3T1HO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3t1hO00
4OPHA 4K0KO 1R6TA 1XEQA 4DV7O 5BR8O 4DR6O 1XMQO 1IBKO 2JRIA 1A32A 3JAMN 5BY1A 2UU9O 2ZKOA 4LFCO 4KHPO 2UUAO 3J81N 2VQFO 4DV0O 1I94O 2UUBO 4DR2O 1DK1A 4DV6O 1HR0O 5IT9N 1N33O 4X65O 5FLXN 1XNQO 3J80N 1IBLO 4LF8O 4LFAO 5LL6Y 4X64O 4JI4O 4DR5O 5BXZA 4JI7O 2N74A 5A2QN 1IBMO 2UXDO 4LFBO 1NS1A 2ZM6O 4DV1O 2UUCO 4YY3O 4LF6O 2Z0AA 2UXCO 1N34O 4B3TO 4B3RO 4B3SO 3R66A 4JI1O 4DV2O 4JI8O 1G1XB 4JI0O 4DV5O 1HNWO 5LMUO 1FYJA 4DV4O 4JI2O 5LMNO 1D2DA 4GKJO 3J7AU 1KUQA 4AQYO 5IWAO 4JI5O 4DUYO 1XMOO 4LF7O 1X59A 3SDLA 4YHHO 3M8AA 1FKAO 3RT3C 1AB3A 5H5NA 1J5EO 4JYAO 4DR3O 4LF5O 2F4VO 4JI3O 1HNZO 4OX9O 3T1YO 4OPAA 2DOSA 4B3MO 4A5UB 2HHHO 2UXBO 4LF9O 2FKXA 1AILA 4LF4O 2E5LO 1FJGO 1N32O 3O65A 4DR7O 3T1HO 4DR4O 2LW7A 2VQEO 4DV3O 4GKKO 4X66O 4NXNO 2AGAA 4JV5O 4JI6O 3OTOO 4NXMO 3F5TA 4X62O 1XNRO 1HNXO 4DR1O 1YZBA 1F7YA 1R1BA 2DJVA 1N36O 4DUZO
chains in the Genus database with same CATH superfamily
4X20B 1V54B 1PM9A 3LSQA 1K8AW 1BZKA 2PI4A 1XL4A 2P6JA 4E4EA 4QE9A 3ZX6A 1IBKO 2BOCC 3THOA 4D7TA 4CC5A 1S5LZ 1RSOA 4LFCB 3OR7C 2QEXV 1UPGA 5EYPA 4DV0B 3W7XA 2M6YA 1YSCA 1H2KA 3IC7A 4Z1MG 3PN1A 1W59A 4ASUG 3LUTB 5B1OA 1CEZA 1H2GA 3EVKA 2HP8A 1M9NA 1H8HG 1NBMG 1DGSA 2R9RB 1NH2B 2L6LA 2Z0AA 4B3TO 2ZXWB 1UFIA 4X1IA 1TA8A 3ZMZA 5J2UB 3ZMSA 4DV5B 5LMUO 4DV4B 2NNUA 5LP6A 1QU7A 4JI5O 3ABMB 4RWUA 2CTQA 4UVBA 3AG3B 4CH3A 1CXZB 4P2ZA 3HKBA 3MD0A 2V1DA 3A0RA 2PUSA 1YTFD 5IY5B 1BQ0A 4I7ZB 4JI3B 1HNZB 3EXAA 5EC1C 4GYCB 1FFTB 1NQTA 3HKDA 1OCOC 1QBZA 1JMKC 1N32O 1TUBB 1VQ7V 2ETNA 4DR7O 2EIKB 2Z5UA 4HAMA 3FD9A 5FPRA 2VQFB 1HNXO 4HBNA 3DGEA 1L1FA 2XAQA 1PD3A 1M1KW 2QKAA 4DV7O 4X88A 1NR1A 3BFRA 4JZ2A 5EIBD 3E8BA 4X64B 3IGAC 3TETA 1AI4A 1K92A 1VQPV 3J81N 3ZJZA 4RQFA 2W6JG 1YCIA 5KUKA 4JI1B 4IHJA 2Q68A 4LCUC 4JI2B 3STZC 3FB5C 1SF9A 3SYOA 1B3QA 4FLXA 4K8XA 1Y66A 1SQQH 4X1YA 5BZBA 4MTGA 4EB6A 3TK1A 4B3TB 2JS3A 1H38A 4FPPA 3M7MX 1S76D 3OE7G 1ZTEA 1OCOB 3E8FA 2DWDC 5LMUB 3BAAA 4GKJO 2V4DA 3ASNB 3CRMA 3JSLA 5KMGA 4J41A 1DTOA 5JQGA 2WLNA 2JEUA 3ZRWA 5J2TB 5LYJA 4PI2A 3K3WA 4BAYA 3D3IA 1NVPD 1PL4A 4PD4F 2CTPA 4RUFA 1BL8A 4U7NA 1HDJA 2UXBO 4LR3A 1FJGO 4I9WA 4DR7B 1Q3EA 4NXNO 4K35A 2X7RB 4UVAA 4NXMO 3K06A 1WA8B 3F5TA 5LA6B 1QR8A 3B77A 3ETQA 5JVDA 3Q4HB 3T1CA 3TCUA 3GVMA 2DN9A 3RYFB 4K8ZA 1WJZA 2IW5A 1SQBH 5FNVA 2E74B 2XAGA 1KD1W 5HFMA 1AVMA 1F23A 2WSSG 1XMQO 5GONA 5JCOA 3RYHA 1MG1A 4PV1B 1YEWA 1OCCB 4KHPO 1KMIZ 1K33A 1N0NA 3HPLC 4G2KA 3FB6C 2WWWA 1DLBA 1WB7A 4RO2A 4PDVA 2B1IA 1FXVA 3JCUZ 3ZRSA 1NU1H 5JJJB 1U96A 4DR5O 4MW8A 4B7KA 4E2LA 1H2SB 1AI7A 5L3CA 1VQ6V 1WB8A 1VQNV 3JD1A 3JALB 3ZIAG 1QVGU 4U7OA 3JD4A 5LHIA 2D2CB 4UV8A 4GKJB 4AQYO 3QO5A 3UM7A 1R3IC 2A06H 1TUEB 1AB3A 2WLJA 4PDMA 2EILC 2PI5A 4FLUA 5EBLC 5CA1B 3P3NA 3OUFA 4LF5O 4IIJB 2Q7EA 4I50B 1AP5A 3B2EE 4GX1A 5D5PA 1I08A 4FM0A 2BOBC 1FJGB 2VQEO 4NXNB 1SC5B 5KA5A 2DYSC 1XNRO 3ZHUA 5DEDA 1LR1A 2Q6AA 2RNBA 2ZE7A 4JAVA 3K58A 1HR0B 1F7YA 1YDXA 4ZOLA 3CD6V 2YUAA 2IJHA 3HB3B 4LF8B 2GUZB 3CX5F 3F7VC 2YIBA 3UO2A 2QWOB 3KZIZ 1H8EG 4I9QA 1XMQB 3FAVB 3L74H 1ZLZA 1Z5WA 5AG2A 4HNAB 5DECA 5LHHA 4KHPB 4DRXA 1VQLV 1K4CC 3UO3A 2R9IA 4HZ3A 2UUBO 3FYIB 5IT9N 1JJOA 3RWRD 1BHAA 2X6BA 5LMNB 4XDLA 3ZCCA 3L70H 1S5HC 2B9ZA 4JPRA 1FAFA 2QM4A 3JAWB 1KC8W 5A2QN 1AR5A 1GH6A 1M4UA 4TV8B 2UUCO 4FIPC 4U3JB 2BTQB 1IXMA 3JATA 4DK1A 3W7UA 1JFFA 1Q43A 4B3SO 4R50A 2JJ1G 3SJBC 5KHKA 2X6AA 3C3SA 1Q6IA 3D36C 1JPXA 1Z5VA 4CH6A 3ABTA 4WFFA 1L8DA 5IWAO 3OMIB 1I5YA 1JJ2U 4JV5B 2DYSB 4WCEV 4WFAV 1KYOF 4LC1A 4PA7A 1MZEA 4UB6Z 2EIJC 3AK2A 1G4YB 2LFRA 1CPYA 5KX5A 1SA0A 4WBNA 3ZHVA 2ZINA 2YS8A 1L0NH 4BW9A 2CGNA 2VQEB 5EBWC 1F4MA 3ASOB 3JARA 2CDYA 4LH7A 2HKOA 3TXSA 1PL0A 1Q8IA 1XNRB 1Y74B 2N04A 4FLTA 5H2FZ 1Y76A 5EC2C 1NZ6A 3K5LA 3LDCA 1VQ9V 1F4NA 3N2KB 4DR6O 5B1BB 1SRYA 1YJ9V 4UVCA 1M90W 4FFBB 1VARA 1S3JA 4X8AA 1Q82W 2FMLA 5FL7G 4O4HB 2UUBB 5IYZA 4JTDB 1N33O 2P90A 1SQVH 1KQSU 1FD9A 1V55C 4CH4A 2WA4A 1PKXA 2ZE8A 4DV1O 2JDIG 1K97A 4L87A 2VWJA 2UUCB 4LF6O 4NYKA 4PA6A 1Q81W 2EJRA 3U10A 2P4VA 2Q69A 4B3SB 3VOUA 4MVMA 3HKCA 1ZSPA 2MK3A 3K59A 5H9CA 4LP8A 5IJ0B 3E83A 2JVDA 1XBLA 1V54C 2XUMA 2CGOA 5LOVB 1JOYA 1PNKA 1PPJH 3ZHRA 1X59A 5IWAB 