2DYRB

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dyrB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dyrB02
4G7RB 2IWFA 1OE2A 1NZRA 1J5DA 4DPAX 1JXGA 2IDFA 3V9CA 3QPKA 3N55A 2PP8A 3FYEB 3IE9A 1X9UA 3TBCA 2XXGA 1NWPA 3OMAB 4HIPA 3NJMA 1GY1A 4WTQA 4YSQA 2DYRB 1UATA 2YAPA 1AR1B 4KNUA 2HLEB 1L9PA 1NPNA 4AKOA 2B08A 5B3SB 1ZV2A 2JKWA 2VSMB 2BWIA 1PCSA 1VLXA 2FT8A 2YXWA 2IH9A 3FT0A 2BP0B 2ZWNA 1ILUA 3QJRB 3QJUB 5FC9A 3EH3B 2FT6A 2R7EA 4HHGA 3HB3B 2PLTA 2MTAA 3WG7B 4YSDA 2BP8A 1JZJA 2YARA 1B3IA 2XX1A 2EIMB 3ZIYA 4YSCA 5LDUA 1JZGA 1DYZA 1OCRB 4BDVB 1ZDSA 2XV0A 3ASOB 4F2FA 1SJMA 2PCYA 3QQXA 3NJGA 9PCYA 4BWTA 4F7KA 2MRYA 1SFHA 3CVBA 1N70A 3ABGA 1MG2C 2DV6A 2GHZA 3NJIA 3NP3A 5B1BB 2AZUA 1JERA 1A3ZA 4GP5B 1M56B 2DYSB 1AAJA 2DWTA 5B1JA 2W8CA 2JXMA 4YSPA 2ZONA 2YAHA 3WNJA 4E9XA 1PAZA 3JT2A 3T6VA 4E9TA 1A4BA 1KYAA 4KO7A 2J56A 2XUWA 3G5WA 1ET5A 4A67A 4P5RA 4A2GA 5A7EA 4YSSA 1AG6A 3EH4B 3RYMA 4AX3A 4DP7X 3OQRA 2HZHA 1PZCA 3TASA 1RKRA 3X1FA 2Q5BA 2X87A 3FSVA 1IBYA 1OCZB 3NJJA 1KBVA 3X2QB 4QLWA 2H3XC 1BQRA 1BQKA 2PPEA 3UGEA 2QT6A 2PP9A 2VW6A 2YAFA 1AS6A 4MFHA 2UXVA 1OF0A 3FYIB 1X9RA 4HCGA 2FT7A 2HX8A 4NAJA 1L9QA 2VW4A 3IBOA 3NP4A 4N4YB 4KNTA 2FQDA 5I6OA 4DP4X 5PAZA 4ENZA 1NIBA 1NIDA 4JKNA 1AIZA 2W88A 1FA4A 4JHVA 1AS8A 1NDTA 3AG1B 1GS7A 8PAZA 4E9YA 4BWWA 1MZZA 7PAZA 2GBAA 3FPXA 3PLYA 2A3TA 3EHBB 1NINA 1BXAA 2EIJB 3V9EA 2J57A 3S3BB 1WS8A 1JVLA 2UX6A 4KOBA 1MG3C 2Q9OA 5I26A 1BYOA 1A4AA 1J9TA 1DZ0A 1SDDA 2N0MA 1T5KA 2HRGA 3FSZA 2GI0A 1GW0A 5PCYA 1A4CA 1KV7A 4YL4A 5TK4A 1FWXA 1AANA 3QJTB 2EINB 1XB8A 3GXUB 1JZEA 1RCYA 1WS7A 5TK2A 1BQ5A 5I6MA 3X1BA 1E65A 1JVOA 1WA0X 1ZIAA 3PCYA 4BK5C 3ABLB 3OM3B 1E30A 4G7SB 4HZ1A 2JFCA 2BZCA 3NJLA 1PY0A 5F7AA 4DPCX 1NTDA 4GY4A 4G70B 4AZUA 2PPDA 2BZ7A 4M4RB 1SFDA 3GDCA 3NSDA 1ETJA 1A8ZA 3TA4D 1PZAA 4AI7A 3UADA 1TEFA 4DP9X 1V10A 2P80A 5I6NA 1PNCA 3FU9A 1NICA 1GYCA 2XX0A 2EILB 4YSUA 4M3HA 3ABMB 2VW7A 2FQGA 4E9SA 3CVCA 5AFAA 1CC3A 1AACA 1W6WA 3CZUB 4E9RA 1E5YA 3SQRA 3KW8A 3WI9A 3X1NA 1AOZA 3SBQA 5AKRA 1XMEB 3OMIB 2UXGA 4DP0X 2I7SA 3H4FA 1SHWA 3QJQB 3ABKB 1OV8A 4KO5A 1KDIA 4L0PB 4AKPA 1AS7A 4G72B 1YLBB 5D4HA 3T6XA 4HALA 4BXVA 4YSRA 4QKTA 1JXFA 1PLCA 2E86A 2TSBA 3DKHA 2BW5A 3FSWA 3CDZA 3H56A 3WNIA 3FS9A 1ID2A 4GP8B 3UACA 4TXVB 4HCIA 2UXFA 3OMNB 4E9QA 3JTBA 5ANHA 2VM4A 4HAKA 1AQ8A 1F56A 4KOCA 1PNDA 2CALA 1ZIBA 2OCCB 6PCYA 2HRHA 5I6LA 3ASNB 4PCYA 4AKQA 4DP1X 4GYBA 1JZHA 1RZQA 2NRDA 3WKQA 2AVFA 2PPAA 1HFUA 2WSDA 3QJSB 1ILSA 4KNSA 4JHUA 1PMYA 4F2EA 1ET8A 1RZPA 4A2HA 1I53A 1KCWA 2H47C 2HXAA 2QDWA 4CSZA 3WKPA 1BYPA 1WA2X 2LLNA 1L9SA 2Y1AA 5F7BA 5I5JA 3FU7A 5B1JC 3FPYA 3H4HA 2BW4A 1L9TA 2YAOA 1NIFA 1A65A 7PCYA 2XYBA 1ADWA 1SNRA 3NJFA 1EHKB 1OCOB 1PF3A 1W6LA 4YSAA 1ET7A 2VM3A 3QJVB 1ASPA 4ZK8A 3FQ2A 4RH4A 1CUOA 2EIKB 2DY2A 3AY2A 2BHFA 4YSTA 1CYWA 1FFTB 3TBBA 2ZXWB 1M9WA 3EF4A 4FAAB 5B7FA 4GXFA 3ZX1A 4W9ZA 3AG4B 4NERA 3S3DB 1KDJA 2CJ3A 1GS8A 5B1AB 1PLAA 2I85A 2GC4C 1J9RA 2GIMA 3X1EA 2AANA 1QNIA 3S3CB 4BDVA 1JZIA 1KBWA 1NIEA 4BXSV 5I5IA 4A2EA 1JOIA 2BP8B 1EZLA 2XXFA 3PAUA 1OE3A 1ZPUA 1L9RA 2YAMA 3HEIB 4A68A 2PPCA 1MZYA 1SHXA 1JZFA 4N8UA 2WO2B 1HAUA 1AZCA 3AG2B 1GS6X 1AZNA 3UABA 4HCFA 2VSKB 1J9SA 2GSMB 1BAWA 2FQEA 3NT0A 5B1KA 3C75A 2GB2A 3NJKA 3SBRA 2IWKA 4KO9A 4PAZA 3NJHA 2CBPA 3NSFA 2OV0A 1ASQA 2J55A 2YQBA 3U25A 2QPDB 6PAZA 2FWLB 1XB6A 4P5SA 2QPEB 3D12B 3PAZA 4HHWA 1AZBA 2PP7A 5I5MA 2UX7A 2H5UA 2VMJA 3UAEA 3MBWB 1SF5A 2AFNA 2OJ1A 3PXLA 1JXDA 2PCFA 4DP2X 3UAAA 2TSAA 3ZDWA 4A66A 3DTUB 4W1TA 1R1CA 3L45A 2FNWA 4DP6X 1IC0A 4G7QB 4EF3A 1OOWA 1J5CA 3AZUA 3IEAA 2IDUA 3T9WA 2XU9A 4X4KA 4DP5X 2XVBA 2WO3B 2CUAA 2BP0A 2YEVB 4DPBX 3BQVA 4KO6A 5E9NA 2IDSA 1WAEA 2FQFA 3ZBMA 5I28A 3FQ1A 5IY5B 3T71A 4YSOA 3CVDA 1CYXA 3AW5A 1L9OA 1SF3A 1QLEB 2RACA 2XV2A 3DIVA 1GR7A 4K9JA 1URIA 2HX9A 2XWZA 3FU7B 3WIAA 1NWOA 3NJNA 1W8EA 4UAHA 1BXUA 1AZUA 1PLBA 1IKOP 1J9QA 1GY2A 3NSCA 2BO0A 2I7OA 3TU6A 4Q89A 2IDQA 1E67A 1SDDB 2X88A 3FQYA 3GYRA 2AZAA 1TKWA 4E9WA 4BWUA 2IWEA 1OE1A 2CAKA 2CCWA 3IN2A 1NPJA 2IH8A 1TEGA 1IUZA 2YAEA 3S8GB 1IBZA 1ZDQA 1QHQA 3MX0B 3N2JA 1ASOA 1KCBA 4A2DA 3PPSA 4NB7A 3KW7A 3T6WA 4DP8X 2R7EB 2Y69B 5B7MA 3EH5B 3OD3A 2FTAA 2YXVA 1AG0A 3X1GA 5D4IA 1OCCB 3PAVA 4WKXA 1HAWA 3FSAA 5EHFA 2FJSA 3BVDB 3NYKA 2QDVA 2PPFA 2P80D 2IAAC 5D4JA 2HX7A 4YVUA 2IDTA 2DWSA 1WA1X 1N68A 2VN3A 4A2FA 2XLLA 1GSKA 1BXVA 3FU8A 1XB3A 4YSEA 2YAQA 4CSPA 5AZUA 1M57B 1E5ZA 4Q8BA 1V55B 3S8FB 4UANA 4YVNA 5I6PA 2XV3A 1KGYE 4UF7C 5I6KA 3IN0A 3CDZB 1BEXA 3CG8A 2UXTA 3AG3B 3NSYA 1V54B 1PZBA 2ZOOA 3SBPA 2J5WA 1TU2A 4GP4B 1AZRA 4E9VA 4G71B 4FA7B 1CURA 5B7EA 1NIAA 3ERXA 2GC7C 3T6ZA 2BWDA 1MDAA 2B3IA
chains in the Genus database with same CATH superfamily
