3ZX6A

Structure of hamp(af1503)-tsr fusion - hamp (a291v) mutant
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
303
structure length
303
Chain Sequence
b'TITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAMP, METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
publication title Axial Helix Rotation as a Mechanism for Signal Regulation Inferred from the Crystallographic Analysis of the E. Coli Serine Chemoreceptor.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling
total genus 149
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00015 MCPsignal Methyl-accepting chemotaxis protein (MCP) signalling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.950 Mainly Alpha Orthogonal Bundle Helix Hairpins Methyl-accepting chemotaxis protein 3zx6A00
3ZX6A 1QU7A 2CH7A 3G6BA 2CH7B 3G67A
chains in the Genus database with same CATH superfamily
4P30A 5LXTB 4X62O 1WP7A 4O2AA 4ICGA 2QGNA 1TUBB 1P84F 4GKKB 3JD4A 3ZEDA 1FXVA 4CC5A 1Q7YW 2Y48A 5FPOA 4J9ZB 3QNEA 5KUKA 4FLTA 2Q5ZA 1XMOB 2AGAA 3G6BA 4LFAB 5L3FA 3B2EE 3J81N 4DR7O 4FMTA 1P7GA 2EIMB 3K03A 4JI5B 4QJFB 4DR2O 2VWJA 2UXCO 3OMIB 1AJPA 4GKJB 2F23A 5LP6C 1N34B 1Q5OA 4LFCO 3SJCC 4DUYB 3AG2B 1B3QA 3SDLA 1FFTB 3HKBB 2HHHB 2RNBA 3GVMA 2ITDC 2LGQA 2ZE6A 3KZIZ 4B3SO 1XREA 3SJBC 4NB5A 4DK1A 5KHGA 2KG7A 1YEWA 4PDMA 2XAGA 1YHQV 1OJHA 2GUZB 5ITZB 2JJ1G 3RYHB 5BY1A 1FXKB 2VQEB 3SYCA 1H8EG 4ZHQA 4FFBB 5C8YA 2PI4A 3ASNB 3ETQA 4TOIA 2X6BA 3F5TA 3SGIA 1FFXA 4OGQB 4PI0A 2JRIA 3H1LH 4YY3O 2ZCEA 4PDVA 4ZOLA 4JI7B 1OZ0A 3AG3B 1CPYA 2XUMA 1VF7A 2EINC 2DWEC 1G4YB 4EKWA 3CRMA 3K9AA 2JDIG 2ILMA 3UM7A 3LDCA 4NTYA 4WFGA 4DRXA 4JV5B 1Q82W 1Q43A 2QWNB 2UU9B 2ZM6B 1VMGA 2DN9A 1V54C 2Q4PA 2JGDB 5KHIA 2EIJC 3FB6C 1FPOA 1UPGA 3SPGA 5B3SC 1QLEB 1YCIA 1BS3A 3A0RA 1Y76B 4DO2A 3Q4HA 2HEPA 4TV8A 4MW8A 1Q6IA 5DEDA 2LQTA 1BCCH 3WFVA 1ZUQA 3PN1A 3T2MA 5GTIZ 3ABUA 4O2AB 3HKEA 4H44B 2DQ0A 1VQ5V 2JJ2G 3CS5A 5IY5C 1KYOF 1SQPH 1R6KA 3A0BZ 2ZXWB 2P90A 3TK1A 4MSWC 2Z0AA 4RO2A 5LP6A 2UXBB 4DV7O 3SYAA 5EZYA 2Q6AA 3ETGA 4P2ZA 1TGOA 3CCLV 1H2LA 1G8MA 2QEXV 4KHPO 4D7TA 2RJZA 4AI8A 3ZMSA 4YJ2B 1H38A 3CC2V 1QQCA 2XNDG 2PYJA 1AVMA 3RGBA 2R9AA 4MVQA 4X65O 3JARA 2YIBD 1S3JA 3L70H 3CCSV 4BAYA 3JASA 3RWRD 4P9PA 1Z5WA 2DYRC 2GTAA 2KG7B 3D3IA 2GDSA 4UCRA 4MVOA 4EB6A 4JYAB 1G6UA 2Q68A 5L3CA 3ASOB 4ZHQB 5C8YB 3A2FA 3K0GA 1LUVA 5IYZA 1K92A 3SR2C 2P06A 1HNXB 4DV4B 2BOCC 4GX5A 5E1AC 3CB2A 2PTMA 5LA6B 2K1EA 1Y6XA 5EBLC 1O9HA 1Q81W 4X66B 1P4RA 4LH6A 2B5UA 4DR3O 4AHCA 2ADPA 4UVAA 3RYCA 2WPDG 2ZKOA 2HP8A 2CK3G 1K34A 4JYYA 4DV0B 5KHKA 4X1IA 4D6TH 1J5EB 5KAIZ 2WAMA 3FX7A 3KCXA 3FYIB 2PY5A 4JI2O 3RYFA 3FYEB 2Q7EA 1AILA 4AQYO 2F43G 2WLLA 3Q4HB 4X89A 2PGGA 1Z2GA 4TV8B 4JI1B 1AR1B 3ICXA 4DUZO 2WSSG 4LNUB 1ROPA 3J80N 3D36A 4G27B 1WN7A 4GX1A 2YEVA 1AI6A 1A32A 3HKEB 2A3QA 4QPJA 3OEEG 2LW1A 1HWYA 3RBZA 4Z1MG 1QHTA 2FMLA 3L72H 4GX2A 1KD1W 3ABKB 3K58A 5LP6B 1XMOO 4MVUA 4DV3B 3LSQA 1YVWA 2OTLV 1AB3A 2OCHA 5EZYB 3T1HO 3BPZA 4JI5O 1KU9A 3ZHUA 4WFFA 1AP5A 3FAVA 1SQBH 1VQ9V 4K0KB 2ZIOA 1N34O 3QG5A 4DUYO 3O9OA 3G71V 3K57A 1F51A 1WLEA 4UVCA 1KP3A 3ZHRA 4KP4A 4N21A 2WLIA 3B8MA 4EFBA 3JARB 3BVOA 3OGIB 4EFEA 2QM8A 2KKWA 2IJKA 3JASB 2HKOA 4JF3A 4LF4B 3B8NA 1XOUA 4YHHB 3DC5A 2YXYA 1YI2V 2KB1A 5JJNB 5IYDO 1BHAA 1EZVH 4JI6B 3CJHB 1OCOC 3CRCA 1F4MA 3DSQA 3K5OA 4MVRA 5JCOC 1Y74A 5LOVA 1M57C 4O4LA 1Q6HA 3OR7C 1W2BU 5IYZB 1FXHA 1V55C 5CA3A 1BSMA 5CA0B 2W6IG 4O4HA 1BZKA 2EINB 1D2DA 1NBMG 2DW4A 5JQGA 4NXMO 4PDRA 4X1YA 3R66A 2GSMB 2D2CB 4JI7O 4JI0O 4EEQA 1JOYA 4NR1A 4U3FH 4FVMA 1V54B 3VOUA 3RYCB 1HNWB 1BHBA 2EIJB 2ZQMA 3UT5A 4RQFA 4RUFA 4GX0A 4JV5O 3I56V 4BR6A 5B3SB 2JEXA 2A06H 1QR9A 4X1IB 3ZIAG 4FLUA 3CCMV 2UU9O 2EZPA 4ZIBA 3X2QC 2H3OA 4FLXA 3JCZA 5LBQA 1IBLB 3RYFB 2AW9A 4OPHA 