3JASA 1H2NA 3EHBB 2ZNJA 1X4TA 4JYAO 3CE2A 1KKCA 3ABKC 3UQ8A 3E8GA 1JA8A 3D8CA 4O4IA 2L35A 3BPZA 2Q8VA 5K1XA 4LF9O 1EM1A 3OGCC 1AILA 3D3QA 1E79G 2QWNB 4DV3O 1R73A 4N23A 4ZIBA 1WP8A 2ZE6A 2YIDA 3AG4B 1W0JG 3ZRVA 1FXHA 3IJ4A 2Y0PA 3R65A 4MTFA 1FFXB 3CJHA 1ZUQA 3CS5A 5LGNA 1VMGA 3E8HA 3OT7A 3L71H 4I4TB 1PNMA 1BSMA 3K0GA 4PDRA 1OCZB 5C93A 4DR6B 1A32A 5C8YA 4FM1A 1AROP 3OMNB 2YSUB 4JTCB 1VQ5V 1JCHA 2EZPA 3ABMC 4YJ3A 3UCSC 1VF6C 4FVMA 2VQFO 4GT1A 3WB1A 4KXRA 4LNUB 1I94O 3CMEV 1ENVA 3OAAG 3K5MA 1NTKH 2BSKA 5IY5C 4P30A 3BA8A 2BTOA 1XOUA 2VS0A 3QF7A 5KHIA 2OWOA 2HVJC 4B7EA 3M99B 2A0LA 4X64O 2QM8A 1Q7YW 2X6CA 4W4KA 3BRCA 4ZKIA 4X9QA 2UXDO 2EIKC 4DV1B 3MAQA 4MVSA 4LF6B 1N34O 3ABKB 4FZ1A 4JI1O 4IYIA 2CTRA 2R72A 3CRRA 3FFQA 3JATB 4KP4A 1RP3B 1GN6A 4JI2O 2LJ2A 2PGGA 3DTUB 4WFBV 1KUQA 1M57C 1MSWD 3IAYA 3SJAC 3OTOB 3ZEDA 4GLXA 5H5NA 3H9VA 1OZ0A 2EINC 3ZN1A 5CB4B 3OTFA 4JYAB 1YJWV 4PJ0Z 4DYLA 1N8RW 3LSSA 2RCVA 3JAKA 4UCVA 3BEHA 1R6NA 1EN6A 4LF9B 2ZDIC 1MNGA 4DW0A 4DV3B 1VF5B 3K57A 5KAFZ 2ZCEA 4QIWF 2UXNA 1GN2A 1GM8A 1IXBA 2OCCB 2W0FC 1AJPA 4JTAB 1D5AA 3FYEB 1YVWA 3JARB 1BGYH 1RPRA 4P9OA 1BQZA 1TVKB 1SESA 1XEQA 2ZT9B 4NB5A 2CAZC 4O4JA 1WN7A 1BCCH 3H1KH 3CCLV 5L3EA 2ZKOA 3ASNC 5KLVH 2H94A 4MW3A 1ZL8A 3UKMA 2KG7B 4CH5A 3G71V 3CXCU 1R6KA 2HR3A 3NXSA 1I94B 1WLEA 2QTSA 3CWBH 5CA0A 5CA3A 1GM7A 4DXWA 1XNQO 4NVPA 2A9HA 1M57B 2ZQMA 1S77D 3RYIA 3K03A 2CK3G 4JI7O 4LWSA 4XDJA 2UXDB 2ZM6O 2CH7B 2EINB 2HJDA 1S5JA 3APOA 3LNMB 4LBEC 4O2AB 1N34B 2QDOA 4JI8O 1R3JC 1G1XB 3T4DA 1WAZA 2Y0IA 3S3WA 2VWKA 2O57A 4JYCA 1K9MW 1IZ3A 2WAMA 3E22A 1HW7A 1YTFB 1AI6A 4F6RB 2E3CA 1XMOO 1SQPH 1XHZA 2QE7G 2D3OW 3AK1A 3ETEA 5ITZB 4TQFA 1VF7A 2Q0OC 1OCCC 2F43G 1Q6UA 3QO8A 4KUMA 2Y4TA 4ZI7B 5E1AC 4YJ2B 1J95A 2FKXA 4O2BA 1M56C 1BS3A 5LXTB 1QLNA 3CCEV 2JS5A 2F1MA 2QKCA 4J7JA 3MHHC 3ZMUA 1Y67A 3RBZA 4J11A 4U3FH 2ITCC 1MA1A 3SPJA 1VQMV 2YEVB 2K1EA 4O4LB 4IGGA 1XQ8A 4JI4B 1U97A 3F5WC 3K0DA 2IM9A 3X2QC 1GMGA 2WLIB 4X1KA 1D5NA 2CE4A 2XTAA 3DXRB 2UXCB 3OR6C 1FXKA 5LGUA 2YDEA 2AHZA 5BMVA 4WF9V 3KCXA 1HR0O 2ADPA 4R8CA 3U11A 2YXYA 4LF8O 1XNQB 3KCYA 4H0LB 3AG1B 2PY5A 2N05A 4H44B 2WA3A 4AHCA 1QNMA 5KHGA 4F6EA 4ZHQA 2HJFC 4D7SA 4JI7B 1NS1A 4I55A 2ZM6B 1P7GA 2WLLA 3HR0A 4QPJA 2WLHA 2UXXA 4PELA 4TV9A 1WP7A 1RSOB 3E89A 1G6UA 4JI8B 3HKEA 4OX9B 2JGDA 5J9PC 4TQDA 1QVFU 3OEHG 5EYPB 1MZFA 2NN4A 1M56B 5LMNO 3WU2Z 4I0XA 2ITDC 2AHYA 1N0JA 1OCRB 2JK5C 1NVPB 4UCUA 1XMOB 2QM7A 2Q5ZA 2Q73A 3TGUH 2P5OA 1WPBA 3U0ZA 3CRCA 2WPDG 2QR4A 2PTMA 2EBOA 4DUZB 3SPGA 3T1YO 3ZBHA 2CUGA 2QA4V 4X1IB 3FX7A 5IJ9A 3H1HH 4DR4O 3X2QB 3W7WA 1PP9H 2V7QG 3N2GA 1Y6XA 1T5EA 4JV5O 5FPOA 2YI9A 4MTOA 5LP6B 5KHJA 3GB7C 2YXLA 4JAUA 1YZBA 4QPKA 3G6EV 4MVUA 2DJVA 3KKYA 1EFRG 3RYCA 3CCJV 3HKBB 2Y69C 4N21A 1QQCA 4Q20A 1P4RA 1VP7A 3B8MA 5IYDO 5JH7A 4UFZA 3SYCA 4MVOA 3QTCA 2IJJA 4UXNA 3HKDB 4WFEA 4DK0A 4G28B 2LO1A 2F95B 3ZHSA 2P4KA 2DYRC 1DK1A 1SQGA 4X65O 5FLXN 1OV9A 5JJNB 2ZE5A 2LGQA 5CBFA 3CC7V 5E79Z 4JZGA 4GUNA 3CHXA 4J9YB 5BXZA 3SJCC 3ABLB 2GTSA 1US6A 3VQVA 3UT5A 4FLZA 4QNHB 3ASOC 3H1IH 5B1AB 3OUSA 4NKGB 2RQ6A 4TOIA 5EBMC 1Y4MA 1KB9F 3JD3A 1XUQA 2XHBA 3I56V 2HHHB 5EZYA 5B3SC 1D2DA 5D5QA 3AG2B 4R6ZA 4IHJB 1WPXA 4LF7O 3NR7A 2R70A 4J80A 5B1BC 3CCSV 2OT5A 4EFBA 4X20A 2DQ3A 2Y48A 5LBQA 1Q90D 2JEXA 4X1YB 2Y69B 3ZN0A 3A0HZ 1SZTA 4EB6B 4IYHA 3T1YB 4FZ0A 1GKFA 4JASA 2P22C 4DR4B 3SYAA 5IDJA 2ZIOA 1NJIW 2DYRB 4EKWA 5KMGB 2A79B 1MMMA 5JQGB 4UUJC 3ZRWB 5LYJB 1EBOA 1R1BA 3RVZA 4IT5A 5CN0A 3ZHQA 1GRJA 2Q0AA 1XL6A 4YXWG 2IH3C 3C90A 1HP8A 1URFA 2H3OA 1S72V 2QJ1A 3F7YC 3SJQC 2LQTA 4UV9A 5J2UA 4J9ZB 1NI8A 4P9PA 4DR2O 4DV6O 3O9OA 2IJKA 4BW5A 5B1NA 4X65B 5B3SB 5CBGA 5JVDB 3T4ZA 5LL6Y 4BR6A 3APQA 2DWEC 3FB7C 3WB0A 2N74A 5FNVB 3C3TA 5F2VO 2QWPB 3AG4C 1KBHA 2YIAA 3BY6A 1G8MA 1WNSA 4X89A 5GONB 3RYHB 1XREA 2KSDA 3GWOA 1TUBA 2Q67A 2DMXA 2ZD9A 4FLWA 5CMUA 1SETA 1L0LH 1OCZC 4I0XB 4LF7B 1Z2GA 2GV9A 3ETGA 3OEEG 2OTJV 5GTIZ 3CP1A 4DR1B 1GAXA 1QCEA 4QE7A 1I5XA 2NR5A 5KA6A 1JR9A 2ZIMA 2K9PA 3VQYA 3SGIA 4X66O 2EULA 4ABMA 3OTOO 1OJHA 2Y4UA 4PA9A 4I5SA 3G80A 4YIOA 3JCZA 1N36O 3P30A 3CCQV 3DC6A 3IC9A 5BR8O 2QTOA 3ZMTA 4KFMA 3BABA 4MVRA 4XDKA 3L9DA 3A8TA 1TGOA 3P3PA 5TISZ 2JRIA 2FTKA 3JAMN 3W7TA 