3IJ4A

Cesium sites in the crystal structure of a functional acid sensing ion channel in the desensitized state
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
406
structure length
406
Chain Sequence
VWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amiloride-sensitive cation channel 2, neuronal
publication title Pore architecture and ion sites in acid-sensing ion channels and P2X receptors.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein
total genus 97
structure length 406
sequence length 406
ec nomenclature
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3ij4A01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 3ij4A04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 3ij4A03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 3ij4A02
4NTYA 4NTXA 2QTSA 4NTWA 4FZ0A 3S3XA 2FB5A 3S3WA 2L35A 1WP7A 1WP8A 3IJ4A 3N27A 4FZ1A 4NYKA
chains in the Genus database with same CATH superfamily
2PY5A 1Q5OA 3K0DA 4JYCA 1SQXH 2UXDB 4FLVA 4TT3G 2ZCEA 4LF8B 4BIOA 2EZPA 3SYOA 4EB6B 3G6EV 5B1OA 1PL0A 3JATA 4I50B 1RFYA 2X6AA 5HFMA 2NLJC 2B5UA 3SJQC 1I5YA 1GH6A 4P9PA 4I55A 4O2AA 1Y67A 2ZE6A 4LF4O 1N34O 4X65O 2V7QG 4EEQA 3QVNA 1ZL8A 2PI4A 4Z1VA 3HKCB 5KMGB 1R3KC 1K73W 1SRYA 2KQXA 2A9HA 1I5XA 4DR2B 1CXZB 3OEEG 4RQFA 1DGSA 1VQ4V 3ASOC 4J11A 1O9GA 2ARHA 1JFFA 3GWOA 1OCZB 2UUBO 2QWRB 4DV3B 1QVGU 1N8RW 1Q8IA 1SQVH 4WCEV 2HHHO 2PUSA 2V4DA 5LMUB 2QGNA 1AR1B 1KMIZ 1SS3A 1S72V 4CH6A 1EFRG 4LWSA 4JV5B 4JI8B 3TGUH 5KHJA 1JCHA 3CMAV 2XAHA 4TV8A 2JEUA 4DUZO 5FNVB 3SYQA 4CZZA 1OCCC 2V1DA 5LOVB 2AHZA 4R50A 1AR4A 3K58A 2BSKA 5L3BA 3A0RA 3ZN1A 4B3RO 1AB3A 4OX9B 1S5HC 3U11A 2VQEO 4I4TA 5BMVB 1YJ9V 4H0LB 1HNZB 1BS3A 4H44B 1EN5A 3UM7A 2LFSA 1SA0A 2JS3A 5ITZB 3T1YB 3BVOA 2EBOA 4Z2WA 3VBBA 4XDJA 2IJIA 1K33A 2PTMA 5JJNB 4DV7B 3ASNB 4N21A 4JASA 2YI8A 4DR1B 4FIPC 3L74H 4NTYA 3OMIB 5GTIZ 1M1KW 4NXNB 1QNMA 3VOUA 2ZNIA 1GTOA 2YXLA 2Q68A 5KA6A 4MVOA 4F4LA 3TJTA 1JA8A 1JMKC 3CEIA 4FZ1A 1XMOO 4LFCO 2YIDA 4LBEC 4J9ZB 4LF6B 2AXTZ 3OAAG 4TUYB 4DK0A 3ZHUA 5BR8B 3RYHB 2BCCH 1QBZA 4ZI7A 4QPKA 3H9VA 5LP6B 5JH7A 3UT5B 1R6NA 5FL7G 4MVUA 4JTCB 3CC2V 2NN4A 2H94A 4HBNA 2UUCO 3OGCC 4DR4O 2RDCA 4DV2O 1M93A 3WB0A 3LSUA 2FB5A 1QLNA 2CUGA 3CCJV 4EFEA 4EFBA 2YIBA 3FAVA 3ZIAG 4X1IB 1FXKC 3MHHC 4B3TO 3ABUA 1Q86W 2ODMA 1JJOA 4LCUC 1G8MA 3DXRA 1LR1A 1PNMA 3IC7A 1WA8B 2ZE8A 5IWAB 3E22A 2ILMA 4I9WA 4B3MB 2F1MA 1U97A 1US6A 1KB9F 3E89A 1HR0B 2QSAA 1Z5WA 2DN9A 4O2BB 2HKOA 3NXSA 4IHJA 4O4IA 5B1BB 2EULA 4X64O 4J9YB 4GUNA 3EVKA 4KUMA 3FFQA 3CXHF 1Q6HA 1Y74B 1QQCA 4PA9A 2GDSA 3JAWA 1X59A 3OD4A 1GN2A 4FLWA 4ZOLA 1FFXA 3AG1B 1BSMA 1P49A 2ZM6B 3K79A 5EK0A 1MZEA 3AG4C 3CCSV 3T4ZA 5J9PC 3MAQA 2Q7GA 4PA4A 4J42A 1NVPB 1XI1A 2IH1C 4DV0B 3VQYA 3KG2A 3FX7A 4FFKA 4EB6A 2GV9A 3CCMV 4I50A 2QKSA 3JALB 3W7TA 3CHXA 4K8ZA 1BQZA 4W4LA 2BTQB 1Q7YW 3J7AU 4X66O 1NZ6A 2P90A 4HNAA 3JASB 2DYRC 3BHPA 2UUAB 1DTOA 2YDEA 1ZTEA 1MSDA 4X1KB 3HKCA 5KMGA 1VIBA 1QVFU 1J95A 2LGQA 4JI5O 1FYJA 4DK1A 2N04A 5IY5C 3LDDA 2QWOB 3EXAA 2CE4A 2JEXA 5LGUA 3WFVA 2GUZB 4FFBB 4TV9A 3JARA 4JI3O 3LNNA 1OCRC 1I94O 2PF4E 4GT1A 3QO8A 3A0BZ 3KKYA 2VQFB 2XTAA 4C7UA 3RBZA 3F7YC 4MS2A 3CPWU 4QJFB 5LHIA 5GW7A 5LYJB 2DE0X 5FNVA 4KXRA 4DUYO 3FKSG 1SETA 4JZGA 5LOVA 4R8CA 2HFEC 3FB6C 3HKEA 3BRCA 2DQ0A 1H8EG 1K5QA 1JVMA 4YY3O 2Y0PA 4ICGA 2ZE5A 4NXMO 3I55V 3K03A 4DW0A 4ASUG 2EINB 4LH7A 4K0KO 5KAIZ 1BMFG 5H5NA 2WLHA 4LF7B 3TXQA 2R70A 3TETA 3ZHQA 4JI1O 5ITZA 1T5EA 4PJ0Z 3LDEA 5H6RA 3WU2Z 2ITDC 1R3IC 4JI0O 2QDOA 1AJQA 1IXBA 1YF2A 4DO2A 1V54C 4D7TA 1N36B 1NJIW 2E75B 1FFTB 1TUEB 2UU9O 4O4LB 2WAMA 4LR3A 3OUFA 3P3PA 1G4YB 2CTQA 3ABTA 3G4SV 1HNXO 4MT8A 3K59A 4RWUA 2EIJB 4NKGB 5C8YA 3W7SA 4G28B 3CCQV 5KUMA 1F51A 4TUYA 4WFEA 3RYHA 1GN4A 2LW1A 2EIKB 4H37A 2JS5A 3STLC 4BIZA 3QNEA 1EN4A 3IGAC 1OCOB 1Q6IA 