2WA3A

Factor inhibiting hif-1 alpha with 2-(3-hydroxyphenyl)-2-oxoacetic acid
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
335
Chain Sequence
b'EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Structural basis for binding of cyclic 2-oxoglutarate analogues to factor-inhibiting hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 335
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2wa3A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2wa3A01
3P3PA 2XUMA 2Y0IA 4B7KA 1MZEA 2W0XA 3P3NA 1MZFA 3KCYA 1H2MA 2CGNA 2WA3A 4QU2A 4Z2WA 2YDEA 1IZ3A 1H2KA 4JAAA 5JWPA 3D8CA 4AI8A 4Z1VA 2CGOA 4BIOA 2YC0A 1YCIA 1H2LA 3KCXA 4B7EA 4NR1A 1H2NA 3OD4A 2WA4A 2ILMA
chains in the Genus database with same CATH superfamily
4Q2FA 1UYYA 3J7NA 5L19A 1SQVH 4I7ZB 2ZGUA 2YUAA 4BWOA 3KCCA 4X20A 1S55A 1OPMA 4DR7O 2WLJA 3AJZA 2VCCA 3OUFA 5EC2C 1RYYA 5BNPA 2CE4A 1QOTA 4RD7A 2RQ6A 3SCHA 1RUC3 3ZPOA 5BMVA 1AR82 4YNIA 2WNUC 4A5UB 5FZDA 1BMV2 5KC5A 4ZU5A 1GN6A 4FTBA 5BNOC 2W95A 1MS1A 4J42A 2VRZA 4Q4Y1 3IWZA 2ZE6A 2OX0A 3U0ZA 2UUBO 3DEMA 5CFDC 1QXJA 4AAPA 1Q8SA 2VD7A 1GWLA 4TOIA 4X8AA 3CL1A 1KGYA 1D0HA 1G9CA 2FDIA 2J1TA 5DG1A 1CIWA 2BNMA 1QJZA 3TN91 3N9PA 2R073 3TK1A 3RNSA 2VZSA 2K2SA 3O0WA 4QX2A 1KFUL 2RS13 5E16A 2XUMA 1L0NH 4B4PA 5LMNB 1QQP2 4QPGB 1Q5OA 1RUD2 5FPBA 2QKAA 4JI1B 4RN5A 1TMF3 2DQ0A 1B3QA 1I94B 3SPGA 4KWJA 4I9QA 2GMEA 4B1LA 2YROA 4IQPA 1AYM2 5FZCA 1PV0A 2LW7A 4FM1A 4GJZA 1AXKA 2YFZA 1XYOA 5FV3A 5A2QN 3CKHA 4CP0A 2QWOB 4O4IB 2HWF1 3POSA 2D97A 4UCTA 4BPZA 3ZXKA 2GUZB 1S0DA 4COYA 5J2TA 1E5SA 3AP7A 1W6QA 4IEYA 2A6VA 5ERLA 4JQRA 4Z8BA 5LP6A 4HKLA 3ZHRA 1EUUA 2CU5A 2ZNIA 2BV4A 3HKCA 3UNPA 2A3WA 3T1HO 1IGOA 1RUE2 5T3NA 3O1UA 4DK0A 1NTMH 1TEIA 5C4WC 2UXDB 1SBFA 2IXHA 2W5FA 3JCZA 1PGL2 2BOJA 5JR2A 4G9SB 3POIA 3ZXFA 1W8FA 5FPRA 4FOVA 3VL9A 1J3QA 3MI8A 3I2FA 3WNNA 4A4AA 2XMLA 5GZEA 1QVGU 1PZ8A 4ASUG 4XUQA 1RSOB 1HR0B 3O0XA 2R70A 5CVRA 1AB3A 1TME1 3P3PA 1CPNA 4ZXKA 2E74B 4HPKB 1TQ5A 1VMJA 1KS5A 1QNWA 3O1TA 3ABKB 2Q8DA 1C28A 4MGZE 5ISLA 2XOMA 2CY6A 4P02B 2YI8A 2XT9A 4DV5O 3UK9A 1AR72 1RUJ3 2FYUH 2VCMA 1H2GA 4DXZA 1VRBA 2HWC2 4I5SA 2WLIB 5GM0A 3DXUA 2A9HA 4O65A 2ZX2A 1ULCA 5LYJA 3CP1A 1PP9H 3OPWA 4KL1A 3LOIA 4LHLA 3IDAA 2YXLA 2B4KA 1GP4A 4YVSC 3OW2U 4Z2AA 1VQPV 2PQQA 2IXJA 2EIBA 2YPDA 1GQPA 3FUOA 2QR4A 4QPIA 4BQXA 4AHYA 1BHAA 2P5BA 3T1YB 3U4XA 3A0RA 3JD3A 1NE4A 1S2BA 2EILB 1JOJA 3UKMA 2JDUA 3HQRA 4LHSA 5GTHZ 1KP2A 1UPIA 2FMYA 3BEHA 5FZEA 4MXWB 4O4HA 1Z5WA 4LFBO 3WUCA 4CC6A 3MDSA 1W0JG 3TYJA 3MIDA 4I9WA 2WJSA 2NMNA 5A33B 2DCJA 2Q7HA 1XMOB 4HVOA 4OLLA 4YGEA 4O4LA 1GNHA 2YBSA 1HNXB 5C8YA 5IJRA 1ZRIA 3SXWA 1B35A 1TVKA 3I97A 2ZHKA 1VR3A 4K8FA 2JD9A 5FO7B 4XACA 4L11A 4JTCB 2BP6A 2RV9A 4LULA 4X8PA 3ZSLA 2W94A 1NR1A 1WCUA 3VBSA 5FOJB 5KWRA 3RG0A 2UUCB 5CNAA 2M6YA 1EV11 5LGUA 4IDZA 4LMFA 3OGJA 4Q0QA 4IE7A 1B09A 4MVSA 5HCBA 3VQWA 4Q1PA 5L9RA 4CDWB 4QT6A 4XFGA 1N36O 4RUEA 5FJHA 3FWEA 3K0GA 1T5EA 1UMHA 3HKDB 4E8CA 1F5FA 1O7FA 1J95A 1JUIA 3UKVA 5IJ0A 1M57C 1W2AX 1NBMG 3SPIA 3TXSA 1DFQA 3H3ZA 2XL9A 3DPRA 1ZRRA 3X2QB 2HKXA 5J2UA 4I50B 1BSMA 4YJ3B 2XTAA 1W6MB 3H7JA 4GKKB 4IETA 1NT0A 1H2KA 2WZEA 1JR9A 5K1PA 3WG7C 1ZZ7A 1H8EG 4UW6A 2YHJA 3M2MA 4AGVA 1GICA 1H1MA 5L7OB 1LODA 1NUKA 3PTRB 5B1OA 1YQ6A 1HRV2 3WDYA 5F8PA 3HWJA 2GN3A 3AP9A 5T54A 4PD4F 4ZZ5A 2N04A 4OXSA 4YFWA 2RDRA 5ITZA 2CWMA 1SA0B 4XZUG 3IJ4A 1NTZH 1RPRA 5LMUB 2ZIMA 1R73A 5D8AB 1AP5A 4Y4RA 3JARA 3QNEA 2VC9A 3VBOC 3BVOA 3G71V 4XHXA 1JW6A 3UT5A 1KBHA 1SPPB 1XC6A 4DV3B 4W4KA 1UY3A 2MEV1 1ZZ9A 1CX4A 3S3WA 5HCAA 2JS5A 3CU7A 3O5SA 4GYCB 2WIIB 2XONA 4RYDA 1FI2A 3D0JA 3W7WA 3FBMA 4KI5M 4NR1A 4UW3A 2WT2A 2PGGA 4WVMA 1NA1B 1MR5A 2YV8A 1PIV2 3L9DA 4FM2A 1E79G 2OTLV 1PVC1 5SV8A 5LK7B 1V6KA 1OFSA 3SH5A 1T6GC 2IXIA 1Z2GA 3H1HH 1LRHA 5CA0B 3FYIB 1RFYA 4PJYA 3WF4A 5TISZ 4C1WA 3LSQA 4EN0A 1PNFA 3S30A 3FFZA 1S1AA 4BIZA 4X88A 3KHCA 4JKLA 4WM8C 1MS0A 3ZHVA 5C3RA 5DECA 3AG1C 3VD4A 4G27B 4IV3A 3RRDA 2AEYA 5KHJA 1IBMO 3PMSA 2AHZA 1ZVFA 1DLCA 2R062 1TUBB 4IERA 4RHV2 4FFFA 1Q3EA 5T5LA 1YITV 4AVVA 1K97A 2ZGTA 4XBLA 1G9BA 4XFIA 1XU1A 5IT6A 4H44B 1UZYA 4ZKTB 5IVJA 2CGPA 2OZ6A 4CSWA 3KB5A 5A7OA 2XASA 3AX4A 4AVCA 1KD1W 3CJIB 1QLNA 3AMMA 4U3JB 3ZYJB 4LKDA 3AB0A 4G3YC 4LLFA 4LO6B 3T2OA 5IYBO 4UOJA 5JOWA 4ORFA 4CDQC 2BE3A 2MEV3 4BISA 3H1YA 3WDWA 3WF1A 2WNVC 2RR13 3E8GA 4RUFA 1JZ6A 3ZMVA 3FAVA 3CLPA 1BL8A 1DF4A 1GN3A 3CZUA 3GVMA 2Q7GA 4AHCA 4DZGA 2NLJC 4LF4O 3AG4C 1IURA 4TZDA 3IM0A 1Y9GA 4R8HA 4Y1XA 3G6BA 2N05A 4CEYA 3FLTA 1FS0G 2R49A 3H1WA 3C7FA 2EA7A 4Z1MG 5IT9N 3LIGA 2WT1A 5LBQA 4HLTA 1NZIA 1DQ1A 3OMAB 2YC0A 4JZ2A 5APAA 5LA6A 4KQ7A 3K3WA 4OVEA 5JQGB 3VKFC 3VN4A 2P3KA 4GQ7A 4XXAA 1QNYA 4CU8A 4HN1A 2JEMA 2WFF1 5JSPA 2JICA 1OD3A 4MADA 5F2VO 1FPN2 4E2SA 3ZXGA 2Q5ZA 5CEHA 1R1BA 1FV3A 3GHNA 5EBLC 2LRPA 4XFCA 4XABA 1HRI1 2WSVA 4XDLA 2UUAO 4DMIA 2YPJA 1W9WA 1VMFA 2D6PA 4GA9A 4WBNB 3ZFGC 2B9VA 5IK5A 4EE2A 3FB6C 3TRSB 4X20B 3WQ1A 3B01A 1CN1A 4M3CE 5KMGA 1WA4A 2VZUA 3QG5A 1YTFD 2GU9A 5LA2A 3T4ZA 1GZCA 5BMVB 2EIDA 1RUG3 1W9TA 2A71A 2GP5A 