3IJ4A

Cesium sites in the crystal structure of a functional acid sensing ion channel in the desensitized state
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
406
structure length
406
Chain Sequence
VWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Amiloride-sensitive cation channel 2, neuronal
publication title Pore architecture and ion sites in acid-sensing ion channels and P2X receptors.
pubmed doi rcsb
source organism Gallus gallus
total genus 97
structure length 406
sequence length 406
ec nomenclature
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3ij4A01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 3ij4A04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 3ij4A03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 3ij4A02
4NYKA 3N27A 4FZ1A 2FB5A 1WP8A 4FZ0A 3IJ4A 2L35A 3S3WA 4NTYA 2QTSA 1WP7A 4NTXA 3S3XA 4NTWA
chains in the Genus database with same CATH superfamily
1GM7A 4GX2A 2BCCH 1N36O 3E86A 3J81N 1G8MA 3FYIB 1P49A 2EIMC 4GCZA 3RGBA 3RYIB 1Z2GA 3K04A 2DYSC 5L3EA 2UUCO 4UCUA 3L70H 1SA0A 2EJ7A 1BE3H 5GONB 3WB0A 1CEZA 1NZ6A 3I5DA 3DXRB 3PJSK 1W0KG 3T4ZA 4QPKA 3P3PA 3CCSV 2CUGA 2PTMA 2IJHA 1YTFB 3FB8C 1WP8A 3P3NA 1ZL8B 1JOYA 4YIOA 4JI1O 2A3QA 1K5QA 1E1RG 4JV5O 3OM3B 4DV7O 2XAHA 4J9ZB 5KHIA 3WG7C 3CRRA 5EYPB 2GTAA 1R3IC 1YXBA 1R3KC 3ZRWB 4MTGA 4JI5B 1LNQA 3M7MX 3MHHC 4HNAB 1HR0O 4DW1A 5J2UB 4QE7A 2Q4PA 4Q20A 3SPCA 2YC0A 1N33B 2DYRC 1Q6IA 2X7RB 5IJ0A 4X66B 1XMOB 1WA8B 2OCHA 3AG1B 3CEIA 4TUYA 4CZZA 4E2LA 2AZ2A 3LSUA 3K0GA 5B5EZ 4XBFA 4AQYO 1FD9A 4BW9A 2HR3A 1N0NA 3ABLB 3UO2A 2CTWA 1Q86W 3J80N 2JGDA 1VQ4V 1NS1A 5JVDA 5K1XA 2ODMA 2HLDG 1VQ7V 2YXYA 3STLC 4BIUA 4FFBA 3JASA 4KP4A 3JAKB 4O4JB 2WSSG 5KMGA 3OEHG 4X62B 3VQWA 4OPAA 4GKJB 1FXHA 3ABKB 3AK3A 3OAAG 2UXBO 4P30A 3H1KH 4PA7A 4H0LB 1FXKA 3APOA 3OTOO 4PDRA 3ZMVA 1V54C 2AW9A 1WB8A 5KX5B 1ORQC 3CXHF 2P6JA 2BOBC 4FIPC 1XNRB 4DXWA 4JF3A 5LMNB 2PI4A 2N74A 4LR3A 4LF6O 1XNQB 3ASOB 4U3FH 4MVOA 4PA4A 3B09A 3RYHA 4EKWA 4DR3O 2YDEA 1G1XB 3B4SA 4UVAA 3OUSA 2VRZA 2ATKC 2XTAA 3BCCH 4HZ3A 1NH2B 1XMOO 1BMFG 3E2EA 1YCIA 2F43G 2RN9A 3UM7A 1X4TA 2XT9A 1SA0B 3VQYA 4WFBV 4DR2B 5DN6G 3I56V 1VQ9V 1PNMA 2E5LB 5IY5B 2DW4A 3AG3B 2ZXWC 4N23A 2DN9A 4DK1A 1P7GA 2IH3C 1L8DA 3ZMUA 2FYUH 1BHAA 1JFFB 1PM9A 1SQFA 3ASNC 3VBBA 1Q90D 4TV8B 4MVSA 4MTXA 2YEVA 4JI8B 3H1IH 2IW5A 1M90W 5L3GA 4DV1O 3ABTA 4NB5A 4DK0A 3CE2A 4BR6A 4UXNA 4FLYA 2A9HA 1XREA 4TUYB 1BHBA 5ITZA 4KFMA 3MD0A 3G71V 4LF7O 4LBEC 5LMNO 4HYOA 2XHBA 4DR4O 5C8YA 3E22A 2R72A 5F2VO 1XNQO 5JVDB 4CC6A 1WPXA 4O4LB 3ABUA 3R65A 2RDCA 1UFIA 3O9OA 4KUMA 3MDSA 3M8AA 5EBLC 3JD2A 1KQSU 2JS3A 1GM9A 1JCHA 2BSKA 4K8XA 3HKBA 5KMGB 2P5OA 3LNMB 4H37A 1VF6A 2ZM6O 1SQVH 4CS2A 4FZ0A 2H94A 4DRXA 5J2TB 2XNDG 5B1AC 4RQEA 3W7SA 4HBNA 1FXKB 3GB7C 5H6RA 4ZOLA 2M7WA 3GWOA 4PA3A 2E5LO 4Z1VA 1WNSA 4LCUC 1TAEA 1LUVA 3D36C 5B3SB 3B77A 1NVPB 2O57A 1G4YB 3JARA 1YJ9V 1VF7A 2GTSA 1E1QG 4TWKA 3IAYA 2P4KA 4GX0A 1Q3EA 2A7WA 3RYHB 2QKSA 1S76D 2DQ0A 5LP6A 3OMAB 2P06A 5IYDO 1I08A 4JI7B 1S72V 4IHJB 4UUJC 4PI2A 1NBMG 1FPOA 5BMVB 1O9GA 3JALA 3NR7A 3DC6A 4DV0B 2UXCB 3B8MA 2GHYA 2GDSA 4PHZA 1H8EG 3ZN0A 4BIZA 5IDJA 3T1HB 3JD3A 4NXMB 1MZEA 4ZI7B 1W59A 4LF4B 3TJTA 4MS2A 1OCOB 1EN4A 4Z2WA 2W6JG 4I0XA 2PUSA 3SGIA 5LYJA 1MSWD 3L75H 1S5HC 1KD1W 2R9IA 4PDLA 1RSOA 1R3JC 1GK9A 3OFNG 3SJBC 3CX5F 5LHGA 3K79A 2UXNA 4TV9A 3K5MA 3IC7A 5LXTA 5L3DA 4MT8A 1AP6A 3RT3C 1AI4A 3BEHA 1NQTA 1XMQO 4GLXA 1I94O 2CK3G 3E8BA 3K59A 4K0KB 4X1KA 1M1KW 4NVPA 4CH6A 5ITZB 3MHSC 2P90A 4X65B 5LA6B 2UXDO 1S5LZ 1HWYA 4LFCB 4B3SB 4JI2B 3E8GA 4DV4B 2GV9A 3ABMB 4UFZA 4UCRA 4JI4O 5C8YB 2QM4A 3E22B 1QLEC 5CBGA 3D3IA 1MZFA 3A8TA 1DGSA 3E35A 1D2DA 2AHYA 1WPBA 3BHPA 2PYJA 4PA6A 1K97A 1RPOA 1PPJH 1XEQA 3F5WC 2E76B 4JI7O 3T1YB 4LF8B 4J10A 3HKBB 5JQGA 2AZ0A 5BR8O 