2DYRB

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dyrB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dyrB02
4YSSA 1ZV2A 2UX7A 5D4JA 3T6WA 3QJVB 3WKPA 4BDVA 8PAZA 1GR7A 1PF3A 3NP4A 5B7MA 1JVLA 4AKOA 1KCBA 2HX7A 3PCYA 1BYPA 2GBAA 2IDSA 3T71A 4AKQA 2X88A 5F7AA 1PZBA 3X1NA 2FT7A 3CG8A 1ETJA 4A68A 1GY1A 4JKNA 5E9NA 3C75A 1XMEB 3JTBA 2RACA 3CVDA 4PAZA 4Q89A 3QJTB 4WKXA 3WI9A 2VSMB 1V10A 2XXFA 4NERA 5TK2A 1ZPUA 1ET8A 2I7SA 2OJ1A 2XUWA 4AX3A 5PCYA 1M9WA 3FU7A 3GXUB 2BP8A 1AQ8A 1GS8A 4F2FA 1PY0A 2FJSA 5B3SB 1AZRA 1NWPA 1GS6X 4UAHA 2PPCA 1JXDA 2AZAA 2BP0B 2YAQA 2E86A 4K9JA 2PP9A 1BXUA 4BXSV 1R1CA 3UACA 4HALA 5I5JA 1J5CA 3UABA 3UAEA 2EIKB 5AFAA 3PAUA 3NSDA 3ABGA 1ET7A 4BWWA 1AS7A 1PMYA 2UX6A 2AANA 4EF3A 5LDUA 4YSPA 1FWXA 2QDVA 1AR1B 3X2QB 1J5DA 3DKHA 3KW8A 1PLBA 1PLAA 1JZJA 4G7QB 4A67A 4AZUA 1BXAA 2BO0A 3NSYA 2ZONA 4F2EA 2J5WA 4DP7X 3T9WA 1X9RA 3IN0A 4TXVB 2OCCB 4YSOA 3ZIYA 2BW4A 5B7EA 3H56A 4G71B 2CALA 1A4AA 4JHVA 4HIPA 1MZZA 2FT8A 1ILUA 4A66A 2J56A 4BK5C 4YSUA 1JZFA 1JZGA 4W1TA 5I5IA 2VSKB 1EHKB 3RYMA 4N8UA 5I6MA 4MFHA 1XB8A 1E65A 1NIFA 4CSZA 1SJMA 2GI0A 1SDDA 2WO2B 3OQRA 2PCYA 3NJJA 4A2GA 2PP7A 2GSMB 4HZ1A 4DPCX 2BZCA 1OCZB 1PLCA 3AW5A 1CYXA 1KDIA 1BXVA 3PLYA 1I53A 5PAZA 1NTDA 4DP8X 1ZIBA 2I85A 3AG1B 1PNDA 2EIMB 1UATA 1WA1X 5I6NA 1ASPA 1L9SA 5AKRA 1ET5A 1DYZA 5B7FA 4P5SA 1AG0A 5TK4A 3PPSA 1HAUA 4BWUA 6PAZA 2W8CA 4KO6A 4A2EA 1M56B 1W6WA 3T6XA 5I6PA 1KDJA 2B3IA 3U25A 1ZDQA 1AG6A 3AG3B 3H4HA 4YL4A 3AG2B 3UADA 1OE1A 2PP8A 3V9CA 4BXVA 3V9EA 2QPEB 4WTQA 2X87A 1J9TA 4UANA 2YXWA 2YAEA 2DV6A 1A4BA 3PAZA 2PCFA 4E9XA 4ZK8A 1OE2A 1EZLA 3SQRA 1AANA 2YAHA 1IC0A 1W6LA 2I7OA 4YSEA 1M57B 1V54B 1OF0A 1SHWA 3EH5B 2HLEB 2Q5BA 7PAZA 1GYCA 1ID2A 2PPEA 3UAAA 3BQVA 4E9RA 1NINA 1MG3C 3NJLA 1E67A 3X1BA 1AIZA 4HHGA 9PCYA 1WS7A 2JKWA 3FT0A 3BVDB 4E9YA 2A3TA 1AS8A 1B3IA 4YSDA 2BWIA 3S3BB 2YAMA 3FQ1A 4JHUA 1JZHA 4E9SA 2PPAA 1X9UA 3MX0B 1SNRA 1PZAA 2VW6A 3NT0A 3EHBB 3N55A 4X4KA 2LLNA 3ZX1A 4A2DA 5I6KA 4E9TA 1IBYA 3FYEB 2BP8B 2UXVA 4KNTA 2FQEA 1A8ZA 3WKQA 3TBBA 1OCRB 2CCWA 2HRGA 2GC4C 2IWKA 1PZCA 2IDFA 4YSAA 5IY5B 4CSPA 2MTAA 4A2HA 2YAPA 1NIAA 1GS7A 3ZBMA 4QLWA 3S8GB 3NJNA 3CDZB 4DP2X 5B1BB 2H47C 5F7BA 4DP5X 1JVOA 2BW5A 6PCYA 3NJMA 2EINB 1ILSA 1WA0X 2HXAA 1RCYA 4RH4A 4NB7A 3H4FA 1L9OA 3OMIB 2OV0A 2VM4A 3NJHA 4NAJA 4GP8B 3FYIB 4KNUA 5I6LA 3EH3B 3IBOA 5I28A 4M4RB 3TU6A 4FAAB 3QQXA 1GW0A 1XB3A 2CAKA 1KBVA 2MRYA 3EH4B 3QPKA 3IN2A 2WSDA 5B1AB 5B1KA 1CURA 1BQRA 2FTAA 4GXFA 3ASOB 3QJRB 5ANHA 4G70B 1BYOA 2GHZA 4YVUA 1N70A 2TSAA 2EIJB 4HHWA 2XLLA 1BQ5A 2YXVA 4E9QA 1SFHA 1QLEB 2BP0A 3T6ZA 1YLBB 4KO9A 2IAAC 1TEFA 3SBPA 4AKPA 4DP4X 4GP4B 3WNJA 4DP6X 3JT2A 3GDCA 3DTUB 1AZUA 4YSQA 2FT6A 1IBZA 3FSVA 1OOWA 3FSAA 4DPBX 1VLXA 3FPYA 1W8EA 2R7EB 1E5ZA 2B08A 1L9QA 3AZUA 1NPNA 4N4YB 3NP3A 2FWLB 5EHFA 1AZBA 3WG7B 2HX8A 1NICA 3AY2A 1OCCB 4E9VA 1MDAA 2YEVB 1NPJA 1SHXA 1FA4A 2IWEA 1BAWA 4YSRA 2H3XC 1JERA 1PCSA 4KO7A 4YVNA 2QT6A 1IKOP 2P80D 1ZDSA 1XB6A 2AZUA 3FQYA 2DWTA 1IUZA 3ABKB 2GC7C 3TA4D 1JXFA 1J9QA 2Y1AA 2BHFA 3TASA 2DYRB 2XV2A 4P5RA 2UXTA 1WA2X 3D12B 1GSKA 1A65A 4GY4A 4KOBA 1CC3A 1URIA 3EF4A 4DP1X 4BDVB 3S3CB 2XWZA 2VW7A 1HAWA 3CVCA 2GIMA 3NJGA 3HB3B 2NRDA 3NJFA 4PCYA 2XVBA 2VN3A 4HAKA 5I6OA 4QKTA 2YARA 7PCYA 4ENZA 1J9RA 1A4CA 1V55B 2FQDA 3IEAA 5D4HA 2GB2A 5B1JC 3PAVA 1CYWA 1TKWA 2VM3A 1ZIAA 1QNIA 3X1FA 3N2JA 2IH8A 2YQBA 2JFCA 4KOCA 1ASQA 1DZ0A 4M3HA 1AZNA 1J9SA 2IWFA 2DWSA 3FU7B 3S8FB 4FA7B 1OE3A 2AVFA 3ABLB 2JXMA 3NSFA 1WAEA 3FQ2A 3ASNB 1KCWA 1N68A 2QDWA 1NIDA 4AI7A 2AFNA 3GYRA 1BQKA 1L9PA 1NIBA 4HCFA 1ADWA 2XV0A 1CUOA 3IE9A 4G72B 1AACA 5B1JA 3ZDWA 3FSZA 3QJSB 2PPFA 1HFUA 2DY2A 1NZRA 2EILB 4KNSA 2XU9A 1KGYE 2DYSB 5FC9A 3OM3B 1SDDB 1JZIA 3KW7A 3ABMB 1E30A 3FU8A 5A7EA 1NIEA 3OMAB 2XYBA 3FPXA 2J57A 2PPDA 3CDZA 1E5YA 4G7SB 3UGEA 2PLTA 5AZUA 3QJUB 3SBQA 3SBRA 1T5KA 2UXFA 4YSTA 3NJIA 2ZWNA 2FNWA 2XXGA 1RZPA 3AG4B 1SF3A 3X1EA 2IDUA 3X1GA 2VW4A 2XX1A 2ZXWB 1QHQA 1BEXA 3WIAA 1NWOA 3HEIB 1AAJA 1JZEA 1NDTA 4E9WA 2W88A 2Y69B 2HX9A 3TBCA 3CVBA 1ASOA 1SFDA 4YSCA 2HRHA 2CJ3A 3G5WA 2IDQA 2HZHA 1RKRA 3WNIA 3OD3A 5D4IA 1KV7A 2YAOA 4W9ZA 4A2FA 2UXGA 3L45A 2FQGA 1MG2C 4GP5B 1FFTB 4HCIA 3NYKA 3FS9A 4DP9X 3ERXA 2J55A 1JOIA 4UF7C 1GY2A 4BWTA 1MZYA 4G7RB 1F56A 1TU2A 4F7KA 1A3ZA 2ZOOA 3PXLA 2Q9OA 3NJKA 4GYBA 1JXGA 4DP0X 1AZCA 3FSWA 1PAZA 2R7EA 3T6VA 2CUAA 2IDTA 3OMNB 2N0MA 5I26A 1L9RA 3S3DB 2WO3B 1SF5A 2YAFA 2P80A 1RZQA 3CZUB 1OV8A 2XV3A 3FU9A 2CBPA 3DIVA 3MBWB 1AS6A 1KBWA 2BWDA 1L9TA 1PNCA 4DPAX 2VMJA 4KO5A 1AOZA 2XX0A 2FQFA 4Q8BA 1KYAA 3QJQB 4L0PB 1TEGA 2QPDB 1OCOB 1WS8A 2H5UA 2BZ7A 2TSBA 2IH9A 5I5MA 3NSCA 4HCGA
chains in the Genus database with same CATH superfamily