4BWAA 5JWPA 1BT8A 4LF9B 2HJFC 2YIDA 2WLLB 2Q67A 2KSDA 4QE7A 1M93A 3K08A 5IY5B 1NH2B 2F1MA 2YEVB 2CE4A 5KHJA 4CH5A 3DGEA 4LF7B 4I7ZB 4U3JA 1PPJH 2Q0AA 1VQNV 1JMKC 2HR3A 4FIPC 2ZT9B 4UCUA 1E1QG 3JAKB 3U11A 3ZRXA 3JALB 5HFMA 1Q8IA 1H2SB 2NLJC 2ODMA 1XL4A 1K5QA 5LMUB 4B3TB 1QBZA 3CCJV 2UUBO 4K8XA 4JGSA 3FAVB 1H8HG 4X88A 3ZMTA 2LW7A 1Q3EA 1GKFA 2FYUH 3VBBA 3T4DA 2DYRB 3SYOA 2E3CA 3K3WA 1RPRA 1IXMA 5KLVH 3JD0A 2WLIB 4DR6B 3UQ8A 5JH7B 1CXZB 1WJZA 2UUAB 4Z1VA 1M4UA 1NU1H 1Y67A 5JCOA 1ZX3A 1ENVA 5J9PC 1JPXA 1H2GA 2ZE8A 5GTHZ 3FD9A 3HKBA 3QF7A 4FJCC 4G28B 2EX3A 1W0KG 1V9PA 4JZGA 1QR8A 3BY6A 3OFNG 4J10A 1Y74B 1LUWA 3N2KB 4O4LB 4DR4B 1VIBA 4JAVA 2NNUA 2BTOA 2P67A 4O4HB 4PA3A 4FLYA 1HNXO 4DV4O 1XNRO 3I5DA 4MTGA 3LNNA 3JCUZ 1J95A 1W0JG 4X1YB 3QO5A 5CBGA 4X66O 2G38A 2XT9A 5EC2C 1ORQC 4JI8B 1XMQB 2QJ1A 3UT5B 3BCCH 2OCCC 3HB3B 5EC1C 1K4DC 5EBMC 2CUGA 2ZDIC 1H2NA 1EN6A 1J5EO 3OTFA 3CXCU 1S0VA 1TUEB 3STLC 5B5EZ 4R6ZA 4O2BA 3CCVV 4J41A 2QM7A 3ZX6A 5H6RA 5LGNA 4PA7A 1VQ6V 1BQZA 4PI2A 4UCVA 2P5OA 3ZHTA 3CRQA 3RVZA 3E8FA 2XOKG 3L73H 3SPIA 3W7TA 4U3JB 1YDXA 2Q8VA 1X59A 3E8GA 4K35A 1AJNA 3WG7B 1FKAO 1JVMA 3B09A 4DV2B 3OW2U 5LHHA 1PD3A 4FFKA 4DV3O 2PI5A 4DK0A 1IVSA 3W7WA 1R3LC 4B7EA 3UO3A 2QR4A 3CRRA 5LHGA 2QWQB 3FFQA 5KA6A 5CMUA 4DW1A 4TQDA 2R72A 2XAFA 3MAQA 5BR8O 1OCOB 4MW3A 3E83A 3LSSA 4LF4O 4X9QA 4NKGB 4MTFA 3RT3C 1M57B 4FZ0A 2IBZH 4YJ2A 1JA8A 3ABMC 5IJ0B 4JI3B 3CCUV 4ZBMA 3ZRVA 1MMMA 4B3RO 2YXLA 3JYCA 2L6LA 1UJWB 1X4TA 5A2QN 4PV1B 2YS8A 3K06A 1MA1A 1R1BA 2WLKA 4LF8B 4UXNA 3S3WA 5FL7G 3LNMB 4QIWF 1KKDA 5EIBC 2PF4E 2VS0A 2VQFB 1IZ3A 1NR7A 5LMNB 1KBHA 3GWOA 3CX5F 1WA8B 2LJ2A 1PL4A 1P49A 2F95B 2HLDG 2V4DA 2AZ2A 1N36B 3X2QB 1HNWO 2IJIA 3OMAB 1JJ2U 2CH7A 5LA6A 3CSXA 3H1IH 5FNVB 4DW0A 1XEQA 5IWAB 1VF6C 3C3SA 2VRZA 1SKVA 4FK5C 3VQYA 3AK2A 3H01A 1HNZB 1K4CC 4JASA 4CZZA 4O2BB 2B9ZA 4OX9B 3OTOB 4TQFA 3WB2A 2Z3YA 2WA3A 2IU3A 1GRJA 2BTQA 1N32B 1WB8A 2YUAA 2ZINA 2GTSA 3G80A 4PA6A 3ZHSA 4LF7O 1KP2A 3WB0A 4CH4A 1JCHA 1M90W 4LNUA 3AG1C 4RAIA 1AI5A 4GT1A 1RSOB 2EILC 5KMGB 3MD0A 4H0LB 3D8CA 1THZA 4BIZA 4C7UA 3E89A 3H9VA 3N27A 1YTFB 2DQ3A 1LR1A 4NVPA 4XDJA 4LWSA 4UV9A 1IBKB 4WFAV 2FB5A 4UCSA 3ABLC 4TV9A 4NTXA 1OCZC 3IC7A 1I0HA 5A9GA 2DJVA 3LSUA 1L1FA 2ZIMA 4DR6O 5B1BC 2QWOB 2CAZC 5CA1A 2OWOA 4U7NA 5EYPA 2AHZA 2UUCB 4UFZA 4CBCA 3TJTA 2MW2B 1SF9A 4B3MO 4MS2A 1SZXA 1IURA 2X6CA 5B66Z 3ZRSA 2LP7A 1NZ6A 3CC4V 3VQVA 5HFLA 5JJJB 4R7CA 2QKCA 1SETA 1I94B 3B40A 3T4ZA 2AXTZ 3CJHA 3L74H 1E79G 4IHJB 4UB6Z 3BRCA 2IU0A 2EULA 3BHPA 1VF6A 3QTCA 4JI8O 1XMQO 4I50A 5CA0A 3UKMA 3EFFK 1QU7A 4DXWA 4QGPA 3HKDA 3F7VC 1L8DA 2CH7B 2OIEA 1OV9A 1VF5B 4X64O 1K5SA 2DOSA 2RDCA 4UB8Z 3IFXA 2UXDB 2FKXA 1EZJA 3K5MA 1M5IA 1YXBA 2BTQB 1MG1A 1SS3A 2HJDA 4XDKA 3W7SA 2RN9A 3TETA 1N33O 3TXQA 1M56C 1WP8A 2E74B 2QTSA 4IT5A 2P6JA 2JS3A 3M99B 3CMEV 4JTCB 2ZR2A 4HNAB 3SPJA 4GKKO 2R70A 3P3NA 4F6RA 5LL6Y 4YJ3A 2Q9LA 4BIUA 2WLHA 3H1HH 3JAKA 4LF5B 4LWSB 4QNHB 2EIKC 3JALA 4JI4B 1ZAUA 4TV9B 1DF4A 4LFAO 1FD9A 2YICA 4H13B 3ABMB 3K04A 3K79A 1AJQA 1GMGA 1PM9A 5CA1B 1H2KA 5EYPB 1L0NH 4MVZA 4GKJO 5B1OA 2DWDC 2Y0IA 3RW0A 2HHHO 1K33A 2W0XA 4JI3O 2YDEA 4F4LA 2YSUB 4J42A 5GONA 5JH7A 5E79Z 1XHZA 3PJSK 1NVPB 4OPAA 4I9QA 3B77A 4DV5B 2YC0A 4MTOA 4J7JA 4RQEA 1RM1C 3CCQV 4JYCA 5H5NA 3RN4A 3MHSC 3DXRA 4LF8O 3JSLA 2P4VA 3ML0A 2VQEO 2WLNA 2AHYA 1SRYA 1NI8A 4H33A 2CTQA 2WWWA 2ZR3A 3N2KA 2UXCB 2UXXA 1N36O 4LFCB 4I50B 4P9OA 3E8HA 2PUSA 3HKDB 2QM4A 2P22C 1YITV 2F66C 1MOFA 5CB4A 1VQPV 3RFRA 1GN2A 1S5LZ 2FL4A 4B3SB 4JAAA 3FB8C 1PP9H 4TUYB 4NTWA 1XHXA 4QE9A 2Y4TA 1HNZO 2QSAA 4UCOA 3CRAA 4LP8A 3HR0A 4OX9O 3OTOO 2B1GA 2CTPA 1YTFD 3EHBB 4J9YB 1R6NA 5CBFA 1PNMA 1N32O 3E86A 2ZM6O 1MSDA 3AG1B 1N4CA 1K7DA 1VQKV 2EILB 3ABTA 4J7KA 4FM2A 1QVGU 3E22A 2QKSA 4U7OA 4KFMA 