4DR2O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr2O00
4DR1O 2F4VO 2ZKOA 1G1XB 1KUQA 4DV5O 4LF9O 4GKJO 5IWAO 1XEQA 5BY1A 4DV0O 4DR3O 4B3MO 1J5EO 1XMQO 2UUCO 4JI0O 3M8AA 4NXMO 4JYAO 1X59A 4JI6O 1XNQO 1I94O 4YHHO 3SDLA 3JAMN 1AILA 4DV3O 1DK1A 4LF6O 4OX9O 2VQEO 1A32A 2JRIA 4X64O 4DUYO 2UUBO 5LL6Y 4DR2O 2UXDO 2FKXA 1N36O 4DR6O 2DJVA 4JI2O 4DV4O 1HNWO 2VQFO 1N33O 3J81N 4X65O 3T1YO 4OPAA 3F5TA 1R6TA 2ZM6O 4DV1O 2UUAO 2AGAA 1XMOO 4LF8O 4AQYO 1IBLO 4DUZO 3J80N 5IT9N 1HNXO 1NS1A 4LFBO 2E5LO 1AB3A 2LW7A 4LF7O 5LMNO 1D2DA 1HR0O 5BXZA 2UXBO 4JI5O 4DV7O 1IBMO 4GKKO 4OPHA 4JI7O 2DOSA 5A2QN 2N74A 1FYJA 3T1HO 2HHHO 4NXNO 4LFAO 3R66A 5BR8O 5H5NA 5LMUO 1FJGO 1XNRO 3OTOO 4DV2O 2UU9O 4DV6O 4JI1O 1N32O 4YY3O 1YZBA 4JI8O 4JV5O 4LF5O 4DR7O 4LFCO 2Z0AA 4X62O 1F7YA 4B3RO 5FLXN 4B3TO 4JI4O 4LF4O 4X66O 4JI3O 1IBKO 4DR4O 4A5UB 4KHPO 3J7AU 1N34O 2UXCO 1R1BA 3RT3C 1FKAO 3O65A 4DR5O 4B3SO 4K0KO 1HNZO
chains in the Genus database with same CATH superfamily
1R3LC 3ZHTA 4JI4B 4MTFA 3K79A 4CH5A 3L75H 5B3SB 1EN6A 1FXHA 3FFQA 2YXYA 1SQPH 1MNGA 5IJ0A 4WBNB 1SQQH 2HG5C 1OCOB 4P2ZA 1COWG 2F66C 3VBBA 3UO2A 1MG1A 4O4JA 1NVPD 2DJVA 4X9QA 1VARA 4AHCA 5IDJA 1SQVH 3JARA 2ITCC 1HR0B 1H2MA 1W0KG 2YC0A 4JGSA 4DUZO 1HNXO 4G27B 3CRAA 2DWEC 1EM1A 3A0BZ 5JJJB 2QWRB 3ABKB 1MZEA 1B6QA 4GX1A 5KX5A 4MSWC 2PZSA 3CD6V 4I50B 2B9ZA 1VQ7V 3T1HO 1MSWD 1P7GA 2Q7EA 3QVNA 3OTOO 4JZGA 2R70A 4GKKB 4DV6O 4JI1O 3UT5A 5FNVA 4ZI7A 4NXNB 2D3OW 5IJ0B 2WSSG 5IY5C 4NB5A 5KHKA 3CC2V 1SC5B 2QM4A 1G4YB 4L8JA 2UU9B 2EZOA 3ZRWA 4R7CA 2D2CB 3BA9A 1SQBH 5C8YA 5LYJA 3SJAC 4EEQA 1NTMH 3ZBHA 4UCTA 2XTAA 1I5XA 4ZIBA 1N4CA 4PHZA 2FL4A 4GLXA 1YI2V 4B3RB 3GWKC 2W6JG 1DGSA 4EFEA 2HFEC 1K4CC 1XBLA 1Q90D 3K04A 3QG5A 3T4ZA 2EILC 2YI9A 1BSMA 3STLC 1AI5A 3CP1A 4YHHO 1Q5OA 2RDCA 2RQ6A 3E22A 2G38A 2AXTZ 3FYIB 5KX5B 2OCCB 1TUBA 1US6A 3JAWA 4RWUA 1URFA 4PI0A 1TAEA 2FB5A 3K0DA 3HKDA 1K8AW 2Q7GA 3T1YO 1XOUA 3X2QB 1HW7A 1NTKH 3UT5B 1YHQV 5FNVB 1SS3A 3R65A 3FYEB 4LF8O 4HZ3A 2YXHA 2P6JA 2YIDA 3JAKA 3AG4B 3I55V 3WU2Z 1Q7YW 1H2GA 1Y76A 4DV1B 2Q6AA 3ZRWB 5C8YB 1ZUQA 5LYJB 3ASOC 3OD4A 2KB1A 3THOA 3JD3A 4P9PA 4XBFA 3OW2U 4J7KA 2JJ2G 4LFCB 1AJPA 1N0JA 2RNBA 3H1KH 1B3QA 1VQKV 4ZBMA 4J11A 4LWSA 3ABLC 1Q43A 2QE7G 2LGWA 2CUGA 3L71H 2NR5A 1BE3H 3D3QA 5J2TA 5E1AC 3CCQV 4DR1B 5H9CA 4I5SA 3H1HH 4KL1A 4EB6B 3PN1A 1TUBB 1R3KC 1KB9F 1NBMG 1OJHA 3JAWB 2CTRA 2Q67A 4JZ2A 2QWNB 4O4HA 2ADQB 3HKDB 2PYLA 4KHPB 5BY1A 4IIJA 4FFBA 1F23A 1HNZB 3AG2B 1M90W 2EJ7A 4UCRA 3K5OA 1XDCA 4MVUA 2DQ3A 1XNQO 2WWWA 1VQ8V 3RYCA 1Y76B 2ILMA 4RQEA 4DR3B 2VQEO 1A32A 1AR4A 2ZINA 4TQDA 4X64O 1XMQB 2UUBO 1M9NA 3Q4HA 4DR6O 5KHHA 5EC2C 1TVKA 1HNWO 2FTKA 4PA4A 3JCUZ 3RYHA 2P4VA 4UFZA 1UJWB 3I56V 2B1IA 5H6RA 5J2TB 2E5LO 4I9WA 4LF7O 1JOYA 4HNAA 3DXRB 2CTPA 1WB7A 2XAFA 2A7WA 3OM3B 4D7SA 4LFBB 1AI6A 4O4HB 5LBQA 2BOBC 1Z5VA 1Y74A 3CRQA 3MAQA 1M93A 4DV2O 1XI1A 4BW5A 1GAXA 4FLYA 3SYCA 2PY5A 2HHHB 4O2AA 1JJ2U 2GDSA 4CS2A 1FXKA 1FJGB 4GT1A 1MABG 4JF3A 3RYCB 1ZX3A 1O9HA 1SA0A 2JIZG 3RYIA 1VF6C 4X89A 1KBHA 2WA4A 4LBEC 5JJEB 1R73A 3Q4HB 4LF5B 3O65A 3SPCA 4IT5A 1TVKB 2JS5A 4N21A 2GTAA 4DV5O 3WB2A 5IJ9B 5B1BC 3JD2A 3LDCA 4GKJO 4JI3B 3D36A 3RYHB 1SQFA 4LC1A 5DM6V 2JS3A 4J41A 4B3SB 1I7FA 3M8AA 4MVMA 3P32A 3JATA 1SF9A 4R8CA 5JVDA 2P22C 5FL7G 5KHGA 5DEDA 2N05A 4JYBA 1AILA 4HNAB 1CEZA 1N33B 2IW5A 4MVSA 4XDKA 3K59A 1JMKC 3CB2A 4MTOA 4TV9A 3JASA 5EYPB 1EFRG 1U96A 2WLKA 5L3FA 2VS0A 4OGQB 2X6AA 3KCYA 5EIBC 1VQLV 2YIAA 1E1QG 4B08A 1MZFA 2Y0IA 2YIBD 3QO5A 2CK3G 2AGAA 1X4TA 3ZHRA 5KA5A 4DK1A 2EINC 1EZJA 1SA0B 3RYIB 4H13B 1Q3EA 4H37A 5EBWC 2ZIOA 1OHHG 1XMOB 1LR1A 4CBCA 3ZEDA 2OTLV 3TK1A 4FLWA 4ZOLA 4FM2A 1W2BU 4JV5B 4JI5B 4J42A 4O2BA 1MMMA 1V55B 4P30A 1N32O 4WFAV 3HKCA 2ATKC 2Q0AA 3ZHQA 1P4RA 1R6NA 3SYAA 3JATB 2LFSA 1SRYA 2ZXWB 3A2FA 4FLVA 1YITV 1F7YA 3ICXA 5FLXN 2RN9A 4YY3B 1GN2A 1GN3A 1OCRC 1QR9A 3JCZA 1FPOA 2QTSA 4BR6A 4TV9B 1N34O 3AK3A 1H2LA 5L3GA 1CXZB 2YSUB 3CCEV 3OUFA 1VEWA 1G1XB 1UPGA 4YJ2A 5GW7A 3G6BA 3ASNB 1S76D 5H6QA 2ARHA 2HVKC 4DR5B 4K0KB 1F4MA 2Y69C 1M56B 1SZXA 1GTOA 1SKVA 4UXNA 2VWJA 3K03A 5L3CA 2PTMA 4JYAO 2H3OA 2P5OA 4HAMA 3T2MA 3OT7A 4LF6O 4DV0B 1Q82W 2VRZA 4C7UA 1BZKA 3LNMB 3HKBB 4E2LA 1R6KA 