3IFXA

Crystal structure of the spin-labeled kcsa mutant v48r1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLACLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Voltage-gated potassium channel
publication title Electron Spin-Echo Envelope Modulation (ESEEM) Reveals Water and Phosphate Interactions with the KcsA Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
total genus 28
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ifxA00
2EIKC 3AG4C 1V55C 2Q6AA 4MTFA 3FB5C 4PDVA 2HFEC 3UKMA 2EINC 3K0DA 4MVZA 3R65A 4R6ZA 2BOCC 1OCZC 4HYOA 4MVMA 4XDJA 2WLLA 3IGAC 1R3LC 5EK0A 1K4DC 2AHZA 3JYCA 4PA6A 4ZBMA 1G4YB 3RVYA 2DYSC 4JTCB 3E8FA 5B1AC 4P9OA 2W0FC 3E8HA 3SJQC 1JVMA 2WLLB 4H33A 2AHYA 4DXWA 3F7VC 3BEHA 1OCOC 2X6CA 3STZC 5CBGA 5J9PC 2IH3C 4XDKA 2DWDC 4BW5A 4X89A 5CBHA 2Y69C 4TWKA 1S5HC 3SPHA 3UM7A 4P9PA 2Q68A 1OCCC 4MS2A 2JK5C 4KFMA 3T2MA 2DYRC 2A9HA 3K08A 2X6AA 4RO2A 3SPGA 3E86A 5KUMA 4R7CA 3X2QC 4R8CA 2WLIA 1KKDA 4QE7A 4G28B 2A79B 4EKWA 3E89A 1P7BA 3E8GA 5EC1C 2X6BA 1V54C 3ASOC 3LDDA 4LBEC 5BZBA 3F5WC 4WFHA 4WFFA 3K04A 3IFXA 4GX0A 2EIJC 3OUSA 4PDMA 1OCRC 3OR7C 3LDCA 4MTOA 4JTAB 4PA3A 3FB8C 1M56C 1M57C 4QE9A 4X8AA 1J95A 2HVKC 3E83A 1ZWIC 2QKSA 3SYAA 4QNHB 2WLJA 1QLEC 3STLC 3SPJA 2ZXWC 4MVUA 2WLHA 5B1BC 4R50A 5KUKA 3FB6C 3RVZA 4P2ZA 1BL8A 1LNQA 4WFEA 4CBCA 3RBZA 2HG5C 5IY5C 5CBFA 2A0LA 3K06A 3T1CA 2ZD9A 3SYQA 2EIMC 3K03A 4LCUC 2HJFC 4PA9A 4MSWC 2OCCC 5EBMC 2R9RB 3SPCA 3HPLC 4PA4A 3SYCA 4MW3A 2KB1A 3T4ZA 4PDRA 2DWEC 4LP8A 4PDLA 4X88A 2ITDC 3RW0A 4J9ZB 4F4LA 4GX5A 2WLIB 2WLKA 3ASNC 4RAIA 3ZRSA 3OGCC 5B3SC 3ABLC 3AG2C 2NLJC 4P30A 4PA7A 1XL6A 3LNMB 1K4CC 3GB7C 3LUTB 5EBWC 4H37A 3PJSK 3SYOA 1R3KC 4WFGA 3ABMC 4OXSA 4MVSA 3TETA 4UUJC 2IH1C 2K1EA 4RUFA 3WG7C 4GX2A 3VOUA 4MTGA 3F7YC 3OR6C 1XL4A 5E1AC 1R3IC 1ORQC 3AG1C 2QTOA 2WLNA 2H8PC 4J9YB 3AG3C 3E8BA 5EC2C 2YEVA 3FB7C 3SPIA 3SYPA 2Q67A 1R3JC 4RUEA 4G27B 4I9WA 3K0GA 4MVQA 4HZ3A 2HVJC 4MVRA 3ABKC 2EILC 3TCUA 3EFFK 2Q69A 2ITCC 3ZJZA 4MW8A 3LDEA 4GX1A 4MVOA 3KG2A 2WLMA 4XDLA 2P7TC 3OUFA 2ATKC 4JTDB 2BOBC 5EBLC 3T4DA
chains in the Genus database with same CATH superfamily
1YZBA 5KAIZ 2C2AA 4MVMA 4TQFA 1K5SA 1XQ8A 4FM0A 4JI5O 4U7OA 2ZR2A 2F1MA 1YJ9V 2W0FC 1Q5OA 2WLLB 4DV0O 3W7UA 5LXTB 3L73H 2P6JA 1XREA 4IIJA 1NH2D 3SPGA 4R7CA 5BMVA 3TXSA 2N05A 3EVKA 3VQVA 1P7BA 3IAYA 2IW5A 2ZIOA 1KECA 4NXMO 2Q5ZA 1ROPA 3LDCA 2E75B 3QO8A 3L71H 2X0LA 2QKSA 1SQBH 2CUGA 1THZA 3ZHVA 3RVZA 5F2VO 1JX9A 4FZ0A 4W4LA 3K03A 2JS5A 4MSWC 1AROP 1P49A 2ZM6B 1XBLA 4RAIA 4B3MO 3ZRSA 4J41A 1M9NA 4IHJB 5DEDA 4N21A 5KA6A 4CC6A 4AQYB 1GN3A 4GX2A 4LC1A 3HKCA 4IT5A 5LGUA 3HKDB 3QNEA 4RUEA 2Y4UA 4ZHQA 3JAWB 2HVJC 5BR8O 2P22C 1QQCA 3B2EE 3L70H 2CTPA 3JASB 4DR1O 5J2TB 2ZKOA 2QWOB 4YJ3B 5H9CA 5IYDO 4X64O 2EINC 2B5UA 3L75H 2PYJA 5EK0A 4DV5B 2E5LB 2PUSA 1K8AW 2XAJA 1PNMA 3WG7B 4K3AA 4CC5A 2X6CA 2CTWA 4DK1A 1PKXA 3AG1B 1I0HA 5KX5A 1K97A 3P32A 2IJHA 3VQXA 3AEIA 2PY5A 3OMAB 2JGDB 3CJHB 3CXHF 4R8CA 4B3RB 4O4LA 3K9SA 4FK5C 1V54C 4DR7O 4DR3B 2ZE5A 2KG7A 3IFXA 5IJ9B 3SJAC 1FKAO 1FXKA 1AP6A 5K1XA 1QVGU 3B09A 3CRCA 3E83A 1ZWIC 2ILMA 1K34A 3A0HZ 1Y74B 3JCUZ 5EIBC 3ZMZA 5JJEB 5CBFA 4MW3A 2IJIA 4JI0O 3T4ZA 1KMIZ 4DR5B 2N74A 4JF3A 5K1PA 1OCCB 3AG2C 4PA7A 4BR6A 3JATA 3K9AA 5JCOA 2NNUA 3PJSK 3X2QB 1FJGO 2K9PA 3RYIA 2ODMA 1NVPD 4FJCC 3ZHUA 2QTOA 4LH6A 4UV9A 3AG2B 3AG3C 1GO3F 4ZOLB 3ZRWA 2UUCO 2JDIG 1XOUA 1HDJA 4X65O 2X7RB 2JS3A 3CCMV 1WB7A 3MDSA 1F7YA 2UUAB 1K92A 1P84F 1WJZA 5CA0B 4DV0B 1M1KW 3HB3B 1F23A 4WF9V 1N33O 4F6RB 1RM1C 3MAQA 2LO1A 1XDCA 5KMGA 1H2LA 4J7JA 5D5QA 4O4IB 1H8HG 1IBKB 2IH3C 2DWDC 5GONA 1AI7A 2DMXA 3JD4A 2ZCEA 3E2EA 1Y76B 3ZMTA 5LP6C 5KUMA 1OJHA 1Q6HA 1I08A 2WA3A 4QIWF 1PNKA 1UFIA 2LJ2A 5A2QN 1Y66A 3JD2A 1BGYH 2JGUA 1AI5A 5LMUO 1JFFA 1CXZB 4HAMA 3R66A 4OPAA 4LF6O 4O4JA 2EZPA 2OT5A 1AJNA 1GN2A 2V1DA 3ZS8C 1N34O 1K33A 2WLKA 5B3SC 3HKBB 1MSDA 3QTCA 2IU3A 1XL6A 4JI2B 2UXXA 1AP5A 4DV2O 1YITV 1PD3A 4IGGA 4JYAO 3F7YC 1M93A 5L3CA 4DR2O 3QF7A 5B3SB 2RMKB 4J9YB 2ZINA 5H5NA 5C93A 1MZFA 5FLXN 3N2GB 4LFAO 3WU2Z 4E2LA 2EILC 5B1BB 3JARB 3WFVA 4H13B 3W7WA 2QWPB 3CCSV 5IDJA 2RJZA 1XILA 4DUZO 1E1QG 5C8YA 1DF4A 5JQGA 3CCJV 1R73A 1H2GA 2HHHO 2EX3A 4NYKA 1PPJH 4AI8A 2IJJA 2JVDA 1YJWV 4P9OA 1Q8IA 4DV4O 4H33A 4JI8B 5KA5A 1HW7A 3JAKB 2XNDG 4BW5A 3CB2A 4DW1A 2Y69C 2GTSA 1SA0B 4FLXA 1P7GA 1S3JA 4YJ2B 4MS2A 3FAVA 1R6NA 3JSNA 4FLVA 2ARHA 1NKDA 3DGEA 2DE0X 3ABKB 4ASUG 4UVAA 2Y69B 3G6EV 1FPOA 2W6IG 2Y0IA 5DECA 4WFFA 2Q7HA 4JI0B 4E4EA 3S3XA 3J7AU 4UCTA 3Q4HA 3UQ8A 4QNHB 1N36O 4K0KO 2DYSB 4GYCB 4A5UB 1S77D 2YDEA 3SYQA 4TV8A 1OCOB 3ML0A 4OPHA 4L8JA 4DR6B 5ITZA 1XI1A 4GKKB 5J2UA 1G1XB 1R6KA 3TETA 2ZR3A 1MG1A 2IH1C 3A0RA 1EBOA 2D2CB 1N0JA 4MTGA 3OTOB 2ADPA 1XL4A 5EYPB 2GV9A 5IJ0B 2H8PC 4JI6B 2PI4A 3ZHTA 1RSOA 2YEVA 3CE2A 1YVWA 4LF8O 4BAYA 1BQZA 4RQFA 3ICXA 4LF9B 1XNRO 1VEWA 2UU9O 5JJNB 4B3SB 3OUFA 1H38A 1IBLO 1L1FA 4O2BB 1ZL8B 4LF5O 5CA1B 3QVNA 4GT1A 3EHBB 2VQEO 3DXRA 4X1KA 1OCZC 1COWG 2Q7GA 4X20B 4C7UA 4DYLA 2F4VO 3HKEA 4JTCB 4LNUB 3E8HA 3RYFA 1VQ5V 5LHGA 3H1JH 3N27A 3STZC 4BW9A 4EEQA 5L3BA 4XDKA 1SESA 2FYUH 4BIUA 4Z2WA 3WB1A 2LGWA 1K9MW 2EJ7A 2X6AA 1VQOV 3KKYA 3E22A 1XNQO 3FKSG 3IC9A 2R9IA 3TXQA 4CH4A 3K5NA 1E79G 2PTMA 2CTRA 4FM1A 2EIKB 2ZQMA 2GDSA 1GK9A 4I9QA 2P4KA 1J95A 4DRXA 4EB6B 2LW1A 2EBOA 2Z0AA 3ZMSA 1EN4A 1IDSA 3CC4V 4ZKIA 1K7DA 4D7SA 4JYBA 1IZ3A 1MNGA 4J9ZB 5LOVA 3ASNC 1N32O 2DYRB 3H01A 1FAFA 5EBWC 5BXZA 4Q6GA 3CCUV 1HNWB 2JJ2G 3JALA 2CGNA 4FZ1A 4FFBA 1AR4A 3D3QA 1R3IC 1AI4A 2IJKA 3SR2C 3ZN1A 2A3QA 3HKCB 1VF7A 4MVRA 4LFBO 4DV1B 1AILA 1Y67A 2XAHA 4H0LB 2ATKC 4ZHQB 4NVPA 4FLYA 3B40A 5KAFZ 4LFCO 1BMFG 3M7MX 4O2AA 4PDVA 3SJCC 3K0DA 2BOCC 