3T1HO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3t1hO00
4OPAA 1NS1A 4DV6O 2UU9O 2UXBO 4JI3O 1N36O 1HNZO 1A32A 5BR8O 4DV4O 1XMQO 2FKXA 4JI8O 1I94O 4LFBO 4B3MO 3JAMN 4DV2O 4LF9O 4DV1O 4LF5O 2UUAO 4B3SO 2DJVA 5LL6Y 4DR5O 1FJGO 4LFAO 1IBLO 1XEQA 1KUQA 3SDLA 4DR6O 4DUYO 2JRIA 1X59A 1IBMO 4DV5O 3J80N 4JI1O 2ZM6O 1IBKO 5LMUO 5BXZA 4DR2O 4JI2O 5BY1A 1AB3A 3T1YO 1YZBA 1DK1A 1FKAO 4GKKO 4X64O 4GKJO 4JYAO 4K0KO 4LF4O 1F7YA 4JV5O 2AGAA 4YHHO 1G1XB 2HHHO 4NXMO 4OPHA 3T1HO 4LF6O 1XNRO 5A2QN 2F4VO 4DR4O 2LW7A 5H5NA 4DR3O 5IT9N 1N32O 5FLXN 1HNXO 1FYJA 2VQEO 1XMOO 4YY3O 4DV7O 4DUZO 1HR0O 1D2DA 1N33O 4X65O 3OTOO 5LMNO 3J7AU 5IWAO 2ZKOA 4JI7O 4X62O 4A5UB 3J81N 4DV3O 4DR1O 4KHPO 1R6TA 4NXNO 4DR7O 1J5EO 1AILA 4OX9O 1N34O 4JI4O 2UUBO 2UXDO 3F5TA 2E5LO 4AQYO 4LF8O 4JI5O 1R1BA 2UXCO 4LFCO 3R66A 1XNQO 3O65A 4B3RO 2UUCO 3M8AA 4JI0O 4B3TO 1HNWO 4X66O 2VQFO 4DV0O 2Z0AA 4LF7O 2DOSA 2N74A 4JI6O 3RT3C
chains in the Genus database with same CATH superfamily
1NS1A 2RCVA 4FK5C 4J41A 1QNMA 4IHJA 2V1DA 3H9VA 1BS3A 1PNLA 3LUTB 3S3WA 3I5DA 3HKCB 1R3KC 3JATA 3PN1A 1XILA 1URFA 4PJ0Z 1HP8A 1VQ7V 1SETA 2PYLA 1S5HC 3K79A 2Q69A 4X20B 1R6KA 1IXMA 2ZE6A 4KP4A 3ZMZA 2M6YA 3CXCU 3OUSA 2WLIA 1H2KA 4YJ3A 2XAHA 5BY1A 4UFZA 1IBMB 4FFBB 4R7CA 1K97A 1YCIA 4O4IA 1FPOA 4LF4O 1F23A 4PDVA 1FFTB 4UCTA 1CXZB 1KKCA 4HNAA 4YIPA 3BVOA 4AHCA 1BT8A 4ZOLA 1G1XB 2EBOA 5B1OA 2YSUB 1SZXA 1QU7A 1XBLA 3SYPA 4DR4O 2LW7A 5J2UB 4O4HA 2VQEO 1YJNV 3STZC 3OAAG 2OIGA 1I5XA 4N21A 1YJWV 2V7QG 4JYAB 4LR3A 2XUMA 1J95A 3ABTA 2GHYA 1JX9A 2P06A 1PNMA 2UXDO 3KZIZ 3FB6C 4OX9B 5CA1A 2IW5A 3UT5B 3ZMVA 4TWKA 1BMFG 3EFFK 1HNXB 2E5LB 4AQYB 2CGNA 2Y69C 2JGUA 2P67A 5LP6B 1QLNA 4DV6O 1GAXA 2UU9O 4WFAV 2KG7B 2A79B 3G6BA 5FNVA 4G28B 4UCOA 4GX2A 3JAMN 2E3CA 4JI5B 3ZCCA 4I4TB 3DXRB 1I94B 1FXKA 1JA8A 2QDOA 4J42A 2QM4A 4DV2B 2LW1A 1YTFD 1AI4A 2BOBC 2ARHA 4GZRB 1QVFU 1K5SA 5LGUA 2WLKA 5IYDO 3UM7A 1MMMA 2ZM6B 4JYAO 2W0FC 3Q4HA 3G4SV 1KKDA 3BRCA 5HFMA 4AI8A 2ADPA 5KUMA 1SQPH 1R73A 2MW2B 2H3OA 3CD6V 4LBEC 4L87A 1YI2V 1BQ0A 2JEUA 5IT9N 1HNXO 4LF6B 1OCRC 4H37A 5EYPB 3WB0A 4LNUB 1Q90D 4FZ1A 1OHHG 4OXSA 5IJ9A 2W6IG 2DYRB 5LMNB 4I55A 1VQKV 3E83A 4FZ0A 4RUFA 1NJIW 4JV5B 4I0XB 2OWOA 4WBNA 4JI5O 5KX5A 4HBNA 1RFYA 4H13B 3M8AA 1HNWO 2UUBB 3SYCA 3JD0A 3AG3C 2Z0AA 5KHIA 2KQXA 1RM1B 1NTMH 4QPJA 1G8MA 3CP1A 3FX7A 4FLUA 3RT3C 4X65B 3D36A 4LH7A 1SQVH 2UXBO 1SS3A 2F66C 4P2ZA 2PY5A 3OTFA 4JI8O 2XT9A 3B09A 5C93A 1VF6C 1X4TA 3CC2V 3RYFA 1TVKA 1XNQB 3IJ4A 1S77D 1WNSA 3L73H 5CA0B 2F43G 4DV5O 1HWYA 2HR3A 4X1KA 5F2VO 4FVMA 1K92A 3BHPA 5LHHA 1IBKB 3JD1A 4LC1A 3A0BZ 1KBHA 3ZMSA 3NXSA 5A9GA 5IY5C 1HW7A 4JV5O 1AR5A 2ETNA 2WA3A 3N2GB 3SPIA 4DK0A 1YIJV 3VOUA 4LF5B 5D5PA 4TSFG 4GUNA 2DN9A 1FJGB 2HVJC 1XMOO 1OCOC 2Q0OC 2XHBA 3EXAA 4UCSA 4E2LA 3GB7C 4MVMA 4U3FH 4K35A 3OM3B 2HP8A 4X65O 5LXTA 1D5NA 1SZTA 2NR5A 3U11A 1AJNA 3CE2A 4LH6A 4CH6A 2A7WA 4XDKA 4UXNA 1EZJA 4DK1A 4UCVA 4JI7B 1YXBA 5CMUA 3RVYA 2LFSA 5KHGA 1J5EB 1XNQO 3RYHB 4JI0O 2OTLV 1T5EA 3P3NA 1R3LC 2XAGA 1Q5OA 3ZRWA 4Z1VA 4ZKIA 2KB1A 3WG7C 2DYSC 2Y69B 3TXSA 5E79Z 1N33B 4BWAA 1YTFB 2AZ0A 1K33A 1Y74B 3CB2A 2Q4PA 1AP5A 2OCCB 4FMTA 3FB5C 2WPDG 4KHPB 3ETGA 3UCSC 3OMNB 1B3QA 1BGYH 1AVMA 2ZT9B 1EM1A 2XAQA 3IAYA 4LF5O 4EEQA 3CSXA 4CS3A 2DJVA 3OEEG 1FJGO 1VEWA 5IYZA 1R3JC 3H1LH 4TOIA 2Z3YA 3RYHA 1OCCC 2X6CA 2ITCC 2QJ1A 5JCOA 1YSCA 4X1YB 4RAIA 3T1YO 4GX5A 2IU3A 3AK1A 3LNNA 4TV8B 1JFFA 3CX5F 2IJKA 4BIZA 1YDXA 4DV1B 4GX1A 4BR6A 3CCRV 1PL0A 1IBLB 3TXQA 1VQ8V 5B66Z 1SF9A 2CDYA 4R6ZA 4MSWC 5LA6A 4DR3B 1N33O 1OCRB 4QGPA 3LSQA 1TUBB 4C7UA 4QIWF 3D3IA 4ASUG 3MDSA 2E75B 3L75H 2IJHA 3ZHQA 5LBQA 4A5UB 2N05A 3RWRD 4KHPO 1NTKH 2ZE8A 2ZNJA 5JQGB 4TV8A 1NU1H 4DXWA 4I50A 3O65A 2UUCO 4JTAB 3R65A 4TV9B 3L72H 3K9AA 4MVRA 5IYCO 4UV9A 2GTSA 3BAAA 2QSAA 3WFVA 3AG3B 3ZS8C 4UV8A 1NZ6A 1KP3A 2ODMA 1NT2B 2ZR3A 1NBMG 3E22A 1Q81W 3CCQV 4NB5A 1ZTEA 4O2AB 1HNZO 5HFLA 3SPHA 2YIBA 1SQGA 3CPWU 4NXNB 1KU9A 2F23A 2IH1C 2IJJA 3WU2Z 4PA7A 4DRXA 1LR1A 2DQ0A 3JD4A 4KXRA 2DMXA 2ZQMA 3BFRA 1W0KG 3AG4C 1BE3H 1W0JG 4DV1O 2BCCH 5KAFZ 1IURA 3DGEA 4B3SO 3JASA 4J7JA 2JS3A 5CB4A 1GTOA 1IBLO 4F6RA 4B3TB 1JMKC 4B08A 4MVZA 1H2GA 4PI0A 1H8EG 1AJQA 2RMKB 3VQVA 4MTXA 