1EFRG 4KXRA 4FM0A 2V1DA 1CXZB 3EFFK 5GW7A 4DRXB 4FZ1A 1S0VA 1QNMA 4MVUA 4LFBB 4ZOLB 3FB5C 3ZN1A 1V55C 3T1HO 4NXMO 2Z5UA 5BXZA 4I50A 1Q5OA 4R7CA 3CCLV 5LMUB 3JARB 4WFFA 2YI9A 1COWG 2LO1A 1K9MW 1IXMA 3OEEG 2ITCC 1F51A 1N36B 1K4DC 1IZ3A 4OX9O 3SPGA 3TCUA 5LP6B 1GM8A 3TETA 1K3EA 3OUFA 3SJQC 4LNUB 2UUCB 4B08A 1NJIW 4LF5O 3AG1C 2UU9O 3G4SV 3ZS8C 2CAZC 2UUAO 2QDOA 5JJNB 1SRYA 2KG7B 2JS5A 4CS3A 2W6IG 1Y6XA 4QPJA 3AG2B 4U3JA 3HPLC 5CA3A 2H3OA 3X2QC 1NR7A 3G6BA 4JI1B 3C3SA 4I0XB 4JV5B 4W4LA 5LYJB 3E8HA 4DV7B 1J5EO 2EZPA 3E8FA 1FAFA 1EBOA 4B3RO 1B04A 1SQXH 2QSAA 2Y48A 2YS8A 1HR0B 4TV9B 1YF2A 2KKWA 3SYQA 5IT9N 3BPZA 4K3AA 1SS3A 3IJ4A 5LOVA 4DV3O 2CTRA 2CGOA 3BY6A 1NR1A 4AQYB 3TXQA 3K3WA 4YJ2A 1IXBA 2CTQA 5JH7B 2ZR3A 2OT5A 1YIJV 1ENVA 2B1IA 2OCCB 3ZRVA 1DF4A 2ZIMA 4OXSA 1EN6A 4YIPA 2NLJC 1AJNA 3SYAA 2IJKA 4NTWA 2EIKB 1TUBA 5IYZA 3ASOC 1BQZA 1WB7A 3G67A 2VQEO 3LNNA 2Q73A 4R8CA 1AI6A 2Q0OC 4ZBMA 2UXBB 1QCEA 1SESA 4J7JA 2Y69B 1YJNV 4TQFA 2XOKG 1VQOV 4PDMA 5D5QA 2QWNB 3OTOB 5LHHA 1OCRB 5AG2A 1XDCA 2JEXA 4WFEA 2AGAA 4ZIBA 4DV2O 1AR5A 4LWSA 1FFXA 3BA9A 3JATA 1JJ2U 1OCCC 2WLLA 1EN5A 1M57B 1Q6UA 3AG3C 2HEPA 2QTOA 4LF6B 5BZBA 4J41A 4W4KA 2Q7EA 5IJ9A 4DR3B 1KP2A 4O2AB 3RBZA 1I5XA 1K4CC 4D6TH 3T1CA 4FLUA 2HFEC 3D3QA 3N2KB 4AILC 1AP5A 1KYOF 2X6AA 2KB1A 1F23A 3OT7A 4X1YB 3K9SA 1FJGO 3K03A 2D2CB 4WFHA 4JZGA 1BSMA 5FPRA 1HDJA 2OIEA 2FMLA 4CH5A 3S3XA 3B8NA 3LDDA 2JIZG 3BAAA 1QU7A 2EINB 4FLZA 1QQCA 4H44B 5BY1A 1K5SA 2CTPA 1S5JA 4JGSA 1SQBH 4GT1A 1NI8A 1UPGA 2VWJA 2P67A 3H1HH 1L1FA 4JPRA 1SERA 3LDCA 4UVBA 2F95B 1YTFD 3AG4C 4GKKO 1ZX3A 4G28B 1YJWV 3FFQA 5B1NA 4JYAO 1XQ8A 4DR6O 2IBZH 3G80A 1GO3F 4DV1B 3W7WA 2F93B 3RYCA 4I55A 4UB8Z 1IURA 1QR9A 2WLIA 1I7FA 4UCVA 2DWDC 3L9DA 5IYCO 2W0XA 3ZHTA 2CE4A 5KAIZ 1GN6A 3W7TA 4PJ0Z 1R6NA 1XOUA 5EIBD 3CRMA 4LF7B 4DR4B 3ZBHA 1K7DA 1XUQA 4YY3O 4F4LA 2VS0A 2UUBB 1XL4A 2DQ3A 2ETNA 2MK3A 3NXSA 3QO8A 2LP7A 4NTYA 5IYZB 3JD1A 5IE9A 4TOIA 2B5UA 1Q8IA 3LDEA 4I4TA 3OR7C 4X64B 1H8HG 2EIMB 1FXVA 2ZM6B 1RM1C 3DC5A 3U0ZA 4QE9A 3CPWU 5HFLA 5KLVH 2DYSB 1RPRA 3DSQA 2YICA 2YIDA 1OCZC 4F6RA 5L3CA 1AVMA 4NXNO 5A9GA 1Y67A 3CRAA 4IGGA 3O65A 2Z0AA 1KMIZ 2XAFA 2WLMA 1VQLV 1VP7A 1M9NA 2ZD9A 4PA9A 2ZDIC 4FVMA 5KHKA 1BT8A 1OV9A 2PGGA 1FFXB 4HAMA 5LGTA 4JI0O 5DEDA 4MSWC 3UQ8A 2QA4V 1Q7YW 1H2KA 4KHPO 3CB2A 1J95A 4JYYA 1R6TA 3QO5A 3WG7B 4C7UA 4ZHQA 5FPOA 5DM6V 5IJ0B 3JCZA 1U97A 2YUAA 2A0LA 4JTCB 2DYRB 4UCSA 1DK1A 2ZKOA 2YXLA 4DUZB 4FM2A 2PI5A 4O2BA 1NH2D 1E79G 2JGDB 4EB6A 2UUBO 1I5YA 2JJ2G 3CCQV 4U7OA 3ZHUA 3ZRSA 3OMNB 3FD9A 3ETGA 3UCSC 3RN4A 3ABMC 5IWAO 4FFBB 3BABA 3JASB 3H1LH 2PY5A 2HHHB 5H9CA 1M56C 3BVOA 2IH1C 4X64O 2HJFC 3B2EE 2RNBA 2ADQB 2OIGA 4IL6Z 3STZC 3K0DA 2JRIA 3KCXA 1VQNV 2EILC 1XMQB 4I55B 3U10A 1XHZA 1YHQV 3HKDA 1I94B 3CYOA 3JAWA 2WLIB 3HKEA 3A2FA 1JMKC 1H38A 3BFRA 3CXCU 1XI1A 5LL6Y 2UXDB 1R3LC 3D36A 1V54B 3QVNA 1HNZB 4FLWA 4NR1A 4JI4B 1N32O 3FX7A 5CA1A 3CD6V 4J7ZA 3ETDA 3SPHA 1P84F 3JAMN 3S3WA 3EXAA 5LHIA 3A0HZ 2WPDG 4I7ZB 1L0LH 4O4IA 1N34O 1IBMO 1HNXO 5HFMA 2LQTA 4G27B 5BR8B 3ZX6A 1VQ8V 1GMGA 3MAQA 1P7BA 4DUZO 1KC8W 1Q6HA 3A0BZ 2HJDA 4F6RB 4LFAO 2QWOB 5CMUA 2LW1A 4UV9A 4NYKA 3APQA 3CC4V 4UVCA 2QM8A 4JZ2A 1GRJA 1GAXA 2B1GA 1KKDA 5H5NA 1YZBA 3ZHQA 4QIWF 1GH6A 2HP8A 3DTUB 4DR1O 2X6CA 2JGUA 2ZXWB 1XBLA 4RUEA 1JQ0A 1YSCA 1SKVA 2DOSA 2Q7GA 4KL1A 3WB1A 2HHHO 1NKDA 4J11A 3CCMV 1NVPD 4K8ZA 4J9YB 4IYHA 3GVMA 4B3MO 4OX9B 2AHZA 2IU0A 2JDIG 2YEVB 2EIJB 4X20A 3KKYA 3ASNB 5EK0A 2XAQA 4JYCA 3K58A 1Q82W 3JD0A 1JPXA 1DTOA 5EBWC 2P7TC 1CP9A 3A0RA 3J7AU 1OHHG 4LF5B 4LC1A 3P30A 1QVFU 2UU9B 4EFEA 2UUAB 2JEUA 1HNZO 4O2BB 4BAYA 3Q4HA 1AI7A 3DGEA 4RAIA 3RYFA 5DECA 3ETEA 1ZAUA 1J5EB 4X88A 2BSKB 3QG5A 1IBLO 2ZINA 4X89A 3CCUV 3LUTB 1YITV 4B3RB 2YIBD 2KQXA 2M6YA 1TUEB 1LUWA 2Y0PA 1M93A 1G6UA 2YIAA 3OR6C 3SDLA 