2DYRB

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dyrB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dyrB02
1ET7A 2VW4A 2FQFA 5B1KA 5I6KA 1FA4A 3EHBB 3IN0A 3OMIB 3FPYA 2XX1A 1I53A 4M4RB 4WTQA 4KNSA 1A8ZA 2WO2B 4HCGA 4W9ZA 1PLBA 4HZ1A 5PCYA 1JZGA 2QDVA 1V55B 1EHKB 1ZV2A 4GYBA 3UAEA 1XMEB 4A66A 1T5KA 1ASQA 1FWXA 2GHZA 3ABMB 2DY2A 2PPEA 2TSBA 4F2EA 2GBAA 1AANA 3WG7B 1V10A 1PMYA 1M57B 1PLAA 4YVNA 3PCYA 1BXAA 4KOCA 3NP3A 1NPJA 4JKNA 2CALA 3AG4B 3JTBA 3ZX1A 3D12B 5AFAA 4RH4A 4NB7A 4GP4B 1PNCA 1M9WA 4E9VA 4GY4A 1BEXA 1JXGA 1OE2A 1SHXA 2WSDA 3NSCA 4YSCA 9PCYA 1X9UA 3AG2B 1JZHA 2W88A 2JKWA 1TKWA 3BVDB 1NZRA 3CVDA 2DWTA 4JHVA 4GP5B 2IDTA 1AG6A 1CC3A 1IBYA 3EH5B 5B3SB 1NDTA 1XB3A 2H3XC 2LLNA 3AY2A 5B1JA 4A2GA 3KW7A 4G7SB 5I5IA 2BP8A 3S3BB 3PAVA 5AKRA 4QLWA 2EILB 2PP7A 3OD3A 1JZJA 2ZWNA 1OCZB 1J9QA 1L9PA 4G7RB 4KO5A 2P80A 4YSDA 4BK5C 1PZAA 4YSSA 2Q5BA 3NJHA 3HB3B 4DPCX 3T6ZA 3CDZB 2NRDA 1V54B 2VMJA 2EIKB 2HRGA 1BYPA 3S8FB 2IDUA 2JXMA 1BQ5A 1A65A 5I6MA 2CJ3A 1PLCA 2VM4A 4PCYA 4UANA 3X1FA 4DP2X 4E9YA 2VW7A 4HHGA 1SDDA 4A68A 1SFHA 2FT8A 3UAAA 3NJKA 3SBPA 1J9RA 4BWWA 4DP6X 3N2JA 3EH4B 4TXVB 2BWIA 2AZAA 1AR1B 3UGEA 2BP0A 4ENZA 2RACA 3CZUB 2J55A 4PAZA 1E5ZA 3UABA 3DKHA 3IN2A 1F56A 2JFCA 1NIFA 1JXDA 1OE3A 2VW6A 5PAZA 3T6VA 4E9QA 3FQ1A 3GXUB 2X88A 4Q8BA 2Q9OA 2YAOA 5B1JC 3PPSA 1GW0A 1KBVA 2XU9A 3ABGA 2XLLA 3TBCA 2OV0A 2QPDB 2IDFA 1MZZA 2PP9A 4G71B 3FYEB 3JT2A 4JHUA 3OQRA 1JXFA 2CBPA 2BP0B 4NAJA 1WS8A 3EF4A 4CSPA 5B1AB 1ZDSA 3IE9A 5TK4A 2PPAA 2PPDA 2FJSA 1GSKA 2H47C 2J56A 1OOWA 1SF3A 1CYWA 2YARA 4AX3A 5B7EA 3V9EA 1AZUA 4KO9A 4BXVA 3TU6A 2YAQA 4DP7X 3IBOA 1ETJA 1W6WA 2FTAA 1AQ8A 2IWEA 1OF0A 1WA0X 3NSYA 1NIBA 1BQRA 2YEVB 1WA1X 1NICA 3NYKA 1AS7A 3FSWA 2GC7C 1ADWA 1MZYA 4FAAB 3FU9A 3PXLA 2W8CA 2WO3B 1VLXA 1BYOA 2FQEA 4YSRA 2XX0A 3CVBA 3H4FA 3BQVA 4E9WA 2CCWA 4DP9X 4KOBA 3QPKA 1L9QA 4HHWA 2A3TA 4WKXA 4X4KA 1HAUA 4YSPA 2FWLB 3IEAA 1J9SA 1IUZA 4A2EA 1QLEB 1JZIA 1RKRA 1RZPA 1B3IA 3T71A 2TSAA 2MRYA 4P5SA 3AZUA 5I6OA 4AZUA 3EH3B 3FT0A 3UACA 4DPAX 1SHWA 3FSVA 2YAMA 2EIJB 4GP8B 3AG1B 2I7SA 4YSOA 5I28A 1AG0A 1JVLA 1AZCA 1MG3C 2PCFA 4K9JA 3KW8A 5I6PA 5LDUA 4UAHA 1PCSA 4P5RA 4DPBX 5D4HA 2PP8A 3ASNB 3GDCA 2DYRB 2DV6A 3DIVA 3H4HA 4AKOA 4KNTA 1AAJA 3H56A 4ZK8A 1KYAA 3S3DB 2UXTA 4KO7A 1SNRA 4DP5X 1J5DA 4YSQA 2FT7A 4KO6A 2B3IA 1PY0A 3NP4A 2AZUA 3DTUB 1W8EA 2DWSA 4YVUA 2XV2A 1CURA 3GYRA 2YAPA 2J5WA 1BXUA 3TA4D 3NSDA 1N70A 1WS7A 3FU8A 3OMAB 4BWTA 3PLYA 7PCYA 1AZNA 2BHFA 1YLBB 2MTAA 3ZBMA 4YSTA 2BP8B 2FQGA 1OCRB 2N0MA 4E9XA 1NIDA 2EIMB 2DYSB 1QHQA 1SF5A 3QQXA 4AKQA 1ASPA 3T9WA 5IY5B 2R7EA 4N4YB 2AVFA 3CG8A 3WKPA 2YXWA 7PAZA 2UXVA 3X1GA 1GY2A 1JZFA 4MFHA 1JVOA 3AW5A 2FT6A 2I7OA 1GYCA 3N55A 1E30A 3QJRB 1SDDB 4BDVA 1TEGA 2ZONA 1E5YA 2IWKA 2GIMA 4NERA 2OJ1A 1SJMA 1BXVA 2CUAA 3X1EA 3FU7A 3FQYA 1KV7A 2H5UA 3QJQB 4YL4A 3WI9A 1AZBA 1JERA 1GY1A 4AI7A 1AS8A 6PAZA 2IDSA 1IC0A 1OCCB 3NJFA 3NJMA 1AZRA 3S8GB 4BDVB 3NJNA 2XVBA 3OMNB 1AS6A 2CAKA 1AOZA 1XB8A 3FYIB 1BAWA 2XXGA 2UXGA 3C75A 4G70B 2HRHA 2IAAC 2IWFA 3FU7B 5I5MA 5I26A 1ZIAA 1NWPA 3QJTB 2BWDA 1UATA 1PF3A 2IDQA 1GS8A 4YSAA 2Y69B 4A67A 1GR7A 1ET5A 2VM3A 4HCFA 2BZCA 2Y1AA 4KNUA 5EHFA 2GB2A 3TASA 5E9NA 4HAKA 5ANHA 1NPNA 5B7FA 5I6LA 1OE1A 1OCOB 1L9TA 3FS9A 2EINB 1PZBA 2VSMB 1KDIA 5F7AA 1DZ0A 1URIA 2FNWA 1PNDA 2HZHA 1R1CA 4YSEA 1E65A 1ILSA 1N68A 3ZIYA 1WAEA 5FC9A 1AACA 1EZLA 1ZPUA 3T6WA 4DP8X 2X87A 1NIAA 3NSFA 6PCYA 3T6XA 5I6NA 4N8UA 2PLTA 2UX6A 2YQBA 2P80D 2BW4A 5AZUA 1L9OA 3U25A 1NWOA 1XB6A 4EF3A 2J57A 1ET8A 1TU2A 1KDJA 3WNJA 1HFUA 2E86A 2UXFA 3UADA 1DYZA 3PAZA 4CSZA 5B7MA 1IBZA 4F7KA 3ZDWA 4FA7B 3NJLA 5B1BB 4HIPA 2QT6A 3HEIB 5I5JA 3FPXA 1ID2A 2XV3A 4DP4X 3TBBA 3X2QB 3PAUA 3CDZA 2BO0A 1BQKA 1J9TA 2HX7A 1GS6X 1KCBA 3G5WA 3NJIA 1IKOP 5D4IA 2BZ7A 3FQ2A 1CYXA 5TK2A 8PAZA 2XWZA 2BW5A 2ZOOA 3SQRA 1L9RA 1PZCA 5D4JA 3ABKB 3QJVB 4M3HA 2AFNA 3V9CA 3WIAA 3AG3B 1MG2C 4G72B 2B08A 4HCIA 3L45A 3WKQA 2YAEA 4E9RA 2IH8A 2XV0A 1RZQA 3SBRA 1M56B 1WA2X 3SBQA 3RYMA 3MBWB 3QJSB 2XXFA 1ZIBA 4GXFA 5F7BA 1NINA 4E9TA 4A2HA 1TEFA 1A4AA 1JOIA 1L9SA 1FFTB 4G7QB 2YXVA 3WNIA 1CUOA 1GS7A 2YAHA 1E67A 2VSKB 1KBWA 2QDWA 2GSMB 3X1BA 2PCYA 4E9SA 2VN3A 4L0PB 2YAFA 3ERXA 3X1NA 4BXSV 2ZXWB 1OV8A 3S3CB 4BWUA 3CVCA 2AANA 4A2FA 4F2FA 1KCWA 2R7EB 2OCCB 1AIZA 4DP0X 2I85A 1ILUA 2XUWA 1A4BA 3OM3B 1KGYE 1X9RA 1A4CA 4QKTA 2GC4C 2GI0A 4AKPA 4W1TA 3NT0A 2HX8A 2UX7A 3ASOB 1QNIA 1SFDA 2PPCA 2XYBA 2IH9A 3NJGA 1A3ZA 5A7EA 1HAWA 3FSZA 1J5CA 4UF7C 4Q89A 4DP1X 3QJUB 4A2DA 2HX9A 4HALA 3MX0B 2PPFA 2QPEB 1PAZA 1JZEA 1ZDQA 1NIEA 4YSUA 1MDAA 2HLEB 1NTDA 1RCYA 3FSAA 3ABLB 3NJJA 2FQDA 1W6LA 2HXAA 1ASOA
chains in the Genus database with same CATH superfamily
