3IJ4A

Cesium sites in the crystal structure of a functional acid sensing ion channel in the desensitized state
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
406
structure length
406
Chain Sequence
VWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pore architecture and ion sites in acid-sensing ion channels and P2X receptors.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein
molecule keywords Amiloride-sensitive cation channel 2, neuronal
total genus 97
structure length 406
sequence length 406
ec nomenclature
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3ij4A01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 3ij4A04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 3ij4A03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 3ij4A02
1WP8A 3IJ4A 3S3WA 4FZ0A 4NTYA 4NYKA 3S3XA 4FZ1A 1WP7A 2QTSA 2L35A 3N27A 4NTXA 4NTWA 2FB5A
chains in the Genus database with same CATH superfamily
5LMUO 2Q7GA 2ZE8A 1KUQA 2P06A 3VQYA 4BIUA 4E2LA 5GW7A 2XUMA 4PJ0Z 1VQ4V 3AG7A 3ZRXA 5B1AB 5KHJA 4QIWF 3VQXA 4G28B 1QR9A 3ASOB 3K08A 4TV8B 3RWRD 3W7XA 5LP6A 1VQMV 4FLUA 1QHTA 3RT3C 2YICA 2Y4TA 1RP3B 3UT5A 1WA8A 3ZMVA 5LGNA 1XI1A 4FVMA 2PGGA 1K9MW 3B8MA 3ABLC 4DUYB 1YITV 5D5QA 4HAMA 3E8HA 4TQDA 5H2FZ 4YY3B 1ZUQA 2UXDO 1Q8IA 2CUGA 2C2AA 1HWYA 2IJHA 3LUTB 1BE3H 4JI0B 3SDLA 4OGQB 4ZBMA 5A9GA 1IBMO 2UXCO 1QU7A 3FAVB 1NTKH 1YSCA 4JI5B 3ASOC 3OTFA 4JAAA 1J5EB 1K7DA 1YVWA 1VQ8V 3CC7V 1Q43A 2YI8A 3R66A 4X65O 1BQZA 4PA7A 3LDEA 3A0RA 1TA8A 1JJ2U 1AP5A 1GH6A 1ZSPA 1M9NA 4LR3A 1N33O 4ZOLB 5J2UA 2NN4A 4B3SO 4O2AA 3OTOB 1NTMH 1R6KA 1FPOA 2UXXA 1COWG 5JVDB 2YSUB 1KP2A 5JH7B 4FJCC 5CMUA 4I50B 1GRJA 4Z2WA 5JVDA 1SESA 1RSOA 1Z2GA 5DM6V 4YJ3B 3ABKB 1IXMA 3CWBH 2OCCB 3ABMC 5FNVA 4K3AA 4CZZA 2XASA 5IE9A 2YI9A 3CCUV 1WN7A 2XT9A 4DV5B 2QKSA 5KHKA 4QJFB 1PV0A 4FLTA 3N27A 3T1YO 1JVMA 3E22A 5KHGA 5KA6A 4FM0A 1OHHG 1VQLV 4B3SB 4JZGA 5LHIA 2X6CA 5K1XA 2B1GA 5CBFA 1S76D 2LFRA 4QE7A 3ZN0A 2ATKC 1VQ7V 1URFA 2QJ1A 4JYAB 4JI6B 4X65B 2A79B 1XMQO 1KP3A 2ZNJA 3BEHA 3K0DA 4DUZB 3T2MA 3Q4HB 2EZOA 1ROPA 2FYUH 3G4SV 4PV1B 3O9OA 4J80A 5HFLA 4LFAO 4U3JA 4O4JB 4GYCB 3RYIA 4UCUA 2WLKA 1Y74B 2A06H 4I9QA 3CJHB 3NXSA 4B3MO 2B1IA 3ML0A 3CS5A 4FIPC 3A8TA 1IX9A 4BW9A 4ZIBA 3IAYA 3ETQA 2Y0IA 3UT5B 5E1AC 4O4HA 1U97A 3H01A 1JFFB 3DTUB 3CRRA 2CTQA 2H3OA 4TV8A 2ZCEA 4GX2A 1NR1A 2W6JG 3CSXA 1OCRB 2P22C 2HEPA 5KAIZ 3RN4A 3J80N 2ETNA 4LF9O 4XDKA 1S77D 3LSQA 2LFSA 5IYZA 3FYEB 4JYYA 5J2TA 2EZPA 4LH6A 1B6QA 1ZAUA 2HHHB 2ZKOA 5H5NA 2DYRB 2K9PA 1Z5WA 2BTQA 1W59A 4JI4O 3CCVV 4EEQA 2ZIMA 1HNXO 4X1KA 3VBBA 2FL4A 3CCEV 1XNQO 3AG4B 5H9CA 5EYPB 1FD9A 2HVKC 5EYPA 2DQ3A 3RYCA 2LGWA 3BA9A 3TJTA 3OGCC 4RUFA 4AILC 3N2KA 3BABA 4LFAB 2WSSG 1LUVA 3U0ZA 4LF6B 3ZCCA 4LC1A 2JVDA 4B3TO 2DYRC 4DV2B 1TUBA 4AHCA 2XNDG 3NR7A 4KL1A 4X20A 5GONA 1O9GA 1R6NA 3SJQC 2DQ0A 4J7ZA 3H1HH 2EJ7A 3D3QA 3JAWB 4JI0O 3RFRA 1RM1B 2IU0A 2QA4V 4TUYB 4KHPO 3L72H 4PHZA 4MTGA 2ZXWC 1SERA 3OMAB 4YJ3A 3B4SA 4ABMA 2WLLB 1DGSA 2E3CA 2UXBB 4FM1A 3RYIB 4JYBA 5J9PC 5BY1A 5IT9N 4I55A 1AB3A 3ZN1A 4WFGA 1P49A 4DV2O 3AG1C 4YJ2A 2YC0A 2HJDA 1M1KW 3ZHSA 3IC7A 5BMVB 2CTWA 1ENVA 2VQFO 4DR1O 1ZX3A 2YIBA 2A3QA 4NB5A 3ZHQA 3I55V 3HR0A 5BR8B 3ZHRA 4UCVA 1I08A 3QO5A 4JI8B 2CE4A 2GBOA 3E89A 1KC8W 1THZA 3K0GA 4B3RB 3P32A 3Q4HA 3APOA 1EM1A 1NS1A 4HYOA 2ZDIA 1PNLA 4NTYA 4D7SA 2P67A 2A7WA 4UFZA 4B3TB 1GK9A 1YI2V 3IC9A 2FTKA 4I55B 2W0FC 1P84F 4JI1O 3VQVA 5DN6G 2IH3C 5L3DA 2QEXV 5CA1B 4I4TB 1SQBH 4TT3G 2WLIB 1UJWB 4FLVA 1VQPV 1IBKB 4DR1B 1OZ0A 2MW2B 4LF5B 5IJ9A 2JS3A 1Q6UA 4IGGA 1XOUA 4JAUA 4E4EA 2N04A 3BFRA 5IWAO 2UUBO 3FB6C 4O2BA 1F23A 5BXZA 4X1IA 3MAQA 4GLXA 2LQTA 4JI2O 1G8MA 1E79G 1SA0A 5IYZB 2ZNIA 4UCRA 4UUJC 3TK1A 2F23A 5ITZA 4K0KO 1R73A 3SPHA 4WFAV 1V54C 4A5UB 4OX9B 5H6QA 3KZIZ 2Y69B 5LXTB 2EX3A 