2DYRB

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dyrB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dyrB02
1KDIA 2QT6A 4KO6A 3QJSB 4HALA 4ZK8A 1QNIA 2GI0A 2BP0B 1NWOA 4JHVA 3NJIA 3FT0A 4KO7A 2Y69B 1WS8A 5FC9A 3NJFA 2DYSB 2P80A 2PCYA 3IN2A 1MG3C 4DP8X 3ZDWA 2MTAA 2XV3A 3N55A 1MZZA 2BWDA 2WSDA 4KOCA 1ZPUA 3EHBB 4HCIA 1OCRB 3QJUB 2EIMB 2VMJA 3ABLB 4JKNA 3ERXA 1ILSA 1SDDB 2R7EB 5F7BA 3PAZA 3S8FB 1JOIA 1AIZA 2ZXWB 1NIDA 4F2EA 1AACA 4YSCA 1JERA 4TXVB 4DP9X 1T5KA 2PPEA 5AZUA 1V55B 1CUOA 4QKTA 3KW8A 1AZBA 1E5YA 4BDVA 3BQVA 2EIKB 3FSVA 2J57A 1AS8A 2IWEA 1ID2A 2I7SA 2TSAA 2XXGA 3TA4D 3OD3A 4YSRA 5I6KA 3H4HA 4P5RA 2HRHA 4Q89A 1OCCB 3UABA 4BWWA 1RCYA 5B7FA 2DYRB 5I6NA 3PXLA 3JT2A 1SNRA 6PAZA 5I5JA 4BXVA 3IN0A 5E9NA 2BZCA 1PNDA 1WA2X 2HZHA 4W9ZA 5TK2A 1AZRA 1EHKB 1X9UA 2BWIA 2BHFA 3FU9A 1CC3A 4YSSA 3ASNB 4M4RB 1J9RA 3QPKA 2XV2A 9PCYA 2GC7C 3MBWB 2I7OA 2N0MA 1GY1A 3V9CA 3S8GB 1WA0X 4GY4A 1PY0A 2XU9A 3EH3B 4DP1X 5PAZA 3EH4B 5B1JA 1MZYA 1V54B 3X1FA 3DKHA 2PP7A 1GS7A 4BK5C 2PLTA 1XB6A 1TEFA 2FT6A 5A7EA 3HB3B 3NT0A 1PF3A 3T6VA 3AG3B 3AY2A 1KCBA 3MX0B 1ADWA 2H3XC 1E30A 3CVBA 1AAJA 4HAKA 1RKRA 3FQYA 2MRYA 4YSTA 2XUWA 1OOWA 2DV6A 2J56A 1I53A 3CG8A 5B3SB 1NIAA 1QLEB 2PPAA 3PCYA 5I5MA 1GYCA 3NJKA 4DP6X 1L9OA 2UXVA 3WKQA 1FA4A 2PPFA 3NJGA 2Y1AA 2XLLA 1GS6X 1ASOA 2YXVA 2FTAA 1HAUA 4UAHA 3FPYA 4AKOA 3FS9A 4BDVB 2HX7A 3NSYA 2QDVA 4G72B 1MDAA 4YVUA 1W6WA 1JXGA 2FJSA 1AOZA 4AZUA 4AKQA 1NIBA 4YL4A 1AZUA 1AS7A 1KYAA 3S3DB 2HXAA 2YAOA 3CZUB 1CURA 4JHUA 1BQ5A 2YAEA 2IDQA 4WKXA 4WTQA 4GXFA 3DTUB 2XVBA 2GBAA 2W88A 1ET8A 1OCZB 2J55A 3GXUB 1E5ZA 3N2JA 1AR1B 3NP3A 2UX6A 4MFHA 4FAAB 1NDTA 1IUZA 4A2DA 7PAZA 1PZCA 1NZRA 1GW0A 2GHZA 4DP5X 2B3IA 1ET5A 1AQ8A 2YAMA 1OV8A 3OMAB 2FQEA 3CVCA 3T9WA 1AS6A 5F7AA 4DPBX 2RACA 4W1TA 1GR7A 1ASPA 3QQXA 2J5WA 4EF3A 3AG2B 3ZX1A 5B7MA 2EIJB 4PCYA 5I26A 1KBVA 1SJMA 1ZIBA 3DIVA 1F56A 1L9SA 1PLCA 5I28A 3H56A 1PLBA 4DP4X 2HX9A 1A4BA 1XMEB 4DPCX 3OMNB 3NSCA 1L9QA 4AKPA 3SQRA 1EZLA 3NJMA 1OCOB 4E9WA 1UATA 2XX0A 1KBWA 1TEGA 3BVDB 3FSWA 3NSDA 3UACA 2WO3B 5LDUA 4HHWA 2H5UA 1PMYA 3FQ2A 1AG6A 4HIPA 1PNCA 2H47C 2NRDA 2OJ1A 2QPEB 2QDWA 2PP8A 1CYXA 3NP4A 3ZBMA 4DP2X 1FWXA 2FT7A 3FYIB 3GDCA 4UF7C 3TBBA 2HLEB 4FA7B 4KOBA 4GP5B 1BQKA 1NWPA 3TASA 2XXFA 2YAQA 4RH4A 2EINB 3FSAA 1X9RA 1HAWA 4AI7A 3ABMB 2VW6A 2IDTA 2BP0A 1XB8A 2BP8A 1BYPA 1FFTB 1AG0A 1ZV2A 4DP0X 1OE3A 1J9TA 1JZFA 2UXTA 4BWTA 4QLWA 4E9RA 5TK4A 4BWUA 4G7QB 1KGYE 2AZUA 2VW7A 2P80D 1M57B 1JVOA 1OF0A 4E9TA 1NIFA 3WNJA 4P5SA 2PCFA 3WG7B 1IKOP 4F2FA 2IWFA 1SFDA 3EH5B 1L9TA 4YSAA 2VSKB 1ZDSA 4AX3A 2IAAC 1ILUA 5I6OA 1A8ZA 2FQGA 3PAUA 4A67A 3IE9A 1PAZA 5D4HA 4YSDA 2E86A 3X2QB 1J5CA 2YARA 2LLNA 4A68A 2ZOOA 3IBOA 5AFAA 1WA1X 1JZIA 5I6LA 3FSZA 5I6MA 1E65A 5B1BB 3OMIB 4E9XA 4HZ1A 2I85A 2IWKA 4E9QA 4KNTA 3T6WA 4K9JA 4CSPA 3CVDA 1URIA 2FWLB 1BXAA 3FU8A 1ZIAA 1E67A 1M56B 2JFCA 3CDZA 2OCCB 2VW4A 4Q8BA 4CSZA 1IBYA 4NAJA 1R1CA 3L45A 4HHGA 6PCYA 2YAHA 1DYZA 1V10A 1GY2A 4DPAX 1JZGA 1HFUA 1KV7A 2OV0A 4A2FA 3HEIB 4YSEA 1KDJA 2XV0A 5B1KA 4N8UA 3FU7A 3S3BB 1PLAA 2IDFA 4G71B 3C75A 4L0PB 4HCGA 2UXGA 2VM4A 4E9VA 1A65A 1BXVA 1YLBB 3NJNA 1NINA 1BQRA 2DY2A 3T6ZA 2QPDB 1L9PA 1SHXA 2VM3A 1J5DA 1NPJA 3JTBA 4M3HA 2GIMA 2BP8B 4A2GA 3X1EA 3X1GA 1L9RA 2HRGA 3ZIYA 2BZ7A 1SF5A 1AANA 1NTDA 2IH8A 1QHQA 2AVFA 1NICA 2YAFA 5IY5B 1KCWA 4YSPA 4GP8B 1SHWA 4G7SB 3TBCA 2BW5A 3X1BA 5B7EA 1RZPA 2HX8A 3H4FA 1TU2A 4UANA 4E9YA 1IC0A 3RYMA 1JZHA 4E9SA 4NB7A 2XYBA 2FT8A 2BO0A 2EILB 2WO2B 3QJTB 2CCWA 2ZONA 3NSFA 1OE1A 1ZDQA 4ENZA 1ET7A 3AZUA 5ANHA 3NYKA 4F7KA 3V9EA 3T6XA 1AZCA 2W8CA 2XX1A 4N4YB 3SBRA 5PCYA 3WIAA 1NIEA 1PCSA 3FPXA 1SF3A 1J9SA 1BAWA 1RZQA 1MG2C 3PLYA 2FQFA 2ZWNA 5AKRA 1OE2A 1JZJA 2B08A 4YSUA 5I5IA 1J9QA 2BW4A 1BYOA 1WS7A 2Q5BA 1PZBA 2CALA 2VN3A 1BEXA 1N70A 1TKWA 1A3ZA 5D4IA 3CDZB 3SBQA 2AZAA 2PPCA 2PP9A 1AZNA 3SBPA 4KNSA 4PAZA 4GP4B 3UGEA 3IEAA 2CJ3A 8PAZA 4YSQA 1ASQA 2TSBA 3FU7B 3WNIA 2VSMB 1SFHA 1SDDA 2R7EA 2GSMB 2IDSA 4X4KA 3GYRA 3OM3B 4BXSV 4KO5A 3UAAA 3AG1B 1A4CA 2Q9OA 3FYEB 4KNUA 3D12B 1PZAA 4KO9A 4A66A 4G70B 3NJHA 3AG4B 2UX7A 3KW7A 1JZEA 3TU6A 2JXMA 7PCYA 2CBPA 1VLXA 2AFNA 5B1JC 5I6PA 4HCFA 3ASOB 1NPNA 2IH9A 2DWTA 3QJQB 3T71A 3NJJA 3NJLA 1M9WA 1DZ0A 3WI9A 5EHFA 3S3CB 2IDUA 3PAVA 1B3IA 5B1AB 1JVLA 1BXUA 1N68A 2JKWA 1W6LA 2DWSA 2YAPA 3PPSA 3ABKB 2FNWA 3OQRA 3FQ1A 3UADA 1WAEA 2CUAA 3QJVB 3UAEA 2A3TA 2CAKA 2X88A 2YXWA 4YVNA 1A4AA 5D4JA 4GYBA 1XB3A 3G5WA 2FQDA 3EF4A 4G7RB 4A2HA 3U25A 1JXFA 1GSKA 1W8EA 2YEVB 3QJRB 3ABGA 3X1NA 2AANA 3WKPA 4NERA 1JXDA 2PPDA 4DP7X 2XWZA 2GC4C 2X87A 3AW5A 4A2EA 2YQBA 4YSOA 1ETJA 2UXFA 2GB2A 1IBZA 1GS8A 1CYWA
chains in the Genus database with same CATH superfamily