3LKSB 3BGFB 4YSSA 2WGXA 2AABL 1MW0A 4KZEH 3RW0A 2FX9L 3EOTH 3ARFA 1J5IA 4N9GB 5KUMA 1UASA 2QPFA 3LVTA 2EVHA 3IVKA 4HK0A 5DT1H 3VI3E 4YE4H 5A6LA 2NDGA 5TF0A 4X4YB 2QTVA 3CZJA 5E7BA 3SGEH 4DVRL 1ZE3C 5JUEL 4CW1A 3EO1B 2YI9A 3ZRVA 4M7KH 5DD0H 5LCVL 4DRXB 5HHME 3O9WA 5C70A 2HSIA 2X0VA 3PQYD 1BLNB 3BUTA 1YG9A 4LLDB 3AK1A 3HC3H 1R3JB 5E2WH 3V6BR 1HNFA 1AO7E 4DOHE 3DECA 1GY1A 3KH4A 4NR1A 4AENB 2H8PA 3ZRFC 4DEWA 3CPUA 3D3VD 1FE8L 4MKMA 3S36X 1MCFA 3K58A 4Z7VB 2W60B 5F9JA 3EGDA 3VXUA 1GRJA 2DKMA 3UXFA 3SR2C 5GTHZ 4JJ5A 2VRKA 5CWSA 3OXSA 4MDJA 1AMXA 2RGSA 2P8PA 3INUH 1PEWA 4FN0A 4XODA 1Q6IA 1NI8A 4NN5B 3WUWG 4PWJA 4NN6B 3IMVA 5B3JF 3HG1B 3D2TA 3AUWB 3EOTL 5ID0B 2H1PH 3SDAA 3LPGA 3U9PH 4OZIB 3P54A 5DD3L 3AVEA 5E70A 1Z9PA 1WB7A 1E90A 3OKMB 4ZSOA 5ADOL 3S36L 3W3BA 4WWOA 3D85D 4MNQA 1OEZW 1FORH 2MQGA 4QY8A 2JCCE 3O3UN 5EZLB 1MHPH 3LOWA 2VQ1A 3FO2B 3HTLX 4BHUI 1A02N 1AS7A 1HI6B 4PN6A 4GX1A 3STLA 4UMGA 3T2QA 1O5DT 5IHUL 4KKPA 2QDVA 3GLDA 2F54A 3C08L 3JWNH 2DIBA 1CFVH 1D3CA 3U48A 3KW8A 1DSWA 1E5UI 5ECJE 5D9SB 3FU3A 4RGMC 5BXZA 2DDQL 3ZE2E 4Z7OF 3WMQA 1BZ9A 4FLYA 3E6FB 3T9WA 4B5EA 2F4VB 1MCLA 3MFGB 3RFRA 5EF2A 4GSDH 2ZUYA 1JF6A 4QYAA 5L9DL 3UGUA 1MI5E 1UXSB 4AIEA 1OGAB 2JKTM 3TJEL 3K71B 4ZFOL 5HI5C 4JFFD 3H1ZA 3CQPA 4IGBD 3SY0A 1ZA3A 2WTRA 1BW8A 3OWRA 3VFSA 1VP7A 2BX5A 4R84A 3G9VA 5T5FL 3L72H 1NFKA 5DK0B 1RJYB 4MJ2A 3HKBA 1RIVH 3TEYA 1WZMA 3CN1A 5HVFB 2ARJB 1CE1L 4IJTA 3U82B 3D0VB 4LDCA 3P0YH 3MGAA 4OIIH 1NSNH 5HHOA 2GJ6B 4ZFFB 1WT5C 1IE4A 4WHYG 4DP8X 5T1DH 2WBWB 1JJOA 1ZIBA 3CIQA 2W0KA 3BVTA 2ZSWB 3QDGB 1SZXA 4AV5A 5I1HL 3A23A 4KH2A 4M93C 2Z0AA 4I2XA 2P67A 1JTPA 1K33A 5IJ0B 3E89A 4WBNA 1P9MA 1TVHA 3FB8B 2HFGH 4HAFA 3GSWB 3SZ6A 4FTVD 3NDZE 3JTSA 1Y66A 4JASA 3DGCR 4E41B 3L16A 4BWUA 1P7KB 1UFUA 1GL4B 3UZEA 3C6EA 4GPVA 3A0HZ 2UU9O 1EXUB 4LNUA 4A7QA 4EI5C 1OK0A 2WINB 3DJ9A 1VQNV 2OQJA 3LKRB 4N8CH 4D7PA 3KCXA 1FNGA 1GZQA 4JO4L 4QOKA 5HVGB 5CLWA 4UM9D 3NAAL 4HLEA 1WRFA 5MP6L 3QUYD 4U6XB 4R6UA 1ZHNA 1RD6A 1LE9B 1IEAB 3HR5A 2J1XA 1RLWA 4ZO8A 3FU5A 2DN7A 1R3IC 1TQBC 3MRHB 4N2EA 4OF0A 5ICYB 2O61A 5DJZB 2EIBA 1B4JL 2ZPKL 2B1AL 4GO8A 2EE2A 2NSQA 1Q0YH 1G5GA 1F42A 1YZZA 3UC0H 4P2YA 3W38A 2P5EE 1BEYL 3GIVA 4AUJA 3RU8H 4ZX5A 1BFSA 4Z77A 2HP8A 1DFBL 2R56L 2HH0L 2PPEA 3T4YB 4JFQB 1OWRM 2OMTB 3C5JB 1UJ3C 4Y4KD 5AAPA 4DRXA 1WLHA 5HP5A 4X0KA 4KK8D 3APQA 5I19L 2IQ9H 5LOVA 5ILTH 4JI0O 3KXFA 4ZNEA 1IAMA 1T6BX 2JKWA 2HPOA 3C6LA 1QR9A 2A3TA 4QGYA 1Y6MR 3Q8FA 5IP4A 1GGCH 2BVQA 1JD7A 4JCLA 4ERSL 3GZQA 1B0IA 5DR5L 1U8PB 2CO7A 4C56B 4YDLB 1Q1JL 3NEOA 4ISVA 1ZVHA 5CP3A 4DOHB 4E9SA 5EK0A 2GITB 3IJ7A 4OV5A 3BZDA 2VW6A 4Q4EA 2Q8VA 2E6QA 4GW1B 1WIUA 3IFOB 5IQ9A 3RDTA 1AHMA 2ZX9A 4H2CA 4K7PY 2KG7B 2R0ZL 3C8KB 4R4ND 5CILL 1C08B 2ICEA 3HUJE 3EGXA 2AV7A 5JHMA 2DD8H 5IB4A 5KJ7E 2OXGB 4JM0A 5TE4L 4PGEB 4UOW1 1VESA 3V6FB 1O7DC 4IBYA 1DSFL 4G3YL 2XG5A 4X20B 4NUPA 4JHZA 4L3EE 3DRQA 3K4AA 1YNTB 5C09D 5CBEA 3VXUD 6PCYA 2F4VO 3DGGB 3SPJA 3ZZLA 4L1BA 4QXGH 5AW1B 3IDIA 3BP5B 3FQTA 2ETNA 3HG3A 1T7ZA 3S3XA 2HB0A 1WBXB 3WS6C 2VMFA 1K73W 1GC1H 1K8IB 5DHMC 1J5OH 1AFVL 2BSRA 3FQNB 1T5XB 2DM7A 5F21B 3T77A 4DR6O 3VO0A 4H0GA 4KZCA 4P59H 5SWSB 4AQYO 4I9WD 4K8ZA 3F7KA 3K08A 2FLBT 4A7SA 1FPTH 4FNRA 4H7VA 3H2PA 1KCVL 4JHBA 3QNEA 4L8BA 3ASOB 2X4UB 5D1ZC 3LEVL 5F1NB 5SX4I 4B9CA 2XQYK 3ES6B 5IJCC 4DR1O 2FUQA 2OTUA 3KPLA 3MSPA 4GMTL 4YJZL 3IWUA 4JREC 5B38G 4HHWA 5B4MD 3CD6V 3AMLA 1X5JA 2IH1A 4I77H 3QXWA 4ORZC 4D9LH 1I3RA 1SFHA 1ZA3B 1AO7D 1G9NH 2OA9A 3AC0A 3BKJH 3EDKA 1YLBB 3F5WB 3MLTA 1FL5B 1O75A 3KLLA 4NWTL 3WMSA 2HJFA 4YN3A 4ODWA 3VQVA 5FUOL 3RL2B 1JBJA 3MRPB 5B1BC 3D3VE 4IIQB 4JFFB 3ZT7A 1XOUA 1I8KB 4WFGA 4P3DA 3HKEB 2H2SD 3K2UL 4FHBD 3BJ91 4YDVB 3VFNA 3BD4A 3FSVA 3LDBC 5JIHA 1VLXA 3ZHLA 2ZR3A 1F6AA 1T6WA 1U8HA 1SYVA 2WWMD 1NFIA 4P07A 4Y1AD 5KS9B 1VF6C 5K69A 1NPNA 3DC0A 3DXAE 1NMAH 4XPFL 2WWOA 5AVTB 3S8WA 5DEFA 1PL0A 5FO9A 3WG7B 3AWEA 1R34A 2Z4QB 4HYTB 4I3RH 1SQGA 5F7DB 4DR1B 4F9PC 3ZL4L 1AKJD 5BXFA 5ISZD 1DBKH 2AQRA 2H3XC 5GS1B 3SYPA 2VQFO 2XRAL 2RTTA 2XBZA 3KWVA 4KHXH 2IXQA 1XBDA 2BNUA 1EZVX 1AGFB 1ORQA 5C0DA 5FUCE 4LNUB 4HW6A 2DLTA 1FLRH 2WINA 2YPLE 1MNNA 3OKEA 3O2VH 3RTQB 1Y67A 4OCYL 3WNPA 5BW7A 3E83A 4WHTA 1NTMH 3TYFA 5E8DH 3UAFA 2DQFA 4DCQA 4DJMA 1IRAY 5DFVD 1MQKL 3HJ0A 1I8MA 4P2QB 1CLYL 4IKJA 1Z9LA 2AXJA 5GISH 4KJYA 1WD8A 2HFFB 3RVWD 3H9SD 2GIMA 3RI5F 4ANKA 5DS2A 1AHWA 3GPSA 1L7IH 2OMUB 5BMVA 2Y36L 4X2UA 1IQWL 3BPNC 3IRCA 4I2XB 3GSOA 2IFFH 3B1UA 2WBJC 3UQ8A 4MCYA 4ZXBA 2AK4A 3QJXA 3VRJA 1M6OA 4J4PD 3J07A 4PJIA 5M94B 3RWIA 1WAAE 2ZF9A 3BAJA 3UTQA 4LCIL 4E2LA 1I8AA 3KXFB 2BS71 2OJEB 2QM8A 3VXNA 1S3RA 3IMRA 3OB0K 3KNBA 2VZ1A 2JIXB 1NR7A 2WBJD 3QDJB 3HE6A 4C57C 2YKLL 1EAOA 2VLRB 1KYOJ 1UM5L 3B8SA 5JDJA 2BVOB 4PWKA 4XP6L 4BBWA 3KPTA 4OF6A 3QQ9C 3T09A 2JXMA 1QRND 5F6IB 2Q0ZX 3VW3L 1CVRA 3HAEA 4GSQA 4XP9H 4AMXA 4FZ8L 1GIGH 1BM7A 2DJSA 3MRMB 3VI4B 4JI2O 3TPKA 4KGLA 2FJFB 1AD0A 1INDL 1KACB 4FJYA 4CVXA 3HR6A 1WQVT 2CLVA 3MUHL 3FONA 3QJSB 4H26B 4QR7A 5B39G 4OFQA 3RG1C 2EIMC 2Y7MA 5F7MC 2DYSB 1S7XA 4WV1A 3OJMB 5CJBA 3MRKA 5F6HI 4JFQA 1DL7L 4PW9A 2DM3A 4PV9A 2VLJE 4I55B 3OMAB 4UT9H 1HOCA 2JTYA 1J1XH 2QFRA 3MO1B 3QJUB 2DTMH 2E4TA 1VDGA 2D7MA 1RPKA 1RQ5A 1HDMA 3PWUB 2ENYA 1Q38A 1G7MB 1Y1DA 2GJ6E 5FYLE 4F8QA 1IAIL 1CLOH 3O0LA 4NZRL 