5FP3A 2EIEA 3F5TA 4PDRA 2NPIA 1MOFA 3ZN5A 2IU0A 3DUIA 4DUYO 5J36A 4MGIE 4PLNA 4QU1A 2PY5A 4ZZ8A 4BOWA 3AP6A 1VBC1 1HXS2 3VZNA 1RMU2 2ZNJA 3J8F2 4MTGA 4Y22A 2KSDA 3VZLA 1N47A 3NJZA 3MW2A 4GZ9A 4A42A 2A73B 2PELA 1Q56A 5JSOA 3WNMA 3FUQA 5L3EA 4BJ0A 3POFA 1F4AA 1W0PA 1RINA 2ZR3A 3UJQA 4R52A 5B3SC 2WAOA 1AR92 1OQEA 3ZDVA 1C4RA 4FAGA 1POV1 3O1MA 1UWWA 1PMJX 3I54A 1H38A 4PELA 5FP7A 1FNZA 2HWD2 3D5OA 1WMDA 2WFF3 5CZKA 5A6ZA 5H6QA 4FM0A 1PO12 3AG2C 5FIXA 1OCCB 1QOSA 5A9GA 4N53A 1BCXA 1UF2C 4E4DX 3PVNA 2H6BA 4LLOA 3N9OA 1GM8A 1CZTA 3AMPA 2BGOA 4B7EA 4FXGB 4PA3A 4DV0B 4JI2O 2XUEA 4J7JA 2VPVA 2D6MA 4TV8A 4Y33A 5J1XA 1CONA 3CX5F 1V54B 4AQYO 4YVWC 2IFRA 5FXWA 5FY1A 2H0BA 3A7QA 4PF5A 1W6QB 1FXVA 4M4PA 4XFBA 4W4ZA 5LP6B 4I55A 3Q8FA 4FP3A 4NRPA 2QWNB 2YIAA 4WFEA 3HKCB 2HEYF 3P32A 3VKMA 3MF6A 5KX5A 5FY4A 3AZYA 5FPVA 4M3CF 1DGRN 3ACIA 3KF5A 2IJHA 2JG9A 5FZ4A 5F5CA 3AZXA 3I2DA 2HLDG 1H8TA 2YB7A 4QXHA 1XILA 3WB2A 2PN5A 5FP9A 1Y67A 4RQFA 1UOGA 2NYYA 3VDDA 5LCWL 1A34A 3O1RA 4CUGA 3BIWE 1ALYA 1NOVA 4BXSV 2DYRB 2X6CA 1O3SA 3HKBB 2VNVA 3A8TA 1LUVA 3K4DA 3CRQA 2VW1A 1S0EA 5JXIA 2O1QA 1ZAUA 4FFKA 2DCTA 5JOYA 5FZAA 2VW0A 3SGIA 1IG0A 5DUWA 4LF5B 2G38A 3NAPA 1HV0A 3JALA 1ND2C 2FCVA 5IK7A 1FYJA 4FLZA 2AEZA 1FAFA 4CP1A 2VG9A 5DDJ2 2V4AA 1LAJA 1POV3 1GANA 5FYMA 2EINC 5KA5A 3OR7C 3AKSA 4ZHQB 4P5YA 2QM8A 5JMOA 5B1BC 2LP7A 4AZZA 1WBLA 2BEOA 1XUQA 4Q4W3 1CR7A 3BUCA 4COZA 3UO3A 1S5LZ 4FT8A 4NAMA 4LFAO 2GH8A 1R1ZA 2UU9O 4YXWG 5GLVA 3O7OA 3OBAA 2WRAA 2Z3YA 3R05A 3SEPA 2WA3A 1Q6IA 1YO8A 1GRJA 3OYWA 4GX5A 5K7PA 3BKZA 1JA8A 1FMD2 3B5LB 3L74H 4X66O 4WVZA 1PVXA 4XAAA 5LY1A 3KGZA 3H8XA 2QBXA 3GWOA 5C8YB 3B9CA 1B35B 3ECQA 1R091 1TVKB 2VZQA 4X6RB 1WP8A 5LW9A 5CB4A 2HWE3 4LIVA 3ES1A 1R6NA 5FYYA 3E22B 3MEPA 2QUOA 5JJNB 3RYKA 1OLRA 5AC92 3ZXJA 1GOGA 4JV5O 4CP9B 4KHPB 1UOFA 1MS5A 2D6KA 2XR4A 4MLOA 4QU2A 1XRUA 1MVEA 1E1QG 1M06G 4UVBA 2RS53 2XBO2 3KQRA 2WZR2 2X05A 4N43A 1YIJV 4B3SB 1XNTA 2ZGOA 5LRRA 1ENQA 2Z79A 3VBUC 2BNNA 2CYFA 3CB2A 1QXPA 2K9PA 2ZXWC 2FHRA 4FXKB 5KHHA 3K5LA 3WB0A 2A6ZA 5HV0A 5IJ0B 5EJ3A 1CIYA 4YW3A 3IKWA 4FFIA 2ZEWA 4BQ3A 3DPRB 3C90A 5J2UB 2ZXQA 4P9GA 1WPXA 4JKKA 1JFFA 3AVSA 1TZOA 3Q8BA 4NUBA 4BXFA 5HXMA 3WT3A 1SFYA 5K8SA 3ZYGA 5F9TA 2DYSC 4Y4YA 2JDZA 2JX9A 2X5IA 4YM3A 3EXUA 4BMEA 2GAUA 1AZDA 2DCZA 2J1AA 1OUSA 3W58A 3K2OA 1QH7A 5I0DA 1PO22 3Q9OA 4HSLA 2A3YA 5ITZB 4A7YA 2GC0A 1LOAA 5I0RA 2R9AA 4Y1VA 1CAUA 2GTSA 5T5PA 1UAIA 2HHHO 4I3PA 3ZRWA 1LR5A 5J37A 5DG2A 4ES9A 4RQPC 4QGLA 4RS5A 3HNBM 4K0KB 5D21A 3CXHF 1H9WA 1WP7A 4MVRA 1W0OA 1W8WA 2JEXA 5CG9A 1GNZA 5GZFA 4R6ZA 4WZFA 4Y1UA 3PMEA 3GCWA 5LWBA 1QJX3 4NHLA 2E5LO 4FJCC 1BBT1 4BE3A 4A41A 1KJLA 4NOTA 4UI9L 1OSGA 2EIJC 2ZGPA 4WM7B 4CU7A 4DXTA 5BR8B 3SPCA 3MO4A 1OQ1A 2PQSA 3AKQA 2PFWA 3BOWA 4SBVA 2VXJA 2ARHA 3OF1A 3J7LA 2RDQA 3I2HA 1OXCA 1S0BA 4QDRA 3K06A 3P6BA 3FC0A 1HNZO 1M56C 2NR5A 4XQ4A 1C8M1 3T2TA 1DCSA 4DR4B 4IV3B 3CPWU 3L2YA 1FXHA 2E9QA 1ND3C 1BEV1 1ZM1A 3E8HA 1LR1A 4FOQA 2FDHA 4COUA 2HR3A 2EXIA 3IPVA 4D69A 1SZTA 1GN4A 3F5WC 1MG1A 5FPOA 1GQHA 2QQNA 4DUZO 2E51A 4JHTA 1OJHA 4XJWA 3JBG3 2ADEA 5EIBC 1IPSA 1VEWA 1Q8OA 4LBMA 1FXZA 3KSCA 2IJIA 1RHI2 4XC9A 3ZX6A 2YGLA 2RJKA 1D4M3 2RDCA 4BIFA 4E2QA 3CO2A 3RN4A 5CAZA 3AFGA 4NVPA 5IVFA 1Q86W 2Q8VA 2KG7B 2KKWA 1AL0G 4L92A 3ABMC 2Y64A 5IK4A 3JASA 2ENRA 2E31A 2BCCH 4U36A 3OJBA 5FMOS 1EUTA 2ZD9A 2LGQA 1ZBA2 3WF3A 3WW3A 2H94A 1VQ6V 1ODMA 2GDFA 4EV0A 2VMEA 4GMP0 1WLWA 1U96A 4LE4A 1POQA 1G86A 2A1XA 1L3JA 1XNQB 3KHBA 4NMIA 3RZMA 1K12A 4CEYB 3AXDA 1JODA 1WBFA 2ETEA 2JDPA 1RM1B 2DTWA 3EJKA 4OUEA 1SG3A 2QWPB 1I5XA 5LA6B 2AZ5A 3JSNA 3CRCA 2QA4V 1MABG 1NKGA 2PHLA 1CAXA 5FUPA 2ZE8A 2DWEC 1AROP 3K51A 1DG6A 5HCHA 1KB9F 4RGKA 2P37A 2NZ9A 4P9YA 3VKLA 1AVBA 5CBHA 2CTPA 1MZ6A 2BOIA 4IGOA 3SHRA 3D36C 1NY72 3C8XA 3E6CC 1NXD1 4QIWF 2MW2B 1VP7A 1AR83 4K9SA 5T5JA 3SYAA 2YYOA 5FQ0A 1OCZB 4YHHO 4H33A 1YI2V 2WDBA 3I3QA 5JIAA 1E5HA 4QKFA 1F7YA 5KMGB 3T0DA 1F4MA 3DYOA 4BQWA 4GKXA 4MVMA 2BW8A 1IXMA 2ZEYA 5C8CC 2KM2A 1DF5A 4FI9A 2DOSA 3ZIAG 1K8AW 5C33A 1BHGA 4M00A 3MLJA 5FMOL 1GKFA 4YZ5A 5JZGB 1OCOC 4QKNA 3TGUH 3FLPA 2EZOA 1PMHX 1GN2A 5K1XA 3MPBA 5A6XA 3PU3A 4HETA 5BXZA 5FREA 3MUY1 1ZNPA 3BOPA 3HPNA 1QQP3 4JYCA 5IUQA 2A06H 3VUOA 2HVJC 2D98A 3WEZA 3U37A 3DKWA 2ILMA 1RUD3 5F32A 2XJPA 1F35A 5F5IA 1BQPA 3ORJA 2R32A 4AVAA 4KGGA 1OFNA 2NLRA 1AYM3 1YJLA 3J9SA 3N2GA 2WO2A 2IXCA 1S5HC 3EVKA 2B45X 3AG3B 5FY0A 3H9AA 1ZL8B 5ACA2 1GOFA 4QKBA 2R6QA 2FZ1A 3NNLA 2VQFO 3SQOA 5E89A 1LOFC 2GSMB 3TWIA 4MSWC 1RUE3 3CMEV 3URFA 2ZACA 2BBAA 4YM0A 4JI4O 1L0LH 4LOSA 4YVSA 3F95A 5JUVA 4LCUC 4UVAA 3ZR6A 3ZFFC 4RFT0 2BFUS 4TV8B 4X1YB 1GLHA 4R4ZA 4RFRB 1FFXA 3G4SV 3IDEA 4QPYA 1WNSA 5C71A 1CWPA 1LOEA 4HKOA 1Y7BA 2UXCO 4I55B 2DF7A 1HLCA 2IZWA 1H2MA 1LHNA 5E88A 5BZBA 3J80N 2R7EB 3N36A 2DCYA 4JI6O 4RGAA 1MSWD 3JATB 1U97A 4R9DA 1GTOA 5KX5B 1UJWB 4OUSA 3D3IA 3AK3A 1SBEA 3Q8AA 3HT2A 4CA9A 3AYDA 1ZX5A 5FR3A 1Y4WA 3KV5A 1BT8A 4IIJB 4D8MA 1H8TB 1XNCA 2VVDA 1W06A 3KD4A 3AP5A 2D3SA 3RMXA 3VDDB 2Q9LA 3H1JH 5GALA 2XKPA 1M9NA 1AR73 2HWC3 2E76B 