3LDDA 2CDYA 3SYQA 3OGCC 3FKSG 4ZI7A 1FXKC 5C93A 4YY3B 5J2TA 3GWKC 3VQWA 4H37A 5LYJA 4L87A 4LF6B 1SA0A 3SPHA 3C3TA 2YIBA 2IH1C 2P7TC 4ASUG 1OHHG 2N74A 2WLMA 3ABLB 3F7YC 1OCZB 3L75H 1T5EA 4F6RB 3LUTB 5B1BB 1QLNA 2C2AA 2R9IA 4YJ3B 3ZRWA 2HFEC 2Q7GA 5DN6G 3T1CA 2GV9A 1IBKO 1VEWA 1GO3F 2UXBO 3OM3B 4X20A 1KC8W 5D5QA 3VQXA 2V1DA 2JVDA 3AK3A 5GONB 1IBMB 5AG2A 1KUQA 3BEHA 4Q20A 5B1AC 2H94A 4YIOA 1NQTA 3G6EV 4FM0A 3QO8A 1K8AW 1GN6A 2HG5C 1YIJV 1R3IC 3JD3A 3DXRB 1PNKA 5IJ0A 3CCEV 1I94O 2QKAA 2DYSC 4DV7B 1EBOA 4IGGA 4JYAO 1B6QA 1DLBA 1F4NA 5IYBO 3KKYA 5L3DA 2IM9A 1QCEA 1TAEA 1E1RG 2XHBA 1ZTEA 4WCEV 3B4SA 3ZCCA 3KCYA 1QVFU 5CB4B 1OCCC 4X65B 2BCCH 1WA8A 1M1KW 4WFHA 4KL1A 1GM8A 1HDJA 3BA9A 3O65A 1BMFG 4GCZA 3EVKA 1FJGB 1M56B 1G1XB 4DR5B 4WF9V 4DV0O 2L35A 5FNVA 3CHXA 1S72V 1GN4A 4TSFG 1SQQH 4JTAB 2PZSA 3TGUH 3ZHVA 4LC1A 3ZBHA 1GH6A 3E22B 1ZWIC 1VARA 4LR3A 1SERA 3ETDA 4MVMA 4ZI7B 1Q90D 1N0NA 5J2TB 4JI1O 3E35A 1NJIW 5LYJB 2X0LA 1SA0B 4JTDB 3JSNA 4JZ2A 4DR3B 1XL6A 4E2LA 1XILA 2BOBC 1AR5A 4GYCB 4FZ1A 2QWPB 1IDSA 4J80A 4J7ZA 2K9PA 5BZBA 3ZRWB 2E75B 2Y69C 1EFRG 1RSOA 4LF5O 3P30A 4JI4O 3CMAV 2A79B 2LO1A 5KMGA 4WFBV 1WNSA 4X20B 3JATA 2IW5A 1SQXH 1JX9A 1O9GA 1AP6A 1M9NA 3CWBH 5D5PA 4K0KO 2Q73A 1XBLA 5J2UA 1RM1B 1XI1A 4DR1B 3OAAG 1VQOV 4GUNA 1VP7A 1IXBA 2H8PC 3AEIA 2W0FC 4HAMA 4DV5O 4YHHO 1Q6UA 1R3JC 1V55B 2QWRB 4LH7A 4MTXA 3STZC 3THOA 4JI6O 3OUSA 3QVNA 3T1HB 4X8AA 3SPCA 1P7BA 4YXWG 3FB5C 4BW5A 3ABKC 4MT8A 1L0LH 1U97A 1MSWD 2AZ0A 2M7WA 3UCSC 1Q86W 3HPLC 3C90A 1RPOA 4IHJA 1RFYA 3HKCA 1NH2D 5IT9N 2ZDIA 1S77D 4NXNB 4DV6B 4NYKA 1QNMA 2ADQB 1K73W 4L8JA 3WB1A 3OD4A 2IJHA 3ZMUA 1FS0G 4MVSA 2GHYA 4PDLA 3ZN0A 3ZMZA 3U0ZA 1IBLO 1KKCA 2XAHA 2OT5A 4LF9O 1VQ8V 1K3EA 4NXMB 5IE9A 5LHIA 4LF6O 1XQ8A 4LFBB 4IYIA 4JI0B 3RYIA 2ITCC 3W7UA 5FLXN 4CS4A 3CC7V 3G4SV 1N0JA 2NN4A 5JVDA 3E2EA 3J7AU 1XNQB 2ZD9A 1NT2B 1DGSA 4IIJA 1NKDA 3A0HZ 3BABA 1KB9F 2E76B 4GLXA 5CN0A 2LFSA 1I5XA 3S3XA 3P3PA 2WA4A 4HNAA 1Y66A 4FLWA 4I55A 2EBOA 3JATB 5LMUO 3I55V 3OMNB 4B3TO 2RMKB 1VQMV 1ZLZA 1N8RW 5B1AB 1IX9A 5J2UB 1B04A 1JR9A 1D5NA 3OE7G 2N05A 4I4TA 2BSKA 2Q7HA 1YJNV 1I08A 5BMVA 3MDSA 2DYSB 1IBMO 2FTKA 2UUAO 2W6JG 4Q6GA 2HVKC 4JYBA 1ZL8A 3CXHF 4TT3G 3D36C 1H2MA 5JJEB 4XBFA 1PL0A 4FM1A 3L9DA 4F6EA 4E4EA 2O57A 4G2KA 3JD2A 3MHHC 2LFRA 3K9SA 1OCCB 4DV1B 2UUBB 2F4VB 5KAFZ 2XTAA 4R50A 4DR4O 5DECA 3OEHG 2ZE7A 4UUJC 4O4IA 4I0XA 4HZ3A 4WFEA 2KQXA 2OCCB 3HKCB 1BGYH 2N04A 5KUMA 3ZJZA 1KQSU 3SJAC 1B06A 1US6A 4W4LA 1FYJA 1JFFA 1COWG 4CH3A 1NTMH 1GN3A 1FJGO 4DR5O 4J11A 1SC5B 1Y4MA 3JD1A 5GW7A 3IJ4A 1MZEA 5LGTA 1EM1A 1AI7A 3DC6A 1BQ0A 4JPRA 4D7SA 1R73A 4TUYA 4XDLA 1GTOA 2B1IA 4LBEC 1GK9A 4KXRA 1FFXB 1XNRB 3APQA 3CPWU 1YJWV 1NTKH 3CE2A 3H1KH 1GM7A 1HR0B 3IGAC 3T1YB 3ZN1A 4ZOLB 3RYIB 2Y69B 2BE3A 4OXSA 3SJQC 3CD6V 3NR7A 5L3EA 5KX5A 2XASA 5JVDB 4DRXB 4IIJB 2EJRA 3D3QA 1JJOA 1VQ4V 3BFRA 3AG4C 2F93B 4DV2O 2Q0OC 1D5AA 1RP3B 4I55B 3M7MX 1KMIZ 4RWUA 1EN4A 1S5HC 4LCUC 1OCRC 5L3BA 4ABMA 2Z5UA 1I7FA 3TCUA 2QE7G 2IH3C 1S76D 4I4TB 2BSKB 2E5LB 3CP1A 4DR1O 2Q69A 5BMVB 5IJ9A 2MK3A 3K0DA 5H2FZ 4HBNA 1SESA 1HW7A 1ZL8B 2R9RB 1LNQA 3P32A 4R8CA 4BIOA 4I9WA 4O4JA 4X62B 5K1XA 2RCVA 4YIPA 5BXZA 1DF5A 2A0LA 2ZNJA 4DYLA 1S5JA 3EXAA 5KA5A 1YZBA 5TISZ 4PELA 2X6AA 3JAMN 4IL6Z 2EZOA 3IC9A 3SYPA 3L71H 3WG7C 1F23A 2DE0X 1YF2A 4QPKA 1PV0A 5EBWC 1WPBA 1AI4A 4O4IB 1TA8A 4DR7B 4I0XB 2EJ7A 2VQFO 5LMNO 3N2GA 5BR8B 1URFA 4DR2B 4CS3A 3QO7A 4TWKA 2HVJC 4NXNO 4DV6O 4FLZA 3W7XA 4ZKIA 1JFFB 1W59A 3H1JH 1EN5A 2CGOA 4UV8A 3WU2Z 2EIMC 1SQFA 4EB6B 3GB7C 3KG2A 3R65A 4B3RB 2XAJA 5IWAO 1HP8A 3U10A 3G67A 4FPPA 4IYHA 1AROP 4X1KA 4PHZA 4CC6A 1KECA 2X7RB 3AG2C 4BW9A 3BAAA 3M8AA 4RUEA 2UXNA 1SZTA 3K5NA 4Z2WA 3ETEA 2Y4UA 1NTZH 1TVKA 4LFBO 2QDOA 2Y0PA 2V7QG 4B7KA 5KX5B 4PJ0Z 1BE3H 