5BXZA 4J11A 4KFMA 4CH4A 5JH7B 4JI3B 5CBGA 1N36B 3A0RA 3ETQA 2Q68A 1Y66A 2VS0A 3B8NA 5B1AB 1KECA 5IY5B 1US6A 3LDDA 4JAVA 1VARA 2ATKC 1B04A 4NVPA 1VF6A 1ZSPA 1QR8A 3L70H 4DUZO 1D2DA 1SERA 2PZSA 3E8BA 4R8CA 2PGGA 2WLMA 3K0GA 4RQFA 3RYCA 4ZI7A 5IWAO 2PTMA 1Y67A 3DTUB 5C8YA 1WP7A 4JYYA 3FB8C 4X62O 2F93B 2NLJC 1O9HA 2VWKA 1KC8W 3CCLV 5LOVB 4NXNO 2EIKC 2EINC 2HHHB 2OIEA 3MD0A 3I55V 1WA8A 4JZ2A 2Q0AA 3JSNA 1JPXA 4DW0A 2A3QA 4YJ2A 1U96A 4HYOA 1DTOA 4IHJB 4B3TO 1WB8A 2B9ZA 3TETA 2XOKG 4JTDB 1HR0B 4AILC 1B6QA 5DECA 4B3RB 2XNDG 5EZYA 1MABG 3WG7B 4NYKA 2DYSB 3SYOA 1TUEB 3JATB 2LO1A 2Q7GA 3ETDA 4HAMA 4JI3O 3ZBHA 1N36O 3JAWA 4DV4O 2Y4UA 3AG7A 1M90W 2DE0X 2WLIB 4YJ3B 3M99B 1VF7A 1NH2D 5B1BC 1G4YB 2QM7A 2UUAO 4QE7A 5LL6Y 4DR5O 3P32A 3LNMB 4X66B 2Q8VA 4O4IB 1RP3B 3T1CA 3FKSG 5DM6V 4HNAB 4CC6A 4EFBA 4FLTA 4DR6B 2VWJA 4J7KA 4ZOLB 2CH7A 1VQPV 5CBFA 1DK1A 5D5QA 5EC1C 2QTSA 1RPRA 1P84F 3CCJV 2QWQB 1S72V 3LSUA 1PPJH 4O4HB 4TQDA 4W4LA 1K73W 2HHHO 1R6NA 4PDMA 1PNKA 1BL8A 1IDSA 4P30A 4ABMA 3BEHA 5EC2C 3SJCC 4DV7O 1HR0O 1BZKA 1H2NA 3D8CA 5H9CA 2X6AA 3O9OA 4HZ3A 4MTGA 2XAJA 3RYIA 4ZHQA 5GONA 3G71V 5CA1B 3J81N 4FLXA 1WLEA 3H1KH 4LWSA 5GTHZ 4WFHA 2HJFC 1VQ5V 2CAZC 1Q82W 1VIBA 1CP9A 1SESA 1WAZA 3TGUH 4JI4B 1H2MA 3P3PA 1VP7A 4X66O 3SJAC 2HEPA 5IDJA 1EN5A 5AG2A 5FNVB 4LCUC 1P49A 5JJEB 2B1IA 2L6LA 1FXKB 4DR1B 5JWPA 3ZHRA 1QLEB 3E89A 1V54C 2ZIOA 3UO3A 5FPRA 3SPGA 3ML0A 2Y48A 4H0LB 5JCOC 3FB7C 3DC5A 3CRMA 1Q3EA 3RBZA 1KMIZ 1Q8IA 5B5EZ 5EIBC 4I9QA 1XEQA 1EZVH 1KUQA 2QWPB 4RUEA 3ZHVA 1YF2A 4KL1A 1IBMO 3Q4HB 1N0JA 4MW8A 4NTWA 1XHZA 5CBHA 1UJWB 1FKAO 4WF9V 2D3OW 4DO2A 3ASOC 2V4DA 4UB8Z 1F7YA 3K59A 2RQ6A 1I0HA 1ZX3A 4FPPA 4IYIA 2RNBA 2AGAA 3HKDA 1Q6IA 4ICGA 5BMVA 1E1QG 3IGAC 3K0DA 5IJ9B 3CRAA 1DGSA 3KCXA 3KKYA 2EX3A 4I55B 5FPOA 3SYAA 5LHGA 4PA3A 1YHQV 1QCEA 4WBNB 5KX5B 3E8HA 2AHZA 1LNQA 4PDRA 4DR1O 2LQTA 3QO7A 4OX9O 5IE9A 4FLVA 4DV3B 3FYEB 1QQCA 4BW5A 2E5LO 2EINB 1S3JA 4AQYO 1XNRB 4X1IA 4FM0A 3ZRSA 2DWEC 4UUJC 2E74B 3CYOA 1NH2B 3B8MA 4D7SA 2WLLA 4MVQA 1VF5B 4I9WA 4ZIBA 2JJ1G 3D3QA 3OW2U 3N2KA 3QO8A 3RYFB 1I5YA 1TVKB 4QNHB 1JJOA 3ZN1A 4CZZA 3SJQC 4PV1B 1I94O 2WLJA 5DN6G 1OCZC 1M93A 2ZE7A 4N23A 3OUFA 4DV2O 4LF8B 4X1KB 3RGBA 1Q86W 4W4KA 4LFBB 2YIBD 3APOA 1M56C 3MHSC 3ZHUA 1VQNV 1XUQA 4UVAA 2ZM6O 1JR9A 3FAVA 2AW9A 5H6QA 5LGNA 2HJDA 3BABA 5KHJA 1V9PA 1K7DA 3OD4A 4DW1A 1ZUQA 4X64B 4K0KB 1PKXA 3AG2C 3HKEA 4OPHA 3ZMUA 4LF6O 1XNRO 3ASNC 5LXTB 1L8DA 3JALA 4DYLA 1YEWA 3U10A 3K08A 4DUYB 4ZBMA 1N32B 1CPYA 2QM8A 4NTYA 5LMNO 3X2QC 3VQWA 1WPXA 3J7AU 4PHZA 1NI8A 4IGGA 2ZKOA 1L0NH 2CTPA 1UPGA 2Q67A 1JJ2U 1AR4A 2RN9A 1PL4A 1K34A 4UB6Z 3OMAB 3ZRWB 2HKOA 1BHBA 2JGDA 2UUBO 4G2KA 4LF8O 1FD9A 1GN4A 1GMGA 3JARA 4NR1A 3G6EV 4R50A 1KYOF 3BA9A 1NR1A 1MNGA 4U7OA 2EJ7A 3JCUZ 2QKAA 2IU0A 3P30A 3FYIB 1CEZA 4U3JA 2Q9LA 4TUYA 4CS4A 4YXWG 3B40A 2CTWA 3CEIA 2KSDA 2PYJA 3L9DA 5IYZB 1ZL8A 1V54B 5J9PC 2L35A 3OGIB 3KG2A 3AEIA 1K8AW 3CCVV 4DUYO 4D7TA 4LF7B 1NR7A 3B77A 3F7VC 1IBKO 1JFFB 3A8TA 4H33A 3H1JH 1XDCA 2BSKB 2JK5C 1EFRG 2CGOA 1GRJA 2EZOA 2RJZA 4JI2B 3ASOB 4PELA 1MA1A 2FL4A 4G27B 4GKKB 2W0XA 5DEDA 4FLZA 5LA6B 2JJ2G 5K1PA 2BTQA 3QNEA 1P4RA 4U7NA 5KHHA 4IYHA 4YHHB 3JAKA 3ZN0A 1NVPD 3ETEA 5J2TA 4UCRA 1ZWIC 3JD2A 4FFKA 5GW7A 2CE4A 4UCUA 5KA6A 2GV9A 1KB9F 2WAMA 2OT5A 4FLWA 1WB7A 3LDEA 3OTOB 4JI7O 4I50B 3K04A 4RWUA 5EK0A 4CH5A 1J5EO 2BSKA 2LP7A 3A2FA 3I56V 3W7TA 1D5AA 3ABLC 3OT7A 2Q6AA 3E22B 4GCZA 2QEXV 5LYJA 4O2BA 1BCCH 3JCZA 4YY3B 4LF7O 1XREA 2A06H 3BPZA 4F6EA 2KKWA 4DRXB 1KP2A 2K1EA 4GT1A 2XTAA 4FJCC 1A32A 3K5MA 1AR1B 3JASB 2HFEC 5CB4B 2W6JG 4F6RB 4YIOA 3OE7G 3QVNA 1OCZB 1BSMA 1FXHA 4WFEA 2YXYA 1YITV 2AHYA 3L74H 3E8GA 1QR9A 1FS0G 2YEVA 4LF9B 4CC5A 3J80N 1OZ0A 1K5QA 2FYUH 1AB3A 5L3FA 3CCUV 1F4NA 2ZIMA 4MVSA 2YXHA 3OFNG 1Q6HA 2QR4A 1FFXA 3AG2B 4DR3O 3RYCB 4ZI7B 3ASNB 2C2AA 1L0LH 5C8YB 4YY3O 4D6TH 4P9PA 4BIUA 1Y76B 5LMUB 3MAQA 2R9AA 4NKGB 2ZINA 3OMIB 5LP6C 2AZ2A 1K9MW 3W7WA 2FMLA 1M5IA 2X6BA 5KMGA 1WA8B 4YJ2B 4QJFB 3E2EA 2MK3A 5H2FZ 1M1KW 3LSSA 1AP6A 3ZHTA 3TJTA 1H8HG 3FD9A 5EZYB 3T1HB 1UFIA 2QA4V 1OCOB 1AROP 3ZEDA 3F5WC 3WB2A 3JAWB 3W7UA 1ZAUA 5L3CA 1IX9A 4UVCA 5E1AC 3ICXA 3TCUA 1P7GA 1Y76A 1M4UA 1PP9H 4O4LA 3A0HZ 4JPRA 