5LP6A 3CE2A 1AI5A 1GM8A 2X7RB 2RJZA 1S5LZ 4LFBO 2FL4A 1KKDA 3RYFB 2JVDA 1XILA 3DC6A 2AW9A 3DGEA 5LBQA 1PP9H 1FXHA 5LMNO 1H2LA 1K3EA 2WLIB 4LFAO 4CS4A 1XEQA 5L3DA 1PM9A 2Y69B 4X9QA 4X1IA 3K57A 2QWPB 1AP6A 2Q6AA 3F7VC 3JAKB 1WA8A 5DN6G 5HFLA 3F5TA 3P3NA 1HNWO 1URFA 4OPHA 2HLDG 2HVKC 4TWKA 5BZBA 4O2BA 2DQ3A 2OIGA 1IDSA 2K1EA 4K3AA 4Q6GA 1EN6A 1CP9A 4JYYA 5EYPA 5B3SB 1L0NH 2EZOA 4FJCC 1SQPH 3SPIA 1Y74A 2IH3C 2YUAA 4JYAO 1GM7A 1J5EB 1M4UA 2ZDIC 3OW2U 5FPOA 4GX5A 5H6QA 1TVKB 5J2TB 5K1PA 3ZX6A 2HP8A 4JZ2A 3OMAB 5CB4A 4NTWA 4DV5B 2UXCO 4JAAA 4GCZA 2A79B 4P2ZA 5JVDB 2IU0A 1LUVA 2OCCB 4U3JB 4XDKA 4PA6A 4AHCA 2F43G 3ETEA 4DR6B 1RP3B 1YITV 5CBFA 4YXWG 3JALA 4PDLA 1S0VA 4PI2A 4DV6B 2BTQA 2EX3A 1N4CA 2JGUA 4F6RB 3RN4A 1KP3A 3JASA 4DRXB 2ZKOA 1WN7A 4YIOA 1I08A 1Q43A 4X1KA 2CDYA 3N2GB 2R9AA 1PV0A 3A0HZ 1K4CC 1PKXA 4BR6A 5KUKA 2GUZA 3OT7A 1M56C 1FD9A 1ZSPA 3OR7C 4FMTA 4MVRA 1BZKA 3CRMA 2NNUA 3ABLC 3AEIA 1RSOB 2QWQB 3SR2C 1RPOA 3AG2C 3BAAA 2WLLB 4P9OA 3QO5A 1VP7A 3B8MA 2PZSA 4L8JA 4UVBA 1RM1B 2UXDO 2E74B 1R73A 2IU3A 5EBWC 2QR4A 3L70H 1V55C 5LYJA 4LF8O 3ABKB 1JX9A 5B1NA 2FYUH 5AG2A 2EILC 3K5LA 3ZN0A 2YIBD 1YHQV 3ZMSA 3K3WA 3CX5F 1N32B 1VQ6V 3N2KB 1XNRB 2DYSB 2JRIA 4LP8A 1MZFA 4FLTA 1B06A 4JTDB 2WLJA 1X4TA 3M7MX 4PA3A 2L6LA 3AK2A 4Z1MG 4H13B 4DR2O 2H8PC 1KC8W 2QM4A 3HR0A 2WA3A 3BPZA 1YDXA 2GTAA 4JTAB 4A5UB 4DV3O 1NTKH 1JR9A 4O4LA 2O57A 1UFIA 3CCVV 2MW2B 2YEVB 4RUEA 5LMUO 4FM1A 3AG3C 1LUWA 2CTRA 2ADPA 2GHYA 1GM9A 3CB2A 1XNQB 4JV5O 4JI8O 4E2LA 2Q8VA 3WG7B 4PDRA 1QLEB 1E79G 5CMUA 4LF4B 2JGDA 2OYQA 3E8HA 2QM7A 4E4EA 3ABMB 4RAIA 5KAFZ 2ZR3A 3ZRXA 2DMXA 1DLBA 1VMGA 4LC1A 3U0ZA 5EBLC 4OXSA 2ZT9B 1H2MA 1MG1A 5IYZB 4OX9O 3FB7C 3RYFA 3CWBH 2ZXWC 4O4HB 4WFFA 4LNUB 3ML0A 1HNZO 4JYBA 1KYOF 2WLIA 4MVSA 2ATKC 5KLVH 1VF6C 3IFXA 2G38A 3SGIA 3I5DA 5IYCO 4X1YB 1W59A 2R9RB 4DV7O 5B1AB 3E35A 3D3QA 3HPLC 3JAKA 3JYCA 2OTLV 4DR1O 2VWJA 2RMKB 3OEHG 4NXNO 2HEPA 3ZHTA 4IYIA 4U3FH 5CA3A 1IXMA 1F4MA 2E76B 3B77A 1AP5A 3OR6C 4LF6O 2HVJC 3AG7A 4B3SB 1PNLA 4NR1A 1XREA 4KP4A 3CS5A 5BR8O 3SJBC 1B04A 4UB6Z 4JAVA 2Y4UA 1MMMA 1TVKA 5J2TA 4JI7B 1YZBA 2W0XA 2Z3YA 3BA8A 1XDCA 2ZINA 2FTKA 2LGWA 1SZTA 3SYCA 5JVDA 1TGOA 3RW0A 3C3SA 2ZQMA 4LH6A 4KL1A 1AVMA 4H33A 3ZHRA 3ASOB 4MW3A 1ZLZA 5LGTA 4BAYA 2QA4V 4RUFA 1KBHA 1Q81W 1P4RA 4F6RA 4DRXA 4BW5A 2C2AA 4GKJB 5IWAO 1QHTA 2M6YA 3B09A 1JJ2U 3D36A 4PELA 4B3MO 4IGGA 2RCVA 3N2GA 2QM8A 3T4DA 1IBKB 1HR0O 2MK3A 1MSWD 5LA6B 1NI8A 2PI5A 3CRQA 4BWAA 1OCCB 2A3QA 2VRZA 3UKMA 1YI2V 4PD4F 2RQ6A 1WPBA 3CCUV 1N33B 2LFRA 3RYIB 4DR4B 3CRCA 3T2MA 1N0JA 2ZM6O 2EJRA 2EIMC 1VQPV 3SDLA 4DV0O 1BT8A 3BCCH 1BQ0A 1KD1W 2IJJA 2XAFA 5JCOA 4FLUA 4TOIA 3EFFK 1B3QA 4X20B 4EKWA 2YC0A 3N2KA 2ZIOA 2Z5UA 2HG5C 3ZMZA 3GWKC 3LUTB 3J81N 1ORQC 2CGNA 3UO3A 3RVYA 4CH5A 1K97A 4YHHB 2UUAO 1Y76B 4GKKB 5LXTB 1W0KG 1LNQA 1YTFB 4MVQA 2NR5A 3HKBB 3DC5A 3VQWA 3AK3A 5TISZ 2JJ2G 5LHHA 4P30A 3K04A 2XHBA 2ADQB 3FB5C 1M57C 5H9CA 5IYDO 3Q4HB 4HAMA 2N05A 2YEVA 5IE9A 2VQFO 3SPCA 2F93B 2UXBO 1FAFA 4Q20A 2QEXV 5JQGB 1NVPD 1K8AW 2QKAA 4IIJB 5CN0A 3J80N 1QR8A 4BIUA 1Q3EA 2QWNB 4RQEA 2IW5A 1K34A 1B6QA 2Z0AA 1BGYH 1FXKB 2P4VA 3ZBHA 3KZIZ 3JCZA 2Q73A 4WFGA 4XDLA 1H2KA 5IYZA 4CC5A 2IM9A 4DV4B 4UCRA 4LNUA 4JI3B 4LF7O 4UXNA 2AZ0A 2F4VB 1K5SA 1L1FA 3CRAA 4I9QA 1PD3A 4UV9A 5BMVA 2Y4TA 1H2SB 4MSWC 1N36O 3HKDB 5F2VO 3PJSK 2JK5C 4YIPA 2WWWA 4DR5B 5B66Z 4JI2B 1YSCA 4UCSA 3CCLV 3JD0A 4GX2A 4DXWA 3RYCB 1KQSU 3AG4B 1V9PA 1A32A 4LF9O 1GKFA 1HW7A 1WPXA 1VQ9V 3RVZA 1NS1A 2CAZC 3TK1A 1I0HA 1BCCH 3ETDA 3DTUB 4I55B 1VQMV 3APOA 3OMNB 4CH3A 4KHPO 4G27B 5IJ9B 1IBLB 3CC4V 1PL4A 2E5LB 5GTHZ 5DECA 2DYRB 2AHYA 4UCVA 3X2QC 5L3EA 1NBMG 4JI4O 3STZC 1YXBA 1FS0G 2ZNJA 5IY5B 3T1HB 5EZYB 2PYLA 3LSQA 1AILA 3D3IA 2XNDG 2BOCC 3UT5A 1AROP 2DJVA 3JSNA 2AGAA 2AZ2A 3P30A 2FKXA 3H1LH 3D36C 