4DR2O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr2O00
4JI2O 4X65O 2ZKOA 1XMQO 1D2DA 5IWAO 1N36O 4YHHO 1A32A 4B3TO 1HNWO 2F4VO 4DR5O 4JI6O 4LF5O 3JAMN 4GKKO 4B3RO 4LF8O 4JV5O 4JI1O 2UXCO 4DV2O 4NXMO 4A5UB 2UUCO 3M8AA 1HR0O 4GKJO 4DV0O 3J7AU 2DJVA 1KUQA 4DR7O 4B3MO 1HNZO 3F5TA 2VQFO 2HHHO 4DV5O 3RT3C 4K0KO 1F7YA 4DV7O 4LF9O 3T1HO 2DOSA 3J80N 4DR1O 4LFBO 2AGAA 4DV3O 4DR2O 1N34O 4JI4O 2UXBO 4OPAA 4LFAO 1DK1A 3O65A 4DUYO 5LMNO 4JI0O 4DV6O 5H5NA 1AB3A 5LMUO 4DV1O 2UUAO 1XNRO 1N32O 5IT9N 1XNQO 4LFCO 2UU9O 1R6TA 1NS1A 2ZM6O 4OX9O 1N33O 1FJGO 2UUBO 1XEQA 1HNXO 5FLXN 1I94O 4DR6O 5LL6Y 4JI5O 4JI7O 3T1YO 4LF4O 5BR8O 2E5LO 4JI3O 4DR3O 5A2QN 4JI8O 4NXNO 4JYAO 1YZBA 4X64O 3OTOO 1IBLO 4DR4O 4OPHA 2FKXA 1FYJA 3J81N 4LF6O 4X62O 5BXZA 1R1BA 4B3SO 1IBKO 1IBMO 1G1XB 5BY1A 4AQYO 2UXDO 4DV4O 2LW7A 3SDLA 4X66O 1AILA 1XMOO 2JRIA 4DUZO 1FKAO 2VQEO 1J5EO 4LF7O 2N74A 3R66A 4KHPO 4YY3O 1X59A 2Z0AA
chains in the Genus database with same CATH superfamily
2IU3A 2CTWA 4U3JB 2EINC 2X6BA 3B40A 2QTOA 1EM1A 1MZFA 1AI4A 4PDVA 4JI1O 3ZIAG 5IYDO 3BA9A 1SRYA 2PF4E 2VWKA 2BCCH 1M57B 2EINB 4DK1A 4DXWA 3B4SA 1NTZH 1RPOA 4PDMA 1KECA 4X1KB 2UXBO 1AJPA 1RPRA 4PDLA 1VQ9V 2ZDIC 1M9NA 1R3JC 3HKEB 4JI0O 2CDYA 1HWYA 3ZEDA 2WAMA 4FMTA 1TUBA 1NKDA 1XREA 3K57A 2IJJA 1PV0A 3CCSV 1OCZB 3ZS8C 1JJ2U 5JVDA 3OW2U 2VS0A 1YVWA 4X1YA 3SPJA 3APQA 4O2AB 1L8DA 2LW1A 2ZIOA 4DR3O 2CGOA 5A2QN 3OT7A 1E1RG 3AG3B 3OTOO 2QR4A 4MT8A 3FAVA 1EN4A 2GSMB 1S0VA 4EFEA 4DRXA 1NT2B 1XQ8A 4J7KA 1YI2V 4PD4F 4FLXA 3SDLA 1AI6A 1M56C 2CAZC 2JRIA 4RWUA 4HYOA 1H38A 3KCYA 1Y74A 4X66B 2IJHA 5IJ0A 2M7WA 1H8HG 1AP6A 2WWWA 4NB5A 3OR7C 1M5IA 5IWAO 1XI1A 1M4UA 1OJHA 3K5LA 2UXXA 3M99B 1VF7A 2N04A 4JI6O 4LF5O 3RYIB 4B3RO 1B3QA 3OGIB 4DR5B 4GLXA 1XHZA 1QVGU 1F51A 2ZR2A 4OXSA 4U3JA 2E76B 1FXHA 4I9WA 1FFTB 2HHHO 3ZHSA 1F7YA 3ZRVA 3WU2Z 3BRCA 4ZBMA 1P49A 3JASB 2VRZA 4DV3O 1Q5OA 2ZIMA 3ZHUA 4F4LA 4LFBB 1R73A 2OCCB 4DV1O 1IVSA 4DV6B 2EIJB 3CCRV 4R50A 4X1KA 5B3SB 1R6TA 4OX9O 4GT1A 3JSLA 1BHBA 4CZZA 2V4DA 3HKEA 1AI7A 4O4IB 1N33B 1B06A 1ENVA 2IM9A 4PA7A 3JSNA 3WB1A 3SPCA 3HKCB 1VQ7V 4JZ2A 2HEPA 3APOA 4LF4B 4JI8B 1XL4A 4LF6O 1N8RW 3ZHRA 2QTSA 5JJEB 5JH7B 3HPLC 4AI8A 4ASUG 4O2AA 4DK0A 4AQYO 1Q81W 2PY5A 2EX3A 3LDEA 1NH2B 2WA4A 1EN5A 1QBZA 1VQKV 5IDJA 2X7RB 1GTOA 2HFEC 1WA8B 1SESA 3K0DA 3RYHA 1FKAO 2LFSA 2XAJA 1UFIA 5BR8B 1JR9A 3CCMV 1J5EB 5L3CA 3JCZA 3AG1C 4GUNA 2ZKOA 4X62B 2FTKA 3UKMA 4B3TO 2B1GA 2OYQA 2ZT9B 4IHJB 1JA8A 1V9PA 1P7BA 3ZRXA 2Q73A 2UUCO 1V55B 2NLJC 3AG1B 2M6YA 2Q6AA 1JVMA 4GKJB 3L75H 1W0KG 4QPKA 3RYIA 2Y0IA 3K04A 1Y6XA 2V7QG 4AHCA 3AK3A 2CGNA 3CX5F 4Z1MG 4LH6A 2Q0OC 5LHIA 3W7WA 2X0LA 2PYJA 4LFAO 1Q6IA 3CC4V 4B7KA 1V54C 1S5JA 1EZVH 1GN4A 1PPJH 3AG4C 2HLDG 3FB8C 3LUTB 4X1IB 4QPJA 3ZMSA 3IJ4A 2R9RB 3JASA 2BTQB 4QJFB 1WNSA 1FJGO 3ETDA 4YXWG 4JTDB 4QE9A 4DR6O 1IX9A 1JQ0A 2Y69B 5LHHA 3TXQA 5JCOC 4MVZA 4ABMA 4FLVA 1IBLO 2WLNA 3HKBB 4FVMA 5KHKA 1NZ6A 4O4IA 1ZLZA 4O4HB 1K34A 4B7EA 3VQXA 5ITZA 3HKCA 2UXDO 4DV4O 2DYSC 2PI4A 4JGSA 3ASNB 2IJKA 2JIZG 3CRCA 1XOUA 5FPOA 5JH7A 4GCZA 2OIEA 1H2KA 4YY3O 1X59A 3B8MA 4LF7B 3VQWA 4JI2O 1ORQC 4EFBA 1WA8A 2KG7B 2OIGA 3DC5A 1XL6A 1QCEA 2YDEA 1Q7YW 1RM1C 4TSFG 5C93A 2QM4A 1URFA 3KKYA 4JI1B 2QKAA 1B6QA 3DGEA 5L3EA 4DV5O 4IHJA 1D5AA 3GB7C 3U11A 1WB7A 3OUFA 5LGTA 5D5QA 1GM8A 3F5WC 3R65A 3SJCC 3ZMUA 1VQ6V 4JI4O 4LBEC 3H1JH 1QR9A 1ZL8B 4YJ2B 1KP3A 4CH3A 2UXBB 5H5NA 1AR5A 2DMXA 2ZXWC 3N27A 3C3SA 1Q82W 1HR0B 2B5UA 4J80A 5LGUA 4UCVA 2B1IA 2UUBO 1D5NA 1VQOV 1H2SB 4BWAA 2E74B 2YIBA 4JI5O 2RNBA 3BCCH 4X1IA 5H6QA 4QNHB 2BTQA 2H94A 4CH5A 1BSMA 3UM7A 5LP6B 1KC8W 4K8XA 5KHIA 4DR3B 1U96A 4UVBA 3OTOB 5K1PA 4IT5A 1Q43A 4MW3A 2HVKC 3TCUA 2CTRA 4P2ZA 1AR1B 1H8EG 2WLIB 4PI0A 2N05A 3K79A 1K3EA 3K0GA 1VF6A 3AG2B 5J9PC 3ASOC 3ZMTA 3G71V 4XDJA 4CBCA 5BZBA 3U0ZA 5JQGB 5IJ9B 3CCLV 4WFEA 4O4HA 3DXRB 3L71H 2A9HA 2GV9A 3ZN1A 1H2GA 2FYUH 4ZI7B 1IZ3A 1AI5A 2EZPA 4JYBA 1QVFU 1EFRG 2LGWA 2QJ1A 3LSSA 5GTIZ 4P9PA 2F4VO 1VQMV 4TV8B 5IWAB 4ZHQA 4RQEA 4LF8O 1SS3A 3WG7C 4JI6B 4LF5B 4PDRA 1G4YB 5DECA 2Q4PA 4Q20A 4UB6Z 2KG7A 3CCUV 3FYIB 3F5TA 3G4SV 1DF4A 4IYHA 3AEIA 1ZUQA 3K5NA 1BHAA 2JGUA 4NYKA 3QO5A 3OD4A 1SQPH 2AGAA 3WG7B 3NR7A 3BVOA 2Q7EA 