3PWJA 2H0PA 3QNZA 4OGYL 4X99B 3ZO0A 3LQAH 3MUHL 3QR0A 3ZYZA 2GIXA 4FQXD 3VQMA 4R90L 3L95A 3PQYD 2IJKA 3R06B 3JCZA 4ZNCD 1A6VL 2PP8A 5IVXE 3JD2A 3ZKMD 5LGKA 2H2PD 1KP3A 4N1HB 1YMHA 4J12A 4UQIM 3GI8L 4JYCA 4UILL 1Q6UA 1S7RA 3D50A 4UT6A 1EDQA 3QRLA 1G6RH 5IM7B 3E9TA 3NMEA 5JA8B 1NPNA 2CDGA 4O2BB 2KHAA 1MHPL 5H37G 4HIXL 4K3JH 5C0BA 5CLTA 5JZ7D 3OGOE 4KKBC 4YHZH 3B9KD 3U0WL 3VXRA 1QVOA 1EQWA 1F1AA 4DUZO 2WKGA 2VC2L 1UC6A 3K6SB 2WQWA 5EC2C 4KI5C 4HYTB 4TNFA 3BHBA 5D1XC 3TJHC 4NI6A 2J6EL 1INEL 4MD4B 3IGFA 1XMQB 4NLAA 3IJYA 3JTSB 3VFOB 3KPRA 1C08A 4PELA 2DB8A 4QEGA 2Z0BA 1SJMA 4KBPA 3VXMA 3PHQA 3QGVA 4RX4A 9PCYA 3EGXA 3PABB 4ZJ9A 1PEWA 3CVBA 4ZFGL 1RL1A 3SJVD 4Z7NB 3MOAL 1A0QL 3ARRA 4B0MM 1JXKA 4JFSA 2O61B 3ARDA 5EA0L 5HGAA 3JWNH 3GMMA 2XN9B 1QBAA 4FLUA 5EU6B 4C58B 4AW4A 3VU1A 4GW5B 4ZODA 5B3JF 3W57A 4K0KB 2IBBA 3MOBH 2I9LA 5AZ2H 1V27A 3SGIA 2X2YA 2JV6A 2P43B 3HAEH 3L3KB 5JNYA 1I1FA 3Q44A 1I9RH 2IQAA 3RA7L 3OPZL 4KXRA 4M4RA 4KHPB 1PG7X 5ECGA 4L87A 3WFBL 3RYMA 1T6VN 2YUAA 1Q0YH 3DSFH 4H8UA 2PWHA 4Y5XA 5FYLE 1RKRA 2O5XH 3ZHKA 4PBVC 3VFUB 2X87A 4OF7A 2GSIB 3K79A 3QXAA 1MCDA 1RZIA 5I0WA 2EVFA 3V4VH 4U1HB 5IB2A 4YGVB 3O3BB 3W38A 2RMKB 1N5YH 3AG2C 3I85A 3HR5A 1BQKA 3P54A 3IVKA 3FHAA 3DX8B 1CL7L 3FQRA 1P9MA 1KBHA 4JFPB 5FR3A 4XN9A 3APOA 3GXPA 1X9RA 4RZCB 4YY3B 3KBFA 4QWWC 2JELH 1XUQA 1S7SB 1TTFA 4QGYA 5JDSA 5AENA 2FKXA 3T0XA 3K3WA 1KCSH 2E46A 1IC5L 1YYLL 2BOBC 1O7DC 3RZCC 4Z77A 1Q43A 5T1KA 1DVXA 1F6LL 2F1EA 5PAZA 5DMJB 4Q14A 4JKNA 2WYTA 3IJSB 4JHVA 4ZPTB 3HE6A 4YHML 4JAUA 2JK5B 3QXAB 3X3GH 2CO7B 5B1CA 1BQHG 7PAZA 4P4KA 1PW3A 1UVQA 5AOKA 5ID0A 4XMLH 5FM8A 2EIJB 1BW8A 1SEBB 4I55B 1JGUL 2EDTA 1Z9NA 3K81A 4GAAA 3G6DL 4K94L 4YDIL 2HTLD 2IIJA 1BVOA 2L6LA 1PFCA 3ECWA 3WNLA 1MG3C 3JTSA 1XL4A 3L7EA 3FB5A 1UD8A 3SN6N 5I26A 3OE7G 1DZ0A 2D9QB 3MXVH 2GJZA 5C07B 4DRXB 1G6RB 1WBYB 4JVWA 4CVXA 1WAAF 1PYWA 1PYWB 2QHLA 3EKCA 3SKNA 2Q67A 5H2BB 1P2CB 4N6RB 4FG4A 2KH2B 1KTLB 3PE9A 4Y2DA 1DUZA 5AVVB 4FNTA 4J3OF 2ZNIA 5FUOH 2VCOA 1ZE3H 3MRJB 5IFJB 5C9KA 1M4UA 5SV4A 3VD5A 4KRPB 4PGCA 5BMVA 3RPIB 1ZLUH 4HXAL 3JV0A 2JGUA 1WA0X 5LBSL 4OZHB 4BK5C 1H3PL 4FJ6A 2C1OA 1CGVA 3HE6B 1ZLDA 3LKSA 1LO3L 1MCQA 3GUFA 3RBSA 4AZUA 4QRPD 1XSKA 4LGRB 1XX9C 3NSDA 3MR9A 2AHIA 2W0LA 4AV0A 5EEVA 2X40A 3UC0H 1JK9A 3ARDB 2PTTB 3TVMC 3W0WD 1KZYA 1ZA3B 1MI5B 3FU9A 3BVTA 5T1DH 3DX1A 3L9YA 3DX8A 2CCVA 5JVDB 1KJ2H 2FL5B 3BYTA 1ZTXH 2HG5A 4NENA 4HISA 4L8DA 5KMGA 4JCMA 4HUUB 2DWYA 4R6UA 4CSSA 1K7DA 2M26A 3GXMA 3WLBB 3CZUB 2P28B 4QHMB 4NTYA 1JR9A 1J9CT 3CN4A 1U8LB 3WS6C 1QTYT 1JJ2U 1VZIA 1N59B 4H0IA 1FS0G 4NWTL 1F1DA 1QFWI 5FECB 2PR9A 4HJSA 5KS9F 1LVEA 2CJUH 4W4KA 2CNYA 3E2HC 2EDLA 4C83A 4M6AA 1T20A 1GKEA 1BBDL 3APDA 4L0YA 1G5GA 3IMWA 4L0PB 4WFGE 4AGQA 2ZOTA 4B3RB 4DTGL 3OR6C 2Y5TB 3VB8A 4GKSB 2E86A 2FLMA 3RVWC 1VIBA 4JB9H 2F4VO 4R4BA 3TZVD 3BISA 3BGFB 3L4UA 3VW3H 2AZ2A 5I75B 3P2BA 1E0OB 2QGEA 5AKSA 1OGAB 3IXTB 2YKLL 2OZ4A 3AJ7A 5KVGE 1GPOH 5ANMA 3L1FA 3DX6A 5KSBF 1JCKA 2WZAA 3GMOA 4I9QA 2RB8A 2ICEC 4X62O 1BV8A 4MB4A 3KBHE 1YMMB 2BOCB 4KOCA 1DVFA 3L74H 3GXNA 2EDWA 5KANI 4NZFA 1R3IC 5C9JB 4L37B 3SZ6A 2IJIA 3M1OA 3P40A 4YDMA 2EDRA 1O9GA 4FM0A 4FLVA 1UQSA 3JVFC 4P9OA 5CZVL 2CGOA 5CILL 1N32B 2PYLA 1KCRL 4PP2A 5TQ2L 4BHUI 3D25B 4IQHA 5IJBC 4YHPB 1NQTA 4MRBA 2ODMA 2QELA 4XXWA 4MVOA 3TS8A 1AI1L 1KCWA 1YNKL 2NR6A 5AVTB 5DQDL 4L8SB 2A6JA 3ZO9A 1XD0A 5FA4A 4QRTA 4F7TA 3WLWC 3DVGB 2PWFA 1X6NA 3CFUA 2CO1A 3TK1A 2XTSA 3QZWB 4LCCA 2CH7A 2QKIC 3K6NA 5IJ9A 4N90E 4KXZI 3G6EV 3MLTB 1EBPA 8FABA 1EM1A 3DNKA 4LT7A 1N0LA 5HDOA 4NQDB 4ZMOA 2UZXA 1IGIH 4P2RE 4UU9A 4GQQA 4PN6A 2PGGA 1J5EB 3QQDA 1PKQA 4ONFH 4GRLA 5I1JH 2L3BA 1UM6L 3C5JA 4R7DB 1XCQB 1B9ZA 3C6LA 2FYYA 3ARZA 3WIHL 1FP5A 3TA3D 1FFTB 4O4LA 1HILA 2KL6A 2HJLB 4C57C 1EVUA 5CJBA 5GGRB 2APTA 5IW6B 5JLZB 2P67A 3S35L 1QBMH 4NAMA 2MEJB 4HPYH 3VGEA 4JQIL 2VQFB 4OD3L 5G5DA 1LD9A 2OMBA 1IVTA 1R34A 3OGIB 4MNGB 4ZMAT 1PL3A 3H7LA 1XGRA 3GB7B 5D5ME 1ES0A 3BCFA 3VI3B 1U8NB 3VI3A 1ZSHA 1JNLH 4FNLL 1SKVA 1RZKC 1GKFA 5IQ7L 4W68A 3KEHA 3FFDB 1E8ZA 3R66A 1PQZA 3NH7H 4DESA 2WXOA 2R23B 2XQYK 3I9GL 3UIYA 3P0VH 1BX2A 5TISZ 3IU4H 4EUPG 3ZDYF 4GIAA 4LP8A 3E8GA 1JPXA 4E4EA 1MZYA 1JZFA 4N8UA 2BSED 3VWKA 4DGWC 3HZYA 3OEHG 1DEEB 4HH8A 3IPEA 3SDCB 3RYHB 2VSKB 4Z8FL 2UUBB 3THOA 1XXDC 4I7ZB 3TEWA 3VFMA 2Q2LA 4U6YA 1EV2E 1S9YB 1KJ2L 3BT2L 1WZKA 1WHOA 3ZE1E 5JW3H 5K9KB 4MZRA 1Q9WA 1DK1A 1PTZA 5L3BA 3C3TA 2LU3A 2DYPB 5AVUB 4KMTL 1WRFA 4LSTL 3EJCA 5CSZA 1RULL 3D12B 3ZHRA 1T1ZA 4R2GC 4FLWA 2PP7A 5EZIH 1HXKA 4JFQA 2KKWA 1B4TA 3ZTNH 3RG1C 1LNQA 5IHHA 3QI9A 4OBSA 2A6JB 3P3NA 2Y2WA 3GUTB 4B3SB 2OT5A 2WLHA 4EKJA 2BVPA 4XBFA 3QHFL 4FE9A 3CN1A 3MYJB 1TTUA 1H3GA 1YN7A 4ZSOE 2LE9A 5K93A 3SDXA 4OBRA 4ZMTA 1ACYL 1QPXA 1LUWA 1KC8W 4RRPA 4HUXA 2PUQT 1HHJB 1K6QL 4KRPD 2OZNA 5GS3A 4PRAB 3KZIZ 4M5ZH 2GUOA 5FUOL 2YQGA 1OHZA 3GQFA 3B2DC 4KDTA 3U46B 1IM9D 4GRWF 4JI1O 2LLGA 3M6DA 4W6WB 2XCMC 1NDMA 1IIIA 3HG1B 3OKKB 3GSOA 4LMQE 2Z93B 2DLTA 3WEOA 4JFOB 4K7PY 2H3NA 4U3XA 3U83A 4JZJB 5DC9B 3MREB 3FU7B 4DR3B 3GJFH 2R70A 2JKIS 4TNEA 2DTSA 1PZUB 1T03L 3IT8D 3NCWA 1I7TB 1WZMA 4ZBMA 3BUDA 3CU1A 2AK4E 4D7BA 3U1SH 4H25B 5D2NA 2HG5C 1Z5YD 4OLYL 4WI3A 2Q8AL 2R1XB 4EUPA 4M56A 3I50H 5I1IH 4JNXA 2X3AA 3BRGC 1H6UA 4MA8L 5CSBA 5EBMA 2V4DA 2N74A 4OFDA 1GGTA 