3T1HO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3t1hO00
2JRIA 4X62O 4B3SO 4GKKO 4JI6O 2DOSA 4LFCO 4AQYO 5LL6Y 4DV6O 1XNRO 1N36O 4X66O 4DV2O 4LF5O 4OX9O 3R66A 5BR8O 2UXCO 1HR0O 3JAMN 4JI8O 5BY1A 1J5EO 4K0KO 1AB3A 4LF7O 2ZKOA 2FKXA 4DR5O 1HNXO 4JI0O 2UUAO 4DR3O 1N32O 1I94O 4YY3O 4JV5O 1R1BA 2UU9O 2DJVA 4X65O 1HNWO 4LFBO 4LF4O 1KUQA 4LF8O 3F5TA 3M8AA 3J81N 2UUCO 5LMNO 4DV0O 1D2DA 1R6TA 4DUYO 2Z0AA 1XEQA 4JI3O 1FYJA 1N34O 2LW7A 2HHHO 4DV5O 4NXNO 4X64O 4NXMO 3T1YO 1IBMO 4JI1O 4DR4O 1HNZO 1XNQO 1FKAO 2AGAA 1IBLO 4LFAO 2VQFO 5A2QN 1FJGO 2UUBO 4OPHA 4YHHO 2E5LO 1G1XB 4DV4O 4JYAO 4LF6O 1X59A 4DR2O 4JI4O 1AILA 2UXBO 4DR1O 4LF9O 1DK1A 1A32A 4DV1O 5LMUO 2N74A 4JI7O 4JI2O 1NS1A 4JI5O 3J80N 5H5NA 3RT3C 4DV3O 2UXDO 4B3RO 4DV7O 4B3TO 3SDLA 5IWAO 1XMQO 2F4VO 4DR7O 3OTOO 4GKJO 1YZBA 5FLXN 4KHPO 4OPAA 4B3MO 4DUZO 5BXZA 1XMOO 3J7AU 4DR6O 2VQEO 1IBKO 2ZM6O 3O65A 1F7YA 3T1HO 1N33O 4A5UB 5IT9N
chains in the Genus database with same CATH superfamily
1EN4A 4FM0A 3BHPA 4I9QA 4UCVA 2EILB 2ETNA 3E22A 3GVMA 1K5QA 3IAYA 1HR0O 2XAFA 1DF5A 3L74H 3RYIA 1XMOB 3ZMSA 3K57A 1HNXB 1MZFA 3Q4HB 2HFEC 2ZNJA 1I7FA 3ZIAG 5IJ0A 1N32O 2DWEC 4JZGA 5ITZA 2DJVA 3QTCA 4DR1B 1PL4A 2YSUB 3F5TA 4DV0O 2PZSA 1I0HA 2HHHO 5KLVH 2PI4A 2WLMA 1NR7A 2EZPA 5IE9A 3APOA 1IURA 1BQ0A 4K35A 4R7CA 1VQ6V 1SF9A 4X1KA 4RWUA 2DYRC 1PP9H 3CC2V 3D8CA 1EN6A 4OPHA 1YEWA 4DV4O 4L87A 4LF4B 3VOUA 1N33B 4NTWA 2EINC 1QLNA 4J7ZA 1H2NA 1G4YB 1HP8A 4J10A 1Y74B 2DYSB 5L3BA 1H2SB 2Y0IA 4X1IB 3S3WA 3A0RA 5EBMC 3SPIA 2ODMA 2ZQMA 4JYYA 3RN4A 3T4ZA 1VF6C 4OX9B 1N8RW 2B9ZA 3KZIZ 2OTJV 4EFBA 4TUYA 3U10A 3CRMA 3FB7C 1JX9A 2VQEO 3ZCCA 2OCCC 1K34A 3W7TA 1YDXA 3SPGA 1JJ2U 1FXHA 1YTFD 2LFRA 4IYHA 3B09A 2Q6AA 2E5LB 1P84F 2CGNA 2QWNB 3BCCH 4X66O 3DGEA 4LF5O 2AXTZ 4JZ2A 2B5UA 2AHYA 3QG5A 4B3SB 2F93B 3CPWU 1W0JG 4ZBMA 3BRCA 2ZM6B 2VWJA 2UUAO 4K3AA 3OMIB 5KX5B 4X65O 1G8MA 3I5DA 2IJHA 4FVMA 1M57B 3U11A 1L1FA 2EINB 4RUFA 2H3OA 3CHXA 4CS2A 1AP5A 2EIMB 4NXNB 1IBLO 5IYBO 5A2QN 3PN1A 2BSKB 3ETEA 1V54C 4GUNA 1VQNV 3I56V 2W6JG 1I5YA 2QJ1A 4DRXA 4WCEV 1NVPB 5E79Z 3JATB 1AI6A 3JD1A 5EZYB 5L3FA 4FFBA 5JQGB 1RM1B 1Q7YW 2X0LA 2IU0A 2LW1A 4J42A 4B08A 4JI3B 1XI1A 5LGNA 5LA6B 2Q8VA 4JYCA 3RFRA 4BIOA 3OTOO 5EK0A 1LNQA 2Z3YA 1P7BA 3AG4B 4K8XA 1NH2B 2WAMA 3NR7A 2IJKA 2Y4UA 5JH7B 1VQLV 1PM9A 3OGIB 1VQPV 4MTOA 3ZHUA 3R65A 3EFFK 4MS2A 3HR0A 1KP3A 4LFCO 1ZUQA 3ZMZA 1AR5A 3JD4A 1P7GA 3A8TA 4IIJB 4OX9O 1GM7A 3CD6V 1AI5A 2QM8A 3LUTB 3KKYA 1VARA 2IH1C 2VQFB 4ICGA 3OAAG 2QWQB 5JVDB 1KMIZ 3MDSA 4PA3A 1N4CA 1FD9A 2YXLA 3BY6A 1NTMH 4JV5B 3UT5A 4LH6A 1M1KW 3ABUA 2UXDB 1FFXB 1ZSPA 1V54B 1YVWA 3TXQA 1WN7A 4TT3G 3W7WA 3K9AA 5JJNB 2AGAA 1K8AW 3JATA 3T4DA 4YHHO 2R72A 2IW5A 2KB1A 1Q6HA 3E89A 4LF6O 2XAGA 3HKDB 3ZRWA 3CRRA 4DR1O 1XHZA 1OCZB 4YJ3A 3B8NA 4LF9O 1R3KC 1R73A 2RCVA 4P9PA 4JI7O 3ETQA 1OCRB 3HB3B 2FTKA 2EIJB 4CS4A 2YC0A 4DUZB 3G67A 4J9ZB 3K58A 2QM7A 4I0XA 4J41A 3IC9A 5H2FZ 3CP1A 3HKEB 4LH7A 3TGUH 4DUZO 4X8AA 1VQMV 3W7SA 1K33A 4P9OA 2GV9A 2E76B 5KHGA 5J2UA 5LYJB 2N05A 1VQ8V 4B3MB 2DQ0A 1OCRC 4IIJA 3WG7C 5LHHA 3UM7A 2ZT9B 3UQ8A 5B1NA 2R9AA 2AZ2A 5LL6Y 3K5MA 3UKMA 1RPRA 3CJHB 2IJJA 1VQ5V 4DW0A 2CTPA 4AILC 4K0KO 2P4VA 1G6UA 5GONA 1SQFA 2B1GA 4BIUA 4DR2B 4LBEC 1NR1A 5DEDA 3ZEDA 1FXVA 1URFA 1TUBA 2IBZH 4NR1A 4OGQB 5FNVA 5LP6A 1N0JA 3TCUA 2Y69C 5LMNB 2Z0AA 3LSUA 4GX1A 4IT5A 4LFCB 2BCCH 2KG7A 2MK3A 3BAAA 3K5OA 4JI1O 1GMGA 2G38A 5HFLA 1FXKA 2OYQA 1WP8A 4BR6A 2VQFO 1Q6IA 4FLUA 4PDVA 1YTFB 4I50B 1FJGB 2UUAB 2ITCC 4LWSB 3CCLV 1X59A 1XILA 4C7UA 1ZLZA 3JAKA 3IC7A 2QKSA 4FLZA 4UB8Z 3X2QB 1A32A 2N74A 4BIZA 4D6TH 5B3SC 1RP3B 2GTSA 1AJQA 3EVKA 2YEVA 4B3TO 5KHHA 1GO3F 2CE4A 4RAIA 3BABA 4OPAA 3FKSG 1FXKC 2EBOA 3JSNA 1VQOV 1BCCH 1IXBA 4DR3B 4WFHA 1KYOF 3X2QC 2ZIOA 5FNVB 1R3JC 4O4HA 3GWOA 5ITZB 2ZXWB 4JI6O 2DOSA 2AW9A 1AI4A 3JASA 1JPXA 1MSDA 4QIWF 2BE3A 3ZRXA 1SQBH 5BR8O 1EZVH 3DXRB 1FXKB 1QCEA 2CK3G 1L0NH 3CCQV 4W4KA 5L3EA 1IDSA 2Y69B 2ITDC 5IJ9B 4AHCA 1NH2D 4IL6Z 2UU9O 4NVPA 2KSDA 3CRQA 3MD0A 3DC5A 2Q4PA 4LFBO 1M4UA 3ZRSA 5DM6V 3FYIB 4FFKA 1R6TA 4DV0B 1S5HC 2Q69A 2LW7A 1WP7A 3T1HB 1U96A 4NXMO 3E83A 3ABMB 1LR1A 2D2CB 2GSMB 3H1HH 2P7TC 5H6QA 4X64B 4TOIA 1Q90D 4X1KB 2Q7HA 1DF4A 