3E8VA 2DMKA 5I75C 2BLFA 2COVD 3LEYH 5IYZA 3GJFA 1XMOO 3MI6A 4Y4HB 1Q0EA 4WEBH 3P4MA 2VR7A 4KO7A 5D1XC 2DQUH 4E41B 3RWGA 4ELME 5M7QA 2DYSB 3CFDA 3ZE1E 5J89A 2QLYA 2WXGA 4KOCA 5GGVH 1P7KB 4KXCA 2P24B 3KPQB 1NJ9A 1UGKA 2EIMB 2VMJA 1OB1A 3EHBD 3KCPA 4L29B 1EJOL 1MWAL 4F7CB 3UC0L 4DW2L 4QR7A 4RO2A 5LA6A 5JHLA 4KH2A 1ZA3B 2WLNA 4JFDB 1N33O 2DDQH 2ZX8A 5HGHB 4LCCC 5F1KC 4XN8A 3T4YA 3I3DA 4UV4L 4NUQA 1AZBA 5D1QE 4IM8A 3MV8E 2LFRA 2FB5A 5T1LD 3MUGA 3IGAB 3Q8BA 4PI0A 4JI2B 4NR1A 4TSCH 3SDAB 2CIKA 5EWIH 4PGDB 3PP4H 1G0YR 4C4KT 3HKEA 3QEGL 2YGVA 4I85A 4TUJA 2Q6AA 3IJ7A 3MNDA 4K0OA 4W9EC 5I6KA 2EULA 3G9AB 4GI8A 5JVDA 3CBRA 3VMNA 4UQ2B 4O00A 4YDMA 4YDIL 4H1LG 2JI2A 3N2KA 3I2CH 5LP6C 2WXPA 5BMVB 1A7PH 2H26A 5TQ0H 1A7BA 3S36H 2A9HA 3SGDI 2DH2A 4I2XE 1HEHC 2KG7B 2F43G 1YPZB 3W5NA 3OX8A 2OMZA 1KWGA 4FJ6A 1CTNA 1PD1A 2B14A 3TP4A 2ID5A 1HYSC 4Q56A 3V7MA 2FWSA 1NFDF 3QPKA 3JSNA 3IGKA 2I26N 2R1XA 1AI6A 3IETB 4WEUD 4R90H 3K71A 3V9CA 5FO2A 4GY4A 4E5XG 3EOBA 1FNLA 1MXDA 3MHSC 2DIJA 2VKXA 4X7FC 2P45B 4FS0A 1GPOH 2DWEC 1T89A 1A3QA 2XFXA 4PWEA 5CHNA 2WJ7A 1Q9LA 1Q86W 3U6RB 2YBGA 1QVOB 2BSDA 3UYOD 2XAFA 1K7DA 2I25N 4QPEA 3E6HB 2NCEA 3N1MC 1UWEH 3B3BA 3QFGA 3LXAA 5DRWA 3VXMB 3O3UN 3TWCH 3L3KA 1ZHNA 1XREA 1HHIA 1J1PL 3OKNB 5FM5M 5J2UA 3M17B 1YC8A 3QWRD 5C08E 3JAKA 4FTVA 3KCWA 1ADWA 3BFQG 4Y2LA 3O2VH 3D50A 5E4EB 3RFZA 2XT9A 1BAFH 1IT9L 1CXIA 3SDCA 3EJCA 3NEXA 1SDYA 3L9RA 5KTEL 5EU4A 5C0CB 4JF3A 1F4MA 3A0BZ 3EHBC 3WENA 3AM8C 1OCRC 1U3HA 2JSFA 5BRPA 4S0TD 5FA4A 4NPYB 2Q0OC 5IMMA 2VDKH 3D85A 4G5ZH 3PHAA 4FXGB 1FXVA 3OAZH 2PPFA 1HKFA 2R39A 2CRIA 4JY6B 1AHKA 4Q14A 3KVQA 5DEGB 1LILA 5KN5A 2WNGA 1SQQH 5KYYB 4UAHA 2HVKB 1DQIA 1GGTA 1SVCP 2DZEA 2AGJL 3LQZB 5FM4A 3PABB 1VQLV 2JJTC 1XGPA 1B06A 2MNWA 4JRYB 3RVWD 4MLIA 4LAJH 2BFVL 4AM0B 3MLTB 4FYRA 3DV4A 1IARB 1W6WA 1F3RB 1DTOA 5F89A 2Y0IA 1R6KA 4OLXH 4TSFG 4QRSA 1JMKC 3H6AA 2QWQB 1KT2A 4D3CH 2R70A 4F8QA 2DE0X 2YXHA 3II3A 3Q9QA 4I3SL 1EAJA 4XPGL 4ZPTB 1FVDA 3MACL 2P22C 2AGAA 1WHPA 1RUQH 2ALWA 1ZVHA 2WOBA 4J9ZB 1GZPB 3B1TA 3PUCA 4LLDA 4R2GB 4WUUB 4EKJA 4FFZL 5AL8A 4F7TB 1EHLH 5FGBC 2OMXA 2AHZA 2K1EA 1EV2E 4KZDH 1V3KA 2Q3AA 1B2YA 4CS4A 3SJQC 5FNVB 4JRWA 3QEQD 2IGFH 5EH1A 3UBGA 3MRLB 2NY3C 2XZZA 2F2HA 2R1WA 5F9WB 2F54E 2QLVB 2B3IA 4G2AA 5EN3A 5IJ9A 2VUOA 3PNWB 4NDMB 4IIZA 4LCWA 1ZT7B 3MNMA 3T0ED 1NBZA 4MCNA 1N6UA 4K0KO 4UV9A 1GR7A 2BVOB 2NXYD 4KRNA 4BE5A 1UT1A 3SE4C 1S3JA 1D5XB 4O4LA 2GBTA 2WLJA 1ZVSB 2H6PB 2VDQB 3DX6B 4E0RB 4GQZA 2WJ5A 1QVFU 4TVPD 3ARGA 4LNVA 5CGTA 5FB8B 4MCZB 4ZFFB 3RJOA 3GFUA 5SWSE 3GEWB 3IDNA 2PYFA 1RH8A 3BP5A 1PLBA 3L3OA 3QQ4B 5FFGA 2Z8WC 1PYWB 2R56L 2VO8A 4ZOBA 3VJ6A 1F8TH 1NCAH 2IANE 3EJYD 5IM7B 3BP4B 3W11D 1MFAL 4X5WA 3BDBA 4YHHO 3ZHQA 1EHNA 3WLBA 1KUMA 3C09B 4JO3H 2WO3B 1XILA 5FO8A 2QQQA 4H13C 2I9TA 3PYCA 5ACZA 5T3XH 4JVPA 4YFEA 1EN6A 5EEZA 1NCGA 4O2EB 1W0JG 4I7ZC 2UU9B 1S0VA 2D2OA 1H6EA 3ZBMA 1G84A 1S5LZ 3KJ6L 3FYIB 1M1XA 3CMEV 2IV8A 3HCVB 4GT1A 5DZPA 5FYJL 4P4KD 5GGSY 3RY6A 3RVWC 2VWJA 2CWRA 4PJ5E 3V4VL 3V6BR 3VNYA 4BK5A 4JI0B 2Q76B 3LV3B 3VRJA 3EFOB 1UM4L 2JJSA 3F7KA 4Y5VB 3DYPA 2FX9H 1VENA 3HKCB 2H4EA 2C4FU 4JO4L 2AJVL 3FB6A 2BP0A 2DM3A 3BDYL 4P5TA 4PJFA 3DRTB 1JPXA 4QRPE 1CIDA 3MKGA 2MHAA 4LRIA 1UA6H 3D4YA 4M5YL 3W7WA 2BNRE 3CS5A 3GHBH 5GQBA 3NEOA 3HNTL 5EZJA 5LBSA 1DN0A 1E27A 2R29H 3CFDB 3P73B 1FFXB 4TTDD 3ZRCC 3JAWB 4HWNA 3NCEB 2P8MA 1NJ9B 2AABL 1NDGA 1OB1B 3EJZC 3QHFH 1Q1JH 1W0WB 1IKOP 3P30H 4HH9A 1SFDA 4YXLH 3RX9A 2LVEA 5LA6B 3L5WA 3QNFA 3TO4A 4YSAA 2CUHA 5JOPD 3FUKA 1PZUB 4AX3A 4FFKA 2WWKO 1EVTC 1FJGO 3CCLV 1UXSA 2IH1C 1PAZA 3GRWL 4YIQB 5D4HA 8FABA 3TFBA 2EIZB 3E1F1 3APNA 3LQMA 2YARA 3S7GA 2A5UA 1G8MA 3IBOA 4QGTA 4ZNCD 2R0ZH 4L0YA 4B41A 2WIIA 3QRGH 1ETB1 3WUWB 1RVFL 3FSZA 3NEEA 1TETL 2ESVA 2V1DA 4UINL 1E65A 4UT6L 2ENQA 2GABA 2EIKC 4TUJB 4WNSA 4IHOB 4QJ3B 3VFWB 1G9HA 5JNYA 3ZL4H 1QZNA 2MCG1 2HPTA 1UZ6F 3HAEA 3HE7C 3QB7C 4DV3O 5I0WA 3EJYC 3LKRA 2WVVA 3CVDA 4NZTL 3W11C 5GZOD 1BXAA 2L7UA 4BRVA 1Q4NX 1IGIH 1SLUA 3DOSA 5EC2A 1Y6XA 1JD9A 1G5AA 3ZDXF 1MFBL 1GY2A 4FQPA 5D1QD 3GBLA 2B9BA 4XNDA 3MV8D 3OX8B 4IOFD 4OCXL 2PR9A 5HHOE 2P5PA 3H2QA 2M1KA 4JDZA 4JMXA 4LPVA 4PRDA 5DJDA 3RY4A 3V0VB 3K71B 5J12C 4ZIBA 1XF5A 5GPRA 2WXHA 4EI0A 4XAWH 1XCXA 3S35H 4F33A 4N6QA 1SQMA 2QFRA 5J11B 3EOAA 5INDA 1Q9LB 1JRHL 5GGQL 5HGGS 3NTCH 1O6SB 3KXFB 4ODHL 4PJHF 2LLGA 5IROA 4L37B 2WBJD 4MD5B 1JTOA 4MJHA 3G5XA 3ZE0B 4AQAB 3NACH 4DR7O 3IXAA 4IHJB 2OMTA 2BXYA 2JQMA 4XMXA 1Z9NA 2AP2A 3SGKA 2BY1A 3L3KB 4Z9KB 1ZHNB 1HHIB 1ZHLB 4R83A 5C9JA 4P48A 3RGHA 2ERJC 3MJ9A 4ZKIA 2UY7A 3BJ91 1TTCA 3D9AH 3FT1A 4JRFA 3ARFB 3SDCB 4KP4A 1HCFX 2YD4A 3QNZB 1IBKO 4XGZB 2HHHO 4XZ4A 5EU4B 5AALA 3X1BA 4PGCB 4AYFA 3H4FA 1ADQL 2AV7A 2FJHA 1NOLA 2H45A 2IOMA 4RRPA 4R96A 5CU5A 3ABUA 2ZONA 5H9CA 1QTYT 3D85B 4JPIB 4XPFH 3RVXD 1KTKE 4NLAA 3I75A 2HRLA 3II1A 4OQTA 3IJEA 4YQXL 3V9EA 1WQVT 1HNXO 2W0FC 3C2AL 3L3GA 1TVKA 6TAAA 1DLHA 5KN5B 4KXBA 1U8HA 2RQEA 5DC4B 4DUYO 1OAYL 1H2MA 5C08D 4A7GF 2JI1A 2KLTA 3IFPB 5KSBF 2XY2A 3X2QC 4Z18A 1NFAA 1KGWA 4IS6A 2Z35B 4CADB 2IJKA 4DH2A 3US9A 1M1SA 2XKSA 3JARA 4X83A 35C8H 3IXTB 5DHEA 4PJAA 1KT2B 4KROC 5IJDC 3HLKA 3WFZA 2B1IA 4P57A 3PWNB 2YBRB 2GITA 4M7KL 1J5HA 1JK9B 4RFOH 2IU0A 2PPCA 1L7TL 1AI1H 2H2SD 4G6KH 3ZKND 1T0NA 4LLDB 1E9OB 4YE4L 1AGEB 