2DYRB

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dyrB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dyrB02
3NJGA 2P80A 4AKPA 6PCYA 2J56A 4KOCA 1KYAA 5I5JA 4DP6X 4BWUA 4L0PB 1OE1A 1ZDSA 2QT6A 1ET5A 3X1NA 3NJHA 4GP5B 2MTAA 3CG8A 3NJNA 1KGYE 2GBAA 1ASPA 1SFDA 3OMNB 2PPCA 4ENZA 2GHZA 1PNCA 3NJIA 2GC7C 2CAKA 2YXWA 1F56A 3ZIYA 1JZFA 3NT0A 1L9SA 3SQRA 3T6XA 1XB8A 4F7KA 3KW8A 2AANA 2QPEB 1UATA 4BDVB 2R7EA 1GW0A 3OQRA 5I6NA 1AS6A 2XYBA 1L9RA 3UABA 2YAPA 3N2JA 5B7FA 2BHFA 2AFNA 4A2DA 2NRDA 2BO0A 2HRGA 1WS8A 2I85A 2PPFA 4YSQA 1ID2A 1SHXA 1AZCA 1YLBB 1M57B 3NSDA 2OCCB 4X4KA 2UXFA 2CUAA 3TBBA 1OE2A 3OM3B 2VMJA 1WA1X 4UANA 1WAEA 3FYEB 3WG7B 2XV0A 4YSCA 5AFAA 4AI7A 4DP1X 4HZ1A 4DP8X 5AZUA 1JZIA 2GSMB 4Q89A 3EF4A 1FWXA 3T6ZA 2IWFA 2BP8A 2GC4C 3GDCA 5B1BB 1KCBA 7PCYA 2H47C 1ET7A 2FQFA 3WKPA 2I7OA 3TU6A 1E67A 5IY5B 2HRHA 5FC9A 5B7MA 5LDUA 2UX7A 1J5CA 1OCOB 2XU9A 4E9YA 4G72B 2IWKA 1CYXA 3H4HA 3FU8A 5F7AA 3HEIB 1PAZA 5I26A 4KO7A 1BQKA 1NINA 4YSAA 1PZCA 4PCYA 1NIDA 3AW5A 2YXVA 2FNWA 1EZLA 1AS7A 1A3ZA 2DY2A 2HLEB 3QJUB 1PZBA 3QJVB 1ET8A 1XMEB 2AZUA 3SBQA 1AZBA 2FT8A 1WA0X 5B3SB 4HHWA 1BYPA 3TASA 3PXLA 4BK5C 1BYOA 1J9SA 4WKXA 1JERA 1AACA 2FWLB 4E9TA 1E5YA 3T6VA 5E9NA 3V9CA 1I53A 3S3DB 2N0MA 4TXVB 5AKRA 1PLAA 2IDFA 1PY0A 1TU2A 5TK4A 2PP7A 3IE9A 5I6MA 3NP3A 2CJ3A 4BXSV 3CVCA 8PAZA 1OV8A 3IN2A 1J9QA 3D12B 1BQRA 1A4AA 1PCSA 3FU7A 2QDVA 4PAZA 4E9QA 3GXUB 1B3IA 1MDAA 5I28A 1E5ZA 3UADA 5B1AB 1TKWA 3X1GA 1V55B 5I6KA 3NJLA 1JZEA 1KDIA 2IDUA 3X1EA 3CVBA 3H4FA 1EHKB 1NWPA 4HALA 1M9WA 2BZ7A 1X9UA 1W8EA 4BWTA 3HB3B 3CDZA 3QJRB 2FJSA 4NB7A 2EILB 2RACA 4UF7C 4AZUA 2QDWA 2EINB 1N70A 4YSOA 3ABMB 1CURA 1A4BA 4YSPA 1ILUA 1L9OA 2IH8A 2XXFA 1GS6X 4HIPA 3S8FB 2XWZA 3ASOB 1L9QA 3RYMA 1AZNA 1AG6A 1L9PA 3FYIB 1GY2A 2PP9A 1PNDA 1SDDA 3NSYA 1BQ5A 3S3CB 2YQBA 3EH3B 4YSTA 1TEFA 2H5UA 1NDTA 2FT7A 2PPDA 6PAZA 1JXGA 1J5DA 1JZGA 2BZCA 1GY1A 2JKWA 1BXAA 1OCCB 2B3IA 3C75A 4A68A 2QPDB 3FSAA 3PCYA 2EIKB 3KW7A 4W1TA 3ZBMA 3SBPA 1E65A 2EIJB 1MG2C 2FTAA 1AANA 1KV7A 3G5WA 2FQEA 1URIA 2ZOOA 3QPKA 4G71B 4GP8B 3MBWB 4F2EA 1JOIA 1OOWA 1FFTB 2XV3A 3FPXA 1ADWA 2ZONA 1AOZA 1ILSA 3NSFA 5B7EA 3WKQA 4DPAX 1QLEB 2P80D 1PLBA 1QNIA 3FSWA 2R7EB 1SF3A 1HFUA 2GIMA 2HX8A 3UAEA 2UX6A 1NIAA 1ASQA 4HAKA 2YAMA 2E86A 1ASOA 2VSKB 1BXUA 1JXFA 3UACA 1WS7A 3ASNB 3FU9A 1AR1B 2VN3A 4DP7X 1PF3A 2CBPA 5A7EA 2VW6A 1AQ8A 1ZIBA 1A65A 4BXVA 1MZZA 4K9JA 3NYKA 1ZDQA 5PAZA 1T5KA 5D4IA 1GS7A 3TBCA 4UAHA 5B1JC 3U25A 2X88A 4GYBA 3L45A 3ZX1A 3QJTB 5I5IA 4QLWA 2Q5BA 1BEXA 1QHQA 2BP0A 2CCWA 4YSSA 3CZUB 3QJSB 3T9WA 2XVBA 1RZQA 1JZJA 2BP8B 4G7RB 5B1JA 3FQ2A 4HHGA 4DP2X 3DTUB 1ETJA 4KNSA 4E9WA 2PCFA 3V9EA 4E9XA 4YSRA 2XXGA 3AZUA 1GR7A 2JFCA 2BWDA 3ABLB 4G7QB 4Q8BA 4HCIA 3WNJA 5I5MA 3OD3A 3AG1B 2PCYA 2WSDA 2J57A 3AG2B 2YAEA 1SFHA 2VSMB 2DYSB 4G7SB 4P5RA 1NPNA 2IH9A 1GSKA 4A2EA 1L9TA 4YSUA 2BW5A 4BWWA 2AZAA 2PPEA 3WI9A 4AX3A 3PAUA 4KNUA 2DV6A 2DYRB 2ZXWB 4KO9A 1SNRA 4DPBX 4E9RA 4YL4A 3NJJA 3MX0B 1IC0A 5EHFA 3T71A 3DKHA 4YSDA 1BXVA 3NJMA 1NPJA 1JVLA 1NZRA 1CUOA 1M56B 2FQDA 4CSPA 4BDVA 1J9RA 3X1BA 1NTDA 2Y1AA 7PAZA 3TA4D 3AG3B 2YAOA 4NERA 2B08A 1IUZA 3X1FA 1XB6A 3QQXA 2GI0A 5PCYA 4YVUA 4DP0X 3NJFA 2EIMB 1NIBA 3FPYA 2OV0A 1A8ZA 3CDZB 1MZYA 2MRYA 4A67A 3FQYA 1E30A 4W9ZA 4E9SA 3EHBB 2TSBA 3FS9A 1N68A 4RH4A 2A3TA 3IBOA 4AKQA 5I6OA 2FT6A 2LLNA 2XV2A 3PLYA 2IAAC 1MG3C 4HCGA 4DPCX 4ZK8A 3ZDWA 2YAHA 1SDDB 3OMIB 1V10A 2HX7A 3FSVA 1OE3A 3OMAB 2PLTA 1TEGA 1X9RA 1RCYA 2WO2B 2BWIA 2OJ1A 2XX0A 1GS8A 3PAVA 1VLXA 4M4RB 4CSZA 2WO3B 1BAWA 1SF5A 3WIAA 1CYWA 1JXDA 4AKOA 3WNIA 1CC3A 1KBWA 2YAQA 2GB2A 3ERXA 4MFHA 1IBYA 5I6PA 2ZWNA 5B1KA 1NICA 2I7SA 2UXVA 1KDJA 1AZRA 1JVOA 1HAUA 2XX1A 4DP5X 2PP8A 1OCZB 1ZIAA 4P5SA 1ZV2A 4A66A 1RKRA 1AG0A 1AZUA 1DYZA 2IDSA 2VW4A 1FA4A 3S8GB 4FAAB 2PPAA 4QKTA 3GYRA 4EF3A 3ABGA 4DP9X 3SBRA 2DWSA 5D4JA 1NIFA 4GXFA 4A2GA 1AIZA 2YARA 5ANHA 2J5WA 3QJQB 1GYCA 3FSZA 4JKNA 3IN0A 4F2FA 1OCRB 1V54B 1SJMA 2YEVB 2JXMA 3NJKA 2W88A 3NP4A 4G70B 3CVDA 1DZ0A 2J55A 3S3BB 2VW7A 4KO5A 2H3XC 3JTBA 1NIEA 4FA7B 4GY4A 3IEAA 3EH5B 1PMYA 1R1CA 3ABKB 3N55A 1W6WA 2XUWA 4NAJA 1W6LA 1ZPUA 2IWEA 1KCWA 3UGEA 1SHWA 4WTQA 3PAZA 2VM4A 3EH4B 5F7BA 1IBZA 9PCYA 5TK2A 1WA2X 2VM3A 4YVNA 1JZHA 2BP0B 3BQVA 2TSAA 5D4HA 2Y69B 2HXAA 3FQ1A 2UXTA 4N8UA 2YAFA 3X2QB 2HX9A 4HCFA 1IKOP 1A4CA 2FQGA 2UXGA 4KOBA 1OF0A 2Q9OA 4KNTA 3NSCA 4M3HA 3H56A 4DP4X 3JT2A 4A2FA 1PZAA 1J9TA 2DWTA 4N4YB 2XLLA 3AG4B 2HZHA 3FT0A 2CALA 3UAAA 1KBVA 3PPSA 1AS8A 2IDQA 4KO6A 1AAJA 1PLCA 1XB3A 2X87A 3AY2A 1RZPA 4JHUA 2IDTA 4GP4B 4A2HA 3BVDB 4JHVA 2W8CA 1HAWA 4YSEA 3T6WA 5I6LA 2BW4A 3DIVA 4E9VA 2AVFA 1NWOA 3FU7B
chains in the Genus database with same CATH superfamily