1H2SB 1JX9A 2ZE5A 4L87A 4O4HA 4DV3B 3G6EV 2JK5C 3L71H 3JAWB 1FS0G 2E74B 1A32A 2Y69C 1UJWB 1VIBA 2RQ6A 2ZE7A 5GONA 4BW5A 2OTLV 4JI3O 1Y76A 2H8PC 2ZNIA 3DXRA 1SF9A 3OD4A 1K8AW 1WLEA 1ZLZA 4LH6A 4DUYO 1PL0A 5CA1B 4X8AA 1IBKO 1K92A 3OTFA 3K5LA 1B3QA 1ZL8A 5EC2C 3W7XA 4DO2A 2PF4E 3U11A 2Q68A 2VQEB 3RW0A 3N2GA 5EYPA 2HVKC 3KG2A 5EIBC 4DW0A 3JALB 1PNLA 3HR0A 4HNAA 2LJ2A 4FJCC 1Z5WA 1IX9A 4DV5O 1WA8A 4TQDA 1URFA 1YDXA 2Q69A 4DV2B 4B3TO 4J80A 4RWUA 4EEQA 3ABLC 4JAVA 4BWAA 1VARA 2Q67A 3TK1A 1R73A 4NTXA 3CC7V 4GX5A 4RQFA 1RP3B 2UXXA 2EX3A 3BRCA 5TISZ 3UKMA 2NNUA 1RSOB 4ZKIA 2ZCEA 3CMAV 2F4VO 4U7NA 1WP7A 5LXTB 1B06A 5FL7G 4P9OA 4LF9O 1KECA 1X59A 3TGUH 2XAGA 4X20B 3WU2Z 3FYEB 5CN0A 4J7KA 5JJEB 3ABKC 1LR1A 5FLXN 2OWOA 4FK5C 2YSUB 3JAKA 2D3OW 1QBZA 4O4JA 4DR7O 2YXHA 1FJGB 4OGQB 4Z1MG 1NU1H 3SPJA 3W7UA 4XDJA 4X1KB 4MVRA 1Q43A 1N0JA 3P32A 3H1JH 2YI8A 3OGCC 1AR1B 4LP8A 3D8CA 4H13B 3TXSA 5CA0A 1T5EA 3OE7G 4ABMA 5KX5A 3FB7C 2QWQB 2DE0X 1V9PA 3JCUZ 1QLEB 2G38A 2QWRB 4RO2A 2L35A 4X1IA 4J42A 5KA6A 4I5SA 1GTOA 5FNVA 4D7SA 2ZNJA 1VQKV 4GYCB 4GKKB 5JQGB 3WB2A 5IYBO 3PN1A 4JYAB 5LGNA 4DR6B 1YVWA 4OPHA 4O4HB 4PDVA 4GZRB 3F7YC 3VQVA 3AK2A 2IJIA 3N27A 2WLHA 4I50B 4D7TA 2R70A 3ETQA 1MNGA 1V55B 4BIOA 2ZIOA 5IY5C 2QM7A 1Y76B 4YY3B 4X9QA 1WN7A 4YJ3A 3RWRD 5JCOC 1HNWO 1QR8A 4JTDB 3ZMSA 5H2FZ 5B66Z 5JCOA 3CMEV 1L0NH 1AJPA 1AR4A 2Q9LA 2BTOA 4MW8A 1DF5A 1JFFA 3N2GB 1ZUQA 3AG7A 2QR4A 1SZTA 5B1BB 5L3BA 4TV8A 4AHCA 1US6A 2HG5C 1THZA 4UB6Z 4NXNB 4NKGB 1NT2B 4XDLA 2EBOA 5EZYA 1SZXA 4MW3A 1MG1A 1N4CA 5EBMC 3EVKA 2CGNA 4U3JB 4CC5A 5LGUA 3H9VA 3CCRV 2QE7G 3CS5A 3UT5A 5E1AC 3ZRXA 3IFXA 4DR5O 4JI0B 2GSMB 3WFVA 1PNKA 2LGQA 4YXWG 3X2QB 2GUZA 4KHPB 1MABG 4F6EA 4I9QA 2X6BA 1OJHA 1TA8A 4O4LA 1FKAO 2R9RB 1VF5B 4K35A 4P2ZA 4PELA 5L3FA 1FFTB 3HB3B 3ZHVA 3SYOA 3H01A 5LOVB 1IDSA 1XHXA 3IC9A 3ZCCA 3T2MA 3JYCA 2QWPB 4DYLA 4LH7A 1D5NA 4JI6B 1FXKC 2CH7A 3QNEA 2PZSA 3CJHA 5J2TA 4YJ2B 3K57A 3L73H 5B3SC 3LSSA 3B40A 1I0HA 4DV6B 5CBHA 1NTMH 4MVZA 2ZE6A 2DWEC 5CA0B 3L74H 3OMIB 4B7KA 5CB4A 5IWAB 1TUBB 3FAVA 3SR2C 5CBFA 2K1EA 4X1IB 2C2AA 2AXTZ 5FNVB 2K9PA 4QGPA 2IJJA 4JI5O 2E3CA 3KCYA 4UCTA 1BCCH 1JA8A 3AK1A 1N33O 3F7VC 3HKCA 1W0JG 4X66O 4IHJA 1PV0A 2N05A 5BMVA 1BL8A 2BOCC 2JVDA 4LWSB 2B9ZA 2Q7HA 3JATB 2ZDIA 2WLLB 4MTOA 2LFSA 2BTQA 5KUMA 1N32B 5KAFZ 1OCOC 2IM9A 2P4VA 4YJ3B 1VQPV 1OCCB 4ZI7A 5IJ9B 1EZVH 4IT5A 4QJFB 3K5NA 1SQGA 2ZQMA 2YIBA 1R6KA 1U96A 3CP1A 1NTZH 1SQQH 1KB9F 2OTJV 1DLBA 1N34B 1IBMB 1HNXB 2EIJC 4X62O 1IVSA 4IIJA 3E89A 4GKJO 1YEWA 2DJVA 4JI6O 1H2LA 4P9PA 2VWKA 5KUKA 2N04A 4LFAB 1CPYA 4GUNA 3L72H 2EZOA 5EZYB 3K5OA 4DV6O 4B7EA 2XUMA 1QHTA 3ML0A 4DR1B 3UT5B 2GBOA 5E79Z 5LA6A 4JASA 2KSDA 1XNRO 3GWKC 4ASUG 2GUZB 1ZTEA 3E83A 5GTHZ 4B3MB 1H2NA 4IYIA 3K06A 2NN4A 3M99B 3AG4B 4FMTA 3JD4A 1JVMA 3RYCB 1S3JA 3IGAC 4TSFG 1VF6C 4R6ZA 3K9AA 2A06H 1B6QA 1ZSPA 1TGOA 3CHXA 2CH7B 3SJAC 2Y4UA 1WJZA 4MVQA 4WFGA 1BQ0A 4FPPA 3CJHB 4DR2O 1K33A 2EJRA 4QNHB 3RVZA 3ZMTA 2FKXA 5EC1C 2NR5A 3VOUA 3AEIA 4FFKA 3THOA 5CB4B 2ZR2A 1F7YA 3FAVB 2Q5ZA 3CSXA 2W0FC 1K73W 4AI8A 1IBLB 4I4TB 1KBHA 4UCOA 2DMXA 1MOFA 1Y74A 2ZT9B 3CRQA 1H2MA 5LP6C 1JR9A 1Y4MA 3C90A 2VQFB 4JI8O 1RM1B 1Z5VA 1AJQA 1AROP 1TVKA 1GN2A 2LFRA 3HKCB 4CH4A 5J9PC 1YI2V 4ICGA 4JAAA 4WFAV 3JSLA 4R50A 4LNUA 2CDYA 1OCZB 3QF7A 2Y0IA 4JI3B 1S77D 1OZ0A 1R1BA 1GKFA 1SQPH 1MMMA 3AG2C 2BTQB 2KG7A 4DUYB 3ZMZA 3R66A 1IBKB 1MSDA 4CBCA 2Z3YA 3OW2U 2E75B 4JYBA 4JTAB 4WBNA 2PYLA 3SPIA 1M5IA 2FB5A 4EFBA 5C93A 5KA5A 4ZHQB 4CH3A 1KUQA 4FM1A 2MW2B 5GTIZ 4IIJB 1SC5B 1PD3A 2RCVA 2FTKA 3OGIB 3UO3A 2RJZA 3ZIAG 4Q6GA 5B1OA 4DV5B 4GX1A 2ZE8A 3SYPA 1M4UA 2R9AA 1BGYH 4PD4F 1D5AA 2L6LA 4B3TB 3CWBH 4EB6B 5H6QA 2WLKA 3CRCA 1AILA 2OCCC 3QO7A 1HP8A 1VEWA 5JH7A 2RMKB 2HKOA 3ZJZA 3CCJV 3RFRA 1Q81W 2EIKC 2QEXV 2F4VB 1GN4A 1M56B 2VQFO 4LF9B 