1FXVA 3VQXA 3KCYA 3BY6A 1OCRB 3OE7G 2DOSA 4WFAV 2W0FC 1JOYA 3FYIB 5CA1B 4LF5B 3O65A 2IJKA 1NH2B 5KX5B 1FJGB 3E86A 1G1XB 1GN6A 4ABMA 5LA6A 1P7GA 3RWRD 1GO3F 2F95B 4DW1A 3OGIB 3OTOO 5BXZA 3K06A 4DR7B 2X6CA 1R3JC 3S3WA 4IL6Z 2VWKA 2A7WA 1J5EO 3JD2A 1JQ0A 2Q0OC 4DV1B 4G2KA 1K92A 3RYIA 3P32A 4DV5O 4WF9V 3PN1A 1HWYA 4FVMA 2JIZG 1Y4MA 1XL6A 4DR6O 4QGPA 3QG5A 1NH2D 4DV6O 1V54B 1S77D 2XAJA 2YIAA 5J2UB 4NVPA 1QR9A 1VQ5V 3CXCU 1KU9A 1Y76A 2WLMA 1OJHA 1IVSA 3I56V 3UO2A 3HKBA 1NTZH 2UXXA 1H38A 1AI6A 3W7UA 1Z2GA 4JI6B 3JAMN 1XBLA 5B5EZ 2QJ1A 1MA1A 1ZAUA 2UXCB 1WB8A 1OCZC 3B40A 4DR3B 1XMQB 3Q4HA 1Q90D 1M9NA 3K0GA 4FFBA 3BFRA 4WBNB 2BOBC 2DWEC 1MOFA 5KHIA 4IIJA 1SQQH 5IJ0B 3SYAA 4K35A 2D2CB 2W6JG 2XUMA 4ZBMA 1FXKA 4QPJA 3APQA 4YJ3B 1N32O 1VQKV 3IJ4A 1XNRO 2OT5A 3G80A 5KHKA 1NU1H 4X62B 4MW8A 1AJPA 1KECA 1YVWA 2HJFC 2K9PA 1UJWB 1HDJA 3E8GA 4IHJB 3W7XA 2Q7HA 1GMGA 1F4NA 5GONB 5EBMC 3TXSA 4AQYB 3CYOA 3CMEV 1JPXA 4BW9A 1W0JG 4PI0A 4AI8A 1ENVA 2Q5ZA 2LO1A 4PDVA 4KFMA 1E1RG 2OWOA 1SQBH 4U7NA 4IYHA 3QO7A 1CPYA 1SF9A 2BTOA 3HKDA 4UFZA 3ASNC 1TUBB 1F7YA 4HYOA 2QTSA 3RYCA 1IBMB 3ZMVA 5FPRA 2Q4PA 1VQ8V 1XNQO 3E8BA 4N23A 3OTFA 1M90W 5IDJA 3MD0A 1N0NA 4HNAB 1D5AA 1HP8A 5IJ9A 3B4SA 3TCUA 4PA7A 3SJAC 1D2DA 3R65A 4B7KA 3S3XA 2GTSA 3T1CA 3SPGA 5EC1C 5LP6C 3ICXA 4J10A 4X89A 1N34B 4X65B 5JWPA 3SPJA 1UPGA 3SPHA 4TV9B 1VF7A 2W6IG 1WP8A 3JARB 5EZYA 3SJCC 2HJDA 1WJZA 4CS2A 4QE9A 2YS8A 1M5IA 1M56B 3L72H 3ZRSA 1NR1A 4JF3A 2QE7G 4MTXA 3GVMA 5DEDA 2UUBB 3ABLB 2X6BA 3K08A 3NR7A 3K5MA 5CA1A 2GBOA 3ZRWB 3T1YO 5A9GA 5KX5A 3EHBB 1P84F 2Q69A 1DF4A 3AG2B 2R9IA 2ITCC 2PGGA 2HHHB 4FK5C 1YJWV 1THZA 1NKDA 5EIBD 1V55B 2KB1A 3HKEB 3FYEB 5B1BC 4B3SO 3RFRA 2EILB 2XAQA 2ZD9A 2Y48A 4YJ2B 4DUZB 1W2BU 2CGOA 3HB3B 4JI7O 5CA0B 4MTFA 2WA4A 3UQ8A 4J80A 3B8NA 3A2FA 2LP7A 3A8TA 1VQOV 3AG1C 3SYPA 3ZCCA 2A06H 4B3RB 4FPPA 3H1HH 1OHHG 4MTOA 2VQEB 3UCSC 2EJ7A 4UUJC 4FLXA 2WPDG 1SKVA 4CH4A 1XUQA 4U3JA 1NR7A 1L0LH 5J2UA 4GKJO 3IC9A 3C3TA 2YI9A 5C8YB 1R6KA 4NYKA 3AG3B 1D5NA 1WP7A 1IBKO 4FM0A 5KA5A 3H1KH 5BY1A 3ZHSA 4UCOA 2RNBA 4J41A 5DM6V 2B1GA 3E2EA 1SZXA 3H1JH 4B08A 4LFCB 1XMOB 2B1IA 3G71V 2E3CA 5KHHA 1SQFA 4CBCA 5KHGA 4CS3A 3L75H 1NT2B 1NTMH 2CK3G 1N33O 4GYCB 4XBFA 1ROPA 3W7WA 4WFBV 1DF5A 4WBNA 2ZXWB 3OFNG 1YIJV 5IYBO 1L8DA 2XT9A 5IT9N 4FLZA 5IJ0A 1RSOA 2JJ1G 3ZHVA 2UUCB 1SC5B 2WLLA 1GK9A 1SESA 3MHSC 5D5PA 4DV2B 4YJ3A 3THOA 4X88A 1BE3H 1S76D 3BEHA 2KG7B 3QF7A 4B3TB 3D8CA 2XAGA 4R6ZA 1U96A 3LDCA 2D3OW 2P06A 1K7DA 3CJHB 4YHHO 3K9SA 4GKKO 2Q9LA 5GONA 2EINC 3N27A 5EYPB 1GRJA 4QE7A 1KUQA 1YCIA 3ZMUA 4X64B 2Q7EA 5CB4B 3ZS8C 2ZDIA 2A0LA 3DSQA 2YICA 4UV8A 1RPRA 2CH7B 1TUBA 3R66A 4OPAA 2F23A 4D6TH 1S5JA 2IJHA 3JD1A 1PNKA 2KKWA 4TQFA 1VF5B 3L71H 3M99B 3MDSA 2XASA 3IAYA 4UCUA 3M8AA 4ZHQB 2OIEA 3LNMB 2EIJC 3WB1A 2PYJA 3JD3A 2Q67A 5FLXN 1IX9A 3FB8C 1EZJA 3K9AA 4I0XB 4CC6A 4NB5A 4JAUA 1WAZA 2H3OA 2EIKC 2KSDA 3CD6V 4X66B 4O4JB 3ZRVA 1ZUQA 3CCRV 1OCOC 1KKCA 3GB7C 4UB8Z 1I7FA 4DV4O 3K5NA 1YTFD 2B9ZA 4GLXA 1AR5A 2ETNA 1XQ8A 2F4VO 1MNGA 5L3GA 4JI5B 1P7BA 4FLYA 1GAXA 1FKAO 1K9MW 4OGQB 5CBHA 5CBGA 4O4HA 1F23A 3ZEDA 2Y69C 1SQGA 4K8XA 1OZ0A 2UXBB 3CP1A 1BL8A 3RGBA 3ZRWA 1IURA 3CC7V 4DR5O 4JI2O 1I94B 1S3JA 3G67A 2Y0IA 2P67A 1R1BA 3WB2A 2CTWA 4X1YA 4I5SA 5H2FZ 2EIMB 4UVCA 2ZR2A 4W4KA 4FZ0A 2YXHA 1Q6UA 3QTCA 1H8HG 4YJ2A 4GZRB 3BA9A 4PDMA 4DUYB 3JATB 5B3SC 3G6BA 1IBLO 1EBOA 5CA0A 1IZ3A 5LGNA 2M7WA 2E5LO 1R6TA 4YY3B 3E83A 3LSSA 1E1QG 4ZKIA 4O2AB 3CRRA 4NXMB 3O9OA 1R3LC 3U10A 4GX1A 4K0KB 5LHGA 3F5WC 3H01A 1ZL8B 4F6EA 3T1HO 2OCCC 5JJEB 4J7ZA 1QU7A 3E8FA 1XOUA 4JI1B 4JGSA 1ZWIC 5K1XA 3ZJZA 2P6JA 4JI0B 1JFFB 1VEWA 1FPOA 1XL4A 4LF9B 1M57B 4LF5O 1K4DC 1O9HA 1G6UA 2ZIMA 2UU9B 1FJGO 2WLKA 2WSSG 4UCTA 1WLEA 1BHBA 2JGDB 4KHPB 2UXNA 1QCEA 4MVZA 1HNXB 4LWSB 1VQLV 2YXYA 4WFHA 1DK1A 4DR7O 