 2EIJB 1AP6A 4K3UA 3JXSA 5EYPA 3PLQA 4GWNA 4NHMA 3ZXLA 1PO13 4DUZO 1XQ8A 2UYBA 1UCXA 2QDNA 4UVCA 4YW4A 2FDGA 2HWB2 1PX3A 2P6HA 4ATFA 1RMU2 3NJYA 4AF9A 2VY0A 4QPGC 2X05A 1C8M1 5H6RA 2TNFA 5KHIA 4LBQD 4FPOB 1I7FA 1U5YA 2Q1MA 5A7SA 4HXCA 1PMHX 4DR4B 1RXGA 1UXXX 5EJ1B 4WFFA 4X1KA 1RUE1 3RS6A 3VQVA 3ZSMA 1BE3H 1OURA 1J5EO 3FUQA 2TUNA 2VNOA 3JCIA 3EMRA 4X64B 5IWFA 3PUHA 1DGWX 1G86A 3VZMA 4ARYA 2PHXA 5ERLA 4OLLA 2XJRA 4HVRA 4OQ9A 1N32B 4XDQA 4CP1A 1FS0G 3KMHA 2Q0OC 3N7KA 4RR3A 3K3NA 1S0IA 2H6BA 3ZFFB 1I5YA 4IGGA 4G4FA 2WLHA 5LA9A 1ENQA 1AYN1 3QBQA 1F51A 1YHQV 1MSWD 4PV1B 5IVYA 1AR62 3ACFA 1AR1B 4LF6O 5EJ3A 4D7SA 1BQPA 1J95A 4DY3A 5FY0A 3RRDA 3W58A 3LEIA 5C3SA 3D36C 1YQCA 4LKSA 2WZR1 1US2A 4JDOA 4GZ9A 1M06G 5BNOA 1FFTB 1DGRA 1VQ4V 4GT1A 4QT6A 1SDWA 2CGOA 2CUGA 4JGZA 1QNYA 4WM7B 3TEYA 2AEZA 2EIBA 1OBNA 4L97A 4LUMA 5LEJA 4MADA 3E8GA 3I2OA 5C9AA 4P00B 3RYFB 1NT2B 2PQSA 1LJ7A 2QFEA 1WUVA 4EROA 4KP4A 4B08A 3STZC 1F5JA 2PUSA 3W9AA 1TEIA 3U14A 5FO9B 4JGYB 4BWAA 2B8MA 2ZXWB 1F35A 4NIIA 4Q4X2 3SYPA 2LO1A 3GDBA 1VLNA 1K73W 2VQFO 5F5QA 4WZCA 4OPHA 4FPEA 2V5YA 3RYRA 5JXIA 4MYEA 5FRAA 3V0BA 3J4UH 1XYPA 2VG9A 1NVPD 2CU5A 3KD4A 5K1PA 4JQTA 4CE8A 4DINB 1SLLA 4E27A 5CG8A 1NH2B 3KV9A 5APAA 1G6NA 3F95A 5HV4A 5LMNO 5FMOL 3CCJV 1Q8VA 4J42A 5FXVA 1XNQB 3RJRA 1XC6A 1Z5VA 5ANQA 4PLNA 1RUF1 1H2GA 1R64A 2AACA 5A9GA 5LA2A 5FZMA 4WVVA 3G7DA 1A3KA 5IVEA 3E8HA 5JCOC 4PBPA 3NNMA 1JA8A 4GB31 1VAKA 3BGAA 3SDLA 3VD5A 3POYA 3AK1A 1PIV3 2OT5A 1ZRRA 4X8NA 4B3RO 2XBO1 4X89A 4JI0B 5T5LA 1MG1A 3ZYJB 3D5OA 3H1LH 3VHRA 2YV8A 1OVSA 4Z1VA 1HLCA 4D6TH 5FLIA 4LE3A 1VRH2 4GX1A 2C4XA 3AFGA 3BALA 4AW7A 4LHLA 2VUCA 4GKKB 4EN0A 4MGZE 3HQXA 4BW5A 3BTAA 5FZ8A 4NOTA 1KXGA 4P02B 2BERA 2UU8A 1JN2P 3OUSA 3SJCC 1P49A 4FM1A 3VZLA 2Y6KA 2RM23 4P9XA 1X4TA 2UXXA 1GP6A 2IXKA 1Y4WA 3BABA 4MX3A 1OC1A 1YSCA 4XJ9A 2JECA 3HB3B 5I0RA 1ZZ7A 2GV9A 1DIWA 2VW1A 4F83A 1SQXH 2PAKA 1H2KA 1BSMA 3CNAA 3B7MA 4EB6A 4LBQA 4FFIA 4HVQA 3K5NA 3X29B 3C7GA 5FDBA 4I02A 1QXPA 2KD7A 3C8XA 1GZCA 3FYEB 2CV6A 2VD7A 4P5YA 4JI6B 2RQ6A 2ES3A 4J1WA 1UMHA 2P22C 4A6SA 1GSLA 1DBNA 2ETNA 4R50A 2IU0A 5FZOA 3W21A 2G38A 3CU7A 1NR7A 3FLTA 2A3YA 1EAH3 2YXHA 2O8QA 1DDLA 1POV0 4LK6A 3CZUA 1GQPA 1VMJA 2VCMA 4NO4A 2DURA 3D36A 1RVF2 5A2QN 1EAH1 3OCPA 5K0UB 1QNWA 5GTHZ 1FXKC 4CDWB 5FP9A 1F23A 1AI4A 4XXPA 5LK7B 1YI2V 2W08A 2XLFA 1BEV2 2WLMA 3K0DA 2MNGA 1OLRA 4Y1ZA 1IBKB 