1MZEA 5IJ0B 3B2EE 3CS5A 3BY6A 2DQ3A 2JDIG 3IFXA 5KA5A 3ABMC 2VRZA 1Z5VA 4EFEA 1K3EA 2EULA 4WFBV 2QGNA 1HDJA 2CH7B 4H44B 2VQFB 2EILC 2JVDA 2JRIA 1BHAA 3UO2A 1GH6A 1SC5B 4O4JA 5LMUO 2EIJC 1QBZA 4MS2A 1RSOA 2Z5UA 1NVPB 3BCCH 1N8RW 1Q43A 2B1GA 2WLHA 2DYRC 2EZPA 3K5LA 4PDLA 5IJ0A 3CJHA 4IIJA 1MSDA 3T1HO 1S76D 5A2QN 2JIZG 4FLYA 1OCCB 1DF5A 5KUKA 3RYIB 1RPOA 2NN4A 5GONB 4ZHQB 4DR4B 2ZDIC 2CUGA 2UXNA 3G67A 1RM1C 4LWSB 3G80A 4DR2B 2UXXA 3K57A 1JCHA 1SA0A 5KAIZ 1AJPA 1R6TA 5KHKA 2GUZA 2XASA 4F4LA 3JSLA 2Q7HA 2HG5C 3VQXA 4B3RO 2E76B 3ABLB 4BAYA 2UXDB 2PI4A 1VQLV 2VQFO 1BQZA 2M7WA 1WN7A 3HB3B 3QO5A 1E1RG 1WP8A 3K06A 1GM8A 4I5SA 3APQA 3TK1A 1VQOV 3DSQA 2YIAA 2Q5ZA 3HKBA 4DV6B 3M7MX 1GK9A 4GYCB 2UU9B 1M57C 1SQBH 4PI2A 3T2MA 5JJNB 1TGOA 1VQ4V 1IVSA 3HKCA 1XHXA 1GM9A 1LUVA 4DR6O 2P6JA 3SPCA 1Q7YW 1MSWD 2R9IA 3H1IH 5ITZB 4XDLA 3HKDB 4EB6B 4DR2O 4FM1A 3B4SA 1YZBA 4X20A 4E4EA 5BMVB 2QE7G 4Q20A 1SQXH 5BR8B 4MT8A 1XMQB 3STLC 3AG4B 1Q6UA 5B1NA 1H2SB 4FFBA 4JGSA 3AK3A 5L3GA 3CHXA 3K58A 5FLXN 1SKVA 3C3TA 5KLVH 1WJZA 1AI7A 1XL6A 5J2UA 1N4CA 3JYCA 1MG1A 1SQFA 4X9QA 4X1IB 5ITZA 2QWNB 4EB6A 3EVKA 1GN6A 4JZGA 4FM2A 2OCCC 2WLNA 5EIBD 3K03A 2H94A 4JI4O 2WLLB 1XI1A 2HLDG 3F5TA 4NXMB 1W59A 2OYQA 5EBWC 2BE3A 5LGTA 3IC9A 4GX0A 2BTOA 3N2KB 1LUWA 1I08A 3SGIA 1G6UA 1HNWB 3UT5A 1K4CC 3ZJZA 2PF4E 4Z2WA 5BR8O 5BZBA 2EIKB 1XMQO 3K5NA 5LP6A 3ZIAG 2O57A 2UXBB 3E35A 4Z1MG 1NKDA 1NTZH 4DR7B 4X8AA 1P7BA 1GO3F 3JD3A 1S0VA 3FAVB 1OJHA 4JI8B 2FB5A 2KG7A 2R70A 4LFCB 2ZCEA 4CS2A 3ABMB 1V55C 5L3BA 3SDLA 1R3IC 4K8ZA 1TA8A 2DWDC 1VQ9V 2EILB 2GTAA 4J10A 3QF7A 4I4TA 3DXRA 3HPLC 2EIJB 2Q73A 4DV5B 3HKEB 3QTCA 1JVMA 1SQQH 2QWRB 3JALB 3CCMV 2JS5A 1WPBA 1Y6XA 2EIMC 2YXLA 3THOA 2IBZH 5B1BB 1S5LZ 4NXMO 4MTFA 2IJIA 4L8JA 4MTOA 3ABKC 3CCSV 3AG1C 4I7ZB 2P4VA 5H5NA 4LFAB 2YI8A 3RN4A 1PV0A 1M9NA 2P90A 4JYCA 4LP8A 4J9ZB 1XMOB 3K3WA 5LHIA 5GTIZ 2JGDB 3AK2A 4MVOA 1MZFA 1GN3A 4DV3O 5EYPA 3JARB 4LNUA 1ZLZA 3CC7V 4DR7O 1L1FA 3CMAV 4CBCA 3VBBA 4UVBA 4LFCO 2F4VB 4U3JB 4TUYB 1KQSU 2YUAA 3E86A 3E8FA 4I0XA 4PA6A 4B7KA 2N74A 4JI0B 2ADQB 4OPAA 1EN4A 1ZL8B 4K8XA 3OR6C 2H8PC 2G38A 2ZDIA 2WWWA 4XBFA 1O9GA 2Y4TA 2FKXA 3IC7A 3U0ZA 3WB1A 4LFBO 1PD3A 2YS8A 3ZHSA 1H38A 5B1AC 1M57B 4KUMA 4RO2A 4LFAO 1PM9A 4WFGA 4DV0B 1AI6A 3SYQA 1W2BU 3RFRA 3CRCA 2LGQA 4JASA 4PA4A 2BTQB 4X64O 4K0KO 3W7XA 2ZXWC 5CA0A 4IT5A 2IM9A 3JAKB 3T1YB 1E79G 1THZA 3CCEV 4B3MB 5J2TB 1FAFA 4JTCB 2OTJV 2F4VO 3ZRXA 5B3SC 1YVWA 2GDSA 1N32O 2ZE5A 1FYJA 2NNUA 1GM7A 1TAEA 5EBMC 3N2GA 5JJJB 2GSMB 2CTQA 3LDCA 1GN2A 3BA8A 5L3EA 2GBOA 2CK3G 5LYJB 2YC0A 1AILA 4O2BB 3K5OA 3CRQA 1Y4MA 2D2CB 2ITDC 3T4DA 1ROPA 3H01A 3R66A 3OGCC 3ZRVA 4FIPC 2AXTZ 2ZNIA 1F51A 4DV0O 1XL4A 2QKSA 2UUCB 4QPKA 5TISZ 4QE9A 3KCYA 3SR2C 2CTRA 2X0LA 2LJ2A 4Q6GA 2YEVB 1HNZB 1N34B 4BIOA 4B3MO 4MW3A 3ZMTA 1Y74A 4GLXA 2UXCB 4WCEV 4XDJA 2ILMA 4NTXA 4P9OA 3C90A 1IXBA 4JYBA 1V55B 4IL6Z 1X59A 2LGWA 4B3SB 4JI2O 4RQEA 2RDCA 5JVDB 1Z5WA 4GKKO 1FFXB 1VQMV 3K9SA 3RW0A 3QG5A 4OGQB 1COWG 4B7EA 2WSSG 1B06A 5CN0A 4YHHO 4X1YA 2EIMB 4PA9A 3CWBH 1M56B 2P22C 3ABKB 2Q7EA 3AG1B 4PD4F 1F4MA 3F7YC 4MVUA 5KMGB 3DC6A 1XQ8A 2YI9A 2Y0IA 4JI1B 3CXHF 3OTOO 3CRRA 1S5JA 1Z2GA 4BW9A 4EKWA 4JAAA 4DUZB 4GKJB 3N27A 1K4DC 5JVDA 2WA4A 5IWAB 2PUSA 1FXKC 1MOFA 1TUBA 2P4KA 1QLEC 1N34O 2ZR2A 4X62B 2R72A 3UQ8A 2UXCO 1R1BA 2F1MA 2N04A 3EHBB 3RVZA 1EN6A 1NQTA 2B5UA 1JOYA 4O4LB 1U97A 1FXVA 5JQGA 2Y0PA 2DOSA 2R9RB 3X2QB 3T4ZA 1DF4A 2DW4A 3PJSK 4TV9A 1OV9A 5K1XA 2OCHA 2F95B 4WFFA 3HR0A 1KD1W 3ABUA 2XAFA 2LFRA 3ZX6A 3FFQA 3SPJA 4DV4B 4O2AA 4O4JB 4LF9O 2HVKC 1XOUA 4J9YB 2YIDA 1VMGA 4J80A 1QVGU 1RSOB 5H6RA 2P7TC 1GKFA 2JEXA 2YICA 2UUAB 4DR5B 4JI1O 4JI6B 2QKCA 1SRYA 4JF3A 3MHHC 4K3AA 1VQ6V 5FL7G 3S3XA 3CJHB 4IIJB 2P5OA 5EBLC 4GKJO 2IH3C 2ZD9A 2A9HA 1AI5A 3GWOA 4TQFA 2QTOA 2K9PA 2ZXWB 1I7FA 4J7ZA 4X89A 4CH3A 1DLBA 3UKMA 5JH7A 3C3SA 5B3SB 3D36C 3VQYA 2FTKA 1SA0B 2EJRA 3W7SA 2A0LA 3GWKC 3NR7A 1YJ9V 2GUZB 5IYBO 4DV7B 5CA3A 2X7RB 3CC4V 3GVMA 4LF4B 3H1HH 2YDEA 1IZ3A 1JQ0A 4TT3G 1H2LA 1EBOA 4JAUA 1ORQC 1N0NA 1ENVA 2QWOB 5LOVA 2VQEB 4X88A 3L71H 3OEHG 5L3DA 3CMEV 3HKBB 2PI5A 3OR7C 1QHTA 4JI6O 2BOCC 3SJBC
chains in the Genus database with same CATH topology
