4DR2O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr2O00
2AGAA 2UXDO 1IBLO 4JI8O 1R1BA 1YZBA 4X62O 2UUCO 4LF4O 4OPAA 1A32A 4X64O 2Z0AA 4DR4O 1FKAO 3J81N 4DR2O 1I94O 2ZKOA 4JV5O 2F4VO 1AB3A 4B3MO 3OTOO 4YY3O 4OPHA 5BY1A 2DJVA 1XEQA 1FJGO 1R6TA 1X59A 4LF7O 4JI2O 4DV7O 2FKXA 1KUQA 4JI6O 4DV0O 4NXNO 3F5TA 4NXMO 5A2QN 3M8AA 3R66A 2N74A 2VQFO 4DUYO 3J80N 4DV1O 4DR7O 4JI3O 4LFBO 1HNXO 3RT3C 2UXCO 4DR3O 1N32O 3J7AU 5LMNO 2UUAO 4JI4O 4GKJO 5H5NA 1N33O 3T1YO 4B3RO 1J5EO 2DOSA 4DR5O 1XMQO 4K0KO 2ZM6O 4DV5O 2JRIA 1FYJA 1IBKO 4DR1O 4DV2O 2E5LO 1AILA 3JAMN 5BR8O 1F7YA 2VQEO 4B3SO 5BXZA 4B3TO 4X65O 3O65A 4OX9O 1D2DA 3SDLA 1N34O 4JI0O 2HHHO 4DUZO 2UU9O 1XNQO 4LFCO 4DV6O 1XNRO 4KHPO 1DK1A 4LF6O 4LF9O 3T1HO 1N36O 4LFAO 5LMUO 4GKKO 5LL6Y 4X66O 4JYAO 4JI5O 4DV3O 1NS1A 4YHHO 1XMOO 1HNWO 1HNZO 4LF8O 4AQYO 4DR6O 2UXBO 5IT9N 4DV4O 5IWAO 2UUBO 5FLXN 2LW7A 1G1XB 4A5UB 4LF5O 1HR0O 4JI1O 1IBMO 4JI7O
chains in the Genus database with same CATH superfamily
2VRZA 4MVRA 2JIZG 3AG7A 1M90W 4XDJA 4FIPC 1YI2V 3ZHRA 4JTDB 4JASA 2G38A 2ZKOA 4PJ0Z 1CP9A 1RPRA 5LHHA 2DMXA 4O4JA 3DC5A 4F4LA 2VWKA 4UVCA 2QSAA 3W7TA 1RPOA 1GRJA 3EFFK 3M8AA 2QWPB 2N74A 3ZBHA 2UUAB 1AR4A 2EILC 3K03A 5EK0A 1S76D 1Q90D 3FAVB 4FPPA 3OMIB 4XBFA 1AP5A 3E8HA 3ZHQA 4O4LB 1PKXA 2UUAO 2D2CB 3HKCB 3LSUA 1PD3A 1RM1C 1ZUQA 3IFXA 1GK9A 4F6RA 2B1GA 2OIGA 1H8EG 2XAFA 1SZTA 4ICGA 4JI0B 3AK2A 1OCOB 2YXHA 2X6AA 5IYBO 4LF6B 2GUZB 1ZAUA 1AI5A 4JI0O 3UT5A 2QM8A 4EB6B 3MHSC 2KG7B 2ARHA 4LF6O 3STZC 2JJ1G 3ABMB 2B1IA 1N4CA 1BMFG 2YDEA 4I55A 2DQ3A 2ODMA 2FL4A 2IW5A 4LF5B 1MZEA 4TWKA 4TV8B 1XILA 2L6LA 2MK3A 2F43G 2QWQB 2W6JG 1K73W 3UKMA 4LF5O 2Q9LA 3CWBH 4GZRB 4NYKA 3A0BZ 1F4MA 2F23A 5J2TB 3QO8A 4MVQA 5KAFZ 2IH3C 2YXLA 1TGOA 4FLWA 2R9AA 2YSUB 4O4IA 4JI2B 5J2UA 1CPYA 4GYCB 4IT5A 3AG3C 4FZ0A 4JI2O 2ADQB 3MHHC 4I50A 3OUFA 1HNXB 5LP6B 2Q67A 4WBNA 2ZE7A 1MOFA 3K5LA 4FFBA 4JYCA 1LR1A 1HNXO 2E75B 2EINB 1F4NA 1R6NA 2E3CA 4WFAV 5KHGA 1YXBA 4RO2A 4FLVA 1VQOV 5B66Z 1PPJH 1EN5A 1TVKB 3ZN1A 3MAQA 3BRCA 4CH5A 1Q3EA 1M9NA 1EBOA 1VF6A 4NB5A 4B3TB 4ZI7B 1M5IA 1SQFA 3K5OA 1D5NA 5ITZB 1MA1A 1AILA 3JAMN 1AR1B 5CMUA 3OGIB 1PNMA 4B3TO 4UCSA 5FPOA 5L3FA 2WSSG 2PI5A 3JSLA 1S5LZ 5BMVA 2VS0A 2AZ0A 4P9PA 1YHQV 4DV4B 4GKKO 3ABKB 4TUYA 1MSDA 4MVOA 1NS1A 1HWYA 3RYIB 1V54C 5IT9N 5JJNB 4DV4O 4DW1A 3CRRA 4TOIA 3FD9A 4YIOA 2ZXWC 2EULA 1VP7A 1Y66A 1NBMG 4DR2B 2HVKC 3PJSK 1XDCA 2EIJB 4BWAA 2IH1C 2QE7G 4MW3A 5CA0A 3DC6A 4QNHB 3F7VC 3ZN0A 4DR2O 2LW1A 4TSFG 1RFYA 3H1JH 2EJRA 3CJHB 1XL4A 1Q82W 4FM1A 2YXYA 4QE7A 4JTAB 3B4SA 3CHXA 4JZGA 4D6TH 4PI2A 1H2LA 5CBGA 2JVDA 1OZ0A 1GH6A 3K08A 3TJTA 4D7TA 4X1YB 5EIBC 2RN9A 1KECA 3CCVV 2QEXV 5LGNA 3RW0A 4DO2A 1SQGA 1YJNV 3OD4A 4K0KB 3KZIZ 2Y69B 2CGNA 1SA0B 3ETGA 3SJQC 1VARA 1L0NH 2L35A 4K0KO 4G28B 4L87A 1SC5B 4TQDA 1UJWB 1GN2A 4X65B 2A06H 1OCZC 3D8CA 2YIDA 4LH7A 2Q6AA 5EZYA 5LOVB 4X65O 1Y76B 2CGOA 3O9OA 2E76B 3OEHG 3U0ZA 1KQSU 2PYLA 3L74H 3ZCCA 1S5JA 1WB7A 4AQYB 1NTKH 1K5SA 1NI8A 2BCCH 1TUBA 3FAVA 2GTSA 4AQYO 4LR3A 2ZT9B 3G4SV 4O4LA 2P06A 1MZFA 3HKCA 2K9PA 4X62B 4LF4B 2IU3A 4X64B 3FYEB 2ATKC 4QJFB 3BA9A 2HVJC 3LSQA 2JK5C 4LF4O 4X62O 2OT5A 1US6A 4X64O 4MTXA 2BE3A 1O9GA 4Q20A 1QR9A 2ADPA 4CS2A 4HNAB 1M57B 1FJGB 1K8AW 3ZMUA 5AG2A 2XHBA 1QLEC 5KX5B 4DK0A 2GUZA 3WG7B 4EB6A 2KG7A 4DV0B 2Q7EA 4NXNB 2EZOA 3ABMC 4NXMB 1FJGO 5CA1A 4I0XA 1XL6A 2ETNA 4DXWA 4RQEA 1PNKA 1QU7A 2DE0X 4DV0O 4NXNO 2F93B 3N2KB 4NXMO 4UV9A 1SQXH 1RM1B 4TV8A 5FNVA 3E8FA 4GKJB 4YJ3B 3W7SA 1W59A 2CH7A 3I55V 3RWRD 3BEHA 3H1HH 4MVUA 4GKJO 5L3GA 2A7WA 2ZM6B 4PI0A 1GM7A 4L8JA 5J2TA 5KHKA 4QE9A 2W0XA 1I7FA 2DWDC 4DR1B 3OMNB 4BW9A 2FTKA 3ZHTA 1MG1A 1DGSA 2ZM6O 2BOCC 4DR1O 1MNGA 1VF5B 2A79B 1SETA 5EBMC 4UFZA 3CCLV 1BQZA 5IJ9B 3SPCA 1Q7YW 2QDOA 4P30A 3JSNA 4Q6GA 2P90A 2Y0IA 4LFAB 3HR0A 5CBFA 4X66B 4LBEC 4JYAB 2EX3A 3JALB 5LBQA 3P3NA 4B7EA 1NQTA 5LP6A 1YEWA 4LFAO 4X66O 4IHJB 4JYAO 4GX2A 4RAIA 4JI1B 4JI7B 1NT2B 1FD9A 5IYDO 4ZOLB 3K58A 4JI1O 4JI7O 1PNLA 4AI8A 2QWNB 3OEEG 1NU1H 1YZBA 3OR6C 5B1BB 4JPRA 4ZI7A 5ITZA 4YY3B 3ZEDA 3QVNA 4O2AB 2UXXA 4YY3O 3UCSC 3WB0A 1QBZA 1E1RG 5IE9A 3ABKC 2D3OW 3LSSA 3A0RA 3RYIA 2JS5A 2JS3A 5C8YA 1R3IC 3RYHB 2QKSA 2BOBC 1G4YB 4KP4A 2RMKB 4IIJB 