3S97C 2WXNA 2F68X 1UM4H 3GGWA 2ZX5A 4KKLC 3T77B 3TO4B 2G0LA 4AK1A 4FNTA 1AJ7H 1XF3B 1E4HA 1GYVA 3PWLA 4GW1A 1RZ7L 4NGHH 4NQDB 3H1JH 3CCVV 3GXIA 2YRPA 5LNEA 5L2KE 3G5WA 4QXTA 1OK8A 2QPUA 3W57A 4BELD 4OAWA 5D4IA 4I1NB 4O4YL 2FYUH 4BHUA 4GAAA 5JLZA 3EGXB 3GVMA 4ZAKB 2FQGA 2WVUA 4I77L 4JFXB 3RWEA 4X62B 2IW5A 1A7OL 3V6FA 1KNOA 3VD0A 2NSXA 4DP9X 3JALB 1T21B 5FK9A 3J7HA 5CBHA 3CFNA 1NCGA 5BUPA 5EBGA 2P49B 2JKLA 1D6VL 4LF3A 4ZAKC 5CFHA 3W7XA 3QR2A 5T3XE 5H94A 3IETB 4XC3H 4DQOL 5JW3L 2FEEL 3VDCA 2A1WL 1IURA 1U93B 1Z5LB 4NNXA 4WI6A 3NJKA 5TF1L 3V0VB 2ZAHA 3ZKND 4W9DC 3FQ4A 4QNPE 3CXHK 2CUIA 3N44F 4LCUB 1F2XK 5IOPB 4J3OG 5DQJB 3DO4A 4CVWA 4QNHB 1QX1A 2H0JA 2YQ3A 1QBAA 1R6VA 1T5XA 2YAFA 3N6YA 4K7FB 2CGNA 4WUUD 4CMMB 4Y9EA 1A2YA 1MLCA 1NCBL 4B7IA 2ADFL 3VWKD 1ZVNA 3E22A 2A9AA 1QFUH 1CLZL 3DIVA 4ABUA 3SE3C 3MBWB 5ECGA 2XAQA 3ML9A 3W9DA 3IE4A 4PJFA 5AQ0A 2Z91B 3MQIA 4UCFA 1U8OB 5IQ7H 4B9KC 5D71H 3TJTA 4NCC2 1ZE3H 3BWAB 3GMQA 3V4LA 2F08A 4DF9A 4UCVA 2NXZD 3S88L 3OQ3B 1HIMH 3M46A 4N90E 1NS1A 2QQKL 3ZS8C 2X6BA 4U6TA 1BVOA 1FO0B 1UQSB 5D70L 3NJVA 3A4EA 4YHYB 3KJ6L 1NH2B 5DJAA 3B56A 5IVXA 3PPEA 1GR7A 5CEZL 1LO3L 2XN9D 5GJTL 4B7EA 2E75C 3MA9L 1HILA 3TONA 4EUPG 3TNMA 2J43A 3V5HB 1BWWA 5T33L 1OSEA 1HNXB 1KYUA 3P3NA 3H7BA 3NCWA 1GZHA 2Z35B 4L1LA 2Y36H 4BFOA 5F6IC 3SKOB 2MTPA 2PMZA 4W70A 1WA8B 1T2JA 5C6WH 3U2SB 4BFRA 1A7PH 1OY3B 1Q72H 3WTYA 1XMEB 2CBMA 2DZEA 3WLBA 4B9ZA 5D7LA 3CRCA 2KBGA 3CVDA 2A2QT 4Y4HB 2MPVA 3PIQB 3ZL1A 2WXPA 5C0BB 2PW1A 1S7RB 1UXWA 4YMPA 3WI9A 4P9ML 2CG9X 2VSMB 4NIKB 1IM3B 1JMZA 1QRNA 2OIEA 3C5ZD 3BXNA 4FYTA 4NXMB 4KH9A 4F20A 3ULUH 2WLIB 5CNHA 2I9TB 2Y2YA 5PCYA 4DV0O 2XC8A 1I7RB 3SGDH 3DHUA 2QM7A 3QE5A 3QW9A 1AQ8A 4XCYA 4CH5A 5FM5O 5KYUB 3SJAC 1NBZB 3LPOA 5DUBB 3FB7B 3GJEA 4QKXB 2FJSA 3RHWK 3ECBA 4BW5A 1AZRA 1TEYA 2HHHB 3PL6D 3LZRA 4FXGB 2GUZB 1AY1L 4Y1AA 4E36A 3BE1H 4R50A 3JWNC 5F7FA 3WCYA 2WQSA 4NM8L 3CX2A 4O2FA 4MXWH 5HHVH 4Z0XA 5DECA 2G2RB 1DBBL 3DX7B 1GM8A 4GI9A 4HALA 4MSWA 3FCGA 3GM0A 2ZDIC 3QH3B 4BFIA 1HEHC 4HFUH 4XBMA 1HNZO 3LN9A 5DI8B 5F89B 3AGVA 4DKTA 5DD5L 5JO5B 4J23A 5I1IL 1JPTH 1UB6A 4B96A 2FO1A 1HDMB 4OJDH 4JI7O 3TA3C 4BZ2A 1PLAA 4JAMB 3HKZA 4EBQH 2D4DA 4GH7B 5L7XL 2DJMA 4LSQL 4PPTA 3GRWH 4X7DC 4NYLB 3SCMD 1KENH 4M3JA 4OJAA 1KJ3L 5B39B 2IH1C 3HNTH 3DX2A 4WUKH 5F44A 1HNGA 2MWCA 5C0CE 2VC2L 2CALA 2Q1EA 4LBEC 1FN4A 2Q7HA 1HXMA 4XP4L 2RN9A 4RFOH 2BOLA 3QDHA 4EI5A 4A7TA 2GBUA 4F7TA 4JRLA 1SHSA 5I1CL 1XEDA 1F0LA 4JQXC 4JRXB 1IKNC 3BVOA 2LP7A 1EHKB 1UKQA 4DK6A 4N8UA 5D7JA 4TLTA 4XDLA 3KM1A 3LKOB 3QXVA 5C3TA 5DFWH 4CSZA 2OR8A 3AQZA 3RWHA 3BUBA 3OQRA 1YEEH 2DWDA 1AXTH 1F1DA 3O2WL 5D1XC 3VSTA 2V2XB 2DKUA 1QLNA 4WWNA 2UXCO 5IYDO 3MO1A 4X6DF 1X7QA 1WAZA 1EHAA 4U6YB 4K73A 3JUYA 3MAWA 1QR1B 1NCWL 1MCPH 1EVUA 1NTKH 5D1ZB 3I6LD 3L2MA 4PVLA 3IC7A 4LCUA 1ZLSH 3KDMA 5AZEH 3VXQA 4WU7A 1OZUA 32C2A 4WENB 3LAFA 5LCVA 3L7EB 3AG1C 4WF7A 3VFUB 4UVAA 5CCJA 2ZXCA 3QWRD 3LNEA 2O6DA 3E22B 4B27A 1U8LB 5E5UB 4F93B 3PHOA 2XBTA 4YY3B 4N2NA 5EBMB 1J8RA 4LIQH 5A7BA 1ACYL 3NAAH 4FXLA 4EDWH 1LO4H 3CVHA 4PHZA 4R83A 2VDNB 4J12A 3WHE1 3OUSA 2XWRA 2X87A 1B2YA 2YR3A 3MNZB 4MJID 3L9RB 3CCUV 5IWAB 5LXGL 2DV6A 1JPEA 5EU3A 2NZIA 4LCWA 1JZDC 2HWZL 4MTFA 4OLEA 1B6QA 1GN2A 1BQZA 4PJAE 2I7OA 5DHEA 1PZ2A 5DD6A 4HIJA 5D70H 3Q05A 4JG5A 5IVXB 2VDOH 3GBNL 2Z9TA 4MD0B 1GW6A 1MFBL 2FR4B 5L7XH 2EIDA 5I9QB 3UAAA 2J6EH 1EMTL 2XVGA 7TAAA 1ZLVK 1IFHL 2LW1A 2J88L 1LO4L 5CP3H 1E67A 3SDXF 3ZU8A 4HG4J 3U30C 2VKXA 4KQ3L 3AFLA 4DNLA 4HLZG 1E8WA 5E1AC 2G38A 2F8IA 3S96B 2OCCC 3GD1C 4ODSH 2ODMA 3FT0A 1VIWA 2H26B 3GKWH 3L4UA 4NQEA 2LT9A 2O6FA 3RWGA 2X10A 3S3BB 1CL7L 5E94B 2I9LB 3ZYZA 4BFJA 2GSIA 3BIKB 3SKJL 1YHPA 3G6DH 4HMDA 2WTPA 3AREB 3L5IA 2GABA 4L3FA 3FFCD 4QHKJ 1MVYA 5FW7A 5JZ7D 2B1AH 3E3QE 4PV8A 1QP1A 4ADGA 3B40A 3FB7A 2CCWA 2HRGA 2O6EA 2YPVA 3GJEB 1MOFA 2E74C 3KPMB 3ARZA 2H9GA 4L4TB 4ZDHB 5HI4D 4HJTA 5J9PB 2EIZB 4Z3FA 4HS3B 5CN0A 1K8DA 3BE1L 3LV3B 4GI6A 5JXEA 4A2HA 3V5HA 1MCSA 2Z3FA 3RIKA 1T83A 2QQNH 4U4IA 1YYLH 4XPBL 3OXRA 4UM8A 5FUZH 4GRMA 4I5SA 4JM2F 2R8SL 4BUQA 3NJMA 2R2EB 5JIMA 1Q7YW 3OR7A 3DC5A 1QQCA 1ZAUA 2H8PB 3P0YL 4BWAA 4DN4L 4ELMB 1HL5A 4U3XA 2FO4B 3A3YB 1UENA 4RMRA 3X3FL 3IJYB 3EXLA 4X8GA 2J1YA 4HJEA 1AJPA 1AVAA 5FGSA 4NUGH 1S9VA 5KHKA 1Q1JH 1REIA 4KNUA 2CHZA 5FM8A 1XV8A 2XZQH 4I18A 2C3GA 3VFGH 1D7DA 3T3MB 4YZFE 3TU6A 2WLIA 3D3VA 4HC1L 1HHJB 1F1AA 3QUYA 2H6PB 2MRYA 4UQBA 4Q9QH 3EZJB 2WSDA 5B1AB 4JI1B 5E8PA 2FTAA 3B37A 1DVQA 4ZHQB 2YK1H 5FO7B 1RZJC 4X5QA 3O8XD 3V95A 4PRPE 4ODHH 2ZNIA 3O4OB 1QWHA 4TF4A 2QWPB 3VH8G 1T5WA 3PGCA 5EBLB 5E5MA 1BGXH 5ALBH 1IIIA 2A6JB 3QA3B 4O58L 1M3IA 2F66C 2Q9LA 1BMFG 2QGEA 4KAQH 3TFKD 5EA0L 4ZOLB 2OSLB 3DOSB 1F6LL 4HDIA 5IF0A 3DXRB 2IGTA 3QWRA 4ZW3A 5ADPH 2D73A 4EKJA 2I25N 1QAWA 2J6EA 3MTXA 4W9HC 3VFGL 2X4TB 1J5HA 3WSQH 2NX5B 2IAMA 1OOWA 4QRPA 2V9TA 1NGZB 4IRJC 4PJ8A 2WZ6A 1JFQL 4RWUA 2XZZA 4GB9A 4ZS6D 4QTHA 1JPST 3L8QA 4JI1O 2Y7QA 3K4DA 3QHFL 1MZEA 3CPWU 1P4IL 1XSOA 4BK8A 3ZE0E 1MCCA 1S5IH 