1GN2A 1DQJA 3O2DA 2RQ6A 2AF2A 3S6CA 2AXGA 2X3AA 3OB0H 3OBAA 5BS0A 2JGUA 2W07B 3EYUH 4ANKA 2PYEB 1BD2D 4JGUA 4Y19A 1NBZA 1T5EA 3ZTJG 5E8OB 1I5YA 3GBNH 4LF5B 5DURB 4KX9A 3RIKA 4KPHL 2UY6A 1KZYA 1Q0YL 3JD4A 3BKYH 4GQ9L 2BOBC 1OAJA 2XZCL 3GVMA 4PELA 2GIYA 4PB9H 2E76B 2ED6A 3ARFD 4ATTA 5J6HA 2Q10A 3WXWH 3ABMB 3EYFB 3BEVB 1J8RA 1QBBA 4P46A 1INEH 2GTZB 1PG7X 1N7ML 3ECQA 4G8IB 2R8SH 1SETA 5JVDA 1NPJA 3N40F 1T1WA 1N9PA 3VVWA 4G2AA 5FYLH 4ANUA 2CR6A 1OT1A 3CFBA 2DKMA 3RIAF 3B6SA 3ZDXB 1BEXA 2ITDA 2NNAA 4H25A 3KYKL 4WEMB 3U0TB 1T0NB 4GO8A 2OW6A 4DUYB 2ZNXA 1PIGA 2GW5A 3CQPA 3HNSH 3MBXL 1R3KA 1F3DH 2HFTA 3DURB 4Y2LA 3FN0H 1DLHA 1HWWA 3TJHD 4JX0A 3POCA 4TOYL 3CEIA 3U82B 1KPUA 4PMEA 4PJGA 1RZIA 3UZEC 3GS0A 5E5RB 5T1KD 2AV7A 1N2RA 2XTSA 4G6KL 2DD8L 4ZPVB 2HJFB 5LVEA 1DDTA 2J8UA 1Y76B 3UC0L 5E95B 3GMOB 4LP4A 4I87A 3SE9H 4BSJA 3JCZA 4MJIE 4F7TB 4EIUA 1R3IH 3OKMB 4OFYA 3KXFD 3GNMH 5IHZB 2NXZB 3JTTB 3QI9C 4ZX6A 5GGUB 1PZAA 3GMRA 2Q5BA 2EECA 3ML8A 3O45A 2C5DC 5A7BA 5MENE 5E1AA 3VNZA 2WCPA 2JXMA 4HWBA 4HU2A 2OJZL 1U3NA 4RNRB 1WYJA 2QKAA 3ZE2E 2B4CH 5AALA 4X65B 5I1IL 3PWJB 1FZJB 4DP2X 2ITEA 4JN2B 1BVNT 1CZ8L 4X64O 3BT0A 4IL6Z 4HYOA 2ZUTA 4DP6X 1GXEA 1FIGH 4Y9GA 5GZOD 1RPKA 3FBQA 4YLCA 2WZ6A 2BWIA 4PREB 3IJSB 4DGWC 5ABZA 5F9DC 3L3DB 3CZUB 3ZW3A 1DF4A 1BPLB 5BV7L 2YUAA 2VZ3A 3CCHA 4PAZA 1UZGA 1NIFA 4TQDA 3LKQA 5E6IB 5PAZA 2FJHA 2QM8A 2X88A 1QU7A 3C90A 1UVQB 2WCGA 3EO9H 2AJSL 3BE1H 3RA7L 2UVEA 4MA1C 4X6CB 1HH6A 1KBVA 1BAGA 2BCKB 5LWYL 4OZ4A 3QUKB 1E4HA 2J88L 3QEQD 2DBLL 3B7SA 4KJWD 3EZJB 5D1QD 1S5HA 1HINH 3VSUA 3QZLA 2JGDA 4M3KB 1TNNA 1O9VA 1CLYL 2E5LO 1VQMV 3HS0A 4DKDC 3N2GB 2IH3A 3LSSA 2PPAA 3NIGF 1PQZB 2P7TA 3EJUA 4WFFD 2WTRA 2CTPA 3FU5A 1F13A 2IANA 5CN3A 5C0CD 3LEVL 1TJHL 3GSNL 3JATA 1Z66A 4FMVA 1YCSA 3DX8B 2JS3A 5BZWB 3ZSSA 1DJHA 4UMSA 3KPRE 4PSRA 4QR7A 2CDEB 2Z3YA 4Y9FA 5DK0B 2CLRB 3HKFA 1VQ5V 2ZIMA 4PV9B 4YHLH 4P2ZA 4HQQL 5IQ7L 2WLKA 3B77A 1HZKA 1BREA 2Y9RT 3B9KC 5ENWA 3BHBB 3FRPG 5D6CA 4KVPA 1MI5A 2ICCA 3U46B 1USQA 2QL1A 3V4UL 1G6UA 2XN9B 1VGKA 3KYMA 2C26A 3BEHA 2WN2A 4QHMA 3ATEA 3S3XA 5E00B 3N1MC 1RSOA 1BYOA 3APCA 4MCZA 5IWAB 3MV8D 5AKSA 5FUZH 1Q4NX 1MZEA 3E0GA 3O11B 4MDRA 1PY4A 1DVFB 4N23A 3KR3L 4MCYB 3QQDB 3HE7B 3RWEA 1TPXB 2Y07H 3SJVA 1OCWH 2XIIA 3JD3A 4OB5L 5C0ND 3FQRB 2AJXH 3TH3T 5KN5B 3KPSB 1ZHBB 1I9JL 4PRPB 4RSVA 4AGLA 1N8RW 2X4NA 1QQDB 1JGVL 1SLVA 3GRWL 5T3XD 4HIJB 3GZPA 5DFVC 4EI5B 2NXYC 4MJ2A 3CGTA 5L3FA 1A5FH 1YEGL 2Y5TB 4P4KB 5G4MA 1HL4A 5ID1A 4R50A 3RQ3A 1JPST 2JQZA 5J11B 1S7XA 2H26B 2P5ED 3IGFA 4TNVF 3H3BC 3KBFA 2UZIH 4YSOA 1R75A 5HHNA 4UCFA 4Y4FD 1AZCA 1P6FA 4PVMA 4DUVA 3GRBA 1KY6A 5KHGA 2A3QA 3R4DA 5EOCH 5C09E 4AJ0A 2KDYA 3E2HB 1JZ4A 4UVCA 3IDIB 3KLAA 5J6GA 2D3LA 3A6BH 3FF7A 3H4HA 3MJ7A 3HC4H 4TQIA 1KGXA 2ERJC 3MA9H 3PE9A 1KTJA 5B39G 1KYAA 3SPJA 3A5VA 4CVXA 5DRZB 4NB5A 2YC0A 1IILE 1RFDL 2BSED 4HFUL 2VXQA 1GN3A 2VMCA 1KN4H 5F7FA 3FMGL 4XBFA 2JKLA 1PG7W 4A7QA 3DTUB 3LEYH 1F1GA 3WO3B 3UERA 4JL2A 1CURA 5F21B 1TYJA 1HSBB 3GYRA 3KL3A 2YAPA 4D0BB 5IFJA 2WXHA 2CM6A 3RW0A 3FH7A 4R96A 3WE6B 1X5IA 1AIFA 3DUUB 4XE5B 1YITV 4XMPH 5D5MF 4UOW1 4LCIL 1DLFL 5EB9A 3ZBMA 5GS3A 4DUXA 3WL9A 3VAEA 4MHHI 2XV6B 4EJ1C 4X1YA 3BA8A 4EIGB 4PJBF 4KRPC 5TE7L 3T8MA 3WHXB 3QO8A 2E7BA 2WVUA 2DH3A 3MLYH 1QFWI 3ZQXA 4ORGA 2LO1A 1V3KA 1Z9LA 2D7PA 3VXRA 1GGBL 2WCSA 1GY2A 1JZFA 2K7QA 1P4BH 2W6IG 4L18A 4Q9QL 2EJ7A 5C0DA 5J9PB 3AW5A 4JFEB 3K4ZA 1OALA 2VJXA 1W72L 1IM3D 4LHUD 4P3CH 3HTLX 5EPMB 5KSAA 2QQNL 3NK4A 1JMKC 4F7PB 4UU9B 1OAUH 3PUUA 3F6JA 3EGSA 4U3XA 4FZ0A 1I8MB 2X1QA 5I17B 4ZSOE 3I5DA 1FYHB 5C0BA 1LDSA 1C12A 1R24A 4Z76B 3U30C 3BAKA 4QE9A 2BP3A 4JFFA 4XPTH 4YMPA 1I9RH 2UY7B 1QLEH 2HYMA 4APQC 2OTJV 5JZ7D 5J5EA 5EUOF 1MPAH 3P0VH 4UM8B 4WENB 3MNDA 5E4AA 3WTYA 1DK1A 4J6RL 3WIFA 3CHXA 4BDVB 4FLVA 2HJDA 2GJJA 3IE4A 3OJDB 4OJFH 1WSST 3MLTB 4UIMB 1JXJA 1DBMH 1OKEA 1SESA 4TSFG 4PRBB 3FO0L 2OK0H 2HUEA 2VH5H 4FD0A 1XMOO 1XAKA 4GAJL 2JWYA 4UBDC 3SR2C 2ADIB 3CV5A 4DK5A 1P1ZB 2P8LB 3JWNH 3U48A 4UM9B 1ROWA 2KC0A 2X4PA 3MO1A 4HH9A 4RX4D 3HPJB 3QWRA 3TPUB 5ISZB 1GS8A 2JNZA 4WI6A 3LHPH 1WBYA 4N25A 4FCAA 4NM4L 5I16A 1WFNA 1IAIH 3QG6B 1FGVL 3US9A 2VDMH 2BZCA 4KNUA 5EC1B 1NAKH 3V7MA 1JPSL 2ZE6A 3PWNA 4J3UA 2PO6A 1LTXA 3VFNB 5DD5H 1WFMA 4DGUA 5EBMA 1OGTB 4ZPTB 4CKVX 3MFGB 2GK2A 2K9PA 4AXWA 3D3VE 2TRHA 4E68A 5JOFB 5D7LE 5DLLA 5LG1A 1KSRA 1A9EB 4WW2B 4PDLA 4NTXA 1TJIL 2FNWA 2QPFA 4P3DA 5HPMB 4JY6B 1E65A 5KSBA 2HFEB 5KMGB 3LTVA 2L3BA 4FI8A 1OJHA 1T7VA 1CQYA 4AL8H 2G9HA 4DZ8B 1JCVA 3D50A 2J6EL 4V2CB 3CPLB 4DP8X 2IAMC 4KZ0A 2X4SA 5I1DB 2IG2H 3UP1A 5JA8B 1AJ7H 1TNMA 1TSHA 4N8UA 5FKAA 3RWHA 3TT1H 4MNHB 3U25A 4JUSA 2YD3A 2IM9A 4MJ6B 3NRFA 4OLZL 2ZX8A 4G1MA 4ZUVB 3QHTC 5JW3L 1XR8B 1K4DA 1MXDA 1UOWA 3VH8B 5DI8A 5I0WA 1P4LB 1ZD6A 1SJVA 1PL3A 2F5AL 3IJYB 4XPHL 3HE6D 5MI0C 1E8XA 2A9NH 4JQIL 1AHKA 2VDMB 3NDYE 2VIRA 5TDOA 2RD0A 3QUYD 5SWZB 3PWPB 3BH9A 1NCAL 4JANA 3GEFA 3SDXE 5IV2A 1N6QL 3AT9A 4TTDC 3QCUH 5ITFB 1VADB 5TK2A 5IQMA 2BZ7A 3N43B 4FQLL 5DYOB 3NACL 3CUPB 4XRCB 3FTYA 1MCPL 3L3KB 5CLYA 2BTQA 4LF4O 1T89A 1UC6A 2HTKD 4NJ9H 4ZXBA 2ZPKH 1M3IA 5CA1A 4NO3B 1Q9LA 4DUZO 1XGYH 2WXPA 1X5MA 2Z31C 2PKDA 3VG9C 2IOOA 5JMOC 3C3SA 5LYJB 1IBGH 3KEHA 3EYOA 4ODXA 3GBML 4G9DA 3GI9L 4MB5A 5CSZB 4C8XA 4JKPL 2QGCA 4ODWA 1TEFA 3X3FL 