3ZX6A

Structure of hamp(af1503)-tsr fusion - hamp (a291v) mutant
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
303
structure length
303
Chain Sequence
TITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAMP, METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
publication title Axial Helix Rotation as a Mechanism for Signal Regulation Inferred from the Crystallographic Analysis of the E. Coli Serine Chemoreceptor.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling
total genus 149
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00015 MCPsignal Methyl-accepting chemotaxis protein (MCP) signalling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.950 Mainly Alpha Orthogonal Bundle Helix Hairpins Methyl-accepting chemotaxis protein 3zx6A00
3ZX6A 3G6BA 2CH7A 1QU7A 2CH7B 3G67A
chains in the Genus database with same CATH superfamily
3ZHRA 3K0GA 1M1KW 2YC0A 2JGDB 5L3CA 4LF5B 4FFKA 3B77A 1BS3A 5EBMC 1VIBA 1VQKV 2Q7HA 4LF5O 4J7KA 5ITZA 3G71V 3CRRA 4IYHA 3OGIB 4G28B 1I94B 2W0XA 3ZHTA 3SDLA 1NR7A 4TV9A 4DRXB 1G8MA 3Q4HA 2JGUA 1M57B 4J80A 2WLLB 5KX5A 1I94O 1AI4A 3C3SA 3H01A 4UVCA 4JTCB 4MTOA 5F2VO 1WLEA 1AROP 1SRYA 1YEWA 2VWKA 1Z2GA 5GTIZ 4LNUA 1FXVA 1SQXH 5K1PA 3J7AU 1V55C 2L35A 2PUSA 2JIZG 4I9QA 5C8YB 3ASNC 4NKGB 1SQVH 3FD9A 3A0RA 1Y76B 2KB1A 2PI4A 1JPXA 4LBEC 3E8BA 4I55A 2Q5ZA 4FLUA 1YXBA 1XL6A 3OGCC 1L1FA 2UXNA 4B3TB 2ADQB 4R8CA 4X9QA 1ZL8A 1CP9A 1F4MA 3NR7A 4RWUA 4X1YB 1YJ9V 3JAKB 1YCIA 4W4KA 4B3TO 2DYRB 4ZOLA 2OCCC 2B5UA 1N0JA 1NKDA 4K8XA 2JEUA 1KECA 4MVRA 4NB5A 1NH2D 2QDOA 4FFBA 1K34A 1GO3F 4IIJA 2N05A 3O9OA 3CCLV 2A3QA 1FPOA 2YIBD 3CCMV 5H5NA 2ZR3A 2DW4A 3OEEG 3ZRVA 4B7KA 3G4SV 1XNQB 5JJNB 1YHQV 1JJOA 4UFZA 1XNQO 3J81N 3CYOA 4X89A 5LP6A 4U3JB 1UFIA 1TUEB 2EZPA 4O2BA 3ZN0A 2DYSC 4DR2B 5H6RA 2PYLA 2R9IA 2E74B 3FB5C 2CUGA 4DR2O 5B5EZ 2ARHA 2ZE8A 3VQWA 4MTFA 3UT5A 4J41A 4NR1A 1K97A 2A79B 1FS0G 4JGSA 3K59A 1FKAO 3ZIAG 2P22C 2XOKG 4RO2A 5JVDB 5IDJA 2HR3A 1W0KG 1VQ4V 3OUFA 5FNVA 4TV8A 3H1HH 3EVKA 3X2QB 3MAQA 4GKKB 1K8AW 4GX0A 4F6RA 2Q67A 4Z2WA 2K9PA 3N27A 3T1HB 4GKKO 4MVUA 1RPOA 1K73W 2QWQB 1H2NA 1HWYA 2PI5A 4B3RB 1EFRG 3T1HO 2LO1A 3MDSA 4QPJA 5HFLA 1YI2V 4Z1VA 2ZR2A 2H94A 4QE9A 4BWAA 5LHGA 2UU9B 4B3RO 1FD9A 1SC5B 4MVSA 2R9RB 5KHIA 5EYPB 3HPLC 2UU9O 3P32A 4O4HA 3ZX6A 4DV6B 5CMUA 3IC7A 2WLMA 4JYBA 4PA3A 4UXNA 2M7WA 4DV6O 4JTAB 4O4LB 2Q7EA 4FK5C 4X1KA 2QA4V 2LQTA 2GTSA 3LSQA 2XT9A 2Q9LA 1H2MA 4JI4B 1BE3H 1MZEA 1S3JA 3ABUA 1O9HA 2E75B 4I4TB 4JI4O 2P90A 4BR6A 3W7TA 4RAIA 1JJ2U 4L8JA 3CX5F 4PHZA 1HNWB 4LH7A 3FAVA 2DN9A 3K5OA 5CA0A 3N2GB 1SQQH 2F93B 4O2AB 2EIJB 1OCZB 3CJHA 1HNWO 4KL1A 4JI1B 4JZGA 3AG3B 1YTFD 3E8FA 5BMVB 1E79G 4JI1O 5CB4A 4LR3A 1Y74B 1YF2A 1FAFA 5DEDA 3ZMVA 2LW7A 5KHGA 3ZMUA 2E3CA 4GKJB 3CCRV 1I5XA 4X20A 2QWOB 3JSNA 4QE7A 1OCCC 3TXSA 4KFMA 4GKJO 3E83A 3THOA 1AI6A 4WCEV 2PYJA 2DWEC 4J7ZA 3QVNA 2GUZB 3D36C 2OIEA 1YZBA 1IXBA 3MHHC 1XILA 4UVAA 3P30A 5D5PA 5KAIZ 4JASA 4JI0B 5JH7A 4GLXA 1AILA 3B40A 1QR8A 4X65B 4DV4B 1S5JA 3QTCA 4JI0O 2FMLA 2R72A 1S77D 2XAJA 3MHSC 4X65O 4DV4O 2OYQA 2X0LA 5LYJB 5A9GA 1EZVH 4KUMA 4DV3B 1Y6XA 1OCOC 3L70H 3FX7A 3HKCA 4DV3O 4DK1A 4E4EA 4OXSA 5LMUB 2YEVA 3DC6A 3K9AA 2R70A 5LMUO 4E2LA 2HP8A 4DR5B 1NT2B 1J95A 1FFXA 2YIBA 2AZ2A 3MD0A 3I55V 1S5LZ 3RYHA 1R6KA 4WFFA 2QR4A 1AJQA 3ZHSA 1I7FA 2QE7G 3APOA 4DR5O 4J9ZB 3ZBHA 4CH4A 4UCTA 4Z1MG 3ZRWA 4HYOA 3JALB 1NVPB 1R1BA 3RYFB 2JJ2G 2KKWA 1BT8A 1HR0B 1YDXA 1Z5VA 1JVMA 3N2KB 3DXRB 2HJFC 1DF4A 1HR0O 1IBMB 1JFFA 4WFBV 4CS2A 2GBOA 2V1DA 1K5QA 4OPAA 1IBMO 4D6TH 2OIGA 3BVOA 1P7GA 4YJ3B 1VQ7V 2QM7A 3OMAB 1NTZH 3WB1A 2Y48A 4MSWC 3G80A 3DSQA 4PDLA 4D7SA 4CS3A 2NN4A 3U0ZA 1FJGB 5TISZ 3FB8C 2IJHA 4PI0A 1HW7A 2EILC 2C2AA 1FJGO 5IYZB 1EN6A 1P4RA 3BCCH 4MTXA 1ENVA 