2DYRB

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2006-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dyrB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dyrB02
2HZHA 3CVBA 3UADA 1BXAA 4BDVB 5F7AA 3UAAA 3X1FA 1IC0A 1YLBB 1W6WA 3X1BA 2XWZA 1L9PA 5LDUA 4P5RA 1SJMA 2QPDB 3JTBA 1QHQA 3AY2A 3PLYA 4YVUA 2GC7C 3TA4D 4A68A 2PLTA 2IDUA 6PCYA 2R7EA 4AZUA 1E5YA 1SFDA 1ZPUA 3NJIA 2GBAA 4DP0X 1NPJA 1BXUA 5B7EA 2IH9A 1XB8A 4A2DA 2UXVA 4DP2X 2QT6A 3C75A 3NT0A 4QLWA 2VSMB 4DP6X 5D4HA 1JZGA 2PPEA 4Q8BA 4DPBX 1SHXA 2XU9A 2YQBA 5D4IA 4BDVA 1AG6A 2H47C 1QLEB 4KO9A 4KOBA 2JKWA 1OCCB 4N8UA 2IDFA 3S3CB 3ASNB 2HXAA 2J57A 3SBRA 1AZBA 3NJLA 3QJQB 1PNCA 2EIJB 2UXGA 1J9QA 2BO0A 2E86A 7PCYA 5F7BA 3V9EA 3FSWA 1AOZA 4G7RB 1OCRB 3T9WA 2BP8B 2FQFA 3ZBMA 1KDJA 2DWSA 1GS6X 1ADWA 2FTAA 4JKNA 3PXLA 2OV0A 5PCYA 4BXVA 1OE3A 3ZDWA 2IWFA 4DPAX 3PPSA 1N68A 2AVFA 4YSRA 2J55A 4UANA 4BWTA 4GYBA 3WG7B 1E30A 1AZRA 2MTAA 5I26A 5I5IA 1SNRA 4QKTA 3QJVB 1BQ5A 3CVDA 4KOCA 2CALA 1ASQA 3WI9A 3UACA 5I6NA 2XV2A 3CG8A 3FSZA 1NIDA 1SFHA 3UGEA 3NJFA 4F2EA 1AIZA 1V55B 2VW7A 1TKWA 2YAQA 3EHBB 1SDDB 2DV6A 2PPDA 3S3DB 4YSDA 2BW4A 3ERXA 2EINB 1NIEA 5B1JC 2FT6A 1W8EA 2BP0A 1A4AA 2DYSB 4BXSV 1X9UA 4GY4A 5AFAA 2BHFA 1CC3A 3BQVA 1FFTB 4HALA 1JZIA 1A65A 3G5WA 4M4RB 4YSQA 2YARA 4G7QB 2WO3B 3BVDB 1PZAA 3L45A 4E9WA 1JZEA 1SDDA 4MFHA 1B3IA 2QDVA 1A8ZA 2Y1AA 1V54B 2GI0A 4CSPA 1PMYA 2CCWA 4KNTA 4BWWA 4YSCA 4P5SA 1J9SA 4AKQA 2I7SA 4TXVB 1IBYA 2OJ1A 1HFUA 1JOIA 2IDQA 3IN2A 1L9TA 1AACA 5I28A 1OOWA 2VSKB 2X88A 2DY2A 3AW5A 3DTUB 1ET8A 1WA2X 2FJSA 2QDWA 1BAWA 3EH5B 3HEIB 1AZNA 4YSPA 2FT8A 1JXGA 3EF4A 1HAWA 3TBBA 3FQYA 4N4YB 5PAZA 5AZUA 2LLNA 1BYPA 3KW7A 1JERA 3OQRA 3ABGA 2PPFA 2TSBA 2JFCA 2HX7A 2FT7A 5AKRA 3S8GB 1RKRA 2NRDA 2VN3A 2ZONA 1JVOA 1JZJA 1L9RA 1NIAA 2PCYA 1E65A 2XUWA 3IE9A 4K9JA 2I7OA 9PCYA 4HHWA 5D4JA 3T71A 3ZIYA 4E9RA 2YAPA 3H56A 3X1NA 3SBPA 1BEXA 3IBOA 4YSTA 4YVNA 1BXVA 5B1BB 1J9RA 4E9TA 3ASOB 2CAKA 2EIMB 1NINA 2GB2A 4ENZA 4A67A 2EILB 1CURA 3NSYA 1J5CA 2Y69B 1PAZA 1MG2C 2YAEA 2UXTA 3AG2B 5I5MA 4AKPA 1QNIA 1AR1B 5I6OA 4E9SA 1J5DA 1OF0A 4YSSA 3GYRA 1WAEA 1KDIA 2W8CA 3TASA 2XXFA 1WA0X 3T6VA 3FYIB 4YSAA 1ID2A 5I6LA 4UF7C 1AS8A 2FQEA 3AZUA 3DIVA 4A2HA 1PZCA 1XB3A 1CYWA 2XVBA 3D12B 3FSAA 1NPNA 3T6WA 3JT2A 3X2QB 2GHZA 2TSAA 3WIAA 4DP8X 3EH4B 5ANHA 3QJRB 5B1KA 3QJSB 1ZIAA 3SBQA 1MZYA 3FU8A 2YEVB 2CUAA 1GSKA 1KGYE 4FAAB 3OMNB 3FQ1A 3HB3B 4YSEA 3PAUA 1AG0A 1PLAA 4E9QA 2UX6A 7PAZA 1KCWA 2QPEB 1SF3A 2UX7A 3CVCA 1UATA 4GP5B 1JZFA 2BP8A 1KBWA 3OM3B 2IWKA 3H4FA 4ZK8A 3NJGA 2ZWNA 1JZHA 1EZLA 1RCYA 4KNSA 2J5WA 1OE2A 3T6ZA 4RH4A 1XMEB 5B7FA 3PCYA 3FU9A 4UAHA 2YAOA 1EHKB 5I6KA 1AZCA 2ZXWB 3OMIB 1F56A 2DWTA 4PCYA 3MBWB 2GSMB 1SHWA 2XX0A 4KO5A 3UAEA 3QQXA 1AAJA 2CBPA 1ZIBA 3ZX1A 2FQGA 3CDZB 2IH8A 4A2EA 1JXFA 2YAMA 2VW6A 1XB6A 4YL4A 2VW4A 3NJJA 1AS6A 3X1GA 2XLLA 2XV0A 3ABKB 1M9WA 2VMJA 1TEFA 4JHVA 3NSFA 2FWLB 1URIA 1ZDSA 2YXVA 3S8FB 3DKHA 3MX0B 2P80A 2HX9A 1GS8A 1GY1A 2UXFA 5TK4A 2EIKB 2PP8A 2BW5A 1BQKA 4A2FA 2Q5BA 2BZCA 4E9XA 1PCSA 2PPAA 3OD3A 4GP8B 5I5JA 3T6XA 2B3IA 1E67A 3CDZA 3UABA 1ASPA 2J56A 2H3XC 3GDCA 5E9NA 3PAVA 3IN0A 4PAZA 1NDTA 2W88A 3FS9A 2XYBA 2YAFA 1IBZA 3WKPA 1NZRA 4HZ1A 2OCCB 2IDSA 4Q89A 3NSDA 3SQRA 3AG1B 3QJTB 3WKQA 2P80D 4JHUA 1ET5A 1NIFA 3QPKA 4DP4X 1MG3C 2HRGA 2PP7A 1IUZA 3NJNA 2IWEA 1NTDA 2PP9A 2ZOOA 5TK2A 4A2GA 2WO2B 3NYKA 1ETJA 2XV3A 2BWIA 3WNJA 1TEGA 6PAZA 2N0MA 2AANA 4G71B 3ABMB 1KYAA 2VM3A 3NJHA 1E5ZA 2B08A 3NSCA 3AG3B 1BQRA 1ZV2A 4CSZA 1NICA 3AG4B 1AZUA 1OCOB 1GS7A 3N55A 2VM4A 3TBCA 1WS8A 3N2JA 1W6LA 4BK5C 1PNDA 3FPYA 1PZBA 3CZUB 1ILUA 1MZZA 2PPCA 1RZPA 1RZQA 1J9TA 2RACA 8PAZA 2A3TA 4BWUA 3NP4A 5B7MA 1GY2A 4NERA 1M56B 2I85A 5I6PA 3TU6A 1FA4A 2FQDA 1GW0A 2HX8A 1ASOA 3OMAB 1KBVA 2GC4C 1MDAA 4HCGA 3IEAA 1A3ZA 1NWOA 2GIMA 1WS7A 2X87A 5B3SB 3QJUB 1JXDA 4L0PB 3V9CA 3ABLB 4F7KA 4YSUA 1DYZA 3FPXA 4M3HA 2BWDA 1TU2A 4KO7A 1AS7A 1AANA 4AI7A 3KW8A 2BP0B 4G7SB 4WKXA 2MRYA 4DPCX 4DP1X 4HCIA 4G72B 4GXFA 3H4HA 1ILSA 2AZUA 4WTQA 3GXUB 5EHFA 1PLCA 4GP4B 3NJMA 4DP7X 4E9VA 2CJ3A 3FU7B 2AZAA 1M57B 2HRHA 2WSDA 1KV7A 4HAKA 1KCBA 2XXGA 1WA1X 1R1CA 1ZDQA 4KO6A 1OV8A 4DP9X 1PLBA 3U25A 4FA7B 2PCFA 4E9YA 1I53A 4KNUA 1N70A 4DP5X 2IAAC 5A7EA 3FYEB 2HLEB 3X1EA 1OE1A 1HAUA 1A4BA 1FWXA 2JXMA 1IKOP 4W9ZA 4X4KA 5IY5B 1DZ0A 1CYXA 3FSVA 4AX3A 1V10A 4W1TA 3FT0A 3FU7A 1OCZB 1L9SA 1SF5A 1L9OA 3PAZA 3RYMA 1PY0A 1CUOA 1X9RA 2IDTA 2YXWA 3NJKA 4NAJA 5FC9A 5B1AB 4F2FA 1BYOA 1L9QA 3NP3A 1NWPA 1ET7A 1VLXA 1GYCA 1JVLA 4HCFA 5I6MA 2AFNA 4EF3A 2BZ7A 2Q9OA 4HHGA 3FQ2A 4G70B 4HIPA 2YAHA 1GR7A 3S3BB 4A66A 4AKOA 4YSOA 2R7EB 2XX1A 2FNWA 1A4CA 3WNIA 1PF3A 2DYRB 1T5KA 1NIBA 1AQ8A 2H5UA 3EH3B 5B1JA 4NB7A
chains in the Genus database with same CATH superfamily
1Y74B 3GMOB 4JY4A 2H9GB 4PLKD 5HDRA 1TQCC 3W0WA 1OK0A 2NR5A 1OAJA 3HRPA 2XWZA 1G6VK 5L3BA 2YRLA 4MAYB 2NY5C 2DAVA 3MRLA 1R5IA 3QQDB 1MUJB 4IM8A 1FZKA 1SXZA 1F1AA 4H8QA 1M53A 4GLXA 2HJFB 3HE7A 4UTAL 1HL5A 2QHRH 4LASL 3VSTA 4Z7WB 3TBSA 1QEWB 2ZIMA 2LLLA 3TT3H 3D0VB 3MUGA 4QWWC 1U58A 5DUJA 4XAKD 3FQRB 2IANB 3VGHA 4WNQB 5LWYL 2GBAA 1XD0A 3WNKA 4GS7B 5IF0A 2ZNJA 2NXZB 2JVUA 3T04D 2E74C 4ERSL 3U4BH 2R72A 4MKTA 2YPLB 5D2NB 5KAQG 3ARUA 3JZYA 3BXNA 4ILDA 1SHXA 4NC1C 2K3TA 4KKBD 4HPOL 3UPCA 1HH6A 2Z35B 3MYJB 3MJ7A 3QIUA 4LK4A 5AL8A 5DVMA 4KO9A 1OCCB 2N59A 4F7MB 1H6TA 5D5MB 5L4IA 4I0XA 1PZ3A 1ZL8B 3ML8A 2Q7GA 2CLZA 4NWTL 5C0BB 5LDSA 1RULL 3P9LA 4IEFB 2R0ZH 4HWZB 3DMMD 4XN1A 4N0FB 1I8MB 4XPBH 1KXTB 5KBKA 2PYED 3QDJD 4JAMB 4JQXC 4WFEE 2JTYA 4Q14A 3VG9B 3ZBMA 4DK6A 3K72A 4LSPL 1WB7A 2XFGB 4J4PC 4XNZB 4TMPA 1H2LA 2RTTA 4YMPA 1XZWA 1BOGA 3P3UA 4OF7A 5BMFL 4GFTB 2ODHA 3QXTA 1QR9A 4PLKC 5DLLA 4DPAX 4LCVA 1B0GB 1U8MA 2YPVH 3ARVA 3SIKA 3HRZC 3RKPA 4KVCL 4JFTA 4FS0A 1AZRA 1P7KA 4U1JA 5KVEH 3A2FA 1R9FA 4L48A 5ALBH 4BQ6A 1A6WH 1KT2A 4XXCA 4W6XB 2B9ZA 4O5LH 5H2FZ 2FCBA 3RKDD 5J5EA 1AILA 3FFCD 3P73B 3G6AA 2YD2A 2ZUYA 5I0WA 1J0KA 4F2EA 3P4MB 5GISH 3MLYL 3BJLA 4NNYA 4ETQA 1KJ2A 2GITB 4Q6KA 4EUPH 5F7HA 2XKUA 2AI0H 2BW4A 2ZD0A 2Q10A 2Y2TA 3D3QA 1J10A 4HGWB 4ZFQA 1A4AA 1E8WA 2ZIDA 4LASH 1C7SA 3JXAA 3VXPA 3K6OA 4FLWA 3QNZA 2BS8A 2B2XH 3AQXA 3E80A 4O4HA 3NZ8B 2VJ8A 3CVHB 3CUPA 1FFTB 1WJZA 5LWYH 1JZ6A 3GI9L 1H3PL 2C4FU 4UINL 1EK3A 3D0LB 3BA9A 1MWAB 1QO3A 5JTWA 4GKKB 3ZX6A 4NPYB 3K5MA 5IVZA 3VXRB 4BSWB 1KFAL 3D39E 5B39G 4LOUC 1KB9K 1NBQA 4R7DB 1KOAA 1AHWC 4UWQB 3L5IA 1NFIA 4MFHA 1B90A 1A8ZA 2Y1AA 4KFMA 5ACZA 1Q0YL 3VWJD 2XWDA 1O6TA 3R8QA 1FG9C 1RULH 5EOQL 1FI8C 4KDWA 4F80A 3TZVD 4K2UL 5BZBA 2XIIA 3GSVA 1YJ9V 2YD4A 2QSVA 4R7LA 1ETB1 5EZJA 2JKXA 2O93L 4BD4A 3AW5A 3V0WH 2CIKA 3V6OE 4Y16B 3RKDC 2EIMC 4NQCD 2ARHA 4L05A 3C3TA 4X6DF 3BZEA 1KTLA 2PTTA 1R5VA 3N3EA 2HVKC 1B0RB 4H2AA 4U1HA 5GRJH 4KVCH 1FJGB 4B0MB 5GGUA 2ATPB 2YXMA 3B2PA 1OZTG 2APXA 1QZ1A 3QE5A 2PWDA 3NJXA 3OQRA 5INCA 1J88A 1PVHA 4OZHE 5SX5H 4E41D 2P46B 1OGSA 3US9A 3CFCL 5DXWA 1IB5A 1CS6A 4GRWE 4JRLA 2K9FB 1TUEB 4GEIA 4OLZL 4NB5A 1ZSHA 1N64L 1E28A 1MFDL 1JQ0A 3JD4A 1RURL 2L7JA 3HE6D 4WRLA 5D4JA 1MJ7L 4KY1H 3N04A 5HYSB 3P9MA 4LQFH 1YEFH 5C86A 5BZWA 4MNQE 3THOA 2EIDA 2YAPA 3SPCA 1V27A 3ETEA 3DDFA 4HFWA 3RNKB 3QUXB 1OL0A 5HHQA 1TF4A 3BI9X 3QUYA 3ARDC 2XN9B 4OLUH 3VWJC 1J9RA 4JKWA 1N5YH 1OSYA 2WLIB 4U1GB 2A77L 1XDCA 4UINH 4X98A 3QWOA 3TZVC 4Z2WA 2P45B 5AVQB 3JWDL 3L3OB 3OGOE 4FZ0A 1BHGA 5GZOA 3L74H 2VLMD 3RFZB 3GMLA 1KFAH 5CILL 2OJEB 1RH8A 4G9DA 1NC2B 1V7ML 4PV8B 3D85A 3RGBA 1KDIA 2EDMA 4XNQA 4LF9O 3N9GH 1KCVL 3UC0L 2X4SA 4XP6L 3DIVA 4I5BB 4W9KC 5EBMB 1N34O 5DURD 4JI4O 4M03A 3ZHUA 3WXWL 4TQEL 4NYLA 4PP1D 2FYYA 4NUMA 4FLZA 4PP2A 5DRWB 2ETNA 2VDKH 5E00A 5E51A 2JJVA 3U7WL 3VXTB 1L7IH 2A73A 2XFXB 3C2AH 5C0AB 2JB5H 3UGXA 3L3KB 3C5ZB 2NZ9C 4PPTA 2NY6B 4GG8B 1KECA 5E7BA 4EI5B 1I31A 4JREC 3LQZA 2J7LA 2CD0A 2WBXA 3GKWL 4XP5H 3H2QA 4QRRD 3HAEA 1MCBA 3HE6C 5I1EL 1HNXO 4PA7A 5D7IF 2BP8A 2E9WA 4IBSA 4J2XA 4FG0A 1FZOB 2DJVA 5F0JB 1PEWA 4FNLL 3KCWA 1QPKA 1UQSA 1GVIA 2B5IB 3P4OB 1ETA1 1I3RB 3BCCH 1NMAH 4LVHB 5LA6B 3T6ZA 4ZXBA 1Z5VA 5J8OA 5H9CA 4EMZA 3UO3A 2CK3G 2J88H 3DJ9A 1Z66A 4GIPD 4XVOA 5T5FA 3RVUC 3O4LD 5DJ6B 5CBHA 2WKLA 5LBQA 3WCYA 1GGUA 3TCXA 3VXMD 2V7HA 3HE7C 2ILMA 5BRZB 5ITFA 2YD9A 4G9FE 3N27A 4NQDB 3AG1C 2LW7A 1D5IL 4F6EA 3QXDA 3B9VA 3MYZA 2P5OA 2ZICA 1FIGL 1SOQA 2V37A 4NGHL 2DQGL 3PGCB 4PJIB 1JPEA 5KMGA 2UXBO 1BZ8A 1KEMH 4OD2A 5E56A 4AG4H 4PP1C 1MF2H 3SYQA 1DDTA 2VMJA 2KERA 2R4RH 2JWYA 4ZTOH 3S8FB 3A4FA 3QIUC 2HHHO 2VSCA 2EECA 1GY1A 2E6PA 1UT2A 4PR5A 4YC2B 2VIRA 1TCRB 4FHBD 4PFEA 2DOCA 2OP4L 4LO9A 4PBDA 4PJXE 1ZA6A 1XGPA 2QTVA 2CAZC 4J3OG 3OD3A 5LNEA 3T2NL 1A9VA 3IGAA 4HXBH 2Z1PA 2UU9B 2QQKL 5FYKU 2OMZB 4G8GA 1NFDF 3VQ1C 4TT3G 3GK8L 4AT6A 2PMZA 3EBAA 2ZNIA 3H01A 4RWYH 1DFXA 4PV1B 4MTOA 5ID0A 2ZUWA 4M4PA 1INEL 5HHPA 1K9TA 4FEMA 4OJAA 1KC5H 5FF6B 4RQFA 2E6QA 1CXKA 2LQRA 3F65A 3NN8A 4O9HH 3BA8A 1TJGH 5DQ9A 4OFKA 4AIXA 3TO4A 3SJAC 4FIPC 1LE9B 1JGDA 4FNLH 5IHWA 2NDGA 2EIJC 3QDAA 4QRTB 2V7QG 2VLLB 1PDKA 1SM3H 5D93C 2PP9A 1X4YA 1EO8H 3S3XA 2HVJA 3E3QC 1NDGB 2XV3A 5AVYB 5AZ2H 3VGDA 3FN0L 4HJUA 6PAZA 4HV8A 3JATB 3ABMB 1NLDL 4IU2B 1IQDA 4B9YA 4CADA 3PABB 3VXUA 2NMSA 2PUQT 4F4LA 3ZKMD 5B4MD 5I71C 1NUGA 1F58H 1NICA 4FMTA 4H2CA 1FIGH 1XIWA 3KLAA 3D69A 2O5XL 1IAIL 1UKSA 1RERA 2F68X 3ALPA 3SE8H 4OM0H 1OSPL 4EQ2A 3BZ4B 1ILUA 1MLCB 1MZZA 5KTEL 2DS4A 1M1SA 2G3NA 2F74A 3LKOA 3QO1A 5IQLA 3RL2A 4OJCA 1T0NA 1BG1A 8FABA 5KYXA 4GAFB 5CINL 5I6PA 2DWDB 5ICZA 2EJRA 3DV4A 4JX0A 4WZ9A 3KPQA 3LXUX 1AGBB 3W9EB 4HUUA 2L3BA 2AV7B 1J1XH 2CR0A 5CP3A 1OTSC 3OSKA 4HCGA 2IBBA 3JD0A 4MS6A 5GZOD 2FJHA 2Z4QA 3AEIA 1XGTA 1ZT4B 3GMMB 4L0PB 2YIDA 1OB1B 4XAWL 1EZVY 1AP2A 3FPXA 4Z76A 4URKA 4PGEB 5DMYA 3WLBA 3D85D 4K5OA 4RZCA 4D2NA 3BVWA 4LHUD 1N10A 2EYRA 2G0LA 5CLWA 1ACYH 4DP1X 3P30L 3SE4A 5ITBH 1ZLEA 1A1MB 4ABWA 3C90A 3MV8E 3S48A 2ZG1A 4F93B 4L29B 4G80B 4ZPVA 3TV3L 1HNZO 3B5TA 2RMKB 4P9OA 4N2CA 3RX8A 3UGUA 2AZAA 4HJJH 4EJ1C 4HQQL 5KANG 5A2IH 4X6BB 1P7QB 3K9AA 1UWYA 4NZRL 3D36C 1R1CA 5FKPA 2DLFL 4KO6A 3GINA 1T6VN 1QATA 2GAZB 5FGBC 