1IZ3A 4CS4A 3SPIA 5KUMA 2WPDG 2A3QA 1QLNA 2ITCC 4BIUA 2AXTZ 1VQMV 2CDYA 3K57A 3QF7A 3CJHA 2X7RB 1BGYH 1FFXB 3E8GA 5LA6B 4J41A 1WNSA 2B5UA 3K9SA 1ZL8B 2CAZC 3I56V 1AJPA 1SRYA 3WFVA 4DYLA 1G6UA 2ZE8A 1TA8A 3D36A 4P9OA 1MABG 4YHHB 2ZR2A 4LF8B 2ZXWB 4DR6B 4RUFA 2QA4V 4X1YA 4YHHO 2N04A 4LF8O 4DR6O 2IJHA 2XUMA 2YUAA 4AILC 3ZHSA 2Y69C 4U3JB 3SPGA 3VOUA 4J11A 2PY5A 4DR4B 2P22C 3CCEV 2OTJV 4E2LA 3F5WC 3HKEB 4B3MB 4J10A 4X1IB 4FFKA 2R72A 4DR4O 4WCEV 4UB8Z 5CB4B 5H6RA 1S77D 5LXTA 1I5YA 2P5OA 3A2FA 4X20B 4B3MO 2BTOA 2XAQA 1RSOB 1Y76A 1Y67A 3GWOA 5EBWC 1Y74B 2V1DA 2VQFB 4DV1B 2R9RB 5JVDB 5C93A 4LFBB 4JAAA 3LDEA 3H1KH 1E1QG 4BAYA 2UXCB 2VQFO 3SYAA 4ZKIA 4DV1O 2GTAA 4LFBO 5KAIZ 2PYJA 4UVBA 5EIBD 3RT3C 3G67A 2UXCO 4DR5B 3CB2A 1OCZB 4QIWF 1Z2GA 1QVFU 3AG2C 3B77A 2WLIB 3ABTA 4DR5O 4DV2B 1WA8A 4PDVA 1KBHA 1GM8A 3SPHA 3HPLC 1M57C 1KP2A 1FYJA 3CSXA 4HNAA 2K1EA 2XAHA 4OX9B 4CH4A 1BZKA 3WG7C 1F23A 4DV2O 4ZBMA 5KX5A 5LYJB 2N05A 1F7YA 2UU9B 3HKDB 4OX9O 3C3SA 5HFMA 3T1HB 3L72H 4EKWA 1Q43A 1Q6UA 2UU9O 4WFEA 1EFRG 2A0LA 1HNZB 1K92A 3T1HO 3CMEV 2V4DA 3TETA 5LL6Y 4YJ3A 3UO3A 3CD6V 1HNZO 4R7CA 1EN4A 2E74B 2YS8A 4K35A 2CTWA 2X6BA 2LQTA 3E83A 1JFFA 1KB9F 2P4VA 3IC9A 5B1OA 2QTOA 4O2BB 4QPJA 5JJEB 3CCUV 1QLEB 5B1NA 3A0HZ 3VQYA 1R1BA 3JASA 4R50A 4FZ1A 1NZ6A 4JGSA 3HKBB 1P49A 1XI1A 2LP7A 5IJ9A 5H2FZ 1AB3A 3BA8A 4JYBA 5B5EZ 4CS3A 4HZ3A 3UM7A 5TISZ 4NVPA 2Q7GA 2YICA 1VIBA 1GO3F 3W7WA 2WLHA 4JI3B 2M7WA 3R66A 4LCUC 2CK3G 2NR5A 5KA5A 5KA6A 1VQKV 3K9AA 4ZOLA 3J80N 3PN1A 3T1YB 2WLKA 4JI3O 4B3RB 1YJWV 4EFBA 3RGBA 4PDLA 5B1BC 4ZHQB 3EVKA 3T1YO 1XHXA 4B3RO 2WLLB 3OW2U 1NR1A 2H8PC 4N21A 1Q8IA 2HJDA 4JAVA 4U7NA 4DRXB 1KD1W 3JARA 2FMLA 1ZLZA 1SF9A 4X8AA 1YVWA 4PD4F 5KUKA 3AG4B 4H37A 1VQLV 3SJCC 3DXRB 2Z3YA 2BTQB 3FFQA 3CEIA 4YJ2B 1K7DA 1SQQH 3N2GA 5K1XA 1HR0B 1XUQA 3RYHA 3K0GA 4IIJA 4A5UB 3OM3B 1YSCA 1HR0O 3K06A 4O4HB 4GKKB 3SYQA 4J80A 4PDMA 3WU2Z 3NR7A 3L71H 2JGDB 2Z0AA 3J81N 1QNMA 4LNUB 3RYCB 2PGGA 1FFXA 2RCVA 5LA6A 3ASNB 1WLEA 3G6EV 3CRQA 3CXHF 5GONA 1PM9A 1N0JA 1ZL8A 3Q4HB 4JI6B 1I08A 1OCCB 5JWPA 1TAEA 1URFA 1NH2B 2KKWA 2PI4A 3W7UA 2LGWA 4JI6O 4W4LA 3ABLB 3QTCA 3JD2A 3T1CA 3JAKB 4KUMA 2RJZA 1JJOA 3GB7C 4WFHA 4J7ZA 2Q7HA 4DV5B 4J9ZB 4KFMA 4CH3A 2ZQMA 3HKEA 2ZCEA 2X6CA 2DOSA 4X1IA 3BVOA 3D3QA 2R70A 4DV5O 2JRIA 2W0FC 1K4DC 4X20A 2AHZA 2B9ZA 1K5QA 4Z1VA 3B8MA 3ZMSA 3O65A 2LGQA 1D2DA 3RYFB 4D7SA 4J7KA 1SQBH 1DTOA 5LHGA 1JJ2U 1IURA 1H2SB 2M6YA 2ZE5A 3FB6C 2NN4A 5GTHZ 4K8XA 4IYIA 4YIPA 5K1PA 1UFIA 4MW8A 3UO2A 1OHHG 3TXSA 4LH6A 2UXDB 2QTSA 1HW7A 4BIOA 2DYRB 1ZTEA 3MDSA 3SGIA 3CE2A 3K04A 4JF3A 4X1KB 2DWEC 4CBCA 2UXDO 1TUEB 4JV5B 3SYCA 1VQ8V 1A32A 4NR1A 4UV8A 5LYJA 4NTXA 4JV5O 1MMMA 4TV9B 4MSWC 1IXMA 1ORQC 1WP7A 3JYCA 4DV7B 3X2QB 1SESA 5LHIA 3LNMB 5BY1A 1H38A 2Q8VA 1H2NA 1LNQA 1S0VA 4H33A 5JCOC 2ZDIC 3HB3B 4DV7O 1EN6A 3CS5A 5JCOA 1BS3A 1E79G 3P30A 2HKOA 1OV9A 4PA6A 3AG2B 5LMNB 2IM9A 1NVPB 4W4KA 3ZRWB 2HJFC 1WPXA 1J5EB 5LMNO 4X89A 3CCQV 4O2BA 1XBLA 1BQ0A 1M93A 3LDCA 4PHZA 4RQFA 2HFEC 5H5NA 1NTZH 1JPXA 1THZA 1J5EO 3M7MX 3GVMA 1NR7A 5D5PA 4N23A 2HP8A 5KHHA 1PP9H 3T4DA 3IGAC 1QVGU 1XREA 3UQ8A 2XNDG 2Q68A 4HYOA 4DV3B 4BR6A 3ZIAG 1DK1A 4FLZA 3H1LH 1XHZA 5GW7A 2UUBB 4F6RB 1VMGA 4DV3O 5H9CA 3NXSA 1Q86W 2UUBO 1AP6A 4WF9V 4ZHQA 1JCHA 1G1XB 2Q0OC 3E22B 3OUSA 3G71V 1FFTB 1WJZA 3STLC 2WLLA 5DEDA 2EZPA 2ZR3A 3UT5B 2GDSA 2OCHA 3ZHVA 1I5XA 4OPAA 3ZRSA 3FYIB 3FB7C 1S3JA 4DRXA 4EEQA 3BCCH 4I55B 3BY6A 1W0JG 4I9QA 1U97A 4UB6Z 3AG4C 3JCUZ 2RNBA 4JAUA 1TVKA 3G80A 1V9PA 3DXRA 1YF2A 4RUEA 1FXVA 4FJCC 1N32B 1K4CC 3CPWU 4R6ZA 1R6KA 4FLYA 1B6QA 4UUJC 1W2BU 3OT7A 1N32O 1FXHA 1X4TA 4H13B 2GSMB 3ZHUA 1LUVA 3ASNC 3RYCA 4I50B 3RVZA 1VQ4V 2QWRB 2JJ2G 3JD1A 1FXKB 2ITDC 3AK1A 3ZRVA 3Q4HA 1SZXA 1ZWIC 1Q6HA 1OCCC 3ICXA 1XNQB 4RWUA 2A9HA 3KCXA 3BHPA 1QR8A 5EC1C 3CMAV 1B06A 3ABLC 3H1IH 3IJ4A 1FAFA 5IYCO 2RDCA 4I4TB 1XNQO 1Q5OA 1K9MW 2UXBB 2IJKA 4DW0A 5IDJA 1U96A 1FS0G 3AEIA 3A8TA 2UXBO 1GN6A 2ILMA 5FLXN 2YEVB 1L0LH 4X88A 1GAXA 2ZIOA 1OCRB 3K79A 1GN3A 3L73H 1VQ7V 2F4VB 1P7GA 4U3FH 4J9YB 3CX5F 2IBZH 1KYOF 1KKCA 4TUYB 3WB2A 3JAWB 2F4VO 1V55C 3U10A 1YTFB 3RYFA 1AJQA 5H6QA 2HG5C 4KL1A 3SJAC 4OGQB 2Y4TA 4CC5A 1SA0A 3DSQA 1R6TA 2WA4A 