4X50A 4HBNA 1YUHB 1OE1A 2IWEA 3BWAA 1KB9F 5FHBL 5A3IC 4M6ML 4QR7A 1BJ8A 3O0RL 3TVMB 2J8OA 1IBZA 4UNIA 4X83A 3ZKXC 2E7LC 1ASOA 4U1GC 3VFVA 4ZNEA 4RGMB 4WZ9A 3DC0A 1G7PA 2HB0A 3MNWA 5IF0A 3GBEA 3B2XA 3FUHA 4OI9A 3C8KA 3CFTA 4LPXA 3OHMB 4HCRL 5FB8A 5B7MA 2ZYSA 3MLUH 2X0LA 1O6SA 3MGTA 4OM0L 5IK3A 2QADB 3H85A 3QIUA 5GZOA 5ICZA 3UTTA 3SPJA 1RXLA 2AABH 5EULV 4WKXA 3A4DA 1JL8A 4Z7OB 2XHBA 2O6DA 5EBMB 2VDLH 3AUWB 1GH7A 3KGTA 3KYOB 1FHNA 1SOKA 3IDNB 4CS4A 2BLFA 4M5YL 2J88H 4P2YA 3TO4A 3BW9B 4AL8L 9CGTA 3EJTA 5FOBA 3GUTA 4QMEA 4PTTB 4J6RL 2YUXA 4JKKA 4MXWH 2J8HA 5DUBB 3EJPA 3FU8A 4DXWA 1NGZA 1BL8A 3BP4A 4GT7A 3NEOA 1F4WH 3T65A 2BVOB 1OXYA 3KPPA 2R2HA 3VXOA 4PGJA 5IB3A 4PCKA 1BT8A 4RFOL 4XVUC 2DKSA 3DSNB 3O4OB 2UXCO 3VFNB 4RUFA 4UTCA 1KPVA 5HD8C 5FECA 3K04A 4KHXL 4NBXB 5GISH 5HHQB 4OCRH 4J5VA 3MLVL 3CAFA 3LS4L 4XC1L 3MSPA 3W7SA 2P46B 1K33A 2FJFB 2MCPH 2ZUQB 3ES6A 1JP5A 2CRMA 5SX4I 3VWKB 3K72A 4M00A 2BOCC 4XNAA 3MNZA 3TBTA 3NJXA 2L8AA 2XWJB 5EU6D 4E42A 3VE0B 4MJIA 3ZL1A 1Q4NX 1QNZH 1JF1B 2EEAA 3PDOA 1T0MA 2XTAA 4NC1E 1GTOA 1KXTA 4KZDH 3IM1A 5DD6A 4DPAX 2ZUSA 5GS2D 2OLDA 1NOFA 4Q58C 3FU6A 2OL3A 1D5NA 4RSYA 5LP6A 3OMAB 2W80C 4TF4A 2IH1A 3R7QA 5C0NC 3RDTA 1TJHL 2YAPA 3GPSA 3B9VA 5BQ7A 4IYHA 1T1XA 5FIEA 1E4JA 5DLMH 4GXVL 3ZY7A 1A6VH 1RIVL 2X6VA 3AT9A 1YN6B 2FJGB 2WINA 4HV8A 5FO9B 3DVIA 2W60A 3L3OC 2WUBL 4HHAA 2H1LM 4R90H 4F7MB 5ACZB 1SC5B 4Y4HC 4JR9L 3IU3B 5DS1A 2BMKA 4JPSA 4U6XA 5ACMA 2H0FA 4OGYH 5EU6A 1FNLA 4YBLB 4NLHA 3CK0L 4JFHD 4JFQB 5FGBC 3SJQC 1GA2A 2DWXA 2FLRT 3C5ZC 5AAMA 3R7RA 4TOIA 4BCYA 4BZ2H 5C3IA 3MA7B 1WICA 4UCFA 3OJMB 2XFGB 5JOFA 5D5MF 2YR3A 4ISVB 3TEUA 1ZHBA 4LR3A 3LH9A 3JAWA 4QHNA 3VGGA 5CA1B 3MLWL 1D5BB 2AZUA 1QR1A 3PF2A 4XP6L 1N2RA 1K9TA 4JANA 4BSWA 2N7AA 4YH6A 2DYSB 1J8HA 5IBTL 5FKAB 2GQHA 1X5FA 1QX1A 1KYOK 5DRWB 3U1PA 2AXGB 4TTGA 4NNYB 3C5JB 3KR3L 1NJIW 1LE5B 5F8RC 4XB3A 3VM5A 3KXFA 2WIMA 3MQIA 4KTYA 1IAOB 4I18A 4LFBO 4AENA 3O6FC 3UT5B 2YGQA 1DVZA 4XH2B 4UUJA 4DUXA 1Y67A 2QM8A 4XDKA 3BWZA 1CF8H 4P30A 4OLZL 4HS3A 1OLLA 1BVKA 2EE9A 3O3AA 3VQLA 3T2LA 5DMYA 3QA3A 4KPHH 4P4RA 2VXVL 1K4DC 3GKWL 4X9QA 1T7XA 3ELQA 3Q1SL 3WBDA 4OZIF 2ESVA 1AH1A 4PRNA 1KN4H 4EQ2A 3R0MA 2BDNL 2QT6A 3FDWA 3ZKNC 2F43G 4DV0O 2NXYC 3FQUA 4X99A 4FQXA 2V5MA 5EC1C 3STZC 4LPVA 4PCTA 1MDTA 3DOSA 3PFUA 3MRFB 2WWOA 4XVSH 1IZJA 1BZQK 1URZA 3IBOA 1HNWB 3PN1A 1F4NA 1IM3A 2FGZA 3SDYL 3QO0B 4JGNA 1JNHB 3RYIA 1T5XB 4ORGA 4RQQB 5CLZA 4NXNO 5D7JA 1HW7A 4HIJA 4BSWB 4LSPH 3VFWB 4P4KD 4NZTL 5DMIL 1MCWW 3DJZA 3FPXA 5EPMA 5FUZL 5DO8A 4EVNB 3MX0A 4FZ8H 3OJDB 3D69B 4NOFA 3TX4A 4QLRA 4J3UA 3DVGA 2ZQMA 3QUXD 1RU9L 4U0RC 5HGHB 3BN3B 3QUMA 2GK0B 1J88A 5F71A 5T5NG 1WS8A 3O81A 5C8YA 3OB0K 3MRIB 1QKZL 2NZ9C 4XAKD 4IOIB 4U3SB 2UX6A 2XNAA 3LEVL 4F7PB 5GRVK 1SQQH 4K8ZA 2PYEA 1A6PA 1MWOA 4PUBH 1OAZL 3MBEA 4O00A 1KYFA 2F54B 1J9TA 1A6ZA 5SWSB 1VDGA 1E9OA 1RUQL 2K3HA 5LYJB 5C0AB 2EXWD 4JDZB 2F5BH 2IFGA 4D3CL 2YD3A 3B9AA 2JI3A 2E5LO 3TXSA 3ATAA 1DQLH 3HG5A 4WFBV 3D0VB 1N2RB 4JANB 5DYFA 2Q69A 5FYJL 3TLRA 4WEBH 1TMQA 1VJSA 3C5ZA 3C2AL 4WW2B 2EINB 3ARTA 4Q4EA 3ZQ9A 3GXUB 1QHTA 2ADIA 1E9PB 4B7KA 4XCEB 2QADD 4A6YH 1E65A 4PJ7A 2FWOA 1XCTB 3ETGA 1JPFA 4U7SA 3QORD 2JFCA 4L4TB 1I94B 4FNSA 1U6AH 4X4YB 3CPUA 2QTVA 3HVDA 1K4DA 1NTDA 4GY4A 1UT1A 3EJYC 1EUUA 2GY5A 5LJYH 4FFYL 2XQYG 1YZZA 3QUXB 2IJ0C 5EU6E 3MV8A 4QXTA 1EIBA 4OZFB 2DQMA 2C4XA 5KVFE 4ZXBB 1UWGH 3GBNH 3ZKSD 4JDEB 1I3VA 2H6PB 2CHZA 1XGQA 1F3DJ 4DV6O 3QORA 4PJAE 5KZCB 1GAFL 1UXSA 3C87A 2W9EH 4FFKA 1DL7H 2EILB 3CXHK 2NZIA 3HNTL 3AB0B 4QF1A 3EOYG 4NQCE 3P77B 3BH9A 4NZUL 5IFHH 4NPKA 1R5VA 2O57A 2ZZUT 1AACA 1OWRM 2D9CA 4W9IC 4I0PB 3L2MA 1BM3H 2AQSA 1KUMA 1EO5A 1UASA 1TJMA 4N2FA 1X7TA 2BSTA 1TIUA 3G3LA 4N8CL 2VKXA 1DN0B 4JRXD 4WUUB 3T2NH 3VDCA 3VWJC 2GJPA 1QBBA 4PWKA 3S3JA 4GQPH 4Y9CA 3BPOB 5TE7H 4UT9H 3TCTA 3BSZH 2G38A 5H2BA 3L3GA 4N0RA 1W16A 2WQ8A 1JI2A 3SDDC 4RISH 4M8UA 2VH5H 3FQRB 4OQ1A 1UACH 3HUJE 4IJ3C 2L04A 2MNJB 2TSBA 3KYOA 1C12A 2LVEA 4N68A 2EVGA 1W15A 4WF9V 3S5LG 5E9DB 5MEPA 1JFQH 1FO0B 4GAFB 4QIRA 4AGOA 3QVNA 4GP8B 4Q52A 5DEDA 1UD4A 2ZUVA 3WXVH 4LGPB 1ZSDB 4P9ML 2GEQA 4JY6A 4F7EA 5C0JA 3RTLA 4DW2H 4X6BA 2PYJA 2YK1H 1LEIA 4LAJH 2X9YA 1S7QB 3P02A 1QVFU 1T7ZA 3C6LD 3O0LA 1M7DA 3G4SV 2JQAA 5DUMH 5I6LA 5B8CB 3CDGA 1FYTB 3O2VH 3GTNA 4NSKB 4I0PD 4DGIL 4GYBA 1MQKL 3IAGC 1HWYA 2DD8L 5HI3C 1JMXA 2LHAA 4P2QA 3PHAA 2ZP9A 5ERWA 5FDYA 4LCYB 1S7SA 3BXNA 5JDSB 4S1QL 1PMYA 4Z7UF 2X44D 3ZZSA 3DDFA 4A7QA 4ACTA 1TA8A 4UFZA 2ZD9A 4XN5A 2QQQA 4MDRA 1KUQA 2COVD 2H47C 5I0XA 2N01B 4QO1A 2E75C 3UTOA 3HRZC 1GGIH 2QDOA 3QXDA 1WN7A 1Q72L 1FZOB 2A6DB 3VG9C 2FX8H 3C5ZB 4YIQB 1TAEA 1SJXA 1EHKB 1UWEH 1HEHC 2Y7OA 4IEFB 2BSDA 3EDDA 1PF3A 2ARJQ 4HZLB 5CEYA 3MRMA 4Z77B 4FZEH 2Q8VA 3QJVB 4K55A 4YHIA 2IFFH 1WA8A 4DR7B 3JYBA 4FKEA 4PS3A 1GN3A 5CINL 1P6AB 3QNYA 2H41A 1MJ8L 4PWGA 1I1AD 1I1RA 1IEBA 2LABA 4I2XA 4FAAB 5B7FA 5DZNA 4DVBB 5KA5A 1DF5A 1I7TA 4IHOB 1T22B 3D85D 5CBAA 2O61A 1A7QH 1QFWM 2EKJA 1QR8A 3ARBD 4P5KB 5IB2B 1QACA 