3MRRA 3Q9QA 4GT0A 1NPJA 4TUUA 4GFTB 4KQ4H 1DN0A 1ZTXE 4GKZA 4IGBA 1N4XH 4AY0A 1KJVB 5HHMD 4PBWD 2VN6A 1CDHA 4YO0A 1WITA 4MS2A 2X7RB 5C8YA 2P80D 1UXSA 1M1KW 4OW6A 1RU9H 4GG8B 1QHTA 2ZCEA 4P8QA 5FB8A 4S0TD 5KVGE 1T2QH 3ZLQC 2NUTB 2BFVH 1PKQA 2VJ8A 5INDB 1HKLL 1HC1A 3BISA 2BHFA 4IBLT 4PS7A 2X41A 1U58A 2JKIS 1F97A 3PJNA 4L8DA 4RDBA 2ZIMA 2D31B 3LQAL 4NCDA 1CC3A 3BRDA 3FFCB 4XCNA 5E8OB 2NT0A 2JJVA 4R7CA 3BFQG 3GWJA 2APVA 1CLYH 2ZUQC 3BKYL 5IW6B 1NKOA 1M2OA 2NY6B 4PGCB 4X4YA 1IGFL 3IFNL 3HB3B 5J6HB 1KIRB 3ARDA 2VUOA 1S0VA 3WXVL 3T0EC 4UQ3A 3W2DL 1VCBC 3A6BH 4XMKH 3VCLA 5DRNB 2UXBO 2ZCHL 3E8GA 3DK2A 3BPCA 3PV6A 3QUKA 1YN6B 3DBSA 3D9AL 3L4ZA 1TCMA 5D1XB 4CU6A 1IFHH 5CCKL 2OMZA 1TFPA 3VGAC 4N90D 2YWZA 1EAPB 2DL9A 2N05A 1P49A 4WJKB 3BDYL 1TQCC 1KEGH 2NR5A 3CB2A 2J12B 2H7WA 4L3ED 3O9WC 3RRQA 2ITCB 2XWJA 1A4KA 3U36B 3DUSB 3JD4A 3ZOAA 1UH2A 4KTEH 2I9LA 4JJ5B 3MLPA 4XMZA 4HJ0D 1G87A 4PWHA 4OM1H 1FFOA 1X7SA 2VT0A 4JY6B 1UYWL 1G9NC 2AABH 3MRHA 2O61B 1S7VB 3MV7D 1JN6B 3FC8A 4ZMQA 4KVNL 1AGCB 3BUPA 3LSSA 5BS0B 2YDEA 4J9YB 3JSLA 1Q6UA 2D7NA 3GI8L 5EWIL 5EG6C 3C9NA 5D7SL 2OL3H 5J9PA 2EILB 4KNSA 4PI2A 3BGFC 4PJIF 1KGYE 1OGSA 3PWPD 4X1KB 4JM2C 1YJWV 3R06B 4GKOA 1XNQB 2O72A 1NT2B 5K9OB 2GKIA 4JFDB 1NGYA 3QEGL 2J57A 3RZCB 5D7IA 3SBRA 2VR7A 3BDBA 1MIEH 1JPXA 5J89A 4XOCA 1DK1A 4O2CB 1H2LA 2IDUA 4GO9A 4FM0A 2AXHA 3TEWA 4FMTA 4PRNA 2ORBH 3TJHC 3SPHA 3KYOB 4NUGL 4QGTA 1HXYB 4O02L 3T2NH 4ZJ9A 2Q76A 4NNPL 3TVMC 3BP6B 4MX7B 3P4NA 3SJQC 1AAJA 3LKQB 4JKPL 1P4BH 1CT8A 1OGAA 1PD3A 3RNQA 3UPRB 3CX5J 1SOXA 3IFLL 2EZPA 1CE6A 4CS3A 4W9ZA 2KG7A 3K3WA 3C8KA 5LCVH 3C8DA 4URTB 3DVIA 2YMOA 2Z31D 5A2BA 3QPQD 1JPSH 1RJYA 4K9EC 1W72H 3VTMA 2YEQA 5GRVK 5JPNA 2XT1B 3E9UA 1RSYA 2HT2C 4OCYH 3TZVD 4YDMA 5KWYC 3D18B 5CA3A 3E1ZA 5BOZG 4BKSC 3LZLA 2A6IA 4PJ5A 3ZTNH 4M1CC 1XO8A 4IMKA 1A7QH 4ZFFA 4MJHA 3M8OL 3B34A 3QDAA 3TN0C 6FABL 1QLEL 3QIWA 3F04A 4YQXH 5J3HD 1A3ZA 4N2IA 1BCCH 2ZIDA 1FH2A 4ELMA 4IKIA 3G5VA 3TH4T 1OD9A 3A67L 3ZJAA 4EQ2A 2HLAA 5E0QA 1R24B 2AEIT 3CFDA 2Z1KA 4OIBA 1BVKB 3ESNA 3PJLA 3O6KH 1RZIB 2H6PA 3APCA 2E7HA 1A7RL 4FQQA 1KJVA 2KC0A 5ACZA 4UCSA 1KBWA 1C5DA 2O5YL 1L9TA 2W1NA 5DRXB 5CS7A 2R29H 1OQXA 1YUHB 4MBOA 5FHBL 1QLEH 1UWFA 5CZVL 4HCRL 5AG9A 1AOZA 2E7MA 3IJSA 4HD5A 4Q8BA 2FBJH 1IAII 1E4KC 1AGEA 3OTOB 2APXA 2M83A 2VXSH 4L0PB 5D5PA 4NO3A 4ZOLA 1FL5A 2OSLA 2WYIA 4E2OA 4POUB 4P2ZA 5FYJL 4ETQB 2BJMH 1CBVL 1BYNA 1U3NA 2FLMA 5EZOL 3MACL 4P3DB 3T3ME 1KIPA 3ROOB 1V7ML 2JCWA 2ZIOA 8PAZA 4JG1H 1GK9A 1Z5HA 3U1SH 4Q52A 2J8UE 3DVGB 1U96A 4FMKA 2GUYA 1SEBA 1FJ1A 2DWDC 1NLDL 5J1TC 5AVSB 4G9FD 5FYKL 5FGCE 4PJDF 2Y7QB 1UKSA 4MAYD 4NXNO 4J9ZB 1HSBB 3NZ8B 5CN2A 2VAJA 5A1AA 4ZBMA 3MLVH 1R3HB 1QBZA 2FNBA 1FNEB 4RWYH 4K35A 4F6RB 1M7IB 5GZND 1YN6A 3VFRB 4G8GA 3GS0A 4G8FB 2RACA 3VU1A 4J7ZA 3PHSA 4NZUL 3L5WA 3QEQB 4TTDD 4NXMO 1QUPA 2BNUB 4WKXA 3MACH 2M2DA 1US6A 3GSNA 4GG8A 4LSVL 1MFAL 1QI4A 2D3LA 2FH8A 3DHJA 5KVDH 1N6UA 5TK2A 1XREA 1PNMA 4HHAB 3ZUNC 2OJ1A 3V0AC 1G7HB 3QZBA 1FSKC 1ROPA 1W91A 4QRQA 1X5ZA 3DSNA 4Y4FD 3D06A 1JRHH 3HI1B 4NZRH 5FX3A 5GZNA 2EDWA 2WZ0A 3V5KA 1UYWH 4NKDB 2PCXA 4UBDC 4X4XA 1KJMB 3DOHA 1FVEA 1FVCB 1QI3A 2ZYSA 4HIIB 3RTLA 4GQPH 2AZAA 2EZ0D 2YAQA 2WLKA 3FO9B 4JM2B 2Z8RA 1CMOA 2G5RA 2ZTBA 3FXIC 3I75A 4AQEA 1R3KC 4J42A 2W65B 4FK5C 3R06A 5F2VO 3BPCB 1EWHA 3DGGA 4O4LA 5D1XA 1ET7A 1T7WA 2PYFB 2AGJL 5KHIA 4K9EL 2JJTA 1O9HA 3FK3A 3ZZSA 4FOMA 1L6PA 4HEMA 5DC2A 2ARHA 5F7LB 2EXYD 3OTFA 3M1BB 2P1YA 5IBLD 3MV7B 1OB1A 2B3RA 3OR6A 4R3SA 5DQ9A 1JPFA 4G1EA 4HJ1A 4EBQL 2C1PA 2BO0A 1HK6A 3D36C 1K7DA 1LO2L 1A47A 2IH3C 3F7LA 2Q8BH 4OLUL 3SOBL 4L8BB 4OGZA 2J7LA 1BVLB 1F90H 4P0DA 3CPLA 1TQCB 4JHVA 1HYSD 5GGSA 5LQBH 1QSEB 2DEXX 3IPFA 2A0LA 2VQFB 4IJ3C 3E2HB 2A99A 4JFYA 3FKSG 3Q5OA 2FECL 1DE4A 2ZD0A 1D5RA 4MXWL 5HHVL 1JSYA 1I1RA 1OCWL 4YWGL 2OSWA 1LP9F 4H1LH 4BFEA 3PDOB 2I24N 2LGQA 5IQLA 2EXWD 3WY2A 1R4XA 1D7FA 2BSDA 2XA8L 4A2GA 1KD1W 1A6WH 1MUJB 2G3MA 1B4JH 2GSMB 1QWNA 5EC1C 2H32H 1NC4B 3KBFA 4PGDB 4PY7A 1B0WA 5JW4M 2R1XA 3QUZC 1H5BC 1YYMH 2WBJA 4PJGA 3TZVB 1ICTA 1OALA 2PXYB 3X17A 4E5XA 2HMIC 3SO3B 2A9CA 3DXAD 3V0GA 3LQZB 1ASPA 4WFED 4ZXBB 1ET5A 5B1CA 3QAZC 4HX1A 5GS2H 1CF1A 5IHHA 1IEBB 4LVOB 3FO1B 3D39E 3ATFA 3RUGE 3OTOO 3U1PA 3X14B 5HHNB 5TFSH 3KKYA 1S7WA 1UWYA 2WOYA 3PWLB 4ABVA 5IG7A 1W6WA 5CD3A 1P2CB 4EOWL 1YEWA 3RIAF 3JV6B 4FERA 5DWUH 4HUUB 2GTZA 1U41A 3AG3B 2YRBA 3GMPA 4MVBD 3KLSA 1BZEA 2B77A 4FG6D 4M48H 5CBAB 5EBWB 4EEEA 4WZ9A 2JCCF 1R73A 2EULA 3L9BA 4LO9A 1K9TA 1HDJA 5EYPB 1NFDB 2X70B 3CS5A 3BYTA 3G04A 2F1MA 2YAEA 3O3DB 3VGHA 2Q0OC 3RVZA 1A4BA 3Q2LA 4GRWH 2KZKA 3BWUC 3RVTD 1CGSL 5LLIC 1CL7H 1KTDB 1E5BA 4QRAA 4AT6B 2V3DA 1INQB 3N40F 4YHOH 2KKWA 4N2DA 1HWHB 4JPWL 2OMVB 5JOFA 1V54B 1XIWC 2FRGP 2CE4A 3P9MA 1NMCC 4PRAA 4X98B 3RVYA 4MVRA 3VXMB 1X7TA 3K2MC 4FGMA 2R69H 3T4DA 4N2BA 3MJ6A 2EH8H 1DBJL 2R4RL 3MYJB 4UUJC 2K9UA 3BUYB 2EEAA 4F8PA 3FRPG 4MLSA 4MNQE 3NCBB 4DKAA 5E6ID 2YUZA 3UTPE 3FX7A 3MUZ1 1UZGA 2V3FA 5GGTA 3HE6B 5E08L 2D2CB 