3GB7C 2RQ6A 4DR2O 2CH7A 4UCTA 3IGAC 4CS3A 3CX5F 4BW5A 3SJBC 1DLBA 2YDEA 1DK1A 3N2GB 2EILC 3LDCA 4EFEA 2PYLA 4B3RB 4I55B 3CCRV 3I55V 1W0KG 2XT9A 4IYIA 2OIEA 1FS0G 2ARHA 2QTOA 4DR7O 3BPZA 3L72H 2GBOA 3SGIA 5J2TB 4FLYA 4PI2A 2CUGA 3LSQA 3DTUB 1ZWIC 3T1YB 1IBKO 3FAVB 2HLDG 1SQGA 1O9HA 3D3IA 1HWYA 4GCZA 4JI8B 1IBKB 3RYFB 5D5PA 2K1EA 4N21A 4DV2B 4AQYO 1XREA 1UJWB 2UXCO 1GN2A 2VWKA 3P3NA 4JGSA 3CCSV 3M99B 5IJ9A 3G71V 3SYQA 2DMXA 1XMQB 5BY1A 1AJPA 3BA9A 2C2AA 1HDJA 4U7OA 3ZN0A 4P30A 3T2MA 2F1MA 3N27A 1R1BA 2WLHA 1Y6XA 3MHSC 3E86A 2JEXA 4RQEA 1VMGA 4PI0A 3FYEB 4JAAA 2F23A 1LUVA 5EZYA 2CGOA 4MSWC 4ZHQB 3K0GA 3Q4HA 1S5LZ 2DE0X 2HKOA 3ZRVA 1HNZO 1WB8A 3RYHA 2A79B 4JTAB 4JI4B 2GHYA 1AP6A 2UUBO 1XQ8A 1GH6A 4LC1A 2HG5C 2HP8A 1F4MA 2OT5A 1D5NA 4DRXB 2Y0PA 4DR6B 3ABLC 4XBFA 5K1XA 2YIBD 3L71H 3SJAC 3IFXA 4MVMA 1K7DA 2QSAA 1NT2B 1QVGU 4I4TA 2CTQA 4O4IB 3WFVA 3ASNB 2ATKC 2F43G 1Y74A 3CS5A 2ZE6A 2LO1A 2RJZA 1IVSA 1XHXA 1TVKB 3JALA 3AG3B 4EKWA 4X65B 3RYIB 2H94A 1N36O 4DR7B 4YIOA 5KAFZ 4FZ0A 1H8HG 1E79G 1JFFA 4LF9B 1YSCA 3H1KH 1R3IC 2HR3A 2Q7GA 4G27B 4JI2B 4HYOA 4LF8B 1SC5B 4JI0O 3SYOA 2Z5UA 4ZHQA 2UXXA 4UB6Z 4JI6B 4LF8O 4O2BA 3J81N 5EIBD 4X9QA 4YJ3B 5JJEB 1S3JA 5EC2C 3U0ZA 4NXNO 3ETDA 2XOKG 3LNNA 3CRCA 3QNEA 1YJWV 3OGCC 3P30A 1WA8B 2H8PC 2Q67A 3H1IH 4JI4O 1Z5WA 1TA8A 2YXYA 1VF6A 3JCZA 3UCSC 4MVQA 3W7XA 2PGGA 2LFSA 2ZE5A 4PDRA 5IYZB 1VF5B 5H5NA 3OTOB 3VQXA 1SQXH 1JFFB 2BTQA 2XASA 1XNRB 4LNUA 5K1PA 4D7TA 1AI7A 3OD4A 1GKFA 4D7SA 2ZIMA 3J7AU 4DR6O 1OJHA 3OMAB 1VF7A 1MMMA 4DV1B 3FB8C 1MOFA 1K5SA 1F4NA 3VQVA 5IT9N 2EIKC 4HNAA 1I94B 3JD3A 4UVCA 2IU3A 1W59A 4B3SO 2N04A 4UUJC 4WFGA 1N34B 4LF5B 4JAUA 4FLTA 4TV9B 4CH3A 1AVMA 3K06A 3FB6C 3T1CA 1M56B 3NXSA 2Y4TA 3MAQA 1TUEB 4DV5B 4KUMA 4LF7B 4FFBB 4G2KA 4TV8B 4EEQA 4KHPB 2ZKOA 1R3LC 3AG2C 1EM1A 1MABG 1E1RG 1WJZA 2FMLA 3D36A 5CB4A 1Q3EA 2A06H 4MT8A 3CC7V 3SJQC 2A9HA 4JV5O 1RSOA 1OCOC 4UCSA 5IYZA 4UXNA 5EIBC 5IYDO 1VEWA 2P06A 1V9PA 3CRAA 1Q6UA 4YJ2B 3KG2A 1S0VA 1K97A 3H1JH 1FYJA 1H38A 5HFMA 3HKCB 2EIMC 3SYAA 3AK2A 1QLEC 3K3WA 3JARB 3LDDA 4HBNA 2YEVB 1XUQA 3UO3A 2E74B 2AZ0A 5KMGB 3QF7A 5L3DA 1SETA 5L3CA 1K9MW 3ETGA 4PDMA 4X1YA 4JYAO 3SR2C 4LWSA 4XDLA 1OCCB 2HJDA 1FFXA 1QVFU 4UV8A 3E8FA 2QA4V 1RFYA 3CC4V 3ZHTA 4G28B 5CBHA 5C8YB 4YIPA 3BVOA 5GTIZ 1XNQB 5B1AB 3CB2A 3JASB 5KAIZ 5LXTB 2QR4A 1AJNA 5CB4B 3OR6C 3RYCB 2W0XA 4H0LB 5KHJA 2NN4A 1QBZA 2DYSC 3CSXA 2IJIA 4MVOA 3K79A 2ZE7A 2ZE8A 1N33O 4LCUC 4O2AB 5KUKA 2EIKB 3G6BA 2JRIA 3HKCA 4ABMA 3E8BA 3RBZA 2HHHB 5CA1A 3B4SA 3ZHVA 2QM4A 2YI8A 3HKDA 4GKKB 4UCUA 2GTAA 1Q81W 2X6CA 4YY3O 5CN0A 4PV1B 1NTZH 4CBCA 4O4JB 2WA4A 3HKBA 2X7RB 1JR9A 2EX3A 3E2EA 2BOBC 4PHZA 3ZMTA 4JI1B 4F6RA 1BGYH 1LUWA 5B66Z 2ZNIA 1XEQA 4Z1MG 3F7YC 2MW2B 1UPGA 2UXNA 3ZBHA 2QWRB 3ZJZA 1AR4A 5BMVA 3T1YO 4PA4A 5B1BC 3TJTA 3OR7C 3H9VA 2V4DA 1Y4MA 2K9PA 2WLJA 1BE3H 5IDJA 4Q6GA 2UXCB 1YXBA 1EBOA 3QO5A 4DYLA 2HEPA 4DXWA 4XDJA 1NKDA 2P90A 1SQVH 2E75B 4I55A 5H6RA 5LXTA 2CAZC 4B3RO 5EBWC 4DO2A 1GN4A 3ZX6A 1NTKH 2QWPB 4B3MO 2W0FC 3H1LH 2FYUH 4FJCC 1N32B 1R6NA 3QVNA 4GZRB 4PA6A 4QE9A 3WG7B 4DR5B 1XL6A 2NLJC 2QGNA 1Y67A 1GTOA 2KKWA 3M7MX 4DV3B 3SYPA 3TK1A 5JQGA 2ZDIA 1XNRO 5GONB 1OCZC 2AHZA 1YJ9V 3FD9A 3SPJA 4DK1A 4X62B 1THZA 1KBHA 2HJFC 2JJ2G 2YI9A 1TUBB 2A7WA 4FM1A 2EIJC 1SA0A 1YJNV 3ABTA 4WBNB 2JEUA 3BFRA 4I9WA 4FLXA 1E1QG 3VQWA 1SQQH 3WU2Z 1X4TA 4JYBA 1I94O 1GN3A 4DUYB 3KCYA 4RUEA 5FL7G 4DW1A 5LGTA 3H01A 2P67A 1OZ0A 5GTHZ 1QHTA 5LMNO 4DUYO 3K9SA 1N34O 4QGPA 4DV5O 1SZTA 1Q86W 3E8GA 4DR4O 5D5QA 5J9PC 4W4LA 4O4HB 1WPXA 5FPRA 5TISZ 1Q8IA 4TUYB 2V7QG 3JD0A 4J7KA 4CC6A 3S3XA 5KA6A 4PJ0Z 4EB6A 5IYCO 1FJGO 3N2KA 3OUSA 4J9YB 3OEEG 2M6YA 2UXBO 1AILA 1BQZA 4U7NA 2ZINA 1JVMA 3KCXA 3D3QA 1NJIW 2XTAA 2ZD9A 5LHGA 1JMKC 1U97A 1NZ6A 3RT3C 1OCCC 4WF9V 4JTDB 4WBNA 1JQ0A 4I4TB 4R8CA 1DTOA 3N2GA 5KX5A 4FMTA 3ZS8C 1KB9F 4LF6B 2CTRA 2Y48A 1B04A 1TVKA 3JALB 3FB5C 4O2BB 2UUCB 2V1DA 1YI2V 1F51A 1NQTA 2Q0AA 3JAWB 4FIPC 4HZ3A 2DW4A 2WSSG 2GUZB 1QR9A 1HNXO 4CC5A 4I5SA 1K73W 3ZHRA 3OTFA 1SS3A 1HNWO 4MW8A 3M8AA 3TETA 2HVKC 4BW9A 4JI3O 1Y66A 1Y76A 1HNWB 4X64O 4I7ZB 2ZXWC 3FAVA 3K0DA 3N2KB 3ASNC 1PL0A 5IWAB 4QJFB 3E22B 1QR8A 2QE7G 3CCVV 2JS3A 4YY3B 5EYPB 4PD4F 