1K34A 4PA3A 5L3DA 4KL1A 3G6BA 4W4LA 3CXHF 3CC4V 1VQ4V 1H2MA 2WLMA 1NR7A 4DR2B 3P32A 4DV6B 2Q9LA 3RW0A 3J80N 4FJCC 5J2TA 4JYBA 1XILA 2HFEC 3CEIA 1BE3H 4ZOLB 3K79A 1R3KC 4YHHB 3CCUV 1DF5A 3QG5A 2OCCC 2ZR2A 2XNDG 4MSWC 1P7BA 4JI0O 1NH2D 4DRXB 2E76B 1FYJA 4DO2A 4FK5C 2E5LB 1WA8A 5LA6A 1PV0A 5IE9A 4FLYA 1RFYA 3ZHTA 4JI6B 3Q4HA 4UCSA 4CS4A 4TT3G 1SS3A 2PZSA 2F4VO 1F51A 1ORQC 4K0KB 1SKVA 3JD0A 1JFFB 1GN4A 3QNEA 1YJNV 1RM1B 1KECA 4QJFB 2BCCH 2AGAA 4X66B 3T2MA 5B5EZ 2DQ0A 3K5NA 4J7ZA 2FYUH 3CPWU 4X62O 2EZOA 4MVQA 3TXQA 3SYQA 3MHSC 4GX0A 1E1RG 2RN9A 1N36B 2YXHA 4RAIA 2P7TC 1QLEB 2H8PC 3E86A 2RDCA 5BR8B 3BA9A 2HEPA 1YIJV 3ICXA 1S0VA 5KX5B 1EN4A 4EEQA 1AP6A 1SA0B 4H37A 2OYQA 4WBNB 2UUAO 1K5SA 1K7DA 3B4SA 3JALA 3MDSA 2QWRB 2FL4A 2VRZA 1IBLO 3ETDA 5L3FA 4LFAO 3S3XA 5A9GA 1Y76B 1XI1A 3FB8C 1AI5A 4JI4O 2OCHA 4R7CA 5CA1A 1NTMH 2W6IG 4IIJA 4I50A 4B08A 3OW2U 2UXCO 3IFXA 3EFFK 2PYLA 4GX2A 2ILMA 2NLJC 3R66A 4DV2O 1Q86W 2LP7A 5EIBC 4PHZA 4JI0B 1HNWO 2KKWA 1YHQV 1KP3A 3CCRV 2G38A 5IYZB 4GKKB 3CSXA 2HVKC 3CC2V 4UCOA 3H1LH 3CRQA 1KU9A 3CCVV 2GUZA 2Z3YA 3L72H 3VQWA 3B8NA 3SR2C 2CTWA 3A2FA 1AR4A 1NT2B 1PNLA 2F4VB 5H6QA 4BIUA 4OX9O 4Q6GA 3FAVA 2DOSA 2LW1A 3N27A 2IH1C 1GTOA 1SQFA 2HLDG 4HNAA 4JGSA 4GCZA 3AG1C 3HKCB 1IBKB 1Q6HA 5H6RA 5LGTA 3VBBA 2QKSA 1VQKV 1B6QA 4NTXA 4X62B 2ADQB 3B09A 2Q4PA 4AI8A 2GTAA 3JASB 2GHYA 5EK0A 4J42A 4DUZO 3JAWA 3JD2A 3BVOA 3CMAV 1XDCA 4BWAA 3RN4A 4TV8A 4U3JA 2BTQA 2IU3A 3KG2A 4O4IB 4J10A 5BY1A 3RVYA 2UU9O 1OCRC 4YIPA 2YC0A 2UUAB 3K5OA 2F66C 2F23A 2AZ0A 3G4SV 3GWKC 3WFVA 3SPHA 1R3LC 1IBLB 5GTHZ 4LFAB 3CJHB 1MABG 4JI5B 1GM9A 2OIGA 5B66Z 1NKDA 5IYCO 1TAEA 4ZBMA 1K4DC 2IBZH 5C8YB 3B40A 4B3RO 5LP6C 1H2LA 4DV2B 2HG5C 4YJ3B 1HNWB 1COWG 3K08A 4RQEA 3BCCH 3I55V 5KAIZ 5LHGA 1N32B 4CZZA 2QWQB 1K5QA 2BSKB 1Y74A 4WFHA 2GSMB 4C7UA 2C2AA 4JAAA 5L3BA 1HNXB 4PA4A 4TUYA 1J5EO 1GK9A 2PYJA 3N2KA 4Z2WA 2JIZG 1ZAUA 1MSDA 4B3MO 4A5UB 2HHHO 4DV7B 3SYPA 3T1HO 4FFBA 2Q7GA 2LW7A 4FMTA 1GO3F 2AXTZ 4O4HA 1B06A 3OFNG 3ABLC 2R9AA 3D36A 1KP2A 1LNQA 5B1AC 2XAHA 2OTLV 4OPHA 2B1GA 1VQ8V 3H01A 4GX5A 3ABUA 1VQOV 4OGQB 3JAKB 2UU9B 3AG2C 1ROPA 1MOFA 4NTYA 3JSNA 2LGWA 2JGUA 2PF4E 5IJ0A 3K9AA 2EJ7A 3OMAB 5LOVA 4JYYA 2ATKC 4UCRA 2EX3A 4MVZA 4CC6A 4BIZA 1GN3A 4TSFG 1N4CA 5K1PA 1EZVH 5JJEB 2QSAA 2QGNA 1IBMO 4LFBO 4O4JB 4YY3O 1Q5OA 1VIBA 3ML0A 4PI0A 2W0XA 4HYOA 1ZL8B 4B3RB 4LH6A 3W7SA 3RFRA 5GW7A 3BHPA 2UXBB 3STLC 2ODMA 3OM3B 5CA0B 2ARHA 4DUYO 1SZXA 3SPIA 2AZ2A 1FFXA 1P84F 2E75B 3RYIB 4NXMB 1JQ0A 1ZWIC 2YICA 2RJZA 3L75H 4I4TA 1LUWA 3K9SA 4LWSB 5IYBO 1J5EB 3L73H 3WG7C 2RMKB 3JYCA 3FKSG 4B3MB 3E35A 1FXKC 1KKDA 2ZNIA 3LSUA 1I7FA 4H13B 2A7WA 3T1HB 1VEWA 4LNUA 4FM2A 1AR1B 3QO7A 2GBOA 4NTWA 4D6TH 4RUEA 3E22B 4DR1O 2YI8A 2KB1A 4CBCA 5JCOC 2EIMC 1FPOA 4H33A 1R6TA 3LDDA 1I0HA 3G67A 1YITV 4XBFA 4OXSA 1IVSA 4DR5B 3CB2A 1LUVA 2EILB 2XT9A 4O2BB 4NR1A 1AJNA 4WFGA 2B5UA 1YI2V 4UB8Z 1W0KG 5KHHA 2FB5A 4MTXA 4CS2A 4EFEA 4AQYB 1BT8A 4PDLA 5CB4A 1K73W 1IBMB 4LFBB 3VQXA 2XOKG 2XAJA 4YY3B 2DW4A 4L8JA 4LF5B 3WG7B 1HWYA 4X1KB 1FXKB 1QHTA 4Z1VA 2DE0X 2F93B 1VF6A 5BMVB 4AILC 1M5IA 2MW2B 4DUYB 4YHHO 1IURA 3AK3A 3M8AA 1FKAO 3RT3C 1K3EA 4ZHQB 3SPCA 1TVKA 4DR3O 3E2EA 2EIMB 4I55B 1YXBA 2WLLB 2X0LA 4TUYB 4OPAA 4TWKA 4TV9B 4LF4O 2E5LO 2KG7A 3O65A 4MT8A 3HKEB 2JGDB 4UCTA 2XASA 4JI6O 1SERA 1ZX3A 5L3GA 1IDSA 2BE3A 4IL6Z 5CBHA 1EZJA 3PJSK 4K0KO 1IX9A 1OHHG 2CH7A 1AJQA 2P06A 1O9HA 4O2AA 2XAFA 4MS2A 3AG7A 3CRAA 4LFCO 4GZRB 5HFLA 1JX9A 2WLKA 5IJ9B 3ZS8C 4DV0O 4ICGA 2ZDIA 3N2GB 2EIJB 3QVNA 2YIBD 3K04A 1V9PA 3H1JH 3LDEA 4F6RA 5ITZA 1W2BU 3OGIB 1M93A 3RYCB 4QGPA 1E1QG 2IJIA 1RM1C 5KUMA 2LFSA 5JH7B 4F4LA 4BIOA 4ZI7A 4YJ2A 4DW1A 3CYOA 1BHBA 5JWPA 1YF2A 4DV5O 3I5DA 3AEIA 5LXTA 1EN5A 4DV4O 3CCMV 2IU0A 2GDSA 1O9GA 3RGBA 3J7AU 2M7WA 1QLEC 1DF4A 3A0BZ 1CP9A 3SDLA 2Q7HA 2ZR3A 3DC5A 2A3QA 2YEVA 1RPOA 1QR9A 2AW9A 3DSQA 2ZXWC 4JI3O 4DR3B 3UT5B 1HNZO 4FFKA 4O4LA 1SQXH 1V55B 2P67A 2KQXA 1UJWB 3WB2A 2WLIA 5DM6V 4FLVA 3ZRXA 4LF4B 3DXRA 1P49A 3LNNA 3ZMVA 1THZA 3TJTA 4GKKO 4G27B 5EZYB 4CS3A 1BMFG 1FS0G 4JF3A 1NTZH 1JVMA 5DN6G 3AG3C 1XHXA 4J7KA 3OD4A 3RYFA 2OIEA 4K3AA 1B04A 1N33B 2JJ2G
chains in the Genus database with same CATH topology