2RDCA 5IWAO 1SQPH 3B8NA 4I4TA 1R3LC 3ABLB 2F23A 4UCUA 3N2KA 1G4YB 5LHIA 4J10A 1JVMA 4OX9O 2OTJV 4PHZA 5LA6A 5CBHA 3WB2A 2BTQA 1AVMA 2RN9A 4TV9A 1Y6XA 4NTYA 5LL6Y 1H8EG 1WLEA 1YJNV 5DM6V 2A79B 1VF5B 2JEXA 1X59A 2XOKG 1B04A 3H1HH 1FXKC 3RYHB 1US6A 4LBEC 1RFYA 4UCRA 1KKCA 4UB8Z 4O4LB 4MTOA 2DOSA 2VQFO 1M57C 1J5EO 4DR4O 2YI8A 1T5EA 5KUKA 4WFBV 1VP7A 4UXNA 1YSCA 4WFEA 5LMNO 3T1HB 3K06A 2A7WA 3B77A 1BSMA 5EIBD 4PA9A 2B9ZA 5EZYA 1DLBA 1O9GA 4X62O 4DV6O 4UCSA 5B5EZ 4UFZA 2ITDC 5JCOC 2KSDA 4QGPA 2UXCB 4KL1A 1K4CC 3BRCA 3DC6A 1P4RA 1AJPA 3I56V 4J80A 3OT7A 2QKCA 1SERA 1WA8B 1WN7A 4B3TB 1BE3H 3MHHC 5E1AC 3E8BA 5EC2C 3RYIB 1Q90D 2Q67A 1RP3B 4MVQA 5FPOA 3OMIB 4DUYO 1X4TA 1Z2GA 2R9AA 1ZUQA 2HKOA 2BOBC 2QSAA 3AG4C 3BA9A 3FB5C 3O65A 3ETDA 1K4DC 3RVYA 1VQ8V 5BY1A 4JAVA 4F6EA 4DV3B 2F66C 3B8MA 4HNAA 1BHBA 1B6QA 3OEHG 4X66B 4KHPB 4WCEV 4AILC 3C3TA 1V9PA 3UT5A 3OAAG 2XUMA 3E89A 1SS3A 3E8GA 1HNZO 3LDDA 5BZBA 2HLDG 2EINB 3K5OA 1N8RW 3U0ZA 3LNNA 4YY3B 1IXMA 2MW2B 4MVUA 2YS8A 4JV5B 5IY5C 2ZNJA 1FS0G 1NTKH 2R72A 3ZMUA 1IBMB 2ZD9A 5KLVH 3RWRD 2R9RB 1CP9A 4PDRA 1XUQA 4LP8A 1QHTA 2Y0PA 2F95B 4NR1A 4F4LA 3RYCA 2IBZH 1BCCH 2M6YA 5IY5B 3ZHRA 1S5LZ 4LF4O 4H37A 1ZTEA 2Z5UA 1E1RG 2B1IA 3T1YO 4JI1O 4YXWG 2CDYA 1B06A 3OR6C 4JI3O 2UXDB 1HWYA 1V54B 2WA4A 5IYBO 3SPIA 3C90A 1GM8A 3RN4A 5LXTA 1R3JC 4I5SA 2Q7EA 1HR0B 3ZHQA 1R6TA 1NR1A 3RGBA 3T4DA 2YUAA 4W4KA 1W2BU 3ETQA 4N23A 1I94O 2Y48A 3MHSC 3ZN0A 3OM3B 3JYCA 4I55B 2QM4A 2VS0A 5B1AC 5C8YB 1EZJA 3I55V 5KHKA 1GTOA 3CMAV 4JI5B 1TA8A 1UPGA 1AJQA 1KQSU 3ZIAG 3AG3B 3OTFA 1DTOA 1VARA 3JD3A 4RWUA 4LF7O 1SQXH 1QR9A 4FIPC 3O9OA 2KKWA 1KKDA 3CMEV 5EC1C 3D36A 3M99B 2X6BA 4HBNA 2L6LA 4U3JB 2PGGA 2WPDG 3F5WC 1KYOF 3C3SA 1I5XA 5L3FA 1RM1B 2DW4A 1FFXA 3SGIA 2ZXWC 3SDLA 4NXMB 3HKDA 3JAWA 3T1CA 4J7KA 1BS3A 3VQWA 3W7SA 1EZVH 2HJFC 2PZSA 3JASA 2ZXWB 4TT3G 2ZNIA 4QJFB 5CA3A 3ZMVA 4LWSB 4P30A 5LP6B 3PN1A 4TQDA 3ABMC 4RUFA 4B3MB 1PL4A 4JYCA 3VOUA 2QDOA 2DJVA 1YEWA 2N04A 3QO7A 5KHJA 1NJIW 3ABMB 1ZX3A 3K0GA 1XMOO 2EJRA 3ZRVA 4X1IA 2KQXA 1NR7A 1RSOB 2UUBO 4I0XA 2YIAA 2JGDA 4FM2A 3FD9A 1GN6A 5BR8B 3BY6A 5EBLC 2FB5A 1W0JG 3CCRV 1GMGA 4UCOA 5CB4A 2P67A 4DR1B 5IJ9A 5DN6G 1PL0A 5IYZA 2AHZA 4X64B 3NXSA 3BA8A 2OIGA 1QVFU 5CMUA 4DXWA 1XMQO 5CBGA 4QPJA 2BSKB 5JH7B 2UXNA 3UCSC 3UM7A 1HNXO 3T2MA 4NB5A 2Q4PA 1GRJA 2EILB 4JI4O 4QE7A 2QM7A 4AHCA 4PI2A 2QTSA 3CC7V 4FLZA 4PELA 3NR7A 3G4SV 2EIJC 3VBBA 3OUSA 2YI9A 5L3EA 1GAXA 4JAUA 4Q20A 5A9GA 1CEZA 4DR7B 1QLEC 1LUWA 3OFNG 3FB6C 4CBCA 2A0LA 4DRXB 2GUZB 3K79A 3TJTA 5EBMC 3UO3A 1R1BA 3SYCA 4YHHO 2ZDIA 4D7TA 2QWQB 2Y4TA 4ZI7B 2JRIA 2WLIB 1M90W 2H94A 1LR1A 4F6RA 1JA8A 4UV8A 2B1GA 4OXSA 3BFRA 5LOVB 5KHIA 1AR1B 1EN6A 4JZGA 4O4IA 5FNVA 5JVDA 1WP8A 2WAMA 3QO5A 4UB6Z 1FJGB 3RFRA 1YXBA 1GKFA 2CGOA 2MK3A 2YXLA 4LR3A 1U97A 5GTHZ 2LQTA 3CCEV 4G27B 3EFFK 2Q69A 4DV7O 4TSFG 1Y76A 2CK3G 3KG2A 2P90A 2UUCB 4PD4F 1AR5A 1KBHA 1BHAA 4X65B 2VWJA 4QPKA 3DC5A 3UKMA 2CE4A 4HYOA 3FX7A 4JZ2A 4XDJA 1OZ0A 2YIBD 3H1KH 2GBOA 3U11A 1N33B 3SJQC 1YDXA 3S3WA 1TVKB 3OGIB 4TWKA 2NR5A 1YF2A 1IXBA 4IYIA 4I50B 5JWPA 4EKWA 1VQ4V 5L3DA 1MZEA 4K8XA 1H2MA 1OCRC 3L74H 1OCZB 4KUMA 1JJOA 3SPJA 3N2GA 4GUNA 4BIZA 1BL8A 3OE7G 1VQNV 4GKJO 3G6BA 2ZM6O 2XHBA 2EIMC 3JARA 5LMUB 3P3PA 4IIJB 4LF6B 1IURA 4CH5A 4AQYO 5BMVB 2ZIMA 1DK1A 1N34B 1SQFA 2EIMB 2LGQA 1JOYA 1G6UA 1O9HA 2DQ3A 1NTMH 1VQLV 2WLNA 3U10A 4DV2B 1N0NA 1VMGA 4JYAB 2BCCH 3OD4A 4DR2B 2JIZG 5LYJA 4Z1VA 1SA0A 3K5MA 3IC7A 4YJ2A 1EFRG 3LDEA 1JJ2U 1SF9A 4XDLA 4LFAB 3CX5F 2ETNA 5LHHA 4DV5O 1MA1A 1V55C 3CXCU 3ZEDA 2E5LO 3AK3A 5B1OA 4R6ZA 5B66Z 4GCZA 1FYJA 3ASNB 1MMMA 1MSWD 1Z5WA 1YHQV 2Q0OC 4WBNA 3LSUA 1MABG 4DUZB 3CRAA 2P06A 1A32A 1XHZA 4NKGB 4X1YA 2HHHB 3KCYA 1FD9A 2AHYA 2EULA 4NTWA 4Z1MG 1YIJV 3OEEG 1KB9F 3AK1A 2FKXA 3M8AA 4U7NA 4DV4B 2CH7A 4B3RO 2XASA 1S5HC 5L3GA 3K08A 3CPWU 1M5IA 2OCHA 2QWNB 3CEIA 4DR3O 3D8CA 2PF4E 4NXNO 4JI7O 2GTAA 2OIEA 1NQTA 1MOFA 2XAFA 1JR9A 4WFAV 2V7QG 1K5QA 1M56C 4X8AA 5IJ0A 4JASA 4FFKA 2VWKA 2HEPA 2WLJA 4GZRB 5B1NA 3H1LH 4DR5O 4TUYA 3DTUB 4O4HA 5KX5B 1N36B 2OCCC 4CZZA 4K0KB 4ICGA 2DWEC 4CS4A 2QKAA 1NZ6A 3CSXA 1TUBA 1ZL8A 4XBFA 1VF6A 1S0VA 2ZE8A 3GB7C 3OMNB 4BWAA 4X20A 3FFQA 3RYCB 3ETGA 1TGOA 2KG7B 4LNUA 4G2KA 2OTLV 1FXKB 1Q43A 2AZ2A 1YTFB 3FB7C 3L9DA 1K3EA 1M57B 1KP2A 2UUAO 2L35A 4PJ0Z 2XT9A 1NT2B 2M7WA 3TCUA 3KCXA 1L8DA 3A0BZ 3JD0A 4LF8B 2WLMA 4FLTA 2AGAA 3EXAA 1XNRB 2UU9B 2HFEC 3CWBH 3G71V 3JATB 1IBLB 3BCCH 1L0LH 1WP7A 1IBKO 4LF5B 2VQEB 4EB6A 4K8ZA 1G8MA 4JGSA 2OYQA 1JQ0A 3BEHA 3F7VC 2F4VB 1LUVA 5J9PC 5TISZ 3ZRWB 2V4DA 1FXHA 2IM9A 4P9PA 3P30A 2QR4A 3ZBHA 3D36C 1H2SB 2AW9A 4GKJB 4CH6A 3BVOA 3THOA 1XNQB 3AG4B 4GX0A 2OWOA 4PA3A 3FB8C 5KMGB 4QE9A 2XAGA 3SYAA 4BIOA 3K57A 1F4MA 4FLUA 4U3FH 2HJDA 1L0NH 2GHYA 5HFMA 4FPPA 3BAAA 1FFXB 1WPXA 5GONB 3CP1A 3HPLC 1I5YA 2W6JG 4JI2O 1VQMV 4PDLA 2YXYA 4FVMA 2QJ1A 2NLJC 3LNMB 4IL6Z 4MVSA 3ZCCA 3WG7C 2QGNA 2JJ1G 1N32B 1WB8A 1QR8A 3AG1C 1KD1W 2YIBA 5JJJB 5E79Z 3P3NA 1JFFB 1ZSPA 1W0KG 1IVSA 1SKVA 4O4JB 3CCQV 4MW8A 3KZIZ 4CS2A 3ZHSA 3GWKC 4X1IB 4DK0A 4LFBB 4YIPA 4I0XB 4MTFA 3BPZA 2LP7A 3RYHA 2WLLA 4LFCB 4ZIBA 4JI8O 5CB4B 3E8FA 3VQYA 5IWAB 5H6QA 5GW7A 3UO2A 4NXNB 2YC0A 4JI7B 4K35A 2H3OA 3TGUH 5KHGA 5IYZB 3AG7A 3K3WA 1HP8A 1Y4MA 4X89A 2PI5A 4OX9B 4GLXA 5LGNA 1OCCC 1Q6IA 2FMLA 3CCLV 1VIBA 4RO2A 3E86A 3X2QC 2BE3A 1NH2B 2QWRB 1QBZA 5LBQA 2WWWA 1H2NA 5JQGB 4FMTA 1WA8A 3E35A 3OR7C 4JTAB 2YXHA 4B08A 1KC8W 1NU1H 2W0XA 2CTQA 3D3IA 3STLC 4MTXA 2WLHA 5KHHA 3JAMN 2QE7G 5H6RA 1Q82W 2VQFB 5B1AB 2HG5C 2XTAA 1J5EB 2ZDIC 4DR4B 4DR6O 3ZRXA 1PNLA 5GTIZ 3JCZA 3ABTA 4KP4A 4FLWA 5LMNB 2RCVA 4GKKO 3FAVB 4IHJA 3CRRA 3FYEB 4X62B 4DV6B 3OTOO 1ENVA 1QCEA 2FTKA 1JCHA 