4P2OC 2BJML 3QC5X 3N2GB 2BIQA 1SN0A 1LE9A 1J0KA 2ICEC 5D1QC 3VXRE 4WW2C 5LUMA 1FNHA 3G5ZA 2Q7GA 1T2JA 2JCCB 3P0GB 5T3XD 5BJTB 2R1WB 4J3OF 1IAII 1YQVL 2JEUA 4J2XA 2DQMA 1KPUB 3EYVA 3VBBA 4NEHB 2NSMA 2HKFH 4ZSOB 2CO7B 4HLZG 4RMQA 4N22A 5IIEA 4LKXA 5IJ9B 3VD1A 4LCWB 1KNOA 1A7OH 4Y4KC 1A0QH 3QQNA 2Q2LA 2WKOF 3TU6A 7PCYA 5I1AA 2ATKA 1KZYA 1MFEL 3BAAA 4WENB 4Z8FH 4O51A 4O4LB 3FMGL 4LF9O 2IW5A 3Q06A 5KW9H 4JI7O 3QJQB 4OZGA 1WIOA 2JGUA 2DM2A 2LU5A 4YBLC 1DZ0A 5HHQA 3ARGB 1H2SB 2VC2H 3OKMB 3NVQA 4JG5A 5JPNB 4KPHH 2A83A 2F74A 2CNYA 3BP5B 1OKEA 3L3OB 2CLRA 4G6JL 5B1AB 3BUTA 4AIEA 5IQMA 3FRUA 5B3JF 5SV3A 4ODSL 1UT2A 1MCJA 4WWID 4BK8A 2FX8L 3DARA 1G6RA 3H0TA 2CXGA 2CUAA 2FZ3A 3A3YB 3QFJB 5FO8B 5IV2B 4X0KA 4PJCB 2IPUK 1LO3L 1SVBA 4PJBF 2E6PA 4WW1A 4MZ3A 1XMQB 5ACZB 4ORZC 5FO9A 1XQ4A 2Z0AA 3N41F 3LAFA 4JFPA 3MJGX 2PW2B 2BK8A 1O7DE 4V1DB 5G5DB 2QSCH 2RD0A 5SWSD 3QUHA 3T3ME 5DRXB 2ZR3A 4ZXBB 1SN2A 3WELA 1M1XB 3MDJA 1JXDA 4PV8A 1FN4A 3RHWK 3AW5A 1EERB 4I88A 2YQBA 3U36A 2IAND 3ATEA 4A2EA 1HQ4B 2FCBA 3D4ZA 2RAMA 1IBZA 5HGDA 4FLXA 4XNMB 5CA1B 3CRMA 1BHBA 2MOGA 1N5AA 2C7UA 5ESVA 2BP0B 4ADJA 4IMLB 1NWOA 1RIHL 4PJFB 1XEDA 1GZHC 3FO0H 2Y69B 1YEJH 1U6AH 2MHAB 3QULA 3UJTL 4I3RL 1MG3C 2O6DA 1NR7A 4HHAB 3C60D 4O9HH 2BWDA 2GCYB 3ZKNC 1F1DA 1CICC 3T6QC 1A21A 3RYCA 1ACCA 1L3NA 2R0LL 3GWJA 4QTHA 4FLHA 3SQBB 3P0VH 3QORD 4PJ5D 1J0JA 2P8MB 3KYAA 3QIUA 1NDGB 5TQ2L 3NZ8B 3WEXB 2J4WL 5DUPL 4KQ3L 1XV8A 2YGNA 1BXXA 5F6IB 3O8XC 4OPAA 3ZJZA 4GQ9L 1QMUA 5JW3H 4WFGA 2GT9B 2K4WA 4YDLB 1K4DB 4XP6H 4QRPD 3UGXA 1Z2GA 8FABB 3Q8EA 4ES9A 4TQPA 1UB5A 4ANVA 5FKPB 5LBQA 1NGWA 1P5VA 5D72L 3WFBH 4CRPA 4BQ6A 4JRXA 1ZAUA 4CN6A 3TA4D 1R3LA 3CZEA 4F1SA 5JTWA 2ESVB 4NZFA 4R7CA 2HUEA 1F4AA 3LXCA 3UABA 4BAYA 1AE6L 1AR5A 4IOSA 4MDRA 3S37X 2PTTA 4P3CH 1JZ3A 3HAEB 1S7WB 1WA2X 2HZHA 1F02I 1IQDB 2M83A 4PQXA 4WK4B 5CP7A 4YH6A 5CZVH 4Z7NB 1GH7A 1YN7A 4XZUA 5EC2B 5BOZG 5JHBA 3LJ3A 5IG7A 5BR8O 1FZJB 1OOAA 2OCCC 4Z7WB 1ZTXE 9PCYA 1PM9A 3B43A 3ALWA 5BZXA 4UVAA 2WINA 1LO2L 4PRDB 1S3KH 1FIGL 5BZBA 1A9BB 4QPJA 2K78A 5D5MA 5BZDA 4QAWA 1JJOA 1P7GA 1AKJD 5F9DC 5IP4A 2CGYA 4I18B 4Q97A 3DKHA 1A2YB 5F7EL 2IDCA 3BUQA 3EOAB 5INDB 2A38A 3QWNA 4NQTA 4OKVA 5HDWA 2A79B 2IAMA 3TJPA 3G5XB 5I1HH 1NT2B 1O9HA 4GSRA 1JPEA 3IXAB 2VXVH 2DLTA 4IRJC 4OFPA 4QXWA 5IFAL 2FMLA 1K8IB 1M6OB 2CJSA 1NOAA 2YN5A 3MCYA 3MRKA 5D6DC 4Z0XA 4GG6F 1AIFB 4HAKA 1HR0B 1GYUA 2NY7L 4KXDA 3A5VA 1LYQA 1CD1B 2XWRA 1JPGA 1ZT1B 2UY7B 4H88L 4MAZA 3RA7L 5DQDH 2ZKMX 3AMKA 4J42A 1EX0A 3EYSL 4EPSA 3K6SA 1PKOA 1OARH 2APFA 2C26A 3HVNA 3NJKA 1MCNA 1BJ1H 5F97E 2FJHB 3WNKA 2BSEA 2ZPKH 4JHWL 1H9DA 2XLLA 2GHWB 2FTAA 3I75B 3OHXB 4LF3A 5LCVA 3VWJD 2R72A 3IJEB 1Y74A 3NPSB 1H3GA 1BZDA 4O4YH 4OVUA 5FWRA 1ZWIA 1IC1A 1U8HB 4FI6A 2FATL 1P84J 1MDAA 4PP2A 1KIRB 3UZVA 1JXGA 3OWRA 4W9KC 3QG6B 4I9XA 4D9LH 3COOA 5EU5B 1YJNV 2A1WH 4IS6B 1I7ZA 1Z3GH 2G30A 3HC4H 4MWFB 4U7SA 2XA8L 3T09A 3JARB 2VWEC 4Y16D 2VR8A 3ROLA 4PJAB 1PQZA 1P84F 2OTUA 1MY7A 1BQ5A 3OKOA 4WTQA 4X6BA 4P57B 3RN4A 3SJAC 1KJ3H 3JWOH 2J6EL 3A6BH 2XI9A 4XH2A 2XY1A 4ZO9A 3WKNA 5A2JH 1B0IA 2YR3A 1X5MA 5ANMA 4RFNC 5FYLH 3LNNA 4EEEA 4ETYA 1AR1B 1RLWA 4Q9RH 3C5SA 3HVDA 3RBGA 1EZUA 4OGYL 3T8MA 3RG1C 2YI8A 2ZOLB 2CLZA 4HUWB 4JG1L 2JVUA 3BYYA 1WAAA 5LOVB 1U8QA 4PJGF 4RGMB 4XBPB 4G8AC 4NZRL 5C8JA 4DP5X 1G43A 4TUYA 2H1PH 1IBGH 4N8VB 3WXVH 4U1GB 5AYUH 3HAEG 4CBCA 1JGIA 5CUSH 5EUOF 4PLNC 1TA8A 1QLNA 2EBOA 1UKQA 5C09A 5IBTH 4MMXB 5IIEB 1OSZA 4RVBA 2WSSG 1MH5B 4FZ8L 4EZMA 5GS1A 3E8HA 4DZBB 4ILDA 5I1AB 2KB1A 1TJMA 5BO1H 2AQ3A 1LWJA 4U6VL 4CSTA 1ZIBA 2WYIA 3QG5A 1F56A 4OZGB 2NSXA 1CWVA 2CO2A 2CH7A 5HHQB 4ZBMA 3NFSH 3VXRD 1KJVB 3DROA 1HNFA 1KCRL 4HIHA 2MMXA 3HE6B 4HP5A 2A83B 4Z23A 2F74B 1FAKT 4J3UA 4AQYB 4ETQB 2I9LA 3JWNE 1A6ZA 4UTAA 1KBWA 2GYSA 4L4VA 3TBTA 1NCUA 3N85L 2R0WH 1UFIA 3WY2A 5DI8A 3U7WH 4M43L 2ITDA 3LDBC 4F3FA 4WJ5B 3INUH 3H7BA 4ZUTB 5C0IB 3GGWA 2EC9T 3PQYE 1BZOA 4GAYA 4G1MA 5FV2A 2LQRA 2NYKA 2JELL 1FCGA 4MAUH 2E75B 1WZLA 4JFTA 2P5WA 3U4EA 5FO9B 4AQ1B 3MYZA 3VWJC 2VQEB 4JFPB 5E5MB 4RDQG 3TBBA 4CVZB 4ZNEE 2VDRB 1RZFL 4MXVE 2TAAA 4E2OA 2VWKA 4N8CL 4H37A 2EINB 1AGDA 1RP9A 1JPTL 4PV8B 4F7PB 2KZKA 5CN2A 5HD8D 4RRPG 3S34H 3UAJA 1OLLA 2AK1L 4XP1L 1U92A 4FXTA 4Y16C 4CNIA 1HL8A 4JN1H 1Q94A 2HUHA 2NOYA 5ESVB 3VNZA 4OFVA 1UH2A 2A6JB 1F3DJ 4F7MA 1KD1W 5JPMA 3BKCL 3ZMUA 1E4XH 4HS3A 4ZI7A 4N23A 1TTRA 4OIBA 3SPJA 1IURA 1I9RH 5F7DA 2KZBA 1JVOA 1TQSA 2B0SH 3MSPA 3QG7L 3R7RA 1I1RA 1MPAH 4PWKA 3U0WL 3IFXA 2NN4A 4U3SB 1EBOA 4MAYD 1WE5A 5T5FL 1AJQA 1JWUB 1QI4A 4LZKA 1JHKL 3VGAC 4A04A 3WG7B 4PD4K 4G8FA 4F2ME 3CDYA 4OPHA 4W9JC 4N21A 1S7VB 1E4JA 4BH7B 4MJ2A 1BFOB 2FEEL 1CBJA 1EFXD 4EMZA 2NY4B 1SOSA 3QUYC 1OCWL 2V5SA 4XMVA 4ZUSB 5C0AD 1BL8A 1RSFA 4JI1B 4KVNH 5IQLA 1E6OH 1CR9L 3KG2A 4N8VG 4LNUB 1P5VB 1ZSDA 1U3NA 2VB5A 3JWNH 4HYTB 3OD4A 2QSQA 4JQVA 1A3RL 3AQDA 4ANKA 2QKSA 4LCIL 4ZFOB 2DBJA 1XF2A 4YWGL 2BSCA 2MQGA 1E4WL 4WI3A 1YJDH 3TV3H 4N87A 3PGCA 1BMFG 1W72A 4QRRA 2CD0A 4P2QA 1IM3B 1UZ6E 3LXBA 