5LMNO 4GKKB 4D7TA 4MVMA 3L70H 2Q9LA 3RVZA 4LFCO 2UXNA 2JDIG 2QE7G 2QA4V 5B1AB 2HJFC 3CMEV 3FD9A 2ZE7A 5KUMA 4JI7O 1EZJA 3FFQA 3OMIB 2L35A 1OCCC 3UT5B 2PYLA 4X64O 3ZBHA 3BPZA 1R1BA 2H8PC 2YC0A 4UCUA 3D3QA 4UVAA 4X9QA 4LF6B 2HVJC 1YTFD 4Z1VA 1OCCB 4NKGB 3ZN0A 5LP6A 3CSXA 4JASA 2CUGA 1IDSA 1DGSA 3E8GA 4GZRB 4JAVA 2RN9A 1VQ4V 1W59A 4JAUA 3IAYA 2WLIA 4UUJC 3OMNB 5H9CA 1VEWA 2B9ZA 1IXMA 2F95B 3CE2A 5JQGA 3E22B 5FPRA 1NU1H 1TGOA 3DXRA 2NNUA 2XNDG 5IE9A 4ZI7A 4U7NA 4B3TB 4PA6A 4I50B 4CH6A 1BE3H 2DJVA 3ZX6A 3JD1A 1L0NH 2GTAA 1PL0A 1WPXA 4J10A 2UUCB 3MD0A 4BIUA 4TV8A 1SZXA 4K0KO 5L3BA 3SYQA 1SQXH 2ZQMA 3L73H 1YCIA 2JS3A 3ML0A 1N4CA 5K1XA 2GHYA 1AP5A 1EBOA 2XTAA 3OEEG 4FLTA 4LFAB 4FPPA 2HP8A 4LC1A 5LMUO 3O9OA 1FAFA 3SJAC 4K35A 1Y76B 4WFAV 4ICGA 2KB1A 2ADPA 1Q86W 2GBOA 5GONB 5KHJA 2BE3A 1HNXO 2Q68A 1P7GA 2DYRC 3T1YO 5L3DA 4DR6B 1CPYA 1QU7A 3E2EA 4WF9V 2AZ2A 3GVMA 2CH7B 1IBLB 1S5LZ 3X2QC 2XAFA 4KL1A 4HBNA 5CN0A 2CE4A 3UT5A 3CB2A 1TVKB 2DYRB 4W4LA 4HNAB 1K9MW 3ABLC 1XMOO 2R72A 4PA4A 4WFBV 1PD3A 2WLLB 3K3WA 3K06A 3E83A 1QLNA 1YEWA 4PELA 4YY3B 3TXSA 5CA1B 5IYCO 1WP8A 3I5DA 3SPIA 4JI2B 1NVPD 2RCVA 1BT8A 4JV5O 1PNKA 1I08A 3T1CA 2LP7A 3N2KB 2QKSA 4CS3A 3E22A 4LWSB 4I7ZB 5F2VO 2P06A 3H1HH 2W6IG 4X88A 3HKDB 4LF9O 4DV5B 4I4TB 1M56B 4I50A 5CBFA 3FYEB 3JCUZ 2WLMA 3FKSG 1F4NA 2FMLA 3UCSC 4R8CA 2Q7GA 4JI4B 5H2FZ 4DV2B 4TUYB 5KUKA 3FX7A 3ABMC 2X6AA 4H33A 4U7OA 4AILC 3BEHA 4LH7A 4B3MB 3QNEA 2EJ7A 3T4DA 2NN4A 2RDCA 4BR6A 2BOBC 3PJSK 1S5HC 4YIPA 2UUBB 3RYFB 1W0JG 2RMKB 4EKWA 2E5LO 4FLYA 4JI5B 1Y76A 4RO2A 1YXBA 4JYAO 3ABMB 2YXHA 2FKXA 1GO3F 4JAAA 5GONA 3OUSA 4P9OA 4JYYA 1PM9A 1QNMA 1US6A 4N21A 1FXKC 2QGNA 1IBMO 2EILC 2HG5C 2DQ0A 4C7UA 2MW2B 1I7FA 2QDOA 4FLWA 3BY6A 3JD2A 4I55B 1ZTEA 2WA3A 2ZR3A 2CH7A 3LNNA 5LBQA 3CEIA 5BMVB 2AZ0A 2VQEO 2N74A 1BCCH 4BIOA 1Q6HA 4NVPA 2ZE8A 1NR1A 2EIMC 3G80A 2JVDA 3K5OA 4HNAA 2HJDA 2Z0AA 3F7YC 3W7UA 2ZDIA 3GWOA 2AXTZ 3IFXA 1KQSU 3E35A 2H3OA 3CRQA 3E8BA 1A32A 1BMFG 5EC2C 3K58A 2WLLA 4WBNB 2XT9A 2QWRB 2F4VB 1VQLV 4NXMO 3FB6C 4MTXA 2EIMB 2PZSA 3QO7A 4LF8B 1XUQA 3TJTA 5CA1A 2ITCC 4DV0O 4WFHA 3LSQA 1KUQA 1KKCA 1WP7A 1AJQA 3JD0A 3P32A 4DV7O 2PUSA 4E4EA 4ZOLB 2ADQB 3T1HO 2F1MA 1CEZA 4EEQA 1KD1W 5CA0B 3M7MX 3N2KA 2YXYA 2Q8VA 4IIJB 3G6EV 4DR2O 4H0LB 2JJ1G 2XASA 3HKDA 2A3QA 5LMNB 4I4TA 2YXLA 1XNQO 3JALB 1SERA 3ABUA 4EB6B 2ZM6O 5GTHZ 1YJ9V 4MTFA 4LFCB 4IYIA 1HNZB 3RFRA 3K9SA 3ABKC 2AHZA 2XUMA 1LR1A 4DO2A 5L3FA 4TUYA 1R3KC 2VWJA 1BGYH 2QM7A 4DYLA 2EBOA 4NXNO 3CRAA 5GW7A 4DUYB 3MHSC 4O4LB 4UXNA 4X64B 3RYFA 3ABKB 3EFFK 3SYOA 1WB8A 5BY1A 1VQ5V 1YJNV 4PV1B 1P84F 2LW7A 3A2FA 1AR4A 1N0JA 1CP9A 1V54B 4H44B 3E8FA 4H37A 3AG4B 3R66A 4GX5A 2EIKC 4JI3B 2YUAA 4I55A 4DR4B 5KHHA 1XMQO 1YHQV 5BMVA 1M1KW 2P4KA 5LXTB 4LCUC 5C8YB 4IGGA 3H1LH 4DW1A 3K08A 1COWG 3RW0A 2UXCO 3CD6V 2D3OW 1MMMA 3BHPA 3K59A 4XDLA 2V1DA 1BQ0A 3A8TA 1SKVA 3RYCB 2VQFO 1JX9A 4WBNA 2DN9A 1OCOC 2DYSB 3L9DA 3SJQC 2G38A 2OCHA 4K0KB 1R3LC 5B66Z 1N34O 4KP4A 4CH4A 5KA5A 3ZRSA 4B08A 1UPGA 1YDXA 2EJRA 1YIJV 4ZOLA 2GDSA 2MK3A 2XHBA 1NJIW 4BIZA 1N32O 5CA0A 4OGQB 1XILA 1KP2A 3IC7A 4CC5A 4E2LA 5DN6G 1RM1B 2P22C 3CHXA 3JD4A 1HNXB 3JALA 4EB6A 2RQ6A 3T1YB 4J9ZB 4CC6A 4W4KA 4JI0B 1E79G 2YS8A 2R9AA 1IBKO 1NTMH 2OTJV 1LNQA 3TK1A 2JEUA 1ROPA 1LUWA 1NBMG 1AILA 1MNGA 4FFBB 4O4LA 1S76D 4DUZO 1K7DA 2W6JG 3NXSA 2ZXWB 1FXVA 4KHPO 2Q0AA 4F6RB 3AK1A 2Q7HA 2LJ2A 5CA3A 3T2MA 3RBZA 4D7SA 2Z5UA 2QWNB 2YICA 5EBLC 4YHHO 1HNWO 1XHXA 3HKBA 2ZNJA 4A5UB 2KQXA 2FL4A 3G67A 1OCRC 3JD3A 4HAMA 3CC7V 5JCOA 5LXTA 3RT3C 1O9HA 5C8YA 4JF3A 4J9YB 4MVSA 4ZIBA 5E1AC 3B8NA 3B09A 1WN7A 2YEVB 3ASOB 3ETQA 3CJHB 4LF9B 2YI9A 4X20B 3RYCA 5B1NA 4B3RB 2QKCA 3OR6C 1TAEA 3JATB 5LYJB 3OM3B 2UU9O 2ILMA 3DTUB 1R3IC 4MW8A 2KSDA 1R6NA 2HHHB 2CTQA 2WPDG 1SF9A 3A0BZ 2E3CA 3E86A 3BABA 3W7XA 1YTFB 5BR8O 1K73W 4UCSA 5HFLA 4DV3B 4D6TH 2E5LB 3CCJV 4Z2WA 1FYJA 4X62O 1T5EA 4JYAB 3QF7A 4TOIA 1QQCA 4DV1B 3VQVA 4DW0A 1ZL8A 4YJ2A 1IBMB 1XDCA 4OX9B 1AROP 5KLVH 4FZ0A 3RGBA 1VARA 1GN6A 3UQ8A 4IL6Z 1VQ8V 1SQBH 4RUEA 2ZE6A 2VQEB 1SA0B 3WFVA 4X65O 1K5SA 2Y0PA 4FFBA 2W0XA 1N36O 3LSUA 5CBGA 5D5PA 4F6RA 4AQYB 3T4ZA 3OFNG 2Y4TA 5JVDB 3U10A 1ZX3A 3M8AA 4UVCA 4NXMB 5B1BC 3SR2C 4PI2A 