3IFXA

Crystal structure of the spin-labeled kcsa mutant v48r1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
b'ALHWRAAGAATVLLVIVLLAGSYLACLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel
publication title Electron Spin-Echo Envelope Modulation (ESEEM) Reveals Water and Phosphate Interactions with the KcsA Potassium Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 28
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ifxA00
1K4DC 2IH3C 3LDCA 4MVMA 2YEVA 4RAIA 1J95A 2QKSA 2R9RB 2ZD9A 4R7CA 5E1AC 3OUSA 4DXWA 3ABMC 4MW8A 3UM7A 3X2QC 4PDLA 2Q6AA 3FB5C 1K4CC 3ABLC 1ORQC 1JVMA 2WLHA 2ZXWC 4JTDB 2K1EA 4MVRA 1R3KC 2P7TC 3LDDA 3OGCC 4MVQA 1V55C 5EBMC 4WFEA 3BEHA 2NLJC 3LUTB 2DWDC 4HYOA 4QE9A 3K04A 2DYRC 3UKMA 3LDEA 3WG7C 4GX0A 3KG2A 4RUEA 4GX2A 3K0GA 4PA6A 4X89A 4R50A 2WLMA 3SJQC 4J9ZB 1R3JC 4P9OA 2A9HA 2AHZA 3RW0A 3HPLC 1QLEC 2X6AA 1BL8A 3R65A 2BOCC 2EIMC 4MVUA 4EKWA 2EILC 4WFFA 1OCCC 4RO2A 3GB7C 2WLLA 2AHYA 4WFHA 4QE7A 3AG1C 4RUFA 2HJFC 4G27B 1G4YB 3T1CA 4X8AA 4G28B 2EIJC 3K08A 4I9WA 4P30A 4TWKA 3SPCA 5CBFA 2BOBC 5CBGA 2WLIB 3TETA 4R6ZA 1M57C 2ITCC 2EINC 4MVOA 3RVYA 3STZC 4LP8A 3E8HA 2HVKC 2EIKC 3AG4C 2A79B 4MS2A 4MVSA 2Q67A 4X88A 1S5HC 1R3LC 2IH1C 3SYPA 2X6BA 1OCZC 5EBWC 3RVZA 2QTOA 2HFEC 2Q68A 2WLNA 4PDMA 2ATKC 3FB7C 4MTFA 5KUKA 4CBCA 3OR7C 1R3IC 3K03A 3T4ZA 2WLJA 4UUJC 3ASOC 4LBEC 4PA4A 4H33A 4PDVA 4J9YB 2HVJC 2Y69C 3E83A 5KUMA 4BW5A 3LNMB 5EC1C 2KB1A 4KFMA 4ZBMA 2HG5C 3T2MA 5J9PC 3SYOA 1XL6A 4JTCB 4PDRA 2H8PC 4OXSA 3ASNC 4P2ZA 3VOUA 3SYAA 3ZRSA 5BZBA 5CBHA 2WLKA 1ZWIC 5EBLC 3IGAC 4MTGA 3TCUA 1XL4A 4H37A 5IY5C 3AG2C 2DWEC 4QNHB 4R8CA 3FB8C 3E8BA 4LCUC 4P9PA 3SYQA 4PA9A 3T4DA 2JK5C 3PJSK 3E89A 4XDJA 3ZJZA 4F4LA 3SPIA 2OCCC 2DYSC 4PA3A 5EK0A 3IFXA 2WLIA 1KKDA 3FB6C 4MW3A 1OCOC 3F7YC 5B1AC 2X6CA 3OUFA 3SPJA 1LNQA 1OCRC 4HZ3A 3K0DA 1P7BA 4MSWC 3E8FA 3E86A 3RBZA 2W0FC 3E8GA 2Q69A 4GX1A 2A0LA 1M56C 4PA7A 5B1BC 3OR6C 4XDLA 1V54C 2WLLB 3SYCA 5B3SC 3EFFK 4JTAB 3K06A 3ABKC 3F5WC 3SPHA 2ITDC 4XDKA 3SPGA 3F7VC 4WFGA 4MVZA 4GX5A 4MTOA 3JYCA 5EC2C 3STLC 3AG3C
chains in the Genus database with same CATH superfamily
1VF6A 4RAIA 3ZMTA 1OHHG 2Q0OC 4DUYB 4JI8O 4LF5O 4FM2A 5CN0A 3BHPA 2OT5A 3UKMA 1SKVA 1L0LH 3LDEA 4GX0A 3RYHB 3Q4HB 1MA1A 1SQGA 4DR5O 3CPWU 1GAXA 4NB5A 2ZE6A 4ZOLB 3RW0A 4NXMB 4D7TA 4FFKA 3ABMB 5E79Z 5EIBC 3UQ8A 1S77D 4GKJO 1RM1C 2ADPA 2QDOA 1V55B 5A2QN 3G80A 2UU9O 3DC5A 2DYRB 1T5EA 3ZMZA 4LP8A 1A32A 2Q67A 5CA0B 1N34O 4DV2O 4YY3B 1AJPA 1JA8A 4O4LA 5IT9N 3ABUA 4CBCA 1KECA 4I50A 5LA6B 3VBBA 1F7YA 1K34A 2QM8A 5KUMA 3OAAG 3CCUV 2CTRA 2RNBA 1XL6A 1K3EA 1FJGB 2AZ2A 1SQQH 1IURA 5BZBA 4UCOA 2ZNJA 1W2BU 1YVWA 4NXNO 3A8TA 1KP3A 1W0KG 3RYCA 4JI5O 1QNMA 3O9OA 3ASOB 1V9PA 4DV6B 4AI8A 1NVPD 2V1DA 2N04A 2QWPB 5B1BB 1BHAA 4MSWC 5LBQA 5LP6A 3JATB 1GM9A 1DK1A 2GTAA 4X1YA 3OTOB 2UXCO 4GUNA 2YXHA 1IBMO 4GLXA 1WNSA 1AI7A 4J42A 1NVPB 4OX9B 4O4JA 1Y67A 2YI9A 5J2UB 4UCSA 1UFIA 3VQXA 3AK1A 5EZYA 1KU9A 4LF7O 3ABMC 2FL4A 3FB5C 2VS0A 4DV7O 1V55C 1PD3A 3MD0A 4HYOA 2P5OA 2DYRC 1H2NA 1SZTA 1W0JG 2YIAA 4LF8B 1YIJV 4H13B 4P9OA 4DV4B 2G38A 2A06H 1E1RG 2ZE8A 1KYOF 2XAGA 4GCZA 2Z3YA 3UO3A 3RYCB 1HDJA 1DTOA 1PL0A 4QE7A 1IBLO 4HBNA 4IIJA 2YIBD 4JYAB 1ENVA 1VF6C 4QPJA 1YEWA 3E8HA 1R3LC 3L74H 5LP6B 1VQPV 1AB3A 4X1YB 4Z1MG 4DV5O 4IL6Z 2B9ZA 3ASOC 3H9VA 4HAMA 4O4JB 5LHIA 1D5AA 1D5NA 3QVNA 5EZYB 5CBHA 1ZWIC 3RYIB 3TCUA 4CH4A 2RQ6A 1WPXA 4EB6A 3ZHRA 5LMNB 1SA0A 2F43G 3F5TA 2ZINA 1NS1A 3OM3B 3CRQA 4DV1O 1F4NA 4X62B 3E2EA 3DXRA 5C93A 5LXTA 1S76D 2WPDG 3MHHC 4WBNA 2PY5A 4JZ2A 1UJWB 1FPOA 3AK2A 4NYKA 3CMAV 4CS3A 2A7WA 4JI7O 3AG3C 4TSFG 2ZD9A 1N32B 5E1AC 1OCRB 2O57A 3X2QC 1HW7A 4FVMA 4MVRA 3RT3C 1AR5A 1K8AW 5EBMC 2RJZA 2DWDC 3K04A 3K5NA 1S3JA 3ZRWA 4X89A 4GYCB 4J9ZB 1NTKH 1Y76A 2UXDO 3LSUA 2PI4A 4KUMA 1B6QA 4B3SB 3W7UA 5LL6Y 3J80N 4EB6B 2WLLA 4G27B 3A2FA 4P30A 4EFBA 1Q81W 2LW1A 1P4RA 3DXRB 2WSSG 3CRRA 5LXTB 2X6BA 2R70A 1BCCH 3P3NA 1YZBA 1R3IC 1VQKV 2WLJA 4LBEC 4GZRB 3OMIB 4LF4O 1SS3A 2CDYA 4DR4O 5BMVA 2ZE5A 3CP1A 3MAQA 2P67A 3ZCCA 1FXKA 1OJHA 4X9QA 1FAFA 2EIKB 2CK3G 2ZR3A 4B3RO 3VOUA 2Q4PA 5KHGA 5KAFZ 2DJVA 2YUAA 3VQWA 1B3QA 2QKAA 1GTOA 1MZFA 2WLIA 3ZRWB 1KKDA 1HWYA 1P7GA 1FKAO 4H0LB 1Y76B 4JI4B 1M4UA 1OCRC 2YDEA 1P7BA 2ODMA 2XOKG 3RBZA 4TQFA 1YDXA 3D8CA 4TUYA 3ZHQA 2EULA 2GHYA 2WLLB 4FMTA 4LFAB 3ZHUA 2UUCB 4LF6B 3F7VC 1R73A 2QWRB 4DR2O 3CMEV 1NTMH 1GO3F 4I4TB 3ZIAG 4UVBA 4AILC 3CYOA 1I08A 5LMUO 4JI6O 3BVOA 3ABLC 2Z5UA 1JVMA 1AP6A 3HR0A 1N4CA 4O2BA 3VQVA 2EBOA 1RSOA 1HNWB 2XT9A 5IDJA 3K0GA 3OT7A 2VQFB 1LR1A 3ZHVA 1VARA 4FK5C 5LYJA 2JJ2G 3CSXA 3NR7A 5KHJA 1S0VA 1NKDA 2IU0A 4J7KA 2QTSA 2WLIB 4K0KO 3STZC 4DV0O 2EIKC 4JI2O 4TV8A 2UXXA 4GKKO 5EBWC 4TUYB 1GM8A 3SDLA 3CRAA 2ZM6B 3T1HO 2HHHB 3B09A 1M57B 4E4EA 1IXMA 3B8MA 4X65B 4IHJB 1WJZA 2H8PC 4P2ZA 1K5SA 1Q90D 1Y6XA 4O2BB 1X4TA 2AW9A 3G67A 4JZGA 2DYSC 1BGYH 1XUQA 1PP9H 1YHQV 2Y0PA 1HNZO 3H01A 3OUFA 4X20B 1QLNA 2UXBO 1IVSA 1ZSPA 5D5QA 1JX9A 2Y4UA 4UB8Z 5KMGA 4J11A 4PA7A 1L8DA 3A0BZ 4YXWG 4AQYO 3OR6C 1NQTA 1J5EO 2N05A 1EN6A 4DR6O 1WA8A 4LF9O 1KMIZ 2ETNA 4DK1A 3ZN0A 1Q6UA 3SPGA 4LH6A 2K9PA 3G6EV 1F23A 3OMNB 4MVMA 2R9RB 3E35A 5FNVA 4PDLA 4UCTA 5B66Z 4QPKA 3CCJV 4IYHA 1NR1A 3QNEA 1YJ9V 1G8MA 4F6RA 1FYJA 3L9DA 1H2GA 4KHPB 5DECA 5J9PC 2OWOA 4U3FH 3RYFA 5L3BA 3FYEB 1NJIW 4GT1A 2ZDIC 1AI4A 1WLEA 2GV9A 1YF2A 2BOCC 2ZXWB 3BABA 4LFBO 3CWBH 2ZE7A 4B3MB 2VRZA 5LGUA 2QWOB 1M57C 3WG7B 3TXQA 3A0RA 2UUAO 4FZ1A 5KMGB 1DF4A 3C3SA 4BIOA 1H2LA 1AI6A 3DGEA 5KUKA 1WAZA 1WA8B 5IJ0B 4Z2WA 2EIJB 4PI2A 1XHZA 1ZL8A 4NKGB 2E5LO 5FL7G 3T1YB 5FNVB 4U3JB 4N23A 4CH3A 1N36O 2RCVA 2OTJV 2DWEC 4QNHB 2ZCEA 4JYBA 5L3GA 1Q3EA 4IGGA 4MTXA 3SYQA 