3CRMA 3TXQA 4UCRA 1ZX3A 3RVYA 1QHTA 2XASA 3ABUA 4NTWA 5A2QN 1JR9A 5IJ0B 4MT8A 4DR3B 1K97A 3VQWA 2DYRC 4P2ZA 2NLJC 4GX1A 3H01A 1VQ9V 5LOVA 4DR3O 1FPOA 1XMQB 3DGEA 1P7BA 1CEZA 3BABA 4MTFA 1IXBA 3MD0A 1XMQO 3KKYA 4OXSA 1SQPH 2AZ2A 3CRAA 3CCMV 2Y4UA 3N27A 4TV9A 2H3OA 3X2QC 4Z2WA 1M1KW 1L1FA 1R73A 1NKDA 3S3WA 4LF9B 4H0LB 4MVSA 2ZD9A 1QCEA 3WB1A 4MS2A 5IYZB 4Z1MG 1HNWB 1BHAA 4LF9O 3B09A 3IAYA 5IWAB 1BSMA 3B2EE 2P6JA 3W7XA 3CC7V 4GCZA 1HNWO 3ZRWA 2ZNIA 3TGUH 5IWAO 3ETQA 4HBNA 2UUCB 1PL0A 5EZYB 5EBLC 1P4RA 1GMGA 4QGPA 4FK5C 1HDJA 2UUCO 3N2KA 2C2AA 5IY5C 4BIZA 2EIKC 1D5AA 2CTPA 1TUBB 2AHYA 2YIBD 1PL4A 4F6EA 1M56C 5J9PC 1Z5WA 3OAAG 4OPHA 2IJIA 3FB5C 1IVSA 1VEWA 5B1AC 1BT8A 4I5SA 2OIEA 3FB8C 4PA7A 4DUYB 4IGGA 3F5TA 1N0NA 2IJJA 4YXWG 1DF5A 4CH6A 4DUYO 1VF7A 4HAMA 3QNEA 4JI4B 2QWOB 2Q0AA 4ZIBA 1AROP 3E22A 4MVMA 1PV0A 3JD0A 1YJ9V 5JH7B 4JI4O 1Q81W 1COWG 1HP8A 3JALA 3ZX6A 2XAJA 5CA1B 4I0XB 4WFFA 1Z5VA 1GKFA 4IHJA 1DF4A 2VQEB 3CCSV 1LUWA 2KQXA 3BFRA 5LGUA 3IC7A 1J95A 3QO7A 3RBZA 5FNVB 1GTOA 2VQEO 4X9QA 2HHHB 4GX5A 2GBOA 4FMTA 4JYYA 2CH7B 4FVMA 4KHPB 2F66C 1N36B 1W0KG 5EYPB 5LMUB 3OMAB 4FLTA 3JCZA 2HHHO 3P32A 1EZVH 1JA8A 2Q5ZA 4CC6A 1SERA 1K33A 4KHPO 1UPGA 3LDDA 1N36O 5LMUO 1M4UA 5F2VO 4JTCB 3E35A 2OCCC 4GT1A 4O2AA 1SKVA 1H2KA 1WP8A 4CZZA 4JI8B 1VQNV 3KG2A 5KMGB 2XTAA 1AI4A 5CA3A 2DN9A 3CP1A 1I94B 4JI8O 1FXKC 2HR3A 2KB1A 4EFEA 2PF4E 2Q73A 1FXKA 1WN7A 3OTOB 2YI9A 2OWOA 3CRCA 1I94O 1RP3B 4LP8A 2PTMA 1NJIW 2DQ0A 2MW2B 2XAGA 2ZNJA 3OTOO 3L75H 4UCUA 3BAAA 1K3EA 3EXAA 3QO5A 4K8ZA 1H8HG 1XEQA 4I4TA 2BSKB 5L3CA 1KC8W 1B3QA 4KXRA 3CYOA 1P84F 1JX9A 1VF6C 2LFRA 4J7JA 5L3EA 3QG5A 2YEVA 4NTYA 4PA4A 1CXZB 1OCRC 4ASUG 3ZMZA 1AI7A 3T4ZA 5JQGB 4MTOA 4G27B 2WAMA 3DTUB 4LC1A 3C3TA 3SR2C 1Y4MA 4B3SB 3JAWA 4K3AA 3P3PA 4LWSB 1K34A 1JQ0A 1G8MA 3U11A 3K0DA 3SYOA 4U3JA 2ZE6A 5C8YB 3JATB 2CE4A 4PV1B 4B3SO 5BXZA 4FLXA 1AJNA 1YCIA 2WLNA 2Q4PA 5B3SB 1S72V 3THOA 1OJHA 1NH2D 3LUTB 2LO1A 1YIJV 3ASOB 2FYUH 1XMOB 3ZJZA 5IJ0A 2P67A 2EIMB 3CC2V 1VQ5V 5CB4A 2QGNA 3S3XA 2H94A 1XMOO 2CUGA 2V7QG 2IU0A 1RSOA 5DM6V 3I5DA 4UXNA 1JVMA 4UVAA 1Y74A 1V55B 3JD4A 5JVDA 5DECA 3ZMVA 3B8NA 3JD3A 1N8RW 1FKAO 2P4KA 3D3IA 3FKSG 5GTIZ 1B04A 1KU9A 2EBOA 3H9VA 4DK1A 3B40A 4PA9A 2HLDG 3E2EA 2YC0A 3GWKC 2DYSB 2YI8A 2F1MA 5IYZA 2WLIA 1WPBA 2QKCA 3K5NA 1BHBA 4BW5A 3R65A 3APQA 4GX0A 5KHJA 1BL8A 3L70H 1L8DA 4UCVA 3ETDA 1JMKC 1WB8A 5LXTB 2YIBA 4U7OA 5JJJB 1ZSPA 1SS3A 3HKDA 1JOYA 4WFGA 3J7AU 1AI6A 2CTRA 4PELA 2XOKG 3AG1B 1XQ8A 2KSDA 1I0HA 2OTLV 2E5LB 5CBHA 2ZDIA 5BR8B 3K3WA 1Q6IA 5FL7G 3SPJA 4GUNA 1VQPV 2E5LO 5LGTA 5BR8O 4DUZB 3T2MA 5KHIA 3M99B 4LFCB 4DV6B 1XNRB 1EM1A 2QM7A 3SDLA 5FPRA 4JI5B 3EHBB 4DUZO 5KLVH 4LFCO 2JGUA 4O4JB 2PZSA 4DV6O 4FLUA 1XNRO 4E4EA 4GLXA 1BCCH 5BZBA 2R9IA 2EJ7A 1WA8B 1NVPD 3HKBA 1OCOC 4JI5O 1MSWD 5L3DA 2Z5UA 2ZINA 5IY5B 5JH7A 5E1AC 1AVMA 2EIKB 2WA3A 2EILB 4I7ZB 4XDLA 1YITV 3ZMTA 1T5EA 1M56B 2UXNA 3FX7A 1KP3A 5B1AB 4IYHA 2RQ6A 1GM9A 4PDRA 4LF7B 3E8BA 2X0LA 5EYPA 2QKAA 3CXCU 4R8CA 2DJVA 1JFFB 2Q69A 1GN4A 3RN4A 1H2MA 4MVZA 4LF7O 3E89A 2FKXA 2HEPA 1KMIZ 4DR7B 1KUQA 2QR4A 1R3LC 1YDXA 3JASB 1EZJA 1KKDA 4TQFA 2LFSA 1IX9A 4DR7O 1R3KC 2OYQA 1N33B 5KMGA 2JEUA 3K5MA 4H44B 2QJ1A 5D5QA 1N33O 1IBKB 5LP6C 3ZRXA 3C90A 2BTQA 4YJ2A 3ETEA 1Y6XA 3AK3A 5EC2C 1IBKO 2EINC 1R3JC 4B08A 2CTQA 4C7UA 5E79Z 2VWJA 2BSKA 2ZIMA 2OCCB 4O4IB 4O4HA 2WLJA 3ML0A 5J2UB 4TT3G 3CCJV 2WWWA 3F7YC 2F95B 3TCUA 3E86A 2JGDA 4FM0A 2PUSA 2W6IG 3VBBA 3AG3B 4LNUA 2YIAA 2WLMA 3BPZA 3K59A 4B7KA 1NTMH 1IBMB 4WBNB 4NKGB 3OE7G 2LW7A 4FFBB 3JARB 1IBLB 5JQGA 1IBMO 3RFRA 2FB5A 1DLBA 2XT9A 2AGAA 5L3BA 1IBLO 3L9DA 2GHYA 1IDSA 4LWSA 5CN0A 5DN6G 3JATA 5B3SC 3N2GB 5HFLA 3JAKA 3APOA 3ASOC 4I9WA 2EIJC 2QM4A 1O9HA 3LNNA 1WAZA 2EIMC 1X59A 4AHCA 4J42A 4FM2A 5BMVB 1ROPA 3CCRV 3KCYA 2NNUA 3ZS8C 2Y0PA 1AR5A 5GONB 4ABMA 1V54B 3TK1A 4XDKA 3D36C 4PA3A 3OTFA 4G2KA 1F51A 1BE3H 1H2GA 2Y48A 2JEXA 4JZ2A 4MTGA 1YTFD 3G6BA 5CA0B 1N34B 2DYSC 1VQ6V 4IL6Z 3SYPA 3OR7C 3VQVA 3OGCC 4UCTA 1N34O 1XOUA 1ENVA 4QPKA 4X1KA 2AW9A 2O57A 3OFNG 1SQVH 4WFBV 2LJ2A 2GV9A 3SJBC 2JDIG 5A9GA 4UCOA 3CC4V 1QQCA 1S5HC 3VQXA 2P7TC 3AG1C 2DW4A
chains in the Genus database with same CATH topology