3STLC 1QU7A 5A9GA 1FPOA 3ZMVA 2YIAA 4WFFA 3A0HZ 2X6BA 1ZX3A 2WLLB 2L6LA 4ZI7A 2R9IA 2PY5A 4P2ZA 1QQCA 2ADQB 2UXDO 3L75H 4DK0A 5B3SB 4GX0A 3G80A 1NBMG 2QTSA 4Q20A 4LNUB 3OEHG 4UCOA 1PNMA 1QNMA 4X1IA 5JVDA 2OIGA 2JGDA 4MTXA 4J7JA 1O9GA 4Z1VA 2EJ7A 3K08A 2VQEB 3P32A 4A5UB 5CA0A 5LMUB 1N36B 1WAZA 4RO2A 4MTFA 3G6EV 5IJ0B 1CP9A 1NI8A 1ZL8B 5EBLC 4XDKA 1YIJV 1UFIA 1SERA 1CEZA 3RVZA 2EULA 3JCUZ 4X88A 3K5LA 1S76D 3HPLC 4B7KA 4LF7O 1ZTEA 4DR5O 4J11A 2OTLV 1KP2A 2RN9A 3QO7A 3SPCA 1EFRG 3LNMB 1RSOB 4ZKIA 1FAFA 1PNKA 1H8EG 1KUQA 2LGWA 4IHJB 1QLEB 3AK1A 5JJJB 2UUCO 4OXSA 1Q5OA 1V55B 4R6ZA 1H2MA 3B40A 3C3TA 3ZMUA 4FK5C 1MZEA 1COWG 1IBMO 1K92A 5AG2A 4DV7B 1XNQO 1PPJH 3G4SV 1IX9A 1R6KA 2WLIB 5DECA 3MHHC 2F4VB 1G1XB 1VIBA 2WLLA 2YUAA 4FZ1A 3SPHA 3CE2A 2R9RB 4QPKA 3DC6A 4CH6A 3VBBA 1V55C 4JAVA 4LR3A 4DV1O 1S72V 1WLEA 5C8YA 3K04A 4GKJB 4PA7A 2GDSA 1M56C 5BR8B 3AG7A 2RNBA 4PELA 4NXMB 5IWAO 3RWRD 2PTMA 5LGUA 5EC1C 5CA0B 3OE7G 1CPYA 3RVYA 2VRZA 1EN5A 1KC8W 1HW7A 1KU9A 3L9DA 1VQ4V 1H2LA 4J80A 1MG1A 5H9CA 1FFTB 2FB5A 1VQ9V 1PNLA 3CXCU 3CCMV 3LSSA 3WB2A 4RQFA 2B1IA 4KFMA 3JSLA 2KG7B 1ENVA 4FLWA 1WA8A 4F6RB 3APQA 1XOUA 2W6IG 5GW7A 2WLIA 4B3TB 3OT7A 1XBLA 3E35A 1SRYA 5E1AC 1J5EO 2P6JA 2JIZG 3K03A 1K4DC 2PUSA 1YF2A 2DQ3A 1MA1A 3CXHF 4IHJA 5LOVB 4DR3O 4CZZA 5LA6A 1DGSA 3O9OA 3CMEV 4E4EA 3UO2A 1J5EB 5JCOC 4MVRA 1JOYA 5B5EZ 3HKBB 4MVUA 2OCHA 1BT8A 2BSKA 3VQYA 4X89A 1RM1C 3WB1A 4TV8A 3C90A 5KHKA 3RYFA 2Q5ZA 2WA3A 2PYJA 5LHIA 2XUMA 3CCEV 3STZC 3BEHA 1TGOA 1GRJA 4NKGB 1Z2GA 4KL1A 3AG2B 3EXAA 1KECA 1YITV 2FL4A 2DWDC 5JCOA 1OCOB 1D5AA 1GM9A 3SJCC 3E8HA 2E3CA 4YHHB 4GX5A 3ABKB 1L0LH 2P5OA 4IGGA 3ICXA 4JI2O 5FPOA 1MSWD 4DV3O 5LBQA 5KMGA 4H44B 4DV7O 2LP7A 4PDLA 3SDLA 2YXHA 3B2EE 3OFNG 4X1YB 1XMQO 1IBLB 4MTGA 5B1OA 4CH4A 4GKJO 1SKVA 4DV4B 4HNAB 1NVPD 4L8JA 3RYHB 5C93A 5KUMA 4YJ2A 1J95A 4HAMA 4UVAA 5B1AC 3O65A 1Q82W 4TV9A 2LGQA 5LP6C 4MVSA 4GKKO 2CDYA 4QPJA 4QNHB 4F6EA 2JS5A 2A3QA 4H33A 2VS0A 3JAMN 4X20B 1JA8A 4O4IA 5CMUA 2R70A 3QO8A 1KKDA 3AG3C 1PV0A 2P22C 2DN9A 1NU1H 2IH3C 4I0XB 3W7UA 2A0LA 4ZOLA 2LJ2A 3HKEA 3JARA 4BWAA 3RYCA 1PD3A 1SESA 4H13B 2EZOA 3GWKC 1ORQC 5KA5A 2QKCA 2YIDA 4TQDA 4FLVA 4MVZA 2JDIG 4O2AA 1FKAO 1VP7A 3L73H 3ABKC 3CCJV 2LQTA 1M57C 4JYAB 2E5LO 1BHAA 4X66B 5CA1B 3K59A 1T5EA 3D36C 1KKCA 4JI0B 2WLKA 4QE7A 4JTCB 4JI5B 1VQKV 1SZXA 4WFEA 1YCIA 1GAXA 3SYCA 3TXSA 4JI5O 4TQFA 1BZKA 1I08A 4X20A 2DYRB 1F23A 4O4LA 2NNUA 1N0NA 2BTOA 2ILMA 2YICA 3ASOC 4O4JA 2F4VO 2QDOA 1KD1W 1YZBA 5FLXN 3OW2U 2ZDIC 2WPDG 5LP6B 1HR0B 2OWOA 4K8ZA 3WB0A 3AG4C 1I5XA 3OM3B 1XMOO 1S5JA 3ZHSA 2ZR2A 2JJ1G 2YS8A 4FPPA 3CJHA 1CXZB 3T1HO 4R50A 2XNDG 2ADPA 3JD2A 4NTYA 4LP8A 3ASOB 5IY5C 4DV6O 3LDEA 1WNSA 4WFBV 3R66A 1VQ7V 4UCRA 3FX7A 5CBGA 3ZHQA 4GT1A 4DV6B 4DR4B 2Q73A 1OHHG 4ZOLB 4UFZA 4JF3A 5JH7A 4H37A 3B8MA 1L8DA 4GYCB 4LF4O 4BAYA 1S77D 4F4LA 1B3QA 2Q9LA 3JYCA 1Q43A 4Z2WA 3THOA 4ZI7B 2JGUA 1US6A 3OUFA 1Y76B 5KHIA 2D3OW 5L3GA 3CYOA 5IY5B 3RGBA 2EJRA 2UXBB 3ABMC 2Q0OC 4NTXA 4LFAO 4U3JA 3C3SA 1JJOA 3B77A 1OV9A 1K3EA 3ZRWB 5DN6G 4GX2A 3DXRA 1AR1B 1BHBA 2JK5C 1W2BU 3UT5B 4JASA 4JI7B 3EHBB 4O4LB 3P3PA 4TWKA 1XL4A 1NS1A 2L35A 4NYKA 1K4CC 2QKAA 2P4KA 4NB5A 1ZL8A 1GN6A 2OCCB 3CWBH 3PJSK 1GM8A 2HVJC 4KHPO 1BMFG 1PKXA 5BXZA 3CCUV 2PI5A 2XAHA 5J2UB 4ASUG 4E2LA 5LYJA 2JGDB 3AEIA 4MW3A 3AG1C 4B7EA 1F7YA 4AI8A 3F7VC 5CA3A 5J2TA 4CH5A 1YHQV 2ZCEA 4TSFG 4X62O 2ZR3A 5CBFA 2Q68A 1XDCA 2Q7EA 4EB6B 2IM9A 1SA0B 1Z5VA 3IJ4A 1WPBA 4DV2O 4AQYB 1ROPA 2BOCC 4JI8O 1JCHA 3A0BZ 4K0KB 4PA9A 3DSQA 1IBMB 1BL8A 1B6QA 1AB3A 2FKXA 3BA8A 4ZIBA 4GLXA 1M9NA 2RDCA 2M7WA 2KQXA 2X6AA 2PF4E 1TAEA 4UV9A 2O57A 2NR5A 1EZJA 5F2VO 2XAQA 1D2DA 3AG1B 2UU9B 1ZAUA 1BS3A 2GUZA 2CH7B 2BTQB 1M5IA 1KQSU 2QWOB 1P4RA 2WLNA 4FM2A 4U3JB 2XAJA 3L70H 5B1BB 4JPRA 2F95B 3OMNB 2WWWA 3K5NA 1MNGA 1AROP 4KXRA 3F5WC 2CTWA 1RPOA 3AK3A 1HNZB 2UUBB 3ML0A 4LFBB 4KP4A 3JAWA 1BSMA 2XHBA 1H2KA 5BZBA 1IXMA 2YIBA 1SQPH 1GK9A 5LMUO 1WB7A 3ABLB 3CEIA 3J80N 4WFAV 3ZN1A 2JVDA 3RW0A 1M90W 2F66C 4N23A 1P49A 5JWPA 3FFQA 5BMVB 4LFAB 5EYPA 1IZ3A 3A2FA 4U3FH 4YXWG 4I50A 4UVBA 2RMKB 1M93A 2QEXV 1H2GA 3CMAV 1B06A 3JAKB 2ZM6O 5LOVA
chains in the Genus database with same CATH topology