4OPHA 4K0KO 1R6TA 1XEQA 4DV7O 5BR8O 4DR6O 1XMQO 1IBKO 2JRIA 1A32A 3JAMN 5BY1A 2UU9O 2ZKOA 4LFCO 4KHPO 2UUAO 3J81N 2VQFO 4DV0O 1I94O 2UUBO 4DR2O 1DK1A 4DV6O 1HR0O 5IT9N 1N33O 4X65O 5FLXN 1XNQO 3J80N 1IBLO 4LF8O 4LFAO 5LL6Y 4X64O 4JI4O 4DR5O 5BXZA 4JI7O 2N74A 5A2QN 1IBMO 2UXDO 4LFBO 1NS1A 2ZM6O 4DV1O 2UUCO 4YY3O 4LF6O 2Z0AA 2UXCO 1N34O 4B3TO 4B3RO 4B3SO 3R66A 4JI1O 4DV2O 4JI8O 1G1XB 4JI0O 4DV5O 1HNWO 5LMUO 1FYJA 4DV4O 4JI2O 5LMNO 1D2DA 4GKJO 3J7AU 1KUQA 4AQYO 5IWAO 4JI5O 4DUYO 1XMOO 4LF7O 1X59A 3SDLA 4YHHO 3M8AA 1FKAO 3RT3C 1AB3A 5H5NA 1J5EO 4JYAO 4DR3O 4LF5O 2F4VO 4JI3O 1HNZO 4OX9O 3T1YO 4OPAA 2DOSA 4B3MO 4A5UB 2HHHO 2UXBO 4LF9O 2FKXA 1AILA 4LF4O 2E5LO 1FJGO 1N32O 3O65A 4DR7O 3T1HO 4DR4O 2LW7A 2VQEO 4DV3O 4GKKO 4X66O 4NXNO 2AGAA 4JV5O 4JI6O 3OTOO 4NXMO 3F5TA 4X62O 1XNRO 1HNXO 4DR1O 1YZBA 1F7YA 1R1BA 2DJVA 1N36O 4DUZO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPH A;  4K0K O;  1R6T A;  1XEQ A;  4DV7 O;  5BR8 O;  4DR6 O;  1XMQ O;  1IBK O;  2JRI A;  1A32 A;  3JAM N;  5BY1 A;  2UU9 O;  2ZKO A;  4LFC O;  4KHP O;  2UUA O;  3J81 N;  2VQF O;  4DV0 O;  1I94 O;  2UUB O;  4DR2 O;  1DK1 A;  4DV6 O;  1HR0 O;  5IT9 N;  1N33 O;  4X65 O;  5FLX N;  1XNQ O;  3J80 N;  1IBL O;  4LF8 O;  4LFA O;  5LL6 Y;  4X64 O;  4JI4 O;  4DR5 O;  5BXZ A;  4JI7 O;  2N74 A;  5A2Q N;  1IBM O;  2UXD O;  4LFB O;  1NS1 A;  2ZM6 O;  4DV1 O;  2UUC O;  4YY3 O;  4LF6 O;  2Z0A A;  2UXC O;  1N34 O;  4B3T O;  4B3R O;  4B3S O;  3R66 A;  4JI1 O;  4DV2 O;  4JI8 O;  1G1X B;  4JI0 O;  4DV5 O;  1HNW O;  5LMU O;  1FYJ A;  4DV4 O;  4JI2 O;  5LMN O;  1D2D A;  4GKJ O;  3J7A U;  1KUQ A;  4AQY O;  5IWA O;  4JI5 O;  4DUY O;  1XMO O;  4LF7 O;  1X59 A;  3SDL A;  4YHH O;  3M8A A;  1FKA O;  3RT3 C;  1AB3 A;  5H5N A;  1J5E O;  4JYA O;  4DR3 O;  4LF5 O;  2F4V O;  4JI3 O;  1HNZ O;  4OX9 O;  3T1Y O;  4OPA A;  2DOS A;  4B3M O;  4A5U B;  2HHH O;  2UXB O;  4LF9 O;  2FKX A;  1AIL A;  4LF4 O;  2E5L O;  1FJG O;  1N32 O;  3O65 A;  4DR7 O;  3T1H O;  4DR4 O;  2LW7 A;  2VQE O;  4DV3 O;  4GKK O;  4X66 O;  4NXN O;  2AGA A;  4JV5 O;  4JI6 O;  3OTO O;  4NXM O;  3F5T A;  4X62 O;  1XNR O;  1HNX O;  4DR1 O;  1YZB A;  1F7Y A;  1R1B A;  2DJV A;  1N36 O;  4DUZ O; 
#chains in the Genus database with same CATH topology
 4X20 B;  1V54 B;  1PM9 A;  3LSQ A;  1K8A W;  1BZK A;  2PI4 A;  1XL4 A;  2P6J A;  4E4E A;  4QE9 A;  3ZX6 A;  1IBK O;  2BOC C;  3THO A;  4D7T A;  4CC5 A;  1S5L Z;  1RSO A;  4LFC B;  3OR7 C;  2QEX V;  1UPG A;  5EYP A;  4DV0 B;  3W7X A;  2M6Y A;  1YSC A;  1H2K A;  3IC7 A;  4Z1M G;  3PN1 A;  1W59 A;  4ASU G;  3LUT B;  5B1O A;  1CEZ A;  1H2G A;  3EVK A;  2HP8 A;  1M9N A;  1H8H G;  1NBM G;  1DGS A;  2R9R B;  1NH2 B;  2L6L A;  2Z0A A;  4B3T O;  2ZXW B;  1UFI A;  4X1I A;  1TA8 A;  3ZMZ A;  5J2U B;  3ZMS A;  4DV5 B;  5LMU O;  4DV4 B;  2NNU A;  5LP6 A;  1QU7 A;  4JI5 O;  3ABM B;  4RWU A;  2CTQ A;  4UVB A;  3AG3 B;  4CH3 A;  1CXZ B;  4P2Z A;  3HKB A;  3MD0 A;  2V1D A;  3A0R A;  2PUS A;  1YTF D;  5IY5 B;  1BQ0 A;  4I7Z B;  4JI3 B;  1HNZ B;  3EXA A;  5EC1 C;  4GYC B;  1FFT B;  1NQT A;  3HKD A;  1OCO C;  1QBZ A;  1JMK C;  1N32 O;  1TUB B;  1VQ7 V;  2ETN A;  4DR7 O;  2EIK B;  2Z5U A;  4HAM A;  3FD9 A;  5FPR A;  2VQF B;  1HNX O;  4HBN A;  3DGE A;  1L1F A;  2XAQ A;  1PD3 A;  1M1K W;  2QKA A;  4DV7 O;  4X88 A;  1NR1 A;  3BFR A;  4JZ2 A;  5EIB D;  3E8B A;  4X64 B;  3IGA C;  3TET A;  1AI4 A;  1K92 A;  1VQP V;  3J81 N;  3ZJZ A;  4RQF A;  2W6J G;  1YCI A;  5KUK A;  4JI1 B;  4IHJ A;  2Q68 A;  4LCU C;  4JI2 B;  3STZ C;  3FB5 C;  1SF9 A;  3SYO A;  1B3Q A;  4FLX A;  4K8X A;  1Y66 A;  1SQQ H;  4X1Y A;  5BZB A;  4MTG A;  4EB6 A;  3TK1 A;  4B3T B;  2JS3 A;  1H38 A;  4FPP A;  3M7M X;  1S76 D;  3OE7 G;  1ZTE A;  1OCO B;  3E8F A;  2DWD C;  5LMU B;  3BAA A;  4GKJ O;  2V4D A;  3ASN B;  3CRM A;  3JSL A;  5KMG A;  4J41 A;  1DTO A;  5JQG A;  2WLN A;  2JEU A;  3ZRW A;  5J2T B;  5LYJ A;  4PI2 A;  3K3W A;  4BAY A;  3D3I A;  1NVP D;  1PL4 A;  4PD4 F;  2CTP A;  4RUF A;  1BL8 A;  4U7N A;  1HDJ A;  2UXB O;  4LR3 A;  1FJG O;  4I9W A;  4DR7 B;  1Q3E A;  4NXN O;  4K35 A;  2X7R B;  4UVA A;  4NXM O;  3K06 A;  1WA8 B;  3F5T A;  5LA6 B;  1QR8 A;  3B77 A;  3ETQ A;  5JVD A;  3Q4H B;  3T1C A;  3TCU A;  3GVM A;  2DN9 A;  3RYF B;  4K8Z A;  1WJZ A;  2IW5 A;  1SQB H;  5FNV A;  2E74 B;  2XAG A;  1KD1 W;  5HFM A;  1AVM A;  1F23 A;  2WSS G;  1XMQ O;  5GON A;  5JCO A;  3RYH A;  1MG1 A;  4PV1 B;  1YEW A;  1OCC B;  4KHP O;  1KMI Z;  1K33 A;  1N0N A;  3HPL C;  4G2K A;  3FB6 C;  2WWW A;  1DLB A;  1WB7 A;  4RO2 A;  4PDV A;  2B1I A;  1FXV A;  3JCU Z;  3ZRS A;  1NU1 H;  5JJJ B;  1U96 A;  4DR5 O;  4MW8 A;  4B7K A;  4E2L A;  1H2S B;  1AI7 A;  5L3C A;  1VQ6 V;  1WB8 A;  1VQN V;  3JD1 A;  3JAL B;  3ZIA G;  1QVG U;  4U7O A;  3JD4 A;  5LHI A;  2D2C B;  4UV8 A;  4GKJ B;  4AQY O;  3QO5 A;  3UM7 A;  1R3I C;  2A06 H;  1TUE B;  1AB3 A;  2WLJ A;  4PDM A;  2EIL C;  2PI5 A;  4FLU A;  5EBL C;  5CA1 B;  3P3N A;  3OUF A;  4LF5 O;  4IIJ B;  2Q7E A;  4I50 B;  1AP5 A;  3B2E E;  4GX1 A;  5D5P A;  1I08 A;  4FM0 A;  2BOB C;  1FJG B;  2VQE O;  4NXN B;  1SC5 B;  5KA5 A;  2DYS C;  1XNR O;  3ZHU A;  5DED A;  1LR1 A;  2Q6A A;  2RNB A;  2ZE7 A;  4JAV A;  3K58 A;  1HR0 B;  1F7Y A;  1YDX A;  4ZOL A;  3CD6 V;  2YUA A;  2IJH A;  3HB3 B;  4LF8 B;  2GUZ B;  3CX5 F;  3F7V C;  2YIB A;  3UO2 A;  2QWO B;  3KZI Z;  1H8E G;  4I9Q A;  1XMQ B;  3FAV B;  3L74 H;  1ZLZ A;  1Z5W A;  5AG2 A;  4HNA B;  5DEC A;  5LHH A;  4KHP B;  4DRX A;  1VQL V;  1K4C C;  3UO3 A;  2R9I A;  4HZ3 A;  2UUB O;  3FYI B;  5IT9 N;  1JJO A;  3RWR D;  1BHA A;  2X6B A;  5LMN B;  4XDL A;  3ZCC A;  3L70 H;  1S5H C;  2B9Z A;  4JPR A;  1FAF A;  2QM4 A;  3JAW B;  1KC8 W;  5A2Q N;  1AR5 A;  1GH6 A;  1M4U A;  4TV8 B;  2UUC O;  4FIP C;  4U3J B;  2BTQ B;  1IXM A;  3JAT A;  4DK1 A;  3W7U A;  1JFF A;  1Q43 A;  4B3S O;  4R50 A;  2JJ1 G;  3SJB C;  5KHK A;  2X6A A;  3C3S A;  1Q6I A;  3D36 C;  1JPX A;  1Z5V A;  4CH6 A;  3ABT A;  4WFF A;  1L8D A;  5IWA O;  3OMI B;  1I5Y A;  1JJ2 U;  4JV5 B;  2DYS B;  4WCE V;  4WFA V;  1KYO F;  4LC1 A;  4PA7 A;  1MZE A;  4UB6 Z;  2EIJ C;  3AK2 A;  1G4Y B;  2LFR A;  1CPY A;  5KX5 A;  1SA0 A;  4WBN A;  3ZHV A;  2ZIN A;  2YS8 A;  1L0N H;  4BW9 A;  2CGN A;  2VQE B;  5EBW C;  1F4M A;  3ASO B;  3JAR A;  2CDY A;  4LH7 A;  2HKO A;  3TXS A;  1PL0 A;  1Q8I A;  1XNR B;  1Y74 B;  2N04 A;  4FLT A;  5H2F Z;  1Y76 A;  5EC2 C;  1NZ6 A;  3K5L A;  3LDC A;  1VQ9 V;  1F4N A;  3N2K B;  4DR6 O;  5B1B B;  1SRY A;  1YJ9 V;  4UVC A;  1M90 W;  4FFB B;  1VAR A;  1S3J A;  4X8A A;  1Q82 W;  2FML A;  5FL7 G;  4O4H B;  2UUB B;  5IYZ A;  4JTD B;  1N33 O;  2P90 A;  1SQV H;  1KQS U;  1FD9 A;  1V55 C;  4CH4 A;  2WA4 A;  1PKX A;  2ZE8 A;  4DV1 O;  2JDI G;  1K97 A;  4L87 A;  2VWJ A;  2UUC B;  4LF6 O;  4NYK A;  4PA6 A;  1Q81 W;  2EJR A;  3U10 A;  2P4V A;  2Q69 A;  4B3S B;  3VOU A;  4MVM A;  3HKC A;  1ZSP A;  2MK3 A;  3K59 A;  5H9C A;  4LP8 A;  5IJ0 B;  3E83 A;  2JVD A;  1XBL A;  1V54 C;  2XUM A;  2CGO A;  5LOV B;  1JOY A;  1PNK A;  1PPJ H;  3ZHR A;  1X59 A;  5IWA B;  3JAS A;  1H2N A;  3EHB B;  2ZNJ A;  1X4T A;  4JYA O;  3CE2 A;  1KKC A;  3ABK C;  3UQ8 A;  3E8G A;  1JA8 A;  3D8C A;  4O4I A;  2L35 A;  3BPZ A;  2Q8V A;  5K1X A;  4LF9 O;  1EM1 A;  3OGC C;  1AIL A;  3D3Q A;  1E79 G;  2QWN B;  4DV3 O;  1R73 A;  4N23 A;  4ZIB A;  1WP8 A;  2ZE6 A;  2YID A;  3AG4 B;  1W0J G;  3ZRV A;  1FXH A;  3IJ4 A;  2Y0P A;  3R65 A;  4MTF A;  1FFX B;  3CJH A;  1ZUQ A;  3CS5 A;  5LGN A;  1VMG A;  3E8H A;  3OT7 A;  3L71 H;  4I4T B;  1PNM A;  1BSM A;  3K0G A;  4PDR A;  1OCZ B;  5C93 A;  4DR6 B;  1A32 A;  5C8Y A;  4FM1 A;  1ARO P;  3OMN B;  2YSU B;  4JTC B;  1VQ5 V;  1JCH A;  2EZP A;  3ABM C;  4YJ3 A;  3UCS C;  1VF6 C;  4FVM A;  2VQF O;  4GT1 A;  3WB1 A;  4KXR A;  4LNU B;  1I94 O;  3CME V;  1ENV A;  3OAA G;  3K5M A;  1NTK H;  2BSK A;  5IY5 C;  4P30 A;  3BA8 A;  2BTO A;  1XOU A;  2VS0 A;  3QF7 A;  5KHI A;  2OWO A;  2HVJ C;  4B7E A;  3M99 B;  2A0L A;  4X64 O;  2QM8 A;  1Q7Y W;  2X6C A;  4W4K A;  3BRC A;  4ZKI A;  4X9Q A;  2UXD O;  2EIK C;  4DV1 B;  3MAQ A;  4MVS A;  4LF6 B;  1N34 O;  3ABK B;  4FZ1 A;  4JI1 O;  4IYI A;  2CTR A;  2R72 A;  3CRR A;  3FFQ A;  3JAT B;  4KP4 A;  1RP3 B;  1GN6 A;  4JI2 O;  2LJ2 A;  2PGG A;  3DTU B;  4WFB V;  1KUQ A;  1M57 C;  1MSW D;  3IAY A;  3SJA C;  3OTO B;  3ZED A;  4GLX A;  5H5N A;  3H9V A;  1OZ0 A;  2EIN