3QTCA 2WLNA 2Q0AA 1PKXA 2LW7A 4TT3G 3RYIA 1VQ6V 4DR7B 3HKDB 2JJ1G 2QGNA 4L8JA 4FLVA 1KP3A 5B1AB 3HKEB 4CS4A 2EILB 2QKCA 3CCEV 1OCRC 1SETA 4YHHB 1N8RW 3ZHRA 3I55V 1FYJA 1ROPA 4DV0O 2UXCO 3CC2V 2FL4A 1XL6A 3LSQA 2A79B 4RUFA 1AB3A 1Y66A 4I9WA 1M57C 4PI0A 2ARHA 3FKSG 4LF4O 2Q8VA 3FB6C 1BS3A 2F1MA 2WA4A 1H2GA 1KKCA 2Y4TA 2HVJC 4O4IB 2ITDC 4JAUA 2ILMA 3ZHSA 1XILA 1K34A 1Y74B 3ZRWA 1F4MA 4O2AA 5J2UA 4N21A 1VQ5V 2BE3A 1ZWIC 5B1BC 3N2KA 1P4RA 1TVKB 2LGWA 2V4DA 4WF9V 2IU3A 5D5PA 3F5TA 4X1YA 4A5UB 3ZEDA 2EINC 1WAZA 2XAJA 3CCVV 1PL4A 4K0KO 4MTFA 3KZIZ 1EZJA 4X65O 2V7QG 5A2QN 5JJJB 2F23A 4UV8A 5KHHA 4B3SO 2OYQA 4JI2O 4LFCO 4DV4O 1EM1A 1RFYA 1HNWB 2WLJA 3EHBB 3K08A 4WCEV 1VMGA 3BA8A 1GN3A 4XDKA 2WWWA 2Q6AA 3RVYA 1O9HA 1QLNA 1W2BU 1KU9A 5KHGA 4FLXA 4WBNB 3ICXA 4E4EA 1MA1A 3T1YO 1BZKA 2ADPA 3C3TA 4LF8O 4G2KA 2WAMA 3SJCC 2QTSA 4MVMA 2QJ1A 2P22C 1AI5A 1QVGU 1HW7A 2X0LA 4YHHO 1NTKH 2EULA 3VQXA 1F4NA 4FLTA 2WA3A 3Q4HB 5LBQA 4LFBO 4PV1B 5KHJA 3T4DA 3RYFB 1VQMV 2F66C 1JJOA 3JSNA 4DR5B 5JWPA 1PP9H 2XASA 5LMUO 5K1PA 3SYCA 2QKAA 4H33A
chains in the Genus database with same CATH topology
4NYKA 3N27A 4FZ1A 2FB5A 1WP8A 4FZ0A 3IJ4A 2L35A 3S3WA 4NTYA 2QTSA 1WP7A 4NTXA 3S3XA 4NTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYK A;  3N27 A;  4FZ1 A;  2FB5 A;  1WP8 A;  4FZ0 A;  3IJ4 A;  2L35 A;  3S3W A;  4NTY A;  2QTS A;  1WP7 A;  4NTX A;  3S3X A;  4NTW A; 
#chains in the Genus database with same CATH topology
 1GM7 A;  4GX2 A;  2BCC H;  1N36 O;  3E86 A;  3J81 N;  1G8M A;  3FYI B;  1P49 A;  2EIM C;  4GCZ A;  3RGB A;  3RYI B;  1Z2G A;  3K04 A;  2DYS C;  5L3E A;  2UUC O;  4UCU A;  3L70 H;  1SA0 A;  2EJ7 A;  1BE3 H;  5GON B;  3WB0 A;  1CEZ A;  1NZ6 A;  3I5D A;  3DXR B;  3PJS K;  1W0K G;  3T4Z A;  4QPK A;  3P3P A;  3CCS V;  2CUG A;  2PTM A;  2IJH A;  1YTF B;  3FB8 C;  1WP8 A;  3P3N A;  1ZL8 B;  1JOY A;  4YIO A;  4JI1 O;  2A3Q A;  1K5Q A;  1E1R G;  4JV5 O;  3OM3 B;  4DV7 O;  2XAH A;  4J9Z B;  5KHI A;  3WG7 C;  3CRR A;  5EYP B;  2GTA A;  1R3I C;  1YXB A;  1R3K C;  3ZRW B;  4MTG A;  4JI5 B;  1LNQ A;  3M7M X;  3MHH C;  4HNA B;  1HR0 O;  4DW1 A;  5J2U B;  4QE7 A;  2Q4P A;  4Q20 A;  3SPC A;  2YC0 A;  1N33 B;  2DYR C;  1Q6I A;  2X7R B;  5IJ0 A;  4X66 B;  1XMO B;  1WA8 B;  2OCH A;  3AG1 B;  3CEI A;  4TUY A;  4CZZ A;  4E2L A;  2AZ2 A;  3LSU A;  3K0G A;  5B5E Z;  4XBF A;  4AQY O;  1FD9 A;  4BW9 A;  2HR3 A;  1N0N A;  3ABL B;  3UO2 A;  2CTW A;  1Q86 W;  3J80 N;  2JGD A;  1VQ4 V;  1NS1 A;  5JVD A;  5K1X A;  2ODM A;  2HLD G;  1VQ7 V;  2YXY A;  3STL C;  4BIU A;  4FFB A;  3JAS A;  4KP4 A;  3JAK B;  4O4J B;  2WSS G;  5KMG A;  3OEH G;  4X62 B;  3VQW A;  4OPA A;  4GKJ B;  1FXH A;  3ABK B;  3AK3 A;  3OAA G;  2UXB O;  4P30 A;  3H1K H;  4PA7 A;  4H0L B;  1FXK A;  3APO A;  3OTO O;  4PDR A;  3ZMV A;  1V54 C;  2AW9 A;  1WB8 A;  5KX5 B;  1ORQ C;  3CXH F;  2P6J A;  2BOB C;  4FIP C;  1XNR B;  4DXW A;  4JF3 A;  5LMN B;  2PI4 A;  2N74 A;  4LR3 A;  4LF6 O;  1XNQ B;  3ASO B;  4U3F H;  4MVO A;  4PA4 A;  3B09 A;  3RYH A;  4EKW A;  4DR3 O;  2YDE A;  1G1X B;  3B4S A;  4UVA A;  3OUS A;  2VRZ A;  2ATK C;  2XTA A;  3BCC H;  4HZ3 A;  1NH2 B;  1XMO O;  1BMF G;  3E2E A;  1YCI A;  2F43 G;  2RN9 A;  3UM7 A;  1X4T A;  2XT9 A;  1SA0 B;  3VQY A;  4WFB V;  4DR2 B;  5DN6 G;  3I56 V;  1VQ9 V;  1PNM A;  2E5L B;  5IY5 B;  2DW4 A;  3AG3 B;  2ZXW C;  4N23 A;  2DN9 A;  4DK1 A;  1P7G A;  2IH3 C;  1L8D A;  3ZMU A;  2FYU H;  1BHA A;  1JFF B;  1PM9 A;  1SQF A;  3ASN C;  3VBB A;  1Q90 D;  4TV8 B;  4MVS A;  4MTX A;  2YEV A;  4JI8 B;  3H1I H;  2IW5 A;  1M90 W;  5L3G A;  4DV1 O;  3ABT A;  4NB5 A;  4DK0 A;  3CE2 A;  4BR6 A;  4UXN A;  4FLY A;  2A9H A;  1XRE A;  4TUY B;  1BHB A;  5ITZ A;  4KFM A;  3MD0 A;  3G71 V;  4LF7 O;  4LBE C;  5LMN O;  4HYO A;  2XHB A;  4DR4 