2DYRC 2WSKA 2GJ6E 3C8KA 1YN7B 4XZUB 3HEIB 4YSEA 1HKLH 4LFBO 3U2JA 2AS5M 3WFDL 1YCIA 3DI3B 3FJTA 3QO1B 4JFZL 4NNXB 3QHZH 4Y8AA 1MNNA 5IJVA 2Z91B 3X3FH 5JIPA 3UTTE 4DO5A 4JY5H 4MHHI 1A65A 1CZ8H 1I8LC 1BDYA 1KLGA 1T1XA 1YVWA 5SWZA 2WM0A 1JF1A 5L2KA 1BLNA 5EV7A 3M8AA 4HKBA 3VXUA 1SJEA 2VDPB 5F9OH 2NR6C 5HD8C 4ZI8A 3L6FA 2NT1A 2WYZA 4K7PL 3BJLA 4PJHE 1KC8W 2D2CC 3L5HA 3VXOA 3LQAC 3FAWA 4HMDA 4OZIE 3QP3A 1CLZL 5T1MA 4QHKI 2ADJA 3ARBD 3UAFA 3BYTA 1NICA 2YAFA 1DP0A 4GP8B 1SHWA 4BELD 3T8VA 1KLFA 4F15C 5ENWA 4LAQH 2DKSA 2QKCA 2ZIDA 1O7DC 1PSKH 3R19A 4PVNA 3MBXL 2BNQB 1H8SA 1JPGB 3WKYA 2PW1B 4BSWA 4X7TA 5FGSA 2YD5A 5JCOC 3BUBA 1KIQB 2G3XA 1CFBA 4HWBA 4DUWA 2D7MA 3D9AL 2O61B 4YNYA 3D39A 1Z5LA 4JAVA 4F7KA 3QTCA 2CMRL 2QPFA 2FECI 3PWVA 4TSAL 3QR2A 1YNKH 4PJEA 5A2LH 1J5OL 4LSTL 1PG7X 2APWA 4LF3B 4ZMVA 1Y74B 3SO3B 3WAKA 4DQOL 3QK0A 3U4BH 5H6RA 1PVHA 2UXBB 1TXKA 4LL4A 5CBEB 3GMNB 5HYJA 3UZVB 4NPKA 4AM0Q 3QUMB 2XWCA 1DVFD 1IGCH 4XRCA 5TE4H 5JDJA 1KB3A 3GSVB 5KSBE 3LEXA 3QJFA 5DWPA 3ZO0A 5FDWB 3VD2A 1A02N 4KXAA 2PR4L 2HEPA 3QCVH 3A47A 4MJIA 3CHOA 3ROLB 5I1EH 1E2ZA 2AZAA 3SDLA 2OTUB 4X6BB 1LEIA 1X4XA 2DPKA 3CWBH 2DM7A 2QR0B 4XH2B 3RGVD 5EBMC 1GVIA 3CFCH 1XI1A 4GJTB 4WU5B 1MFUA 4KUMA 2O6CA 2OP4L 1ASQA 2X41A 3C5SB 4F8LA 2KSDA 1TUBA 3K8KA 2X10A 3O6KH 4NUPA 2CLZB 3WN5A 1U58B 3U0PB 3GIZH 4XOEA 3ZE0F 2XTJB 3D12B 1P9MC 2F1AA 4UCFA 2QQNL 5MP6L 2NY1B 1KELL 4UI2A 3DGDA 5F44A 2EDMA 2CKBB 4AIOA 3AWGA 2WNKA 2HKOA 4P06A 1PX3A 1TVDA 4S1DD 1NPNA 2LAGB 5JXAL 2PTVA 3JV4B 1E42A 2CM6A 5HJ3B 4KUCD 1AJ7H 2AMGA 5CCKH 4R7LA 1I3GL 3TK1A 4AILC 1FZOA 4Q6IB 1BZ9A 4JY4B 2VN5A 4HUVB 3NCXA 2V5RA 3C5ZA 3ARBC 5KW9L 4PA6A 4R8WL 1JVLA 3CVIH 5DC9B 2Q86A 1FDLH 1BZ7A 5MI0C 3LNIA 1HQRB 1QR1B 1I1CA 1OM3H 3OQRA 4TWKA 4L4VB 3TBTB 1INEH 5BMFL 5JHDA 2JLLA 1YDPA 2EDXA 4H0LB 5HDBE 5B3JE 2ITDB 5I2IA 4LNRB 4F3FB 3SSGA 2EVGA 3S98A 1GH6A 4OZHA 2GIYA 5D55A 1DQML 1S5HB 3EW3B 5D7JC 4OT1L 3ML9A 5JXED 4GAYB 2B3RA 4G1MB 2P7TA 4OZ4A 4LDOB 5EOQL 4OTXL 3SB3A 5AZEH 4HIJA 5EO0B 3G80A 5C6TL 3QIBC 4PFEA 3U4EB 4M6OH 2DBLL 4G7YH 2HAZA 3NFNA 2X6UA 4NM8H 3HW7A 5TH2A 5D7EA 2IQAB 3ZDZB 3P9MB 1D5AA 4GMSL 1AGDB 4HCRL 1DVFC 2NQ3A 4AOFA 4GRWH 4FQXA 4Y9GA 2AJSH 1LQSR 1JHLH 1DHKA 1IEAA 1PZ3A 2D31A 3VFSA 3V4VA 5C97A 2WN3A 5K9OB 1FNEA 3IMSA 1VKXB 4CNIB 1Q94B 1NH6A 3IN2A 1KB5H 4IRZH 3MOQA 4LVOC 5K69A 5I18L 4QF1A 3N55A 5DHVB 4UOW1 4HCIA 3WTXA 2KYIA 3VXNA 3ZQ9A 3B9VA 1UJWB 3BZ4A 3EBAA 4HS3B 5JPMB 4ZI7B 2P4AB 5F7DB 3ABLB 3T4DA 2X1PA 1KFAH 3WFHA 2AK4A 4IDJH 4CDGC 1OM9A 2AJZB 3U30C 3TEYA 1VQ9V 4LF5B 3UX9B 4JPRA 4OLWH 1CXZB 5ALBH 4L8CA 1NCBH 5JIKA 2ZD0A 3DX1A 1EPFA 2AXFA 1D5NA 3QI9D 4WSGA 3KWUA 4QKTA 1GGUA 4DGIH 3VCLB 4RWYL 1H6FA 4WCYL 1R3IH 5J57B 4BDVA 3O9WD 1ECYA 1E3FA 1MWAB 1NGPH 2DWDA 2YMXL 4HZLA 1PNMA 4J3TA 3RL1A 4GLXA 4G8IA 3B9KD 5GRJH 5HHMB 1CLYH 4N28A 1FNSL 3BW9B 2VQFB 1INDH 2GY5A 3WL9A 2WXQA 1DE4B 3PWLA 4A2LA 3O6FD 1BAGA 3TEWA 3CWGA 2FBJL 4UT7L 3QZBA 4BWWA 1WUNT 4J6IA 3WD5H 3QDGB 1G6UA 1AMXA 1D9KB 1F00I 3PWPE 1H2GA 3S88L 1XF2B 2H3KA 3WFBL 3HC0B 3C5XA 3AWEA 1S7XB 4X6FA 1KXVC 5F7YC 5KVEH 1W15A 3ARWA 3PGCB 4QRRB 2WQSA 2IBZH 4P2QB 2QQLH 4YY3B 3LQAL 3QUKB 5AB9A 4MXWH 1QYGL 3WNPA 4FMTA 4WHTB 4NUGL 5TE6H 2RFXA 3ZMEA 2GY7B 4XBGA 1R6VA 5JXEC 1JS4A 3BQUD 5DMJB 1PY0A 4XTRC 2XN9D 5KA6A 2AV1A 3MV11 4F6RA 3IMTA 4LU5L 4YHML 4RESB 5IJVB 1H0DA 2CLVA 1EZVH 2YIBD 3DPBB 4OY9A 3DX0A 5A7BA 3QJZA 1GS7A 4GX1A 2YK1H 5SWZB 5L2KB 2OXGA 1JUFB 1BLNB 3JWNC 4L5FH 4HKBB 4PYHA 3VXUB 3K5RA 1WBZA 4GCZA 1NANH 3VGDA 3DO4A 5DT1L 2NY6D 3S5YA 1KCBA 5E1AA 2MKLC 2GJ6D 1RD6A 2DOCA 1H8OA 3CMGA 4JLRA 4JGNA 3JALA 3CVBA 5IGXH 1AI4A 1PNLA 3F3HA 2KKQA 4JPWH 2GK2A 2MRYA 4PJ8D 3TIDA 1S9YA 2DV6A 1OW0A 1LUVA 4GG6E 1NUNB 2JKTM 4TQHA 1NPUA 5IWAB 1KLFB 5EBLC 1OP5H 3UTTD 2WLYA 1YC7A 4L8BB 3WU2Z 3K9AA 5IY5C 2R1YB 3BKML 4NKMA 4OF5A 4OR1A 5ICYB 1FRGH 3QAQA 4BSWB 2UUDK 2RNBA 1WZ1L 2XZAL 4KHXL 4YNYB 3FPYA 2XHNA 4JPKH 2UXCO 3D39B 5FGCB 4X9IA 2JK5A 4PJDA 4RFEA 1LEGB 3PWVB 5D93C 3JWDC 5AW6B 3RWFB 3O9WC 4PJEB 4EXKA 1CT8A 4JQXA 5I19L 4NVPA 4NSKA 3D08A 4YJ2A 3FN3A 1WTLA 4ONHA 4KK8D 3ZKXC 1ED3B 2EDLA 4GKSB 3GKWH 2CPUA 5CJQH 1NCDL 5HYJB 3BKJH 1CGWA 2GK0A 3O6FC 1NIBA 3QS2A 3IS1X 1MHEB 4Z7AA 3OKEB 5L7XL 1UCBL 3FONB 3VFPA 3UIYA 3QJFB 4JKKA 2V2XB 4PEEA 4B9PA 2FR4A 3TGUH 4PV1C 3MLZL 1IAKA 3KGTA 4KI5F 4MJIB 2ZXCA 4RUFA 1ET8A 1BZ8A 2EECA 4NKOA 1E5ZA 4O02L 5DFWH 3V4UH 1KTDA 1P5UB 2OZ4A 1LEIB 1MJ8H 4A2DA 4OX9O 3ESNA 3C90A 5DVKA 1WFTA 2XVLA 3VI3B 2HSIA 3STLB 1ZTXL 3T9WA 1MCPL 1CPUA 2AI0L 3V7AE 3QEUA 4Z3GA 5DJCA 3GB7A 4PJGE 3D87B 3RI5K 1NAKH 5ITFA 1ZT4A 1ZA6B 4S1RH 1P84K 2WXOA 3TNMB 3QUXA 3I9GL 1FE8H 3SPIA 3PJNA 1E4XI 5JJNB 5C07E 1AFVH 4TT3G 3DUHA 4RUEA 1JE6A 4UDUA 3C2SA 4XN7A 2VDOH 2NY6C 2X4QA 2W6IG 3ARDC 2EIDA 5DD6B 4A7TA 3V5DA 3KYOA 4TUOA 4XMLH 2D7QA 3JZYA 3TVMC 4PJ8C 1E40A 4OFDA 5HYFA 1TFHA 4DVRL 1TEGA 3HG1B 3VQXA 3BVDB 5CEYB 3KBHE 3QXAA 2Q86B 5LDUA 1YEHL 5TTRA 2ZZUT 2ED9A 2V0AA 2VCOA 3N0PB 3NCJH 3F58L 1K5NA 4U3CA 1CGSL 4XNUH 5K39B 5JHDB 