4LOEA 5KVGE 1H3TA 2JB5H 4H4NA 2EABA 4Q0XH 1BVZA 5AAWC 3K71A 5JW3L 1RU9H 1KPRB 4XO4A 1GIGL 2NX5E 5TDPA 2C1PA 2WUBH 5EZYA 2E7HA 2K4WA 4J1UA 4ENZA 3GMQA 2VE6B 3CGTA 3FTUA 3HE6C 2GC7C 1Z6JT 1VIBA 4OY9A 2YGVA 3MV9B 4Y4FA 4YDLC 1ZLVK 1BLIA 3FO0L 4MWFA 4O02H 4YLCA 2WXMA 5JPMA 3B7RL 2BS71 3HAEG 5ELIA 1NEZB 1LP9B 2AANA 4NQEE 3T0EA 3AEIA 4X6DB 4BH7A 1X3DA 2DAVA 4ZSOA 3GK8H 3RUGB 3IWUA 5HHNA 3NIFB 3ZDZB 4PJIF 4OFDA 2AEQL 4XTRC 3W9EA 4PLKC 2YAPA 3N2JA 3R7QA 4JPIB 3ZTNH 2Q7HA 3BPOB 3H9YA 4KAQL 2ZXAA 2OMTA 2DN7A 2J21A 3GQFA 4P5KA 4H20L 2FL4A 3TZVC 2IM9A 4D2NA 3IJSA 4YSQA 5L7XL 1Z66A 4PP1D 5INDB 5EC2A 3FB6C 4AVIA 3V7AE 3DI2B 1E3FA 3EJSA 3KDMA 2P7TC 5M7QA 5JHLL 3EH2A 1XF2A 3VWKD 1ZV5A 2EIBA 2WQSA 3BUYA 4J41A 5D1QC 3RG1C 3BIKA 4KI1A 3L9RA 4TTDD 5LHHA 4HKJA 2CBMA 3VSQA 5FM5O 5C0EA 4UV7L 1FJ1B 3HBZA 1JRHI 2EDQA 5GGQH 3VTAA 3A21A 3W37A 4Q6KA 2ODHA 4YDZA 4OCWL 3D36C 1MJJB 2GYSA 4JZJB 1RZKH 2ZWSA 3MYJA 3O3AB 4P46A 4Y1TA 1J1PH 1JPGB 4NZDA 4YLBA 3Q4HB 4YQXL 5I1IL 5E6RB 4N0UA 1DJIA 3GDCA 3MHHC 2WXLA 3F7LA 4LLVB 4X5XB 2NMSA 3T0WA 3UO8B 3JD3A 3MRJA 5LQBL 3AG2C 5B66Z 3GHEH 3LN5B 1VEWA 3PGCA 4WFFA 3N1GC 1F4XL 5IVXA 4MS2A 5HVHC 4A7GA 2CBQA 3EBAA 3FB8C 1S7XB 4KZ0A 4I9WE 2OSWA 2QGEA 4KRPD 1Q1PA 5J6SA 5ISZE 3UTSD 1TIUA 5EPMB 5I26A 3TEYA 4G7YL 2JIZG 2H2SC 4XCFH 1IAKA 2DYRC 2DL2A 3V0HA 2FNWA 1FCGA 3RU8H 2G75B 5EUOA 5CO1A 3U7WL 3KLHD 1QSEB 2JKIS 3KH3A 4AQ8A 4XNMB 3I02B 1KEML 1OIOA 4JZNA 4OI9A 3ZMEA 4LCWB 2C9SA 1IGFH 4PV9A 4YBLB 1NJ9B 5HI4D 3U2SA 2EKSA 4WFHD 1EN4A 5IG7B 4ZW5A 3PAYA 1VA9A 4P4KD 3VH8A 3ESPA 4DR4B 4QTHB 43CAA 2LE9A 1UPGA 1S9VB 2E75C 5CJ8A 3V5KB 5IHWA 1RJYA 3DNKA 3HLKA 5D7JC 4QRTB 3C08H 3QZWA 3QXUA 4QY8B 5GGRB 1JVMA 4RIRA 1PLAA 3P73A 5DJDA 4HSAC 1L5GB 3QYMA 4LP4A 5F8QC 1M05B 4S1SL 3SO3C 2EIMC 2CJ3A 3RTQA 5LXGL 2ZOWA 3KR3L 1MCQA 3CFMA 4X6FB 4Z0XA 5EC1C 4M8QA 5C92A 5INCA 1NOFA 4D7SA 1MLCB 2B1IA 4S2SA 1HI6A 4N23A 5EO1B 2DQ3A 5E4EC 1AR5A 3FQWB 3ZIMA 3T4AA 1T1ZB 4HIJB 3ZDXE 2XIIA 4W68A 4CVXA 2EKJA 2UXCO 3BGMA 4L8SA 4JI2O 4DKEL 4YXLH 4QHMB 4KK6D 3A67H 1IAOA 1L7IH 4AVKA 4QXGH 4X8AA 3PXHA 4PGCB 2Z35A 3UTQA 4DR4O 2HJLB 1BAFL 2DQJH 1J1OL 3BW9B 2VLLA 4Z7AA 5GISL 2V33A 1JN6A 1GS6X 3EOAB 4L3EA 4XPGH 3GRBA 3FN0L 4RAVB 1BOGB 4U33A 2VB5A 1DO6A 4FFYL 4OFVA 1UUNA 1K34A 3VQLA 4EB6B 3JWDL 4RQFA 3IKKA 4FJCC 1E27A 1HL4A 3HCVB 1WC7B 4RVBA 1UXMA 3BAAA 1XCTA 5D96C 1YEJL 3IAPA 1BZ9B 3FQRA 4HCRL 3BQUB 1W91A 2BZCA 2Z7WA 4H0HB 4PV1C 2R0ZH 1F2XK 2IAMC 4NI6A 1UWXH 4NR1A 2VDKB 4FQLH 5DVOA 4E41B 3V9FA 3FB5C 2KBGA 2VDOL 1ZA3B 3K06A 3M1OA 4M1DL 3QI9C 1KCRL 5DRZA 1FNEA 1IV8A 1PD0A 2WXQA 5F7KC 4W1TA 3CK0L 1MY7A 2FEEI 3CFCH 4H2AA 4IRJC 3G5WA 1SJVA 4QRRB 1JUFA 4UQ3A 2H9GB 2JB5L 1NBCA 4Q0XL 2V8LA 4F58H 3R06B 3MV7B 4PD4J 5CCKH 1R6TA 1RU9L 4PU2A 1VQLV 3RY5A 1JA8A 1R1BA 3FPXA 2XWJB 1H2SB 1W0VA 4Q7DA 4U1MB 2ED7A 3KPRB 4MAYA 1MOEA 2WUBL 3MV8A 4R96B 4DPAX 4PJBB 2VN6A 4BFBD 4NTWA 1DVUA 3FSWA 4J8QA 3ARFD 3RVWC 2RJMA 2J88L 4JE4B 4MJ6B 4WO4B 5F7DB 3SPHA 4Z7VA 3UAEA 1E8YA 4O02L 1KFGA 1KTKE 1DZBA 4W4OC 1FYTD 1ZEAH 4BIKA 2RHEA 5F96H 2CIIA 1OOAA 3FU9A 2EEBA 5F0LB 3GK8L 3HG1A 1PF3A 2DM2A 3PWNA 2X0WA 5EZOH 3NMEA 1U6AH 3ZHUA 2ATKC 1VDGA 3DX8A 5I9QC 3LRGA 3ZTNL 5JNYA 2P8LA 2NUTA 4B9YA 3M46A 1GS7A 3DO4A 3FAVA 3ARDD 2G0KA 5B1JC 5D1ZA 3UJIH 1XILA 4IBVA 3NZUA 5D7KE 3JWNG 3HC0B 4GRWE 1II4E 4JGJA 2QKIC 1BEXA 3KBFA 1KKDA 3WOVA 4O58H 4U05A 3SD2A 4N1HB 1PDKB 4MW3A 4MTOA 2W07B 4GSXA 2A79B 4IEFB 4QE9A 5L3CA 3JTSB 4KMQA 3L3OA 4FQHB 5IT2H 1ETJA 5GGQL 3T4ZA 5B1AC 5E8DH 2VWEE 5IYZB 4Z0BH 3KPSD 1JHLH 3TCLB 3ESVF 1YNTB 2D7NA 5FB8B 1QEXA 3GSXB 1RZKL 3L4UA 4PJ7B 1J1PL 3VDCA 3L4YA 2RCVA 5K1VA 4JREB 2JGUA 2CTPA 4WJ5A 5DS2A 1D5MB 4G43A 1B4RA 3AG1B 3A22A 4K5OA 3WN6A 2JI2A 3GHEL 3SKUD 2GIYA 3D5OF 5D93C 4KI5F 4P5RA 1DJXA 1NPNA 3QEUB 4PP1C 5IJ0A 1A1OA 1JMZA 4J3XA 4QT5B 3S48A 3RNQB 3W0WE 1KYUA 3VRIB 5KJ7E 3ASOC 1MRDH 1GSKA 4AI8A 3P3RA 1BVLA 4I0PD 4JAMB 3G5ZB 2IJJA 4I0XA 3LKOA 4AX3A 4TTDC 1J0KA 4UV8A 4KNUA 4XCFL 3S36X 1ZANH 4ANWA 4FNQA 1SNRA 3RU8L 3NOIA 2PW1B 3V6OA 3WV0A 5J2UA 5B8CC 3JATA 3MX0B 5C0BB 1T0NB 2CUHA 3LYRA 2BSKB 1BXVA 1AB3A 4Q6IB 1IGFL 2HPTA 5ESAB 2ROYA 2KC0A 4MQ7B 3S4SG 4JLRA 4XGZA 2Z4QA 5IOPA 3MN8A 2BSED 2OK0H 1PNMA 3LPPA 1MVUA 3QQ3A 4TUJB 2UU9B 1NFDF 3B7YA 3SY0A 2IBGA 4OLYH 1N12A 2B1HH 3C08L 4WENB 4OIAA 3OLGA 1AQDA 3F62A 1XZ0A 2OMWA 3QQ4A 3CD6V 4XMXA 5AYTA 2V5YA 4M5YH 5JW4R 2EDJA 1PG7X 3FPYA 3WE6B 4HW6A 5JHAA 1A8ZA 4KMTH 5I75B 4NDMA 1NMCB 4OKVB 3VXRA 2A4CA 4HUCA 1FAFA 3VWJD 4AY0A 5LN8A 3F7YC 5E1HB 1CL7H 4LHJB 2DQMA 1QI5A 3KYOB 5MERA 2X4SA 3X13A 5BXZA 4X66B 3B9VA 4OFYD 4JW3A 1YJDH 3KLHC 3OLEA 3UCQA 2Y6TE 3JWNC 3POCA 3ZJAA 4RFNB 1BZ8A 2EDBA 4Y2DA 3O4LE 2A3TA 5BXFA 4F7CA 4AKQA 5HI4C 4YXLL 1D2DA 4U3FH 5H35B 1BFOA 4P4KC 3EGSB 1B0IA 3A67L 1L7IL 4PJ8B 5C09B 4AM0Q 3O41A 2UZPA 4QXGL 2OYLA 1FC1A 1X6NA 3K0GA 5DHYB 2DQJL 2CIKB 1JI2A 2COQA 2UU9O 4XPGL 2GUOB 4X42A 5C9JB 2EYRB 4FXKA 5I8EA 4QF1A 4ORZC 1I4FA 1G6RB 1NTMH 2BERA 3A4FA 3VD2A 3J7HA 4MMZA 2VLJB 2XUMA 4OZGA 2I7SA 1KDJA 4CILA 2VR3A 3JBG7 4WI9A 1ZVHA 3VRJB 1IXMA 1VF6C 1I8KA 4M02A 1MWAB 3C6SA 2EDKA 2R0ZL 2DMGA 3AACA 4H1LA 1CCZA 4FQLL 3VFMA 2YUVA 3WFHB 5DQJA 3MJ7A 2VWKA 1JPST 1I1CA 4A6YB 2I32A 5CA1A 3LDEA 2B0SH 2YFOA 1ZT1A 4EFBA 4EEEA 5I1DB 4KK6C 1U97A 1FNSH 3CFCL 5F7LB 1SYSA 3BLKA 1LO5B 4GXFA 4NN7B 