4JPRA 5H2FZ 4NTXA 4JI6B 1AVMA 1TGOA 3FB5C 4H0LB 2X0LA 3ZRSA 2EIMC 3DC5A 2QEXV 2ZE6A 4DUYB 4O2BB 3F5TA 3ZHVA 2DYSC 3HKCB 2CTQA 2UUAO 1Z2GA 2WLJA 2YS8A 2EIKC 2OWOA 3ETDA 3J80N 5JQGA 1QHTA 5KHJA 1QLEC 2EZPA 3GWOA 3E86A 1TUEB 1V54C 5LMNO 2XAJA 2ZM6B 1HDJA 5JCOC 3CC4V 4TV8B 3ZJZA 1BQ0A 1SQGA 2DYRB 1PP9H 1FYJA 3LNNA 3AK2A 5LMUO 3LDDA 1QQCA 1S72V 4RUFA 1SQXH 4X1YA 2PGGA 2UXBB 1PD3A 4K8ZA 2JEXA 2CDYA 3BABA 3SJQC 1QNMA 3OGIB 3FB6C 1AP5A 3LSSA 5BR8B 4F6RB 4FZ1A 4MTGA 2GTSA 4NYKA 2ZQMA 1L1FA 4B7KA 3ZHUA 4A5UB 2F23A 3B40A 1QU7A 1KECA 4U7OA 2R9RB 1JPXA 4U3FH 2WLLA 3L72H 2IM9A 4LF9O 1IBKB 2X7RB 1RFYA 1Q6HA 4PA3A 3AG7A 5K1PA 1J5EO 3SPIA 3UQ8A 3E35A 5JQGB 2UXXA 1KKDA 5IWAB 1W59A 1DK1A 4I50A 2UUCB 1P84F 1ZAUA 3I5DA 3F5WC 4JI2O 4K8XA 1K4DC 3AEIA 5F2VO 2A0LA 4X1YB 2MW2B 1OV9A 4DW1A 5IYDO 1R6TA 1PNLA 3U0ZA 1PPJH 2HJDA 4FMTA 1K7DA 1RM1B 4FPPA 2VQFB 5IT9N 2A06H 3ZRVA 2P4KA 1K92A 3B4SA 3N27A 1PL4A 5BXZA 1NI8A 2WA3A 4FK5C 2EIJC 3E8FA 1NR1A 5LGUA 1XL6A 3RN4A 2HP8A 4B7EA 2WLLB 4G28B 4BW9A 1WN7A 5FPOA 2ZDIA 1IBMB 5BMVA 1BMFG 3D3IA 1MSDA 3RW0A 1KQSU 4DR7O 1N8RW 4FIPC 5CBFA 1WNSA 2P7TC 2AZ2A 1Y67A 1YTFB 4UCVA 1PL0A 4Z2WA 4YXWG 1DF4A 2WPDG 2NN4A 1SESA 3UM7A 4QJFB 4Q20A 1YCIA 2XOKG 4NKGB 1K33A 2UXCB 3F7YC 3K0GA 4MVQA 3QNEA 4X20B 2BTQA 3OMAB 5IY5B 4NXMO 2AZ0A 4I7ZB 4TOIA 1NH2B 3SDLA 3CWBH 4OX9O 2VWKA 1M57B 3RFRA 2FKXA 1QR8A 2JJ1G 2JVDA 2Q73A 2MK3A 1KYOF 4YJ3B 4ASUG 2B1GA 4TSFG 4OXSA 3W7UA 1Q6UA 3RGBA 5EK0A 5BMVB 1IZ3A 4LF7B 4CS3A 5CA0A 2YICA 1VQ9V 1GM8A 2EILB 4EB6A 3OMIB 3WB0A 2PYJA 1BQZA 3IC7A 1AB3A 1ENVA 1WAZA 2OYQA 4UVAA 1D2DA 1EN4A 3M99B 3CPWU 2CGNA 3K5NA 3UKMA 4D6TH 4FLXA 4I4TA 3LDEA 3ABUA 4J9ZB 3SPGA 4F6EA 1GH6A 2XNDG 2Y48A 1YIJV 4DV7B 2W0XA 4AI8A 5IYZA 4JI8O 3AG3C 2BTQB 4BAYA 3K57A 4JI4O 3E8HA 2V1DA 3FAVA 2Q0OC 4J7ZA 1Y6XA 4ICGA 3RT3C 3ASOB 4FLUA 3L70H 3S3XA 4X62B 2XUMA 3WG7C 4CS4A 3U10A 1GMGA 1Y66A 4UCOA 5FPRA 1XEQA 3ABLB 5CA0B 1IVSA 1BS3A 3VQXA 4AILC 2F4VB 3DXRA 5B5EZ 1JR9A 4KP4A 4UCUA 3ZMUA 1NT2B 1XQ8A 3G4SV 3DGEA 3ZMZA 4PDRA 2Q7HA 3EFFK 4YIPA 4I4TB 5D5PA 1I94B 2ZNJA 5CMUA 4U3JA 2CH7A 3J81N 1VQ4V 1GK9A 4DR2B 1Q81W 1WPXA 5IYZB 1N36B 3OUSA 3H1IH 1VQ5V 3AG1C 2CE4A 3DC6A 1IBLO 4WFFA 4X65B 2LP7A 3RVZA 2BTOA 2ZR2A 2Q5ZA 5IYCO 3FAVB 4R6ZA 1BGYH 2E76B 1R3IC 3ZX6A 4GKKO 3C90A 1EZVH 1N32B 5IJ9A 1LUWA 1KP3A 3HB3B 4NXNO 1D5NA 1I5YA 1M5IA 5KMGB 3QO8A 1YF2A 3ETGA 4DYLA 2Q8VA 3M7MX 1WLEA 3HKEA 3CCUV 2UU9O 3P30A 5IYBO 4JI7B 1YZBA 2GHYA 2DQ0A 5LXTA 2XAGA 2E3CA 3IJ4A 5B1AB 4MVZA 2Q9LA 3FD9A 4CH3A 1Q86W 4B3RO 2QM7A 4ABMA 5EYPA 1OCCC 4DR4O 4CH6A 5LA6B 2ZT9B 1L0NH 4FM1A 1ZWIC 3KCXA 4U3JB 2CH7B 3NXSA 1I08A 5J2UA 2QKSA 4LF6B 3ABMB 4PA6A 3EHBB 2L35A 4CH4A 4NR1A 3A0RA 2HLDG 3CSXA 1VP7A 1F4NA 5CBGA 1H8EG 1RPRA 5EZYB 4UV9A 3SYQA 4JI0B 2Z5UA 5CN0A 2KQXA 4TUYA 4QPJA 3CS5A 4NVPA 1N0NA 4I55A 3FB7C 5B1BB 3IFXA 5KAFZ 2CAZC 3HKEB 2UXDB 4DV1O 1AI4A 1S0VA 4PA9A 1D5AA 5LXTB 1NQTA 2EBOA 1EBOA 4G2KA 3APOA 1FFXA 1VF7A 1EN5A 1K5SA 4UB6Z 5CA1A 4RQFA 4JTCB 1AR1B 3ZIAG 3JD4A 2ZIMA 5LMUB 3FB8C 1IXBA 2QSAA 1RP3B 4KFMA 2PF4E 4LH6A 2DWDC 4DRXA 2ETNA 1K5QA 4FLZA 5J2UB 4LFAB 4PI2A 4DXWA 3VQWA 3STZC 1XNRB 1B06A 1GM9A 3HKBA 4FLTA 4J80A 2IH3C 1KKCA 3UO3A 1FXKC 1K73W 4KHPO 3J7AU 1KMIZ 2LGQA 4FVMA 4UUJC 2WLIA 2ZD9A 2F43G 4TUYB 1HNZO 5KA6A 3W7XA 4WF9V 4RUEA 2YXLA 1Y4MA 1QLNA 4I55B 4TT3G 4LF4B 3ZHSA 4O4LA 3OR6C 2LW1A 4LNUA 4DR3O 1E79G 3OE7G 2NLJC 1XMQO 3ABTA 1MA1A 2HJFC 3D36C 3K3WA 1OCZC 5LP6A 1O9GA 4TV8A 3BPZA 1FFXB 4DW0A 5CA1B 2HKOA 5LOVB 5JCOA 1OCRB 3G6EV 3G80A 1JVMA 4GYCB 4BIUA 3GVMA 3CMAV 3SGIA 2KSDA 4WFHA 4I9QA 4DRXB 1AP6A 2DE0X 4F6RA 4XDJA 3S3WA 2R9IA 2Y69B 3FX7A 4AQYO 2W0FC 3TXSA 4CZZA 2P90A 4LFBO 1VQNV 4EFBA 3ETEA 3TETA 2XAQA 1M56C 2IJKA 2OIGA 1JJOA 1GM7A 2WLIB 4DUZB 1HNXB 3K08A 2HHHO 2HR3A 3R66A 4JYYA 1F51A 4L87A 1S5HC 2EIMB 1G8MA 2F93B 1FJGO 4DR7B 4GX0A 3L74H 3MDSA 2LO1A 4O4LB 1FAFA 4IHJA 4LNUB 4LCUC 2EIKB 3T1HB 4JYCA 4LF5O 3B2EE 3P3PA 1HWYA 1JCHA 5LP6B 3OTOB 2Y4UA 4DV6B 2XHBA 4JI1B 4X66O 4JI3O 4CC6A 3AK1A 5KUKA 3BA8A 3GB7C 2E75B 1WA8A 4B3SO 1IURA 2Y0PA 1BHBA 5DECA 3QTCA 1S3JA 3H01A 1K34A 1YSCA 1DTOA 2IU0A 4RAIA 5CBHA 2GSMB 4QE7A 3U11A 3EXAA 2QKCA 5E79Z 2YUAA 4O4IB 3A0HZ 4FFKA 4DV3O 3BHPA 1VF5B 3CCMV 