5EC1C 3EYUL 3KLQA 4I4WB 1YDPB 2FBRA 3BPZA 5GS0C 4X1IA 5I2IB 2V3FA 1P6FA 3AY4A 4JGMA 2VZSA 4HUNB 5CZRA 3RKDC 1HXMA 4HS8H 1DGSA 3CB2A 2MEJB 5I1LB 1Y0LB 3WFEL 4QOKE 3B77A 3NRQA 4PWIA 3KL3A 2HJFA 5LMUB 1NWPA 1ZSHA 2B8OT 4HIJB 3TASA 4JANA 5I75B 2X7LA 3Q2WA 2H32A 1MAKA 2PYEE 2ZKYA 4ZPVB 3FSAA 2Q8AH 3NFNB 4LLVA 1J0IA 1QA9A 1KXQE 4KK8C 5D1XB 1J8HE 1FP5A 2UWEF 2VW6A 4R4NC 2Q0AA 1AXIB 3M88A 5HTSA 2LFGA 2QV4A 4G43A 2NZ9C 2A4EA 2H8PA 5F72S 4QE9A 4FQXB 5CILH 4U1IA 2QR4A 4B3MO 2G3NA 1PD6A 1BF2A 5F7UA 2D31B 4LF6O 3V4VB 2O4EA 4K71B 4BGDA 1FNEB 4XPAH 3PDGA 3JAMN 2ODIA 4QLWA 1JI1A 4Z76A 3UEZA 3W81A 1DUZA 4N2FA 4FQIL 3ABTA 1JGDA 1JSYA 3FB8C 2HFGH 2YFOA 1FGNH 1XGTA 3Q2CA 3KH3A 2DLIA 3VXNB 1OTUD 3F7RA 3BZ4B 1ML0A 1F4XH 4LCCB 5A2KH 3B34A 1ORQB 1GM9A 1KENH 4B7LA 4F2FA 4MDJB 3SGEH 2VLRA 3LDCA 1ZCRA 1I9RL 3L9YA 3OEHG 3O9OA 5ESAA 1BT8A 2EE6A 5C0DA 3PJSB 3ZHNA 2EUWA 4JHZA 3KR3L 3IE9A 4A67A 2Y2TA 4C58B 2KKWA 2VSCA 4MDIA 3RTQA 1OSPL 1CE1H 3AU0A 3T3PF 1WA1X 2DWDB 1RXLA 1ND0A 2GSIA 3VX1A 3RL1B 4XVSH 2A99A 5DEDA 4G8IB 3K81A 5LP6B 4PS8A 3OMIB 3BPCA 4UNVA 5A43C 1CURA 4KFZC 3QPXL 3DC0A 4LPTA 3GINA 1NL0L 2DTML 1NTMH 1XAUA 3OGCC 2Y06H 1TZGL 1ITCA 2QVTA 2ZXGA 2K3HA 2HP8A 5HHNA 1BIHA 4MXQC 2J8UA 1KBHA 1I7FA 1E6JL 3O2WH 4PLJD 4Q8BA 4UNUA 4CSZA 4X6FB 4DN3L 2VR3A 3IU3A 4J3OC 1EFQA 5LBVA 3BMWA 2Z31D 3ZT6A 1SQPH 1I31A 5F9JA 1KDJA 3OLEA 4NO3A 1DFXA 4ZMZA 1TPXC 1PKQA 4DF9A 1D5BA 3U0ZA 2RFXB 5E6ID 1I8AA 2D7OA 2VM4A 5EU6D 3MREB 4YXKL 4YHYC 1YLBB 2KS0A 2C8NA 2LTQB 5KVFL 3BHBB 2CLVB 3J8F7 3DHJA 3JTTB 3P3UA 4PLKD 1PV0A 3BX7C 3CSBA 3VFNA 2XASA 1S7SA 5EORH 1L9RA 4KQ4H 1WBZB 3O45A 2HTKC 4JFED 4L18A 4R6ZA 3FT2A 1XMQO 3JWDL 3IMWA 3PU7A 2V7HA 5E1AB 4HG4K 5CLYA 2AVFA 2GUOA 4JLRB 1JPFA 3WUZA 1U8NA 4FN0A 4P46C 1FXHA 3MGOB 5DM6V 5AVUB 4Q4IA 5FX3A 5ILTL 4WI4A 3EZ8A 1OTUC 3V6ZA 4C56B 2PCFB 1NGXA 32C2A 4AGLA 5KSAA 1BX2A 1YUKB 2FT8A 3OAZK 3QJTB 4LR3A 1HESA 2APVA 2HT3D 3TF7C 4P9OA 1ET7A 1P4RA 1OSYA 4PIBA 5BS0E 5BV7C 1M71B 4M5TA 2JJUA 4YUEL 1WEJL 1F7YA 3RVUD 5PCYA 1T83C 3CX2A 3C3TA 1F90L 4WI5A 3QPQD 5AG2A 1X44A 4EDWH 5BXFA 5K9KA 3QJOA 2JK5B 4D0DA 4PJDB 3O2DL 4OD2A 4AJWA 2P9RA 2G3ZA 1FYTD 5K9JL 4Y5YC 1CT8B 4C4UA 2BY2A 1DQLL 3QISA 4B9FA 2CQVA 4GAJL 2CM5A 2L04A 2Z0UA 4JHAL 4MT8A 2BW4A 3W0WA 5SX4H 1ZK5A 4BSVA 2GJRA 5CINH 1BEXA 1J05A 2VJ0A 1YEGH 3PL6D 4RMRA 2IG2H 2NY3B 3U4BL 2R4SL 2FR4B 5GIRB 2A73A 4FG6D 4FFYH 5CKAA 5I1CL 1KCVH 1JGUL 1OANA 1N6QH 2O6PA 1GKEA 4J11A 1H8NA 2X38A 3NN8A 4NKOB 1WDAA 2H3NA 2Z31C 4DN4L 3GBML 1SFHA 4XNXL 4X4KA 1WBYA 4IRSA 4B6ZA 2PZSA 2J6EA 2EYTB 3N1FC 3RDTC 2CBMA 2WCSA 3MRIA 4D7TA 3HS0A 1I4FA 1BPLB 1E8XA 4G70B 1XR8B 4MJ4A 4OLZH 3V55A 1OWWA 5BOPA 5HVFB 3AG4B 1HWHB 1QBMH 1U8MA 2VLKA 3BPOB 3QEUB 5DJCB 3ZE0E 3ULVE 2E7LA 3P40A 1NCJA 5ITFB 1ZT4B 4JI8B 3ILEA 5B1JC 5AW5B 2OSWA 1URFA 5LMNO 1PP9H 1SS3A 3LSUA 2C9QA 3CHXA 2MSPA 4BQCA 5B38B 3J80N 4Z7QE 2ZCHL 1EJFA 5IW1A 4PRHA 1J1OH 3WHXA 1C5BH 1JGEA 4N68A 5F1SA 1T20A 4H13B 5GGTL 4O4JB 1B3IA 3MLPA 1VRSA 4UZUA 3QYMA 3FQRB 3T2LA 2DWSA 1X5XA 5E2TH 4DKEL 1MJUH 5IQ7H 2VNCA 3CCEV 3UADA 3VQYA 3ZN0A 2A9NH 4OVVA 5H4YA 1CFMA 1J1XH 4NFCA 1WO2A 3L95A 3PRZA 2NW2A 1LE5A 2G75A 4WV1C 3G5WA 2ZDIC 4Z7OB 3JVGC 2C5DC 3RWIA 4FLRA 3X12B 4X1IB 5EO1A 2H0EA 5JOFA 5CJBA 2BP5M 1HXMB 5C07D 5D7SL 3RVUC 1JPSH 1IFHH 2AANA 3BVUA 3P3YA 3VG0L 1HR0O 1FVEB 1GSMA 1A6TA 1YMME 3ARYA 3IDIB 3V5HA 3RAJH 2EKSA 5HYQA 4GBXA 5JW5B 2KZ1B 4XO8A 2HJFB 3MR9A 3U10A 3E22A 2H32B 2EH8L 3TA3D 2MTPA 4F5CA 2A0LA 2IEPA 1FNFA 4DR6B 1VFAB 2H7WA 4LLVB 4WZ9A 4LCUC 3REWA 4JR9H 4HALA 2W65A 4G43B 4LBEA 3U79A 5HHXH 3KHQA 3FT0A 5FGRA 1I9IL 3PIQA 1C5CL 1NCWL 3O4LB 4NKDA 4XP5L 1S9KC 1MW3A 3MLYL 4I1NB 4CUCA 3S36X 3ZYOA 2A7WA 5KWYC 3ASWA 3NSXA 2EH7H 1JGVH 4FG6C 3FW6A 4UB8Z 3MC0A 4H8WH 3VVVA 5J0BA 1JD7A 1FPTL 1H3PL 2I60L 3S8WA 4QOKD 3UXFA 4H0HB 3AQXA 4GZRB 1MCHA 2IF7A 4WO4D 4IT5A 3BGMA 2IH1B 2CDFA 5FW8A 2MCMA 2K8MA 1AACA 1KLUA 2PYED 1ZGLA 1J11A 1HH9A 4PM1A 3ULVH 2Q4PA 4I5BA 1J8HD 2X4RA 1D7FA 1UHVA 4G9FE 5AZUA 2A06H 1S7UB 3AXIA 3EGSB 2PI4A 3FUFA 4P5MA 2JXMB 3BEHA 5ESAB 4PVBA 3L8QA 3C6EA 4Z7UA 3VQLA 4TOYH 5T5FA 1NCNA 4KGJA 2EIKB 1RUMH 1RIUL 4HFUL 1VSCA 3WB0A 1PJWA 2ED6A 3RTQB 1CQYA 3CHPA 4YGAB 3KPSB 4M7LH 3MV9E 2FO4A 4IBWA 1HINH 1ID2A 2GSIB 3M1BB 4UCSA 3BUYA 1SERA 2ZOUA 1OGAA 3OD3A 4YSRA 2HFFA 4PJIB 4ANXA 4RSVA 4P9MH 2XBTA 4FLZA 2K6YA 3MA9L 1J86A 1W8OA 2OL3L 1AHWC 2OX5A 2Y6TE 1CL7I 3LIUA 4CDHA 3OXRB 4ZAKD 1D5ZA 3D25A 1DVTA 4GH7B 4UM9B 5B38G 1KKDA 3TESA 4RISL 4I55B 2GFBA 1MFCH 4YSSA 2D7PA 2YEZA 1J9RA 3IU3B 5IJKA 4FLVA 2XN2A 2GC7C 2HKHH 3OKKA 2BHYA 4HJGB 3W2DL 5L4JA 1G4MA 2FGWL 2XZQL 4NO3B 5L9DH 1PKQB 5KX5A 1V7MH 4G11A 3EH3B 2G3MA 1UD3A 1D5BB 2LHAA 3G5YA 2DICA 4MS8D 1N64L 4M7ZC 5T1DH 1BHAA 3OG6B 4RIRB 1UWGH 3U1SL 2JIXB 5A9GA 5F3BA 3HZVA 3ZMSA 4OCSH 3BFRA 4X9FA 3BRCA 1T04A 4P3DB 4ANUA 4ZUVA 5J1TC 1FZMA 1RK0A 5BV7L 2AC0A 1Q72L 3W57A 4MCYA 3VQWA 4DKAA 4F8NA 5MENA 5ABZA 3MX0B 1OALA 5LL6Y 1LO4H 4G8GA 3PP3H 4AJ0A 5JW4Q 1VARA 5LQBL 1KN2L 2AJ3A 3FT2B 1DN2A 4ZT1A 5AQ0A 