1XNQO 4WBNA 2GBOA 1GM9A 2OTJV 1GAXA 5FPRA 2IJJA 2CTRA 3ASNC 1CP9A 3JAWA 2DMXA 1PNLA 1PKXA 4I5SA 3K59A 1DTOA 1ZSPA 2PYLA 3AG3C 2RQ6A 5H6QA 1AR4A 3F5WC 5IJ9B 3DTUB 5CBHA 3OUFA 4K3AA 2ZE5A 2YIAA 2UUCO 1F7YA 4O4JB 5DM6V 5LXTA 2NR5A 4AILC 2LGWA 2D3OW 5KHHA 5B1NA 1QLEC 5LGUA 1FAFA 2OYQA 2JK5C 1TUBA 1CEZA 1WB7A 4DV1O 5H9CA 1SQVH 2P4KA 2F4VO 2CTWA 2JIZG 3ZS8C 4W4KA 5IDJA 3A8TA 3BA8A 4N23A 1DK1A 3N2GB 3TXSA 1K97A 2ZXWC 1YJ9V 1WPXA 4KHPB 1BL8A 3OR6C 3IAYA 4B3MB 5IYCO 2JS5A 3E8BA 2ARHA 3RVYA 5EK0A 1XUQA 1K9MW 4HYOA 5LOVB 4X1KB 1NR1A 3CYOA 4UVBA 2ZNIA 5K1PA 1XDCA 4PD4F 2QTOA 3ZMVA 2UXDO 3ZHQA 4PA4A 2GUZA 5ITZA 1R3KC 3RYHA 3K5LA 5JQGB 4GZRB 4CS2A 1FXKA 1HR0O 2M6YA 3T1YO 1UFIA 1TVKB 4FFBA 3AK1A 4CH6A 3AG4B 3FB7C 2OIGA 2XAQA 1WAZA 3APOA 2YI9A 1U96A 1YSCA 4WBNB 3CCRV 2YI8A 1SQGA 2VWKA 3ASOC 2ETNA 1NS1A 4X64B 2QA4V 1OCRB 2JEUA 5F2VO 5L3GA 4KUMA 3JAWB 1I5YA 2ATKC 2EIKB 3OT7A 2A9HA 3CEIA 5EIBD 1NVPD 3LDEA 4A5UB 2YXHA 4UCTA 1R6TA 3NXSA 4FLVA 2CGNA 1VQ7V 2A7WA 3UO2A 4B08A 1VQLV 1JQ0A 3AG7A 1MABG 2JGDA 1N33B 1MNGA 4JAUA 4PA9A 4JI2B 1MZFA 2WLJA 2E5LO 1Z5VA 4AQYB 2JGUA 4K8ZA 1Y76A 4DUZB
chains in the Genus database with same CATH topology
3ZX6A 1QU7A 2CH7A 3G6BA 2CH7B 3G67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZX6 A;  1QU7 A;  2CH7 A;  3G6B A;  2CH7 B;  3G67 A; 
#chains in the Genus database with same CATH topology
 4P30 A;  5LXT B;  4X62 O;  1WP7 A;  4O2A A;  4ICG A;  2QGN A;  1TUB B;  1P84 F;  4GKK B;  3JD4 A;  3ZED A;  1FXV A;  4CC5 A;  1Q7Y W;  2Y48 A;  5FPO A;  4J9Z B;  3QNE A;  5KUK A;  4FLT A;  2Q5Z A;  1XMO B;  2AGA A;  3G6B A;  4LFA B;  5L3F A;  3B2E E;  3J81 N;  4DR7 O;  4FMT A;  1P7G A;  2EIM B;  3K03 A;  4JI5 B;  4QJF B;  4DR2 O;  2VWJ A;  2UXC O;  3OMI B;  1AJP A;  4GKJ B;  2F23 A;  5LP6 C;  1N34 B;  1Q5O A;  4LFC O;  3SJC C;  4DUY B;  3AG2 B;  1B3Q A;  3SDL A;  1FFT B;  3HKB B;  2HHH B;  2RNB A;  3GVM A;  2ITD C;  2LGQ A;  2ZE6 A;  3KZI Z;  4B3S O;  1XRE A;  3SJB C;  4NB5 A;  4DK1 A;  5KHG A;  2KG7 A;  1YEW A;  4PDM A;  2XAG A;  1YHQ V;  1OJH A;  2GUZ B;  5ITZ B;  2JJ1 G;  3RYH B;  5BY1 A;  1FXK B;  2VQE B;  3SYC A;  1H8E G;  4ZHQ A;  4FFB B;  5C8Y A;  2PI4 A;  3ASN B;  3ETQ A;  4TOI A;  2X6B A;  3F5T A;  3SGI A;  1FFX A;  4OGQ B;  4PI0 A;  2JRI A;  3H1L H;  4YY3 O;  2ZCE A;  4PDV A;  4ZOL A;  4JI7 B;  1OZ0 A;  3AG3 B;  1CPY A;  2XUM A;  1VF7 A;  2EIN C;  2DWE C;  1G4Y B;  4EKW A;  3CRM A;  3K9A A;  2JDI G;  2ILM A;  3UM7 A;  3LDC A;  4NTY A;  4WFG A;  4DRX A;  4JV5 B;  1Q82 W;  1Q43 A;  2QWN B;  2UU9 B;  2ZM6 B;  1VMG A;  2DN9 A;  1V54 C;  2Q4P A;  2JGD B;  5KHI A;  2EIJ C;  3FB6 C;  1FPO A;  1UPG A;  3SPG A;  5B3S C;  1QLE B;  1YCI A;  1BS3 A;  3A0R A;  1Y76 B;  4DO2 A;  3Q4H A;  2HEP A;  4TV8 A;  4MW8 A;  1Q6I A;  5DED A;  2LQT A;  1BCC H;  3WFV A;  1ZUQ A;  3PN1 A;  3T2M A;  5GTI Z;  3ABU A;  4O2A B;  3HKE A;  4H44 B;  2DQ0 A;  1VQ5 V;  2JJ2 G;  3CS5 A;  5IY5 C;  1KYO F;  1SQP H;  1R6K A;  3A0B Z;  2ZXW B;  2P90 A;  3TK1 A;  4MSW C;  2Z0A A;  4RO2 A;  5LP6 A;  2UXB B;  4DV7 O;  3SYA A;  5EZY A;  2Q6A A;  3ETG A;  4P2Z A;  1TGO A;  3CCL V;  1H2L A;  1G8M A;  2QEX V;  4KHP O;  4D7T A;  2RJZ A;  4AI8 A;  3ZMS A;  4YJ2 B;  1H38 A;  3CC2 V;  1QQC A;  2XND G;  2PYJ A;  1AVM A;  3RGB A;  2R9A A;  4MVQ A;  4X65 O;  3JAR A;  2YIB D;  1S3J A;  3L70 H;  3CCS V;  4BAY A;  3JAS A;  3RWR D;  4P9P A;  1Z5W A;  2DYR C;  2GTA A;  2KG7 B;  3D3I A;  2GDS A;  4UCR A;  4MVO A;  4EB6 A;  4JYA B;  1G6U A;  2Q68 A;  5L3C A;  3ASO B;  4ZHQ B;  5C8Y B;  3A2F A;  3K0G A;  1LUV A;  5IYZ A;  1K92 A;  3SR2 C;  2P06 A;  1HNX B;  4DV4 B;  2BOC C;  4GX5 A;  5E1A C;  3CB2 A;  2PTM A;  5LA6 B;  2K1E A;  1Y6X A;  5EBL C;  1O9H A;  1Q81 W;  4X66 B;  1P4R A;  4LH6 A;  