2GQHA 3BKCL 1BBDH 3MUZ1 3JV4A 1J1OL 1CUOA 1GZQB 1JNLL 1KBWA 1SYSB 3N27A 2AQ3A 2ICEC 2QDWA 3EFDH 3NZUA 4DV5B 4TQEH 5CD3B 2H9GA 2EILC 3GXDA 3I3EA 3MBED 2ZXWB 4S11A 3P11H 4UFZA 4X6DF 1WAZA 3F7YA 4ZW6A 5HTSA 3TLRA 1KGCE 3US1A 5KTEH 1XSJA 1S3KL 4A37A 5KBPA 1X6NA 4LB8A 5G2NA 1B0WA 1G7LA 4U6YB 4M02A 5I1GH 1U3JA 5JHDE 1YEHH 2J25A 1TTFA 1IM9B 4N6QA 1ZEAH 5GGTH 2DBJA 3NABL 4MXWH 1HESA 4JDEB 4EN2A 2COQA 2YKLH 5J2UA 4FQ2L 1CT8A 1KYFA 3IF1A 5I8OL 1LE5A 4L29B 4UQ2B 1KU9A 2SEBB 3ZRSA 4EUPG 1XMQO 2H1LM 1M3JA 1P5VB 2BP5M 1TG8A 3HJEA 5BNXD 1BX2A 3FXIC 3RTQB 2BH0A 1R3LC 3KPPB 4YPGA 3BAIA 3HC0B 1S7SB 1F7YA 1RPUA 1J0ZA 2IH9A 3O6KH 3FSZA 4OBSA 2Y25A 2K7PA 3DIFB 1MFEH 4XXWC 3T5WA 4NQDD 2JEXA 4L4VD 3TO4C 4QRRD 5DMKA 3BFWA 3NIDE 4D8OA 1R3JB 3MX0B 3KGSA 4YDIL 1J05B 2QQQA 3CFNA 5LCVL 1XNRO 4Q6IA 3TH2T 2EIZA 2HLEB 2FUTA 3IU4L 3MV01 1AXTH 3OZ9H 3QO1A 4KTEH 5IMOA 5C0GA 5AB2A 1HE8A 4QRPB 4JM4L 4EBQH 1NC4A 3IETB 1ASOA 1BZ7B 3QFGA 1LLAA 4N0RA 4L23A 3HLAB 5FA4A 2D9CA 1YEIH 3FTXA 2GBVA 4H1LB 5KJ7E 2OL3L 3P73A 4XZUA 1RSFA 1BZOA 1HSAA 2E9IA 4B9PA 4MJIA 2ZWLT 2PF4E 3L74H 3FPYA 4L8DB 2AJ3A 2WO2B 1CFQB 1IEAA 2WPGA 5T1DL 1AI4A 2B59A 1U97A 2QADC 3PGFH 2IADA 4FZ8L 1I3GL 1V55B 4G42B 4NDMA 2QEXV 1BZ8A 3S0PA 3TJTA 3QQ9D 3CXFA 5MENA 2DWEC 3H2PA 1XMEB 2AK4E 2XTJD 4FADA 2X7LB 5DXWA 4HK0A 3I9GL 2PPEA 2GBAA 1NKRA 1S7TB 3WG7B 2Q67A 1X9LA 4RFEB 5D7IB 1RMFL 2K6ZA 5JXED 5FAAA 5L8LB 1NUGA 1NBYB 3DJRA 1M05A 3KS0H 1BVZA 4IIZA 4FKEA 1F97A 2XQYG 5AFAA 4QRQB 5E5UB 4KK5D 2J2ZB 3K59A 1TTUA 3MRQB 3QNYB 5HI3C 1A6UL 1AGFA 2MQGA 1EIBA 4NUPA 1Q8MA 1Z9NA 1RP8A 2XKNB 3ZMUA 1T21A 3BUIA 3ILQD 5C3TA 3WHE1 3QVAA 3ZDXF 2ENYA 3PP3H 4U31A 5T3ZL 1B90A 1TKWA 3OTOB 2NT0A 1NZRA 4S1SH 4LF6B 1NEZG 3CVDA 3RY5A 3VDBA 2YA1A 1JNNL 3QZWA 4JG5A 3BUBA 4Z23A 1F45A 1MCLA 4JAMB 4OZFH 5EF2A 4YHIA 3MDSA 1E8YA 1HCFX 2Y6SD 4F15B 1F2QA 2BVUA 1JDCA 2E46A 2JRIA 1N8ZB 3B8NA 4U1SB 1G7JA 2XXCB 2V6HA 3IGLA 3GSWB 3A67H 1MG1A 1YPZE 3RYIB 3LPPA 2XIBA 3V5DB 4LDLB 5KYXB 3K6IA 4UDUA 1KJ3L 4Z0BL 3JAKB 5I73C 4S1DD 4WFEE 2DW5A 1ERNA 3MOAH 4B0MB 1YY9C 2NRDA 4UDTA 2Q8AL 1JRHH 5E08L 4R84A 4B3SO 5IOPB 4ELDA 4URTB 3DA0A 2DN7A 4HJGA 3M99B 3EDDA 3W39A 4QF1B 3KPRA 3QYNA 2ZX9A 1V3MA 5ADOH 5D1ZA 3T2NH 2HLFC 1VF7A 4WWID 1RZKL 1JHLH 2HWZL 5TQ2H 1MAMH 1UXMA 3CE2A 4UQAA 1TVHB 2ZR3A 3TTYA 1X4TA 4Z1MG 1FORL 4QGPA 3MV9B 1KTRL 1A3QA 3QUXD 1HNXB 3R18A 2DWDB 4N0CD 4POZD 2QBWA 3ARGA 4LSDA 2AQQA 3SDDC 1S7VB 2PCPB 5FB8A 2J55A 1E6JL 4LEOA 1MCWW 4TV8A 1G6RA 2R0KH 4K5OA 2VRAA 4LCCC 4JR9L 3UABA 2F8IA 1BGYH 3CAFA 3KPMA 3CFEB 3TEYA 2VDNH 2H1XA 5FLUA 3OKNA 4LP5A 1USZA 5LGNA 4LLMB 3IDXH 3WYRA 1NL0L 4BBWA 4ZFOB 4V1DB 4UCUA 2AJZA 2WJ7A 4X9FA 2D2CB 1F4WL 3CPUA 4XO8A 4AUUA 5DWPA 1GZPB 2JV6A 4WWOA 5DEGA 5HVGB 4DHLA 2CBPA 2BP0B 1I3RA 4LSQH 4OZIE 5E2TL 2PMZA 1TYRA 3HHSB 4H20H 4FYSA 5IKCA 5IK3A 1ZDSA 2OR9L 2RHEA 4IYIA 3QA3A 3CJHB 3NFNA 2GUYA 4LPVA 3H0TA 5J13C 1WZKA 2VXVH 4L0YA 5C0IB 2WQAA 2HKOA 3ZDYE 2BIHA 5H35B 3IPBA 5C09A 1CDCA 1TZIA 1MCDA 2C3VB 3U0PA 1TJGH 2VDKH 1B88A 2Z4QB 2I25N 4MMXA 5C0FA 2V9UA 3CNKA 4HGKC 2AEIT 7CGTA 1RZ7H 1CK0L 3LJ3A 1UB6B 1H8EG 4NNPL 1HNZB 1QKZL 1S7UA 1YJDC 35C8H 3IMWA 1FXKB 2JJTC 5F1KC 2Z7ZA 5GGTA 2XNDG 5FECA 4S1QL 4YDLB 4P2OA 4X5WB 2AHIA 3MPCA 3EH1A 4H8WH 5F2FA 1LO3H 4HWUA 1EM1A 2OZ4L 4PLJC 5BRZD 2UZYA 2EZPA 1B3JA 3OKOB 1JCHA 4R26L 2PI4A 4H8VA 1JZ8A 5ABAA 1U8HA 3T3MB 3UBFA 2H8PB 5CFAA 3RYHA 3ZHRA 4QRTA 2UZPA 3P2DA 1P9MA 3D52A 4L8BB 4EIZC 3QPKA 2F95B 5EOQH 1QPKA 2VL5B 3L4TA 4DK1A 3IDJA 3CN2A 4LF3A 4YJ2A 4PJ9D 2FWLB 3BGFB 4HK3N 2RA1A 1NC2B 3L4WA 1T4KB 4FQQA 4EPSA 4ZO8A 3X3GH 2YUWA 4A2EA 5JR1H 3RL1B 4FYRA 3SE3C 2Y48A 5HHOD 1C8PA 1J8HB 5I28A 1AG0A 5E9DE 4OH2A 5F93C 4WSKA 1B4TA 3S96B 2VDKB 1EFXB 4QRAA 3P77A 5TE6H 1E6OH 4JEGB 2EVIA 3P3YA 4XVTL 3QDJD 1BMFG 1W80A 1QBZA 1BEYL 1DVFC 4NN5B 4UV4L 5DGRA 4IBUA 2E5EA 1TPXC 1RJCA 3BVVA 2OCJA 4JYYA 2A99A 4JE4B 3FQTB 5GSRB 5DRNA 1KTKE 2ISDA 4J11A 4X4ZA 4ETYA 1IAII 4UCVA 2D03H 4QHUB 3WXVH 3LS5L 3VXTA 4A04A 4ZSOA 4NXMB 1VQ4V 4W9DC 2CTQA 1MCWM 3MRPA 3DX3A 3RU8L 4P4KC 3V7AE 1ZL8B 2ZXEB 4GMSL 3IDMB 5J11C 3OG4B 2O5ZH 2HMIC 2Z7YA 3DECA 4WCEV 3QZMA 1RV6X 1VFAA 2CK0H 1XR9B 2A9ML 2BHFA 1AGEA 2WQXA 3QIWB 2MTAA 4GBXA 5K33A 1CFVH 3K2IA 2PXYA 4R97C 4DGYL 2A73A 3E2HC 2AABH 1TZHA 2W9LA 3D07A 5DS8B 4P2QD 2AXHA 2DYSB 4FJZA 4P2YA 5J2TB 3CHQA 5KYUB 3J7HA 1PZ2A 3HI5H 2D7OA 4AKQA 4NKIH 1FNEA 5IY5B 4K8RH 5FHBH 1K85A 3E22A 5T33L 1T1ZA 3TGXA 5B38G 4S0TD 2J8OA 5D1XB 4UTAA 3ZHKA 1HXKA 1FLRL 2J8HA 5DYFA 2RJZA 2XWDA 3TIDA 1RJZA 1AP6A 2C2AA 5D1ZI 2YIBD 3C8KB 2W9DL 4UINL 3G6DH 2AGAA 4DV6B 1CGTA 1GRWA 1U8LA 2H2PD 2JSFA 3ARXA 1I7UA 2EDEA 5FW7A 1E5YA 1H2LA 3D3VA 4G8AC 2EO7A 5D7LA 3RDTA 3IMBA 3OKKA 4ERSH 4N2EA 3ULAB 5GGVH 3SO3B 3RL2B 2W0FC 4AQEA 1A0QH 1ODUA 1AXSA 2D8KA 3CWGA 5TD4A 5DFWH 3BZFB 4G6AC 1YECH 4XBGB 1CG9B 4JG0L 1JWMB 4AI7A 6PAZA 2EABA 2IJKA 1WA8A 2V8MA 5J9PC 3LNDA 4IDJH 1GOGA 4PY8J 3D8CA 4Y19D 5BZDB 5KBNC 4FULA 3L3HB 2OYPA 1VFOA 2WO4A 1PY9A 4B3RB 4C56B 4NUJB 4OCWH 3IFNL 1U8QA 4DQOH 1BAWA 