3ZX6A

Structure of hamp(af1503)-tsr fusion - hamp (a291v) mutant
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
303
structure length
303
Chain Sequence
TITRPIIELSNTVDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling
molecule keywords HAMP, METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
publication title Axial Helix Rotation as a Mechanism for Signal Regulation Inferred from the Crystallographic Analysis of the E. Coli Serine Chemoreceptor.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 149
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00015 MCPsignal Methyl-accepting chemotaxis protein (MCP) signalling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.950 Mainly Alpha Orthogonal Bundle Helix Hairpins Methyl-accepting chemotaxis protein 3zx6A00
2CH7A 3ZX6A 1QU7A 3G67A 3G6BA 2CH7B
chains in the Genus database with same CATH superfamily
3AK1A 3CRCA 1KECA 2LQTA 1UFIA 1R6NA 1W59A 4RUEA 1CP9A 1NVPB 2X6AA 2WA3A 2QWPB 1RSOA 2PY5A 5D5QA 4CS4A 4WBNB 2A79B 3D3IA 3SPIA 4Z1VA 2QSAA 4TT3G 2Y4TA 3AG3B 3JD2A 5CBHA 4LF4B 2B9ZA 1J5EB 4QNHB 3OUSA 2Q7GA 5LP6C 3AEIA 2QM4A 1XMOB 4PDVA 2OCCC 2ZE7A 4NXNB 1XHZA 2ADQB 2EZPA 2BTQA 1H8HG 3M7MX 4MVRA 1AJPA 1K73W 2IJHA 4ZI7A 1NBMG 3D36A 1Y6XA 4O4LB 3ZHRA 2KQXA 3TETA 1S0VA 4OXSA 2Q67A 4ZHQA 2M6YA 4IHJB 3CCMV 2RDCA 3CRAA 4C7UA 4I7ZB 3K79A 4BWAA 3CYOA 1DK1A 4MVMA 4X66O 2HG5C 3HKDB 3UT5A 1JOYA 1WA8A 1W2BU 2WLIA 3L72H 3CCVV 1SQPH 2PI4A 4XDLA 2VWJA 4O4HA 2UUBB 4EKWA 5CA0B 1QR8A 2Q7HA 4AI8A 2JRIA 2JGDB 3CCUV 2YIBD 1N34O 2Y69B 1GM8A 4B7KA 2VS0A 4X89A 4UCSA 4HAMA 1SZXA 4JI8B 3SJCC 2BSKB 3B09A 4J10A 2EILC 1B06A 3ZRXA 1HP8A 1R3IC 1FD9A 1LUVA 3C90A 2OT5A 3SDLA 4E2LA 3GB7C 5FNVB 5KUKA 4BIUA 3UO3A 5KA5A 3LUTB 4LF5O 4GX5A 1JFFA 5EZYA 3B40A 5LHIA 1AILA 4CS3A 1TUEB 3ZBHA 2BCCH 4I4TB 4JI4O 3HB3B 4I0XA 4UCUA 1OZ0A 4U3JA 5ITZA 2GHYA 4DV4B 1N8RW 4HBNA 4KUMA 5KA6A 4J9ZB 4FLXA 5IYZA 4DR2B 4WFBV 3IFXA 1K5SA 2K9PA 1OCRB 3I56V 1VQ8V 1OCOC 3GVMA 2ZM6O 3OMIB 2YI9A 3TXSA 4PI2A 2UUAO 1K5QA 1Y67A 1VQMV 2QDOA 5BXZA 4JI1O 1M57C 1RSOB 4GX1A 2XHBA 3G67A 3ZN0A 1GTOA 1M5IA 4CS2A 4RQEA 5DECA 3B8MA 4D7TA 3NR7A 3EXAA 1IBLB 4KL1A 3RYCA 3JSNA 1YI2V 3RT3C 5CA1A 1AB3A 4DR1B 3A0RA 4P9PA 2H94A 4JTAB 1VQKV 4ZOLA 1XQ8A 4I9WA 3SGIA 4JYAB 5LL6Y 5L3DA 4GKKB 4J41A 3RWRD 3GWKC 3Q4HA 3T1CA 4YHHB 3J7AU 2DYRC 2BTQB 2XAGA 3VQWA 3J81N 2GV9A 1VEWA 4JV5B 2BOCC 1LUWA 4ZI7B 3QTCA 5IE9A 5IJ0A 2XAHA 2D2CB 4R8CA 5A9GA 5E1AC 3OGIB 4YY3O 4ZHQB 4X62B 3IC9A 2XAQA 2A06H 1K33A 1EZJA 1YEWA 2ZT9B 5LGUA 5B66Z 4X64O 2YC0A 2KG7A 4BIZA 4GKJB 3F5TA 4PDRA 1YZBA 4MW8A 2CK3G 3ABLB 1XREA 3O65A 3UT5B 3KCXA 1DF4A 