2Q8VA 3W7TA 1RPRA 4JI6O 2K1EA 1SETA 2IU0A 3Q4HB 1NTZH 3CYOA 4EFBA 4LF9O 3H9VA 2LFRA 3B4SA 2HP8A 5FNVB 4HZ3A 5JVDB 1F4NA 5J2TA 4B3SO 3GWOA 4TV8B 4YJ3A 1ZAUA 4MVOA 4DUYB 1D5AA 5ITZB 3QG5A 4MVZA 5J2UB 4DW0A 2AXTZ 3GVMA 3A2FA 4ZBMA 2Z3YA 2D3OW 4MT8A 1VQ9V 1EM1A 2YEVB 5LGTA 3CJHA 2LW7A 2Q68A 1CPYA 4KFMA 2GSMB 1SRYA 1EN5A 2HR3A 1SC5B 3CRMA 3DXRB 4X1KB 4WFHA 3J81N 3LSSA 2ZE7A 4J7ZA 1Y74A 4EFEA 1HNZB 3HKEB 2HVKC 3JD1A 1BQ0A 3RYFB 4PV1B 5B1BC 4CS3A 4P2ZA 1Q86W 3BABA 3CS5A 1K73W 1ZLZA 2E3CA 3F5TA 1GM9A 1RPOA 3A8TA 1HNWO 2QA4V 1XHXA 1I7FA 3E22B 4J11A 4UCVA 2E74B 1BT8A 3FYIB 4I55A 3L72H 4LF4B 4KXRA 4I7ZB 4ZOLA 3T1YB 4JI1B 1XEQA 2EIJB 3SYPA 1PV0A 4DV1O 1H2KA 1NVPB 4JI3B 1QLEB 2F43G 5CA0A 3ABKC 2ADQB 1GM7A 1D5NA 5LYJB 4JTDB 4LH7A 3SJBC 2Q6AA 3TK1A 1URFA 4UVCA 4U3JA 1QU7A 2YIDA 1IX9A 1TAEA 3JALB 1Z5VA 2NN4A 2DYSC 4FFBB 2UXBO 1I94B 2AZ0A 4NTXA 4WBNB 1OCOC 3RT3C 2QM8A 4X1YB 2XAQA 3CRQA 2CH7B 4G28B 4LWSA 5FPRA 3G67A 1JMKC 5LP6A 4LF7B 1UJWB 1GN4A 1KU9A 4O2AB 1S72V 1GH6A 4I4TB 2Q9LA 4PDMA 2JEUA 1W59A 4JYYA 4X9QA 3N2KB 1DGSA 1B3QA 3T1HO 1SQVH 4CH3A 2A06H 2PYLA 1KP3A 5IT9N 1LNQA 2YSUB 2DN9A 5LA6B 1Q3EA 4LCUC 1PP9H 1S5JA 2BTQB 3HKBA 3SPCA 2CAZC 4ABMA 2UXCO 2YICA 3AK2A 4TV9B 3W7XA 1VF6C 1YI2V 2LFSA 4TUYB 1WAZA 4JAAA 3ZX6A 4RQEA 3JSLA 4O4HB 4GX5A 3J80N 4B3TO 3SYOA 3LUTB 4H44B 4UVBA 4L87A 4UUJC 1YTFD 3LSQA 1FXVA 1N4CA 2VRZA 1TUBB 1Q81W 1SQGA 3WB0A 3K59A 1NS1A 1OCRB 2RNBA 2BSKA 5JH7A 3ETEA 2R70A 4J42A 2ITCC 3ZJZA 3I5DA 1BZKA 4GX1A 5EZYB 2BTOA 4OGQB 1DF5A 1XMOB 2P7TC 2Q0AA 1VQ6V 2F93B 2EIKC 2UUBB 3APQA 1PM9A 3CCVV 1SQQH 3IJ4A 3R65A 5CN0A 5IE9A 3IGAC 1AI6A 1WNSA 4PA6A 4DV3O 2EZOA 3JAKA 1Q6UA 1OV9A 1OHHG 4X66O 1QNMA 5AG2A 2P4VA 4KHPO 4PI0A 1NI8A 1VQPV 1Q7YW 2GUZA 3SPHA 1XMQB 5D5PA 2FL4A 4B7EA 2JK5C 2DYRC 2A9HA 4TOIA 4ZI7A 4IYHA 2WLIA 2DQ0A 1HNXB 1NBMG 3G80A 1AB3A 4YY3O 3ASOC 4JI4B 1YCIA 1V55B 3K04A 3K58A 4JV5O 1QLNA 3H1IH 1WPBA 3K5LA 3CC2V 1IBMO 1F51A 1VQ7V 1JPXA 4R50A 3HR0A 3ASOB 3RBZA 1S76D 2ZT9B 5FL7G 4HNAB 4PA4A 2KB1A 3BHPA 4D6TH 1SZTA 4X88A 5H2FZ 3RW0A 2Q73A 3OGCC 3ABLC 3UT5B 4YHHB 2G38A 5EYPA 4JPRA 2UXDO 1FFTB 1R3KC 4WFGA 3OW2U 5IYCO 2E76B 2ZE6A 3CHXA 1U96A 1TUEB 1SZXA 1ORQC 3MD0A 1VQKV 3ABUA 2O57A 4B7KA 1TVKA 3DSQA 1D2DA 1M56B 1KUQA 4I9WA 1HR0O 3APOA 2WSSG 3CD6V 4O2BA 5CA1A 2RQ6A 2QEXV 1M4UA 4I50A 2UXBB 4DO2A 5HFLA 2P5OA 2OCCB 4YIOA 4DV7B
chains in the Genus database with same CATH topology
1W0JG 3CCRV 1GMGA 4MTFA 2LP7A 2P67A 4GT1A 3EHBB 2C2AA 1OCZC 4MVMA 1COWG 2WLLA 1K5SA 5DN6G 1PL0A 4U7OA 2AHZA 2ZR2A 3NXSA 4JTCB 3E8FA 1YJ9V 2W0FC 3E8HA 1QVFU 5H6QA 5GW7A 1VQ5V 5LHGA 2WLLB 5CMUA 4DXWA 3STZC 3K3WA 5CBGA 3W7UA 1Y4MA 5L3BA 4QPJA 4XDKA 1SESA 4X89A 2P6JA 4BIUA 2UXNA 2PI5A 3UM7A 5LGNA 1K9MW 1OCCC 1NH2D 3T2MA 3CCLV 2X6AA 4RO2A 3SPGA 3E86A 4R7CA 3X2QC 1VQOV 2EILB 4QE7A 3FKSG 2QM7A 2R9IA 1NH2B 1P7BA 1E79G 1QBZA 5LBQA 2WWWA 2IW5A 3CC7V 4FMTA 2EIKB 4PELA 2ZQMA 3G4SV 1KECA 2EIJC 3E35A 3OUSA 3VBBA 1GK9A 5L3EA 3OR7C 4JAUA 1ROPA 3LDCA 4Q20A 3QO8A 4JTAB 1CEZA 2X0LA 1J95A 1KC8W 2QKSA 2EBOA 3D3IA 1QLEC 3STLC 4MTXA 2WLHA 1THZA 3OFNG 3FB6C 3ZMSA 3RVZA 2QE7G 5H6RA 4CBCA 1Q82W 5B1AB 2HG5C 2A0LA 2ZDIC 1JX9A 3ZRXA 3CC4V 3K03A 3K79A 4ZKIA 4MSWC 1K7DA 1PNLA 5EBMC 3JCZA 3ABTA 1AROP 4KP4A 3SYCA 2ZDIA 4JYBA 4J9ZB 2WLIB 3ASNC 4RAIA 1M90W 3ZRSA 2H94A 2DYRB 3FYEB 3H01A 5EBWC 1ENVA 3CCUV 1M9NA 4UV8A 2B1GA 4N21A 1QCEA 2FTKA 1JCHA 4OXSA 5KA6A 3W7TA 1RPRA 2JJ2G 2K1EA 4GX2A 1SETA 4LC1A 2IU0A 1AR1B 1R3IC 1AI4A 2IJKA 2WAMA 3QO5A 1GKFA 2MK3A 3CYOA 3ZN1A 5LGUA 2LFRA 3QNEA 3CCEV 4RUEA 4G27B 4HZ3A 1F4NA 3GWOA 2HVJC 4MVRA 3EFFK 2Q69A 4TSFG 4MVOA 2CK3G 2XAHA 2P90A 3KG2A 2ATKC 1BHAA 1BMFG 5H9CA 4QPKA 3UKMA 4PDVA 5IYDO 2EINC 3K0DA 4MVZA 2BOCC 4HYOA 2B5UA 3B8NA 4XDJA 1OZ0A 1R3LC 5EK0A 3ABLB 4ZBMA 2Z3YA 1G4YB 5LHIA 1K8AW 2D3OW 2XAJA 1PNMA 4MT8A 3SJQC 1JVMA 1VQ9V 3WG7B 2X6CA 2YEVB 5LGTA 2OTJV 1PKXA 3AG1B 1K97A 5CBHA 4TWKA 3P32A 2IJHA 3AEIA 2Q68A 1CPYA 4KFMA 2GSMB 3OMAB 1SRYA 1H8EG 1WLEA 4R8CA 1YJNV 5DM6V 2A79B 2JEXA 2HR3A 4FK5C 2XOKG 4EKWA 1FXKC 1VQ4V 5L3DA 1V54C 4LBEC 4WFHA 3IFXA 3LSSA 1FXKA 1OCRC 4MTOA 1QVGU 1M57C 1OCZB 2HVKC 3JD1A 3E83A 1ZWIC 4KUMA 5KUKA 1K34A 3SPJA 4WFBV 5B1BC 4UXNA 1YSCA 4P2ZA 1BL8A 3OE7G 4WFEA 4BIZA 3ZMZA 1Q86W 1VQNV 5CBFA 3K06A 1K73W 3B77A 2EIMC 1GM9A 1RPOA 4PA9A 4MW3A 1DLBA 2IJIA 3T4ZA 2ITDC 4JF3A 2QA4V 1OCCB 3AG2C 4PA7A 1K4CC 3K9AA 2NNUA 2EIMB 3FYIB 3PJSK 3X2QB 1JOYA 1P4RA 1AJPA 3I56V 2DQ3A 1SERA 1NVPD 3MHHC 4FJCC 5E1AC 1VQLV 2QTOA 2WLNA 4UV9A 3AG2B 3AG3C 3E8BA 2EIJB 5EC2C 3SYPA 2Q67A 1GO3F 1NVPB 2JIZG 4MVQA 3ZRWA 1QLEB 2F43G 2JDIG 3ABKC 3IC7A 3OMIB 1EFRG 2X7RB 3CCMV 3LDEA 1GM7A 1JJ2U 4XDLA 4JTDB 2HKOA 2BOBC 1K92A 5LHHA 1M1KW 3AG4C 1V55C 3HB3B 3CXCU 1F23A 2Q6AA 3TK1A 4WF9V 5B1OA 3FB5C 4R6ZA 4UVCA 3ETDA 1RM1C 4GCZA 3ASNB 1MSWD 1YHQV 1K4DC 3RVYA 1MABG 2DYSC 1VQ8V 1H8HG 4JAVA 2AHYA 1OCOC 1YIJV 4Z1MG 2IH3C 2QM8A 3B8MA 3OEEG 2DWDC 4U7NA 1BHBA 2XASA 1B6QA 1AI7A 1S5HC 3OEHG 2XAQA 3JD4A 5L3GA 3K08A 3E2EA 4WCEV 3CPWU 3ZMTA 5KUMA 4G28B 3OAAG 3E89A 3E8GA 1UJWB 1S72V 3LDDA 1NQTA 1MOFA 2XAFA 4QIWF 5BZBA 1PNKA 2HLDG 4PDMA 4WFAV 2JEUA 2V7QG 2EINB 1K5QA 1N8RW 1M56C 4X8AA 4JASA 1Y66A 3JD2A 1IXMA 2WLJA 1AI5A 4MVUA 1KP3A 5B1NA 1LNQA 2YSUB 4HAMA 5IY5C 1FS0G 3DTUB 3ZMUA 2EZPA 2ZD9A 2OT5A 4LCUC 1AJNA 2OCCC 4CZZA 2R9RB 3SPCA 2V1DA 1CP9A 4PDRA 2DWEC 4LP8A 3W7XA 1YI2V 2LFSA 4RQEA 4F4LA 4GX5A 1K33A 2WLKA 5B3SC 5IY5B 4XBFA 2IU3A 1S0VA 1XL6A 3SYOA 3LUTB 3GB7C 3OMNB 4H37A 2UXXA 4UVBA 2Z5UA 1E1RG 4L87A 4UUJC 2B1IA 1YTFD 3ETGA 3LSQA 1FXVA 1YITV 1PD3A 1Q81W 3F7YC 4YXWG 4G2KA 3OR6C 2OTLV 1FXKB 5L3CA 1HWYA 1V54B 5IYBO 5B3SB 4J9YB 1YTFB 3SPIA 3FB7C 1OCRB 1GM8A 1R3JC 5C93A 1K3EA 1M57B 4I5SA 