1REDA 4DW1A 4X64B 2XGXA 3FHIB 2F95B 4JI7B 3RVZA 3H8UA 3JD4A 3M7AA 3RSJA 5CISA 1DYPA 1QDOA 1E5RA 1OLQA 4KWUA 2ZAAA 3BALA 1NH2D 4NROA 4UFZA 2BTVC 4QE7A 3ZFEC 5TSWA 2HJFC 2JG8C 5J9PC 1U12A 3I2IA 4R9AA 4LF8O 4ABMA 5FNVA 1XEQA 3NAPB 4WV8A 3C3SA 2OTJV 5DEDA 2WNEA 3JALB 2WAMA 2Z69A 4AYUA 4JRAA 4QQLA 1VRH2 1DZRA 1ZUQA 4LA2A 5EIYB 3QOPA 1Q43A 4GZRB 2VJXA 3STLC 2PI5A 1OOPC 4XTPA 4YIOA 2YEVA 4IEZA 1FXKC 3MV01 3NJVA 4MYEA 5JWPA 5A3OA 4NKGB 1PD3A 4HK9A 4XUPA 2Y38A 4DB5A 2BFUL 3TETA 3ZYIB 4B1MA 4AFBA 1ODNA 4DV2B 3VDAA 4BDVB 5C8WA 4LBQA 4NXNB 1ULOA 3IDBB 1UZ0A 3BCWA 4QPKA 5A7NA 3ZM8A 3EHKA 2RNBA 1SFNA 2WBKA 2EXHA 4DPNA 1W6PB 3F7VC 2W1WA 1CJPA 1DYKA 5FY5A 4W4LA 4JQTA 1IXBA 4BHPA 1JTZX 3IAQA 4HOOA 3FJSA 1N8RW 1VQ4V 4E4EA 4CCDA 4CCOA 1CD3G 1Q90D 5H9PA 1VF7A 4ARXA 2W52A 4AFMA 1SRYA 3KKYA 3ZYFA 1BK0A 2VQUA 3OB8A 3T08A 4GLXA 5CB4B 1ST8A 4OHZA 5EFUA 5D1IA 2ZX3A 1D2SA 2VUDA 3SYCA 4EYUA 4IHJA 2RN9A 4RAIA 2ATKC 1F8VA 4A6OA 4XW3A 4N43B 1MS4A 3OUJA 4M4RA 1HDKA 1FNYA 5LBEA 3ZN0A 4E2GA 4PLOA 3WB1A 3MUZ1 2ARXA 4DRXA 4DV7B 2QQWA 2HEWF 4ZU4A 2F4LA 2ERFA 4K6BA 1VJ2A 3MF9A 1H6XA 3WZ1A 1HRV3 2B7YA 1RUH1 4P5HA 3NL1A 2GMPA 4O9EA 4Q0UA 3ZYBA 4CDUC 1WD3A 1JFFB 2W6IG 3ZN4A 2VOTA 2WPDG 3SPJA 1SQQH 3QH6A 4AI1A 5GLUA 3ATGA 4HBNA 1Y76A 3IN9A 4FFGA 1ZREA 1WAZA 1YSCA 1RUI2 2OXBA 1F4NA 4BB3A 2YIDA 1BK1A 4B3TB 3RZHA 4G2KA 3H50A 2XVKA 3KVBA 1QKQA 1AL22 2X5IB 3PTYA 3IC9A 2BOCC 5E79Z 3ZYRA 3TXQA 4D3WA 1T2XA 2J1VA 3OGRA 1EPWA 4PQQA 1XOUA 2VQEB 2Y0PA 3H8RA 2UYAA 2GDSA 4UFIA 5CG8A 3BA9A 1GBGA 1OT5A 5FZ3A 3E1F1 1W3XA 3VHOA 3WP5A 1AR62 5LATA 4I01A 1PIV3 1VMGA 3WP6A 1WN7A 4JI0O 4QHBA 4NIAA 3H1KH 3ZRWB 5BNNB 5LGNA 2D6NA 3E2EA 4FVVA 4IE0A 2ZIOA 4C0BA 4CCKA 4PI0A 2P6HA 4CXXA 3APBA 2IWGB 3P5BA 5DAQA 3D0SA 4K3UA 1Y9MA 2JD4A 5FUNA 3WQ7A 1G7YA 5CBLA 3RI8A 4EFEA 4JI5O 5JH7A 2JIGA 3ZMUA 3VQXA 4BIUA 5DAPA 1QJU2 1XNKA 4GMP3 4RHV3 4IYHA 4FZ1A 2R16A 1FYUA 4UAPA 4LBQD 5T52A 4QPGC 2IVJA 2YIBA 2JDNA 4GWIA 4N9HA 3WDVA 3B4SA 3FZ3A 3KVAA 2UU9B 2WYSA 4XJAA 1QU0A 2YC2A 3TNPB 3ALQA 3VHRA 3NKTA 4MGQA 3GJAA 4ATEA 5GZDA 2XJSA 4G28B 3IPVB 3ZHQA 4MW3A 4INDA 2WLQA 3W20A 3OG2A 1XNBA 3RYHA 1JH5A 3WHUA 3VBUB 1P7GA 3T1LA 1H30A 1I0HA 2Z4FA 4AGGA 1AF9A 2Z0AA 3B8NA 2JVDA 1OD5A 2A3XA 2E7AA 3ZFGA 2DVAA 2XQXA 2O57A 4XAEA 3MHSC 4FPEA 4JV5B 4MUVA 1W28A 2XJUA 2DCKA 2Z42A 4AGRA 1EAH1 4B3MB 4EB6A 2DJVA 5FZ1A 4JAUA 4XIKA 2VOKA 3JASB 2V72A 4DNYA 3I4IA 1QWRA 4YG3A 2GC2A 2YXHA 2ZTNA 5J7MA 2F4VO 2OS2A 1XSRA 4WFFA 5FP4A 3D6EA 3M3CA 1QCEA 2OCHA 3ABKC 4QX5A 3NR7A 4D6RA 1YVWA 3CCLV 3SEEA 4UCOA 3LPFA 4DY5A 4Y3OA 1IZ3A 4KG0A 1W8TA 2ADDA 3JUUA 3CCSV 5IVYA 4LTAA 1QJY2 3SMHA 3JCIA 1X7NA 2Q8CA 2RMU1 2JDYA 3O9OA 1CAXB 4FFBA 3E35A 4TT3G 5EBMC 2XQRA 4LA3A 2OZJA 4GT1A 1A3KA 2EILC 1NH2B 3UQ8A 2P2KA 3IBMA 1CAWA 3LE0A 3CZJA 1IPKA 2BGCA 4META 1M1KW 1MEC1 4LBEC 1WCQA 1GOHA 5HCFA 1WKYA 5I8TA 2W2IA 3U07A 3I49A 4IESA 1HXS3 1RMU3 2RS32 2VTXA 3J8F3 4M0HA 3PJSK 4FLUA 3W7TA 1W8NA 2BJSA 2F17A 1FKAO 4XIOA 3MFAA 4YY3O 5A3PA 3LDRA 3THOA 2DBNA 3AL5A 4TWTA 2W39A 4DS0A 4IEXA 1EAH3 1WZXA 4R50A 2XAGA 1DZTA 2B9UA 2YIBD 1GZTA 2VTXJ 3ETQA 1TVGA 2DDUA 2IH3C 5LOVB 1AR93 4OI4A 2YG0A 1VQMV 3SISA 1JJOA 3MICA 3I5DA 3ICXA 4CDWC 2VCBA 1Q8IA 2KD7A 2JDAA 4FPJA 1V55B 1PO13 5FP8A 3WCSA 4MGKE 4Q29A 4LKFA 4QAWA 3H7YA 3VBFA 1UMIA 4RWUA 3AFKA 3X2QC 1ZWIC 2X6BA 5KXEA 2K1EA 2W0FC 4QNHB 4LF9O 4WVWA 1FOD2 3WNOA 2Y60A 4N23A 1XBFA 2AENA 2PLV1 1ND2A 1TGOA 5A7QA 1PL0A 1RIRA 2ZS6B 5L7OC 5CYYA 2QFEA 3UJOA 4NIGA 1V9U2 2F4PA 2ZKOA 2EULA 1QDCA 5EYPB 1JYIA 1B04A 5DZEA 3DYMA 3EYPA 4HZFA 1K92A 2PA7A 2E7TA 1MEC3 4R9CA 3JXSA 3R6SA 5D8AC 4O2BA 1E57A 1AYN1 1IDSA 3HN1A 3SCFA 4Q8LA 3CCRV 2AC1A 3KQ4B 3ZMOA 4NTYA 4XF9A 1AXYA 1ZBE2 3CQOA 3WDTA 5EQUA 3ZPYA 2IVIB 2Y69B 1W2TA 2ZGSA 3HMYA 1XYPA 1YJNV 2ZMKA 1LEMA 3R4SA 1IHMA 3CRMA 2P3JA 2VNGA 2A79B 4KXRA 2PHRA 1CJDA 4DR6B 1Z7S1 5I0TA 1VQOV 4KU8A 4O2AA 4CE8A 4H0LB 3N2KA 1C1FA 2ZHLA 1VBA1 2WLKA 4OHYA 3DECA 5DDJ3 2XWBB 2BWCA 4KG8A 4DINB 2VOWA 4N7UA 4JTDB 3LB9A 2WQ8A 1OA2A 1O5LA 1XU2A 1N32B 3I3MA 1KRIA 4JYAB 3JAKB 1OZ0A 3RYFA 1TG7A 5FNVB 3A4UA 1BLZA 3GZAA 1ULPA 3L70H 3NNFA 4LORA 5CIRA 1OF4A 4GWNA 4UBHA 1GZWA 4TSFG 5LASA 3JQWA 4XF3A 2HWB2 4XPVA 3OMNB 1R1A2 4YG6A 5EZWA 4CUBA 1LUWA 1YCIA 1RB8G 3KCXA 5FYTA 4JTOA 4NYKA 1SQGA 4YHHB 4E8DA 5F3EA 1O5UA 1FMD3 1ASJ2 4LXLA 4OX9O 1XB9A 4GB31 2PAMA 3QLQA 4BLIA 3ACGA 1LHOA 3E8BA 4DV4O 3ENRA 1UCXA 5HBAA 4AVTA 4DR1O 3MW3A 4LPLA 3CJIC 4LHNA 1YI7A 2WS92 1XNRO 3VD7A 5A1AA 2IH1C 4FLYA 5C7GA 3RZKA 4JGYB 4XBNA 3SJQC 3GBGA 4EWAA 4BH9A 5AC93 4A3ZA 1TAEA 4Q0VA 3WVJA 2D2CB 3TJTA 3CCQV 4TQFA 3THPA 1AYN3 3VHNA 2WZR3 3MW4A 2DFBA 1RUF1 2I74A 1K5SA 4CH6A 1FPOA 4AILC 1F15A 1EM1A 3F2ZA 3B8MA 1VQNV 3WSOA 4TUYB 2VQ0A 5D5PA 4DR2B 4SLIA 1KC8W 1COV1 1O6UA 3KV4A 1SC5B 4RQPA 2BERA 4IV1A 5FZ0A 4CXWA 4IHJB 3ACLA 1GQGA 2C9KA 3BAAA 5A80A 4J80A 1VBA3 3IB3A 4QGMA 4XUNA 3ZSJA 2G1MA 2NP0A 3OMIB 2EIMB 3UKNA 2IXLA 3RBZA 3T30A 4AVBA 4NN0A 1XREA 4HG6B 4S2HA 4U3FH 3POGA 5BPXA 1UL9A 4C8DA 5FY9A 4QGPA 1ZZBA 1ORQC 4CH4A 2PI4A 1DGWX 4AL9A 4EZHA 3AL6A 5HI0A 4KH9A 4XMIA 