1G6VK 4DUYB 1RXLA 2ZT9C 4X0NA 1WPXA 4GUOA 1VF6A 2ITDC 1BHGA 1CXKA 4LU5H 4ANWA 4FTDA 4PJBA 1XGUA 4J1UA 4Z7QF 3DGDA 1DJGA 1R0AL 4WFGD 1A14H 3LX9A 3GGWB 1PP9H 3MGOA 4GRLA 5F7WC 4AILC 4XB8A 2ZX7A 4O2AB 3MLUL 4F7PB 1OL0A 1M3JA 4L3AA 3HRZA 4OGQC 1DBJH 3N1QC 4KNTA 5IBUG 2Q10A 3V5KB 4K3DH 1VFBB 1OLZA 3QCVH 5D2NE 4DH2A 4B9PA 2ZD9A 4HIIA 4PJXE 3RE0A 2XFGB 4RNRB 5C7ZA 1TLMA 2X4OA 5LBSL 3CDYA 3IFPB 1WV7T 2ATKC 1DSFH 2KDGA 2R4RH 4G3YH 4U6VL 4XN5A 2E74B 5E0FA 3ZIMA 5A2FA 3KXFD 3QR0A 2GY5A 2WQAA 4FLWA 5LBSA 5T1LD 4DP5X 5I1GH 4XNQB 3MLYL 1XF2A 4HEPG 3TEUA 5CLYA 4AQ1A 5AW6B 4RH4A 4Y4HA 1IVSA 1MLBA 3FZUC 2IC2A 1ZSHA 1L9OA 3LTVA 2VM4A 3R4DA 4MA1B 3WFBL 1CXEA 3LZNA 3NBNA 4GP8B 4UT7L 3OSVA 4K23L 4KTDH 2LLGA 1VQKV 4M43L 1QRNB 2LFRA 2IPTH 4CMMA 4MA3A 1LILA 3OGOE 2ZAIA 1UWEL 4HXBH 1V3MA 3RGVC 5IBLC 1KBVA 4K3AA 2EYTA 4ZOEA 4BZ1H 3LNIA 2NY4B 1ANUA 4UV4L 4MS6A 3NVQA 1WPBA 4PCTA 1IBGL 1Z3RA 4MYWB 4PRPB 1F4YH 4KMLB 2BIMA 2N0KA 4ABQA 3DJRA 3FO9A 4JM2A 2BS9A 3PGFL 1ZSPA 4AKPA 3V79C 5KJ4A 4HPYH 1NUFA 3F01A 4OGXH 3FTWA 3QBTB 4LF3B 4D0CA 1QQDB 2VXQH 2Z64C 3QJHA 4L3EA 5DJCA 4UBDD 4O4LB 4F27A 1YJ9V 2RDCA 5DJAB 3TCXA 3CSGA 3V0VA 4X66O 1EFXB 1GZHC 3QO1B 4TUJB 4Y8AA 3VFVA 3GIZL 4FLOA 1Q0YL 2IPUK 1SQVH 4I0PC 4QO1A 1OM3L 3M1BA 4DAGL 4GIOA 4K7FA 1I75A 4N5EC 4NPKA 4Y5XC 2NPLX 1BD2D 2A77H 4OGAD 1ES0B 4XOBA 3F7YA 5J11B 1XXDC 5D8JH 3GXPA 4X5XB 3W9DB 1PCSA 4KK5D 4KO7A 4DR5O 3EHBD 1KFAH 4KQ3H 2BCKA 3ZMNA 1HWWA 4PLKD 4ANXA 3KPNA 3JV6A 2E9BA 1U8OA 5HDQL 3H6AA 4JR9L 3TA4D 3GI9L 5LHGA 3U4EA 2HVJA 3HG0A 4MW3A 4MTXA 1G4YB 1YEJH 1OT1A 3JUZA 3WMPA 1NCIA 4M8QA 4ZUTB 4KNQA 2NY0B 2UYLB 2V33A 5ETUB 3PDOA 4N1HB 5KBMA 3RDJA 3ZRXA 2CBQA 1LEGB 4S1SL 4K5MA 5AG2A 1Z66A 4KXZH 4KY1H 4TNWK 4YBLB 2EDYA 3ARPA 3D0LB 5EOCJ 4ZI7B 1C7SA 2D2CC 1H2SB 3CXDL 3MZGB 3LH2L 4N8VG 5KVEE 3CVCA 3OZ9L 4PH8A 1HEZA 1OTUC 4N2OA 5IIEA 2RA1A 4I0XA 1XF1A 2X0LA 4KPHH 2O5XL 2Z35A 4WKZB 5IB5B 4HAKA 1EXGA 4NN7C 4L4VD 5I5RA 4IMKC 3K59A 5I1LB 3K0DA 1B0GB 2FHCA 4Z7WF 4YHLH 5INCA 4Z0BH 4BFIB 5AEAA 3CH8A 3F8UB 7PCYA 1C9SA 3HBZA 3L5HA 3C12A 1QPXA 2EE9A 2K6WA 4WO4B 3X14A 1FRGH 1OPGH 2Q3ZA 3BT2L 4OTXH 1CXZB 2BMKA 5CEYB 2ZWYA 1AR5A 5J57B 2YLKA 1ZVSA 5I1KL 4PMEA 1AQHA 1RHFA 4HJIA 3HR0A 2YBRB 1BWMA 4LNVA 3K72A 2X09A 1PBYA 2G9HB 3P2BA 4X4ME 4MMZA 3OLEA 1KC8W 1DZ0A 3KVPA 3RFZA 1U8CA 4AVJA 1GYWA 4XP6H 2DWSA 2IOOA 3S8FB 3Q1EA 2Y1VA 2YJQA 2QEXV 1A7QL 1J0JA 5EYPA 1U4EA 5TE6H 2QSVA 1IGCL 1RPQA 4Y9CA 4DO4A 4G8IB 5EOTA 2LGWA 2CO6A 2F7IA 1MCDA 3SDAB 3V0HA 4JO2L 1ADWA 5IHLB 3L3DA 1E2WA 3LD8B 5SWZB 3LY6A 1WYJA 1ZHKA 1DTUA 3CE1A 5LAXA 4OFVA 3FT2A 4HUXB 4LDEB 3QB7C 4WI8A 3WS3B 1H6FA 4GSUA 3AGWA 1IDSA 2VXTH 2WUCL 3OF6D 4PRPD 1SDDB 5DSCA 3QH3A 1XGQA 4KV5F 4QEGA 3N3EA 2YS4A 3ULUD 3ZR6A 4DR3B 3VI3A 1QFWM 4LCCC 3QUZB 4I0PB 1KT2A 3ARQA 3HNSH 4MMXC 4YSTA 3V4VA 1NCAH 4R2GD 2UXCB 5H35A 1NR1A 1YNTF 4MSWC 3CTTA 3NN8A 1SF3A 4LFHG 4V1DB 3DIFA 1LNUB 4UINL 1SERA 2RALA 32C2B 4XAWH 3ISRA 5IJVB 1M53A 4O2AA 2VXTL 2WUCH 3IPBA 2N4IA 1IC1A 1U8KB 1QEWA 4HBCH 4JG1L 1ASOA 3EO0B 2KQNA 4PV8B 1R3LB 1DVSA 1RKRA 1ZX3A 2ICCA 3CSPA 3QIBA 3OJDA 4XT1C 4P23A 5EWIH 2G4EA 3D50A 3U7AA 4ZYKA 3G6JE 3I6KB 4F9LC 5CJXA 1MG2C 4HCIA 4XPTL 2LFSA 3K6SB 5KSBA 1FO0H 3O45A 5D7IF 5GONB 4BR6A 3QIUC 3UTTE 5JXAH 3ZMEA 3TBSB 2UXBB 1MCOL 2R2BB 5SX5K 2ENJA 2R29L 3U9UB 4AJYV 3IU4H 1JPTL 3HNVH 2YXHA 4L48A 4JZGA 1BMGA 3B4SA 2EYRB 1QWUA 4PFEA 1OHQA 5AWNH 2LW7A 4C7UA 4MYPA 2R7EA 2F95B 1EHNA 1JWSA 4QHPA 1YJDC 1FYTA 3KYKL 1SF5A 2FGWL 2WVTA 1PZ5A 3PQYA 5C0AB 4LH7A 3D3VB 4JFFE 3RVVD 4PG9A 2QJDA 2CUMA 4JKPH 1LK3H 4WW2C 1AR1D 4LFAB 3POCA 3GMLB 2BSTB 3ARYA 2HT4C 3LZQA 4A55A 4W6WB 2OQJB 3LKRA 3KYMB 4NO0D 2IALA 4F33B 3MRJB 1PNCA 3MYZA 2JLLA 3Q6FA 3CLFL 3IJ9A 3SE4C 1IEAA 4D7SA 5DHVH 5LGHL 4Q9RH 2HLDG 1SDAB 5EZIL 1Z9SA 4WUUB 2XTSA 2VL5B 2H5UA 2BZ7A 3INUL 1VGKA 2NLJB 3NSCA 2Y1YA 1SF9A 4XBPA 2QQKH 4OUOA 3OGCC 3OC8A 4MA8H 4C54A 3RAJH 3OB0H 1A1OA 2OI9B 3E80A 3P30A 3P32A 3QI9B 4Z7VE 4TUYB 1PF3A 1FXKC 1J9CT 2OMYA 1T89A 2VDKH 3FCTA 5DYFA 3VE0B 4JNXA 2OK0H 5LGKA 3V4VL 1YPZE 2D8KA 4JFUA 2GW5A 3T3MF 3AM8C 2GBAA 1FDLH 5DO2D 2BIIA 2OX5B 2R0KH 4NQCA 4X0KB 5AG8A 4JFZH 4MS8D 1PZBA 2B9BA 3O6KL 4NC2B 4NXKA 1H2NA 1QFUL 3GXFA 1ZVYA 4JKNA 4K3JL 3OR7B 5D7HA 1GGUA 4NQEB 3BH8B 4LSTL 4TOYH 1X5XA 5DQDH 2YS8A 2BVQB 2E5LO 2DMBA 3ZDYF 3VOUA 2BLFA 4MTGA 2XPZA 2K7PA 5E94A 3B1TA 3NZHL 2CM5A 1CFVL 4R4NC 5F1KC 3A4AA 1EJ6A 1MHCB 2HVJB 1QACA 1LUVA 2IMNA 4M4RA 1Z0NA 5LBVA 4ZS7H 3FU7A 4OZFB 1DQJA 4K9EH 3UH8A 2DOCA 3W0WA 1BM3H 4OM1L 4WFFD 3JD3A 3ZQWA 5MEQA 1H3TA 5D2NC 3ZDXE 2OM5A 2HFTA 4MCNA 5E7FA 3KPMA 2X0UA 1HNWO 4DR3O 1FS0G 3C2AL 3X13B 3ZHFA 2EIZA 4UAHA 3PP3K 2WAQA 1IGJA 3BKMH 4L9DA 3IFLH 3QO5A 5EU6D 2E86A 4NPYB 4TV8A 1IX2A 1IO4C 4JY5H 4K71C 1MCJA 4BXSV 2IVFC 5FEBA 4MZIA 2CIIB 1I1YA 3K3QA 1CF8L 1NGWB 4GQZA 3MN8A 1F18A 1KGJA 3D52A 1S72V 1FYTE 1YCSA 4ZS7L 2YD6A 5ID1B 3D4GA 3IDIB 2GEEA 5B3NA 3FT3A 1A7BA 5E24E 4F57H 1WBXA 4RFNC 3VG0H 1XL6A 1P1VA 1NAKL 3FUKA 4I5BA 3U36A 3K1KC 1XHXA 3RVUC 1IL1A 1ZLEA 3T65B 