3EVKA 3ZRXA 4F6RB 4C7UA 4X64B 2RN9A 2JDIG 3CJHA 2B1IA 2DQ3A 3ICXA 3RYFB 3SPJA 4JGSA 4FIPC 2Q73A 1Y4MA 2KKWA 4X1KB 2LFSA 2A0LA 4IT5A 2D3OW 3I55V 3I56V 1AP5A 1LUWA 2QE7G 3CRMA 2Q9LA 4YIPA 2OCCB 5BR8B 1HR0O 4WF9V 3OEHG 1MSWD 3SJAC 3DTUB 1Q6HA 1L1FA 2BTOA 2EJ7A 2WLHA 2ZXWC 4QE9A 3K5OA 1GRJA 3L72H 3WG7C 1ZL8B 4F6EA 3RN4A 1LUVA 2A9HA 4LR3A 1F51A 2EIMB 2IJIA 1SQVH 4LNUA 2X6AA 3AG1B 3R65A 1Z5WA 1O9HA 5HFLA 2QJ1A 4FZ0A 3G4SV 4NVPA 2EIJC 3K08A 3CJHB 1XNRO 4R6ZA 1BQ0A 1QVGU 2A79B 4MVSA 2OTLV 2KSDA 1XNQB 1D2DA 3SYPA 2FTKA 2GBOA 5ITZA 1O9GA 1AI5A 3K03A 2HKOA 3P32A 2PTMA 2XAHA 3ABTA 2ILMA 4DV3O 3G6BA 1G6UA 4YHHB 3SJBC 2XNDG 2KG7A 3BPZA 4CC6A 4B08A 4FM0A 4O4IA 3LNNA 1WPBA 5JVDB 3ZRSA 5EBLC 2CUGA 4H44B 1TA8A 1ZAUA 5IYDO 1AILA 2XASA 2OCCC 1VQ6V 3LSQA 4D7SA 3U0ZA 4FJCC 4JI0B 5DN6G 5IYCO 4X66O 1Y74A 4LNUB 1FXHA 1XEQA 2ARHA 4UFZA 2YS8A 1QQCA 3SYCA 1S5JA 2E74B 4BIZA 3SJCC 1VQ7V 2Y0IA 2GTSA 1IDSA 4DR7O 5ITZB 2W6IG 1I94O 4LWSA 1ORQC 3TK1A 5L3EA 1Q86W 5KLVH 5JCOA 1HNXB 3L73H 1JQ0A 4R50A 4O4IB 1NI8A 2IJKA 3JD0A 3ZX6A 5K1XA 2ZT9B 3JD4A 3GB7C 3L75H 3HKEA 1QU7A 3T1CA 4O4LB 4B3TO 3CC7V 2BOBC 4I50B 2AZ0A 1WP8A 2YXYA 2HVKC 4KXRA 1B04A 5LHGA 2B1GA 1WB7A 1Y74B 2CTPA 1TVKA 3WB2A 2E75B 4UB6Z 2JS5A 2EILB 2H94A 4A5UB 3P3PA 5EC1C 5JJJB 2CTWA 4DUYO 4UVCA 3HKBA 1OV9A 3CEIA 3EXAA 3IGAC 4LWSB 1XL4A 4H37A 5H2FZ 4FLWA 1M1KW 1FD9A 3WB1A 3OMAB 1GK9A 2LO1A 2OIEA 4CH5A 3K58A 3H1IH 4NXMO 5J2TA 1VQLV 3QO8A 2Y4TA 3E8GA 1JPXA 3CXHF 4JYYA 5B1BC 1YXBA 3AG2B 1XQ8A 3FX7A 2JVDA 3K06A 1X59A 4JTAB 3D36A 2DW4A 4WFGA 4MVZA 4GX5A 3JYCA 3K5LA 4YY3O 2XHBA 3LDCA 5B1AB 3K5MA 3FKSG 1TVKB 5D5PA 2F93B 1WN7A 3I5DA 2L35A 4MVQA 4ZI7A 2FYUH 2X0LA 1M5IA 2R72A 2P90A 3HKDA 4IIJB 1FJGO 3TGUH 4FLUA 5IE9A 4FM1A 2QEXV 2GDSA 2RMKB 4PI0A 3HKBB 3B2EE 3HB3B 3CRCA 5KHKA 3N2KA 2EILC 4RO2A 1JJ2U 3GVMA 3K9SA 4DV6O 4I9WA 4UCRA 2EZPA 3N27A 2GSMB 2ITCC 4J7ZA 4DUZB 1MG1A 3UT5A 4YIOA 3OTOO 1QLEB 1YJNV 1H2MA 5FPRA 5LP6C 5JCOC 4OX9O 5GTIZ 5IWAB 3CE2A 3IAYA 2FMLA 4H33A 4YJ3A 2Q7GA 5CA1A 2PGGA 1SA0B 1URFA 1W59A 4DR1B 3CHXA 4OXSA 3O65A 4CS4A 1XMOB 1OCZB 3AG2C 4UVAA 5A9GA 4OPHA 1M9NA 4ZI7B 1PKXA 3E8BA 4P9PA 4WBNB 2D2CB 2JK5C 5B5EZ 4JV5B 2CGNA 3SPIA 4LF8O 4HNAA 2LW7A 5EK0A 3CX5F 3HKDB 4DV4O 4NTYA 2HP8A 5B1AC 4KL1A 4DR3B 1NZ6A 4HZ3A 3JD1A 4ZHQA 3N2KB 1KC8W 1XREA 1US6A 3ABKB 2F95B 1NR7A 4XDLA 2P6JA 4JYAO 2ITDC 4DRXA 5FLXN 3JD2A 1JOYA 2GUZA 2QGNA 3UT5B 1R1BA 1E79G 4B7EA 2BE3A 5DM6V 5LGNA 1KP2A 3K57A 2Q5ZA 2Q8VA 2N74A 5F2VO 5B3SB 3JSLA 1COWG 4PV1B 4YJ3B 1RPOA 3QF7A 5CA1B 2ZKOA 3UCSC 1Y66A 2AHZA 1SQXH 2QA4V 2Q0AA 1QLEC 2QM4A 3SGIA 4D6TH 5LMNO 3OFNG 2YICA 4X62O 2EZOA 2HLDG 1VP7A 4I55A 1S5HC 3J7AU 4TQDA 4ZHQB 5BMVB 4ABMA 1OCZC 1CXZB 1FXKB 1YSCA 4PDMA 4MTFA 2AXTZ 2LQTA 3M8AA 2UUBB 4FLVA 3K59A 1Z2GA 3RGBA 1BSMA 4DRXB 2F66C 4JYCA 2VQEB 1F4MA 2WWWA 2M7WA 2PF4E 1N33B 2GUZB 2P06A 1N32O 1PM9A 4ZIBA 3JCUZ 1IZ3A 4CZZA 4BW9A 4K8ZA 4LFCB 2P4KA 1OCOB 3H1HH 1YJWV 1K7DA 1QCEA 1XMQB 1B06A 4I9QA 5LGTA 4FPPA 1K97A 1CEZA 4JAUA 4B3SO 3K0DA 5JH7A 2LP7A 4NTWA 3ETQA 5B3SC 3ZRVA 4CS2A 2VWJA 3ZMVA 3QO5A 3B77A 1RSOB 2IH3C 3JAWA 4I55B 2JGUA 2YEVA 1PNMA 2YIDA 4LH7A 3NXSA 4JI1B 3U10A 1VQ8V 4QJFB 2Q6AA 1SQPH 1VIBA 4JI3B 5LYJB 3TXSA 3JSNA 1JJOA 3D3QA 1VQNV 1FXKC 2QKCA 3J81N 3M7MX 3MHSC 2CH7A 4TV8B 2IU3A 3L71H 1RP3B 1H2SB 4EFEA 3W7SA 1XI1A 1QR8A 4TWKA 2R9AA 1IBKB 4JI4O 2F4VB 4RQFA 2YXLA 1GN6A 1H38A 1WP7A 4JAAA 4LFAO 2Q68A 2M6YA 2NN4A 2UUCO 4JI8B 2BCCH 4LF6O 1Q7YW 4LF5B 1Q6IA 4NTXA 3E83A 3LNMB 4KFMA 2F23A 3P30A 2EINB 3JAWB 1JCHA 1N0NA 3JAMN 2V7QG 4PDRA 1DGSA 1CP9A 4DR5B 5KX5A 3CB2A 3N2GA 4UV9A 1R6TA 1IX9A 4AHCA 4J7JA 5GW7A 1HNWO 1I7FA 4PA9A 4GKJB 5H5NA 4UXNA 4XDJA 2UU9B 3JCZA 5CB4A 1THZA 2JEUA 2VQFO 3QO7A 2ZIOA 3TJTA 3UO2A 1BQZA 1N34B 3CCSV 4DV2B 2CH7B 2QM7A 3F5WC 3IC9A 2A3QA 4XDKA 5LHHA 4IYIA 1FFTB 3ZHSA 1K9MW 1J95A 3IC7A 3OTFA 2X7RB 1GMGA 1AJQA 2ZM6O 2K1EA 3LDDA 4FFBA 3ZMSA 3QTCA 2HHHO 4NXNB 4JI5B 2WA3A 2P4VA 1VF5B 4X65O 2JRIA 5KX5B 1RM1B 4L87A 3ZHTA 1TUEB 4WFFA 4DYLA 2UXCB 5DEDA 5LOVA 1IBMB 5JJEB 3FD9A 3TETA 2EINC 5CB4B 2LGWA 1YCIA 2IH1C 4DW1A 3M99B 3OW2U 1QVFU 2DOSA 4LF7B 3JAKA 1AR1B 1NTZH 4DV7B 4FLXA 5CA0A 3BAAA 1ZLZA 2KB1A 1ZUQA 3H1JH 4K3AA 3OD4A 3D3IA 4W4KA 2WLKA 1UPGA 4PJ0Z 2XTAA 4FFBB 4R8CA 3FB8C 1Q8IA 3T4DA 4KHPO 2QSAA 1IBLB 1I5XA 5K1PA 1QHTA 3ZBHA 4YJ2A 3GWKC 1LNQA 1BZKA 3E86A 5KHHA 1QR9A 4B3MO 4OGQB 1HP8A 5LOVB 4DV5B 2DQ0A 3OGIB 2BTQA 1XILA 5EYPA 5EC2C 2V4DA 3JATA 3B4SA 1KKCA 2QWNB 3OUSA 5H6RA 2WA4A 5C8YA 4BR6A 2YC0A 1XDCA 3JAKB 1M56B 3APQA 5GONA 2B5UA 5J2UA 4I0XA 1K73W 2PI5A 4GX2A 4JPRA 3THOA 2WLMA 4J10A 4DV1B 3T1YO 2W0XA 5B1NA 2RDCA 2XAQA 4FLZA 5L3CA 1GKFA 2EIMC 3CCMV 3B8NA 2IM9A 3AG1C 3AK3A 4X64O 1Q5OA 5BY1A 3SPCA 1XHXA 4MVOA 3RVYA 1R6KA 4YJ2B 1PNKA 4JI7B 2KG7B 1GN4A 1JFFA 3DSQA 3BCCH 4W4LA 4N21A 3RVZA 3FB7C 3MDSA 1VQOV 1OCCB 4CC5A 5BR8O 1KD1W 2BTQB 5EYPB 4BW5A 3ML0A 2XAFA 5CA3A 1DF5A 3T2MA 4RQEA 3FYIB 4X1IA 5BXZA 3AG4B 1OZ0A 2Z0AA 3FAVA 2DN9A 5C8YB 2UXDB 2YIBA 1MZEA 5GONB 1SF9A 3BFRA 4LCUC 2E3CA 4I0XB 4F4LA 2KQXA 1RPRA 4K35A 1FXVA 1RFYA 3RWRD 3RYIA 1YI2V 1N0JA 3ASNB 3ZN1A 5JQGA 1M56C 1MOFA 5IY5B 1VQMV 1JR9A 3EFFK 1CPYA 3IJ4A 1YITV 3DC6A 3AG3B 3CXCU 4BIUA 4LF4B 2LGQA 4L8JA 1XNQO 1U96A 2IJJA 1N8RW 3X2QB 4DR4B 1JFFB 4DO2A 1AR4A 2QKSA 4R7CA 1DLBA 3UM7A 4B3RB 3VQYA 1R3KC 5CMUA 2OCHA 4NR1A 4YHHO 2LFRA 2QWQB 4WFEA 1P84F 1Z5VA 1XOUA 3CCLV 3HKEB 1GN2A 4X1IB 3L70H 4FLTA 1S72V 3FAVB 5IYBO 4PD4F 1GM7A 1I5YA 1OCCC 2HJFC 5IYZA 3CCRV 2LJ2A 4G28B 4WCEV 3C3TA 1EM1A 5CBGA 5B1OA 4JI0O 3APOA 1TAEA 4DR2B 2ZIMA 3AG4C 2IW5A 3C90A 3EHBB 3OE7G 4MS2A 4Q6GA 3BA9A 1TGOA 1XBLA 5JQGB 1K33A 3ETEA 5LMUB 4JI6B 3S3WA 3OR7C 1PL4A 1EFRG 1SQBH 4J9YB 4U7OA 3HKCA 2JEXA 