4PEEA 5LQBL 1MFUA 3DUUB 3RDTC 3SKMA 4PJ7B 1GS8A 1JA8A 1NCBH 2H1PL 2ZOKB 3ARVA 3QUZA 3TWCH 1UTDA 2FJHA 5B1BC 1E42A 2JF1A 5GTHZ 3ZDZE 3O4LB 2ZAGA 4ZOEA 1AP2B 1CLZH 3Q2VA 4PJXF 3E1F1 5TQ0H 1EZLA 3FO9A 4JZOA 1HDMA 5KSUB 1I8KB 4R8WH 3H6AA 5SX5K 4F7CB 4WCYH 4U7MA 3OAYH 1E4XI 4ORGB 5LCVL 1MELA 4HMDA 3CMOL 4ZO6A 1CXIA 1G7HB 1HAUA 1I9JH 3NIGE 4MQTB 3FZUC 3L3HB 4TRPH 4PRHA 1I9EA 2CO2A 1T6WA 3DGEA 4HYOA 1D6EB 2VZSA 3S2CA 3JSSA 4G5ZH 1PNMA 3EXLA 4Y19E 3ZTCC 5EU7C 4CSTA 1BVLB 3APMA 3ME0B 4OM1H 5I2IB 2YFNA 4RMRA 1DLHA 1F1GA 1LP9A 2FWLB 2E9GA 4ONHA 1BVNP 4HHWA 4HBCH 4AC2A 2AMUA 2C5DC 2Z7YA 3ARBB 3BGMB 3HKZA 3P73A 4XDLA 4LSUH 4MD4A 4BZ1H 1JI1A 3C3SA 2AFNA 4MSWC 4CMHB 5IV2A 3PU7A 5BOPA 4YHYB 3HC3H 3DTUB 3R65A 3CSPA 1L0PA 4GAJH 3E83A 3L45A 4JPIB 4Q7DA 3QQ4A 5F0JB 2ISDA 1VSCA 3D08A 5C0CE 4BH8A 1J5CA 4AJYV 1GJUA 3H9SA 4JYAO 3ZRFC 4XNYL 5EDXA 2ZG1A 5BQDA 4JQVC 3VFPB 4YNYA 5L4FA 1BJMA 1FO0L 1AGDA 1SY6H 3CFBB 5DWUH 3RJQB 2DMXA 3Q8BA 3EJUA 4OF5A 1RZ8B 1XQ8A 2FQFA 2OMYB 3ZBMA 3AACA 4N90D 2D73A 5CD3A 1IL1A 5J56B 3S36L 4ZUWA 1YMHB 5EN2A 3C60B 1MW0A 1CYXA 5I1KH 2D3NA 2J1WA 1JPGA 2P47B 3RL1B 4ERSL 5ALBL 4O2AA 3TBVA 2B4CC 2P5EA 4GKZA 4DKTA 2QQNH 3HKBB 1OGPA 5CN3A 3IRCA 3AY4A 3THML 1I1YA 4LCUC 3QRFM 4L4VD 4JDTL 3ZYIA 2UY6B 5HHMD 1IKOP 1GY2A 3I6KB 2BWQA 3VJ6B 1Z5LA 1SDDB 2NY6C 3GMPA 3B7RL 2X88A 4GRWB 4JVUA 4UTAA 1RUKH 4S10A 2RH0A 1YHPA 3L54A 3MRPB 1SA0A 1ZE3C 5ILTH 3NA9H 4PA9A 5ABDE 3CX2A 3OR7A 4X80L 2AJXH 3BQUC 2AP2A 4JM2F 2HEPA 4LWSB 1FHGA 2YAEA 4GKNB 1DVFB 2P42B 3LEYH 3LYRA 2ADFH 3HMXH 5I8CA 2N0KA 2YC1A 1DUYA 1SM3L 4GFXA 3QH3B 4HC1L 1PLGL 3BGAA 4ELKA 3L9EA 1KACB 1XV8A 4WO4C 4ZS6C 1B0GB 3L4XA 4H44C 3CFMA 2RCVA 2IJHA 4N2BA 3LNMB 3SKMB 4F8TA 4EUPH 4P3DA 2OULB 4BV1A 4X65O 3C60A 2RNBA 3KNBA 1GTNA 4XPAH 3M86A 3FTZA 1AFVH 1IEBB 4X1IB 2ARWA 3FMGL 2PPFA 5HXMA 5C2UB 4K5PA 4PP2B 3LSOA 3GLZA 3WB0A 3WFEH 1MFVA 1G7HA 1LNUA 3HUJF 4KY2A 3HI1B 3II3A 1INDH 4ZDHA 1H5BC 4H40A 4U49A 4BH8B 5AVRB 2FBRA 1ZHLB 2WM0A 1BJ1J 5CIPH 4HKBA 5F0PB 3DPBB 4J8RA 2OX5B 2VRZA 1NAMH 4ICGA 3CZKA 5HYSB 4DR6O 3C08H 5BZWB 5I24A 3F6JA 3GVMA 3OGCB 1UXLA 1QEWA 3EJYD 2FUQA 3FH7A 1BEXA 3NCFB 2EIJC 1LP9B 2M8XA 3K4DA 3W0WE 2NOYA 2W9DL 1AZRA 1X7SA 1E28A 1TJIH 4KXZH 5FYLH 1DSFL 3LN5B 3OXRB 4HUNB 2JJ1G 3TT1L 5B8CC 1SQMA 4H13C 2GEEA 4KXBA 2WLJA 4PB9L 1ZLWH 5BNXD 2QSCH 4A04A 4DAGH 4PREB 4WBNA 1RJZB 5AW6B 3NAAH 4WJ5A 3L13A 1IQDB 5C0FB 4Q2ZB 3V9CA 2PI5A 4H1LH 1FFNA 3B2UC 3DSNA 4CN4A 4WK2B 3QPKA 2JJSA 4OCSH 4YFDB 4CJ0A 4OV5A 3UCQA 4L18A 1KTCA 4HIPA 4WEMB 2CQVA 5DHVH 2G9HA 4CMMA 5KMGB 5D7JD 2CDFB 3HRZB 1VMGA 4JPVH 4PWIA 2GK2A 3T4AB 2HLEB 5GHWL 3V5DB 3QHZL 2WGXA 2BFVL 3DIFB 2B08A 2Z5UA 4ICWA 5SWZA 2RALA 3CJHA 4J6IA 3TBSA 4XBEL 3Q6GH 4ZW6A 2VABB 3HE6C 3TH3T 2FJUB 1DBAL 3JT0A 6FABL 5H8DA 2CHWA 1TVBB 2VZ1A 1NLBH 5IYZB 4DUYB 1LGVA 3L5XH 4ZUTB 3WNPA 3B34A 3VRJB 5EOQH 3KDPB 1L5GA 1N10A 1SDAB 1ND0B 3HLAB 2NY3B 1AD9B 3IGLA 5KHKA 3HR0A 2P24A 3QEHA 4UQBA 1XBLA 3DYPA 1Z5HA 3FFCB 2XX1A 1O75A 3S5ZA 5BZWA 1DYZA 2DQFA 5C09E 2CXKA 2GYSA 3EUUA 4CADA 3QC6X 2XV0A 3RZCD 4J2XA 3VXUA 1FNFA 4WU7B 4F2ME 5LWYL 1SFHA 4LCCC 5BRZD 4JI5O 4M1CC 2X0WA 1MFEH 1FZOA 2A6DA 3AQXA 3ZEDA 3O41A 4YGAB 3MODH 3TPUB 5B1BB 3K0WA 1W59A 5AALA 4QRFA 2LOEA 3Q8CA 2VDML 1AGEB 3T09A 2JXMB 3RFRA 2P5WD 1CLYH 1NKOA 3EYUH 4PJ8B 3QXTA 4QXVA 2WKLA 1PDKB 1NM9A 1ET5A 4G8FB 4P5RA 3RVZA 5B4MD 1CD8A 4A2GA 1XBDA 3QUXA 1R75A 4YSSA 3EH4B 4KKLC 4AX3A 1ZKAA 2NW2B 2NXZB 1A6WL 3FQTB 4RDQG 4YDJB 1M6UA 4EE2A 4JFDE 4YDVA 1CT8B 1VF5B 5AVYB 1XNQB 2CO4A 5JIQA 5KSBE 5L2KB 1RPQA 4DF9A 4DQAA 5D5PA 1FUNA 2J43A 3NG5A 3LNFA 4G6FD 1ZGLP 3CTTA 1LEIB 1R6NA 2JCWA 4CBZA 1J1XH 5DJ8B 4MCMA 2FZ3B 4WJKB 3GSUA 2VW6A 4WFHA 4MFHA 4JY5L 1KSRA 2F19L 3S96A 4LLAA 4KK5C 2XWBA 4KHTL 3VGAB 1CK0H 5HJGA 3EJQA 3PWPD 4MSWB 1P5UB 4EIZC 5E8PA 3JD3A 5AOJA 4OZFH 5CEZH 1HTYA 3T1FB 3U2SA 4OCSL 4Z7WE 5H94B 5D7KD 1CLCA 1BG9A 1ZEAH 4Y4HD 3L3GB 3CWGA 3GXTA 8PAZA 3CSXA 3A4AA 2WXLA 3DO4A 4TPRL 3HHSA 4XWGL 3LH8A 4NQTA 1FZMA 4Z7VB 3V5HB 2Z0AA 2KPWA 3ZMZA 4YAQB 3B9KC 5DI8B 1TPXC 4PJ5B 2FCBA 1F6AB 2BTQA 3S3BB 4KTEH 3V0VB 1LK3L 2NXZD 5DGRA 4XN8A 3MGOB 1KCKA 3GEFA 5C0ND 3FQWB 4NQQA 3BD4A 4U1NB 3EIFA 5GS0L 4P5TA 4MMZA 1OP9A 2V8MA 3MC0A 1NCOA 3QO0A 5CU9A 4JX0A 4KKZA 1JZ4A 2ALAA 4B9JA 1YITV 4FTVE 2VDPL 2WWNA 4FQCH 2A9AA 2CGYA 2FHBA 4KRMB 4AEIL 5EZYA 1FWXA 2C26A 2M6YA 3APCA 3B7TA 1VFAA 4QXTB 2BOBA 4KXCA 3W7XA 1DQQB 4H8VA 1U9KA 1INDL 3I5DA 3D3QA 2BCKB 2AEPL 1X3DA 1BD2E 4I77L 5TK2A 3PQYE 1JV2B 3WFEL 5T1MA 2V7QG 3SKJH 2YRLA 3T08A 1A7PH 1DQIA 1RHFA 4PB0H 3QG6A 4HZ1A 4QI3A 4S2SB 1HVXA 5HY9A 4L8SA 3MUGA 3F2LA 1SMOA 3N41F 1XEUA 3PUUA 3H1LH 4X5WB 4PWEA 2VERA 3TNMB 4M1GL 5ANME 4DZBB 1WD8A 2V2XA 4OFPA 4PJBF 2EH7L 1Q9OA 2W07A 4I5BA 4Y1AB 3RX8A 2D8KA 3SQBA 2X2JA 2QSQA 2E56A 1H0DB 2R1YB 1V10A 3LY6A 4X0NA 1MJUL 3NIDE 4XHJC 3SDLA 4DR2O 2CK0H 4NRXB 5FKAA 3K59A 3EGDA 3W1ZA 4NYLB 1OAQH 1ITCA 1WFOA 1S5IH 1U2YA 4FJZA 1JGVH 4GW1B 3ASOC 3EDEA 3MRKB 1MFMA 3D3VD 3RHWF 5D1QA 4HIEA 4XNMA 2VDOL 1OARL 4QJFB 