4TSCH 4ZX3A 1ZGLB 4F58L 1QPKA 2BFVH 4TV9B 5CCKL 5J06A 4N5ED 2EXWD 1NCCH 1KIPB 4CA4A 1NC2B 4IIQA 4XN9A 3BP6B 1U8LB 3MO1B 1T7VA 4TL4A 3X3FH 2R0WH 3S3WA 1IZKA 4APQB 4FIPC 4XP5H 4ZFOB 2XWBB 3KL5A 3SKMB 1T89A 4TNEA 5CJ5A 1I1FA 5IW6A 4ONOA 1L0QA 2H8PC 2FLMA 3IXTA 2CO1A 2G60H 3FT2A 3GHBH 4MA1B 1ZEAL 4WI7A 2PMZA 1U8MA 5F96L 2QWOB 2CPCA 3QG7H 3H9SB 2N74A 2V0AA 2RGSA 3VVWA 2ZIDA 5EZOL 2C3XA 3PAZA 2VM4A 3DJTA 4O51A 1U6AL 1EHXA 2QE7G 1WA2X 1Q9KA 1S3RA 2BP0B 4Y5YC 3BGFB 5I6XC 3SKOA 3OE7G 4FXGC 3DXRA 3RDJA 4R6UA 4BM7A 4DV4O 5F2VO 1ZHLB 2QQQA 2V4LA 2I9LA 1TTBA 3F6JA 3GPEA 3KVDD 4FG6D 4LGRB 4N9GB 4OR1A 3UFIA 3UJIL 3K79A 1SRYA 2KPWA 4M3HA 2J5LC 2A6DB 3C60B 3GGWB 3MLYH 4GI8A 5GS0H 2PTTA 2QADC 5IBLD 3B83A 3VD1A 2IH3C 2Y0IA 1GZPB 2HZHA 3LEYH 4O58L 5ENWA 5IFAH 2EZOA 1G0XA 1OHHG 4XN7A 1TVHB 1QSED 4Y19E 3ARFC 3UG3A 1U4EA 3HVNA 3HNVH 3MTRA 1O6TA 5IT2L 2A4EA 5B4MD 5E8DL 3GSUB 2ESVB 3MTXA 2CM5A 2X38A 4GAJH 1JHLL 2JVUA 4U2ZA 3BT0A 3E8BA 4Z0BL 2M26A 2D2OA 1O9ZA 1LDPH 2XOTA 5H4YA 5GS1B 3CFTA 3DPBB 1KGCE 2JCWA 4UYPA 3Q43A 4DJMA 5EU4A 3OKKB 1O6SB 5J9PC 3DWTA 4K2UH 4HHAB 5F1IA 5JWPA 1FS0G 3RTLA 2WW8A 5B5EZ 1GM7A 3ARDC 4MS6A 3PWLA 3AM8A 3LKPA 3OAZK 3GEFA 1JGEB 4X98A 5AVWB 3VD0A 3K6IA 2VAAB 4OLXH 4ERSH 1HCVA 1MRDL 5EOCJ 4YUEH 2QSAA 1AIFB 2AXHA 3CXHF 1JJUA 3NT0A 4DGYH 1UT2A 2WM0A 3CHRA 2IVFC 3BHBA 1PJ9A 3RVYA 1KLUA 1OKEA 2LAAA 4G42A 1ZANL 1SM3H 3WKMH 3IKCA 1S3KH 4J6IA 2W9EH 3UZEC 5ID0A 5J6HB 5EEWA 1QFWI 3MFFB 4XN1A 4FYQA 3UABA 1XWVA 1FBIH 5ITFB 3MROA 3C6LC 3NIGE 3QWRA 3U6RB 4FABH 3TBWB 4I3RH 4NYLA 2HRGA 2F5AH 2PPFA 3EO0B 3VTMA 2OK0L 4OD2B 4HIQA 2IOOA 5TDNA 4ZT1A 2W94A 1N0NA 2UXXA 2ZOLA 5LGHH 5I1AB 2AEWA 4OLYL 2B1HL 4JCLA 4DQOH 4UANA 3GMNA 2VZ3A 2IGLA 1RIHH 5HY9A 2WINA 4YSCA 2GKIA 4M5YL 2Y4UA 4ZHQB 4LPWA 4XX5A 3VXUA 4P2OB 4X99B 4KMTL 5GJTH 4I0PC 1JF5A 3K57A 3BQUD 2X4NA 3MUJA 5DHDA 1CL7L 1NUFA 4E41D 4BYHA 3CBKB 4Y4HB 4ZO8A 2GSMB 3ZKSD 2UWEE 1YJDL 3FQUA 3FFOA 4B7EA 4J9YB 1YNKH 4W9GC 4PI0A 3QISA 5IMKA 3V52H 5CEXA 1ET7A 4IQHA 2MK3A 5J1TC 4Y2LA 1C9SA 1EJ8A 1J7VR 1ONQA 3R4DA 2WXRA 3L4XA 4RO2A 1R24A 4LF9B 2WLYA 3ZN1A 3BD5A 1HYRC 4FLXA 3IBEA 3MA7B 4YFLF 1C8PA 3IAQA 2AITA 2A83A 2A73B 2XWTA 3NESA 4I2XA 4AGNA 3UAJD 4R6ZA 1ID5I 3ZDXF 1QO3A 3B43A 2HTLD 2ITCB 5EU5A 3B2EE 3HKDB 3RB7A 1BDYA 3PF2A 3DECA 1XMEB 3RGHA 3VWJC 5CIPH 5HHOB 2OL3A 3PV7A 3Q8EA 4CRPA 5JDJA 4AL8C 1MHPH 5ABAA 1OTUD 1A1NB 1T83C 1U8CB 4XB8A 3UZVA 4HWUA 5JOEA 3Q3GB 1VMGA 1BECA 4PA4A 2F15A 3GMOB 3B5GA 2J25A 5IHHA 1J9SA 2YIAA 4KH9A 5I0WA 2GTQA 4UQEA 3FUFA 3FUMA 1T6BX 4E9TA 4LCIH 2B0SL 1FG2B 1MVYA 3EDEA 1FNSL 4GG8B 1QPPA 4X6CE 1F3JB 2FO4B 4PR5B 3U83A 4TSCL 2PP7A 1UOKA 3IE9A 3IGAA 2BFVL 4LF9O 4NQCE 2AJVH 4PJGA 2JH2A 1EH9A 4F1ZA 1NCCL 4GBXB 5IMLB 2Z1PA 1CD0A 1B3IA 2HWZH 3LHPH 3WY1A 2J2ZB 3LH2H 1TKWA 2AV1B 2VT0A 5I6KA 4XC3H 2MH4A 2NY5C 2R0WL 2Z91A 3X3FL 5HTSA 3W38A 2QR0A 3C8KA 4XP5L 3CVBA 4RWYH 3C9NA 2BMKA 1T21B 2X1XR 3QXAA 2G60L 3GHBL 3FUDA 3TA3A 4XPBH 1TYJA 1G4RA 4WV1B 3L7FA 3NACH 3J07A 3QG7L 4FFBB 2DMHA 2YC0A 2A5UA 5C8YB 1DQQA 2YLKA 5A2LH 4M00A 3QFJA 5DJAB 4LH7A 5KSVA 4V1DA 3BSZA 3F5WC 4NQEB 1L9OA 2C7UB 2JB6A 1AVMA 3OJMB 3BO8B 3GXPA 3QDJB 1H5BA 2DICA 2OS7A 3M17A 3ZPDA 4BFJA 5HXMA 3QEQA 4OM0H 2JS5A 1L9PA 3P4NA 5FGBA 3BEWB 3H6AA 4P06A 4EIZC 2OJEB 2DLGA 1BIIA 1LQSR 1PNDA 2DIJA 1ZSHA 4ZMZA 2EXWC 2IFGA 1J8HB 2VXVH 1IAIH 2EEFA 3MLYL 4NPYB 4XP9H 4HUXA 5D72H 3T2NH 4FA8A 4Z5RB 3SE3C 3EH3B 3LEYL 5BRZD 4ELME 3PREA 2VN4A 3PFUA 5IFAL 4LSTH 5E2TL 4NI3A 3RZCD 3P3YA 5C0BD 3TL5A 3BUQA 1KGWA 5ESQB 3AMKA 4DTGH 4PDMA 1SLVA 1BXAA 3HNVL 5DYOA 3ZKND 3BABA 2Y5TA 4Y5VA 1MFDH 2QPDB 3R18A 1N64H 3GRGA 4GAJL 4LFAB 3KVPA 4LSDA 2NY7H 2CGNA 1OXYA 4GUPB 4YHIB 2ZE5A 1LDPL 2WCGA 4M7JH 4GRWF 2CHDA 3RLSA 1URIA 4AK2A 4TLSA 4PRBB 2ZOKB 1ZS8A 2FO1A 3DBXB 3TP4A 2OX5A 2PW2A 3WEAA 5J3HC 4FG6C 3OF6A 5E1AB 3D0LA 4ZG1A 3K6SA 4KK8D 3OR6A 3JAWA 2QSQA 2AMGA 4PJCE 1BFSA 2YFNA 1G6VK 4OLXL 3OKMB 4ERSL 4N1CA 5IBLC 4YUEL 1MOFA 4JI0B 3NFPB 5GGTA 4F57H 4DGYL 4KK9D 4QGTA 3DXAA 4ZXBA 3CC1A 3CC2V 5EBLB 1ZWIA 3TS8A 3SD5A 3MJ8A 4L5FE 1SM3L 1LWRA 1XTLA 2VN3A 5TQ2H 2QLYA 3WKML 3RBZA 1S3KL 2W9EL 2ZQMA 2WK2A 1Y4MA 5B4MC 5C08A 2P5WB 3EYQD 1FBIL 4MB4A 4XI5D 2A0LA 4PJ8D 3O3UN 5C09D 5CEZD 4NUQA 2J8UE 4FABL 2E76B 1SZTA 3QF7A 4I3RL 3LNNA 2F5AL 4Y1AE 4DZ8A 5FA4B 4OM1H 5KBMA 1BBJA 2OMZB 2X4OB 1E4WH 4S0HA 2XKSA 5LGHL 3ENEA 2BTQA 3N85H 4DQOL 3MODH 1YVLA 3IDXH 3US9A 3VGAC 1RIHL 2DRUA 3GSWB 3U48A 3QO0B 2VLJD 1KEGH 1T66C 4N2NA 3V0GA 1QSZA 1A6AA 2DQEH 4Z7WE 2R72A 3OLIA 2EVIA 4J3BA 2ZUXA 3QULA 4DR6B 1P7KA 2RFXA 2I9TB 2X3BA 5GJTL 4E9XA 3N40P 1N3NB 4JI0O 2ITDB 4FP8H 5CR1A 4HFWB 5DC2A 3RWGB 4X1YB 1BQLH 4AUYA 5HGHB 3LMJH 4TNWK 2CO6A 3UMNA 3QFGA 2W38A 1SQBH 1YNKL 5ALCH 3TPUB 4OZFB 3V52L 3DRTA 2OR8A 2J57A 5IK3A 4OCNC 3C3TA 1SFHA 5L4IA 3FB7A 4UUJB 1CLZH 3CSXA 1HILA 3AXLA 2E59A 3H3KA 1NC2D 2R56H 3IMRA 4JVUA 4PA6A 1HWYA 4DR3B 1BOYA 2BW5A 5L8LB 1JOYA 1OT4A 1KIQA 4TUYB 2VDMH 3HZVA 1R5WA 1P2CB 1S7TB 4L29B 4WDIB 4IKJA 3V0FA 4PTTB 1OGSA 4X64B 4U6YA 1A1MA 