4C90A 1OQEA 2IJKA 2HJDA 4GKXA 3MI8A 2EXJA 5BXZA 1IXBA 3MAQA 3LIHA 4UFIA 4WM8B 2WA4A 3AXDA 2WT0A 1GOFA 4YWAA 4XEZA 2W47A 5LBFA 4QB1A 2VQUA 4UCOA 4DIQA 1ZBA3 4IV3A 1V54C 1WCQA 5E16A 4IL6Z 2HLDG 3RBZA 3ZXAC 3N2GB 3S7IA 2KR2A 1RUC1 3JD0A 4P30A 5FJHA 5CNAA 1AR81 2E7QA 4N8MA 5IK5A 1OOPB 1C57A 4MVRA 5DAPA 4HETA 3KKYA 3VQWA 2ZNIA 2C6SA 2HEWF 3WDUA 1NE4A 3U75A 5FJKA 5KC6A 5J2TB 2RJZA 3AK3A 2BVVA 2F6BA 3DF0A 1AR83 3ZYFA 3BPZA 4WVMA 4WVMB 4UUJC 1J1LA 2GHYA 2KQXA 2L35A 4CDUA 4IESA 4XAEA 3NV3A 3ZKUA 1W8ZA 3KHBA 2QA4V 5M0TA 4UV8A 4MGYE 2YYOA 3PIJA 3ETEA 2VWKA 2PA7A 1LULA 3JD71 4GALA 3OYWA 1OHHG 4CCMA 4GX0A 2XR4A 4QKNA 2EJRA 4Y22B 1LR5A 4C91A 3JAKA 3LSUA 1CD3G 5A3PA 1PKXA 4LEJA 2NYYA 2WO7A 2HWD3 2VMDA 4GCZA 4EB6B 2MK3A 3RVYA 4UVAA 1IURA 1N0JA 4DXWA 3JSNA 2WR9A 5B1BB 2ZKOA 5LHGA 3AYDA 5IFPA 3AJYA 2XQRA 3PMEA 3AKTA 4UCSA 4QHZA 3MHHC 4LLOA 1C8M2 4YVSB 2RDRA 3ACIA 3USUB 3AKSA 1TAEA 1LOFC 2JXAA 4FVMA 1CN1A 5FY7A 4F4LA 4ZS3A 3ZSJA 2P2KA 4FT8A 3OTOB 4CTEA 3K06A 5A1FA 1ULGA 3TEXA 3NSTA 1AR71 1K33A 3PVNA 3UNPA 2QQOA 1SRYA 1AB3A 1V70A 2OUJA 5EBMC 3ZRWA 1CAWB 1O6UA 2ZX2A 3NRUA 2ZT9B 5C71A 2HLEA 5I8TA 5EYYA 3FX7A 1Y74B 2XG3A 1S55A 1QJX3 3OR6C 4XACA 1F4MA 2XJUA 4LOSA 5J2UB 4KQ7A 2DF7A 2SBAA 1SCRA 1LHWA 3RN4A 3VKLA 1AR61 3WNKA 3GYDA 2PHLA 1J3QA 2Q4SA 1SQPH 2CAUA 3G6JB 1NG0A 5FAXA 2R30A 4J1XA 2D3PA 2QQUA 3K58A 4XABA 2Q8OA 5B1AB 1N0NA 1YFWA 2DYCA 3O1PA 1AJKA 5F6KA 1LUWA 5C3QA 1O3SA 1LGBA 4QHOA 3FB5C 3OGJA 4COWA 2FDKA 3GXUA 1OA4A 1ZZ8A 2XAFA 4NYKA 1FFXB 5FFOC 5JIAA 3H9VA 5IE9A 4DV3O 4KXRA 4YZ5A 4IIJA 1B06A 3CC2V 4L87A 3LPGA 2HH9A 5IT6A 3KSCA 4P9IA 1EUUA 4W4ZA 2ZGQA 2R32A 2IXHA 2VPVA 3ZX7A 5GLWA 3T4DA 4Y1UA 3ZOIA 4AWDA 3BIEA 5FZ3A 2AZ2A 2XTAA 2WPDG 4AQSA 5DDJ2 3GGLA 1IBLB 1ZUQA 3FLRA 4X8AA 4Y33A 3TAYA 1FXVA 2XBO3 3G71V 1OFSA 1ZX3A 1NXD1 5C7GA 2VOXA 4CA9A 5IK8A 5L7OB 4JV5B 1AYM2 4TWTA 4YW3A 2JG8C 2MEV3 3URFA 4OMCA 4DOUA 4E4EA 1XU2A 5C8CC 2ET1A 4AGRA 2YFZA 4YZ4A 5IVJA 2YSUB 1JVMA 5ABJA 2B42B 3B5LB 2XVGA 4LOTA 5FYVA 5A6XA 4LF4B 2FB5A 1Q43A 3SJBC 5CBFA 1XYOA 3WF4A 3HQRA 1YC61 1S0VA 1O7FA 1S1AA 4Q20A 3TNQA 4HL0A 1FOD1 3RYHA 1A6CA 2NPIA 4G9SB 1ND2B 2E53A 4QX7A 5J7MA 3OGRA 4AFBA 4NPRA 3LDBA 3ZR5A 4AEDC 1DLCA 1YJNV 3H8OA 5C4WA 4YFWA 5LA0A 3SCHA 1AR5A 4LK7A 3T1HB 1KYOF 2F1MA 1ZZCA 2E32A 3UL2A 1K7DA 1KEXA 3ATGA 3FC0A 4QPGB 1W6OB 2HWC2 4DO2A 1JHJA 1OMIA 3I2JA 5EYXA 3MGUA 1HV1A 1OV9A 3HD8B 2WLLA 