1PO23 1VBD2 2ZDIC 4P9JA 1YIPA 5JXJA 1MQTA 1PNMA 2DYCA 3OUIA 1J84A 5I91A 1CAVA 3H8OA 4AQ6A 3BB6A 5LA9A 4JI6B 4A6SA 3ZR5A 2N7GA 4GB33 3MYXA 1SMVA 1WLDA 3A2FA 1YNAA 2JJ2G 4OFGA 4A3XA 2FD8A 2N74A 4EWEA 2V1DA 2V7QG 2GC1A 4YSFA 3N9QA 1ZLZA 3ASNB 3JAWA 2D3RA 3NV1A 2CWSA 4Y26A 1RC6A 2D3OW 2XJVA 1LGCA 3CWBH 2AW9A 2I07B 3M3IA 4CDXA 1QY4A 1RXFA 3FX7A 3BU7A 1RVF1 5FKCA 2C24A 2O0OA 1PGSA 2W46A 3LIHA 4JDOA 3ZKYA 5AVPA 2VNOA 3ZBHA 1HQNA 1K5MA 4ZXEA 2JDHA 1LHUA 4QPWA 3A22A 4PDVA 1VP6A 3B2EE 2E26A 3HT1A 3UT0A 4LF7O 5EC1C 4YG0A 3UKTA 1UNBA 1ZZCA 5JH7B 2Q73A 2EICA 3LPGA 1UZZA 2ID4A 4XOGA 2OT5A 4L99A 2SBAA 4FLWA 4D7YA 1QHDA 3W7UA 1RUC1 2WLLA 4QX1A 2YDEA 3CMGA 1H2SB 1NQTA 5FZGA 1RTVA 3QO7A 3K04A 2ODMA 1SQXH 1SHWB 5A32B 1J58A 3J4UH 4DXRA 4JTNA 1AJPA 1J5EO 3MZHA 4Q4Y2 4NRQA 4DYLA 4KBBA 3HR0A 1OCCC 1RHI3 1L7QA 1W8HA 3RJRA 4YPJA 3ZO0B 4YGBA 1IOAA 4ZU7A 3RVYA 1W2NA 3ZXLA 2I2SA 3A0BZ 1V54C 5IE9A 3UO2A 2UXBO 1W90A 2ZGKA 2R071 3HPLC 3TN92 2JEUA 3RYHB 5LP6C 2F1MA 4LBJA 2RS11 3WX5A 2JS3A 2BPA2 3JD1A 4F8AA 2X6AA 4PJ0Z 1ZBA3 1CZVA 1Z5VA 2VZPA 2BQPA 3LFIA 2DURA 2A7WA 2WZ8A 4X65B 1UQXA 1TMF1 5C3QA 2QWRB 3AMNA 1KITA 2WWJA 2EIKB 3WNPA 1EZJA 5IFPA 5L3DA 1RVF3 3BTZA 3OGSA 5KXDA 1BS3A 3WR0A 4MO3M 2G9ZA 2DYRC 5IWAB 3STZC 4Q4V2 3ASIA 1U5YA 2OIGA 2HWF2 2IXKA 5IVEA 1NU1H 3I59B 3LEKA 1A32A 1SERA 2VW2A 3FHAA 2ZM6O 3TEYA 2O8OA 1N4CA 4FAHA 1M4UA 2EALA 3SNMA 1XPWA 5A6QA 3QF7A 1SDDB 3MGUA 1JVMA 2CAVA 1Y66A 4P9PA 4XEZA 3MFCA 3CCMV 1HDJA 2H8PC 2B9ZA 2XVLA 2R1BA 1IBLB 2YUEA 3DXRA 3J7AU 4BIOA 4OI2A 4LO5B 3BN6A 2LW1A 1JHNA 3O1PA 2VS0A 1YWKA 2IUWA 2FTKA 3GWKC 2R0FA 2YMZA 5I8SA 1W6OA 3KZIZ 3I3BA 2HYXA 1TME2 5FZIA 5FYCA 4DR5O 3HR9A 4IE5A 1JZ8A 1W05A 3MV11 1LOFA 3OEBA 3WD5A 2OT7A 3QTCA 4ISRA 2CDPA 4JI0B 3T4HB 2ZR2A 3IFXA 4BK5A 1J83A 2BTOA 1C8NA 1RUJ1 1Y6XA 3K46A 2FMDA 3JQXA 1N34O 2CDOA 3AYEA 4M3CA 3G67A 3CCUV 2CH7A 1PHMA 1V6NA 1VF6C 3HNMA 1F2NA 4FPKA 2QE3A 3I8TA 2VBDA 3ZMSA 2VMGA 1B35C 1O8SA 3NJYA 4YZ4A 1KQRA 2Y4UA 3LEGA 3WV6A 2ZZJA 2QDOA 2HYKA 4XBFA 4CYDA 2X7RB 1F5JA 4EROA 3FD9A 3ABZA 1XJAA 5DAWA 4TN7A 5EZYA 4Y1ZA 1DLLA 5L73A 2ZMNA 4GX0A 1V6OA 5ACA3 3M3QA 4XETA 4Y20A 1H2NA 4IEPA 4ONUA 1JZ2A 3USSA 2XAQA 3MAQA 4EEQA 5ANQA 4GKJB 4AQ2A 2K46A 1KEXA 3WHTA 3OE7G 1UMZA 1W2UA 4GWJA 5H9CA 3U1XA 3J7HA 1MPXA 4CBCA 5FPLA 3VBFB 5D2AA 3GCXA 3AP4A 1KMIZ 3DPRC 2OQ7A 3BIEA 2QTOA 4ZPIA 2B1GA 5FZ8A 3CS5A 5IHRA 3UL2A 2BZDA 4YGDA 1YF2A 2CK3G 5J98B 3WG2A 1CP9A 1HJGA 3CHXA 4W6XA 3ABUA 3RYIA 3GF6A 3RVHA 2CTRA 1EV12 4ASMB 4QX8A 2ZPXA 1YHQV 3PLQA 4AF9A 5IVVA 4X1KB 4MZUA 4IT5A 1XXNA 2R0HA 4P14A 2D5FA 1AJKA 1FJGB 1DP0A 5CKNA 1W03A 3UCSC 4JDMA 3P1IA 1JPXA 3POEA 4LBLA 3PVEA 1PX4A 1XNAA 3EQEA 5LBFA 5LMNO 1N1TA 1V6IA 3NNJA 2OA2A 4PHZA 3GBWA 4YIPA 1Q8VA 4XQWA 4JI1O 3ZRVA 1QOOA 1I08A 1JS9A 3VD5A 3N7LA 2VOXA 3A23A 5C70A 2VZVA 2F23A 3ZCCA 5A3MA 1BGYH 3E86A 5FBJA 1THZA 1HB1A 2F66C 2E33A 4QQHA 5KHIA 5FXZA 3M1HA 3OTOB 1M5IA 3J26N 2BTQA 3CXCU 4ZIBA 1W6NA 2O8QA 1CPMA 5M0TA 2W1SA 1X50A 5JCOA 1MS8A 3H3LA 3E6BA 4U2AA 4ZI7A 3JB8A 4FVMA 4O2AB 2W0XA 4JHZA 3P3NA 1VRH3 1QJEA 3N2KB 1QJFA 2VGDA 1QQCA 4CUCA 3HKEB 2UXDO 5IYZA 5DZFA 3OGGA 4WM7C 3WG4A 1YC61 1Q8QA 2HJDA 1KP3A 4Q1RA 1NG0A 4CXYA 1XSQA 4DR3B 2VVEA 5FMBA 4PDWA 4OI1A 3ZDSA 4DQAA 3N7KA 4UCUA 5DAVA 2MEV2 1HR0O 2WAAA 2CGOA 2DQ3A 3K79A 1PK6A 4KWLA 5GW7A 5KA6A 1IBKB 4IV3C 1D4VB 4W65A 3I2KA 1GZWB 1ULGA 4ET7A 3KCYA 3SJBC 2R9RB 1G8MA 1OH4A 2Q1ZB 2SLIA 1JQ0A 4N9IA 4CDUA 5CMUA 4X9QA 3EHBB 1OKQA 1OC1A 1PVC2 1OVPA 4L0PA 1YIFA 3WQ0A 3ZIWA 4YY3B 2OKXA 3IIIA 1YI9A 1REFA 1IS3A 1NI8A 4J7KA 2VTFA 5JVDB 1OV9A 2ORXA 5B2GB 4EN7B 3AM2A 2W91A 2C0ZA 1NQDA 5GONB 1A78A 3GZUC 5J48A 5LL6Y 3T1YO 3LSDA 4E4SA 4AEDA 2C5DA 4ZKIA 4C0HA 3WDXA 2DVDA 1O8PA 4OHXA 3ZEDA 2LO1A 4FOWA 4LT5A 1BE3H 3GNEA 5BV6A 4AFDA 2QQJA 1S5JA 3CF6E 4IV1B 5IYYA 2YXYA 2H6CA 4LBOA 3U10A 3T2MA 1XMOO 4OUMA 2C9AA 4CEYC 3SPHA 3QO8A 4JGZB 4UCSA 1D5NA 1JZ7A 4BLJA 4EZ4A 2JE8A 1DQ0A 4BQYA 1HNXO 2OQ6A 1VBB1 4WZCA 2QGNA 1OHHG 4AI0A 1RM1C 1CEZA 1RUI3 2GNDA 3DV8A 1K3EA 2HP8A 1LECA 4BR6A 3FLRA 1QXRA 1DGSA 3ELNA 1AL23 1JYXA 2UUCO 1MZEA 3AK1A 2PHXA 5CFCB 2RR11 1R3JC 1S2KA 4BW5A 2ORZA 3DXTA 4NHYA 3QO5A 4XFAA 1Q81W 4Z1VA 4QPGA 2JGDA 1XE0A 4OHVA 1MQTB 1DQ5A 2QQKA 4I0XA 4Z82A 5KR7A 1JU3A 2WLNA 1AR63 1CAVB 1IKPA 2ZGLA 4ASLA 1OCZC 3HAGA 4DRVA 1D5AA 3N35A 1KKDA 3HVDA 4KBZA 2OPWA 4H2AA 2UWAA 4GKKO 4F6RA 2UURA 3VBHB 5CKMA 1JYNA 4Z2WA 1AVMA 2GC3A 4FFHA 5F39A 2J1EA 1AX1A 4CDXB 4XHBA 2D5HA 1SACA 4FPHA 5FPXA 5AFEA 4JC1A 5JZGC 2HFEC 5L3FA 3HBZA 1QJU3 1H8HG 5K0UA 2VO5A 1K5MB 1ZRDA 1HRI2 2HKOA 2LQTA 3K5MA 1IKQA 5KLVH 4BU2A 2VNRA 3VLBB 1QEXA 2A70A 4XVHA 3K4ZA 5LMUO 5FY8A 4XF4A 4X89A 5JCTA 1NVPD 3N3HA 3UV9A 1AI4A 2LUWA 4OQ9A 3SKJE 5FYUA 2VZTA 4DV3O 5H2FZ 3ZMZA 1XI1A 4D6QA 1VBB3 3AG3C 3K58A 4E9KA 1ZSPA 1RUG1 5FXXA 1SDWA 4OX9B 4KGQA 4LIUA 4Q5OA 5EP9A 2ZQMA 4HXCA 4JDNA 3B7MA 1O3RA 1SS3A 4QWNA 4DR1B 2ZKNA 4J7ZA 3W7SA 4KWKA 2BBVA 3CYOA 1VBC2 3M70A 4RR3A 1Y74B 5H5NA 2Y6FA 1ENXA 4R4XA 4NPMA 3PN1A 3D4KA 4TXWA 1QNMA 3N4MA 1LGBA 2D6OX 5KC6A 3WG1A 3V56A 4XDKA 3WCRA 3CEWA 4DY3A 