2B5U A;  4DR3 O;  4AHC A;  2ADP A;  4UVA A;  3RYC A;  2WPD G;  2ZKO A;  2HP8 A;  2CK3 G;  1K34 A;  4JYY A;  4DV0 B;  5KHK A;  4X1I A;  4D6T H;  1J5E B;  5KAI Z;  2WAM A;  3FX7 A;  3KCX A;  3FYI B;  2PY5 A;  4JI2 O;  3RYF A;  3FYE B;  2Q7E A;  1AIL A;  4AQY O;  2F43 G;  2WLL A;  3Q4H B;  4X89 A;  2PGG A;  1Z2G A;  4TV8 B;  4JI1 B;  1AR1 B;  3ICX A;  4DUZ O;  2WSS G;  4LNU B;  1ROP A;  3J80 N;  3D36 A;  4G27 B;  1WN7 A;  4GX1 A;  2YEV A;  1AI6 A;  1A32 A;  3HKE B;  2A3Q A;  4QPJ A;  3OEE G;  2LW1 A;  1HWY A;  3RBZ A;  4Z1M G;  1QHT A;  2FML A;  3L72 H;  4GX2 A;  1KD1 W;  3ABK B;  3K58 A;  5LP6 B;  1XMO O;  4MVU A;  4DV3 B;  3LSQ A;  1YVW A;  2OTL V;  1AB3 A;  2OCH A;  5EZY B;  3T1H O;  3BPZ A;  4JI5 O;  1KU9 A;  3ZHU A;  4WFF A;  1AP5 A;  3FAV A;  1SQB H;  1VQ9 V;  4K0K B;  2ZIO A;  1N34 O;  3QG5 A;  4DUY O;  3O9O A;  3G71 V;  3K57 A;  1F51 A;  1WLE A;  4UVC A;  1KP3 A;  3ZHR A;  4KP4 A;  4N21 A;  2WLI A;  3B8M A;  4EFB A;  3JAR B;  3BVO A;  3OGI B;  4EFE A;  2QM8 A;  2KKW A;  2IJK A;  3JAS B;  2HKO A;  4JF3 A;  4LF4 B;  3B8N A;  1XOU A;  4YHH B;  3DC5 A;  2YXY A;  1YI2 V;  2KB1 A;  5JJN B;  5IYD O;  1BHA A;  1EZV H;  4JI6 B;  3CJH B;  1OCO C;  3CRC A;  1F4M A;  3DSQ A;  3K5O A;  4MVR A;  5JCO C;  1Y74 A;  5LOV A;  1M57 C;  4O4L A;  1Q6H A;  3OR7 C;  1W2B U;  5IYZ B;  1FXH A;  1V55 C;  5CA3 A;  1BSM A;  5CA0 B;  2W6I G;  4O4H A;  1BZK A;  2EIN B;  1D2D A;  1NBM G;  2DW4 A;  5JQG A;  4NXM O;  4PDR A;  4X1Y A;  3R66 A;  2GSM B;  2D2C B;  4JI7 O;  4JI0 O;  4EEQ A;  1JOY A;  4NR1 A;  4U3F H;  4FVM A;  1V54 B;  3VOU A;  3RYC B;  1HNW B;  1BHB A;  2EIJ B;  2ZQM A;  3UT5 A;  4RQF A;  4RUF A;  4GX0 A;  4JV5 O;  3I56 V;  4BR6 A;  5B3S B;  2JEX A;  2A06 H;  1QR9 A;  4X1I B;  3ZIA G;  4FLU A;  3CCM V;  2UU9 O;  2EZP A;  4ZIB A;  3X2Q C;  2H3O A;  4FLX A;  3JCZ A;  5LBQ A;  1IBL B;  3RYF B;  2AW9 A;  4OPH A;  4BWA A;  5JWP A;  1BT8 A;  4LF9 B;  2HJF C;  2YID A;  2WLL B;  2Q67 A;  2KSD A;  4QE7 A;  1M93 A;  3K08 A;  5IY5 B;  1NH2 B;  2F1M A;  2YEV B;  2CE4 A;  5KHJ A;  4CH5 A;  3DGE A;  4LF7 B;  4I7Z B;  4U3J A;  1PPJ H;  2Q0A A;  1VQN V;  1JMK C;  2HR3 A;  4FIP C;  2ZT9 B;  4UCU A;  1E1Q G;  3JAK B;  3U11 A;  3ZRX A;  3JAL B;  5HFM A;  1Q8I A;  1H2S B;  2NLJ C;  2ODM A;  1XL4 A;  1K5Q A;  5LMU B;  4B3T B;  1QBZ A;  3CCJ V;  2UUB O;  4K8X A;  4JGS A;  3FAV B;  1H8H G;  4X88 A;  3ZMT A;  2LW7 A;  1Q3E A;  1GKF A;  2FYU H;  3VBB A;  3T4D A;  2DYR B;  3SYO A;  2E3C A;  3K3W A;  1RPR A;  1IXM A;  5KLV H;  3JD0 A;  2WLI B;  4DR6 B;  3UQ8 A;  5JH7 B;  1CXZ B;  1WJZ A;  2UUA B;  4Z1V A;  1M4U A;  1NU1 H;  1Y67 A;  5JCO A;  1ZX3 A;  1ENV A;  5J9P C;  1JPX A;  1H2G A;  2ZE8 A;  5GTH Z;  3FD9 A;  3HKB A;  3QF7 A;  4FJC C;  4G28 B;  2EX3 A;  1W0K G;  1V9P A;  4JZG A;  1QR8 A;  3BY6 A;  3OFN G;  4J10 A;  1Y74 B;  1LUW A;  3N2K B;  4O4L B;  4DR4 B;  1VIB A;  4JAV A;  2NNU A;  2BTO A;  2P67 A;  4O4H B;  4PA3 A;  4FLY A;  1HNX O;  4DV4 O;  1XNR O;  3I5D A;  4MTG A;  3LNN A;  3JCU Z;  1J95 A;  1W0J G;  4X1Y B;  3QO5 A;  5CBG A;  4X66 O;  2G38 A;  2XT9 A;  5EC2 C;  1ORQ C;  4JI8 B;  1XMQ B;  2QJ1 A;  3UT5 B;  3BCC H;  2OCC C;  3HB3 B;  5EC1 C;  1K4D C;  5EBM C;  2CUG A;  2ZDI C;  1H2N A;  1EN6 A;  1J5E O;  3OTF A;  3CXC U;  1S0V A;  1TUE B;  3STL C;  5B5E Z;  4R6Z A;  4O2B A;  3CCV V;  4J41 A;  2QM7 A;  3ZX6 A;  5H6R A;  5LGN A;  4PA7 A;  1VQ6 V;  1BQZ A;  4PI2 A;  4UCV A;  2P5O A;  3ZHT A;  3CRQ A;  3RVZ A;  3E8F A;  2XOK G;  3L73 H;  3SPI A;  3W7T A;  4U3J B;  1YDX A;  2Q8V A;  1X59 A;  3E8G A;  4K35 A;  1AJN A;  3WG7 B;  1FKA O;  1JVM A;  3B09 A;  4DV2 B;  3OW2 U;  5LHH A;  1PD3 A;  4FFK A;  4DV3 O;  2PI5 A;  4DK0 A;  1IVS A;  3W7W A;  1R3L C;  4B7E A;  3UO3 A;  2QR4 