5GZOA 2EVHA 1UT1A 2FK9A 4EI6B 3U1SH 5KWYC 4DR6O 4F6RB 3H9SD 1Y0LA 1MH5A 1MHPL 4KNQA 1N8ZB 4FLYA 2NNUA 1CXEA 2AMUA 3BPCA 4AIOA 1SDYA 2R83A 2E7LA 1MHEA 3N5AA 4D9RD 4F5CE 1F97A 1TMCB 1EUTA 1BT8A 3SDDD 4M61A 2WIMA 4ISVA 4H25B 4MVRA 1J11A 4LCIL 4KVPA 3ZZQA 4MYWB 5BVJA 3L2MA 1U8OB 3G6JB 5GHWH 2IPUG 3HUJE 4U3XA 1MCBA 2YIHA 2HG0A 3C60D 5JW5A 1K3ZA 3QW9A 1XF3B 4Q56A 4WWOA 4JL1A 4XP4H 1FN4B 2AJVL 3QXDB 1F86A 3N50A 1YSOA 2ICWA 3HS0A 1IQDA 4MVBC 1UJWB 1T1XA 1YNLH 3VACA 2BVPB 4Z1PA 4DR3O 2HWZL 3LHPL 5F70A 3LH2L 5DECA 3LAFA 1SA0A 4XC3L 2HTLC 2X40A 2Z92A 1HS6A 4N8CH 2QELA 5ES4B 1Q9LA 2VL4A 3NFNA 4KUZH 1A4JB 4RWYL 2XN9A 5DO2D 2YGPA 5IQNA 1LUVA 4KBPA 3VRLE 1OTUC 4XPBL 4JO3H 4HCGA 5KS9B 1QVGU 2ADIB 2NLJA 3NACL 4ZK8A 5BS0A 2CDYA 2PLTA 4FTVA 4IJ3B 1TUBB 1JP5A 4WNQB 1LNUA 2FR4A 3CFDB 1OCOC 1A3LH 3U0PA 5CP7B 1PS3A 1GSMA 2YWZA 2WO3B 4GSUA 1MAJA 1WIPA 4KZDH 3K6DA 4LE8A 4OM0L 2H4EA 1IGTB 3ILPA 5DJZB 4Q9QH 3C12A 1CC3A 4G9FE 1KBWA 2WXFA 2V9QA 4I0KA 4NHUB 1KOAA 2DD8H 5DD6B 5A6LA 5IB5A 1N6QH 1MJ7H 1ZK5A 4J39A 4GFXA 2VXVL 3CV5A 5D72L 1IAIL 4XP9L 3T2NL 3L2LA 4XXCA 1HAUA 4DVRH 3DX7A 2VN7A 1TQTA 3PJSB 4HETA 1D5XA 4LSTL 1O9WA 2XPYA 1MRFH 2VW4A 3ESOA 3CPLB 5H2BB 1GPOH 1S7SB 4IRSA 4TV8B 1QSFB 5JH7A 1ZT4A 3QIBB 1SVBA 4DTGL 4F1SA 1MFDL 4GZRB 4OGQC 2NYZA 1N64L 5HJBA 4GEJA 2CGRH 3ZMZA 1FZKB 2NY7L 5AL0A 4ZUSA 1KZQA 2WVVA 2CPUA 3ZHTA 2WANA 3N40F 3OGCA 4M7JL 1JZ3A 3L4CA 1FZJA 4JASA 4YBHA 4YDNA 2ED8A 4PWEA 2ARJQ 3OGOE 4QRPE 3JD2A 3GBDA 3I9AA 2GTSA 3VFSA 4P2OD 3GZQA 3CB2A 1P4LB 5IJKC 4L9DA 3QUYB 3LRHA 2AI0H 3L1EA 4B7LA 2PUSA 1X6LA 1LD9A 1TZIB 3IEAA 4F57L 4MDJA 4XNXH 1E28A 3MLTB 5D1XB 1ZHNA 5D5QA 3FCGA 3RZCC 4QNPE 5MENA 3KPTA 1H3WM 1LR1A 3RYCA 3E2HB 1U3ZA 1AVAA 4L87A 2R9AA 2DM7A 2VXQA 3HPLC 5TQ2L 5F3BA 2FATH 5F7EH 1Z5HA 2UUCB 1HX0A 3CN0A 3QO1B 2IEPA 3BQVA 2Y69B 2ICWJ 2R2HB 3WN5A 5ICZA 5L0QB 5GGSA 2EYTB 2BSRA 5C07D 2EJ1A 4OM1L 1H3UA 1A4CA 2D7QA 1HOEA 2XNDG 3H2QA 3EXAA 3DK2A 4KWUA 2NY6D 2YD6A 2YK1H 1E4WL 4AYFB 1FZOB 2GJRA 3ML0A 4JYYA 4FLVA 1QVOA 1T0MA 5IVZB 3N85L 3MODL 5C6WH 3IDXL 5AB9A 4KK8C 4Y9GA 1C12B 1KEGL 2DQEL 4OZIE 3QUZD 5HHOD 3TO4B 3NIGF 1XNQB 3NCWA 5F3HB 4KK9C 2A99A 1KNOA 1WK0A 1BS3A 4B7KA 4QPJA 2C9VA 4I1RA 2CDGB 4FP8L 3N0AA 4NP4H 4WO0A 4YE0A 5BOZG 5IFHH 4L4TE 2XAQA 4RFNC 1BQLL 2FNBA 3LMJL 1K8AW 2DWYA 3O11A 1Q5OA 4U7OA 3ZT7A 2NY4C 3E9TA 1RUMH 5ALCL 1ZDSA 3EYQC 4MXVE 4JG1H 4XI5C 3L75H 4PJ8C 5A2IH 4WHTB 4PJ9B 2UUCO 3Q44A 4GI6A 3IJ7A 1FZMB 3F7PC 2PGGA 2MTAA 3FAXA 2DI7A 3LSQA 1B4JH 1DSWA 1QBZA 2HHHB 1N67A 1CLZL 3QORD 1KV3A 2ZWLT 3PJLA 3T2QA 4P2CG 2P3YA 4H1LH 3WEXA 4A2LA 1QHPA 5FGCE 4U1SB 4GBXD 4DIXA 3T1HO 1UM5H 3WJMA 2R56L 3MHSC 1F56A 4LCYA 1U3HD 2Q2LA 5TDOA 3IFPB 2HP8A 2UWEF 3T6XA 1CGWA 5BZDB 4URKA 5DA0B 1RM1B 1OTSD 2VZTA 4LMQE 4XN5A 2QJ1A 4M9OA 2VDML 3UPRB 4L8JA 4QJ4B 1NCDH 2YIBA 1VQNV 4X8JB 5AQ0A 3T0EE 1UOWA 1GW0A 3RGVA 1GN6A 2WKGA 4FHJA 4ZSOE 5IGXH 3U1SL 5HHQA 1XNQO 4HIHB 1NS1A 2BVOA 1ZVSB 2X6AA 4J8RB 4NQQA 1IARB 3UTTA 3BRCA 1WS8A 1EGJA 3P2DA 4I9XA 2OZ4A 1X7QA 5GW7A 5GGUA 1PY4A 2Z8WC 3QDJD 2NNCA 4PPTA 5I1KH 2G4EA 5C0RH 1JV5A 1R73A 3OHMB 4X9FA 2H26B 4HF5H 4XBMA 4N21A 3FYEB 5GHWL 3EFFK 1KB9F 4MHHI 3HI1B 3IMWA 5AG2A 2HHHO 3QHZH 4F93B 5IEHB 2DKMA 4P3WA 3E83A 5DDHA 5AFAA 1SUJA 4XP4L 4FMKA 4AI7A 1MCKA 4GH7B 4Q2ZA 4HEPG 5AZUA 1YNLL 4DYLA 1CFNB 4ZW8A 2R2BB 3TWCH 1MPAH 4JRWA 3T6ZA 4N8CL 2IH1A 1W15A 4OSUH 2ZG3A 2Z8RA 4IBLT 2ZDIC 2QLVB 4KUZL 4YN3A 4CVUA 4X6CF 4AIZB 4GW4B 3ZBHA 4N0UE 1E4XI 3D3VD 5IY5B 3NR7A 3GSVB 4JO3L 2FUQA 1E90A 3VYNA 1NGZA 2VMFA 3D6GA 3RFZA 1IGIH 4HLJA 5DFVD 3CSYB 3ATBA 3BGFC 3FT4B 4WFFE 3SDDC 5IVXE 3BIAX 1A3LL 3QDGB 3OC5A 2KDYA 3OPZH 4KZDL 2IIJA 2CQVA 3LEXA 4PREB 4JHWH 4Q9QL 4R7NB 3TEUA 1JIBA 1KECA 1EZLA 4J7RA 4XNQB 3T2PA 1N6QL 5GZNC 2DD8L 4UCUA 4MD0A 1MJ7L 4NLAA 4RSYA 1E7VA 1P84J 1YEEH 3CVIH 1AI7A 5EUOE 1J18A 4NN6B 5J0BA 4DVRL 3OAYH 2GJ6A 3MRBA 1AZBA 3MUGA 4ODUB 4ZTPH 1XAUA 1BP3B 1MRFL 1U92B 5E23A 3VGGA 2VAJA 4TM9A 1GPOL 1C5DA 4G1MA 2P5WD 5E8PA 4GRMB 2ARHA 5DO2C 1KXTA 1IFHH 3BSHA 5FPRA 6FABH 3R0MA 5GS1C 3ARTA 5AKRA 1JGDA 2CGRL 3W39B 4JAAA 4NRYA 1W72B 5EMYA 4HUUB 5CGMA 2ENYA 1HCFX 4X65B 2AQ2A 3QWOB 32C2A 4FLRA 3RJDA 4ELMF 4HBQA 4G8FB 2G4GA 3F12A 4X7TA 4LBEC 1UB5B 4YC2C 4TNWF 1ZX3A 4U1HA 3QDMB 3BDBA 5JR1H 5DXWA 4JGSA 5LA6A 3NJLA 4R2GD 2AI0L 2F7PA 5BUAA 3P54A 1IGJB 2XZQH 3CRMA 3P0VH 3HBPA 4HALA 4LRIC 1IVSA 1WFJA 4XCEB 3Q5OA 4P2RB 5C70A 4NSKB 4XNXL 3VM5A 3HB3B 4W81A 4WI0A 4XX1E 1VJSA 4RMTA 2WXKA 4BQ6A 5GRVK 1VCAA 4TLKA 3R65A 2B4CC 1WUNT 4JN2A 2FATL 4HX1B 4EVNA 5F7EL 5I1EH 3SKJH 1JHTA 1YCSA 2R23B 3GJEA 4QTFA 4ELDA 5C0DB 2QPUA 3JQOB 4PJCF 1OB1A 3GSRB 2D73A 3HR0A 1P5VA 1NR7A 4L3EE 2GTWB 4EXPX 2OBGA 5FW8A 4MD4B 1ZLSH 1ENVA 4O4LA 4JRYB 2YK1L 1TPXC 4X65O 3CFKB 3ZTCC 4PCSA 3SBWA 4UQ2B 2MHAB 2UZIH 4QXVA 4XN8A 3O3BA 3Q8FA 5IB4B 4P2OC 4P2QB 1J5DA 2YS4A 2BSTA 4NNXA 1OCCB 1NH6A 2J8UF 4JI3B 3QUKB 4JY6B 5EIBD 4I3SH 4N2HA 5K9KB 4OFPA 3LSUA 1OF2A 2EADA 1QR1B 4XAWH 3NQIA 1P1VA 4NP4L 3SDXA 1E65A 2EIJB 1VFAB 4NO5A 5IFHL 2VQEB 