2B15A 5AB0A 1RFYA 1O6SB 1ZVYA 1EBAA 2HLEB 5D7LE 2Y5TB 4YDVB 3GSOA 4Z3EA 1UB5B 2BFVL 4HKZA 1T20A 3QUYC 1S77D 3FFOA 4G6JL 4HK0B 1S7RB 2KUTA 3KBEA 3UP6A 4G83A 4K5MA 2UZPA 2J1YA 4DR6B 1HNGA 5GZOC 4GW4A 1VGEH 5DYOB 1BZ9B 5KTEH 1DLHB 4MNGE 4UUJB 5FC9A 3BP5A 5GPRA 4ZO9A 4OZ4A 4BE5A 1ZGLB 1QBZA 5DJXA 4PWIA 4JO2L 5H37H 1D5ZB 3PGDB 4OUUB 3KHOA 1IIKA 2R59A 4DGIL 2MEJB 5L2JA 1OARL 3ZGIA 4F2MA 3V0VA 3D2TA 4K8RC 4MQ7B 3ZL4H 5J1AB 2WSKA 3QG7L 1MCLA 3SD5A 5HYFA 1FO0H 1KYDA 2FD6H 3OKLA 4L1LA 1P53A 5FO8A 4L1HA 1JRHI 1MCIA 2Q7NA 3LMJL 1L0QA 1BLNB 2CO7B 4LF7O 2D7QA 1C5BL 5T3ZH 4WSKA 3VI4F 2YBGA 4Y5VB 4LCCB 4XAWH 1ULVA 4NM8L 2CDYA 5AVXB 3VFTB 2GFBB 2NXYB 3I84A 2WWMD 2B4CH 4OJFL 5H2BA 4ECNA 4QRUB 3C2SA 3PHSA 1FFRA 2DEXX 1B4TA 3D4YA 2L7EA 4WO0A 2HFGH 3WIIL 1SVCP 4J1UA 1OSZA 3HZMB 3BH4A 3EH3B 3Q8EA 2HTLD 2ITDB 4ZD3L 4O2FB 3BEVB 5D7HA 5FKAA 1Q72L 3P30H 2LGQA 3ZO0A 3MREB 5CN2A 4B96A 4ZOLB 3W7TA 5F7AA 3B7UX 3JARA 4O2BA 4NI6A 4B9IA 1ZTMA 4LEXL 5D70L 3FRUA 3SY0B 5KANI 4G8GD 4P2QB 2HB0A 5EWIL 3DURB 1H5BA 1FF5A 2YOAA 4HQQH 2CRMA 3PLYA 4KKZA 2AC0A 2NX5D 1DVSA 3QEGH 4LPCA 2A6DA 2BP5M 4Z7QE 4NC2B 4JDTL 2DLFH 3KZ8A 3T3MF 1P84F 3AAZA 1ZPUA 1MSPA 2FGZA 3MA7B 3I9GL 5GRVL 1QHPA 5B7EA 4UYQA 2XAGA 1QUNB 4X6DA 4OZFA 3SDXF 4JM4H 3VFNA 1HXYB 1C5CL 4JY6B 4HH8A 4OT1L 4JKPH 1CFQB 3CMOL 3EYSL 2V2WA 4YJZL 4P5TD 2Y24A 1BZ7B 3D3VA 4XBEL 1N6QH 1HILB 4FQQB 5M94B 1AIFA 4FXKB 3FTVA 1TVHB 2O61A 3CCHA 3WMPA 4FZEL 2Z7YA 4FN0A 2P8PB 3ZE1E 4F1SA 3SBRA 3IRPX 4GQZA 3QXVA 4AQZA 4AGMA 1BF5A 2BO0A 3VXUD 4DV6B 2C1OB 1P4RA 4P59L 7PCYA 4JO2H 1NMBH 5EU6B 2V6HA 3K58A 3BQUD 4P46A 2WWMC 4PU2A 3KLHD 1UFGA 4DGIH 4TNWK 1VQKV 2NYYC 1OARH 4Y88A 35C8H 1RZKC 3DVFA 3VD0A 2PF6A 4PW4A 1NR7A 3D87B 5JNYA 1BEYH 2KQNA 4N85A 4BXVA 3QT2A 5FX3A 1MFCH 5IOPB 2EDTA 2P06A 1OK8A 1U8HA 1IM9A 1JWUB 1KCRH 4X62B 3IGAC 2AVFA 1ADQA 2Z31B 3L3HA 2BNRD 4X6CE 3W1ZA 4DV5B 1MRFL 4PRHE 3V52L 4DQAA 1Q9OA 1RPKA 1WZKA 4K3AA 4OJFH 3KH4A 4FNRA 3ZDYE 1PQZB 2R9IA 1IAII 2EACA 3UACA 1JG9A 3OZ9H 1UD6A 1K4DB 2BS9A 4ZD3H 1AKPA 4QYAA 3FSZA 3UGEA 3LNNA 2CPCA 2G0KA 5DZAA 2DQEL 2A0LD 2C7UB 1BAGA 2YAQA 2M1KA 4K7PX 4WGKA 5D70H 4LEXH 2BNQB 2PPDA 3ENEA 2LU5A 3EJRA 3DXAB 4J3TA 4OXSA 5B1JC 4UILH 2EYSB 3ZQXA 1SDAB 2VDMB 1RIVH 3GHBL 1F13A 4P5TC 2HVJC 3E35A 4LC1A 1E27A 3F2LA 4PLOB 4XOAA 3H85A 1CFBA 1JTTA 5LGJA 1TIUA 3WEMA 4GAJL 1PJ9A 4XO5A 1S2EA 5D71L 3I9GH 4NRZB 4Y2DB 3DJSA 4K23L 3STBA 2D7NA 4PW9A 4XWGL 1A8JH 1OY3B 1XF3B 5J9PC 2L8AA 1C5CH 4PWGA 4WWOA 3A0BZ 5HVHB 3KLHC 3EYSH 5FA4A 1I4FA 2DWEA 1JMXA 4HT1L 1KC8W 1XIWC 1VFOA 2VLKE 1I1AA 4I9QA 2CK2A 2ZAIA 3MBEB 6FABH 3TBWB 3ZDZB 1UJTA 4KNTA 2CHZA 1L0NH 3FO0L 1THAA 5EFIA 4OFPA 3D25A 2IF7A 2W6JG 1HFUA 1HX0A 1M42A 2IAMB 5FNVB 2VRAA 4ODWB 2VSKB 2D3NA 3E2EA 1ET8A 3C12A 2LFSA 4BA0A 5A6MA 3C3SA 4XVSL 2BPBA 4W4LA 5HYSG 2AJZA 2WB7A 4JE0A 4AZ8B 4X7FC 4NTXA 2V3DA 4HUMB 3GBNL 3G4SV 4Z7NE 3KWTA 4BYHA 3R66A 3V52H 2X4UB 1R19A 3U1PA 3CN3A 3RRQA 1XF2A 2J8UE 1IVTA 2NUTB 1NTKH 2ZINA 1FVEA 2P8LB 4NDMA 4OTXH 4HULB 4M43H 4QEGA 3BVXA 4JVWA 3Q6GL 1R0AL 2KHAA 1Y6XA 3LV3B 4FQ1L 3SE4C 1PTZA 3LSOB 2ZONA 3HNVL 2FMLA 1NBYB 3FCBA 1G87A 4N26A 3ULSA 1ZS8A 5AD0A 2ED7A 4F3FB 4EQ3A 1T1ZB 1QBAA 4WV1A 1QD0A 5BO1H 3UJJL 2ZSVA 4LSSH 2CU9A 3VFMA 1UXWB 2HN7A 5C0JB 5D7SL 4XP4L 4L2YA 2J6EH 5CNHA 5EOCH 5I1DA 4RMWA 4MWFB 5EIIA 3PWNB 4Z7OB 3MRQA 4ENZA 3BP4B 4A67A 2LABA 3DSNB 4D7SA 5HBBA 3WHXA 3CTTA 1O75A 1FC2D 2R1XA 2G4EA 3B9KA 5DZVA 2HH0H 1EH9A 3CXCU 4E9SA 1GO3F 3BKJL 3KH3A 1UG9A 2BVTA 2DDQL 2W8CA 2D3VA 1M3JA 3F04A 3O81A 3TIEA 3X12B 3CX2A 4OFVA 5MERA 1NOLA 4K8XA 2W59A 1JL8A 1J8HD 5MHSD 4OCNC 3FO0H 2R83A 3QK0A 3NA9H 1HR0B 2XVBA 3FSAA 3B4NA 1CE6B 5I6XC 4JM2A 4JG9A 1R47A 3JT2A 1IX9A 2CGRL 2GHZA 5DJYB 5EH1A 2HFEB 3FQNB 3ABTA 4JQVA 4K7FA 5F7FA 3KR3H 3D3VD 2NY0D 5ANHA 1QA9A 1IGYB 2ADJB 2CH7B 3OR7B 3QR1A 4MDJA 2CUAA 1ZWIB 1KGYE 3S3PA 3L95B 2EDFA 1IBDA 3PWJA 4KI5D 4PRNB 4X99B 5DD0H 2UUAB 1OAZH 2CXGA 4LLQA 4MSWA 5C92A 4LEBA 1FL6B 4AH2B 2XZQH 4P46D 1YEKH 2YQ2A 3STZA 2JB6A 1RZGB 3BUYB 2CLVA 4L9LB 4YNYA 4DSYA 1CXZB 4ZBMA 5JIDA 1XCTA 2J8HA 2QGBA 5F1IA 3HZYA 1HEHC 1AI1L 4XN9A 4J8RA 3VD1A 4FFBB 5J11B 3OAUL 4RH4A 3HNVH 2VQFB 3D39B 5INDB 3VFVA 1IE4A 5EORL 1T4WA 1J1PH 1U8LB 1TMQA 3WBDA 1H5BC 1QSEE 1RK1B 5IW1A 5EO0A 1EFXA 2MPVA 4XP4H 1R33A 2K1MA 4TV3A 4CH5A 2QWPB 3OL2A 1WA8B 3SQBA 1S9WA 1UWEH 1UZ6E 2XWRA 1EIBA 5FB8A 5I19H 4JFZL 4JKMA 2XV0A 2AKRA 1PLGL 3MRKB 2XT9A 3G71V 3K6SB 1HTYA 3DKHA 3P0VH 1CICB 2V2XB 3BKJH 4ONGH 4FLTA 4OPHA 5FGRA 3ULUH 4LCYB 5ESQB 5C0CA 4M3KB 1UD4A 3WL9A 4KI5C 4P06A 5DRNA 4AQEA 5FM8A 4OZHB 4L8DB 2OCHA 2AEQL 5F2FA 4JI1O 4P46C 4HISA 1JNNL 1OAQL 4DGYL 2J5LB 1GN4A 1S78D 3O0RL 4OFQA 4GRWB 3DV6B 3DROA 5H8DA 4PJ9A 4DHLA 5IVXB 2ZUSA 5KHKA 4DR4O 2HMID 1KXQA 2OCCB 1MHCA 1U8CB 1NCCH 5GIRB 1XGQB 1LLAA 2WQSA 3UH8A 1TJIL 1NIFA 3N0PB 2ZCLL 4WSGA 1QI3A 2ZSWB 4UV7L 4HUNB 4F1ZA 1MG3C 2HRGA 1XH1A 3F6JA 4HUXB 2FAUA 3V0IA 5HYJA 1SUJA 1GHFH 1YMMA 4LNUB 3T77A 4H1LB 1BSMA 2WA3A 1R24B 1NTDA 4UQAA 4X7EC 2VZ3A 4RWUA 4W70A 5F8QC 2MHAB 2XA8H 