2GV9A 3ZN1A 4FZ0A 1XREA 5B1NA 2Z3YA 1AJNA 4PJ0Z 1XHXA 4YHHB 1JX9A 1JFFA 3VQYA 1BT8A 3HR0A 2XT9A 1RSOA 1GN4A 4IHJB 3C3SA 4BIOA 2JGDA 3BCCH 1XMOO 5BZBA 1NS1A 1WB8A 1ZLZA 4X8AA 1M4UA 3OAAG 4PELA 3T1YB 5A9GA 2CGOA 3VQVA 4JI5O 4LF8B 1S5LZ 4GX5A 1NR7A 1WA8B 2R72A 3CMEV 1YJWV 1YVWA 5H5NA 1NVPB 2ZCEA 4X20A 4HYOA 2UXNA 4ZHQA 5L3DA 5B3SC 5TISZ 4YY3O 3K06A 3ZMSA 3UCSC 2RJZA 2E74B 2NNUA 2EX3A 2LJ2A 3A8TA 3B8NA 1U97A 1OCOC 1YJNV 1RM1C 2IJIA 4YJ3A 1NU1H 2QM8A 2FYUH 3E2EA 2X6BA 1R3JC 2EIJB 2QGNA 4QGPA 4DR5O 3LSUA 4K0KO 2A79B 2JEUA 3SJCC 1JFFB 1PM9A 3MHHC 1GKFA 1MOFA 2ITDC 1RSOB 4JAVA 3RYFA 4DV0O 2PI4A 2JGDB 4PDVA 5CB4B 1NZ6A 1VQOV 1BCCH 4MTXA 3D8CA 4JI6O 4TWKA 1J95A 2M6YA 3ABKC 4GUNA 3APQA 3FKSG 4IL6Z 3ML0A 2JRIA 4DUYO 1XILA 2QWPB 3W7WA 1XNQB 3RVYA 3N2GA 1VQPV 1Z5WA 4DV4O 1W0JG 2R9AA 1IBLB 2VQEB 4X1IA 2DN9A 3OEEG 5L3EA 4X64B 4ZHQB 2UUBB 2CTWA 2ZM6O 1YDXA 5KLVH 4DR6B 3ZMTA 3EVKA 1HNWB 4XDLA 3IC9A 2QA4V 1YTFD 2DMXA 2YEVA 3ZRXA 3SR2C 1XL4A 2L6LA 2UXBO 4EKWA 4GX2A 3SPJA 3W7SA 2E5LB 4O4JB 5JH7A 1M57C 5BR8O 2N04A 3C3TA 3K5MA 2Q68A 3TJTA 4UVBA 2V7QG 1AI7A 5J9PC 4JTAB 3RYFB 3SYOA 1NH2D 3K9AA 4DR4B 3JARB 2XAHA 2ZDIC 2BCCH 4DV2B 4B3TO 1WP8A 3CX5F 1WPBA 3G67A 3JALA 1IBKO 5C93A 2OCCC 3TXQA 2HVJC 3HPLC 3N2GB 2ZKOA 4PDMA 1E1RG 4YIOA 2K1EA 4X1IB 3K5LA 5IWAO 1AR5A 3CRRA 3IGAC 3E8BA 4B3MO 3X2QC 2UUCO 3AG3B 2RCVA 3QF7A 4CC5A 2BSKA 2A9HA 2WLNA 1KD1W 1X59A 2YEVB 4DV5B 1B04A 2OCHA 3JSNA 5GTHZ 4QE9A 3B8MA 4ZI7B 3ZS8C 4GKJB 3AG4C 3E8GA 5DN6G 3SYPA 1IDSA 3CXHF 3SPHA 1WJZA 5KMGA 1VQMV 1PNMA 1FS0G 3MD0A 2F1MA 1P7BA 2DW4A 4PDLA 5JH7B 2VQFO 3WG7B 4OPAA 2OIEA 1G6UA 2IU3A 2BOCC 4TQFA 1SERA 1QCEA 4JAAA 2M7WA 4R50A 4Z1MG 2OTJV 5LA6A 4D7TA 1HP8A 1HR0O 1KU9A 4J9YB 3JALB 2Q4PA 2ZE8A 3CYOA 2LFRA 4X1KA 1IBMO 3E22B 4IYHA 2P06A 4MVRA 3K9SA 1IX9A 3MHSC 5B1OA 2AHYA 1AROP 2WLMA 4BIZA 3AG1B 1GN6A 2Y4TA 3KZIZ 3AG2C 2BSKB 1VF6A 1JQ0A 3CHXA 5EZYA 1PKXA 5EBLC 3OEHG 4MW8A 2QDOA 3LSQA 2ADPA 3W7TA 3ZCCA 2W6IG 3JAKB 3QO7A 3G71V 3TCUA 2AW9A 2UXCO 1R1BA 2ZE7A 1FKAO 1DLBA 1DF5A 2AHZA 2B5UA 2JK5C 3H1LH 5LGNA 4KUMA 5EC1C 1N34B 1WP7A 4QPKA 2ZR3A 4I0XA 3WB1A 1BHAA 4LWSB 3KKYA 2YIBA 5JJNB 1FFTB 5ITZA 4Q6GA 1OCCB 5B1AC 4X1KB 3CXCU 1UFIA 3CCJV 5D5QA 4JYAB 3O9OA 3F7VC 3N2KA 4AQYB 3E89A 1AJQA 2IH1C 3WFVA 4H33A 3PJSK 2K9PA 3L9DA 4MVOA 2FMLA 3ETQA 4ZKIA 3B77A 4GCZA 4E4EA 4KXRA 4IIJB 4FFBB 4NTWA 2WLHA 5LHGA 3ABMC 4WFEA 1K9MW 1OZ0A 4JASA 2IJHA 1V9PA 4FM0A 2UUAB 4DV7O 5KUMA 1Q8IA 3CCVV 5A2QN 2YI8A 1YXBA 3TGUH 5LMNB 3CC7V 2C2AA 3ZMVA 3RBZA 1SETA 2BE3A 5GTIZ 5JWPA 4X66B 4I0XB 3BEHA 5AG2A 2IJJA 5KAIZ 5LOVA 4LFCO 1RPOA 5GONA 2RMKB 4X62O 5ITZB 4K3AA 2LQTA 4UV8A 1THZA 4DR1O 2F4VO 3N2KB 1ZL8A 4PA7A 3H9VA 3CEIA 4WFGA 1CP9A 3JD1A 4DV3B 1T5EA 3T4DA 4H44B 2EINB 4LH7A 2PI5A 1Y74B 2IBZH 3CE2A 1H2NA 2QR4A 5LGTA 5B66Z 2ZNIA 1S77D 5K1XA 1I94O 5HFLA 3BVOA 4LF9B 4O2AB 4QIWF 3CCSV 2PUSA 4JAUA 1FXKB 1YJ9V 5EBMC 3B09A 1J5EB 1QVFU 4DR2O 5IE9A 4MW3A 3E83A 2OT5A 1N36O 5EIBD 2P67A 4BWAA 2EJRA 1ZSPA 1GO3F 4W4KA 1GRJA 4X65O 1H2KA 4F4LA 3K58A 3T1CA 3CRMA 1V55C 3BY6A 1NTZH 1BL8A 1I0HA 1L0LH 4NTYA 1QVGU 4LP8A 1OCZB 4JI2B 2X6CA 5GONB 2ZXWC 2HEPA 5CA3A 1TA8A 3RWRD 5JVDB 3OR7C 4WFBV 3BRCA 2H94A 4OPHA 4JI7O 3LUTB 2DOSA 1K3EA 1PNKA 2EULA 4MT8A 1ZL8B 3P3NA 3JASB 4W4LA 2H8PC 3ASNC 1P49A 5LHIA 1VIBA 1LNQA 3DSQA 3NR7A 4GZRB 3JYCA 4O4IA 2KG7A 4Z1VA 2JDIG 4DK0A 3KG2A 2WAMA 1FXVA 1KP2A 3CJHA 4HBNA 3OMNB 1H38A 1ORQC 3SJBC 4PV1B 4X88A 2JGUA 2DYSB 1KUQA 5KHIA 3DTUB 3CRCA 4FJCC 1SZTA 4ZOLB 1ROPA 1QLEB 4JI0O 2GUZA 1L8DA 1IXMA 1V54B 1QBZA 2YDEA 4QNHB 1VMGA 2V4DA 1XUQA 3JAMN 4DV4B 1K97A 3IAYA 3OGCC 3ZN0A 5LP6C 1ZTEA 4WCEV 5LL6Y 2UXDO 3OFNG 5HFMA 4JTDB 2DYRC 4IGGA 4MS2A 4NXMB 3JD0A 1H8HG 2Q69A 1N33O 1VQ6V 4N23A 4OX9B 1YEWA 1NJIW 3L73H 4YJ2B 2QWOB 2ZE5A 4U7NA 2KKWA 4RO2A 5LHHA 2KG7B 4WBNA 1CPYA 2QJ1A 1S5JA 1FD9A 2LW7A 3BFRA 4PD4F 3CCLV 1PV0A 4K35A 2F95B 3CJHB 3BAAA 3CCRV 2N74A 1NKDA 2GBOA 3H1JH 4LFAO 3JSLA 4DO2A 2A3QA 1XNRO 5CB4A 1Q6IA 4IYIA 4UVCA 4B3TB 4UB8Z 4P9OA 2GUZB 3OTFA 4JV5O 1JA8A 2Z0AA 1KC8W 4UCSA 3VOUA 1XHZA 4J10A 2QTOA 2ODMA 2QKAA 4J7JA 4LF4O 1H2SB 4LR3A 4JI8B 2O57A 1LUVA 1M1KW 2XASA 2QWQB 4B3MB 5L3BA
chains in the Genus database with same CATH topology