3A0HZ 3ASNC 4TOIA 1WB8A 4XBFA 4MTGA 2AGAA 5IY5C 5J2TB 3R66A 1YTFD 1HNXO 3SR2C 1H8EG 1NH2D 3PJSK 1FFXA 3ZJZA 2OYQA 2IJHA 1SZXA 3FFQA 4LC1A 3IFXA 1SESA 2CAZC 2HR3A 2NNUA 1MABG 4K0KB 3ZMUA 4DV0B 4JI2B 4DK0A 2HEPA 2VWKA 1K5QA 3KKYA 1YTFB 4Z1VA 4RWUA 4GKKB 1NH2B 5IYZB 1NT2B 4MTOA 3T1HB 3K3WA 1IXBA 4E2LA 1VF7A 1NBMG 3ABLB 2ZQMA 1EBOA 2CE4A 1K4CC 3CC2V 2PUSA 4CH6A 2P7TC 2FB5A 2NLJC 4I7ZB 1VEWA 4I4TA 3HKCB 3CCEV 3K79A 3PN1A 4PA6A 5H6QA 1R3JC 1PNLA 2MW2B 1HNZB 1ROPA 2UXBB 2Q7HA 1M93A 1S5LZ 1G1XB 3G71V 4WFHA 1BHBA 4AQYB 1FFXB 3WFVA 1J5EB 4UCVA 4DR6B 4LF9B 3U11A 1BE3H 1BT8A 5CBFA 4PHZA 1EN5A 3CCQV 5KHIA 1Q82W 1M90W 2H3OA 3KCYA 3E22A 4B7KA 2QTOA 2WLNA 1KQSU 3W7TA 4PA4A 4EEQA 3AG7A 3D36C 2HG5C 2ZDIA 4HNAB 3QG5A 4JTCB 3SYAA 2JIZG 3WU2Z 3CD6V 2MK3A 3H1KH 1VQ4V 2DYSB 4JAVA 2XUMA 4KP4A 4LFBB 1MMMA 4PA3A 2ZNIA 2Y69B 4IHJA 2DMXA 3FB6C 2WAMA 2BSKA 4MW3A 1SC5B 2CGOA 3ETDA 1H8HG 2X6CA 3E8FA 5L3FA 1EN4A 4QGPA 4UCUA 2UUAB 1SERA 3ABKC 2E76B 4QIWF 4TT3G 4DUZO 4X20A 4GX1A 2W6JG 3LSSA 2E5LB 2F1MA 3E22B 1QBZA 3CC4V 1N36B 5IWAO 3OGCC 1V54B 3GWOA 2FKXA 4I5SA 1VMGA 3S3XA 2PZSA 2DE0X 1TUBA 3CCVV 2JGDA 4Q20A 4DR1O 1XMOO 5AG2A 3HPLC 4BAYA 3JARA 4WFBV 1VQ9V 1BL8A 1GH6A 4O4HA 2Q7EA 4J41A 1H2KA 4JV5O 1E1QG 2AHYA 2YSUB 2JJ1G 3K9AA 1BMFG 4K8XA 2BSKB 4G2KA 4DR3O 1I0HA 4OPAA 3H1LH 1HR0B 4O2AA 3OEEG 4MT8A 2ZR2A 3BRCA 1SQFA 3T4ZA 3JASA 4PDVA 2HVJC 2Y69C 4ZBMA 2L6LA 1PPJH 1KUQA 3W7WA 5L3DA 5IJ0A 5JH7B 4ASUG 3ZEDA 3BA8A 3E89A 1TUBB 1SETA 3AEIA 2ADQB 2JGDB 5KA5A 5HFMA 4U3JA 1OCOC 1XNRB 1MSDA 3F7YC 4UV8A 3JARB 5IJ9A 2JS3A 4DW0A 2W0FC 1R6NA 4O4HB 2YEVB 2P22C 3CS5A 1V54C 5GTHZ 4ZKIA 3SPHA 5TISZ 4WFAV 1KB9F 5FPOA 3W7XA 3ZS8C 4DV3B 1KBHA 3STLC 1K4DC 3JALA 4X1KA 4JASA 4O2AB 1ZTEA 3KZIZ 1EZVH 4TV9A 2C2AA 2CTQA 1U97A 4DXWA 4MW8A 4FLYA 2UUBO 4U7NA 4JTDB 3JASB 2VQEO 3BEHA 3LUTB 1AJNA 2PYJA 1N33O 5JWPA 1BS3A 4RUEA 3KG2A 3SJQC 1JMKC 1ZX3A 2YI8A 1MNGA 4X66B 4MVUA 2HJDA 4PELA 4EKWA 4LFCO 1K92A 5EIBD 4RUFA 1G4YB 4X8AA 1XMQO 5KA6A 5KAIZ 1Q43A 3RFRA 2PYLA 4JF3A 4X88A 1P49A 3ETGA 5IJ9B 4DR7B 1AROP 2HFEC 2ATKC 2UXNA 1I94B 1GN3A 2R9IA 3N2GB 1AVMA 5H9CA 4UUJC 2EX3A 3JALB 4JI1O 3RYHA 3Q4HA 3SYOA 4ZOLA 4TV9B 4JI3O 2OIGA 2NR5A 3B40A 2IBZH 3JD3A 1PV0A 1SRYA 5JJNB 3WB0A 4B3TB 5JVDA 2Y48A 2XAJA 1NU1H 1EZJA 2QR4A 2Q69A 2EJRA 3BY6A 1VQ5V 4BWAA 4ICGA 5LA6A 1L0NH 1IBKO 3KCXA 4J80A 2F4VO 1FS0G
chains in the Genus database with same CATH topology
3G6EV 1F23A 3OMNB 2IJJA 1N8RW 3X2QB 4MVMA 4RAIA 4DO2A 3ZMTA 1E79G 2QKSA 2R9RB 4R7CA 5DM6V 1DLBA 3E35A 1KP2A 3UM7A 5LGNA 4PDLA 1OHHG 4QPKA 5CN0A 3CCJV 1R3KC 1NR1A 5CMUA 2OT5A 5B3SB 3QNEA 2LFRA 4WFEA 1COWG 1G8MA 1YJ9V 1RPOA 3CCLV 3UKMA 3LDEA 1H2GA 4GX0A 5J9PC 1Y66A 3CPWU 1S72V 2AHZA 3RW0A 5IYBO 3FYEB 5L3BA 1NJIW 4GT1A 2QA4V 2ZDIC 1AI4A 1QLEC 1GM7A 3ABMB 1I5YA 1WLEA 2BOCC 1S77D 1OCCC 2ZXWB 1RM1C 3OFNG 2HJFC 1V55B 3CCRV 4G28B 4WCEV 2EZOA 2DYRB 5CBGA 2HLDG 5LGUA 1M57C 5B1OA 3ZMZA 3WG7B 3A0RA 4LP8A 3AG4C 2IW5A 3EHBB 3OE7G 2Q67A 4MS2A 1S5HC 1AJPA 1OCZC 1FXKB 1DF4A 1YSCA 1K33A 1AI6A 3DGEA 3ETEA 4PDMA 3ABUA 4MTFA 5KUKA 4CBCA 1KECA 3OR7C 3VBBA 1K34A 1EFRG 2QM8A 4J9YB 2EIJB 4JYCA 4U7OA 5KUMA 1F4MA 2WWWA 2M7WA 3OAAG 3CCUV 2JEXA 1XL6A 1K3EA 5FL7G 3ASNC 5BZBA 4N23A 4XBFA 2OTJV 4MTGA 5IY5C 4CZZA 1W2BU 2DWEC 4QNHB 1YTFD 1KP3A 1W0KG 4JYBA 5L3GA 1H8EG 4MTXA 3SYQA 3ZRXA 1NH2D 3PJSK 3ZJZA 1OCOB 3ASOB 2IJHA 4LC1A 1YJWV 1K7DA 1QCEA 2JDIG 3IFXA 1SESA 2B1IA 1NVPD 5LGTA 4FPPA 1K97A 1CEZA 2V1DA 2HR3A 2DQ3A 4JAUA 2NNUA 1MABG 3SPJA 4JGSA 4FIPC 3ZMUA 3K0DA 5B1BB 1BHAA 4MSWC 5LBQA 1Y4MA 2LP7A 1GM9A 2LFSA 1K5QA 1YTFB 2A0LA 2D3OW 3I55V 3I56V 1NH2B 5B3SC 3ZRVA 1AI7A 2QE7G 1NVPB 3ZMVA 2OCCB 4MTOA 3QO5A 3B77A 3K3WA 4WF9V 3OEHG 1MSWD 2IH3C 4E2LA 2YEVA 1PNMA 1NBMG 3ABLB 3NXSA 2ZQMA 3DTUB 1EBOA 1L1FA 3ABMC 1VQ8V 4QJFB 2Q6AA 3FB5C 1K4CC 3CC2V 2WLHA 2ZXWC 2P7TC 1V55C 1PD3A 3MD0A 2NLJC 4HYOA 4QE9A 2DYRC 1SZTA 1W0JG 3CCEV 3WG7C 3K79A 4PA6A 5H6QA 1YIJV 1R3JC 4P9OA 2A9HA 1PNLA 1VQNV 1F51A 2EIMB 1E1RG 2IJIA 1ROPA 1FXKC 2X6AA 3AG1B 3R65A 3MHSC 5HFLA 2XAGA 2IU3A 2Z3YA 4GCZA 3G71V 3W7SA 1DTOA 4WFHA 1BHBA 1PL0A 4QE7A 3G4SV 3WFVA 1QR8A 2EIJC 3K08A 4TWKA 5CBFA 4R6ZA 1ENVA 3CCQV 4QPJA 3E8HA 1QVGU 2A79B 4MVSA 2OTLV 4RQFA 1Q82W 1R3LC 3SYPA 2FTKA 1M90W 1H38A 1VQPV 2QTOA 4Z1MG 2Q68A 2WLNA 1KQSU 1Q7YW 1AI5A 3K03A 2HKOA 3P32A 2XAHA 3W7TA 3ABTA 3ASOC 4PA4A 4HAMA 3E83A 2XNDG 5LHIA 3LNMB 4KFMA 3P30A 2EINB 2HG5C 1JCHA 2ZDIA 2V7QG 4JTCB 4PDRA 1CP9A 3SYAA 3ZRSA 2JIZG 5CBHA 1ZWIC 5EBLC 4UV9A 3TCUA 3CD6V 2MK3A 5GW7A 1WPXA 1VQ4V 2DYSB 4PA9A 4JAVA 5IYDO 2F43G 4UXNA 4KP4A 4XDJA 2XASA 2OCCC 3OM3B 1VQ6V 4PA3A 3LSQA 2Y69B 1F4NA 3E2EA 4FJCC 3FB6C 2WAMA 3JCZA 4MW3A 3ETDA 1H8HG 1THZA 2JEUA 2X6CA 5DN6G 5IYCO 5C93A 3QO7A 3E8FA 1S76D 5L3FA 3CCSV 1FXHA 2WPDG 3MHHC 2QM7A 1UJWB 3SYCA 1SERA 3ABKC 3F5WC 3CMAV 4XDKA 4QIWF 4TT3G 5LHHA 4BIZA 1FFTB 4GX1A 1VQ7V 2W6JG 3LSSA 3AG3C 4TSFG 1K9MW 1J95A 2ZD9A 5E1AC 1OCRB 3IC7A 2X7RB 3X2QC 1QBZA 2W6IG 1GMGA 3CC4V 1AJQA 1ORQC 2K1EA 4MVRA 3LDDA 3OGCC 3TK1A 1V54B 3ZMSA 3GWOA 5L3EA 4I5SA 1K8AW 5EBMC 1Q86W 2DWDC 3K04A 3CCVV 1S3JA 4Q20A 1JQ0A 3ZRWA 4X89A 4R50A 4J9ZB 2IJKA 3JD0A 2PI4A 4KUMA 1B6QA 3HPLC 4BAYA 4WFBV 1RM1B 4L87A 1VQ9V 1BL8A 3W7UA 3JD4A 1TUEB 4WFFA 3GB7C 2WLLA 1E1QG 2AHYA 2YSUB 2JJ1G 3K9AA 4G27B 3T1CA 4P30A 3CC7V 2BOBC 1BMFG 3TETA 1Q81W 2EINC 4G2KA 1P4RA 2HVKC 2WSSG 5LHGA 2B1GA 2IH1C 2X6BA 3OEEG 4MT8A 2ZR2A 3M99B 3OW2U 1QVFU 2EILB 1AR1B 1R3IC 1VQKV 3T4ZA 2WLJA 4LBEC 2H94A 3OMIB 4PDVA 2HVJC 2Y69C 5EC1C 2KB1A 4ZBMA 3CP1A 2P67A 3ZCCA 1FXKA 3W7WA 2EIKB 2CK3G 2ZR3A 5L3DA 3VOUA 3D3IA 4UVCA 2WLKA 3IGAC 1XL4A 4H37A 4R8CA 1M1KW 3FB8C 4ASUG 3T4DA 3E89A 1SETA 3AEIA 3OMAB 5KA5A 1GK9A 1I5XA 1GTOA 5HFMA 