2AGAA 2UXDO 1IBLO 4JI8O 1R1BA 1YZBA 4X62O 2UUCO 4LF4O 4OPAA 1A32A 4X64O 2Z0AA 4DR4O 1FKAO 3J81N 4DR2O 1I94O 2ZKOA 4JV5O 2F4VO 1AB3A 4B3MO 3OTOO 4YY3O 4OPHA 5BY1A 2DJVA 1XEQA 1FJGO 1R6TA 1X59A 4LF7O 4JI2O 4DV7O 2FKXA 1KUQA 4JI6O 4DV0O 4NXNO 3F5TA 4NXMO 5A2QN 3M8AA 3R66A 2N74A 2VQFO 4DUYO 3J80N 4DV1O 4DR7O 4JI3O 4LFBO 1HNXO 3RT3C 2UXCO 4DR3O 1N32O 3J7AU 5LMNO 2UUAO 4JI4O 4GKJO 5H5NA 1N33O 3T1YO 4B3RO 1J5EO 2DOSA 4DR5O 1XMQO 4K0KO 2ZM6O 4DV5O 2JRIA 1FYJA 1IBKO 4DR1O 4DV2O 2E5LO 1AILA 3JAMN 5BR8O 1F7YA 2VQEO 4B3SO 5BXZA 4B3TO 4X65O 3O65A 4OX9O 1D2DA 3SDLA 1N34O 4JI0O 2HHHO 4DUZO 2UU9O 1XNQO 4LFCO 4DV6O 1XNRO 4KHPO 1DK1A 4LF6O 4LF9O 3T1HO 1N36O 4LFAO 5LMUO 4GKKO 5LL6Y 4X66O 4JYAO 4JI5O 4DV3O 1NS1A 4YHHO 1XMOO 1HNWO 1HNZO 4LF8O 4AQYO 4DR6O 2UXBO 5IT9N 4DV4O 5IWAO 2UUBO 5FLXN 2LW7A 1G1XB 4A5UB 4LF5O 1HR0O 4JI1O 1IBMO 4JI7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGA A;  2UXD O;  1IBL O;  4JI8 O;  1R1B A;  1YZB A;  4X62 O;  2UUC O;  4LF4 O;  4OPA A;  1A32 A;  4X64 O;  2Z0A A;  4DR4 O;  1FKA O;  3J81 N;  4DR2 O;  1I94 O;  2ZKO A;  4JV5 O;  2F4V O;  1AB3 A;  4B3M O;  3OTO O;  4YY3 O;  4OPH A;  5BY1 A;  2DJV A;  1XEQ A;  1FJG O;  1R6T A;  1X59 A;  4LF7 O;  4JI2 O;  4DV7 O;  2FKX A;  1KUQ A;  4JI6 O;  4DV0 O;  4NXN O;  3F5T A;  4NXM O;  5A2Q N;  3M8A A;  3R66 A;  2N74 A;  2VQF O;  4DUY O;  3J80 N;  4DV1 O;  4DR7 O;  4JI3 O;  4LFB O;  1HNX O;  3RT3 C;  2UXC O;  4DR3 O;  1N32 O;  3J7A U;  5LMN O;  2UUA O;  4JI4 O;  4GKJ O;  5H5N A;  1N33 O;  3T1Y O;  4B3R O;  1J5E O;  2DOS A;  4DR5 O;  1XMQ O;  4K0K O;  2ZM6 O;  4DV5 O;  2JRI A;  1FYJ A;  1IBK O;  4DR1 O;  4DV2 O;  2E5L O;  1AIL A;  3JAM N;  5BR8 O;  1F7Y A;  2VQE O;  4B3S O;  5BXZ A;  4B3T O;  4X65 O;  3O65 A;  4OX9 O;  1D2D A;  3SDL A;  1N34 O;  4JI0 O;  2HHH O;  4DUZ O;  2UU9 O;  1XNQ O;  4LFC O;  4DV6 O;  1XNR O;  4KHP O;  1DK1 A;  4LF6 O;  4LF9 O;  3T1H O;  1N36 O;  4LFA O;  5LMU O;  4GKK O;  5LL6 Y;  4X66 O;  4JYA O;  4JI5 O;  4DV3 O;  1NS1 A;  4YHH O;  1XMO O;  1HNW O;  1HNZ O;  4LF8 O;  4AQY O;  4DR6 O;  2UXB O;  5IT9 N;  4DV4 O;  5IWA O;  2UUB O;  5FLX N;  2LW7 A;  1G1X B;  4A5U B;  4LF5 O;  1HR0 O;  4JI1 O;  1IBM O;  4JI7 O; 
#chains in the Genus database with same CATH topology
 2VRZ A;  4MVR A;  2JIZ G;  3AG7 A;  1M90 W;  4XDJ A;  4FIP C;  1YI2 V;  3ZHR A;  4JTD B;  4JAS A;  2G38 A;  2ZKO A;  4PJ0 Z;  1CP9 A;  1RPR A;  5LHH A;  2DMX A;  4O4J A;  3DC5 A;  4F4L A;  2VWK A;  4UVC A;  2QSA A;  3W7T A;  1RPO A;  1GRJ A;  3EFF K;  3M8A A;  2QWP B;  2N74 A;  3ZBH A;  2UUA B;  1AR4 A;  2EIL C;  3K03 A;  5EK0 A;  1S76 D;  1Q90 D;  3FAV B;  4FPP A;  3OMI B;  4XBF A;  1AP5 A;  3E8H A;  3ZHQ A;  4O4L B;  1PKX A;  2UUA O;  2D2C B;  3HKC B;  3LSU A;  1PD3 A;  1RM1 C;  1ZUQ A;  3IFX A;  1GK9 A;  4F6R A;  2B1G A;  2OIG A;  1H8E G;  2XAF A;  1SZT A;  4ICG A;  4JI0 B;  3AK2 A;  1OCO B;  2YXH A;  2X6A A;  5IYB O;  4LF6 B;  2GUZ B;  1ZAU A;  1AI5 A;  4JI0 O;  3UT5 A;  2QM8 A;  4EB6 B;  3MHS C;  2KG7 B;  2ARH A;  4LF6 O;  3STZ C;  2JJ1 G;  3ABM B;  2B1I A;  1N4C A;  1BMF G;  2YDE A;  4I55 A;  2DQ3 A;  2ODM A;  2FL4 A;  2IW5 A;  4LF5 B;  1MZE A;  4TWK A;  4TV8 B;  1XIL A;  2L6L A;  2MK3 A;  2F43 G;  2QWQ B;  2W6J G;  1K73 W;  3UKM A;  4LF5 O;  2Q9L A;  3CWB H;  4GZR B;  4NYK A;  3A0B Z;  1F4M A;  2F23 A;  5J2T B;  3QO8 A;  4MVQ A;  5KAF Z;  2IH3 C;  2YXL A;  1TGO A;  4FLW A;  2R9A A;  2YSU B;  4O4I A;  4JI2 B;  5J2U A;  1CPY A;  4GYC B;  4IT5 A;  3AG3 C;  4FZ0 A;  4JI2 O;  2ADQ B;  3MHH C;  4I50 A;  3OUF A;  1HNX B;  5LP6 B;  2Q67 A;  4WBN A;  2ZE7 A;  1MOF A;  3K5L A;  4FFB A;  4JYC A;  1LR1 A;  1HNX O;  2E75 B;  2EIN B;  1F4N A;  1R6N A;  2E3C A;  4WFA V;  5KHG A;  1YXB A;  4RO2 A;  4FLV A;  1VQO V;  5B66 Z;  1PPJ H;  1EN5 A;  1TVK B;  3ZN1 A;  3MAQ A;  3BRC A;  4CH5 A;  1Q3E A;  1M9N A;  1EBO A;  1VF6 A;  4NB5 A;  4B3T B;  4ZI7 B;  1M5I A;  1SQF A;  3K5O A;  1D5N A;  5ITZ B;  1MA1 A;  1AIL A;  3JAM N;  1AR1 B;  5CMU A;  3OGI B;  1PNM A;  4B3T O;  4UCS A;  5FPO A;  5L3F A;  2WSS G;  2PI5 A;  3JSL A;  1S5L Z;  5BMV A;  2VS0 A;  2AZ0 A;  4P9P A;  1YHQ V;  4DV4 B;  4GKK O;  3ABK B;  4TUY A;  1MSD A;  4MVO A;  