3MDSA 1NU1H 3D8CA 1J5EO 4GKJO 2QKAA 3UQ8A 2CDYA 1YCIA 1AJNA 2ITCC 2BE3A 1JOYA 4IYIA 4YJ2B 1F4NA 4H37A 1D2DA 2QGNA 4DV5O 4FLZA 3HPLC 1GN3A 2UXCB 2Q0AA 2CK3G 4ZHQB 4LFBB 4LFBO 4J9YB 2ZDIC 2ARHA 2QTSA 3WB2A 2P6JA 2EIKB 4DR5B 3SPCA 4XDJA 1BS3A 2V1DA 4MVRA 3H1IH 1HP8A 4NXNO 1QBZA 5KAFZ 2W6IG 4QNHB 4PA6A 1QLEC 4NTWA 1HNWB 1NT2B 2JGDA 3SPIA 2R72A 3ZS8C 4EKWA 1VQNV 1FFTB 1FJGO 3UCSC 3SYAA 2DWEC 3STZC 5IY5B 4X1YA 2KKWA 4JTAB 5C93A 2YDEA 1FXKB 1ZL8B 3G6EV 1K34A 4LFCO 4DV6B 1QQCA 4XDLA 4DV6O 1S5JA 3ZRSA 1K92A 2ODMA 4LF4O 2AW9A 2IM9A 2Q4PA 3JD1A 4KUMA 3ZJZA 1TVKA 4CH3A 1V55B 1K33A 1KMIZ 2XAHA 3SYCA 4X62B 4W4LA 5F2VO 2F93B 3QNEA 2AXTZ 3ETGA 5LGTA 1V9PA 4FZ1A 2CH7A 4HNAA 1PKXA 2Q8VA 1I5YA 3ASNC 3FX7A 1RM1C 2F4VB 3LDCA 3CCLV 1H2MA 1NBMG 1ZLZA 3CEIA 4PELA 5JJNB 2ADPA 3RW0A 3T4ZA 4DYLA 5KA5A 1XREA 4LF5O 3JATB 3TGUH 1VQKV 2EULA 4DR2O 5HFMA 4MVZA 1UPGA 3LSUA 1SQVH 5CN0A 1JMKC 3RYFA 5B66Z 2WLMA 4B3MB 5C8YA 3G80A 2X0LA 4LFCB 2UUBB 2ZQMA 3KCYA 3M8AA 4PDVA 5GTHZ 4JI1B 4DV1B 1P7GA 3ZMSA 2QTOA 4DK1A 3BRCA 1OCZB 4Q20A 2E74B 2YXYA 4BR6A 4X64O 1LR1A 5LL6Y 3QO7A 4B7KA 1I94B 4DUZO 2QM8A 5GONB 3WFVA 3CCJV 1VQ6V 3QO8A 3QVNA 3E8FA 2GUZB 1OCCC 4JI4B 3K58A 3J7AU 3OAAG 1S5LZ 5IWAB 5ITZB 2V4DA 1AP6A 5JWPA 3X2QC 2F43G 2Y0PA 1W0JG 2EIJB 3CMAV 2IJIA 1BQ0A 1N33B 1GN6A 2JRIA 3ZHUA 4I0XA 3GB7C 1E1QG 4X20B 1H8HG 2OWOA 1P7BA 1Y76B 3RBZA 1MABG 4RQEA 2YIDA 5KMGB 3T1CA 4JI7O 3JASB 4TUYA 4DV0O 1NH2D 5E79Z 2Z0AA 1V55C 1XBLA 1Q3EA 1YJNV 3A0HZ 3WG7B 3AG3B 2GDSA 2XTAA 4UXNA 4J7JA 4K0KB 3EXAA 4DR2B 3K5OA 3S3WA 1TGOA 3H9VA 4TOIA 1M57C 2JGDB 1XL6A 2RCVA 3S3XA 2B9ZA 2UUAB 5LGUA 4R7CA 1VF6A 1AJQA 2GHYA 3CD6V 1NVPD 5IYBO 2QM4A 5B3SC 4OXSA 2OCHA 3E8GA 4RO2A 3U10A 1K4CC 4PDLA 2QSAA 2E5LB 5EC2C 3AK1A 1KU9A 3ABKC 2JIZG 3CYOA 2QWNB 1HR0O 2HJFC 5KHHA 1ZL8A 3AG1B 3B09A 3ZMTA 3IGAC 1Y67A 3CB2A 4RQFA 4G27B 4R8CA 3HB3B 5EC1C 3FFQA 5B1NA 4JI7B 2EILC 4PDRA 2OYQA 1XHXA 4MTOA 1JPXA 4LF9B 4Z1MG 3T1HB 4JAVA 4R6ZA 1N0JA 4O4HB 2JGUA 3C3SA 3DSQA 4H44B 1SA0B 2CGOA 1WAZA 2IW5A 1KECA 3APQA 2QDOA 1MZEA 3CRQA 1S5HC 4HNAB 5EBLC 4BIOA 1BL8A 3JD2A 2DW4A 4Q6GA 4N21A 3TCUA 1E1RG 1KD1W 4DV1O 4NTXA 3DGEA 1B04A 1SF9A 3UM7A 5KUKA 2Q0OC 5LYJA 1EN6A 2Q68A 1CPYA 2LJ2A 3AG4C 2DYSC 4LF7B 2DJVA 2VWKA 2EIJC 1AI4A 2CH7B 3QTCA 2Q7EA 4O4LA 3CMEV 3L70H 1KQSU 3HKDA 4GKJB 2AZ2A 2EJRA 3CCQV 1G1XB 4WFBV 1HNXB 4GUNA 3P3PA 1Y6XA 5IYDO 3JATA 5LYJB 1IBKO 2KSDA 2EINB 5KLVH 5IYCO 3CRAA 3G67A 3JAMN 3EHBB 3L75H 2UU9O 2VS0A 3CCSV 5FNVB 3E35A 2N05A 4MW8A 2Z3YA 2L35A 2UXBO 1IZ3A 1QLNA 1MG1A 4X1YB 4PA3A 2KG7A 3JASA 4I50A 4O2AB 4DV0B 2IU3A 2WAMA 2QE7G 1G6UA 3OR6C 3U11A 3ZRVA 4DR3O 1RPOA 4FPPA 4IL6Z 3K04A 1Q86W 4PA4A 2ZE6A 5LA6A 2DN9A 1H8EG 1SKVA 4RWUA 4P30A 1R3KC 1WJZA 2JEUA 3ICXA 5LMNB 3SYPA 4NXMB 2FKXA 5LOVA 5B1OA 4PD4F 2G38A 4WFHA 4YIOA 4DR5O 4FMTA 3C90A 4O4IB 1Q5OA 1X4TA 5L3EA 4I7ZB 2JJ1G 1I5XA 1A32A 1YJWV 4HBNA 3VOUA 3JSLA 4NXNB 3F7VC 1VQ9V 1VF5B 3K79A 3CXHF 3WG7C 1M5IA 2JDIG 1VQ5V 1FKAO 3VQWA 1PP9H 3A0BZ 3F7YC 3M7MX 1SC5B 4CH6A 3HKCB 5BR8O 5LP6B 1M56C 2LGQA 3D3IA 3ETDA 2ZR2A 5AG2A 1YEWA 1XMOB 2A0LA 3ETEA 3ZEDA 2LP7A 1M57B 1DK1A 4P2ZA 5CBGA 4PI0A 4DRXB 1QCEA 3G6BA 4TQFA 4GX5A 1BSMA 4LH7A 3UO3A 2PI5A 3CXCU 3RVYA 1R6TA 5C8YB 1HR0B 1WNSA 1S0VA 1TUEB 3JD3A 4TV9B 1GM9A 2LW1A 3BVOA 2EIKC 4UVAA 3SJCC 4DV3B 2PTMA 4DV3O 1DF5A 1HNZB 2Y69C 1SZTA 2GTAA 3JYCA 4UCOA 1P4RA 5JCOA 2HVJC 3W7TA 3W7SA 4BIZA 2QM7A 3D36C 1I7FA 4J7KA 1RSOB 2UUCO 2EIMB 3ABLB 1K4DC 2H8PC 1Q6IA 1BHBA 4GT1A 4DR7O 4Z1VA 2WA4A 1S3JA 3OMIB 1GAXA 1VQOV 4O4LB 1GN2A 1PL0A 2ZD9A 3RYCB 2KB1A 2WLHA 1VP7A 1YDXA 1L1FA 1L0NH 1WB8A 1IBLB 1IBLO 2ITDC 2DMXA 1S72V 5TISZ 4DV7O 4F4LA 4MVOA 3OFNG 1H38A 3QF7A 1HW7A 2CGNA 4GX0A 3SR2C 4NYKA 1EN4A 3EVKA 1K8AW 2P5OA 1F51A 1KKCA 4L87A 3FAVA 2RMKB 3DC6A 4DV4B 3T4DA 4LCUC 1M4UA 2F4VO 3JALA 5EIBC 1CXZB 