2X89A 4B3EA 2PYFB 1UENA 3ETTA 3CXDH 2DWDC 2W0XA 2AW9A 3H1ZA 5EFIA 4BHUA 5J9PA 1AOZA 2A9HA 4UUJB 5EFIB 1EH9A 3GSVA 4UVAA 3LNHA 1G9HA 3MRBB 4EIBA 1F11B 4OCXL 2Y6TE 2GSGA 4HIHA 1SHWA 3DBXB 4UB0L 3M88A 1WWAX 3GMQA 4G6KH 4PJIE 5JQHC 2WB1A 2BVYA 3GMLB 1G1XB 5FPRA 3VD9A 5DZPA 1Y1UA 3JWOC 4X89A 5DRWA 5DZAA 2F9BT 1X5ZA 1IGJA 4OR1A 3HG4A 1VADB 4U2YA 2R27A 3VXQB 1AHWA 1HNFA 3FQWA 4OZGB 4RGND 1ID2A 1WAPA 3TZVB 3FO9B 3EJSA 1CQKA 3LKNB 2OIGA 2XKUA 2W07B 1FBIL 3BFOA 4Y1AA 4EN3D 1F3RB 1CFNA 1FSKB 1YEIL 2BPBA 3NZUA 4X6CF 3ROLB 6CGTA 3IFNL 5JQGB 3EDJA 1KENH 2R51A 3FB6A 3RI5K 3K03A 3MNVA 5E5UB 1F56A 1Q1PA 4XXDA 4BWAA 4PJ7F 1YHQV 2G5BA 3L3DA 4AQ1B 4R4BB 5DD6B 4HIEB 4XNMB 3REVB 1W0JG 1MCOL 5E9DD 1LUVA 1XO8A 4PBDA 3UO8B 2AVFA 3EGDB 2BNRA 3C8DA 3DURB 2QGCA 3RTQB 2ZX6A 1FVCA 3SYQA 2PWEA 1HOCA 3JWOH 4PDMA 4TT3G 1KJ2B 2GI7A 3EXJA 4D6TH 3RJOA 3DROB 2D2OA 2UWEA 2DQUL 1AHKA 2JQZA 1TQCC 3LV3B 1KB5B 4M8RA 1QR1B 2BRQA 3T2OA 2YICA 1B4RA 3FQXB 2VLJA 1J0YA 1X5XA 4NQSB 4KFMA 2WXGA 3PY9A 4AM0B 3WFCL 4A7GA 5K33A 1BG1A 3BUBA 2DEYX 1DJSA 4AJ0A 2OMXA 1NUDA 4PGBA 2MPAH 3F7VC 1OTUC 4WCYL 5I1DA 4AIZB 4R8WL 1AIFA 1BBJA 3BXNB 1NBZB 3WKML 3NK3A 5LXVA 3AUVA 1CUOA 4ZYKB 4Y7MA 1L0XA 4FXKA 1G6RA 1WBYA 3SPVB 4CVXB 4JI4B 1BCIA 2ZXWB 1KTDB 4AQAB 3KCYA 3ZN1A 4W4OA 3K5RA 2LP7A 2G0KA 4NC0B 3ZR6A 2JS3A 3ZSTA 1KU9A 5E99H 3T77B 4OPHA 1KOAA 1CG9A 3LHPH 3NIFE 3L7FB 3OBAA 5T1MB 3CFCH 1PLAA 5TE4H 1OCWL 2JWYA 3X12A 1MJ8H 4NRYB 5JCOA 2VQUA 4LCVA 3AQYA 3QDGB 1OANA 1LR1A 4L1HA 2J4WH 3HEIB 1VQPV 1SYVB 5JPMC 1R4XA 5HVHC 1E4HA 1OSPL 4JO2H 3SPVA 1CS6A 5CUSH 5FOBB 4CH6A 4QXWA 3UABA 4DRXA 1QD0A 5M94B 4W9FC 4O02A 1RHHA 4XTRD 4BFRA 4Y2DD 5LGHL 3RWIA 3RIKA 5DWPA 2NR6D 2VDNB 1Y74A 4WSGA 3NCXA 3QDME 2VDOB 5KAFZ 3LB6C 2WLKA 1D5MB 2YQBA 4G28B 1N8ZB 2FGWL 4CL7A 1BQSA 5KTEH 1AO7A 5C6TL 4XMKH 2BSKB 3KVDD 5GQBA 1BF8A 4MVZA 4FQ2H 3PRZA 1FDLL 3IAPA 2XY2A 2VLJE 4QYOB 4B97A 3GSOB 3BZEB 2IAND 4PLJD 2YPLD 4XVJH 1SJHA 4KY1H 5JHDA 3KCXA 3OHXA 2H2PC 1XGQB 3QORB 4L4TD 5BVPH 3DHJA 3OR6B 1JWSA 1Z66A 2JLPA 2Q86A 1CN4A 5EH1A 3TEYA 3FUIA 2XVBA 3MPCA 4JKPL 4TLUA 1XD1A 1B0WA 4YLQT 4MQ7A 5JHLH 1N4CA 3L3OB 4YXLL 1WCBA 3WXVL 2XNAB 4F7PA 5CKGA 5EZJA 3S3WA 4ZHQB 1T21B 3G08A 2W92A 4XNXH 2FEJA 3LKQB 3M17A 5D5MA 2ZX5A 1CGSL 2B1GA 2VQ1B 2ZX9A 4UAOB 1NSNH 3EYSH 2P8MB 4Y5XB 1NPUA 2EDEA 1NWOA 2UXNA 4MLIA 3A2FA 2EZ0D 2ZICA 3CSGA 2NY4C 2AJVL 4G7YH 4LLUB 4KZ0A 3SY0B 5K9QG 2X70A 1ZWIC 1DFBH 2DRUA 3MXWL 3NCBB 1HHKB 1A14H 3U4AA 4LVEA 1N4XL 4NBYB 3P0YL 1N34O 2C1PB 4V2BA 2F53B 4NQEE 5E1AC 4ZOBA 3HZMA 3H42H 2IMMA 3FQUB 5C08A 4TULL 4JRFA 4FIPC 3F7RA 4K5NA 5E99L 1SRDA 1S7RB 4JPKH 3FOLB 4O51B 5DJCA 1H6TA 5DJDA 2W9EL 1KLUA 1GAFH 1OP3K 3D69A 3MNMA 1KCBA 2CDEA 3PPSA 2G2PA 5D2NC 4ZG1A 2RDCA 3HAEG 3L95B 3VFWA 2D7TL 2FEEL 2Y69B 5ESVB 2ZG2A 1IGYB 1O0VA 5LDSA 4JI0B 3CEIA 4P07A 3JWNG 4ZIBA 3V0HA 4P59L 4M3KB 1U3YA 1R9FA 4O4LB 4ZO8A 2Z64C 1A47A 4I5BB 2P80D 25C8H 1MNNA 3OSVA 5AW4B 3TBWB 3V52H 5DYOA 3JV4B 5LAPA 5CJQH 1S7XA 1N68A 3UPRA 3Q01A 2MWCA 4BQ6A 3L08A 1AY1H 1QYGH 1BZOA 1GSKA 3AT0A 3LN5A 3OXRA 2AHYA 3RWFB 4DJMA 1UB6A 5JIIA 4G83A 4UMGA 2Y4UA 4F33A 4MD5B 3ZHVA 4A39A 3L4CA 3NR7A 4B3RO 3HFFA 2WTOA 2XV3A 4IKKA 4UOW0 5GZNC 1Z2GA 3CCSV 2F4VB 4H5SB 2VLKD 4OCMC 1W0KG 1MH5A 1Z9PA 2CIIB 3QI9C 4UVBA 5ICYB 5J4MA 4I3RL 4ZUSA 4XN1A 4IBTA 2ADGB 4X8CA 5H37H 1FFQA 3HKFA 1JN6A 4JRYB 4Z23A 1CTOA 1YECL 1DHKA 4I48B 4LCWA 4MDJA 1IAKA 4KK9C 5DD5L 4ZFZA 3AXLB 2BM3A 5D7LE 4FA7B 1FJGB 1MWAL 3G04A 1AZZC 4PRIB 1NBYB 2OSLA 2P5ED 2WMPA 1FGNH 3GXIA 3ETEA 2VDOH 5IQOA 3QWQB 1KN2H 4L37A 1C8QA 3RTQC 1AKJA 1PX3A 3M8OL 1B04A 4JFFD 1RZKH 1TOXA 3DLQR 5D72L 3MLTA 1AMXA 4XBMA 1CPUA 3NEEA 1UEMA 1KLGA 1RZ7L 4Z7IA 2ITCB 3N85H 4XCFH 5ADPL 5FCSH 4NKGB 1P7HL 5AUMB 5L9DL 2HP4A 5ECJE 3O4LD 3QWOB 1FXVA 1SDYA 5H94A 3ZN6A 4GX0A 3T0EB 1W2KT 3VH8G 4K71B 2NUPA 4KMLB 5GGQH 3CXDL 2AJ3B 4UNVA 3DC6A 2B20A 5JLZA 3KPQA 2F68X 4HUKB 1OOAA 4H1LB 4K0OA 4XWOD 3BPCA 4HS6A 3BRFA 2ICEA 3ESMA 3EH3B 1XTMA 2R69L 3MBXL 2LV4A 1BZ7A 4GQZA 4QXUL 1N19A 4I48A 2RQEA 3TURA 2KERA 4JZOB 2VE6A 5LNDA 3ZMTA 1A66A 4DR7O 5DA0B 2LTQC 4F2FA 1VQ9V 4L4VA 4PG2A 1QSEA 1SLUA 1PX8A 4WCEV 1ZOXA 4FVMA 1CGXA 3LS5H 4YJ3B 3CCVV 1UKSA 4I0PC 3QJOA 3S6CA 3MJ8B 3MCKA 3RBGA 3SJAC 5H9CA 2YOCA 1KGCE 3GBML 1SQGA 4IMKC 4OCYL 3OFNG 2XQBH 5D96B 4ATTA 1ZVYA 5CIPA 2ZONA 1YEJH 2VR7A 3IJHB 4MYWB 5ADOL 2LQRA 2AJUL 4YX2H 1CIDA 2XUWA 2XIBA 3G6BA 2QQLL 5CJ8A 3Q48A 4ZUSB 5GGTA 5IW3A 3OWRA 4PRHE 1DJGA 1R24A 2JB5H 2A83A 3UXFA 1DJXA 3INUL 5GRZA 3ZMSA 4WU7A 3HA0A 4AEIH 1N59A 2J3SA 3FSVA 4N2AA 4OV6F 4ZO9A 5DJ6B 5IF0B 4JR9H 2B3RA 4U6HA 3N6YA 3A5VA 3I75A 5GGSB 3L5JA 4IM8A 1UB6B 4LSSH 1XZWA 1KPUA 1WZLA 3P69A 2EEXA 2VO5A 2Q6AA 5DS8A 3UGEA 3WFDL 4D0DB 2Y5EA 1KTKE 2JTYA 3PWLA 3SE8H 1J1XL 5T1LA 2ZQKA 2AV7B 2O72A 4KJPC 2FT7A 2JCCE 4XN2A 2MQ0A 4GMTH 1DBJH 3ZYOA 2PWGA 2VW4A 3FTXA 3E8FA 5ESQA 1JN6B 3QORC 3HOGA 3G6AA 5EOCL 1D7BA 4HWBH 4J3WA 1UHVA 4ENZA 2QWRB 4PJFB 5IHLB 4I13B 4CMMB 3LKSB 1QSFD 3MV8E 4M5TA 2MOQA 5DN6G 1KCVH 2EDYA 5EIBD 1Q82W 