4FIPC 5BY1A 1WPXA 3H1JH 2QGNA 1T5EA 4UUJC 5DECA 2QSAA 4WFEA 1Q6HA 2VS0A 1NJIW 1N32B 2F43G 3O65A 3JASA 5J2UA 1F7YA 4K8ZA 3P3NA 4MTGA 1OCRC 5LP6C 1N32O 2YI9A 1RM1B 1PNMA 3BY6A 1QVGU 1KUQA 2ATKC 4CH3A 4LFCB 4WFGA 1NR1A 2ITCC 5JQGA 1XDCA 1D5NA 3VQVA 3TETA 4LFCO 3VQYA 1GN2A 3GVMA 4PA7A 1YIJV 1PNLA 5B3SB 2ZDIA 5H6QA 1AP5A 4DUYB 1QVFU 3E2EA 2KG7A 1S0VA 1VP7A 5LOVB 2F1MA 3K5NA 2Z5UA 4DUYO 5CA1A 4FVMA 4ZI7B 1M4UA 1EM1A 1M93A 1XQ8A 1VQLV 4GT1A 1R3LC 1G1XB 1GM7A 4X8AA 5ITZB 4GUNA 1VQ5V 4A5UB 3LDDA 2ADPA 5J9PC 1XMOB 3LNNA 3CC7V 4DYLA 4H44B 5E1AC 4RQEA 1JR9A 3D3QA 2W6IG 3CMEV 2CK3G 4IT5A 1XMOO 5KX5B 4DV1B 2AZ0A 2HVKC 1OJHA 3CWBH 3OTFA 2VRZA 1QCEA 4DV1O 4HAMA 1BCCH 4PI2A 2IM9A 3KKYA 3LNMB 3RGBA 4JZ2A 4NTWA 4B3SB 2DQ0A 4LFAB 2GSMB 4J11A 5GTHZ 1QLNA 4B3SO 2JEXA 3CSXA 4LFAO 4FLYA 1URFA 1WPBA 2Q0AA 2R9AA 2N74A 2DJVA 4NXNB 3CC4V 1KBHA 3CC2V 4JTDB 1R3KC 2CH7A 5KMGB 2DMXA 2BTQB 1FFTB 2YXHA 1TVKB 4NXNO 4I55B 3RW0A 2RMKB 4XDLA 2XAGA 3JARB 1ZAUA 4D7TA 3AG1C 2LP7A 5IJ0A 2ZNJA 1W2BU 2ZINA 2EULA 1D2DA 3J80N 3ETQA 3ABKC 4YJ2A 5KHJA 4H0LB 2V4DA 2Q6AA 2BOBC 4X64B 5CBHA 2YS8A 2RN9A 4B08A 4BIZA 4X64O 2NLJC 4FFBB 1AVMA 5GW7A 2P06A 4IIJB 1AR4A 4JAUA 1DF5A 3D3IA 1SKVA 5L3DA 1B6QA 1N33B 1N8RW 1V54B 1WP7A 1SETA 3W7SA 1BMFG 5B1BB 3CRMA 4JYCA 1N33O 2D2CB 4MW3A 4JV5B 1FYJA 3M8AA 1NU1H 4EB6B 2FB5A 1GM9A 3JATB 3FYEB 3RBZA 2YIAA 4TWKA 1OCRB 3SPIA 4JV5O 3RVZA 2CTRA 4MVMA 4O2BB 2WLIB 4U3FH 4JI6B 1ZWIC 2EINB 1Q82W 1M56B 2RNBA 3ABMB 4IL6Z 1B3QA 3L73H 4PDVA 4JI6O 2QKCA 3SPGA 4NVPA 2ZD9A 4ZKIA 1QLEC 2F4VB 3UM7A 2YXLA 3UKMA 3CCVV 5IY5C 2QTSA 2DOSA 2F4VO 2IBZH 3DTUB 4UCRA 3B4SA 1ZSPA 4MVZA 4P9OA 5B1NA 1KMIZ 3H9VA 3ZMZA 1AJNA 4WFAV 2WLNA 2XTAA 3E86A 1FXKB 2JGDA 2QKAA 5KA6A 5HFMA 1BGYH 4U7NA 1ZX3A 4BW9A 4Q6GA 4U7OA 3QO5A 5LA6A 2YXYA 2UUBB 1F23A 1WP8A 3ML0A 3JCUZ 5EIBC 4O4JB 1KQSU 3RYIB 2BSKB 1SA0B 2UUBO 1H2LA 4FM2A 3C3TA 1Q6UA 3TGUH 2WA3A 3E8GA 3E22B 4FLWA 4O4IA 2AW9A 4FLTA 1SZTA 3K57A 2IU3A 3ABLC 2PTMA 1PPJH 2EZOA 2RQ6A 4J9YB 5EIBD 4LCUC 2NR5A 4GX1A 5AG2A 3JD4A 3APQA 5A2QN 3ZHQA 2DE0X 1MNGA 3CXCU 5IE9A 4X1KB 2GV9A 1PKXA 3JD0A 2OT5A 1H38A 4LF7B 1AJPA 2QTOA 1Q90D 3AG2B 2Y0IA 4KXRA 4LF7O 1P49A 1MMMA 1WA8A 4DW0A 2WWWA 1KP3A 1NZ6A 5IJ9A 4UB8Z 4QJFB 2UUAB 1SQGA 1TGOA 5CA0B 5B1AC 3ASOC 1XEQA 4MS2A 2UUAO 4X1YA 3CJHB 2D3OW 1WAZA 2IW5A 2QJ1A 2EIKC 1B06A 4DW1A 1TUBB 4ZIBA 2NNUA 1QNMA 2QM4A 4C7UA 1PP9H 4OX9B 4TQDA 3W7UA 4X20B 4OX9O 3RT3C 2QKSA 2ZDIC 1ORQC 2AGAA 3JD2A 4QNHB 3HKBA 5KLVH 3E8HA 2Q7GA 4DXWA 4U3JA 1UJWB 1V55B 2XNDG 3LSUA 1SZXA 1DK1A 3ETEA 3CCSV 2QWRB 5BR8B 1R73A 3ASNB 1QQCA 1JOYA 4KP4A 3RYCA 1K3EA 1JQ0A 5KUKA 5BR8O 1B04A 2Q8VA 1ZUQA 4TUYB 3OAAG 4LF4B 1VQOV 3BA8A 1MZFA 2YEVB 1K92A 1L8DA 1NH2B 5FLXN 5IT9N 5JVDA 2CTQA 5GONA 4LF4O 1FFXB 3CP1A 1NQTA 2Y69C 3AG4C 2EIMC 4LWSA 4YXWG 1XNRB 2OCCB 2A0LA 1NI8A 4X88A 4GZRB 3RFRA 3OUSA 5LL6Y 2YDEA 1XNRO 1IURA 2JJ1G 1Q8IA 4JPRA 4R50A 2BOCC 2ZXWC 4HNAA 3B2EE 1YJNV 1G4YB 1RSOA 4FLZA 2VQEB 3CCUV 1SQBH 1MOFA 1SQFA 5EYPA 3ABTA 1GN3A 2VQEO 1AI7A 3T1YB 1LUVA 4B3MB 3T2MA 1NBMG 3PJSK 4QPKA 4BIOA 4K0KB 2UUCB 3T1YO 2CGOA 3CCQV 3QNEA 2K1EA 1IZ3A 4B3MO 4O4LA 2DYSB 3K79A 4K0KO 2UUCO 3OR7C 5L3EA 3ZRSA 3CHXA 2WSSG 4LC1A 5KHKA 3F5WC 3CS5A 2UXXA 5LXTB 4JI3B 1K9MW 1JX9A 1R3IC 4I0XA 1H2SB 1PD3A 1WB7A 4X62B 3W7XA 2F95B 4JI3O 4ASUG 3JD1A 1DTOA 3S3WA 4X62O 3N2GA 3R65A 4O2AA 2ODMA 1O9GA 4TT3G 2LGQA 5E79Z 1VF7A 2GHYA 2GDSA 2MK3A 5J2UB 5BMVA 4UV9A 3OMIB 4EKWA 4JF3A 3IFXA 1BSMA 1QBZA 3BABA 2FL4A 4UCUA 3CPWU 3ICXA 1GAXA 5IWAB 3ZHUA 5EZYA 2ZT9B 2YIDA 5KHHA 4L87A 1VQ8V 3JAWA 5IWAO 2FYUH 1COWG 1PNKA 1LR1A 2E76B 4F6EA 2Y4UA 2P6JA 3SJAC 3M7MX 3AG7A 3S3XA 1AB3A 2GUZA 3SPHA 2ZNIA 1DGSA 3A0BZ 2IU0A 1IXMA 4QIWF 1Q86W 3D8CA 2WLKA 2KG7B 2LW1A 3SGIA 2WPDG 5IYBO 4WBNB 5CA1B 1VF5B 4CC6A 1S72V 4MVQA 