3ZHVA 3FYIB 5JQGA 2D2CB 3JD4A 3BPZA 2Q7HA 3FD9A 3AK2A 2VRZA 1FFXA 1GN4A 2X6AA 3C3TA 5JJJB 1AILA 1J95A 2UUAO 3CRCA 3WB0A 3OR7C 3OM3B 1IDSA 1QLEB 2RDCA 5LOVB 4YHHB 5LP6C 3K5LA 5LXTA 4FFBA 4I5SA 2OTJV 3KG2A 1AI5A 2Q69A 1GO3F 4W4KA 1FXVA 4G2KA 4O4IA 1QNMA 3ZX6A 3ZRWB 4CH5A 4MTFA 3QG5A 4IYHA 2GTSA 4RUEA 4DR7B 3E22B 2VQEB 2YEVA 4JGSA 2IBZH 5EIBD 4NVPA 1JCHA 5LBQA 3CC4V 4DXWA 4CBCA 3KKYA 3GVMA 1RPRA 2WLNA 3KCXA 1YTFB 4DRXA 2Y4UA 4KP4A 2ILMA 4F6RB 3R65A 1GM8A 5A2QN 2MK3A 2DWDC 2E75B 4MSWC 4F6EA 4U3FH 3JAWA 4CS2A 2OCCC 2Q9LA 1RFYA 1N36B 2N74A 4YIPA 3CHXA 2E76B 3L74H 3AG3C 2BOCC 3HKCA 4LF8B 3CCMV 3PJSK 1XNQB 4KXRA 2Z5UA 1V54B 1N4CA 1F7YA 1MNGA 3FB7C 3TETA 1Q7YW 3X2QB 5B1BC 4DR4B 1MMMA 5CA1A 2K1EA 1N32B 2Q6AA 3F5TA 1SQGA 4LWSB 4JI3B 4MVUA 3MHHC 4ICGA 1XMOO 5LHGA 4X8AA 5JCOC 4MT8A 4XBFA 3HKBB 4IIJA 3SPGA 1JA8A 1EFRG 2R9RB 5CA0B 4IIJB 4MVMA 3ZMZA 2RN9A 4WF9V 2JEXA 4BWAA 5IDJA 4X1IB 2UU9B 4FFKA 4TWKA 4DV7B 4BW5A 4K8ZA 2PYJA 2PUSA 3LNNA 4WCEV 5JQGB 4B08A 5K1PA 1I94O 4QE9A 2BSKB 4UVCA 1D5AA 1OCRC 4LBEC 3HKBA 3B8NA 3K5NA 4DW1A 2WWWA 5EBWC 1DF4A 2B5UA 4IHJA 4EFBA 5CA0A 1Q82W 3OEHG 4X1KB 4U7NA 1XILA 4JTCB 4ASUG 4DR4O 2XHBA 5IJ0A 4JV5B 5KHIA 4J42A 5B1AC 3JARB 1US6A 3ASNB 5LMNO 4ZI7B 4JI3O 3N2KB 1O9HA 2JJ2G 2X7RB 3AG2B 4CH4A 2IH1C 4FK5C 4YHHO 1AJPA 4P9PA 2EILB 3ZRWA 1CP9A 2PYLA 1QR8A 1MSWD 4FZ0A 2HR3A 1WPBA 3SYQA 1KKDA 4DR3B 1FXKA 2RQ6A 4K35A 1K73W 1PNMA 1XDCA 5FPOA 4UVBA 3RGBA 5EZYB 4TV9A 5L3GA 4GKKO 1NR7A 4QPJA 4NXMO 3I56V 4H33A 5IY5C 4DR6O 1FXHA 4GX1A 5LMUB 1FS0G 3H1LH 4JF3A 1T5EA 1VARA 1NTZH 1H2GA 4QPKA 3K03A 3G71V 4FFBB 1NI8A 1XQ8A 4K8XA 2YXLA 4D7TA 1VMGA 3PN1A 2R9IA 1PL4A 3IFXA 3N2GA 3M99B 4H13B 4TSFG 1XEQA 2YS8A 3AK3A 1OCZC 5L3FA 2R9AA 4UV9A 5L3CA 1K3EA 4YY3O 2XOKG 2XAFA 1PD3A 1SETA 1B3QA 1GMGA 3RVZA 1QVGU 3L9DA 3I5DA 3RYHB 3GWKC 3CJHA 4FLXA 3WB1A 3RYFB 4X88A 1OCOC 3ZHTA 3DXRB 2DOSA 2EIMC 4JI5O 1U96A 1WPXA 3OW2U 2V7QG 2BTOA 1EBOA 3UO2A 2E5LO 4LF7O 2ZE5A 3O65A 3CX5F 3CC2V 4X62O 5KX5B 3BA8A 1GM7A 1MA1A 2ZE7A 1DLBA 1PNKA 5IJ9B 3IJ4A 2P90A 4AQYB 1IURA 2P7TC 4J10A 1JQ0A 1Q81W 1XUQA 2L6LA 3T1HO 3E8BA 1W2BU 4MW3A 5D5PA 2D3OW 1FYJA 2F95B 1IBMB 4NKGB 3AEIA 3OT7A 2KG7B 1EZVH 2XAGA 1AVMA 2PY5A 3JARA 3MHSC 1I0HA 2QWRB 5JH7A 4X66B 3K3WA 1LUWA 3TXSA 1UFIA 1DTOA 3T1YB 1YHQV 1AROP 1VF6C 4J11A 1H2NA 2KQXA 3H1KH 1XNRO 1G4YB 1SZXA 1XNRB 1AR5A 1YIJV 1PPJH 1FFXB 4CS4A 2ZIOA 3DC5A 2NNUA 4UB6Z 4JYAO 2FB5A 1FXKC 3ABUA 4CC6A 4X89A 4GZRB 1BGYH 1TVKB 3JALB 2QWPB 1SQQH 4N23A 2IJKA 4DW0A 1JFFA 1ORQC 5BMVA 2M7WA 3UKMA 1WP8A 4PA9A 2XAQA 1MZFA 4O2BB 2O57A 1AI7A 3JAKA 5GTIZ 2HP8A 4AI8A 4JTDB 1BCCH 5DECA 1EN5A 1MOFA 4NR1A 4PDMA 2PI4A 1FAFA 1AI6A 2YUAA 4JASA 1SS3A 4MVSA 2F1MA 1QVFU 3AG2C 4DK0A 1JJOA 3CRMA 2A9HA 1BMFG 2OIEA 4PI2A 2OT5A 4DR6B 1AR4A 4WFFA 2VWJA 5FL7G 1HDJA 1WA8B 5LHHA 4UCSA 2RNBA 3SYOA 3JAKB 1OJHA 2QWQB 3K57A 4D6TH 4O4JA 2EINC 4X66O 4LF8O 4YXWG 3BCCH 3N2GB 4OPHA 4MTXA 1YXBA 2QKCA 1VEWA 3FB5C 3LDDA 4C7UA 2HHHO 4FLWA 4LF4B 4EB6A 2AZ0A 3L73H 3OTOO 3A2FA 2LW7A 2FMLA 2YIAA 1TAEA 1N8RW 3GWOA 2P4KA 5EK0A 5IJ0B 1OV9A 2AGAA 4OPAA 1TUBB 2BTQB 1Z5VA 5H6RA 4UCTA 2VQEO 1OCOB 3EFFK 4LF6O 5DEDA 3F5WC 3K59A 1NQTA 1H2LA 4UB8Z 4IHJB 2OIGA 4UV8A 1L8DA 4JYCA 4KFMA 2RJZA 4CS3A 2IJJA 4DV4O 1SRYA 4U7OA 1NVPB 2GUZA 2YIBD 5CA3A 1ZWIC 1M56B 1H2KA 2WLJA 2DE0X 4B7EA 3E2EA 3E83A 4ZI7A 2ZM6O 4IT5A 3THOA 4JI6O 3SJBC 2W0XA 1XMQB 1SQXH 4I0XB 1YTFD 3B77A 4FLYA 2NR5A 4GKKB 4LNUB 4X9QA 1NH2B 2EBOA 4LNUA 2P4VA 3J81N 2UXNA 4JPRA 3OE7G 4JZ2A 5JJEB 3HKEB 1GTOA 4JI8O 1K5QA 2PZSA 1N36O 1EZJA 3STLC 3FB8C 5EZYA 4L8JA 3OUFA 2Y48A 3SJAC 2WLLA 1Y74A 3E86A 5BZBA 1IXBA 3K9SA 1KB9F 3ABTA 4R50A 2BCCH 5B3SB 1VIBA 1AR1B 3W7UA 1SQPH 5EBMC 1CEZA 3LNMB 1LNQA 3MD0A 3CPWU 1Q6HA 4RAIA 3SPJA 1M90W 2CTRA 1KBHA 2HLDG 1N32O 2ZXWB 1PM9A 3FKSG 3BHPA 1R3LC 2AHYA 3SGIA 2JK5C 