4DR7O 1G6UA 4DV0B 2Q67A 1JMKC 3FAVB 4NTXA 3ABTA 2JJ2G 2K9PA 5JJJB 2WLKA 4DR1O 4JPRA 5IJ9A 4DV7B 1S72V 3T1HB 1YF2A 3H9VA 4G2KA 4KFMA 2C2AA 3ZRWB 4DR2B 1BL8A 4G28B 3JAKB 3CP1A 1WJZA 1MSWD 1XNRO 2YEVA 4UCRA 4HZ3A 3D3IA 3CJHA 4J7JA 5L3GA 2X6CA 1VIBA 4X20A 2Z3YA 4GYCB 1XNQB 3B77A 4MTGA 2ZM6B 3VQYA 3JATA 5H6RA 5LYJA 1UJWB 3K9AA 1THZA 1PP9H 1YZBA 2F93B 4OPHA 1NI8A 3SGIA 2ZCEA 5LOVB 3A0RA 4NXNB 1MSDA 1JFFB 4FZ1A 1M57C 4Q6GA 4MTOA 2EULA 1FJGB 5KX5B 4RAIA 1NR7A 4N23A 1KU9A 4NTWA 2XAGA 1NVPB 2IH3C 4KUMA 1Q3EA 1L1FA 4RQFA 3F7VC 4TQDA 1Y4MA 4TV9B 5A9GA 3STZC 1BZKA 2GTSA 2XAQA 2P4VA 1OCZC 1YJWV 5DM6V 5JWPA 2A06H 1XMQB 1J95A 3JAWB 2UXDB 2A0LA 4DV4B 4K8ZA 1SA0A 1SQVH 1Q90D 2KKWA 1JPXA 1HR0O 2UXCB 3AG7A 2PGGA 3EVKA 3X2QB 3AG3C 1YSCA 3UO3A 4O2BB 1LUVA 1H2LA 2VQFB 4X89A 5B1OA 4RUFA 3ABLB 2P7TC 3VOUA 2WLJA 4WFGA 1JOYA 1IXBA 5LGNA 3SJBC 5EZYB 1N34B 1IURA 4MVUA 3S3WA 4UFZA 1FFXB 2UUAO 2ZINA 3STLC 1K4CC 3RYHB 1N32B 4K3AA 2ODMA 5EBMC 2OWOA 4J7ZA 3ZRWA 4J11A 3JAKA 1GRJA 3TETA 4UCOA 2BSKB 2BOCC 5CBHA 3MAQA 3P30A 4BAYA 1Z5WA 4CS2A 4FM0A 3SYAA 1S3JA 2CK3G 2IBZH 5BXZA 1G1XB 1JCHA 3ICXA 4QIWF 3C3TA 3RN4A 1IBKB 4GX2A 1WLEA 2XAHA 3CPWU 3P3NA 1GH6A 1GKFA 4GX1A 1PKXA 3SYPA 5LOVA 2NR5A 4PHZA 4MVQA 2QWPB 4FJCC 1JFFA 1K33A 4DUZB 4FM2A 1Q8IA 4H13B 2OCCC 4KHPB 2DWDC 5LHGA 5KX5A 1ZWIC 2EIJC 2JEXA 5B3SC 4P30A 4LP8A 3ZHQA 4NTYA 1WAZA 1MOFA 3JAMN 4GKKO 2FB5A 1H2MA 3DC6A 3E89A 4CS4A 4YHHB 2K1EA 1HNWB 3LDCA 3OMAB 3CCVV 4KXRA 4TV9A 3JARB 3GWKC 4QGPA 2ITDC 3EHBB 1FXKB 2EILB 1TVKA 2O57A 2ATKC 5EBWC 1GM7A 3JAWA 2ARHA 3OGCC 4X8AA 3ZCCA 2GUZB 4FLUA 3ETEA 4OPAA 5ITZB 3O65A 1DTOA 5LA6B 4O2BA 2IW5A 2YIAA 2QEXV 3HR0A 3I55V 2ZD9A 5IT9N 1G8MA 2ZNIA 1PL4A 3QG5A 1Z2GA 1VQPV 3AK2A 2RJZA 1L0LH 4TWKA 5EZYA 1MABG 2UU9B 3PN1A 1YITV 1I94O 1RSOB 1FFXA 4I0XB 5J2TB 4L87A 4LWSA 2L6LA 3VBBA 2ZE5A 4L8JA 3CS5A 2P90A 2CTPA 1V55C 1BQZA 3W7TA 3CCQV 4B3SO 1GMGA 2BSKA 1RP3B 4NR1A 1XBLA 3BA8A 3OEHG 2YSUB 1I0HA 3N2GB 1KYOF 2QWOB 2A7WA 1I5YA 4JI7B 1FD9A 4GX0A 1SQGA 3SPHA 2EZOA 4PA9A 1NH2D 1GAXA 1OV9A 1QLEC 1AVMA 1ZAUA 3E8HA 4WFFA 1D2DA 3RWRD 2IU0A 3THOA 1KBHA 4JYCA 4X65B 3K03A 2D2CB 2P67A 2XOKG 1N36B 2Y69C 3D36C 4TT3G 3CCEV 1KB9F 1QLEB 5B5EZ 5HFMA 2JS5A 3QVNA 3CXHF 1VF5B 1VF6C 3DSQA 1QHTA 4DR7B 1P4RA 5J2UB 3J80N 3I56V 2JGDB 3JARA 2Y4UA 4FIPC 5TISZ 1FXKA 4DR1B 1DK1A 2PI5A 3ASNC 1M93A 2EIKB 1K4DC 1MZEA 1RFYA 2DE0X 3Q4HB 5IYBO 4I9QA 2GUZA 5AG2A 1K92A 1XNRB 1U97A 1XEQA 1H2NA 5LA6A 2AW9A 5CMUA 1SC5B 3G6BA 2YIBD 2F23A 4XDKA 4ZHQB 1KKDA 3P3PA 1VQNV 5CB4B 1OCOB 1GN3A 4UV8A 1E1QG 4TQFA 1RSOA 3CYOA 4I0XA 4IIJA 5J2TA 5LMUB 1Z5VA 5FL7G 4J41A 3IC9A 3KZIZ 4LNUB 3UO2A 4MVRA 3H1KH 5EYPB 3W7SA 3CWBH 4X66O 3L72H 3SPGA 3ZMVA 5EK0A 1O9GA 1HP8A 4FM1A 5IYZB 1OHHG 3IGAC 5EC1C 3LNMB 4MS2A 3N2GA 3FB7C 3D8CA 3ZMZA 1FPOA 4G27B 2IH1C 4DR5O 3OAAG 2P5OA 4YIOA 2DQ3A 1SQFA 3BAAA 4YJ3B 4DV2O 3TGUH 3ZHTA 1NTKH 2F66C 3CRRA 4R6ZA 1XMOB 1HDJA 1WPBA 2P6JA 3C90A 2OT5A 3ETGA 5LP6C 4B3MO 1S77D 1F23A 1VP7A 2LQTA 1SZTA 2E75B 3OE7G 4LFBO 1DF5A 3HB3B 1Y67A 1Y66A 2LFRA 3OTFA 2Q69A 4QE7A 3AG2C 1K8AW 4XBFA 2R9IA 3CC2V 4DV6O 5J2UA 4JV5B 3WB0A 4J42A 2JGDA 3D36A 2AHYA 1K5QA 2UUAB 1NS1A 3S3XA 1CXZB 4FFKA 1N33O 3QO8A 1BS3A 4R7CA 3MDSA 5FLXN 4O4JB 2DWEC 3Q4HA 4LF4O 5EIBC 1OCRB 1EN6A 1MG1A 3KG2A 1SQQH 2R70A 4JI8O 3B2EE 1DLBA 1TA8A 5E79Z 4FLZA 3J81N 3LDDA 4JZGA 5KHGA 1PNLA 3CMAV 5KMGB 4I5SA 2QWQB 1GK9A 3RVYA 4ZKIA 4MVOA 3SYCA 4UCTA 4WCEV 2F43G 1B04A 5FNVB 3L74H 5CB4A 2QM8A 4LR3A 2ETNA 2WLHA 3H1IH 1N0NA 1R6KA 1J5EO 2OTLV 2IJIA 1FS0G 3CRMA 3A0HZ 1VMGA 4LNUA 1X4TA 1QR8A 4JTAB 5EYPA 5B1AC 1W2BU 5DEDA 5IYZA 1K97A 3ZJZA 4GKJO 3BFRA 3J7AU 2WSSG 2HKOA 1GM9A 3JYCA 4PJ0Z 1HNZO 1TUEB 3KCXA 5EIBD 1SETA 2Q5ZA 4YJ3A 2DOSA 1TUBB 4U3FH 1AJNA 1HW7A 4UB8Z 1GN2A 4DUYO 3WB2A 2YIDA 2W0FC 1M90W 1AB3A 5KAFZ 4X1YB 5JJNB 1MA1A 1Q6UA 1JJOA 2DW4A 1I5XA 5IY5C 3ZHVA 4JTCB 1KMIZ 2BTOA 3QTCA 2HR3A 5LL6Y 4UV9A 3K5MA 3FB5C 4DRXB 1I94B 4MSWC 4JI3O 2LO1A 2JK5C 5B1BB 1OZ0A 4DR4O 2QSAA 3MHHC 1F4MA 5IY5B 5KAIZ 4FK5C 1NQTA 1Y74B 4O4JA 2Y48A 1PNMA 5IJ0B 5KA6A 4B3SB 3CXCU 3H01A 2PTMA 3EXAA 4BW5A 4PA3A 2YI8A 1ZSPA 4BW9A 5KMGA 4LF7O 4F6EA 2LGQA 2A79B 5FNVA
chains in the Genus database with same CATH topology