5LYJA 1AP6A 1LNQA 5D5QA 3OMNB 2RJZA 3BRCA 4ZHQA 4ICGA 1RP3B 4FPPA 4CBCA 4I50A 1M57C 5L3FA 1G6UA 4OPHA 5EBWC 4FZ1A 3L72H 1N36B 2KQXA 1MSDA 2HVJC 3JYCA 3H1LH 4FLXA 2IH3C 1Q6IA 5C93A 1N36O 1QR9A 1GTOA 1VQNV 3EHBB 2X6BA 2JS3A 4TQFA 2FTKA 1FXHA 4QGPA 1BQZA 1KD1W 5BZBA 3RYFA 4LF9B 3T1CA 2RDCA 1OCCB 1IX9A 4AQYB 3T4ZA 4LF9O 3KG2A 3N2KA 3CRCA 4YIPA 3DXRA 4AQYO 4JI5B 1H2GA 3HKDB 3BA9A 1H8EG 3A8TA 3CXHF 1OV9A 1MSWD 4JI5O 4YY3B 3K5MA 3ZRXA 1QU7A 2EX3A 1L0LH 5J2TA 3A0HZ 1E1RG 4UV8A 5FPOA 4YY3O 3EFFK 2X7RB 2DYRC 2HJDA 2YSUB 2VWJA 3ZMSA 4R6ZA 4EEQA 2HFEC 1R6NA 3B8MA 4KHPB 1OCOB 3TXQA 4MW8A 3F5TA 4PDMA 3SYOA 1A32A 4TV9B 4KHPO 3Q4HB 3TK1A 1WNSA 4GX2A 1W59A 2OTJV 3TCUA 2L6LA 1XHZA 3FB7C 4AI8A 5B1OA 2YUAA 3PN1A 5KA5A 2YI8A 2MW2B 3FB6C 3KZIZ 3LDCA 3CRAA 4LNUB 3HKEA 2W6JG 2ZKOA 4P9PA 3OR6C 2H3OA 2N04A 3KCYA 2JS5A 3U10A 4P2ZA 3CMAV 3OE7G 2WA4A 1GM8A 1CXZB 3JD3A 3FKSG 2JRIA 1VQ6V 4NXMB 4RUFA 1BHBA 3F7YC 3BEHA 2B1GA 4IHJA 1ROPA 4NXMO 5JCOC 2A7WA 4IGGA 1M9NA 1ZL8B 3ETGA 1Y4MA 5LHIA 2A9HA 4CC5A 3IC9A 3RN4A 2ZIOA 4ZOLB 3X2QC 3NXSA 3ETDA 4ZI7A 3B8NA 4CH5A 3W7WA 2OWOA 2QM8A 3L74H 2AHZA 3CRQA 2EILB 3ZMTA 1M90W 5LA6B 4FMTA 3QO7A 2Q73A 3CB2A 2QWNB 1XBLA 4JI7B 2P67A 1ZTEA 2OTLV 4O4IB 4JI7O 3OTOB 5IYCO 2XAHA 3SR2C 3GB7C 5DN6G 1P7BA 2B1IA 2F23A 5LP6B 2HLDG 4N21A 3SJCC 3OTOO 4FM0A 2EJ7A 4J10A 4X1IA 4NTXA 3QG5A 2JDIG 1GK9A 1IBLB 5DM6V 3OM3B 2JVDA 4AILC 4H37A 1IBLO 3UT5B 2QEXV 4EFBA 3LDEA 4DR7B 3U11A 4DR3B 1YITV 4FJCC 1IBKB 2ZE6A 1OZ0A 4GCZA 3OEHG 4MT8A 4NTYA 1YVWA 3A2FA 5KMGA 4DR7O 2ZIMA 2BTQA 1WA8B 2EIJC 1TVKA 2H8PC 4DR3O 1PL0A 1OCZC 1IBKO 1K4DC 5IJ9B 3JARA 5FNVB 4TV8B 3AG3C 2DQ3A 2LJ2A 4DK0A 1SQPH 4PELA 2CTWA 3WG7C 1P84F 1VF6C 4F6RB 2XAFA 1XI1A 4WF9V 1GKFA 5L3GA 3BPZA 4DRXA 3L75H 1YSCA 4PDRA 3CCJV 5LMNB 2WLLA 2Z0AA 2O57A 1YJWV 3RWRD 1KB9F 3STZC 3UO3A 2P5OA 4NYKA 2B9ZA 2Y4TA 3WU2Z 5LMNO 3AEIA 4LF8B 2GTAA 5FL7G 4O4HB 1W0JG 2A06H 1OHHG 1WB8A 4N23A 4LF8O 3VQXA 4LP8A 1Y66A 3SJBC 1AI5A 3HKBB 1VQMV 1J5EB 4EB6A 3JATA 3R66A 4W4LA 4CH6A 1F4NA 5CBFA 2IJJA 1HNXB 5C8YA 1J5EO 2G38A 2P7TC 1Y76A 4Q20A 3WB2A 2WLIA 1HNZB 3AK3A 1HNXO 2X6AA 1IVSA 1VMGA 1HNZO 3CD6V 3RYCB 1ZLZA 3BFRA 2X6CA 3FAVB 3JCZA 2ZM6B 1JCHA 4F4LA 1EBOA 3JAKA 2HHHB 5CN0A 1V9PA 3AG1B 4UCSA 3IAYA 1KKDA 2ZM6O 1PL4A 5GONB 1GMGA 3ZN1A 1U97A 2HHHO 5CB4B 3ABKB 3HR0A 1FXKA 2F66C 4LWSB 3AK2A 3G6BA 1BZKA 2CAZC 3OT7A 1HP8A 1K7DA 3LSSA 1MABG 1Q43A 4I5SA 1U96A 5EC1C 1I0HA 4O4JA 3VOUA 3WFVA 3RYIA 2BSKA 2WLHA 1KYOF 1SA0A 5LGUA 4HNAB 3E22A 1NVPD 1XMQB 1XOUA 3K3WA 1RSOB 1BQ0A 2CTPA 3SYAA 2P4KA 4UCOA 5JH7B 2VQFB 1XMQO 4FZ0A 1NTKH 1R3JC 3K06A 3FYIB 3ZJZA 2JK5C 5CA3A 5LHHA 2XUMA 2VQFO 3GWKC 5JJEB 1D5AA 2BCCH 1Q5OA 3IJ4A 4H13B 4DV7B 2E5LB 3HKCB 3K5LA 1TAEA 3OFNG 1EN5A 4DV7O 2E5LO 4DR6B 1E1QG 1LUWA 4EFEA 1K4CC 5JCOA 2IH1C 4I0XB 4PA4A 4DR6O 1MA1A 1BHAA 3ZHVA 1QLEB 5EBLC 5EK0A 2XASA 3RYHB 2CDYA 5IY5B 1M5IA 2BTOA 4WFHA 3SYCA 4CZZA 3ZRWB 3OD4A 3RVYA 2AXTZ 3HB3B 1RM1C 4X66B 3SJQC 2AHYA 3SYPA 1TUBA 1GN6A 1GH6A 1IDSA 2Q69A 1RPRA 1WN7A 3EXAA 4X66O 3WG7B 2IJKA 4DV2B 5EZYB 4FM1A 1SF9A 4JI2B 4HBNA 5CBGA 5JWPA 3JAWB 3QO8A 1VEWA 2ITDC 3VBBA 4DV2O 3L9DA 1CPYA 1VARA 1XL4A 3G67A 1I08A 3DGEA 4JI2O 1JFFB 1PV0A 2ZE5A 5B3SC 3K58A 4FLVA 3ABLB 1SERA 2YICA 4LFBB 4JAVA 1Y67A 3SYQA 4I7ZB 3T4DA 3QF7A 2W0FC 5L3BA 5FPRA 4LFBO 4I4TA 1US6A 1N34B 1KP2A 1THZA 4AHCA 4GYCB 2Q4PA 4JI8B 3K04A 1EN4A 1N34O 4ZHQB 2ETNA 4TUYA 1R6TA 1WJZA 4JI8O 2HG5C 4PV1B 4I50B 3BAAA 4ZBMA 3JASB 3UCSC 4BAYA 5B1AB 1N0NA 1EZJA 3ASOB 1Y74A 3H1KH 1VF6A 2EIKB 4I9WA 3OW2U 2WLJA 2M6YA 2PF4E 2Q68A 2ZCEA 4OGQB 2RCVA 2OCHA 1VQPV 5JQGB 4YIOA 2PZSA 3BHPA 4LF6B 3SPCA 3SPJA 2Y0PA 4BW5A 3E35A 4LF6O 5H9CA 4LH6A 1MG1A 3UQ8A 2ILMA 3ZS8C 4DR1B 3M99B 1H2KA 3E89A 4PA6A 4XDJA 3TJTA 4H33A 4DR1O 4PA9A 4R7CA 4CS4A 1RFYA 2XAQA 4UB6Z 4TOIA 5J2TB 5EC2C 1N4CA 5LGTA 4JYAB 1Z5WA 4MVOA 1YTFB 4G27B 1KC8W 5IYDO 4K3AA 4JYAO 1SESA 4UVBA 1JMKC 1GRJA 2BE3A 4ABMA 5LXTA 1L0NH 4YHHB 5K1XA 1NTMH 5JJJB 3C90A 3K08A 4YHHO 1XHXA 1V54C 5B1BC 3LUTB 1AR5A 3AK1A 3DC5A 2Q0OC 2Y69B 4JYYA 3AG4B 2EIMB 3JALA 3I5DA 3HKEB 2Z3YA 1XUQA 3WB0A 1DLBA 2ZE7A 4TSFG 2UXBB 3H1IH 2EJRA 5LGNA 3UO2A 2PGGA 2EINC 2CE4A 4DR4B 1M56C 4B7EA 2P4VA 2UXBO 3ZCCA 5B66Z 2ZXWB 3ABMC 3FFQA 2FKXA 1SS3A 4DR4O 5KUMA 2HKOA 3G6EV 1K5SA 2CH7B 4PJ0Z 4G2KA 5LBQA 3K03A 4IHJB 2UXDB 4YJ3A 2PY5A 5IJ0B 1KKCA 1PM9A 2UXDO 2WAMA 1Q7YW 4YJ2B 5H2FZ 1QHTA 1FXKC 1VQ9V 2KSDA 4WBNA 4RQFA 3CEIA 1Q3EA 4UCVA 3K9SA 1S76D 4P30A 1UPGA 3L71H 4HZ3A 4DUZB 5IYZA 4J42A 1K33A 1F51A 2CGNA 2V7QG 3ZEDA 4DUZO 3KCXA 1TA8A 3CCEV 1CEZA 4XDKA 2DWDC 3STLC 3JAMN 2LFSA 2QWPB 1X59A 4XBFA 4IYIA 2LGWA 4DV0B 1XREA 2UXCB 3F7VC 1I5YA 4K35A 2LFRA 4DV0O 2UXCO 4DO2A 3GWOA 4RUEA 3JSLA 4X1IB 1KU9A 1JA8A 1Q81W 1BL8A 2XHBA 1H8HG 5KAFZ 3K0DA 3AG2C 3D36A 3IGAC 1HDJA 4DV5B 5BXZA 1NS1A 3HKDA 3I56V 2ZQMA 4PD4F 2HEPA 5LOVA 1GN4A 3B09A 4J7JA 1AR1B 4DV5O 1X4TA 4GX5A 3P3PA 1S5HC 2EBOA 2IJIA 3CE2A 4BIUA 4JAAA
chains in the Genus database with same CATH topology
3ZX6A 3G6BA 2CH7A 1QU7A 2CH7B 3G67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZX6 A;  3G6B A;  2CH7 A;  1QU7 A;  2CH7 B;  3G67 A; 
#chains in the Genus database with same CATH topology
 3ZHR A;  3K0G A;  1M1K W;  2YC0 A;  2JGD B;  5L3C A;  4LF5 B;  4FFK A;  3B77 A;  1BS3 A;  5EBM C;  1VIB A;  1VQK V;  2Q7H A;  4LF5 O;  4J7K A;  5ITZ A;  3G71 V;  3CRR A;  4IYH A;  3OGI B;  4G28 B;  1I94 B;  2W0X A;  3ZHT A;  3SDL A;  1NR7 A;  4TV9 A;  4DRX B;  1G8M A;  3Q4H A;  2JGU A;  1M57 B;  4J80 A;  2WLL B;  5KX5 A;  1I94 O;  1AI4 A;  3C3S A;  3H01 A;  4UVC A;  4JTC B;  4MTO A;  5F2V O;  1WLE A;  1ARO P;  1SRY A;  1YEW A;  2VWK A;  1Z2G A;  5GTI Z;  4LNU A;  1FXV A;  1SQX H;  5K1P A;  3J7A U;  1V55 C;  2L35 A;  2PUS A;  2JIZ G;  4I9Q A;  5C8Y B;  3ASN C;  4NKG B;  1SQV H;  3FD9 A;  3A0R A;  1Y76 B;  2KB1 A;  2PI4 A;  1JPX A;  4LBE C;  3E8B A;  4I55 A;  2Q5Z A;  4FLU A;  1YXB A;  1XL6 A;  3OGC C;  1L1F A;  2UXN A;  4B3T B;  2ADQ B;  4R8C A;  4X9Q A;  1ZL8 A;  1CP9 A;  1F4M A;  3NR7 A;  4RWU A;  4X1Y B;  1YJ9 V;  3JAK B;  1YCI A;  4W4K A;  4B3T O;  2DYR B;  4ZOL A;  2OCC C;  2B5U A;  1N0J A;  1NKD A;  4K8X A;  2JEU A;  1KEC A;  4MVR A;  4NB5 A;  1NH2 D;  2QDO A;  4FFB A;  1K34 A;  1GO3 F;  4IIJ A;  2N05 A;  3O9O A;  3CCL V;  2A3Q A;  1FPO A;  2YIB D;  3CCM V;  5H5N A;  2ZR3 A;  2DW4 A;  3OEE G;  3ZRV A;  4B7K A;  3G4S V;  1XNQ B;  5JJN B;  1YHQ V;  1JJO A;  4UFZ A;  1XNQ O;  3J81 N;  3CYO A;  4X89 A;  5LP6 A;  4U3J B;  1UFI A;  1TUE B;  2EZP A;  4O2B A;  3ZN0 A;  2DYS C;  4DR2 B;  5H6R A;  2PYL A;  2R9I A;  2E74 B;  3FB5 C;  2CUG A;  4DR2 O;  5B5E Z;  2ARH A;  2ZE8 A;  3VQW A;  4MTF A;  3UT5 A;  4J41 A;  4NR1 A;  1K97 A;  2A79 B;  1FS0 G;  4JGS A;  3K59 A;  1FKA O;  3ZIA G;  2P22 C;  2XOK G;  4RO2 A;  5JVD B;  5IDJ A;  2HR3 A;  1W0K G;  1VQ4 V;  3OUF A;  5FNV A;  4TV8 A;  3H1H H;  3EVK A;  3X2Q B;  3MAQ A;  4GKK B;  1K8A W;  4GX0 A;  4F6R A;  2Q67 A;  4Z2W A;  2K9P A;  3N27 A;  3T1H B;  4GKK O;  4MVU A;  1RPO A;  1K73 W;  2QWQ B;  1H2N A;  1HWY A;  2PI5 A;  4B3R B;  1EFR G;  3T1H O;  2LO1 A;  3MDS A;  4QPJ A;  5HFL A;  1YI2 V;  4Z1V A;  2ZR2 A;  2H94 A;  4QE9 A;  4BWA A;  5LHG A;  2UU9 B;  4B3R O;  1FD9 A;  1SC5 B;  4MVS A;  2R9R B;  5KHI A;  5EYP B;  3HPL C;  2UU9 O;  3P32 A;  4O4H A;  3ZX6 A;  4DV6 B;  5CMU A;  3IC7 A;  2WLM A;  4JYB A;  4PA3 A;  4UXN A;  2M7W A;  4DV6 O;  4JTA B;  4O4L B;  2Q7E A;  4FK5 C;  4X1K A;  2QA4 V;  2LQT A;  2GTS A;  3LSQ A;  2XT9 A;  2Q9L A;  1H2M A;  4JI4 B;  1BE3 H;  1MZE A;  1S3J A;  3ABU A;  1O9H A;  