2R70A 1N0NA 2M6YA 1OCCB 4J41A 3B40A 4EB6B 1YZBA 3JD0A 3DXRA 4MS2A 4MVQA 1Y66A 4I4TA 2XAJA 3JSNA 5FLXN 2OTLV 4GCZA 3OMNB 1Y76A 2GSMB 2GV9A 3JCZA 2AHZA 2BSKA 3BY6A 1XHZA 3L71H 1R1BA 5J2TB 1NKDA 1GKFA 2HKOA 3LSSA 4J9ZB 2WA3A 3BAAA 3ZMUA 1WB7A 2LO1A 4JI2B 3OGIB 4FM2A 4AQYO 4WBNB 5KUMA 2VQFB 1NJIW 3D36A 3W7WA 1IVSA 3B2EE 1M93A 2F66C 1HNWO 4DO2A 5FPRA 1WLEA 5L3BA 3CCRV 1K97A 3OUSA 1B06A 3K06A 4ZOLA 5J2UB 2NLJC 1XL4A 4WFEA 2ZINA 5KMGA 4LWSA 1JR9A 1R3IC 3HKDB 1ZTEA 1JX9A 3P3NA 1KYOF 5KX5A 1Y4MA 2ADQB 2CTPA 5B1BB 4EFEA 2HG5C 3RYHA 2DYSB 2Q5ZA 2Q73A 1YF2A 3ZBHA 2QR4A 4BAYA 2YXHA 4KHPB 5LA6B 1R3JC 2ZT9B 4LP8A 1SQFA 2CAZC 1BHAA 1N34B 4HZ3A 1N34O 1K5SA 1NZ6A 1Q90D 4P9OA 3ZIAG 2X6BA 1BZKA 2QWOB 2ZM6B 2PF4E 4DUYO 2UUCB 4OX9O 4WBNA 4JV5O 3JCUZ 4ZHQA 2H94A 5CBHA 2WPDG 3CE2A 4ZKIA 4B3RO 2BOBC 2JS5A 5B5EZ 1MSDA 4QGPA 1L0LH 3OEEG 1FJGB 3OD4A 2YEVB 3WU2Z 4CC5A 5CB4B 4U3JB 4I9WA 3ABMB 3H1JH 1HNZO 1VF7A 1H2SB 1BT8A 4F6RA 2UXDB 3TXQA 1F4MA 1X59A 1YJ9V 4H0LB 4X64B 2Q67A 3HKEA 3K9AA 1WP7A 3CP1A 2ZR3A 3P30A 1W0KG 2WLIA 1D5NA 2HFEC 5CB4A 3K5MA
chains in the Genus database with same CATH topology
1WP8A 3IJ4A 3S3WA 4FZ0A 4NTYA 4NYKA 3S3XA 4FZ1A 1WP7A 2QTSA 2L35A 3N27A 4NTXA 4NTWA 2FB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WP8 A;  3IJ4 A;  3S3W A;  4FZ0 A;  4NTY A;  4NYK A;  3S3X A;  4FZ1 A;  1WP7 A;  2QTS A;  2L35 A;  3N27 A;  4NTX A;  4NTW A;  2FB5 A; 
#chains in the Genus database with same CATH topology
 5LMU O;  2Q7G A;  2ZE8 A;  1KUQ A;  2P06 A;  3VQY A;  4BIU A;  4E2L A;  5GW7 A;  2XUM A;  4PJ0 Z;  1VQ4 V;  3AG7 A;  3ZRX A;  5B1A B;  5KHJ A;  4QIW F;  3VQX A;  4G28 B;  1QR9 A;  3ASO B;  3K08 A;  4TV8 B;  3RWR D;  3W7X A;  5LP6 A;  1VQM V;  4FLU A;  1QHT A;  3RT3 C;  2YIC A;  2Y4T A;  1RP3 B;  3UT5 A;  1WA8 A;  3ZMV A;  5LGN A;  1XI1 A;  4FVM A;  2PGG A;  1K9M W;  3B8M A;  3ABL C;  4DUY B;  1YIT V;  5D5Q A;  4HAM A;  3E8H A;  4TQD A;  5H2F Z;  4YY3 B;  1ZUQ A;  2UXD O;  1Q8I A;  2CUG A;  2C2A A;  1HWY A;  2IJH A;  3LUT B;  1BE3 H;  4JI0 B;  3SDL A;  4OGQ B;  4ZBM A;  5A9G A;  1IBM O;  2UXC O;  1QU7 A;  3FAV B;  1NTK H;  1YSC A;  4JI5 B;  3ASO C;  3OTF A;  4JAA A;  1J5E B;  1K7D A;  1YVW A;  1VQ8 V;  3CC7 V;  1Q43 A;  2YI8 A;  3R66 A;  4X65 O;  1BQZ A;  4PA7 A;  3LDE A;  3A0R A;  1TA8 A;  1JJ2 U;  1AP5 A;  1GH6 A;  1ZSP A;  1M9N A;  4LR3 A;  1N33 O;  4ZOL B;  5J2U A;  2NN4 A;  4B3S O;  4O2A A;  3OTO B;  1NTM H;  1R6K A;  1FPO A;  2UXX A;  1COW G;  5JVD B;  2YSU B;  1KP2 A;  5JH7 B;  4FJC C;  5CMU A;  4I50 B;  1GRJ A;  4Z2W A;  5JVD A;  1SES A;  1RSO A;  1Z2G A;  5DM6 V;  4YJ3 B;  3ABK B;  1IXM A;  3CWB H;  2OCC B;  3ABM C;  5FNV A;  4K3A A;  4CZZ A;  2XAS A;  5IE9 A;  2YI9 A;  3CCU V;  1WN7 A;  2XT9 A;  4DV5 B;  2QKS A;  5KHK A;  4QJF B;  1PV0 A;  4FLT A;  3N27 A;  3T1Y O;  1JVM A;  3E22 A;  5KHG A;  5KA6 A;  4FM0 A;  1OHH G;  1VQL V;  4B3S B;  4JZG A;  5LHI A;  2X6C A;  5K1X A;  2B1G A;  5CBF A;  1S76 D;  2LFR A;  4QE7 A;  3ZN0 A;  2ATK C;  1VQ7 V;  1URF A;  2QJ1 A;  4JYA B;  4JI6 B;  4X65 B;  2A79 B;  1XMQ O;  1KP3 A;  2ZNJ A;  3BEH A;  3K0D A;  4DUZ B;  3T2M A;  3Q4H B;  2EZO A;  1ROP A;  2FYU H;  3G4S V;  4PV1 B;  3O9O A;  4J80 A;  5HFL A;  4LFA O;  4U3J A;  4O4J B;  4GYC B;  3RYI A;  4UCU A;  2WLK A;  1Y74 B;  2A06 H;  4I9Q A;  3CJH B;  3NXS A;  4B3M O;  2B1I A;  3ML0 A;  3CS5 A;  4FIP C;  3A8T A;  1IX9 A;  4BW9 A;  4ZIB A;  3IAY A;  3ETQ A;  2Y0I A;  3UT5 B;  5E1A C;  4O4H A;  1U97 A;  3H01 A;  1JFF B;  3DTU B;  3CRR A;  2CTQ A;  2H3O A;  4TV8 A;  2ZCE A;  4GX2 A;  1NR1 A;  2W6J G;  3CSX A;  1OCR B;  2P22 C;  2HEP A;  5KAI Z;  3RN4 A;  3J80 N;  2ETN A;  4LF9 O;  4XDK A;  1S77 D;  3LSQ A;  2LFS A;  5IYZ A;  3FYE B;  4JYY A;  5J2T A;  2EZP A;  4LH6 A;  1B6Q A;  1ZAU A;  2HHH B;  