1BS3A 3KV6A 5IWAO 3DKWA 1ORQC 1RJ8A 1C3HA 2R16A 3P1IA 4BM8A 1RUD1 4QGPA 4YY3O 1FKAO 4LF7B 3LA3A 4XF1A 1H4HA 1E5HA 4AVVA 1JBCA 3JARA 1PMJX 3LUTB 2HG5C 1T6GC 1JU3A 2IJHA 3D3AA 4OX9O 4QX0A 3LNMB 3GHNA 3V65A 4LA3A 4CS4A 2ZMNA 4IEPA 1UY2A 5FYSA 3RW0A 3N9LA 2DN9A 4QB6A 2N74A 4MHUA 2BOIA 2ZGRA 2FCVA 1YQ2A 1UMIA 2OA2A 4QHBA 1LHVA 5CFDC 3R4DB 5EV7A 2W1UA 2IFWA 3LEGA 5JAXA 1O3QA 3KCYA 1C8NA 3AZVA 4DW0A 1O4YA 5K9YA 5ACA1 1N33B 3K9SA 4C1XA 4XQ4A 2P3JA 3I55V 3ASIA 2WO2A 3N9OA 2WIIB 1R3LC 5DECA 1SEFA 4Y1XA 4YHHB 3ZYPA 1M5IA 1UPGA 1POV1 2XNDG 1OPOA 1WD4A 2VMIA 2BUKA 2X5IA 1SQQH 3VBRC 3LD8A 1Q6HA 3WF1A 1VQOV 3CZJA 4DUYB 2GNMA 4QGMA 3Q8BA 4PI0A 3ST7A 3VD4A 1ND3A 5L7OA 5FYYA 1GO3F 4P9WA 1HJGA 1AI5A 3LSQA 3FMGA 1DU3D 4QQ2A 5B66Z 3RYCB 4XUNA 4RS5A 3QF7A 5J48A 1WLEA 2WAAA 2FDIA 1GTOA 4YGEA 2UXBO 2YUEA 1WGPA 2VJXA 4DR2B 1VQPV 1R081 2QM8A 3RGBA 1NLRA 2E31A 5CFCA 5C33A 1JYIA 1JZ5A 1L7QA 4HNAA 4EEQA 1WPXA 3T1YB 2X10A 4YG0A 4L99A 3AP5A 4YVWC 3UKVA 1WJZA 2VZRA 3HKEA 4XCAA 4YVWA 3IWZA 2OUHA 1W59A 2K0GA 3FWEA 5I0UA 2A79B 1P4RA 3T4VA 3V0BB 4KU7A 4CEYA 2CK3G 3OGCC 2R7EB 3VBFC 4JDNA 1RUC2 2JGDA 3C3SA 1VBC2 5EJZB 1Q6UA 1X59A 5B5EZ 3T4HB 2DCKA 4D94A 1SCSA 3DYPA 3VDAA 3UKTA 2WBKA 2BE3A 1PNFA 5JZGA 1BZKA 2UY9A 3ZMOA 1MS4A 2G9ZA 1B35A 5LA6A 4FMTA 3FJSA 5LYJB 1D4M1 1QVFU 1ZZ9A 3LA2A 5EZWA 4N43B 2HWF1 4JYBA 5A7OA 4JZGA 2QM4A 1QJX2 3CXHF 1QQP2 1F7YA 1GQHA 2Y38A 4WFEA 4R4XA 1D4M3 3KQRA 1YFXA 2BRTA 3AKQA 1OH3A 2Y0OA 4ZXEA 5JMOA 2FKXA 1QJY2 4U3FH 4OZXA 1DLBA 2VM9A 2VZPA 3NW4A 2GTSA 3OGGA 2W0XA 4X20A 2WN3A 4X1YA 3ELNA 1K5MA 3ZS8C 3VBUB 4UVBA 4MTGA 5A7WA 1OH4A 1BBT2 1D4VB 2XVLA 2ZPXA 1UZVA 4PA7A 3EHKA 2RV9A 2B9ZA 3ZXJA 1H1IA 1UYPA 1MEC1 4M3CB 2A1XA 2LP7A 4DR4O 3NNLA 4ZOLB 2DUPA 2Y69C 2B1GA 1MEC3 5FR3A 1YI9A 4B1MA 4AE2A 4MVQA 3VZNA 5FP8A 1MS0A 4X64O 5F37A 4O61A 2ZQMA 2LFSA 2H0BA 2YU2A 4FVVA 4QJFB 2YICA 3GCXA 2J1AA 2JJ6A 3MIGA 1PM4A 2VMCA 1CESA 1VBD3 1YZBA 3HN1A 4GQ7A 1T5EA 3OMIB 1G9BA 4E4DX 2EINC 4XJWA 1SZTA 5HCBA 3I3DA 4COUA 4TTGA 4M3CA 4W6YA 5GONA 3I2FA 2XJVA 1QGLA 2VCAA 5IATA 3FZ3A 4Q0UA 1JYWA 4LF6B 4LR3A 5K0UC 3ZYRA 5DZEA 1XBFA 4CP0A 5C3RA 3LZZA 4RHV3 1NJIW 4GH4A 5BNNB 1S76D 3CJIB 3PDQA 1MMMA 3VB9A 2Y6GA 4AHWA 5F1RA 2EXIA 3RJ2X 3B9CA 4BYYA 4YPJA 4GMP3 3DGEA 4RD7A 3H1MA 3RFRA 1VQ7V 3NL1A 2ITCC 3H8XA 3IGAC 1UJWB 3WP5A 1DQ5A 3H42B 1WWYA 5FPVA 3H1JH 4DV6O 4IE6A 3K77A 3PJYA 5JZGC 4XFIA 2OQ7A 5F9TA 