2QADC 2V7HB 2VQEO 1WC7A 4QRUA 2GUYA 1XF3A 3L08A 1JPFB 1DFBH 3REVA 1U8PB 4W4OC 4NWUL 2AHIA 2C4FT 5D7IA 4YPGB 3F7VA 1RK1A 2PPAA 4L8SA 4OH2A 3TH4T 2NXZB 3H1KH 1L9OA 3V6ZB 5CB4B 4WO4C 32C2B 2P4VA 4UQCA 5TF1H 5KSAB 5K93A 4X9BA 4RA3A 3WS3B 3NJGA 1Q7YW 1A66A 4D8OA 4QTFA 1ENVA 5B1OA 4DEUA 1FVCA 2Q67A 4R26H 2J12B 4C55A 2GPZA 4KROB 4Q7DA 3NAAH 3FB7A 5IFJA 2HT2D 1CFQA 2XQ0A 4NP9A 2WTOA 4OD2B 3RVZA 4N90E 3FTWA 4CAGA 2P5EE 1HEJC 1HZHL 3CCVV 3HTLX 2VLJA 1WLHA 4PWFA 2VJ8A 4P2OB 2Q0ZX 1N0LA 4YHNA 1TZOA 1XTLA 2IC2A 1KYAA 3VFMA 2VZ3A 3CZUB 2NNAB 3FH8A 4ZAKC 3SCMA 2HG5C 2FIRT 4OFYD 5IEHA 5BS0D 2JKLA 1OGSA 2A73B 4Y5XA 5C0JA 4X64O 3DO7A 1NSNH 3IRZA 3OLDA 1LP9A 4N2MA 4P2RA 4X1YB 4WU7A 1A4JB 1S78D 4Y4KB 5JQGA 4NM4H 1OJHA 3Q2VA 1KEML 2CK0L 1LHZA 2F53D 3CVCA 2XDHA 4IRSB 5DS2A 4WGWB 2EICA 5F7HA 4XC3L 3OAWA 2F1BA 3MRIB 2CGOA 1Q90A 5BY1A 4YBLB 3BKYL 1WT5C 2VQTA 1U8MB 5DN6G 2X0LA 2VLKB 1YEFH 2Q6WA 5H4ZA 1RUAL 2LOEA 3GXNA 4A2MA 3SDXF 1QLRA 1SY6H 1PFCA 5ERWA 3NGBC 5EA0H 2QMKA 3O0RH 1YEDA 4NXNB 1DBAH 3NCYS 4IYKA 4GX2A 1VAHA 2JV6A 2FBOJ 3LPWA 5AKVA 1DBMH 1RZJH 3MMEB 5KANG 4X6DA 3HBPA 4KHTL 3NZSA 1I82A 3SQRA 1C12A 4PJFF 4HPOH 3SGEI 2WLLB 2XG5A 3KPNA 2A3QA 4X0NA 2OCFD 3N91A 5IJ0A 2YD0A 3KEHA 3WOVA 3IJHA 5F21B 3TT1H 4FQ2H 2HTLD 4XMUA 3VB9A 3WFCL 3ULVD 1E50A 2OJ1A 2NRDA 3G3LA 4E41E 3B8NA 1FBIL 1DL7H 3GNMH 4F20A 1CYXA 2NUPB 4LSVL 1SA0A 4DEPB 2NW2B 2YKLH 1LE5B 3UJIL 3WBDA 2QVIA 1BHGA 1INQA 2EXYC 5EO1B 3VRIA 2K70A 3FTZA 3KGSA 2WYHA 2FGZA 3V0FA 3K9SA 3S96A 3GWKC 4TLSA 2XN0A 3WFVA 2E5LO 1VF6C 4XHJD 3V5HB 2C7FA 1HI6A 2EKSB 2HT2C 4AUJA 1H6TA 2B2XH 4JFDE 5MHSE 1OTSC 4N1CA 3TV8A 5T1KA 1CICB 1T21B 3REWB 2BP8A 5DD5L 5CD5C 5KA5A 1F11A 2W65B 4LOUC 4JYBA 5LXTA 4AEHH 3QH3A 4NKDB 4D0BA 4OZFB 3DUSB 1QWHA 5DGRA 2DQGH 4JGUA 1KIPA 2VW7A 4FZ0A 4FP8H 4FQJL 4NGHL 5KVGE 2PTMA 1RMFH 3WY4A 1JJ2U 3O8XB 4XXCC 5ELIA 4NWTH 5IKCB 1YMMD 4G3YL 4NHUB 3EYFB 1S78C 3LZQA 2E6QA 1OHQA 2ZYHA 3EH5B 1UFGA 3N5AA 4ICWA 1UPGA 1CE6A 2LW7A 4PDLA 3O3DB 1HH9B 4Z95L 1RK7A 3UTPE 5I1DA 2CHXA 2VXTL 3LN4B 4OJCA 2DQHL 4K94H 5D71L 3S35X 2YQGA 5T5NG 2EAEA 2WKGA 1IBHA 2E86A 2QKIA 4IU3A 2DN9A 3T1WA 3TT3H 4CZZA 2AEPH 1V05A 5I74C 4JKPL 4Z7UB 2XVKA 1RP8A 2J88H 3B8MA 1G6VK 4QIWF 4JBSA 1R5VA 1QFWH 4TVUA 3V4PA 4FNSA 2FO4B 1KP2A 5JQ6L 4E9XA 3L4XA 1ZLSL 4JI6B 3GXIA 4U3HA 1AQKH 5LKNA 5DUML 5IMOA 1URIA 2XQYK 2IPTH 4H8WC 5E5LA 4QAMB 1COWG 1XCTA 2OCCB 2VW4A 4JYYA 4Y1AA 3VXME 5C71A 3D25B 3ZT7A 3SYCA 4NAJA 4M00A 4G9FD 2RJZA 4OIFA 4HX1A 1IAIL 2ZXDA 1KPVA 1SLWA 4RSYA 2OV0A 3AWFA 4RDQF 5GISL 1MCEA 5DZOA 2E4TA 2YPVL 4UOW0 1HVXA 2VQ1A 3MV9D 5C0CE 1XSOA 1FO0A 4HCGA 4YIPA 1IQWH 1MCKA 1BPVA 3DX8A 1GAFH 1P7QA 4H5SB 3CFIC 1QKZH 3CFEA 4IRJB 1IMHC 1AYOA 2BIOA 3UG3A 3K5OA 4B3VA 5DJ6A 1WCBA 4X6EB 1V3JA 1FZMB 3OPZH 3FH5A 5C6WH 4MCYB 2ZUQB 3Q6FA 1PNKA 3FTUA 4JRYE 4XCCH 1S8DA 3WY3A 2OTJV 4DVBA 1QNZH 1G1KA 2AJ3B 2BDNH 3D2UA 5C0BA 1D5RA 4C4BA 4O2CA 3CVHA 1TU2A 2BMKA 3QEHB 4UANA 5D7IB 4WJG3 2Q8BL 3F7VB 3A0OA 2ZX6A 1E43A 4NXMO 3T77A 1GOHA 3B7UX 1KBGL 1QATA 1MRCL 1S9XA 1UXLA 4WUUE 3RYIA 3MRPA 3WKML 1WFOA 2BNRB 1TENA 3BISA 4MMYA 4OCWH 1X5ZA 3K2MC 4F6EA 3GO1L 3I3BA 1FVCB 3FTGA 1RUPH 1HCYA 1VACA 3L9EA 3QCTH 4ABUA 3TF4A 4RBPK 1O7SA 5J6SA 2BVUA 3KJ4B 1BSMA 4K3EL 3RWEA 3V0EA 1OE2A 2B08A 2GIXA 4L1TA 4YSUA 4Z1PA 4HC1H 5I8KL 3KWWA 2EDJA 5SX5K 1CFQB 1K6QL 4NPJA 3B2EE 4HFWA 1MKFA 2Y36L 3AUVA 3HFML 1X4YA 1QSEB 2CTPA 1OAKL 4JG0H 3GMOB 1GJWA 4YHKH 1BBJA 2B1AH 3LZNA 2YGOA 3C87A 1J8RA 3BDXA 1DEEB 4Y9EA 4QI3A 3E1ZA 1P7BA 3D0LA 2KH2B 1AHMA 1VA9A 3BAJA 4PAZA 3TNNA 4Y5XB 2OS7A 1G7QA 3SKMB 1SDDA 1W80A 2R7EA 4AYEC 1NMAH 3H2PA 3MODH 5CCJA 2VQFO 1JZ8A 4P4RA 3DX2A 1WIUA 3GC3A 5JQGB 3FYEB 1CFTB 5CLZA 4ERSH 1LD9B 2P5ED 5C0RH 2MNJB 3C6LB 1MJJB 1FORH 1NC2B 2NX5D 1E1RG 4PA9A 3AB0C 2Z4QA 3B4SA 1SEQL 3CJJA 4HWZA 2YSSB 1NKRA 1CD8A 4U1KA 1EDYA 4AGMA 4X9QA 3BLKA 2JKIS 43CAA 2AXWA 3DJ9A 1M9WA 1VMGA 1KJ2L 2BVPA 2X4PA 1KPRB 4BINA 4WNQB 5ERWB 3EO1A 3R4DA 5AVRB 4AC2A 1ANUA 4PS4H 1YEDB 1JMXA 4UUJC 3L2MA 1WB7A 1EAPA 1MWOA 2WCPA 2KHAA 2IDUA 3VGHA 4JV5B 4LF4B 4FM2A 1P2CB 2LFSA 3LDBB 4X6DB 1TYRA 2Y25A 3R8QA 4TSBL 1MEXL 4IGBC 5GRWA 3KH4A 4PSRA 3GSNA 3G6JB 1IC7L 3CCHB 5FO7A 2XT1B 4NIYE 5IJ0B 5L8KB 5MEQA 3QXVA 5C2BL 3ARVA 5DHYA 1EJ6A 3DC5A 2PO6D 5D4JA 3CSFA 4B9JA 3F5WA 4GKZA 5E2TL 3EF4A 3JV0A 4L1BA 1GC1C 5IQ7L 3LKSB 3P77A 3MTRA 4XVJH 1SA0B 3X1NA 1A1MB 2YHGA 3L75H 1BVOA 5B3NA 3ARZA 2ORBL 1CDBA 3VRIB 1HW7A 1F18A 2H41A 4TKWA 3D36C 3S96B 1M7DB 1OD9A 5EZLB 4LLWA 5JUEL 2OJZH 5IWAO 3CH1B 3T1CA 1HI6B 5EOTB 3KYKL 1CBVL 3TH2T 1HXYA 3RVTC 5KBKA 3ZKMD 4LPXA 3MRJA 2WUBH 4OV5A 3RPBA 3GLZA 5AAWC 3RAJL 1U91A 1IE4A 1XGUB 4MQXD 4Y4HD 5T1KB 3LKOB 1TQCC 2A7BA 1G9ML 3NJFA 2P80A 1AY1H 3ECVA 3H1ZA 4E41D 4FABH 2MTAA 1F11B 2G4GA 1QO3B 1QNMA 5LXTB 1I1AA 1M7IB 4D0BB 1IGYA 1B9ZA 1AILA 1TO5A 1VGEL 1WISA 2JTYA 3V0AC 4AYBA 3OWEA 5ACMA 2G0LA 3LIZH 2DQEL 3MCKA 4I50A 4H20H 4PB9H 1BD2A 4R97C 4MW8A 3MRNA 2C1OA 1JGLH 3QUYB 4H2CA 4NUMA 2NT0A 4H8WL 2DQFA 4JFDD 5MHSD 2D03H 1PD3A 1FIEA 4YFLI 