3LEXB 2BWIA 4N3UA 4XNXL 3HKDB 2YFNA 4L5FE 3M8OH 1QTPA 1IE5A 1TVDA 2A7BA 5I8OH 1W72H 2Y36L 1I0HA 3AG3B 1TG8A 2YRPA 3MOBL 1KN2L 4OPAA 2X3BA 3V6FA 2J25A 1NCWL 3OX8B 4NQTA 1DVFA 3G04A 1YCIA 3BRDA 1OCOB 1NBVL 5D6DA 2WHVA 4L4VA 1ZT7A 1QR1B 5HHXL 4Z23A 4PRIE 4LQ1A 3N40P 4UDTB 4XMWA 1DSWA 1XVSA 3PRZA 4OLXL 2X9WA 3SKNB 4LU5L 4NC0B 1G43A 1F2QA 1PLGH 1RZPA 2XTJE 3IF1B 5F1SA 3HN3A 3CH1A 4TNEA 4NJ9H 4PRAA 1QABA 2DWEC 4BWUA 5BS0E 4KK5D 3I56V 2BOLA 3QZWB 1G6RH 2AERT 1C08B 3CFJB 5DZOA 2EINC 4DUYB 2WM0A 4WY7L 2FQDA 3M1CA 4FQCL 1U3YA 4WKZB 3ZT5A 2GC4C 4KTYA 4X7SH 1I9RL 4N0UA 4OZGE 3DK2A 4L37B 4PJAF 1M05B 4XBMA 1UJ3B 4ZKIA 5IJ0A 4XZUB 2AEQH 4HHAA 5IR1B 4PJFB 2BDNH 5CEYA 3MUY1 2ZP0T 2VDRB 2IV8A 4LOVA 2HKOA 1RHHA 1OAQH 5HHVL 3U46B 3V5HB 3S5LA 1IFRA 4WWKB 2JCCE 4YDJA 3G6JE 3HOGA 4G8EB 3RVTC 4DQOL 4HAMA 3EKCA 3KVPA 4XPTH 4B3RO 5E1HB 3U6RA 1A7RL 5AZEH 2GHWB 2J3SA 4L3AA 4HCIA 1THCA 4G9FB 4LVOB 3GB7A 3N41B 4YH6A 5F9WB 3WJJA 5I0YA 1P2CA 4JM2D 1A5FL 1F18A 1FKAO 4LKXB 3WTWA 4QD2E 5EO1A 3NJMA 2BVQA 3TN0B 1UEYA 4E36A 2GIYA 4G6AC 3GGWA 4M5ZH 4MAZA 3WTSA 4NUQA 2G2PA 3QPXL 5FO9A 5HGBB 2HUHA 2B16A 4KV5E 3VI3F 1VMGA 3NESA 5CWSA 1U30A 4GB9A 4YAQA 1JJ2U 5DHVH 4WV1C 2NY2B 1TUBA 2QKAA 1I53A 2Y36H 3QORD 5LBSL 2O5NA 4RFOH 4KK8D 2YSUB 2ICWA 4KK5C 3KPLA 1DQKA 1NGXB 2OJZL 4X4KA 3SZKC 1DZ0A 2ZE6A 2Q0AA 3SHSA 1IM3D 4BHUI 3S5YA 3SJVD 2EVFA 3NCEB 2CLRB 3MLVL 1RUAL 5EA0L 4ZMVA 1TYJA 4YUEH 1Y0LB 2ZQKA 3B34A 5I75B 1UB6B 4MBRA 5AEAA 5JQ6L 4IDLA 1EFXD 1CBJA 4AM0B 4AQ8A 4XCEA 1K72A 3O3EB 4WJ5A 3HIZA 3IC9A 2MQGA 2FWSA 3QUZB 3WIFA 4RCAA 4NXMO 1RSYA 2M8XA 4DZ8A 1JYXA 2WQWA 4U3CA 5F44A 4LLWA 4NO2B 3FOMA 3L1OL 4HHGA 4RAHA 1AD0B 5CCKL 2ZUVA 1WWCA 3FTSA 2V9RA 3N2GA 4JHWH 4JM2C 5FOBA 4WUUB 1U91B 5BQ7A 2AXFA 2A83B 2EADA 4A66A 3E38A 4JQVC 2VKXA 3HVNA 4QIWF 1MH5A 2PR4H 2EILC 5EEZA 1TPXB 3PDOB 4P23B 1SRYA 1KQSU 1A4CA 4X50A 4PEEA 2AV1A 3TWCL 2NTFB 3H1KH 3C9NB 5G4NA 4IRJB 5C0CD 2BVPA 1CFNB 1KJ3L 4DEPC 4LFAB 3SDLA 4ZUTB 2I25N 2ZCEA 4AXWB 1JZ7A 3UAAA 3X1FA 2FUQA 1U3HB 1Q0XL 2WZAA 3STZC 4X65O 1CI3M 4H13C 2CM6A 4KK8C 3IPBA 2BP3A 5AFAA 1SJMA 3AY4A 5AOIA 5J6HA 1FL5B 1QHQA 1XH3B 4N6RA 4PJ9D 3MRGB 4Y5YC 3GSNB 4PBWD 5HYIA 5T33H 1UD8A 4D9LL 1HI6B 2IDUA 3RTQD 2VR6A 3TC9A 2HRPH 4JHAH 2YPVA 3QEUA 4QRQB 4DP0X 1V8HA 4MHHI 3ZT7A 1R3IC 1XB8A 4WCYL 2WLLA 5LBSH 4BQ8A 2VSMB 3MGOB 4BGLA 2YGNA 2OJZH 5D4IA 4L18A 4QGTA 1KELH 2G2RA 2H26B 3AXIA 2Y0SA 4WU7B 3V5KB 4LLUA 3QJHA 2EZOA 5EN2A 5JOFA 5D5MF 3ZL2A 2E7LA 2OXGB 4OIIL 3FQUB 4GSRA 2Q5ZA 4P2CG 4ZRGA 2FX7L 2BJML 3NCFB 3PGFL 4JRYE 4DAGL 1YEIH 1JF1B 4EUPA 2VDOL 3KG2A 2AJXH 1IBLO 3FUFA 3T9WA 3ZMRA 3COOA 4S11A 4L4TA 1TKWB 3X17A 3FW6A 2WYTA 4ZMAT 4DV3B 4RBPK 1CDUA 1USQA 5HGAB 1T1XA 2W9DH 1GW6A 3EFOB 1PG7H 5ACMA 2WP3T 2AQSA 4V1DE 3IXTB 3KDMA 2AEPL 2ENPA 2IH1A 4EIGB 1T5EA 3OUFA 4C4UA 2XI9A 2FGWL 4LBEB 2F8XC 3QG5A 5LYJB 5KHIA 5KSAB 1MJJB 4NO0B 4PJ9C 1INQB 2AVGA 1NC4A 1GN3A 1RZFL 3D09A 3TWCH 2IU0A 2CR3A 1EMTL 2DEWX 4U1SA 2CTPA 4WU5B 2ED9A 3V6BR 2C3GA 4RWHA 1M71B 4MA3A 5D7LB 1NM9A 2NY7L 3H2PA 5ABZA 2X7LA 4HIEB 2EDNA 1KUMA 1SDDB 2QWNB 2IJKA 1ROCA 1IC5L 3S3DB 4PDRA 2ZOTA 4X42A 1KXHA 1YECL 7CGTA 2P4AB 3JAWA 5EK0A 1R6KA 3W5MA 4QTHB 4A5UB 1QRNB 4YHLL 4FFKA 3C5JB 4JFQB 4NC1E 2UVEA 4OCSH 4PJGA 3R7RA 3KPSD 4D9LH 1HHIA 3H7BB 4MVMA 5H6QA 2VXQH 4KHTL 1LHZA 4NO5B 2ARJQ 4WENB 3IM1A 2BMKA 4MD5A 4BK5A 1TGOA 3S37L 4L1SA 4WCYH 5SWZA 3RQ3A 1NFAA 4R97C 4KQ4L 1U8NB 1WQVT 2OSLA 3BSZL 3TVMA 5EUKB 4FLRA 4EDXA 1DVFC 4IMKA 4Y5XB 2AJYL 2ZYSA 5D6DC 5AYUH 5IMMB 4NUGL 4K0OA 3NXSA 4PY8I 3R1GH 2UUDH 4XCFL 5D9SB 2FX7H 3HI1A 1X5LA 3SD2A 4CSPA 3GWJA 1YYLL 1Q4NX 3RYIB 5A9GA 5DI8A 4FFTA 1VQOV 4U1NB 1IBYA 5CJOH 4YXHH 5ITZB 4RAVA 4MJ6A 5E94B 2FSEB 2FJFB 5IFJA 4X4ZA 2MIZA 1U92A 4YPGA 2CK0L 4N90D 4JO3L 4ZOBA 2C9VA 4WUKL 5EIVA 2NT0A 4FEIA 1N5AA 1ZSPA 3IKKA 2PTUA 1ND0A 3D34A 4ZT1A 4QOKE 2YWYA 1LO5B 2AEPH 1AP6A 1I1FA 2R39A 5JHDD 3ECUA 4HS8H 2XKNA 4FQXB 4K7PL 3ZMNA 1LEKA 3BUTA 3PDDA 4Z7QB 3H53A 3ROOA 5K5YA 1VZHA 3HCVB 3HKEB 2XETA 4G3YL 1PX4A 4NX0A 4AGLA 5C9JA 5DTFB 5E6SB 1RZIB 4KTDL 1E50A 4F7PA 1ZHBB 2XG5B 3GS7A 3LXAA 3AJ7A 4NKDA 5LOVB 1BG9A 2HX7A 5F9OL 1A25A 3GSQA 1G1KA 3G5YB 4AVJA 4RAUA 3GB7C 2DQDL 3QCVL 4PRPA 3WJJC 4L3EB 3W7WA 5F71A 4B5EA 1FNEA 5IVNA 3HZ3A 3QFJD 3MV9A 4C55A 4F37K 2MQ3A 3IK2A 3U6XA 3L3IB 4TQIA 4RGND 3OV6A 4YHLH 3ZE1B 5CEXB 3EGDA 4AYSA 2LQTA 4NO3A 4GRLA 4KHTH 1F4YH 3A47A 3IJEB 4QY8A 2CAKA 3RI5F 2X6MA 1TT6A 3QDGE 2F23A 4KROB 1JVMA 1DJIA 4LHQB 3SPJA 4HAFA 4EZJA 3VXSA 3CXHJ 5BV7B 3S88H 2A99A 4X5XA 4UB8Z 4G1EA 1A7OL 3CCUV 4O4LA 1ED3A 4X7TB 2AJYH 5D1XA 2ZWKA 3DETC 3THML 1KB5L 4X6CB 3BD4A 1YJDL 5HI3C 4PRHB 2GT9B 2ZJSL 3F7LA 1ID2A 4N8PA 3OKNA 1JFQL 3NIDB 4AL8L 3AZUA 3ATFA 2NLJA 3MFFB 1YYLH 2I32A 2IOIA 3NABL 4WI9A 1AXSB 3PF2A 3ZDYB 4O51A 1SJVA 4PJ5B 4JW3A 4WGVB 1U33A 4DCQA 3BT2L 4G43B 4AQ8C 4UOQA 4YHNA 3BSHA 1VEPA 1FPOA 2YUAA 2CK0H 1MFEL 3OGIB 1QLRB 3MRCB 1QFHA 1A6TB 2G75B 3BW9A 4OCYL 4WUKH 5BO0D 1AHMA 1IBKO 1QI4A 4HUKB 4ZDHA 2MNWA 3VD7A 5AUMB 1EHAA 2ODMA 1RXLA 2QZQA 