1KP2A 3ETEA 4E2LA 2EILC 2M7WA 5B1BB 3TCUA 3WFVA 3W7WA 2ITCC 3ZJZA 3JD0A 4GX1A 1DF5A 2WLMA 2P7TC 1NR1A 3CCSV 1VQ6V 5IDJA 3T4DA 2EIKC 3CCVV 2HFEC 1E1QG 1W2BU 3G71V 1DF4A 3R65A 4N23A 3CCJV 1R73A 2Y48A 3MHSC 3IGAC 1H2GA 5CN0A 1AI6A 3ZN0A 3OM3B 3JYCA 4PA6A 2EZOA 2IJJA 5B1AC 1YJWV 4P9OA 1G8MA 1EZJA 3I55V 1GTOA 4JGSA 3CMAV 4H33A 1OHHG 1JQ0A 3BEHA 3F7VC 5KA5A 5J9PC 1VQPV 1Q7YW 2XNDG 4BW5A 1AJQA 2Y69C 1KQSU 3ZIAG 3AG3B 3ZRWB 1FXHA 1DTOA 3SPHA 4P9PA 1S3JA 3JD3A 3P30A 2JK5C 4MS2A 2DYRC 2A9HA 1R6NA 1QR9A 1NKDA 3DGEA 4FIPC 3ABKB 2WLIA 4ASUG 1KKDA 2DQ0A 3CMEV 1NBMG 4UVAA 2Y69B 3G6EV 5EC1C 3D36A 3M99B 2X6BA 2W6IG 3ASOC 2WPDG 3F5WC 4WFFA 3AG4B 1V55B 3K04A 4GX0A 1I5XA 1QLNA 4PA3A 3FB8C 5L3FA 4QE9A 1RM1B 3CC2V 2XAGA 2DW4A 1F51A 3SYAA 4QNHB 2ZXWC 1VQ7V 1JPXA 1F4MA 4R50A 2DYSB 3ASOB 3RBZA 1S77D 3T1CA 2GHYA 5HFMA 1S76D 3SYQA 4FPPA 3W7SA 5FL7G 2HJFC 1WPXA 1OCOB 3ML0A 3CP1A 3HPLC 1I5YA 4PA4A 2KB1A 2W6JG 1VQMV 1SZTA 4PDLA 4X88A 2ZXWB 3RW0A 4TT3G 4QJFB 5CA3A 3OGCC 3ABLC 2NLJC 3ZMVA 4P30A 3LNMB 4JPRA 5EBLC 1FFTB 1R3KC 4WFGA 1R6KA 3OW2U 3ABMC 3TETA 4MVSA 2ZR3A 1MG1A 2IH1C 5IYCO 4RUFA 3ZCCA 3WG7C 2JJ1G 3A0RA 1EBOA 4JYCA 3VOUA 4MTGA 1TUEB 1QR8A 1XL4A 1ORQC 3AG1C 1KD1W 3MD0A 1VQKV 2H8PC 2PI4A 3ABUA 2YEVA 3QO7A 1NJIW 1M56B 3ABMB 1W0KG 4I9WA 3K0GA 2EJRA 4BAYA 3ZRVA 2WSSG 4RQFA 3CD6V 1NR7A 3CCQV 4MW8A 2QEXV 4DO2A 3OUFA 1H38A 5HFLA 3BY6A 2OCCB 1L1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIK C;  3AG4 C;  1V55 C;  2Q6A A;  4MTF A;  3FB5 C;  4PDV A;  2HFE C;  3UKM A;  2EIN C;  3K0D A;  4MVZ A;  3R65 A;  4R6Z A;  2BOC C;  1OCZ C;  4HYO A;  4MVM A;  4XDJ A;  2WLL A;  3IGA C;  1R3L C;  5EK0 A;  1K4D C;  2AHZ A;  3JYC A;  4PA6 A;  4ZBM A;  1G4Y B;  3RVY A;  2DYS C;  4JTC B;  3E8F A;  5B1A C;  4P9O A;  2W0F C;  3E8H A;  3SJQ C;  1JVM A;  2WLL B;  4H33 A;  2AHY A;  4DXW A;  3F7V C;  3BEH A;  1OCO C;  2X6C A;  3STZ C;  5CBG A;  5J9P C;  2IH3 C;  4XDK A;  2DWD C;  4BW5 A;  4X89 A;  5CBH A;  2Y69 C;  4TWK A;  1S5H C;  3SPH A;  3UM7 A;  4P9P A;  2Q68 A;  1OCC C;  4MS2 A;  2JK5 C;  4KFM A;  3T2M A;  2DYR C;  2A9H A;  3K08 A;  2X6A A;  4RO2 A;  3SPG A;  3E86 A;  5KUM A;  4R7C A;  3X2Q C;  4R8C A;  2WLI A;  1KKD A;  4QE7 A;  4G28 B;  2A79 B;  4EKW A;  3E89 A;  1P7B A;  3E8G A;  5EC1 C;  2X6B A;  1V54 C;  3ASO C;  3LDD A;  4LBE C;  5BZB A;  3F5W C;  4WFH A;  4WFF A;  3K04 A;  3IFX A;  4GX0 A;  2EIJ C;  3OUS A;  4PDM A;  1OCR C;  3OR7 C;  3LDC A;  4MTO A;  4JTA B;  4PA3 A;  3FB8 C;  1M56 C;  1M57 C;  4QE9 A;  4X8A A;  1J95 A;  2HVK C;  3E83 A;  1ZWI C;  2QKS A;  3SYA A;  4QNH B;  2WLJ A;  1QLE C;  3STL C;  3SPJ A;  2ZXW C;  4MVU A;  2WLH A;  5B1B C;  4R50 A;  5KUK A;  3FB6 C;  3RVZ A;  4P2Z A;  1BL8 A;  1LNQ A;  4WFE A;  4CBC A;  3RBZ A;  2HG5 C;  5IY5 C;  5CBF A;  2A0L A;  3K06 A;  3T1C A;  2ZD9 A;  3SYQ A;  2EIM C;  3K03 A;  4LCU C;  2HJF C;  4PA9 A;  4MSW C;  2OCC C;  5EBM C;  2R9R B;  3SPC A;  3HPL C;  4PA4 A;  3SYC A;  4MW3 A;  2KB1 A;  3T4Z A;  4PDR A;  2DWE C;  4LP8 A;  4PDL A;  4X88 A;  2ITD C;  3RW0 A;  4J9Z B;  4F4L A;  4GX5 A;  2WLI B;  2WLK A;  3ASN C;  4RAI A;  3ZRS A;  3OGC C;  5B3S C;  3ABL C;  3AG2 C;  2NLJ C;  4P30 A;  4PA7 A;  1XL6 A;  3LNM B;  1K4C C;  3GB7 C;  3LUT B;  5EBW C;  4H37 A;  3PJS K;  3SYO A;  1R3K C;  4WFG A;  3ABM C;  4OXS A;  4MVS A;  3TET A;  4UUJ C;  2IH1 C;  2K1E A;  4RUF A;  3WG7 C;  4GX2 A;  3VOU A;  4MTG A;  3F7Y C;  3OR6 C;  1XL4 A;  5E1A C;  1R3I C;  1ORQ C;  3AG1 C;  2QTO A;  2WLN A;  2H8P C;  4J9Y B;  3AG3 C;  3E8B A;  5EC2 C;  2YEV A;  3FB7 C;  3SPI A;  3SYP A;  2Q67 A;  1R3J C;  4RUE A;  4G27 B;  4I9W A;  3K0G A;  4MVQ A;  4HZ3 A;  2HVJ C;  4MVR A;  3ABK C;  2EIL C;  3TCU A;  3EFF K;  2Q69 A;  2ITC C;  3ZJZ A;  4MW8 A;  3LDE A;  4GX1 A;  4MVO A;  3KG2 A;  2WLM A;  4XDL A;  2P7T C;  3OUF A;  2ATK C;  4JTD B;  2BOB C;  5EBL C;  3T4D A; 
#chains in the Genus database with same CATH topology
 1YZB A;  5KAI Z;  2C2A A;  4MVM A;  4TQF A;  1K5S A;  1XQ8 A;  4FM0 A;  4JI5 O;  4U7O A;  2ZR2 A;  2F1M A;  1YJ9 V;  2W0F C;  1Q5O A;  2WLL B;  4DV0 O;  3W7U A;  5LXT B;  3L73 H;  2P6J A;  1XRE A;  4IIJ A;  1NH2 D;  3SPG A;  4R7C A;  5BMV A;  3TXS A;  2N05 A;  3EVK A;  3VQV A;  1P7B A;  3IAY A;  2IW5 A;  2ZIO A;  1KEC A;  4NXM O;  2Q5Z A;  1ROP A;  3LDC A;  2E75 B;  3QO8 A;  3L71 H;  2X0L A;  2QKS A;  1SQB H;  2CUG A;  1THZ A;  3ZHV A;  3RVZ A;  5F2V O;  1JX9 A;  4FZ0 A;  4W4L A;  3K03 A;  2JS5 A;  4MSW C;  1ARO P;  1P49 A;  2ZM6 B;  1XBL A;  4RAI A;  4B3M O;  3ZRS A;  4J41 A;  1M9N A;  4IHJ B;  5DED A;  4N21 A;  5KA6 A;  4CC6 A;  4AQY B;  1GN3 A;  4GX2 A;  4LC1 A;  3HKC A;  4IT5 A;  5LGU A;  3HKD B;  3QNE A;  4RUE A;  2Y4U A;  4ZHQ A;  3JAW B;  2HVJ C;  5BR8 O;  2P22 C;  1QQC A;  3B2E E;  3L70 H;  2CTP A;  3JAS B;  4DR1 O;  5J2T B;  2ZKO A;  2QWO B;  4YJ3 B;  5H9C A;  5IYD O;  4X64 O;  2EIN C;  2B5U A;  3L75 H;  2PYJ A;  5EK0 A;  4DV5 B;  2E5L B;  2PUS A;  1K8A W;  2XAJ A;  1PNM A;  3WG7 B;  4K3A A;  4CC5 A;  2X6C A;  2CTW A;  4DK1 A;  1PKX A;  3AG1 B;  1I0H A;  5KX5 A;  1K97 A;  3P32 A;  2IJH A;  3VQX A;  3AEI A;  2PY5 A;  3OMA B;  2JGD B;  3CJH B;  3CXH F;  4R8C A;  4B3R B;  4O4L A;  3K9S A;  4FK5 C;  1V54 C;  4DR7 O;  4DR3 B;  2ZE5 A;  2KG7 A;  3IFX A;  5IJ9 B;  3SJA C;  1FKA O;  1FXK A;  1AP6 A;  5K1X A;  1QVG U;  3B09 A;  3CRC A;  3E83 A;  1ZWI C;  2ILM A;  1K34 A;  3A0H Z;  1Y74 B;  3JCU Z;  5EIB C;  3ZMZ A;  5JJE B;  5CBF A;  4MW3 A;  2IJI A;  4JI0 O;  3T4Z A;  1KMI Z;  4DR5 B;  2N74 A;  4JF3 A;  5K1P A;  1OCC B;  3AG2 C;  4PA7 A;  4BR6 A;  3JAT A;  3K9A A;  5JCO A;  2NNU A;  3PJS K;  3X2Q B;  1FJG O;  2K9P A;  3RYI