2ZKO A;  5H5N A;  2DYR B;  2K9P A;  1Z5W A;  2BTQ A;  1W59 A;  4JI4 O;  3CCV V;  4EEQ A;  2ZIM A;  1HNX O;  4X1K A;  3VBB A;  2FL4 A;  3CCE V;  1XNQ O;  3AG4 B;  5H9C A;  5EYP B;  1FD9 A;  2HVK C;  5EYP A;  2DQ3 A;  3RYC A;  2LGW A;  3BA9 A;  3TJT A;  3OGC C;  4RUF A;  4AIL C;  3N2K A;  3BAB A;  4LFA B;  2WSS G;  1LUV A;  3U0Z A;  4LF6 B;  3ZCC A;  4LC1 A;  2JVD A;  4B3T O;  2DYR C;  4DV2 B;  1TUB A;  4AHC A;  2XND G;  3NR7 A;  4KL1 A;  4X20 A;  5GON A;  1O9G A;  1R6N A;  3SJQ C;  2DQ0 A;  4J7Z A;  3H1H H;  2EJ7 A;  3D3Q A;  3JAW B;  4JI0 O;  3RFR A;  1RM1 B;  2IU0 A;  2QA4 V;  4TUY B;  4KHP O;  3L72 H;  4PHZ A;  4MTG A;  2ZXW C;  1SER A;  3OMA B;  4YJ3 A;  3B4S A;  4ABM A;  2WLL B;  1DGS A;  2E3C A;  2UXB B;  4FM1 A;  3RYI B;  4JYB A;  5J9P C;  5BY1 A;  5IT9 N;  4I55 A;  1AB3 A;  3ZN1 A;  4WFG A;  1P49 A;  4DV2 O;  3AG1 C;  4YJ2 A;  2YC0 A;  2HJD A;  1M1K W;  3ZHS A;  3IC7 A;  5BMV B;  2CTW A;  1ENV A;  2VQF O;  4DR1 O;  1ZX3 A;  2YIB A;  2A3Q A;  4NB5 A;  3ZHQ A;  3I55 V;  3HR0 A;  5BR8 B;  3ZHR A;  4UCV A;  1I08 A;  3QO5 A;  4JI8 B;  2CE4 A;  2GBO A;  3E89 A;  1KC8 W;  1THZ A;  3K0G A;  4B3R B;  3P32 A;  3Q4H A;  3APO A;  1EM1 A;  1NS1 A;  4HYO A;  2ZDI A;  1PNL A;  4NTY A;  4D7S A;  2P67 A;  2A7W A;  4UFZ A;  4B3T B;  1GK9 A;  1YI2 V;  3IC9 A;  2FTK A;  4I55 B;  2W0F C;  1P84 F;  4JI1 O;  3VQV A;  5DN6 G;  2IH3 C;  5L3D A;  2QEX V;  5CA1 B;  4I4T B;  1SQB H;  4TT3 G;  2WLI B;  1UJW B;  4FLV A;  1VQP V;  1IBK B;  4DR1 B;  1OZ0 A;  2MW2 B;  4LF5 B;  5IJ9 A;  2JS3 A;  1Q6U A;  4IGG A;  1XOU A;  4JAU A;  4E4E A;  2N04 A;  3BFR A;  5IWA O;  2UUB O;  3FB6 C;  4O2B A;  1F23 A;  5BXZ A;  4X1I A;  3MAQ A;  4GLX A;  2LQT A;  4JI2 O;  1G8M A;  1E79 G;  1SA0 A;  5IYZ B;  2ZNI A;  4UCR A;  4UUJ C;  3TK1 A;  2F23 A;  5ITZ A;  4K0K O;  1R73 A;  3SPH A;  4WFA V;  1V54 C;  4A5U B;  4OX9 B;  5H6Q A;  3KZI Z;  2Y69 B;  5LXT B;  2EX3 A;  3MDS A;  1NU1 H;  3D8C A;  1J5E O;  4GKJ O;  2QKA A;  3UQ8 A;  2CDY A;  1YCI A;  1AJN A;  2ITC C;  2BE3 A;  1JOY A;  4IYI A;  4YJ2 B;  1F4N A;  4H37 A;  1D2D A;  2QGN A;  4DV5 O;  4FLZ A;  3HPL C;  1GN3 A;  2UXC B;  2Q0A A;  2CK3 G;  4ZHQ B;  4LFB B;  4LFB O;  4J9Y B;  2ZDI C;  2ARH A;  2QTS A;  3WB2 A;  2P6J A;  2EIK B;  4DR5 B;  3SPC A;  4XDJ A;  1BS3 A;  2V1D A;  4MVR A;  3H1I H;  1HP8 A;  4NXN O;  1QBZ A;  5KAF Z;  2W6I G;  4QNH B;  4PA6 A;  1QLE C;  4NTW A;  1HNW B;  1NT2 B;  2JGD A;  3SPI A;  2R72 A;  3ZS8 C;  4EKW A;  1VQN V;  1FFT B;  1FJG O;  3UCS C;  3SYA A;  2DWE C;  3STZ C;  5IY5 B;  4X1Y A;  2KKW A;  4JTA B;  5C93 A;  2YDE A;  1FXK B;  1ZL8 B;  3G6E V;  1K34 A;  4LFC O;  4DV6 B;  1QQC A;  4XDL A;  4DV6 O;  1S5J A;  3ZRS A;  1K92 A;  2ODM A;  4LF4 O;  2AW9 A;  2IM9 A;  2Q4P A;  3JD1 A;  4KUM A;  3ZJZ A;  1TVK A;  4CH3 A;  1V55 B;  1K33 A;  1KMI Z;  2XAH A;  3SYC A;  4X62 B;  4W4L A;  5F2V O;  2F93 B;  3QNE A;  2AXT Z;  3ETG A;  5LGT A;  1V9P A;  4FZ1 A;  2CH7 A;  4HNA A;  1PKX A;  2Q8V A;  1I5Y A;  3ASN C;  3FX7 A;  1RM1 C;  2F4V B;  3LDC A;  3CCL V;  1H2M A;  1NBM G;  1ZLZ A;  3CEI A;  4PEL A;  5JJN B;  2ADP A;  3RW0 A;  3T4Z A;  4DYL A;  5KA5 A;  1XRE A;  4LF5 O;  3JAT B;  3TGU H;  1VQK V;  2EUL A;  4DR2 O;  5HFM A;  4MVZ A;  1UPG A;  3LSU A;  1SQV H;  5CN0 A;  1JMK C;  3RYF A;  5B66 Z;  2WLM A;  4B3M B;  5C8Y A;  3G80 A;  2X0L A;  4LFC B;  2UUB B;  2ZQM A;  3KCY A;  3M8A A;  4PDV A;  5GTH Z;  4JI1 B;  4DV1 B;  1P7G A;  3ZMS A;  2QTO A;  4DK1 A;  3BRC A;  1OCZ B;  4Q20 A;  2E74 B;  2YXY A;  4BR6 A;  4X64 O;  1LR1 A;  5LL6 Y;  3QO7 A;  4B7K A;  1I94 B;  4DUZ O;  2QM8 A;  5GON B;  3WFV A;  3CCJ V;  1VQ6 V;  3QO8 A;  3QVN A;  3E8F A;  2GUZ B;  1OCC C;  4JI4 B;  3K58 A;  3J7A U;  3OAA G;  1S5L Z;  5IWA B;  5ITZ B;  2V4D A;  1AP6 A;  5JWP A;  3X2Q