O;  5C8Y A;  3E22 A;  2R72 A;  5F2V O;  1XNQ O;  5JVD B;  4CC6 A;  1WPX A;  4O4L B;  3ABU A;  3R65 A;  2RDC A;  1UFI A;  3O9O A;  4KUM A;  3MDS A;  3M8A A;  5EBL C;  3JD2 A;  1KQS U;  2JS3 A;  1GM9 A;  1JCH A;  2BSK A;  4K8X A;  3HKB A;  5KMG B;  2P5O A;  3LNM B;  4H37 A;  1VF6 A;  2ZM6 O;  1SQV H;  4CS2 A;  4FZ0 A;  2H94 A;  4DRX A;  5J2T B;  2XND G;  5B1A C;  4RQE A;  3W7S A;  4HBN A;  1FXK B;  3GB7 C;  5H6R A;  4ZOL A;  2M7W A;  3GWO A;  4PA3 A;  2E5L O;  4Z1V A;  1WNS A;  4LCU C;  1TAE A;  1LUV A;  3D36 C;  5B3S B;  3B77 A;  1NVP B;  2O57 A;  1G4Y B;  3JAR A;  1YJ9 V;  1VF7 A;  2GTS A;  1E1Q G;  4TWK A;  3IAY A;  2P4K A;  4GX0 A;  1Q3E A;  2A7W A;  3RYH B;  2QKS A;  1S76 D;  2DQ0 A;  5LP6 A;  3OMA B;  2P06 A;  5IYD O;  1I08 A;  4JI7 B;  1S72 V;  4IHJ B;  4UUJ C;  4PI2 A;  1NBM G;  1FPO A;  5BMV B;  1O9G A;  3JAL A;  3NR7 A;  3DC6 A;  4DV0 B;  2UXC B;  3B8M A;  2GHY A;  2GDS A;  4PHZ A;  1H8E G;  3ZN0 A;  4BIZ A;  5IDJ A;  3T1H B;  3JD3 A;  4NXM B;  1MZE A;  4ZI7 B;  1W59 A;  4LF4 B;  3TJT A;  4MS2 A;  1OCO B;  1EN4 A;  4Z2W A;  2W6J G;  4I0X A;  2PUS A;  3SGI A;  5LYJ A;  1MSW D;  3L75 H;  1S5H C;  1KD1 W;  2R9I A;  4PDL A;  1RSO A;  1R3J C;  1GK9 A;  3OFN G;  3SJB C;  3CX5 F;  5LHG A;  3K79 A;  2UXN A;  4TV9 A;  3K5M A;  3IC7 A;  5LXT A;  5L3D A;  4MT8 A;  1AP6 A;  3RT3 C;  1AI4 A;  3BEH A;  1NQT A;  1XMQ O;  4GLX A;  1I94 O;  2CK3 G;  3E8B A;  3K59 A;  4K0K B;  4X1K A;  1M1K W;  4NVP A;  4CH6 A;  5ITZ B;  3MHS C;  2P90 A;  4X65 B;  5LA6 B;  2UXD O;  1S5L Z;  1HWY A;  4LFC B;  4B3S B;  4JI2 B;  3E8G A;  4DV4 B;  2GV9 A;  3ABM B;  4UFZ A;  4UCR A;  4JI4 O;  5C8Y B;  2QM4 A;  3E22 B;  1QLE C;  5CBG A;  3D3I A;  1MZF A;  3A8T A;  1DGS A;  3E35 A;  1D2D A;  2AHY A;  1WPB A;  3BHP A;  2PYJ A;  4PA6 A;  1K97 A;  1RPO A;  1PPJ H;  1XEQ A;  3F5W C;  2E76 B;  4JI7 O;  3T1Y B;  4LF8 B;  4J10 A;  3HKB B;  5JQG A;  2AZ0 A;  5BR8 O;  1EFR G;  4KXR A;  4FM0 A;  2V1D A;  1CXZ B;  3EFF K;  5GW7 A;  4DRX B;  4FZ1 A;  1S0V A;  1QNM A;  4MVU A;  4LFB B;  4ZOL B;  3FB5 C;  3ZN1 A;  1V55 C;  3T1H O;  4NXM O;  2Z5U A;  5BXZ A;  4I50 A;  1Q5O A;  4R7C A;  3CCL V;  5LMU B;  3JAR B;  4WFF A;  2YI9 A;  1COW G;  2LO1 A;  1K9M W;  1IXM A;  3OEE G;  2ITC C;  1F51 A;  1N36 B;  1K4D C;  1IZ3 A;  4OX9 O;  3SPG A;  3TCU A;  5LP6 B;  1GM8 A;  3TET A;  1K3E A;  3OUF A;  3SJQ C;  4LNU B;  2UUC B;  4B08 A;  1NJI W;  4LF5 O;  3AG1 C;  2UU9 O;  3G4S V;  3ZS8 C;  2CAZ C;  2UUA O;  2QDO A;  5JJN B;  1SRY A;  2KG7 B;  2JS5 A;  4CS3 A;  2W6I G;  1Y6X A;  4QPJ A;  3AG2 B;  4U3J A;  3HPL C;  5CA3 A;  2H3O A;  3X2Q C;  1NR7 A;  3G6B A;  4JI1 B;  3C3S A;  4I0X B;  4JV5 B;  4W4L A;  5LYJ B;  3E8H A;  4DV7 B;  1J5E O;  2EZP A;  3E8F A;  1FAF A;  1EBO A;  4B3R O;  1B04 A;  1SQX H;  2QSA A;  2Y48 A;  2YS8 A;  1HR0 B;  4TV9 B;  1YF2 A;  2KKW A;  3SYQ A;  5IT9 N;  3BPZ A;  4K3A A;  1SS3 A;  3IJ4 A;  5LOV A;  4DV3 O;  2CTR A;  2CGO A;  3BY6 A;  1NR1 A;  4AQY B;  3TXQ A;  3K3W A;  4YJ2 A;  1IXB A;  2CTQ A;  5JH7 B;  2ZR3 A;  2OT5 A;  1YIJ V;  1ENV A;  2B1I A;  2OCC B;  3ZRV A;  1DF4 A;  2ZIM A;  4OXS A;  1EN6 A;  4YIP A;  2NLJ C;  1AJN A;  3SYA A;  2IJK A;  4NTW A;  2EIK B;  1TUB A;  5IYZ A;  3ASO C;  1BQZ A;  1WB7 A;  3G67 A;  2VQE O;  3LNN A;  2Q73 A;  4R8C A;  1AI6 A;  2Q0O C;  4ZBM A;  2UXB B;  1QCE A;  1SES A;  4J7J A;  2Y69 B;  1YJN V;  4TQF A;  2XOK G;  1VQO V;  4PDM A;  5D5Q A;  2QWN B;  3OTO B;  5LHH A;  1OCR B;  5AG2 A;  1XDC A;  2JEX A;  4WFE A;  2AGA A;  4ZIB A;  4DV2 O;  1AR5 A;  4LWS A;  1FFX A;  3BA9 A;  3JAT A;  1JJ2 U;  1OCC C;  2WLL A;  1EN5 A;  1M57 B;  1Q6U A;  3AG3 C;  2HEP A;  2QTO A;  4LF6 B;  5BZB A;  4J41 A;  4W4K A;  2Q7E A;  5IJ9 A;  4DR3 B;  1KP2 A;  4O2A B;  3RBZ A;  1I5X A;  1K4C C;  4D6T H;  