1UATA 2VR7A 1BLIA 1FZJA 3VH8B 1U95A 4RGNC 4ZK8A 3SOTA 4G3YH 4L4TD 1JZHA 3H9HA 3U6XS 4KTDH 4PDVA 1I7UB 4ZI7B 4HUVA 1MZFA 4WW2B 2J43A 5F9OH 5EO9B 1QSFD 2HJLA 2FO8A 4GAGL 1HE8A 1H0DA 2YEZA 1A3LL 2R2HB 2UZYA 5HHOA 4M5YL 2RD0A 1IILE 4U6VL 2VLKB 2CKBB 3AY4C 4JRWA 5FPIA 4B7IA 3ZR5A 2XJLA 1NC4D 1SYVB 3KS0J 4X4XA 4X64B 1JVKA 3APCA 1JFHA 2YD5A 4TSBL 1NBZA 1SHWA 2XG4A 1DQQA 3CHQA 4PJIF 4UQ2A 2VDNB 2WBJD 1BFOA 1JZ2A 5E70A 3DUHA 3N43B 3FL7A 4JANA 3OAAG 1I8KB 4MVBC 1MJUL 5A2CA 3O45A 1XILA 4NRXA 2J1KA 3NEEA 1A2YA 2DI8A 1R6TA 3BGFB 3Q6FA 2H0PA 1ZVSB 1G7IA 4DK0A 1OTTD 1R3HB 5DJ0B 3U83A 4DV7B 1A7OH 1BFSA 1SJHB 4Z7NB 5I0ZA 5DD3H 1K33A 3Q9PA 3THMH 4CC1A 5TK4A 2E7LC 1U8KB 1YJDH 3EJZC 3MLRH 2ZJSH 4I4TA 1HINL 2R9RB 1Z1WA 4ZPTA 3O9WA 1E3ZA 2J8UB 1GKEA 1GOFA 1CXLA 1VAHA 2JIXD 1HDMA 2QL1A 2ZXDA 3QUML 4FGMA 3P3RA 4H8VA 1FAKT 1YN7B 5AW5B 4ZO7A 3PIQB 3U4AA 4OLEA 5KYUA 4ZNCD 4IHBA 1NCUA 4GG6E 3CQFA 5JHDA 1W0VB 3SJQC 1N0XH 1X5GA 3U0WH 4DRXB 1YSCA 3LKPA 1QYGH 2JLPA 3P0YL 4C83A 4DR3O 5F1OB 2PN5A 4HZ1A 4R8WL 4YHKL 5GS2H 1CJYA 1JFFA 3W0WE 3IGKA 4POYA 4YO0B 2OMNA 2IH1C 2GSIB 2VN7A 1AMXA 4GMTH 3OG4B 2WCGA 4NKMA 3WEXB 1UPGA 4GQ9H 3H1IH 2VLME 2X41A 3K6NA 1S7TA 1T2XA 3OTTA 4LL9A 1RP8A 5ISZA 3K2MC 4FFYH 5LO7A 3TLRA 4FXLA 4Z8FH 4R26H 5A2KH 1YQ2A 1VACA 5IP4A 1EANA 4UB6Z 4Q9BA 1E4WL 4GAGH 3F8UB 4LCUA 4TOYH 2N0MA 3QZWG 5A16A 3FB6B 1HHKB 5CA0A 2ZXGA 3SJBC 3K6DA 4M5YH 5FEBA 3ZPDA 4BKLB 1OTTC 1E2ZA 4P2OA 5EOTB 1IQWL 3N06B 1BMGA 4ABUA 5D2LF 4GBXB 2QA4V 4LH7A 1LL1A 1M90W 2QFPA 4GUPB 5CKGA 1IBGL 1HL8A 4I2XA 1CTNA 1AQDB 5FIEA 4PRPD 3CN2A 1J5EB 1HYRC 1W91A 4BK5C 2ZM6O 3FT3A 3WHE0 3K3QA 1WIOA 5TGBB 2R69L 4PY7A 3ETBF 4MLSA 3OGCA 1RZQA 4HD5A 5HHNB 1M7IA 4Q9RL 2I69A 3TVMC 2PXYA 2Q1EA 4PYGA 4WO4D 1BS3A 1V55C 1E4HA 4IMKC 2XVLA 4GIAA 3NP4A 1ZTXE 4UCUA 4LF5O 4YR6A 3QRFM 3UBHA 1FFOA 4F9PA 3U0TB 1KBVA 1G0DA 4X9GA 5IV2B 4MJ2A 1NEZA 3ZTDC 4O58L 3IGUA 4F7CA 4LAJH 1OZUA 1JA8A 2XXCB 3FRPA 3W56A 1MOFA 4LT7A 4AJWA 5ADPL 4H0HB 5JHMA 1GJIA 4F7KA 3T1FA 5B22A 1T4KB 5D1XD 3E6FA 3L9YA 4ZQKA 5D7JB 3VWKD 3S8WA 3TCLA 5KYWB 3D18A 2ITCC 3F85A 2W1NA 4NZ8A 1J8KA 3SGEH 4AI7A 5B38B 5EU3A 4Y4FA 1HZHL 3RYFA 1QSEB 4JBSA 4YHKH 5A2BA 4G7SB 1I1YA 3E3QE 4X5QA 4R96A 2H32B 4GRMA 5K93A 1ILSA 3FO2B 1WFUA 3QDMD 5HGDB 4ZNEA 1TQWA 1OTUD 3VFRB 4Y2NA 2O6PA 4DP7X 1IZ3A 3IDUA 5H37A 1NCJA 1Z9SA 2VTFA 1KYUA 3ZGHA 1SJXA 4LSTH 4X9BA 3IFLH 2WUCH 5IIEB 2IV9A 4TKWA 1WIPA 1M7DB 4OQTL 1ZLUH 1WBYA 1N2RA 5EPMA 1EQWA 5HDBB 2AHYA 2KH2B 2QJDA 2ZP9A 2JS3A 1XGUA 4K94L 3RDJA 3NOIA 1EAQA 2BK8A 4FA7B 4FCAA 4YXLH 1OAXL 2V9QA 4NENA 3M6DA 3QFGA 3SKOA 4WO4C 1IQWH 3G5VA 3P40A 2YIBD 1FL3B 4G11A 5ESAB 5IB4A 1XSKA 2H6OA 4MNHA 1S7QA 3EJSA 5E9AA 4UCVA 1KY7A 2YA0A 1OGTA 3OXRA 4HCRH 4JMXA 1E9QA 4GRLC 4NSKA 3WFHB 1UH2A 2DKMA 3MODL 2AS5M 2LFGA 3ARBB 4ZX4A 1LR1A 2P48B 2JSFA 3P30A 1GMGA 2CDEA 2QVIA 2NNFA 5KWYC 4IBWA 2LGWA 1T6WA 3VOUA 2R0LL 4RGOH 3TWYA 5GS0L 1YYML 2Y4TA 1MRCH 3I55V 2UXXA 1KPRB 1JR9A 2RR3A 2ZCHH 3SE6A 5FR3A 5D1XC 4F33A 3DK0A 3W39B 3FCSB 2FIKA 2GY7B 2WXGA 1G9NH 3W7SA 4HETA 3VX1A 4XDJA 1NCDL 4OJYA 3T2PA 2EBOA 1BMZA 3JWOL 2NLJC 4JFPB 4YZFE 3B7YA 2B1IA 2Q9OA 2HRLA 1WBXB 2XAQA 2RHEA 1WTGT 2GJZB 4O58H 1HU8A 1KG0B 4AW7A 1S7VB 1SHMA 4FYQA 5CHNA 3DX6B 3WLWD 4IOFC 1OTUC 3U79A 3O8XB 3N85L 4W6YB 5ADPH 1U8IA 5IWLA 3ASOC 4KHPO 4JFVA 4R2GB 2JLLA 5DEGA 2XSKA 2DYRB 3K5LA 1CGWA 5EUOB 4Z7AA 3O41B 4D0BA 3AGWA 1LO4H 3KJ6H 4BQCA 2QQNH 3P4NA 4UIMB 3GPSA 3JD1A 5AG9A 3JWDC 2EJ7A 4QNPF 3KVQA 1S9XA 4GAAA 4QAMB 4X8CA 2OZ4L 4WI0A 4YGAB 5E99L 4N8VB 5GS1A 2BVOB 3BHBA 4PRIB 5ESVB 4F7TA 4LPTA 4PSRA 2WWKT 2EVGA 1EERB 3GIVA 4HWBL 5CBEA 4O2AB 5L2KA 3A4EA 2XTJB 4UQDA 4OX9O 1GH6A 1TTGA 1Z2KA 3JALB 2H8PB 3LZLA 1SZXA 1Y6MR 2JQZA 5BS0B 2GY5A 4TN9A 2R8SH 1XI1A 5JIIA 3HG5A 1IL1B 1BF2A 2O30A 3NQIA 4RX4D 2QT6A 5ISZD 3UKMA 5JHBA 2H3NB 3LN4A 2H1XA 1OLZA 3CLFL 3MRJA 1L0LH 4J41A 3MGTA 4OZGB 3OR6B 3BLKA 3B83A 1JHLL 2WP3O 4JYAO 4CRPA 3M86A 1VEOA 1EEZA 3MODH 3W3BA 2E75B 5JW4Q 3B3IB 1DBKL 1Q9WB 4UV4H 4KOBA 2FX8L 3CFEB 5J2UB 5L9DH 4Q6YA 3LZRA 1CF1A 3C08L 5FYKH 3WLWC 1U2CA 2UXGA 5GS0H 4X20A 1J8RA 3G6JB 4JZJB 4AV4A 2VE6B 4HIJB 3TEXA 1OP5K 4MS2A 2R2BA 3DPBA 4KXZH 1HSAB 4G7RB 2BSRA 3CDGA 1X59A 1CQYA 5AW0B 1ZGLP 2DW4A 4U1MB 3AREB 1C16A 2P5ED 3JWOH 3O9WC 5DO2D 4IIQB 4ORZC 2WLNA 3RVYA 4F57L 1CT8B 3X3GL 2N0KA 2CUHA 2BTQB 3ZBHA 2J55A 4YSRA 3T1YB 1OF2B 1Z9PA 3IMUA 1Y1DA 1AFVL 4K71B 4KH2A 3V4PL 4I0PA 5I26A 1RUPL 2OAAA 3VDBA 2PW2B 3IMSA 4X8JA 1LE5A 2OMWB 2WO4A 3IFOA 3N42B 4J3OH 2CGYA 4B08A 4KOCA 4YE4H 1XCQA 5I1GL 3TS8A 2HVBA 5DJ8B 3EYQC 1CFMA 2C3VB 3EO1A 4OCRL 5DMGC 3SDCD 1AJ7H 3GJFB 4B9PA 4PRBA 5JPNA 1U8OA 2DRUA 3CG8A 4PJ7A 5DS8B 4GUNA 1YYCA 1P4UA 2LVEA 1ORQB 4NFDA 1G1XB 1X9QA 4IMLB 5SX5K 2QQQA 1S5HC 1DQMH 5IK3A 1EJ8A 2WKOF 4M6OL 1NL0L 2NXZD 3E1ZA 4J7JA 1Z32X 4FP8L 4TL4A 1F2XK 3AS3A 5FUZL 2YPLD 4ENED 3GEWB 1GGCL 2DYSB 4LE8A 5HVFB 2BC4B 4LCUC 3MLSL 3O6MH 3CC2V 3N1QC 4L23A 5C09B 1IBFA 3I02A 4KDVA 1J5HA 3V0HA 4LPYA 4DVRL 1N4CA 1N18A 1N34B 4LDCA 3DX9A 4JI4B 4HKJA 1SQ2N 