4DR1O 2F4VO 2ZKOA 1G1XB 1KUQA 4DV5O 4LF9O 4GKJO 5IWAO 1XEQA 5BY1A 4DV0O 4DR3O 4B3MO 1J5EO 1XMQO 2UUCO 4JI0O 3M8AA 4NXMO 4JYAO 1X59A 4JI6O 1XNQO 1I94O 4YHHO 3SDLA 3JAMN 1AILA 4DV3O 1DK1A 4LF6O 4OX9O 2VQEO 1A32A 2JRIA 4X64O 4DUYO 2UUBO 5LL6Y 4DR2O 2UXDO 2FKXA 1N36O 4DR6O 2DJVA 4JI2O 4DV4O 1HNWO 2VQFO 1N33O 3J81N 4X65O 3T1YO 4OPAA 3F5TA 1R6TA 2ZM6O 4DV1O 2UUAO 2AGAA 1XMOO 4LF8O 4AQYO 1IBLO 4DUZO 3J80N 5IT9N 1HNXO 1NS1A 4LFBO 2E5LO 1AB3A 2LW7A 4LF7O 5LMNO 1D2DA 1HR0O 5BXZA 2UXBO 4JI5O 4DV7O 1IBMO 4GKKO 4OPHA 4JI7O 2DOSA 5A2QN 2N74A 1FYJA 3T1HO 2HHHO 4NXNO 4LFAO 3R66A 5BR8O 5H5NA 5LMUO 1FJGO 1XNRO 3OTOO 4DV2O 2UU9O 4DV6O 4JI1O 1N32O 4YY3O 1YZBA 4JI8O 4JV5O 4LF5O 4DR7O 4LFCO 2Z0AA 4X62O 1F7YA 4B3RO 5FLXN 4B3TO 4JI4O 4LF4O 4X66O 4JI3O 1IBKO 4DR4O 4A5UB 4KHPO 3J7AU 1N34O 2UXCO 1R1BA 3RT3C 1FKAO 3O65A 4DR5O 4B3SO 4K0KO 1HNZO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 O;  2F4V O;  2ZKO A;  1G1X B;  1KUQ A;  4DV5 O;  4LF9 O;  4GKJ O;  5IWA O;  1XEQ A;  5BY1 A;  4DV0 O;  4DR3 O;  4B3M O;  1J5E O;  1XMQ O;  2UUC O;  4JI0 O;  3M8A A;  4NXM O;  4JYA O;  1X59 A;  4JI6 O;  1XNQ O;  1I94 O;  4YHH O;  3SDL A;  3JAM N;  1AIL A;  4DV3 O;  1DK1 A;  4LF6 O;  4OX9 O;  2VQE O;  1A32 A;  2JRI A;  4X64 O;  4DUY O;  2UUB O;  5LL6 Y;  4DR2 O;  2UXD O;  2FKX A;  1N36 O;  4DR6 O;  2DJV A;  4JI2 O;  4DV4 O;  1HNW O;  2VQF O;  1N33 O;  3J81 N;  4X65 O;  3T1Y O;  4OPA A;  3F5T A;  1R6T A;  2ZM6 O;  4DV1 O;  2UUA O;  2AGA A;  1XMO O;  4LF8 O;  4AQY O;  1IBL O;  4DUZ O;  3J80 N;  5IT9 N;  1HNX O;  1NS1 A;  4LFB O;  2E5L O;  1AB3 A;  2LW7 A;  4LF7 O;  5LMN O;  1D2D A;  1HR0 O;  5BXZ A;  2UXB O;  4JI5 O;  4DV7 O;  1IBM O;  4GKK O;  4OPH A;  4JI7 O;  2DOS A;  5A2Q N;  2N74 A;  1FYJ A;  3T1H O;  2HHH O;  4NXN O;  4LFA O;  3R66 A;  5BR8 O;  5H5N A;  5LMU O;  1FJG O;  1XNR O;  3OTO O;  4DV2 O;  2UU9 O;  4DV6 O;  4JI1 O;  1N32 O;  4YY3 O;  1YZB A;  4JI8 O;  4JV5 O;  4LF5 O;  4DR7 O;  4LFC O;  2Z0A A;  4X62 O;  1F7Y A;  4B3R O;  5FLX N;  4B3T O;  4JI4 O;  4LF4 O;  4X66 O;  4JI3 O;  1IBK O;  4DR4 O;  4A5U B;  4KHP O;  3J7A U;  1N34 O;  2UXC O;  1R1B A;  3RT3 C;  1FKA O;  3O65 A;  4DR5 O;  4B3S O;  4K0K O;  1HNZ O; 
#chains in the Genus database with same CATH topology
 1R3L C;  3ZHT A;  4JI4 B;  4MTF A;  3K79 A;  4CH5 A;  3L75 H;  5B3S B;  1EN6 A;  1FXH A;  3FFQ A;  2YXY A;  1SQP H;  1MNG A;  5IJ0 A;  4WBN B;  1SQQ H;  2HG5 C;  1OCO B;  4P2Z A;  1COW G;  2F66 C;  3VBB A;  3UO2 A;  1MG1 A;  4O4J A;  1NVP D;  2DJV A;  4X9Q A;  1VAR A;  4AHC A;  5IDJ A;  1SQV H;  3JAR A;  2ITC C;  1HR0 B;  1H2M A;  1W0K G;  2YC0 A;  4JGS A;  4DUZ O;  1HNX O;  4G27 B;  3CRA A;  2DWE C;  1EM1 A;  3A0B Z;  5JJJ B;  2QWR B;  3ABK B;  1MZE A;  1B6Q A;  4GX1 A;  5KX5 A;  4MSW C;  2PZS A;  3CD6 V;  4I50 B;  2B9Z A;  1VQ7 V;  3T1H O;  1MSW D;  1P7G A;  2Q7E A;  3QVN A;  3OTO O;  4JZG A;  2R70 A;  4GKK B;  4DV6 O;  4JI1 O;  3UT5 A;  5FNV A;  4ZI7 A;  4NXN B;  2D3O W;  5IJ0 B;  2WSS G;  5IY5 C;  4NB5 A;  5KHK A;  3CC2 V;  1SC5 B;  2QM4 A;  1G4Y B;  4L8J A;  2UU9 B;  2EZO A;  3ZRW A;  4R7C A;  2D2C B;  3BA9 A;  1SQB H;  5C8Y A;  5LYJ A;  3SJA C;  4EEQ A;  1NTM H;  3ZBH A;  4UCT A;  2XTA A;  1I5X A;  4ZIB A;  1N4C A;  4PHZ A;  2FL4 A;  4GLX A;  1YI2 V;  4B3R B;  3GWK C;  2W6J G;  1DGS A;  4EFE A;  2HFE C;  1K4C C;  1XBL A;  1Q90 D;  3K04 A;  3QG5 A;  3T4Z A;  2EIL C;  2YI9 A;  1BSM A;  3STL C;  1AI5 A;  3CP1 A;  4YHH O;  1Q5O A;  2RDC A;  2RQ6 A;  3E22 A;  2G38 A;  2AXT Z;  3FYI B;  5KX5 B;  2OCC B;  1TUB A;  1US6 A;  3JAW A;  4RWU A;  1URF A;  4PI0 A;  1TAE A;  2FB5 A;  3K0D A;  3HKD A;  1K8A W;  2Q7G A;  3T1Y O;  1XOU A;  3X2Q B;  1HW7 A;  1NTK H;  3UT5 B;  1YHQ V;  5FNV B;  1SS3 A;  3R65 A;  3FYE B;  4LF8 O;  4HZ3 A;  2YXH A;  2P6J A;  2YID A;  3JAK A;  3AG4 B;  3I55 V;  3WU2 Z;  1Q7Y W;  1H2G A;  1Y76 A;  4DV1 B;  2Q6A A;  3ZRW B;  5C8Y B;  1ZUQ A;  5LYJ B;  3ASO C;  3OD4 A;  2KB1 A;  3THO A;  3JD3 A;  4P9P A;  4XBF A;  3OW2 U;  4J7K A;  2JJ2 G;  4LFC B;  1AJP A;  1N0J A;  2RNB A;  3H1K H;  1B3Q A;  1VQK V;  4ZBM A;  4J11 A;  4LWS A;  3ABL C;  1Q43 A;  2QE7 G;  2LGW A;  2CUG A;  3L71 H;  2NR5 A;  1BE3 H;  