4OPAA 1NS1A 4DV6O 2UU9O 2UXBO 4JI3O 1N36O 1HNZO 1A32A 5BR8O 4DV4O 1XMQO 2FKXA 4JI8O 1I94O 4LFBO 4B3MO 3JAMN 4DV2O 4LF9O 4DV1O 4LF5O 2UUAO 4B3SO 2DJVA 5LL6Y 4DR5O 1FJGO 4LFAO 1IBLO 1XEQA 1KUQA 3SDLA 4DR6O 4DUYO 2JRIA 1X59A 1IBMO 4DV5O 3J80N 4JI1O 2ZM6O 1IBKO 5LMUO 5BXZA 4DR2O 4JI2O 5BY1A 1AB3A 3T1YO 1YZBA 1DK1A 1FKAO 4GKKO 4X64O 4GKJO 4JYAO 4K0KO 4LF4O 1F7YA 4JV5O 2AGAA 4YHHO 1G1XB 2HHHO 4NXMO 4OPHA 3T1HO 4LF6O 1XNRO 5A2QN 2F4VO 4DR4O 2LW7A 5H5NA 4DR3O 5IT9N 1N32O 5FLXN 1HNXO 1FYJA 2VQEO 1XMOO 4YY3O 4DV7O 4DUZO 1HR0O 1D2DA 1N33O 4X65O 3OTOO 5LMNO 3J7AU 5IWAO 2ZKOA 4JI7O 4X62O 4A5UB 3J81N 4DV3O 4DR1O 4KHPO 1R6TA 4NXNO 4DR7O 1J5EO 1AILA 4OX9O 1N34O 4JI4O 2UUBO 2UXDO 3F5TA 2E5LO 4AQYO 4LF8O 4JI5O 1R1BA 2UXCO 4LFCO 3R66A 1XNQO 3O65A 4B3RO 2UUCO 3M8AA 4JI0O 4B3TO 1HNWO 4X66O 2VQFO 4DV0O 2Z0AA 4LF7O 2DOSA 2N74A 4JI6O 3RT3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPA A;  1NS1 A;  4DV6 O;  2UU9 O;  2UXB O;  4JI3 O;  1N36 O;  1HNZ O;  1A32 A;  5BR8 O;  4DV4 O;  1XMQ O;  2FKX A;  4JI8 O;  1I94 O;  4LFB O;  4B3M O;  3JAM N;  4DV2 O;  4LF9 O;  4DV1 O;  4LF5 O;  2UUA O;  4B3S O;  2DJV A;  5LL6 Y;  4DR5 O;  1FJG O;  4LFA O;  1IBL O;  1XEQ A;  1KUQ A;  3SDL A;  4DR6 O;  4DUY O;  2JRI A;  1X59 A;  1IBM O;  4DV5 O;  3J80 N;  4JI1 O;  2ZM6 O;  1IBK O;  5LMU O;  5BXZ A;  4DR2 O;  4JI2 O;  5BY1 A;  1AB3 A;  3T1Y O;  1YZB A;  1DK1 A;  1FKA O;  4GKK O;  4X64 O;  4GKJ O;  4JYA O;  4K0K O;  4LF4 O;  1F7Y A;  4JV5 O;  2AGA A;  4YHH O;  1G1X B;  2HHH O;  4NXM O;  4OPH A;  3T1H O;  4LF6 O;  1XNR O;  5A2Q N;  2F4V O;  4DR4 O;  2LW7 A;  5H5N A;  4DR3 O;  5IT9 N;  1N32 O;  5FLX N;  1HNX O;  1FYJ A;  2VQE O;  1XMO O;  4YY3 O;  4DV7 O;  4DUZ O;  1HR0 O;  1D2D A;  1N33 O;  4X65 O;  3OTO O;  5LMN O;  3J7A U;  5IWA O;  2ZKO A;  4JI7 O;  4X62 O;  4A5U B;  3J81 N;  4DV3 O;  4DR1 O;  4KHP O;  1R6T A;  4NXN O;  4DR7 O;  1J5E O;  1AIL A;  4OX9 O;  1N34 O;  4JI4 O;  2UUB O;  2UXD O;  3F5T A;  2E5L O;  4AQY O;  4LF8 O;  4JI5 O;  1R1B A;  2UXC O;  4LFC O;  3R66 A;  1XNQ O;  3O65 A;  4B3R O;  2UUC O;  3M8A A;  4JI0 O;  4B3T O;  1HNW O;  4X66 O;  2VQF O;  4DV0 O;  2Z0A A;  4LF7 O;  2DOS A;  2N74 A;  4JI6 O;  3RT3 C; 
#chains in the Genus database with same CATH topology
 1NS1 A;  2RCV A;  4FK5 C;  4J41 A;  1QNM A;  4IHJ A;  2V1D A;  3H9V A;  1BS3 A;  1PNL A;  3LUT B;  3S3W A;  3I5D A;  3HKC B;  1R3K C;  3JAT A;  3PN1 A;  1XIL A;  1URF A;  4PJ0 Z;  1HP8 A;  1VQ7 V;  1SET A;  2PYL A;  1S5H C;  3K79 A;  2Q69 A;  4X20 B;  1R6K A;  1IXM A;  2ZE6 A;  4KP4 A;  3ZMZ A;  2M6Y A;  3CXC U;  3OUS A;  2WLI A;  1H2K A;  4YJ3 A;  2XAH A;  5BY1 A;  4UFZ A;  1IBM B;  4FFB B;  4R7C A;  1K97 A;  1YCI A;  4O4I A;  1FPO A;  4LF4 O;  1F23 A;  4PDV A;  1FFT B;  4UCT A;  1CXZ B;  1KKC A;  4HNA A;  4YIP A;  3BVO A;  4AHC A;  1BT8 A;  4ZOL A;  1G1X B;  2EBO A;  5B1O A;  2YSU B;  1SZX A;  1QU7 A;  1XBL A;  3SYP A;  4DR4 O;  2LW7 A;  5J2U B;  4O4H A;  2VQE O;  1YJN V;  3STZ C;  3OAA G;  2OIG A;  1I5X A;  4N21 A;  1YJW V;  2V7Q G;  4JYA B;  4LR3 A;  2XUM A;  1J95 A;  3ABT A;  2GHY A;  1JX9 A;  2P06 A;  1PNM A;  2UXD O;  3KZI Z;  3FB6 C;  4OX9 B;  5CA1 A;  2IW5 A;  3UT5 B;  3ZMV A;  4TWK A;  1BMF G;  3EFF K;  1HNX B;  2E5L B;  4AQY B;  2CGN A;  2Y69 C;  2JGU A;  2P67 A;  5LP6 B;  1QLN A;  4DV6 O;  1GAX A;  2UU9 O;  4WFA V;  2KG7 B;  2A79 B;  3G6B A;  5FNV A;  4G28 B;  4UCO A;  4GX2 A;  3JAM N;  2E3C A;  4JI5 B;  3ZCC A;  4I4T B;  3DXR B;  1I94 B;  1FXK A;  1JA8 A;  2QDO A;  4J42 A;  2QM4 A;  4DV2 B;  2LW1 A;  1YTF D;  1AI4 A;  2BOB C;  2ARH A;  4GZR B;  1QVF U;  1K5S A;  5LGU A;  2WLK A;  5IYD O;  3UM7 A;  1MMM A;  2ZM6 B;  4JYA O;  2W0F C;  3Q4H A;  3G4S V;  1KKD A;  3BRC A;  5HFM A;  4AI8 A;  2ADP A;  5KUM A;  1SQP H;  1R73 A;  2MW2 B;  2H3O A;  3CD6 V;  4LBE C;  4L87 A;  1YI2 V;  1BQ0 A;  2JEU A;  5IT9 N;  1HNX O;  4LF6 B;  1OCR C;  4H37 A;  5EYP B;  3WB0 A;  4LNU B;  1Q90 D;  4FZ1 A;  1OHH G;  4OXS A;  5IJ9 A;  2W6I G;  2DYR B;  5LMN B;  4I55 A;  1VQK V;  3E83 A;  4FZ0 A;  4RUF A;  1NJI W;  4JV5 B;  4I0X B;  2OWO A;  4WBN A;  4JI5 O;  5KX5 A;  4HBN A;  1RFY A;  4H13 B;  3M8A A;  1HNW O;  2UUB B;  3SYC