A;  2ODM A;  1NVP D;  4FJC C;  3ZHU A;  2QTO A;  4LH6 A;  4UV9 A;  3AG2 B;  3AG3 C;  1GO3 F;  4ZOL B;  3ZRW A;  2UUC O;  2JDI G;  1XOU A;  1HDJ A;  4X65 O;  2X7R B;  2JS3 A;  3CCM V;  1WB7 A;  3MDS A;  1F7Y A;  2UUA B;  1K92 A;  1P84 F;  1WJZ A;  5CA0 B;  4DV0 B;  1M1K W;  3HB3 B;  1F23 A;  4WF9 V;  1N33 O;  4F6R B;  1RM1 C;  3MAQ A;  2LO1 A;  1XDC A;  5KMG A;  1H2L A;  4J7J A;  5D5Q A;  4O4I B;  1H8H G;  1IBK B;  2IH3 C;  2DWD C;  5GON A;  1AI7 A;  2DMX A;  3JD4 A;  2ZCE A;  3E2E A;  1Y76 B;  3ZMT A;  5LP6 C;  5KUM A;  1OJH A;  1Q6H A;  1I08 A;  2WA3 A;  4QIW F;  1PNK A;  1UFI A;  2LJ2 A;  5A2Q N;  1Y66 A;  3JD2 A;  1BGY H;  2JGU A;  1AI5 A;  5LMU O;  1JFF A;  1CXZ B;  4HAM A;  3R66 A;  4OPA A;  4LF6 O;  4O4J A;  2EZP A;  2OT5 A;  1AJN A;  1GN2 A;  2V1D A;  3ZS8 C;  1N34 O;  1K33 A;  2WLK A;  5B3S C;  3HKB B;  1MSD A;  3QTC A;  2IU3 A;  1XL6 A;  4JI2 B;  2UXX A;  1AP5 A;  4DV2 O;  1YIT V;  1PD3 A;  4IGG A;  4JYA O;  3F7Y C;  1M93 A;  5L3C A;  4DR2 O;  3QF7 A;  5B3S B;  2RMK B;  4J9Y B;  2ZIN A;  5H5N A;  5C93 A;  1MZF A;  5FLX N;  3N2G B;  4LFA O;  3WU2 Z;  4E2L A;  2EIL C;  5B1B B;  3JAR B;  3WFV A;  4H13 B;  3W7W A;  2QWP B;  3CCS V;  5IDJ A;  2RJZ A;  1XIL A;  4DUZ O;  1E1Q G;  5C8Y A;  1DF4 A;  5JQG A;  3CCJ V;  1R73 A;  1H2G A;  2HHH O;  2EX3 A;  4NYK A;  1PPJ H;  4AI8 A;  2IJJ A;  2JVD A;  1YJW V;  4P9O A;  1Q8I A;  4DV4 O;  4H33 A;  4JI8 B;  5KA5 A;  1HW7 A;  3JAK B;  2XND G;  4BW5 A;  3CB2 A;  4DW1 A;  2Y69 C;  2GTS A;  1SA0 B;  4FLX A;  1P7G A;  1S3J A;  4YJ2 B;  4MS2 A;  3FAV A;  1R6N A;  3JSN A;  4FLV A;  2ARH A;  1NKD A;  3DGE A;  2DE0 X;  3ABK B;  4ASU G;  4UVA A;  2Y69 B;  3G6E V;  1FPO A;  2W6I G;  2Y0I A;  5DEC A;  4WFF A;  2Q7H A;  4JI0 B;  4E4E A;  3S3X A;  3J7A U;  4UCT A;  3Q4H A;  3UQ8 A;  4QNH B;  1N36 O;  4K0K O;  2DYS B;  4GYC B;  4A5U B;  1S77 D;  2YDE A;  3SYQ A;  4TV8 A;  1OCO B;  3ML0 A;  4OPH A;  4L8J A;  4DR6 B;  5ITZ A;  1XI1 A;  4GKK B;  5J2U A;  1G1X B;  1R6K A;  3TET A;  2ZR3 A;  1MG1 A;  2IH1 C;  3A0R A;  1EBO A;  2D2C B;  1N0J A;  4MTG A;  3OTO B;  2ADP A;  1XL4 A;  5EYP B;  2GV9 A;  5IJ0 B;  2H8P C;  4JI6 B;  2PI4 A;  3ZHT A;  1RSO A;  2YEV A;  3CE2 A;  1YVW A;  4LF8 O;  4BAY A;  1BQZ A;  4RQF A;  3ICX A;  4LF9 B;  1XNR O;  1VEW A;  2UU9 O;  5JJN B;  4B3S B;  3OUF A;  1H38 A;  1IBL O;  1L1F A;  4O2B B;  1ZL8 B;  4LF5 O;  5CA1 B;  3QVN A;  4GT1 A;  3EHB B;  2VQE O;  3DXR A;  4X1K A;  1OCZ C;  1COW G;  2Q7G A;  4X20 B;  4C7U A;  4DYL A;  2F4V O;  3HKE A;  4JTC B;  4LNU B;  3E8H A;  3RYF A;  1VQ5 V;  5LHG A;  3H1J H;  3N27 A;  3STZ C;  4BW9 A;  4EEQ A;  5L3B A;  4XDK A;  1SES A;  2FYU H;  4BIU A;  4Z2W A;  3WB1 A;  2LGW A;  1K9M W;  2EJ7 A;  2X6A A;  1VQO V;  3KKY A;  3E22 A;  1XNQ O;  3FKS G;  3IC9 A;  2R9I A;  3TXQ A;  4CH4 A;  3K5N A;  1E79 G;  2PTM A;  2CTR A;  4FM1 A;  2EIK B;  2ZQM A;  2GDS A;  1GK9 A;  4I9Q A;  2P4K A;  1J95 A;  4DRX A;  4EB6 B;  2LW1 A;  2EBO A;  2Z0A A;  3ZMS A;  1EN4 A;  1IDS A;  3CC4 V;  4ZKI A;  1K7D A;  4D7S A;  4JYB A;  1IZ3 A;  1MNG A;  4J9Z B;  5LOV A;  3ASN C;  1N32 O;  2DYR B;  3H01 A;  1FAF A;  5EBW C;  5BXZ A;  4Q6G A;  3CCU V;  1HNW B;  2JJ2 G;  3JAL A;  2CGN A;  4FZ1 A;  4FFB A;  1AR4 A;  3D3Q A;  1R3I C;  1AI4 A;  2IJK A;  3SR2 C;  3ZN1 A;  2A3Q A;  3HKC B;  1VF7 A;  4MVR A;  4LFB O;  4DV1 B;  1AIL A;  1Y67 A;  2XAH A;  4H0L B;  2ATK C;  4ZHQ B;  4NVP A;  4FLY A;  3B40 A;  5KAF Z;  4LFC O;  1BMF G;  3M7M X;  4O2A A;  4PDV A;  3SJC C;  3K0D A;  2BOC C;  2RDC A;  5IWA O;  1SQP H;  3B8N A;  4I4T A;  1R3L C;  3ABL B;  2F23 A;  4UCU A;  3N2K A;  1G4Y B;  5LHI A;  4J10 A;  1JVM A;  4OX9 O;  2OTJ V;  4PHZ A;  5LA6 A;  5CBH A;  3WB2 A;  2BTQ A;  1AVM A;  2RN9 A;  4TV9 A;  1Y6X A;  4NTY A;  5LL6 Y;  1H8E G;  1WLE A;  1YJN V;  5DM6 V;  2A79 B;  1VF5 B;  2JEX A;  1X59 A;  2XOK G;  1B04 A;  3H1H H;  1FXK C;  3RYH B;  1US6 A;  4LBE C;  1RFY A;  4UCR A;  1KKC A;  4UB8 Z;  4O4L B;  4MTO A;  2DOS A;  2VQF O;  1M57 C;  1J5E O;  4DR4 O;  2YI8 A;  1T5E A;  5KUK A;  4WFB V;  1VP7 A;  4UXN A;  1YSC A;  4WFE A;  5LMN O;  3T1H B;  3K06 A;  2A7W A;  3B77 A;  1BSM A;  5EIB D;  4PA9 A;  2B9Z A;  5EZY A;  1DLB A;  1O9G A;  4X62 O;  4DV6 O;  4UCS A;  5B5E Z;  4UFZ A;  2ITD C;  5JCO C;  2KSD A;  4QGP A;  2UXC B;  4KL1 A;  1K4C C;  3BRC A;  3DC6 A;  1P4R A;  1AJP A;  3I56 V;  4J80 A;  3OT7 A;  2QKC A;  1SER A;  1WA8 B;  1WN7 A;  4B3T B;  1BE3 H;  3MHH C;  5E1A C;  3E8B A;  5EC2 C;  3RYI B;  1Q90 D;  2Q67 A;  1RP3 B;  4MVQ A;  5FPO A;  3OMI B;  4DUY O;  1X4T A;  1Z2G A;  2R9A A;  1ZUQ A;  2HKO A;  2BOB C;  2QSA A;  3AG4 C;  3BA9 A;  3FB5 C;  3O65 A;  3ETD A;  1K4D C;  3RVY A;  1VQ8 V;  5BY1 A;  4JAV A;  4F6E A;  4DV3 B;  2F66 C;  3B8M A;  4HNA A;  1BHB A;  1B6Q A;  3OEH G;  4X66 B;  4KHP B;  4WCE V;  4AIL C;  3C3T A;  1V9P A;  3UT5 A;  3OAA G;  2XUM A;  3E89 A;  1SS3 A;  3E8G A;  1HNZ O;  3LDD A;  5BZB A;  2HLD G;  2EIN B;  3K5O A;  1N8R W;  3U0Z A;  3LNN A;  4YY3 B;  1IXM A;  2MW2 B;  4MVU A;  2YS8 A;  4JV5 B;  5IY5 C;  2ZNJ A;  1FS0 G;  1NTK H;  2R72 A;  3ZMU A;  1IBM B;  2ZD9 A;  5KLV H;  3RWR D;  2R9R B;  1CP9 A;  4PDR A;  1XUQ A;  4LP8 A;  1QHT A;  2Y0P A;  2F95 B;  4NR1 A;  4F4L A;  3RYC A;  2IBZ H;  1BCC H;  2M6Y A;  5IY5 B;  3ZHR A;  1S5L Z;  4LF4 O;  4H37 A;  1ZTE A;  2Z5U A;  1E1R G;  2B1I A;  3T1Y O;  4JI1 O;  4YXW G;  2CDY A;  1B06 A;  3OR6 C;  4JI3 O;  2UXD B;  1HWY A;  1V54 B;  2WA4 A;  5IYB O;  3SPI A;  3C90 A;  1GM8 A;  3RN4 A;  5LXT A;  1R3J C;  4I5S A;  2Q7E A;  1HR0 B;  3ZHQ A;  1R6T A;  1NR1 A;  3RGB A;  3T4D A;  2YUA A;  4W4K A;  1W2B U;  3ETQ A;  