1NS1 A;  1HWY A;  3RYI B;  1V54 C;  5IT9 N;  5JJN B;  4DV4 O;  4DW1 A;  3CRR A;  4TOI A;  3FD9 A;  4YIO A;  2ZXW C;  2EUL A;  1VP7 A;  1Y66 A;  1NBM G;  4DR2 B;  2HVK C;  3PJS K;  1XDC A;  2EIJ B;  4BWA A;  2IH1 C;  2QE7 G;  4MW3 A;  5CA0 A;  3DC6 A;  4QNH B;  3F7V C;  3ZN0 A;  4DR2 O;  2LW1 A;  4TSF G;  1RFY A;  3H1J H;  2EJR A;  3CJH B;  1XL4 A;  1Q82 W;  4FM1 A;  2YXY A;  4QE7 A;  4JTA B;  3B4S A;  3CHX A;  4JZG A;  4D6T H;  4PI2 A;  1H2L A;  5CBG A;  2JVD A;  1OZ0 A;  1GH6 A;  3K08 A;  3TJT A;  4D7T A;  4X1Y B;  5EIB C;  2RN9 A;  1KEC A;  3CCV V;  2QEX V;  5LGN A;  3RW0 A;  4DO2 A;  1SQG A;  1YJN V;  3OD4 A;  4K0K B;  3KZI Z;  2Y69 B;  2CGN A;  1SA0 B;  3ETG A;  3SJQ C;  1VAR A;  1L0N H;  2L35 A;  4K0K O;  4G28 B;  4L87 A;  1SC5 B;  4TQD A;  1UJW B;  1GN2 A;  4X65 B;  2A06 H;  1OCZ C;  3D8C A;  2YID A;  4LH7 A;  2Q6A A;  5EZY A;  5LOV B;  4X65 O;  1Y76 B;  2CGO A;  3O9O A;  2E76 B;  3OEH G;  3U0Z A;  1KQS U;  2PYL A;  3L74 H;  3ZCC A;  1S5J A;  1WB7 A;  4AQY B;  1NTK H;  1K5S A;  1NI8 A;  2BCC H;  1TUB A;  3FAV A;  2GTS A;  4AQY O;  4LR3 A;  2ZT9 B;  3G4S V;  4O4L A;  2P06 A;  1MZF A;  3HKC A;  2K9P A;  4X62 B;  4LF4 B;  2IU3 A;  4X64 B;  3FYE B;  2ATK C;  4QJF B;  3BA9 A;  2HVJ C;  3LSQ A;  2JK5 C;  4LF4 O;  4X62 O;  2OT5 A;  1US6 A;  4X64 O;  4MTX A;  2BE3 A;  1O9G A;  4Q20 A;  1QR9 A;  2ADP A;  4CS2 A;  4HNA B;  1M57 B;  1FJG B;  1K8A W;  3ZMU A;  5AG2 A;  2XHB A;  1QLE C;  5KX5 B;  4DK0 A;  2GUZ A;  3WG7 B;  4EB6 A;  2KG7 A;  4DV0 B;  2Q7E A;  4NXN B;  2EZO A;  3ABM C;  4NXM B;  1FJG O;  5CA1 A;  4I0X A;  1XL6 A;  2ETN A;  4DXW A;  4RQE A;  1PNK A;  1QU7 A;  2DE0 X;  4DV0 O;  4NXN O;  2F93 B;  3N2K B;  4NXM O;  4UV9 A;  1SQX H;  1RM1 B;  4TV8 A;  5FNV A;  3E8F A;  4GKJ B;  4YJ3 B;  3W7S A;  1W59 A;  2CH7 A;  3I55 V;  3RWR D;  3BEH A;  3H1H H;  4MVU A;  4GKJ O;  5L3G A;  2A7W A;  2ZM6 B;  4PI0 A;  1GM7 A;  4L8J A;  5J2T A;  5KHK A;  4QE9 A;  2W0X A;  1I7F A;  2DWD C;  4DR1 B;  3OMN B;  4BW9 A;  2FTK A;  3ZHT A;  1MG1 A;  1DGS A;  2ZM6 O;  2BOC C;  4DR1 O;  1MNG A;  1VF5 B;  2A79 B;  1SET A;  5EBM C;  4UFZ A;  3CCL V;  1BQZ A;  5IJ9 B;  3SPC A;  1Q7Y W;  2QDO A;  4P30 A;  3JSN A;  4Q6G A;  2P90 A;  2Y0I A;  4LFA B;  3HR0 A;  5CBF A;  4X66 B;  4LBE C;  4JYA B;  2EX3 A;  3JAL B;  5LBQ A;  3P3N A;  4B7E A;  1NQT A;  5LP6 A;  1YEW A;  4LFA O;  4X66 O;  4IHJ B;  4JYA O;  4GX2 A;  4RAI A;  4JI1 B;  4JI7 B;  1NT2 B;  1FD9 A;  5IYD O;  4ZOL B;  3K58 A;  4JI1 O;  4JI7 O;  1PNL A;  4AI8 A;  2QWN B;  3OEE G;  1NU1 H;  1YZB A;  3OR6 C;  5B1B B;  4JPR A;  4ZI7 A;  5ITZ A;  4YY3 B;  3ZED A;  3QVN A;  4O2A B;  2UXX A;  4YY3 O;  3UCS C;  3WB0 A;  1QBZ A;  1E1R G;  5IE9 A;  3ABK C;  2D3O W;  3LSS A;  3A0R A;  3RYI A;  2JS5 A;  2JS3 A;  5C8Y A;  1R3I C;  3RYH B;  2QKS A;  2BOB C;  1G4Y B;  4KP4 A;  2RMK B;  4IIJ B;  1IZ3 A;  4CS4 A;  3SPI A;  5KUM A;  2WPD G;  2A3Q A;  1QLN A;  2ITC C;  4BIU A;  2AXT Z;  1VQM V;  2CDY A;  3K57 A;  3QF7 A;  3CJH A;  2X7R B;  1BGY H;  1FFX B;  3E8G A;  5LA6 B;  4J41 A;  1WNS A;  2B5U A;  3K9S A;  1ZL8 B;  2CAZ C;  3I56 V;  1AJP A;  1SRY A;  3WFV A;  4DYL A;  1G6U A;  2ZE8 A;  1TA8 A;  3D36 A;  4P9O A;  1MAB G;  4YHH B;  2ZR2 A;  4LF8 B;  2ZXW B;  4DR6 B;  4RUF A;  2QA4 V;  4X1Y A;  4YHH O;  2N04 A;  4LF8 O;  4DR6 O;  2IJH A;  2XUM A;  2YUA A;  4AIL C;  3ZHS A;  2Y69 C;  4U3J B;  3SPG A;  3VOU A;  4J11 A;  2PY5 A;  4DR4 B;  2P22 C;  3CCE V;  2OTJ V;  4E2L A;  3F5W C;  3HKE B;  4B3M B;  4J10 A;  4X1I B;  4FFK A;  2R72 A;  4DR4 O;  4WCE V;  4UB8 Z;  5CB4 B;  5H6R A;  1S77 D;  5LXT A;  1I5Y A;  2P5O A;  3A2F A;  4X20 B;  4B3M O;  2BTO A;  2XAQ A;  1RSO B;  1Y76 A;  1Y67 A;  3GWO A;  5EBW C;  1Y74 B;  2V1D A;  2VQF B;  4DV1 B;  2R9R B;  5JVD B;  5C93 A;  4LFB B;  4JAA A;  3LDE A;  3H1K H;  1E1Q G;  4BAY A;  2UXC B;  2VQF O;  3SYA A;  4ZKI A;  4DV1 O;  2GTA A;  4LFB O;  5KAI Z;  2PYJ A;  4UVB A;  5EIB D;  3RT3 C;  3G67 A;  2UXC O;  4DR5 B;  3CB2 A;  1OCZ B;  4QIW F;  1Z2G A;  1QVF U;  3AG2 C;  3B77 A;  2WLI B;  3ABT A;  4DR5 O;  4DV2 B;  1WA8 A;  4PDV A;  1KBH A;  1GM8 A;  3SPH A;  3HPL C;  1M57 C;  1KP2 A;  1FYJ A;  3CSX