2JRIA 4X62O 4B3SO 4GKKO 4JI6O 2DOSA 4LFCO 4AQYO 5LL6Y 4DV6O 1XNRO 1N36O 4X66O 4DV2O 4LF5O 4OX9O 3R66A 5BR8O 2UXCO 1HR0O 3JAMN 4JI8O 5BY1A 1J5EO 4K0KO 1AB3A 4LF7O 2ZKOA 2FKXA 4DR5O 1HNXO 4JI0O 2UUAO 4DR3O 1N32O 1I94O 4YY3O 4JV5O 1R1BA 2UU9O 2DJVA 4X65O 1HNWO 4LFBO 4LF4O 1KUQA 4LF8O 3F5TA 3M8AA 3J81N 2UUCO 5LMNO 4DV0O 1D2DA 1R6TA 4DUYO 2Z0AA 1XEQA 4JI3O 1FYJA 1N34O 2LW7A 2HHHO 4DV5O 4NXNO 4X64O 4NXMO 3T1YO 1IBMO 4JI1O 4DR4O 1HNZO 1XNQO 1FKAO 2AGAA 1IBLO 4LFAO 2VQFO 5A2QN 1FJGO 2UUBO 4OPHA 4YHHO 2E5LO 1G1XB 4DV4O 4JYAO 4LF6O 1X59A 4DR2O 4JI4O 1AILA 2UXBO 4DR1O 4LF9O 1DK1A 1A32A 4DV1O 5LMUO 2N74A 4JI7O 4JI2O 1NS1A 4JI5O 3J80N 5H5NA 3RT3C 4DV3O 2UXDO 4B3RO 4DV7O 4B3TO 3SDLA 5IWAO 1XMQO 2F4VO 4DR7O 3OTOO 4GKJO 1YZBA 5FLXN 4KHPO 4OPAA 4B3MO 4DUZO 5BXZA 1XMOO 3J7AU 4DR6O 2VQEO 1IBKO 2ZM6O 3O65A 1F7YA 3T1HO 1N33O 4A5UB 5IT9N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI A;  4X62 O;  4B3S O;  4GKK O;  4JI6 O;  2DOS A;  4LFC O;  4AQY O;  5LL6 Y;  4DV6 O;  1XNR O;  1N36 O;  4X66 O;  4DV2 O;  4LF5 O;  4OX9 O;  3R66 A;  5BR8 O;  2UXC O;  1HR0 O;  3JAM N;  4JI8 O;  5BY1 A;  1J5E O;  4K0K O;  1AB3 A;  4LF7 O;  2ZKO A;  2FKX A;  4DR5 O;  1HNX O;  4JI0 O;  2UUA O;  4DR3 O;  1N32 O;  1I94 O;  4YY3 O;  4JV5 O;  1R1B A;  2UU9 O;  2DJV A;  4X65 O;  1HNW O;  4LFB O;  4LF4 O;  1KUQ A;  4LF8 O;  3F5T A;  3M8A A;  3J81 N;  2UUC O;  5LMN O;  4DV0 O;  1D2D A;  1R6T A;  4DUY O;  2Z0A A;  1XEQ A;  4JI3 O;  1FYJ A;  1N34 O;  2LW7 A;  2HHH O;  4DV5 O;  4NXN O;  4X64 O;  4NXM O;  3T1Y O;  1IBM O;  4JI1 O;  4DR4 O;  1HNZ O;  1XNQ O;  1FKA O;  2AGA A;  1IBL O;  4LFA O;  2VQF O;  5A2Q N;  1FJG O;  2UUB O;  4OPH A;  4YHH O;  2E5L O;  1G1X B;  4DV4 O;  4JYA O;  4LF6 O;  1X59 A;  4DR2 O;  4JI4 O;  1AIL A;  2UXB O;  4DR1 O;  4LF9 O;  1DK1 A;  1A32 A;  4DV1 O;  5LMU O;  2N74 A;  4JI7 O;  4JI2 O;  1NS1 A;  4JI5 O;  3J80 N;  5H5N A;  3RT3 C;  4DV3 O;  2UXD O;  4B3R O;  4DV7 O;  4B3T O;  3SDL A;  5IWA O;  1XMQ O;  2F4V O;  4DR7 O;  3OTO O;  4GKJ O;  1YZB A;  5FLX N;  4KHP O;  4OPA A;  4B3M O;  4DUZ O;  5BXZ A;  1XMO O;  3J7A U;  4DR6 O;  2VQE O;  1IBK O;  2ZM6 O;  3O65 A;  1F7Y A;  3T1H O;  1N33 O;  4A5U B;  5IT9 N; 
#chains in the Genus database with same CATH topology
 1EN4 A;  4FM0 A;  3BHP A;  4I9Q A;  4UCV A;  2EIL B;  2ETN A;  3E22 A;  3GVM A;  1K5Q A;  3IAY A;  1HR0 O;  2XAF A;  1DF5 A;  3L74 H;  3RYI A;  1XMO B;  3ZMS A;  3K57 A;  1HNX B;  1MZF A;  3Q4H B;  2HFE C;  2ZNJ A;  1I7F A;  3ZIA G;  5IJ0 A;  1N32 O;  2DWE C;  4JZG A;  5ITZ A;  2DJV A;  3QTC A;  4DR1 B;  1PL4 A;  2YSU B;  3F5T A;  4DV0 O;  2PZS A;  1I0H A;  2HHH O;  5KLV H;  2PI4 A;  2WLM A;  1NR7 A;  2EZP A;  5IE9 A;  3APO A;  1IUR A;  1BQ0 A;  4K35 A;  4R7C A;  1VQ6 V;  1SF9 A;  4X1K A;  4RWU A;  2DYR C;  1PP9 H;  3CC2 V;  3D8C A;  1EN6 A;  4OPH A;  1YEW A;  4DV4 O;  4L87 A;  4LF4 B;  3VOU A;  1N33 B;  4NTW A;  2EIN C;  1QLN A;  4J7Z A;  1H2N A;  1G4Y B;  1HP8 A;  4J10 A;  1Y74 B;  2DYS B;  5L3B A;  1H2S B;  2Y0I A;  4X1I B;  3S3W A;  3A0R A;  5EBM C;  3SPI A;  2ODM A;  2ZQM A;  4JYY A;  3RN4 A;  3T4Z A;  1VF6 C;  4OX9 B;  1N8R W;  2B9Z A;  3KZI Z;  2OTJ V;  4EFB A;  4TUY A;  3U10 A;  3CRM A;  3FB7 C;  1JX9 A;  2VQE O;  3ZCC A;  2OCC C;  1K34 A;  3W7T A;  1YDX A;  3SPG A;  1JJ2 U;  1FXH A;  1YTF D;  2LFR A;  4IYH A;  3B09 A;  2Q6A A;  2E5L B;  1P84 F;  2CGN A;  2QWN B;  3BCC H;  4X66 O;  3DGE A;  4LF5 O;  2AXT Z;  4JZ2 A;  2B5U A;  2AHY A;  3QG5 A;  4B3S B;  2F93 B;  3CPW U;  1W0J G;  4ZBM A;  3BRC A;  2ZM6 B;  2VWJ A;  2UUA O;  4K3A A;  3OMI B;  5KX5 B;  4X65 O;  1G8M A;  3I5D A;  2IJH A;  4FVM A;  1M57 B;  3U11 A;  1L1F A;  2EIN B;  4RUF A;  2H3O A;  3CHX A;  4CS2 A;  1AP5 A;  2EIM B;  4NXN B;  1IBL O;  5IYB O;  5A2Q N;  3PN1 A;  2BSK B;  3ETE A;  1V54 C;  4GUN A;  1VQN V;  3I56 V;  2W6J G;  1I5Y A;  2QJ1 A;  4DRX A;  4WCE V;  1NVP B;  5E79 Z;  3JAT B;  1AI6 A;  3JD1 A;  5EZY B;  5L3F A;  4FFB A;  5JQG B;  1RM1 B;  1Q7Y W;  2X0L A;  2IU0 A;  2LW1 A;  4J42 A;  4B08 A;  4JI3 B;  1XI1 A;  5LGN A;  5LA6 B;  2Q8V A;  4JYC A;  3RFR A;  4BIO A;  3OTO O;  5EK0 A;  1LNQ A;  2Z3Y A;  1P7B A;  3AG4 B;  4K8X A;  1NH2 