3LKPB 4YK4C 3V52H 5C97A 2A9NL 2EBOA 2NW2A 3HE7A 1ZANH 3P2DA 1GRWA 4UIKH 4ZHQA 4UU9A 3DXAA 1GGIL 5A40E 5DUPL 4G8IA 3REVB 3WB0A 1UVQA 5JHLH 1L7TH 2OTPA 1GZPA 4IK6A 1Q9WA 1D5MB 5KYWA 1PG7X 1T66D 5AOZA 1N6QL 2XA3A 4BRJA 3T1HO 4HJJH 1DVXA 1PZ3A 1ADQA 1IT9H 2MOVA 2PTTB 3ECWA 2N7BA 35C8H 3C9NB 4QHLA 4WGVB 3ARFC 4YOKA 3MRIB 2D31A 2AMGA 3I6KA 4Q7DA 4B7LA 1RIUH 2R59A 3L4TA 1L6ZA 1XGQB 1B2WL 4XCNB 3K6SA 3SKMB 3J27A 5GONA 1VACB 2IAMB 4NXNB 3RYIA 4HZ1A 4FABL 4DUXA 3JAWA 2GJ6D 5FYLD 4GMSH 5GZOA 4IKLA 5KVMC 4IRJA 4PJ8C 1KBGL 3IU4L 1SOQA 4NOBA 4PTTA 2ZUVA 4N23A 5BMFH 4MDIA 4IKKA 1JMKC 1MF2H 1WA1X 2ZCZA 2YRLA 4KVCH 5GS0L 5JA8B 1OXYA 3MRRB 3V6OA 4FNPA 4M6ML 2PTUA 2B4CC 1PDKB 1RUKH 4HLJA 3HMXH 3OHMB 3SY6A 4WUUE 4QJ4B 4Z7QB 1SA0B 2IBBA 3BEVA 2V7HA 4QHMA 1PZ5B 5F93C 3DX8B 4IBQA 2BSKB 3NABL 1G1KA 3MREA 1UA6L 3S35X 5EF1A 1EO5A 3OPZH 4OD3H 3H3PL 4PJEA 5EV7A 2ISDA 2DLFH 4LFCB 3LNHA 3TV3H 3UPRA 4KC3B 5KVFL 3BKJL 2MHAB 3LHAA 4UQEA 2BFGA 2B5UA 3RY5A 4HJ0C 4R5XA 4BXVA 4YWGH 2LHAA 3UM7A 1NEUA 3RBGA 3HHRB 1QASA 3PF2A 4PLJC 3ATAA 1FYJA 4QCIA 4NKIH 3KEDA 4CKQA 3GTTA 3L5JA 1I1AD 1KELL 1MQKH 2BC4A 4IQHA 3SYCA 4K5LA 3T1YB 2VJ0A 5H2BB 3V0IA 1XGTA 4AGOA 5FF6A 4P2QA 3IU3B 2QQLL 2WPGA 2DM2A 2Q7GA 1EUTA 2QL1A 1NCTA 5I2IA 2YAHA 4OZGA 1AHWB 4MD4A 1NC2D 4XPGL 1MY5A 2UY7B 4NKMA 1U97A 5K39B 2XNAA 2VDKB 3KWUA 4HC1H 2L6LA 5CZXD 2OYLA 4P4RB 4B97A 4HKXA 3PV6B 3QUKB 1MRCL 1NINA 2WZPD 1KOAA 3ZXAC 3DETC 5CMUA 3UTZA 3WGVB 1FAFA 5IR1A 4FZ1A 2A9BA 1E27B 5BVPH 3QDJA 4Z7UA 1EBPA 2NYKA 2NYYC 2P46B 3DSFL 4ENEC 5ANMB 3L3GB 1UCBL 3F6IA 2DF3A 4ZG1A 5GRJL 5KZCB 2UUCB 3KPSB 3LDDA 4BINA 2VL4A 3H9SE 5DC0A 2LTQB 3GHPA 3LXAA 4P4KA 1NDMB 4G5ZH 4WJ5B 3ZRSA 2YPLB 4XZ4A 4JPWH 3TL5A 1H9VA 4JKMA 4K71B 5L2JA 1PY9A 2YD0A 3BAYA 1SBSH 4TSBL 5AW8B 4A2LA 5C93A 3TC9A 4HU2A 1GGCL 4LASL 1Q90D 2APBA 5D4QA 1TIUA 4M00A 2JVUA 2VLKE 3DPDA 3OKMA 1TR7A 5E5RB 2WNWA 5LUMA 2OX5A 4NQCB 5F3FA 5FUOH 3CFKB 3Q3GB 2AZ2A 1RZFH 3UBXA 5CFAA 5JOPD 1R6NA 1Q8IA 1XIWD 1DLHB 1ZWIA 2B59A 5I17B 4AI8A 1LWJA 3K8LA 4N86A 1JGVL 2VDRB 4LLYB 3KBEA 3ARWA 5HHPA 1IFGA 3RFZC 2IANE 3PGFH 4HZ3A 2F54B 3RVTC 4Z7VA 5HJBA 3QYCA 4TVSa 1MI5B 5DJ2B 3ARBA 3SOTA 2J4WH 1MFBH 3EH4B 4TQ8A 4JFWA 2DMHA 4LLVB 5CA1B 3RBSA 2QELA 4N26A 3RDTC 3JAKA 1CU4L 3B9KD 3LZFL 2GHZA 5JORA 5BO1L 3V4PA 2AVGA 3I3EA 5IM7B 1J7VR 4D8PB 5T3ZE 3EFFK 2KH2B 3W2DH 3K71A 1JUFB 3I3DA 1AXSB 4MCZB 1TZHA 3PY9A 4XN4A 3IDJB 4LSPH 5J6SA 2UUBO 5DJ0A 4UTAH 2PTTA 4JFED 4B08A 5B3SC 1HE8A 4DR2B 3KGUA 4NQDD 4KZDL 1P7QB 3ZIAG 3TVMB 1YUKB 3OZKA 4WW2F 3PL6C 2NUPB 1XEUA 2VZ3A 3C60C 4L3CA 3WEXA 3O8XB 4ILDA 5CJ5A 1I9RL 4N25A 4TS6A 3ZYJA 3B2PA 3GUTB 4Y0GA 2PR4L 3VD3A 1WUZA 3H42L 3L81A 4FI8A 3EFFA 3KPQB 1F02I 2W9DH 1X5FA 4MDIB 2A9HA 1K9MW 1WT5A 2QZQA 3RY4A 1P84F 1OGTA 5FLUA 3CDGA 3BPOB 2P8LB 6CGTA 1SHXA 4FFYH 3D3QA 5JPMB 3TIDA 1FA4A 2CJUL 4NO2B 2J88H 4YUEH 5IB2A 3KMDA 1N4XL 4A7VA 1S7TB 2M1KA 4JE0A 4LF6B 4M4PA 5EU6E 5GGSB 4FG0A 4U1KB 5CJQL 1A6AA 1IUZA 4JM4L 3VNZA 5LB1A 2YA0A 4LF8O 2EEXA 3CX5K 4B7KA 1W9XA 3BWAA 3GMQB 3MBEC 4UYQA 4KUCD 3OKDB 1Q9OB 4OZHE 1LMIA 3U7YH 3RYCB 3VFSB 3VXOA 5G2NA 2DLGA 3WIIL 4ELKA 3EJYD 1P1ZB 3IRZA 1D9KB 3HZYA 2CD0A 3NRQA 1ODUA 4BIUA 2P4AB 2ZKMX 3JD2A 5KMGA 2LVEA 4WFHD 1KECA 4PJHB 3HIZA 1Z5YD 5DHXB 1LTXA 1B3QA 1HAWA 1SEQL 1SLVA 2AKRA 2JB6A 1ZS2A 3NJGA 1Z2KA 3TZVA 1K92A 1D5BB 3IJ8A 1KXTB 3WXVH 5K1VA 2Z0BA 5FNVA 3Q0HA 2A77L 2Z31A 2ILLA 5E2WL 5CGMA 2RBLA 3RJQB 3KHQA 1EAJA 4U3HA 3WO4C 5HDWA 1IEBA 4AEHL 4LH6A 2GCYA 2ICES 4JI4B 3O3EA 3NIGB 4LT7A 3L5WB 1ORQC 3DX8A 3QEQA 2GB2A 3D8MA 5F8RC 3T0EB 3KM2A 5KVGH 3RWCB 1EFRG 1S7RA 1BAGA 1BLIA 2JIXD 4E0RB 2BY3A 3C6LB 4XNYL 3TH2T 1J8KA 1QNIA 3GMPB 1SS3A 4PV1B 3RX9A 3N43B 1ASQA 4ENED 2I9TA 3WS6A 1A5FH 5HJGA 4DN3L 2H41A 1QI5A 2VLME 4RQFA 3QP3A 3EJUA 3JVGA 4UB0L 4EKWA 4Y4FC 1I7RA 3KS0H 3QWOA 1FFNA 2FCBA 4M6OL 3QO8A 3G04B 4JFPB 2E7DA 1NC2B 1WBZB 4UTAA 3QT2A 4C4KT 2X1PA 4XWOC 3I6GB 5E4AA 3RT3C 5DD3H 4YLCA 5IHZA 3EOAA 4XH2B 2F19H 2GVYA 2XPYA 3WJJC 4ZNEE 4F37F 4O2FB 2XZAH 3DYMA 4H20L 4QJ5B 3RKPA 5L2JB 5K39A 5L88H 3UDWC 1HZKA 2EIKC 4S1QH 3GPEA 3T0EE 3O81A 3KG2A 1U8MA 4ASUG 1CK0L 4TVPL 3A2FA 4PG2C 5F72S 4JK0D 4X20A 2ZOTA 2W0FC 4PY7B 4XVSH 1PFCA 5JVDA 2AQ3A 4XC3L 5JW3H 1B88A 2RR3A 1T5KA 3HE7C 5CZVH 4O5LL 4OBRA 4XCEA 2NT1A 2PXYA 4LLYA 2XXGA 4JDZB 3AG4B 1IX9A 1UA7A 2XWTB 1K34A 3O4LA 3X1GA 4CVZA 4J10A 4LGPB 4NQEE 1XGUB 4J1UB 3SD5A 4RO2A 4J6RL 1XBRA 3O6FB 1DVFD 4GSDL 2VWKA 1RFDH 4JPSA 5SWQA 4ELDA 1W0WB 3QZMA 4OFYD 2R0LH 3E2EA 4WFEE 2ADFH 2VO5A 2P5WB 3P4OA 3CFEB 4JL1A 2D4FA 1DL7H 2D0GA 4OLXL 2CJ3A 3B3IB 3F62A 5IQ9B 5I23A 5I71C 2VZVA 5KTEL 2VNCA 5E79Z 4NBYB 4QXUH 3OPUA 3SE4A 3AXLA 3MVSA 4FNLL 4UQAA 4MDRA 3MRFB 4HMCA 4GP5B 3FFDA 4CADB 5LGJA 3F5WA 1LWRA 3DARA 4LRIC 3WIHH 2R39A 4V11A 5D96B 2HJFB 1XTMA 3O3BB 3CC7V 1B0RA 5E6RB 1J0ZA 5I30H 4AE1A 3Q3GA 3UBXB 1S5HA 1YNTA 4DTGL 5CBEB 3F7VA 3V0FA 1BFVH 4GYBA 4N6QA 4WTXA 3U9PL 1S8DA 2D7PA 2YKLH 2X53A 5E6UB 5DMGD 3MRGA 2KKQA 4G9DA 4JG9A 4LEEA 1IM3D 1C16A 5KTEH 4R97C 2L0DA 1H2GA 