A;  4HNA A;  2K1E A;  2XAH A;  4OX9 B;  4CH4 A;  1BZK A;  3WG7 C;  1F23 A;  4DV2 O;  4ZBM A;  5KX5 A;  5LYJ B;  2N05 A;  1F7Y A;  2UU9 B;  3HKD B;  4OX9 O;  3C3S A;  5HFM A;  3T1H B;  3L72 H;  4EKW A;  1Q43 A;  1Q6U A;  2UU9 O;  4WFE A;  1EFR G;  2A0L A;  1HNZ B;  1K92 A;  3T1H O;  3CME V;  2V4D A;  3TET A;  5LL6 Y;  4YJ3 A;  3UO3 A;  3CD6 V;  1HNZ O;  4R7C A;  1EN4 A;  2E74 B;  2YS8 A;  4K35 A;  2CTW A;  2X6B A;  2LQT A;  3E83 A;  1JFF A;  1KB9 F;  2P4V A;  3IC9 A;  5B1O A;  2QTO A;  4O2B B;  4QPJ A;  5JJE B;  3CCU V;  1QLE B;  5B1N A;  3A0H Z;  3VQY A;  1R1B A;  3JAS A;  4R50 A;  4FZ1 A;  1NZ6 A;  4JGS A;  3HKB B;  1P49 A;  1XI1 A;  2LP7 A;  5IJ9 A;  5H2F Z;  1AB3 A;  3BA8 A;  4JYB A;  5B5E Z;  4CS3 A;  4HZ3 A;  3UM7 A;  5TIS Z;  4NVP A;  2Q7G A;  2YIC A;  1VIB A;  1GO3 F;  3W7W A;  2WLH A;  4JI3 B;  2M7W A;  3R66 A;  4LCU C;  2CK3 G;  2NR5 A;  5KA5 A;  5KA6 A;  1VQK V;  3K9A A;  4ZOL A;  3J80 N;  3PN1 A;  3T1Y B;  2WLK A;  4JI3 O;  4B3R B;  1YJW V;  4EFB A;  3RGB A;  4PDL A;  5B1B C;  4ZHQ B;  3EVK A;  3T1Y O;  1XHX A;  4B3R O;  2WLL B;  3OW2 U;  1NR1 A;  2H8P C;  4N21 A;  1Q8I A;  2HJD A;  4JAV A;  4U7N A;  4DRX B;  1KD1 W;  3JAR A;  2FML A;  1ZLZ A;  1SF9 A;  4X8A A;  1YVW A;  4PD4 F;  5KUK A;  3AG4 B;  4H37 A;  1VQL V;  3SJC C;  3DXR B;  2Z3Y A;  2BTQ B;  3FFQ A;  3CEI A;  4YJ2 B;  1K7D A;  1SQQ H;  3N2G A;  5K1X A;  1HR0 B;  1XUQ A;  3RYH A;  3K0G A;  4IIJ A;  4A5U B;  3OM3 B;  1YSC A;  1HR0 O;  3K06 A;  4O4H B;  4GKK B;  3SYQ A;  4J80 A;  4PDM A;  3WU2 Z;  3NR7 A;  3L71 H;  2JGD B;  2Z0A A;  3J81 N;  1QNM A;  4LNU B;  3RYC B;  2PGG A;  1FFX A;  2RCV A;  5LA6 A;  3ASN B;  1WLE A;  3G6E V;  3CRQ A;  3CXH F;  5GON A;  1PM9 A;  1N0J A;  1ZL8 A;  3Q4H B;  4JI6 B;  1I08 A;  1OCC B;  5JWP A;  1TAE A;  1URF A;  1NH2 B;  2KKW A;  2PI4 A;  3W7U A;  2LGW A;  4JI6 O;  4W4L A;  3ABL B;  3QTC A;  3JD2 A;  3T1C A;  3JAK B;  4KUM A;  2RJZ A;  1JJO A;  3GB7 C;  4WFH A;  4J7Z A;  2Q7H A;  4DV5 B;  4J9Z B;  4KFM A;  4CH3 A;  2ZQM A;  3HKE A;  2ZCE A;  2X6C A;  2DOS A;  4X1I A;  3BVO A;  3D3Q A;  2R70 A;  4DV5 O;  2JRI A;  2W0F C;  1K4D C;  4X20 A;  2AHZ A;  2B9Z A;  1K5Q A;  4Z1V A;  3B8M A;  3ZMS A;  3O65 A;  2LGQ A;  1D2D A;  3RYF B;  4D7S A;  4J7K A;  1SQB H;  1DTO A;  5LHG A;  1JJ2 U;  1IUR A;  1H2S B;  2M6Y A;  2ZE5 A;  3FB6 C;  2NN4 A;  5GTH Z;  4K8X A;  4IYI A;  4YIP A;  5K1P A;  1UFI A;  4MW8 A;  3UO2 A;  1OHH G;  3TXS A;  4LH6 A;  2UXD B;  2QTS A;  1HW7 A;  4BIO A;  2DYR B;  1ZTE A;  3MDS A;  3SGI A;  3CE2 A;  3K04 A;  4JF3 A;  4X1K B;  2DWE C;  4CBC A;  2UXD O;  1TUE B;  4JV5 B;  3SYC A;  1VQ8 V;  1A32 A;  4NR1 A;  4UV8 A;  5LYJ A;  4NTX A;  4JV5 O;  1MMM A;  4TV9 B;  4MSW C;  1IXM A;  1ORQ C;  1WP7 A;  3JYC A;  4DV7 B;  3X2Q B;  1SES A;  5LHI A;  3LNM B;  5BY1 A;  1H38 A;  2Q8V A;  1H2N A;  1LNQ A;  1S0V A;  4H33 A;  5JCO C;  2ZDI C;  3HB3 B;  4DV7 O;  1EN6 A;  3CS5 A;  5JCO A;  1BS3 A;  1E79 G;  3P30 A;  2HKO A;  1OV9 A;  4PA6 A;  3AG2 B;  5LMN B;  2IM9 A;  1NVP B;  4W4K A;  3ZRW B;  2HJF C;  1WPX A;  1J5E B;  5LMN O;  4X89 A;  3CCQ V;  4O2B A;  1XBL A;  1BQ0 A;  1M93 A;  3LDC A;  4PHZ A;  4RQF A;  2HFE C;  5H5N A;  1NTZ H;  1JPX A;  1THZ A;  1J5E O;  3M7M X;  3GVM A;  1NR7 A;  5D5P A;  4N23 A;  2HP8 A;  5KHH A;  1PP9 H;  3T4D A;  3IGA C;  1QVG U;  1XRE A;  3UQ8 A;  2XND G;  2Q68 A;  4HYO A;  4DV3 B;  4BR6 A;  3ZIA G;  1DK1 A;  4FLZ A;  3H1L H;  1XHZ A;  5GW7 A;  2UUB B;  4F6R B;  1VMG A;  4DV3 O;  5H9C A;  3NXS A;  1Q86 W;  2UUB O;  1AP6 A;  4WF9 V;  4ZHQ A;  1JCH A;  1G1X B;  2Q0O C;  3E22 B;  3OUS A;  3G71 V;  1FFT B;  1WJZ A;  3STL C;  2WLL A;  5DED A;  2EZP A;  2ZR3 A;  3UT5 B;  2GDS A;  2OCH A;  3ZHV A;  1I5X A;  4OPA A;  3ZRS A;  3FYI B;  3FB7 C;  1S3J A;  4DRX A;  4EEQ A;  3BCC H;  4I55 B;  3BY6 A;  1W0J G;  4I9Q A;  1U97 A;  4UB6 Z;  3AG4 C;  3JCU Z;  2RNB A;  4JAU A;  1TVK A;  3G80 A;  1V9P A;  3DXR A;  1YF2 A;  4RUE A;  1FXV A;  4FJC C;  1N32 B;  1K4C C;  3CPW U;  4R6Z A;  1R6K A;  4FLY A;  1B6Q A;  4UUJ C;  1W2B U;  3OT7 A;  1N32 O;  1FXH A;  1X4T A;  4H13 B;  2GSM B;  3ZHU A;  1LUV A;  3ASN C;  3RYC A;  4I50 B;  3RVZ A;  1VQ4 