B;  2WAM A;  3NR7 A;  2IJK A;  2Y4U A;  5JH7 B;  1VQL V;  1PM9 A;  3OGI B;  1VQP V;  4MTO A;  3ZHU A;  3R65 A;  3EFF K;  4MS2 A;  3HR0 A;  1KP3 A;  4LFC O;  1ZUQ A;  3ZMZ A;  1AR5 A;  3JD4 A;  1P7G A;  3A8T A;  4IIJ B;  4OX9 O;  1GM7 A;  3CD6 V;  1AI5 A;  2QM8 A;  3LUT B;  3KKY A;  1VAR A;  2IH1 C;  2VQF B;  4ICG A;  3OAA G;  2QWQ B;  5JVD B;  1KMI Z;  3MDS A;  4PA3 A;  1N4C A;  1FD9 A;  2YXL A;  3BY6 A;  1NTM H;  4JV5 B;  3UT5 A;  4LH6 A;  1M1K W;  3ABU A;  2UXD B;  1FFX B;  1ZSP A;  1V54 B;  1YVW A;  3TXQ A;  1WN7 A;  4TT3 G;  3W7W A;  3K9A A;  5JJN B;  2AGA A;  1K8A W;  3JAT A;  3T4D A;  4YHH O;  2R72 A;  2IW5 A;  2KB1 A;  1Q6H A;  3E89 A;  4LF6 O;  2XAG A;  3HKD B;  3ZRW A;  3CRR A;  4DR1 O;  1XHZ A;  1OCZ B;  4YJ3 A;  3B8N A;  4LF9 O;  1R3K C;  1R73 A;  2RCV A;  4P9P A;  4JI7 O;  3ETQ A;  1OCR B;  3HB3 B;  2FTK A;  2EIJ B;  4CS4 A;  2YC0 A;  4DUZ B;  3G67 A;  4J9Z B;  3K58 A;  2QM7 A;  4I0X A;  4J41 A;  3IC9 A;  5H2F Z;  3CP1 A;  3HKE B;  4LH7 A;  3TGU H;  4DUZ O;  4X8A A;  1VQM V;  3W7S A;  1K33 A;  4P9O A;  2GV9 A;  2E76 B;  5KHG A;  5J2U A;  5LYJ B;  2N05 A;  1VQ8 V;  4B3M B;  2DQ0 A;  1OCR C;  4IIJ A;  3WG7 C;  5LHH A;  3UM7 A;  2ZT9 B;  3UQ8 A;  5B1N A;  2R9A A;  2AZ2 A;  5LL6 Y;  3K5M A;  3UKM A;  1RPR A;  3CJH B;  2IJJ A;  1VQ5 V;  4DW0 A;  2CTP A;  4AIL C;  4K0K O;  2P4V A;  1G6U A;  5GON A;  1SQF A;  2B1G A;  4BIU A;  4DR2 B;  4LBE C;  1NR1 A;  5DED A;  3ZED A;  1FXV A;  1URF A;  1TUB A;  2IBZ H;  4NR1 A;  4OGQ B;  5FNV A;  5LP6 A;  1N0J A;  3TCU A;  2Y69 C;  5LMN B;  2Z0A A;  3LSU A;  4GX1 A;  4IT5 A;  4LFC B;  2BCC H;  2KG7 A;  2MK3 A;  3BAA A;  3K5O A;  4JI1 O;  1GMG A;  2G38 A;  5HFL A;  1FXK A;  2OYQ A;  1WP8 A;  4BR6 A;  2VQF O;  1Q6I A;  4FLU A;  4PDV A;  1YTF B;  4I50 B;  1FJG B;  2UUA B;  2ITC C;  4LWS B;  3CCL V;  1X59 A;  1XIL A;  4C7U A;  1ZLZ A;  3JAK A;  3IC7 A;  2QKS A;  4FLZ A;  4UB8 Z;  3X2Q B;  1A32 A;  2N74 A;  4BIZ A;  4D6T H;  5B3S C;  1RP3 B;  2GTS A;  1AJQ A;  3EVK A;  2YEV A;  4B3T O;  5KHH A;  1GO3 F;  2CE4 A;  4RAI A;  3BAB A;  4OPA A;  3FKS G;  1FXK C;  2EBO A;  3JSN A;  1VQO V;  1BCC H;  1IXB A;  4DR3 B;  4WFH A;  1KYO F;  3X2Q C;  2ZIO A;  5FNV B;  1R3J C;  4O4H A;  3GWO A;  5ITZ B;  2ZXW B;  4JI6 O;  2DOS A;  2AW9 A;  1AI4 A;  3JAS A;  1JPX A;  1MSD A;  4QIW F;  2BE3 A;  3ZRX A;  1SQB H;  5BR8 O;  1EZV H;  3DXR B;  1FXK B;  1QCE A;  2CK3 G;  1L0N H;  3CCQ V;  4W4K A;  5L3E A;  1IDS A;  2Y69 B;  2ITD C;  5IJ9 B;  4AHC A;  1NH2 D;  4IL6 Z;  2UU9 O;  4NVP A;  2KSD A;  3CRQ A;  3MD0 A;  3DC5 A;  2Q4P A;  4LFB O;  1M4U A;  3ZRS A;  5DM6 V;  3FYI B;  4FFK A;  1R6T A;  4DV0 B;  1S5H C;  2Q69 A;  2LW7 A;  1WP7 A;  3T1H B;  1U96 A;  4NXM O;  3E83 A;  3ABM B;  1LR1 A;  2D2C B;  2GSM B;  3H1H H;  2P7T C;  5H6Q A;  4X64 B;  4TOI A;  1Q90 D;  4X1K B;  2Q7H A;  1DF4 A;  3GB7 C;  2RQ6 A;  4DR2 O;  2CH7 A;  4UCT A;  3IGA C;  4CS3 A;  3CX5 F;  4BW5 A;  3SJB C;  1DLB A;  2YDE A;  1DK1 A;  3N2G B;  2EIL C;  3LDC A;  4EFE A;  2PYL A;  4B3R B;  4I55 B;  3CCR V;  3I55 V;  1W0K G;  2XT9 A;  4IYI A;  2OIE A;  1FS0 G;  2ARH A;  2QTO A;  4DR7 O;  3BPZ A;  3L72 H;  2GBO A;  3SGI A;  5J2T B;  4FLY A;  4PI2 A;  2CUG A;  3LSQ A;  3DTU B;  1ZWI C;  3T1Y B;  1IBK O;  3FAV B;  2HLD G;  1SQG A;  1O9H A;  3D3I A;  1HWY A;  4GCZ A;  4JI8 B;  1IBK B;  3RYF B;  5D5P A;  2K1E A;  4N21 A;  4DV2 B;  4AQY O;  1XRE A;  1UJW B;  2UXC O;  1GN2 A;  2VWK A;  3P3N A;  4JGS A;  3CCS V;  3M99 B;  5IJ9 A;  3G71 V;  3SYQ A;  2DMX A;  1XMQ B;  5BY1 A;  1AJP A;  3BA9 A;  2C2A A;  1HDJ A;  4U7O A;  3ZN0 A;  4P30 A;  3T2M A;  2F1M A;  3N27 A;  1R1B A;  2WLH A;  1Y6X A;  3MHS C;  3E86 A;  2JEX A;  4RQE A;  1VMG A;  4PI0 A;  3FYE B;  4JAA A;  2F23 A;  1LUV A;  5EZY A;  2CGO A;  4MSW C;  4ZHQ B;  3K0G A;  3Q4H A;  1S5L Z;  2DE0 X;  2HKO A;  3ZRV A;  1HNZ O;  1WB8 A;  3RYH A;  2A79 B;  4JTA B;  4JI4 B;  2GHY A;  1AP6 A;  2UUB O;  1XQ8 A;  1GH6 A;  4LC1 A;  2HG5 C;  2HP8 A;  1F4M A;  2OT5 A;  1D5N A;  4DRX B;  2Y0P A;  4DR6 B;  3ABL C;  4XBF A;  5K1X A;  2YIB D;  3L71 H;  3SJA C;  3IFX A;  4MVM A;  1K7D A;  2QSA A;  1NT2 B;  1QVG U;  4I4T A;  2CTQ A;  4O4I