2MCAA 1E28B 3DUHA 3I9PA 3R4RA 4I1NB 2NDFA 3MLSH 1NOAA 2R39A 1F58L 2EEBA 3G80A 1RIVH 5A3ID 1BLNB 4P46D 3HJ0A 4IBLT 4LF9O 4JPWL 1XEQA 5I1EL 4X6EB 3C2AH 3WD5H 2IDQA 2X4OB 2EEFA 4KJQD 3SDXA 4EQ2A 5HDWA 2FD6L 1TVDA 3TCXA 3BT2L 3WB2A 4B9ZA 4DV0B 3KH4A 4NTYA 3SKJL 2G60H 4DR7B 1QPXA 1X3DA 5F89A 4KITB 1XCWA 2F54E 3B56A 4PG9B 3ASOC 4QKXB 1AI1H 5CP3H 5F1IA 5H37H 3RGVC 2VSMB 1AZZC 3U4EA 4OCRL 4P5TC 2GAZB 2NQDA 2GABA 1DBJH 2UU9O 3KPOA 2ZYSA 1NCGA 4WW2F 1AMYA 3GSOB 4B9KC 3PN1A 2HG5A 4NWTL 4IJTA 1OM9A 1T20B 2ATAA 3BZ4B 4XPAL 4MASA 2Z8WC 1TUBA 3OXRA 1MHCA 1XEUA 2CLVA 4U3JB 3GSXB 5IYZA 3DX6A 5I15L 4ZUSA 4BIUA 1QLRA 4LBAA 4OFYD 1M71B 4Q2ZA 4I5SA 2F53B 1MUJA 3L1FA 4AM0B 3GD1C 4QE7A 1XHXA 3BPOC 3SPCA 4ZS7H 3MLVL 3C8DA 1TU2A 5LAXB 4LPUA 2FH6A 3B3IB 2OA9A 3EO0A 2YXMA 2QGNA 3F01A 2K4WA 3QORB 2UXFA 3KG2A 4FXKB 2PWGA 4DAGH 3DI2B 2Q3AA 2CO2A 4QOKE 2Q7EA 3IK2A 3O6MH 4WW2C 2PTTA 4NHUA 1WCBB 1RPRA 2CR0A 4AH2B 2XV3A 3ME0B 4RZCA 1HKLH 2X70B 1SERA 1CLZL 2X10A 5BQDA 1HX0A 2X6VA 3W0WE 5JHDA 1B2YA 5L88L 1U3YA 5CN2A 4MJ5B 1ZGLB 4LFAO 1DBAL 3UO2A 1F41A 2MKLC 4G43B 5I0ZA 1XF3A 4YBQD 4IMLA 5AW8B 3N43F 4G5ZH 4M7KL 3ABKB 2Z8SA 3JD1A 4GLXA 3FQWB 4J4PA 2JTDA 3GM8A 3EJRA 2VDOH 2OSLB 3AG3B 1OPGH 3NCFB 3L45A 3U7AA 1UUNA 3RWCB 3JARB 2Z8VC 4W9KC 4L8JA 1AGBA 5F1NA 3SBQA 3S37H 4YHOH 3RYMA 4U05A 2LU4A 2NW3B 1C5BH 3HNTH 3RVUC 3VU1A 5C6PB 1JK9A 2FL5B 1IBLB 1BZQK 2JI3A 3BP6B 4E9TA 1H5BC 1ACXA 2XPZA 4H8HA 4XCFH 5FUOL 3B8YA 3GIVA 3Q48A 4Z5RA 4ZFGL 4OF7A 3A0RA 4CJ0A 5LGTA 5CR1A 3H9HA 4NUGL 3QUML 2Q7NA 2XBDA 5CILL 5I23A 4M9PA 5CBGA 1S7QA 4GX1A 3OLGA 1WZMA 3L8QA 4L1TA 3UROR 3VCLB 2DJVA 2CO1A 3V6FB 3UTZA 3CVCA 4OIIL 3NZHL 1U8IB 3FNKA 1C08B 3MACH 4HKJA 4D8PA 1LEIA 5D7KE 3T8VA 2F8XC 1OARH 4Z3IA 5KSUB 2ZUWA 4KMQA 2EADA 5AVTB 5EK0A 2Q9LA 2RH0A 2LW7A 5ALBL 1ILUA 2XUWA 2BOBA 4FFYL 3N42B 2YD5A 2AK4A 4AE1A 1JFFB 1QR9A 2VZOA 1WD9A 2WKGA 2AGJL 2GJZB 3HFMH 4HJ0D 4FA6A 5DF0A 2ZICA 1T3FB 2DWYA 2VDOB 3GJFK 4GUPA 3VFPB 5HD8C 3K71A 1L7TH 3RYFB 1MI5D 3JALA 3MRHA 3CFJB 5EBWB 4JDZB 4XPFL 3FTZA 4YDJA 1JRHI 5DEDA 1WZ1L 3I6GA 3NJGA 4LFHD 4MD5B 1CGUA 4CBCA 1BSMA 1ZK9A 5CEYB 3SKMB 1I8LC 3U4BL 3LXCA 1K33A 4K94H 4EQ3A 1RZ8B 4DRXA 2VLKD 3SJVD 1OTSD 1JZEA 1RP9A 4QJ3B 5AW3B 5ACMA 1UA6H 3GSQA 2YD6A 4PJIE 5E2WH 3K5OA 5ECGA 5HYQB 2ICWB 3UZEA 3GIZL 4MTOA 4JI3B 3RAJL 1BOGB 3OAYH 1K8IB 1H2KA 4ZMVA 2GIXA 4CDGC 1OTUC 3FFDB 5CGYC 3QJXA 3UO3A 1UZ6E 2W81C 2VDLB 4QCIB 1R6VA 1QA9B 2F1EA 3RTQC 3FCSA 1GN4A 3NAAH 2JE8A 1YPZA 1DQMH 1A8ZA 3EG9A 3QI9A 2HA1A 4UYQA 1MCIA 3HI1B 4QAMB 3B2VL 4MZ2A 3FTSA 5D2NB 4P99A 4KK8C 1JZGA 4WFEA 3G6JB 4MNGE 3OC5A 4ZRGA 4BK8A 4HT1H 1DJYA 5JJJB 3RVTD 2DM4A 2PR4L 1RUKH 4PV1C 3VXUB 1MABG 1UURA 2DY2A 1VZGA 4M48H 4UZSA 1P7QA 4RAUB 4QXUL 1V10A 1HHJB 5E2UH 4MYPA 4YVNA 3C5ZB 3VI4E 3PCYA 4HDIA 1Y6XA 1QSZA 3GJFB 4K71C 4BCXA 1UWFA 5KG9A 5D7IF 2YC1A 1XTLA 2NUPA 2OULB 2ZNWA 3G5ZB 1OK0A 1DBBH 1YMME 4I88A 2VQFB 2Y4TA 4RMRA 1QOKA 3V0HA 5CO1A 4UV8A 3CZGA 1Z1WA 3PWUA 2Q0OC 3N2KB 3MGOB 3SYOA 4ORZC 2WIIA 1QLFB 1W15A 9PCYA 5F7DA 3VXQA 4WUUE 2CWRA 4Y2DB 4XXDA 5H37A 3QW9A 5CP3A 3A21A 2VDPL 4Z7UB 1M6UA 3VFMA 2VC2B 4JHVA 1I7RA 1A6VL 1IFGA 4FHJA 4JRYD 4DV3O 3VFRA 4UCTA 5B3SB 3WG7C 3LRMA 4A2GA 2Z4TA 2YGQA 5IIEA 1J1PL 2GEEA 4LSRL 4KJPC 2YUZA 1UJ3B 2OSWA 4EVNB 3JWOH 1J86A 3AUVA 1IMHC 1J9QA 3T0EC 4W4LA 1MRDH 5HFLA 1Z5VA 3FUEA 4HXAH 4RRPG 3VXRD 2P42B 3L3JA 4JI4O 2DIEA 4OZIA 1MDTA 1WGOA 1HILB 1IBMB 3ESNA 4LT7A 5BO1L 2R2HA 4FEIA 1MFCH 3AG1C 3VB9A 2P67A 1TO4A 1U95A 2BX5A 4KKPA 4MA3A 3ASWA 2VM4A 4PLKD 4DN3H 2OI9B 1E2ZA 5HGHB 3LN5B 4OD3H 5HVFB 1J1XH 3PG2A 1DUZB 3WMPA 3OL2A 5C0BD 1I94O 2DYRC 1KBGL 1EEUA 1D5MB 4JFFD 3B9KA 1A6AA 2WZPA 1CXEA 2E0PA 3MA7B 4JCLA 2FB5A 5AW9B 1S9WB 2N59A 2UYLB 3WN5B 2AZAA 4O4HB 3HZMA 4LH7A 3QDMD 4P9ML 2BMKA 3BH8A 3MRJA 3OGIB 4MX7B 1F56A 2ZXDA 4D0CB 1E8WA 2CO6A 2Z93A 5DQDL 1IBDA 5ABDE 2HG0A 2XU9A 4F2ME 5JPMB 5DMIH 2VWJA 3NXSA 4BSWB 3MAWA 4G2KA 3GHPA 4Z1PA 1KJ2B 3QWRD 2P52A 1Z0NA 2FH8A 2WW8A 4G6ML 3IKCB 4WAFA 4MA7L 5IBUB 5I1JL 5KANG 1QWUA 4N5ED 2G38A 2VRZA 1NEPA 4NGHL 4W9GC 5FO7A 1E9QA 4CADB 5B1AB 1VCAA 4R5VA 2PO6D 5DR5H 3VD5A 5LMNB 5BOPA 2LU5A 4H5SB 1B0GA 3VB8A 3L3IA 3VD9A 1SF3A 5E9DA 2Z1PA 2YD9A 2DLHA 3LXUX 4Q20A 3RB5A 3RG1C 2MQ0A 3TIEB 1PTZA 4LLUA 4ZI8A 4X6CE 3QUZC 4LFBO 1DJWA 4XPBH 2UXNA 3ULUC 3F7QA 3VFWB 3BDXA 2IMMA 3LNFA 4YHMH 4YQXL 2APSA 3BMWA 1AS7A 3FSWA 2XWCA 4OFIA 1SM3H 5GZNC 4M1CD 2X38A 2F1MA 1MAJA 2XA8H 3QEGH 2ZSVA 3UG5A 4DEWA 1CLVA 1F18A 5KZCD 1WPCA 1CXZB 3BFRA 4YFDB 3AROA 2CDYA 2FYVA 3F7PC 2XX0A 4MB4A 2X41A 2HLAA 2NY6B 5EU5B 4LOUD 2CMRH 3TN0D 5IJ9B 3T3MF 1TSRA 1LMIA 3EUDA 1FGNL 1MJUH 3RZCB 2AKRA 4DV7O 3ARUA 5DQJA 1DBKL 2PWHA 5C08E 3RE0A 4JPIB 4IKJA 5CMUA 3TNMB 2A3TA 3FT4B 4OUUB 5DK2A 1RSYA 4FQHA 4GQ9H 4EDWH 2ZT9C 2GT9B 4DESA 2ILMA 3RP1A 1GAFL 3ZR5A 5KWYC 3WLBA 1QNMA 1VEMA 5LNDA 4KZDH 4XH2B 4DR3B 4N6RB 4AZUA 4YDLC 3G5VA 2XN9E 3AGWA 4M7ZC 4J3XA 4NRXA 3O0RH 2YAMA 4ZXBD 3ESVF 3NCYP 3JT0A 3TPKA 3VXNB 1JVLA 4Z3JA 3O4OC 4D9RD 2IQAA 1FG2B 4UAHA 4RFOH 