C;  3ZN1 A;  5CB4 B;  3OTF A;  4JYA B;  1YJW V;  4PJ0 Z;  4DYL A;  1N8R W;  3LSS A;  2RCV A;  3JAK A;  4UCV A;  3BEH A;  1R6N A;  1EN6 A;  4LF9 B;  2ZDI C;  1MNG A;  4DW0 A;  4DV3 B;  1VF5 B;  3K57 A;  5KAF Z;  2ZCE A;  4QIW F;  2UXN A;  1GN2 A;  1GM8 A;  1IXB A;  2OCC B;  2W0F C;  1AJP A;  4JTA B;  1D5A A;  3FYE B;  1YVW A;  3JAR B;  1BGY H;  1RPR A;  4P9O A;  1BQZ A;  1TVK B;  1SES A;  1XEQ A;  2ZT9 B;  4NB5 A;  2CAZ C;  4O4J A;  1WN7 A;  1BCC H;  3H1K H;  3CCL V;  5L3E A;  2ZKO A;  3ASN C;  5KLV H;  2H94 A;  4MW3 A;  1ZL8 A;  3UKM A;  2KG7 B;  4CH5 A;  3G71 V;  3CXC U;  1R6K A;  2HR3 A;  3NXS A;  1I94 B;  1WLE A;  2QTS A;  3CWB H;  5CA0 A;  5CA3 A;  1GM7 A;  4DXW A;  1XNQ O;  4NVP A;  2A9H A;  1M57 B;  2ZQM A;  1S77 D;  3RYI A;  3K03 A;  2CK3 G;  4JI7 O;  4LWS A;  4XDJ A;  2UXD B;  2ZM6 O;  2CH7 B;  2EIN B;  2HJD A;  1S5J A;  3APO A;  3LNM B;  4LBE C;  4O2A B;  1N34 B;  2QDO A;  4JI8 O;  1R3J C;  1G1X B;  3T4D A;  1WAZ A;  2Y0I A;  3S3W A;  2VWK A;  2O57 A;  4JYC A;  1K9M W;  1IZ3 A;  2WAM A;  3E22 A;  1HW7 A;  1YTF B;  1AI6 A;  4F6R B;  2E3C A;  1XMO O;  1SQP H;  1XHZ A;  2QE7 G;  2D3O W;  3AK1 A;  3ETE A;  5ITZ B;  4TQF A;  1VF7 A;  2Q0O C;  1OCC C;  2F43 G;  1Q6U A;  3QO8 A;  4KUM A;  2Y4T A;  4ZI7 B;  5E1A C;  4YJ2 B;  1J95 A;  2FKX A;  4O2B A;  1M56 C;  1BS3 A;  5LXT B;  1QLN A;  3CCE V;  2JS5 A;  2F1M A;  2QKC A;  4J7J A;  3MHH C;  3ZMU A;  1Y67 A;  3RBZ A;  4J11 A;  4U3F H;  2ITC C;  1MA1 A;  3SPJ A;  1VQM V;  2YEV B;  2K1E A;  4O4L B;  4IGG A;  1XQ8 A;  4JI4 B;  1U97 A;  3F5W C;  3K0D A;  2IM9 A;  3X2Q C;  1GMG A;  2WLI B;  4X1K A;  1D5N A;  2CE4 A;  2XTA A;  3DXR B;  2UXC B;  3OR6 C;  1FXK A;  5LGU A;  2YDE A;  2AHZ A;  5BMV A;  4WF9 V;  3KCX A;  1HR0 O;  2ADP A;  4R8C A;  3U11 A;  2YXY A;  4LF8 O;  1XNQ B;  3KCY A;  4H0L B;  3AG1 B;  2PY5 A;  2N05 A;  4H44 B;  2WA3 A;  4AHC A;  1QNM A;  5KHG A;  4F6E A;  4ZHQ A;  2HJF C;  4D7S A;  4JI7 B;  1NS1 A;  4I55 A;  2ZM6 B;  1P7G A;  2WLL A;  3HR0 A;  4QPJ A;  2WLH A;  2UXX A;  4PEL A;  4TV9 A;  1WP7 A;  1RSO B;  3E89 A;  1G6U A;  4JI8 B;  3HKE A;  4OX9 B;  2JGD A;  5J9P C;  4TQD A;  1QVF U;  3OEH G;  5EYP B;  1MZF A;  2NN4 A;  1M56 B;  5LMN O;  3WU2 Z;  4I0X A;  2ITD C;  2AHY A;  1N0J A;  1OCR B;  2JK5 C;  1NVP B;  4UCU A;  1XMO B;  2QM7 A;  2Q5Z A;  2Q73 A;  3TGU H;  2P5O A;  1WPB A;  3U0Z A;  3CRC A;  2WPD G;  2QR4 A;  2PTM A;  2EBO A;  4DUZ B;  3SPG A;  3T1Y O;  3ZBH A;  2CUG A;  2QA4 V;  4X1I B;  3FX7 A;  5IJ9 A;  3H1H H;  4DR4 O;  3X2Q B;  3W7W A;  1PP9 H;  2V7Q G;  3N2G A;  1Y6X A;  1T5E A;  4JV5 O;  5FPO A;  2YI9 A;  4MTO A;  5LP6 B;  5KHJ A;  3GB7 C;  2YXL A;  4JAU A;  1YZB A;  4QPK A;  3G6E V;  4MVU A;  2DJV A;  3KKY A;  1EFR G;  3RYC A;  3CCJ V;  3HKB B;  2Y69 C;  4N21 A;  1QQC A;  4Q20 A;  1P4R A;  1VP7 A;  3B8M A;  5IYD O;  5JH7 A;  4UFZ A;  3SYC A;  4MVO A;  3QTC A;  2IJJ A;  4UXN A;  3HKD B;  4WFE A;  4DK0 A;  4G28 B;  2LO1 A;  2F95 B;  3ZHS A;  2P4K A;  2DYR C;  1DK1 A;  1SQG A;  4X65 O;  5FLX N;  1OV9 A;  5JJN B;  2ZE5 A;  2LGQ A;  5CBF A;  3CC7 V;  5E79 Z;  4JZG A;  4GUN A;  3CHX A;  4J9Y B;  5BXZ A;  3SJC C;  3ABL B;  2GTS A;  1US6 A;  3VQV A;  3UT5 A;  4FLZ A;  4QNH B;  3ASO C;  3H1I H;  5B1A B;  3OUS A;  4NKG B;  2RQ6 A;  4TOI A;  5EBM C;  1Y4M A;  1KB9 F;  3JD3 A;  1XUQ A;  2XHB A;  3I56 V;  2HHH B;  5EZY A;  5B3S C;  1D2D A;  5D5Q A;  3AG2 B;  4R6Z A;  4IHJ B;  1WPX A;  4LF7 O;  3NR7 A;  2R70 A;  4J80 A;  5B1B C;  3CCS V;  2OT5 A;  4EFB A;  4X20 A;  2DQ3 A;  2Y48 A;  5LBQ A;  1Q90 D;  2JEX A;  4X1Y B;  2Y69 B;  3ZN0 A;  3A0H Z;  1SZT A;  4EB6 B;  4IYH A;  3T1Y B;  4FZ0 A;  1GKF A;  4JAS A;  2P22 C;  4DR4 B;  3SYA A;  5IDJ A;  2ZIO A;  1NJI W;  2DYR B;  4EKW A;  5KMG B;  2A79 B;  1MMM A;  5JQG B;  4UUJ C;  3ZRW B;  5LYJ B;  1EBO A;  1R1B A;  3RVZ A;  4IT5 A;  5CN0 A;  3ZHQ A;  1GRJ A;  2Q0A A;  1XL6 A;  4YXW G;  2IH3 C;  3C90 A;  1HP8 A;  1URF A;  2H3O A;  1S72 V;  2QJ1 A;  3F7Y C;  3SJQ C;  2LQT A;  4UV9 A;  5J2U A;  4J9Z B;  1NI8 A;  4P9P A;  4DR2 O;  4DV6 O;  3O9O A;  2IJK A;  4BW5 A;  5B1N A;  4X65 B;  5B3S B;  5CBG A;  5JVD B;  3T4Z A;  5LL6 Y;  4BR6 A;  