4KI5M 1H8TB 2HBUA 4BJ0A 2R1DA 1XI1A 3QOPA 5CB7A 4ASMB 2ZDIC 4ISRA 3PUQA 5GLTA 3NKGA 4U7OA 4CZZA 4Y4YA 3SCGA 4UCRA 2XKPA 4Q0VA 1P8JA 4INDA 3TB0A 2LALA 3VBOA 1UPIA 3QD6A 2GMMA 2P06A 1JJOA 4JKMA 2OZ6A 5JQGB 1WA4A 2WKKA 1G9AA 3QH7A 1AHSA 1US3A 3VKNA 2CTQA 3ETDA 3E83A 5C3OA 5IVBA 5I0DA 1UIKA 3HKCA 3I2IA 1W8TA 1UN1A 5IYCO 4ZKTB 3BTYA 3AC0A 3THOA 4A4AA 4A7KA 2EIKB 3WHUA 3K04A 3OPZA 2EICA 1E57A 1EZJA 1GN6A 4DR1B 3S57A 1DGSA 1R6KA 4PIYA 5LK5A 3T2TA 2VZTA 3VZKA 2JJ2G 1MA1A 3WX5A 4WM8A 3I3QA 1VQ8V 4WM7C 4YSFA 4RL7A 4FCAA 1LGNA 3APOA 2RR12 2ZGMA 1VAMA 2DFCA 5FPAA 1RUD3 5JH7B 4B3RB 1FMD2 5TSWA 2WO1A 3NNJA 1GN2A 2E74B 3OGVA 1PPJH 2C5DA 1HRV3 4AI1A 1AVBA 2NQYA 2A73B 2C9KA 4K20A 4QWNA 5B1BC 3Q4HB 3ZN5A 1OFNA 4GKJO 2E76B 4ASUG 3AYCA 2IZWA 2PELA 2Y4UA 4EV0A 1XOUA 1HRV1 1V6LA 4FTBA 3JATB 3UKNA 4NXMB 1SKVA 2Y34A 5E1RA 1JFFB 3O1TA 1OUSA 5IUQA 3DXRB 3QCWA 3M4FA 1H38A 2WS91 3CWBH 1AYM3 5JI9A 2WWJA 4NIDA 2JD4A 2DV9A 3ZX6A 3OUFA 3AM2A 4UF0A 1UX7A 2EBOA 1MQTB 4DR3O 2OIIA 2VBDA 1NLSA 3SPIA 1G7YA 2QTSA 1TGOA 1I5XA 3A0NA 1X36A 2XOKG 1RUH2 4DV2O 2UXDB 1MPXA 2WRAA 5FPUA 4HN0A 2ZACA 3E97A 2RM21 4IEWA 4QDQA 1VBE3 2A3XA 3EJKA 1Y76A 3L2YA 2WLIB 3PTYA 3H3ZA 4PDVA 3LGRA 4PDWA 5CFCC 4A41A 2JDIG 2SLIA 3ZN0A 5BNPB 1EM1A 2ZX3A 5FXWA 3INAA 1RUJ2 1OCZC 3S5AA 1KS5A 1SERA 3NV2A 2LJ2A 4UF0B 3CQOA 4PF1A 4GWJA 4CP9B 5FL7G 4MSVA 3E5QA 3ZXKA 4AEDB 4DXTA 2RJLA 4K8ZA 1UYZA 1AXKA 2BU9A 2BDRA 1D5AA 3FE5A 1UOGA 5LRSA 3ON7A 4D69A 2BTVC 4U7NA 2YHJA 1W2NA 2ZHNA 3WQ1A 4JGZC 1CIYA 1LHOA 1F4NA 3C7EA 2DQ0A 2VVFA 2UUAO 4BMEA 1IBKO 3FX3A 3HAGA 3L74H 4QQLA 3E86A 1FJGB 2CDPA 2UWAA 2XOMA 3ZVXA 4H13B 4N23A 5B4NA 1QJZA 4JGYA 1J3PA 5LYJA 3T2MA 1ZNPA 1Z7S2 2Q5TA 4O4JB 1O4ZA 1OQDA 2HWF2 2F93B 3I2DA 3EBRA 4O9EA 3O12A 2P3KA 2VU9A 5LP6C 4CUAA 3AP6A 5CFDA 1QU0A 2W0FC 2W5FA 2O14A 5HI0A 2A6WA 4QPYA 1AJNA 4D3WA 5CU1A 4NR1A 3RYKA 1OCOB 3HR9A 4UBGA 2YGLA 2NN4A 1OUXA 1H6XA 4RA0A 1GRJA 4L8JA 2WL1A 3LDDA 4U36A 3D6EA 1NZCA 2PZSA 3FB6C 1UOFA 4Z2WA 3K3OA 2ZINA 4MW8A 4ZKIA 4UV9A 3POIA 3FFQA 1LODA 4A2UA 4MGSA 1K9MW 4CDWC 2XUEA 4AFCA 2WSSG 5FYHA 1A32A 3V64A 3B2EE 1QXJA 4UXAA 3GBGA 1QJX1 4Y1YA 1D0HA 2I2SA 4AI0A 5HXMA 1RTVA 2DFBA 1LNQA 4CC6A 5HCHA 3BOPA 5B3SC 4LBNA 1R6TA 4ES8A 5C9AB 4RQPB 4LIVA 2OS2A 1O59A 1TZOA 5IJ0A 2HBTA 3WLUA 1U5XA 1W2OA 4WM8C 4QNHB 4K21A 1ZSPA 2LS6A 2DUQA 4O4JA 4PDWC 1LOGA 2JDNA 1AR91 4COYA 1YJ9V 3WG4A 2XL9A 3OBAA 1MQTA 