4JI8O 3HI6H 2PZSA 1AGCA 3KLHD 2W92A 3PU7A 1TZOA 4POUB 4Q6YA 5CNHA 5DZ9A 3DX2A 2OR8A 1I1RA 2YWZA 4PRPE 1AAJA 2XVGA 3S5YA 3OFNG 1NVPD 1A1NB 2O5XL 1IAKA 3BGFC 3HMXL 2UXXA 2DQFB 3F7VB 4HUKB 4KVCH 4XHJC 1OP5H 1QUNA 1XVSA 3WFZA 1BVKB 1JI2A 1WC7B 5HHVH 3OSKA 4QHLB 3PHQB 3CSPA 5E1GA 2D0GA 4OCSH 2NY2D 2NY5L 3HKDA 4GS7B 4NKOA 1X5YA 3D30A 3OKEA 4APQA 3BQUB 2MKWA 1NFIB 3M1CA 4KK9C 5DSCA 2BHUA 2HVJA 4XBPB 4XMLH 4IS6A 4IHJA 1IQDB 2XJLA 1FC1A 5CR8A 1EN6A 4XMTA 4E41B 3E6FA 3PNWA 1X5KA 1D5XA 1JF1B 1AQDB 4H88L 1JTPA 2H4EA 3IDUA 4HKXB 1EFQA 1SF5A 2VDQL 2DRUA 3C5XA 2LFGA 4DVBB 1ASPA 2PCXA 1HZHL 3OG6B 3VRJA 1IBFA 1S9XB 4YE4H 4TVPL 3ZTNH 4L87A 3D3QA 1JP5A 1F3RB 4LARH 5BMVA 2ADJB 3BSHA 4N2DA 3NA9H 4JN1H 1IAOB 1M1SA 4MFHA 4RMSA 3IDYB 5F72S 3ULSA 1HS6A 2JQAA 3UYRH 3LNNA 4FM1A 2OMWB 5I75B 4B60A 2ZYIA 4FFKA 2F54A 2R56H 1KIRA 3C6EA 3ZE1B 4WJKB 3AM8C 2EKSA 2DQMA 1N0NA 3MAQA 4PV8B 3OLDA 3ORJA 2N74A 4FABL 4X7SL 4H0LB 3BUQA 3Q4HA 4J3OC 1NC4D 1HDMA 1K5NB 5IY5C 2ZXQA 3RA7H 2J4WH 3U1SH 5C93A 2NUTB 3HZYB 4O02A 2IAMA 3HZVA 2JB6B 4Q97A 3T1YB 2HP4A 3MRGB 2YIAA 2H0FA 3SKUD 2NZ9C 4JFEE 5EEYA 1IT9L 4A5UB 2ZKXA 2O72A 3DGDA 4HUCA 3V8OA 4DWHA 1YEKH 3STBA 1WITA 4HC1L 2CAKA 3ISRA 4KRMB 4PW3A 4ZZKA 3HR5B 4QXTA 2I9TB 4FLQA 1F51A 2D4DA 5MEND 2F9BT 4M93B 4MA8L 1S9YB 4QOKA 5EIIG 3DSNA 3LEVH 1JGEA 3DRTB 3FFQA 1YJNV 1ZSDB 1K34A 2DI7A 4MTMA 5IBLD 5EG6C 1YO4A 3WENA 1DQIA 2ICWI 4KVNH 1PF3A 2OJEA 4X8JB 3W0WA 3P3TA 4JRLA 32C2B 2B5UA 3JV6A 4HQQH 4K23H 5JNYA 2CKNA 4FNLH 2NLJB 4HJEA 5IQLA 4MTGA 1KCUL 3HKEA 1DO5A 2GB2A 3DUSB 4MDIA 1MRCH 5E9NA 3ZKXB 5I5RA 4QNHB 2XZAL 1M9NA 4NEHB 2QWPB 1OE1A 3LZRA 3OPZL 2EINB 3LUTB 1JTOA 1UM5L 2KERA 5AW5B 3V4UH 3HHRB 2KPNA 2AJUL 3MZGB 4YLBA 4ZMWA 2Z31A 1WWWX 2YS4A 3DO7A 3FQXA 4C57C 1XMWA 3DVGA 4RA3A 2B16A 2BSSB 2EXSA 3N0AA 3QFDA 5KS9B 4BFIB 1AZVA 4NJAH 4ZUWB 1HEZA 1WAEA 4XGZB 4LNUB 2MH4A 3QPXH 4HPOH 1C7SA 5LA6B 2HT2D 3RFZC 3LDEA 3CU1A 3LQAC 1XL6A 3RWIA 5AB9A 3OGOE 4HWEL 1TUEB 4IRSB 1IAMA 3DGGB 3NSFA 4KQ3H 2X2YA 3Q6GL 3U79A 4JFDB 4YDVB 2BVTA 2UX6A 1A6TB 3L5WA 1KXTA 2FTKA 4QTHB 2IPTH 1CICB 4JZJB 4X62B 2J57A 3MUJA 2ICEA 4L5FH 2HVBA 5CCHE 1YEGH 3GSNB 3CIQA 4XNXL 5C8JB 1JJUA 1FVDA 2CUIA 1T0MA 3WJMB 5JXAL 1AO7D 2MHAA 4NP9A 4XOAA 5AUMB 4FP8L 2AV1B 4UB6Z 1T2QL 3NTCL 1I1CA 4DYLA 5MEQB 4RWHA 2XC8A 1EVTC 3V5KA 4LPXA 1HCZA 3PAUA 1JUFB 3KPRD 1W0KG 2BO0A 1SUHA 1LO0L 3ZIAG 1OB0A 4BA0A 4GI6A 1GH6A 4F58L 3ZRFC 3BPNC 3I2CH 4YHZH 3MXWH 2HRPL 4O4YH 5H94B 4MQ7B 5BZZA 4IM8A 1AC0A 3HUJB 1KLFB 3DHJA 4GKNB 4XP5H 5FYJU 1BBJA 1R3LA 3AG4C 2OTLV 2OMVB 3KCPA 4M3HA 1UD4A 1LEGB 3OVUB 2WQSA 2QSTA 3NSXA 3QORC 4FXKC 4XXWA 1Y1UA 5DO8A 1FZMA 1V7NL 4O4IA 1CF8L 4OAWA 4RAVB 3BY6A 2CO7A 5AKTA 4X2UA 3S3JA 1KYDA 2VMDA 3TO4A 4CRPA 3VOUA 4U1LA 2HKHL 1RPOA 2XXFA 2V8LA 3F83A 2P5WD 4X4YB 3ETDA 4PJIA 3MRCA 2BLFA 2BOLA 4X20A 5MHSE 2VABA 3CFMA 1T5WA 1XHZA 3LNEA 3BW9A 5F9WB 4R7NA 4H26A 4JFZH 5JO5B 2VN3A 3ZRXA 1TQSA 4BXSV 2OCFD 4JI0B 4WNQA 4PD4F 3AG3C 1QFHA 1TQTA 2W80C 1U3ZA 3TJPA 2OXGA 1JVMA 5FW6A 5HJBA 3JASB 2NY3C 3SCMB 5T1MA 2X4QB 3AWFA 3EJYC 5F7NC 4L9LB 1S7RA 5C09D 1W72H 2ZE0A 1XSKA 2QTSA 2DWEA 4HIXH 1ODAA 1J18A 1W2KT 4QKTA 1E4JA 1TA8A 1H3WM 1W0YT 3AACA 3VXOB 1I4FB 4I50B 1YSOA 4D7TA 3N42F 3CDGA 4JGSA 2IOIA 1BP3B 1YHPA 3EFFA 3LS4L 1A7QH 3NZ8B 1KCLA 4RISH 5JOPE 3VI4A 1MCOH 4CSSA 4O4LA 1JGUL 2P4VA 4G11A 1QSFD 3H9SE 1O5DT 1MOEA 3ZHDA 5EZPA 1ZTEA 1KACB 3SHSA 3RRQA 4F7CB 4XC1H 2R0ZL 1AP2A 1YMMA 3DVIA 1EX0A 4OT1H 5E8OA 3WE1A 4UCOA 2ZUXA 2R70A 1LK3L 4H37A 3G67A 4GW4A 1JZ6A 3B4SA 1WAAE 3BAAA 3CFQA 3F62A 4ICWA 1NFAA 1VQKV 3PABA 4WUUA 5L8JB 3ARBB 3QDGD 4XAKE 1XDCA 2BJML 4B3TO 1CVSC 4YO0B 3BEVA 4NERA 1EJFA 1E42A 2R4RL 5GS0L 1EH9A 2A4EA 4N2IA 2E27L 5CU5A 1X5ZA 4TV9A 1T5XA 1QI4A 4G8GB 4Y9EA 1VMGA 3WFBH 3U11A 1N12A 2BY3A 5D7JC 4Z7QE 5EBWC 3B7YA 4JPQA 2P28B 1W72B 2YIHA 3T09A 4QPJA 4Y4KB 2P24B 1ACYL 4XB3A 1L9NA 4Y16B 1JZ2A 2ICES 2IPKA 2XAHA 5GJTL 2G75A 3U0TA 1JPSH 4UTCA 1KC5L 1WP7A 2EH8L 2EE9A 4QGTA 3K6NA 1CFNA 3G6JF 3MV7D 3L75H 4A66A 1FCCA 2BIOA 1VHPA 3Q8CA 5DTFA 5B8CC 3QRBA 4FOMA 5FO9B 1MIEH 5ICXB 4R90L 2M7WA 5B4MD 3K2UH 2LGQA 1TJIH 5DZAA 1QBAA 1UQSB 3EZ8A 3QHZH 3U0WL 1CXKA 4X9YA 3LNMB 4NM8L 3UO1L 5IJVB 3NA4A 3CSTA 3GMOA 1QFPA 4LEXL 1ECYA 3MKGA 2Z64C 3CD6V 3FRPB 1NQTA 3O9WA 1R5IA 2BNRE 2FAUA 3AQDA 3JTTA 5JHAA 4M43L 4BM7A 3OJVC 2P5OA 5D2NC 2WSDA 3SDDA 3VSVA 3VE0B 1H3PH 4GBXD 3FB6B 3WNOA 3VQWA 2VUOA 4LCCA 1XH2A 3QS3A 4P2RD 3V0IA 3APMA 4GCZA 4HOWA 3MLPA 4GP5B 3NESA 5B66Z 1Z9SA 3DV6A 4Z7UF 5FYJE 5HVWA 3F5TA 1URFA 1EBPA 2CH8A 3S3BB 4GPVA 5L2KB 2BVOA 2M6YA 3C5ZC 4F2MA 2ILLA 3H8NA 2DYPA 4JN2A 2VTFA 1AR4A 2RCSH 2RFXB 4FNSA 5DLMH 4F57H 1NCAH 1OCZB 3T0EE 3VW3L 1SMOA 2QVFB 3V5KB 1P53A 1XAUA 5H8DA 1EANA 1MCKA 4X80H 3FO9B 1KG0B 2JB5H 4FTVB 4HIEA 2Z35B 3VX0A 1MCPH 2NY7L 2VLJE 3L3DA 2BVQA 3PDDA 4JF3A 2AHZA 4L8SB 1ZVHA 4F93B 3VD0A 3D05A 4XMKL 3ZRWA 2DICA 1ZMYA 3LMJL 4NQSB 5BRPA 1L7IH 3ZR6A 4AEIH 4DKFH 3HZKB 1QWNA 4HHGA 4G7VL 4X6CA 3GI9H 3SOBH 4PJHB 5B39B 2BCKA 3PAYA 5F9JB 5ID0B 2J1YA 