2DM7A 3SE3C 4GBXD 3VDBA 4EZLA 4LHUD 1DE4A 3L73H 1E6JH 1PZ2A 4MD0B 5T3ZH 1B3QA 1RIHL 2E75B 5CGYD 5EUOB 3PHSA 4LCWD 4Y2DC 1RV6X 1HIMH 2YKKA 4R26H 3TGXA 3MRHB 3DGGA 4L3EE 2PF4E 1VACB 1YC7A 4P2QE 3D48R 2ZOKA 4Q74A 2GAZA 2P44B 4OD1L 1OF2A 3VG9B 4NS0A 4Y16B 1IC7H 2E6PA 1G7MA 4ZPVA 4XHQA 2N0MA 3K6DA 1JS4A 1T5KA 4LLWB 4NQUA 3UPCA 3DUSA 2LLLA 4I2XB 3NZHH 5L6YL 3AC0A 3OX8B 1JPTH 3U2IA 2G60H 4C55A 2ZKXA 1NANI 2OMZA 1TR7A 4P4KC 3EBHA 3FSOA 1RFYA 5KJ4A 5E8EA 1J8RA 1XB8A 2F18A 3LOWA 3K71B 2E8ZA 1WS7A 2YEZA 4N0FB 2RFXB 2RD0A 4NO0D 4YIQA 4CKVX 1EJ8A 4ELME 1R0AH 1Q8IA 1CLYL 2FB5A 1IKNA 1G4RA 2XUMA 1JAEA 5DJXA 4OZ4B 3ZIAG 2BZCA 2DYPA 3U46A 3WTVA 3BD3A 2OYMA 1BLIA 4F9LA 2BFVH 1KXHA 1LNUB 2NQ3A 4DERA 2OMWB 4XBGA 1EXGA 2CUMA 4ENED 1DSWA 4G1MB 1GIGL 3O11A 2SODB 1TEFA 2HT3D 4NNXB 4MA7L 2V7HA 3FTYA 1OGAD 4WHYG 4DVRL 4KKPA 2HUEA 1S9XB 1U8MB 3SDAB 4TTDD 2C3XA 4TYUA 3RRQA 4B3VA 4IEFA 4Z0BL 4Z7VF 4WGKA 5ERWB 2XX0A 3ZRSA 1NBZA 3KS0H 2VW7A 2WKOA 5K69A 3B5TA 1GN2A 5KBKA 4I50A 3R1GH 3V6BR 2CHXA 2QSCL 1E5YA 4TNWK 3ZE2B 1V3MA 3KM2A 1B4LA 2ICES 3AMKA 3RL2B 2NCMA 4YPJA 1IX2A 3S97C 1PZDA 3VFUA 3MFFA 2WPDG 4X1YB 2HJFA 1UYWL 3LZRA 2WV3A 4JHWL 4TL5A 5CS7A 3QHZH 4ZTOL 4HKJA 4QRUA 2WCPA 5HYQB 4MJ2A 2WIIB 1ZTXE 1AGFB 3T77A 3S88H 2PWDA 4AEHL 2X41A 5AG8A 1FVDB 3AG3C 2ILLA 2UXCB 1DCEA 5EU5A 3UJTL 2ERJC 5J11C 4H37A 1XH2A 5LVEA 3F00A 3Q1EA 3QW9A 4JFFB 2EDNA 3D39A 2HVKA 2OMTA 4QAWA 3HZKB 4XPFH 5JHMA 1QRNE 5AW9B 5LBSA 2PCPA 3BJ91 2Y6SC 3LQAC 4AOFA 3OWEA 2YBRA 3NGBC 1WGVA 3ISRA 3Q3GB 4E9QA 2P48B 1W0VB 2ZSWB 2O6EA 3JTBA 5CN2A 1RSOA 2ZCEA 1IEAA 3CZSA 3NFNB 3CBJB 1VQ6V 4MVRA 1DBJL 1ZCRA 2Q9LA 2VDRH 2X4QA 3O3BA 3V4VB 5A16A 4O9HL 1VEWA 5BCAA 4BIOA 1AFVL 1M7IA 2VMEA 3LUTB 2J1YA 3GMNB 2BFGA 1DDHA 3GZKA 3KJ6H 1TJIL 5FYLL 4C56E 5I0YA 4OU3A 5CGMA 2AQNA 1KB9J 1C12B 3RU8L 3CHOA 2ITCC 2ZUTA 3CUPB 4L29A 3LEXB 3FCSB 5DMGD 1M05A 3GLAA 1DVQA 2WSDA 3VXQA 1PKQB 3DOSB 3H9HB 2WQSA 2R0KL 1PLGH 1SM3H 1I53A 4OW6A 2ZINA 4DW1A 2NNAB 1UXWB 1I3GL 3ZDXF 2VWJA 4A6YA 3IKCB 1WFMA 3KLAA 4QXUH 5JOPE 3EHBC 2CK2A 3NA9L 2WBJB 1FNSH 1H2GA 2DQEH 1JTOA 2W9LA 4DV7B 3D4CA 1JG9A 3SYPA 3T3MF 2YIBD 5C0RH 1NEUA 1P5VA 3KBPA 2BE3A 5F96L 5IBLD 3TGUH 1FNAA 1XH0A 1QP1A 5HGHA 4L3AA 1A6UH 5FNVB 3P4NA 5K1PA 4TUUA 3NJFA 4IS6B 4NO0A 1WDAA 1QLEH 1A1NA 2VM3A 3EYQC 3Q43A 1XDTT 2BSRA 5IWAB 5HHVH 2JS5A 4J4PD 3MRKA 4PWHA 1E7VA 4UCTA 1EANA 2R0LL 4YEFA 2NTFA 2EBOA 4AGLA 2X6CA 5IFAH 4V1DD 4UQ9A 4JMNA 4C83B 3RYCB 4CW1A 3ZHNA 4JLRA 5ILTL 2O30A 1M9NA 3CDFA 2APBA 4L29B 4N6QA 1WO2A 4J3TA 4BFOA 5L0QC 1FKAO 3KGRA 4L1LA 3EO9L 4BDVA 1K85A 4P8QA 1YECH 2EE0A 5TDNA 1OE3A 5IMLA 1NCHA 4GAJL 1N64H 2WBJA 4L1DA 3UT5A 4JQXA 1IGIL 3N85L 4XCFL 3FRUA 2OSXA 1IQWL 5HD8D 4OJFH 4JAVA 5KW9H 2Y36L 5E94B 2Q7AA 4H26A 2Y7LA 1IM9B 4M48L 3RYIB 4PGDB 4RQQA 3V0AC 3ZVVA 4HIHB 2GSMB 1CICA 1BAWA 1H0DA 3M8OH 4L0ZA 1WP6A 1DBKH 2I9TB 3GS7A 1AJ7H 1FVDA 1TEYA 1GZHC 3CUPA 2JJUA 3U25A 4XXCC 4JHAL 2C1OB 2JQMA 2ENSA 1IEHA 4LFCB 3TYFB 3PAZA 1AZBA 5DD5H 1SZTA 4OGQB 4I9WD 5TQ2H 2WKOF 1MRFH 4DV3B 3N42F 1RSOB 1IEAB 4PM1A 4DV3O 2A1WH 2ZSWA 5BY1A 2NY7L 3B9EA 3AWEA 1MI5A 2MKWA 3NRQA 4Y2DB 5D1QD 1IBFA 2ZCHH 5F9AC 3ZHFA 1OOWA 4MB1A 1XMOO 4LSUL 3AWFA 4LIQH 32C2A 3F58H 1MW1A 4LF5O 1T2JA 4F93B 3KZ8A 4Y1AD 4ZRGA 1J5OL 4F7MA 1EWHA 2BVQB 2A73A 2EECA 4GT1A 3QJXA 4POZD 4YQXH 4LRNH 4DKEH 3B2MA 4NP9A 2KT6A 4JRXB 2X10A 3MRGB 4WUUD 5IE9A 2CUGA 3AW5A 4LESA 4Y9BA 2NW3A 1BREA 5GGRY 5C07D 4JI7B 4FXLA 2DIEA 3H2PA 4P4KB 2Y7QB 1TQTA 3QZPA 4NN6B 1WLEA 2EVJA 1S7WA 1XF1A 3CMOH 2Z31C 3CFDA 4KH2A 1HE7A 3NJNA 5KVGL 3WUWG 5BXZA 1MNUH 4EI0A 5DUBA 5DJYB 4F91B 1AZUA 4URKA 2Z7ZA 3ZL4H 2C3WA 4LOUC 1J9QA 1MLCA 4B53A 1EAQA 4GSDH 1E67A 3R19A 4JFWA 1X6LA 4AXWB 1G8MA 4PJIF 3LDCA 1NCBL 2H1PH 3V0WH 1JCVA 2BHZA 4LEOA 4LARH 5F97E 5T33L 4BK4A 2X4QB 2A6IB 1S7VB 2F58L 2XV6B 5IEKA 1ZTXL 4G7VH 5JOFB 1RK1B 1E9QB 2VZVA 4LH6A 3HG2A 4TSBL 1T1XB 2BCMA 4PJHB 5F70A 3HHSB 4A2DA 1A6AB 4WNQA 3TPUA 2NXYD 5CEZE 3IDMB 4DP8X 1Q6HA 2OL3B 4FZEL 1I7ZA 1AG0A 3ZCCA 2ALWA 4JPWL 4G80A 4XP5H 4F92B 4FN0A 4N28A 5DUPH 4XOAA 2V9TA 4PW3A 4LNRA 4LFCO 2CPCA 4Z7UB 4RZCA 3WMPA 5D4JA 1MRDH 3TO4B 2C9PA 4LF9O 2WSPA 4J3XA 5HGAB 1WQVT 2VN3A 5D1ZI 5FYKL 3RTQD 2Y0PA 1BXVA 4JFEE 5F7DB 2BNQE 2H3KA 2B15A 4ORZC 3QIBB 3G6JF 2GJ6A 5C0GA 3S8FB 1G7LB 4O2CB 4YVNA 5AB0A 3DRTB 1HZLA 1UZ6F 4JQIA 4PJGB 4MBRA 5I6PA 2GCYB 1DTOA 1FXKC 4OUUA 2AF2A 1SQXH 2IGFL 4ZD3L 4WUKH 4B3TB 2NX5E 2P3YA 2X5PA 4NKIH 1PZBA 4DCQA 1OD9A 5DJ6A 3K6SA 3U11A 4MQXC 2EUVA 2X4TB 1F4AA 4WK0B 4E42B 4IRZH 2DKMA 5A2AA 4JO1H 4JASA 1YNLH 1BCCH 4ZI7A 3OAZH 2GC7C 4NCC1 4H20H 5K9QI 4V1DA 5EZLB 4G7RB 4X7SH 2CTRA 5T1LB 2JNZA 4MMXA 5D55A 3BP5A 5IOPA 3QUMB 2G3NA 4LVHB 3WJLC 2AQTA 4F3FA 3MV7E 1U58B 2X3CA 4WV1B 4ZNEE 2HHHO 1KULA 1UACL 3TBCA 2R0WL 2LFSA 4UQ3B 1NWPA 3I6LE 3LZLA 4JFYB 2YC0A 5D7JB 3HBQA 4AVIA 2AGJH 2DICA 3SDXF 1L9PA 3MLZH 4FL4C 4XC3L 2WQUA 4U3CA 1AR5A 3H1HH 2VR4A 4V1DB 4D9QD 1S9WB 5J1AB 4QKXB 4W81A 4ZUUA 4FQXB 2QSAA 3QRGH 2YS8A 3PIQA 3BUQA 4I5SA 1NEZA 3OLDA 4J8QA 2YIHA 