2IJHA 2VE6B 5C08A 3LS5L 3Q43A 1QFUL 2YC1B 4GT7A 4IU3B 1P6WA 4PMEA 4WEMB 4E42B 1GHFH 5FUZH 3SDAD 4XHQA 2QQKL 1SLVA 1WH0A 5D5MF 3ZO9A 2OULB 4KZEL 3BGAA 1KEGL 4B53A 3L48A 4Q89A 5HI3D 5KJRH 2ZJSL 3UQ8A 4KI5C 3BRFA 1HSAA 4L4TA 2PY5A 2DYRB 3HKBA 3B7RL 3OR7C 2DWYA 4APQA 5FEBA 3KXFE 4IIQA 2H94A 2OYQA 4DPRA 3FO9A 5ADPH 1I1FA 3DXAB 4WCEV 3ECBB 1EEZB 3UTPD 4QNPE 3THML 5EF2A 1KMIZ 2OMVA 1XCTB 3FU9A 4I0XB 4Y1AB 5K59F 3ULUE 5AVZB 3B2VL 4JZOB 1G9EA 2XQBH 4N0YL 3FH7A 2RCSL 3EZJB 3TPUA 4G6AD 3LRGA 4DSYA 4Z2WA 4LL1A 4DP1X 5JHLH 5DA4A 2VQ1B 3VO0A 4PJXA 1IFRA 2F7RA 1V8HA 5I16B 5AWNH 1P7QB 1RJYB 4NKIL 4BZ2H 1RZGA 4CN1A 5H35A 3CFEB 1E5CA 3H9SA 4QXUH 4TV8A 1QTSA 4N0CD 4I9WA 3V0JA 5AD0B 3NBNA 2D73A 3VXMD 5F1OB 2FYYA 2X09A 4XPHH 1PF3A 3ZKMC 1E4KC 4AGPA 4F15B 3HG2A 4MQXC 2K6ZA 4Y4HC 2UUAO 5KHHA 1E30A 2G2NA 2HLAB 2A6DA 4JG9A 1VQ6V 1RPUA 3HMXH 3FT3B 3GXDA 3NIGB 4IBTA 1IC4L 3VTAA 1IBFA 2DYSC 2OWOA 3CTTA 5KEZA 4NQSA 3KCXA 4K23H 4PJ9A 4DV0O 5C0CD 5TE7L 1H19A 3PCYA 3D2UB 4YDVA 3H01A 2EIMC 2LGQA 1CU4L 4TUKL 2E4FA 4M6NL 4U1HA 5DHXB 1WWBX 4MVOA 2FJFB 5IHUL 5I0VA 1S9XB 3IE4A 2BRRL 3GXMA 3K2UH 3GHPA 5IESL 4PRNB 3HI1B 2W07A 3CXDL 3MRPB 4HIIA 1E8YA 1FJ1B 2OQJB 1ZHBA 4LASL 1BF5A 1JFQH 1WAAF 4EKXA 2FLRT 3S3PA 1F45A 3R1GL 4NLHA 4FLTA 4AK1A 2JCCE 4JRYD 4J3SA 3IGAC 2QGNA 4JPVL 4MA8L 3N40F 5GZNA 5GS2H 4OAWA 3K79A 1ES0A 5E7FA 2YUAA 1AO7A 5E2JA 3E83A 3OAUL 5LAXB 3DRQA 1PS3A 1Q6IA 4AZUA 4GMTL 2UXNA 2IFFH 4NQXA 5AOIA 2OYLA 4LCWE 5HI3C 1HJBC 2ICCA 5EBMB 1IV8A 5AAMC 5CM1A 3ULUH 3ARUA 2XRAL 1LLAA 5IF0B 3WCYA 3RIFK 2VDNH 1KCSL 4R2GD 3NH7H 3HZKA 4WUUD 3RVYA 2MIZA 1N18A 2OM5A 3WO3B 3B2DC 2P67A 2X4SA 3K5NA 4JDTL 2V7QG 1CQKA 1IUZA 3MOAL 1QRNA 1RZIA 1W8NA 4XB8A 3CN2A 3TURA 4FVMA 3SN6N 3V52H 3FX7A 1UCTA 3TNNB 3DX7A 4ZDHB 5LO7A 1IRAY 4HWUA 4X5LA 2FNBA 2WTRB 1O6TA 4FFWD 3GMRB 3VXSB 3QVNA 2A4CA 2B5IC 4P4RB 4W9HC 1W0YT 3RURA 3C5JB 4A5UB 2VMCA 4O02B 1DCEA 2OI9B 4KK9D 3QFJE 1MI5A 4N9GA 1TOXA 4P23A 5DJ2A 2DMCA 3ZX1A 4M48L 2TRYA 1SRYA 2E46A 3UPCA 2E3CA 4HWZB 5CS7A 5J7CC 5HGAA 2N7AA 2QTEA 5DFTA 2IPUG 3MGAA 1KBVA 43CAB 2N7SA 1GC1L 2FSEB 1DEDA 5DUBA 3PHOA 4J4PA 4NX0A 1HCZA 2BERA 1EEUA 4V1DE 3KLHD 5I28A 5MI0B 2X4PB 1N19A 5TFSH 2ADQB 1NFDB 4ZHQB 4DYLA 4HOXA 3EO1B 1OD7A 4HPYH 2YS4A 5E4EC 1Y66A 5EEVA 2W9EH 1UATA 2HLFD 2JKSA 3DMMA 2CO4A 5EA0L 2Q20A 4X8JB 1RUKH 1YVLA 4HHWA 1M05A 2WQUA 5D7JB 3ALXA 2X6VA 1XHZA 4PJFE 3SYQA 5I15H 1HDMA 2JB6A 3QIBB 5F1IA 2FX7L 1RIVH 4J3XA 1Q0YL 3AROA 4N9OB 4MJ6B 4FF9A 5F88B 5DR5H 1XD1A 2CO6A 5J13B 2VAAB 1MFDH 3ZTJG 2KI6A 4FA7B 3P77B 4H33A 3T0VA 3VWKD 4XN4A 3MJ8A 2XXFA 4HJUA 3VRLF 3X11A 1X9RA 4QT5A 4ZD3L 2DAVA 3SKOB 2X70B 5DD0L 1YXBA 3L81A 2IDTA 4LLWB 1N12A 4LRNH 4LVOB 3O6LH 3IBEA 5HJDA 3FDWA 4EI5C 2XVGA 2KZWA 2RHEA 1MFNA 4OV5B 5CGYC 1D5IL 5D1ZA 3U6XA 4X4YA 1JWSB 1U91B 5E9DA 1BVLB 3IMBA 1U96A 1KGIA 1JJUA 1IBMO 1T5EA 1L4IA 3E9UA 4WWKC 1EDQA 1Y18B 3IPFA 5HDQL 4FYTA 4QJFB 1IGYB 1YY8B 4XPTL 4XP9L 3JD4A 2ESVE 4UOZA 1MW0A 2RB8A 5F70A 5F9WC 1MNUH 4O4HB 1XXFC 4I50B 3CU1A 2E76C 1BD2B 1LK2A 4OD1L 4UQIM 3RYHA 2FECL 3NESA 3SKNB 4A6YH 2FHBA 5ES4B 1S9WB 5CJ8A 2JB5L 3LN5A 5CP3A 5CWSB 1R3KA 5EOCJ 2DQFB 4FKHA 4Z7NE 3LRSB 3DHUA 2QGCA 1SF9A 1F97A 4Z7WE 2E74B 1Z7JA 2ZWYA 3IF1B 3EJTA 4LHJB 3H1IH 1TNMA 4QO1B 5DEJA 5CNHA 5EUKB 1TQBC 3P0YH 1L0PA 3S0PA 3IFOB 5ITBL 3IDMB 2P8PA 2AEPL 4M62H 1Q43A 4WSKA 3BO8B 7CGTA 4JFWA 2VXQH 2WBWB 4HMCA 5F7LB 1G7JA 2F6AA 4UIKH 2Y1VA 2JFCA 5KMGA 2XBDA 1IBLB 4Z5RA 3L45A 3C09C 2A77H 4YFLF 1T1YA 5LBSH 4OCLC 3L3JB 4GUCA 1KV7A 5IYDO 2OL3A 2Z64C 4TV3A 4EUPB 3HZYA 3K0YA 1G0XA 5H6QA 1EMTL 3CCRV 4HISA 3FU7A 1ACYL 4G71B 4HOWA 2PUSA 5K1PA 1I7TA 4OM0H 4JVWA 2C1PA 3QXTA 2XG4A 3L72H 3JUYA 4GIPD 5HYEA 2WMPA 3TPUB 2BC4A 4UDTB 2NNCA 4N2NA 3HMWL 3IRCA 1XF1A 5FLUA 3BP7A 5GS2D 4WWPA 4NJAH 2DI9A 1GGIL 4NHCL 3V9FA 1HX0A 4UCTA 1J18A 3KXFD 1QHOA 1RZGB 1Q5OA 4PJEF 4Y5VC 1SKVA 4GX0A 3PQYB 1NC4A 4WTZG 5DS8A 3MROB 3RZCA 3VACA 5K33A 1Z5WA 5E00A 2D7TH 3ULUD 1QKZL 4W9LC 1U8OA 3AMLA 4PN6A 2X1OA 4PJBA 4ZG1A 1NM4A 2OAAA 1U3ZA 3K3QA 3LSOA 3Q6GL 2X40A 5IB1A 1F13A 5IY5B 2DTSA 2XZCH 2IV9A 4X1KB 5LGYA 4LGPB 5IMKA 4QXVA 3TBCA 3SDCD 3PHQB 1KFGA 3ARFD 5KVGL 3CBKB 3OPZL 4NQSB 4PJ9B 1XEQA 3IVKA 4B08A 1S77D 1I8IA 4R4BA 2EILB 3QUGA 4DR6O 4PJAE 2DQCL 1FAIH 2G60L 4HK0A 4U1HB 3W7TA 1VQKV 1U8CA 3BAEL 2N56A 3D85D 1UJ3A 4GAGL 4XP4L 4MJJA 4DV2O 1UUSA 5TGBB 3MRMA 1YYML 5EPMB 4HUUB 2GTQA 2EIEA 1BZQK 2W07B 1B0GA 3K04A 2WZAA 4HIIB 1MN4A 3BPNB 3AK1A 1J9SA 2O5NA 4MB3A 1WVZA 3PLYA 5L3DA 4U6HB 4X8GA 5DC2A 2SEBB 1CLOH 4U1LA 1QQDA 1AGCA 4LEXL 4PV1B 1EN4A 4AEEA 1AO7B 1ZANH 2YA1A 1A7QH 1VEWA 4B7KA 4FQ1H 3CSPA 5E1HB 1IBBA 3CZLA 5FWQA 4JB9H 5D4IA 5EFIA 5B39B 1NAMA 5HXMA 3MFFB 5FDYA 4F57L 1AMYA 1L7IH 2J25A 3HZKB 3WJLA 1IX2A 1BVKB 3APCA 3BSZL 4GSDH 1EGJA 1R19A 2PCXA 4OZGE 4W68A 1E28B 1TTFA 2X4SB 3AS0A 3F6LA 3QDJA 4QY8A 3STZA 4L8DA 2VIRB 2OYMA 5KSUA 4DTGH 5DA0B 4KO5A 3NA9L 3FOLA 5CIPB 3MUY1 4LSSH 3LRKA 5JLZA 3VA2C 2VZUA 2DD8H 4PRBA 4LCWD 1T89C 1IAMA 4OZHF 1NMAL 2CBOA 1JV2A 4EUPG 3ARDB 