3INUH 2UXBB 4XCCH 2H0JA 2Z0AA 4W93A 1AFVL 4JKPH 1ADQL 3O3BB 2JJTA 1ZJAA 2HJKB 4WU7B 4HUWA 2GVYA 1JAEA 4PRAB 3UTSE 3D51A 2EUVA 2FO4B 1T6VN 5F0MB 4B50A 1HT6A 3GT6A 1YYLH 2K0RA 4NNYB 3DKHA 3OGCB 1FFXA 1TQBB 3AMLA 4HBNA 1OE3A 3CLEH 5IFAL 5IJKC 3WOVA 1IKFL 3DX8A 4U33A 1WLHA 2DQHL 1JOYA 5TF1H 1T7WA 2FIKA 2OI9C 5GHWL 3ZT6A 1QR8A 3SPHA 1S3KH 5C08A 1RZJH 2Y7OA 3F3HA 1Q1PA 4NIYE 4OI9A 1IE4A 1XGQB 3ULVL 3JT2A 4JHUA 1MVUA 4ODTL 2XQ0A 1WD8A 1G1XB 1T66D 4ZUTB 3SE3A 1FFOB 1EZVY 1H3XA 1UACL 4ZO6A 4F33B 2APXA 1IDSA 4X4XB 4XTRC 2XN9A 5EZIH 2HUHA 1XREA 5EFIB 4HAFA 4G9FB 2ADFH 4WUKH 5LNGA 3H55A 1MFBH 4L48A 4U6VH 2JJWA 4FLHA 1SYVA 4PJ7B 4YK4B 1DN0A 3WY2A 2H2SC 4PJFB 3IBOA 1DVFA 3OKDB 2CH7A 4MCYA 4PJEB 3TA3D 4FRWA 1KTLA 3U9PL 3VRIA 3CS5A 3IJEB 4U7SA 5IESL 4PRIB 4PRPA 4HNAA 2Y5EA 5JPMC 3D18A 3TM6A 1Z5LB 2C9SA 1QQDA 3CFKB 1ZA6B 3D33A 3BDBA 3ULUE 1SC5B 2WZ0A 2E75C 3S5LB 2CD0A 1SQVH 1JZ7A 2DQCL 1OGAB 2C9PA 4I3SH 2LAGB 4JM4H 5LDSA 1ADWA 2BNQB 3T0VA 1ENVA 2P5PA 4P4KA 5AAMC 3G9AB 2E74B 5B1AC 1N5AB 1OL0A 3IMRA 4NQCB 4XWGL 4YGVB 2ESVB 2H26A 2WO3B 3PJNA 1ZT1B 2F7PA 3DPDA 5GGQH 4YSRA 4JI2O 1JHKL 5LOVB 3CCSV 4ZX5A 4R8WH 5A2JH 1IEHA 1J87A 1KGCD 1LNUA 2BFVL 5HY9B 4X5RA 4ENED 4PS8A 3PXHA 1FFQA 1U91B 4JB9H 2DQEL 4X5XA 4CS2A 1ZTXL 5JHDD 1I08A 1WB7A 2J1WA 4OLYH 3KWXA 4X1KB 3O6LH 1B3IA 2FX9L 2UZXA 2OX5B 1JDAA 2FR4B 1MREL 2PI5A 2CXKA 4ABMA 1G4MA 1HSBA 2WGXA 3F64A 4NRZA 3WSQL 4D0BA 1DE4B 4IMKC 4J4PD 1FCGA 4YX2H 2J44A 4G82A 1T4WA 1JV5B 1S78C 4ODHL 5T8IA 2GCYB 4RZKA 2HFFB 2K6WA 3DIVA 4K3JL 2WWOA 3RZCC 1MWAA 2YEZA 3GMMB 2EDRA 1HK6A 3VXME 1I9IH 2Q68A 2FEDC 1W8OA 5IVZB 2NNFA 4PJXE 2E9WA 2W0FA 1DDHB 1JWSA 4M6NH 3ESMA 1B4LA 4X6FA 1K2DA 3MKKA 2EUXA 2OL3B 3TBSA 3VWJD 2CJUH 1A7RH 4LR3A 4BH8A 4J28A 2J5WA 4GKZB 2JIXB 1GCYA 3QR2A 4FG2A 5K9OB 1JWUB 2CNYA 1NH2B 1CD0A 5J9PA 4Y9CA 4IRZL 1QABA 2XFXB 4JFEA 2A5UA 1OOAA 3LN4B 3RN4A 4R6UA 5EPMA 2WBJB 1FFPB 3NJVA 1Z2GA 5DJ8A 4FQ1H 4A6YL 3B2DC 1BMGA 3WUWG 4MBOA 3MI6A 2Q8AH 4J12A 2AK4D 1P7HL 1Q82W 4JFSA 4JRFA 1VIWA 1I8MA 4I4TA 1DEEB 4F6RB 2DAVA 1HI6A 2B1AH 2WLHA 4M6AA 2DQTL 2LFRA 1DFXA 5KYWA 4Z76A 2V3FA 5IB4B 5CD5D 1KGIA 1INDH 1W0JG 4NNXB 4LP8A 4G8EB 1JVOA 4GS7C 1YDXA 1O9ZA 3RILA 4JNXA 4FJCC 1B2WL 3O6FD 2PW2A 4ONFH 3M46A 3N55A 3T2QA 1UD2A 3RGVA 4BDVA 2YD1A 4JI5B 1OGSA 5J8OA 5DJ6A 1N4CA 3MLWL 4KC3B 2WLNA 5GISH 4P5TA 2PABA 4G1EA 3ZE1F 4AQYB 4A38A 4QT5A 5C0RL 5IW1A 4X5QA 2LR4A 4DZBB 2VJ8A 5I0VA 5DD6A 4LRNH 1SDAB 2V17H 2K3TA 2XWRA 4LSVH 4I9WE 1P1ZA 4L9DA 2G5RA 1IEBA 3ZHUA 1DSYA 2XG4B 4WDIB 4WJ5B 2DQUH 1TAEA 3T65B 1BF5A 1IC7H 4OLXH 4OLWL 4AVIA 5CB4B 4FZ1A 2G0LA 4ABQA 3O4LE 3QI9D 1OB1A 3D39B 3ZO9A 3IGAC 3Q8BA 4Y4FC 1FVCA 3VXSD 2DI8A 4WFED 2R29L 4ZOLB 4PJ8A 2XXGA 1YN7B 1XIWC 2PTUA 4M8QB 4AYFA 1QSEB 2DF3A 2X2HA 4E5XA 1P7QD 3L5XL 5D2LB 3GZKA 2JJUA 4NXNO 2OCCC 1TCMA 1UATA 2QTOA 2LLGA 4DZ8A 3IVKB 1ACCA 2QM4A 2Y69B 2XNAA 5FV1L 3WELA 4AZ8B 1MXGA 1SJEA 1HHGB 3D4ZA 4CL7A 1EZUA 1T83C 5CF3A 5F8RC 3SGDH 2A77H 1OCOB 2XQYK 3IT8D 3VFVB 4S1QH 2EYRA 2EC8A 1LP9E 5DZPA 5IHUH 3RWJA 3P30A 4RLDA 1RY7B 2P8PA 4LBEB 4NQUA 4AYGA 3UCSC 1D2OA 4Z95L 2FEEL 4PS3A 5AVQB 1RVFL 4ELMB 5ACLA 4NO0B 3ZUCA 3U7WL 4QEGA 2I07A 3ARDB 1ILSA 5I1KL 2Y23A 5JW4M 3IJYA 1VGEH 3W5NA 4TS6A 1BSIA 4AVHA 1CLOH 1OHZA 1A64A 1EZLA 3C5JB 3T6WA 4WK4B 5GGRY 2QPSA 1NIAA 1H5BA 1RD6A 3WKYA 2A6JB 2R2BA 3X11B 1BJMA 5DYOA 4AYID 3ZKXC 1LD9B 2QQKH 3CUPA 5BV7C 3GZOA 1F3DJ 2ZNJA 1CF1A 3WFDH 2NNRA 1NUFA 3O41A 4IQHA 3RI5K 3WEXB 3UADA 4GXUM 1N0XH 4MHHG 2ZIOA 1HOEA 4LIQL 2KUTA 2QPUA 3NJLA 2FE0A 2ZCLH 3L95B 1J5HA 3MSPA 5LYJA 1LR1A 3HRZB 4FERA 2X6MA 4X1IB 4XVTH 4A7GA 5IVXB 3DJSA 3MYZA 2YPVA 2K6YA 4MTXA 2FBJH 5H4YA 5CSZA 4JV5O 1P5UC 2EO9A 4B95C 1ZKAA 3MGTA 4OFKA 1BQKA 2XPGB 5EYPA 5F0JB 3VQ1C 3II1A 1NUDA 3ZMVA 2Q8BL 3L16A 1RJLA 3B9KD 1DQDH 1P1VA 3C6SB 2EDBA 1GZQA 4U1MB 5D4JA 1CICC 4P4RA 4JZJC 1SYSA 3SPVB 5CD3A 4MSWB 3HUJF 4U7KA 5EZJB 3UPRA 3H9SA 2E4TA 3JV5A 1EHNA 1DGSA 1NJ9B 3LY6A 1KECA 3TBYB 1CDIA 4GMSH 1U8PA 1U8KB 3RURA 3V0FA 1NBMG 5DC2A 4Y1AE 5DT1H 1G9HA 1FFNB 3L4XA 1I8LA 4XVSH 5AWNH 2ORBL 1OAKL 4I0XA 2EDWA 2NYKA 3WBDA 5C07E 5C7ZA 1DQLH 3WJJC 5EA0H 4OCXL 3I75B 4IU2B 4U6YA 5DJ0B 1NINA 1WAAA 2YR3A 4FQIL 1NEZB 4WW1B 3FJTA 4OU3A 1BFSA 1L9SA 4JDEA 5DFVD 3UEZA 4KKLC 1IB5A 1UM4L 2SEBA 4UQ2A 2NXYD 3X13B 2O61A 2O4EA 3LKNA 3OHXB 1AE6L 5DJAB 1LK2B 3SE4C 3UZQA 3RTQA 1QR1B 4ZDHB 1GM8A 4L3ED 3OAWA 4X98A 3S3CB 1QNZL 2F7IA 3VGAB 5CBEA 2AANA 3TOPA 4XMWA 4F2FA 1WPXA 5E9DD 3BSGA 4JJ5B 1CGVA 1AIZA 1RURH 2MCMA 3BUPA 1TOXA 4K0KO 1FE8L 2K4AA 2XZQL 1BZKA 3O2DL 4UQCA 3UKMA 1KGJA 2XBZA 3BISA 1WZLA 1XD0A 1JF5A 2OMUB 2XAGA 5I6XC 4JO4H 3OSVA 5D8JH 3T0XA 4QRPA 2R72A 3TONA 1EO8H 1N3NB 3STZB 4GAYB 1N26A 4AIEA 3HLAA 4U6HB 4Q4EA 3HW7A 5F9WC 4Y1TA 2VR3A 4KHPO 3NGBC 5KVDL 3V52H 1FDLH 5FOBB 2BOCC 1MNGA 2BNRA 4FMFA 4RMUA 4OI7A 1GMIA 2B9BA 1TGOA 1Q1JL 4HALA 4NP4L 3ARVA 3BP4A 3M8OL 4MVUA 3PQYD 3K5NA 4L9LC 3L6FB 4U0RB 5HYFA 1A4KA 2IGTA 5TH2A 1L6XA 1L9MA 4UV7H 2BVPA 1C5CL 2JI1A 3ABLB 3QPQC 4LPYA 4XNQB 5DZOA 4JPRA 