3B1TA 2HKHH 2YO3A 4P46B 3UYOD 1KB3A 4N0UA 4WEBL 4G9FE 3FO2A 2YARA 4MVSA 4MB3A 4DOHE 4WNJA 3VMOA 1AILA 3W82A 3VXTA 3ASOB 4Y4FB 4I0KA 3QQXA 1OJHA 3WKMH 4X9BA 4LF9B 4MCYB 2FH6A 2JJSC 1MAMH 4Y5VB 5DO2D 5EEUA 1MCOH 1M1XA 3PV6A 5KVGH 1HXMB 3VXSB 2VDPB 3FO1A 1XFPA 3BA8A 4MNQB 4QHUB 1FIEA 2NY6B 4CZZA 3TV8A 1AAJA 1Q9WB 5EIBC 3BSHA 3ILPB 1NEZG 1OM9A 2ESVD 4XCCL 5KWYC 4B9FA 5DO2C 1BOGB 3S7GA 4ZQTA 3C2AH 4AMWA 4LRNL 4DK0A 2DTMH 3IFPB 3OGCA 4URTB 1AG6A 5FAAA 4UXNA 2JB6A 4N24A 3WTXA 3JCUZ 5IT2H 5H37A 4Q97A 4L4VB 3VFRA 1JGIA 1KIPA 1MVUB 3JWOL 4JRYA 1HSAA 1X44A 3RGVC 3TZVC 5ICUA 2H45A 1QLFA 1EEZA 2BS8A 1BS3A 2F54D 4K8XA 4J7KA 2FBJL 5E4AA 1B90A 1OCCC 4FI6A 1U93B 2A1WL 5LOVB 1WP8A 4OVVA 5T5FA 2WXRA 1BQLH 1AS6A 3X13A 4X1IA 1CZ8L 1PS3A 4HCGA 1I7UA 3GKWH 4Z7QB 1I7UB 1FL3A 1EPFA 3KGSA 1M53A 4L4JA 3PWPB 4MS6A 5C6WH 1U3HD 3PL6A 1YEIH 3UERA 1KEGH 3V6OC 3GMPB 5FUZH 1BOYA 5I6OA 1N6QL 3SDAD 5BQ7B 5B3NA 1KT2B 3AXLA 1SF9A 4G82A 3GBLA 3L71H 3LQAL 1GS7A 1A7BA 2OCHA 3IRPX 3QQ4B 5IFAL 4TVPH 2IAMD 4ZKIA 5E5MA 1RUPL 5E5MB 2NNUA 3ZT7A 5I8CB 4LPYA 1M1XB 1EK3A 2NY5C 2LGWA 1IAMA 2F66C 2XZCH 3K1DA 1F8TH 1D2OA 3H3KA 3LIZL 3UC2A 5FO8A 1VKXB 4HJ0D 5IVOA 5KYWB 4IRZA 1OGAA 3IXTA 5GSRB 1F0LA 1GYUA 4D0CB 4IBUA 1JHKH 5BMFH 1DLHB 1NAKL 5IMMB 5KZCD 2FO4A 3EO9H 5DECA 3CRQA 2BXYA 2ZCKH 1CEZA 3KNBB 2JVUA 3FRPG 3I84A 4AILC 5KYUA 3T0EA 1XGTA 3V79C 3ZHSA 1OHHG 2R9HC 2X1XR 2OSWA 1H19A 3L72H 3KEDA 4I4WB 1JIBA 2FB4H 4PJXA 4QGPA 1K34A 2XETA 4GO6B 4PWFA 1QSEE 2JDIG 1UJ3A 2W65B 1R6TA 1YDPA 1NFDB 5DSCA 4HSAC 2QA4V 1BJ1H 2IANB 2Q76B 4MDIB 4OF6A 2PW2B 4N0UB 3C60D 3OM3B 2OMYA 3ETDA 1WK0A 1QLEL 2D31A 1IBMO 3DMMD 1EAJA 3J27A 2HVJA 5CMAA 3NJVA 2HG5B 2OL3L 4NENB 4ODHH 5DT1H 5L4IA 5KJRH 5I1GH 5EEWA 2YQ3A 2OMNA 2WGNB 4HU2A 4F7TB 1VP7A 1HE8A 1MY7A 3D0LB 3A0BZ 4FDWA 3VAEA 4POUB 3KJ6L 4A7VA 5F2FA 1ETJA 1A7PL 2NY5L 4K23L 5KSAA 1ZHKB 4Y4KD 3T0BA 3UADA 3SKJL 1JK9B 2XYCA 2Z8VC 4FI7A 1MJ7L 1K4CB 4MTFA 1H8SA 5DHVB 4NN7B 5HVHB 1NKDA 2B9AA 3EOBB 4OX9O 5ESVA 2OTUB 3MCG1 1XSIA 2WVSA 3JWDH 2Q86B 4WFGA 3LN9A 5AL8A 4M3HA 4QRBA 5I82A 1Q81W 3TJTA 1QHOA 4K3EH 4L3CB 2YSTA 3WNMA 1SJVA 3MRMB 3MA9L 3DGCR 3DX9A 1CC3A 2J8UF 1OK8A 4TUOB 4X8JA 5EO0B 2HRPL 1YC8A 1B6DA 4AEHH 5F89B 3SBQA 1KIPB 1YVLA 3LZFL 3JALA 1S7XB 3UAJC 2QM7A 2Y48A 2XN1A 1HEZB 2KMWA 2QPSA 2WXQA 3M17B 1NCCH 1HC1A 4JHWH 5EU7E 2I7SA 2WLMA 3VX1A 5LL6Y 1TJHH 3RYCA 4P5KA 1OV8A 2IADB 4XNZC 5E8DH 5K39A 3LD8C 3GZPA 3OKLA 4P2OC 1F6FB 3HC0A 1Y74B 1JUFB 3F5TA 1QW8A 4MAUH 4BXVA 2FRGP 5DRXB 4TPRH 4W9JC 1TVHB 2E7CA 2ICWJ 4MHHG 2OKMA 3IJ4A 5LMUO 2NNXA 2QGBA 1A8JH 1A6WH 2DQTL 2NY2C 3CDZA 3DBSA 4TLTA 3WNIA 1J18A 4KHPO 3RFZC 4FJCC 3JWNE 3HE7D 2UUAB 4IKLA 4O2EB 3JTTA 4OSUL 2UUAO 5CEYB 1L9NA 4E0RA 1A7RH 4EBQH 5GRJL 2OCFD 5AD0A 3OKNA 5ANHA 4ZMLA 1TO5A 5A1AA 4M5YH 3O9OA 1KJMA 5EU4A 3HR6A 1S7QA 4DR3O 3S4SB 3ULUD 2VDMH 5KANG 2CALA 3BFRA 1P49A 4X9IA 3SDDD 1VA9A 3J81N 4XMUA 4G11A 3WE6A 1DJWA 1YNTB 1NFDF 2O5YH 4LCIH 4E41A 3WTYA 3HPJA 2PPAA 3R1GL 1ZWIB 4JBSA 3D6GA 3KL5A 3P4OA 2ZKHH 5JW4Q 1KB5L 1XR8B 2B1AL 2XWDA 1YMMD 4FQXC 4J80A 5LHHA 3ZX6A 4R4FH 4YPGB 2IVFC 4RAVA 2D2CB 4KX8A 3EGSA 1IFHL 4ODVL 3TBYB 3OKDA 2MH4A 4OKVA 2DH2A 3U7WL 2BY1A 1LO5B 1DBAH 1OAKL 1U58A 2YGOA 2IPKA 3DYMA 3HFMH 3I6GA 3SKOB 1S7UB 3WO4C 1SEBA 5HHOE 3CB2A 3BEVA 2HR3A 3U9WA 1AO7E 1B2YA 4MX7B 3G5YA 4NQEA 2IQAB 2LR4A 4Y4HB 1WA8B 1PZ5A 1AXIB 1R0AL 4FFVC 3RGVD 3AY2A 2WY3B 4YBLC 2EJ1A 3ZKMC 1CYWA 3K58A 3DVNA 3FB7B 4NKOB 2EXSA 1IBGH 3KLKA 3NIFF 1OCRC 1RI8A 3LZNA 3VO0A 4G8GE 2OJEB 4OZFA 3BEHA 2J71A 4QPEA 1LEKA 1JNJA 1Z9MA 4JL1A 3TC9A 3S3DB 1HNZO 2P06A 1JOYA 4OZIB 1GMIA 4PGBB 4M5ZL 3OKEB 1NC4D 1Y07A 4ZO7A 1MNGA 1XGRB 3GB7A 1S7UA 2DN9A 4UV7H 3AFLA 1N8ZA 1AHMA 1I31A 5E8DL 3NBNA 1NUGA 1YEFL 2QMKA 3SE8L 5MEPB 5C8JA 4DO2A 3B1UA 4LLVB 4LOEA 3GJFB 1ZA6A 5GHWH 1ACXA 5CZXC 4N2CA 4J3OD 4FQLH 2KZKA 5JA9A 1LMIA 1RIHH 1J0ZA 3LKNA 1NGYB 4EEQA 5HYJE 1HHHB 4ETQB 4X1KA 4PJDA 5DD1H 2V7HB 4HAGA 1B0RB 5IBLC 3CC7V 2WOBA 4AVHA 4R97C 3C75A 2GB2A 4IGBB 4LSTH 2P5WB 5I74C 3JWDL 5KX5B 2G0LA 1T5EA 3NAAL 3ZMRA 4QY8B 1BF5A 5JXAL 4AL8C 2EDKA 5LHGA 4YX2L 4L9LC 4UTAL 3H9ZA 2G5BB 3L3DB 4NUGH 3QR1A 4XX1E 1K4DB 2PYEB 4YC2B 4GX5A 4K23H 1EJOH 3GSVB 4DZ8B 3MV9E 4P9PA 2NXYB 1XMWA 5CFAA 2LW3A 1KXQA 4XODA 2Y23A 2OL3H 3FX7A 4EB6B 3UAAA 4HS8H 4FI8A 2YPLB 4DP2X 3ATFA 5F1IB 3IU4L 3OJVC 2KDYA 4L8BA 5D7EA 5HHNA 3I9GH 2ED8A 2X42A 3HS0B 3LAFA 3C08L 2E7DA 5DQ9B 2YUZA 4GMSL 4PFEA 2AQ3A 4LL9A 4LF4O 1UQSB 3X14B 4FXGB 5ITBH 2DJVA 1YNTA 4HD9A 1WBXB 2MCMA 1QBLH 4AM0A 4EIUA 4HKZB 4HULB 3HN5A 1YY9D 2PI4A 2HKFH 1OF2B 1ZX3A 4I0CC 1WPXA 3A4FA 1ED3B 2CR3A 3BAIA 1SLVA 3GSNB 4KMQA 3GRBA 1WP7A 3TETA 2MCAA 1CFVL 3HBPA 4KUZL 4IJTA 4RO2A 5D4QA 2XV2A 1SBBA 3DPDA 1GJWA 5E8NA 3LCYA 2DZEA 2N4IA 2WZPA 1CE1H 5JTWA 4NDMA 1FQ9C 5CMUA 4JDEA 1AD0A 1XF4A 4RX4D 4J11A 1O7VA 4NNPH 1XF5B 3N5AA 1IM9A 1JGLH 4KQ0A 3STLB 3VXRE 7FABL 4ZMPA 4RIRA 5E6SB 1G6UA 3AABA 4RIRB 5J3HD 4GUPA 3A3YB 4UBDD 1PU0A 1Q90A 4Q89A 5J57B 3U0ZA 3LRSA 5D72H 3LEYL 4E9LA 3D4ZA 5BZDB 1RQ5A 