3APQ A;  2DWE C;  3FB7 C;  3WB0 A;  2N74 A;  5FNV B;  3C3T A;  5F2V O;  2QWP B;  3AG4 C;  1KBH A;  2YIA A;  3BY6 A;  1G8M A;  1WNS A;  4X89 A;  5GON B;  3RYH B;  1XRE A;  2KSD A;  3GWO A;  1TUB A;  2Q67 A;  2DMX A;  2ZD9 A;  4FLW A;  5CMU A;  1SET A;  1L0L H;  1OCZ C;  4I0X B;  4LF7 B;  1Z2G A;  2GV9 A;  3ETG A;  3OEE G;  2OTJ V;  5GTI Z;  3CP1 A;  4DR1 B;  1GAX A;  1QCE A;  4QE7 A;  1I5X A;  2NR5 A;  5KA6 A;  1JR9 A;  2ZIM A;  2K9P A;  3VQY A;  3SGI A;  4X66 O;  2EUL A;  4ABM A;  3OTO O;  1OJH A;  2Y4U A;  4PA9 A;  4I5S A;  3G80 A;  4YIO A;  3JCZ A;  1N36 O;  3P30 A;  3CCQ V;  3DC6 A;  3IC9 A;  5BR8 O;  2QTO A;  3ZMT A;  4KFM A;  3BAB A;  4MVR A;  4XDK A;  3L9D A;  3A8T A;  1TGO A;  3P3P A;  5TIS Z;  2JRI A;  2FTK A;  3JAM N;  3W7T A;  1K34 A;  4PA3 A;  5L3D A;  4KL1 A;  3G6B A;  4W4L A;  3CXH F;  3CC4 V;  1VQ4 V;  1H2M A;  2WLM A;  1NR7 A;  4DR2 B;  3P32 A;  4DV6 B;  2Q9L A;  3RW0 A;  3J80 N;  4FJC C;  5J2T A;  4JYB A;  1XIL A;  2HFE C;  3CEI A;  1BE3 H;  4ZOL B;  3K79 A;  1R3K C;  4YHH B;  3CCU V;  1DF5 A;  3QG5 A;  2OCC C;  2ZR2 A;  2XND G;  4MSW C;  1P7B A;  4JI0 O;  1NH2 D;  4DRX B;  2E76 B;  1FYJ A;  4DO2 A;  4FK5 C;  2E5L B;  1WA8 A;  5LA6 A;  1PV0 A;  5IE9 A;  4FLY A;  1RFY A;  3ZHT A;  4JI6 B;  3Q4H A;  4UCS A;  4CS4 A;  4TT3 G;  1SS3 A;  2PZS A;  2F4V O;  1F51 A;  1ORQ C;  4K0K B;  1SKV A;  3JD0 A;  1JFF B;  1GN4 A;  3QNE A;  1YJN V;  1RM1 B;  1KEC A;  4QJF B;  2BCC H;  2AGA A;  4X66 B;  3T2M A;  5B5E Z;  2DQ0 A;  3K5N A;  4J7Z A;  2FYU H;  3CPW U;  4X62 O;  2EZO A;  4MVQ A;  3TXQ A;  3SYQ A;  3MHS C;  4GX0 A;  1E1R G;  2RN9 A;  1N36 B;  2YXH A;  4RAI A;  2P7T C;  1QLE B;  2H8P C;  3E86 A;  2RDC A;  5BR8 B;  3BA9 A;  2HEP A;  1YIJ V;  3ICX A;  1S0V A;  5KX5 B;  1EN4 A;  4EEQ A;  1AP6 A;  1SA0 B;  4H37 A;  2OYQ A;  4WBN B;  2UUA O;  1K5S A;  1K7D A;  3B4S A;  3JAL A;  3MDS A;  2QWR B;  2FL4 A;  2VRZ A;  1IBL O;  3ETD A;  5L3F A;  4LFA O;  3S3X A;  5A9G A;  1Y76 B;  1XI1 A;  3FB8 C;  1AI5 A;  4JI4 O;  2OCH A;  4R7C A;  5CA1 A;  1NTM H;  2W6I G;  4IIJ A;  4I50 A;  4B08 A;  3OW2 U;  2UXC O;  3IFX A;  3EFF K;  2PYL A;  4GX2 A;  2ILM A;  2NLJ C;  3R66 A;  4DV2 O;  1Q86 W;  2LP7 A;  5EIB C;  4PHZ A;  4JI0 B;  1HNW O;  2KKW A;  1YHQ V;  1KP3 A;  3CCR V;  2G38 A;  5IYZ B;  4GKK B;  3CSX A;  2HVK C;  3CC2 V;  4UCO A;  3H1L H;  3CRQ A;  1KU9 A;  3CCV V;  2GUZ A;  2Z3Y A;  3L72 H;  3VQW A;  3B8N A;  3SR2 C;  2CTW A;  3A2F A;  1AR4 A;  1NT2 B;  1PNL A;  2F4V B;  5H6Q A;  4BIU A;  4OX9 O;  4Q6G A;  3FAV A;  2DOS A;  2LW1 A;  3N27 A;  2IH1 C;  1GTO A;  1SQF A;  2HLD G;  4HNA A;  4JGS A;  4GCZ A;  3AG1 C;  3HKC B;  1IBK B;  1Q6H A;  5H6R A;  5LGT A;  3VBB A;  2QKS A;  1VQK V;  1B6Q A;  4NTX A;  4X62 B;  2ADQ B;  3B09 A;  2Q4P A;  4AI8 A;  2GTA A;  3JAS B;  2GHY A;  5EK0 A;  4J42 A;  4DUZ O;  3JAW A;  3JD2 A;  3BVO A;  3CMA V;  1XDC A;  4BWA A;  3RN4 A;  4TV8 A;  4U3J A;  2BTQ A;  2IU3 A;  3KG2 A;  4O4I B;  4J10 A;  5BY1 A;  3RVY A;  2UU9 O;  1OCR C;  4YIP A;  2YC0 A;  2UUA B;  3K5O A;  2F66 C;  2F23 A;  2AZ0 A;  3G4S V;  3GWK C;  3WFV A;  3SPH A;  1R3L C;  1IBL B;  5GTH Z;  4LFA B;  3CJH B;  1MAB G;  4JI5 B;  1GM9 A;  2OIG A;  5B66 Z;  1NKD A;  5IYC O;  1TAE A;  4ZBM A;  1K4D C;  2IBZ H;  5C8Y B;  3B40 A;  4B3R O;  5LP6 C;  1H2L A;  4DV2 B;  2HG5 C;  4YJ3 B;  1HNW B;  1COW G;  3K08 A;  4RQE A;  3BCC H;  3I55 V;  5KAI Z;  5LHG A;  1N32 B;  4CZZ A;  2QWQ B;  1K5Q A;  2BSK B;  1Y74 A;  4WFH A;  2GSM B;  4C7U A;  2C2A A;  4JAA A;  5L3B A;  1HNX B;  4PA4 A;  4TUY A;  1J5E O;  1GK9 A;  2PYJ A;  3N2K A;  4Z2W A;  2JIZ G;  1ZAU A;  1MSD A;  4B3M O;  4A5U B;  2HHH O;  4DV7 B;  3SYP A;  3T1H O;  4FFB A;  2Q7G A;  2LW7 A;  4FMT A;  1GO3 F;  2AXT Z;  4O4H A;  1B06 A;  3OFN G;  3ABL C;  2R9A A;  3D36 A;  1KP2 A;  1LNQ A;  5B1A C;  2XAH A;  2OTL V;  4OPH A;  2B1G A;  1VQ8 V;  3H01 A;  4GX5 A;  3ABU A;  1VQO V;  4OGQ B;  3JAK B;  2UU9 B;  3AG2 C;  1ROP A;  1MOF A;  4NTY A;  3JSN A;  2LGW A;  2JGU A;  2PF4 E;  5IJ0 A;  3K9A A;  2EJ7 A;  3OMA B;  5LOV A;  4JYY A;  2ATK C;  4UCR A;  2EX3 A;  4MVZ A;  4CC6 A;  4BIZ A;  1GN3 A;  4TSF G;  1N4C A;  5K1P A;  1EZV H;  