1AI4A 5D5QA 4TV8B 3ETQA 4X8AA 2YSUB 1BHAA 1WNSA 1TA8A 1WB7A 2R72A 2JDIG 3H1IH 4DV1O 4JI4B 2GSMB 1EM1A 4MTGA 1VQNV 2RN9A 1Y66A 4MVMA 2BSKB 2P4KA 2HR3A 4LFBB 1AJNA 2L35A 5E1AC 5EC2C 4I4TB 1RM1C 4FM2A 1VF6A 1AI7A 5LMNB 2P5OA 2QKCA 1SA0B 3ABKC 1OV9A 4LFAB 2LW7A 5JCOC 4J7JA 2KG7A 1Y6XA 2LQTA 4U7OA 3KCXA 4ZIBA 1XHZA 1TAEA 1VQ7V 2WLNA 3OM3B 4NTXA 2DYSC 3CJHA 3OTOB 4X20A 2P22C 1EZVH 4RO2A 2OTJV 1PPJH 4J7KA 3VQVA 1HNWB 2N74A 3JCUZ 3L9DA 4QIWF 3K5OA 3JSLA 1XHXA 5LXTA 4JI6O 2XOKG 2DW4A 5A2QN 2BE3A 4GX0A 4QNHB 1YJNV 4DR3O 3AK1A 4JYAB 2CH7A 4L87A 1H2GA 1XMQO 3OUSA 2ZE7A 3BABA 4ZI7B 4HZ3A 1CEZA 4R7CA 1H2NA 5JH7B 3X2QB 3FD9A 5L3FA 2FMLA 2Q0AA 4PHZA 4ZHQA 1SERA 5EIBC 1MABG 1NQTA 4AILC 4D7SA 3WG7C 1QLEC 5JQGA 4I0XA 2LJ2A 5L3CA 2P7TC 2IBZH 3FAVB 4PV1B 1VARA 4X62O 3ABMC 1COWG 4DYLA 2F66C 4O4JA 1YEWA 3CCEV 3JD4A 3DXRB 1Q82W 2X0LA 4TSFG 3C90A 3E22B 3ZMTA 2CTPA 1Z5VA 2QTOA 5JJJB 1ZX3A 3L73H 4AQYO 5LL6Y 2OCHA 3B2EE 4O4IB 4IT5A 5E79Z 4JPRA 4I7ZB 5C93A 3CSXA 1KP2A 2DWDC 2VS0A 5B1AC 3ETGA 3JAWB 4TQDA 1IBMO 4ZOLB 1FFXB 4UVAA 3RT3C 4B7EA 1GN3A
chains in the Genus database with same CATH topology
4NTYA 4NTXA 2QTSA 4NTWA 4FZ0A 3S3XA 2FB5A 3S3WA 2L35A 1WP7A 1WP8A 3IJ4A 3N27A 4FZ1A 4NYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTY A;  4NTX A;  2QTS A;  4NTW A;  4FZ0 A;  3S3X A;  2FB5 A;  3S3W A;  2L35 A;  1WP7 A;  1WP8 A;  3IJ4 A;  3N27 A;  4FZ1 A;  4NYK A; 
#chains in the Genus database with same CATH topology
 2PY5 A;  1Q5O A;  3K0D A;  4JYC A;  1SQX H;  2UXD B;  4FLV A;  4TT3 G;  2ZCE A;  4LF8 B;  4BIO A;  2EZP A;  3SYO A;  4EB6 B;  3G6E V;  5B1O A;  1PL0 A;  3JAT A;  4I50 B;  1RFY A;  2X6A A;  5HFM A;  2NLJ C;  2B5U A;  3SJQ C;  1I5Y A;  1GH6 A;  4P9P A;  4I55 A;  4O2A A;  1Y67 A;  2ZE6 A;  4LF4 O;  1N34 O;  4X65 O;  2V7Q G;  4EEQ A;  3QVN A;  1ZL8 A;  2PI4 A;  4Z1V A;  3HKC B;  5KMG B;  1R3K C;  1K73 W;  1SRY A;  2KQX A;  2A9H A;  1I5X A;  4DR2 B;  1CXZ B;  3OEE G;  4RQF A;  1DGS A;  1VQ4 V;  3ASO C;  4J11 A;  1O9G A;  2ARH A;  1JFF A;  3GWO A;  1OCZ B;  2UUB O;  2QWR B;  4DV3 B;  1QVG U;  1N8R W;  1Q8I A;  1SQV H;  4WCE V;  2HHH O;  2PUS A;  2V4D A;  5LMU B;  2QGN A;  1AR1 B;  1KMI Z;  1SS3 A;  1S72 V;  4CH6 A;  1EFR G;  4LWS A;  4JV5 B;  4JI8 B;  3TGU H;  5KHJ A;  1JCH A;  3CMA V;  2XAH A;  4TV8 A;  2JEU A;  4DUZ O;  5FNV B;  3SYQ A;  4CZZ A;  1OCC C;  2V1D A;  5LOV B;  2AHZ A;  4R50 A;  1AR4 A;  3K58 A;  2BSK A;  5L3B A;  3A0R A;  3ZN1 A;  4B3R O;  1AB3 A;  4OX9 B;  1S5H C;  3U11 A;  2VQE O;  4I4T A;  5BMV B;  1YJ9 V;  4H0L B;  1HNZ B;  1BS3 A;  4H44 B;  1EN5 A;  3UM7 A;  2LFS A;  1SA0 A;  2JS3 A;  5ITZ B;  3T1Y B;  3BVO A;  2EBO A;  4Z2W A;  3VBB A;  4XDJ A;  2IJI A;  1K33 A;  2PTM A;  5JJN B;  4DV7 B;  3ASN B;  4N21 A;  4JAS A;  2YI8 A;  4DR1 B;  4FIP C;  3L74 H;  4NTY A;  3OMI B;  5GTI Z;  1M1K W;  4NXN B;  1QNM A;  3VOU A;  2ZNI A;  1GTO A;  2YXL A;  2Q68 A;  5KA6 A;  4MVO A;  4F4L A;  3TJT A;  1JA8 A;  1JMK C;  3CEI A;  4FZ1 A;  1XMO O;  4LFC O;  2YID A;  4LBE C;  4J9Z B;  4LF6 B;  2AXT Z;  3OAA G;  4TUY B;  4DK0 A;  3ZHU A;  5BR8 B;  3RYH B;  2BCC H;  1QBZ A;  4ZI7 A;  4QPK A;  3H9V A;  5LP6 B;  5JH7 A;  3UT5 B;  1R6N A;  5FL7 G;  4MVU A;  4JTC B;  3CC2 V;  2NN4 A;  2H94 A;  4HBN A;  2UUC O;  3OGC C;  4DR4 O;  2RDC A;  4DV2 O;  1M93 A;  3WB0 A;  3LSU A;  2FB5 A;  1QLN A;  2CUG A;  3CCJ V;  4EFE A;  4EFB A;  2YIB A;  3FAV A;  3ZIA G;  4X1I B;  1FXK C;  3MHH C;  4B3T O;  3ABU A;  1Q86 W;  2ODM A;  1JJO A;  4LCU C;  1G8M A;  3DXR A;  1LR1 A;  1PNM A;  3IC7 A;  1WA8 B;  2ZE8 A;  5IWA B;  3E22 A;  2ILM A;  4I9W A;  4B3M B;  2F1M A;  1U97 A;  1US6 A;  1KB9 F;  3E89 A;  1HR0 B;  2QSA A;  1Z5W A;  2DN9 A;  4O2B B;  2HKO A;  3NXS A;  4IHJ A;  4O4I A;  5B1B B;  2EUL A;  4X64 O;  4J9Y B;  