3D3Q A;  5J2T A;  5E1A C;  3CCQ V;  4DR1 B;  5H9C A;  4I5S A;  3H1H H;  4KL1 A;  4EB6 B;  3PN1 A;  1TUB B;  1R3K C;  1KB9 F;  1NBM G;  1OJH A;  3JAW B;  2CTR A;  2Q67 A;  4JZ2 A;  2QWN B;  4O4H A;  2ADQ B;  3HKD B;  2PYL A;  4KHP B;  5BY1 A;  4IIJ A;  4FFB A;  1F23 A;  1HNZ B;  3AG2 B;  1M90 W;  2EJ7 A;  4UCR A;  3K5O A;  1XDC A;  4MVU A;  2DQ3 A;  1XNQ O;  2WWW A;  1VQ8 V;  3RYC A;  1Y76 B;  2ILM A;  4RQE A;  4DR3 B;  2VQE O;  1A32 A;  1AR4 A;  2ZIN A;  4TQD A;  4X64 O;  1XMQ B;  2UUB O;  1M9N A;  3Q4H A;  4DR6 O;  5KHH A;  5EC2 C;  1TVK A;  1HNW O;  2FTK A;  4PA4 A;  3JCU Z;  3RYH A;  2P4V A;  4UFZ A;  1UJW B;  3I56 V;  2B1I A;  5H6R A;  5J2T B;  2E5L O;  4I9W A;  4LF7 O;  1JOY A;  4HNA A;  3DXR B;  2CTP A;  1WB7 A;  2XAF A;  2A7W A;  3OM3 B;  4D7S A;  4LFB B;  1AI6 A;  4O4H B;  5LBQ A;  2BOB C;  1Z5V A;  1Y74 A;  3CRQ A;  3MAQ A;  1M93 A;  4DV2 O;  1XI1 A;  4BW5 A;  1GAX A;  4FLY A;  3SYC A;  2PY5 A;  2HHH B;  4O2A A;  1JJ2 U;  2GDS A;  4CS2 A;  1FXK A;  1FJG B;  4GT1 A;  1MAB G;  4JF3 A;  3RYC B;  1ZX3 A;  1O9H A;  1SA0 A;  2JIZ G;  3RYI A;  1VF6 C;  4X89 A;  1KBH A;  2WA4 A;  4LBE C;  5JJE B;  1R73 A;  3Q4H B;  4LF5 B;  3O65 A;  3SPC A;  4IT5 A;  1TVK B;  2JS5 A;  4N21 A;  2GTA A;  4DV5 O;  3WB2 A;  5IJ9 B;  5B1B C;  3JD2 A;  3LDC A;  4GKJ O;  4JI3 B;  3D36 A;  3RYH B;  1SQF A;  4LC1 A;  5DM6 V;  2JS3 A;  4J41 A;  4B3S B;  1I7F A;  3M8A A;  4MVM A;  3P32 A;  3JAT A;  1SF9 A;  4R8C A;  5JVD A;  2P22 C;  5FL7 G;  5KHG A;  5DED A;  2N05 A;  4JYB A;  1AIL A;  4HNA B;  1CEZ A;  1N33 B;  2IW5 A;  4MVS A;  4XDK A;  3K59 A;  1JMK C;  3CB2 A;  4MTO A;  4TV9 A;  3JAS A;  5EYP B;  1EFR G;  1U96 A;  2WLK A;  5L3F A;  2VS0 A;  4OGQ B;  2X6A A;  3KCY A;  5EIB C;  1VQL V;  2YIA A;  1E1Q G;  4B08 A;  1MZF A;  2Y0I A;  2YIB D;  3QO5 A;  2CK3 G;  2AGA A;  1X4T A;  3ZHR A;  5KA5 A;  4DK1 A;  2EIN C;  1EZJ A;  1SA0 B;  3RYI B;  4H13 B;  1Q3E A;  4H37 A;  5EBW C;  2ZIO A;  1OHH G;  1XMO B;  1LR1 A;  4CBC A;  3ZED A;  2OTL V;  3TK1 A;  4FLW A;  4ZOL A;  4FM2 A;  1W2B U;  4JV5 B;  4JI5 B;  4J42 A;  4O2B A;  1MMM A;  1V55 B;  4P30 A;  1N32 O;  4WFA V;  3HKC A;  2ATK C;  2Q0A A;  3ZHQ A;  1P4R A;  1R6N A;  3SYA A;  3JAT B;  2LFS A;  1SRY A;  2ZXW B;  3A2F A;  4FLV A;  1YIT V;  1F7Y A;  3ICX A;  5FLX N;  2RN9 A;  4YY3 B;  1GN2 A;  1GN3 A;  1OCR C;  1QR9 A;  3JCZ A;  1FPO A;  2QTS A;  4BR6 A;  4TV9 B;  1N34 O;  3AK3 A;  1H2L A;  5L3G A;  1CXZ B;  2YSU B;  3CCE V;  3OUF A;  1VEW A;  1G1X B;  1UPG A;  4YJ2 A;  5GW7 A;  3G6B A;  3ASN B;  1S76 D;  5H6Q A;  2ARH A;  2HVK C;  4DR5 B;  4K0K B;  1F4M A;  2Y69 C;  1M56 B;  1SZX A;  1GTO A;  1SKV A;  4UXN A;  2VWJ A;  3K03 A;  5L3C A;  2PTM A;  4JYA O;  2H3O A;  2P5O A;  4HAM A;  3T2M A;  3OT7 A;  4LF6 O;  4DV0 B;  1Q82 W;  2VRZ A;  4C7U A;  1BZK A;  3LNM B;  3HKB B;  4E2L A;  1R6K A;  4JPR A;  5H2F Z;  4NTX A;  4JI6 B;  1AVM A;  1TGO A;  3FB5 C;  4H0L B;  2X0L A;  3ZRS A;  2EIM C;  3DC5 A;  2QEX V;  2ZE6 A;  4DUY B;  4O2B B;  3F5T A;  3ZHV A;  2DYS C;  3HKC B;  2CTQ A;  2UUA O;  1Z2G A;  2WLJ A;  2YS8 A;  2EIK C;  2OWO A;  3ETD A;  3J80 N;  5JQG A;  1QHT A;  5KHJ A;  1QLE C;  2EZP A;  3GWO A;  3E86 A;  1TUE B;  1V54 C;  5LMN O;  2XAJ A;  2ZM6 B;  1HDJ A;  5JCO C;  3CC4 V;  4TV8 B;  3ZJZ A;  1BQ0 A;  1SQG A;  2DYR B;  1PP9 H;  1FYJ A;  3LNN A;  3AK2 A;  5LMU O;  3LDD A;  1QQC A;  1S72 V;  4RUF A;  1SQX H;  4X1Y A;  2PGG A;  2UXB B;  1PD3 A;  4K8Z A;  2JEX A;  2CDY A;  3BAB A;  3SJQ C;  1QNM A;  3OGI B;  3FB6 C;  1AP5 A;  3LSS A;  5BR8 B;  4F6R B;  4FZ1 A;  4MTG A;  2GTS A;  4NYK A;  2ZQM A;  1L1F A;  4B7K A;  3ZHU A;  4A5U B;  2F23 A;  3B40 A;  1QU7 A;  1KEC A;  4U7O A;  2R9R B;  1JPX A;  4U3F H;  2WLL A;  3L72 H;  2IM9 A;  4LF9 O;  1IBK B;  2X7R B;  1RFY A;  1Q6H A;  4PA3 A;  3AG7 A;  5K1P A;  1J5E O;  3SPI A;  3UQ8 A;  3E35 A;  5JQG B;  2UXX A;  1KKD A;  5IWA B;  1W59 A;  1DK1 A;  4I50 A;  2UUC B;  1P84 F;  1ZAU A;  3I5D A;  3F5W C;  4JI2 O;  4K8X A;  1K4D C;  3AEI A;  5F2V O;  2A0L A;  4X1Y B;  2MW2 B;  1OV9 A;  4DW1 A;  5IYD O;  1R6T A;  1PNL A;  3U0Z A;  1PPJ H;  2HJD A;  4FMT A;  1K7D A;  1RM1 B;  4FPP A;  2VQF