A;  3JD0 A;  3AG3 C;  2Z0A A;  5KHI A;  2KQX A;  1RM1 B;  1NTM H;  4QPJ A;  1G8M A;  3CP1 A;  3FX7 A;  4FLU A;  3RT3 C;  4X65 B;  3D36 A;  4LH7 A;  1SQV H;  2UXB O;  1SS3 A;  2F66 C;  4P2Z A;  2PY5 A;  3OTF A;  4JI8 O;  2XT9 A;  3B09 A;  5C93 A;  1VF6 C;  1X4T A;  3CC2 V;  3RYF A;  1TVK A;  1XNQ B;  3IJ4 A;  1S77 D;  1WNS A;  3L73 H;  5CA0 B;  2F43 G;  4DV5 O;  1HWY A;  2HR3 A;  4X1K A;  5F2V O;  4FVM A;  1K92 A;  3BHP A;  5LHH A;  1IBK B;  3JD1 A;  4LC1 A;  3A0B Z;  1KBH A;  3ZMS A;  3NXS A;  5A9G A;  5IY5 C;  1HW7 A;  4JV5 O;  1AR5 A;  2ETN A;  2WA3 A;  3N2G B;  3SPI A;  4DK0 A;  1YIJ V;  3VOU A;  4LF5 B;  5D5P A;  4TSF G;  4GUN A;  2DN9 A;  1FJG B;  2HVJ C;  1XMO O;  1OCO C;  2Q0O C;  2XHB A;  3EXA A;  4UCS A;  4E2L A;  3GB7 C;  4MVM A;  4U3F H;  4K35 A;  3OM3 B;  2HP8 A;  4X65 O;  5LXT A;  1D5N A;  1SZT A;  2NR5 A;  3U11 A;  1AJN A;  3CE2 A;  4LH6 A;  4CH6 A;  2A7W A;  4XDK A;  4UXN A;  1EZJ A;  4DK1 A;  4UCV A;  4JI7 B;  1YXB A;  5CMU A;  3RVY A;  2LFS A;  5KHG A;  1J5E B;  1XNQ O;  3RYH B;  4JI0 O;  2OTL V;  1T5E A;  3P3N A;  1R3L C;  2XAG A;  1Q5O A;  3ZRW A;  4Z1V A;  4ZKI A;  2KB1 A;  3WG7 C;  2DYS C;  2Y69 B;  3TXS A;  5E79 Z;  1N33 B;  4BWA A;  1YTF B;  2AZ0 A;  1K33 A;  1Y74 B;  3CB2 A;  2Q4P A;  1AP5 A;  2OCC B;  4FMT A;  3FB5 C;  2WPD G;  4KHP B;  3ETG A;  3UCS C;  3OMN B;  1B3Q A;  1BGY H;  1AVM A;  2ZT9 B;  1EM1 A;  2XAQ A;  3IAY A;  4LF5 O;  4EEQ A;  3CSX A;  4CS3 A;  2DJV A;  3OEE G;  1FJG O;  1VEW A;  5IYZ A;  1R3J C;  3H1L H;  4TOI A;  2Z3Y A;  3RYH A;  1OCC C;  2X6C A;  2ITC C;  2QJ1 A;  5JCO A;  1YSC A;  4X1Y B;  4RAI A;  3T1Y O;  4GX5 A;  2IU3 A;  3AK1 A;  3LNN A;  4TV8 B;  1JFF A;  3CX5 F;  2IJK A;  4BIZ A;  1YDX A;  4DV1 B;  4GX1 A;  4BR6 A;  3CCR V;  1PL0 A;  1IBL B;  3TXQ A;  1VQ8 V;  5B66 Z;  1SF9 A;  2CDY A;  4R6Z A;  4MSW C;  5LA6 A;  4DR3 B;  1N33 O;  1OCR B;  4QGP A;  3LSQ A;  1TUB B;  4C7U A;  4QIW F;  3D3I A;  4ASU G;  3MDS A;  2E75 B;  3L75 H;  2IJH A;  3ZHQ A;  5LBQ A;  4A5U B;  2N05 A;  3RWR D;  4KHP O;  1NTK H;  2ZE8 A;  2ZNJ A;  5JQG B;  4TV8 A;  1NU1 H;  4DXW A;  4I50 A;  3O65 A;  2UUC O;  4JTA B;  3R65 A;  4TV9 B;  3L72 H;  3K9A A;  4MVR A;  5IYC O;  4UV9 A;  2GTS A;  3BAA A;  2QSA A;  3WFV A;  3AG3 B;  3ZS8 C;  4UV8 A;  1NZ6 A;  1KP3 A;  2ODM A;  1NT2 B;  2ZR3 A;  1NBM G;  3E22 A;  1Q81 W;  3CCQ V;  4NB5 A;  1ZTE A;  4O2A B;  1HNZ O;  5HFL A;  3SPH A;  2YIB A;  1SQG A;  3CPW U;  4NXN B;  1KU9 A;  2F23 A;  2IH1 C;  2IJJ A;  3WU2 Z;  4PA7 A;  4DRX A;  1LR1 A;  2DQ0 A;  3JD4 A;  4KXR A;  2DMX A;  2ZQM A;  3BFR A;  1W0K G;  3AG4 C;  1BE3 H;  1W0J G;  4DV1 O;  2BCC H;  5KAF Z;  1IUR A;  3DGE A;  4B3S O;  3JAS A;  4J7J A;  2JS3 A;  5CB4 A;  1GTO A;  1IBL O;  4F6R A;  4B3T B;  1JMK C;  4B08 A;  4MVZ A;  1H2G A;  4PI0 A;  1H8E G;  1AJQ A;  2RMK B;  3VQV A;  4MTX A;  5BXZ A;  4J11 A;  4KFM A;  4CH4 A;  5JH7 B;  4JI3 B;  5CBG A;  1N36 B;  3A0R A;  3ETQ A;  2Q68 A;  1Y66 A;  2VS0 A;  3B8N A;  5B1A B;  1KEC A;  5IY5 B;  1US6 A;  3LDD A;  4JAV A;  1VAR A;  2ATK C;  1B04 A;  4NVP A;  1VF6 A;  1ZSP A;  1QR8 A;  3L70 H;  4DUZ O;  1D2D A;  1SER A;  2PZS A;  3E8B A;  4R8C A;  2PGG A;  2WLM A;  3K0G A;  4RQF A;  3RYC A;  4ZI7 A;  5IWA O;  2PTM A;  1Y67 A;  3DTU B;  5C8Y A;  1WP7 A;  4JYY A;  3FB8 C;  4X62 O;  2F93 B;  2NLJ C;  1O9H A;  2VWK A;  1KC8 W;  3CCL V;  5LOV B;  4NXN O;  2EIK C;  2EIN C;  2HHH B;  2OIE A;  3MD0 A;  3I55 V;  1WA8 A;  4JZ2 A;  2Q0A A;  3JSN A;  1JPX A;  4DW0 A;  2A3Q A;  4YJ2 A;  1U96 A;  4HYO A;  1DTO A;  4IHJ B;  4B3T O;  1WB8 A;  2B9Z A;  3TET A;  2XOK G;  4JTD B;  1HR0 B;  4AIL C;  1B6Q A;  5DEC A;  4B3R B;  2XND G;  5EZY A;  1MAB G;  3WG7 B;  4NYK A;  2DYS B;  3SYO A;  1TUE B;  3JAT B;  2LO1 A;  2Q7G A;  3ETD A;  4HAM A;  4JI3 O;  3ZBH A;  1N36 O;  3JAW A;  4DV4 O;  2Y4U A;  3AG7 A;  1M90 W;  2DE0 X;  2WLI B;  4YJ3 B;  3M99 B;  1VF7 A;  1NH2 D;  5B1B C;  1G4Y B;  2QM7 A;  2UUA O;  4QE7 A;  5LL6 Y;  4DR5 O;  3P32 A;  3LNM B;  4X66 B;  2Q8V A;  4O4I B;  1RP3 B;  3T1C A;  3FKS G;  5DM6 V;  4HNA B;  4CC6 A;  4EFB A;  4FLT A;  4DR6 B;  2VWJ A;  4J7K A;  4ZOL B;  2CH7 A;  1VQP V;  5CBF A;  1DK1 