B;  3WFV A;  3ASN B;  2ATK C;  2F43 G;  1Y74 A;  3CS5 A;  2ZE6 A;  2LO1 A;  2RJZ A;  1IVS A;  1XHX A;  1TVK B;  3JAL A;  3AG3 B;  4EKW A;  4X65 B;  3RYI B;  2H94 A;  1N36 O;  4DR7 B;  4YIO A;  5KAF Z;  4FZ0 A;  1H8H G;  1E79 G;  1JFF A;  4LF9 B;  1YSC A;  3H1K H;  1R3I C;  2HR3 A;  2Q7G A;  4G27 B;  4JI2 B;  4HYO A;  4LF8 B;  1SC5 B;  4JI0 O;  3SYO A;  2Z5U A;  4ZHQ A;  2UXX A;  4UB6 Z;  4JI6 B;  4LF8 O;  4O2B A;  3J81 N;  5EIB D;  4X9Q A;  4YJ3 B;  5JJE B;  1S3J A;  5EC2 C;  3U0Z A;  4NXN O;  3ETD A;  2XOK G;  3LNN A;  3CRC A;  3QNE A;  1YJW V;  3OGC C;  3P30 A;  1WA8 B;  2H8P C;  2Q67 A;  3H1I H;  4JI4 O;  1Z5W A;  1TA8 A;  2YXY A;  1VF6 A;  3JCZ A;  3UCS C;  4MVQ A;  3W7X A;  2PGG A;  2LFS A;  2ZE5 A;  4PDR A;  5IYZ B;  1VF5 B;  5H5N A;  3OTO B;  3VQX A;  1SQX H;  1JFF B;  2BTQ A;  2XAS A;  1XNR B;  4LNU A;  5K1P A;  4D7T A;  1AI7 A;  3OD4 A;  1GKF A;  4D7S A;  2ZIM A;  3J7A U;  4DR6 O;  1OJH A;  3OMA B;  1VF7 A;  1MMM A;  4DV1 B;  3FB8 C;  1MOF A;  1K5S A;  1F4N A;  3VQV A;  5IT9 N;  2EIK C;  4HNA A;  1I94 B;  3JD3 A;  4UVC A;  2IU3 A;  1W59 A;  4B3S O;  2N04 A;  4UUJ C;  4WFG A;  1N34 B;  4LF5 B;  4JAU A;  4FLT A;  4TV9 B;  4CH3 A;  1AVM A;  3K06 A;  3FB6 C;  3T1C A;  1M56 B;  3NXS A;  2Y4T A;  3MAQ A;  1TUE B;  4DV5 B;  4KUM A;  4LF7 B;  4FFB B;  4G2K A;  4TV8 B;  4EEQ A;  4KHP B;  2ZKO A;  1R3L C;  3AG2 C;  1EM1 A;  1MAB G;  1E1R G;  1WJZ A;  2FML A;  3D36 A;  5CB4 A;  1Q3E A;  2A06 H;  4MT8 A;  3CC7 V;  3SJQ C;  2A9H A;  4JV5 O;  1RSO A;  1OCO C;  4UCS A;  5IYZ A;  4UXN A;  5EIB C;  5IYD O;  1VEW A;  2P06 A;  1V9P A;  3CRA A;  1Q6U A;  4YJ2 B;  3KG2 A;  1S0V A;  1K97 A;  3H1J H;  1FYJ A;  1H38 A;  5HFM A;  3HKC B;  2EIM C;  3SYA A;  3AK2 A;  1QLE C;  3K3W A;  3JAR B;  3LDD A;  4HBN A;  2YEV B;  1XUQ A;  3UO3 A;  2E74 B;  2AZ0 A;  5KMG B;  3QF7 A;  5L3D A;  1SET A;  5L3C A;  1K9M W;  3ETG A;  4PDM A;  4X1Y A;  4JYA O;  3SR2 C;  4LWS A;  4XDL A;  1OCC B;  2HJD A;  1FFX A;  1QVF U;  4UV8 A;  3E8F A;  2QA4 V;  1RFY A;  3CC4 V;  3ZHT A;  4G28 B;  5CBH A;  5C8Y B;  4YIP A;  3BVO A;  5GTI Z;  1XNQ B;  5B1A B;  3CB2 A;  3JAS B;  5KAI Z;  5LXT B;  2QR4 A;  1AJN A;  5CB4 B;  3OR6 C;  3RYC B;  2W0X A;  4H0L B;  5KHJ A;  2NN4 A;  1QBZ A;  2DYS C;  3CSX A;  2IJI A;  4MVO A;  3K79 A;  2ZE7 A;  2ZE8 A;  1N33 O;  4LCU C;  4O2A B;  5KUK A;  2EIK B;  3G6B A;  2JRI A;  3HKC A;  4ABM A;  3E8B A;  3RBZ A;  2HHH B;  5CA1 A;  3B4S A;  3ZHV A;  2QM4 A;  2YI8 A;  3HKD A;  4GKK B;  4UCU A;  2GTA A;  1Q81 W;  2X6C A;  4YY3 O;  5CN0 A;  4PV1 B;  1NTZ H;  4CBC A;  4O4J B;  2WA4 A;  3HKB A;  2X7R B;  1JR9 A;  2EX3 A;  3E2E A;  2BOB C;  4PHZ A;  3ZMT A;  4JI1 B;  4F6R A;  1BGY H;  1LUW A;  5B66 Z;  2ZNI A;  1XEQ A;  4Z1M G;  3F7Y C;  2MW2 B;  1UPG A;  2UXN A;  3ZBH A;  2QWR B;  3ZJZ A;  1AR4 A;  5BMV A;  3T1Y O;  4PA4 A;  5B1B C;  3TJT A;  3OR7 C;  3H9V A;  2V4D A;  1Y4M A;  2K9P A;  2WLJ A;  1BE3 H;  5IDJ A;  4Q6G A;  2UXC B;  1YXB A;  1EBO A;  3QO5 A;  4DYL A;  2HEP A;  4DXW A;  4XDJ A;  1NKD A;  2P90 A;  1SQV H;  2E75 B;  4I55 A;  5H6R A;  5LXT A;  2CAZ C;  4B3R O;  5EBW C;  4DO2 A;  1GN4 A;  3ZX6 A;  1NTK H;  2QWP B;  4B3M O;  2W0F C;  3H1L H;  2FYU H;  4FJC C;  1N32 B;  1R6N A;  3QVN A;  4GZR B;  4PA6 A;  4QE9 A;  3WG7 B;  4DR5 B;  1XL6 A;  2NLJ C;  2QGN A;  1Y67 A;  1GTO A;  2KKW A;  3M7M X;  4DV3 B;  3SYP A;  3TK1 A;  5JQG A;  2ZDI A;  1XNR O;  5GON B;  1OCZ C;  2AHZ A;  1YJ9 V;  3FD9 A;  3SPJ A;  4DK1 A;  4X62 B;  1THZ A;  1KBH A;  2HJF C;  2JJ2 G;  2YI9 A;  1TUB B;  2A7W A;  4FM1 A;  2EIJ C;  1SA0 A;  1YJN V;  3ABT A;  4WBN B;  2JEU A;  3BFR A;  4I9W A;  4FLX A;  1E1Q G;  3VQW A;  1SQQ H;  3WU2 Z;  1X4T A;  4JYB A;  1I94 O;  1GN3 A;  4DUY B;  3KCY A;  4RUE A;  5FL7 G;  4DW1 A;  5LGT A;  3H01 A;  2P67 A;  1OZ0 A;  5GTH Z;  1QHT A;  5LMN O;  4DUY O;  3K9S A;  1N34 O;  4QGP A;  4DV5 O;  1SZT A;  1Q86 W;  3E8G A;  4DR4 O;  5D5Q A;  5J9P C;  4W4L A;  4O4H B;  1WPX A;  5FPR A;  5TIS Z;  1Q8I A;  4TUY B;  2V7Q G;  3JD0 A;  4J7K A;  4CC6 A;  3S3X A;  5KA6 A;  4PJ0 Z;  4EB6 A;  5IYC O;  1FJG O;  3N2K A;  3OUS A;  4J9Y B;  3OEE G;  2M6Y A;  2UXB O;  1AIL A;  1BQZ A;  4U7N A;  2ZIN A;  1JVM A;  3KCX A;  3D3Q A;  1NJI W;  2XTA A;  2ZD9 A;  5LHG A;  1JMK C;  1U97 A;  1NZ6 A;  3RT3 C;  1OCC C;  4WF9 V;  4JTD B;  4WBN A;  1JQ0 A;  4I4T B;  4R8C A;  1DTO A;  3N2G A;  5KX5 A;  4FMT A;  3ZS8 C;  1KB9 F;  4LF6 B;  2CTR A;  2Y48 A;  1B04 A;  1TVK A;  3JAL B;  3FB5 C;  4O2B B;  2UUC B;  2V1D A;  1YI2 V;  1F51 A;  1NQT A;  2Q0A A;  3JAW B;  4FIP C;  4HZ3 A;  2DW4 A;  2WSS G;  2GUZ B;  1QR9 A;  1HNX O;  4CC5 A;  4I5S A;  1K73 W;  3ZHR A;  3OTF A;  1SS3 A;  1HNW O;  4MW8 A;  3M8A A;  3TET A;  2HVK C;  4BW9 A;  4JI3 O;  1Y66 A;  1Y76 A;  1HNW B;  4X64 O;  4I7Z B;  2ZXW C;  3FAV A;  3K0D A;  3N2K B;  3ASN C;  1PL0 A;  5IWA B;  4QJF B;  3E22 B;  1QR8 A;  2QE7 G;  3CCV V;  2JS3 A;  4YY3 B;  5EYP B;  4PD4 F;  3STL C;  1QU7 A;  5A9G A;  1FPO A;  3ZMV A;  2YIA A;  4WFF A;  3A0H Z;  2X6B A;  1ZX3 A;  2WLL B;  2L6L A;  4ZI7 A;  2R9I A;  2PY5 A;  4P2Z A;  1QQC A;  2ADQ B;  2UXD O;  3L75 H;  4DK0 A;  5B3S B;  4GX0 A;  3G80 A;  1NBM G;  2QTS A;  4Q20 A;  4LNU B;  3OEH G;  4UCO A;  1PNM A;  1QNM A;  4X1I A;  5JVD A;  2OIG A;  2JGD A;  4MTX A;  4J7J A;  1O9G A;  4Z1V A;  2EJ7 A;  3K08 A;  2VQE B;  3P32 A;  4A5U B;  5CA0 A;  5LMU B;  1N36 B;  1WAZ A;  4RO2 A;  4MTF A;  3G6E V;  5IJ0 B;  1CP9 A;  1NI8 A;  1ZL8 B;  5EBL C;  4XDK A;  1YIJ V;  1UFI A;  1SER A;  1CEZ A;  3RVZ A;  2EUL A;  3JCU Z;  4X88 A;  3K5L A;  1S76 D;  3HPL C;  4B7K A;  4LF7 O;  1ZTE A;  4DR5 O;  4J11 A;  2OTL V;  1KP2 A;  2RN9 A;  3QO7 A;  3SPC A;  1EFR G;  3LNM B;  1RSO B;  4ZKI A;  1FAF A;  1PNK A;  1H8E G;  1KUQ A;  2LGW A;  4IHJ B;  1QLE B;  3AK1 A;  5JJJ B;  2UUC O;  4OXS A;  1Q5O A;  1V55 B;  4R6Z A;  1H2M A;  3B40 A;  3C3T A;  3ZMU A;  4FK5 C;  1MZE A;  1COW G;  1IBM O;  1K92 A;  5AG2 A;  4DV7 B;  1XNQ O;  1PPJ H;  3G4S V;  1IX9 A;  1R6K A;  2WLI B;  5DEC A;  3MHH C;  2F4V B;  1G1X B;  1VIB A;  2WLL A;  2YUA A;  4FZ1 A;  3SPH A;  3CE2 A;  2R9R B;  4QPK A;  3DC6 A;  4CH6 A;  3VBB A;  1V55 C;  4JAV A;  4LR3 A;  4DV1 O;  1S72 V;  1WLE A;  5C8Y A;  3K04 A;  4GKJ B;  4PA7 A;  2GDS A;  1M56 C;  5BR8 B;  3AG7 A;  2RNB A;  4PEL A;  4NXM B;  5IWA O;  3RWR D;  2PTM A;  5LGU A;  5EC1 C;  5CA0 B;  3OE7 G;  1CPY A;  3RVY A;  2VRZ A;  1EN5 A;  1KC8 W;  1HW7 A;  1KU9 A;  3L9D A;  1VQ4 V;  1H2L A;  4J80 A;  1MG1 A;  5H9C A;  1FFT B;  2FB5 A;  1VQ9 V;  1PNL A;  3CXC U;  3CCM V;  3LSS A;  3WB2 A;  4RQF A;  2B1I A;  4KFM A;  3JSL A;  2KG7 B;  1ENV A;  4FLW A;  1WA8 A;  4F6R B;  3APQ A;  1XOU A;  2W6I G;  5GW7 A;  2WLI A;  4B3T B;  3OT7 A;  1XBL A;  3E35 A;  1SRY A;  5E1A C;  1J5E O;  2P6J A;  2JIZ G;  3K03 A;  1K4D C;  2PUS A;  1YF2 A;  2DQ3 A;  1MA1 A;  3CXH F;  4IHJ A;  5LOV B;  4DR3 O;  4CZZ A;  5LA6 A;  1DGS A;  3O9O A;  3CME V;  4E4E A;  3UO2 A;  1J5E B;  5JCO C;  4MVR A;  1JOY A;  5B5E Z;  3HKB B;  4MVU A;  2OCH A;  1BT8 A;  2BSK A;  3VQY A;  4X89 A;  1RM1 C;  3WB1 A;  4TV8 A;  3C90 A;  5KHK A;  3RYF A;  2Q5Z A;  2WA3 A;  2PYJ A;  5LHI A;  2XUM A;  3CCE V;  3STZ C;  3BEH A;  1TGO A;  1GRJ A;  4NKG B;  1Z2G A;  4KL1 A;  3AG2 B;  3EXA A;  1KEC A;  1YIT V;  2FL4 A;  2DWD C;  5JCO A;  1OCO B;  1D5A A;  1GM9 A;  3SJC C;  3E8H A;  2E3C A;  4YHH B;  4GX5 A;  3ABK B;  1L0L H;  2P5O A;  4IGG A;  3ICX A;  4JI2 O;  5FPO A;  1MSW D;  4DV3 O;  5LBQ A;  5KMG A;  4H44 B;  4DV7 O;  2LP7 A;  4PDL A;  3SDL A;  2YXH A;  3B2E E;  3OFN G;  4X1Y B;  1XMQ O;  1IBL B;  4MTG A;  5B1O A;  4CH4 A;  4GKJ O;  1SKV A;  4DV4 B;  4HNA B;  1NVP D;  4L8J A;  3RYH B;  5C93 A;  5KUM A;  4YJ2 A;  1J95 A;  4HAM A;  4UVA A;  5B1A C;  3O65 A;  1Q82 W;  4TV9 A;  2LGQ A;  5LP6 C;  4MVS A;  4GKK O;  2CDY A;  4QPJ A;  4QNH B;  4F6E A;  2JS5 A;  2A3Q A;  4H33 A;  2VS0 A;  3JAM N;  4X20 B;  1JA8 A;  4O4I A;  5CMU A;  2R70 A;  3QO8 A;  1KKD A;  3AG3 C;  1PV0 A;  2P22 C;  2DN9 A;  1NU1 H;  2IH3 C;  4I0X B;  3W7U A;  2A0L A;  4ZOL A;  2LJ2 A;  3HKE A;  3JAR A;  4BWA A;  3RYC A;  1PD3 A;  1SES A;  4H13 B;  2EZO A;  3GWK C;  1ORQ C;  5KA5 A;  2QKC A;  2YID A;  4TQD A;  4FLV A;  4MVZ A;  2JDI G;  4O2A A;  1FKA O;  1VP7 A;  3L73 H;  3ABK C;  3CCJ V;  2LQT A;  1M57 C;  4JYA B;  2E5L O;  1BHA A;  4X66 B;  5CA1 B;  