2WLIA 3ZRWB 1KKDA 1HWYA 1OCOC 3F7YC 4UV8A 1LNQA 1OCRC 1P7BA 2XOKG 3E86A 3QO8A 3RBZA 1VQLV 2W0FC 1QR9A 3E8GA 1R6NA 1JPXA 2YEVB 5B1BC 3AG2B 1V54C 2GHYA 2WLLB 4FMTA 4JTAB 3K06A 4ZKIA 3D36A 2DQ0A 3SPHA 4WFAV 2DW4A 3W7XA 3F7VC 1R73A 4MVZA 4GX5A 4WFGA 3JYCA 5EC2C 3STLC 3CMEV 1K4DC 1GO3F 4JASA 3LDCA 3ZIAG 4UVBA 5B1AB 3CYOA 3FKSG 2C2AA 3OUSA 5H6RA 4DXWA 4MW8A 4U7NA 3ABLC 2Z5UA 1JVMA 1M56B 4JTDB 4MVQA 2EBOA 2B5UA 3BEHA 3LUTB 2X0LA 1AJNA 1K73W 5IDJA 2P90A 2PI5A 4RUEA 3KG2A 3SJQC 4GX2A 3K0GA 4JPRA 2WLMA 2QEXV 3HB3B 5B1NA 2XAQA 4FK5C 5L3CA 1GKFA 2EIMC 4MVUA 3CCMV 4EKWA 2EILC 4PELA 2JJ2G 3B8NA 4RO2A 1JJ2U 1K92A 3AG1C 1S0VA 4RUFA 1G4YB 1NKDA 4X8AA 2IU0A 5KA6A 4I9WA 3SPCA 2EZPA 2WLIB 2GSMB 2ITCC 4MVOA 3RVYA 1R6KA 3STZC 4JF3A 1MG1A 1PNKA 2EIKC 4X88A 3ETGA 2UXXA 4N21A 5EBWC 1QLEB 3RVZA 1AROP 1YJNV 2HFEC 2ATKC 1GM8A 2UXNA 3FB7C 1VQOV 1OCCB 2R9IA 5H9CA 4UUJC 1KD1W 4H33A 4BW5A 3ML0A 2XAFA 1M57B 5CA3A 1DF5A 3T2MA 4RQEA 3FYIB 1IXMA 3B8MA 3AG4B 1OZ0A 3SYOA 2H8PC 4OXSA 4P2ZA 1K5SA 1OCZB 3AG2C 4UVAA 1M9NA 1PKXA 3E8BA 4LCUC 3JD3A 4P9PA 2JK5C 4F4LA 1SRYA 3SPIA 1RPRA 2DYSC 5EK0A 1FXVA 2Y48A 1YHQV 5B1AC 3H01A 3OUFA 2XAJA 1QLNA 4HZ3A 1YI2V 1JX9A 1EZJA 3JD1A 3ASNB 3ZN1A 2Q69A 1KC8W 3ABKB 1M56C 4PA7A 1NR7A 1MOFA 2EJRA 4YXWG 3BY6A 1NQTA 3OR6C 4XDLA 5IY5B 1VQMV 1VQ5V 3EFFK 1CPYA 2P6JA 1YITV 3AG3B 2ITDC 3ZN0A 3SPGA 3CXCU 4BIUA 3JD2A 1FS0G 1JOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4D C;  2IH3 C;  3LDC A;  4MVM A;  2YEV A;  4RAI A;  1J95 A;  2QKS A;  2R9R B;  2ZD9 A;  4R7C A;  5E1A C;  3OUS A;  4DXW A;  3ABM C;  4MW8 A;  3UM7 A;  3X2Q C;  4PDL A;  2Q6A A;  3FB5 C;  1K4C C;  3ABL C;  1ORQ C;  1JVM A;  2WLH A;  2ZXW C;  4JTD B;  2K1E A;  4MVR A;  1R3K C;  2P7T C;  3LDD A;  3OGC C;  4MVQ A;  1V55 C;  5EBM C;  4WFE A;  3BEH A;  2NLJ C;  3LUT B;  2DWD C;  4HYO A;  4QE9 A;  3K04 A;  2DYR C;  3UKM A;  3LDE A;  3WG7 C;  4GX0 A;  3KG2 A;  4RUE A;  4GX2 A;  3K0G A;  4PA6 A;  4X89 A;  4R50 A;  2WLM A;  3SJQ C;  4J9Z B;  1R3J C;  4P9O A;  2A9H A;  2AHZ A;  3RW0 A;  3HPL C;  1QLE C;  2X6A A;  1BL8 A;  3R65 A;  2BOC C;  2EIM C;  4MVU A;  4EKW A;  2EIL C;  4WFF A;  1OCC C;  4RO2 A;  3GB7 C;  2WLL A;  2AHY A;  4WFH A;  4QE7 A;  3AG1 C;  4RUF A;  2HJF C;  4G27 B;  1G4Y B;  3T1C A;  4X8A A;  4G28 B;  2EIJ C;  3K08 A;  4I9W A;  4P30 A;  4TWK A;  3SPC A;  5CBF A;  2BOB C;  5CBG A;  2WLI B;  3TET A;  4R6Z A;  1M57 C;  2ITC C;  2EIN C;  4MVO A;  3RVY A;  3STZ C;  4LP8 A;  3E8H A;  2HVK C;  2EIK C;  3AG4 C;  2A79 B;  4MS2 A;  4MVS A;  2Q67 A;  4X88 A;  1S5H C;  1R3L C;  2IH1 C;  3SYP A;  2X6B A;  1OCZ C;  5EBW C;  3RVZ A;  2QTO A;  2HFE C;  2Q68 A;  2WLN A;  4PDM A;  2ATK C;  3FB7 C;  4MTF A;  5KUK A;  4CBC A;  3OR7 C;  1R3I C;  3K03 A;  3T4Z A;  2WLJ A;  4UUJ C;  3ASO C;  4LBE C;  4PA4 A;  4H33 A;  4PDV A;  4J9Y B;  2HVJ C;  2Y69 C;  3E83 A;  5KUM A;  4BW5 A;  3LNM B;  5EC1 C;  2KB1 A;  4KFM A;  4ZBM A;  2HG5 C;  3T2M A;  5J9P C;  3SYO A;  1XL6 A;  4JTC B;  4PDR A;  2H8P C;  4OXS A;  3ASN C;  4P2Z A;  3VOU A;  3SYA A;  3ZRS A;  5BZB A;  5CBH A;  2WLK A;  1ZWI C;  5EBL C;  3IGA C;  4MTG A;  3TCU A;  1XL4 A;  4H37 A;  5IY5 C;  3AG2 C;  2DWE C;  4QNH B;  4R8C A;  3FB8 C;  3E8B A;  4LCU C;  4P9P A;  3SYQ A;  4PA9 A;  3T4D A;  2JK5 C;  3PJS K;  3E89 A;  4XDJ A;  3ZJZ A;  4F4L A;  3SPI A;  2OCC C;  2DYS C;  4PA3 A;  5EK0 A;  3IFX A;  2WLI A;  1KKD A;  3FB6 C;  4MW3 A;  1OCO C;  3F7Y C;  5B1A C;  2X6C A;  3OUF A;  3SPJ A;  1LNQ A;  1OCR C;  4HZ3 A;  3K0D A;  1P7B A;  4MSW C;  3E8F A;  3E86 A;  3RBZ A;  2W0F C;  3E8G A;  2Q69 A;  4GX1 A;  2A0L A;  1M56 C;  4PA7 A;  5B1B C;  3OR6 C;  4XDL A;  1V54 C;  2WLL B;  3SYC A;  5B3S C;  3EFF K;  4JTA B;  3K06 A;  3ABK C;  3F5W C;  3SPH A;  2ITD C;  4XDK A;  3SPG A;  3F7V C;  4WFG A;  4MVZ A;  4GX5 A;  4MTO A;  3JYC A;  5EC2 C;  3STL C;  3AG3 C; 
#chains in the Genus database with same CATH topology
 1VF6 A;  4RAI A;  3ZMT A;  1OHH G;  2Q0O C;  4DUY B;  4JI8 O;  4LF5 O;  4FM2 A;  5CN0 A;  3BHP A;  2OT5 A;  3UKM A;  1SKV A;  1L0L H;  3LDE A;  4GX0 A;  3RYH B;  3Q4H B;  1MA1 A;  1SQG A;  4DR5 O;  3CPW U;  1GAX A;  4NB5 A;  2ZE6 A;  4ZOL B;  3RW0 A;  4NXM B;  4D7T A;  4FFK A;  3ABM B;  5E79 Z;  5EIB C;  3UQ8 A;  1S77 D;  4GKJ O;  1RM1 C;  2ADP A;  2QDO A;  1V55 B;  5A2Q N;  3G80 A;  2UU9 O;  3DC5 A;  2DYR B;  1T5E A;  3ZMZ A;  4LP8 A;  1A32 A;  2Q67 A;  5CA0 B;  1N34 O;  4DV2 O;  4YY3 B;  1AJP A;  1JA8 A;  4O4L A;  5IT9 N;  3ABU A;  4CBC A;  1KEC A;  4I50 A;  5LA6 B;  3VBB A;  1F7Y A;  1K34 A;  2QM8 A;  5KUM A;  3OAA G;  3CCU V;  2CTR A;  2RNB A;  1XL6 A;  1K3E A;  1FJG B;  2AZ2 A;  1SQQ H;  1IUR A;  5BZB A;  4UCO A;  2ZNJ A;  1W2B U;  1YVW A;  4NXN O;  3A8T A;  1KP3 A;  1W0K G;  3RYC A;  4JI5 O;  1QNM A;  3O9O A;  3ASO B;  1V9P A;  4DV6 B;  4AI8 A;  1NVP D;  2V1D A;  2N04 A;  2QWP B;  5B1B B;  1BHA A;  4MSW C;  5LBQ A;  5LP6 A;  3JAT B;  1GM9 A;  1DK1 A;  2GTA A;  4X1Y A;  3OTO B;  2UXC O;  4GUN A;  2YXH A;  1IBM O;  4GLX A;  1WNS A;  1AI7 A;  4J42 A;  1NVP B;  4OX9 B;  4O4J A;  1Y67 A;  2YI9 A;  5J2U B;  4UCS A;  1UFI A;  3VQX A;  3AK1 A;  5EZY A;  1KU9 A;  4LF7 O;  3ABM C;  2FL4 A;  3FB5 C;  2VS0 A;  4DV7 O;  1V55 C;  1PD3 A;  3MD0 A;  4HYO A;  2P5O A;  2DYR C;  1H2N A;  1SZT A;  1W0J G;  2YIA A;  4LF8 B;  1YIJ V;  4H13 B;  4P9O A;  4DV4 B;  2G38 A;  2A06 H;  1E1R G;  2ZE8 A;  1KYO F;  2XAG A;  4GCZ A;  2Z3Y A;  3UO3 A;  3RYC B;  1HDJ A;  1DTO A;  1PL0 A;  4QE7 A;  1IBL O;  4HBN A;  4IIJ A;  2YIB D;  4JYA B;  1ENV A;  1VF6 C;  4QPJ A;  1YEW A;  3E8H A;  1R3L C;  3L74 H;  5LP6 B;  1VQP V;  1AB3 A;  4X1Y B;  4Z1M G;  4DV5 O;  