2E75 B;  4I4T B;  4JI4 O;  2P90 A;  4BR6 A;  3W7T A;  4RAI A;  1JJ2 U;  4L8J A;  3CX5 F;  4PHZ A;  1HNW B;  4LH7 A;  3FAV A;  2DN9 A;  3K5O A;  5CA0 A;  3N2G B;  1SQQ H;  2F93 B;  4O2A B;  2EIJ B;  1OCZ B;  3CJH A;  1HNW O;  4KL1 A;  4JI1 B;  4JZG A;  3AG3 B;  1YTF D;  3E8F A;  5BMV B;  1E79 G;  4JI1 O;  5CB4 A;  4LR3 A;  1Y74 B;  1YF2 A;  1FAF A;  5DED A;  3ZMV A;  2LW7 A;  5KHG A;  3ZMU A;  2E3C A;  4GKJ B;  3CCR V;  1I5X A;  4X20 A;  2QWO B;  3JSN A;  4QE7 A;  1OCC C;  3TXS A;  4KFM A;  4GKJ O;  3E83 A;  3THO A;  1AI6 A;  4WCE V;  2PYJ A;  2DWE C;  4J7Z A;  3QVN A;  2GUZ B;  3D36 C;  2OIE A;  1YZB A;  1IXB A;  3MHH C;  1XIL A;  4UVA A;  3P30 A;  5D5P A;  5KAI Z;  4JAS A;  4JI0 B;  5JH7 A;  4GLX A;  1AIL A;  3B40 A;  1QR8 A;  4X65 B;  4DV4 B;  1S5J A;  3QTC A;  4JI0 O;  2FML A;  2R72 A;  1S77 D;  2XAJ A;  3MHS C;  4X65 O;  4DV4 O;  2OYQ A;  2X0L A;  5LYJ B;  5A9G A;  1EZV H;  4KUM A;  4DV3 B;  1Y6X A;  1OCO C;  3L70 H;  3FX7 A;  3HKC A;  4DV3 O;  4DK1 A;  4E4E A;  4OXS A;  5LMU B;  2YEV A;  3DC6 A;  3K9A A;  2R70 A;  5LMU O;  4E2L A;  2HP8 A;  4DR5 B;  1NT2 B;  1J95 A;  1FFX A;  2YIB A;  2AZ2 A;  3MD0 A;  3I55 V;  1S5L Z;  3RYH A;  1R6K A;  4WFF A;  2QR4 A;  1AJQ A;  3ZHS A;  1I7F A;  2QE7 G;  3APO A;  4DR5 O;  4J9Z B;  3ZBH A;  4CH4 A;  4UCT A;  4Z1M G;  3ZRW A;  4HYO A;  3JAL B;  1NVP B;  1R1B A;  3RYF B;  2JJ2 G;  2KKW A;  1BT8 A;  1HR0 B;  1YDX A;  1Z5V A;  1JVM A;  3N2K B;  3DXR B;  2HJF C;  1DF4 A;  1HR0 O;  1IBM B;  1JFF A;  4WFB V;  4CS2 A;  2GBO A;  2V1D A;  1K5Q A;  4OPA A;  1IBM O;  4D6T H;  2OIG A;  3BVO A;  1P7G A;  4YJ3 B;  1VQ7 V;  2QM7 A;  3OMA B;  1NTZ H;  3WB1 A;  2Y48 A;  4MSW C;  3G80 A;  3DSQ A;  4PDL A;  4D7S A;  4CS3 A;  2NN4 A;  3U0Z A;  1FJG B;  5TIS Z;  3FB8 C;  2IJH A;  4PI0 A;  1HW7 A;  2EIL C;  2C2A A;  1FJG O;  5IYZ B;  1EN6 A;  1P4R A;  3BCC H;  4MTX A;  1ENV A;  4FIP C;  5BY1 A;  1WPX A;  3H1J H;  2QGN A;  1T5E A;  4UUJ C;  5DEC A;  2QSA A;  4WFE A;  1Q6H A;  2VS0 A;  1NJI W;  1N32 B;  2F43 G;  3O65 A;  3JAS A;  5J2U A;  1F7Y A;  4K8Z A;  3P3N A;  4MTG A;  1OCR C;  5LP6 C;  1N32 O;  2YI9 A;  1RM1 B;  1PNM A;  3BY6 A;  1QVG U;  1KUQ A;  2ATK C;  4CH3 A;  4LFC B;  4WFG A;  1NR1 A;  2ITC C;  5JQG A;  1XDC A;  1D5N A;  3VQV A;  3TET A;  4LFC O;  3VQY A;  1GN2 A;  3GVM A;  4PA7 A;  1YIJ V;  1PNL A;  5B3S B;  2ZDI A;  5H6Q A;  1AP5 A;  4DUY B;  1QVF U;  3E2E A;  2KG7 A;  1S0V A;  1VP7 A;  5LOV B;  2F1M A;  3K5N A;  2Z5U A;  4DUY O;  5CA1 A;  4FVM A;  4ZI7 B;  1M4U A;  1EM1 A;  1M93 A;  1XQ8 A;  1VQL V;  4GT1 A;  1R3L C;  1G1X B;  1GM7 A;  4X8A A;  5ITZ B;  4GUN A;  1VQ5 V;  4A5U B;  3LDD A;  2ADP A;  5J9P C;  1XMO B;  3LNN A;  3CC7 V;  4DYL A;  4H44 B;  5E1A C;  4RQE A;  1JR9 A;  3D3Q A;  2W6I G;  3CME V;  2CK3 G;  4IT5 A;  1XMO O;  5KX5 B;  4DV1 B;  2AZ0 A;  2HVK C;  1OJH A;  3CWB H;  3OTF A;  2VRZ A;  1QCE A;  4DV1 O;  4HAM A;  1BCC H;  4PI2 A;  2IM9 A;  3KKY A;  3LNM B;  3RGB A;  4JZ2 A;  4NTW A;  4B3S B;  2DQ0 A;  4LFA B;  2GSM B;  4J11 A;  5GTH Z;  1QLN A;  4B3S O;  2JEX A;  3CSX A;  4LFA O;  4FLY A;  1URF A;  1WPB A;  2Q0A A;  2R9A A;  2N74 A;  2DJV A;  4NXN B;  3CC4 V;  1KBH A;  3CC2 V;  4JTD B;  1R3K C;  2CH7 A;  5KMG B;  2DMX A;  2BTQ B;  1FFT B;  2YXH A;  1TVK B;  4NXN O;  4I55 B;  3RW0 A;  2RMK B;  4XDL A;  2XAG A;  3JAR B;  1ZAU A;  4D7T A;  3AG1 C;  2LP7 A;  5IJ0 A;  2ZNJ A;  1W2B U;  2ZIN A;  2EUL A;  1D2D A;  3J80 N;  3ETQ A;  3ABK C;  4YJ2 A;  5KHJ A;  4H0L B;  2V4D A;  2Q6A A;  2BOB C;  4X64 B;  5CBH A;  2YS8 A;  2RN9 A;  4B08 A;  4BIZ A;  4X64 O;  2NLJ C;  4FFB B;  1AVM A;  5GW7 A;  2P06 A;  4IIJ B;  1AR4 A;  4JAU A;  1DF5 A;  3D3I A;  1SKV A;  5L3D A;  1B6Q A;  1N33 B;  1N8R W;  1V54 B;  1WP7 A;  