5J11C 2Y07L 1HP8A 1EXUB 1MI5B 4B7IA 3BP6A 3TVMB 3ZDXB 5D9SA 2CGRL 1AXSA 2V4DA 5DO2D 3ZCCA 3ARGD 5DUBB 3PHOB 4FD0A 3DURA 3CC5B 3H42H 5EHFA 1NBVL 1PD0A 2F8VA 2QWRB 5ICZA 2FO8A 4NYKA 12E8L 3VAEA 1F51A 3IDUA 2YAPA 3IWUA 4K3DH 2DQDH 2C34A 3SDCC 3CC1A 2PXYD 5E6ZA 1HNWO 3KPLB 4K3GA 4HLJA 1XFPA 3DMMB 4ODVH 3VYNA 3US1A 2J1YA 1CMOA 1MHCB 3PUUA 5E2WH 3QFJD 1P4LB 2M26A 3JBG7 5F96L 1U3HC 4P99A 1QEWB 5F1IB 3E8FA 1IM9B 1COBA 4G7RB 3NK4A 4UQBA 1JXFA 3E8BA 5DMIH 4MD4B 4V1DD 2CBTA 1N59B 3WKPA 2CO6B 5CO1A 3SJCC 1SZNA 4FLYA 3GJEA 4ZXBD 4JQIA 2OYKA 2RN9A 4X80L 1RZ7L 1ETJA 1R0AL 3X11B 4H44B 1OT4A 2NDGA 5H2BA 1EO5A 1WPBA 4U7NA 2O5YH 1UUNA 4G80B 4NRYB 4JFHE 3P32A 5ADOL 3W9EA 2ZOWA 1DQKA 5LHGA 3OZ9L 5L0QC 2KERA 1MZZA 4K2UL 1ZPUA 2VDQL 3B9EA 3HZMA 5AW8B 3VFVA 2IBZX 4AMKL 4Y2OA 5JIHA 3I6SA 1VZIA 1QBLH 1WGVA 3P3TA 3IAPA 1WZMA 1R34A 3P69A 5F7BA 1QZ1A 3A24A 1D2PA 5I73C 1U8KB 2R9RB 3S3JA 4AC4A 3HRZA 1Y6MR 1MIML 4YSCA 4BR6A 1K72A 1NTKH 1NMBL 1RURL 3KS0H 2UYLA 5B39G 3UMNA 1T5KA 1EAQA 3N27A 4DUVA 4OKDA 4QLRA 3WEOA 4JJ5A 1XH3B 1EZVX 2OR9H 1T22A 1N8ZA 1QUNB 4KUZL 4LCYB 1URLA 1O7VA 3LN5B 3CSTA 3I9AA 2RQ8A 1EUTA 3U6XS 3ES6A 2AJXL 3ZLQC 1X9QA 4HSCX 2VDRH 1XMWA 3ARQA 2AAAA 4FULA 3OGCB 4LQFH 4TULH 3BCDA 3CZFA 1LGVA 3EOYG 4FG0A 3RZWA 1W59A 1F6AB 2DB8A 2HRHA 5DO2C 3ARGC 1ZVNA 3UYRH 4K7FA 4LLUA 2ESVD 2F8OA 4JZNA 2BIIA 4L2YA 5A16B 2Q2EB 3IKCA 4MA7L 5F1NA 2X0VA 5FL7G 3L3OC 5EUOA 5HY9A 4RGOL 5B1AC 4DV6B 3LD8C 1G7JB 5HI4D 3KNBA 3EYOB 3QEQA 4KKBC 4JZ2A 4O5LL 3GMMB 4M4RB 2JKXA 2VABB 3UERA 3CFUA 3BVVA 3BZFA 3DNKA 2XV2A 3T1HO 2YKKA 4M1GH 2OL3B 1P1ZB 2R69H 3MOBH 3MRCB 3HZYB 4CC6A 1SXAA 5K59E 2KC0A 3A21A 4NXNO 3B7TA 4NQCA 4N6RB 3TBSA 4AL8C 4RAHA 3T0EA 5PAZA 3AITA 2XG4B 3MZTA 4XMPL 5F3HA 2WMPB 4HD5A 2BNQE 4ZOLB 3BA9A 1DBKL 2BSSA 2X3BA 3INOA 4DV5B 4ZXBC 3HS8A 4S11A 3TXAA 2BC4B 1T80A 3QO0B 3VA6A 3RY6C 4AZ8B 5E99H 4BK5C 4BZ1L 5DWUH 4LSUH 3GSXB 2VISB 4PJDF 3NIDB 2CO3A 4PDRA 3IMVA 2YQ3A 2JJSC 4S1SH 1NC4B 4P46B 1I85A 1KXTA 2X4UA 4NZ8A 2MJWA 1W0VA 1WD8A 3LCYA 4JAAA 4P5TC 3BXNA 4YL9A 5KZCD 1I8MA 2NUTB 4PJBB 1YEKH 2ZE6A 4Z1VA 1J5EB 4LRIC 4XDKA 4X98A 4J6RH 5IB1B 2ZXQA 5AB1A 2VDLH 2NY2C 2P8LB 4UB0H 5IMKB 3IMUA 2E9GA 3ZHFA 1FNGA 3ESUF 4HIXL 1ROPA 4MA3A 4MZIA 3TM6A 2FJGA 2ICWI 2KPNA 4BH8A 1JVKA 5I5RA 1I8IB 2X05A 1KCUH 4M3JA 4O2AA 5F6IC 1UENA 4KAQH 3V6FA 5IQ9B 4XWOD 1UA7A 1QOKA 3TO4C 2NLJA 4UYPA 4YDLC 2KT6A 3VFGL 4P4KA 1D6VH 4PCSA 4KTEL 4LOFA 3G6DH 4JMNA 1SM3H 1IILE 1THCA 2FJSA 1H2LA 2CZNA 1WAAE 2XA3A 2XTJE 3RUGA 4W6YB 1E7UA 4U1LB 1X5IA 3KMDA 1J10A 2VDPH 4IHBA 4ZQTA 2J43A 1EQWA 4JGJA 1AS7A 1EO7A 3Q7JA 2GTWA 4B3RB 2MNUA 5GGRA 5C09E 1F6LL 4OLVH 2N59A 4JHUA 4PB0L 4DV4B 3KCYA 2HH0L 3RPKA 3HNSH 2GBAA 2WXFA 5EFIB 3LH8A 4MASA 3LN9A 3GQFA 3ZRWB 3N2JA 5HI4C 5BVPL 2BE3A 2EXSA 4NT6A 4MFHA 3K5LA 1SBSL 3RDTB 1AR1D 2I69A 5EC2C 1EXHA 5LNDA 2UUBB 1I9JH 2MPAL 3STZB 3V0HA 3QDJB 1J9CT 1RJLB 4M93B 5JYMA 3CHRA 5I8OL 1Z9OA 3IDJA 2FQEA 4BFIA 3PWPB 5GRVL 4DRXA 2W0FA 3OAAG 2RACA 3FOLB 4LLYA 4HIEA 1T2QL 3QJHA 1YDXA 4L4VE 4U6TA 4Z7OF 5JLZB 1S7TB 4QKXB 3ETQA 2J8OA 2BWQA 1GIGH 4PRBB 1QWNA 4I18C 2EIJB 4PCYA 5I26A 2X6CA 4X65O 4I13B 2BVQB 3GTTA 3WTWA 2EC9U 5IROC 3DIVA 2UXDO 1HOCB 5ESQA 3QUMH 4NOFA 2NW3A 4QHNA 3ZT5A 1AXSB 3CIAA 1T0PB 1Y1UA 3SGKC 1OK0A 4CBZA 3HE6D 4KI1A 5GZOA 2RMKB 5AVWB 3CFKB 3FT9A 1RY7B 3ZDZE 4X4XA 5ICZB 2WPGA 3PGFL 4GFTB 3RYFA 5FPIA 1A5FL 3LSSA 4J8QA 3SPHA 1I3RA 2HYMA 1KJMB 4WW2A 5BZZA 2V6HA 3MV8A 3TIEA 4JFOB 1DBBL 2FVNA 2QPEB 4OJFL 3U9PH 1S9VB 2K6WA 5CEZE 2E8ZA 4HXBH 4I0PA 3CLFL 3SY0A 2EO7A 1OAUH 5J56B 2FT7A 3V0GA 1L9NA 4LCUB 4GP5B 4MTOA 4GG6B 3KPPA 5AYTA 5L3GA 5L6YL 3BT2H 2ZCLL 4RH4A 3IJYB 2CKBH 1TMCB 5IVNA 1DBJL 4JFXA 4LARH 1T5WA 2WBJA 3E2EA 4P2YA 1LUWA 1QFWM 5I24A 3GLEA 3ILDA 3DHPA 3VRLE 5FF6A 2CA3A 4WQOA 5HJBA 3W39A 5I1KH 4KDWA 3VVWA 1SXBA 2J1WA 3UH8A 1GKFA 4OCRL 5J1AA 3AREA 4LIQH 1CDHA 2UXTA 3M8OH 2YSUB 5JHAA 2VM9A 5TK4A 3T8XA 3PF2A 3U9WA 1QSFA 4G7QB 1BG9A 3GI9H 5C7ZA 5MEOA 4FK5C 4X66B 4NP4H 5E8EB 1KBBA 5HHME 2X9WA 2RQ6A 1BZEA 3ABZA 3HZMB 3LMJH 4QGYA 1AR1C 4KRLB 3VFVB 3FCBA 4CH3A 1V5JA 4D8PA 2EYSB 3QDGE 4JM0A 2J8UF 4RGMC 1HTYA 4R7VA 1FCCA 4QJ4B 2OSLA 4LP5A 5FIEA 2CJUH 2XIIA 4U1GC 2RTTA 4ISVA 5AW3B 4X88A 4RZCB 3O41A 2WO4A 1EO8H 1WAPA 3ZJAA 4QRRE 5C0FA 1A6VL 2BH0A 1T22B 4P2QE 1N8ZB 4RAVA 2FL4A 3JTSA 3MO1A 3FT4B 4JFHD 2NY4D 3V5KA 1IC5H 1W2KT 1RULL 3L1OL 1JZIA 3ES6B 3T65B 4AV4A 4P5KA 1V9PA 2ATKC 4GO8A 4DIXA 2RBLA 5DJ8A 4AL8L 3GSWB 4ODWB 1ETZA 4NI3A 1NCCH 2AZ2A 4B96A 5JJEB 1S72V 4K7FB 4K9JA 3OKLA 4CSPA 3MLWH 5I0XA 1TCRB 1OP4A 1M56B 4P9HC 4IOSD 4V2CB 5SWZE 5L2KE 3B8SA 5EUOB 3ZVVA 1HHJA 5HY9B 3VXUE 1IBYA 3HC3L 1S2EA 3QR0A 4XCNA 1V10A 1UG9A 1IM3D 5DHVH 1SDAB 4N2DA 3SD2A 2VR6A 4IQHA 4AWJC 1RZ8A 1N4XL 4M7ZB 3R7QA 2XTSA 4PDMA 3B2MA 4EB6A 2ZG2A 4NZJA 3JT0A 2N05A 8CGTA 3NR7A 1LVEA 4JPQA 1YNLL 1GGBL 2E75C 5LBSL 6CGTA 4NQCB 3TBSB 4DAGL 3UTZB 1EANA 4U3JA 5F3HB 4ANWA 4WHYG 4ZS7L 4OCMC 5HFMA 5AVYB 1SHXA 3BAKA 3T2NL 4QWWD 3ZYIA 1FD9A 1X4TA 1EJOH 1MWAH 1CG9A 1KTBA 2RALA