C;  2F43 G;  2Y0P A;  1W0J G;  2EIJ B;  3CMA V;  2IJI A;  1BQ0 A;  1N33 B;  1GN6 A;  2JRI A;  3ZHU A;  4I0X A;  3GB7 C;  1E1Q G;  4X20 B;  1H8H G;  2OWO A;  1P7B A;  1Y76 B;  3RBZ A;  1MAB G;  4RQE A;  2YID A;  5KMG B;  3T1C A;  4JI7 O;  3JAS B;  4TUY A;  4DV0 O;  1NH2 D;  5E79 Z;  2Z0A A;  1V55 C;  1XBL A;  1Q3E A;  1YJN V;  3A0H Z;  3WG7 B;  3AG3 B;  2GDS A;  2XTA A;  4UXN A;  4J7J A;  4K0K B;  3EXA A;  4DR2 B;  3K5O A;  3S3W A;  1TGO A;  3H9V A;  4TOI A;  1M57 C;  2JGD B;  1XL6 A;  2RCV A;  3S3X A;  2B9Z A;  2UUA B;  5LGU A;  4R7C A;  1VF6 A;  1AJQ A;  2GHY A;  3CD6 V;  1NVP D;  5IYB O;  2QM4 A;  5B3S C;  4OXS A;  2OCH A;  3E8G A;  4RO2 A;  3U10 A;  1K4C C;  4PDL A;  2QSA A;  2E5L B;  5EC2 C;  3AK1 A;  1KU9 A;  3ABK C;  2JIZ G;  3CYO A;  2QWN B;  1HR0 O;  2HJF C;  5KHH A;  1ZL8 A;  3AG1 B;  3B09 A;  3ZMT A;  3IGA C;  1Y67 A;  3CB2 A;  4RQF A;  4G27 B;  4R8C A;  3HB3 B;  5EC1 C;  3FFQ A;  5B1N A;  4JI7 B;  2EIL C;  4PDR A;  2OYQ A;  1XHX A;  4MTO A;  1JPX A;  4LF9 B;  4Z1M G;  3T1H B;  4JAV A;  4R6Z A;  1N0J A;  4O4H B;  2JGU A;  3C3S A;  3DSQ A;  4H44 B;  1SA0 B;  2CGO A;  1WAZ A;  2IW5 A;  1KEC A;  3APQ A;  2QDO A;  1MZE A;  3CRQ A;  1S5H C;  4HNA B;  5EBL C;  4BIO A;  1BL8 A;  3JD2 A;  2DW4 A;  4Q6G A;  4N21 A;  3TCU A;  1E1R G;  1KD1 W;  4DV1 O;  4NTX A;  3DGE A;  1B04 A;  1SF9 A;  3UM7 A;  5KUK A;  2Q0O C;  5LYJ A;  1EN6 A;  2Q68 A;  1CPY A;  2LJ2 A;  3AG4 C;  2DYS C;  4LF7 B;  2DJV A;  2VWK A;  2EIJ C;  1AI4 A;  2CH7 B;  3QTC A;  2Q7E A;  4O4L A;  3CME V;  3L70 H;  1KQS U;  3HKD A;  4GKJ B;  2AZ2 A;  2EJR A;  3CCQ V;  1G1X B;  4WFB V;  1HNX B;  4GUN A;  3P3P A;  1Y6X A;  5IYD O;  3JAT A;  5LYJ B;  1IBK O;  2KSD A;  2EIN B;  5KLV H;  5IYC O;  3CRA A;  3G67 A;  3JAM N;  3EHB B;  3L75 H;  2UU9 O;  2VS0 A;  3CCS V;  5FNV B;  3E35 A;  2N05 A;  4MW8 A;  2Z3Y A;  2L35 A;  2UXB O;  1IZ3 A;  1QLN A;  1MG1 A;  4X1Y B;  4PA3 A;  2KG7 A;  3JAS A;  4I50 A;  4O2A B;  4DV0 B;  2IU3 A;  2WAM A;  2QE7 G;  1G6U A;  3OR6 C;  3U11 A;  3ZRV A;  4DR3 O;  1RPO A;  4FPP A;  4IL6 Z;  3K04 A;  1Q86 W;  4PA4 A;  2ZE6 A;  5LA6 A;  2DN9 A;  1H8E G;  1SKV A;  4RWU A;  4P30 A;  1R3K C;  1WJZ A;  2JEU A;  3ICX A;  5LMN B;  3SYP A;  4NXM B;  2FKX A;  5LOV A;  5B1O A;  4PD4 F;  2G38 A;  4WFH A;  4YIO A;  4DR5 O;  4FMT A;  3C90 A;  4O4I B;  1Q5O A;  1X4T A;  5L3E A;  4I7Z B;  2JJ1 G;  1I5X A;  1A32 A;  1YJW V;  4HBN A;  3VOU A;  3JSL A;  4NXN B;  3F7V C;  1VQ9 V;  1VF5 B;  3K79 A;  3CXH F;  3WG7 C;  1M5I A;  2JDI G;  1VQ5 V;  1FKA O;  3VQW A;  1PP9 H;  3A0B Z;  3F7Y C;  3M7M X;  1SC5 B;  4CH6 A;  3HKC B;  5BR8 O;  5LP6 B;  1M56 C;  2LGQ A;  3D3I A;  3ETD A;  2ZR2 A;  5AG2 A;  1YEW A;  1XMO B;  2A0L A;  3ETE A;  3ZED A;  2LP7 A;  1M57 B;  1DK1 A;  4P2Z A;  5CBG A;  4PI0 A;  4DRX B;  1QCE A;  3G6B A;  4TQF A;  4GX5 A;  1BSM A;  4LH7 A;  3UO3 A;  2PI5 A;  3CXC U;  3RVY A;  1R6T A;  5C8Y B;  1HR0 B;  1WNS A;  1S0V A;  1TUE B;  3JD3 A;  4TV9 B;  1GM9 A;  2LW1 A;  3BVO A;  2EIK C;  4UVA A;  3SJC C;  4DV3 B;  2PTM A;  4DV3 O;  1DF5 A;  1HNZ B;  2Y69 C;  1SZT A;  2GTA A;  3JYC A;  4UCO A;  1P4R A;  5JCO A;  2HVJ C;  3W7T A;  3W7S A;  4BIZ A;  2QM7 A;  3D36 C;  1I7F A;  4J7K A;  1RSO B;  2UUC O;  2EIM B;  3ABL B;  1K4D C;  2H8P C;  1Q6I A;  1BHB A;  4GT1 A;  4DR7 O;  4Z1V A;  2WA4 A;  1S3J A;  3OMI B;  1GAX A;  1VQO V;  4O4L B;  1GN2 A;  1PL0 A;  2ZD9 A;  3RYC B;  2KB1 A;  2WLH A;  1VP7 A;  1YDX A;  1L1F A;  1L0N H;  1WB8 A;  1IBL B;  1IBL O;  2ITD C;  2DMX A;  1S72 V;  5TIS Z;  4DV7 O;  4F4L A;  4MVO A;  3OFN G;  1H38 A;  3QF7 A;  1HW7 A;  2CGN A;  4GX0 A;  3SR2 C;  4NYK A;  1EN4 A;  3EVK A;  1K8A W;  2P5O A;  1F51 A;  1KKC A;  4L87 A;  3FAV A;  2RMK B;  3DC6 A;  4DV4 B;  3T4D A;  4LCU C;  1M4U A;  2F4V O;  