3T1C A;  4FLU A;  2HFE C;  3D3Q A;  3N2K B;  4AIL C;  1AP5 A;  1KYO F;  2X6A A;  2KB1 A;  1F23 A;  3OT7 A;  4X1Y B;  3K9S A;  1FJG O;  3K03 A;  2D2C B;  4WFH A;  4JZG A;  1BSM A;  5FPR A;  1HDJ A;  2OIE A;  2FML A;  4CH5 A;  3S3X A;  3B8N A;  3LDD A;  2JIZ G;  3BAA A;  1QU7 A;  2EIN B;  4FLZ A;  1QQC A;  4H44 B;  5BY1 A;  1K5S A;  2CTP A;  1S5J A;  4JGS A;  1SQB H;  4GT1 A;  1NI8 A;  1UPG A;  2VWJ A;  2P67 A;  3H1H H;  1L1F A;  4JPR A;  1SER A;  3LDC A;  4UVB A;  2F95 B;  1YTF D;  3AG4 C;  4GKK O;  1ZX3 A;  4G28 B;  1YJW V;  3FFQ A;  5B1N A;  4JYA O;  1XQ8 A;  4DR6 O;  2IBZ H;  3G80 A;  1GO3 F;  4DV1 B;  3W7W A;  2F93 B;  3RYC A;  4I55 A;  4UB8 Z;  1IUR A;  1QR9 A;  2WLI A;  1I7F A;  4UCV A;  2DWD C;  3L9D A;  5IYC O;  2W0X A;  3ZHT A;  2CE4 A;  5KAI Z;  1GN6 A;  3W7T A;  4PJ0 Z;  1R6N A;  1XOU A;  5EIB D;  3CRM A;  4LF7 B;  4DR4 B;  3ZBH A;  1K7D A;  1XUQ A;  4YY3 O;  4F4L A;  2VS0 A;  2UUB B;  1XL4 A;  2DQ3 A;  2ETN A;  2MK3 A;  3NXS A;  3QO8 A;  2LP7 A;  4NTY A;  5IYZ B;  3JD1 A;  5IE9 A;  4TOI A;  2B5U A;  1Q8I A;  3LDE A;  4I4T A;  3OR7 C;  4X64 B;  1H8H G;  2EIM B;  1FXV A;  2ZM6 B;  1RM1 C;  3DC5 A;  3U0Z A;  4QE9 A;  3CPW U;  5HFL A;  5KLV H;  2DYS B;  1RPR A;  3DSQ A;  2YIC A;  2YID A;  1OCZ C;  4F6R A;  5L3C A;  1AVM A;  4NXN O;  5A9G A;  1Y67 A;  3CRA A;  4IGG A;  3O65 A;  2Z0A A;  1KMI Z;  2XAF A;  2WLM A;  1VQL V;  1VP7 A;  1M9N A;  2ZD9 A;  4PA9 A;  2ZDI C;  4FVM A;  5KHK A;  1BT8 A;  1OV9 A;  2PGG A;  1FFX B;  4HAM A;  5LGT A;  4JI0 O;  5DED A;  4MSW C;  3UQ8 A;  2QA4 V;  1Q7Y W;  1H2K A;  4KHP O;  3CB2 A;  1J95 A;  4JYY A;  1R6T A;  3QO5 A;  3WG7 B;  4C7U A;  4ZHQ A;  5FPO A;  5DM6 V;  5IJ0 B;  3JCZ A;  1U97 A;  2YUA A;  2A0L A;  4JTC B;  2DYR B;  4UCS A;  1DK1 A;  2ZKO A;  2YXL A;  4DUZ B;  4FM2 A;  2PI5 A;  4O2B A;  1NH2 D;  1E79 G;  2JGD B;  4EB6 A;  2UUB O;  1I5Y A;  2JJ2 G;  3CCQ V;  4U7O A;  3ZHU A;  3ZRS A;  3OMN B;  3FD9 A;  3ETG A;  3UCS C;  3RN4 A;  3ABM C;  5IWA O;  4FFB B;  3BAB A;  3JAS B;  3H1L H;  2PY5 A;  2HHH B;  5H9C A;  1M56 C;  3BVO A;  2IH1 C;  4X64 O;  2HJF C;  3B2E E;  2RNB A;  2ADQ B;  2OIG A;  4IL6 Z;  3STZ C;  3K0D A;  2JRI A;  3KCX A;  1VQN V;  2EIL C;  1XMQ B;  4I55 B;  3U10 A;  1XHZ A;  1YHQ V;  3HKD A;  1I94 B;  3CYO A;  3JAW A;  2WLI B;  3HKE A;  3A2F A;  1JMK C;  1H38 A;  3BFR A;  3CXC U;  1XI1 A;  5LL6 Y;  2UXD B;  1R3L C;  3D36 A;  1V54 B;  3QVN A;  1HNZ B;  4FLW A;  4NR1 A;  4JI4 B;  1N32 O;  3FX7 A;  5CA1 A;  3CD6 V;  4J7Z A;  3ETD A;  3SPH A;  1P84 F;  3JAM N;  3S3W A;  3EXA A;  5LHI A;  3A0H Z;  2WPD G;  4I7Z B;  1L0L H;  4O4I A;  1N34 O;  1IBM O;  1HNX O;  5HFM A;  2LQT A;  4G27 B;  5BR8 B;  3ZX6 A;  1VQ8 V;  1GMG A;  3MAQ A;  1P7B A;  4DUZ O;  1KC8 W;  1Q6H A;  3A0B Z;  2HJD A;  4F6R B;  4LFA O;  2QWO B;  5CMU A;  2LW1 A;  4UV9 A;  4NYK A;  3APQ A;  3CC4 V;  4UVC A;  2QM8 A;  4JZ2 A;  1GRJ A;  1GAX A;  2B1G A;  1KKD A;  5H5N A;  1YZB A;  3ZHQ A;  4QIW F;  1GH6 A;  2HP8 A;  3DTU B;  4DR1 O;  2X6C A;  2JGU A;  2ZXW B;  1XBL A;  4RUE A;  1JQ0 A;  1YSC A;  1SKV A;  2DOS A;  2Q7G A;  4KL1 A;  3WB1 A;  2HHH O;  1NKD A;  4J11 A;  3CCM V;  1NVP D;  4K8Z A;  4J9Y B;  4IYH A;  3GVM A;  4B3M O;  4OX9 B;  2AHZ A;  2IU0 A;  2JDI G;  2YEV B;  2EIJ B;  4X20 A;  3KKY A;  3ASN B;  5EK0 A;  2XAQ A;  4JYC A;  3K58 A;  1Q82 W;  3JD0 A;  1JPX A;  1DTO A;  5EBW C;  2P7T C;  1CP9 A;  3A0R A;  3J7A U;  1OHH G;  4LF5 B;  4LC1 A;  3P30 A;  1QVF U;  2UU9 B;  4EFE A;  2UUA B;  2JEU A;  1HNZ O;  4O2B B;  4BAY A;  3Q4H A;  1AI7 A;  3DGE A;  4RAI A;  3RYF A;  5DEC A;  3ETE A;  1ZAU A;  1J5E B;  4X88 A;  2BSK B;  3QG5 A;  1IBL O;  2ZIN A;  4X89 A;  3CCU V;  3LUT B;  1YIT V;  4B3R B;  2YIB D;  2KQX A;  2M6Y A;  1TUE B;  1LUW A;  2Y0P A;  1M93 A;  