1PVC3 4DV0O 4S2FA 5J37A 4MVSA 3ZRVA 5CKMA 3NQHA 1OOPC 1YDXA 4HKLA 3VN4A 4IIJB 2VTXJ 2XONA 1QVGU 1HDKA 1VR3A 5DZGA 1CJPA 2LUWA 1R6NA 3JB4C 4RHV1 3VBBA 4FLUA 4W8JA 4NRQA 3B4SA 4FPFA 5CMUA 2XHKA 1SLIA 4JYCA 1ROPA 3D3QA 5LP6A 2ATFA 3BPSA 3I5DA 4W6WA 3POJA 3P30A 1XNRB 2XT9A 1PVC2 3JBG3 4Z82A 3GB7C 3K0GA 3D82A 1H1AA 1ZA7A 1ZYBA 1L0NH 3QACA 5F3GA 5BNPA 3N36A 1Y43B 2QQVA 1SZBA 1CZTA 5KA6A 1Z2GA 4BA6A 2GU9A 3VBRB 2YIDA 2VTFA 4O2AA 4L92A 3OD4A 4D0QA 5J2UA 3UT5A 1KKCA 3SEEA 4FFHA 3TCUA 3AXEA 4A7ZA 1P84F 4KBZA 3WCSA 5FYZA 2F4LA 3KT7A 4AFAA 2Z0AA 2A5ZA 1VRH1 5KXDA 4N9HA 4XTPA 2ZGSA 4CXYA 1O5LA 2ZAAA 4AK3A 4AHCA 4WBBA 1TE1B 4LULA 1W39A 1K45A 4AEMA 1YCIA 4K8FA 5EXOA 3POWA 3RWKX 2J1TA 5L19A 2RMU2 5CAZA 4BE3A 3W20A 1G6UA 3I49A 1GOGA 1ZTEA 3UO3A 3M3QA 1SBFA 5BY5A 1GMMA 5JPNB 2VZUA 3VQYA 1WB8A 5GZEA 5JJEB 3ZIXA 2V73A 4MH0E 1JFFA 4IV3B 3RZJA 1JW6A 1VBD2 3OGSA 5CB4A 4CSWA 1NAEA 3KCXA 4RWUA 3JAWB 3JAWA 3M8LA 1R091 4WFHA 1HKDA 2RMU3 5CB4B 1PO12 3H7YA 2NZ9A 5KAFZ 5H9CA 1HNZB 3CRRA 1SETA 5FKCA 1IBMB 4RO2A 4NHYA 4AXOA 1MNGA 2BCCH 3F7YC 3UESA 3MPPG 3WG3A 2R042 3QTCA 2G19A 2W6IG 4OCTA 4J9ZB 1VF6C 2A75A 1VP6A 4YARA 5FY4A 1SFYA 3RT3C 1EPZA 3ZO0B 3A21A 1OA2A 4BXFA 1PV0A 1HRV2 1REDA 4LF4O 1FPN3 4I9WA 3AKRA 1T6BX 2VNRA 3T09A 3K57A 2JIJA 2EULA 1RUH1 4A42A 1W6QB 3JALB 4UAPA 3CJIC 4PA4A 2RR11 2WSVA 3HKDB 1CWPA 1E5SA 2PHFA 3A22A 1QDOA 2P4KA 5F5AA 1A78A 3ABZA 3P3PA 4YW6A 3E5XA 1DZQA 2QDOA 1FPN2 1Y66A 4MHRA 3IPVB 3RYCA 3VBOB 5K0UA 2A7AA 3AVRA 5IVFA 4M0HA 2P3YA 5HFLA 1UXZA 1S77D 4C0HA 2P4EA 5D5PA 3ZFEB 3IIIA 2K9PA 3WF0A 4H37A 5LHHA 4TV8B 3I7DA 1H8TC 1WCDJ 3VD3A 4X62B 2V4AA 1X50A 2P67A 5KHJA 1H8TA 4RFRB 4WBNB 2ZE7A 3SYAA 3DECA 3CKHA 1VBA2 4O65A 4QQPA 4NTXA 1F2NA 2CH7B 3N2KB 1LGCA 3FHIB 3P3NA 4AG4A 1VBE1 3B3QE 4I50B 2PGGA 2DW4A 4FFFA 5EPAA 3VOUA 3VHOA 2CHHA 1HRI1 4NKGB 3A7QA 5KUMA 1YHFA 2WZEA 1PD3A 4JTNA 2EA7A 5FZBA 1QJY3 4B3TO 2JS5A 2CTWA 2D2CB 3KV4A 1BJQA 2QKDA 1VQ6V 1ALYA 1S0CA 3CMEV 3B09A 3BA8A 3RZZA 1O8PA 4DR6O 4JASA 5FK7A 4CH6A 1Q90D 4DEQA 2W1SA 4F6RA 3ES4A 4JI8O 3ZHRA 4LWSA 2YC4A 4QX8A 1N4CA 5FNVA 4FFGA 1HQLA 1GP4A 4B3SO 2H3OA 2Z3YA 3H0OA 4FZ1A 1JZ2A 3KHCA 3GWKC 3RYIB 1CAVB 2ZGUA 2CTRA 2O0OA 2DBIA 3MEPA 4XAAA 2XDVA 4JI5B 1AP5A 4R9CA 4CU7A 4DUYO 4RYDA 2WNUC 1BLZA 4B4RA 2BZDA 3M3IA 4RQEA 4GIQA 4OUSA 3B01A 3IAPA 3BUCA 3FAVB 4DK0A 3A0BZ 1UZWA 4DRXB 2IM9A 2KXLA 3BN6A 1AXYA 4DV7O 1SQVH 3P5BA 