3K59 A;  1T5E A;  3D36 C;  1KKC A;  4JI0 B;  2WLK A;  4QE7 A;  4JTC B;  4JI5 B;  1VQK V;  1SZX A;  4WFE A;  1YCI A;  1GAX A;  3SYC A;  3TXS A;  4JI5 O;  4TQF A;  1BZK A;  1I08 A;  4X20 A;  2DYR B;  1F23 A;  4O4L A;  2NNU A;  1N0N A;  2BTO A;  2ILM A;  2YIC A;  3ASO C;  4O4J A;  2F4V O;  2QDO A;  1KD1 W;  1YZB A;  5FLX N;  3OW2 U;  2ZDI C;  2WPD G;  5LP6 B;  1HR0 B;  2OWO A;  4K8Z A;  3WB0 A;  3AG4 C;  1I5X A;  3OM3 B;  1XMO O;  1S5J A;  3ZHS A;  2ZR2 A;  2JJ1 G;  2YS8 A;  4FPP A;  3CJH A;  1CXZ B;  3T1H O;  4R50 A;  2XND G;  2ADP A;  3JD2 A;  4NTY A;  4LP8 A;  3ASO B;  5IY5 C;  4DV6 O;  3LDE A;  1WNS A;  4WFB V;  3R66 A;  1VQ7 V;  4UCR A;  3FX7 A;  5CBG A;  3ZHQ A;  4GT1 A;  4DV6 B;  4DR4 B;  2Q73 A;  1OHH G;  4ZOL B;  4UFZ A;  4JF3 A;  5JH7 A;  4H37 A;  3B8M A;  1L8D A;  4GYC B;  4LF4 O;  4BAY A;  1S77 D;  4F4L A;  1B3Q A;  2Q9L A;  3JYC A;  1Q43 A;  4Z2W A;  3THO A;  4ZI7 B;  2JGU A;  1US6 A;  3OUF A;  1Y76 B;  5KHI A;  2D3O W;  5L3G A;  3CYO A;  5IY5 B;  3RGB A;  2EJR A;  2UXB B;  3ABM C;  2Q0O C;  4NTX A;  4LFA O;  4U3J A;  3C3S A;  1JJO A;  3B77 A;  1OV9 A;  1K3E A;  3ZRW B;  5DN6 G;  4GX2 A;  3DXR A;  1AR1 B;  1BHB A;  2JK5 C;  1W2B U;  3UT5 B;  4JAS A;  4JI7 B;  3EHB B;  4O4L B;  3P3P A;  4TWK A;  1XL4 A;  1NS1 A;  2L35 A;  4NYK A;  1K4C C;  2QKA A;  2P4K A;  4NB5 A;  1ZL8 A;  1GN6 A;  2OCC B;  3CWB H;  3PJS K;  1GM8 A;  2HVJ C;  4KHP O;  1BMF G;  1PKX A;  5BXZ A;  3CCU V;  2PI5 A;  2XAH A;  5J2U B;  4ASU G;  4E2L A;  5LYJ A;  2JGD B;  3AEI A;  4MW3 A;  3AG1 C;  4B7E A;  1F7Y A;  4AI8 A;  3F7V C;  5CA3 A;  5J2T A;  4CH5 A;  1YHQ V;  2ZCE A;  4TSF G;  4X62 O;  2ZR3 A;  5CBF A;  2Q68 A;  1XDC A;  2Q7E A;  4EB6 B;  2IM9 A;  1SA0 B;  1Z5V A;  3IJ4 A;  1WPB A;  4DV2 O;  4AQY B;  1ROP A;  2BOC C;  4JI8 O;  1JCH A;  3A0B Z;  4K0K B;  4PA9 A;  3DSQ A;  1IBM B;  1BL8 A;  1B6Q A;  1AB3 A;  2FKX A;  3BA8 A;  4ZIB A;  4GLX A;  1M9N A;  2RDC A;  2M7W A;  2KQX A;  2X6A A;  2PF4 E;  1TAE A;  4UV9 A;  2O57 A;  2NR5 A;  1EZJ A;  5F2V O;  2XAQ A;  1D2D A;  3AG1 B;  2UU9 B;  1ZAU A;  1BS3 A;  2GUZ A;  2CH7 B;  2BTQ B;  1M5I A;  1KQS U;  2QWO B;  1P4R A;  2WLN A;  4FM2 A;  4U3J B;  2XAJ A;  3L70 H;  5B1B B;  4JPR A;  2F95 B;  3OMN B;  2WWW A;  3K5N A;  1MNG A;  1ARO P;  4KXR A;  3F5W C;  2CTW A;  1RPO A;  3AK3 A;  1HNZ B;  2UUB B;  3ML0 A;  4LFB B;  4KP4 A;  3JAW A;  1BSM A;  2XHB A;  1H2K A;  5BZB A;  1IXM A;  2YIB A;  1SQP H;  1GK9 A;  5LMU O;  1WB7 A;  3ABL B;  3CEI A;  3J80 N;  4WFA V;  3ZN1 A;  2JVD A;  3RW0 A;  1M90 W;  2F66 C;  4N23 A;  1P49 A;  5JWP A;  3FFQ A;  5BMV B;  4LFA B;  5EYP A;  1IZ3 A;  3A2F A;  4U3F H;  4YXW G;  4I50 A;  4UVB A;  2RMK B;  1M93 A;  2QEX V;  1H2G A;  3CMA V;  1B06 A;  3JAK B;  2ZM6 O;  5LOV A; 
#chains in the Genus database with same CATH homology
 2JRI A;  4X62 O;  4B3S O;  4GKK O;  4JI6 O;  2DOS A;  4LFC O;  4AQY O;  5LL6 Y;  4DV6 O;  1XNR O;  1N36 O;  4X66 O;  4DV2 O;  4LF5 O;  4OX9 O;  3R66 A;  5BR8 O;  2UXC O;  1HR0 O;  3JAM N;  4JI8 O;  5BY1 A;  1J5E O;  4K0K O;  1AB3 A;  4LF7 O;  2ZKO A;  2FKX A;  4DR5 O;  1HNX O;  4JI0 O;  2UUA O;  4DR3 O;  1N32 O;  1I94 O;  4YY3 O;  4JV5 O;  1R1B A;  2UU9 O;  2DJV A;  4X65 O;  1HNW O;  4LFB O;  4LF4 O;  1KUQ A;  4LF8 O;  3F5T A;  3M8A A;  3J81 N;  2UUC O;  5LMN O;  4DV0 O;  1D2D A;  1R6T A;  4DUY O;  2Z0A A;  1XEQ A;  4JI3 O;  1FYJ A;  1N34 O;  2LW7 A;  2HHH O;  4DV5 O;  4NXN O;  4X64 O;  4NXM O;  3T1Y O;  1IBM O;  4JI1 O;  4DR4 O;  1HNZ O;  1XNQ O;  1FKA O;  2AGA A;  1IBL O;  4LFA O;  2VQF O;  5A2Q N;  1FJG O;  2UUB O;  4OPH A;  4YHH O;  2E5L O;  1G1X B;  4DV4 O;  4JYA O;  4LF6 O;  1X59 A;  4DR2 O;  4JI4 O;  1AIL A;  2UXB O;  4DR1 O;  4LF9 O;  1DK1 A;  1A32 A;  4DV1 O;  5LMU O;  2N74 A;  4JI7 O;  4JI2 O;  1NS1 A;  4JI5 O;  3J80 N;  5H5N A;  3RT3 C;  4DV3 O;  2UXD O;  4B3R O;  4DV7 O;  4B3T O;  3SDL A;  5IWA O;  1XMQ O;  2F4V O;  4DR7 O;  3OTO O;  4GKJ O;  1YZB A;  5FLX N;  4KHP O;  4OPA A;  4B3M O;  4DUZ O;  5BXZ A;  1XMO O;  3J7A U;  4DR6 O;  2VQE O;  1IBK O;  2ZM6 O;  3O65 A;  1F7Y A;  3T1H O;  1N33 O;  4A5U B;  5IT9 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...