B;  5IT9 N;  2A06 H;  3ZRV A;  2P4K A;  1K92 A;  3B4S A;  3N27 A;  1PL4 A;  5BXZ A;  1NI8 A;  2WA3 A;  4FK5 C;  2EIJ C;  3E8F A;  1NR1 A;  5LGU A;  1XL6 A;  3RN4 A;  2HP8 A;  4B7E A;  2WLL B;  4G28 B;  4BW9 A;  1WN7 A;  5FPO A;  2ZDI A;  1IBM B;  5BMV A;  1BMF G;  3D3I A;  1MSD A;  3RW0 A;  1KQS U;  4DR7 O;  1N8R W;  4FIP C;  5CBF A;  1WNS A;  2P7T C;  2AZ2 A;  1Y67 A;  1YTF B;  4UCV A;  1PL0 A;  4Z2W A;  4YXW G;  1DF4 A;  2WPD G;  2NN4 A;  1SES A;  3UM7 A;  4QJF B;  4Q20 A;  1YCI A;  2XOK G;  4NKG B;  1K33 A;  2UXC B;  3F7Y C;  3K0G A;  4MVQ A;  3QNE A;  4X20 B;  2BTQ A;  3OMA B;  5IY5 B;  4NXM O;  2AZ0 A;  4I7Z B;  4TOI A;  1NH2 B;  3SDL A;  3CWB H;  4OX9 O;  2VWK A;  1M57 B;  3RFR A;  2FKX A;  1QR8 A;  2JJ1 G;  2JVD A;  2Q73 A;  2MK3 A;  1KYO F;  4YJ3 B;  4ASU G;  2B1G A;  4TSF G;  4OXS A;  3W7U A;  1Q6U A;  3RGB A;  5EK0 A;  5BMV B;  1IZ3 A;  4LF7 B;  4CS3 A;  5CA0 A;  2YIC A;  1VQ9 V;  1GM8 A;  2EIL B;  4EB6 A;  3OMI B;  3WB0 A;  2PYJ A;  1BQZ A;  3IC7 A;  1AB3 A;  1ENV A;  1WAZ A;  2OYQ A;  4UVA A;  1D2D A;  1EN4 A;  3M99 B;  3CPW U;  2CGN A;  3K5N A;  3UKM A;  4D6T H;  4FLX A;  4I4T A;  3LDE A;  3ABU A;  4J9Z B;  3SPG A;  4F6E A;  1GH6 A;  2XND G;  2Y48 A;  1YIJ V;  4DV7 B;  2W0X A;  4AI8 A;  5IYZ A;  4JI8 O;  3AG3 C;  2BTQ B;  4BAY A;  3K57 A;  4JI4 O;  3E8H A;  2V1D A;  3FAV A;  2Q0O C;  4J7Z A;  1Y6X A;  4ICG A;  3RT3 C;  3ASO B;  4FLU A;  3L70 H;  3S3X A;  4X62 B;  2XUM A;  3WG7 C;  4CS4 A;  3U10 A;  1GMG A;  1Y66 A;  4UCO A;  5FPR A;  1XEQ A;  3ABL B;  5CA0 B;  1IVS A;  1BS3 A;  3VQX A;  4AIL C;  2F4V B;  3DXR A;  5B5E Z;  1JR9 A;  4KP4 A;  4UCU A;  3ZMU A;  1NT2 B;  1XQ8 A;  3G4S V;  3DGE A;  3ZMZ A;  4PDR A;  2Q7H A;  3EFF K;  4YIP A;  4I4T B;  5D5P A;  1I94 B;  2ZNJ A;  5CMU A;  4U3J A;  2CH7 A;  3J81 N;  1VQ4 V;  1GK9 A;  4DR2 B;  1Q81 W;  1WPX A;  5IYZ B;  1N36 B;  3OUS A;  3H1I H;  1VQ5 V;  3AG1 C;  2CE4 A;  3DC6 A;  1IBL O;  4WFF A;  4X65 B;  2LP7 A;  3RVZ A;  2BTO A;  2ZR2 A;  2Q5Z A;  5IYC O;  3FAV B;  4R6Z A;  1BGY H;  2E76 B;  1R3I C;  3ZX6 A;  4GKK O;  3C90 A;  1EZV H;  1N32 B;  5IJ9 A;  1LUW A;  1KP3 A;  3HB3 B;  4NXN O;  1D5N A;  1I5Y A;  1M5I A;  5KMG B;  3QO8 A;  1YF2 A;  3ETG A;  4DYL A;  2Q8V A;  3M7M X;  1WLE A;  3HKE A;  3CCU V;  2UU9 O;  3P30 A;  5IYB O;  4JI7 B;  1YZB A;  2GHY A;  2DQ0 A;  5LXT A;  2XAG A;  2E3C A;  3IJ4 A;  5B1A B;  4MVZ A;  2Q9L A;  3FD9 A;  4CH3 A;  1Q86 W;  4B3R O;  2QM7 A;  4ABM A;  5EYP A;  1OCC C;  4DR4 O;  4CH6 A;  5LA6 B;  2ZT9 B;  1L0N H;  4FM1 A;  1ZWI C;  3KCX A;  4U3J B;  2CH7 B;  3NXS A;  1I08 A;  5J2U A;  2QKS A;  4LF6 B;  3ABM B;  4PA6 A;  3EHB B;  2L35 A;  4CH4 A;  4NR1 A;  3A0R A;  2HLD G;  3CSX A;  1VP7 A;  1F4N A;  5CBG A;  1H8E G;  1RPR A;  5EZY B;  4UV9 A;  3SYQ A;  4JI0 B;  2Z5U A;  5CN0 A;  2KQX A;  4TUY A;  4QPJ A;  3CS5 A;  4NVP A;  1N0N A;  4I55 A;  3FB7 C;  5B1B B;  3IFX A;  5KAF Z;  2CAZ C;  3HKE B;  2UXD B;  4DV1 O;  1AI4 A;  1S0V A;  4PA9 A;  1D5A A;  5LXT B;  1NQT A;  2EBO A;  1EBO A;  4G2K A;  3APO A;  1FFX A;  1VF7 A;  1EN5 A;  1K5S A;  4UB6 Z;  5CA1 A;  4RQF A;  4JTC B;  1AR1 B;  3ZIA G;  3JD4 A;  2ZIM A;  5LMU B;  3FB8 C;  1IXB A;  2QSA A;  1RP3 B;  4KFM A;  2PF4 E;  4LH6 A;  2DWD C;  4DRX A;  2ETN A;  1K5Q A;  4FLZ A;  5J2U B;  4LFA B;  4PI2 A;  4DXW A;  3VQW A;  3STZ C;  1XNR B;  1B06 A;  1GM9 A;  3HKB A;  4FLT A;  4J80 A;  2IH3 C;  1KKC A;  3UO3 A;  1FXK C;  1K73 W;  4KHP O;  3J7A U;  1KMI Z;  2LGQ A;  4FVM A;  4UUJ C;  2WLI A;  2ZD9 A;  2F43 G;  4TUY B;  1HNZ O;  5KA6 A;  3W7X A;  4WF9 V;  4RUE A;  2YXL A;  1Y4M A;  1QLN A;  4I55 B;  4TT3 G;  4LF4 B;  3ZHS A;  4O4L A;  3OR6 C;  2LW1 A;  4LNU A;  4DR3 O;  1E79 G;  3OE7 G;  2NLJ C;  1XMQ O;  3ABT A;  1MA1 A;  2HJF C;  3D36 C;  3K3W A;  1OCZ C;  5LP6 A;  1O9G A;  4TV8 A;  3BPZ A;  1FFX B;  4DW0 A;  5CA1 B;  2HKO A;  5LOV B;  5JCO A;  1OCR B;  3G6E V;  3G80 A;  1JVM A;  4GYC B;  4BIU A;  3GVM A;  3CMA V;  3SGI A;  2KSD A;  4WFH A;  4I9Q A;  4DRX B;  1AP6 A;  2DE0 X;  4F6R A;  4XDJ A;  3S3W A;  2R9I A;  2Y69 B;  3FX7 A;  4AQY O;  2W0F C;  3TXS A;  4CZZ A;  2P90 A;  4LFB O;  1VQN V;  4EFB A;  3ETE A;  3TET