4JI3B 3C7GA 3RGBA 3Q4HB 4MVTA 4CCLA 1NTKH 3ETPA 2LJ2A 5FLHA 4RQEA 1QR9A 4CEWB 4AI3A 1MMMA 3LNMB 5FZBA 3FKSG 4NRMA 2QVSB 2Q7EA 1H8TC 4QE9A 3MBWA 4E4HA 4GH4B 4Q27A 4E4ZA 4Y5TA 1U5XA 3OBRA 1PL4A 2WA4A 3VDDC 4HNAB 3PVBB 3VBRA 1BQZA 3K5OA 2VZOA 1G1XB 2HLEA 1QJY3 4IL6Z 4OPHA 4Q4X1 4FTEA 1XQNA 2WWSA 4J6GA 4ICGA 4PA6A 4GCZA 4XFHA 4NXMB 1NE6A 1PNGA 2YGMA 5BYNA 3USUA 5JOZA 3BTYA 2FKXA 1REEA 4QX7A 3OUSA 1XMQB 2AUYA 3NAPC 5BNPB 2A7AA 2OIEA 4IEVA 4CDWA 1I5YA 5CADA 2JKXA 2DUQA 4GJYA 1JZ3A 4TSVA 1LESA 3DXRB 4PDLA 2R9IA 3NMBA 4CU9A 4TLGA 5EHDA 3NVCA 2PUSA 4MS2A 4D94A 5KAIZ 5F3CA 4FLVA 1BQ0A 2OW4A 2XWJB 4YW6A 4ISQA 1DQ4A 3EO6A 2RS33 4LQRA 4AWDA 3FL7A 1R081 3SITA 4E2LA 2YSUB 2BVBA 1SBDA 2CHHA 4B8EA 4KNCA 3W5MA 3MIGA 1JCHA 2Q68A 5H9RA 5ANNA 3WW2A 4M3CB 1HNWB 2CH7B 2ZCEA 4PA9A 3E5UA 2R041 1SCSA 1XNDA 4H13B 3RT3C 1JN2P 1YFXA 4XILA 4QQ2A 5D8AA 4GIQA 4QM8A 4FLTA 1W8UA 2X8KA 2VWJA 4AEJA 1PM9A 4K8ZA 4AR2A 4P9LA 1UIKA 3LSUA 4AHXA 2CV6A 2LGWA 1YQ2A 4Q4W1 3K0DA 1LULA 5CKQA 4FOYA 3KG2A 3ZSEA 2Y6JA 3OD0A 1SF9A 1WB7A 1X9TA 4Q4X3 3F7YC 5J2TB 1QH6A 4N43C 3NO8A 1SFPA 4X62O 5LZ6A 5EWSA 3VOUA 1NA1A 2RM21 2LALA 1AILA 3CJHA 2HJIA 2ET1A 4XUTA 4I0WB 3SDLA 4JCKA 4UYBA 3EMRA 5L9VA 3HB3B 1UYXA 1YYNA 1V9U3 4EFBA 2V5YA 1R092 4CUAA 5FPAA 2ZHMA 2HWE1 1W9YA 3CDZB 2P6JA 2KXLA 4AHWA 1US6A 1SZXA 3RYIB 2ZA9A 1BKZA 3KT1A 4BQ1A 2RS51 4NAOA 3S0MA 1AR4A 2X5IC 5BY1A 4D6TH 1PX3A 1N33B 1IX9A 4UFHA 1TUBA 1S0GA 1M4WA 4AHZA 4MTOA 1R083 3AZWA 2C26A 3WOGA 2XVGA 2EBOA 3FB7C 2X0LA 2WO3A 2CSGA 1RJ8A 2QQIA 4CZSA 3IT8A 3N9NA 2XOKG 5FBZA 1N1SA 2BNOA 5BNNC 5E1AC 5LYJB 1OVSA 2R043 4U3JA 4H55A 2D43A 3C7EA 5IW0A 3LAGA 3HBKA 3RWNA 3WF2A 4XYXA 1V0AA 3OD4A 4URAA 4DR7B 4P08A 1ENRA 4QPIB 2NQYA 3FBYA 1W6NB 3DGTA 1NCQA 3T3YA 2FDKA 1HB3A 3PIJA 2X53S 2Y6HA 4ZI7B 1EP0A 4XFFA 4TYSA 3ZHTA 1WMXA 4QXCA 4O4HB 3HD8B 2Q5TA 1G9AA 2GTAA 4CPBA 2HWB3 5ABJA 3ME2A 1R1A3 3WY6A 1NCRA 2RM23 2UUBB 1K33A 4DV1O 4LO8A 1ASJ3 3HEIA 3ZX7A 3DL3A 2AZ2A 4CCEA 4PDWB 4LO7A 4O4LB 3C2UA 3IZOA 3V0BA 1HP8A 3FE5A 1RJ7A 3CRAA 1MA1A 1PK6B 3N7JA 1UU6A 3WDUA 2WS93 4QM9A 3VBSB 2EX3A 1JZ4A 2D6LX 4G4FA 1QJX1 5FWJA 4L9BA 1NVPB 2EJ7A 3AZZA 4BYYA 5LEKA 1G8WA 2VZ1A 3OBTA 4LF5O 1M93A 1BBT2 3BRCA 2GSYA 4BWAA 1HJFA 1US2A 3OSDA 1KU9A 2J7MA 2ZCWA 5C6CA 5GTIZ 5LXTA 3GBFA 4MW8A 1YJ9V 2PHFA 5I0UA 1TNFA 2YC4A 3R0RA 4RO2A 3O14A 1HKDA 1UY2A 4WBNA 3DKQA 4L8QA 3AK0A 2XNDG 4PT6A 1HQWA 4DXWA 5FZ6A 4GUNA 2WR9A 3PJYA 1U0AA 1C8M2 1SKVA 5BUVA 2AACA 2VH9A 3HN3A 5B1AB 4AEDB 3PL0A 4FO9A 5LB6A 1BEV2 3JD71 2YICA 3T1HB 3CC2V 4NPRA 3CIHA 4W50A 5L9BA 3ZN6A 3B3QE 3JBG1 3OGIB 3BU0A 3IGAC 3E5QA 1GFF2 2ZBJA 1OQDA 1G6NA 4PBOA 3J7MA 5CA1A 1K3IA 4LP8A 1D4M1 1V9PA 5CA3A 1VBD3 3NXSA 3GYDA 4IW3A 4B4QA 5H6RA 3I3DA 5FY7A 1HN0A 4F4LA 3JARB 2Y26A 3WLUA 3LNNA 3K48A 2B1IA 3UT5B 1S77D 2KQXA 5F3IA 1BHBA 3NKGA 2WN3A 3IMNA 4DK1A 3M4FA 4KHPO 4AFCA 5FRAA 3KV6A 1JOBA 3ABTA 2JGDB 4LKSA 3W21A 5IY5B 4K21A 3PDQA 4B3SO 4DV5B 3S5QA 5G05L 4WVMB 1VARA 4I0XB 2Y6LA 4GX1A 5L36A 4LH6A 1BYHA 1UKRA 4ARYA 5IVCA 2OIIA 3SYPA 5C9AA 1YTFB 3JB4C 2BRTA 4H37A 5J3UA 4HT1T 4Q4V1 3THDA 4PI2A 1EN6A 4PLMA 3MHHC 4F6RB 4IE4A 5G04L 4CPBD 2Q6AA 1OH3A 5FYVA 3LZZA 3CC7V 1VAKA 4LFBB 4D0QA 1UZVA 3GALA 2WLPA 5C5TA 3AC0A 3VKNA 5K9YA 4J41A 3ZJZA 2P6CA 1AR81 5K0UB 3E89A 2WYFA 3JD73 1AI7A 1BMV1 2OUHA 2ITCC 4MH0E 2PHWA 4OMCA 3EXAA 2JDMA 5EYYA 1FD9A 4Q4Y3 5BY5A 3ZXEA 3HKBA 4F7ZA 2QM4A 1V55C 3AKTA 2YU2A 4MSVA 2WABA 1DYOA 3WP3A 4BM8A 1LB2A 1F51A 1NQJA 2QDRA 3GB7C 4IGQA 4ZOLA 2P1BA 4K0KO 1W59A 2TEPA 4OMDA 5JPMB 2L6LA 1J3PA 2W1UA 1K9MW 5FO9B 1Y4MA 1PPJH 5C3PA 3TN93 1LNSA 1I5ZA 4LWSA 3L72H 4IEOA 4K7JA 1K45A 3MIBA 1N36B 1ZA4A 2ZGMA 1WLCA 2WNUA 2WWUA 1QQP1 5HFLA 3FAVB 2AGSA 4BQ5A 1JZ5A 4RR3B 5BNOA 1RUD1 1GH6A 5BR8O 5HXVA 2NN4A 4ZHQA 2PHUA 5CFDA 1AYM1 1VMHA 1MSDA 4YZ3A 3LDEA 3J81N 2EF6A 5GZGA 2P06A 1QHTA 1OI6A 1GK9A 5FDBA 4Q4V3 3T0AA 4DR4O 1UD1A 3ROUA 4N8MA 2HWF3 1Y3TA 1ULFA 4O4JA 2MHFA 4ZHNA 3K4AA 1YJKA 2Y69C 2XAFA 5GJ6A 1VB4A 2WKKA 1RUE1 3RYCA 5DUUA 1OPOA 4W6YA 1W39A 3L2HA 2C1FA 3E97A 1VF6A 2A6YA 5JAXA 1NS1A 3VBRB 2JDKA 1PGL1 2D40A 2VMIA 1N1VA 4QJFB 2OYZA 4LC1A 3U78A 2PHDA 3T0BA 5GLWA 1X9PA 2Y34A 5KAFZ 2VULA 4AEKA 3E22A 3HQUA 4P9WA 5EXOA 4CP9A 3OTFA 4DXSA 3USUB 1PZ9A 1TME3 3LQCA 3BY6A 2F6BA 2TBVA 2VM9A 1W0NA 1NJIW 4JRLA 5K4LA 1YLLA 2Y48A 1BZKA 2VE1A 2BDRA 2WO7A 2ZX1A 3BABA 4LK7A 1JMUB 1D7PM 5FFOC 3V65A 1ENVA 1POV0 5C4WA 1VQ5V 4D7TA 1KKCA 2TNFA 1AR71 4J1XA 2HWC1 3PUQA 4FTSA 1XNQO 2LW8A 4JYYA 2JGUA 1JXNA 1UO9A 5DMYA 3OEEG 4I02A 4Y22B 2ZOEB 5CBFA 4UF0A 4HMZA 2X29A 1WWYA 4XCBA 4FPGA 5E6HA 4RA0A 4CU6A 1X82A 1IBMB 1OCRB 4FQ4A 1OLME 1G9FA 1QR8A 1S72V 4JGYC 2VBBA 2XLAA 3TEZA 3T4DA 2JXAA 5IJ9A 1G6UA 1GSLA 3KWVA 2ET7A 3OBZA 4HFSA 1WB8A 2QTWB 4DIQA 1BZWA 5JJJB 1R3IC 2UWBA 5CN0A 5FKBA 5A3WA 4N90A 3VZMA 3RWRD 1N3QA 1ZTEA 2JE7A 2ARBA 1I1EA 4I3GA 1VQKV 3EB7A 4F83A 1AI5A 3PUHA 4N53B 5KXBA 1VQLV 3N7MA 4QMAA 3GJBA 5F3GA 5DXDA 4B3NA 5FZKA 1Z78A 3ZMTA 3PUSA 3D3AA 4AAXA 1RXGA 1VBE2 3TOJA 1NR7A 1AJNA 1MACA 5LHIA 4URTA 3AXEA 3KS7A 2EIMC 2XJTA 4P30A 1EV13 4HL0A 3CJHB 