4IL6 Z;  2B9Z A;  3ASO C;  3H9V A;  4HAM A;  4O4J B;  5LHI A;  1D5A A;  1D5N A;  3QVN A;  5EZY B;  5CBH A;  1ZWI C;  3RYI B;  3TCU A;  4CH4 A;  2RQ6 A;  1WPX A;  4EB6 A;  3ZHR A;  5LMN B;  1SA0 A;  2F43 G;  3F5T A;  2ZIN A;  1NS1 A;  3OM3 B;  3CRQ A;  4DV1 O;  1F4N A;  4X62 B;  3E2E A;  3DXR A;  5C93 A;  5LXT A;  1S76 D;  2WPD G;  3MHH C;  4WBN A;  2PY5 A;  4JZ2 A;  1UJW B;  1FPO A;  3AK2 A;  4NYK A;  3CMA V;  4CS3 A;  2A7W A;  4JI7 O;  3AG3 C;  4TSF G;  2ZD9 A;  1N32 B;  5E1A C;  1OCR B;  2O57 A;  3X2Q C;  1HW7 A;  4FVM A;  4MVR A;  3RT3 C;  1AR5 A;  1K8A W;  5EBM C;  2RJZ A;  2DWD C;  3K04 A;  3K5N A;  1S3J A;  3ZRW A;  4X89 A;  4GYC B;  4J9Z B;  1NTK H;  1Y76 A;  2UXD O;  3LSU A;  2PI4 A;  4KUM A;  1B6Q A;  4B3S B;  3W7U A;  5LL6 Y;  3J80 N;  4EB6 B;  2WLL A;  4G27 B;  3A2F A;  4P30 A;  4EFB A;  1Q81 W;  2LW1 A;  1P4R A;  3DXR B;  2WSS G;  3CRR A;  5LXT B;  2X6B A;  2R70 A;  1BCC H;  3P3N A;  1YZB A;  1R3I C;  1VQK V;  2WLJ A;  4LBE C;  4GZR B;  3OMI B;  4LF4 O;  1SS3 A;  2CDY A;  4DR4 O;  5BMV A;  2ZE5 A;  3CP1 A;  3MAQ A;  2P67 A;  3ZCC A;  1FXK A;  1OJH A;  4X9Q A;  1FAF A;  2EIK B;  2CK3 G;  2ZR3 A;  4B3R O;  3VOU A;  2Q4P A;  5KHG A;  5KAF Z;  2DJV A;  2YUA A;  3VQW A;  1B3Q A;  2QKA A;  1GTO A;  1MZF A;  2WLI A;  3ZRW B;  1KKD A;  1HWY A;  1P7G A;  1FKA O;  4H0L B;  1Y76 B;  4JI4 B;  1M4U A;  1OCR C;  2YDE A;  1P7B A;  2ODM A;  2XOK G;  3RBZ A;  4TQF A;  1YDX A;  3D8C A;  4TUY A;  3ZHQ A;  2EUL A;  2GHY A;  2WLL B;  4FMT A;  4LFA B;  3ZHU A;  2UUC B;  4LF6 B;  3F7V C;  1R73 A;  2QWR B;  4DR2 O;  3CME V;  1NTM H;  1GO3 F;  4I4T B;  3ZIA G;  4UVB A;  4AIL C;  3CYO A;  1I08 A;  5LMU O;  4JI6 O;  3BVO A;  3ABL C;  2Z5U A;  1JVM A;  1AP6 A;  3HR0 A;  1N4C A;  4O2B A;  3VQV A;  2EBO A;  1RSO A;  1HNW B;  2XT9 A;  5IDJ A;  3K0G A;  3OT7 A;  2VQF B;  1LR1 A;  3ZHV A;  1VAR A;  4FK5 C;  5LYJ A;  2JJ2 G;  3CSX A;  3NR7 A;  5KHJ A;  1S0V A;  1NKD A;  2IU0 A;  4J7K A;  2QTS A;  2WLI B;  4K0K O;  3STZ C;  4DV0 O;  2EIK C;  4JI2 O;  4TV8 A;  2UXX A;  4GKK O;  5EBW C;  4TUY B;  1GM8 A;  3SDL A;  3CRA A;  2ZM6 B;  3T1H O;  2HHH B;  3B09 A;  1M57 B;  4E4E A;  1IXM A;  3B8M A;  4X65 B;  4IHJ B;  1WJZ A;  2H8P C;  4P2Z A;  1K5S A;  1Q90 D;  1Y6X A;  4O2B B;  1X4T A;  2AW9 A;  3G67 A;  4JZG A;  2DYS C;  1BGY H;  1XUQ A;  1PP9 H;  1YHQ V;  2Y0P A;  1HNZ O;  3H01 A;  3OUF A;  4X20 B;  1QLN A;  2UXB O;  1IVS A;  1ZSP A;  5D5Q A;  1JX9 A;  2Y4U A;  4UB8 Z;  5KMG A;  4J11 A;  4PA7 A;  1L8D A;  3A0B Z;  4YXW G;  4AQY O;  3OR6 C;  1NQT A;  1J5E O;  2N05 A;  1EN6 A;  4DR6 O;  1WA8 A;  4LF9 O;  1KMI Z;  2ETN A;  4DK1 A;  3ZN0 A;  1Q6U A;  3SPG A;  4LH6 A;  2K9P A;  3G6E V;  1F23 A;  3OMN B;  4MVM A;  2R9R B;  3E35 A;  5FNV A;  4PDL A;  4UCT A;  5B66 Z;  4QPK A;  3CCJ V;  4IYH A;  1NR1 A;  3QNE A;  1YJ9 V;  1G8M A;  4F6R A;  1FYJ A;  3L9D A;  1H2G A;  4KHP B;  5DEC A;  5J9P C;  2OWO A;  4U3F H;  3RYF A;  5L3B A;  3FYE B;  1NJI W;  4GT1 A;  2ZDI C;  1AI4 A;  1WLE A;  2GV9 A;  1YF2 A;  2BOC C;  2ZXW B;  3BAB A;  4LFB O;  3CWB H;  2ZE7 A;  4B3M B;  2VRZ A;  5LGU A;  2QWO B;  1M57 C;  3WG7 B;  3TXQ A;  3A0R A;  2UUA O;  4FZ1 A;  5KMG B;  1DF4 A;  3C3S A;  4BIO A;  1H2L A;  1AI6 A;  3DGE A;  5KUK A;  1WAZ A;  1WA8 B;  5IJ0 B;  4Z2W A;  2EIJ B;  4PI2 A;  1XHZ A;  1ZL8 A;  4NKG B;  2E5L O;  5FL7 G;  3T1Y B;  5FNV B;  4U3J B;  4N23 A;  4CH3 A;  1N36 O;  2RCV A;  2OTJ V;  2DWE C;  4QNH B;  2ZCE A;  4JYB A;  5L3G A;  1Q3E A;  4IGG A;  4MTX A;  3SYQ A;  3EVK A;  3ZRX A;  4F6R B;  4C7U A;  4X64 B;  2RN9 A;  2JDI G;  3CJH A;  2B1I A;  2DQ3 A;  3ICX A;  3RYF B;  3SPJ A;  4JGS A;  4FIP C;  2Q73 A;  1Y4M A;  2KKW A;  4X1K B;  2LFS A;  2A0L A;  4IT5 A;  2D3O W;  3I55 V;  3I56 V;  1AP5 A;  1LUW A;  2QE7 G;  3CRM A;  2Q9L A;  4YIP A;  2OCC B;  5BR8 B;  1HR0 O;  4WF9 V;  3OEH G;  1MSW D;  3SJA C;  3DTU B;  1Q6H A;  1L1F A;  2BTO A;  2EJ7 A;  2WLH A;  2ZXW C;  4QE9 A;  3K5O A;  1GRJ A;  3L72 H;  3WG7 C;  1ZL8 B;  4F6E A;  3RN4 A;  1LUV A;  2A9H A;  4LR3 A;  1F51 A;  2EIM B;  2IJI A;  1SQV H;  4LNU A;  2X6A A;  3AG1 B;  3R65 A;  1Z5W A;  1O9H A;  5HFL A;  2QJ1 A;  4FZ0 A;  3G4S V;  4NVP A;  2EIJ C;  3K08 A;  3CJH B;  1XNR O;  4R6Z A;  1BQ0 A;  1QVG U;  2A79 B;  4MVS A;  2OTL V;  2KSD A;  1XNQ B;  1D2D A;  3SYP A;  2FTK A;  2GBO A;  5ITZ A;  1O9G A;  1AI5 A;  3K03 A;  2HKO A;  3P32 A;  2PTM A;  2XAH A;  3ABT A;  2ILM A;  4DV3 O;  3G6B A;  1G6U A;  4YHH B;  3SJB C;  2XND G;  2KG7 A;  3BPZ A;  4CC6 A;  4B08 A;  4FM0 A;  4O4I A;  3LNN A;  1WPB A;  5JVD B;  3ZRS A;  5EBL C;  2CUG A;  4H44 B;  1TA8 A;  1ZAU A;  5IYD O;  1AIL A;  2XAS A;  2OCC C;  1VQ6 V;  3LSQ A;  4D7S A;  3U0Z A;  4FJC C;  4JI0 B;  5DN6 G;  5IYC O;  4X66 O;  1Y74 A;  4LNU B;  1FXH A;  1XEQ A;  2ARH A;  4UFZ A;  2YS8 A;  1QQC A;  3SYC A;  1S5J A;  2E74 B;  4BIZ A;  3SJC C;  1VQ7 V;  2Y0I A;  2GTS A;  1IDS A;  4DR7 O;  5ITZ B;  2W6I G;  1I94 O;  4LWS A;  1ORQ C;  3TK1 A;  5L3E A;  1Q86 W;  5KLV H;  5JCO A;  1HNX B;  3L73 H;  1JQ0 A;  4R50 A;  4O4I B;  1NI8 A;  2IJK A;  3JD0 A;  3ZX6 A;  5K1X A;  2ZT9 B;  3JD4 A;  3GB7 C;  3L75 H;  3HKE A;  1QU7 A;  3T1C A;  4O4L B;  4B3T O;  3CC7 V;  2BOB C;  4I50 B;  2AZ0 A;  1WP8 A;  2YXY A;  2HVK C;  4KXR A;  1B04 A;  5LHG A;  2B1G A;  1WB7 A;  1Y74 B;  2CTP A;  1TVK A;  3WB2 A;  2E75 B;  4UB6 Z;  2JS5 A;  2EIL B;  2H94 A;  4A5U B;  3P3P A;  5EC1 C;  5JJJ B;  2CTW A;  4DUY O;  4UVC A;  3HKB A;  1OV9 A;  3CEI A;  3EXA A;  3IGA C;  4LWS B;  1XL4 A;  4H37 A;  5H2F Z;  4FLW A;  1M1K W;  1FD9 A;  3WB1 A;  3OMA B;  1GK9 A;  2LO1 A;  2OIE A;  4CH5 A;  3K58 A;  3H1I H;  4NXM O;  5J2T A;  1VQL V;  3QO8 A;  2Y4T A;  3E8G A;  1JPX A;  3CXH F;  4JYY A;  5B1B C;  1YXB A;  3AG2 B;  1XQ8 A;  3FX7 A;  2JVD A;  3K06 A;  1X59 A;  4JTA B;  3D36 A;  2DW4 A;  4WFG A;  4MVZ A;  4GX5 A;  3JYC A;  3K5L A;  4YY3 O;  2XHB A;  3LDC A;  5B1A B;  3K5M A;  3FKS G;  1TVK B;  5D5P A;  2F93 B;  1WN7 A;  3I5D A;  2L35 A;  4MVQ A;  4ZI7 A;  2FYU H;  2X0L A;  1M5I A;  2R72 A;  2P90 A;  3HKD A;  4IIJ B;  1FJG O;  3TGU H;  4FLU A;  5IE9 A;  4FM1 A;  2QEX V;  2GDS A;  2RMK B;  4PI0 A;  3HKB B;  3B2E E;  3HB3 B;  3CRC A;  5KHK A;  3N2K A;  2EIL C;  4RO2 A;  1JJ2 U;  3GVM A;  3K9S A;  4DV6 O;  4I9W A;  4UCR A;  2EZP A;  3N27 A;  2GSM B;  2ITC C;  4J7Z A;  4DUZ B;  1MG1 A;  3UT5 A;  4YIO A;  3OTO O;  1QLE B;  1YJN V;  1H2M A;  5FPR A;  5LP6 C;  5JCO C;  4OX9 O;  5GTI Z;  5IWA B;  3CE2 A;  3IAY A;  2FML A;  4H33 A;  4YJ3 A;  2Q7G A;  5CA1 A;  2PGG A;  1SA0 B;  1URF A;  1W59 A;  4DR1 B;  3CHX A;  4OXS A;  3O65 A;  4CS4 A;  1XMO B;  1OCZ B;  3AG2 C;  4UVA A;  5A9G A;  4OPH A;  1M9N A;  4ZI7 B;  1PKX A;  3E8B A;  4P9P A;  4WBN B;  2D2C B;  2JK5 C;  5B5E Z;  4JV5 B;  2CGN A;  3SPI A;  4LF8 O;  4HNA A;  2LW7 A;  5EK0 A;  3CX5 F;  3HKD B;  4DV4 O;  4NTY A;  2HP8 A;  5B1A C;  4KL1 A;  4DR3 B;  1NZ6 A;  4HZ3 A;  3JD1 A;  4ZHQ A;  3N2K B;  1KC8 W;  1XRE A;  1US6 A;  3ABK B;  2F95 B;  1NR7 A;  4XDL A;  2P6J A;  4JYA O;  2ITD C;  4DRX A;  5FLX N;  3JD2 A;  1JOY A;  2GUZ A;  2QGN A;  3UT5 B;  1R1B A;  1E79 G;  4B7E A;  2BE3 A;  5DM6 V;  5LGN A;  1KP2 A;  3K57 A;  2Q5Z A;  2Q8V A;  2N74 A;  5F2V O;  5B3S B;  3JSL A;  1COW G;  4PV1 B;  4YJ3 B;  1RPO A;  3QF7 A;  5CA1 B;  2ZKO A;  3UCS C;  1Y66 A;  2AHZ A;  1SQX H;  2QA4 V;  2Q0A A;  1QLE C;  2QM4 A;  3SGI A;  4D6T H;  5LMN O;  3OFN G;  2YIC A;  4X62 O;  2EZO A;  2HLD G;  1VP7 A;  4I55 A;  1S5H C;  3J7A U;  4TQD A;  4ZHQ B;  5BMV B;  4ABM A;  1OCZ C;  1CXZ B;  1FXK B;  1YSC A;  4PDM A;  4MTF A;  2AXT Z;  2LQT A;  3M8A A;  2UUB B;  4FLV A;  3K59 A;  1Z2G A;  3RGB A;  1BSM A;  4DRX B;  2F66 C;  4JYC A;  2VQE B;  1F4M A;  2WWW A;  2M7W A;  2PF4 E;  1N33 B;  2GUZ B;  2P06 A;  1N32 O;  1PM9 A;  4ZIB A;  3JCU Z;  1IZ3 A;  4CZZ A;  4BW9 A;  4K8Z A;  4LFC B;  2P4K A;  1OCO B;  3H1H H;  1YJW V;  1K7D A;  1QCE A;  1XMQ B;  1B06 A;  4I9Q A;  5LGT A;  4FPP A;  1K97 A;  1CEZ A;  4JAU A;  4B3S O;  3K0D A;  5JH7 A;  2LP7 A;  4NTW A;  3ETQ A;  5B3S C;  3ZRV A;  4CS2 A;  2VWJ A;  3ZMV A;  3QO5 A;  3B77 A;  1RSO B;  2IH3 C;  3JAW A;  4I55 B;  2JGU A;  2YEV A;  1PNM A;  2YID A;  4LH7 A;  3NXS A;  4JI1 B;  3U10 A;  1VQ8 V;  4QJF B;  2Q6A A;  1SQP H;  1VIB A;  4JI3 B;  5LYJ B;  3TXS A;  3JSN A;  1JJO A;  3D3Q A;  1VQN V;  1FXK C;  2QKC A;  3J81 N;  3M7M X;  3MHS C;  2CH7 A;  4TV8 B;  2IU3 A;  3L71 H;  1RP3 B;  1H2S B;  4EFE A;  3W7S A;  1XI1 A;  1QR8 A;  4TWK A;  2R9A A;  1IBK B;  4JI4 O;  2F4V B;  4RQF A;  2YXL A;  1GN6 A;  1H38 A;  1WP7 A;  4JAA A;  4LFA O;  2Q68 A;  2M6Y A;  2NN4 A;  2UUC O;  4JI8 B;  2BCC H;  4LF6 O;  1Q7Y W;  4LF5 B;  1Q6I A;  4NTX A;  3E83 A;  3LNM B;  4KFM A;  2F23 A;  3P30 A;  2EIN B;  3JAW B;  1JCH A;  1N0N A;  3JAM N;  2V7Q G;  4PDR A;  1DGS A;  1CP9 A;  4DR5 B;  5KX5 A;  3CB2 A;  3N2G A;  4UV9 A;  1R6T A;  1IX9 A;  4AHC A;  4J7J A;  5GW7 A;  1HNW O;  1I7F A;  4PA9 A;  4GKJ B;  5H5N A;  4UXN A;  4XDJ A;  2UU9 B;  3JCZ A;  5CB4 A;  1THZ A;  2JEU A;  2VQF O;  3QO7 A;  2ZIO A;  3TJT A;  3UO2 A;  1BQZ A;  1N34 B;  3CCS V;  4DV2 B;  2CH7 B;  2QM7 A;  3F5W C;  3IC9 A;  2A3Q A;  4XDK A;  5LHH A;  4IYI A;  1FFT B;  3ZHS A;  1K9M W;  1J95 A;  3IC7 A;  3OTF A;  2X7R B;  1GMG A;  1AJQ A;  2ZM6 O;  2K1E A;  3LDD A;  4FFB A;  3ZMS A;  3QTC A;  2HHH O;  4NXN B;  4JI5 B;  2WA3 A;  2P4V A;  1VF5 B;  4X65 O;  2JRI A;  5KX5 B;  1RM1 B;  4L87 A;  3ZHT A;  1TUE B;  4WFF A;  4DYL A;  2UXC B;  5DED A;  5LOV A;  1IBM B;  5JJE B;  3FD9 A;  3TET A;  2EIN C;  5CB4 B;  2LGW A;  1YCI A;  2IH1 C;  4DW1 A;  3M99 B;  3OW2 U;  1QVF U;  2DOS A;  4LF7 B;  3JAK A;  1AR1 B;  1NTZ H;  4DV7 B;  4FLX A;  5CA0 A;  3BAA A;  1ZLZ A;  2KB1 A;  1ZUQ A;  3H1J H;  4K3A A;  3OD4 A;  3D3I A;  4W4K A;  2WLK A;  1UPG A;  4PJ0 Z;  2XTA A;  4FFB B;  4R8C A;  3FB8 C;  1Q8I A;  3T4D A;  4KHP O;  2QSA A;  1IBL B;  1I5X A;  5K1P A;  1QHT A;  3ZBH A;  4YJ2 A;  3GWK C;  1LNQ A;  1BZK A;  3E86 A;  5KHH A;  1QR9 A;  4B3M O;  4OGQ B;  1HP8 A;  5LOV B;  4DV5 B;  2DQ0 A;  3OGI B;  2BTQ A;  1XIL A;  5EYP A;  5EC2 C;  2V4D A;  3JAT A;  3B4S A;  1KKC A;  2QWN B;  3OUS A;  5H6R A;  2WA4 A;  5C8Y A;  4BR6 A;  2YC0 A;  1XDC A;  3JAK B;  1M56 B;  3APQ A;  5GON A;  2B5U A;  5J2U A;  4I0X A;  1K73 W;  2PI5 A;  4GX2 A;  4JPR A;  3THO A;  2WLM A;  4J10 A;  4DV1 B;  3T1Y O;  2W0X A;  5B1N A;  2RDC A;  2XAQ A;  4FLZ A;  5L3C A;  1GKF A;  2EIM C;  3CCM V;  3B8N A;  2IM9 A;  3AG1 C;  3AK3 A;  4X64 O;  1Q5O A;  5BY1 A;  3SPC A;  1XHX A;  4MVO A;  3RVY A;  1R6K A;  4YJ2 B;  1PNK A;  4JI7 B;  2KG7 B;  1GN4 A;  1JFF A;  3DSQ A;  3BCC H;  4W4L A;  4N21 A;  3RVZ A;  3FB7 C;  3MDS A;  1VQO V;  1OCC B;  4CC5 A;  5BR8 O;  1KD1 W;  2BTQ B;  5EYP B;  4BW5 A;  3ML0 A;  2XAF A;  5CA3 A;  1DF5 A;  3T2M A;  4RQE A;  3FYI B;  4X1I A;  5BXZ A;  3AG4 B;  1OZ0 A;  2Z0A A;  3FAV A;  2DN9 A;  5C8Y B;  2UXD B;  2YIB A;  1MZE A;  5GON B;  1SF9 A;  3BFR A;  4LCU C;  2E3C A;  4I0X B;  4F4L A;  2KQX A;  1RPR A;  4K35 A;  1FXV A;  1RFY A;  3RWR D;  3RYI A;  1YI2 V;  1N0J A;  3ASN B;  3ZN1 A;  5JQG A;  1M56 C;  1MOF A;  5IY5 B;  1VQM V;  1JR9 A;  3EFF K;  1CPY A;  3IJ4 A;  1YIT V;  3DC6 A;  3AG3 B;  3CXC U;  4BIU A;  4LF4 B;  2LGQ A;  4L8J A;  1XNQ O;  1U96 A;  2IJJ A;  1N8R W;  3X2Q B;  4DR4 B;  1JFF B;  4DO2 A;  1AR4 A;  2QKS A;  4R7C A;  1DLB A;  3UM7 A;  4B3R B;  3VQY A;  1R3K C;  5CMU A;  2OCH A;  4NR1 A;  4YHH O;  2LFR A;  2QWQ B;  4WFE A;  1P84 F;  1Z5V A;  1XOU A;  3CCL V;  3HKE B;  1GN2 A;  4X1I B;  3L70 H;  4FLT A;  1S72 V;  3FAV B;  5IYB O;  4PD4 F;  1GM7 A;  1I5Y A;  1OCC C;  2HJF C;  5IYZ A;  3CCR V;  2LJ2 A;  4G28 B;  4WCE V;  3C3T A;  1EM1 A;  5CBG A;  5B1O A;  4JI0 O;  3APO A;  1TAE A;  4DR2 B;  2ZIM A;  3AG4 C;  2IW5 A;  3C90 A;  3EHB B;  3OE7 G;  4MS2 A;  4Q6G A;  3BA9 A;  1TGO A;  1XBL A;  5JQG B;  1K33 A;  3ETE A;  5LMU B;  4JI6 B;  3S3W A;  3OR7 C;  1PL4 A;  1EFR G;  1SQB H;  4J9Y B;  4U7O A;  3HKC A;  2JEX A;  3A0H Z;  3ASN C;  4TOI A;  1WB8 A;  4XBF A;  4MTG A;  2AGA A;  5IY5 C;  5J2T B;  3R66 A;  1YTF D;  1HNX O;  3SR2 C;  1H8E G;  1NH2 D;  3PJS K;  1FFX A;  3ZJZ A;  2OYQ A;  2IJH A;  1SZX A;  3FFQ A;  4LC1 A;  3IFX A;  1SES A;  2CAZ C;  2HR3 A;  2NNU A;  1MAB G;  4K0K B;  3ZMU A;  4DV0 B;  4JI2 B;  4DK0 A;  2HEP A;  2VWK A;  1K5Q A;  3KKY A;  1YTF B;  4Z1V A;  4RWU A;  4GKK B;  1NH2 B;  5IYZ B;  1NT2 B;  4MTO A;  3T1H B;  3K3W A;  1IXB A;  4E2L A;  1VF7 A;  1NBM G;  3ABL B;  2ZQM A;  1EBO A;  2CE4 A;  1K4C C;  3CC2 V;  2PUS A;  4CH6 A;  2P7T C;  2FB5 A;  2NLJ C;  4I7Z B;  1VEW A;  4I4T A;  3HKC B;  3CCE V;  3K79 A;  3PN1 A;  4PA6 A;  5H6Q A;  1R3J C;  1PNL A;  2MW2 B;  1HNZ B;  1ROP A;  2UXB B;  2Q7H A;  1M93 A;  1S5L Z;  1G1X B;  3G71 V;  4WFH A;  1BHB A;  4AQY B;  1FFX B;  3WFV A;  1J5E B;  4UCV A;  4DR6 B;  4LF9 B;  3U11 A;  1BE3 H;  1BT8 A;  5CBF A;  4PHZ A;  1EN5 A;  3CCQ V;  5KHI A;  1Q82 W;  1M90 W;  2H3O A;  3KCY A;  3E22 A;  4B7K A;  2QTO A;  2WLN A;  1KQS U;  3W7T A;  4PA4 A;  4EEQ A;  3AG7 A;  3D36 C;  2HG5 C;  2ZDI A;  4HNA B;  3QG5 A;  4JTC B;  3SYA A;  2JIZ G;  3WU2 Z;  3CD6 V;  2MK3 A;  3H1K H;  1VQ4 V;  2DYS B;  4JAV A;  2XUM A;  4KP4 A;  4LFB B;  1MMM A;  4PA3 A;  2ZNI A;  2Y69 B;  4IHJ A;  2DMX A;  3FB6 C;  2WAM A;  2BSK A;  4MW3 A;  1SC5 B;  2CGO A;  3ETD A;  1H8H G;  2X6C A;  3E8F A;  5L3F A;  1EN4 A;  4QGP A;  4UCU A;  2UUA B;  1SER A;  3ABK C;  2E76 B;  4QIW F;  4TT3 G;  4DUZ O;  4X20 A;  4GX1 A;  2W6J G;  3LSS A;  2E5L B;  2F1M A;  3E22 B;  1QBZ A;  3CC4 V;  1N36 B;  5IWA O;  3OGC C;  1V54 B;  3GWO A;  2FKX A;  4I5S A;  1VMG A;  3S3X A;  2PZS A;  2DE0 X;  1TUB A;  3CCV V;  2JGD A;  4Q20 A;  4DR1 O;  1XMO O;  5AG2 A;  3HPL C;  4BAY A;  3JAR A;  4WFB V;  1VQ9 V;  1BL8 A;  1GH6 A;  4O4H A;  2Q7E A;  4J41 A;  1H2K A;  4JV5 O;  1E1Q G;  2AHY A;  2YSU B;  2JJ1 G;  3K9A A;  1BMF G;  4K8X A;  2BSK B;  4G2K A;  4DR3 O;  1I0H A;  4OPA A;  3H1L H;  1HR0 B;  4O2A A;  3OEE G;  4MT8 A;  2ZR2 A;  3BRC A;  1SQF A;  3T4Z A;  3JAS A;  4PDV A;  2HVJ C;  2Y69 C;  4ZBM A;  2L6L A;  1PPJ H;  1KUQ A;  3W7W A;  5L3D A;  5IJ0 A;  5JH7 B;  4ASU G;  3ZED A;  3BA8 A;  3E89 A;  1TUB B;  1SET A;  3AEI A;  2ADQ B;  2JGD B;  5KA5 A;  5HFM A;  4U3J A;  1OCO C;  1XNR B;  1MSD A;  3F7Y C;  4UV8 A;  3JAR B;  5IJ9 A;  2JS3 A;  4DW0 A;  2W0F C;  1R6N A;  4O4H B;  2YEV B;  2P22 C;  3CS5 A;  1V54 C;  5GTH Z;  4ZKI A;  3SPH A;  5TIS Z;  4WFA V;  1KB9 F;  5FPO A;  3W7X A;  3ZS8 C;  4DV3 B;  1KBH A;  3STL C;  1K4D C;  3JAL A;  4X1K A;  4JAS A;  4O2A B;  1ZTE A;  3KZI Z;  1EZV H;  4TV9 A;  2C2A A;  2CTQ A;  1U97 A;  4DXW A;  4MW8 A;  4FLY A;  2UUB O;  4U7N A;  4JTD B;  3JAS B;  2VQE O;  3BEH A;  3LUT B;  1AJN A;  2PYJ A;  1N33 O;  5JWP A;  1BS3 A;  4RUE A;  3KG2 A;  3SJQ C;  1JMK C;  1ZX3 A;  2YI8 A;  1MNG A;  4X66 B;  4MVU A;  2HJD A;  4PEL A;  4EKW A;  4LFC O;  1K92 A;  5EIB D;  4RUF A;  1G4Y B;  4X8A A;  1XMQ O;  5KA6 A;  5KAI Z;  1Q43 A;  3RFR A;  2PYL A;  4JF3 A;  4X88 A;  1P49 A;  3ETG A;  5IJ9 B;  4DR7 B;  1ARO P;  2HFE C;  2ATK C;  2UXN A;  1I94 B;  1GN3 A;  2R9I A;  3N2G B;  1AVM A;  5H9C A;  4UUJ C;  2EX3 A;  3JAL B;  4JI1 O;  3RYH A;  3Q4H A;  3SYO A;  4ZOL A;  4TV9 B;  4JI3 O;  2OIG A;  2NR5 A;  3B40 A;  2IBZ H;  3JD3 A;  1PV0 A;  1SRY A;  5JJN B;  3WB0 A;  4B3T B;  5JVD A;  2Y48 A;  2XAJ A;  1NU1 H;  1EZJ A;  2QR4 A;  2Q69 A;  2EJR A;  3BY6 A;  1VQ5 V;  4BWA A;  4ICG A;  5LA6 A;  1L0N H;  1IBK O;  3KCX A;  4J80 A;  2F4V O;  1FS0 G; 
#chains in the Genus database with same CATH homology
 3G6E V;  1F23 A;  3OMN B;  2IJJ A;  1N8R W;  3X2Q B;  4MVM A;  4RAI A;  4DO2 A;  3ZMT A;  1E79 G;  2QKS A;  2R9R B;  4R7C A;  5DM6 V;  1DLB A;  3E35 A;  1KP2 A;  3UM7 A;  5LGN A;  4PDL A;  1OHH G;  4QPK A;  5CN0 A;  3CCJ V;  1R3K C;  1NR1 A;  5CMU A;  2OT5 A;  5B3S B;  3QNE A;  2LFR A;  4WFE A;  1COW G;  1G8M A;  1YJ9 V;  1RPO A;  3CCL V;  3UKM A;  3LDE A;  1H2G A;  4GX0 A;  5J9P C;  1Y66 A;  3CPW U;  1S72 V;  2AHZ A;  3RW0 A;  5IYB O;  3FYE B;  5L3B A;  1NJI W;  4GT1 A;  2QA4 V;  2ZDI C;  1AI4 A;  1QLE C;  1GM7 A;  3ABM B;  1I5Y A;  1WLE A;  2BOC C;  1S77 D;  1OCC C;  2ZXW B;  1RM1 C;  3OFN G;  2HJF C;  1V55 B;  3CCR V;  4G28 B;  4WCE V;  2EZO A;  2DYR B;  5CBG A;  2HLD G;  5LGU A;  1M57 C;  5B1O A;  3ZMZ A;  3WG7 B;  3A0R A;  4LP8 A;  3AG4 C;  2IW5 A;  3EHB B;  3OE7 G;  2Q67 A;  4MS2 A;  1S5H C;  1AJP A;  1OCZ C;  1FXK B;  1DF4 A;  1YSC A;  1K33 A;  1AI6 A;  3DGE A;  3ETE A;  4PDM A;  3ABU A;  4MTF A;  5KUK A;  4CBC A;  1KEC A;  3OR7 C;  3VBB A;  1K34 A;  1EFR G;  2QM8 A;  4J9Y B;  2EIJ B;  4JYC A;  4U7O A;  5KUM A;  1F4M A;  2WWW A;  2M7W A;  3OAA G;  3CCU V;  2JEX A;  1XL6 A;  1K3E A;  5FL7 G;  3ASN C;  5BZB A;  4N23 A;  4XBF A;  2OTJ V;  4MTG A;  5IY5 C;  4CZZ A;  1W2B U;  2DWE C;  4QNH B;  1YTF D;  1KP3 A;  1W0K G;  4JYB A;  5L3G A;  1H8E G;  4MTX A;  3SYQ A;  3ZRX A;  