4GUN A;  3EVK A;  4KUM A;  3FFQ A;  3CXH F;  1Q6H A;  1Y74 B;  1QQC A;  4PA9 A;  2GDS A;  3JAW A;  1X59 A;  3OD4 A;  1GN2 A;  4FLW A;  4ZOL A;  1FFX A;  3AG1 B;  1BSM A;  1P49 A;  2ZM6 B;  3K79 A;  5EK0 A;  1MZE A;  3AG4 C;  3CCS V;  3T4Z A;  5J9P C;  3MAQ A;  2Q7G A;  4PA4 A;  4J42 A;  1NVP B;  1XI1 A;  2IH1 C;  4DV0 B;  3VQY A;  3KG2 A;  3FX7 A;  4FFK A;  4EB6 A;  2GV9 A;  3CCM V;  4I50 A;  2QKS A;  3JAL B;  3W7T A;  3CHX A;  4K8Z A;  1BQZ A;  4W4L A;  2BTQ B;  1Q7Y W;  3J7A U;  4X66 O;  1NZ6 A;  2P90 A;  4HNA A;  3JAS B;  2DYR C;  3BHP A;  2UUA B;  1DTO A;  2YDE A;  1ZTE A;  1MSD A;  4X1K B;  3HKC A;  5KMG A;  1VIB A;  1QVF U;  1J95 A;  2LGQ A;  4JI5 O;  1FYJ A;  4DK1 A;  2N04 A;  5IY5 C;  3LDD A;  2QWO B;  3EXA A;  2CE4 A;  2JEX A;  5LGU A;  3WFV A;  2GUZ B;  4FFB B;  4TV9 A;  3JAR A;  4JI3 O;  3LNN A;  1OCR C;  1I94 O;  2PF4 E;  4GT1 A;  3QO8 A;  3A0B Z;  3KKY A;  2VQF B;  2XTA A;  4C7U A;  3RBZ A;  3F7Y C;  4MS2 A;  3CPW U;  4QJF B;  5LHI A;  5GW7 A;  5LYJ B;  2DE0 X;  5FNV A;  4KXR A;  4DUY O;  3FKS G;  1SET A;  4JZG A;  5LOV A;  4R8C A;  2HFE C;  3FB6 C;  3HKE A;  3BRC A;  2DQ0 A;  1H8E G;  1K5Q A;  1JVM A;  4YY3 O;  2Y0P A;  4ICG A;  2ZE5 A;  4NXM O;  3I55 V;  3K03 A;  4DW0 A;  4ASU G;  2EIN B;  4LH7 A;  4K0K O;  5KAI Z;  1BMF G;  5H5N A;  2WLH A;  4LF7 B;  3TXQ A;  2R70 A;  3TET A;  3ZHQ A;  4JI1 O;  5ITZ A;  1T5E A;  4PJ0 Z;  3LDE A;  5H6R A;  3WU2 Z;  2ITD C;  1R3I C;  4JI0 O;  2QDO A;  1AJQ A;  1IXB A;  1YF2 A;  4DO2 A;  1V54 C;  4D7T A;  1N36 B;  1NJI W;  2E75 B;  1FFT B;  1TUE B;  2UU9 O;  4O4L B;  2WAM A;  4LR3 A;  3OUF A;  3P3P A;  1G4Y B;  2CTQ A;  3ABT A;  3G4S V;  1HNX O;  4MT8 A;  3K59 A;  4RWU A;  2EIJ B;  4NKG B;  5C8Y A;  3W7S A;  4G28 B;  3CCQ V;  5KUM A;  1F51 A;  4TUY A;  4WFE A;  3RYH A;  1GN4 A;  2LW1 A;  2EIK B;  4H37 A;  2JS5 A;  3STL C;  4BIZ A;  3QNE A;  1EN4 A;  3IGA C;  1OCO B;  1Q6I A;  5LP6 A;  3CE2 A;  1AI5 A;  1GM8 A;  2X7R B;  2RJZ A;  1S5L Z;  4LFB O;  2FL4 A;  1KKD A;  3RYF B;  2JVD A;  1XIL A;  3DC6 A;  2AW9 A;  3DGE A;  5LBQ A;  1PP9 H;  1FXH A;  5LMN O;  1H2L A;  1K3E A;  2WLI B;  4LFA O;  4CS4 A;  1XEQ A;  5L3D A;  1PM9 A;  2Y69 B;  4X9Q A;  4X1I A;  3K57 A;  2QWP B;  1AP6 A;  2Q6A A;  3F7V C;  3JAK B;  1WA8 A;  5DN6 G;  5HFL A;  3F5T A;  3P3N A;  1HNW O;  1URF A;  4OPH A;  2HLD G;  2HVK C;  4TWK A;  5BZB A;  4O2B A;  2DQ3 A;  2OIG A;  1IDS A;  2K1E A;  4K3A A;  4Q6G A;  1EN6 A;  1CP9 A;  4JYY A;  5EYP A;  5B3S B;  1L0N H;  2EZO A;  4FJC C;  1SQP H;  3SPI A;  1Y74 A;  2IH3 C;  2YUA A;  4JYA O;  1GM7 A;  1J5E B;  1M4U A;  2ZDI C;  3OW2 U;  5FPO A;  4GX5 A;  5H6Q A;  1TVK B;  5J2T B;  5K1P A;  3ZX6 A;  2HP8 A;  4JZ2 A;  3OMA B;  5CB4 A;  4NTW A;  4DV5 B;  2UXC O;  4JAA A;  4GCZ A;  2A79 B;  4P2Z A;  5JVD B;  2IU0 A;  1LUV A;  2OCC B;  4U3J B;  4XDK A;  4PA6 A;  4AHC A;  2F43 G;  3ETE A;  4DR6 B;  1RP3 B;  1YIT V;  5CBF A;  4YXW G;  3JAL A;  4PDL A;  1S0V A;  4PI2 A;  4DV6 B;  2BTQ A;  2EX3 A;  1N4C A;  2JGU A;  4F6R B;  3RN4 A;  1KP3 A;  3JAS A;  4DRX B;  2ZKO A;  1WN7 A;  4YIO A;  1I08 A;  1Q43 A;  4X1K A;  2CDY A;  3N2G B;  2R9A A;  1PV0 A;  3A0H Z;  1K4C C;  1PKX A;  4BR6 A;  5KUK A;  2GUZ A;  3OT7 A;  1M56 C;  1FD9 A;  1ZSP A;  3OR7 C;  4FMT A;  4MVR A;  1BZK A;  3CRM A;  2NNU A;  3ABL C;  3AEI A;  1RSO B;  2QWQ B;  3SR2 C;  1RPO A;  3AG2 C;  3BAA A;  2WLL B;  4P9O A;  3QO5 A;  1VP7 A;  3B8M A;  2PZS A;  4L8J A;  4UVB A;  1RM1 B;  2UXD O;  2E74 B;  1R73 A;  2IU3 A;  5EBW C;  2QR4 A;  3L70 H;  1V55 C;  5LYJ A;  4LF8 O;  3ABK B;  1JX9 A;  5B1N A;  2FYU H;  5AG2 A;  2EIL C;  3K5L A;  3ZN0 A;  2YIB D;  1YHQ V;  3ZMS A;  3K3W A;  3CX5 F;  1N32 B;  1VQ6 V;  3N2K B;  1XNR B;  2DYS B;  2JRI A;  4LP8 A;  1MZF A;  4FLT A;  1B06 A;  4JTD