1SET A;  3W7S A;  1BMF G;  5B1B B;  3CRM A;  4JYC A;  1N33 O;  2D2C B;  4MW3 A;  4JV5 B;  1FYJ A;  3M8A A;  1NU1 H;  4EB6 B;  2FB5 A;  1GM9 A;  3JAT B;  3FYE B;  3RBZ A;  2YIA A;  4TWK A;  1OCR B;  3SPI A;  4JV5 O;  3RVZ A;  2CTR A;  4MVM A;  4O2B B;  2WLI B;  4U3F H;  4JI6 B;  1ZWI C;  2EIN B;  1Q82 W;  1M56 B;  2RNB A;  3ABM B;  4IL6 Z;  1B3Q A;  3L73 H;  4PDV A;  4JI6 O;  2QKC A;  3SPG A;  4NVP A;  2ZD9 A;  4ZKI A;  1QLE C;  2F4V B;  3UM7 A;  2YXL A;  3UKM A;  3CCV V;  5IY5 C;  2QTS A;  2DOS A;  2F4V O;  2IBZ H;  3DTU B;  4UCR A;  3B4S A;  1ZSP A;  4MVZ A;  4P9O A;  5B1N A;  1KMI Z;  3H9V A;  3ZMZ A;  1AJN A;  4WFA V;  2WLN A;  2XTA A;  3E86 A;  1FXK B;  2JGD A;  2QKA A;  5KA6 A;  5HFM A;  1BGY H;  4U7N A;  1ZX3 A;  4BW9 A;  4Q6G A;  4U7O A;  3QO5 A;  5LA6 A;  2YXY A;  2UUB B;  1F23 A;  1WP8 A;  3ML0 A;  3JCU Z;  5EIB C;  4O4J B;  1KQS U;  3RYI B;  2BSK B;  1SA0 B;  2UUB O;  1H2L A;  4FM2 A;  3C3T A;  1Q6U A;  3TGU H;  2WA3 A;  3E8G A;  3E22 B;  4FLW A;  4O4I A;  2AW9 A;  4FLT A;  1SZT A;  3K57 A;  2IU3 A;  3ABL C;  2PTM A;  1PPJ H;  2EZO A;  2RQ6 A;  4J9Y B;  5EIB D;  4LCU C;  2NR5 A;  4GX1 A;  5AG2 A;  3JD4 A;  3APQ A;  5A2Q N;  3ZHQ A;  2DE0 X;  1MNG A;  3CXC U;  5IE9 A;  4X1K B;  2GV9 A;  1PKX A;  3JD0 A;  2OT5 A;  1H38 A;  4LF7 B;  1AJP A;  2QTO A;  1Q90 D;  3AG2 B;  2Y0I A;  4KXR A;  4LF7 O;  1P49 A;  1MMM A;  1WA8 A;  4DW0 A;  2WWW A;  1KP3 A;  1NZ6 A;  5IJ9 A;  4UB8 Z;  4QJF B;  2UUA B;  1SQG A;  1TGO A;  5CA0 B;  5B1A C;  3ASO C;  1XEQ A;  4MS2 A;  2UUA O;  4X1Y A;  3CJH B;  2D3O W;  1WAZ A;  2IW5 A;  2QJ1 A;  2EIK C;  1B06 A;  4DW1 A;  1TUB B;  4ZIB A;  2NNU A;  1QNM A;  2QM4 A;  4C7U A;  1PP9 H;  4OX9 B;  4TQD A;  3W7U A;  4X20 B;  4OX9 O;  3RT3 C;  2QKS A;  2ZDI C;  1ORQ C;  2AGA A;  3JD2 A;  4QNH B;  3HKB A;  5KLV H;  3E8H A;  2Q7G A;  4DXW A;  4U3J A;  1UJW B;  1V55 B;  2XND G;  3LSU A;  1SZX A;  1DK1 A;  3ETE A;  3CCS V;  2QWR B;  5BR8 B;  1R73 A;  3ASN B;  1QQC A;  1JOY A;  4KP4 A;  3RYC A;  1K3E A;  1JQ0 A;  5KUK A;  5BR8 O;  1B04 A;  2Q8V A;  1ZUQ A;  4TUY B;  3OAA G;  4LF4 B;  1VQO V;  3BA8 A;  1MZF A;  2YEV B;  1K92 A;  1L8D A;  1NH2 B;  5FLX N;  5IT9 N;  5JVD A;  2CTQ A;  5GON A;  4LF4 O;  1FFX B;  3CP1 A;  1NQT A;  2Y69 C;  3AG4 C;  2EIM C;  4LWS A;  4YXW G;  1XNR B;  2OCC B;  2A0L A;  1NI8 A;  4X88 A;  4GZR B;  3RFR A;  3OUS A;  5LL6 Y;  2YDE A;  1XNR O;  1IUR A;  2JJ1 G;  1Q8I A;  4JPR A;  4R50 A;  2BOC C;  2ZXW C;  4HNA A;  3B2E E;  1YJN V;  1G4Y B;  1RSO A;  4FLZ A;  2VQE B;  3CCU V;  1SQB H;  1MOF A;  1SQF A;  5EYP A;  3ABT A;  1GN3 A;  2VQE O;  1AI7 A;  3T1Y B;  1LUV A;  4B3M B;  3T2M A;  1NBM G;  3PJS K;  4QPK A;  4BIO A;  4K0K B;  2UUC B;  3T1Y O;  2CGO A;  3CCQ V;  3QNE A;  2K1E A;  1IZ3 A;  4B3M O;  4O4L A;  2DYS B;  3K79 A;  4K0K O;  2UUC O;  3OR7 C;  5L3E A;  3ZRS A;  3CHX A;  2WSS G;  4LC1 A;  5KHK A;  3F5W C;  3CS5 A;  2UXX A;  5LXT B;  4JI3 B;  1K9M W;  1JX9 A;  1R3I C;  4I0X A;  1H2S B;  1PD3 A;  1WB7 A;  4X62 B;  3W7X A;  2F95 B;  4JI3 O;  4ASU G;  3JD1 A;  1DTO A;  3S3W A;  4X62 O;  3N2G A;  3R65 A;  4O2A A;  2ODM A;  1O9G A;  4TT3 G;  2LGQ A;  5E79 Z;  1VF7 A;  2GHY A;  2GDS A;  2MK3 A;  5J2U B;  5BMV A;  4UV9 A;  3OMI B;  4EKW A;  4JF3 A;  3IFX A;  1BSM A;  1QBZ A;  3BAB A;  2FL4 A;  4UCU A;  3CPW U;  3ICX A;  1GAX A;  5IWA B;  3ZHU A;  5EZY A;  2ZT9 B;  2YID A;  5KHH A;  4L87 A;  1VQ8 V;  3JAW A;  5IWA O;  2FYU H;  1COW G;  1PNK A;  1LR1 A;  2E76 B;  4F6E A;  2Y4U A;  2P6J A;  3SJA C;  3M7M X;  3AG7 A;  3S3X A;  1AB3 A;  2GUZ A;  3SPH A;  2ZNI A;  1DGS A;  3A0B Z;  2IU0 A;  1IXM A;  4QIW F;  1Q86 W;  3D8C A;  2WLK A;  2KG7 B;  2LW1 A;  3SGI A;  2WPD G;  5IYB O;  4WBN B;  5CA1 B;  1VF5 B;  4CC6 