4JI2O 4X65O 2ZKOA 1XMQO 1D2DA 5IWAO 1N36O 4YHHO 1A32A 4B3TO 1HNWO 2F4VO 4DR5O 4JI6O 4LF5O 3JAMN 4GKKO 4B3RO 4LF8O 4JV5O 4JI1O 2UXCO 4DV2O 4NXMO 4A5UB 2UUCO 3M8AA 1HR0O 4GKJO 4DV0O 3J7AU 2DJVA 1KUQA 4DR7O 4B3MO 1HNZO 3F5TA 2VQFO 2HHHO 4DV5O 3RT3C 4K0KO 1F7YA 4DV7O 4LF9O 3T1HO 2DOSA 3J80N 4DR1O 4LFBO 2AGAA 4DV3O 4DR2O 1N34O 4JI4O 2UXBO 4OPAA 4LFAO 1DK1A 3O65A 4DUYO 5LMNO 4JI0O 4DV6O 5H5NA 1AB3A 5LMUO 4DV1O 2UUAO 1XNRO 1N32O 5IT9N 1XNQO 4LFCO 2UU9O 1R6TA 1NS1A 2ZM6O 4OX9O 1N33O 1FJGO 2UUBO 1XEQA 1HNXO 5FLXN 1I94O 4DR6O 5LL6Y 4JI5O 4JI7O 3T1YO 4LF4O 5BR8O 2E5LO 4JI3O 4DR3O 5A2QN 4JI8O 4NXNO 4JYAO 1YZBA 4X64O 3OTOO 1IBLO 4DR4O 4OPHA 2FKXA 1FYJA 3J81N 4LF6O 4X62O 5BXZA 1R1BA 4B3SO 1IBKO 1IBMO 1G1XB 5BY1A 4AQYO 2UXDO 4DV4O 2LW7A 3SDLA 4X66O 1AILA 1XMOO 2JRIA 4DUZO 1FKAO 2VQEO 1J5EO 4LF7O 2N74A 3R66A 4KHPO 4YY3O 1X59A 2Z0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 O;  4X65 O;  2ZKO A;  1XMQ O;  1D2D A;  5IWA O;  1N36 O;  4YHH O;  1A32 A;  4B3T O;  1HNW O;  2F4V O;  4DR5 O;  4JI6 O;  4LF5 O;  3JAM N;  4GKK O;  4B3R O;  4LF8 O;  4JV5 O;  4JI1 O;  2UXC O;  4DV2 O;  4NXM O;  4A5U B;  2UUC O;  3M8A A;  1HR0 O;  4GKJ O;  4DV0 O;  3J7A U;  2DJV A;  1KUQ A;  4DR7 O;  4B3M O;  1HNZ O;  3F5T A;  2VQF O;  2HHH O;  4DV5 O;  3RT3 C;  4K0K O;  1F7Y A;  4DV7 O;  4LF9 O;  3T1H O;  2DOS A;  3J80 N;  4DR1 O;  4LFB O;  2AGA A;  4DV3 O;  4DR2 O;  1N34 O;  4JI4 O;  2UXB O;  4OPA A;  4LFA O;  1DK1 A;  3O65 A;  4DUY O;  5LMN O;  4JI0 O;  4DV6 O;  5H5N A;  1AB3 A;  5LMU O;  4DV1 O;  2UUA O;  1XNR O;  1N32 O;  5IT9 N;  1XNQ O;  4LFC O;  2UU9 O;  1R6T A;  1NS1 A;  2ZM6 O;  4OX9 O;  1N33 O;  1FJG O;  2UUB O;  1XEQ A;  1HNX O;  5FLX N;  1I94 O;  4DR6 O;  5LL6 Y;  4JI5 O;  4JI7 O;  3T1Y O;  4LF4 O;  5BR8 O;  2E5L O;  4JI3 O;  4DR3 O;  5A2Q N;  4JI8 O;  4NXN O;  4JYA O;  1YZB A;  4X64 O;  3OTO O;  1IBL O;  4DR4 O;  4OPH A;  2FKX A;  1FYJ A;  3J81 N;  4LF6 O;  4X62 O;  5BXZ A;  1R1B A;  4B3S O;  1IBK O;  1IBM O;  1G1X B;  5BY1 A;  4AQY O;  2UXD O;  4DV4 O;  2LW7 A;  3SDL A;  4X66 O;  1AIL A;  1XMO O;  2JRI A;  4DUZ O;  1FKA O;  2VQE O;  1J5E O;  4LF7 O;  2N74 A;  3R66 A;  4KHP O;  4YY3 O;  1X59 A;  2Z0A A; 
#chains in the Genus database with same CATH topology
 2IU3 A;  2CTW A;  4U3J B;  2EIN C;  2X6B A;  3B40 A;  2QTO A;  1EM1 A;  1MZF A;  1AI4 A;  4PDV A;  4JI1 O;  3ZIA G;  5IYD O;  3BA9 A;  1SRY A;  2PF4 E;  2VWK A;  2BCC H;  1M57 B;  2EIN B;  4DK1 A;  4DXW A;  3B4S A;  1NTZ H;  1RPO A;  4PDM A;  1KEC A;  4X1K B;  2UXB O;  1AJP A;  1RPR A;  4PDL A;  1VQ9 V;  2ZDI C;  1M9N A;  1R3J C;  3HKE B;  4JI0 O;  2CDY A;  1HWY A;  3ZED A;  2WAM A;  4FMT A;  1TUB A;  1NKD A;  1XRE A;  3K57 A;  2IJJ A;  1PV0 A;  3CCS V;  1OCZ B;  3ZS8 C;  1JJ2 U;  5JVD A;  3OW2 U;  2VS0 A;  1YVW A;  4X1Y A;  3SPJ A;  3APQ A;  4O2A B;  1L8D A;  2LW1 A;  2ZIO A;  4DR3 O;  2CGO A;  5A2Q N;  3OT7 A;  1E1R G;  3AG3 B;  3OTO O;  2QR4 A;  4MT8 A;  3FAV A;  1EN4 A;  2GSM B;  1S0V A;  4EFE A;  4DRX A;  1NT2 B;  1XQ8 A;  4J7K A;  1YI2 V;  4PD4 F;  4FLX A;  3SDL A;  1AI6 A;  1M56 C;  2CAZ C;  2JRI A;  4RWU A;  4HYO A;  1H38 A;  3KCY A;  1Y74 A;  4X66 B;  2IJH A;  5IJ0 A;  2M7W A;  1H8H G;  1AP6 A;  2WWW A;  4NB5 A;  3OR7 C;  1M5I A;  5IWA O;  1XI1 A;  1M4U A;  1OJH A;  3K5L A;  2UXX A;  3M99 B;  1VF7 A;  2N04 A;  4JI6 O;  4LF5 O;  3RYI B;  4B3R O;  1B3Q A;  3OGI B;  4DR5 B;  4GLX A;  1XHZ A;  1QVG U;  1F51 A;  2ZR2 A;  4OXS A;  4U3J A;  2E76 B;  1FXH A;  4I9W A;  1FFT B;  2HHH O;  3ZHS A;  1F7Y A;  3ZRV A;  3WU2 Z;  3BRC A;  4ZBM A;  1P49 A;  3JAS B;  2VRZ A;  4DV3 O;  1Q5O A;  2ZIM A;  3ZHU A;  4F4L A;  4LFB B;  1R73 A;  2OCC B;  4DV1 O;  1IVS A;  4DV6 B;  2EIJ B;  3CCR V;  4R50 A;  4X1K A;  5B3S B;  1R6T A;  4OX9 O;  4GT1 A;  3JSL A;  1BHB A;  4CZZ A;  2V4D A;  3HKE A;  1AI7 A;  4O4I B;  1N33 B;  1B06 A;  1ENV A;  2IM9 A;  4PA7 A;  3JSN A;  3WB1 A;  3SPC A;  3HKC B;  1VQ7 V;  4JZ2 A;  2HEP A;  3APO A;  4LF4 B;  4JI8 B;  1XL4 A;  4LF6 O;  1N8R W;  3ZHR A;  2QTS A;  5JJE B;  5JH7 B;  3HPL C;  4AI8 A;  4ASU G;  4O2A A;  4DK0 A;  4AQY O;  1Q81 W;  2PY5 A;  2EX3 A;  3LDE A;  1NH2 B;  2WA4 A;  1EN5 A;  1QBZ A;  