1KCSH 1FO0A 3CC7V 2VR4A 3BKML 4RAIA 4KRPD 5F8QC 1PYWB 5I6KA 1SXZA 3F2LA 3QS2A 1L3WA 1NBYA 5I1EH 1YEFL 3L81A 4DVRH 2R23A 3QXDB 4XN1A 1N33B 2QEJA 1MN4A 3O3DB 4IRJC 6FABH 4JFOB 3T0EA 4GG6F 25C8L 2J2ZA 5ESVB 2MPAL 3MRQA 1XGTB 3BT2H 3QNYA 5BUAA 4F4LA 1INQA 5GQBA 3SKJH 4A7VA 5I1HL 1NQBA 3EXJA 5I66A 3QAQA 2VLJA 4P23C 4P0DA 2IF7A 2TSBA 3BWUF 1BIIB 2PR9A 1K5QA 3ARBC 3M7OA 4OR1A 5HDRA 2YN5A 1PSKL 1IGFL 2DM7A 4PWJA 1BXAA 4I0PB 4PTTB 5HVHB 1H6EA 1FNFA 4PMFA 5HDOA 1TLKA 2ZJSH 1KIPB 4HF5L 1N8ZA 2B15A 1YYMH 2WXIA 4N90D 3TTSA 1THZA 4A7TA 5EF0A 1QFWL 4WI4A 1LE9B 2KPWA 3QIUB 3HMWH 4UILH 2XY1A 4HWBL 1FL5A 5EOCJ 5BMFH 4Y16C 5ICYB 1IBBA 2EIBA 3MBEC 1C1EH 4RWYH 3UTSA 1A8JH 1LGVA 3OJMB 4PJ5B 4MTFA 4X8XA 3IFLH 2WBWB 4NOBA 2IDTA 1E43A 3G08B 1LYQA 2WLLB 4NFCA 1BVLB 5FPOA 3B8MA 3P9MA 1QZNA 4XVOA 4RGND 4UBDD 1NKOA 4FNRA 5I5IA 1OAQH 1PFCA 4JZOB 5L2JA 5L7XH 3SY0B 3U1QA 4K8ZA 1V9PA 1I1AC 3OD3A 2MOGA 3KKYA 3BVTA 1EVUA 3BVOA 3R65A 2VCOA 3UTTB 5CCKH 1TVHA 2EVFA 4XBMA 3RTLA 3NJHA 1G7MB 1LDPL 2QE7G 2YD8A 1BE3H 3CDZB 4PJAB 4OKVB 1U8OB 1WT5C 4LVEA 3WEBA 3B43A 3NSJA 4GEJA 3FB6C 1U96A 4KY1H 2H6PB 4JZNB 4MD0B 3GHBL 1XF4B 1PLCA 4KHXH 3VFUA 4ALAH 5L4JA 4EFBA 1YY8A 1EGJA 3LQAH 3WFCL 4QNPE 2D2OA 4GQQA 4JJHA 4LLMA 3DYOA 2W65A 4X6BB 3QUZA 1BA9A 4XT1C 1UCBH 2C3GA 3UYPA 15C8H 1AKJB 5LUMA 3PGDA 3NJKA 3TBTA 1R3HB 4PN6A 5ANMB 4X42A 4ZQKA 4LL9A 2IAMD 4PJHF 1OCZC 2UXCO 1BM3H 2EXYC 1B4RA 4NBZB 2B1HH 5GZNA 1D5IH 4YIOA 3THOA 3L4VA 3TYFA 4Z7WB 2BP0A 4YHHO 4GUCA 1BD2E 1KT2B 2XN2A 1EEZA 4BHUA 5TQ0L 1NBVL 3K72A 3FQUA 5CILH 2GJPA 1QTYT 2JFCA 4F1ZA 4OF0A 3R7QA 2HHHO 3FKUS 4FDWA 4TULL 4KI5C 5DJXA 3WB0A 3I50L 4TUKL 4DV2O 2Q9OA 1CDJA 4QOKD 1MF2L 4PG2C 3NZHH 3MREB 2VUKA 5CJQH 2PTVA 2OV0A 5CP7B 3L4CA 4LFAB 1WO2A 2C3VA 2NY4B 2PP9A 2B0SL 3FU3A 2AZ0A 1A14L 1KENL 2Y7LA 1ZTMA 5ALBH 5DJCB 1JXFA 1TQCB 3OQRA 5SV4A 4AITA 3W0WD 4N2AA 1T6BX 2V3DA 1JFHA 3D85B 4TTDD 1J0IA 1AQKL 2AGJH 5LXGH 3EYQC 4TSCL 1R5WA 2BHYA 2RB8A 4CMMA 3E8GA 1QFWM 3MXVL 2ZE7A 4TVSa 5DA4A 5F70A 1HKFA 1MCHA 5L6YH 4XPFH 5GJSL 1NKDA 1ONQB 1AZUA 1KTBA 5F0PB 1K4CB 4B9GA 4BXVA 4CC4C 1T22B 4PJ7F 2YXFA 1EHLH 1OAXH 4PJFF 3B09A 1Z9OA 4L8BA 3FO1A 4PJEF 5J1TC 1AQ8A 3VXMA 1KN2H 4XN2A 2VL5A 2FVNA 1ZE3H 3GFUA 2JS5A 3MJ9A 4JASA 4PJXA 4I48A 4WI7A 1LJMA 3BSZH 3QUMB 5D5PA 1NCDH 1IGYA 2AITA 3L3GB 4HUVA 3GGWA 5LGYA 1CXHA 3RB7A 2JQMA 4EB6B 2VQEB 3GBNL 3D6GA 3OR6C 4N0YH 2CBQA 3BUTA 4B3VA 3FHEA 3BKYL 4RQFA 5ITBH 3QWOB 4PB9L 4W9CC 3R7RA 4PI2A 4LPWA 3JSSA 2DQJH 4CS3A 4HOMA 4Z7NF 2ATPA 1U9KA 5TGBB 1TZGH 1J9SA 2R8SL 2PR4H 1S5IH 4JUTA 3VI3E 1MVYA 1V3LA 1K3IA 1LUVA 1N32B 2YRBA 3MRBA 2Q6WB 4O2EB 3NEEA 5A16B 1XX9C 3EH3B 3FT0A 3KYNB 3RX7A 1Q9WA 4F8OA 1RH8A 2BDNH 3EDJA 3ZYZA 1FJ1B 2BSDA 4MNQD 4YHYC 4IEFA 5E8NB 5AYUH 5HGAB 1XZ0A 4AVJA 3C12A 3DMMB 3HNSL 5JIMA 3LRSA 3LDDA 3ILPB 3FN0L 3QZOA 1NTZH 1XDTT 2GJ6B 4JE0A 3TO4D 4GMTH 3A8TA 2OKMA 3AM8A 3V0AC 4AIZB 2YDEA 4NSKB 1SUJA 1ZVYA 1EFRG 4W68A 3WFHB 2FT7A 4Y7OC 5J2TA 1WV7T 2VDPH 1OF2B 3RNQB 4JI1B 4OIBA 4MAYC 5KYUA 4BKSC 4HW6A 2AZUA 3SE9L 3SGDI 2A1WH 3GLDA 3GNML 2FHFA 4I9WA 1UEYA 2YEQA 3ESPA 5E7BA 5CFHA 5LGHL 3QG7H 4CMHB 1F1DA 2ENPA 2WK2A 4NC1C 4DKTA 3WIHA 2ZE8A 3BDYH 1WB8A 4WFFE 1TMQA 1ZHLB 1BZ9B 4W9FC 4BKLB 3O4LA 5D55A 3ET9F 5C0CE 1FPTH 3G6AB 1IC4H 1ID5I 4MVBD 3BIBX 2QADD 3IXAA 4I1PA 4TSBH 5IB2A 3OZLA 3EJQA 2B4CL 2EIMB 3SZKC 4NO2A 4RMQA 1U6AH 4IHOB 5CBHA 4R0LC 4WV1C 1QLNA 4F3FA 3O8XB 4Q7DA 4GSQA 4IGBD 3CG8A 1CDYA 1FIGL 1IKNC 2CDGA 3BZFA 2ZYRA 3ETEA 3DETC 4MZIA 3KYAA 5C9JB 4XBGA 1J48A 4N0UE 4PVNA 4WEEA 1ZWIC 4NKDA 3EXAA 1C5DB 1JWMA 3L9RB 1KBGH 1T1YA 4CGTA 2ZCKH 5KHIA 1FIEA 2P22C 3CZSA 4G8FA 1YMMD 1GYCA 5HI3D 1D9KA 4LOFA 5K39B 3MV8E 2VDPB 1E30A 1FN4B 1E2WA 4PTUA 1TEGA 5DURD 1N10A 1LP9A 2VITB 1QD0A 5FYKU 4C56A 3AVEA 2WBJC 4HAGA 4NUJA 4XNMB 4X9BA 3OEEG 3LQMA 3P69A 3ZLQC 5DQ9A 4YNYA 1RUQH 1TTBA 4XCNB 5JJEB 4UT9H 5T3XE 1X5AA 1PNLA 1U8NA 3S3SA 4PJ9C 1BLNA 2L8AA 1HINL 2A6IA 3RFZA 4BFKA 1AI6A 1XGPB 2EDNA 2O5YH 3O3AA 1KIUA 2X4OA 3LKOB 4QUOA 4NKGB 1AS8A 3BGMA 1ORQB 5LHDA 3FT2B 4MW3A 2AQPA 4KROB 3ZHNA 1XCQB 1VQ6V 2A6KB 4G6MH 2NPLX 3OTFA 1M7UA 4MA7H 4C55A 1ZT4B 5L8KB 4KGLA 4JPVH 3RBSA 2Q2LA 4PG9A 4ZX3A 4FPPA 1XH3B 3CK0H 4PRNA 2F18A 3MRKA 4UIKH 4J7JA 3G5XB 3PDOB 2P43B 2H32A 3MNVA 5K1XA 1XEDA 5J57B 4YHLL 1L0PA 5JH7A 1I94B 3WKNA 5CWSA 2OCHA 3FU7B 4KHTH 3LSOA 4R9HA 1CI3M 3PL6B 4Z9KB 3WTSA 2VR7A 2C9RA 2R1XB 2MEJB 2A2QT 2BIQA 3RYCB 2GJRA 4KI1A 3BZ4A 5D2LF 1QZ1A 2HLFD 3D2UB 1ICTA 1A6ZA 4YSAA 1HYSC 3BXNA 3FB5B 2D31A 4OF6A 1H15A 4HCFA 3CVIH 1MJ7H 1M71A 2Z0BA 3S36H 1OSYA 1ZLZA 5FUZL 4XP4H 4J10A 2DB8A 3MRRB 5DD3L 2VDRH 1WFTA 1AQMA 1QTSA 5FO2A 3VH8G 4FF9A 3MHSC 3BCFA 3CFDB 2Y07L 4BAYA 1OCWL 3CH1B 3QORA 2IJJA 4FXKA 3CZLA 4Y1AA 5E99H 5EEXA 3W9EB 1MJJB 4ELMF 2Q6AA 2VXTH 4AH2A 1UD6A 1RZKC 3QB7C 4P30A 1OPOA 3KS0J 4NCDA 1LO4H 5C07A 3SQOL 3K6SB 1AD0B 2E7LC 2ZOTA 4NZJA 3TFKC 1DBKH 2FO8A 3EYVB 1BF2A 1UZ8B 2Y69C 1SHMA 2X87A 3QZWG 1RZGA 2AXFB 1J0HA 4OPHA 1S2EA 3VQ2C 4Z7IA 3FO2A 4LWSB 1FV1B 3E83A 4N8CH 3UDWC 