A;  1S72 V;  4MVQ A;  5LYJ A;  1AP6 A;  1LNQ A;  5D5Q A;  3OMN B;  2RJZ A;  3BRC A;  4ZHQ A;  4ICG A;  1RP3 B;  4FPP A;  4CBC A;  4I50 A;  1M57 C;  5L3F A;  1G6U A;  4OPH A;  5EBW C;  4FZ1 A;  3L72 H;  1N36 B;  2KQX A;  1MSD A;  2HVJ C;  3JYC A;  3H1L H;  4FLX A;  2IH3 C;  1Q6I A;  5C93 A;  1N36 O;  1QR9 A;  1GTO A;  1VQN V;  3EHB B;  2X6B A;  2JS3 A;  4TQF A;  2FTK A;  1FXH A;  4QGP A;  1BQZ A;  1KD1 W;  5BZB A;  3RYF A;  4LF9 B;  3T1C A;  2RDC A;  1OCC B;  1IX9 A;  4AQY B;  3T4Z A;  4LF9 O;  3KG2 A;  3N2K A;  3CRC A;  4YIP A;  3DXR A;  4AQY O;  4JI5 B;  1H2G A;  3HKD B;  3BA9 A;  1H8E G;  3A8T A;  3CXH F;  1OV9 A;  1MSW D;  4JI5 O;  4YY3 B;  3K5M A;  3ZRX A;  1QU7 A;  2EX3 A;  1L0L H;  5J2T A;  3A0H Z;  1E1R G;  4UV8 A;  5FPO A;  4YY3 O;  3EFF K;  2X7R B;  2DYR C;  2HJD A;  2YSU B;  2VWJ A;  3ZMS A;  4R6Z A;  4EEQ A;  2HFE C;  1R6N A;  3B8M A;  4KHP B;  1OCO B;  3TXQ A;  4MW8 A;  3F5T A;  4PDM A;  3SYO A;  1A32 A;  4TV9 B;  4KHP O;  3Q4H B;  3TK1 A;  1WNS A;  4GX2 A;  1W59 A;  2OTJ V;  3TCU A;  2L6L A;  1XHZ A;  3FB7 C;  4AI8 A;  5B1O A;  2YUA A;  3PN1 A;  5KA5 A;  2YI8 A;  2MW2 B;  3FB6 C;  3KZI Z;  3LDC A;  3CRA A;  4LNU B;  3HKE A;  2W6J G;  2ZKO A;  4P9P A;  3OR6 C;  2H3O A;  2N04 A;  3KCY A;  2JS5 A;  3U10 A;  4P2Z A;  3CMA V;  3OE7 G;  2WA4 A;  1GM8 A;  1CXZ B;  3JD3 A;  3FKS G;  2JRI A;  1VQ6 V;  4NXM B;  4RUF A;  1BHB A;  3F7Y C;  3BEH A;  2B1G A;  4IHJ A;  1ROP A;  4NXM O;  5JCO C;  2A7W A;  4IGG A;  1M9N A;  1ZL8 B;  3ETG A;  1Y4M A;  5LHI A;  2A9H A;  4CC5 A;  3IC9 A;  3RN4 A;  2ZIO A;  4ZOL B;  3X2Q C;  3NXS A;  3ETD A;  4ZI7 A;  3B8N A;  4CH5 A;  3W7W A;  2OWO A;  2QM8 A;  3L74 H;  2AHZ A;  3CRQ A;  2EIL B;  3ZMT A;  1M90 W;  5LA6 B;  4FMT A;  3QO7 A;  2Q73 A;  3CB2 A;  2QWN B;  1XBL A;  4JI7 B;  2P67 A;  1ZTE A;  2OTL V;  4O4I B;  4JI7 O;  3OTO B;  5IYC O;  2XAH A;  3SR2 C;  3GB7 C;  5DN6 G;  1P7B A;  2B1I A;  2F23 A;  5LP6 B;  2HLD G;  4N21 A;  3SJC C;  3OTO O;  4FM0 A;  2EJ7 A;  4J10 A;  4X1I A;  4NTX A;  3QG5 A;  2JDI G;  1GK9 A;  1IBL B;  5DM6 V;  3OM3 B;  2JVD A;  4AIL C;  4H37 A;  1IBL O;  3UT5 B;  2QEX V;  4EFB A;  3LDE A;  4DR7 B;  3U11 A;  4DR3 B;  1YIT V;  4FJC C;  1IBK B;  2ZE6 A;  1OZ0 A;  4GCZ A;  3OEH G;  4MT8 A;  4NTY A;  1YVW A;  3A2F A;  5KMG A;  4DR7 O;  2ZIM A;  2BTQ A;  1WA8 B;  2EIJ C;  1TVK A;  2H8P C;  4DR3 O;  1PL0 A;  1OCZ C;  1IBK O;  1K4D C;  5IJ9 B;  3JAR A;  5FNV B;  4TV8 B;  3AG3 C;  2DQ3 A;  2LJ2 A;  4DK0 A;  1SQP H;  4PEL A;  2CTW A;  3WG7 C;  1P84 F;  1VF6 C;  4F6R B;  2XAF A;  1XI1 A;  4WF9 V;  1GKF A;  5L3G A;  3BPZ A;  4DRX A;  3L75 H;  1YSC A;  4PDR A;  3CCJ V;  5LMN B;  2WLL A;  2Z0A A;  2O57 A;  1YJW V;  3RWR D;  1KB9 F;  3STZ C;  3UO3 A;  2P5O A;  4NYK A;  2B9Z A;  2Y4T A;  3WU2 Z;  5LMN O;  3AEI A;  4LF8 B;  2GTA A;  5FL7 G;  4O4H B;  1W0J G;  2A06 H;  1OHH G;  1WB8 A;  4N23 A;  4LF8 O;  3VQX A;  4LP8 A;  1Y66 A;  3SJB C;  1AI5 A;  3HKB B;  1VQM V;  1J5E B;  4EB6 A;  3JAT A;  3R66 A;  4W4L A;  4CH6 A;  1F4N A;  5CBF A;  2IJJ A;  1HNX B;  5C8Y A;  1J5E O;  2G38 A;  2P7T C;  1Y76 A;  4Q20 A;  3WB2 A;  2WLI A;  1HNZ B;  3AK3 A;  1HNX O;  2X6A A;  1IVS A;  1VMG A;  1HNZ O;  3CD6 V;  3RYC B;  1ZLZ A;  3BFR A;  2X6C A;  3FAV B;  3JCZ A;  2ZM6 B;  1JCH A;  4F4L A;  1EBO A;  3JAK A;  2HHH B;  5CN0 A;  1V9P A;  3AG1 B;  4UCS A;  3IAY A;  1KKD A;  2ZM6 O;  1PL4 A;  5GON B;  1GMG A;  3ZN1 A;  1U97 A;  2HHH O;  5CB4 B;  3ABK B;  3HR0 A;  1FXK A;  2F66 C;  4LWS B;  3AK2 A;  3G6B A;  1BZK A;  2CAZ C;  3OT7 A;  1HP8 A;  1K7D A;  3LSS A;  1MAB G;  1Q43 A;  4I5S A;  1U96 A;  5EC1 C;  1I0H A;  4O4J A;  3VOU A;  3WFV A;  3RYI A;  2BSK A;  2WLH A;  1KYO F;  1SA0 A;  5LGU A;  4HNA B;  3E22 A;  1NVP D;  