4N23 A;  1I94 O;  2Y48 A;  3MHS C;  3ZN0 A;  3OM3 B;  3JYC A;  4I55 B;  2QM4 A;  2VS0 A;  5B1A C;  5C8Y B;  1EZJ A;  3I55 V;  5KHK A;  1GTO A;  3CMA V;  4JI5 B;  1TA8 A;  1UPG A;  1AJQ A;  1KQS U;  3ZIA G;  3AG3 B;  3OTF A;  1DTO A;  1VAR A;  3JD3 A;  4RWU A;  4LF7 O;  1SQX H;  1QR9 A;  4FIP C;  3O9O A;  2KKW A;  1KKD A;  3CME V;  5EC1 C;  3D36 A;  3M99 B;  2X6B A;  4HBN A;  2L6L A;  4U3J B;  2PGG A;  2WPD G;  3F5W C;  1KYO F;  3C3S A;  1I5X A;  5L3F A;  1RM1 B;  2DW4 A;  1FFX A;  3SGI A;  2ZXW C;  3SDL A;  4NXM B;  3HKD A;  3JAW A;  3T1C A;  4J7K A;  1BS3 A;  3VQW A;  3W7S A;  1EZV H;  2HJF C;  2PZS A;  3JAS A;  2ZXW B;  4TT3 G;  2ZNI A;  4QJF B;  5CA3 A;  3ZMV A;  4LWS B;  4P30 A;  5LP6 B;  3PN1 A;  4TQD A;  3ABM C;  4RUF A;  4B3M B;  1PL4 A;  4JYC A;  3VOU A;  2QDO A;  2DJV A;  1YEW A;  2N04 A;  3QO7 A;  5KHJ A;  1NJI W;  3ABM B;  1ZX3 A;  3K0G A;  1XMO O;  2EJR A;  3ZRV A;  4X1I A;  2KQX A;  1NR7 A;  1RSO B;  2UUB O;  4I0X A;  2YIA A;  2JGD A;  4FM2 A;  3FD9 A;  1GN6 A;  5BR8 B;  3BY6 A;  5EBL C;  2FB5 A;  1W0J G;  3CCR V;  1GMG A;  4UCO A;  5CB4 A;  2P67 A;  4DR1 B;  5IJ9 A;  5DN6 G;  1PL0 A;  5IYZ A;  2AHZ A;  4X64 B;  3NXS A;  3BA8 A;  2OIG A;  1QVF U;  5CMU A;  4DXW A;  1XMQ O;  5CBG A;  4QPJ A;  2BSK B;  5JH7 B;  2UXN A;  3UCS C;  3UM7 A;  1HNX O;  3T2M A;  4NB5 A;  2Q4P A;  1GRJ A;  2EIL B;  4JI4 O;  4QE7 A;  2QM7 A;  4AHC A;  4PI2 A;  2QTS A;  3CC7 V;  4FLZ A;  4PEL A;  3NR7 A;  3G4S V;  2EIJ C;  3VBB A;  3OUS A;  2YI9 A;  5L3E A;  1GAX A;  4JAU A;  4Q20 A;  5A9G A;  1CEZ A;  4DR7 B;  1QLE C;  1LUW A;  3OFN G;  3FB6 C;  4CBC A;  2A0L A;  4DRX B;  2GUZ B;  3K79 A;  3TJT A;  5EBM C;  3UO3 A;  1R1B A;  3SYC A;  4YHH O;  2ZDI A;  4D7T A;  2QWQ B;  2Y4T A;  4ZI7 B;  2JRI A;  2WLI B;  1M90 W;  2H94 A;  1LR1 A;  4F6R A;  1JA8 A;  4UV8 A;  2B1G A;  4OXS A;  3BFR A;  5LOV B;  5KHI A;  1AR1 B;  1EN6 A;  4JZG A;  4O4I A;  5FNV A;  5JVD A;  1WP8 A;  2WAM A;  3QO5 A;  4UB6 Z;  1FJG B;  3RFR A;  1YXB A;  1GKF A;  2CGO A;  2MK3 A;  2YXL A;  4LR3 A;  1U97 A;  5GTH Z;  2LQT A;  3CCE V;  4G27 B;  3EFF K;  2Q69 A;  4DV7 O;  4TSF G;  1Y76 A;  2CK3 G;  3KG2 A;  2P90 A;  2UUC B;  4PD4 F;  1AR5 A;  1KBH A;  1BHA A;  4X65 B;  2VWJ A;  4QPK A;  3DC5 A;  3UKM A;  2CE4 A;  4HYO A;  3FX7 A;  4JZ2 A;  4XDJ A;  1OZ0 A;  2YIB D;  3H1K H;  2GBO A;  3U11 A;  1N33 B;  3SJQ C;  1YDX A;  3S3W A;  1TVK B;  3OGI B;  4TWK A;  2NR5 A;  1YF2 A;  1IXB A;  4IYI A;  4I50 B;  5JWP A;  4EKW A;  1VQ4 V;  5L3D A;  1MZE A;  4K8X A;  1H2M A;  1OCR C;  3L74 H;  1OCZ B;  4KUM A;  1JJO A;  3SPJ A;  3N2G A;  4GUN A;  4BIZ A;  1BL8 A;  3OE7 G;  1VQN V;  4GKJ O;  3G6B A;  2ZM6 O;  2XHB A;  2EIM C;  3JAR A;  5LMU B;  3P3P A;  4IIJ B;  4LF6 B;  1IUR A;  4CH5 A;  4AQY O;  5BMV B;  2ZIM A;  1DK1 A;  1N34 B;  1SQF A;  2EIM B;  2LGQ A;  1JOY A;  1G6U A;  1O9H A;  2DQ3 A;  1NTM H;  1VQL V;  2WLN A;  3U10 A;  4DV2 B;  1N0N A;  1VMG A;  4JYA B;  2BCC H;  3OD4 A;  4DR2 B;  2JIZ G;  5LYJ A;  4Z1V A;  1SA0 A;  3K5M A;  3IC7 A;  4YJ2 A;  1EFR G;  3LDE A;  1JJ2 U;  1SF9 A;  4XDL A;  4LFA B;  3CX5 F;  2ETN A;  5LHH A;  4DV5 O;  1MA1 A;  1V55 C;  3CXC U;  3ZED A;  2E5L O;  3AK3 A;  5B1O A;  4R6Z A;  5B66 Z;  4GCZ A;  1FYJ A;  3ASN B;  1MMM A;  1MSW D;  1Z5W A;  1YHQ V;  2Q0O C;  4WBN A;  3LSU A;  1MAB G;  4DUZ B;  3CRA A;  2P06 A;  1A32 A;  1XHZ A;  4NKG B;  4X1Y A;  2HHH B;  3KCY A;  1FD9 A;  2AHY A;  2EUL A;  4NTW A;  4Z1M G;  1YIJ V;  3OEE G;  1KB9 F;  3AK1 A;  2FKX A;  3M8A A;  4U7N A;  4DV4 B;  2CH7 A;  4B3R O;  2XAS A;  1S5H C;  5L3G A;  3K08 A;  3CPW U;  1M5I A;  2OCH A;  2QWN B;  3CEI A;  4DR3 O;  3D8C A;  2PF4 E;  4NXN O;  4JI7 O;  2GTA A;  2OIE A;  1NQT A;  1MOF A;  2XAF A;  1JR9 A;  4WFA V;  2V7Q G;  1K5Q A;  1M56 C;  4X8A A;  5IJ0 A;  4JAS A;  4FFK A;  2VWK A;  2HEP A;  2WLJ A;  4GZR B;  5B1N A;  3H1L H;  4DR5 O;  4TUY A;  3DTU B;  4O4H A;  5KX5 B;  1N36 B;  2OCC C;  4CZZ A;  4K0K B;  4ICG A;  2DWE C;  4CS4 A;  2QKA A;  1NZ6 A;  3CSX A;  1TUB A;  1ZL8 A;  4XBF A;  1VF6 A;  1S0V A;  2ZE8 A;  3GB7 C;  3OMN B;  4BWA A;  4X20 A;  3FFQ A;  3RYC B;  3ETG A;  1TGO A;  2KG7 B;  4LNU A;  4G2K A;  2OTL V;  1FXK B;  1Q43 A;  2AZ2 A;  1YTF B;  3FB7 C;  3L9D A;  1K3E A;  1M57 B;  1KP2 A;  2UUA O;  2L35 A;  4PJ0 Z;  2XT9 A;  1NT2 B;  2M7W A;  3TCU A;  3KCX A;  1L8D A;  3A0B Z;  3JD0 A;  4LF8 B;  2WLM A;  4FLT A;  2AGA A;  3EXA A;  1XNR B;  2UU9 B;  2HFE C;  3CWB H;  3G71 V;  3JAT B;  1IBL B;  3BCC H;  1L0L H;  1WP7 A;  1IBK O;  4LF5 B;  2VQE B;  4EB6 A;  4K8Z A;  1G8M A;  4JGS A;  2OYQ A;  1JQ0 A;  3BEH A;  3F7V C;  2F4V B;  1LUV A;  5J9P C;  5TIS Z;  3ZRW B;  2V4D A;  1FXH A;  2IM9 A;  4P9P A;  3P30 A;  2QR4 A;  3ZBH A;  3D36 C;  1H2S B;  2AW9 A;  4GKJ B;  4CH6 A;  3BVO A;  3THO A;  1XNQ B;  3AG4 B;  4GX0 A;  2OWO A;  4PA3 A;  3FB8 C;  5KMG B;  4QE9 A;  2XAG A;  3SYA A;  4BIO A;  3K57 A;  1F4M A;  4FLU A;  4U3F H;  2HJD A;  1L0N H;  2GHY A;  5HFM A;  4FPP A;  3BAA A;  1FFX B;  1WPX A;  5GON B;  3CP1 A;  3HPL C;  1I5Y A;  2W6J G;  4JI2 O;  1VQM V;  4PDL A;  2YXY A;  4FVM A;  2QJ1 A;  2NLJ C;  3LNM B;  4IL6 Z;  4MVS A;  3ZCC A;  3WG7 C;  2QGN A;  2JJ1 G;  1N32 B;  1WB8 A;  1QR8 A;  3AG1 C;  1KD1 W;  2YIB A;  5JJJ B;  5E79 Z;  3P3N A;  1JFF B;  1ZSP A;  1W0K G;  1IVS A;  1SKV A;  4O4J B;  3CCQ V;  4MW8 A;  3KZI Z;  4CS2 A;  3ZHS A;  3GWK C;  4X1I B;  4DK0 A;  4LFB B;  4YIP A;  4I0X B;  4MTF A;  3BPZ A;  2LP7 A;  3RYH A;  2WLL A;  4LFC B;  4ZIB A;  4JI8 O;  5CB4 B;  3E8F A;  3VQY A;  5IWA B;  5H6Q A;  5GW7 A;  3UO2 A;  4NXN B;  2YC0 A;  4JI7 B;  4K35 A;  2H3O A;  3TGU H;  5KHG