3LB6D 3ZHDA 2WO3B 2EADA 2PYEE 3BUYA 1ZGLA 2NCEA 2Z4QA 2E5EA 5SWSA 4IBUA 1IE5A 1NBYB 4POZD 1KXQA 4F7CA 5ELIA 4Q58C 1EPFA 4NDMB 3C5ZB 1KUMA 1MXGA 1ADQH 4P49A 5EIBC 3R7RA 3ZGIA 5T3ZD 5KSBF 2ED7A 2CTWA 4ZUWA 3RTQA 1BDYA 1I3RB 3QJQB 4NHUB 1TEGA 2Z7YA 2ZP0T 4J2QA 4K3JH 4JEGB 1RZJH 1WS8A 4OLYL 3VXOB 4BK4A 4F2MA 3CZFA 4JFEE 4TQPA 1NC4D 4UT9L 2D2OA 4CN1A 1KYDA 1D5XB 3AQYA 5KJRL 3QYMA 3H1LH 3DDFA 3DX0A 4DEUA 5KVEH 2EKSA 4Y16C 4I2XE 5DFAA 5I8CA 5IE9A 2F9BT 5EEWA 3QJOA 5C0FB 4J27A 2OYMA 2AERT 2IJKA 1A0QL 1F6AB 3HRPA 2OMWB 4B95C 2W0XA 1KN4H 1SXAA 1AP6A 5FO9B 2IBZH 3C2SA 1CQYA 3APDA 1JFHA 2JQMA 3B2VL 1PG7L 2VLKB 4W81A 4AIZA 5DQDL 4RGNC 4U49A 1SM3L 3LZPA 5C09B 1OP5K 1VAHA 3DYPA 3OKEB 1KC5H 4N5UA 1FL3B 4AX3A 4BEIA 1MFEL 3JV5A 3BIAX 3ZE1E 1XNRB 1A9EB 3UROR 4OZ4A 2B5IC 1FZMB 1ZKAA 2X4SB 4X4MA 5KBDA 4KU1A 3VJ6A 3O9WD 3VD9A 1QSED 3L6FB 4Q6KA 5CGYC 4N1EA 1XCQA 4Z7IA 3HPJA 4P48A 4DO6A 4ORGA 2WXJA 4D0BB 3ISWA 1C5BL 2JELH 4K2UL 5C6TH 3VX0A 2YGVA 2PP9A 5IVZA 4LCWD 4W9IC 4LCVA 4AYBA 2Y2WA 3CK0L 2W38A 1S7XB 1A6ZB 3L95B 2EIKB 1KTKE 1SJXA 3LEYL 4TULL 5AFAA 4OIAA 4G6JL 3VXRE 1KMGA 5C08E 5EBWA 4OCWH 1CGUA 4HXAH 3ULVH 1EDQA 4I55A 2J8OA 4PREA 1Z2GA 4EF3A 2GDSA 1IXMA 3HHMA 2JJ2G 4MVMA 1ML0A 2CK0H 4FNSA 4N2FA 4EXKA 2G9KA 2WN3A 3O0RL 3QNXB 4NCC1 4FP8H 4UDTA 5B66Z 4YFLI 5CHNB 1G7MA 1JZJA 1G6RA 1EFQA 3AADB 4U3FH 1U8CB 2AEQH 2NDFA 4HWBA 4R7DB 3NIFB 1LD9B 2IADB 3ZHSA 4M5TA 5BZBA 2WTOA 3RVVC 3US9A 5H9CA 2I07A 3E8UL 3C5SA 5KSUB 1NOAA 2DQJH 5CUSH 4EPSA 1E7VA 4IS6B 4XPGH 4LSDA 4QT5A 4PRHA 5DTFB 3G08A 1RJZB 4A66A 3MRQA 1G9MH 4QXTB 4HIEB 5DHVA 4ICGA 1Z3GH 1XUQA 1HYRC 1R5VA 4PB0L 2LOEA 1E28B 4S2SA 4H26A 3WO4B 2ALAA 3K2IA 3POHA 1N5AB 1N0LB 4LFHD 4X1YB 3CNKA 3UBGA 3TYGL 4P5TA 4PA4A 3A24A 3NJJA 4JZNB 3SJVE 3VVWA 4YR6A 2FZ3B 1BZDA 2IPUG 3D0LA 3AW5A 5BRZB 3W56A 5IGXL 1KKCA 3MODH 5EU4B 1M9SA 3VU2A 3VD1A 2V5YA 4MASA 1E6JH 4BCXA 1CTOA 2W0PA 4K8RL 2ZNJA 4JZJA 3P40A 4AGLA 1KCKA 2Q8AH 3QC5X 4MXQD 2OKMA 2K45A 5HGAB 4EDXB 1NKDA 1NLDH 4NRXA 4UVCA 4LL1A 2MPAH 5CXPA 5IJKC 2OWOA 2IG2H 2ROYA 3W9EB 5L8JB 1P53A 4LAJH 5LGNA 2XTJD 2GEQA 5I18H 1KDJA 2UZYA 4F7CB 4MJ5A 2Y0PA 3QAZB 4QRTB 5AYUL 3TLRA 5DZVA 3H4HA 1INEH 4KK8C 4FYRA 2BY2A 5ITBL 4Y7OC 5DEZA 1WTLA 5EIBD 3SE8H 4L8DB 2Y4TA 4X6CF 1MAJA 4XX1G 5C0AE 4MJIB 4WTQA 1BIIA 4JDEB 5ERWA 1KUQA 2XXCB 2X38A 4GBXB 1FV1A 5G5DB 4OGYH 4ZW8A 1Y18B 5HYSG 5JOEA 5EOTB 2HRLA 1FH5L 1HCZA 4GX5A 2AW2A 1SBBA 1NBMG 5EC2B 3K0WA 2CHXA 3L3DB 1X4YA 4GKLA 4ES9A 3TGXA 2EDBA 4L9LB 5TDNB 1IC7H 4QWWC 2YPKA 4FE9A 2OZ4H 5B8CA 1EJFA 4ABWA 4NZTL 5DRNA 3BZFB 4GKKO 4TSCH 5HYQB 1P4LA 3SEPA 4CNIB 2AEPH 4H8WC 1FYTB 4O02A 3ALXA 5C0AA 4DGIH 1MLCB 1AILA 1VEWA 1UJWB 1T0NA 3C09B 1SXZA 2XVLA 2WZPA 4AIZB 5I18L 3K72B 1B3IA 2ITCA 2DLFL 2XWJB 3EJCA 1DQQA 5D7LB 3TJPA 3CWGA 1F86A 1TTUA 4V1DA 1DCEA 1KLGB 1SQ2N 2HG5C 2MFNA 4J3WA 4Q9BA 2EH7H 2XG4B 4ZUUB 3TEZA 5F7EH 2RCSL 1I94B 4P46A 2LLNA 4OZ4B 4Y1SA 3MBEA 3F85A 3MODL 2DQUL 3WKQA 3TBBA 1MFCL 3GUFA 2EUWA 2KLSA 4HJUA 5C0FA 3QC6X 2W0FA 4XN2A 4H13B 2OCFD 4FNQA 4YEEA 4HKBB 2DW5A 3EBGA 3JV4B 3MU3A 2R1YB 2G2RA 1FGVH 4KKQA 4R4BB 1A6ZA 1UEMA 3L95A 2BW5A 4TULH 4MZ3A 1P5UC 1M05A 2FWOB 1KB9J 3DX3A 4XCCL 1MIEL 2BIHA 4EKXA 1UPGA 5I74C 5KOVC 3CJHB 3VFPB 3FMGH 1EFXD 1ACXA 3JTTA 2YOCA 4TKWA 5JHAA 5C0IB 1MMMA 2R72A 1T1XA 4PJFF 3U4AA 1HL9A 4TV9B 1KG0B 3MLXH 4FHJA 4OLVL 4PLKC 2RCVA 4WWID 3KCPA 3KJ4B 4QXVA 3VD2A 4FCHA 1UXMA 3BESR 1HQRB 4XWOD 3P2TA 4UT6A 3W7UA 4E5XG 1EHLL 4N87A 5L9DH 1M2VB 4QT5B 5J1SC 4LARH 4N2LA 3ASOC 3MJ7A 4AGMA 4JR9H 3FFQA 3L17A 4E9QA 2BFVL 2BP0A 1JS4A 2B15A 1KLUB 3O45B 3VYOA 1NCUA 4Z0XB 1BCIA 2XN9A 4G7VH 3OL2A 2GIXA 2R2BA 5AAWC 4GYCB 3WNJA 5KG9B 4ZMNA 1CE1H 5CGYD 1KIQA 1JGEA 1RHHB 3AY4A 1LQSR 1IBZA 3VH8B 4DKFH 4Z1PA 5K5YA 3TXSA 4PR5A 1E7UA 4AIOA 2QVTA 3GIZH 2R29A 2Y3AA 4LWSB 2ZX8A 4IIZA 4NS0A 5D1XD 3EO1A 5T1DL 4YBQD 4I18C 3QUHA 1RK0A 4M6OH 4JUTA 5DDHB 2O5XH 2CNYA 4LLDA 2HX8A 3WFZA 4UNIA 3K9SA 2BK8A 5B39A 4UOZA 4FQQB 3F58H 3M7FB 5FA3B 2NY4D 2I07B 1XF5B 2OXHB 2X1XR 3MV8A 2UZIL 5CLZA 5DRXA 3VQYA 4MNGA 5E99H 2Q2LA 4TNVF 2R9IA 5K9QI 4BFBD 2GQHA 1YTFB 5EN3A 1BVZA 2XAFA 3P4MA 3D69A 3DVNA 1WTGT 5EU6A 5E08H 1Z9SB 5C86A 1UM5H 2Y1AA 1G0YR 5DJDB 4WWKC 5IMKB 1YSOA 5C08D 4WW2A 4Y5YA 5F70A 4IYHA 3FUHA 4XVSL 4OR1A 1A65A 1U8IA 4KOBA 1BQHG 3HC4L 3EF4A 4N9OB 3ROLA 2JE8A 3D2UD 5KSAA 1E42A 1UGKA 5LGTA 4Q6IA 4OZIA 3MD0A 2UZIH 2F61A 4U6YA 4JHAL 1SMAA 3DX9A 3QCUL 4KKBD 4ZSOB 2WA3A 4DAGH 1V27A 3NZSA 3VA6A 4RAHA 4QY8B 1S5HC 1QBLH 2YARA 3BZFA 2DWEB 4X8CA 4QRRA 4ZTPH 3QIUA 4CNIA 4Q9QL 3MV9D 1V55B 1KCVH 2WLNA 4ZNCD 1JHLH 3L7FB 5GW7A 3MFFA 5CJQH 1SLWA 4EB6B 4P9MH 4ZW7A 4F1SA 3QARA 2C9VA 2NY7H 3AG7A 3GBML 3A21A 4KOCA 5EF0A 1A6VH 3W82A 2DH3A 3L3IB 2QE7G 3MV9E 4JN2B 3LKPA 4WTWA 2F7PA 1L0YA 4LHUD 3SBWC 4OPAA 3L9RA 3FUMA 1OW0A 3CCLV 3TPUA 2GJZB 3D33A 4LLUA 2QSCH 1YECL 1F7YA 2B9ZA 2PGGA 1FZOA 4PLNC 4J3XA 5DD6B 5B1JA 4NPYA 5C9KA 4G11A 1V8HA 2NXYB 2R9HC 4LC1A 1TETH 4O4IA 2X7LB 3UPCA 3SJCC 3S88H 3ENEA 2BXZA 3MOBL 2F23A 1HI6A 3STLB 2PPDA 