4OD3L 4M4RB 2GUYA 1A1OA 2GTZA 3ECBB 3ZJZA 5SWSD 4ZUWB 2VWJA 3FTUA 2WO3B 1TQBB 1QWHA 1JHLH 3O11B 1OCWH 3F7YB 4DKDC 5KVFL 5F1NB 3SCMA 4QHNB 5DO2C 1FXVA 4R7VA 3V10A 3FH7A 2SODB 4NLAA 3BP6B 1NR1A 2CDFB 2PWEA 1BVNT 15C8L 3C08H 4WHYG 5KX5A 3BEWB 1RM1B 1KB3A 2N4IA 5HY9B 2PXYC 4I88A 4AKQA 3NGBB 5KUMA 1RJYA 3INUL 4OZIB 1RIHH 4G8GE 2UUCB 2QFRA 3ES6A 1KLFA 4IKNA 1BJ8A 3L75H 4AHCA 2BHUA 4XH2B 5B3NA 2O6EA 4Y4HD 1PZSA 4QCIA 2J6EA 3SDCC 1BAWA 3QFDA 1WPBA 3O3BA 1FFNA 2ADFL 3LAFA 1JXGA 3K8LA 2JE8A 1INDH 3FONB 1YPZF 3PJSK 5CU9A 1MZEA 1PKQA 4QYOA 3SGJA 1AFVH 1M4UA 1AMYA 1JV5A 4MX7B 3WN5B 1GM8A 3KKYA 4ENEC 4JDVB 3BUBA 4Y4FC 3ABGA 4OCRH 1XNQO 2X6VA 1X5MA 2HLAB 2HT3D 5H35B 5KVGE 1JRHH 2VN3A 1U21A 4O4JB 4G2KA 1FYTB 3W7XA 2LU4A 2QHLA 2ZOWA 3JSSA 4IBYA 1FJ1B 1NIAA 3EGXB 3V6ZA 3VJ6A 1MRDH 3ZTNH 3VXUE 1NL0H 3C6SA 3PHOA 2NW3A 2W6IG 2WNXA 1VFUA 4PREA 5FUZH 4Y2OB 5E4EB 3RIKA 5DDHA 4AE0A 2ZAGA 1WF5A 1UACL 3H56A 1G9ML 4JRYB 1ZS2A 3B7SA 3IBOA 2XPGA 1EFRG 2IALA 5GW7A 2P47B 4HIIA 3RWFB 3WKNA 1GTFA 5I66A 2BCKB 4QXTA 1JK8B 4KZ0A 2UWEB 1U3ZA 1UC6A 3MI6A 1OPGL 3F12A 4M93C 1PG7W 3AS2A 4UM9B 4DVRH 2VXUL 2DMXA 2YC1B 1AH1A 4L9DA 5DQDH 2Y69B 1FHGA 2VUYA 5E8OA 5EBWB 4HOWA 1MDTA 2AZ2A 2IDCA 2B0SL 3AG2B 3UAFA 1E4XL 2JMRA 3EYVB 3Q01A 4Y4HC 1N7MH 4N8CL 1BIHA 1YNLH 5MP6L 1TQCB 4ZMPA 3C60D 3VH8G 2FBRA 4YSAA 4A7VA 1I7ZA 2Z92B 2FQEA 3X14A 3VW3L 1BOYA 3CJJA 15C8H 4FULA 2XVGA 4TLKA 3WENA 1B6UA 4Z9KB 4F9LA 4YJ2A 5B8CA 3INUH 3SE3A 1TVBA 4MGXA 5E8PA 1I7TA 3KJ4B 1XMQB 1QZNA 4Y9BA 2W94A 1G7MA 2AQ2A 4X1IA 4S0SD 1A22B 1C9SA 3TA3A 5K1JA 1RY7B 2HT3C 3JWNG 1BX2A 4NQVA 2ZX7A 4OI7A 3O2DL 2Z91A 1QQDB 2E74B 1MHHA 3L9EA 3SKMB 2G9HA 5IWLC 1UM5H 1BQHB 1IEBB 3GT6A 3IVKA 2QM7A 1X6LA 1PZ5B 3RVXD 5T1JA 2CUGA 2ZD9A 5IMOA 3QVNA 1WJ3A 3EDEA 2KDYA 2GQHA 5JHLL 3E7JA 1KWKA 2QPFA 1EBPA 3TH3T 1LP9B 1IO4C 2IXQB 4IJ3C 5E24E 1RIUH 3L5XL 3TGXA 4OFIA 5BW7A 3FO1B 3N0AA 4PA9A 3HKBA 2ARWA 2YAOA 3J7HA 1P4IH 3LYRA 4FXTA 3V0GA 5GS1C 4P3DA 4P48A 1IGIL 1SPDA 2EUVA 1DBBL 1CYGA 1NU1H 1MKFA 5C71A 3Q43A 5F88B 1UACH 3ZMTA 32C2A 4OU3A 2JJTA 1ITCA 1HW7A 2VLRA 5AWNH 2XWJB 3VFPA 3QQXA 4L8BA 4C4BA 1HXMA 2XIBA 3GXIA 4QJFB 3CDZB 2DKUA 3MNVA 3QW9A 3FQTA 3EYFB 4H5SB 4TUJB 9CGTA 5IFHL 4LCWD 1SVBA 2H45A 5A6IA 2I24N 4ZMOA 3U7YH 3DRTA 4JHVA 2B0SH 3UTPD 2ATKB 1EO7A 1ORSB 1MJ8L 3QEHB 4N2MA 2NW2B 4QOKB 3T3PE 2UXFA 2HPTA 2VMCA 4EXKA 4J3UA 5DT1H 1GZPB 2C2AA 1H2GA 2JGDB 4M6ML 3FB8A 1FVDB 5TDNA 4MD4B 5AENA 5J6GA 4IW4C 5JYLA 3MKGA 2B3IA 3IDGA 1W72A 3RVXC 2IADA 4PDMA 4GRWF 4FLOA 3T4YA 1N4XL 2W9LA 4MJIA 5DK2B 3WS6A 3EJPA 3AC0A 3UABA 4CS4A 4KJPD 1XGYH 1T6BX 1HNWO 3O6FD 1NKDA 5JW5B 3HFMH 1YRKA 1HNZB 1P84J 1PSKL 2BSCA 3PAVA 4X4YB 1WGVA 1BJMA 1NGWB 1X5KA 4L5FL 4KUCF 4P9HL 4PUBH 4LNRA 3DMMB 1CU4L 4IBZA 1XR8A 4NQXA 4UT6H 5DGQA 2WQAA 4ZUUB 2QKCA 4PDLA 2ENQA 2D2CC 2PYEB 4FE9A 4KKAD 4U1IB 4N2DA 3JASA 4U7NA 4I0PC 2I9TA 1AHWB 4XMLL 5MEPB 1WP8A 4JZOB 4ZMXA 1SVZA 5ALCH 2BNUB 4Q20A 4JS7A 2IWEA 1A14L 5JPNC 1G6RA 4LP4A 5I1CL 3KPMB 3Q2NA 1BHBA 2DICA 2KT6A 4AYID 3CVHH 2CHDA 2B39A 3WTTA 1TEGA 3BZ5A 4JPWL 1MWAH 5MHSE 4X6DE 4LAQH 4AW4A 4ZW7A 4YHIA 1AZVA 3DC6A 3FFCB 4MJJA 2MOVA 1FNGA 4J80A 3T4AC 3ZMSA 4TULH 2C9XA 2J6WA 3GS4A 3QVAA 1KV3A 2HVKB 4JPIA 3SOBL 2ICWJ 3D3VE 5LNDA 1T5XB 2WYHA 2B1AH 3PWVA 4B97A 4FA8A 3HLAA 4GX5A 5J3HC 1P1ZB 2P22C 3ZRWA 4IBTA 4UU9B 1CGSL 3RWIA 3HZVB 1TU2B 3MRRB 3T2QA 4BUQA 1KCLA 1I9JL 4KI5E 3GNML 3BPCA 2PPCA 4BFJA 1BGXL 1TVKB 1CG9A 1HESA 8PAZA 3TEYA 1ZX3A 1JWSA 3G08A 3LKSA 4WEBL 5GRZA 1LEIB 4G6ML 1SOKA 4ODUA 4TRPH 3ZUNC 4BW9A 4X7CC 3TU6A 3CMAV 2K8MA 2J73A 2XNDG 1LEGA 1I75A 3SE9H 1XZ0B 1F4XL 4KVPA 2EE9A 3R4DA 3ROLA 3E6HB 4KKAC 2X42A 3FT2B 3L16A 5DHVA 1HK6A 1NWOA 5FYJE 1SC5B 4XE5B 2E8YA 3RX9A 3V9CA 1JBJA 5BMVA 4N2KA 2JK5A 3D2UD 3VWJB 1P6AB 4P3CH 3UZQA 5I76A 1DQJA 1DUZA 5H94A 4ZMNA 4LVNC 5IG7B 1K8DA 1RMFL 2X89A 2BP0B 3TZVB 4H8WH 4WKXA 3N41F 3TXAA 4DPCX 3GWOA 2DYPA 1XF4A 2JXMB 3P54A 2UXDO 4O02L 2CNYA 1E4XI 1I8LA 3WAJA 4AYGA 2E6JA 4UCOA 2DN9A 4W9JC 1Z3GH 5GHWH 1A14H 3MJ6A 4GKZA 4IJTA 1QW9A 4FKKA 3NCMA 3B8SA 1D5MA 3T0EA 1JPSH 3FKSG 3B1UA 2YI8A 1E4KA 1JIBA 1QWNA 4MMYA 1WC7B 4E0RA 1MA1A 1AR1D 3OKDA 1GRJA 3TXQA 1F97A 4QGPA 4E9YA 3WIHL 1VKXA 5DUBB 4HUWB 4WLCA 4E41B 5A7EA 5F9JB 3FYEB 4PJXF 4LP5A 3KNBB 4JREB 1FWXA 4BZYA 4K9EL 1NT2B 1NGQH 3PWPA 2OA9A 4J23A 3RY4A 4AC2A 4ZW8A 2DJSA 1FIEA 3HE6B 2V17L 4FKEA 4I3RL 1CGSH 1MIEL 3VSVA 4ZUVB 1I9JH 3GNMH 2QV4A 3TNNA 3MO1A 1L9OA 3PAZA 2H3OA 1BGXH 2MCPH 5ERWA 1SJEB 3QIBA 1NEPA 4HNAA 3S7GA 1ET7A 4G6MH 4GLRI 3W0WB 5B1NA 1SESA 4QPEA 3B9EA 4N8VG 3NSJA 2C1PB 5B8CC 1F4XH 4F9LC 5LQBH 3QDHA 4CN4A 2ZOKA 3LKNB 2I26N 5CGBA 4AQYB 3VU2A 3SE3C 2WWKO 4PJDB 3IDMA 1AC0A 5B1BC 3S4SB 3ZKND 2E56A 3R65A 4RETB 5LBSA 2UY6A 4JGNA 4UZGA 3S3SA 2E5LO 4D0CA 4I1NB 3TA3C 1TAEA 3EIFA 1JDDA 5IF0B 5DURB 1LK3L 3WS3B 4ELMF 1XR9A 4EPSA 3CQPA 2P5PA 1NIBA 5AVVB 3KPPA 2WK2A 1P7QD 2N3JA 1AR1C 3D4ZA 3BXNB 4O4YH 4APQA 1MFBL 1RUMH 2W81C 4G7YH 3L5WA 5DR5L 3FQXA 3NEXA 4MJ4A 4MT8A 3IKCA 3OKKA 1XH0A 3K0DA 3AT0A 2XVKA 3RWGA 