A;  5IYZ B;  3AG7 A;  3K3W A;  1HP8 A;  1Y4M A;  4X89 A;  2PI5 A;  4OX9 B;  4GLX A;  5LGN A;  1OCC C;  1Q6I A;  2FML A;  3CCL V;  1VIB A;  4RO2 A;  3E86 A;  3X2Q C;  2BE3 A;  1NH2 B;  2QWR B;  1QBZ A;  5LBQ A;  2WWW A;  1H2N A;  5JQG B;  4FMT A;  1WA8 A;  3E35 A;  3OR7 C;  4JTA B;  2YXH A;  4B08 A;  1KC8 W;  1NU1 H;  2W0X A;  2CTQ A;  3D3I A;  3STL C;  4MTX A;  2WLH A;  5KHH A;  3JAM N;  2QE7 G;  5H6R A;  1Q82 W;  2VQF B;  5B1A B;  2HG5 C;  2XTA A;  1J5E B;  2ZDI C;  4DR4 B;  4DR6 O;  3ZRX A;  1PNL A;  5GTI Z;  3JCZ A;  3ABT A;  4KP4 A;  4FLW A;  5LMN B;  2RCV A;  4GKK O;  3FAV B;  4IHJ A;  3CRR A;  3FYE B;  4X62 B;  4DV6 B;  3OTO O;  1ENV A;  1QCE A;  2FTK A;  1JCH A;  2Q8V A;  3W7T A;  1RPR A;  4JI6 O;  2K1E A;  1SET A;  2IU0 A;  3Q4H B;  1NTZ H;  3CYO A;  4EFB A;  4LF9 O;  3H9V A;  2LFR A;  3B4S A;  2HP8 A;  5FNV B;  4HZ3 A;  5JVD B;  1F4N A;  5J2T A;  4B3S O;  3GWO A;  4TV8 B;  4YJ3 A;  1ZAU A;  4MVO A;  4DUY B;  1D5A A;  5ITZ B;  3QG5 A;  4MVZ A;  5J2U B;  4DW0 A;  2AXT Z;  3GVM A;  3A2F A;  4ZBM A;  2Z3Y A;  2D3O W;  4MT8 A;  1VQ9 V;  1EM1 A;  2YEV B;  5LGT A;  3CJH A;  2LW7 A;  2Q68 A;  1CPY A;  4KFM A;  2GSM B;  1SRY A;  1EN5 A;  2HR3 A;  1SC5 B;  3CRM A;  3DXR B;  4X1K B;  4WFH A;  3J81 N;  3LSS A;  2ZE7 A;  4J7Z A;  1Y74 A;  4EFE A;  1HNZ B;  3HKE B;  2HVK C;  3JD1 A;  1BQ0 A;  3RYF B;  4PV1 B;  5B1B C;  4CS3 A;  4P2Z A;  1Q86 W;  3BAB A;  3CS5 A;  1K73 W;  1ZLZ A;  2E3C A;  3F5T A;  1GM9 A;  1RPO A;  3A8T A;  1HNW O;  2QA4 V;  1XHX A;  1I7F A;  3E22 B;  4J11 A;  4UCV A;  2E74 B;  1BT8 A;  3FYI B;  4I55 A;  3L72 H;  4LF4 B;  4KXR A;  4I7Z B;  4ZOL A;  3T1Y B;  4JI1 B;  1XEQ A;  2EIJ B;  3SYP A;  1PV0 A;  4DV1 O;  1H2K A;  1NVP B;  4JI3 B;  1QLE B;  2F43 G;  5CA0 A;  3ABK C;  2ADQ B;  1GM7 A;  1D5N A;  5LYJ B;  4JTD B;  4LH7 A;  3SJB C;  2Q6A A;  3TK1 A;  1URF A;  4UVC A;  4U3J A;  1QU7 A;  2YID A;  1IX9 A;  1TAE A;  3JAL B;  1Z5V A;  2NN4 A;  2DYS C;  4FFB B;  2UXB O;  1I94 B;  2AZ0 A;  4NTX A;  4WBN B;  1OCO C;  3RT3 C;  2QM8 A;  4X1Y B;  2XAQ A;  3CRQ A;  2CH7 B;  4G28 B;  4LWS A;  5FPR A;  3G67 A;  1JMK C;  5LP6 A;  4LF7 B;  1UJW B;  1GN4 A;  1KU9 A;  4O2A B;  1S72 V;  1GH6 A;  4I4T B;  2Q9L A;  4PDM A;  2JEU A;  1W59 A;  4JYY A;  4X9Q A;  3N2K B;  1DGS A;  1B3Q A;  3T1H O;  1SQV H;  4CH3 A;  2A06 H;  2PYL A;  1KP3 A;  5IT9 N;  1LNQ A;  2YSU B;  2DN9 A;  5LA6 B;  1Q3E A;  4LCU C;  1PP9 H;  1S5J A;  2BTQ B;  3HKB A;  3SPC A;  2CAZ C;  4ABM A;  2UXC O;  2YIC A;  3AK2 A;  4TV9 B;  3W7X A;  1VF6 C;  1YI2 V;  2LFS A;  4TUY B;  1WAZ A;  4JAA A;  3ZX6 A;  4RQE A;  3JSL A;  4O4H B;  4GX5 A;  3J80 N;  4B3T O;  3SYO A;  3LUT B;  4H44 B;  4UVB A;  4L87 A;  4UUJ C;  1YTF D;  3LSQ A;  1FXV A;  1N4C A;  2VRZ A;  1TUB B;  1Q81 W;  1SQG A;  3WB0 A;  3K59 A;  1NS1 A;  1OCR B;  2RNB A;  2BSK A;  5JH7 A;  3ETE A;  2R70 A;  4J42 A;  2ITC C;  3ZJZ A;  3I5D A;  1BZK A;  4GX1 A;  5EZY B;  2BTO A;  4OGQ B;  1DF5 A;  1XMO B;  2P7T C;  2Q0A A;  1VQ6 V;  2F93 B;  2EIK C;  2UUB B;  3APQ A;  1PM9 A;  3CCV V;  1SQQ H;  3IJ4 A;  3R65 A;  5CN0 A;  5IE9 A;  3IGA C;  1AI6 A;  1WNS A;  4PA6 A;  4DV3 O;  2EZO A;  3JAK A;  1Q6U A;  1OV9 A;  1OHH G;  4X66 O;  1QNM A;  5AG2 A;  2P4V A;  4KHP O;  4PI0 A;  1NI8 A;  1VQP V;  1Q7Y W;  2GUZ A;  3SPH A;  1XMQ B;  5D5P A;  2FL4 A;  4B7E A;  2JK5 C;  2DYR C;  2A9H A;  4TOI A;  4ZI7 A;  4IYH A;  2WLI A;  2DQ0 A;  1HNX B;  1NBM G;  3G80 A;  1AB3 A;  4YY3 O;  3ASO C;  4JI4 B;  1YCI A;  1V55 B;  3K04 A;  3K58 A;  4JV5 O;  1QLN A;  3H1I H;  1WPB A;  3K5L A;  3CC2 V;  1IBM O;  1F51 A;  1VQ7 V;  1JPX A;  4R50 A;  3HR0 A;  3ASO B;  3RBZ A;  1S76 D;  2ZT9 B;  5FL7 G;  4HNA B;  4PA4 A;  2KB1 A;  3BHP A;  4D6T H;  1SZT A;  4X88 A;  5H2F Z;  3RW0 A;  2Q73 A;  3OGC C;  3ABL C;  3UT5 B;  4YHH B;  2G38 A;  5EYP A;  4JPR A;  2UXD O;  1FFT B;  1R3K C;  4WFG A;  3OW2 U;  5IYC O;  2E76 B;  2ZE6 A;  3CHX A;  1U96 A;  1TUE B;  1SZX A;  1ORQ C;  3MD0 A;  1VQK V;  3ABU A;  2O57 A;  4B7K A;  1TVK A;  3DSQ A;  1D2D A;  1M56 B;  1KUQ A;  4I9W A;  1HR0 O;  3APO A;  2WSS G;  3CD6 V;  4O2B A;  5CA1 A;  2RQ6 A;  2QEX V;  1M4U A;  4I50 A;  2UXB B;  4DO2 A;  5HFL A;  2P5O A;  2OCC B;  4YIO A;  4DV7 B; 
#chains in the Genus database with same CATH homology
 1W0J G;  3CCR V;  1GMG A;  4MTF A;  2LP7 A;  2P67 A;  4GT1 A;  3EHB B;  2C2A A;  1OCZ C;  4MVM A;  1COW G;  2WLL A;  1K5S A;  5DN6 G;  1PL0 A;  4U7O A;  2AHZ A;  2ZR2 A;  3NXS A;  4JTC B;  3E8F A;  1YJ9 V;  2W0F C;  3E8H A;  1QVF U;  5H6Q A;  5GW7 A;  1VQ5 V;  5LHG A;  2WLL B;  5CMU A;  4DXW A;  3STZ C;  3K3W A;  5CBG A;  3W7U A;  1Y4M A;  5L3B A;  4QPJ A;  4XDK A;  1SES A;  4X89 A;  2P6J A;  4BIU A;  2UXN A;  2PI5 A;  3UM7 A;  5LGN A;  1K9M W;  1OCC C;  1NH2 D;  3T2M A;  3CCL V;  2X6A A;  4RO2 A;  3SPG A;  3E86 A;  4R7C A;  3X2Q C;  1VQO V;  2EIL B;  4QE7 A;  3FKS G;  2QM7 A;  2R9I A;  1NH2 B;  1P7B A;  1E79 G;  1QBZ A;  5LBQ A;  2WWW A;  2IW5 A;  3CC7 V;  4FMT A;  2EIK B;  4PEL A;  2ZQM A;  3G4S V;  1KEC A;  2EIJ C;  3E35 A;  3OUS A;  3VBB A;  1GK9 A;  5L3E A;  3OR7 C;  4JAU A;  1ROP A;  3LDC A;  4Q20 A;  3QO8 A;  4JTA B;  1CEZ A;  2X0L A;  1J95 A;  1KC8 W;  2QKS A;  2EBO A;  3D3I A;  1QLE C;  3STL C;  4MTX A;  2WLH A;  1THZ A;  3OFN G;  3FB6 C;  3ZMS A;  3RVZ A;  2QE7 G;  5H6R A;  4CBC A;  1Q82 W;  5B1A B;  2HG5 C;  2A0L A;  2ZDI C;  1JX9 A;  3ZRX A;  3CC4 V;  3K03 A;  3K79 A;  4ZKI A;  4MSW C;  1K7D A;  1PNL A;  5EBM C;  3JCZ A;  3ABT A;  1ARO P;  4KP4 A;  3SYC A;  2ZDI A;  4JYB A;  4J9Z B;  2WLI B;  3ASN C;  4RAI A;  1M90 W;  3ZRS A;  2H94 A;  2DYR B;  3FYE B;  3H01 A;  