A;  2XAQ A;  1M56 C;  2IJK A;  2OIG A;  1JJO A;  1GM7 A;  2WLI B;  4DUZ B;  1HNX B;  3K08 A;  2HHH O;  2HR3 A;  3R66 A;  4JYY A;  1F51 A;  4L87 A;  1S5H C;  2EIM B;  1G8M A;  2F93 B;  1FJG O;  4DR7 B;  4GX0 A;  3L74 H;  3MDS A;  2LO1 A;  4O4L B;  1FAF A;  4IHJ A;  4LNU B;  4LCU C;  2EIK B;  3T1H B;  4JYC A;  4LF5 O;  3B2E E;  3P3P A;  1HWY A;  1JCH A;  5LP6 B;  3OTO B;  2Y4U A;  4DV6 B;  2XHB A;  4JI1 B;  4X66 O;  4JI3 O;  4CC6 A;  3AK1 A;  5KUK A;  3BA8 A;  3GB7 C;  2E75 B;  1WA8 A;  4B3S O;  1IUR A;  2Y0P A;  1BHB A;  5DEC A;  3QTC A;  1S3J A;  3H01 A;  1K34 A;  1YSC A;  1DTO A;  2IU0 A;  4RAI A;  5CBH A;  2GSM B;  4QE7 A;  3U11 A;  3EXA A;  2QKC A;  5E79 Z;  2YUA A;  4O4I B;  3A0H Z;  4FFK A;  4DV3 O;  3BHP A;  1VF5 B;  3CCM V;  2GV9 A;  3ZN1 A;  4FZ0 A;  1XRE A;  5B1N A;  2Z3Y A;  1AJN A;  4PJ0 Z;  1XHX A;  4YHH B;  1JX9 A;  1JFF A;  3VQY A;  1BT8 A;  3HR0 A;  2XT9 A;  1RSO A;  1GN4 A;  4IHJ B;  3C3S A;  4BIO A;  2JGD A;  3BCC H;  1XMO O;  5BZB A;  1NS1 A;  1WB8 A;  1ZLZ A;  4X8A A;  1M4U A;  3OAA G;  4PEL A;  3T1Y B;  5A9G A;  2CGO A;  3VQV A;  4JI5 O;  4LF8 B;  1S5L Z;  4GX5 A;  1NR7 A;  1WA8 B;  2R72 A;  3CME V;  1YJW V;  1YVW A;  5H5N A;  1NVP B;  2ZCE A;  4X20 A;  4HYO A;  2UXN A;  4ZHQ A;  5L3D A;  5B3S C;  5TIS Z;  4YY3 O;  3K06 A;  3ZMS A;  3UCS C;  2RJZ A;  2E74 B;  2NNU A;  2EX3 A;  2LJ2 A;  3A8T A;  3B8N A;  1U97 A;  1OCO C;  1YJN V;  1RM1 C;  2IJI A;  4YJ3 A;  1NU1 H;  2QM8 A;  2FYU H;  3E2E A;  2X6B A;  1R3J C;  2EIJ B;  2QGN A;  4QGP A;  4DR5 O;  3LSU A;  4K0K O;  2A79 B;  2JEU A;  3SJC C;  1JFF B;  1PM9 A;  3MHH C;  1GKF A;  1MOF A;  2ITD C;  1RSO B;  4JAV A;  3RYF A;  4DV0 O;  2PI4 A;  2JGD B;  4PDV A;  5CB4 B;  1NZ6 A;  1VQO V;  1BCC H;  4MTX A;  3D8C A;  4JI6 O;  4TWK A;  1J95 A;  2M6Y A;  3ABK C;  4GUN A;  3APQ A;  3FKS G;  4IL6 Z;  3ML0 A;  2JRI A;  4DUY O;  1XIL A;  2QWP B;  3W7W A;  1XNQ B;  3RVY A;  3N2G A;  1VQP V;  1Z5W A;  4DV4 O;  1W0J G;  2R9A A;  1IBL B;  2VQE B;  4X1I A;  2DN9 A;  3OEE G;  5L3E A;  4X64 B;  4ZHQ B;  2UUB B;  2CTW A;  2ZM6 O;  1YDX A;  5KLV H;  4DR6 B;  3ZMT A;  3EVK A;  1HNW B;  4XDL A;  3IC9 A;  2QA4 V;  1YTF D;  2DMX A;  2YEV A;  3ZRX A;  3SR2 C;  1XL4 A;  2L6L A;  2UXB O;  4EKW A;  4GX2 A;  3SPJ A;  3W7S A;  2E5L B;  4O4J B;  5JH7 A;  1M57 C;  5BR8 O;  2N04 A;  3C3T A;  3K5M A;  2Q68 A;  3TJT A;  4UVB A;  2V7Q G;  1AI7 A;  5J9P C;  4JTA B;  3RYF B;  3SYO A;  1NH2 D;  3K9A A;  4DR4 B;  3JAR B;  2XAH A;  2ZDI C;  2BCC H;  4DV2 B;  4B3T O;  1WP8 A;  3CX5 F;  1WPB A;  3G67 A;  3JAL A;  1IBK O;  5C93 A;  2OCC C;  3TXQ A;  2HVJ C;  3HPL C;  3N2G B;  2ZKO A;  4PDM A;  1E1R G;  4YIO A;  2K1E A;  4X1I B;  3K5L A;  5IWA O;  1AR5 A;  3CRR A;  3IGA C;  3E8B A;  4B3M O;  3X2Q C;  2UUC O;  3AG3 B;  2RCV A;  3QF7 A;  4CC5 A;  2BSK A;  2A9H A;  2WLN A;  1KD1 W;  1X59 A;  2YEV B;  4DV5 B;  1B04 A;  2OCH A;  3JSN A;  5GTH Z;  4QE9 A;  3B8M A;  4ZI7 B;  3ZS8 C;  4GKJ B;  3AG4 C;  3E8G A;  5DN6 G;  3SYP A;  1IDS A;  3CXH F;  3SPH A;  1WJZ A;  5KMG A;  1VQM V;  1PNM A;  1FS0 G;  3MD0 A;  2F1M A;  1P7B A;  2DW4 A;  4PDL A;  5JH7 B;  2VQF O;  3WG7 B;  4OPA A;  2OIE A;  1G6U A;  2IU3 A;  2BOC C;  4TQF A;  1SER A;  1QCE A;  4JAA A;  2M7W A;  4R50 A;  4Z1M G;  2OTJ V;  5LA6 A;  4D7T A;  1HP8 A;  1HR0 O;  1KU9 A;  4J9Y B;  3JAL B;  2Q4P A;  2ZE8 A;  3CYO A;  2LFR A;  4X1K A;  1IBM O;  3E22 B;  4IYH A;  2P06 A;  4MVR A;  3K9S A;  1IX9 A;  3MHS C;  5B1O A;  2AHY A;  1ARO P;  2WLM A;  4BIZ A;  3AG1 B;  1GN6 A;  2Y4T A;  3KZI Z;  3AG2 C;  2BSK B;  1VF6 A;  1JQ0 A;  3CHX A;  5EZY A;  1PKX A;  5EBL C;  3OEH G;  4MW8 A;  2QDO A;  3LSQ A;  2ADP A;  3W7T A;  3ZCC A;  2W6I G;  3JAK B;  3QO7 A;  3G71 V;  3TCU A;  2AW9 A;  2UXC O;  1R1B A;  2ZE7 A;  1FKA O;  1DLB A;  1DF5 A;  2AHZ A;  2B5U A;  2JK5 C;  3H1L H;  5LGN A;  4KUM A;  5EC1 C;  1N34 B;  1WP7 A;  4QPK A;  2ZR3 A;  4I0X A;  3WB1 A;  1BHA A;  4LWS B;  3KKY A;  2YIB A;  5JJN B;  1FFT B;  5ITZ A;  4Q6G A;  1OCC B;  5B1A C;  4X1K B;  3CXC U;  1UFI A;  3CCJ V;  5D5Q A;  4JYA B;  3O9O A;  3F7V C;  3N2K A;  4AQY B;  3E89 A;  1AJQ A;  2IH1 C;  3WFV A;  4H33 A;  3PJS K;  