4H0LB 1BVVA 1RMU1 4R9BA 1ZRCA 1UU4A 3VGIA 2YY1A 5CFDB 4KGQA 3ZN4A 3AEIA 2HJIA 4X1YB 1PIV1 2I45A 3ASNC 4KBBA 3RI9A 2AHZA 1PGSA 1RC6A 1KUQA 4QKBA 3IT8A 3SYCA 3OGIB 2RHPA 4P14A 3THCA 2EIKC 4TN7A 3M2MA 1HN1A 4IYIA 1PZ9A 2VQEO 2GZWA 2ADQB 4JRAA 3JZVA 4LO4B 1QQCA 5FPXA 1JYVA 1Z5WA 5AVPA 3MYXA 1XJAA 3KF5A 5IT9N 4X66O 5A3WA 4PQQA 3R66A 4O9GA 1NX9A 2HEVF 2X5IB 3J7NA 5H9PA 1OCZB 3B8NA 3SC7X 2K9ZA 4FAGA 2Y6FA 2V5DA 4QMAA 2F4VO 1OT5A 3RWRD 4I4TA 2YC2A 1KITA 4BR6A 1PVC1 4BHPA 1PO22 1CAUA 1YXWA 1MS8A 2UWBA 2X6AA 5IYZB 1HNXB 3F2ZA 1YTFB 4JX0A 5CIRA 1R3IC 1CPYA 4HOOA 4JGZB 3ZIWA 3BI3A 4XTMA 4AEKA 5EZYA 5FP7A 4HONA 5DZFA 2A9HA 4ZONA 3O9OA 1GN4A 1GLHA 4DO0A 3ZRXA 1Q8QA 1OKQA 5I0TA 4TUYA 2YBPA 3WQ0A 4OMDA 2RS13 2YBSA 3LAGA 1RUI1 2W52A 3EQEA 4JVAA 4FPGA 3PIGA 3H1KH 1I94B 3AYEA 2WLPA 3PTRB 1GFF2 4A3ZA 3ZFFA 1BMFG 1Y3TA 4Q0SA 3UM7A 2AYHA 2WNEA 2DWRA 1ODNA 5FY9A 2HJFC 3L73H 4OPAA 3AMMA 2E3CA 4FPHA 4AAXA 4O2BB 5KAIZ 3TNPB 5DAQA 5EZYB 1WMDA 3T2PA 3HKBA 1HX6A 2OCHA 5HFMA 4IT5A 5LOVB 4ZZ5A 4JAUA 1SA0B 4QGNA 5FYMA 1QF3A 2IUWA 2PY5A 1U12A 4PF5A 2Z4FA 1FXHA 4AFDA 4J10A 1KFXL 2WQZC 5A80A 4YFZA 2D6LX 5A6QA 1YJLA 4CCEA 4B8EA 5C9AC 1JOYA 3MW2A 4AGVA 2HWE2 2B5UA 3CRQA 3N2KA 3J8F2 3NNFA 4MOAA 4KG8A 1VBD1 2VZ1A 1LOFA 3SKVA 1DYPA 2TBVA 4JYAO 2BOJA 2VQTA 3IDCB 2VMFA 1NR1A 4QKFA 2WFF1 4CDQB 1CQ9A 3WNXA 1LHUA 4R7CA 1RGSA 2H8PC 2CAVA 5BR8O 1YIJV 2J1SA 4CVUA 2R041 1ULCA 2VH9A 4DV6B 2MEV2 1M4UA 2EJ7A 5JUVA 1RJ7A 2XLGA 5JH7A 3H50A 2Y0PA 1ULOA 1BZWA 4GH4C 2DU1A 4RAIA 4EN7B 5F3IA 4AOCA 2XJSA 4GMP1 1FPN1 4FOVA 2YZ4A 3U78A 2XQXA 1OCOC 5JXJA 1SQGA 2HEPA 1W8FA 5JVVA 1ZL8B 3CDZB 4DYLA 2YI8A 3L70H 1HB4A 3AZWA 3ME2A 3CJXA 5C4WB 4NMIA 1X8MA 4ZI7A 4HKWA 2YXLA 5GALA 1DQ1A 5EYPB 1RXFA 3OBTA 2GSYA 2DWDC 1H2SB 1SS3A 2P4VA 5ACA2 3JSLA 5T54A 2Q4PA 1OD3A 3S30A 2FQPA 1YLLA 1IQAA 5F5CA 4ZY9A 5CKQA 5FBJA 1Y67A 4ZHNA 1F4HA 2CL2A 3KWVA 1ULPA 4UYBA 4OI2A 2BSKB 4LKDA 4LFBB 4MXWB 3HPNA 4B1LA 1IGOA 3EO6A 1XMOB 3ETQA 5DG1A 2W1WA 4KFMA 4UXNA 4JHZA 2E33A 2WO3A 1S0FA 4QPWA 5F2SA 3AX4A 3FHQA 1GMGA 4H55A 4LCUC 4NXNB 3RWNA 2P37A 3N27A 1GAXA 4FPPA 3UKMA 2ZBJA 5E89A 4OHYA 1HNWO 4C7UA 2RJ2A 4MGIE 3V56A 3FLPA 1E1QG 2H0VA 1BQ0A 2ZS6B 3NNGA 1EUTA 4N90A 4NWVA 2RDQA 1O91A 1WZXA 4COZA 4PA9A 4KWKA 4X8PA 3CE2A 5JVDA 3DN7A 2ZABA 1F15A 3WDYA 4MVZA 1WCKA 1R1ZA 4I7ZB 4TV9B 5LGNA 3WW1A 4UWDA 3MD0A 1N1SA 5J98B 1QOOA 2UUBO 3WUDA 5FZEA 3AMNA 4PA3A 