1VQK V;  5IDJ A;  2X7R B;  1GTO A;  2HFE C;  1WA8 B;  1SES A;  3K0D A;  3RYH A;  1FKA O;  2LFS A;  2XAJ A;  1UFI A;  5BR8 B;  1JR9 A;  3CCM V;  1J5E B;  5L3C A;  3JCZ A;  3AG1 C;  4GUN A;  2ZKO A;  4X62 B;  2FTK A;  3UKM A;  4B3T O;  2B1G A;  2OYQ A;  2ZT9 B;  4IHJ B;  1JA8 A;  1V9P A;  1P7B A;  3ZRX A;  2Q73 A;  2UUC O;  1V55 B;  2NLJ C;  3AG1 B;  2M6Y A;  2Q6A A;  1JVM A;  4GKJ B;  3L75 H;  1W0K G;  4QPK A;  3RYI A;  2Y0I A;  3K04 A;  1Y6X A;  2V7Q G;  4AHC A;  3AK3 A;  2CGN A;  3CX5 F;  4Z1M G;  4LH6 A;  2Q0O C;  5LHI A;  3W7W A;  2X0L A;  2PYJ A;  4LFA O;  1Q6I A;  3CC4 V;  4B7K A;  1V54 C;  1S5J A;  1EZV H;  1GN4 A;  1PPJ H;  3AG4 C;  2HLD G;  3FB8 C;  3LUT B;  4X1I B;  4QPJ A;  3ZMS A;  3IJ4 A;  2R9R B;  3JAS A;  2BTQ B;  4QJF B;  1WNS A;  1FJG O;  3ETD A;  4YXW G;  4JTD B;  4QE9 A;  4DR6 O;  1IX9 A;  1JQ0 A;  2Y69 B;  5LHH A;  3TXQ A;  5JCO C;  4MVZ A;  4ABM A;  4FLV A;  1IBL O;  2WLN A;  3HKB B;  4FVM A;  5KHK A;  1NZ6 A;  4O4I A;  1ZLZ A;  4O4H B;  1K34 A;  4B7E A;  3VQX A;  5ITZ A;  3HKC A;  2UXD O;  4DV4 O;  2DYS C;  2PI4 A;  4JGS A;  3ASN B;  2IJK A;  2JIZ G;  3CRC A;  1XOU A;  5FPO A;  5JH7 A;  4GCZ A;  2OIE A;  1H2K A;  4YY3 O;  1X59 A;  3B8M A;  4LF7 B;  3VQW A;  4JI2 O;  1ORQ C;  4EFB A;  1WA8 A;  2KG7 B;  2OIG A;  3DC5 A;  1XL6 A;  1QCE A;  2YDE A;  1Q7Y W;  1RM1 C;  4TSF G;  5C93 A;  2QM4 A;  1URF A;  3KKY A;  4JI1 B;  2QKA A;  1B6Q A;  3DGE A;  5L3E A;  4DV5 O;  4IHJ A;  1D5A A;  3GB7 C;  3U11 A;  1WB7 A;  3OUF A;  5LGT A;  5D5Q A;  1GM8 A;  3F5W C;  3R65 A;  3SJC C;  3ZMU A;  1VQ6 V;  4JI4 O;  4LBE C;  3H1J H;  1QR9 A;  1ZL8 B;  4YJ2 B;  1KP3 A;  4CH3 A;  2UXB B;  5H5N A;  1AR5 A;  2DMX A;  2ZXW C;  3N27 A;  3C3S A;  1Q82 W;  1HR0 B;  2B5U A;  4J80 A;  5LGU A;  4UCV A;  2B1I A;  2UUB O;  1D5N A;  1VQO V;  1H2S B;  4BWA A;  2E74 B;  2YIB A;  4JI5 O;  2RNB A;  3BCC H;  4X1I A;  5H6Q A;  4QNH B;  2BTQ A;  2H94 A;  4CH5 A;  1BSM A;  3UM7 A;  5LP6 B;  1KC8 W;  4K8X A;  5KHI A;  4DR3 B;  1U96 A;  4UVB A;  3OTO B;  5K1P A;  4IT5 A;  1Q43 A;  4MW3 A;  2HVK C;  3TCU A;  2CTR A;  4P2Z A;  1AR1 B;  1H8E G;  2WLI B;  4PI0 A;  2N05 A;  3K79 A;  1K3E A;  3K0G A;  1VF6 A;  3AG2 B;  5J9P C;  3ASO C;  3ZMT A;  3G71 V;  4XDJ A;  4CBC A;  5BZB A;  3U0Z A;  5JQG B;  5IJ9 B;  3CCL V;  4WFE A;  4O4H A;  3DXR B;  3L71 H;  2A9H A;  2GV9 A;  3ZN1 A;  1H2G A;  2FYU H;  4ZI7 B;  1IZ3 A;  1AI5 A;  2EZP A;  4JYB A;  1QVF U;  1EFR G;  2LGW A;  2QJ1 A;  3LSS A;  5GTI Z;  4P9P A;  2F4V O;  1VQM V;  4TV8 B;  5IWA B;  4ZHQ A;  4RQE A;  4LF8 O;  1SS3 A;  3WG7 C;  4JI6 B;  4LF5 B;  4PDR A;  1G4Y B;  5DEC A;  2Q4P A;  4Q20 A;  4UB6 Z;  2KG7 A;  3CCU V;  3FYI B;  3F5T A;  3G4S V;  1DF4 A;  4IYH A;  3AEI A;  1ZUQ A;  3K5N A;  1BHA A;  2JGU A;  4NYK A;  3QO5 A;  3OD4 A;  1SQP H;  2AGA A;  3WG7 B;  3NR7 A;  3BVO A;  2Q7E A;  5LMN O;  4GKK B;  4D7T A;  4MVM A;  3L70 H;  2Q9L A;  3RVZ A;  4LFC O;  2UXN A;  2JDI G;  2QE7 G;  2QA4 V;  5B1A B;  2HJF C;  3CME V;  3FD9 A;  2ZE7 A;  5KUM A;  4JI7 O;  1EZJ A;  3FFQ A;  3OMI B;  2L35 A;  1OCC C;  3UT5 B;  2PYL A;  4X64 O;  3ZBH A;  3BPZ A;  1R1B A;  2H8P C;  2YC0 A;  4UCU A;  3D3Q A;  4UVA A;  4X9Q A;  4LF6 B;  2HVJ C;  1YTF D;  4Z1V A;  1OCC B;  4NKG B;  3ZN0 A;  5LP6 A;  3CSX A;  4JAS A;  2CUG A;  1IDS A;  1DGS A;  3E8G A;  4GZR B;  4JAV A;  2RN9 A;  1VQ4 V;  1W59 A;  4JAU A;  3IAY A;  2WLI A;  4UUJ C;  3OMN B;  5H9C A;  1VEW A;  2B9Z A;  1IXM A;  2F95 B;  3CE2 A;  5JQG A;  3E22 B;  5FPR A;  1NU1 H;  1TGO A;  3DXR A;  2NNU A;  2XND G;  5IE9 A;  4ZI7 A;  4U7N A;  4B3T B;  4PA6 A;  4I50 B;  4CH6 A;  1BE3 H;  2DJV A;  3ZX6 A;  3JD1 A;  1L0N H;  2GTA A;  1PL0 A;  1WPX A;  4J10 A;  2UUC B;  3MD0 A;  4BIU A;  4TV8 A;  1SZX A;  4K0K O;  5L3B A;  3SYQ A;  1SQX H;  2ZQM A;  3L73 H;  1YCI A;  2JS3 A;  3ML0 A;  1N4C A;  5K1X A;  2GHY A;  1AP5 A;  1EBO A;  2XTA A;  3OEE G;  4FLT A;  4LFA B;  4FPP A;  2HP8 A;  4LC1 A;  5LMU O;  3O9O A;  1FAF A;  3SJA C;  4K35 A;  1Y76 B;  4WFA V;  4ICG A;  2KB1 A;  2ADP A;  1Q86 W;  2GBO A;  5GON B;  5KHJ A;  2BE3 A;  1HNX O;  2Q68 A;  1P7G A;  2DYR C;  3T1Y O;  5L3D A;  4DR6 B;  1CPY A;  1QU7 