1XMQ B;  1XOU A;  3K3W A;  1RSO B;  1BQ0 A;  2CTP A;  3SYA A;  2P4K A;  4UCO A;  5JH7 B;  2VQF B;  1XMQ O;  4FZ0 A;  1NTK H;  1R3J C;  3K06 A;  3FYI B;  3ZJZ A;  2JK5 C;  5CA3 A;  5LHH A;  2XUM A;  2VQF O;  3GWK C;  5JJE B;  1D5A A;  2BCC H;  1Q5O A;  3IJ4 A;  4H13 B;  4DV7 B;  2E5L B;  3HKC B;  3K5L A;  1TAE A;  3OFN G;  1EN5 A;  4DV7 O;  2E5L O;  4DR6 B;  1E1Q G;  1LUW A;  4EFE A;  1K4C C;  5JCO A;  2IH1 C;  4I0X B;  4PA4 A;  4DR6 O;  1MA1 A;  1BHA A;  3ZHV A;  1QLE B;  5EBL C;  5EK0 A;  2XAS A;  3RYH B;  2CDY A;  5IY5 B;  1M5I A;  2BTO A;  4WFH A;  3SYC A;  4CZZ A;  3ZRW B;  3OD4 A;  3RVY A;  2AXT Z;  3HB3 B;  1RM1 C;  4X66 B;  3SJQ C;  2AHY A;  3SYP A;  1TUB A;  1GN6 A;  1GH6 A;  1IDS A;  2Q69 A;  1RPR A;  1WN7 A;  3EXA A;  4X66 O;  3WG7 B;  2IJK A;  4DV2 B;  5EZY B;  4FM1 A;  1SF9 A;  4JI2 B;  4HBN A;  5CBG A;  5JWP A;  3JAW B;  3QO8 A;  1VEW A;  2ITD C;  3VBB A;  4DV2 O;  3L9D A;  1CPY A;  1VAR A;  1XL4 A;  3G67 A;  1I08 A;  3DGE A;  4JI2 O;  1JFF B;  1PV0 A;  2ZE5 A;  5B3S C;  3K58 A;  4FLV A;  3ABL B;  1SER A;  2YIC A;  4LFB B;  4JAV A;  1Y67 A;  3SYQ A;  4I7Z B;  3T4D A;  3QF7 A;  2W0F C;  5L3B A;  5FPR A;  4LFB O;  4I4T A;  1US6 A;  1N34 B;  1KP2 A;  1THZ A;  4AHC A;  4GYC B;  2Q4P A;  4JI8 B;  3K04 A;  1EN4 A;  1N34 O;  4ZHQ B;  2ETN A;  4TUY A;  1R6T A;  1WJZ A;  4JI8 O;  2HG5 C;  4PV1 B;  4I50 B;  3BAA A;  4ZBM A;  3JAS B;  3UCS C;  4BAY A;  5B1A B;  1N0N A;  1EZJ A;  3ASO B;  1Y74 A;  3H1K H;  1VF6 A;  2EIK B;  4I9W A;  3OW2 U;  2WLJ A;  2M6Y A;  2PF4 E;  2Q68 A;  2ZCE A;  4OGQ B;  2RCV A;  2OCH A;  1VQP V;  5JQG B;  4YIO A;  2PZS A;  3BHP A;  4LF6 B;  3SPC A;  3SPJ A;  2Y0P A;  4BW5 A;  3E35 A;  4LF6 O;  5H9C A;  4LH6 A;  1MG1 A;  3UQ8 A;  2ILM A;  3ZS8 C;  4DR1 B;  3M99 B;  1H2K A;  3E89 A;  4PA6 A;  4XDJ A;  3TJT A;  4H33 A;  4DR1 O;  4PA9 A;  4R7C A;  4CS4 A;  1RFY A;  2XAQ A;  4UB6 Z;  4TOI A;  5J2T B;  5EC2 C;  1N4C A;  5LGT A;  4JYA B;  1Z5W A;  4MVO A;  1YTF B;  4G27 B;  1KC8 W;  5IYD O;  4K3A A;  4JYA O;  1SES A;  4UVB A;  1JMK C;  1GRJ A;  2BE3 A;  4ABM A;  5LXT A;  1L0N H;  4YHH B;  5K1X A;  1NTM H;  5JJJ B;  3C90 A;  3K08 A;  4YHH O;  1XHX A;  1V54 C;  5B1B C;  3LUT B;  1AR5 A;  3AK1 A;  3DC5 A;  2Q0O C;  2Y69 B;  4JYY A;  3AG4 B;  2EIM B;  3JAL A;  3I5D A;  3HKE B;  2Z3Y A;  1XUQ A;  3WB0 A;  1DLB A;  2ZE7 A;  4TSF G;  2UXB B;  3H1I H;  2EJR A;  5LGN A;  3UO2 A;  2PGG A;  2EIN C;  2CE4 A;  4DR4 B;  1M56 C;  4B7E A;  2P4V A;  2UXB O;  3ZCC A;  5B66 Z;  2ZXW B;  3ABM C;  3FFQ A;  2FKX A;  1SS3 A;  4DR4 O;  5KUM A;  2HKO A;  3G6E V;  1K5S A;  2CH7 B;  4PJ0 Z;  4G2K A;  5LBQ A;  3K03 A;  4IHJ B;  2UXD B;  4YJ3 A;  2PY5 A;  5IJ0 B;  1KKC A;  1PM9 A;  2UXD O;  2WAM A;  1Q7Y W;  4YJ2 B;  5H2F Z;  1QHT A;  1FXK C;  1VQ9 V;  2KSD A;  4WBN A;  4RQF A;  3CEI A;  1Q3E A;  4UCV A;  3K9S A;  1S76 D;  4P30 A;  1UPG A;  3L71 H;  4HZ3 A;  4DUZ B;  5IYZ A;  4J42 A;  1K33 A;  1F51 A;  2CGN A;  2V7Q G;  3ZED A;  4DUZ O;  3KCX A;  1TA8 A;  3CCE V;  1CEZ A;  4XDK A;  2DWD C;  3STL C;  3JAM N;  2LFS A;  2QWP B;  1X59 A;  4XBF A;  4IYI A;  2LGW A;  4DV0 B;  1XRE A;  2UXC B;  3F7V C;  1I5Y A;  4K35 A;  2LFR A;  4DV0 O;  2UXC O;  4DO2 A;  3GWO A;  4RUE A;  3JSL A;  4X1I B;  1KU9 A;  1JA8 A;  1Q81 W;  1BL8 A;  2XHB A;  1H8H G;  5KAF Z;  3K0D A;  3AG2 C;  3D36 A;  3IGA C;  1HDJ A;  4DV5 B;  5BXZ A;  1NS1 A;  3HKD A;  3I56 V;  2ZQM A;  4PD4 F;  2HEP A;  5LOV A;  1GN4 A;  3B09 A;  4J7J A;  1AR1 B;  4DV5 O;  1X4T A;  4GX5 A;  3P3P A;  1S5H C;  2EBO A;  2IJI A;  3CE2 A;  4BIU A;  4JAA A; 
#chains in the Genus database with same CATH homology
 3ZX6 A;  3G6B A;  2CH7 A;  1QU7 A;  2CH7 B;  3G67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...