1G6U A;  2YIA A;  3OR6 C;  3SDL A;  1H2S B;  1JX9 A;  2ZE5 A;  4L87 A;  4O4H A;  4DV3 B;  3G6E V;  2JK5 C;  3L71 H;  3JAW B;  1FS0 G;  2E74 B;  1A32 A;  2Y69 C;  1UJW B;  1VIB A;  2RQ6 A;  2ZE7 A;  5GON A;  4BW5 A;  2OTL V;  4JI3 O;  1Y76 A;  2H8P C;  2ZNI A;  3DXR A;  1SF9 A;  3OD4 A;  1K8A W;  1WLE A;  1ZLZ A;  4LH6 A;  4DUY O;  1PL0 A;  5CA1 B;  4X8A A;  1IBK O;  1K92 A;  3OTF A;  3K5L A;  1B3Q A;  1ZL8 A;  5EC2 C;  3W7X A;  4DO2 A;  2PF4 E;  3U11 A;  2Q68 A;  2VQE B;  3RW0 A;  3N2G A;  5EYP A;  2HVK C;  3KG2 A;  5EIB C;  4DW0 A;  3JAL B;  1PNL A;  3HR0 A;  4HNA A;  2LJ2 A;  4FJC C;  1Z5W A;  1IX9 A;  4DV5 O;  1WA8 A;  4TQD A;  1URF A;  1YDX A;  2Q69 A;  4DV2 B;  4B3T O;  4J80 A;  4RWU A;  4EEQ A;  3ABL C;  4JAV A;  4BWA A;  1VAR A;  2Q67 A;  3TK1 A;  1R73 A;  4NTX A;  3CC7 V;  4GX5 A;  4RQF A;  1RP3 B;  2UXX A;  2EX3 A;  3BRC A;  5TIS Z;  3UKM A;  2NNU A;  1RSO B;  4ZKI A;  2ZCE A;  3CMA V;  2F4V O;  4U7N A;  1WP7 A;  5LXT B;  1B06 A;  5FL7 G;  4P9O A;  4LF9 O;  1KEC A;  1X59 A;  3TGU H;  2XAG A;  4X20 B;  3WU2 Z;  3FYE B;  5CN0 A;  4J7K A;  5JJE B;  3ABK C;  1LR1 A;  5FLX N;  2OWO A;  4FK5 C;  2YSU B;  3JAK A;  2D3O W;  1QBZ A;  4O4J A;  4DR7 O;  2YXH A;  1FJG B;  4OGQ B;  4Z1M G;  1NU1 H;  3SPJ A;  3W7U A;  4XDJ A;  4X1K B;  4MVR A;  1Q43 A;  1N0J A;  3P32 A;  3H1J H;  2YI8 A;  3OGC C;  1AR1 B;  4LP8 A;  3D8C A;  4H13 B;  3TXS A;  5CA0 A;  1T5E A;  3OE7 G;  4ABM A;  5KX5 A;  3FB7 C;  2QWQ B;  2DE0 X;  1V9P A;  3JCU Z;  1QLE B;  2G38 A;  2QWR B;  4RO2 A;  2L35 A;  4X1I A;  4J42 A;  5KA6 A;  4I5S A;  1GTO A;  5FNV A;  4D7S A;  2ZNJ A;  1VQK V;  4GYC B;  4GKK B;  5JQG B;  3WB2 A;  5IYB O;  3PN1 A;  4JYA B;  5LGN A;  4DR6 B;  1YVW A;  4OPH A;  4O4H B;  4PDV A;  4GZR B;  3F7Y C;  3VQV A;  3AK2 A;  2IJI A;  3N27 A;  2WLH A;  4I50 B;  4D7T A;  2R70 A;  3ETQ A;  1MNG A;  1V55 B;  4BIO A;  2ZIO A;  5IY5 C;  2QM7 A;  1Y76 B;  4YY3 B;  4X9Q A;  1WN7 A;  4YJ3 A;  3RWR D;  5JCO C;  1HNW O;  1QR8 A;  4JTD B;  3ZMS A;  5H2F Z;  5B66 Z;  5JCO A;  3CME V;  1L0N H;  1AJP A;  1AR4 A;  2Q9L A;  2BTO A;  4MW8 A;  1DF5 A;  1JFF A;  3N2G B;  1ZUQ A;  3AG7 A;  2QR4 A;  1SZT A;  5B1B B;  5L3B A;  4TV8 A;  4AHC A;  1US6 A;  2HG5 C;  1THZ A;  4UB6 Z;  4NXN B;  4NKG B;  1NT2 B;  4XDL A;  2EBO A;  5EZY A;  1SZX A;  4MW3 A;  1MG1 A;  1N4C A;  5EBM C;  3EVK A;  2CGN A;  4U3J B;  4CC5 A;  5LGU A;  3H9V A;  3CCR V;  2QE7 G;  3CS5 A;  3UT5 A;  5E1A C;  3ZRX A;  3IFX A;  4DR5 O;  4JI0 B;  2GSM B;  3WFV A;  1PNK A;  2LGQ A;  4YXW G;  3X2Q B;  2GUZ A;  4KHP B;  1MAB G;  4F6E A;  4I9Q A;  2X6B A;  1OJH A;  1TA8 A;  4O4L A;  1FKA O;  2R9R B;  1VF5 B;  4K35 A;  4P2Z A;  4PEL A;  5L3F A;  1FFT B;  3HB3 B;  3ZHV A;  3SYO A;  3H01 A;  5LOV B;  1IDS A;  1XHX A;  3IC9 A;  3ZCC A;  3T2M A;  3JYC A;  2QWP B;  4DYL A;  4LH7 A;  1D5N A;  4JI6 B;  1FXK C;  2CH7 A;  3QNE A;  2PZS A;  3CJH A;  5J2T A;  4YJ2 B;  3K57 A;  3L73 H;  5B3S C;  3LSS A;  3B40 A;  1I0H A;  4DV6 B;  5CBH A;  1NTM H;  4MVZ A;  2ZE6 A;  2DWE C;  5CA0 B;  3L74 H;  3OMI B;  4B7K A;  5CB4 A;  5IWA B;  1TUB B;  3FAV A;  3SR2 C;  5CBF A;  2K1E A;  4X1I B;  2C2A A;  2AXT Z;  5FNV B;  2K9P A;  4QGP A;  2IJJ A;  4JI5 O;  2E3C A;  3KCY A;  4UCT A;  1BCC H;  1JA8 A;  3AK1 A;  1N33 O;  3F7V C;  3HKC A;  1W0J G;  4X66 O;  4IHJ A;  1PV0 A;  2N05 A;  5BMV A;  1BL8 A;  2BOC C;  2JVD A;  4LWS B;  2B9Z A;  2Q7H A;  3JAT B;  2ZDI A;  2WLL B;  4MTO A;  2LFS A;  2BTQ A;  5KUM A;  1N32 B;  5KAF Z;  1OCO C;  2IM9 A;  2P4V A;  4YJ3 B;  1VQP V;  1OCC B;  4ZI7 A;  5IJ9 B;  1EZV H;  4IT5 A;  4QJF B;  3K5N A;  1SQG A;  2ZQM A;  2YIB A;  1R6K A;  1U96 A;  3CP1 A;  1NTZ H;  1SQQ H;  1KB9 F;  2OTJ V;  1DLB A;  1N34 B;  1IBM B;  1HNX B;  2EIJ C;  4X62 O;  1IVS A;  4IIJ A;  3E89 