A;  3CRR A;  5LHG A;  2QWQ B;  3FFQ A;  5KA6 A;  5CMU A;  4DW1 A;  4TQD A;  2R72 A;  2XAF A;  3MAQ A;  5BR8 O;  1OCO B;  4MW3 A;  3E83 A;  3LSS A;  4LF4 O;  4X9Q A;  4NKG B;  4MTF A;  3RT3 C;  1M57 B;  4FZ0 A;  2IBZ H;  4YJ2 A;  1JA8 A;  3ABM C;  5IJ0 B;  4JI3 B;  3CCU V;  4ZBM A;  3ZRV A;  1MMM A;  4B3R O;  2YXL A;  3JYC A;  2L6L A;  1UJW B;  1X4T A;  5A2Q N;  4PV1 B;  2YS8 A;  3K06 A;  1MA1 A;  1R1B A;  2WLK A;  4LF8 B;  4UXN A;  3S3W A;  5FL7 G;  3LNM B;  4QIW F;  1KKD A;  5EIB C;  2PF4 E;  2VS0 A;  2VQF B;  1IZ3 A;  1NR7 A;  5LMN B;  1KBH A;  3GWO A;  3CX5 F;  1WA8 B;  2LJ2 A;  1PL4 A;  1P49 A;  2F95 B;  2HLD G;  2V4D A;  2AZ2 A;  1N36 B;  3X2Q B;  1HNW O;  2IJI A;  3OMA B;  1JJ2 U;  2CH7 A;  5LA6 A;  3CSX A;  3H1I H;  5FNV B;  4DW0 A;  1XEQ A;  5IWA B;  1VF6 C;  3C3S A;  2VRZ A;  1SKV A;  4FK5 C;  3VQY A;  3AK2 A;  3H01 A;  1HNZ B;  1K4C C;  4JAS A;  4CZZ A;  4O2B B;  2B9Z A;  4OX9 B;  3OTO B;  4TQF A;  3WB2 A;  2Z3Y A;  2WA3 A;  2IU3 A;  1GRJ A;  2BTQ A;  1N32 B;  1WB8 A;  2YUA A;  2ZIN A;  2GTS A;  3G80 A;  4PA6 A;  3ZHS A;  4LF7 O;  1KP2 A;  3WB0 A;  4CH4 A;  1JCH A;  1M90 W;  4LNU A;  3AG1 C;  4RAI A;  1AI5 A;  4GT1 A;  1RSO B;  2EIL C;  5KMG B;  3MD0 A;  4H0L B;  3D8C A;  1THZ A;  4BIZ A;  4C7U A;  3E89 A;  3H9V A;  3N27 A;  1YTF B;  2DQ3 A;  1LR1 A;  4NVP A;  4XDJ A;  4LWS A;  4UV9 A;  1IBK B;  4WFA V;  2FB5 A;  4UCS A;  3ABL C;  4TV9 A;  4NTX A;  1OCZ C;  3IC7 A;  1I0H A;  5A9G A;  2DJV A;  3LSU A;  1L1F A;  2ZIM A;  4DR6 O;  5B1B C;  2QWO B;  2CAZ C;  5CA1 A;  2OWO A;  4U7N A;  5EYP A;  2AHZ A;  2UUC B;  4UFZ A;  4CBC A;  3TJT A;  2MW2 B;  1SF9 A;  4B3M O;  4MS2 A;  1SZX A;  1IUR A;  2X6C A;  5B66 Z;  3ZRS A;  2LP7 A;  1NZ6 A;  3CC4 V;  3VQV A;  5HFL A;  5JJJ B;  4R7C A;  2QKC A;  1SET A;  1I94 B;  3B40 A;  3T4Z A;  2AXT Z;  3CJH A;  3L74 H;  1E79 G;  4IHJ B;  4UB6 Z;  3BRC A;  2IU0 A;  2EUL A;  3BHP A;  1VF6 A;  3QTC A;  4JI8 O;  1XMQ O;  4I50 A;  5CA0 A;  3UKM A;  3EFF K;  1QU7 A;  4DXW A;  4QGP A;  3HKD A;  3F7V C;  1L8D A;  2CH7 B;  2OIE A;  1OV9 A;  1VF5 B;  4X64 O;  1K5S A;  2DOS A;  2RDC A;  4UB8 Z;  3IFX A;  2UXD B;  2FKX A;  1EZJ A;  3K5M A;  1M5I A;  1YXB A;  2BTQ B;  1MG1 A;  1SS3 A;  2HJD A;  4XDK A;  3W7S A;  2RN9 A;  3TET A;  1N33 O;  3TXQ A;  1M56 C;  1WP8 A;  2E74 B;  2QTS A;  4IT5 A;  2P6J A;  2JS3 A;  3M99 B;  3CME V;  4JTC B;  2ZR2 A;  4HNA B;  3SPJ A;  4GKK O;  2R70 A;  3P3N A;  4F6R A;  5LL6 Y;  4YJ3 A;  2Q9L A;  4BIU A;  2WLH A;  3H1H H;  3JAK A;  4LF5 B;  4LWS B;  4QNH B;  2EIK C;  3JAL A;  4JI4 B;  1ZAU A;  4TV9 B;  1DF4 A;  4LFA O;  1FD9 A;  2YIC A;  4H13 B;  3ABM B;  3K04 A;  3K79 A;  1AJQ A;  1GMG A;  1PM9 A;  5CA1 B;  1H2K A;  5EYP B;  1L0N H;  4MVZ A;  4GKJ O;  5B1O A;  2DWD C;  2Y0I A;  3RW0 A;  2HHH O;  1K33 A;  2W0X A;  4JI3 O;  2YDE A;  4F4L A;  2YSU B;  4J42 A;  5GON A;  5JH7 A;  5E79 Z;  1XHZ A;  3PJS K;  1NVP B;  4OPA A;  4I9Q A;  3B77 A;  4DV5 B;  2YC0 A;  4MTO A;  4J7J A;  4RQE A;  1RM1 C;  3CCQ V;  4JYC A;  5H5N A;  3RN4 A;  3MHS C;  3DXR A;  4LF8 O;  3JSL A;  2P4V A;  3ML0 A;  2VQE O;  2WLN A;  2AHY A;  1SRY A;  1NI8 A;  4H33 A;  2CTQ A;  2WWW A;  2ZR3 A;  3N2K A;  2UXC B;  2UXX A;  1N36 O;  4LFC B;  4I50 B;  4P9O A;  3E8H A;  2PUS A;  3HKD B;  2QM4 A;  2P22 C;  1YIT V;  2F66 C;  1MOF A;  5CB4 A;  1VQP V;  3RFR A;  1GN2 A;  1S5L Z;  2FL4 A;  4B3S B;  4JAA A;  3FB8 C;  1PP9 H;  4TUY B;  4NTW A;  1XHX A;  4QE9 A;  2Y4T A;  1HNZ O;  2QSA A;  4UCO A;  3CRA A;  4LP8 A;  3HR0 A;  4OX9 O;  3OTO O;  2B1G A;  2CTP A;  1YTF D;  3EHB B;  4J9Y B;  1R6N A;  5CBF A;  1PNM A;  1N32 O;  3E86 A;  2ZM6 O;  1MSD A;  3AG1 B;  1N4C A;  1K7D A;  1VQK V;  2EIL B;  3ABT A;  4J7K A;  4FM2 A;  1QVG U;  3E22 A;  2QKS