3QNYB 2APBA 5FDWB 4LZKA 1U8NB 4PUBH 1DJWA 3ARGA 3D2UA 4CU8A 1J05B 2CA4A 2WNGA 2OMUB 4CW1B 1RUML 2E9BA 3TK1A 4JG1L 3L3HA 5JCOC 2YEQA 2OL3H 2CJSA 5IHZB 3EYVA 2WXJA 4FLWA 1B4JL 3RDTC 4Z7WF 4ESKA 5DUJA 2NY6C 4MVSA 1WITA 2B20A 3MV8E 5KSBA 4Y5XA 4KQ0A 4WI3A 1UM5L 3HE7A 1YVWA 1CGTA 1K5NA 1TTGA 1ODAA 3VG0H 2YEVA 3WFZA 4Z7VE 2VSKB 4F7EA 5H37G 3UACA 1DQVA 4FXLA 1EO8H 3QUZC 3T8XA 2YMOA 4Q74A 1T5EA 1NCDL 1D5BB 1LQBC 1AQ8A 5IGXL 2Q67A 1A65A 1WSST 1ZHBB 4JI3O 3HG1E 1Z2KA 3F8UB 3H1JH 5I15H 2VISB 3NJXA 2P26A 3MMEB 2BCKB 3BZEB 3WHXA 2VQEO 3DVNA 3WL9A 2YIDA 4WUKH 5I1KL 1H8SA 2BNQB 3L45A 3S5LB 5C0RL 1JZ4A 3KPQB 4O2AA 4OAWB 5I5IA 4BCYA 2FWUA 4HF5L 1OD7A 3QORC 2GBUA 5JUEH 3RX5A 3WSQH 4BFOA 5EEVA 1MNNA 2R8SH 4OF6A 4GKJB 4XO5A 3U9UA 5E6IA 4F2MB 1JZJA 3QHZL 2K6YA 3TIDB 2WBJA 1T20B 1HXYB 4GBXC 2CRZA 4URTB 3FMGH 5FNVB 4KNSA 1U3HC 4HQQH 1DQTA 1KXVA 4YSRA 2XXGA 3IJHB 4HPOH 4XH2B 1OTSC 3DTDA 3DJRA 1GK9A 1VEOA 5HYJA 2AZ2A 1QSFD 3S3JA 3TWCL 1MPAL 3QIBD 3K9AA 4OSUL 4ZRGA 4F8LA 3QS3A 5LAPA 1RD6A 1D5NA 2DM3A 5I8CA 4WV1C 3VD3A 1OSZB 2VUOA 2K9FB 4Y2OA 3PP3K 3HUJF 1JVKA 5I16A 3MOBH 1ITCA 4L1DA 2VKXA 3VO0A 1ZE3H 2XJLA 3CH1A 5F44A 3L5IA 3RILA 1IGIL 3ORJA 5J11C 1F3RB 1OQOA 3V4VB 3T3ME 4BINA 1QABA 1XF4B 4HUMB 3TBSB 4DV6B 1MCWM 4EFEA 2W1NA 2H32B 2VLKA 3OPZL 4KJYB 4LVNC 3RYHB 4U3SA 2H2PD 3QUYD 3WIHA 3VQXA 4FG2A 4JHWL 3ZHQA 3BCCH 2PCPB 2F7OA 3CN3A 2RCSH 3NIDE 1G7PB 2P46B 5CMAB 1FPOA 4JFFA 3VFPB 4HWBA 4DPBX 4B50A 1EN6A 3VRLF 5J13B 1AH1A 1GN4A 4FLZA 3ZMRA 1YEEL 1U41A 3CVIL 2QKCA 3OD4A 4KPHH 3TBVA 3V6OE 1EXUA 2E9IA 4NNYA 1BMFG 4GYCB 4ZTPL 3FSOA 1OAXH 3BHPA 3IJYB 4Y4KA 4Z3IA 4U6VH 5IJDC 3JD0A 4KMLB 4ZFZB 3IDMA 4NO2B 3JALA 2YBGA 3QRLA 1SXZA 5CEYA 3HA0A 1MG1A 5GGTH 1PTZA 4AIXA 6FABL 5I74B 3TA4D 1UZGA 4YHYB 1UH3A 3UBFA 3KLKA 4CMMA 4LWSB 5DFVC 2E0PA 3OKNB 3WNKA 4PS8A 2LVEA 2ODMA 1SEQH 4IKIA 2Y3NA 1JGUH 4DV6O 2Q4PA 3VXRE 5JR1L 4DF9A 5AB1A 1BGYH 3CNKA 3TO4D 1PZ2A 5F7WC 1JK9B 3BCDA 4QXTB 2XICA 2NW2B 4CVZA 5LNGA 5KN5A 4JFZH 3VGHA 2OQJA 5KHKA 2XZQL 2YD9A 3EBIA 3LH8A 2OCHA 3P0VL 4W6XB 4YGVB 1XR8B 4PJFA 3HC4H 1INQA 3E1F1 1HL5A 4UU9B 1RLWA 2AQTA 2A6JA 2BPBA 1KBKA 2P1YA 4CSTA 5CAYB 1HOCB 2HUHA 2QV2A 2WZ5A 2YAHA 3EJUA 3OMIB 2HH0H 3VE0A 1ZL8B 3E8UH 3UEQA 4KVCH 2Y48A 3ZHNA 4LDLB 1A7RH 4PJ9D 4D0BA 5I1EL 1ML0A 4NCDA 4ILDA 4H33A 4MXQC 1GTOA 2XT1B 1K97A 2ZQKA 3F7VA 4XVTH 1IIKA 4M4RB 3SKJL 5JJJB 1HHJB 4GX1A 2A9CA 3MLXH 1FGVH 1CYWA 1AD9A 1YEDB 3PWPA 4JAUA 2YXFA 5HFLA 2F66C 3G6DH 1NKRA 4DQAA 1ZLSL 3QHFH 1JDCA 5MEOB 5I6PA 5KVDH 2LJ2A 5IEKB 4XVSH 1NICA 3EHBD 5L8KB 1E9QA 4NFCA 4JUSA 4QNPF 3PNWA 3M1BB 2IG2H 3DPDA 2PP8A 2UZIL 4J3TA 1JV2B 5T1LA 3BVNB 4OZGE 3P3SA 1K8DA 3EFOA 4JFPA 4R2GC 1JPFB 1RKRA 1AG0A 5I0ZA 5C0CA 2NSMA 1AI1H 5F6IB 4PS3A 4I3SL 4NM4H 1H3VA 1H2GA 1QWHA 2P52A 4ODXA 2G2NA 3GYRA 3QVAA 3EYUH 4OVVA 4XAWL 3H1LH 1YEHH 7FABH 3FC8A 4DP9X 3LSSA 2O30A 4PUBL 2J5WA 5ANHA 2Y7QB 3O0LA 2BIOA 4F2FA 1ICTA 1WZKA 4HU8A 1G43A 4K8RD 5CBEB 3ULUD 4F24A 5KZCD 3TN0B 4WRLA 4I5SA 2OL3L 3UTPD 4PJIB 4ZI8A 5GONB 3L4VA 4JYBA 4AEHH 3II3A 3Q8CA 4OZIF 5C0ND 2DS4A 4PHXA 3OKLA 1DZ0A 1JWMA 4B0MM 1URLA 2Y25A 2ZG2A 4MMXB 1BZQK 1QQCA 4Y16B 1WZAA 3CDCA 3ATDA 3DRQA 1IBKB 4XOCA 3VG0L 4XMVA 5A3ID 4B3TB 4R0LC 3O9WA 3OG6B 2BVUA 4FMTA 1BQUA 2YKLH 1ZSPA 5GSRA 3RL1A 2IDCA 3AT8A 1EO8L 5DEJA 1TVDA 3UBXG 4MXVF 3BKYH 3BRDA 3PHOA 1EANA 1LHZA 5GSVA 5E5MA 5EIBC 2WLJA 1YDXA 2ZT9C 2XC8A 2JIXB 3ZRXA 2OTWA 3N0PB 4PY8J 1NBVH 1CLYH 4AMWA 3JTTA 4XBPB 3WUWA 5I15L 3V6FB 5DRNB 5F9DC 3BH4A 3FO1B 3NUKA 3SPVA 5LBSA 1A3QA 4WUKL 1J8SA 2F43G 3AG7A 2AQRA 3QFDB 2PWDA 3JT2A 2FECI 1MHCA 1RJLA 5E4AA 1XGQB 5BJTA 3MV01 4O2CA 4X4ZA 1JFFB 2F8IA 2X12A 1XO8A 3FQNB 1WYJA 3MRNB 2EDYA 5JUEL 3WSQL 4ADIA 2R8SL 3VWKA 4HYOA 4O4HA 1BZ7A 3C2SA 3TYFA 1XB3A 2VR8A 1TQSA 1WA8A 4UT9H 1TITA 1XGUA 2R1YB 3FMGL 1FCCA 4AGOA 4HQQL 4HPOL 4PFEA 5JYLA 4JQXA 1IBKO 3O2DA 4OQTA 1EEQA 2VABB 3SPCA 1HWGB 2A1WH 3FU7B 3OD3A 4PELA 3E7JA 3LPWA 2IALA 3A23A 1EFRG 4L0PB 5CHNB 4KDTA 4LNRA 3OB0H 1CP9A 2YGNA 5FV2A 1FP5A 5IWAB 4IJ3C 3MOBL 5TTRA 3NJNA 3EH1A 5DHMC 3GC3A 4NIYE 2RBLA 4E0RB 1CBVH 2HVJB 3GF8A 2GBOA 1VZGA 5C3TA 4TQDA 1AGBB 2V7HB 5JORB 4UZUA 4TT3G 1HQRB 2OWOA 1TT6A 1LE5B 2H45A 2W65A 4N2MA 3GBNH 3CFNA 3UTSA 5F9WB 1U93A 1ZUQA 1UACH 1YQVH 2NNXA 2RCSL 2GJZB 1RAMA 4GXUN 3IAYA 3OQRA 2YZ1A 3EBGA 5BUGA 2XZZA 4OJAA 4EE2A 1RHHB 3CRQA 4KPHL 4LF7B 3MNWB 1F7YA 1D6VH 4RGND 5F0MB 4TRPH 3QIBC 1OAXL 3UC0H 4YHPA 3WTXA 4U6VL 5L2KE 4AH2A 5IVXF 5CIPB 1AR2A 3WIFB 1AI6A 4JDVB 4A7GF 2WJ5A 5GPRA 4WFHA 4EN3C 3DDGA 4U31A 4PCKA 5GGTL 5J7CC 1XCQA 4LEXH 4PG9B 5GIRB 1OE2A 3U10A 4AQAB 3FFCD 1WAEA 2DYPA 4JRYD 4LLYA 1QU7A 3KBHE 4N8VA 1LMIA 4PD4F 1U8QA 5EUOF 1IAII 4QOKB 2P5EA 4D0DB 1T7YA 2M1KA 3R8QA 2L0DA 1K33A 1SEQL 4HZ1A 1KTRL 3EOBA 4J23A 5EV7A 3VXUE 2H2PC 2VO5A 3QUYC 1JGUL 1KP3A 3ZR5A 2ENSA 5B22A 3W9DB 4JFZL 7PCYA 5JPNB 4NZFA 5FPIA 4YJ3A 1B2WH 3HC4L 4ZMTA 3T77B 3ARVA 2DYSC 1X7TA 1VQKV 2HH0L 5IV2A 4KJQD 3E8UL 1DUZB 4KVCL 1U96A 3OR7A 1A7RL 2E5EA 3VX0A 2UZYA 1G1YA 2Y69C 5DCCA 