A;  4GKJ O;  1YEW A;  2DJV A;  4JI6 O;  1H2L A;  4P9P A;  2VWK A;  5KUK A;  2N04 A;  4LFA B;  1CPY A;  4GUN A;  3L72 H;  2EZO A;  5EZY B;  3K5O A;  4DV6 O;  4B7E A;  2XUM A;  1QHT A;  3ML0 A;  4DR1 B;  3UT5 B;  2GBO A;  5E79 Z;  5LA6 A;  4JAS A;  2KSD A;  1XNR O;  3GWK C;  4ASU G;  2GUZ B;  1ZTE A;  3E83 A;  5GTH Z;  4B3M B;  1H2N A;  4IYI A;  3K06 A;  2NN4 A;  3M99 B;  3AG4 B;  4FMT A;  3JD4 A;  1JVM A;  3RYC B;  1S3J A;  3IGA C;  4TSF G;  1VF6 C;  4R6Z A;  3K9A A;  2A06 H;  1B6Q A;  1ZSP A;  1TGO A;  3CHX A;  2CH7 B;  3SJA C;  2Y4U A;  1WJZ A;  4MVQ A;  4WFG A;  1BQ0 A;  4FPP A;  3CJH B;  4DR2 O;  1K33 A;  2EJR A;  4QNH B;  3RVZ A;  3ZMT A;  2FKX A;  5EC1 C;  2NR5 A;  3VOU A;  3AEI A;  4FFK A;  3THO A;  5CB4 B;  2ZR2 A;  1F7Y A;  3FAV B;  2Q5Z A;  3CSX A;  2W0F C;  1K73 W;  4AI8 A;  1IBL B;  4I4T B;  1KBH A;  4UCO A;  2DMX A;  1MOF A;  1Y74 A;  2ZT9 B;  3CRQ A;  1H2M A;  5LP6 C;  1JR9 A;  1Y4M A;  3C90 A;  2VQF B;  4JI8 O;  1RM1 B;  1Z5V A;  1AJQ A;  1ARO P;  1TVK A;  1GN2 A;  2LFR A;  3HKC B;  4CH4 A;  5J9P C;  1YI2 V;  4ICG A;  4JAA A;  4WFA V;  3JSL A;  4R50 A;  4LNU A;  2CDY A;  1OCZ B;  3QF7 A;  2Y0I A;  4JI3 B;  1S77 D;  1OZ0 A;  1R1B A;  1GKF A;  1SQP H;  1MMM A;  3AG2 C;  2BTQ B;  2KG7 A;  4DUY B;  3ZMZ A;  3R66 A;  1IBK B;  1MSD A;  4CBC A;  2Z3Y A;  3OW2 U;  2E75 B;  4JYB A;  4JTA B;  4WBN A;  2PYL A;  3SPI A;  1M5I A;  2FB5 A;  4EFB A;  5C93 A;  5KA5 A;  4ZHQ B;  4CH3 A;  1KUQ A;  4FM1 A;  2MW2 B;  5GTI Z;  4IIJ B;  1SC5 B;  1PD3 A;  2RCV A;  2FTK A;  3OGI B;  3UO3 A;  2RJZ A;  3ZIA G;  4Q6G A;  5B1O A;  4DV5 B;  4GX1 A;  2ZE8 A;  3SYP A;  1M4U A;  2R9A A;  1BGY H;  4PD4 F;  1D5A A;  2L6L A;  4B3T B;  3CWB H;  4EB6 B;  5H6Q A;  2WLK A;  3CRC A;  1AIL A;  2OCC C;  3QO7 A;  1HP8 A;  1VEW A;  5JH7 A;  2RMK B;  2HKO A;  3ZJZ A;  3CCJ V;  3RFR A;  1Q81 W;  2EIK C;  2QEX V;  2F4V B;  1GN4 A;  1M56 B;  2VQF O;  4LF9 B;  3QTC A;  2WLN A;  2Q0A A;  1PKX A;  2LW7 A;  4TT3 G;  3RYI A;  1VQ6 V;  4DR7 B;  3HKD B;  2JJ1 G;  2QGN A;  4L8J A;  4FLV A;  1KP3 A;  5B1A B;  3HKE B;  4CS4 A;  2EIL B;  2QKC A;  3CCE V;  1OCR C;  1SET A;  4YHH B;  1N8R W;  3ZHR A;  3I55 V;  1FYJ A;  1ROP A;  4DV0 O;  2UXC O;  3CC2 V;  2FL4 A;  1XL6 A;  3LSQ A;  2A79 B;  4RUF A;  1AB3 A;  1Y66 A;  4I9W A;  1M57 C;  4PI0 A;  2ARH A;  3FKS G;  4LF4 O;  2Q8V A;  3FB6 C;  1BS3 A;  2F1M A;  2WA4 A;  1H2G A;  1KKC A;  2Y4T A;  2HVJ C;  4O4I B;  2ITD C;  4JAU A;  2ILM A;  3ZHS A;  1XIL A;  1K34 A;  1Y74 B;  3ZRW A;  1F4M A;  4O2A A;  5J2U A;  4N21 A;  1VQ5 V;  2BE3 A;  1ZWI C;  5B1B C;  3N2K A;  1P4R A;  1TVK B;  2LGW A;  2V4D A;  4WF9 V;  2IU3 A;  5D5P A;  3F5T A;  4X1Y A;  4A5U B;  3ZED A;  2EIN C;  1WAZ A;  2XAJ A;  3CCV V;  1PL4 A;  4K0K O;  4MTF A;  3KZI Z;  1EZJ A;  4X65 O;  2V7Q G;  5A2Q N;  5JJJ B;  2F23 A;  4UV8 A;  5KHH A;  4B3S O;  2OYQ A;  4JI2 O;  4LFC O;  4DV4 O;  1EM1 A;  1RFY A;  1HNW B;  2WLJ A;  3EHB B;  3K08 A;  4WCE V;  1VMG A;  3BA8 A;  1GN3 A;  4XDK A;  2WWW A;  2Q6A A;  3RVY A;  1O9H A;  1QLN A;  1W2B U;  1KU9 A;  5KHG A;  4FLX A;  4WBN B;  3ICX A;  4E4E A;  1MA1 A;  3T1Y O;  1BZK A;  2ADP A;  3C3T A;  4LF8 O;  4G2K A;  2WAM A;  3SJC C;  2QTS A;  4MVM A;  2QJ1 A;  2P22 C;  1AI5 A;  1QVG U;  1HW7 A;  2X0L A;  4YHH O;  1NTK H;  2EUL A;  3VQX A;  1F4N A;  4FLT A;  2WA3 A;  3Q4H B;  5LBQ A;  4LFB O;  4PV1 B;  5KHJ A;  3T4D A;  3RYF B;  1VQM V;  2F66 C;  1JJO A;  3JSN A;  4DR5 B;  5JWP A;  1PP9 H;  2XAS A;  5LMU O;  5K1P A;  3SYC A;  2QKA A;  4H33 A; 
#chains in the Genus database with same CATH homology
 4NYK A;  3N27 A;  4FZ1 A;  2FB5 A;  1WP8 A;  4FZ0 A;  3IJ4 A;  2L35 A;  3S3W A;  4NTY A;  2QTS A;  1WP7 A;  4NTX A;  3S3X A;  4NTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...