3SE9L 2BP5M 2VISA 4WW2C 3FBKA 4RBPK 5FYKD 5JPNA 3IAYA 3SE4C 2AV7A 1YF2A 3B2VH 3MRCA 4JQIH 3JV5A 2V2XB 3S35H 1F90L 3BN9C 4BQ9A 1SUJA 3WIIH 5JH7A 5C93A 1OPOA 3BDYL 4OT1H 3RUGA 4QTFA 3F7VB 3V4VA 2IANA 4MDIA 4IDJH 1BQLL 4BM7A 2Y72A 2W6IG 1INQB 4AQYO 5JVDA 1TXKA 2ATKA 4U6VL 3Q05A 4I3RH 3WNOA 1E5CA 2Z8SA 1G6VK 2JKTM 3THMH 3BH8B 4NO2A 1IBKB 4QNHB 1RFDH 2OMTB 4WLCA 2ZXWC 4M7KL 4PJEA 2BSRB 2QGDA 3BVDB 1WIPA 1S2EA 3QIWD 2OK0L 1MCFA 4MW8A 3AB0C 2AK1L 4X5WA 2PTMA 5IT2L 3S36H 4OM1L 4YBHA 3GD1C 2QVKA 4DETA 1GPOL 2MMXA 4ODXB 2YKLH 4J3VA 4IKIA 4QOKE 3TM6A 2CA4A 2AV1A 2WIIA 4ZW5A 3CPLA 3KPSB 4P46D 2ZUYA 2QVFB 3RB5A 2AGAA 1YEHH 1ZXQA 3BT0A 3DHMA 1SQFA 5DJ8A 1ZK9A 5F0LB 1JFFB 2O5ZL 1M6OB 4FTDA 3FTWA 4M7LL 3P1VA 3TXAA 1LE5A 3ESPA 2P8LA 3NSYA 1UCTA 4RWUA 3PWVB 3LPFA 4LASH 3SBPA 3ARGC 1JYXA 3SCMC 2HLFC 4LKXA 3I9PA 5CB4B 1AC0A 1YDXA 1V7NL 4R50A 1NMCC 4Y16C 5GS0D 1K8AW 4PRBA 4CBCA 3GEWB 3K8LA 3E8VA 2DQGH 5IESL 3QDGD 1JVKA 4PJ5A 2F15A 5DI8A 5FNVA 2R4RH 3BKML 3IJ8A 25C8L 3GSUB 1YIJV 1E79G 3P0YH 2SEBA 3CE2A 3N55A 1X9UA 4IOFD 5CINH 1I9JL 1A4KA 3RUGE 1ED3A 1FFOA 4L3FA 1DFBL 4FYRA 4ZPTA 3UJJH 1UATA 4Z0XB 4NKOA 3IKCA 4XAWL 2OWOA 2XFXB 1IJNA 3EH2A 4L9LA 5T8IA 1LO3H 2NW2A 1A9VA 1AQKL 4L23A 2AQ2A 4NNXA 1HK6A 5BV7L 3SBWA 2HJKB 5IMOA 5GGVH 5AAWA 3GIVB 1KNOB 4AITA 2YRPA 3I9IA 2YXWA 5IKCA 5J06A 5CA1A 3CMAV 1RD6A 3EBIA 1IAIL 4KQ4L 3N0PB 5E23A 4X7SL 4N0CD 3HB3B 2MTAA 2KB1A 3WG7B 3H42L 3QZWG 2V0AA 3MGAA 4UDUA 1OCRB 5A16B 4IRZL 5D8JH 3QT2A 3D05A 2JI2A 2FECI 3QEQA 4MJJA 4X6CE 4XP1H 1RJYA 2V2TA 1AKPA 1AVMA 2AJVH 3ABGA 2A9NL 2YBRB 3DXAA 4TOYL 4H7VA 2YOAA 3L4YA 3SJVB 1BFTA 3DETD 3K6OA 3OZKA 1DJZA 3B8YA 4XVJL 1HSBB 2Y1YA 1YN6A 4HV8B 1ZXKA 1E50A 5AW5B 3H9SE 2I26N 4FQIH 4HGWB 3T0AA 2H8PB 5EU5B 2W0FB 3FTGB 5SWQB 4J9ZB 5JXEA 4DR5B 4UQ2A 2I07B 3JT2A 4MASA 4XNXL 2LFRA 4GSQA 1B6QA 3IETB 3TCLB 1A4BA 4YLBA 4YZFE 1I1CA 3T3PF 2HFFB 3VQ2C 4JG0H 5EOTB 1KBGH 5HDBE 12E8H 5HJDA 5I8EB 5SWZB 5J11B 3AS0A 4K2UH 2VLRA 3ET9F 2K9UA 2WTRA 4S1QH 1IBYA 1FJGO 2QZ5A 4J4PC 1IC5H 4R7VA 1MCIA 1KBVA 4ODWB 4PG9B 1GZQB 5I1LB 3KS0J 1E4WL 3VRIB 4QLWA 1G1YA 1X5IA 3Q5YA 4FPPA 3FT2B 3ZKND 2F53D 3QNEA 4CU7A 3QXVA 3CSFA 4HKBB 1TTRA 2R2EA 2YD0A 1BFOB 1E2ZA 3CCUV 1MCKA 1OF0A 2FIKA 1C9SA 3SD5A 1R24B 2F1BA 3EDFA 3QDJE 3D36A 4HKXB 4LLYA 3E8UL 5F93C 1PG7H 1XHHA 3S3SA 4XXWC 4XMLL 4M62L 1IZKA 5C6TH 2PO6D 4JCWA 4KNTA 1HEZA 2J12B 2VN6A 2UWEF 3HS0C 4QGTA 4G6JH 3F7YB 2MOVA 5J8OA 4PJAF 5CJOL 1KPUB 1HSBA 3C8KB 3A6OA 1IDSA 3NPZB 3WJMA 2KKQA 2FX9H 4P2OD 1X59A 2A74A 1PY4A 4GSDL 2E7BA 3DXAB 5IJCC 1VHPA 1HL5A 3Q9QA 5CUSL 5DFAA 4XB8A 1UPGA 1IQDA 1E27B 1PJWA 4N22A 4A7TA 1A4JA 1AD9A 4PJGF 3RWHB 3UAJD 4F3FB 1H5BA 3G6AB 5EEXA 5I8EA 1GRJA 4BGLA 1QLEC 4JS7A 5EZJB 2V33A 4WEUD 3TCLA 1JNNH 2M1KA 2GT9B 2KQNA 2P26A 3HKCB 5EO1A 5T3ZE 1G7JA 2KBGA 2TRYA 1LO4L 5IFHL 3NIDF 3P30L 3VFMB 1OSZA 5A2FA 3VI4F 4B9ZA 2VZTA 2VLKB 1LM8V 3MCLL 4J9YB 5AZEH 2VL4A 2XC8A 1QPPA 3HE7B 4N1CA 4HJGA 2VLRE 5DHMC 1SXAA 5AW1B 4EI5D 1WFNA 1F23A 1BQZA 3X1BA 1FG2A 1ZIAA 3DRTA 3FFDA 4ENEC 2C7UB 4KTGA 5KYNA 1MWAB 3BWAB 1RP3B 4UIMB 4O2AB 3UBGA 4L3CA 4RGMC 3GMRB 3VXUE 2M7WA 1NEPA 4QRQB 1ICTA 4PGEA 2CHNA 1U8IB 4J3OC 3WTUA 3QIWB 3D52A 3GDCA 3SDXB 2CG9X 3GINA 4ZFGH 3QJZA 1DVFD 2DL2A 2NUPB 4X2UA 4EN3B 4KGJA 4OH2A 1S9KC 1NBYA 2OSLB 2WMPB 4JHAH 3IFOA 4Z7AA 4HJIA 8CGTA 1QQDA 3BAXA 2DF3A 3QEQE 1DANT 4R5XA 3UBFA 3RNKB 5DVMA 4DGVL 1EBOA 1IBKO 4YDKH 1KTJA 1KMIZ 4ONGL 3HG1A 3OKKA 4TVPD 4Z7OF 4TUYB 3L4ZA 2VE6B 1KKDA 2Y36H 3W2DH 1IQWH 1IXMA 1ORQA 5EBWB 4MS2A 3UTZB 1OB1A 3PGDA 4K3JL 3FRPA 1FNEB 4PUBL 2RAMA 2WXKA 3QZMA 2FSEA 2E7LA 1D5RA 1EFXA 2DLFH 1W8OA 2XTJE 2XBDA 1QOKA 1QSVA 2IBZX 4N3TA 3Q6FA 4AXWA 3D2TA 1CF8L 4FZ8L 5D2NE 4LBAA 5CIPB 1JXFA 2ITDC 3CC5B 3J7HA 1BMZA 1FBIH 2BW5A 5E7BA 1YUKB 1WYJA 1WUZA 1XGZA 5ITFB 3RGVA 4ES9A 2VN5A 1NVPB 4G8GA 2FWUA 3UACA 2X7LA 3HBGA 2I24N 2FD6L 1MJUH 4WTXA 2QJ1A 3VFRB 2PMZA 2Y7QA 5D6DA 3G5ZB 1HP8A 3UBXI 2B4CH 1NAMA 2EH8L 4G6KL 1S6NA 3M45A 4L5FH 2EH7H 1L0QA 3R8BB 1HWWA 5T3XE 5FL7G 1OAYL 5AOZA 2E7HA 5BXFA 3WS3A 4LSDA 5KS9E 1KN4L 2OFQA 2HRHA 4G8IA 1A6UL 4H13B 5TE6L 4R7NA 2EX3A 2YEVA 1A22B 1WB7A 4PB0L 2ICWI 2IC2A 3DX3A 5C0RL 5JIKA 3G5XB 3JVGC 2XAHA 1XF3A 1S3JA 2NLJB 3L9RA 5BUAA 2VUKA 4WI2A 5AW0B 3PJLA 4IBQA 5EZOH 4UU9B 3JAMN 1GGYA 1X5JA 3UTSB 4Q9RL 3UQ8A 4PGEB 1RAMA 1SBSL 4LMQI 2PCFB 2XTJD 4GG8B 2ZM6B 2NTSP 4D7SA 4RMWA 2ZM6O 3HPLB 1XMOB 1J0JA 2Y2YA 2P45B 5E9AA 3FPYA 2L4OA 4OB5L 4W4LA 5IP4A 2DI9A 3HE7A 4DN3H 1RPKA 2F0CA 1MRCL 3HMXA 3VOUA 3WE1A 4E41D 3WTSA 1SNRA 3WJJA 1XGYH 3OKYA 4FQHA 3SGKC 5CCKL 3I3DA 4X65B 4EDWL 2I69A 3GSWB 1CDJA 1QSFB 5SWZE 3L4WA 3TBYA 2W94A 3O2WH 3CX5K 1FL3B 4K3DL 4LHUB 1L8DA 1I8KA 4IDLA 2DQJL 4LCWB 4HW6A 4YDLB 4RUEA 2BSEA 3EADA 4G5AA 4L9DA 4W9ZA 8FABB 1HJBC 4FGMA 4B60A 4IIQB 3VVVA 4KJWD 1KELH 5C97A 3QUYC 3QUZB 4JL2A 2CZNA 4K0KO 1QZ1A 1A1OB 3X1EA 3S88L 4GXVH 4ANKA 4BXSV 2J25A 4PJ8D 4WI0A 3BVNB 3ULUH 4EIGB 3IFPA 3PAUA 4JPRA 4IW4C 4ANUA 5I19L 3JWNC 3L9BA 3LRGA 1N9PA 3JV4A 2BINA 1ZJAA 5EC2A 1P84K