1DYOA 1OPMA 3CBNA 3HWJA 3TEZA 5HCAA 2R9IA 4M4RA 4CCKA 4C1WA 4HK8A 2XWJB 1H4GA 4Q4V3 4DV2B 2UXDO 4JI1B 3HN3A 4A6OA 3CCRV 3WNNA 1SLBA 1VBB3 3GWOA 4J9YB 1EYBA 1RUE3 1PIV2 2A70A 5A32A 1LB2A 1M93A 1J83A 2L9LA 4BQYA 1X33A 2YC0A 4X20B 2PYTA 4LBJA 5H9QA 2AC1A 4XFFA 1RUNA 1APNA 1OHFA 5BXXA 4XFCA 1VF5B 3WG7B 5CBGA 4Q6GA 4F3JA 4PBOA 1BMV1 1EN6A 1OLME 4P9JA 4N7UA 2D97A 3WEZA 5K7PA 4FP2A 1PGW1 3A23A 3OMAB 3GALA 2IC1A 2DMXA 4PT6A 1D0GA 1RPRA 1U97A 3OB8A 3WSOA 4EJRA 2BBAA 4DQAA 3KF3A 3NWKA 4LR4A 3PJQA 3EB7A 2HWB3 3GJAA 3LIGA 3DC6A 1NCQA 3IBMA 1VQLV 1CR7A 2EXKA 3RMXA 1P7BA 2QUOA 5LRRA 1PO21 2FMYA 2UUAB 1Q86W 2RVAA 3S0MA 2A06H 1E1RG 1I08A 4ASLA 3JYCA 2B1IA 1ZLZA 3H9AA 1XXNA 1FJGO 3RZLA 1F5FA 5L73A 1AX1A 2XKOA 3CCVV 2ZHMA 1SFNA 4LMFA 4QKDA 5FLJA 2WUHA 2ARAA 1W6NA 3PHMA 2FDHA 3ASOB 3H8UA 1NQDA 2J1UA 2DE0X 2RMKB 3LNNA 2GUZB 4L9BA 2HKXA 4I55B 3ZMSA 1AJQA 3RMYA 5CFCB 4Y20A 2ZIOA 3M3EA 5AFEA 4QDRA 2RS31 1AR63 4AHZA 3QH6A 4M01A 4X6QB 2Y4TA 2A6ZA 3MHZA 4Q4X1 3QNEA 3A0HZ 4IYHA 2Q7HA 2CDOA 3SPHA 4FFBA 3KT1A 4MVMA 1HQNA 4EE2A 3BA9A 3SGIA 2HEYF 2XGXA 5FPRA 1JUHA 1PL4A 2CTVA 3B77A 2VMGA 4MGTA 4I0XB 2JIZG 4AQYO 3D0SA 4GX2A 4M3CE 5DUVA 5FZOB 2IW5A 1SBEA 4IV1A 4Y3OA 1M57B 1OLMA 2XJQA 2Q8DA 3KGZA 1ND3B 2QJVA 4Q26A 4Y4RA 1GH6A 4DMIA 2E5LB 3UV9A 1HWYA 1C1FA 4LBQB 5KA5A 1IQDC 1CPMA 1SA0A 5LP6B 1TMF3 3ZXGA 2EXHA 5I91A 2CWSA 2CY6A 3O1UA 1CXZB 3ZYGA 2OIGA 5FP4A 4JI2B 1XNKA 3A2FA 1H1MA 5HPOA 4YRDA 1STMA 2ERFA 1K42A 1NXMA 1RUG2 2FTKA 2JKXA 4DV0B 3L9DA 2DYRB 2V1DA 4PLOA 4BQ2A 2KA3A 1LECA 3HPLC 4NUBA 3CL1A 3WB0A 4H7MA 3Q4HA 3S5QA 2I07B 3NAPC 1V9U1 2JDKA 1XOYA 1W0NA 3N7LA 3DPRB 1QH7A 3KG2A 2QWOB 2PHDA 2WNUA 5LMUB 1S0GA 3J8F1 1M56C 1SC5B 5FREA 2QTOA 2WLIA 3CMAV 1V9U3 1HXS2 4FTSA 1H2LA 2VOWA 3AL5A 1GOHA 1X9TA 1KU9A 4I0XA 5B3SB 4G3YC 4B7KA 4Q1RA 5FCCA 1NE6A 2ZD9A 4KWLA 3UT0A 2X5IC 4R9DA 4XBNA 4JAAA 2EAAA 4XETA 5I93A 1TVKB 3OG2A 4RQPC 1RHI2 1HQWA 2PLV3 1RSOA 1HR0O 2BGCA 4LXLA 4FFBB 3W7XA 5ITZA 1VAVA 4K6BA 1CVNA 1UKRA 5BNOC 2NM1A 2UXCO 2JDZA 5IYZA 4DRRA 4TUYB 1CPNA 2HWE1 2CE4A 5KHGA 1CAUB 1W9FA 3SNMA 1GP5A 5CA1A 1BKZA 1VE0A 3W7SA 5E88A 4MVTA 4PIXA 3ZSEA 4PI2A 5FPOA 3IZOA 4XUQA 3UETA 4MGKE 1W9WA 5JXGA 1SQBH 4LC1A 3R0RA 4MVUA 1C8M3 2PQQA 2BOCC 5LY2A 2MEV1 2FZ2A 3ACHA 2RN9A 1G8MA 2Q8CA 4UFHA 3RYHB 1NA1C 3UYJA 5GZCA 2R9AA 1QCEA 4MG2A 1KGYA 1O8SA 5FMOS 4CCCA 5JDBA 2VS0A 1LNSA 2ETEA 1I6XA 1S0JA