A;  5D5Q A;  5EC1 C;  2QTS A;  1RPR A;  1P84 F;  3CCJ V;  2QWQ B;  1S72 V;  3LSU A;  1PPJ H;  4O4H B;  4TQD A;  4W4L A;  1K73 W;  2HHH O;  1R6N A;  4PDM A;  1PNK A;  1BL8 A;  1IDS A;  4P30 A;  4ABM A;  3BEH A;  5EC2 C;  3SJC C;  4DV7 O;  1HR0 O;  1BZK A;  1H2N A;  3D8C A;  5H9C A;  2X6A A;  3O9O A;  4HZ3 A;  4MTG A;  2XAJ A;  3RYI A;  4ZHQ A;  5GON A;  3G71 V;  5CA1 B;  3J81 N;  4FLX A;  1WLE A;  3H1K H;  4LWS A;  5GTH Z;  4WFH A;  2HJF C;  1VQ5 V;  2CAZ C;  1Q82 W;  1VIB A;  1CP9 A;  1SES A;  1WAZ A;  3TGU H;  4JI4 B;  1H2M A;  3P3P A;  1VP7 A;  4X66 O;  3SJA C;  2HEP A;  5IDJ A;  1EN5 A;  5AG2 A;  5FNV B;  4LCU C;  1P49 A;  5JJE B;  2B1I A;  2L6L A;  1FXK B;  4DR1 B;  5JWP A;  3ZHR A;  1QLE B;  3E89 A;  1V54 C;  2ZIO A;  3UO3 A;  5FPR A;  3SPG A;  3ML0 A;  2Y48 A;  4H0L B;  5JCO C;  3FB7 C;  3DC5 A;  3CRM A;  1Q3E A;  3RBZ A;  1KMI Z;  1Q8I A;  5B5E Z;  5EIB C;  4I9Q A;  1XEQ A;  1EZV H;  1KUQ A;  2QWP B;  4RUE A;  3ZHV A;  1YF2 A;  4KL1 A;  1IBM O;  3Q4H B;  1N0J A;  4MW8 A;  4NTW A;  1XHZ A;  5CBH A;  1UJW B;  1FKA O;  4WF9 V;  2D3O W;  4DO2 A;  3ASO C;  2V4D A;  4UB8 Z;  1F7Y A;  3K59 A;  2RQ6 A;  1I0H A;  1ZX3 A;  4FPP A;  4IYI A;  2RNB A;  2AGA A;  3HKD A;  1Q6I A;  4ICG A;  5BMV A;  1E1Q G;  3IGA C;  3K0D A;  5IJ9 B;  3CRA A;  1DGS A;  3KCX A;  3KKY A;  2EX3 A;  4I55 B;  5FPO A;  3SYA A;  5LHG A;  4PA3 A;  1YHQ V;  1QCE A;  4WBN B;  5KX5 B;  3E8H A;  2AHZ A;  1LNQ A;  4PDR A;  4DR1 O;  2LQT A;  3QO7 A;  4OX9 O;  5IE9 A;  4FLV A;  4DV3 B;  3FYE B;  1QQC A;  4BW5 A;  2E5L O;  2EIN B;  1S3J A;  4AQY O;  1XNR B;  4X1I A;  4FM0 A;  3ZRS A;  2DWE C;  4UUJ C;  2E74 B;  3CYO A;  1NH2 B;  3B8M A;  4D7S A;  2WLL A;  4MVQ A;  1VF5 B;  4I9W A;  4ZIB A;  2JJ1 G;  3D3Q A;  3OW2 U;  3N2K A;  3QO8 A;  3RYF B;  1I5Y A;  1TVK B;  4QNH B;  1JJO A;  3ZN1 A;  4CZZ A;  3SJQ C;  4PV1 B;  1I94 O;  2WLJ A;  5DN6 G;  1OCZ C;  1M93 A;  2ZE7 A;  4N23 A;  3OUF A;  4DV2 O;  4LF8 B;  4X1K B;  3RGB A;  1Q86 W;  4W4K A;  4LFB B;  2YIB D;  3APO A;  1M56 C;  3MHS C;  3ZHU A;  1VQN V;  1XUQ A;  4UVA A;  2ZM6 O;  1JR9 A;  3FAV A;  2AW9 A;  5H6Q A;  5LGN A;  2HJD A;  3BAB A;  5KHJ A;  1V9P A;  1K7D A;  3OD4 A;  4DW1 A;  1ZUQ A;  4X64 B;  4K0K B;  1PKX A;  3AG2 C;  3HKE A;  4OPH A;  3ZMU A;  4LF6 O;  1XNR O;  3ASN C;  5LXT B;  1L8D A;  3JAL A;  4DYL A;  1YEW A;  3U10 A;  3K08 A;  4DUY B;  4ZBM A;  1N32 B;  1CPY A;  2QM8 A;  4NTY A;  5LMN O;  3X2Q C;  3VQW A;  1WPX A;  3J7A U;  4PHZ A;  1NI8 A;  4IGG A;  2ZKO A;  1L0N H;  2CTP A;  1UPG A;  2Q67 A;  1JJ2 U;  1AR4 A;  2RN9 A;  1PL4 A;  1K34 A;  4UB6 Z;  3OMA B;  3ZRW B;  2HKO A;  1BHB A;  2JGD A;  2UUB O;  4G2K A;  4LF8 O;  1FD9 A;  1GN4 A;  1GMG A;  3JAR A;  4NR1 A;  3G6E V;  4R50 A;  1KYO F;  3BA9 A;  1NR1 A;  1MNG A;  4U7O A;  2EJ7 A;  3JCU Z;  2QKA A;  2IU0 A;  3P30 A;  3FYI B;  1CEZ A;  4U3J A;  2Q9L A;  4TUY A;  4CS4 A;  4YXW G;  3B40 A;  2CTW A;  3CEI A;  2KSD A;  2PYJ A;  3L9D A;  5IYZ B;  1ZL8 A;  1V54 B;  5J9P C;  2L35 A;  3OGI B;  3KG2 A;  3AEI A;  1K8A W;  3CCV V;  4DUY O;  4D7T A;  4LF7 B;  1NR7 A;  3B77 A;  3F7V C;  1IBK O;  1JFF B;  3A8T A;  4H33 A;  3H1J H;  1XDC A;  2BSK B;  2JK5 C;  1EFR G;  2CGO A;  1GRJ A;  2EZO A;  2RJZ A;  4JI2 B;  3ASO B;  4PEL A;  1MA1 A;  2FL4 A;  4G27 B;  4GKK B;  2W0X A;  5DED A;  4FLZ A;  5LA6 B;  2JJ2 G;  5K1P A;  2BTQ A;  3QNE A;  1P4R A;  4U7N A;  5KHH A;  4IYH A;  4YHH B;  3JAK A;  3ZN0 A;  1NVP D;  3ETE A;  5J2T A;  4UCR A;  1ZWI C;  3JD2 A;  4FFK A;  5GW7 A;  2CE4 A;  4UCU A;  5KA6 A;  2GV9 A;  1KB9 F;  2WAM A;  2OT5 A;  4FLW A;  1WB7 A;  3LDE A;  3OTO B;  4JI7 O;  4I50 B;  3K04 A;  4RWU A;  5EK0 A;  4CH5 A;  1J5E O;  2BSK A;  2LP7 A;  3A2F A;  3I56 V;  3W7T A;  1D5A A;  3ABL C;  3OT7 A;  2Q6A A;  3E22 B;  4GCZ A;  2QEX V;  5LYJ A;  4O2B A;  1BCC H;  3JCZ A;  4YY3 B;  4LF7 O;  1XRE A;  2A06 H;  3BPZ A;  4F6E A;  2KKW A;  4DRX B;  1KP2 A;  2K1E A;  4GT1 A;  2XTA A;  4FJC C;  1A32 A;  3K5M A;  1AR1 B;  3JAS B;  2HFE C;  5CB4 B;  2W6J G;  4F6R B;  4YIO A;  3OE7 G;  3QVN A;  1OCZ B;  1BSM A;  1FXH A;  4WFE A;  2YXY A;  1YIT V;  2AHY A;  3L74 H;  3E8G A;  1QR9 A;  1FS0 G;  