1QW8A 2PO6D 4Y2DA 5JXEC 5KZCD 4XBEL 5LHDA 4Q20A 4LB8A 3G80A 1WP6A 5TD4A 5K1XA 1BG9A 4QXWA 2ODHA 3QIWD 1FXKA 5D2LE 3X11B 2FX8L 2W59A 1DJWA 1E40A 3OV6A 4X5PA 2AQSA 4DGVL 1CFBA 1YECH 1IGTB 3OG6B 2VLJB 1XT5A 2QLYA 3IDNB 3KPRD 3N2KA 3NIDF 1BZ9B 2Q3AA 1L5GA 4AMKH 2BNQA 3ZE0B 1F90L 2X4QA 4U1NA 4IIQC 1AGDB 4TPRH 3UYOD 4I4TB 1JZEA 2VITA 1XILA 5D6CB 1JYWA 2XY2A 4C59B 1IXBA 1BIHA 1YMMB 4PJEB 1CGVA 1A4JB 3G6BA 1Q9WB 4RAVA 3IMBA 3WNIA 3GLEA 1I08A 2CO2A 4Z3JA 2PWFA 2PWEA 2Q73A 1T0PB 1IBKB 3L1OH 1N59A 3V7MA 3LS4L 4WDIA 4DUYO 5HYEA 2BRRL 3WFDH 2YFNA 1T5WB 2DLHA 3NTCH 4M62L 3EHBC 3SIKA 4DKEL 3VG9B 1ECZA 3LRHA 1YEJL 3MRBB 3PWJA 2F5BH 3T0AA 4V33A 4BYHA 3ALPA 2HJKB 1PFOA 3FUJA 1GY2A 4K7PL 3SDXA 1IZKA 4X9YA 2X4TA 4OPHA 4I0PD 4JJOA 4KMTL 1G7LA 2XIDA 5F97E 1EJ8A 1SQFA 2OP4H 3QDME 5CZXC 4NM8H 3VMNA 1MWOA 2FYYA 5MI0B 1JNHB 5BS0E 3CFQA 4H8WL 2JK5B 1PSKL 2VE6B 3MKKA 2V8MA 4RA0C 4I88A 3UTZB 3NFNB 1P5UB 4GQQA 4P2OC 1LJMA 3OKYA 1HNXO 1VQ4V 2YSUB 4HBCL 3EOBA 4LLMA 2YEVA 5HI3D 3GZKA 5FLXN 1E27A 3OJ2C 4GKZB 2JLPA 1KJ2B 1H19A 4DVRH 2MHAA 1N32B 4BUGA 4YC2B 4KV5E 4XVTH 1CIUA 1KGUA 3CZLA 3H2QA 4F8OA 1JUFA 4JRYA 2B2XL 1OJHA 4UIMA 3IDJA 2DOSA 4RLDA 2Q6WA 5DD1H 1SQMA 2QPDB 3U0PA 2FUTA 3HI6H 5H2BA 4ZRGA 1H3UA 3IFOA 1EQWA 3NXSA 1H6UA 2Y7OA 4APXA 1X5MA 3BT0A 3BEHA 2EIEA 2VAAB 3QFJD 3TNNA 4FLXA 3ROLB 2DJVA 1C5CL 4C58B 2VR6A 1YDPB 5EDXA 3P9MB 5EEYA 3L75H 1BD2E 2NW3B 2BCCH 3JD0A 4JPVH 3T0BA 1XSKA 4P4RA 1L6XA 2WQUA 4JN1L 2E9GA 1S9YA 1BS3A 1FIGL 2OTWA 3KPQA 2AQQA 1AO7A 1D6EA 5BVJB 4HS6A 1XX9C 3CCSV 4RMWA 1TYEB 1MEXH 5AVYB 4WK2B 3ZT6A 1RURL 4L4TD 2WXRA 2ADGB 3RB5A 3X1NA 4H88L 1A9VA 3CG8A 2H45A 2VXSL 3GC3A 5IB2B 3MLWH 4FQIH 4ZZFA 5MHSD 4PAZA 3AK3A 5DJ8B 1NCJA 2L04A 4PJBB 1YEGL 4QIWF 3JVFC 2F5AH 2NY3B 3MGOB 4GRLB 2OS7A 4M7ZC 4D9RE 2I7SA 3ZDZE 4JN2A 5IMKA 4QYOA 3T4ZA 1MJJA 1TZGL 5JCOA 4LLVA 4NUMA 2AJXH 3KPRB 3EVKA 1FFOB 2X44D 4JY6A 3VYPA 1NDMA 4WJ5A 3BVWA 4MAYC 5CU9A 5KANI 2J71A 3FRUB 4IOSA 1I7FA 4UV9A 3QCVL 1C5CH 3DGEA 4F1ZA 3X12B 4TQDA 3N40P 5ISZB 3RNKB 4S11A 2WVVB 5DJ0B 5C7XH 3HN5A 5H37H 2HJDA 4WUKL 2NZ9D 3NFSL 5E6IC 3PFUA 1KCUH 1IAIM 3H2WA 3TXAA 1S76D 2LU4A 3F65A 1J5CA 2WLLA 3B9AA 1I8KA 3BY6A 1OAYL 4X5WA 3QRFM 3BRGC 1A7PL 1Q72L 1TTFA 4HCRA 4BWWA 1X5YA 5AOLA 4FLUA 1KGWA 5KSAC 4KXBA 4IOIB 1FWXA 1KXVC 2NR6D 1U3HC 1O6SB 2ZKHH 4WY7L 2C9XA 2WQRA 4AG4H 4HSAC 3D25B 1F2QA 3KHOA 4M6NL 1P7GA 2OCCB 2Y7SA 4WWKD 4X6FA 1CBVH 1L9NA 2X4UA 3H56A 2PWGA 1U95B 5F1NA 4BQ6A 4EUPB 5I73C 3MJ8A 2CRIA 2WWKO 2VITB 4D8PA 1JWUA 4KJPC 3DURA 2VN4A 4OQTL 2HG0A 3H3PH 3P3UA 1OF2A 5GJTH 4KRPC 3MXWL 4N68A 3ZTEA 4D6TH 1JI1A 1NH2D 3MRLB 4OI9A 5CMAA 3ULUE 4ELKB 2ZKXA 5A3ID 3QNYB 3JV0A 3SJBC 5KMGB 1B2WH 2NUPA 4LKCA 1TJIL 2VDML 4FQ1H 1EV2E 4XI5D 3P1VA 4JJHA 4JRXE 5LNDA 2VLJD 2NXZB 4JAAA 3I84A 4PJ9D 4CBPA 5IGXH 3IAYA 4H25A 5JVDB 1KBGH 4BK5C 5KYXB 4PJXB 5MERA 4XCEB 2OYQA 1FXKB 2HKHL 1U92B 1J1OH 4IKNA 4NLAA 2N01B 4W9FC 3CZSA 3G5VB 1RUPH 4RBPK 3HG2A 5EUOE 2WXFA 1DYZA 5JIPA 4A7UA 1PVHA 3CFDB 1JCVA 1MCIA 2P42B 4N0RA 5D5MB 5I24A 5H37A 4AC4A 1RZIA 4PA9A 1IB5A 3CGTA 3P4NB 3SDDB 3TJHD 1N64H 2WKLA 1YMHA 1AG6A 4PJ5E 1T1ZA 3T0VA 5JIDA 1XDTT 3E1F1 3OKDA 1I7ZA 2CO1A 3FD9A 5T5FH 3RKDD 1JGLL 2VDPH 4AZ8A 2A74B 1NUDA 3JZYA 1CB4A 5JPNB 1NPUA 2DB8A 5F8QC 1J9TA 4A6YA 2IU0A 4JQIA 3V8OA 2HT4D 2NXYD 2DN9A 3R1GL 2VWJA 5IDJA 4UILL 3RJDA 4ETQA 1MFEH 4I89A 3V4UL 4E9XA 4M7LH 3GB7C 1RV6X 1FZJA 4ZK8A 2XCMC 1OVZA 1FXHA 3VACA 2K8MA 3E6HB 4I3SL 5LQBL 3K0YA 5AW7B 2AP2A 1F3DH 4XNBA 4HOXA 2F1EA 1AD9A 3C2AH 4WK0B 3DVGA 3EDEA 4MCYB 4OCXL 4PLJD 4WV1B 3EFOB 1K4DB 2QTOA 3E35A 2PCPA 4K2UH 5C6TL 5CINL 2C26A 1I1AB 3V6OE 4WFHA 1PIFA 3CHQA 4IU3B 1WEJH 4IHJA 4Y5VA 3ARTA 3D51A 1EIBA 2TRYA 3NCYS 3VXNB 4LVEA 2MOQA 1OPOA 3GSUB 4QPEA 3UEZA 4RCAA 4UDUB 3LH8A 3SDXE 3NQKA 3QS3A 4X6CA 5I6XC 3CU7A 5C1MB 4ZODA 1I94O 3FAVA 4AM0Q 1KCRL 2A0LC 2ZCLH 3QHZL 2FEJA 3RWFB 1GM7A 3QFJB 5ABZA 1S7QB 1N7MH 4FXKB 3U46B 4NHUA 1NAMA 1VENA 4N2GA 3TBTB 1QLFA 3WLWC 1TJIH 2VDMH 1GGTA 4YC2C 2AJUL 2FIRT 3MJ9L 3DSNB 4BZ1L 5DZJA 4Z5RA 3O11B 3ARFD 4P5MA 4YIPA 1Q9LB 5E6YA 3KWXA 5HHQB 2WXGA 4ZD3L 3D85A 3S2CA 1BGYH 4U1GB 2F1BA 4HEPA 1PM9A 1VF5B 3A6CH 1KB5H 4UQ2A 1A6UH 4F15C 1FJ1B 4UUJA 5LMUB 4AL8H 3F7VC 1CIDA 35C8L 4WU5A 1FNFA 1J11A 5MI0C 2VH5L 5DWPA 3B3BA 1XF4A 4XNMA 2ZSVB 1E4XH 5EZLA 3OJVC 1I8LC 1I85A 1OQOA 3EH1A 4KJQC 4P2RE 3AK2A 4R90L 4E42B 2AV1B 4ZTOH 4O58H 4OFKA 3UJIH 1YRKA 1JNNL 2OV0A 4AYSA 2D7QA 2HT3D 1IGFH 3IFNH 1AXIB 4M9PA 4NFBA 5L4IA 2YGNA 3FYIB 4X64B 1RJCA 1M56C 3J7AU 1QLRA 1J18A 2QSQA 4TLSA 4X80L 3SDAC 5I6LA 1R5WA 3SE9H 3QG5A 2RHEA 3MGTA 4A7GF 3A4DA 5I28A 4PRBB 1QFHA 1J05B 4U7MA 4JI5B 2QV2A 3HRZC 1IAKB 1NH6A 5ANHA 1VFAA 1Z0MA 4EUPA 3C5ZA 3STZC 3ASNC 3OBAA 1L7IL 1XAKA 4P23B 3CRRA 4FG4A 4EI5D 1Q82W 2DPKA 2JQZA 4XO4A 2H0PA 3EDFA 4FXTA 1P4IH 1FVCA 2WSPA 4ZAKA 4H0LB 4UCRA 4DN4H 2NY1B 3SY0B 3B2MA 1A3LL 4N2MA 3O9OA 1TO5A 5IYZB 1MCOH 3R8QA 1G1CA 1BZ7A 1T4KA 4BSWB 1D5XA 1PZSA 3D8CA 4NB5A 1NMCB 5FFGA 2DW4A 2FJGB 5H94B 1IMHC 3RL1B 3OKLA 4FZEL 4B3EA