3S3JA 4GFXA 3VRIA 3ULUC 3LS5L 1NKOA 3UTQA 2VLJD 3P9LB 4QRRB 5FM4A 5BW7C 1CDJA 3KYAA 5F3BA 5E6IA 3NJIA 4MQXC 5DRZA 1Z7JA 3K72B 4Y1AA 2QWRB 1BXUA 3O3DA 1NCAL 4TSAH 5IB1A 3U9PH 4MCZB 3SKJH 2R70A 3UEZA 1U8MB 2A6JA 4K9EH 1TMCB 5BY1A 5LAPA 4BDVA 4MJ5B 5JLZB 1L0PA 1P6WA 3FO9A 3HS9A 3A5VA 1WISA 5I0VA 5K9JL 3O4LB 1P7KB 4JASA 1P9MA 3VXMB 1EUUA 2HXAA 3FUEA 1KT2B 5K1NA 2EIJB 3ZKNC 3DGCR 3KYKL 1J9QA 2E86A 3B2UD 5D93B 5A40E 5KSBA 1E2VA 1NUFA 4AGNA 1KY6A 1FRGL 4ICWA 3GUTA 3OFNG 2WSPA 2EDEA 4JG5A 5CD5D 3WHE1 3MDJA 4NNYB 3MLZH 1KJ2B 4N2IA 4WK0B 4Z3TA 2QQLL 3ESPA 1RPOA 1SQVH 3FB8C 1REIA 3VDAA 2VXQA 4ZW3A 1H3TA 5EBLA 3ECQA 1W2KT 1H15A 1HZKA 1S9YB 5I71B 2H3KA 1FH2A 1S9VB 5IHHA 3WS6C 3EBGA 3QNZB 2N7SA 1P69B 2WXKA 2MTAA 4ZSOE 4KMQA 3CUPB 1V54C 1T7WA 1LK3H 5KSUB 2WLMA 2Y4SA 2HFFA 1AGFA 4LF8O 1Z5LA 2XV2A 3EJUA 5IVZB 3UMTA 1KYOK 2A9BA 3HPLA 5EEUA 3WB1A 4HDIA 3RHWK 2Z0UA 1MCRA 4BUGA 5C0FA 4N2FA 4U0RC 1K3ZA 5JUEL 1NIEA 5AVTB 4ATTA 4OGQC 4N0YL 1HOCB 5IBTL 3MOAH 4ZS6D 2OQJA 5JDSA 4GY4A 4BM7A 3VFGH 3GSVB 2DYPD 3DTXB 3BQVA 4IS6A 1S7SA 5EZJB 2E27H 2CIKB 3TBTB 1B88A 3VD2A 2MK3A 3B2UC 2WXNA 4KRPD 3UCQA 4LMQE 4KZDL 2PCPA 3PHAA 3BZEB 2PTTB 2YKLH 5C2BH 2IG2L 1E8YA 2PYFA 5CD5C 1XQ8A 2UXCO 2JQMA 5CBAA 2YGQA 1T5WA 3GFUA 2IQAA 2OMYA 1FE8L 4M7LT 3KAAA 5GGUB 5C0CE 5C0RL 3FSOA 1UA3A 5JVDA 3T09A 3HC4L 4JRXD 3QQ4A 5INCB 1YNKH 3KYKH 1XTMA 5BNXD 5KAFZ 1JGVH 1H8LA 2G9KA 4IBVA 1JGEA 2Q8AL 4QHKI 1S8DA 2X88A 3PWPD 3DTUB 2GJPA 1XL4A 2ZP8A 4DTGL 1A7PL 2F2HA 4QRSB 4XXDA 4LESA 4MD0A 1YY9D 1KXQE 2N05A 3T65B 4P2YA 4BAYA 4IU3A 5BZWB 4GKNA 3AG4C 2H6PA 1T21A 4RIRB 3RE0A 4B5ZA 4HFWB 1EGJL 3M88A 4JFXA 4NKOA 5HHQB 3QUYB 1D3CA 4PWHA 2JK5C 5CD3A 3MHHC 5HYJE 3MCYA 5DHEA 1YMME 1JERA 4K5LA 4ZS6C 4X98B 3QWOB 2TSBA 5EMYA 2ED6A 4N1EA 3US1A 3TBYA 5C0DA 4OD1L 3HS0B 2YGVA 5AKRA 3IJYB 2F43G 2W0LA 3GMLB 3QZMA 4M6NH 2AZ0A 4WF7A 4UCTA 1MCJA 3TGUH 2F93B 1I8LC 1U2YA 4J2QA 4G9DB 3VUAA 4P4KD 2GJJA 1JXJA 3MJWA 4XNQB 3D85B 3CIAA 4JHZA 2A9MH 3ZTJG 4LHUB 3ZE1F 2X4SB 3T0EC 1E2WA 4NYLB 2X0UA 4PP2B 1BEXA 1E4KC 4YSTA 4EOWL 4NN6C 4BKSC 3NFNB 3B8MA 4L4VE 4R4ND 4CU8A 4OJEH 2ZKWA 3FN3A 4OGXL 4APQD 3GLDA 4LIQE 4Y19D 1B2WH 4TTDD 4HMDA 4GIOA 1MWOA 5F1KC 3QR2A 4PMEA 4B3VA 5IW3A 3QEQA 1NUNB 2IG2H 2J2ZB 2UXTA 4JCMA 2YN5A 4JI1B 4JJOA 1OAYL 1VPOH 4X6CF 4P2RA 3ZHRA 3JAKA 5F9DC 5HJDA 4GO6B 5C6TL 3OB8A 4N0UE 2GK0A 5E6ID 3LH2H 5FA3B 3ZDYF 3DHPA 3HC4H 1GGBL 4P57A 5D96C 5DQJA 1UQSB 3I6GA 3WUWA 4K3EL 2M26A 4DKTA 3QIBC 4P9ML 5T1DL 4ZUSA 2R9HC 1BFVH 1AD9B 3T3ME 3CN1A 1G6UA 1ZHKB 2H2SD 3L3JB 4FJ6A 4PVNA 3UPAA 1YAZA 2F54A 3NCJL 5D1ZA 4HLEA 2LAGB 5GRXG 4DTGH 5DYFA 1D6VH 4CU7A 1MZYA 4HC1H 4DUVA 2Y0PA 1GSKA 2V7HB 3IJHB 2X4PA 3OMNB 4YSEA 2ZWSA 1NPUA 3FT9A 3KGRA 4X66B 2KZKA 3T8MA 1CVRA 1LNQA 2DQMA 3OW2U 2IWKA 2XJKA 5D7KD 3U48A 5KMGB 2ZWNA 4ZOEA 2XOKG 4JI0B 1QOKA 4I13B 4R4NC 4M8UA 3HNTH 5FO2A 1GAXA 4APQC 2XQBL 4R4BB 3RB5A 4TTDC 3B9AA 4JHBA 1PX8A 2XAHA 5KEZA 1IGFH 4PR5B 4WFED 2VIRB 1T04A 3DGGA 1X5ZA 3U82B 1XGPB 3WV0A 3ARZA 4NYKA 1EVUA 4EOWH 2JELL 2LTQC 1QRKA 4BE6A 3N43F 4DZBA 2BSKA 2VZOA 5E6IC 3DHUA 4XCYB 4XVUD 4G8GB 2P52A 3BKYL 1XB6A 1EJOH 2DLGA 3JSLA 2ZWLT 4MTFA 3FNKA 4KTEH 4URTB 4AEIH 3LKQA 3B2MA 2D2OA 3CCMV 3CN0A 2IIJA 1W2BU 1CTMA 2H2SC 4FFYA 4NQEA 2P80A 5F0PB 4PJ8A 3HUJB 3BIKA 3NN8B 1R6NA 1VQ5V 5IQ7H 4K55A 5C6TH 4FXGA 1P9MC 1JMZA 1JGUL 2J8UF 3AK1A 4PGDB 4XMKH 1CLOH 1U8QB 2G30A 1LILA 1JGDB 1T2JA 4HGKC 2Q5BA 4ZX3A 4Q56A 1MFUA 5DFVD 4KXAA 5JA8B 3MDSA 4NXSA 2BSEA 2FECI 4P5TB 4LLYA 3ZW3A 2B8OT 1KZYA 3QCUH 4P5MA 3IJ4A 2V8MA 4RGNE 2X2YA 3NCJH 4J11A 2LFEA 2DQHH 3HG1A 1FXKA 5JW4M 1WGOA 5TF0A 1H2NA 1QQCA 4YBQD 1IBZA 4JFYB 2UZIL 3VXUB 1TCMA 5CIPH 5CS7A 3BQUB 5AW9B 1MCCA 5J9PB 2LP7A 1MPAH 3D39D 3TO2A 5AW8B 3KBPA 1ZVNA 3K91A 2Q0OC 2VDMH 2EJ1A 2APSA 4KGLA 4XPGL 1A9BA 3MXVH 3CDYA 2Y3AA 3UL4A 3AVEA 5JJJB 5IJCC 3LDCA 1KBGH 4A2GA 3HPLC 5IJKC 1X9LA 2FLRT 4PD4F 2BNRB 4Q7DA 3JV4B 3UJTL 3BABA 1JP5A 4XVUC 5B39A 4KMLB 2F74B 2XQBH 3LKOB 3LHPL 3QUMA 3RL2B 2IPKA 1E6JH 1J5IA 5KYXB 1AO7A 1KYAA 2WLJA 3B2XA 3KGUA 1HZLA 3NRFA 3U11A 3KPQB 4GQQA 2Q2EB 2WTPA 2Q6AA 2X70B 1MREH 1CR9L 2ZX6A 4HUUB 1GZQB 1BQRA 4H88L 5KVEE 4ZTEA 3DX7B 2HJDA 2JELH 2YO3A 2Z4QB 3U2SB 3GZOA 4JAAA 2AQQA 5CZVL 3MJ9L 1KCSH 3MNZA 3OJDB 5CR8A 5CSZA 1ZLWK 4U1LA 5DFVC 4NXNO 3BUPA 3WLBB 4ELMA 4RZCB 2BSTA 4FABL 3CZUB 4JL2A 1ETZA 2CJUL 3A6CL 1H19A 5E5UB 2EYRB 2DQCL 3U1SH 1J9TA 4NZTL 1JZ3A 1JCVA 3F3HA 5AYTA 4L4TE 3J7AU 1ZK9A 5LHDA 1CI5A 3VFOA 4YBQC 1GW0A 5LXTB 4ZPVB 4NR1A 4E42A 5TDPB 1DN2A 2GYSA 4GKLA 1DQLH 4POZD 2XY1A 3V7AE 2FTKA 2AXJA 3K80A 5BR8B 4KUCD 4MNQD 3QEQD 2X4NA 5FKPB 1X4TA 2OT5A 1JPFB 4XOCA 1A7NL 4MAUL 1NTZH 4HCRA 1OCZC 3D50A 4ZFOB 4MVRA 4EE2A 3L71H 3QUGA 3BN9D 3GSOB 4ANXA 2AABH 4G72B 3KEHA 5AYQA 1ONQB 1F11A 3EFFA 1CL7L 1T20B 2BIMA 4HKZB 3L7EA 4HZLB 3DC5A 4HX1A 4XPGH 2F54D 4D7BA 1KTJA 3GIZH 4RQEA 5D1ZD 4IGBD 1MCNA 4GW4B 1KMGA 4PJGE 3TCTA 1G7LA 3H9SA 4MVQA 2ADGB 3X11A 2OR9L 5I6XB 4WFGA 1R3JA 5JA9A 4QTIL 4DP9X 1I1CA 4TPRL 4UM8B 3TT1H 3BDBA 5L2JB 3U25A 5L8KB 