3I56V 5FUIA 4PIXA 1JMKC 2JENA 1V70A 2P4KA 1MZ5A 1UOBA 4E27A 4LF4B 4B4RA 4WM7A 1L8DA 2YZ4A 2JG9B 2TUNA 1R6TA 1UPGA 5LEJA 1JBCA 3JSLA 4Q8KA 1UXZA 3M7MX 1PGW2 1VAVA 3Q8EA 3WFVA 1VAMA 5LHHA 5EJ1B 2Y33A 4LO4B 2RDSA 3I2GA 4COWA 4IGGA 4NTXA 1L7RA 2BUKA 1R3KC 1O4TA 4AK3A 2QTSA 1EZVH 2WWWA 4R9BA 4QQPA 2Q8OA 3VD3A 1AR5A 3ASNC 2JWPA 1GAXA 3SC7X 1YEWA 1HRV1 1OA3A 1KUQA 1WW6A 3S57A 4FIPC 1RUH2 3A0NA 2J1UA 2XAJA 4FQZA 5JI9A 2UUAB 5H9SA 1QLEC 2BWAA 4AFAA 2ZGRA 2QZ2A 1N0NA 4CS2A 1I5PA 1GP6A 3RFRA 4QX3A 4ES8A 1JYTA 2P7TC 2WNOA 2AXTZ 4PV1B 4MXVA 2KG7A 1O9GA 4LH7A 1NCQB 4GULA 3UYJA 2ZGNA 5F6LB 5A3UA 3DTUB 3N27A 4QB6A 3BTAA 4DUYB 5ABJB 4K1YA 4Y5SA 4X1IA 3E8FA 5LHGA 1NCRB 1PIV1 2ZHNA 3OYWB 4PCRA 2CAZC 1NXMA 3AKRA 1PVC3 5F37A 5FK8A 1GMGA 2E63A 3V0BB 4R7CA 3BPSA 1ZA7A 4TTGA 2VZRA 3PVOA 1KXGA 4WBBA 4X64O 3KT7A 2P3IA 1HB2A 5DUXA 4QDSA 4JI7O 4MGTA 3VBOA 1OUXA 1UZWA 4MVQA 4YM2A 1XHXA 2DWDC 5EK0A 2ZJCA 2AZ0A 2H0VA 3NWKA 3ACHA 1G9DA 3HOBA 3S6PA 1ENSA 3ZRXA 1WPBA 2R061 4GMP1 4A2UA 4RHV1 3X29B 4IL7A 1RPOA 5LXTB 4EKWA 2PYTA 1K5QA 1YJWV 2Q4SA 5JVVA 2AYHA 1WA6X 3SH3A 2JRIA 4JI2B 3O1OA 1LJ7A 2EAAA 5FZFA 2EIKC 2L35A 2OCCB 4AQYB 4OGQB 2WFPA 4HAMA 5A3NA 4DO2A 4X6QB 4X62B 1OURA 4MTFA 4DV2O 1ROPA 5LRSA 3ZN1A 4CVUA 3AMHA 4WM8A 4NXNO 2DU0A 3PURA 4WFBV 3ITQA 4UXNA 3APQA 5JZGA 2VMFA 3U75A 3POYA 4EQVA 3ZN6B 2G19A 2E7QA 1WW4A 4O61A 4L97A 4XJ9A 1O3TA 3VZKA 2YS8A 2XHBA 4O9GA 5JLVA 5CA1B 1UX7A 3SYOA 5H9QA 1NZ6A 5I0SA 3ETEA 5A7SA 3RDIA 3PJQA 3MLLA 4HYOA 2Q4PA 3T1CA 5KXCA 1CAUB 3ZVXA 3OEAA 1EAH2 3H1IH 1ZRCA 2FB5A 3BODA 2OVUA 4RS5B 1GP5A 3JD2A 4UW4A 5EBWC 1W8OA 1ZL8A 1YQ5A 3AYAA 4H14A 3FYEB 1GWMA 3UESA 2W3JA 3ZKUA 4CDQA 4WVVA 2W6JG 1R6KA 1WMFA 1FPN1 3OM3B 2WNVA 4BQ2A 4FSJA 4DV7O 2HH9A 3OPZA 3G6EV 1SZBA 2JJ1G 3ABLB 1HN1A 2QKDA 5E1RA 3H42B 4NIIA 3DF0A 5C9AB 2E75B 1Q6HA 2R063 1PMIA 3M3OA 2G9GA 2XKOA 3QH7A 2QJVA 5C3OA 1NX9A 4C1XA 3VBBA 3LDKA 1S2EA 3O1SA 1HRI3 4X1YA 2P4EA 4P9XA 2RMU2 2WZPP 2QQVA 3ETGA 4Q6GA 1SLAA 1URXA 2XAHA 2DVFA 5KBFA 1CVNA 3NV3A 2RJ2A 1SLBA 2W9XA 2DBIA 4UFKA 1CESA 4B3TO 4LFAB 4S2DA 1QF3A 1DQ2A 1OMIA 2XJRA 3CSXA 2Q0OC 3JATA 4OHWA 3LA2A 1UY4A 4DV1B 3BFRA 4IIJA 2JB4A 4A7KA 2VQEO 4X66B 3KZ4C 4F3JA 2GNTA 4U7OA 3WNXA 1MEC2 3ASOB 3C3TA 3BHPA 1H4HA 3VQYA 3O12A 5FZOA 5B4XA 1O9HA 1HXS1 1H8VA 1RMU1 3J8F1 1WLTA 1LENA 1X4TA 1LEDA 1VBC3 1UN1A 3VV1A 1SLCA 4YW5A 3VBFC 3VZJA 4ZOLB 4Z07A 1JOPA 4JVAA 5L3CA 4CC5A 1D2DA 1RGSA 3PUIA 1HV1A 3ZSMA 3ZS8C 3U4SA 4K8RB 4EN8B 4N21A 4LWSB 4PA4A 1AX0A 4UCRA 4Y5Z0 1AI6A 1GM7A 1AR91 2WNUB 4CS3A 2P22C 5I8YA 2RJLA 3I3EA 2QEXV 5BNOB 2HWD1 5DN6G 1PO11 2C6SA 1V00A 1FPN3 2VAUA 1SQ4A 5CFDB 1LOCA 4IEWA 1COWG 3TBDA 1X36A 2FDFA 3W9AA 5A7PA 3IC7A 3CC4V 5FOBB 5FYHA 3I2JA 2KA3A 2W92A 4HKWA 4O4JB 3P30A 4EN6B 4NIHA 2QSAA 1W6PA 4LKEA 2WSSG 1DLBA 4OQ8A 4DUWA 2XB6C 3CEIA 2PLV2 4MVUA 4HN0A 5FZ9A 3RYCB 3LA3A 3SYQA 1ZZ6A 3CCJV 2XLGA 1YQCA 4Z92B 1WLEA 2XHKA 2J42A 1XL6A 1LNQA 2J22A 2ITDC 1UXXX 3ZXDA 2HHHB 4FPLA 3MIHA 1CQ9A 4HVQA 3JAMN 1IPJA 5FQ0B 4K40A 1FAYA 5GKAC 3ILNA 1AJQA 1DHKB 4JV4A 4YVWA 2ZT9B 1AYN2 4B3MO 3GXUA 2ZAHA 4FCAA 2ARAA 2UY8A 1AUYA 4QGNA 1GV9A 2WSUA 3OOXA 2HEVF 4XUOA 1HQLA 4AE2A 2E5LB 5JSRA 1VLNA 3NRUA 5C4WB 2DW4A 3K5NA 5JPNB 2OPKA 1BJQA 3B77A 1V6LA 4EWDA 4BCUA 1Z7S2 3BTXA 2CUGA 2AREA 5DABA 1BCCH 3BYWA 5FMDA 5DDJ1 2Y8KA 4XDJA 4B7KA 5FWEA 1VBA2 1P49A 5DPNA 1APNA 2NNUA 2IJJA 1H9PA 2HWD3 3GZEA 3ZIXA 1HNZB 1JOYA 4UF0B 3KMHA 3OT7A 3OFNG 3OAAG 1QBZA 1F9KA 2WQZC 2VOVA 3K75B 4XBQA 3N2GB 3ILFA 2JKBA 3EBRA 1RP3B 1UY0A 5IJ9B 4LNVA 1LU1A 1OBNA 4H7LA 4MX3A 4HONA 4RSUA 4DRRA 2FCUA 4XQDA 4PA7A 2VVFA 1UKGA 3ZHSA 4DUZB 1IS6A 2LROA 5J09A 1A6CA 3CNAA 3JD0A 1FMD1 3APOA 5FAXA 1FT9A 4GB32 5BNNA 1PKXA 3LF7A 1K34A 3C7OA 3AMQA 1B6QA 2VUCA 4IV1C 1WW5A 4YVSB 2CTWA 5L3BA 1R093 5F2SA 4JGZC 1H1IA 4UFMA 5IFTA 2JK5C 2Z5UA 1Q82W 2NN8A 1FFXB 2DUPA 4AQSA 5FMCA 4FPYA 1ULDA 4J9YB 3QD6A 2FL4A 4NHKA 2VWKA 3VL8A 5AC91 1TNRA 4K1ZA 3JYCA 2WT0A 2XBO1 2W08A 2WZR1 4UBGA 4UUJC 3RQ0A 5F1RA 1VALA 1S76D 2QKCA 1RUF2 4GALA 5CFCC 5A7WA 4YGCA 2R30A 1WA8A 4JTAB 3KGLA 1X33A 3LSSA 3QCWA 1MQTC 1COV2 1FFTB 4Y24A 5L3GA 4Q20A 2YU1A 3H3UA 2Z2SB 4ZONA 4AI8A 4LBNA 3WU2Z 3UETA 4ZY9A 3MIFA 4NPLA 2EXJA 3K3NA 4IGPA 5C93A 4MV2A 4LITA 4GXLA 1AR1B 3AKPA 4FLXA 4JF3A 3K57A 3A0HZ 5IDJA 3VBHC 3L9JT 1BMFG 1XL4A 4HK8A 3VBUA 3U14A 4I0AA 2Y6GA 2BSKA 5FYZA 3R66A 4CDXC 4YW4A 4X8NA 1PO21 4QB2A 2CGNA 4NB5A 4L2NA 2VQAA 1W99A 3THCA 1O59A 1M57B 4IUGA 4KMQA 2YBKA 1DBNA 4LF6O 3IMMA 1K5MC 1DF0A 3PUAA 1VIWB 2YEVB 3BCCH 4QD2A 5FL7G 2DFCA 4LUKA 4CCMA 3OY8A 4MGYE 3WNLA 1S3JA 3BGAA 3ZMNA 4DO0A 4DV6O 4LBKA 3WG7B 2WUHA 4LBQB 4AOCA 3OGVA 2P67A 4JZGA 2QQMA 4LFCO 2B8MA 3JU9A 3O1VA 3AYCA 3CRRA 3DGEA 2EXKA 3I55V 3BPZA 5DAXA 1VQ7V 5JJEB 1XDCA 3L75H 4X1IB 3SR2C 1ULEA 2E32A 2O14A 1XHZA 3CE2A 1CZSA 2XBO3 3V0AA 5JMCA 1BBT3 1RVF2 4YW2A 3U11A 1P7BA 3L71H 1AJOA 3RZGA 4DR6O 1C5HA 2X10A 3TB0A 2R72A 4HANA 2PHTA 3VBOB 1BXHA 5T55A 1CX1A 1UX6A 3FX3A 4EN9B 4JYBA 3JCUZ 4DOUA 1N32O 2XH6A 4JYAO 1C8M3 1W2OA 4XF0A 4XJZA 1S0CA 2H3OA 2QM7A 3E5XA 1GKBA 4A45A 1PZ7A 2CAUA 