A;  4U7O A;  4KFM A;  3LDD A;  2CDY A;  3SYQ A;  3OGC C;  3FKS G;  4ZI7 A;  1FXK C;  5C93 A;  4YY3 B;  5J2T A;  3GWK C;  3VQW A;  4H37 A;  5LYJ A;  4L87 A;  4LF6 B;  1SA0 A;  3SPH A;  3C3T A;  2YIB A;  2IH1 C;  2P7T C;  4ASU G;  1OHH G;  2N74 A;  2WLM A;  3ABL B;  3F7Y C;  1OCZ B;  3L75 H;  1T5E A;  4F6R B;  3LUT B;  5B1B B;  1QLN A;  2C2A A;  2R9I A;  4YJ3 B;  3ZRW A;  2HFE C;  2Q7G A;  5DN6 G;  3T1C A;  2GV9 A;  1IBK O;  1VEW A;  1GO3 F;  2UXB O;  3OM3 B;  4X20 A;  1KC8 W;  5D5Q A;  3VQX A;  2V1D A;  2JVD A;  3AK3 A;  5GON B;  1IBM B;  5AG2 A;  1KUQ A;  3BEH A;  4Q20 A;  5B1A C;  2H94 A;  4YIO A;  1NQT A;  3G6E V;  4FM0 A;  3QO8 A;  1K8A W;  1GN6 A;  2HG5 C;  1YIJ V;  1R3I C;  3JD3 A;  3DXR B;  1PNK A;  5IJ0 A;  3CCE V;  1I94 O;  2QKA A;  2DYS C;  4DV7 B;  1EBO A;  4IGG A;  4JYA O;  1B6Q A;  1DLB A;  1F4N A;  5IYB O;  3KKY A;  5L3D A;  2IM9 A;  1QCE A;  1TAE A;  1E1R G;  2XHB A;  1ZTE A;  4WCE V;  3B4S A;  3ZCC A;  3KCY A;  1QVF U;  5CB4 B;  1OCC C;  4X65 B;  2BCC H;  1WA8 A;  1M1K W;  4WFH A;  4KL1 A;  1GM8 A;  1HDJ A;  3BA9 A;  3O65 A;  1BMF G;  4GCZ A;  3EVK A;  1FJG B;  1M56 B;  1G1X B;  4DR5 B;  4WF9 V;  4DV0 O;  2L35 A;  5FNV A;  3CHX A;  1S72 V;  1GN4 A;  4TSF G;  1SQQ H;  4JTA B;  2PZS A;  3TGU H;  3ZHV A;  4LC1 A;  3ZBH A;  1GH6 A;  3E22 B;  1ZWI C;  1VAR A;  4LR3 A;  1SER A;  3ETD A;  4MVM A;  4ZI7 B;  1Q90 D;  1N0N A;  5J2T B;  4JI1 O;  3E35 A;  1NJI W;  5LYJ B;  2X0L A;  1SA0 B;  4JTD B;  3JSN A;  4JZ2 A;  4DR3 B;  1XL6 A;  4E2L A;  1XIL A;  2BOB C;  1AR5 A;  4GYC B;  4FZ1 A;  2QWP B;  1IDS A;  4J80 A;  4J7Z A;  2K9P A;  5BZB A;  3ZRW B;  2E75 B;  2Y69 C;  1EFR G;  1RSO A;  4LF5 O;  3P30 A;  4JI4 O;  3CMA V;  2A79 B;  2LO1 A;  5KMG A;  4WFB V;  1WNS A;  4X20 B;  3JAT A;  2IW5 A;  1SQX H;  1JX9 A;  1O9G A;  1AP6 A;  1M9N A;  3CWB H;  5D5P A;  4K0K O;  2Q73 A;  1XBL A;  5J2U A;  1RM1 B;  1XI1 A;  4DR1 B;  3OAA G;  1VQO V;  4GUN A;  1VP7 A;  1IXB A;  2H8P C;  3AEI A;  2W0F C;  4HAM A;  4DV5 O;  4YHH O;  1Q6U A;  1R3J C;  1V55 B;  2QWR B;  4LH7 A;  4MTX A;  3STZ C;  3THO A;  4JI6 O;  3OUS A;  3QVN A;  3T1H B;  4X8A A;  3SPC A;  1P7B A;  4YXW G;  3FB5 C;  4BW5 A;  3ABK C;  4MT8 A;  1L0L H;  1U97 A;  1MSW D;  2AZ0 A;  2M7W A;  3UCS C;  1Q86 W;  3HPL C;  3C90 A;  1RPO A;  4IHJ A;  1RFY A;  3HKC A;  1NH2 D;  5IT9 N;  2ZDI A;  1S77 D;  4NXN B;  4DV6 B;  4NYK A;  1QNM A;  2ADQ B;  1K73 W;  4L8J A;  3WB1 A;  3OD4 A;  2IJH A;  3ZMU A;  1FS0 G;  4MVS A;  2GHY A;  4PDL A;  3ZN0 A;  3ZMZ A;  3U0Z A;  1IBL O;  1KKC A;  2XAH A;  2OT5 A;  4LF9 O;  1VQ8 V;  1K3E A;  4NXM B;  5IE9 A;  5LHI A;  4LF6 O;  1XQ8 A;  4LFB B;  4IYI A;  4JI0 B;  3RYI A;  2ITC C;  3W7U A;  5FLX N;  4CS4 A;  3CC7 V;  3G4S V;  1N0J A;  2NN4 A;  5JVD A;  3E2E A;  3J7A U;  1XNQ B;  2ZD9 A;  1NT2 B;  1DGS A;  4IIJ A;  1NKD A;  3A0H Z;  3BAB A;  1KB9 F;  2E76 B;  4GLX A;  5CN0 A;  2LFS A;  1I5X A;  3S3X A;  3P3P A;  2WA4 A;  4HNA A;  1Y66 A;  4FLW A;  4I55 A;  2EBO A;  3JAT B;  5LMU O;  3I55 V;  3OMN B;  4B3T O;  2RMK B;  1VQM V;  1ZLZ A;  1N8R W;  5B1A B;  1IX9 A;  5J2U B;  1B04 A;  1JR9 A;  1D5N A;  3OE7 G;  2N05 A;  4I4T A;  2BSK A;  2Q7H A;  1YJN V;  1I08 A;  5BMV A;  3MDS A;  2DYS B;  1IBM O;  2FTK A;  2UUA O;  2W6J G;  4Q6G A;  2HVK C;  4JYB A;  1ZL8 A;  3CXH F;  4TT3 G;  3D36 C;  1H2M A;  5JJE B;  4XBF A;  1PL0 A;  4FM1 A;  3L9D A;  4F6E A;  4E4E A;  2O57 A;  4G2K A;  3JD2 A;  3MHH C;  2LFR A;  3K9S A;  1OCC B;  4DV1 B;  2UUB B;  2F4V B;  5KAF Z;  2XTA A;  4R50 A;  4DR4 O;  5DEC A;  3OEH G;  2ZE7 A;  4UUJ C;  4O4I A;  4I0X A;  4HZ3 A;  4WFE A;  2KQX A;  2OCC B;  3HKC B;  1BGY H;  2N04 A;  5KUM A;  3ZJZ A;  1KQS U;  3SJA C;  1B06 A;  1US6 A;  4W4L A;  1FYJ A;  1JFF A;  