chains in the Genus database with same CATH topology
4I3PA 4YM1A 2DTWA 4BPZA 5GLUA 3IIAA 1UU5A 1UIKA 3J9SA 4ISQA 1UN1A 1HIXA 1LEDA 4ZKTB 3AZYA 1AL23 2W68A 1OA3A 4BGKA 4I01A 4CP2A 4A7KA 4QGLA 3WHUA 4Y26A 1ZZBA 5BNNA 5CVRA 3OPZA 3VLBB 1E57A 1O3RA 1RIRA 4PIYA 1Q56A 5LK5A 1KDMA 3T2TA 1TQ5A 1REEA 3GZUC 3PVBB 1MVQA 3VZKA 1YRZA 3WDVA 1OIKA 1QJY1 3FUOA 4WM8A 3WX5A 2KM2A 4E9KA 4WM7C 5L7OC 4YSFA 4RL7A 1HV0A 2E9QA 4FCAA 4LO6B 1LGNA 1LCLA 2R0HA 1GR3A 3ZFGC 3ECQA 4KGGA 3VBOC 2RR12 3IM0A 2GC3A 2ZGMA 1VAMA 2DFCA 4U2AA 3T1MA 1QMJA 1RUD3 1XNDA 4JTOA 1FMD2 2PTMA 5TSWA 4EWAA 2VW0A 4XFGA 1NY71 1LOBA 1FV3A 1DZTA 4ORFA 4M3CF 1WMEA 3B02A 2DCZA 4META 2C5DA 2CWMA 1LENA 1HRV3 1YFUA 2D44A 4COVA 4AI1A 3U0ZA 2A6YA 4DFSA 1AVBA 2NQYA 2A73B 2RS51 4XFHA 4K20A 4DZGA 4UW5A 4YZ3A 3R6SA 5KWRA 1XRUA 4H7LA 4B4QA 1QJU2 1EPWA 4CDXA 3ZN5A 1SBDA 1OFNA 4QXKA 2QZ2A 3IDEA 1YO8A 3AYCA 1CAXB 1C28A 2IZWA 3B93A 2PELA 4DXZA 1BBT3 4M2IA 4R8HA 1XYNA 4R4ZA 3NJZA 3VZOA 3WT3A 2Q1ZB 4EV0A 1GYKA 1HRV1 1SQ4A 1V6LA 2OYZA 4FTBA 3UKNA 1ENRA 5F6LB 2GC2A 4AI2A 5E1RA 2RS53 3C3VA 1R092 5L36A 5JOWA 1WCSA 5AFBA 1PK6A 2UURA 5IUQA 3VBHA 4QPIA 1MACA 1GANA 3QCWA 4QQOA 5T5JA 4H14A 3M4FA 4IQPA 4M0NA 2R062 2WS91 1C4RA 4TZDA 1PGW2 1AYM3 2ENRA 3JD73 3NO8A 4WVWA 5JI9A 2JD4A 4HPKA 2DV9A 3AM2A 3ZFEA 1B35C 2LM3A 2WNVC 4Q4V1 1MQTB 2GN7A 4FPCA 1IS3A 4LTAA 2CYFA 4I09A 4YVSC 3WVJA 2OIIA 1YI7A 5ACA3 1TME1 2EAKA 4KWJA 1NLSA 5A33A 3VBUA 5AC92 5GJ6A 2ZJCA 2IXIA 3WDWA 1LHNA 1G7YA 1GQGA 3H1YA 2PAEA 1Q5OA 2EIGA 2HWD1 3WW4A 4HMZA 3VL9A 3A0NA 1RUE2 1X36A 2WC2A 2G9GA 2IFRA 4FOYA 1V00A 1RUH2 4AFMA 2DCJA 4CEYC 3LB9A 4WM7A 1SACA 5DXDA 4XJAA 4XHBA 4LNVA 4HN0A 2ZACA 3E97A 3MF9A 2RM21 4IEWA 1FOD3 3MW4A 2R1BA 1O5UA 3CO2A 2IWGB 3ILFA 1VBE3 1CAWA 5E8AA 1IZ3A 2ZX0A 2YGMA 1N3PA 2A3XA 1GZWA 1XU1A 1EP0A 1W6QA 3EJKA 2BYVE 3L2YA 3VDDB 1YJKA 2WINB 3H3ZA 3PTYA 2DVBA 4M23A 2QNKA 3LGRA 2HWB1 3D8CA 4UBHA 1W6PA 4PDWA 5CFCC 4YM2A 4FXKB 3WDTA 3U10A 2SLIA 1Q8PA 2WNUB 4N43A 5BNPB 3CEWA 1S0EA 4PJYA 2ZX3A 3T1LA 1OI6A 4KU8A 1VBC1 1Z78A 1RUJ2 3INAA 4MXWA 4OFGA 1KS5A 3NV2A 4XILA 2XB6C 5FOBB 2A6VA 4IXLA 3NVCA 4XXAA 3VL8A 3MDPA 5D8AA 2VXRA 1VIWB 3DV8A 3MFCA 4MSVA 3BB6A 3E5QA 3VHNA 3ZXKA 4AEDB 4BH9A 4N53B 4RS5C 3S6PA 1AYN3 3PNAA 5JPMB 2RJLA 4KG0A 5HXVA 3OYWB 1X7NA 1IOAA 5KXBA 1AXKA 5SV5A 3VBHB 4CDQC 4IEUA 2ZA9A 1TNFA 2N7GA 3BCWA 2CGNA 3FE5A 1WW7A 1NYWA 4AGGA 1UF2C 3LA7A 4DS0A 5LRSA 4YGB