3B9KC 5L0QC 5I73B 2J7LA 4XVTL 1KB5B 4E4EA 2EACA 3H4HA 3I5DA 4J3OG 3MLXL 3TGXA 3J7AU 1FGVL 5AOJA 3HRZB 3T8MA 1YZZA 3TH4T 4DCQB 2CGZA 3UROR 2EYSA 1CS6A 2WAHA 3DROB 3G6DL 4I2XE 1AS7A 3BP7B 3QHFL 4LKCB 4Y8AA 3WFBH 5KVDL 3ZYJA 5C2BH 5CBAB 4WWID 4XVSL 3K46A 2IG2L 4IKLA 3F5TA 1EZVX 1WA0X 3ALPA 3GSNB 4BSWA 4LCVA 4FNTA 4OUUA 1M1XA 1DLFH 1F8TH 2BVQA 2H8PA 3FDWA 4HHWA 2UXBO 3O6FB 3P3UA 3PXLA 1AI1L 4GNKB 3L7EA 5AUMA 3FU3A 4WKXA 2HFTA 2X53A 1KBBA 5G2NA 1LO0H 4NM4L 2JXMB 5LCVA 1CDGA 5A16B 3ZO9A 5IIEB 3AWGA 3N41B 4MDIA 4XMTA 1EFXB 1GKOA 3EYUL 1YEHL 3LZNA 2XSKA 3QR1A 4JEGB 3FRPA 7FABL 1JYVA 2BNQD 4CC0A 4CDHA 1RP3B 4X62B 3QZMA 4R7VA 3QAZB 2JEXA 3AREC 3RHWF 1IX9A 2WZPD 1IC7H 2GJJA 3IJ8A 4XOBA 3VW3H 3IFOA 2PKDA 1MDAA 3V4PA 2MQGA 4AEHL 1ZVYA 1E5ZA 4FQIH 4PJGE 2CTRA 1G9MC 1V55B 1HDMB 4JMXA 1EGJH 2GT9B 2X70A 1HHGB 2YRPA 4GIOA 3L5WA 3T09A 3DUSA 4JG9A 3IM1A 1H0DB 3EHBC 4BUHA 5EF0A 5ACMA 2YGQA 3KWWA 1RM1C 4XP6H 5A40E 3O65A 2BNRA 4LDOB 5SWSB 1CF1A 1X5AA 1UTDA 2YKLL 5E94B 3UKMA 1FO0H 4PJEA 3WNMA 1FYTA 4XVUD 5J8OA 1AXSA 4BKTC 1P49A 2BOBC 1J12A 1WT5A 3X12B 3ZYOA 3B1TA 1YJ9V 5DJCB 2O57A 3ZIAG 1NBVL 1CLYL 2XFXB 2YRBA 3QFJE 4WTZA 1EEUA 2QR4A 4G8GB 4V1DE 5F88A 1NAMA 1J8KA 4PJHB 4BRJA 2IXQB 1J1XL 1VGKA 2R9RB 4DW1A 1V05A 3L71H 5KHJA 4J7JA 3QGVA 3QEQE 3D25A 3SQBA 3D51A 4P59H 4X62O 5BO0D 2C4FT 4Z7VF 5DU7A 2YN3A 1P7BA 3ULUC 1B3QA 4FFKA 1T04A 4GAYA 2FH8A 4QUOA 5EEXA 4YSTA 1OCZC 3W3BA 2PPDA 5C0NC 4MAUH 3DV6A 2VYRE 1Y76A 5D5ME 2DIEA 2WTRB 1NQTA 4UT9L 1MDTA 5IUSA 4XXDB 4LARH 4S0SD 2ZX7A 5A3IC 2P24A 4J3OC 1T1YB 2NXYD 4BHUI 1BA9A 3KYAA 5HYQA 4OI7A 2YBRB 2FTAA 2PXYB 2A1WL 1QUPA 3KPSA 5FF6A 3CHSA 4OJFH 4FCHA 5IY5C 3PYCA 3HKCB 1JOIA 3RWHA 5FUCE 5JHMA 4WW2A 5C0FA 1PEZA 2IANA 4TOYH 2ZONA 1IAMA 3V7MA 1TNMA 2I07A 1CD1A 4LLQA 5B7EA 1NUDA 1WTLA 2NW3B 1CBVL 1QLEB 3NAAH 1UJ3C 1DVFB 5H94A 4AUUA 1RSOB 2L7JA 5EU3B 1TR7A 5E9DA 2ZUTA 4PY7B 3TC9A 3TJHC 3JASB 2LABA 4KTDH 2FWOB 4OUOA 4XO8A 3ZCCA 4G80A 4MASA 1RJZA 3GBNL 5L4JA 4WFEA 3OPUA 1UACL 1YQVL 3DXAE 4PRPD 2M7WA 4JB9H 1R75A 2PYEB 1R3KC 1AMXA 4XHJC 3P3NA 1PKQA 1D6VL 1G9NC 5C08E 2OIGA 2ZCZA 3O6MH 4H8UA 4TRPL 3UC0L 3G6EV 2Q6WB 1FXKC 1CFTB 1RZFL 1AHWA 1VACA 2P47B 3T3MF 2MFNA 1W0WB 3SCMA 2A9DA 4YDJA 4RZCB 4KK5D 1H3PH 3VXQB 3QJTB 3DETD 1KIRA 4LEXL 5MEPA 1KY7A 1QHQA 5BUPA 4L8BB 2YUZA 3NIDF 4J4PC 1XDCA 3NCJH 3EFDH 4C55A 5I76B 1XL6A 3PWUA 1CDBA 1J87A 3TIEA 3NN8A 2D2CC 3FQXB 3P30H 3WY4A 1CBJA 4GG6A 2X0UA 4J28A 2FBRA 4ALAH 2CLVB 4PP2B 5BOJA 1N5AB 1RFYA 1JCHA 1TZHA 3MCYA 43C9B 2Q0AA 5JLZB 2C9PA 4Q8BA 1A6PA 4X4MA 1UQSB 2PCYA 4IMKA 4R50A 3VMPA 2A9AA 1B2WL 1WVZA 1M2VB 3EGXA 3MRIA 1JX9A 4RGNC 5I2IA 5KVDE 3GLZA 1EAQA 3H2PA 5IVOA 1BAGA 3BMWA 1MLBB 4UIMB 2ADGB 1UA3A 1I7ZB 1JWSB 3C3SA 3TN0D 5K9OB 3CN4A 1MRCH 4DT2A 3MR9B 1KPRA 5FECB 5EBWB 3CSGA 1BVKB 4LH6A 4W9FC 4YSUA 1E9OB 3P1VA 2B5IB 3APOA 1YMHA 4HJUA 1CQYA 4M3JA 5D2LA 4Z7QB 5TJWK 5C2BL 3WFBL 4FKKA 1XMQB 2P28B 3MV9A 4WFAV 1FYJA 2AGJH 1NEZA 1MFNA 1NZRA 2N59A 1DLFL 1F8TL 1SBSH 4X6DA 4A63A 2HJFB 3L13A 3WD5H 1LK3H 2JIXD 1HWWA 2PWHA 4N20A 1ZLZA 4X80H 1FNHA 1LO0L 3PGDB 2ZKHH 3ETTA 4JPIA 1F41A 3QS2A 2FX8H 2FAUA 2ZXGA 1RSFA 4KJQC 1Q8MA 4MMYB 4K5LA 1V3KA 5INDA 4Z95H 5IMMB 4OLWH 3CZGA 1U95B 3HKEB 4WF9V 1IC7L 5FYKE 1E9PB 3VW3L 4WJKB 1JNHB 5C93A 2MRYA 3EYFB 4FQIL 5EOQH 3CPUA 1R5VB 1EGJL 1PX3A 3RW0A 1TJIH 1FJ1A 1UXLA 3KLLA 2WSPA 2WP3T 1UGKA 2VRKA 3E3QE 4Q9RH 4RMQA 2APVA 2APTA 1XMQO 2XV2A 4GOSA 1XGYH 2XN9E 4QHNB 4XNZB 4ETQA 4JZJA 3MRGB 4DGWC 4UB8Z 3DLQR 3U11A 1JPGA 4Z7OE 1L8DA 3Q4HA 2WZ6A 5DMIH 1YCIA 2ZIMA 4LLVA 5BS0E 4G27B 1Z9PA 2EDWA 4FTVE 4NKMA 4UBDD 1B6UA 1BAWA 1GGUA 2YEZB 2QWPB 4P30A 5FXCH 3HKFA 2QPSA 1BM7A 1JTPA 4P59L 2X2JA 2K6ZA 1IVTA 4JTAB 5ETUB 2XX1A 4LQFH 2VLME 2IPUK 4C4KT 1KULA 4MAUL 3GXTA 5SV3A 3HAEH 3LIZA 2G75A 4N86A 4L3FA 1KCLA 3OW2U 4PMFA 3U0WH 4LARL 4XNMA 4N2IA 4RDBA 4LCWA 2VQ4A 1L0NH 1NJ9A 2YD8A 3LKSB 4PJAB 5CFHA 1EAPB 7CGTA 5IG7A 2EE3A 4XVUC 5D4JA 1S5JA 4U3JB 1MFEH 4OJFL 4ZIBA 3PQYB 1GYCA 4HWBH 4QTHA 4JMNA 5EOTB 4BKLB 3V5KA 1G1OA 1SJMA 2GABA 3ZU8A 4QRTA 1HSAB 4TOYL 3BXNB 3IDYC 5KSAC 3B8MA 4L18A 2IPKB 4QY8A 1Q0EA 5B39B 3NAAL 1L5GA 2J20A 5J1AB 1VERA 2VW7A 3I50H 1OP5K 4L1TA 4GB9A 4LLWB 5CBGA 4L2YA 4X6FA 1PX8A 3CSBA 1BVNP 1UH4A 3U9PH 4KTDL 2WLMA 1FHNA 1MLCA 4I5BA 1BSMA 3IT8D 3QC5X 5EO1A 4B5ZA 4HOZA 3FQWA 4JQVA 3FAWA 3H6JA 4NZ8A 5MENE 4JB9L 1T1ZA 4J3WA 4HIJA 4K71C 4K7PX 1IBZA 5TE7H 2NXYC 3PL6B 1LEKB 1JZHA 3C6EA 4MVOA 1Q6HA 3W11D 4M1CC 3O6ML 4PGBB 4QHMA 3U4EA 5T1KB 5I1GH 2ZIOA 4IGGA 2HX9A 2UXGA 4Q9BA 1OF0A 4PGCA 2Q20A 3NSCA 2V17H 4YHYC 3DSFH 2HJLA 1H3PL 2AXTZ 2IBZX 3HHMA 3BW9A 3TEXA 2GDSA 5JVDA 4EKJA 3WLBB 3AJ7A 1BOGA 3NCJL 3GNMH 4RAVA 3EFDL 5E0QA 3PPSA 5FYLH 1CIUA 1DN0A 2DQFB 3E9UA 5DRWB 2YI9A 3P30L 5BV7C 3CP1A 1F3DH 2G0LA 2AQSA 2LLGA 1IX2A 3HCVA 4LF4B 4GS7C 4FFZA 4ALAL 4XMKH 1NQBA 3EDKA 5IMOA 3S6CA 5JXED 4PDRA 3O6FD 4I18B 4YAQB 4JI6B 2ICEB 2WA3A 2MQ0A 3SE8H 3BQUA 4E41A 2CJTA 4FZEH 4PBWD 1ZA3A 1EFXD 4RAUB 3RWIB 4ZUWA 3GB7A 1E6OH 2A2QT 2HT4D 5A2FA 4BSVB 