2XL7A 3L73H 5DZGA 1RUC2 2VQFB 1BEV3 1GUIA 1BVP1 4P00B 4LNUA 4DRXB 3MHZA 3LEMA 2RCVA 4PIZA 2IM9A 3B40A 1M90W 4JI4B 5GLZA 4CEWC 4TV9A 4U7NA 1YUDA 2PYJA 2G4IA 1RHI1 4DUXA 4GH4C 3GGLA 4QXBA 1EPZA 5LA1A 1V6JA 4HSJA 2UXCB 3IDCB 1Y76B 1N3PA 5EYXA 1QMJA 4WM8B 2GH2A 4FP2A 1GM9A 3AG1B 5DQ0A 3B69A 4Q26A 2Q69A 2R072 3G80A 3AJYA 4BA6A 1ND3A 2B42B 2Y6KA 4LJHA 1ZBA1 2HEPA 2RS12 4I4TA 2Q30A 5LOVA 2ZEZA 5B4NA 2K0GA 4UCVA 5BNPC 2C2AA 3TEXA 3S7EA 4K35A 2IBZH 4UFJA 4I0BA 1TMF2 4JI8O 3G7DA 1SQBH 4OI0A 2L9LA 1I9RA 5B66Z 3A21A 2VUAA 4DR2O 1QLEB 1WJZA 1VPHA 2VECA 2MNGA 3ETDA 3K08A 4CTEA 4GAZA 2DN9A 4DUVA 3SJCC 3A0KA 4MGSA 4NHXA 1N0JA 3TCUA 2GMMA 4EJRA 1DDLA 4LF8B 4LEJA 5A70A 1I6XA 3GZTB 3WINE 4CDQB 3RZJA 1VQ8V 2EVXA 1W3VA 2WNVB 4KUMA 4BW9A 2AHYA 5FK7A 4JX0A 3B09A 1NY71 3AG4B 4ASKA 5EYPA 2A3QA 2A6WA 1KD7A 3I7DA 4M01A 1JHJA 4OCTA 4NWWA 2RDNA 4JGSA 3ES4A 2WN2A 4MVOA 2ZINA 3NNMA 5A3LA 3LFMA 3UGHA 1B06A 1I7FA 1ONAA 3BI3A 3FMGA 4QPJA 4QHZA 1PNKA 2V5DA 2ADPA 3LA7A 3NJXA 3K03A 2G9FA 2YBPA 1HW5A 2OUJA 4M0NA 2QQLA 2D7FA 5DM6V 2VMDA 1RITA 1QGLA 2Q8EA 4B3RO 4HVRA 1RUJ2 3D36A 4LK6A 5FZOB 5A1FA 3Q8CA 1XBLA 3B00A 2LFSA 3KLSA 1JU4A 2IFWA 3LD8A 4K20A 4YWAA 1OF3A 2QQUA 4W8JA 1WCKA 3ZFGB 5HFMA 1YFWA 3OCPA 3JAKA 1WCSA 2DV9A 3IAPA 4OYUA 2ADQB 4EB6B 2AR6A 3NSTA 3N9LA 1W9FA 1ACCA 1FV2A 1J59A 4V2WA 5C8CA 1D0GA 4AVSA 1QIQA 1H0BA 5ACA1 1KS4A 4A44A 1JYVA 1UPSA 3DYPA 3NQHA 4XMAA 3RYPA 3RW0A 4ZS2A 1P84F 1U5IA 2JE9A 4IEQA 2Y0OA 3CCVV 4CS4A 5DN2A 4H7MA 2P5OA 2FDJA 3D3QA 1L7LA 1J3RA 2WL1A 1VBE1 2B5HA 1GR3A 4I30A 3OGCC 2WC2A 2ZE5A 2VUJA 2MPFA 3RMYA 4FFBB 5C3SA 4JGYA 3LGRA 5BXXA 2E3CA 1NLRA 5B3SB 4XDOA 4XDQA 1GMMA 4QPIC 5EIBD 2Z5WA 3LDBA 1GWKA 4XDPA 2Q67A 5JCOC 2BGPA 1XOYA 2QQOA 5KUKA 5AFBA 1NLSA 4PIYA 1CAWB 2BYVE 1YRZA 2GNBA 2YFUA 4TUYA 3AG2B 1PGW1 4J9ZB 1STMA 2ATFA 2ES3A 4CRQA 4NIDA 3SLIA 1O3QA 1UYPA 1CGPA 2GP3A 4ATFA 4X65O 3RPQA 3D8CA 3K3OA 1X8EA 3ZFFA 4FK5C 3ZSKA 4YVWB 1ZZ8A 4PDWC 3H1MA 3S5AA 2Q1MA 4MG2A 5FPZA 3NW4A 5HPOA 2CTVA 5KUMA 2ZEXA 5IWAO 1PK6C 1EY2A 2PF4E 3VKOA 3M8AA 1IVSA 4JI5B 1YDXA 2QE7G 1JYCA 3W7XA 3FB5C 3VBSC 2Y0IA 3WW4A 2DUOA 4MT8A 1VRH1 4UV9A 1KJRA 4L87A 1EBOA 1O4ZA 2VMCA 3BA8A 2Q0AA 4C7UA 2PAEA 4TLFA 1IBLO 1GNYA 3VHPA 3GHMA 1SQFA 3LDDA 4F6EA 1Y43B 1OHFA 2GHYA 3IIAA 1W2BU 4FPOB 2X09A 4WFGA 1VBE3 2P34A 3ZFEA 1I3HA 3VDBA 2DE0X 3WP4A 3M99B 1R64A 2BVVA 2JG8A 2CNAA 5B1AC 4AEDC 1WMEA 4UB8Z 2UU8A 3WF0A 1ND2B 1RUOA 3DSQA 3H01A 3ZRSA 3UGGA 1VQ9V 4UXAA 4LUMA 3W59A 2J1RA 1AHSA 1LKNA 1EYBA 2LM3A 4MHUA 3PU8A 3POJA 2EINB 1EFRG 1OOPA 1PNLA 3DC5A 5FLXN 1LU2A 1FXKA 5FYSA 3QBQA 1K7DA 4L8JA 1UW8A 2ZKLA 5FLIA 5B1BB 2I45A 2FQPA 1GZ9A 2XJQA 4RL7A 1QVFU 4O2BB 5FTTC 5FYBA 1DGRA 1I94O 3K9AA 2F4VB 1Q7YW 5GLTA 1HW7A 1DK1A 4YJ2A 5J96B 4PF1A 1GYKA 1WCDJ 1JI6A 1AX2A 5A7WB 5JOXA 4DEVA 3MLKA 2E53A 1T6BX 4I09A 1WA8B 4PQ9A 2P3YA 1KECA 5A32A 3BVCA 2RE9A 3AK2A 5IY5C 4COVA 4QKDA 4JKMA 3WW1A 4CP2A 4DFSA 2VQTA 5KHGA 4MHRA 1H2LA 4GKJO 4XXPA 5IAVA 3THTA 2YY1A 4BZ4A 2PZSA 1RUH3 3ZOIA 1IQDC 1US3A 5LBCA 2A0LA 1C3HA 4Y1YA 2PTMA 4J25A 4LE3A 3LDCA 4IYIA 1SLTA 1VBB2 1RUI1 2R1DA 2UY9A 5EV7A 2WLMA 2UXXA 4D7SA 3LWCA 1AL21 2QQPA 2ZZQA 4H3WA 1MZFA 3RYFB 3INAA 2XDVA 3RI9A 5FO8B 4IE6A 1PM7A 1LGNA 2GN7A 1HX6A 4BK4A 1SETA 1BVVA 2ZXWB 4CCJA 2BSKB 2RR12 3QACA 1K4DC 2DMXA 3C3VA 2IC1A 3KF3A 4GD4A 5F2WA 2DWRA 3K59A 2HG5C 3FHQA 2ETNA 1FJGO 1JYWA 3LOBA 3AEIA 3QVNA 1WW7A 3RJ2X 5T50A 1AR61 2W68A 5K0UC 2QJ1A 2HBUA 5JDBA 3OY8B 1Z0HA 2DVGA 5FZMA 4CCNA 2XXZA 4W6WA 3S7IA 4YZ1A 2WINB 2QNKA 3M3EA 1SLLA 2DYSB 2AGAA 3O0VA 2D3PA 1S0FA 4CZZA 2P4VA 3I59A 3DN7A 4MOAA 3NV4A 4QX0A 1KDMA 4WFAV 3R65A 3RZLA 4OZOA 3OTOO 1N1YA 3H1LH 1O91A 4QHOA 3V0AB 1QJU1 4S2FA 1NT2B 3WNKA 5JR7B 5F6KA 1YHFA 1AP6A 3HJRA 4NWVA 2DVBA 4XF1A 2Q1FA 1LCLA 4RR3C 3RZZA 4Q0SA 5F5AA 1N3OA 4DEQA 1YZBA 1URFA 1VB2A 4RQPB 2LFRA 4BMBA 4QXKA 5IVBA 4NTWA 4J1WA 1PM4A 4AI9A 2P17A 3DCQA 4DR3O 4LF9B 4MTXA 5JI7A 3RS6A 4AG4A 1HB4A 3H9VA 2V4DA 3IAYA 1RUG2 1V6MA 1IBKO 4J11A 2ZMLA 4LNUB 5B5EZ 4NO4A 4CH3A 1DZQA 3TAYA 5FZ7A 4OPAA 4WCEV 1SQPH 2UXNA 2KR2A 4TV9B 2EIJB 2OYQA 2B5UA 5I93A 4LHKA 4PDMA 1CXZB 3DC6A 2QDNA 1KFXL 4UW5A 4BAYA 1IG3A 2RHPA 2LTNA 4I2OA 3VBRC 5CU1A 5B1NA 1VF5B 1LTEA 5IYDO 1M56B 1K5JA 2EZPA 2F93B 3KM5A 2FMLA 5CBGA 4XTMA 1ND3B 5IK8A 4P9IA 1A8MA 1SEFA 3AG7A 4O4IA 4NE9A 4I4TB 5FPUA 4UT5A 2GUZA 3JAWB 3EFFK 2HBTA 2W87A 3RYRA 4AXOA 5LGTA 5IWFA 2CTQA 1YXBA 3WXPA 4DW0A 3PNAA 1ZRFA 2WFF2 1FX5A 2RJZA 2GBOA 1NZCA 1YXWA 2BU9A 2JJ6A 2PAKA 4RGGA 2ZX0A 4K3AA 1QU7A 2VR4A 3W5NA 1S0JA 1QJY1 4YZ2A 3NV2A 2VU9A 4LR3A 2VCAA 4OZXA 3GM8A 4LOTA 1NLQA 4Q4X2 3ML0A 2RMU3 4V1PA 3ZLIA 3C7HA 3ON7A 3ABMB 3GDBA 3KT4A 1KDKA 2QKSA 1W8ZA 3K77A 3VDCA 1RSOA 1DQ6A 2PXJA 3MIEA 5F7UA 1LOBA 1YFYA 2GALA 4X1KA 3V64A 4HPKA 1OCRC 1UYZA 4LR4A 2JIZG 3VGIA 1R3LC 2LS6A 2UYBA 1HIXA 2WO1A 3E83A 2EAKA 2WLLB 4LF6B 1GO3F 2ZGQA 1XE7A 2IJKA 2CL2A 5EJZB 2IW5A 2P90A 5JXGA 1RUNA 1S4CA 4DV6B 2E6VA 4YYOA 3LEIA 4DV4B 4GX2A 3T09A 2WLIA 1P8JA 3ILRA 1F4HA 4LFCB 1F23A 1IS5A 2RS31 4N53C 5C5UA 4XJUA 5LK5A 5BNQA 4AW7A 1XNRB 1UOJA 4FPPA 4A7ZA 