A;  3E2E A;  4WF9 V;  2AZ2 A;  3GVM A;  2CH7 B;  1IBL B;  1S5L Z;  3X2Q C;  2XAF A;  4KL1 A;  4HBN A;  5CN0 A;  2CE4 A;  3UT5 A;  3CB2 A;  1TVK B;  2DYR B;  4W4L A;  4HNA B;  1K9M W;  3ABL C;  1XMO O;  2R72 A;  4PA4 A;  4WFB V;  1PD3 A;  2WLL B;  3K3W A;  3K06 A;  3E83 A;  1QLN A;  1YEW A;  4PEL A;  4YY3 B;  3TXS A;  5CA1 B;  5IYC O;  1WP8 A;  3I5D A;  3SPI A;  4JI2 B;  1NVP D;  2RCV A;  1BT8 A;  4JV5 O;  1PNK A;  1I08 A;  3T1C A;  2LP7 A;  3N2K B;  2QKS A;  4CS3 A;  3E22 A;  4LWS B;  4I7Z B;  5F2V O;  2P06 A;  3H1H H;  2W6I G;  4X88 A;  3HKD B;  4LF9 O;  4DV5 B;  4I4T B;  1M56 B;  4I50 A;  5CBF A;  3FYE B;  3JCU Z;  2WLM A;  3FKS G;  1F4N A;  2FML A;  3UCS C;  4R8C A;  2Q7G A;  4JI4 B;  5H2F Z;  4DV2 B;  4TUY B;  5KUK A;  3FX7 A;  3ABM C;  2X6A A;  4H33 A;  4U7O A;  4AIL C;  3BEH A;  4LH7 A;  4B3M B;  3QNE A;  2EJ7 A;  3T4D A;  2NN4 A;  2RDC A;  4BR6 A;  2BOB C;  3PJS K;  1S5H C;  4YIP A;  2UUB B;  3RYF B;  1W0J G;  2RMK B;  4EKW A;  2E5L O;  4FLY A;  4JI5 B;  1Y76 A;  4RO2 A;  1YXB A;  4JYA O;  3ABM B;  2YXH A;  2FKX A;  1GO3 F;  4JAA A;  5GON A;  3OUS A;  4P9O A;  4JYY A;  1PM9 A;  1QNM A;  1US6 A;  4N21 A;  1FXK C;  2QGN A;  1IBM O;  2EIL C;  2HG5 C;  2DQ0 A;  4C7U A;  2MW2 B;  1I7F A;  2QDO A;  4FLW A;  3BY6 A;  3JD2 A;  4I55 B;  1ZTE A;  2WA3 A;  2ZR3 A;  2CH7 A;  3LNN A;  5LBQ A;  3CEI A;  5BMV B;  2AZ0 A;  2VQE O;  2N74 A;  1BCC H;  4BIO A;  1Q6H A;  4NVP A;  2ZE8 A;  1NR1 A;  2EIM C;  3G80 A;  2JVD A;  3K5O A;  4HNA A;  2HJD A;  2Z0A A;  3F7Y C;  3W7U A;  2ZDI A;  3GWO A;  2AXT Z;  3IFX A;  1KQS U;  3E35 A;  2H3O A;  3CRQ A;  3E8B A;  1A32 A;  1BMF G;  5EC2 C;  3K58 A;  2WLL A;  4WBN B;  2XT9 A;  2QWR B;  2F4V B;  1VQL V;  4NXM O;  3FB6 C;  4MTX A;  2EIM B;  2PZS A;  3QO7 A;  4LF8 B;  1XUQ A;  3TJT A;  5CA1 A;  2ITC C;  4DV0 O;  4WFH A;  3LSQ A;  1KUQ A;  1KKC A;  1WP7 A;  1AJQ A;  3JD0 A;  3P32 A;  4DV7 O;  2PUS A;  4E4E A;  4ZOL B;  2ADQ B;  3T1H O;  2F1M A;  1CEZ A;  4EEQ A;  1KD1 W;  5CA0 B;  3M7M X;  3N2K A;  2YXY A;  2Q8V A;  4IIJ B;  3G6E V;  4DR2 O;  4H0L B;  2JJ1 G;  2XAS A;  3HKD A;  2A3Q A;  5LMN B;  4I4T A;  2YXL A;  1XNQ O;  3JAL B;  1SER A;  3ABU A;  4EB6 B;  2ZM6 O;  5GTH Z;  1YJ9 V;  4MTF A;  4LFC B;  4IYI A;  1HNZ B;  3RFR A;  3K9S A;  3ABK C;  2AHZ A;  2XUM A;  1LR1 A;  4DO2 A;  5L3F A;  4TUY A;  1R3K C;  2VWJ A;  1BGY H;  2QM7 A;  4DYL A;  2EBO A;  4NXN O;  3CRA A;  5GW7 A;  4DUY B;  3MHS C;  4O4L B;  4UXN A;  4X64 B;  3RYF A;  3ABK B;  3EFF K;  3SYO A;  1WB8 A;  5BY1 A;  1VQ5 V;  1YJN V;  4PV1 B;  1P84 F;  2LW7 A;  3A2F A;  1AR4 A;  1N0J A;  1CP9 A;  1V54 B;  4H44 B;  3E8F A;  4H37 A;  3AG4 B;  3R66 A;  4GX5 A;  2EIK C;  4JI3 B;  2YUA A;  4I55 A;  4DR4 B;  5KHH A;  1XMQ O;  1YHQ V;  5BMV A;  1M1K W;  2P4K A;  5LXT B;  4LCU C;  5C8Y B;  4IGG A;  3H1L H;  4DW1 A;  3K08 A;  1COW G;  3RW0 A;  2UXC O;  3CD6 V;  2D3O W;  1MMM A;  3BHP A;  3K59 A;  4XDL A;  2V1D A;  1BQ0 A;  3A8T A;  1SKV A;  3RYC B;  2VQF O;  1JX9 A;  4WBN A;  2DN9 A;  1OCO C;  2DYS B;  3L9D A;  3SJQ C;  2G38 A;  2OCH A;  4K0K B;  1R3L C;  5B66 Z;  1N34 O;  4KP4 A;  4CH4 A;  5KA5 A;  3ZRS A;  4B08 A;  1UPG A;  1YDX A;  2EJR A;  1YIJ V;  4ZOL A;  2GDS A;  2MK3 A;  2XHB A;  1NJI W;  4BIZ A;  1N32 O;  5CA0 A;  4OGQ B;  1XIL A;  1KP2 A;  3IC7 A;  4CC5 A;  4E2L A;  5DN6 G;  1RM1 B;  2P22 C;  3CHX A;  3JD4 A;  1HNX B;  3JAL A;  4EB6 A;  2RQ6 A;  3T1Y B;  4J9Z B;  4CC6 A;  4W4K A;  4JI0 B;  1E79 G;  2YS8 A;  2R9A A;  1IBK O;  1NTM H;  2OTJ V;  1LNQ A;  3TK1 A;  2JEU A;  1ROP A;  1LUW A;  1NBM G;  1AIL A;  1MNG A;  4FFB B;  4O4L A;  1S76 D;  4DUZ O;  1K7D A;  2W6J G;  3NXS A;  2ZXW B;  1FXV A;  4KHP O;  2Q0A A;  4F6R B;  3AK1 A;  2Q7H A;  2LJ2 A;  5CA3 A;  3T2M A;  3RBZ A;  4D7S A;  2Z5U A;  2QWN B;  2YIC A;  5EBL C;  4YHH O;  1HNW O;  1XHX A;  3HKB A;  2ZNJ A;  4A5U B;  2KQX A;  2FL4 A;  3G67 A;  1OCR C;  3JD3 A;  4HAM A;  3CC7 V;  5JCO A;  5LXT A;  3RT3 C;  1O9H A;  5C8Y A;  4JF3 A;  4J9Y B;  4MVS A;  4ZIB A;  5E1A C;  3B8N A;  3B09 A;  1WN7 A;  2YEV B;  3ASO B;  3ETQ A;  3CJH B;  4LF9 B;  2YI9 A;  4X20 B;  3RYC A;  5B1N A;  4B3R B;  2QKC A;  3OR6 C;  1TAE