4HJSA 4EF3A 1GAFH 2UZIL 3LPFA 2R15A 3SE8H 5HYIA 2PTMA 1OCOC 1VFUA 2E86A 2GTWB 2YI9A 5EOCL 4P57A 2OSLA 3ZZQA 5HDBB 4JM2C 2QT6A 3A6BL 1X9QA 3HEIB 3OLIA 3HC4L 2HAZA 3MA9L 5KS9E 1VF5B 1HL5A 1EZJA 3X2QB 1WJ3A 3VMPA 3F00A 2NW3A 1P0SE 1KN4L 1ANUA 1S6NA 4Q6GA 5BXFA 3O3EB 5IVXF 2FL5A 3JUYA 2CGYA 1N0JA 3LEYL 5I71C 4CC6A 5C97A 3ZXAC 1NGWB 1ZVSB 2P90A 3LEXA 1SMDA 2DMBA 5EOTB 1G9MH 1NMCC 4A39A 3ARFB 2WINA 3LH2H 2H45A 2Y0PA 4TUYB 4MMZC 4XMPL 2A9HA 3WIAA 4F91B 3WEMA 2VISB 4PLJD 4FFBB 1JFQL 1H9VA 4XPGH 4LCYB 4X83A 5IW6B 4BUHA 1B3QA 4QO1A 1SQ2N 3ROOA 1TITA 1JDDA 3S7GA 4DGVH 3HRZC 3Q0HA 5FF6B 4AYMC 2QFPA 5FXCH 1ZXQA 3OR7C 3ARPA 4BQBA 3MLYL 4H88H 5FV2A 5T5FA 3OKLA 4G7QB 3KHOA 5DZVA 3OX8B 4OQTH 3VUAA 4MVMA 1DO6A 1P4BL 3BIKB 4QYOA 5FYKE 2F6AA 4BFOA 1MCNA 5AG9A 3T1FA 2YAFA 5FL7G 5D7JA 4UOZA 4JI8B 3JAWB 2CBOA 3CFJA 5DJYB 4JDZA 5EBWA 2XN9D 4L8CB 1NGQH 5TDNA 5FM5O 4LAJH 3WLWC 43CAA 1DQQA 1R6TA 1FH5H 1OAUL 3HB3C 3DX9A 2AK1H 3RI5F 5IE9A 1DVFD 3KXFB 4FHKA 1LQSR 3VU2A 3JCUZ 4KDTC 5B8CA 3TV3H 4BINA 5J1AB 1UTDA 3KPSD 5HYQA 3IXTA 4PRPD 1HHHA 4G7YH 4GG8A 4OLEA 4NAQA 5LP6A 1K72A 1BOGA 1NBQA 3QWNA 4EI5D 1I9RL 2D3OW 3S88H 1QLEL 1Z7JA 1U2YA 4R5XA 3OHXC 1UXSB 1MPAL 3P0VL 3VVVA 4BH7B 4P4KD 1QA9A 2OMBA 1A3ZA 2YEVA 4NKMB 4OJFL 3NR7A 4BEIA 2HMID 3RJDA 2R9IA 3M07A 4J3TA 3ISYA 2CO4A 2PYFA 1DBML 5D2NA 4UNIA 1FNSH 3LV3A 1MZFA 4E0RB 2OK0L 2VDQB 1ZDQA 4FZEH 4YSUA 2VH5L 3A4DA 1CXIA 4ECNA 1HOCA 3D7PA 2F74B 2IH1C 1GGYA 3HNVH 3LHPL 3BPCA 1R73A 3C5ZA 2DKSA 4NENA 1FZOA 4J27A 3GJFA 2ATKC 2VDML 4UT9A 3OMIB 1NAKL 1NUNB 3L2LA 4K7PH 4WTZG 3D0LA 4ZOAA 1OAZH 2C9AA 2NX5B 5DD5L 2F4VO 4C4KT 4ZFFB 2YGOA 3QEQB 3GSVB 1V5JA 2FJFA 3N2KA 1JE6A 4UT7L 4E2LA 4YZFE 1A7BA 1QLFA 5D1QB 4I5BB 3H6JA 3F7KA 2WSSG 1EBAA 3LZQA 1PVHA 4U0RC 1FWXA 4L3CB 5EN2B 1IFRA 1A9BB 2EDOA 4J7RA 5T3XH 3ABLC 1R34A 4G28B 4AL8L 4X4ME 1MCJA 4WLCA 5BPPA 3LIZA 1O6VA 1IXMA 1HL9A 2A83B 2E9BA 4JKNA 2ZINA 2IG2L 1VEPA 1AJ7L 2NNXA 1UXLA 3CC2V 2Q3XA 4G6AD 3TT1L 3GZQA 4FLSA 4UCSA 3BP7B 1RXLA 4PH8A 4MZRA 3U2SB 4NO5A 2OSXA 4HKBB 4JHZA 3B2UC 5DWUH 1JXGA 1IGJA 4U2ZA 1FS0G 1VQ7V 2CO3A 1HILA 4JFED 1BD2A 1RK1B 4QXGH 1X9UA 2WQUA 4XBEH 3K91A 4FLOA 4XNBA 2FO1A 2EJ1A 4XNXH 4ODSH 4YBLB 5DM6V 2A9NL 4U1KB 4BRVA 5JXAH 3GDBA 1GYVA 1IBYA 1RJYB 3BZ5A 1T2QH 4LRIC 3B83A 1DUZA 3QCUL 4P5KA 5EZLA 1DTOA 2QA4V 4YJ3A 5HVHC 3PY9A 2VZ1A 3EOBB 4P9OA 4DR1O 1HWYA 2NY1B 1WAPA 3D06A 4JJOA 1HQRB 4MD4B 4DSYA 4NJ9L 2X40A 2PY5A 2ZPKL 3MA7A 3FDWA 4F58H 2QKIC 5E8DH 2UYLA 1XGYL 4DR4O 4OZFG 1M42A 4K5LA 1MWOA 1IBGL 1RUPL 3RGVD 4PJAF 3ZRVA 3P54A 3LXAA 3U9UB 4QRRE 5EEVA 4QY8B 1U93B 4WHDA 1Q38A 4P5TD 2WB7A 3J8F7 3JQOB 3TZVB 2B77A 4DV1O 1GAXA 3NEXA 4LLWB 2GKIA 1SDDA 1BBDL 2H3NB 1SFHA 5MP6H 1N36O 1HNWO 4UM9D 3HKBB 4K5MA 5ISZD 3Q05A 3DRQA 3PPEA 4LSUH 4ETQA 3EFDL 1GC1C 4TQEL 5I24A 5IQ9B 4TRPH 3IKCA 3RPBA 4M8VA 2WUCH 2FEJA 1IAIM 4I13B 1PW3A 4XN8A 4DKEH 4HUXB 1KBKA 3AUWB 4PEEA 5AD0A 1E5ZA 2LU3A 4Z7WF 3QJOA 4YC2B 5KTEL 1VENA 1MFAL 4KI5E 2DN9A 5CM1A 5I1GL 5ITZB 5GONB 2GSIB 1YEHL 2IBZH 1GW0A 1ZEAL 1PX3A 2Q20A 1E4WH 3C9NA 5AW2B 5GGTL 4MXWL 3VFOA 3TIEA 3K81A 2CSPA 2YKLL 5INDA 3O0LA 2ENSA 3TX4A 4BSVA 3VI3A 5L3GA 3Q2LA 2ZOLB 2ITCB 3W3BA 2EUWA 1Q72H 2Q7YA 5FWRA 2EJRA 2YMXH 4W4NA 2CTRA 3O6KL 4U4BA 3FZUC 1MFEL 4UZGA 2J56A 5GGSB 4IMKA 4I55B 2ZKHH 1UYWH 1X7QB 2R0ZH 2GI7A 3DBSA 5IJ9A 3B5GA 2DLGA 2IALB 1AXTL 3OZ9L 3Q6FB 3QQ3B 4Z18A 1DSFH 3RZCA 2R2EB 3EF7A 3U4AA 1PZ5A 2Z91B 1LK3H 4EBQL 3RVUD 4ZNEE 2IQ9L 3AU1B 2VZSA 1AD9A 5L4FA 4OUUA 1YEDA 1OP3H 5SWZD 1YEIL 1TQCC 4DNLA 2DTSA 3E8UH 3QEHB 1DTUA 3R1GL 3U0ZA 2R4RH 4ZOBA 5AL0A 5GS1C 2E27H 1IE5A 4QHNA 4FS0A 1TVKB 1JZDC 5D7SH 3EGDB 3QARA 2UWEE 3PGFL 3L2MA 1U8CB 1K73W 1H6FA 2YD0A 3CVBA 3HPLB 2VE6A 3TF4A 1K4CC 4TUOB 4BFFA 5ETUB 5C0CA 2YBRB 5GJTH 1AI5A 4BIZA 1ES0A 3TO2B 3L2NA 4MWFB 4WKXA 4PLKC 3U6XS 4JDVA 1CD8A 3NZSA 1IUZA 4GKLA 2V9RA 1K6QH 4QWWC 1A1NA 5EIIB 4B3MB 1JZIA 2N0KA 5E5MB 4NLHA 1WRFA 2DQFA 1BVKA 3UACA 3IFOB 5HD8D 5JOPD 3VQMA 5EU6E 3BUDA 3PHQA 2FJUB 3H3PH 5E4EB 5BOJA 3J81N 4UUJB 2ESVE 4N0UA 3L7FB 3JYBA 1UH3A 2ZM6O 3F12B 4ZFZA 1U3HB 3KW8A 3MZTA 4TNFA 4CU6A 1NDMB 3MNZB 1NFIA 2YRPA 3QYCA 4PD4J 5CZXC 4UQ3B 1U4EA 1Z2KA 2EP6A 5BVJB 5D4HA 2PP8A 3ASNB 4S1SL 4XBPA 4EI6B 3ZKNC 4OQ1A 3MV8A 4KNTA 2LW1A 1P4RA 3D1MC 3NIFE 5HPOA 1JF1A 4HKXA 1G9NH 4LLQB 3RBGA 1SPDA 3C60B 1NDGB 5C9KA 1UB5B 4WY7H 2QWOB 5I76B 2Y4UA 2JKTM 4O4JB 5L3CA 3A67L 4PRHE 1OTUD 2WKOF 5CGYD 1MHEA 1O6SA 2J1ZA 3UBGA 3HN8A 5K9KA 4DFHA 1DR9A 3IU3B 3A6OA 4NC1E 3RTQD 1B9KA 5CHNA 3MOAL 3R06B 3P4MA 3DMMC 4ISVA 1SOQA 2AQSA 3AEIA 1JRHL 2CAZC 2CU9A 3IGAA 2V7HA 2APFA 2BM3A 4XNZB 1DJIA 1BFOA 4Y4FA 4KK8D 4E9XA 3KZ8A 1HDJA 3I02B 2BS8A 1F11A 4N0FB 4YR6B 1JN6B 2GFBA 1XIWA 4JFQB 3TBWA 2EDLA 2VSDA 2DEXX 4PV8A 3QJHB 4AQOA 3T2NL 5ADOL 5AVSB 5EO1A 2FYYB 4UTBH 3T9WA 5CN1A 4N28A 4XMKH 5DVLA 5TQ2L 4AVKA 1D7FA 2ICWJ 2BSEA 4HETA 4QRPD 5IUCA 4GAAA 4NC0B 7PAZA 4JAUA 3H1KH 4KP4A 3P4NA 2XN1A 1I8UA 1TZ8A 1IBKB 2VLRB 3KLQA 4G7VH 4ZI7B 5DHVB 5IMLA 2XKSA 1T83A 2JB6A 3DHUA 4CMHC 3CTTA