2YEV A;  4LF9 B;  4CC5 A;  3J80 N;  1OZ0 A;  1K5Q A;  2FYU H;  1AB3 A;  5L3F A;  3CCU V;  1F4N A;  2ZIM A;  4MVS A;  2YXH A;  3OFN G;  1Q6H A;  2QR4 A;  1FFX A;  3AG2 B;  4DR3 O;  3RYC B;  4ZI7 B;  3ASN B;  2C2A A;  1L0L H;  5C8Y B;  4YY3 O;  4D6T H;  4P9P A;  4BIU A;  1Y76 B;  5LMU B;  3MAQ A;  2R9A A;  4NKG B;  2ZIN A;  3OMI B;  5LP6 C;  2AZ2 A;  1K9M W;  3W7W A;  2FML A;  1M5I A;  2X6B A;  5KMG A;  1WA8 B;  4YJ2 B;  4QJF B;  3E2E A;  2MK3 A;  5H2F Z;  1M1K W;  3LSS A;  1AP6 A;  3ZHT A;  3TJT A;  1H8H G;  3FD9 A;  5EZY B;  3T1H B;  1UFI A;  2QA4 V;  1OCO B;  1ARO P;  3ZED A;  3F5W C;  3WB2 A;  3JAW B;  3W7U A;  1ZAU A;  5L3C A;  1IX9 A;  4UVC A;  5E1A C;  3ICX A;  3TCU A;  1P7G A;  1Y76 A;  1M4U A;  1PP9 H;  4O4L A;  3A0H Z;  4JPR A;  1MZE A;  5IJ0 B;  3B2E E;  3CS5 A;  3BY6 A;  2DQ3 A;  2JDI G;  3IFX A;  5KA5 A;  3ABM C;  2VRZ A;  1Z5V A;  4EFE A;  1K3E A;  2EUL A;  4WFB V;  2QGN A;  1HDJ A;  2CH7 B;  4H44 B;  2VQF B;  2EIL C;  2JVD A;  2JRI A;  1BHA A;  3UO2 A;  1GH6 A;  1SC5 B;  4O4J A;  5LMU O;  2EIJ C;  1QBZ A;  4MS2 A;  1RSO A;  2Z5U A;  1NVP B;  3BCC H;  1N8R W;  1Q43 A;  2B1G A;  2WLH A;  2DYR C;  2EZP A;  3K5L A;  4PDL A;  5IJ0 A;  3CJH A;  4IIJ A;  1MSD A;  3T1H O;  1S76 D;  5A2Q N;  2JIZ G;  4FLY A;  1OCC B;  1DF5 A;  5KUK A;  3RYI B;  1RPO A;  2NN4 A;  5GON B;  4ZHQ B;  4DR4 B;  2ZDI C;  2CUG A;  2UXN A;  3G67 A;  1RM1 C;  4LWS B;  3G80 A;  4DR2 B;  2UXX A;  3K57 A;  1JCH A;  1SA0 A;  5KAI Z;  1AJP A;  1R6T A;  5KHK A;  2GUZ A;  2XAS A;  4F4L A;  3JSL A;  2Q7H A;  2HG5 C;  3VQX A;  4B3R O;  2E76 B;  3ABL B;  4BAY A;  2UXD B;  2PI4 A;  1VQL V;  2VQF O;  1BQZ A;  2M7W A;  1WN7 A;  3HB3 B;  3QO5 A;  1E1R G;  1WP8 A;  3K06 A;  1GM8 A;  4I5S A;  3APQ A;  3TK1 A;  1VQO V;  3DSQ A;  2YIA A;  2Q5Z A;  3HKB A;  4DV6 B;  3M7M X;  1GK9 A;  4GYC B;  2UU9 B;  1M57 C;  1SQB H;  4PI2 A;  3T2M A;  5JJN B;  1TGO A;  1VQ4 V;  1IVS A;  3HKC A;  1XHX A;  1GM9 A;  1LUV A;  4DR6 O;  2P6J A;  3SPC A;  1Q7Y W;  1MSW D;  2R9I A;  3H1I H;  5ITZ B;  4XDL A;  3HKD B;  4EB6 B;  4DR2 O;  4FM1 A;  3B4S A;  1YZB A;  4X20 A;  4E4E A;  5BMV B;  2QE7 G;  4Q20 A;  1SQX H;  5BR8 B;  4MT8 A;  1XMQ B;  3STL C;  3AG4 B;  1Q6U A;  5B1N A;  1H2S B;  4FFB A;  4JGS A;  3AK3 A;  5L3G A;  3CHX A;  3K58 A;  5FLX N;  1SKV A;  3C3T A;  5KLV H;  1WJZ A;  1AI7 A;  1XL6 A;  5J2U A;  1N4C A;  3JYC A;  1MG1 A;  1SQF A;  4X9Q A;  4X1I B;  5ITZ A;  2QWN B;  4EB6 A;  3EVK A;  1GN6 A;  4JZG A;  4FM2 A;  2OCC C;  2WLN A;  5EIB D;  3K03 A;  2H94 A;  4JI4 O;  2WLL B;  1XI1 A;  2HLD G;  3F5T A;  4NXM B;  1W59 A;  2OYQ A;  5EBW C;  2BE3 A;  5LGT A;  3IC9 A;  4GX0 A;  2BTO A;  3N2K B;  1LUW A;  1I08 A;  3SGI A;  1G6U A;  1HNW B;  3UT5 A;  1K4C C;  3ZJZ A;  2PF4 E;  4Z2W A;  5BR8 O;  5BZB A;  2EIK B;  1XMQ O;  3K5N A;  5LP6 A;  3ZIA G;  2O57 A;  2UXB B;  3E35 A;  4Z1M G;  1NKD A;  1NTZ H;  4DR7 B;  4X8A A;  1P7B A;  1GO3 F;  3JD3 A;  1S0V A;  3FAV B;  1OJH A;  4JI8 B;  2FB5 A;  2KG7 A;  2R70 A;  4LFC B;  2ZCE A;  4CS2 A;  3ABM B;  1V55 C;  5L3B A;  3SDL A;  1R3I C;  4K8Z A;  1TA8 A;  2DWD C;  1VQ9 V;  2EIL B;  2GTA A;  4J10 A;  3QF7 A;  4I4T A;  3DXR A;  3HPL C;  2EIJ B;  2Q73 A;  4DV5 B;  3HKE B;  3QTC A;  1JVM A;  1SQQ H;  2QWR B;  3JAL B;  3CCM V;  2JS5 A;  1WPB A;  1Y6X A;  2EIM C;  2YXL A;  3THO A;  2IBZ H;  5B1B B;  1S5L Z;  4NXM O;  4MTF A;  2IJI A;  4L8J A;  4MTO A;  3ABK C;  3CCS V;  3AG1 C;  4I7Z B;  2P4V A;  5H5N A;  4LFA B;  2YI8 A;  3RN4 A;  1PV0 A;  1M9N A;  2P90 A;  4JYC A;  4LP8 A;  4J9Z B;  1XMO B;  3K3W A;  5LHI A;  5GTI Z;  2JGD B;  3AK2 A;  4MVO A;  1MZF A;  1GN3 A;  4DV3 O;  5EYP A;  3JAR B;  4LNU A;  1ZLZ A;  3CC7 V;  4DR7 O;  1L1F A;  3CMA V;  4CBC A;  3VBB A;  4UVB A;  4LFC O;  2F4V B;  4U3J B;  4TUY B;  1KQS U;  2YUA A;  3E86 A;  3E8F A;  4I0X A;  4PA6 A;  4B7K A;  2N74 A;  4JI0 B;  2ADQ B;  4OPA A;  1EN4 A;  1ZL8 B;  4K8X A;  3OR6 C;  2H8P C;  2G38 A;  2ZDI A;  2WWW A;  4XBF A;  1O9G A;  2Y4T A;  2FKX A;  3IC7 A;  3U0Z A;  3WB1 A;  4LFB O;  1PD3 A;  2YS8 A;  3ZHS A;  1H38 A;  5B1A C;  1M57 B;  4KUM A;  4RO2 A;  4LFA O;  1PM9 A;  4WFG A;  4DV0 B;  1AI6 A;  3SYQ A;  