B;  2WLJ A;  1X4T A;  3M7M X;  4PA3 A;  2L6L A;  3AK2 A;  4Z1M G;  4H13 B;  4DR2 O;  2H8P C;  1KC8 W;  2QM4 A;  3HR0 A;  2WA3 A;  3BPZ A;  1YDX A;  2GTA A;  4JTA B;  4A5U B;  4DV3 O;  1NTK H;  1JR9 A;  4O4L A;  2O57 A;  1UFI A;  3CCV V;  2MW2 B;  2YEV B;  4RUE A;  5LMU O;  4FM1 A;  3AG3 C;  1LUW A;  2CTR A;  2ADP A;  2GHY A;  1GM9 A;  3CB2 A;  1XNQ B;  4JV5 O;  4JI8 O;  4E2L A;  2Q8V A;  3WG7 B;  4PDR A;  1QLE B;  1E79 G;  5CMU A;  4LF4 B;  2JGD A;  2OYQ A;  3E8H A;  2QM7 A;  4E4E A;  3ABM B;  4RAI A;  5KAF Z;  2ZR3 A;  3ZRX A;  2DMX A;  1DLB A;  1VMG A;  4LC1 A;  3U0Z A;  5EBL C;  4OXS A;  2ZT9 B;  1H2M A;  1MG1 A;  5IYZ B;  4OX9 O;  3FB7 C;  3RYF A;  3CWB H;  2ZXW C;  4O4H B;  4WFF A;  4LNU B;  3ML0 A;  1HNZ O;  4JYB A;  1KYO F;  2WLI A;  4MVS A;  2ATK C;  5KLV H;  1VF6 C;  3IFX A;  2G38 A;  3SGI A;  3I5D A;  5IYC O;  4X1Y B;  1W59 A;  2R9R B;  4DV7 O;  5B1A B;  3E35 A;  3D3Q A;  3HPL C;  3JAK A;  3JYC A;  2OTL V;  4DR1 O;  2VWJ A;  2RMK B;  3OEH G;  4NXN O;  2HEP A;  3ZHT A;  4IYI A;  4U3F H;  5CA3 A;  1IXM A;  1F4M A;  2E76 B;  3B77 A;  1AP5 A;  3OR6 C;  4LF6 O;  2HVJ C;  3AG7 A;  4B3S B;  1PNL A;  4NR1 A;  1XRE A;  4KP4 A;  3CS5 A;  5BR8 O;  3SJB C;  1B04 A;  4UB6 Z;  4JAV A;  2Y4U A;  1MMM A;  1TVK A;  5J2T A;  4JI7 B;  1YZB A;  2W0X A;  2Z3Y A;  3BA8 A;  1XDC A;  2ZIN A;  2FTK A;  2LGW A;  1SZT A;  3SYC A;  5JVD A;  1TGO A;  3RW0 A;  3C3S A;  2ZQM A;  4LH6 A;  4KL1 A;  1AVM A;  4H33 A;  3ZHR A;  3ASO B;  4MW3 A;  1ZLZ A;  5LGT A;  4BAY A;  2QA4 V;  4RUF A;  1KBH A;  1Q81 W;  1P4R A;  4F6R A;  4DRX A;  4BW5 A;  2C2A A;  4GKJ B;  5IWA O;  1QHT A;  2M6Y A;  3B09 A;  1JJ2 U;  3D36 A;  4PEL A;  4B3M O;  4IGG A;  2RCV A;  3N2G A;  2QM8 A;  3T4D A;  1IBK B;  1HR0 O;  2MK3 A;  1MSW D;  5LA6 B;  1NI8 A;  2PI5 A;  3CRQ A;  4BWA A;  1OCC B;  2A3Q A;  2VRZ A;  3UKM A;  1YI2 V;  4PD4 F;  2RQ6 A;  1WPB A;  3CCU V;  1N33 B;  2LFR A;  3RYI B;  4DR4 B;  3CRC A;  3T2M A;  1N0J A;  2ZM6 O;  2EJR A;  2EIM C;  1VQP V;  3SDL A;  4DV0 O;  1BT8 A;  3BCC H;  1BQ0 A;  1KD1 W;  2IJJ A;  2XAF A;  5JCO A;  4FLU A;  4TOI A;  3EFF K;  1B3Q A;  4X20 B;  4EKW A;  2YC0 A;  3N2K A;  2ZIO A;  2Z5U A;  2HG5 C;  3ZMZ A;  3GWK C;  3LUT B;  3J81 N;  1ORQ C;  2CGN A;  3UO3 A;  3RVY A;  4CH5 A;  1K97 A;  4YHH B;  2UUA O;  1Y76 B;  4GKK B;  5LXT B;  1W0K G;  1LNQ A;  1YTF B;  4MVQ A;  2NR5 A;  3HKB B;  3DC5 A;  3VQW A;  3AK3 A;  5TIS Z;  2JJ2 G;  5LHH A;  4P30 A;  3K04 A;  2XHB A;  2ADQ B;  3FB5 C;  1M57 C;  5H9C A;  5IYD O;  3Q4H B;  4HAM A;  2N05 A;  2YEV A;  5IE9 A;  2VQF O;  3SPC A;  2F93 B;  2UXB O;  1FAF A;  4Q20 A;  2QEX V;  5JQG B;  1NVP D;  1K8A W;  2QKA A;  4IIJ B;  5CN0 A;  3J80 N;  1QR8 A;  4BIU A;  1Q3E A;  2QWN B;  4RQE A;  2IW5 A;  1K34 A;  1B6Q A;  2Z0A A;  1BGY H;  1FXK B;  2P4V A;  3ZBH A;  3KZI Z;  3JCZ A;  2Q73 A;  4WFG A;  4XDL A;  1H2K A;  5IYZ A;  4CC5 A;  2IM9 A;  4DV4 B;  4UCR A;  4LNU A;  4JI3 B;  4LF7 O;  4UXN A;  2AZ0 A;  2F4V B;  1K5S A;  1L1F A;  3CRA A;  4I9Q A;  1PD3 A;  4UV9 A;  5BMV A;  2Y4T A;  1H2S B;  4MSW C;  1N36 O;  3HKD B;  5F2V O;  3PJS K;  2JK5 C;  4YIP A;  2WWW A;  4DR5 B;  5B66 Z;  4JI2 B;  1YSC A;  4UCS A;  3CCL V;  3JD0 A;  4GX2 A;  4DXW A;  3RYC B;  1KQS U;  3AG4 B;  1V9P A;  1A32 A;  4LF9 O;  1GKF A;  1HW7 A;  1WPX A;  1VQ9 V;  3RVZ A;  1NS1 A;  2CAZ C;  3TK1 A;  1I0H A;  1BCC H;  3ETD A;  3DTU B;  4I55 B;  1VQM V;  3APO A;  3OMN B;  4CH3 A;  4KHP O;  4G27 B;  5IJ9 B;  1IBL B;  3CC4 V;  1PL4 A;  2E5L B;  5GTH Z;  5DEC A;  2DYR B;  2AHY A;  4UCV A;  3X2Q C;  5L3E A;  1NBM G;  4JI4 O;  3STZ C;  1YXB A;  1FS0 G;  2ZNJ A;  5IY5 B;  3T1H B;  5EZY B;  2PYL A;  3LSQ A;  1AIL A;  3D3I A;  2XND G;  2BOC C;  3UT5 A;  1ARO P;  2DJV A;  3JSN A;  2AGA A;  2AZ2 A;  3P30 A;  