5JJE B;  2QSA A;  2QGN A;  1IBM O;  4LFB O;  4O4J B;  4YY3 O;  1Q5O A;  1VIB A;  3ML0 A;  4PI0 A;  2W0X A;  4HYO A;  1ZL8 B;  4B3R B;  4LH6 A;  3W7S A;  3RFR A;  5GW7 A;  3BHP A;  2UXB B;  3STL C;  2ODM A;  3OM3 B;  5CA0 B;  2ARH A;  4DUY O;  1SZX A;  3SPI A;  2AZ2 A;  1FFX A;  1P84 F;  2E75 B;  3RYI B;  4NXM B;  1JQ0 A;  1ZWI C;  2YIC A;  2RJZ A;  3L75 H;  4I4T A;  1LUW A;  3K9S A;  4LWS B;  5IYB O;  1J5E B;  3L73 H;  3WG7 C;  2RMK B;  3JYC A;  3FKS G;  4B3M B;  3E35 A;  1FXK C;  1KKD A;  2ZNI A;  3LSU A;  1I7F A;  4H13 B;  2A7W A;  3T1H B;  1VEW A;  4LNU A;  4FM2 A;  1AR1 B;  3QO7 A;  2GBO A;  4NTW A;  4D6T H;  4RUE A;  3E22 B;  4DR1 O;  2YI8 A;  2KB1 A;  4CBC A;  5JCO C;  2EIM C;  1FPO A;  4H33 A;  1R6T A;  3LDD A;  1I0H A;  3G67 A;  1YIT V;  4XBF A;  4OXS A;  1IVS A;  4DR5 B;  3CB2 A;  1LUV A;  2EIL B;  2XT9 A;  4O2B B;  4NR1 A;  1AJN A;  4WFG A;  2B5U A;  1YI2 V;  4UB8 Z;  1W0K G;  5KHH A;  2FB5 A;  4MTX A;  4CS2 A;  4EFE A;  4AQY B;  1BT8 A;  4PDL A;  5CB4 A;  1K73 W;  1IBM B;  4LFB B;  3VQX A;  2XOK G;  2XAJ A;  4YY3 B;  2DW4 A;  4L8J A;  4LF5 B;  3WG7 B;  1HWY A;  4X1K B;  1FXK B;  1QHT A;  4Z1V A;  2DE0 X;  2F93 B;  1VF6 A;  5BMV B;  4AIL C;  1M5I A;  2MW2 B;  4DUY B;  4YHH O;  1IUR A;  3AK3 A;  3M8A A;  1FKA O;  3RT3 C;  1K3E A;  4ZHQ B;  3SPC A;  1TVK A;  4DR3 O;  3E2E A;  2EIM B;  4I55 B;  1YXB A;  2WLL B;  2X0L A;  4TUY B;  4OPA A;  4TWK A;  4TV9 B;  4LF4 O;  2E5L O;  2KG7 A;  3O65 A;  4MT8 A;  3HKE B;  2JGD B;  4UCT A;  2XAS A;  4JI6 O;  1SER A;  1ZX3 A;  5L3G A;  1IDS A;  2BE3 A;  4IL6 Z;  5CBH A;  1EZJ A;  3PJS K;  4K0K O;  1IX9 A;  1OHH G;  2CH7 A;  1AJQ A;  2P06 A;  1O9H A;  4O2A A;  2XAF A;  4MS2 A;  3AG7 A;  3CRA A;  4LFC O;  4GZR B;  5HFL A;  1JX9 A;  2WLK A;  5IJ9 B;  3ZS8 C;  4DV0 O;  4ICG A;  2ZDI A;  3N2G B;  2EIJ B;  3QVN A;  2YIB D;  3K04 A;  1V9P A;  3H1J H;  3LDE A;  4F6R A;  5ITZ A;  1W2B U;  3OGI B;  1M93 A;  3RYC B;  4QGP A;  1E1Q G;  2IJI A;  1RM1 C;  5KUM A;  2LFS A;  5JH7 B;  4F4L A;  4BIO A;  4ZI7 A;  4YJ2 A;  4DW1 A;  3CYO A;  1BHB A;  5JWP A;  1YF2 A;  4DV5 O;  3I5D A;  3AEI A;  5LXT A;  1EN5 A;  4DV4 O;  3CCM V;  2IU0 A;  2GDS A;  1O9G A;  3RGB A;  3J7A U;  2M7W A;  1QLE C;  1DF4 A;  3A0B Z;  1CP9 A;  3SDL A;  2Q7H A;  2ZR3 A;  3DC5 A;  2A3Q A;  2YEV A;  1RPO A;  1QR9 A;  2AW9 A;  3DSQ A;  2ZXW C;  4JI3 O;  4DR3 B;  3UT5 B;  1HNZ O;  4FFK A;  4O4L A;  1SQX H;  1V55 B;  2P67 A;  2KQX A;  1UJW B;  3WB2 A;  2WLI A;  5DM6 V;  4FLV A;  3ZRX A;  4LF4 B;  3DXR A;  1P49 A;  3LNN A;  3ZMV A;  1THZ A;  3TJT A;  4GKK O;  4G27 B;  5EZY B;  4CS3 A;  1BMF G;  1FS0 G;  4JF3 A;  1NTZ H;  1JVM A;  5DN6 G;  3AG3 C;  1XHX A;  4J7K A;  3OD4 A;  3RYF A;  2OIE A;  4K3A A;  1B04 A;  1N33 B;  2JJ2 G; 
#chains in the Genus database with same CATH homology
 4OPH A;  4K0K O;  1R6T A;  1XEQ A;  4DV7 O;  5BR8 O;  4DR6 O;  1XMQ O;  1IBK O;  2JRI A;  1A32 A;  3JAM N;  5BY1 A;  2UU9 O;  2ZKO A;  4LFC O;  4KHP O;  2UUA O;  3J81 N;  2VQF O;  4DV0 O;  1I94 O;  2UUB O;  4DR2 O;  1DK1 A;  4DV6 O;  1HR0 O;  5IT9 N;  1N33 O;  4X65 O;  5FLX N;  1XNQ O;  3J80 N;  1IBL O;  4LF8 O;  4LFA O;  5LL6 Y;  4X64 O;  4JI4 O;  4DR5 O;  5BXZ A;  4JI7 O;  2N74 A;  5A2Q N;  1IBM O;  2UXD O;  4LFB O;  1NS1 A;  2ZM6 O;  4DV1 O;  2UUC O;  4YY3 O;  4LF6 O;  2Z0A A;  2UXC O;  1N34 O;  4B3T O;  4B3R O;  4B3S O;  3R66 A;  4JI1 O;  4DV2 O;  4JI8 O;  1G1X B;  4JI0 O;  4DV5 O;  1HNW O;  5LMU O;  1FYJ A;  4DV4 O;  4JI2 O;  5LMN O;  1D2D A;  4GKJ O;  3J7A U;  1KUQ A;  4AQY O;  5IWA O;  4JI5 O;  4DUY O;  1XMO O;  4LF7 O;  1X59 A;  3SDL A;  4YHH O;  3M8A A;  1FKA O;  3RT3 C;  1AB3 A;  5H5N A;  1J5E O;  4JYA O;  4DR3 O;  4LF5 O;  2F4V O;  4JI3 O;  1HNZ O;  4OX9 O;  3T1Y O;  4OPA A;  2DOS A;  4B3M O;  4A5U B;  2HHH O;  2UXB O;  4LF9 O;  2FKX A;  1AIL A;  4LF4 O;  2E5L O;  1FJG O;  1N32 O;  3O65 A;  4DR7 O;  3T1H O;  4DR4 O;  2LW7 A;  2VQE O;  4DV3 O;  4GKK O;  4X66 O;  4NXN O;  2AGA A;  4JV5 O;  4JI6 O;  3OTO O;  4NXM O;  3F5T A;  4X62 O;  1XNR O;  1HNX O;  4DR1 O;  1YZB A;  1F7Y A;  1R1B A;  2DJV A;  1N36 O;  4DUZ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...