3V0VB 5SWZE 3T3PB 3MR9A 1NCTA 4OCWL 1RU9H 1IRAY 1CR9H 4UCSA 4H88H 3OKLB 3LS4L 5FHBL 5IKCA 3V0JA 5FO8B 3D48R 3S4SG 1AE6L 3MRNB 1D7BA 3IJ9A 1ZLSH 2CRIA 3EADA 4MBOA 1M2OA 3IU3A 3QHFL 4POZC 1NAML 4LLVA 1R4XA 4MA7L 3FBQA 1WP6A 3FU7A 5JORB 5FK9A 4UT7H 2CJUH 3A6CH 4J1UB 1BD2A 5IM7A 1OSZB 2WN2A 5DUPH 5FKAB 3HR6A 4XNDA 3RJOA 4QJ4B 3APDA 1N19A 1Y1UA 3RPKA 3JARB 5J56B 3FFDA 4QXWA 4ABQA 5GS2D 2GBOA 3TBVA 3OHMB 3UYPB 4N2AA 4CAGA 1DVZA 3K2KA 4MMXA 5EU4B 1QPPA 4EIZC 2A6DB 3MX0A 3RAJL 3UBXG 4KK6D 1C8QA 3VGFA 5D1ZC 4OLWH 1J8HB 3BH9A 3OAWA 3FUIA 3ATEA 4X6DB 4OZFB 1FSKC 2GPZA 1H3UA 4HMEA 3VFNB 3OKEB 3BGAA 4PRPE 2BZDA 1RK7A 4JYCA 3DBXA 5DHDA 5LMUB 3GI8H 5FCUH 1BAFH 2NY0B 4I5SA 3D3VB 5IBUB 5IEKA 4OV5A 2X3AA 5LP6A 1AIFB 1HVXA 1LO0L 3TYFB 1OGAA 2ZX9A 2X2JA 1GAFL 3HG1D 1B0WA 3F7VA 4ABVA 2CGOA 1YJDC 1X7QA 4K8RL 1CXHA 4NN5C 1MCPL 2AAVA 3X2QC 4TQPA 5LAXA 4ALAL 2NCEA 4P2AA 2R7EA 4P46B 3OHXA 3O6KH 3B56A 2MMXA 4QTIH 3QNYA 3ULVH 4PGCA 1B6DA 2ENSA 3Q1SL 2QGDA 2IH9A 3VXSE 5JNYB 2B7DT 2CH8A 2F19L 2XY2A 2O6DA 3QPQD 2Z3YA 5CBGA 3PU7A 4FI7A 4MKMA 4MB1A 1I9IL 1U8HB 5EYPB 5D1XE 3HG3A 5C07A 3J8F7 4KQ3L 4DR2B 3RIAK 1AE6H 4IHOB 1ZKAA 1Q9OB 1PX3A 3QUZD 5H5NA 2JCCF 2EVHA 3V5DA 2VN6A 2OTPA 2YSSA 3CK0L 1TSRA 2EZPA 3OPUA 2IGLA 3TNMA 2MNJB 2CIIA 4A7GA 2UUDK 5F7BA 1YAIA 4M61A 4PJ8C 4TSFG 1DF4A 5CJQL 4ZMQA 2FQFA 3FULA 5DSCB 4X6EA 4Z5RA 1BVLA 4UQCA 4HOXA 1RJLA 4IRSA 1GGIL 2YPKA 3ZDWA 3WMSA 2MW2B 3ZE0E 2Z1KA 2Y72A 5IESL 5IYCO 4UANA 2Y2YA 3GZKA 1WYJA 5KJ4A 4KV5F 3MNWA 1U3HD 3ORJA 4GYBA 3WFCH 3N42F 1QP1A 2Y06H 3DX8A 3NZHH 1FXKC 4JO1L 2Y6SC 4OF8A 4UTCA 3VXOB 1QR8A 4IOIA 1BSIA 2DZEA 2EE0A 4FM0A 2OTLV 5IT9N 5LGHL 1WZ1L 3CCSV 1DQVA 4X9HA 2Z7UA 2DQTH 2V5SA 2XPYA 3QWNA 4ADJA 3A0HZ 1A7QH 2VS0A 1I4FB 2DWEB 4LSUL 5E2UL 5FA4B 5HHOE 3MRIA 3ZSTA 3IGLA 1X5HA 3U4EB 3MAWA 2WMPB 3ERXA 2EINB 1GAFH 4HKBA 5DZNA 4QHMB 3RTLA 5EFIB 3ULAB 4MCYB 3D25B 2AHZA 2JKRM 4ALAH 1ZUQA 4R4FL 1X5XA 4J6RL 3Q48A 4U6TA 3UTQB 2E4TA 3VXNA 3HPJA 2P4VA 1U42A 4U1KA 1GYAA 1KJMA 4FLQA 4X1KB 2AJZB 4NT6A 2G2NA 5IFAH 25C8L 1M9NA 5KHGA 3I9PA 1W16A 3BVDB 3FUDA 4M8QA 4KQ3H 3H9SD 5AAWC 3QYMA 1UUSA 1AXIB 3I75A 3MV8D 3D08A 1KBPA 1AKJA 4WFGD 1XF2B 3L9DA 1CFSB 1YEWA 5CN3A 1FVEB 3AABA 3CK0H 1SLVA 4PJCA 2AK1H 2VDRH 1CE1H 4PIRF 4NP9A 5IMLB 4ZMTA 5FPRA 3ZHVA 3VX0A 2GV9A 1JOIA 1WFTA 4R5TA 2CJSA 4CNIA 2IFGA 5JHDE 4HWEL 2F1MA 2XDHA 3LPFA 1VRSA 1ZS8B 4LFBO 1KENH 5GGSB 3HC2A 2OI9C 4NO0D 5CFAA 5IB2B 4LHUG 4NHCL 3MLTA 4GXUM 1MCWW 4WV1B 3WEOA 2GUOA 3G7TA 2P5WA 4FNSA 4YIQB 3H3KA 5IBLD 5G5DB 3VFMB 4GX1A 2PWGA 3MRBB 4P3WA 2HN7B 4PTUA 4KRMB 4Q0XH 4B9FA 3MLWH 1BD2D 1RZJH 4J3VA 1KPUA 3E86A 2DPKA 3PFUA 5TQ0H 4F2ME 4YLBA 5ISZE 5IVOA 4JO1H 1NFDB 3C6EA 2J1ZA 5DJZA 4J28A 1L6ZA 4NUJB 2K7PA 5EIIB 2CUIA 4PTTA 3RPBA 3CSGA 2YUXA 3WHXB 3QYCA 3ETBJ 2R1XB 2FKXA 5LMNB 1UA6H 1SY6H 1PBYA 5TDOA 4CSSA 4PJBF 2D0FA 2VXVH 3D0AA 1F86A 2FBJL 5HDQL 3NZUA 4K4KA 3HI6L 1K2DB 3MSPA 2Y9RT 1IBMB 1F8TH 1KP2A 1MQ8A 3WEBA 2CTRA 1G9HA 1Y74A 1HQRA 4I2XE 1PCXA 1EXHA 4JM2B 1R3JC 4J6RH 4XZ4A 2B59B 3D5OF 3BN3B 3NVQA 2B9BA 3SKUD 5I74C 1N6UA 3RYHB 3N5AA 4MAYA 5GS0D 1SQGA 2EDYA 2EILB 2Q7HA 1S6NA 3UAJA 3QQDA 4DGUA 1MUJA 4KVNH 4YHYC 4MDJB 2YFOA 1Z6JT 1DBJH 4QXUL 5I5MA 1SMAA 3PWJB 4DEPB 1Y67A 1QEWA 4LLQB 1WAEA 3FQRA 2NYKA 1AVMA 1WA0X 3WNIA 3KG5A 2IVFC 4WNQA 5IBLC 5I6LA 3STZB 1MHPH 3QORB 4V33A 2CLVB 4ZSOB 4YNYB 2WXMA 4H13B 4JN2B 1XCTB 4AYBA 1Q9LA 4YWGL 1ZT1A 3ARGA 4J8RB 3N50A 4JFFA 4Y5YB 3QRBA 5EIQA 1IM3B 1U2HA 5HI4D 2Z35A 3AB0C 3R18A 4K3JH 4XO9A 5C07D 3VFVB 3AADB 1A6UH 4X0NA 4RMTA 4O00A 4UV9A 1BWWA 4RUFA 1KIRA 4OQ1A 1AYOA 1VZGA 4K94C 2YEVB 3QZNA 1I1RA 4DUZO 4MMXC 3JTSA 5IW1B 5EO0B 3EUUA 1EFXB 4HWZA 4IEFA 3ZZLA 4JO4L 4ZNEE 5BCAA 2RFXA 4M7KL 4N0FA 2FLMA 5DMIL 2EEBA 3B2VL 4JAMA 5FDWB 1JZFA 5EZOH 2VZVA 3H4FA 4DWHA 5HYQA 4XNAA 5TQ2H 3CLEL 1U8PB 3LRSB 3OC8A 3NACL 2NQ3A 2AKRB 5I1LA 4F5CA 5FM5O 2WANA 4FJZA 1AYRA 1N0LB 5GS0C 3C5XA 3F83A 3PAYA 3BE1L 3TF7C 3ZK0A 3MJ8A 5LP6C 1IZKA 3OF6A 5T3ZE 1QX1A 1NA8A 4J3SA 2ZDIC 4KROD 2WYZA 2P28B 3FF7A 3CD6V 3HI5L 5C0CB 4ZFFB 3F7VC 4RA3A 4PCYA 3WL9B 3MBWB 1ICTA 4AQEB 3L6FB 3DRQB 3JWOC 4UAOC 4NM4L 5LGYA 3OHXC 3P4MA 3O2DA 1Q1JL 2YUZA 1ZIBA 2WLZA 3BAEL 4PG9A 3AXLB 5TE7L 2GITA 4FZ8H 5KSVA 4YL4A 1ZEAL 3DROB 4U4IA 5IWAO 1LQSR 4DV0O 1W0WB 3RDTD 3NAAL 4Z6AT 4PJ9B 4HP5A 3N91A 2DBLL 4P99A 1KLGA 1ZDSA 4J3OC 1XOUA 1G8MA 1KPVA 4BFKA 3FU0A 3NZ8A 5IROA 3CVHA 1CN4A 3L2MA 4FYTA 4XVTL 5GZNA 4I4WA 4Z3GA 5CN1A 1WG3A 1VQ9V 3D0LA 1YEHL 1B4LA 1WLHA 2BZCA 2WW8A 1DSFH 3G6DH 3VXRA 3IXAB 4BSWA 5I5JA 2HKAA 1QKZL 4QT5A 3LZQA 3IDYC 2EYTA 2UY7A 2BRQA 4KI1A 3Q8BA 2DM4A 1URLA 2P4KA 1NCNA 1F4WL 5HI5D 1DL7H 1ES0B 1HHJA 4IRSC 3FS9A 4NAMA 5E8DH 2XWTB 4GKSA 5LB1A 3BKML 4R97B 5JXED 5DJAB 3VQMA 3WXVH 5BVPH 5I1IL 3V6FB 1HJCA 1Z0NA 4M7KH 5DMIH 3G04B 2QR4A 3VI4B 4DP4X 2RAMA 4JI7B 1ZT7B 2DW5A 3U0PB 5L8JB 3IAYA 4NAQA 2UZXA 4FRWA 3LHAA 4XP1L 2OTUA 2QADD 3EBHA 5TK2A 3SGKC 5L2KE 3NYKA 1YNTF 2R1WA 1B0RA 4M7JH 1TETH 4Y9FA 3WJMB 2EXWD 3WTYA 5DJDB 2R0WL 2YMXH 1YDPA 3LPGA 1EHLL