2ENQA 3ALXA 1AGFA 1N7MH 1U36A 4HUVA 2F5BH 5HYSB 3CRCA 2QKSA 4QRRA 3MBEB 4M3KB 2H9GA 1A5FH 4HJTA 1NEPA 4JFSA 3R06A 4KK5C 5FUOH 3MV7A 3E6HB 1MRCL 1X9LA 3DETC 2R1WB 1KP2A 4JPSA 4TVUA 3QA3B 3IXAB 2F1MA 3FTSA 2XWJA 1V27A 4HFUH 1F1AA 4U1MA 4PG2A 3KPRA 1OAUH 1XREA 4R96A 4PJBA 2D7OA 1RZIB 3UAJA 3I84A 4LT7A 5CZXD 4WO4A 4MJ6A 5F7DA 5SWSD 1EQWA 3ETBF 4LF4O 1IBDA 4B3RB 1BQHB 2AGJL 2AFNA 3RZWA 4B53A 1CIDA 2GQHA 1SBSL 4ZUVA 3GSOB 3L5XL 3RY6C 4JI6O 3ZZSA 3GPSA 1LK3L 3WD5L 4OKDA 3UTTE 1YLBB 3NZSA 4PV8B 4G8GD 2EJ7A 1O7SA 5AG8A 4PLNC 4HG4J 2ZKHL 3DGGB 1WA1X 1WHOA 4UQIM 1H15B 4DOHE 1VHPA 2LGWA 2FX8L 3T6QC 5D7LB 3TN0C 3WJJC 4PVBA 4Z95L 3GSQB 4OLWL 5HVGB 4WF7A 5L3DA 3KPMB 4BIZA 2D31B 3HC0A 4KI5D 5LB1A 3NQKA 5EOQL 1DJYA 1PDKA 3C5JB 3GTNA 3WTUA 1BG9A 4CN4A 4OZHA 2O93L 2W07A 4IEFA 1TJIL 3JTSA 1XGTA 1LWHA 4FQHA 5EIQA 5EEZA 2ILLA 4Q9RL 1XMWA 1JF6A 3C2AH 2PXYD 3I6KB 4PWHA 5IYZA 1B2YA 1J10A 4DUWA 3TCLA 1XGYL 2K1EA 2Z4TA 1YNTA 4AM0B 5FB8A 1JYWA 4P5TD 3GSXA 1IM3B 4BFFA 5LDSA 2HRHA 4PJ7A 2P44B 3DX6B 2Y0SA 3H3PH 4JF3A 5DMIL 1P9MC 1D5MA 2FYYB 4PJGF 1TAEA 1N0LB 4G72B 4X6EB 3ABTA 1P84K 1H2KA 3WY2A 4DN3H 4NO0B 3HEIB 3O2DH 1PAZA 2V5RA 4F20A 1DVFD 2R15A 3DTXB 3QEUA 2HKOA 4QT5A 1MFBH 3RNQA 1AO7B 3RJQB 1IM9D 4GRWB 1FC2D 4LQFL 2X2UA 3G5ZA 4ZBMA 4CH4A 3L5JA 2DJVA 3G04B 3A47A 1BJ8A 4FQ1H 5LVEA 2GJ6E 2PYED 5I1HH 1SETA 1M56C 1S8DB 1DBJH 4PSRA 1C5CH 2WVTA 3ATFA 1K92A 3JV6B 4G11A 2BTOA 5CA0B 2BFGA 3MX0A 5C0BA 1AACA 3U0WL 5CCGE 1T0NA 5IHUL 3Q9PA 1CFBA 2BSKA 4Q6IA 1EWHA 5ESAA 3GINA 4FHBD 4I0CC 5FGRA 3B37A 4N28A 2LU5A 3B77A 2ZYRA 3ZHDA 2PUQT 1EFQA 5KYNA 5FOBB 1MFEL 4HWBL 4F7MA 8PAZA 2UV3A 3C5XA 1AI4A 1C08B 1YMMB 4UBDC 5D2NC 3DIFA 2OIEA 5DEFB 5T3ZD 4ONGH 1ZS2A 1WP8A 3RKDD 3ZTJH 5E00A 3W0WB 1JZEA 2O1AA 4LSPH 3I50L 4WEUD 5CINH 2AHZA 3MREB 2HP4A 2X28A 4KFZC 3D0VB 4OKVA 4O5LH 5F9WC 3U9PL 4MTXA 3I56V 3QQ9C 3VAEA 4B9IA 3KYOA 1CVRA 5JIPA 3L4ZA 3CN2A 4HLZG 4QI3A 4UZGA 3OGIB 1A8JH 3R1GH 2RNBA 4IKNA 1BSIA 2AGAA 4JO5A 4LQ1A 3BUIA 4M8UA 4QDGA 4TVPD 5TE7L 4HVBA 2EEXA 3S8FB 2F08A 2D3JA 2FB4H 1QLFB 2RALA 2Q69A 4OCXH 5G5DB 5H35A 1GYVA 1YG9A 2BSSB 3C8HA 3EGSA 5C09A 3SGDI 3WGVB 4F7TB 5I1GL 1WWWX 4Y2NA 1CGVA 2V17L 5FFLA 1YPZB 1D7CA 1L9MA 3L70H 2QHLA 5LKNA 2EVGA 2HG5B 3HC2A 3OHXC 4J9ZB 1A9EB 2NY2B 4OJCA 1EX0A 2GUOA 3DX9B 5BPPA 3GNML 3L3GB 1JXGA 4PRIB 3QNEA 2EYRA 5FYLL 4FA6A 5C9JA 9CGTA 1G6RA 4HIIB 4NT6B 4MT8A 5DR5H 4A68A 4XMKL 3GM0A 1KJMB 4MDRA 5EWIH 3UCSC 2ATAA 3FONA 1AANA 1R46A 1G1CA 2Y22A 5GJSH 3SE8L 1Q90D 1MWAA 1UOLA 3MRDB 3VD5A 3SDXE 2XZAH 1BLNB 1FORH 1VF5C 3QPKA 4FZEL 1MELA 3T1YB 4ZAKB 3WFHA 5BMFH 3O4LB 1FFTB 2QSVA 4M7ZB 1JE6A 3T1FB 4C47A 4A6YA 1E6OL 1HP8A 3W11C 5I1DA 5F71A 4ANXA 3T0VA 1N7ML 3SE4A 2F5BL 4G6FB 5KOMC 5EN2B 5C6TH 1LO5A 2WGXA 5I73C 1A5FL 1HXKA 2NX5D 3VXTB 1ZGLA 1T6VN 4PWJA 1F4HA 4LL1A 5FUOL 1HFUA 3BI9X 4YDIH 5CJXA 4HPHA 2K0RA 1XH3B 5KSBE 3D07A 2IQAA 4HFUL 5EIIG 1BZKA 1NC2A 5FA3A 3V5HA 1YITV 1U8LA 2XN2A 3BP6A 1OAUL 3MO1A 1EO5A 3I9PA 4K7PH 2XV6B 2PO6D 4APQA 4F9LC 4ZFOA 3NPSB 3SKMA 3B2VH 3K0YA 4BGLA 3CX5J 1FFNB 5JXEC 1R3LC 4NBZB 3V4PH 3K81A 4X9BA 5IJBC 3J27A 4PWKA 5D6DA 2VRQA 5D4IA 1Y66A 3ILQC 5HGGS 1TZAA 1CG9B 2IBZH 3OAWA 3TBCA 1JXJA 4JCMA 4D8OA 3DGEA 3F01A 3K5OA 2JI1A 3NA4A 4L8DB 2HT4C 3T1YO 5KW9H 1YF2A 2BP0A 2E9GA 3KPNA 3QAZC 1ZHLA 2FJFB 3P9WB 2PR9A 1PL3A 4N9GA 4NRZA 2Y6SD 4DEUA 3N04A 4Z8FH 3BN3B 3SR2C 2A6DA 3ARSA 1RMFH 3C60A 3PWVB 1V55C 3EYSH 2N7BA 1NAMH 4ICXA 4AOFA 5JYMA 1XL4A 3A0BZ 1Q94B 3WO4B 4NQVB 2HKAA 4L4VA 3HLAB 3ABLB 3APFA 5CZXC 4F33B 2DLTA 3BP5B 5B1OA 3WNJA 5HYJE 4N2KA 3JD4A 2WSDA 3GSUA 2ESVA 3C2AL 3KBEA 2TRHA 5I8KH 1Z7JA 1D6EB 4MSWB 5DZPA 2JKTM 4FRWA 3H3PL 2ZM6B 5GRXG 4KKAC 1DVXA 4LCUB 5DMJB 3OKKA 4DN3L 1O6SA 2AXFB 3KJ4B 4HHAA 3SGJA 3G6BA 4I50B 3O2DL 3PUCA 1VQ7V 2VLKE 3BH8B 1U0QA 1MFBL 3U9WA 1WWCA 5ISZD 1GGTA 1JGEA 1MCNA 2CGYA 3AMLA 3G5YB 4S11A 3G08B 1B3JA 2A4ZA 1AIFA 2HKHH 3O8XB 4L9LB 4JFFE 3KYNB 2YS8A 3SPGA 4JDEB 2P43B 4QIRA 4KI5C 4TVSa 4AV4A 1UWYA 3LPOA 4XZ4A 3BKCH 4YMPA 4FQ1L 3AC0A 1NOLA 4HH8A 5I1HL 4NZJA 1DBJL 2IU0A 1C5CL 1JI1A 1KJ3H 4L3AA 3DA0A 4RCAA 2VSCA 1NTDA 3MFFA 3JXAA 3OZ9H 5HJGA 4F27A 2CMRH 5T1KD 4MD5B 2C3WA 3U6RA 5IROD 4P5TC 1RZJC 3QUXB 3TBWA 3CZEA 3EO0A 3A4DA 3QAQA 1N32B 1F90H 4S10A 2EJRA 2ZM6O 2W60B 1KYOK 5I1AA 4PEEA 3ZRVA 1PIFA 3K58A 3OEEG 4HJGA 2ZUQC 4ONGL 1E30A 3EKCA 4ZHQA 3EYOA 4NZRH 4LSPL 3RNKB 5CINL 3LKNB 1T7XA 4P2OA 4X99A 4OPAA 5KA5A 1UB6B 3G9AB 3NEOA 4O5LL 3RN4A 1Z5VA 2IAAC 1H8NA 1BM3H 1MCJA 4WW1B 4Y4HA 4PJFE 1FVDB 4GUOA 2W9DH 5MHSD 1TEGA 3R1GL 4JKKA 1KLGB 2XVLA 3LDBB 5FYLE 2YPVH 2CKBA 2BH0A 5DLMH 4O4IB 2WLLB 4PRHB 5CSGA 2FB4L 5I18H 3WIAA 1JBJA 4OCXL 2YN5A 2NUPB 4IGBA 3QDAA 4GRLB 4HUWB 4G6MH 3R7RA 4ZKIA 5HHPA 5AOKA 4YZFE 5TGBB 4AL8H 2Y0PA 3MA7A 3PWPE 1D5IH 4ORGB 2ZWNA 5MP6H 4KUCF 3UIYA 1SVZA 2V5TA 3O6LH 1OGPA 4RGOH 1N32O 1BX2B 1CFVH 2A73A 2X0VA 3RKDC 1KT2B 3ZL4H 3Q2LA 1BQSA 2NY0B 4C56B 1BJ1J 5DLLA 2ITCA 3JV4A 4EI5B 3HKDA 4P3DA 4PBXA 5DR5L 3S8GB 5CN2A 5C0CE 1J0JA 3ZKXC 1G4MA 5HHOA 3BVXA 2FO8A 