V;  2QWR B;  2JJ2 G;  3JD1 A;  1FXK B;  2ITD C;  3AK1 A;  3ZRV A;  3Q4H A;  1SZX A;  1ZWI C;  1Q6H A;  1OCC C;  3ICX A;  1XNQ B;  4RWU A;  2A9H A;  3KCX A;  3BHP A;  1QR8 A;  5EC1 C;  3CMA V;  1B06 A;  3ABL C;  3H1I H;  3IJ4 A;  1FAF A;  5IYC O;  2RDC A;  4I4T B;  1XNQ O;  1Q5O A;  1K9M W;  2UXB B;  2IJK A;  4DW0 A;  5IDJ A;  1U96 A;  1FS0 G;  3AEI A;  3A8T A;  2UXB O;  1GN6 A;  2ILM A;  5FLX N;  2YEV B;  1L0L H;  4X88 A;  1GAX A;  2ZIO A;  1OCR B;  3K79 A;  1GN3 A;  3L73 H;  1VQ7 V;  2F4V B;  1P7G A;  4U3F H;  4J9Y B;  3CX5 F;  2IBZ H;  1KYO F;  1KKC A;  4TUY B;  3WB2 A;  3JAW B;  2F4V O;  1V55 C;  3U10 A;  1YTF B;  3RYF A;  1AJQ A;  5H6Q A;  2HG5 C;  4KL1 A;  3SJA C;  4OGQ B;  2Y4T A;  4CC5 A;  1SA0 A;  3DSQ A;  1R6T A;  2WA4 A;  3CRM A;  3TXQ A;  4UCR A;  1ZX3 A;  3RVY A;  1QHT A;  2XAS A;  3ABU A;  4NTW A;  5A2Q N;  1JR9 A;  5IJ0 B;  4MT8 A;  4DR3 B;  1K97 A;  3VQW A;  2DYR C;  4P2Z A;  2NLJ C;  4GX1 A;  3H01 A;  1VQ9 V;  5LOV A;  4DR3 O;  1FPO A;  1XMQ B;  3DGE A;  1P7B A;  1CEZ A;  3BAB A;  4MTF A;  1IXB A;  3MD0 A;  1XMQ O;  3KKY A;  4OXS A;  1SQP H;  2AZ2 A;  3CRA A;  3CCM V;  2Y4U A;  3N27 A;  4TV9 A;  2H3O A;  3X2Q C;  4Z2W A;  1M1K W;  1L1F A;  1R73 A;  1NKD A;  3S3W A;  4LF9 B;  4H0L B;  4MVS A;  2ZD9 A;  1QCE A;  3WB1 A;  4MS2 A;  5IYZ B;  4Z1M G;  1HNW B;  1BHA A;  4LF9 O;  3B09 A;  3IAY A;  5IWA B;  1BSM A;  3B2E E;  2P6J A;  3W7X A;  3CC7 V;  4GCZ A;  1HNW O;  3ZRW A;  2ZNI A;  3TGU H;  5IWA O;  3ETQ A;  4HBN A;  2UUC B;  1PL0 A;  5EZY B;  5EBL C;  1P4R A;  1GMG A;  4QGP A;  4FK5 C;  1HDJ A;  2UUC O;  3N2K A;  2C2A A;  5IY5 C;  4BIZ A;  2EIK C;  1D5A A;  2CTP A;  1TUB B;  2AHY A;  2YIB D;  1PL4 A;  4F6E A;  1M56 C;  5J9P C;  1Z5W A;  3OAA G;  4OPH A;  2IJI A;  3FB5 C;  1IVS A;  1VEW A;  5B1A C;  1BT8 A;  4I5S A;  2OIE A;  3FB8 C;  4PA7 A;  4DUY B;  4IGG A;  3F5T A;  1N0N A;  2IJJ A;  4YXW G;  1DF5 A;  4CH6 A;  4DUY O;  1VF7 A;  4HAM A;  3QNE A;  4JI4 B;  2QWO B;  2Q0A A;  4ZIB A;  1ARO P;  3E22 A;  4MVM A;  1PV0 A;  3JD0 A;  1YJ9 V;  5JH7 B;  4JI4 O;  1Q81 W;  1COW G;  1HP8 A;  3JAL A;  3ZX6 A;  2XAJ A;  5CA1 B;  4I0X B;  4WFF A;  1Z5V A;  1GKF A;  4IHJ A;  1DF4 A;  2VQE B;  3CCS V;  1LUW A;  2KQX A;  3BFR A;  5LGU A;  3IC7 A;  1J95 A;  3QO7 A;  3RBZ A;  5FNV B;  1GTO A;  2VQE O;  4X9Q A;  2HHH B;  4GX5 A;  2GBO A;  4FMT A;  4JYY A;  2CH7 B;  4FVM A;  4KHP B;  2F66 C;  1N36 B;  1W0K G;  5EYP B;  5LMU B;  3OMA B;  4FLT A;  3JCZ A;  2HHH O;  3P32 A;  1EZV H;  1JA8 A;  2Q5Z A;  4CC6 A;  1SER A;  1K33 A;  4KHP O;  1UPG A;  3LDD A;  1N36 O;  5LMU O;  1M4U A;  5F2V O;  4JTC B;  3E35 A;  2OCC C;  4GT1 A;  4O2A A;  1SKV A;  1H2K A;  1WP8 A;  4CZZ A;  4JI8 B;  1VQN V;  3KG2 A;  5KMG B;  2XTA A;  1AI4 A;  5CA3 A;  2DN9 A;  3CP1 A;  1I94 B;  4JI8 O;  1FXK C;  2HR3 A;  2KB1 A;  4EFE A;  2PF4 E;  2Q73 A;  1FXK A;  1WN7 A;  3OTO B;  2YI9 A;  2OWO A;  3CRC A;  1I94 O;  1RP3 B;  4LP8 A;  2PTM A;  1NJI W;  2DQ0 A;  2MW2 B;  2XAG A;  2ZNJ A;  3OTO O;  3L75 H;  4UCU A;  3BAA A;  1K3E A;  3EXA A;  3QO5 A;  4K8Z A;  1H8H G;  1XEQ A;  4I4T A;  2BSK B;  5L3C A;  1KC8 W;  1B3Q A;  4KXR A;  3CYO A;  1P84 F;  1JX9 A;  1VF6 C;  2LFR A;  4J7J A;  5L3E A;  3QG5 A;  2YEV A;  4NTY A;  4PA4 A;  1CXZ B;  1OCR C;  4ASU G;  3ZMZ A;  1AI7 A;  3T4Z A;  5JQG B;  4MTO A;  4G27 B;  2WAM A;  3DTU B;  4LC1 A;  3C3T A;  3SR2 C;  1Y4M A;  4B3S B;  3JAW A;  4K3A A;  3P3P A;  4LWS B;  1K34 A;  1JQ0 A;  1G8M A;  3U11 A;  3K0D A;  3SYO A;  4U3J A;  2ZE6 A;  5C8Y B;  3JAT B;  2CE4 A;  4PV1 B;  4B3S O;  5BXZ A;  4FLX A;  1AJN A;  1YCI A;  2WLN A;  2Q4P A;  5B3S B;  1S72 V;  3THO A;  1OJH A;  1NH2 D;  3LUT B;  2LO1 A;  1YIJ V;  3ASO B;  2FYU H;  1XMO B;  3ZJZ A;  5IJ0 A;  2P67 A;  2EIM B;  3CC2 V;  1VQ5 V;  5CB4 A;  2QGN A;  3S3X A;  2H94 A;  1XMO O;  2CUG A;  2V7Q G;  2IU0 A;  1RSO A;  5DM6 V;  3I5D A;  4UXN A;  1JVM A;  4UVA A;  1Y74 A;  1V55 B;  3JD4 A;  5JVD A;  5DEC A;  3ZMV A;  3B8N A;  3JD3 A;  1N8R W;  1FKA O;  2P4K A;  3D3I A;  3FKS G;  5GTI Z;  1B04 A;  1KU9 A;  2EBO A;  3H9V A;  4DK1 A;  3B40 A;  4PA9 A;  2HLD G;  3E2E A;  2YC0 A;  3GWK C;  2DYS B;  2YI8 A;  