A;  3JAT B;  5LYJ B;  3OM3 B;  2UU9 O;  2ILM A;  3DTU B;  1R3I C;  4MW8 A;  2KSD A;  1R6N A;  2HHH B;  2CTQ A;  2WPD G;  1SF9 A;  3A0B Z;  2E3C A;  3E86 A;  3BAB A;  3W7X A;  1YTF B;  5BR8 O;  1K73 W;  4UCS A;  5HFL A;  4DV3 B;  4D6T H;  2E5L B;  3CCJ V;  4Z2W A;  1FYJ A;  4X62 O;  1T5E A;  4JYA B;  3QF7 A;  4TOI A;  1QQC A;  4DV1 B;  3VQV A;  4DW0 A;  1ZL8 A;  4YJ2 A;  1IBM B;  1XDC A;  4OX9 B;  1ARO P;  5KLV H;  4FZ0 A;  3RGB A;  1VAR A;  1GN6 A;  3UQ8 A;  4IL6 Z;  1VQ8 V;  1SQB H;  4RUE A;  2ZE6 A;  2VQE B;  1SA0 B;  3WFV A;  4X65 O;  1K5S A;  2Y0P A;  4FFB A;  2W0X A;  1N36 O;  3LSU A;  5CBG A;  5D5P A;  4F6R A;  4AQY B;  3T4Z A;  3OFN G;  2Y4T A;  5JVD B;  3U10 A;  1ZX3 A;  3M8A A;  4UVC A;  4NXM B;  5B1B C;  3SR2 C;  4PI2 A;  4DR7 O;  1G6U A;  4DV0 B;  2Q67 A;  1JMK C;  3FAV B;  4NTX A;  3ABT A;  2JJ2 G;  2K9P A;  5JJJ B;  2WLK A;  4DR1 O;  4JPR A;  5IJ9 A;  4DV7 B;  1S72 V;  3T1H B;  1YF2 A;  3H9V A;  4G2K A;  4KFM A;  2C2A A;  3ZRW B;  4DR2 B;  1BL8 A;  4G28 B;  3JAK B;  3CP1 A;  1WJZ A;  1MSW D;  1XNR O;  2YEV A;  4UCR A;  4HZ3 A;  3D3I A;  3CJH A;  4J7J A;  5L3G A;  2X6C A;  1VIB A;  4X20 A;  2Z3Y A;  4GYC B;  1XNQ B;  3B77 A;  4MTG A;  2ZM6 B;  3VQY A;  3JAT A;  5H6R A;  5LYJ A;  1UJW B;  3K9A A;  1THZ A;  1PP9 H;  1YZB A;  2F93 B;  4OPH A;  1NI8 A;  3SGI A;  2ZCE A;  5LOV B;  3A0R A;  4NXN B;  1MSD A;  1JFF B;  4FZ1 A;  1M57 C;  4Q6G A;  4MTO A;  2EUL A;  1FJG B;  5KX5 B;  4RAI A;  1NR7 A;  4N23 A;  1KU9 A;  4NTW A;  2XAG A;  1NVP B;  2IH3 C;  4KUM A;  1Q3E A;  1L1F A;  4RQF A;  3F7V C;  4TQD A;  1Y4M A;  4TV9 B;  5A9G A;  3STZ C;  1BZK A;  2GTS A;  2XAQ A;  2P4V A;  1OCZ C;  1YJW V;  5DM6 V;  5JWP A;  2A06 H;  1XMQ B;  1J95 A;  3JAW B;  2UXD B;  2A0L A;  4DV4 B;  4K8Z A;  1SA0 A;  1SQV H;  1Q90 D;  2KKW A;  1JPX A;  1HR0 O;  2UXC B;  3AG7 A;  2PGG A;  3EVK A;  3X2Q B;  3AG3 C;  1YSC A;  3UO3 A;  4O2B B;  1LUV A;  1H2L A;  2VQF B;  4X89 A;  5B1O A;  4RUF A;  3ABL B;  2P7T C;  3VOU A;  2WLJ A;  4WFG A;  1JOY A;  1IXB A;  5LGN A;  3SJB C;  5EZY B;  1N34 B;  1IUR A;  4MVU A;  3S3W A;  4UFZ A;  1FFX B;  2UUA O;  2ZIN A;  3STL C;  1K4C C;  3RYH B;  1N32 B;  4K3A A;  2ODM A;  5EBM C;  2OWO A;  4J7Z A;  3ZRW A;  4J11 A;  3JAK A;  1GRJ A;  3TET A;  4UCO A;  2BSK B;  2BOC C;  5CBH A;  3MAQ A;  3P30 A;  4BAY A;  1Z5W A;  4CS2 A;  4FM0 A;  3SYA A;  1S3J A;  2CK3 G;  2IBZ H;  5BXZ A;  1G1X B;  1JCH A;  3ICX A;  4QIW F;  3C3T A;  3RN4 A;  1IBK B;  4GX2 A;  1WLE A;  2XAH A;  3CPW U;  3P3N A;  1GH6 A;  1GKF A;  4GX1 A;  1PKX A;  3SYP A;  5LOV A;  2NR5 A;  4PHZ A;  4MVQ A;  2QWP B;  4FJC C;  1JFF A;  1K33 A;  4DUZ B;  4FM2 A;  1Q8I A;  4H13 B;  2OCC C;  4KHP B;  2DWD C;  5LHG A;  5KX5 A;  1ZWI C;  2EIJ C;  2JEX A;  5B3S C;  4P30 A;  4LP8 A;  3ZHQ A;  4NTY A;  1WAZ A;  1MOF A;  3JAM N;  4GKK O;  2FB5 A;  1H2M A;  3DC6 A;  3E89 A;  4CS4 A;  4YHH B;  2K1E A;  1HNW B;  3LDC A;  3OMA B;  3CCV V;  4KXR A;  4TV9 A;  3JAR B;  3GWK C;  4QGP A;  2ITD C;  3EHB B;  1FXK B;  2EIL B;  1TVK A;  2O57 A;  2ATK C;  5EBW C;  1GM7 A;  3JAW A;  2ARH A;  3OGC C;  4X8A A;  3ZCC A;  2GUZ B;  4FLU A;  3ETE A;  4OPA A;  5ITZ B;  3O65 A;  1DTO A;  5LA6 B;  4O2B A;  2IW5 A;  2YIA A;  2QEX V;  3HR0 A;  3I55 V;  2ZD9 A;  5IT9 N;  1G8M A;  2ZNI A;  1PL4 A;  3QG5 A;  1Z2G A;  1VQP V;  3AK2 A;  2RJZ A;  1L0L H;  4TWK A;  5EZY A;  1MAB G;  2UU9 B;  3PN1 A;  1YIT V;  1I94 O;  1RSO B;  1FFX A;  4I0X B;  5J2T B;  4L87 A;  4LWS A;  2L6L A;  3VBB A;  2ZE5 A;  4L8J A;  3CS5 A;  2P90 A;  2CTP A;  1V55 C;  1BQZ A;  3W7T A;  3CCQ V;  4B3S O;  1GMG A;  2BSK A;  1RP3 B;  4NR1 A;  1XBL A;  3BA8 A;  3OEH G;  2YSU B;  1I0H A;  3N2G B;  1KYO F;  2QWO B;  2A7W A;  1I5Y A;  4JI7 B;  1FD9 A;  4GX0 A;  1SQG A;  3SPH A;  2EZO A;  4PA9 A;  1NH2 D;  1GAX A;  1OV9 A;  1QLE C;  1AVM A;  1ZAU A;  3E8H A;  4WFF A;  1D2D A;  3RWR D;  2IU0 A;  3THO A;  1KBH A;  4JYC A;  4X65 B;  3K03 A;  2D2C B;  2P67 A;  2XOK G;  1N36 B;  2Y69 C;  3D36 C;  4TT3 G;  3CCE V;  1KB9 F;  1QLE B;  5B5E Z;  5HFM A;  2JS5 A;  3QVN A;  3CXH F;  1VF5 B;  1VF6 C;  3DSQ A;  1QHT A;  4DR7 B;  1P4R A;  5J2U B;  3J80 N;  3I56 V;  