5EBW C;  1ENV A;  3CCU V;  1M9N A;  4UV8 A;  2B1G A;  4N21 A;  1QCE A;  2FTK A;  1JCH A;  4OXS A;  5KA6 A;  3W7T A;  1RPR A;  2JJ2 G;  2K1E A;  4GX2 A;  1SET A;  4LC1 A;  2IU0 A;  1AR1 B;  1R3I C;  1AI4 A;  2IJK A;  2WAM A;  3QO5 A;  1GKF A;  2MK3 A;  3CYO A;  3ZN1 A;  5LGU A;  2LFR A;  3QNE A;  3CCE V;  4RUE A;  4G27 B;  4HZ3 A;  1F4N A;  3GWO A;  2HVJ C;  4MVR A;  3EFF K;  2Q69 A;  4TSF G;  4MVO A;  2CK3 G;  2XAH A;  2P90 A;  3KG2 A;  2ATK C;  1BHA A;  1BMF G;  5H9C A;  4QPK A;  3UKM A;  4PDV A;  5IYD O;  2EIN C;  3K0D A;  4MVZ A;  2BOC C;  4HYO A;  2B5U A;  3B8N A;  4XDJ A;  1OZ0 A;  1R3L C;  5EK0 A;  3ABL B;  4ZBM A;  2Z3Y A;  1G4Y B;  5LHI A;  1K8A W;  2D3O W;  2XAJ A;  1PNM A;  4MT8 A;  3SJQ C;  1JVM A;  1VQ9 V;  3WG7 B;  2X6C A;  2YEV B;  5LGT A;  2OTJ V;  1PKX A;  3AG1 B;  1K97 A;  5CBH A;  4TWK A;  3P32 A;  2IJH A;  3AEI A;  2Q68 A;  1CPY A;  4KFM A;  2GSM B;  3OMA B;  1SRY A;  1H8E G;  1WLE A;  4R8C A;  1YJN V;  5DM6 V;  2A79 B;  2JEX A;  2HR3 A;  4FK5 C;  2XOK G;  4EKW A;  1FXK C;  1VQ4 V;  5L3D A;  1V54 C;  4LBE C;  4WFH A;  3IFX A;  3LSS A;  1FXK A;  1OCR C;  4MTO A;  1QVG U;  1M57 C;  1OCZ B;  2HVK C;  3JD1 A;  3E83 A;  1ZWI C;  4KUM A;  5KUK A;  1K34 A;  3SPJ A;  4WFB V;  5B1B C;  4UXN A;  1YSC A;  4P2Z A;  1BL8 A;  3OE7 G;  4WFE A;  4BIZ A;  3ZMZ A;  1Q86 W;  1VQN V;  5CBF A;  3K06 A;  1K73 W;  3B77 A;  2EIM C;  1GM9 A;  1RPO A;  4PA9 A;  4MW3 A;  1DLB A;  2IJI A;  3T4Z A;  2ITD C;  4JF3 A;  2QA4 V;  1OCC B;  3AG2 C;  4PA7 A;  1K4C C;  3K9A A;  2NNU A;  2EIM B;  3FYI B;  3PJS K;  3X2Q B;  1JOY A;  1P4R A;  1AJP A;  3I56 V;  2DQ3 A;  1SER A;  1NVP D;  3MHH C;  4FJC C;  5E1A C;  1VQL V;  2QTO A;  2WLN A;  4UV9 A;  3AG2 B;  3AG3 C;  3E8B A;  2EIJ B;  5EC2 C;  3SYP A;  2Q67 A;  1GO3 F;  1NVP B;  2JIZ G;  4MVQ A;  3ZRW A;  1QLE B;  2F43 G;  2JDI G;  3ABK C;  3IC7 A;  3OMI B;  1EFR G;  2X7R B;  3CCM V;  3LDE A;  1GM7 A;  1JJ2 U;  4XDL A;  4JTD B;  2HKO A;  2BOB C;  1K92 A;  5LHH A;  1M1K W;  3AG4 C;  1V55 C;  3HB3 B;  3CXC U;  1F23 A;  2Q6A A;  3TK1 A;  4WF9 V;  5B1O A;  3FB5 C;  4R6Z A;  4UVC A;  3ETD A;  1RM1 C;  4GCZ A;  3ASN B;  1MSW D;  1YHQ V;  1K4D C;  3RVY A;  1MAB G;  2DYS C;  1VQ8 V;  1H8H G;  4JAV A;  2AHY A;  1OCO C;  1YIJ V;  4Z1M G;  2IH3 C;  2QM8 A;  3B8M A;  3OEE G;  2DWD C;  4U7N A;  1BHB A;  2XAS A;  1B6Q A;  1AI7 A;  1S5H C;  3OEH G;  2XAQ A;  3JD4 A;  5L3G A;  3K08 A;  3E2E A;  4WCE V;  3CPW U;  3ZMT A;  5KUM A;  4G28 B;  3OAA G;  3E89 A;  3E8G A;  1UJW B;  1S72 V;  3LDD A;  1NQT A;  1MOF A;  2XAF A;  4QIW F;  5BZB A;  1PNK A;  2HLD G;  4PDM A;  4WFA V;  2JEU A;  2V7Q G;  2EIN B;  1K5Q A;  1N8R W;  1M56 C;  4X8A A;  4JAS A;  1Y66 A;  3JD2 A;  1IXM A;  2WLJ A;  1AI5 A;  4MVU A;  1KP3 A;  5B1N A;  1LNQ A;  2YSU B;  4HAM A;  5IY5 C;  1FS0 G;  3DTU B;  3ZMU A;  2EZP A;  2ZD9 A;  2OT5 A;  4LCU C;  1AJN A;  2OCC C;  4CZZ A;  2R9R B;  3SPC A;  2V1D A;  1CP9 A;  4PDR A;  2DWE C;  4LP8 A;  3W7X A;  1YI2 V;  2LFS A;  4RQE A;  4F4L A;  4GX5 A;  1K33 A;  2WLK A;  5B3S C;  5IY5 B;  4XBF A;  2IU3 A;  1S0V A;  1XL6 A;  3SYO A;  3LUT B;  3GB7 C;  3OMN B;  4H37 A;  2UXX A;  4UVB A;  2Z5U A;  1E1R G;  4L87 A;  4UUJ C;  2B1I A;  1YTF D;  3ETG A;  3LSQ A;  1FXV A;  1YIT V;  1PD3 A;  1Q81 W;  3F7Y C;  4YXW G;  4G2K A;  3OR6 C;  2OTL V;  1FXK B;  5L3C A;  1HWY A;  1V54 B;  5IYB O;  5B3S B;  4J9Y B;  1YTF B;  3SPI A;  3FB7 C;  1OCR B;  1GM8 A;  1R3J C;  5C93 A;  1K3E A;  1M57 B;  4I5S A;  1KP2 A;  3ETE A;  4E2L A;  2EIL C;  2M7W A;  5B1B B;  3TCU A;  3WFV A;  3W7W A;  2ITC C;  3ZJZ A;  3JD0 A;  4GX1 A;  1DF5 A;  2WLM A;  2P7T C;  1NR1 A;  3CCS V;  1VQ6 V;  5IDJ A;  3T4D A;  2EIK C;  3CCV V;  2HFE C;  1E1Q G;  1W2B U;  3G71 V;  1DF4 A;  3R65 A;  4N23 A;  3CCJ V;  1R73 A;  2Y48 A;  3MHS C;  3IGA C;  1H2G A;  5CN0 A;  1AI6 A;  3ZN0 A;  3OM3 B;  3JYC A;  4PA6 A;  2EZO A;  2IJJ A;  5B1A C;  1YJW V;  4P9O A;  1G8M A;  1EZJ A;  3I55 V;  1GTO A;  4JGS A;  3CMA V;  4H33 A;  1OHH G;  1JQ0 A;  3BEH A;  3F7V C;  5KA5 A;  5J9P C;  1VQP V;  1Q7Y W;  2XND G;  4BW5 A;  1AJQ A;  2Y69 C;  1KQS U;  3ZIA G;  3AG3 B;  3ZRW B;  1FXH A;  1DTO A;  3SPH A;  4P9P A;  1S3J A;  3JD3 A;  3P30 A;  2JK5 C;  4MS2 A;  2DYR C;  2A9H A;  1R6N A;  1QR9 A;  1NKD A;  3DGE A;  4FIP C;  3ABK B;  2WLI A;  4ASU G;  1KKD A;  2DQ0 A;  3CME V;  1NBM G;  4UVA A;  2Y69 B;  3G6E V;  5EC1 C;  3D36 A;  3M99 B;  2X6B A;  2W6I G;  3ASO C;  2WPD G;  3F5W C;  4WFF A;  3AG4 B;  1V55 B;  3K04 A;  4GX0 A;  1I5X A;  1QLN A;  4PA3 A;  3FB8 C;  5L3F A;  4QE9 A;  1RM1 B;  3CC2 V;  2XAG A;  2DW4 A;  1F51 A;  3SYA A;  4QNH B;  2ZXW C;  1VQ7 V;  1JPX A;  1F4M A;  4R50 A;  2DYS B;  3ASO B;  3RBZ A;  1S77 D;  3T1C A;  2GHY A;  5HFM A;  1S76 D;  3SYQ A;  4FPP A;  3W7S A;  5FL7 G;  2HJF C;  1WPX A;  1OCO B;  3ML0 A;  3CP1 A;  3HPL C;  1I5Y A;  4PA4 A;  2KB1 A;  2W6J G;  1VQM V;  1SZT A;  4PDL A;  4X88 A;  2ZXW B;  3RW0 A;  4TT3 G;  4QJF B;  5CA3 A;  3OGC C;  3ABL C;  2NLJ C;  3ZMV A;  4P30 A;  3LNM B;  4JPR A;  5EBL C;  1FFT B;  1R3K C;  4WFG A;  1R6K A;  3OW2 U;  3ABM C;  3TET A;  4MVS A;  2ZR3 A;  1MG1 A;  2IH1 C;  5IYC O;  4RUF A;  3ZCC A;  3WG7 C;  2JJ1 G;  3A0R A;  1EBO A;  4JYC A;  3VOU A;  4MTG A;  1TUE B;  1QR8 A;  1XL4 A;  1ORQ C;  3AG1 C;  1KD1 W;  3MD0 A;  1VQK V;  2H8P C;  2PI4 A;  3ABU A;  2YEV A;  3QO7 A;  1NJI W;  1M56 B;  3ABM B;  1W0K G;  4I9W A;  3K0G A;  2EJR A;  4BAY A;  3ZRV A;  2WSS G;  4RQF A;  3CD6 V;  1NR7 A;  3CCQ V;  4MW8 A;  2QEX V;  4DO2 A;  3OUF A;  1H38 A;  5HFL A;  3BY6 A;  2OCC B;  1L1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...