2F1M A;  5IYZ A;  2WLI A;  1WPB A;  2QKC A;  3K5N A;  1BHB A;  4BW5 A;  3R65 A;  3APQ A;  4GX0 A;  5KHJ A;  1BL8 A;  3L70 H;  1L8D A;  4UCV A;  3ETD A;  1JMK C;  1WB8 A;  5LXT B;  2YIB A;  4U7O A;  5JJJ B;  1ZSP A;  1SS3 A;  3HKD A;  1JOY A;  4WFG A;  3J7A U;  1AI6 A;  2CTR A;  4PEL A;  2XOK G;  3AG1 B;  1XQ8 A;  2KSD A;  1I0H A;  2OTL V;  2E5L B;  5CBH A;  2ZDI A;  5BR8 B;  3K3W A;  1Q6I A;  5FL7 G;  3SPJ A;  4GUN A;  1VQP V;  2E5L O;  5LGT A;  5BR8 O;  4DUZ B;  3T2M A;  5KHI A;  3M99 B;  4LFC B;  4DV6 B;  1XNR B;  1EM1 A;  2QM7 A;  3SDL A;  5FPR A;  4JI5 B;  3EHB B;  4DUZ O;  5KLV H;  4LFC O;  2JGU A;  4O4J B;  2PZS A;  4DV6 O;  4FLU A;  1XNR O;  4E4E A;  4GLX A;  1BCC H;  5BZB A;  2R9I A;  2EJ7 A;  1WA8 B;  1NVP D;  3HKB A;  1OCO C;  4JI5 O;  1MSW D;  5L3D A;  2Z5U A;  2ZIN A;  5IY5 B;  5JH7 A;  5E1A C;  1AVM A;  2EIK B;  2WA3 A;  2EIL B;  4I7Z B;  4XDL A;  1YIT V;  3ZMT A;  1T5E A;  1M56 B;  2UXN A;  3FX7 A;  1KP3 A;  5B1A B;  4IYH A;  2RQ6 A;  1GM9 A;  4PDR A;  4LF7 B;  3E8B A;  2X0L A;  5EYP A;  2QKA A;  3CXC U;  4R8C A;  2DJV A;  1JFF B;  2Q69 A;  1GN4 A;  3RN4 A;  1H2M A;  4MVZ A;  4LF7 O;  3E89 A;  2FKX A;  2HEP A;  1KMI Z;  4DR7 B;  1KUQ A;  2QR4 A;  1R3L C;  1YDX A;  3JAS B;  1EZJ A;  1KKD A;  4TQF A;  2LFS A;  1IX9 A;  4DR7 O;  1R3K C;  2OYQ A;  1N33 B;  5KMG A;  2JEU A;  3K5M A;  4H44 B;  2QJ1 A;  5D5Q A;  1N33 O;  1IBK B;  5LP6 C;  3ZRX A;  3C90 A;  2BTQ A;  4YJ2 A;  3ETE A;  1Y6X A;  3AK3 A;  5EC2 C;  1IBK O;  2EIN C;  1R3J C;  4B08 A;  2CTQ A;  4C7U A;  5E79 Z;  2VWJ A;  2BSK A;  2ZIM A;  2OCC B;  4O4I B;  4O4H A;  2WLJ A;  3ML0 A;  5J2U B;  4TT3 G;  3CCJ V;  2WWW A;  3F7Y C;  2F95 B;  3TCU A;  3E86 A;  2JGD A;  4FM0 A;  2PUS A;  2W6I G;  3VBB A;  3AG3 B;  4LNU A;  2YIA A;  2WLM A;  3BPZ A;  3K59 A;  4B7K A;  1NTM H;  1IBM B;  4WBN B;  4NKG B;  3OE7 G;  2LW7 A;  4FFB B;  3JAR B;  1IBL B;  5JQG A;  1IBM O;  3RFR A;  2FB5 A;  1DLB A;  2XT9 A;  2AGA A;  5L3B A;  1IBL O;  3L9D A;  2GHY A;  1IDS A;  4LWS A;  5CN0 A;  5DN6 G;  3JAT A;  5B3S C;  3N2G B;  5HFL A;  3JAK A;  3APO A;  3ASO C;  4I9W A;  2EIJ C;  2QM4 A;  1O9H A;  3LNN A;  1WAZ A;  2EIM C;  1X59 A;  4AHC A;  4J42 A;  4FM2 A;  5BMV B;  1ROP A;  3CCR V;  3KCY A;  2NNU A;  3ZS8 C;  2Y0P A;  1AR5 A;  5GON B;  4ABM A;  1V54 B;  3TK1 A;  4XDK A;  3D36 C;  4PA3 A;  3OTF A;  4G2K A;  1F51 A;  1BE3 H;  1H2G A;  2Y48 A;  2JEX A;  4JZ2 A;  4MTG A;  1YTF D;  3G6B A;  5CA0 B;  1N34 B;  2DYS C;  1VQ6 V;  4IL6 Z;  3SYP A;  3OR7 C;  3VQV A;  3OGC C;  4UCT A;  1N34 O;  1XOU A;  1ENV A;  4QPK A;  4X1K A;  2AW9 A;  2O57 A;  3OFN G;  1SQV H;  4WFB V;  2LJ2 A;  2GV9 A;  3SJB C;  2JDI G;  5A9G A;  4UCO A;  3CC4 V;  1QQC A;  1S5H C;  3VQX A;  2P7T C;  3AG1 C;  2DW4 A; 
#chains in the Genus database with same CATH homology
 2AGA A;  2UXD O;  1IBL O;  4JI8 O;  1R1B A;  1YZB A;  4X62 O;  2UUC O;  4LF4 O;  4OPA A;  1A32 A;  4X64 O;  2Z0A A;  4DR4 O;  1FKA O;  3J81 N;  4DR2 O;  1I94 O;  2ZKO A;  4JV5 O;  2F4V O;  1AB3 A;  4B3M O;  3OTO O;  4YY3 O;  4OPH A;  5BY1 A;  2DJV A;  1XEQ A;  1FJG O;  1R6T A;  1X59 A;  4LF7 O;  4JI2 O;  4DV7 O;  2FKX A;  1KUQ A;  4JI6 O;  4DV0 O;  4NXN O;  3F5T A;  4NXM O;  5A2Q N;  3M8A A;  3R66 A;  2N74 A;  2VQF O;  4DUY O;  3J80 N;  4DV1 O;  4DR7 O;  4JI3 O;  4LFB O;  1HNX O;  3RT3 C;  2UXC O;  4DR3 O;  1N32 O;  3J7A U;  5LMN O;  2UUA O;  4JI4 O;  4GKJ O;  5H5N A;  1N33 O;  3T1Y O;  4B3R O;  1J5E O;  2DOS A;  4DR5 O;  1XMQ O;  4K0K O;  2ZM6 O;  4DV5 O;  2JRI A;  1FYJ A;  1IBK O;  4DR1 O;  4DV2 O;  2E5L O;  1AIL A;  3JAM N;  5BR8 O;  1F7Y A;  2VQE O;  4B3S O;  5BXZ A;  4B3T O;  4X65 O;  3O65 A;  4OX9 O;  1D2D A;  3SDL A;  1N34 O;  4JI0 O;  2HHH O;  4DUZ O;  2UU9 O;  1XNQ O;  4LFC O;  4DV6 O;  1XNR O;  4KHP O;  1DK1 A;  4LF6 O;  4LF9 O;  3T1H O;  1N36 O;  4LFA O;  5LMU O;  4GKK O;  5LL6 Y;  4X66 O;  4JYA O;  4JI5 O;  4DV3 O;  1NS1 A;  4YHH O;  1XMO O;  1HNW O;  1HNZ O;  4LF8 O;  4AQY O;  4DR6 O;  2UXB O;  5IT9 N;  4DV4 O;  5IWA O;  2UUB O;  5FLX N;  2LW7 A;  1G1X B;  4A5U B;  4LF5 O;  1HR0 O;  4JI1 O;  1IBM O;  4JI7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...