3WUDA 2K9ZA 1J1LA 5EPAA 4JAAA 4XURA 1DGWA 1E5IA 2B39A 2FCTA 1AXZA 1R082 1H4GA 5IATA 1FATA 2EJRA 4QQOA 1XE8A 1DTOA 2F43G 3ZHUA 2W47A 2XPJA 3MDPA 1Q8PA 1NA1C 3CJXA 1H6YA 2HVKC 3CBNA 2NMOA 2ZE7A 2FDGA 4MXWA 1S0VA 4YW7A 2GV9A 3HKEA 2ZX4A 1VIBA 2R042 1K4CC 3HQXA 1IS4A 2JG9C 3M8LA 5A33A 1D2QA 5LA0A 1XQ8A 3LUTB 4WF9V 4N7IA 2A5ZA 2ARCA 2DU1A 4Q4W2 4JPRA 1UU4A 5C8CB 2VZ3A 2IU3A 1FOD1 3O65A 2VY0A 3ACFA 2AH2A 1OCOB 4YLZA 4YW1A 2CDYA 4GWMA 2RM22 5A3TA 2PLV3 2JDIG 1UIJA 3CMAV 1MVQA 4UV8A 1C1LA 5FXVA 2XHNA 1V9U1 3MPPG 4UWDA 3VQVA 3T2QA 4YM1A 4ITCA 2EIGA 3CD6V 1WUVA 4FMTA 4C90A 2RVAA 3AVRA 3HKDA 1SCRA 2HWE2 1L1FA 3ZYPA 3TNQA 4P9OA 4C91A 1TE1B 5JVDA 3B94A 1XYNA 4P2ZA 4I50A 4YJ3A 2PMWB 1W6MA 5FZHA 4Q0PA 2V73A 1YQ8A 5GONA 1W6OB 4CH5A 2C4XA 1VE0A 3CCEV 2D93A 2RS52 5AVAA 3AZVA 4D6SA 1ZBE1 3PIGA 3MD0A 1ZYBA 2A75A 3SKVA 1UFIA 5CB7A 1NCQC 5IYCO 4XE9A 5AG2A 4FBFA 4TWKA 4JI3O 3HIFA 4JI8B 4XJ8A 3NNGA 1EN5A 1DU3D 4KU7A 5L7OA 1JUHA 4QDQA 5D5QA 3OR6C 5ABJC 5SV5A 1JX9A 1NCRC 3LCPA 3WG3A 1Z7S3 3ZFFB 3KV9A 5F5QA 4JGZA 5A6YA 1TUEB 1K73W 1SA0A 2OWOA 4JZRA 4LF7B 2MK3A 2WLHA 5CA6A 1K42A 1OA4A 2UWCA 1C57A 5GZCA 4FZ0A 3FB8C 4KFMA 1LHWA 1NKDA 1SPPA 4IXLA 4GKYA 2VXRA 3POBA 1DGLA 1NYWA 5CFCA 4WFHA 1DIWA 4NXMO 4PBPA 2FBEA 5EZYB 1LOGA 4AQTA 1FOD3 3ZXAC 2HWB1 3D82A 1XMQO 1J5EB 4Y20B 1R1A1 3SH4A 5JIUA 1KYOF 4B08A 2YI9A 4UFLA 2RMKB 1CPYA 3TEWA 1ASJ1 3R4DB 1OLMA 1C5IA 1TA8A 2VL4A 4FPFA 1SLIA 1G4YB 1OKOA 3T1MA 1A8DA 5CA0A 2OCCC 2UXBB 1NAEA 3UGFA 3ZFEB 2WS91 2JIJA 1MNGA 1X59A 2JG8B 3VBHA 3RWKX 4B3RB 3FFQA 3T4VA 5FLJA 3PHMA 1QJX2 1E1RG 3VD9A 5E8AA 3OUHA 1W0KG 4NJ4A 3FN9A 5T5OA 4FPCA 2QCSB 4IEUA 2KB1A 1ZBE3 1RUF3 1EN4A 2WQ4A 4TQDA 3G6JB 1OOPB 1HNWO 1FXKB 1RL3A 2A6XA 4CCCA 4R8CA 2GNMA 1COV3 3E6DA 3OEHG 2Y4TA 4YFZA 5FZLA 3SCGA 1MS9A 3UM7A 1J1TA 3CJIA 1UU5A 1U5ZA 2XG3A 4O7XA 1O4YA 1Y9QA 2RG4A 4MVZA 4BQ4A 4YJ2B 1X8MA 2D44A 4RS5C 2W1QA 2ZM6B 4DV0O 3K9SA 4JAVA 2ZABA 2XLFA 2JB8A 3JD72 2M7WA 3VZOA 3HNYM 4NHMA 1MS3A 2BTQB 1WD4A 1W9SA 4QB1A 4K8XA 3N9MA 3JBG2 3T2PA 3S3XA 1HWYA 4ZS3A 2NM1A 2QWQB 3ABLC 2GZWA 2PYLA 1VBD1 1F31A 2V4VA 4UVCA 5C9AC 1D4M2 5JXHA 4YRDA 1Y74A 5IYZB 4XZPA 5FYIA 1WGPA 2QZ3A 4V2VA 2J1SA 4JASA 2BOBC 1YFUA 5LBBA 4J10A 2V09A 1JJ2U 3R4UA 2DTYA 3VB9A 3B02A 2VMHA 2YXSA 5IAXA 4DR5B 2JECA 1P4RA 3SJAC 1LHVA 4XCAA 5A1LA 2FZ2A 3Q4HA 1UY1A 3B9IA 3H0OA 5JQGA 5LY2A 1H1AA 1SESA 1ZX3A 5FCCA 5HV4A 1N33O 1KQSU 4OULA 1GU3A 4CEWA 4B29A 4AI2A 4YARA 1Q6UA 1N34B 4AEMA 5FJKA 1IQAA 4ZBMA 4GH4A 4S2GA 4CDUB 5DUVA 3ZYHA 2ZDIA 3WQBA 3ASOC 4HNAA 4UB6Z 2VBPA 1W04A 3POWA 4HZ3A 3OPTA 2B46X 3B93A 4KP4A 3JZVA 5KHKA 3ST7A 3I2OA 3LKJA 3LSEA 1S0IA
chains in the Genus database with same CATH topology
4FPHA 5FPXA 4Q2FA 5AFEA 3MS5A 2JG8C 1U12A 5L19A 4JC1A 4B7KA 1VBA2 5JZGC 4R9AA 3HBZA 1APNA 2ZGUA 1QJU3 3NAPB 4WV8A 1H9PA 2HWD3 3ZIXA 2WNEA 5K0UA 4BWOA 2Z69A 3KCCA 3KMHA 4AYUA 1K5MB 1S55A 1ZRDA 4JRAA 1HRI2 1OPMA 4QQLA 1VRH2 1DZRA 3AJZA 1IKQA 1F9KA 2WQZC 2VOVA 4LA2A 2VNRA 4XBQA 3ILFA 3QOPA 3VLBB 5BNPA 1QOTA 2JKBA 2A70A 4RD7A 1Q43A 3SCHA 1RUC3 3EBRA 4XTPA 1OOPC 4LNVA 1LU1A 1AR82 4YNIA 4IEZA 4XF4A 4H7LA 2WNUC 4MYEA 4MX3A 5JWPA 5JCTA 3N3HA 4RSUA 3UV9A 4DRRA 1BMV2 5KC5A 4ZU5A 2LUWA 4HK9A 4DB5A 2Y38A 4FTBA 2BFUL 5BNOC 4XQDA 3ZYIB 4AFBA 2VVFA 1MS1A 1UKGA 1VBB3 4Q4Y1 3IWZA 1IS6A 5J09A 1A6CA 5C8WA 4LBQA 4E9KA 3CNAA 1RUG1 3U0ZA 1FMD1 1SDWA 4M2FA 3IDBB 5FAXA 1FT9A 5CFDC 4KGQA 1QXJA 1Q8SA 3BCWA 4GB32 5KEUA 5BNNA 3AMQA 4JDNA 3B7MA 3EHKA 1O3RA 1SFNA 4IV1C 1WW5A 2EXHA 4DPNA 1W6PB 4YVSB 3CL1A 1R093 1D0HA 1CJPA 1DYKA 1G9CA 2ZKNA 4BHPA 5DG1A 4JGZC 3O2GA 1H1IA 1CIWA 1JTZX 4KWKA 2BBVA 2BNMA 2NN8A 1QJZA 1VBC2 3TN91 3M70A 3FJSA 2DUPA 4AQSA 4RR3A 4FPYA 2R073 1ULDA 1CD3G 3RNSA 5H9PA 3QD6A 4NHKA 1ENXA 2K2SA 3O0WA 4R4XA 2W52A 3VL8A 4AFMA 5AC91 1KFUL 1TNRA 4K1ZA 2RS13 3D4KA 5HSXA 5E16A 3N4MA 1LGBA 2WT0A 2XUMA 4B4PA 2D6OX 2XBO1 1QQP2 2W08A 2WZR1 4QPGB 4UBGA 5F1RA 3RQ0A 4OHZA 4CWDA 1VALA 5EFUA 3WG1A 5KC6A 5D1IA 3V56A 2ZX3A 1Q5OA 1D2SA 1RUF2 4BGMA 3WCRA 3CEWA 4GALA 1RUD2 4DY3A 5CFCC 4M2IA 4YGCA 1TMF3 4KWJA 2R30A 4MVTA 2GMEA 1F8VA 3KGLA 1X33A 2YROA 4IQPA 1AYM2 4M2GA 4FFAA 4XW3A 3QCWA 4N43B 1MS4A 1MQTC 1COV2 5FLHA 4CEWB 4AI3A 1HDKA 1AXKA 1FNYA 1XYOA 4E2GA 4Y24A 4PLOA 4CP0A 3H3UA 2Z2SB 2QVSB 2ARXA 1H8TC 2HWF1 4AI8A 3POSA 4M2EA 2D97A 2HEWF 4LBNA 4BPZA 4GH4B 4Q27A 4ZU4A 3ZXKA 4E4ZA 1S0DA 4COYA 2ERFA 1U5XA 3AP7A 1VJ2A 3OBRA 4K6BA 3MF9A 1W6QA 4IEYA 2WA4A 2A6VA 3VDDC 1OIJA 3MIFA 4JQRA 2EXJA 4Z8BA 3PVBB 3VBRA 3WZ1A 1HRV3 1OS7A 4HKLA 4MV2A 2B7YA 1RUH1 4P5HA 3NL1A 1QJY3 2GMPA 4GXLA 4O9EA 4Q0UA 4CDUC 2A3WA 1IGOA 1WD3A 3AKPA 4Q4X1 1RUE2 5T3NA 3ZN4A 4FTEA 1XQNA 1TEIA 4C5WA 3VBHC 5C4WC 3QH6A 2WWSA 3L9JT 4AI1A 4J6GA 5GLUA 1SBFA 2IXHA 3ATGA 4HK8A 4HBNA 3VBUA 4I0AA 4XFHA 3IN9A 1PGL2 1ZREA 1NE6A 1PNGA 1RUI2 2YGMA 4G9SB 4CDXC 4YW4A 5BYNA 1BK1A 3ZXFA 4X8NA 3USUA 5JOZA 1PO21 3H50A 2CGNA 4FOVA 1DRYA 2XVKA 3VL9A 4L2NA 1J3QA 3MI8A 2VQAA 1JR7A 1QKQA 1REEA 5GZEA 1AL22 2X5IB 3PTYA 1PZ8A 2AUYA 3ZYRA 3NAPC 5BNPB 2A7AA 4D3WA 1DBNA 4IEVA 4CDWA 5CADA 3O0XA 1K5MC 1DF0A