2JGD B;  3JAR A;  2Y4U A;  4FIP C;  5TIS Z;  1FXK A;  4DR1 B;  1DK1 A;  2PI5 A;  3ASN C;  1M93 A;  2EIK B;  1K4D C;  1MZE A;  1RFY A;  2DE0 X;  3Q4H B;  5IYB O;  4I9Q A;  2GUZ A;  5AG2 A;  1K92 A;  1XNR B;  1U97 A;  1XEQ A;  1H2N A;  5LA6 A;  2AW9 A;  5CMU A;  1SC5 B;  3G6B A;  2YIB D;  2F23 A;  4XDK A;  4ZHQ B;  1KKD A;  3P3P A;  1VQN V;  5CB4 B;  1OCO B;  1GN3 A;  4UV8 A;  1E1Q G;  4TQF A;  1RSO A;  3CYO A;  4I0X A;  4IIJ A;  5J2T A;  5LMU B;  1Z5V A;  5FL7 G;  4J41 A;  3IC9 A;  3KZI Z;  4LNU B;  3UO2 A;  4MVR A;  3H1K H;  5EYP B;  3W7S A;  3CWB H;  4X66 O;  3L72 H;  3SPG A;  3ZMV A;  5EK0 A;  1O9G A;  1HP8 A;  4FM1 A;  5IYZ B;  1OHH G;  3IGA C;  5EC1 C;  3LNM B;  4MS2 A;  3N2G A;  3FB7 C;  3D8C A;  3ZMZ A;  1FPO A;  4G27 B;  2IH1 C;  4DR5 O;  3OAA G;  2P5O A;  4YIO A;  2DQ3 A;  1SQF A;  3BAA A;  4YJ3 B;  4DV2 O;  3TGU H;  3ZHT A;  1NTK H;  2F66 C;  3CRR A;  4R6Z A;  1XMO B;  1HDJ A;  1WPB A;  2P6J A;  3C90 A;  2OT5 A;  3ETG A;  5LP6 C;  4B3M O;  1S77 D;  1F23 A;  1VP7 A;  2LQT A;  1SZT A;  2E75 B;  3OE7 G;  4LFB O;  1DF5 A;  3HB3 B;  1Y67 A;  1Y66 A;  2LFR A;  3OTF A;  2Q69 A;  4QE7 A;  3AG2 C;  1K8A W;  4XBF A;  2R9I A;  3CC2 V;  4DV6 O;  5J2U A;  4JV5 B;  3WB0 A;  4J42 A;  2JGD A;  3D36 A;  2AHY A;  1K5Q A;  2UUA B;  1NS1 A;  3S3X A;  1CXZ B;  4FFK A;  1N33 O;  3QO8 A;  1BS3 A;  4R7C A;  3MDS A;  5FLX N;  4O4J B;  2DWE C;  3Q4H A;  4LF4 O;  5EIB C;  1OCR B;  1EN6 A;  1MG1 A;  3KG2 A;  1SQQ H;  2R70 A;  4JI8 O;  3B2E E;  1DLB A;  1TA8 A;  5E79 Z;  4FLZ A;  3J81 N;  3LDD A;  4JZG A;  5KHG A;  1PNL A;  3CMA V;  5KMG B;  4I5S A;  2QWQ B;  1GK9 A;  3RVY A;  4ZKI A;  4MVO A;  3SYC A;  4UCT A;  4WCE V;  2F43 G;  1B04 A;  5FNV B;  3L74 H;  5CB4 A;  2QM8 A;  4LR3 A;  2ETN A;  2WLH A;  3H1I H;  1N0N A;  1R6K A;  1J5E O;  2OTL V;  2IJI A;  1FS0 G;  3CRM A;  3A0H Z;  1VMG A;  4LNU A;  1X4T A;  1QR8 A;  4JTA B;  5EYP A;  5B1A C;  1W2B U;  5DED A;  5IYZ A;  1K97 A;  3ZJZ A;  4GKJ O;  3BFR A;  3J7A U;  2WSS G;  2HKO A;  1GM9 A;  3JYC A;  4PJ0 Z;  1HNZ O;  1TUE B;  3KCX A;  5EIB D;  1SET A;  2Q5Z A;  4YJ3 A;  2DOS A;  1TUB B;  4U3F H;  1AJN A;  1HW7 A;  4UB8 Z;  1GN2 A;  4DUY O;  3WB2 A;  2YID A;  2W0F C;  1M90 W;  1AB3 A;  5KAF Z;  4X1Y B;  5JJN B;  1MA1 A;  1Q6U A;  1JJO A;  2DW4 A;  1I5X A;  5IY5 C;  3ZHV A;  4JTC B;  1KMI Z;  2BTO A;  3QTC A;  2HR3 A;  5LL6 Y;  4UV9 A;  3K5M A;  3FB5 C;  4DRX B;  1I94 B;  4MSW C;  4JI3 O;  2LO1 A;  2JK5 C;  5B1B B;  1OZ0 A;  4DR4 O;  2QSA A;  3MHH C;  1F4M A;  5IY5 B;  5KAI Z;  4FK5 C;  1NQT A;  1Y74 B;  4O4J A;  2Y48 A;  1PNM A;  5IJ0 B;  5KA6 A;  4B3S B;  3CXC U;  3H01 A;  2PTM A;  3EXA A;  4BW5 A;  4PA3 A;  2YI8 A;  1ZSP A;  4BW9 A;  5KMG A;  4LF7 O;  4F6E A;  2LGQ A;  2A79 B;  5FNV A; 
#chains in the Genus database with same CATH homology
 4JI2 O;  4X65 O;  2ZKO A;  1XMQ O;  1D2D A;  5IWA O;  1N36 O;  4YHH O;  1A32 A;  4B3T O;  1HNW O;  2F4V O;  4DR5 O;  4JI6 O;  4LF5 O;  3JAM N;  4GKK O;  4B3R O;  4LF8 O;  4JV5 O;  4JI1 O;  2UXC O;  4DV2 O;  4NXM O;  4A5U B;  2UUC O;  3M8A A;  1HR0 O;  4GKJ O;  4DV0 O;  3J7A U;  2DJV A;  1KUQ A;  4DR7 O;  4B3M O;  1HNZ O;  3F5T A;  2VQF O;  2HHH O;  4DV5 O;  3RT3 C;  4K0K O;  1F7Y A;  4DV7 O;  4LF9 O;  3T1H O;  2DOS A;  3J80 N;  4DR1 O;  4LFB O;  2AGA A;  4DV3 O;  4DR2 O;  1N34 O;  4JI4 O;  2UXB O;  4OPA A;  4LFA O;  1DK1 A;  3O65 A;  4DUY O;  5LMN O;  4JI0 O;  4DV6 O;  5H5N A;  1AB3 A;  5LMU O;  4DV1 O;  2UUA O;  1XNR O;  1N32 O;  5IT9 N;  1XNQ O;  4LFC O;  2UU9 O;  1R6T A;  1NS1 A;  2ZM6 O;  4OX9 O;  1N33 O;  1FJG O;  2UUB O;  1XEQ A;  1HNX O;  5FLX N;  1I94 O;  4DR6 O;  5LL6 Y;  4JI5 O;  4JI7 O;  3T1Y O;  4LF4 O;  5BR8 O;  2E5L O;  4JI3 O;  4DR3 O;  5A2Q N;  4JI8 O;  4NXN O;  4JYA O;  1YZB A;  4X64 O;  3OTO O;  1IBL O;  4DR4 O;  4OPH A;  2FKX A;  1FYJ A;  3J81 N;  4LF6 O;  4X62 O;  5BXZ A;  1R1B A;  4B3S O;  1IBK O;  1IBM O;  1G1X B;  5BY1 A;  4AQY O;  2UXD O;  4DV4 O;  2LW7 A;  3SDL A;  4X66 O;  1AIL A;  1XMO O;  2JRI A;  4DUZ O;  1FKA O;  2VQE O;  1J5E O;  4LF7 O;  2N74 A;  3R66 A;  4KHP O;  4YY3 O;  1X59 A;  2Z0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...