3JAL A;  5EIB C;  1CXZ B;  3ZHV A;  3FYI B;  5JQG A;  2D2C B;  3JD4 A;  3BPZ A;  2Q7H A;  3FD9 A;  3AK2 A;  2VRZ A;  1FFX A;  1GN4 A;  2X6A A;  3C3T A;  5JJJ B;  1AIL A;  1J95 A;  2UUA O;  3CRC A;  3WB0 A;  3OR7 C;  3OM3 B;  1IDS A;  1QLE B;  2RDC A;  5LOV B;  4YHH B;  5LP6 C;  3K5L A;  5LXT A;  4FFB A;  4I5S A;  2OTJ V;  3KG2 A;  1AI5 A;  2Q69 A;  1GO3 F;  4W4K A;  1FXV A;  4G2K A;  4O4I A;  1QNM A;  3ZX6 A;  3ZRW B;  4CH5 A;  4MTF A;  3QG5 A;  4IYH A;  2GTS A;  4RUE A;  4DR7 B;  3E22 B;  2VQE B;  2YEV A;  4JGS A;  2IBZ H;  5EIB D;  4NVP A;  1JCH A;  5LBQ A;  3CC4 V;  4DXW A;  4CBC A;  3KKY A;  3GVM A;  1RPR A;  2WLN A;  3KCX A;  1YTF B;  4DRX A;  2Y4U A;  4KP4 A;  2ILM A;  4F6R B;  3R65 A;  1GM8 A;  5A2Q N;  2MK3 A;  2DWD C;  2E75 B;  4MSW C;  4F6E A;  4U3F H;  3JAW A;  4CS2 A;  2OCC C;  2Q9L A;  1RFY A;  1N36 B;  2N74 A;  4YIP A;  3CHX A;  2E76 B;  3L74 H;  3AG3 C;  2BOC C;  3HKC A;  4LF8 B;  3CCM V;  3PJS K;  1XNQ B;  4KXR A;  2Z5U A;  1V54 B;  1N4C A;  1F7Y A;  1MNG A;  3FB7 C;  3TET A;  1Q7Y W;  3X2Q B;  5B1B C;  4DR4 B;  1MMM A;  5CA1 A;  2K1E A;  1N32 B;  2Q6A A;  3F5T A;  1SQG A;  4LWS B;  4JI3 B;  4MVU A;  3MHH C;  4ICG A;  1XMO O;  5LHG A;  4X8A A;  5JCO C;  4MT8 A;  4XBF A;  3HKB B;  4IIJ A;  3SPG A;  1JA8 A;  1EFR G;  2R9R B;  5CA0 B;  4IIJ B;  4MVM A;  3ZMZ A;  2RN9 A;  4WF9 V;  2JEX A;  4BWA A;  5IDJ A;  4X1I B;  2UU9 B;  4FFK A;  4TWK A;  4DV7 B;  4BW5 A;  4K8Z A;  2PYJ A;  2PUS A;  3LNN A;  4WCE V;  5JQG B;  4B08 A;  5K1P A;  1I94 O;  4QE9 A;  2BSK B;  4UVC A;  1D5A A;  1OCR C;  4LBE C;  3HKB A;  3B8N A;  3K5N A;  4DW1 A;  2WWW A;  5EBW C;  1DF4 A;  2B5U A;  4IHJ A;  4EFB A;  5CA0 A;  1Q82 W;  3OEH G;  4X1K B;  4U7N A;  1XIL A;  4JTC B;  4ASU G;  4DR4 O;  2XHB A;  5IJ0 A;  4JV5 B;  5KHI A;  4J42 A;  5B1A C;  3JAR B;  1US6 A;  3ASN B;  5LMN O;  4ZI7 B;  4JI3 O;  3N2K B;  1O9H A;  2JJ2 G;  2X7R B;  3AG2 B;  4CH4 A;  2IH1 C;  4FK5 C;  4YHH O;  1AJP A;  4P9P A;  2EIL B;  3ZRW A;  1CP9 A;  2PYL A;  1QR8 A;  1MSW D;  4FZ0 A;  2HR3 A;  1WPB A;  3SYQ A;  1KKD A;  4DR3 B;  1FXK A;  2RQ6 A;  4K35 A;  1K73 W;  1PNM A;  1XDC A;  5FPO A;  4UVB A;  3RGB A;  5EZY B;  4TV9 A;  5L3G A;  4GKK O;  1NR7 A;  4QPJ A;  4NXM O;  3I56 V;  4H33 A;  5IY5 C;  4DR6 O;  1FXH A;  4GX1 A;  5LMU B;  1FS0 G;  3H1L H;  4JF3 A;  1T5E A;  1VAR A;  1NTZ H;  1H2G A;  4QPK A;  3K03 A;  3G71 V;  4FFB B;  1NI8 A;  1XQ8 A;  4K8X A;  2YXL A;  4D7T A;  1VMG A;  3PN1 A;  2R9I A;  1PL4 A;  3IFX A;  3N2G A;  3M99 B;  4H13 B;  4TSF G;  1XEQ A;  2YS8 A;  3AK3 A;  1OCZ C;  5L3F A;  2R9A A;  4UV9 A;  5L3C A;  1K3E A;  4YY3 O;  2XOK G;  2XAF A;  1PD3 A;  1SET A;  1B3Q A;  1GMG A;  3RVZ A;  1QVG U;  3L9D A;  3I5D A;  3RYH B;  3GWK C;  3CJH A;  4FLX A;  3WB1 A;  3RYF B;  4X88 A;  1OCO C;  3ZHT A;  3DXR B;  2DOS A;  2EIM C;  4JI5 O;  1U96 A;  1WPX A;  3OW2 U;  2V7Q G;  2BTO A;  1EBO A;  3UO2 A;  2E5L O;  4LF7 O;  2ZE5 A;  3O65 A;  3CX5 F;  3CC2 V;  4X62 O;  5KX5 B;  3BA8 A;  1GM7 A;  1MA1 A;  2ZE7 A;  1DLB A;  1PNK A;  5IJ9 B;  3IJ4 A;  2P90 A;  4AQY B;  1IUR A;  2P7T C;  4J10 A;  1JQ0 A;  1Q81 W;  1XUQ A;  2L6L A;  3T1H O;  3E8B A;  1W2B U;  4MW3 A;  5D5P A;  2D3O W;  1FYJ A;  2F95 B;  1IBM B;  4NKG B;  3AEI A;  3OT7 A;  2KG7 B;  1EZV H;  2XAG A;  1AVM A;  2PY5 A;  3JAR A;  3MHS C;  1I0H A;  2QWR B;  5JH7 A;  4X66 B;  3K3W A;  1LUW A;  3TXS A;  1UFI A;  1DTO A;  3T1Y B;  1YHQ V;  1ARO P;  1VF6 C;  4J11 A;  1H2N A;  2KQX A;  3H1K H;  1XNR O;  1G4Y B;  1SZX A;  1XNR B;  1AR5 A;  1YIJ V;  1PPJ H;  1FFX B;  4CS4 A;  2ZIO A;  3DC5 A;  2NNU A;  4UB6 Z;  4JYA O;  2FB5 A;  1FXK C;  3ABU A;  4CC6 A;  4X89 A;  4GZR B;  1BGY H;  1TVK B;  3JAL B;  2QWP B;  1SQQ H;  4N23 A;  2IJK A;  4DW0 A;  1JFF A;  1ORQ C;  5BMV A;  