3F84A 4JFHD 2EDRA 2EEDA 4M6OH 5EWIL 3VFOB 2IMMA 5GJSL 3TGUH 2UWEB 3FCTB 4AC4A 2X4TA 4A2GA 3SY6A 2XZAL 3DMMB 3GMOA 1FORL 5A2JH 2M6YA 5J56B 1S5HB 5BMFL 3CZFB 2ZXQA 3BD3A 4X4YA 3VD4A 1N2RB 2ATPA 1FG2A 3FNKA 4IOIB 1A21A 4GG8A 4JTDB 4UOQA 3TXSA 3M45A 5C6TL 1F3JA 3CDGB 2FO4A 1KMGA 3CFJB 4PR5A 4HK0B 3HRPA 2BINA 2FL5B 3JTBA 4R7DB 1I7RB 2MWCA 4YDIL 2G3XA 1AD0B 1IIIA 3IMSA 4OGAD 2A6IB 2PWEA 4NAJA 1ZPUA 1KUQA 4X4XB 2CTQA 1QR4A 4HOXA 3BUBA 5IMLA 2J2ZA 1GYWA 2AV1A 4K7PL 1R3IC 5FYJE 1S46A 3B2VL 4HMEA 1QBAA 2ZKYA 2AAVA 1X4TA 1T21A 2WCPA 2ZXBA 4NO3B 4JX0A 5DT1H 3V4PL 2HVKC 1DDHA 4Z7NE 1HNZB 1YEKH 2YAFA 4MRBA 2EIZB 2WB1A 1ZA6B 4CSSA 5C8YA 2ZP8A 1A6WH 3OAAG 3VD9A 4M7LH 4NO0D 4UT7H 3ETGA 4NQEA 2C7UA 2V7QG 1ACYH 1YEGH 3BO8A 3QDJA 5KW9L 3DVIA 5LNDA 4JY4B 1BQ0A 3WTTA 5D7KD 1AO7D 2MW2B 5CLTA 3BEWA 1NVPB 2OJEA 1NGQH 4KO6A 3LKQB 2IV9A 4JHUA 4Z8FL 2HVBA 4A2HA 1J8HA 1RMFL 1YQ2A 2WWMD 5DK3A 3EYSL 2UY6A 4WFBV 1NAML 3TH2T 4HZ3A 2GK0B 2WIIA 2I5YH 3GMPA 4J3VA 2P80A 2PO6C 6PCYA 4FEIA 4KOCA 4DAGH 5ESQA 3ETDA 1EVTC 1RQ5A 3FBKA 3X1NA 5I8KL 4KJWD 1HW7A 2ODIA 1UD8A 3HPJB 1LLAA 1Z9OA 4HKZB 3SJVB 2PPCA 2GSIB 1K4CC 2VLRB 3LIZH 1IC1A 2CLZB 1HNZO 4GUPA 4YHIA 5DFTA 1I5YA 3CXHJ 2GFBA 4JI5B 5H4ZA 1ZK9A 4PRBA 5CR8A 3OFNG 2ZOKA 3CZNA 3BVOA 3DBXA 3OXRB 4R26H 1TQVA 3W0WD 4FDWA 3EXLA 4K94C 5I71C 2YD3A 1TYEB 1JRHH 2QPEB 4GKNB 2Y6SC 1ZSDB 5E1AA 2LGNA 5GRUH 1DCLA 3BVUA 3SDAB 2WXOA 1P5UB 2H0FA 3OKMA 1D9KB 2FH6A 3LQZA 4RMVA 3UTSE 3VFTA 2HKHL 5DGQA 4E9LA 2Z93B 5L3EA 2CO7B 2VRZA 2GV9A 2DWEC 1JG9A 5EBLA 5CGBA 1Z2GA 2BC4A 5LGJB 2FZ3B 3IJEB 1DCEA 4XDLA 1KJ3L 1L3WA 2FDBP 2WHVA 4M03A 3OZ9L 3D4GA 1Z0NA 3IF1B 2ZF9A 2CMRL 3P9LB 2P5WA 2EVFA 3OM3B 3W81A 5HJ3B 1VQ4V 1SESA 2A74A 5FA4A 5F1SA 2O5ZH 4JI8B 2OMZA 2X4OA 4X83A 5DHEA 3KXFB 1F90L 2BOCB 2NY2D 1H3XA 3D85B 1OO2A 2P5EE 1Z0MA 4MJJA 2AJZA 1VSCA 3GSWA 3L4WA 3GWOA 3QO0A 1O7VA 5JHLA 1FL6B 2EC9U 4NZRL 1YECH 2GC4C 4DKAA 2G5BB 4KU1A 3KS0J 2MOQA 5TF1H 1TQBC 3M7MX 4JPRA 4D9QD 5C3LD 4JFTA 1N3NA 2ITDA 3IETB 4HFWA 4YZWA 3RWGA 4X1YA 1BM3L 5IKCB 4ZAKD 2W9DL 5HGHA 1YHPA 3O4LD 3GM8A 5HI5D 2RAMA 3T2MA 1NUNB 3WLWD 4FFZH 2YPVL 4OZFA 1FO0B 5DLML 3MNVB 3BPNC 4QPKA 4G6FD 5I18L 1KGJA 1I8IB 3IPEA 4PCYA 4UUJA 1N36B 4B9JA 1VARA 2UYLB 4G6ML 5FEBA 2G3NA 4AL8L 2VDKH 5MP6L 1D5IL 1KSRA 3REVB 4PBVC 4R97C 3DHJA 4Z77A 5FFOA 3O6LL 4HWEH 1DEDA 3RL2B 4RGOL 5F7FA 4LFCB 1PZUB 1CFSB 1CFVL 5CCHE 3NZHH 4U1LB 5BW7C 5B3SB 2ERJB 3ZL4L 4TUYA 5EB9A 4WDIA 1P2CA 1S7TA 2Y07H 4L29A 5FGSA 4PTTA 5CD3A 4JFEA 4I18C 4JN1H 4AILC 3QUHA 2G5RA 2DLEA 3D34A 5I19H 4EI6A 4ZS7H 4PJDB 4UXNA 5AVUB 4B3SB 5E9NA 4X1IB 4F6RA 2FJGB 2NCMA 4M6OL 5TFSH 1N8ZA 1QNMA 4AYEC 1SYVB 1U30A 4CMHB 5G4OA 1QEWA 1QW9A 2J71A 1H19A 2DH3A 4BXSV 2ARJB 4Q4IA 1WTGT 4LAJH 4FJZA 4JL2A 3MD0A 5DVNA 4FLOA 4H25A 5EZJB 5HBBA 4NPJA 4E9QA 1FH5H 1RUAH 4LL4A 1U8OA 3G6JA 4GMSH 5D71H 4ABUA 2IDUA 4K3DH 5IROA 3WNLA 5FO7B 1C7TA 1XF3A 2E4FA 3AAZB 1FN4A 1CTNA 2FHCA 3QXDA 3FTGB 3NSJA 2BVPA 3QJRB 3SDXF 4LFCO 2CUGA 3OZKA 5C0AB 4DUYB 3F58H 4KTYA 3VXMB 2BNRE 1XIWA 4N3TA 5FKPA 3ABMB 1WISA 4ZTOH 1A4JA 1EEZB 4AT6B 4PJEE 5E4IA 1FYTE 3BAJA 1M93A 3K6OA 1CK0H 1SLUA 1NC4B 1S7UB 4HIPA 4E5XG 1L9QA 3RYMA 1QTPA 5DT1L 5JOPD 2ZXDA 4B3SO 3JYBA 5KS9A 1YEKL 2ADIA 3EADA 1GY2A 1K72A 3F05A 3H0TB 2DWDC 3JSSA 4M6NH 3L48A 1A6WL 4QR7A 4BAYA 4M7LL 1TUBA 1WBXB 4PJ5B 4U1KB 4WNQA 4UT7L 2PR4H 1XH0A 5KSBF 3S3CB 4L37B 2BM3A 5CP7A 1YEGL 1ACYL 1Q6UA 2NNAB 2KKQA 1Q0XH 1Y6NR 3IRCA 5EZLB 1IGTA 4BCZA 5DJZA 1NGQL 4UM8B 4NHUA 1UGNA 3DK0A 3M88A 3O8XD 5DD6A 1R6VA 4MAZA 3KYMB 3N9GH 3MJ9H 4FFYA 4LHUB 4EIGB 2KZWA 4Y19D 3PJSA 1FFPA 2I5YL 1SQFA 3ARBA 1JPEA 1IILE 1PQZB 1WD9A 4MA3B 2CTWA 5H2BA 1S7SA 4G71B 4DAGL 4P9HH 2Q68A 4TV8A 1QSFA 1PYWB 3MBWB 1OCRC 4AENA 4UIKH 1OOWA 3KPSE 4GW5A 4HCRA 3I3BA 3QUXD 1WP6A 2ETNA 5JHDB 1ZVNA 2K4AA 1KGCD 1QBMH 3DV4B 2IANE 3LIZL 5LHIA 3BJ91 3HE6B 1CXIA 2O6CA 1Q7YW 3SO5A 3ZN6A 5E2VH 1YRKA 2YAMA 4HAKA 1CGSH 1BG1A 3BWUF 2IV8A 4R26L 4ZX4A 2ZWYA 3E0GA 5E9DE 4G8IB 1JRHL 4WSKA 1CEZA 1SOSA 2XXMB 1P7QB 1P4LA 5GRUL 2CKNA 2CHWA 1PNLA 3ZMUA 3QUYA 2AK4B 3EUUA 4U3CA 2XAJA 2WWMC 1JAEA 3N43F 2VW6A 4WFEE 1TZIA 3WB1A 2YKKA 3MLTA 5D1XA 4FYTA 3DUUB 1ZDQA 3STBA 3X2QC 2CHXA 3GIVB 1PKQE 3TZVB 1Y18B 2VWEC 4LR3A 4O02A 4JM2A 5HPOA 2F23A 4MQTB 4MNQB 1ZTXE 4X8CA 1I1AA 1OTTD 5IQLA 2QQNH 2RN9A 1XGRA 2P7TB 4GLXA 2CXKA 4KJWC 4J10A 2P9RA 4YSSA 4U4IA 5D1QB 3CZUB 5AYUH 2ZNWA 3BZFB 2R2HA 3QJSB 4U4BA 2EYTA 3FU0A 1DR9A 1PX4A 3TCTA 4G7RB 1ES0B 4A7UA 2O5ZL 2OJZH 1BD2B 2X10A 2ZSVB 3BAXA 4X50A 1FZOA 4XT1C 4JM0A 3LXBA 5K9JH 5IVZA 3ELAT 4GG6E 2H0JA 4DO2A 4C56D 4KGLA 4MJIB 5T3XE 2KLSA 2WBXA 1CDIA 5CEZH 1X5GA 3BWAB 1N6UA 2FEJA 1YECL 3ULVD 2OXHB 3TO4A 3WEMA 1A6ZA 5F3HA 5TF1L 2BP5M 3ARPA 3AG2B 2VZSA 1R3JC 2AC0A 4X4ME 2CDGA 2NQDA 1NR1A 1PZ5B 1DQIA 2LFGA 5HVHB 4GT7A 5AW7B 1G6RH 3FB8B 5DS1A 3DVFA 1JWUB 1TCRB 3MGAA 1YAZA 3BPZA 4FFZL 3MUUA 5SX5K 4PDLA 4M29A 4PJ9A 1FZMA 3EJPA 3CMOH 3TCUA 1F00I 2DYRB 2B16A 4ICWA 1MWAH 2HG5C 1VADB 1UD3A 1IKNC 3M99B 3CHPA 3K5SA 3N1MC 3FCSB 5I30H</