2FKX A;  3H1L H;  3D36 C;  1FXV A;  3VQX A;  3KCY A;  3BY6 A;  1OCR B;  3OE7 G;  2DOS A;  4WFA V;  2W0F C;  1JOY A;  3FYI B;  5CA1 B;  4LF5 B;  3O65 A;  2IJK A;  1NH2 B;  5KX5 B;  1FJG B;  3E86 A;  1G1X B;  1GN6 A;  4ABM A;  5LA6 A;  1P7G A;  3RWR D;  1GO3 F;  2F95 B;  4DW1 A;  3OGI B;  3OTO O;  5BXZ A;  3K06 A;  4DR7 B;  2X6C A;  1R3J C;  3S3W A;  4IL6 Z;  2VWK A;  2A7W A;  1J5E O;  3JD2 A;  1JQ0 A;  2Q0O C;  4DV1 B;  4G2K A;  1K92 A;  3RYI A;  3P32 A;  4DV5 O;  4WF9 V;  3PN1 A;  1HWY A;  4FVM A;  2JIZ G;  1Y4M A;  1XL6 A;  4DR6 O;  4QGP A;  3QG5 A;  1NH2 D;  4DV6 O;  1V54 B;  1S77 D;  2XAJ A;  2YIA A;  5J2U B;  4NVP A;  1QR9 A;  1VQ5 V;  3CXC U;  1KU9 A;  1Y76 A;  2WLM A;  1OJH A;  1IVS A;  3I56 V;  3UO2 A;  3HKB A;  1NTZ H;  2UXX A;  1H38 A;  1AI6 A;  3W7U A;  1Z2G A;  4JI6 B;  3JAM N;  1XBL A;  5B5E Z;  2QJ1 A;  1MA1 A;  1ZAU A;  2UXC B;  1WB8 A;  1OCZ C;  3B40 A;  4DR3 B;  1XMQ B;  3Q4H A;  1Q90 D;  1M9N A;  3K0G A;  4FFB A;  3BFR A;  4WBN B;  2BOB C;  2DWE C;  1MOF A;  5KHI A;  4IIJ A;  1SQQ H;  5IJ0 B;  3SYA A;  4K35 A;  2D2C B;  2W6J G;  2XUM A;  4ZBM A;  1FXK A;  4QPJ A;  3APQ A;  4YJ3 B;  1N32 O;  1VQK V;  3IJ4 A;  1XNR O;  2OT5 A;  3G80 A;  5KHK A;  1NU1 H;  4X62 B;  4MW8 A;  1AJP A;  1KEC A;  1YVW A;  2HJF C;  2K9P A;  1UJW B;  1HDJ A;  3E8G A;  4IHJ B;  3W7X A;  2Q7H A;  1GMG A;  1F4N A;  5GON B;  5EBM C;  3TXS A;  4AQY B;  3CYO A;  3CME V;  1JPX A;  4BW9 A;  1W0J G;  4PI0 A;  4AI8 A;  1ENV A;  2Q5Z A;  2LO1 A;  4PDV A;  4KFM A;  1E1R G;  2OWO A;  1SQB H;  4U7N A;  4IYH A;  3QO7 A;  1CPY A;  1SF9 A;  2BTO A;  3HKD A;  4UFZ A;  3ASN C;  1TUB B;  1F7Y A;  4HYO A;  2QTS A;  3RYC A;  1IBM B;  3ZMV A;  5FPR A;  2Q4P A;  1VQ8 V;  1XNQ O;  3E8B A;  4N23 A;  3OTF A;  1M90 W;  5IDJ A;  3MD0 A;  1N0N A;  4HNA B;  1D5A A;  1HP8 A;  5IJ9 A;  3B4S A;  3TCU A;  4PA7 A;  3SJA C;  1D2D A;  3R65 A;  4B7K A;  3S3X A;  2GTS A;  3T1C A;  3SPG A;  5EC1 C;  5LP6 C;  3ICX A;  4J10 A;  4X89 A;  1N34 B;  4X65 B;  5JWP A;  3SPJ A;  1UPG A;  3SPH A;  4TV9 B;  1VF7 A;  2W6I G;  1WP8 A;  3JAR B;  5EZY A;  3SJC C;  2HJD A;  1WJZ A;  4CS2 A;  4QE9 A;  2YS8 A;  1M5I A;  1M56 B;  3L72 H;  3ZRS A;  1NR1 A;  4JF3 A;  2QE7 G;  4MTX A;  3GVM A;  5DED A;  2UUB B;  3ABL B;  2X6B A;  3K08 A;  3NR7 A;  3K5M A;  5CA1 A;  2GBO A;  3ZRW B;  3T1Y O;  5A9G A;  5KX5 A;  3EHB B;  1P84 F;  2Q69 A;  1DF4 A;  3AG2 B;  2R9I A;  2ITC C;  2PGG A;  2HHH B;  4FK5 C;  1YJW V;  1THZ A;  1NKD A;  5EIB D;  1V55 B;  2KB1 A;  3HKE B;  3FYE B;  5B1B C;  4B3S O;  3RFR A;  2EIL B;  2XAQ A;  2ZD9 A;  2Y48 A;  4YJ2 B;  4DUZ B;  1W2B U;  2CGO A;  3HB3 B;  4JI7 O;  5CA0 B;  4MTF A;  2WA4 A;  3UQ8 A;  4J80 A;  3B8N A;  3A2F A;  2LP7 A;  3A8T A;  1VQO V;  3AG1 C;  3SYP A;  3ZCC A;  2A06 H;  4B3R B;  4FPP A;  3H1H H;  1OHH G;  4MTO A;  2VQE B;  3UCS C;  2EJ7 A;  4UUJ C;  4FLX A;  2WPD G;  1SKV A;  4CH4 A;  1XUQ A;  4U3J A;  1NR7 A;  1L0L H;  5J2U A;  4GKJ O;  3IC9 A;  3C3T A;  2YI9 A;  5C8Y B;  1R6K A;  4NYK A;  3AG3 B;  1D5N A;  1WP7 A;  1IBK O;  4FM0 A;  5KA5 A;  3H1K H;  5BY1 A;  3ZHS A;  4UCO A;  2RNB A;  4J41 A;  5DM6 V;  2B1G A;  3E2E A;  1SZX A;  3H1J H;  4B08 A;  4LFC B;  1XMO B;  2B1I A;  3G71 V;  2E3C A;  5KHH A;  1SQF A;  4CBC A;  5KHG A;  4CS3 A;  3L75 H;  1NT2 B;  1NTM H;  2CK3 G;  1N33 O;  4GYC B;  4XBF A;  1ROP A;  3W7W A;  4WFB V;  1DF5 A;  4WBN A;  2ZXW B;  3OFN G;  1YIJ V;  5IYB O;  1L8D A;  2XT9 A;  5IT9 N;  4FLZ A;  5IJ0 A;  1RSO A;  2JJ1 G;  3ZHV A;  2UUC B;  1SC5 B;  2WLL A;  1GK9 A;  1SES A;  3MHS C;  5D5P A;  4DV2 B;  4YJ3 A;  3THO A;  4X88 A;  1BE3 H;  1S76 D;  3BEH A;  2KG7 B;  3QF7 A;  4B3T B;  3D8C A;  2XAG A;  4R6Z A;  1U96 A;  3LDC A;  2D3O W;  2P06 A;  1K7D A;  3CJH B;  4YHH O;  3K9S A;  4GKK O;  2Q9L