2M7W A;  3UKM A;  1WP8 A;  4PA9 A;  2XAQ A;  1MZF A;  4O2B B;  2O57 A;  1AI7 A;  3JAK A;  5GTI Z;  2HP8 A;  4AI8 A;  4JTD B;  1BCC H;  5DEC A;  1EN5 A;  1MOF A;  4NR1 A;  4PDM A;  2PI4 A;  1FAF A;  1AI6 A;  2YUA A;  4JAS A;  1SS3 A;  4MVS A;  2F1M A;  1QVF U;  3AG2 C;  4DK0 A;  1JJO A;  3CRM A;  2A9H A;  1BMF G;  2OIE A;  4PI2 A;  2OT5 A;  4DR6 B;  1AR4 A;  4WFF A;  2VWJ A;  5FL7 G;  1HDJ A;  1WA8 B;  5LHH A;  4UCS A;  2RNB A;  3SYO A;  3JAK B;  1OJH A;  2QWQ B;  3K57 A;  4D6T H;  4O4J A;  2EIN C;  4X66 O;  4LF8 O;  4YXW G;  3BCC H;  3N2G B;  4OPH A;  4MTX A;  1YXB A;  2QKC A;  1VEW A;  3FB5 C;  3LDD A;  4C7U A;  2HHH O;  4FLW A;  4LF4 B;  4EB6 A;  2AZ0 A;  3L73 H;  3OTO O;  3A2F A;  2LW7 A;  2FML A;  2YIA A;  1TAE A;  1N8R W;  3GWO A;  2P4K A;  5EK0 A;  5IJ0 B;  1OV9 A;  2AGA A;  4OPA A;  1TUB B;  2BTQ B;  1Z5V A;  5H6R A;  4UCT A;  2VQE O;  1OCO B;  3EFF K;  4LF6 O;  5DED A;  3F5W C;  3K59 A;  1NQT A;  1H2L A;  4UB8 Z;  4IHJ B;  2OIG A;  4UV8 A;  1L8D A;  4JYC A;  4KFM A;  2RJZ A;  4CS3 A;  2IJJ A;  4DV4 O;  1SRY A;  4U7O A;  1NVP B;  2GUZ A;  2YIB D;  5CA3 A;  1ZWI C;  1M56 B;  1H2K A;  2WLJ A;  2DE0 X;  4B7E A;  3E2E A;  3E83 A;  4ZI7 A;  2ZM6 O;  4IT5 A;  3THO A;  4JI6 O;  3SJB C;  2W0X A;  1XMQ B;  1SQX H;  4I0X B;  1YTF D;  3B77 A;  4FLY A;  2NR5 A;  4GKK B;  4LNU B;  4X9Q A;  1NH2 B;  2EBO A;  4LNU A;  2P4V A;  3J81 N;  2UXN A;  4JPR A;  3OE7 G;  4JZ2 A;  5JJE B;  3HKE B;  1GTO A;  4JI8 O;  1K5Q A;  2PZS A;  1N36 O;  1EZJ A;  3STL C;  3FB8 C;  5EZY A;  4L8J A;  3OUF A;  2Y48 A;  3SJA C;  2WLL A;  1Y74 A;  3E86 A;  5BZB A;  1IXB A;  3K9S A;  1KB9 F;  3ABT A;  4R50 A;  2BCC H;  5B3S B;  1VIB A;  1AR1 B;  3W7U A;  1SQP H;  5EBM C;  1CEZ A;  3LNM B;  1LNQ A;  3MD0 A;  3CPW U;  1Q6H A;  4RAI A;  3SPJ A;  1M90 W;  2CTR A;  1KBH A;  2HLD G;  1N32 O;  2ZXW B;  1PM9 A;  3FKS G;  3BHP A;  1R3L C;  2AHY A;  3SGI A;  2JK5 C;  2R70 A;  1N0N A;  2M6Y A;  1OCC B;  4J41 A;  3B40 A;  4EB6 B;  1YZB A;  3JD0 A;  3DXR A;  4MS2 A;  4MVQ A;  1Y66 A;  4I4T A;  2XAJ A;  3JSN A;  5FLX N;  2OTL V;  4GCZ A;  3OMN B;  1Y76 A;  2GSM B;  2GV9 A;  3JCZ A;  2AHZ A;  2BSK A;  3BY6 A;  1XHZ A;  3L71 H;  1R1B A;  5J2T B;  1NKD A;  1GKF A;  2HKO A;  3LSS A;  4J9Z B;  2WA3 A;  3BAA A;  3ZMU A;  1WB7 A;  2LO1 A;  4JI2 B;  3OGI B;  4FM2 A;  4AQY O;  4WBN B;  5KUM A;  2VQF B;  1NJI W;  3D36 A;  3W7W A;  1IVS A;  3B2E E;  1M93 A;  2F66 C;  1HNW O;  4DO2 A;  5FPR A;  1WLE A;  5L3B A;  3CCR V;  1K97 A;  3OUS A;  1B06 A;  3K06 A;  4ZOL A;  5J2U B;  2NLJ C;  1XL4 A;  4WFE A;  2ZIN A;  5KMG A;  4LWS A;  1JR9 A;  1R3I C;  3HKD B;  1ZTE A;  1JX9 A;  3P3N A;  1KYO F;  5KX5 A;  1Y4M A;  2ADQ B;  2CTP A;  5B1B B;  4EFE A;  2HG5 C;  3RYH A;  2DYS B;  2Q5Z A;  2Q73 A;  1YF2 A;  3ZBH A;  2QR4 A;  4BAY A;  2YXH A;  4KHP B;  5LA6 B;  1R3J C;  2ZT9 B;  4LP8 A;  1SQF A;  2CAZ C;  1BHA A;  1N34 B;  4HZ3 A;  1N34 O;  1K5S A;  1NZ6 A;  1Q90 D;  4P9O A;  3ZIA G;  2X6B A;  1BZK A;  2QWO B;  2ZM6 B;  2PF4 E;  4DUY O;  2UUC B;  4OX9 O;  4WBN A;  4JV5 O;  3JCU Z;  4ZHQ A;  2H94 A;  5CBH A;  2WPD G;  3CE2 A;  4ZKI A;  4B3R O;  2BOB C;  2JS5 A;  5B5E Z;  1MSD A;  4QGP A;  1L0L H;  3OEE G;  1FJG B;  3OD4 A;  2YEV B;  3WU2 Z;  4CC5 A;  5CB4 B;  4U3J B;  4I9W A;  3ABM B;  3H1J H;  1HNZ O;  1VF7 A;  1H2S B;  1BT8 A;  4F6R A;  2UXD B;  3TXQ A;  1F4M A;  1X59 A;  1YJ9 V;  4H0L B;  4X64 B;  2Q67 A;  3HKE A;  3K9A A;  1WP7 A;  3CP1 A;  2ZR3 A;  3P30 A;  1W0K G;  2WLI A;  1D5N A;  2HFE C;  5CB4 A;  3K5M A; 
#chains in the Genus database with same CATH homology
 1WP8 A;  3IJ4 A;  3S3W A;  4FZ0 A;  4NTY A;  4NYK A;  3S3X A;  4FZ1 A;  1WP7 A;  2QTS A;  2L35 A;  3N27 A;  4NTX A;  4NTW A;  2FB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...