1NH2 D;  3PJS K;  3ZJZ A;  1OCO B;  3ASO B;  2IJH A;  4LC1 A;  1YJW V;  1K7D A;  1QCE A;  2JDI G;  3IFX A;  1SES A;  2B1I A;  1NVP D;  5LGT A;  4FPP A;  1K97 A;  1CEZ A;  2V1D A;  2HR3 A;  2DQ3 A;  4JAU A;  2NNU A;  1MAB G;  3SPJ A;  4JGS A;  4FIP C;  3ZMU A;  3K0D A;  5B1B B;  1BHA A;  4MSW C;  5LBQ A;  1Y4M A;  2LP7 A;  1GM9 A;  2LFS A;  1K5Q A;  1YTF B;  2A0L A;  2D3O W;  3I55 V;  3I56 V;  1NH2 B;  5B3S C;  3ZRV A;  1AI7 A;  2QE7 G;  1NVP B;  3ZMV A;  2OCC B;  4MTO A;  3QO5 A;  3B77 A;  3K3W A;  4WF9 V;  3OEH G;  1MSW D;  2IH3 C;  4E2L A;  2YEV A;  1PNM A;  1NBM G;  3ABL B;  3NXS A;  2ZQM A;  3DTU B;  1EBO A;  1L1F A;  3ABM C;  1VQ8 V;  4QJF B;  2Q6A A;  3FB5 C;  1K4C C;  3CC2 V;  2WLH A;  2ZXW C;  2P7T C;  1V55 C;  1PD3 A;  3MD0 A;  2NLJ C;  4HYO A;  4QE9 A;  2DYR C;  1SZT A;  1W0J G;  3CCE V;  3WG7 C;  3K79 A;  4PA6 A;  5H6Q A;  1YIJ V;  1R3J C;  4P9O A;  2A9H A;  1PNL A;  1VQN V;  1F51 A;  2EIM B;  1E1R G;  2IJI A;  1ROP A;  1FXK C;  2X6A A;  3AG1 B;  3R65 A;  3MHS C;  5HFL A;  2XAG A;  2IU3 A;  2Z3Y A;  4GCZ A;  3G71 V;  3W7S A;  1DTO A;  4WFH A;  1BHB A;  1PL0 A;  4QE7 A;  3G4S V;  3WFV A;  1QR8 A;  2EIJ C;  3K08 A;  4TWK A;  5CBF A;  4R6Z A;  1ENV A;  3CCQ V;  4QPJ A;  3E8H A;  1QVG U;  2A79 B;  4MVS A;  2OTL V;  4RQF A;  1Q82 W;  1R3L C;  3SYP A;  2FTK A;  1M90 W;  1H38 A;  1VQP V;  2QTO A;  4Z1M G;  2Q68 A;  2WLN A;  1KQS U;  1Q7Y W;  1AI5 A;  3K03 A;  2HKO A;  3P32 A;  2XAH A;  3W7T A;  3ABT A;  3ASO C;  4PA4 A;  4HAM A;  3E83 A;  2XND G;  5LHI A;  3LNM B;  4KFM A;  3P30 A;  2EIN B;  2HG5 C;  1JCH A;  2ZDI A;  2V7Q G;  4JTC B;  4PDR A;  1CP9 A;  3SYA A;  3ZRS A;  2JIZ G;  5CBH A;  1ZWI C;  5EBL C;  4UV9 A;  3TCU A;  3CD6 V;  2MK3 A;  5GW7 A;  1WPX A;  1VQ4 V;  2DYS B;  4PA9 A;  4JAV A;  5IYD O;  2F43 G;  4UXN A;  4KP4 A;  4XDJ A;  2XAS A;  2OCC C;  3OM3 B;  1VQ6 V;  4PA3 A;  3LSQ A;  2Y69 B;  1F4N A;  3E2E A;  4FJC C;  3FB6 C;  2WAM A;  3JCZ A;  4MW3 A;  3ETD A;  1H8H G;  1THZ A;  2JEU A;  2X6C A;  5DN6 G;  5IYC O;  5C93 A;  3QO7 A;  3E8F A;  1S76 D;  5L3F A;  3CCS V;  1FXH A;  2WPD G;  3MHH C;  2QM7 A;  1UJW B;  3SYC A;  1SER A;  3ABK C;  3F5W C;  3CMA V;  4XDK A;  4QIW F;  4TT3 G;  5LHH A;  4BIZ A;  1FFT B;  4GX1 A;  1VQ7 V;  2W6J G;  3LSS A;  3AG3 C;  4TSF G;  1K9M W;  1J95 A;  2ZD9 A;  5E1A C;  1OCR B;  3IC7 A;  2X7R B;  3X2Q C;  1QBZ A;  2W6I G;  1GMG A;  3CC4 V;  1AJQ A;  1ORQ C;  2K1E A;  4MVR A;  3LDD A;  3OGC C;  3TK1 A;  1V54 B;  3ZMS A;  3GWO A;  5L3E A;  4I5S A;  1K8A W;  5EBM C;  1Q86 W;  2DWD C;  3K04 A;  3CCV V;  1S3J A;  4Q20 A;  1JQ0 A;  3ZRW A;  4X89 A;  4R50 A;  4J9Z B;  2IJK A;  3JD0 A;  2PI4 A;  4KUM A;  1B6Q A;  3HPL C;  4BAY A;  4WFB V;  1RM1 B;  4L87 A;  1VQ9 V;  1BL8 A;  3W7U A;  3JD4 A;  1TUE B;  4WFF A;  3GB7 C;  2WLL A;  1E1Q G;  2AHY A;  2YSU B;  2JJ1 G;  3K9A A;  4G27 B;  3T1C A;  4P30 A;  3CC7 V;  2BOB C;  1BMF G;  3TET A;  1Q81 W;  2EIN C;  4G2K A;  1P4R A;  2HVK C;  2WSS G;  5LHG A;  2B1G A;  2IH1 C;  2X6B A;  3OEE G;  4MT8 A;  2ZR2 A;  3M99 B;  3OW2 U;  1QVF U;  2EIL B;  1AR1 B;  1R3I C;  1VQK V;  3T4Z A;  2WLJ A;  4LBE C;  2H94 A;  3OMI B;  4PDV A;  2HVJ C;  2Y69 C;  5EC1 C;  2KB1 A;  4ZBM A;  3CP1 A;  2P67 A;  3ZCC A;  1FXK A;  3W7W A;  2EIK B;  2CK3 G;  2ZR3 A;  5L3D A;  3VOU A;  3D3I A;  4UVC A;  2WLK A;  3IGA C;  1XL4 A;  4H37 A;  4R8C A;  1M1K W;  3FB8 C;  4ASU G;  3T4D A;  3E89 A;  1SET A;  3AEI A;  3OMA B;  5KA5 A;  1GK9 A;  1I5X A;  1GTO A;  5HFM A;  2WLI A;  3ZRW B;  1KKD A;  1HWY A;  1OCO C;  3F7Y C;  4UV8 A;  1LNQ A;  1OCR C;  1P7B A;  2XOK G;  3E86 A;  3QO8 A;  3RBZ A;  1VQL V;  2W0F C;  1QR9 A;  3E8G A;  1R6N A;  1JPX A;  2YEV B;  5B1B C;  3AG2 B;  1V54 C;  2GHY A;  2WLL B;  4FMT A;  4JTA B;  3K06 A;  4ZKI A;  3D36 A;  2DQ0 A;  3SPH A;  4WFA V;  2DW4 A;  3W7X A;  3F7V C;  1R73 A;  4MVZ A;  4GX5 A;  4WFG A;  3JYC A;  5EC2 C;  3STL C;  3CME V;  1K4D C;  1GO3 F;  4JAS A;  3LDC A;  3ZIA G;  4UVB A;  5B1A B;  3CYO A;  3FKS G;  2C2A A;  3OUS A;  5H6R A;  4DXW A;  4MW8 A;  4U7N A;  3ABL C;  2Z5U A;  1JVM A;  1M56 B;  4JTD B;  4MVQ A;  2EBO A;  2B5U A;  3BEH A;  3LUT B;  2X0L A;  1AJN A;  1K73 W;  5IDJ A;  2P90 A;  2PI5 A;  4RUE A;  3KG2 A;  3SJQ C;  4GX2 A;  3K0G A;  4JPR A;  2WLM A;  2QEX V;  3HB3 B;  5B1N A;  2XAQ A;  4FK5 C;  5L3C A;  1GKF A;  2EIM C;  4MVU A;  3CCM V;  4EKW A;  2EIL C;  4PEL A;  2JJ2 G;  3B8N A;  4RO2 A;  1JJ2 U;  1K92 A;  3AG1 C;  1S0V A;  4RUF A;  1G4Y B;  1NKD A;  4X8A A;  2IU0 A;  5KA6 A;  4I9W A;  3SPC A;  2EZP A;  2WLI B;  2GSM B;  2ITC C;  4MVO A;  3RVY A;  1R6K A;  3STZ C;  4JF3 A;  1MG1 A;  1PNK A;  2EIK C;  4X88 A;  3ETG A;  2UXX A;  4N21 A;  5EBW C;  1QLE B;  3RVZ A;  1ARO P;  1YJN V;  2HFE C;  2ATK C;  1GM8 A;  2UXN A;  3FB7 C;  1VQO V;  1OCC B;  2R9I A;  5H9C A;  4UUJ C;  1KD1 W;  4H33 A;  4BW5 A;  3ML0 A;  2XAF A;  1M57 B;  5CA3 A;  1DF5 A;  3T2M A;  4RQE A;  3FYI B;  1IXM A;  3B8M A;  3AG4 B;  1OZ0 A;  3SYO A;  2H8P C;  4OXS A;  4P2Z A;  1K5S A;  1OCZ B;  3AG2 C;  4UVA A;  1M9N A;  1PKX A;  3E8B A;  4LCU C;  3JD3 A;  4P9P A;  2JK5 C;  4F4L A;  1SRY A;  3SPI A;  1RPR A;  2DYS C;  5EK0 A;  1FXV A;  2Y48 A;  1YHQ V;  5B1A C;  3H01 A;  3OUF A;  2XAJ A;  1QLN A;  4HZ3 A;  1YI2 V;  1JX9 A;  1EZJ A;  3JD1 A;  3ASN B;  3ZN1 A;  2Q69 A;  1KC8 W;  3ABK B;  1M56 C;  4PA7 A;  1NR7 A;  1MOF A;  2EJR A;  4YXW G;  3BY6 A;  1NQT A;  3OR6 C;  4XDL A;  5IY5 B;  1VQM V;  1VQ5 V;  3EFF K;  1CPY A;  2P6J A;  1YIT V;  3AG3 B;  2ITD C;  3ZN0 A;  3SPG A;  3CXC U;  4BIU A;  3JD2 A;  1FS0 G;  1JOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...