1W2B U;  3RFR A;  3CRC A;  2LGQ A;  4JAS A;  4PA4 A;  2BTQ B;  4X64 O;  4K0K O;  3W7X A;  2ZXW C;  5CA0 A;  4IT5 A;  2IM9 A;  3JAK B;  3T1Y B;  1E79 G;  1THZ A;  3CCE V;  4B3M B;  5J2T B;  1FAF A;  4JTC B;  2OTJ V;  2F4V O;  3ZRX A;  5B3S C;  1YVW A;  2GDS A;  1N32 O;  2ZE5 A;  1FYJ A;  2NNU A;  1GM7 A;  1TAE A;  5EBM C;  3N2G A;  5JJJ B;  2GSM B;  2CTQ A;  3LDC A;  1GN2 A;  3BA8 A;  5L3E A;  2GBO A;  2CK3 G;  5LYJ B;  2YC0 A;  1AIL A;  4O2B B;  3K5O A;  3CRQ A;  1Y4M A;  2D2C B;  2ITD C;  3T4D A;  1ROP A;  3H01 A;  3R66 A;  3OGC C;  3ZRV A;  4FIP C;  2AXT Z;  2ZNI A;  1F51 A;  4DV0 O;  1XL4 A;  2QKS A;  2UUC B;  4QPK A;  5TIS Z;  4QE9 A;  3KCY A;  3SR2 C;  2CTR A;  2X0L A;  2LJ2 A;  4Q6G A;  2YEV B;  1HNZ B;  1N34 B;  4BIO A;  4B3M O;  4MW3 A;  3ZMT A;  1Y74 A;  4GLX A;  2UXC B;  4WCE V;  4XDJ A;  2ILM A;  4NTX A;  4P9O A;  3C90 A;  1IXB A;  4JYB A;  1V55 B;  4IL6 Z;  1X59 A;  2LGW A;  4B3S B;  4JI2 O;  4RQE A;  2RDC A;  5JVD B;  1Z5W A;  4GKK O;  1FFX B;  1VQM V;  3K9S A;  3RW0 A;  3QG5 A;  4OGQ B;  1COW G;  4B7E A;  2WSS G;  1B06 A;  5CN0 A;  4YHH O;  4X1Y A;  2EIM B;  4PA9 A;  3CWB H;  1M56 B;  2P22 C;  3ABK B;  2Q7E A;  3AG1 B;  4PD4 F;  1F4M A;  3F7Y C;  4MVU A;  5KMG B;  3DC6 A;  1XQ8 A;  2YI9 A;  2Y0I A;  4JI1 B;  3CXH F;  3OTO O;  3CRR A;  1S5J A;  1Z2G A;  4BW9 A;  4EKW A;  4JAA A;  4DUZ B;  4GKJ B;  3N27 A;  1K4D C;  5JVD A;  2WA4 A;  5IWA B;  2PUS A;  1FXK C;  1MOF A;  1TUB A;  2P4K A;  1QLE C;  1N34 O;  2ZR2 A;  4X62 B;  2R72 A;  3UQ8 A;  2UXC O;  1R1B A;  2F1M A;  2N04 A;  3EHB B;  3RVZ A;  1EN6 A;  1NQT A;  2B5U A;  1JOY A;  4O4L B;  1U97 A;  1FXV A;  5JQG A;  2Y0P A;  2DOS A;  2R9R B;  3X2Q B;  3T4Z A;  1DF4 A;  2DW4 A;  3PJS K;  4TV9 A;  1OV9 A;  5K1X A;  2OCH A;  2F95 B;  4WFF A;  3HR0 A;  1KD1 W;  3ABU A;  2XAF A;  2LFR A;  3ZX6 A;  3FFQ A;  3SPJ A;  4DV4 B;  4O2A A;  4O4J B;  4LF9 O;  2HVK C;  1XOU A;  4J9Y B;  2YID A;  1VMG A;  4J80 A;  1QVG U;  1RSO B;  5H6R A;  2P7T C;  1GKF A;  2JEX A;  2YIC A;  2UUA B;  4DR5 B;  4JI1 O;  4JI6 B;  2QKC A;  1SRY A;  4JF3 A;  3MHH C;  4K3A A;  1VQ6 V;  5FL7 G;  3S3X A;  3CJH B;  4IIJ B;  2P5O A;  5EBL C;  4GKJ O;  2IH3 C;  2ZD9 A;  2A9H A;  1AI5 A;  3GWO A;  4TQF A;  2QTO A;  2K9P A;  2ZXW B;  1I7F A;  4J7Z A;  4X89 A;  4CH3 A;  1DLB A;  3UKM A;  5JH7 A;  3C3S A;  5B3S B;  3D36 C;  3VQY A;  2FTK A;  1SA0 B;  2EJR A;  3W7S A;  2A0L A;  3GWK C;  3NR7 A;  1YJ9 V;  2GUZ B;  5IYB O;  4DV7 B;  5CA3 A;  2X7R B;  3CC4 V;  3GVM A;  4LF4 B;  3H1H H;  2YDE A;  1IZ3 A;  1JQ0 A;  4TT3 G;  1H2L A;  1EBO A;  4JAU A;  1ORQ C;  1N0N A;  1ENV A;  2QWO B;  5LOV A;  2VQE B;  4X88 A;  3L71 H;  3OEH G;  5L3D A;  3CME V;  3HKB B;  2PI5 A;  3OR7 C;  1QHT A;  4JI6 O;  2BOC C;  3SJB C; 
#chains in the Genus database with same CATH homology
 4OPA A;  1NS1 A;  4DV6 O;  2UU9 O;  2UXB O;  4JI3 O;  1N36 O;  1HNZ O;  1A32 A;  5BR8 O;  4DV4 O;  1XMQ O;  2FKX A;  4JI8 O;  1I94 O;  4LFB O;  4B3M O;  3JAM N;  4DV2 O;  4LF9 O;  4DV1 O;  4LF5 O;  2UUA O;  4B3S O;  2DJV A;  5LL6 Y;  4DR5 O;  1FJG O;  4LFA O;  1IBL O;  1XEQ A;  1KUQ A;  3SDL A;  4DR6 O;  4DUY O;  2JRI A;  1X59 A;  1IBM O;  4DV5 O;  3J80 N;  4JI1 O;  2ZM6 O;  1IBK O;  5LMU O;  5BXZ A;  4DR2 O;  4JI2 O;  5BY1 A;  1AB3 A;  3T1Y O;  1YZB A;  1DK1 A;  1FKA O;  4GKK O;  4X64 O;  4GKJ O;  4JYA O;  4K0K O;  4LF4 O;  1F7Y A;  4JV5 O;  2AGA A;  4YHH O;  1G1X B;  2HHH O;  4NXM O;  4OPH A;  3T1H O;  4LF6 O;  1XNR O;  5A2Q N;  2F4V O;  4DR4 O;  2LW7 A;  5H5N A;  4DR3 O;  5IT9 N;  1N32 O;  5FLX N;  1HNX O;  1FYJ A;  2VQE O;  1XMO O;  4YY3 O;  4DV7 O;  4DUZ O;  1HR0 O;  1D2D A;  1N33 O;  4X65 O;  3OTO O;  5LMN O;  3J7A U;  5IWA O;  2ZKO A;  4JI7 O;  4X62 O;  4A5U B;  3J81 N;  4DV3 O;  4DR1 O;  4KHP O;  1R6T A;  4NXN O;  4DR7 O;  1J5E O;  1AIL A;  4OX9 O;  1N34 O;  4JI4 O;  2UUB O;  2UXD O;  3F5T A;  2E5L O;  4AQY O;  4LF8 O;  4JI5 O;  1R1B A;  2UXC O;  4LFC O;  3R66 A;  1XNQ O;  3O65 A;  4B3R O;  2UUC O;  3M8A A;  4JI0 O;  4B3T O;  1HNW O;  4X66 O;  2VQF O;  4DV0 O;  2Z0A A;  4LF7 O;  2DOS A;  2N74 A;  4JI6 O;  3RT3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...