1COW G;  4CH3 A;  1NTM H;  1GN3 A;  1FJG O;  4DR5 O;  4J11 A;  1SC5 B;  1Y4M A;  3JD1 A;  5GW7 A;  3IJ4 A;  1MZE A;  5LGT A;  1EM1 A;  1AI7 A;  3DC6 A;  1BQ0 A;  4JPR A;  4D7S A;  1R73 A;  4TUY A;  4XDL A;  1GTO A;  2B1I A;  4LBE C;  1GK9 A;  4KXR A;  1FFX B;  1XNR B;  3APQ A;  3CPW U;  1YJW V;  1NTK H;  3CE2 A;  3H1K H;  1GM7 A;  1HR0 B;  3IGA C;  3T1Y B;  3ZN1 A;  4ZOL B;  3RYI B;  2Y69 B;  2BE3 A;  4OXS A;  3SJQ C;  3CD6 V;  3NR7 A;  5L3E A;  5KX5 A;  2XAS A;  5JVD B;  4DRX B;  4IIJ B;  2EJR A;  3D3Q A;  1JJO A;  1VQ4 V;  3BFR A;  3AG4 C;  2F93 B;  4DV2 O;  2Q0O C;  1D5A A;  1RP3 B;  4I55 B;  3M7M X;  1KMI Z;  4RWU A;  1EN4 A;  1S5H C;  4LCU C;  1OCR C;  5L3B A;  4ABM A;  2Z5U A;  1I7F A;  3TCU A;  2QE7 G;  2IH3 C;  1S76 D;  4I4T B;  2BSK B;  2E5L B;  3CP1 A;  4DR1 O;  2Q69 A;  5BMV B;  5IJ9 A;  2MK3 A;  3K0D A;  5H2F Z;  4HBN A;  1SES A;  1HW7 A;  1ZL8 B;  2R9R B;  1LNQ A;  3P32 A;  4R8C A;  4BIO A;  4I9W A;  4O4J A;  4X62 B;  5K1X A;  2RCV A;  4YIP A;  5BXZ A;  1DF5 A;  2A0L A;  2ZNJ A;  4DYL A;  1S5J A;  3EXA A;  5KA5 A;  1YZB A;  5TIS Z;  4PEL A;  2X6A A;  3JAM N;  4IL6 Z;  2EZO A;  3IC9 A;  3SYP A;  3L71 H;  3WG7 C;  1F23 A;  2DE0 X;  1YF2 A;  4QPK A;  1PV0 A;  5EBW C;  1WPB A;  1AI4 A;  4O4I B;  1TA8 A;  4DR7 B;  4I0X B;  2EJ7 A;  2VQF O;  5LMN O;  3N2G A;  5BR8 B;  1URF A;  4DR2 B;  4CS3 A;  3QO7 A;  4TWK A;  2HVJ C;  4NXN O;  4DV6 O;  4FLZ A;  3W7X A;  4ZKI A;  1JFF B;  1W59 A;  3H1J H;  1EN5 A;  2CGO A;  4UV8 A;  3WU2 Z;  2EIM C;  1SQF A;  4EB6 B;  3GB7 C;  3KG2 A;  3R65 A;  4B3R B;  2XAJ A;  5IWA O;  1HP8 A;  3U10 A;  3G67 A;  4FPP A;  4IYH A;  1ARO P;  4X1K A;  4PHZ A;  4CC6 A;  1KEC A;  2X7R B;  3AG2 C;  4BW9 A;  3BAA A;  3M8A A;  4RUE A;  2UXN A;  1SZT A;  3K5N A;  4Z2W A;  3ETE A;  2Y4U A;  1NTZ H;  1TVK A;  4LFB O;  2QDO A;  2Y0P A;  2V7Q G;  4B7K A;  5KX5 B;  4PJ0 Z;  1BE3 H;  1XNQ O;  4WBN A;  2GBO A;  1GM9 A;  2OTJ V;  1GAX A;  5FPR A;  2IJJ A;  2CTR A;  3ASN C;  1CP9 A;  3JAW A;  2DMX A;  1PNL A;  1PKX A;  4I5S A;  3K59 A;  1DTO A;  1ZSP A;  2PYL A;  3AG3 C;  2RQ6 A;  5H6Q A;  1AR4 A;  3F5W C;  5IJ9 B;  3DTU B;  5CBH A;  3OUF A;  4K3A A;  2ZE5 A;  2YIA A;  2UUC O;  1F7Y A;  4O4J B;  5DM6 V;  5LXT A;  2NR5 A;  4AIL C;  2LGW A;  2D3O W;  5KHH A;  5B1N A;  1QLE C;  5LGU A;  1FAF A;  2OYQ A;  2JK5 C;  1TUB A;  1CEZ A;  1WB7 A;  4DV1 O;  5H9C A;  1SQV H;  2P4K A;  2F4V O;  2CTW A;  2JIZ G;  3ZS8 C;  4W4K A;  5IDJ A;  3A8T A;  3BA8 A;  4N23 A;  1DK1 A;  3N2G B;  3TXS A;  1K97 A;  2ZXW C;  1YJ9 V;  1WPX A;  4KHP B;  1BL8 A;  3OR6 C;  3IAY A;  4B3M B;  5IYC O;  2JS5 A;  3E8B A;  2ARH A;  3RVY A;  5EK0 A;  1XUQ A;  1K9M W;  4HYO A;  5LOV B;  4X1K B;  1NR1 A;  3CYO A;  4UVB A;  2ZNI A;  5K1P A;  1XDC A;  4PD4 F;  2QTO A;  3ZMV A;  2UXD O;  3ZHQ A;  4PA4 A;  2GUZ A;  5ITZ A;  1R3K C;  3RYH A;  3K5L A;  5JQG B;  4GZR B;  4CS2 A;  1FXK A;  1HR0 O;  2M6Y A;  3T1Y O;  1UFI A;  1TVK B;  4FFB A;  3AK1 A;  4CH6 A;  3AG4 B;  3FB7 C;  2OIG A;  2XAQ A;  1WAZ A;  3APO A;  2YI9 A;  1U96 A;  1YSC A;  4WBN B;  3CCR V;  2YI8 A;  1SQG A;  2VWK A;  3ASO C;  2ETN A;  1NS1 A;  4X64 B;  2QA4 V;  1OCR B;  2JEU A;  5F2V O;  5L3G A;  4KUM A;  3JAW B;  1I5Y A;  2ATK C;  2EIK B;  3OT7 A;  2A9H A;  3CEI A;  5EIB D;  1NVP D;  3LDE A;  4A5U B;  2YXH A;  4UCT A;  1R6T A;  3NXS A;  4FLV A;  2CGN A;  1VQ7 V;  2A7W A;  3UO2 A;  4B08 A;  1VQL V;  1JQ0 A;  3AG7 A;  1MAB G;  2JGD A;  1N33 B;  1MNG A;  4JAU A;  4PA9 A;  4JI2 B;  1MZF A;  2WLJ A;  2E5L O;  1Z5V A;  4AQY B;  2JGU A;  4K8Z A;  1Y76 A;  4DUZ B; 
#chains in the Genus database with same CATH homology
 3ZX6 A;  1QU7 A;  2CH7 A;  3G6B A;  2CH7 B;  3G67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...