2K9P A;  3L9D A;  4MVO A;  2FML A;  3ETQ A;  4ZKI A;  3B77 A;  4GCZ A;  4E4E A;  4KXR A;  4IIJ B;  4FFB B;  4NTW A;  2WLH A;  5LHG A;  3ABM C;  4WFE A;  1K9M W;  1OZ0 A;  4JAS A;  2IJH A;  1V9P A;  4FM0 A;  2UUA B;  4DV7 O;  5KUM A;  1Q8I A;  3CCV V;  5A2Q N;  2YI8 A;  1YXB A;  3TGU H;  5LMN B;  3CC7 V;  2C2A A;  3ZMV A;  3RBZ A;  1SET A;  2BE3 A;  5GTI Z;  5JWP A;  4X66 B;  4I0X B;  3BEH A;  5AG2 A;  2IJJ A;  5KAI Z;  5LOV A;  4LFC O;  1RPO A;  5GON A;  2RMK B;  4X62 O;  5ITZ B;  4K3A A;  2LQT A;  4UV8 A;  1THZ A;  4DR1 O;  2F4V O;  3N2K B;  1ZL8 A;  4PA7 A;  3H9V A;  3CEI A;  4WFG A;  1CP9 A;  3JD1 A;  4DV3 B;  1T5E A;  3T4D A;  4H44 B;  2EIN B;  4LH7 A;  2PI5 A;  1Y74 B;  2IBZ H;  3CE2 A;  1H2N A;  2QR4 A;  5LGT A;  5B66 Z;  2ZNI A;  1S77 D;  5K1X A;  1I94 O;  5HFL A;  3BVO A;  4LF9 B;  4O2A B;  4QIW F;  3CCS V;  2PUS A;  4JAU A;  1FXK B;  1YJ9 V;  5EBM C;  3B09 A;  1J5E B;  1QVF U;  4DR2 O;  5IE9 A;  4MW3 A;  3E83 A;  2OT5 A;  1N36 O;  5EIB D;  2P67 A;  4BWA A;  2EJR A;  1ZSP A;  1GO3 F;  4W4K A;  1GRJ A;  4X65 O;  1H2K A;  4F4L A;  3K58 A;  3T1C A;  3CRM A;  1V55 C;  3BY6 A;  1NTZ H;  1BL8 A;  1I0H A;  1L0L H;  4NTY A;  1QVG U;  4LP8 A;  1OCZ B;  4JI2 B;  2X6C A;  5GON B;  2ZXW C;  2HEP A;  5CA3 A;  1TA8 A;  3RWR D;  5JVD B;  3OR7 C;  4WFB V;  3BRC A;  2H94 A;  4OPH A;  4JI7 O;  3LUT B;  2DOS A;  1K3E A;  1PNK A;  2EUL A;  4MT8 A;  1ZL8 B;  3P3N A;  3JAS B;  4W4L A;  2H8P C;  3ASN C;  1P49 A;  5LHI A;  1VIB A;  1LNQ A;  3DSQ A;  3NR7 A;  4GZR B;  3JYC A;  4O4I A;  2KG7 A;  4Z1V A;  2JDI G;  4DK0 A;  3KG2 A;  2WAM A;  1FXV A;  1KP2 A;  3CJH A;  4HBN A;  3OMN B;  1H38 A;  1ORQ C;  3SJB C;  4PV1 B;  4X88 A;  2JGU A;  2DYS B;  1KUQ A;  5KHI A;  3DTU B;  3CRC A;  4FJC C;  1SZT A;  4ZOL B;  1ROP A;  1QLE B;  4JI0 O;  2GUZ A;  1L8D A;  1IXM A;  1V54 B;  1QBZ A;  2YDE A;  4QNH B;  1VMG A;  2V4D A;  1XUQ A;  3JAM N;  4DV4 B;  1K97 A;  3IAY A;  3OGC C;  3ZN0 A;  5LP6 C;  1ZTE A;  4WCE V;  5LL6 Y;  2UXD O;  3OFN G;  5HFM A;  4JTD B;  2DYR C;  4IGG A;  4MS2 A;  4NXM B;  3JD0 A;  1H8H G;  2Q69 A;  1N33 O;  1VQ6 V;  4N23 A;  4OX9 B;  1YEW A;  1NJI W;  3L73 H;  4YJ2 B;  2QWO B;  2ZE5 A;  4U7N A;  2KKW A;  4RO2 A;  5LHH A;  2KG7 B;  4WBN A;  1CPY A;  2QJ1 A;  1S5J A;  1FD9 A;  2LW7 A;  3BFR A;  4PD4 F;  3CCL V;  1PV0 A;  4K35 A;  2F95 B;  3CJH B;  3BAA A;  3CCR V;  2N74 A;  1NKD A;  2GBO A;  3H1J H;  4LFA O;  3JSL A;  4DO2 A;  2A3Q A;  1XNR O;  5CB4 A;  1Q6I A;  4IYI A;  4UVC A;  4B3T B;  4UB8 Z;  4P9O A;  2GUZ B;  3OTF A;  4JV5 O;  1JA8 A;  2Z0A A;  1KC8 W;  4UCS A;  3VOU A;  1XHZ A;  4J10 A;  2QTO A;  2ODM A;  2QKA A;  4J7J A;  4LF4 O;  1H2S B;  4LR3 A;  4JI8 B;  2O57 A;  1LUV A;  1M1K W;  2XAS A;  2QWQ B;  4B3M B;  5L3B A; 
#chains in the Genus database with same CATH homology
 4DR1 O;  2F4V O;  2ZKO A;  1G1X B;  1KUQ A;  4DV5 O;  4LF9 O;  4GKJ O;  5IWA O;  1XEQ A;  5BY1 A;  4DV0 O;  4DR3 O;  4B3M O;  1J5E O;  1XMQ O;  2UUC O;  4JI0 O;  3M8A A;  4NXM O;  4JYA O;  1X59 A;  4JI6 O;  1XNQ O;  1I94 O;  4YHH O;  3SDL A;  3JAM N;  1AIL A;  4DV3 O;  1DK1 A;  4LF6 O;  4OX9 O;  2VQE O;  1A32 A;  2JRI A;  4X64 O;  4DUY O;  2UUB O;  5LL6 Y;  4DR2 O;  2UXD O;  2FKX A;  1N36 O;  4DR6 O;  2DJV A;  4JI2 O;  4DV4 O;  1HNW O;  2VQF O;  1N33 O;  3J81 N;  4X65 O;  3T1Y O;  4OPA A;  3F5T A;  1R6T A;  2ZM6 O;  4DV1 O;  2UUA O;  2AGA A;  1XMO O;  4LF8 O;  4AQY O;  1IBL O;  4DUZ O;  3J80 N;  5IT9 N;  1HNX O;  1NS1 A;  4LFB O;  2E5L O;  1AB3 A;  2LW7 A;  4LF7 O;  5LMN O;  1D2D A;  1HR0 O;  5BXZ A;  2UXB O;  4JI5 O;  4DV7 O;  1IBM O;  4GKK O;  4OPH A;  4JI7 O;  2DOS A;  5A2Q N;  2N74 A;  1FYJ A;  3T1H O;  2HHH O;  4NXN O;  4LFA O;  3R66 A;  5BR8 O;  5H5N A;  5LMU O;  1FJG O;  1XNR O;  3OTO O;  4DV2 O;  2UU9 O;  4DV6 O;  4JI1 O;  1N32 O;  4YY3 O;  1YZB A;  4JI8 O;  4JV5 O;  4LF5 O;  4DR7 O;  4LFC O;  2Z0A A;  4X62 O;  1F7Y A;  4B3R O;  5FLX N;  4B3T O;  4JI4 O;  4LF4 O;  4X66 O;  4JI3 O;  1IBK O;  4DR4 O;  4A5U B;  4KHP O;  3J7A U;  1N34 O;  2UXC O;  1R1B A;  3RT3 C;  1FKA O;  3O65 A;  4DR5 O;  4B3S O;  4K0K O;  1HNZ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...