A;  5GON A;  2EIN C;  3N27 A;  5EYP B;  1GRJ A;  4QE7 A;  1KUQ A;  1YCI A;  3ZMU A;  4X64 B;  2Q7E A;  5CB4 B;  3ZS8 C;  2ZDI A;  2A0L A;  3DSQ A;  2YIC A;  4UV8 A;  1RPR A;  2CH7 B;  1TUB A;  3R66 A;  4OPA A;  2F23 A;  4D6T H;  1S5J A;  2IJH A;  3JD1 A;  1PNK A;  2KKW A;  4TQF A;  1VF5 B;  3L71 H;  3M99 B;  3MDS A;  2XAS A;  3IAY A;  4UCU A;  3M8A A;  4ZHQ B;  2OIE A;  3LNM B;  2EIJ C;  3WB1 A;  2PYJ A;  3JD3 A;  2Q67 A;  5FLX N;  1IX9 A;  3FB8 C;  1EZJ A;  3K9A A;  4I0X B;  4CC6 A;  4NB5 A;  4JAU A;  1WAZ A;  2H3O A;  2EIK C;  2KSD A;  3CD6 V;  4X66 B;  4O4J B;  3ZRV A;  1ZUQ A;  3CCR V;  1OCO C;  1KKC A;  3GB7 C;  4UB8 Z;  1I7F A;  4DV4 O;  3K5N A;  1YTF D;  2B9Z A;  4GLX A;  1AR5 A;  2ETN A;  1XQ8 A;  2F4V O;  1MNG A;  5L3G A;  4JI5 B;  1P7B A;  4FLY A;  1GAX A;  1FKA O;  1K9M W;  4OGQ B;  5CBH A;  5CBG A;  4O4H A;  1F23 A;  3ZED A;  2Y69 C;  1SQG A;  4K8X A;  1OZ0 A;  2UXB B;  3CP1 A;  1BL8 A;  3RGB A;  3ZRW A;  1IUR A;  3CC7 V;  4DR5 O;  4JI2 O;  1I94 B;  1S3J A;  3G67 A;  2Y0I A;  2P67 A;  1R1B A;  3WB2 A;  2CTW A;  4X1Y A;  4I5S A;  5H2F Z;  2EIM B;  4UVC A;  2ZR2 A;  4W4K A;  4FZ0 A;  2YXH A;  1Q6U A;  3QTC A;  1H8H G;  4YJ2 A;  4GZR B;  3BA9 A;  4PDM A;  4DUY B;  3JAT B;  5B3S C;  3G6B A;  1IBL O;  1EBO A;  5CA0 A;  1IZ3 A;  5LGN A;  2M7W A;  2E5L O;  1R6T A;  4YY3 B;  3E83 A;  3LSS A;  1E1Q G;  4ZKI A;  4O2A B;  3CRR A;  4NXM B;  3O9O A;  1R3L C;  3U10 A;  4GX1 A;  4K0K B;  5LHG A;  3F5W C;  3H01 A;  1ZL8 B;  4F6E A;  3T1H O;  2OCC C;  5JJE B;  4J7Z A;  1QU7 A;  3E8F A;  1XOU A;  4JI1 B;  4JGS A;  1ZWI C;  5K1X A;  3ZJZ A;  2P6J A;  4JI0 B;  1JFF B;  1VEW A;  1FPO A;  1XL4 A;  4LF9 B;  1M57 B;  4LF5 O;  1K4D C;  1O9H A;  1G6U A;  2ZIM A;  2UU9 B;  1FJG O;  2WLK A;  2WSS G;  4UCT A;  1WLE A;  1BHB A;  2JGD B;  4KHP B;  2UXN A;  1QCE A;  4MVZ A;  1HNX B;  4LWS B;  1VQL V;  2YXY A;  4WFH A;  1DK1 A;  4DR7 O;  1AI4 A;  5D5Q A;  4TV8 B;  3ETQ A;  4X8A A;  2YSU B;  1BHA A;  1WNS A;  1TA8 A;  1WB7 A;  2R72 A;  2JDI G;  3H1I H;  4DV1 O;  4JI4 B;  2GSM B;  1EM1 A;  4MTG A;  1VQN V;  2RN9 A;  1Y66 A;  4MVM A;  2BSK B;  2P4K A;  2HR3 A;  4LFB B;  1AJN A;  2L35 A;  5E1A C;  5EC2 C;  4I4T B;  1RM1 C;  4FM2 A;  1VF6 A;  1AI7 A;  5LMN B;  2P5O A;  2QKC A;  1SA0 B;  3ABK C;  1OV9 A;  4LFA B;  2LW7 A;  5JCO C;  4J7J A;  2KG7 A;  1Y6X A;  2LQT A;  4U7O A;  3KCX A;  4ZIB A;  1XHZ A;  1TAE A;  1VQ7 V;  2WLN A;  3OM3 B;  4NTX A;  2DYS C;  3CJH A;  3OTO B;  4X20 A;  2P22 C;  1EZV H;  4RO2 A;  2OTJ V;  1PPJ H;  4J7K A;  3VQV A;  1HNW B;  2N74 A;  3JCU Z;  3L9D A;  4QIW F;  3K5O A;  3JSL A;  1XHX A;  5LXT A;  4JI6 O;  2XOK G;  2DW4 A;  5A2Q N;  2BE3 A;  4GX0 A;  4QNH B;  1YJN V;  4DR3 O;  3AK1 A;  4JYA B;  2CH7 A;  4L87 A;  1H2G A;  1XMQ O;  3OUS A;  2ZE7 A;  3BAB A;  4ZI7 B;  4HZ3 A;  1CEZ A;  4R7C A;  1H2N A;  5JH7 B;  3X2Q B;  3FD9 A;  5L3F A;  2FML A;  2Q0A A;  4PHZ A;  4ZHQ A;  1SER A;  5EIB C;  1MAB G;  1NQT A;  4AIL C;  4D7S A;  3WG7 C;  1QLE C;  5JQG A;  4I0X A;  2LJ2 A;  5L3C A;  2P7T C;  2IBZ H;  3FAV B;  4PV1 B;  1VAR A;  4X62 O;  3ABM C;  1COW G;  4DYL A;  2F66 C;  4O4J A;  1YEW A;  3CCE V;  3JD4 A;  3DXR B;  1Q82 W;  2X0L A;  4TSF G;  3C90 A;  3E22 B;  3ZMT A;  2CTP A;  1Z5V A;  2QTO A;  5JJJ B;  1ZX3 A;  3L73 H;  4AQY O;  5LL6 Y;  2OCH A;  3B2E E;  4O4I B;  4IT5 A;  5E79 Z;  4JPR A;  4I7Z B;  5C93 A;  3CSX A;  1KP2 A;  2DWD C;  2VS0 A;  5B1A C;  3ETG A;  3JAW B;  4TQD A;  1IBM O;  4ZOL B;  1FFX B;  4UVA A;  3RT3 C;  4B7E A;  1GN3 A; 
#chains in the Genus database with same CATH homology
 4NTY A;  4NTX A;  2QTS A;  4NTW A;  4FZ0 A;  3S3X A;  2FB5 A;  3S3W A;  2L35 A;  1WP7 A;  1WP8 A;  3IJ4 A;  3N27 A;  4FZ1 A;  4NYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...