3OW2U 1XNRO 1WA8B 2RNBA 5CA3A 2WLIB 4DR5B 4O4HB 1ORQC 2Z3YA 4U7NA 4O4IA 3L71H 2MK3A 1XMQO 4KP4A 1AJQA 1NTMH 3CS5A 1MNGA 3SPGA 1AI6A 5B1BC 1TVKA 1W0KG 3RYFA 3L74H 1H2NA 1ROPA 1RFYA 1P7GA 2Q6AA 3WG7B 3K5MA 2G38A 1JFFB 5EZYB 1IURA 2R9IA 1FXKC 2EIMC 4EB6A 1HNXB 4FLWA 2B1GA 3T1HO 2V1DA 4JI3B 4I0XB 1SRYA 1SQVH 1HR0O 4UFZA 4U3JB 5ITZB 2QWOB 1YHQV 2Q68A 4DR4B 5IYZB 4LFBB 3C3SA 1QQCA 3BVOA 2Y0IA 4DR6B 1WJZA 1K4DC 3ZN1A 4DR3B 4LFAO 2P5OA 2LGQA 2XAFA 5J2TA 3W7SA 5CBGA 3X2QC 2HR3A 1KBHA 2EBOA 1Q82W 1JA8A 1TAEA 1RM1B 1I94O 5KHGA 3STLC 3E8BA 5B1NA 4DV3O 3LNNA 2Q5ZA 1Q43A 4WFAV 3RYCB 2WLMA 5CA1B 3QNEA 1IZ3A 4F6RA 1FFTB 2QTOA 4ZOLB 3PJSK 2IJIA 1OCCC 4JPRA 4JGSA 5JJJB 1M9NA 2K1EA 3D3QA 3SPHA 4JI5B 1QR9A 4DV2B 1KMIZ 3CXHF 3U0ZA 5B5EZ 2L6LA 3Q4HB 1ZUQA 3RYHA 1IVSA 2OIEA 2L35A 1M56C 3AG4B 2GUZA 3ZRWA 5IJ0B 4NB5A 1KC8W 2JJ1G 4B3MO 3B4SA 1IBMB 3CWBH 4LF7O 2UU9B 1ENVA 4PA4A 2ITDC 4PD4F 5IYCO 3AK2A 2KG7B 2HJFC 4IL6Z 2AHZA 2H3OA 3QF7A 3ETDA 4BAYA 4IIJA 2CAZC 1VMGA 3AG1B 1I7FA 3CJHA 3SYAA 2Q8VA 3JAKA 2E74B 2BTOA 4O4IB 3T1YB 1PNKA 3E35A 2EX3A 4BR6A 4TSFG 3RBZA 1GN6A 1V9PA 2FYUH 1OHHG 4FLVA 2F95B 4RQFA 4AQYO 1TVKB 4UVAA 3RYFB 3TXQA 4QPJA 3ICXA 3DC6A 2WA4A 3T4DA 4ICGA 1NVPD 3H9VA 2RN9A 3RN4A 2UXDB 3OR7C 5B3SC 2DWEC 3ABMC 4EB6B 3CCEV 4OPAA 1AP5A 1SQFA 4BW9A 4UCVA 5IY5C 3CCQV 3TCUA 5KHKA 3APQA 1F4NA 5JQGA 1FJGO 1KB9F 2D3OW 1EFRG 1IX9A 4DR7B 5K1PA 4JI2O 5J2TB 2VQEO 1I5YA 3CSXA 2OCHA 4LF6B 2LW1A 3SJQC 4I55A 1K4CC 2WLLA 1N33O 4PA9A 2UXNA 2ZIMA 3EVKA 1N36B 3FD9A 1Y76A 3AG7A 3N2GA 1MZFA 3B8NA 2QM8A 2CUGA 2EULA 2ZDIC 1I5XA 2WPDG 4D6TH 1WP8A 4PDMA 3MHHC 3WB0A 4F6RB 3F7VC 3KG2A 1H8EG 5EC2C 4HNAA 2PZSA 4K8ZA 4RUFA 1BHBA 1XL4A 2JK5C 1ZL8A 1OCZB 2VQFO 1AJNA 5IYBO 3ASOB 3UQ8A 4MVQA 4JAAA 3CC2V 3WB2A 1KYOF 3RYHB 2OCCB 2OTJV 3MD0A 3IGAC 4LH7A 1VQLV 2GUZB 3ZRWB 4QIWF 2GTSA 5BR8B 4K0KO 5KX5A 2F4VO 2F66C 3ETQA 4PA6A 4J9YB 3BA9A 3JALA 3LSQA 1P84F 2GSMB 3CP1A 2YXLA 3ABKC 3K57A 2Q0AA 2MW2B 3H1IH 1F23A 4IIJB 5LBQA 1FPOA 2ZXWC 1Q6HA 3S3XA 5JJEB 2ZQMA 1HWYA 3RFRA 3CJHB 3JSLA 3EHBB 3R66A 4ABMA 3DTUB 2XAJA 3JAKB 3LDDA 2EIJC 5J2UA 3E22A 1VARA 4RAIA 1MZEA 4B7EA 3SR2C 1NTZH 3E8FA 4U7OA 2XUMA 2NR5A 3LDCA 1YJNV 4FLYA 4YXWG 1GRJA 4X66B 3ASNB 1SQBH 1NKDA 5LA6A 1JQ0A 1PL4A 5LHGA 2Q7EA 2IH3C 5KHHA 1HNWB 5EYPA 1GO3F 3JARA 2HLDG 2JS5A 1FAFA 3SJAC 4NTYA 5DN6G 2JIZG 2F43G 4MW3A 1G1XB 1QLEB 4HZ3A 3DGEA 4NR1A 2LO1A 1N34B 4WCEV 5JCOA 1SS3A 1DTOA 2W6IG 1WP7A 4J7KA 2GTAA 1FFXA 3K0GA 4B3TO 2CE4A 3K9AA 3JD1A 2ETNA 1N0NA 4DV1O 2DYSB 4CH5A 1BZKA 5GONA 4JAVA 1IDSA 5JQGB 4UV9A 2QKCA 1KUQA 4LFCO 1J95A 4XBFA 2PF4E 4GT1A 2ITCC 2ATKC 2RCVA 4JI4B 4WFFA 4DV6B 3JAWA 4Q20A 2ADPA 4I55B 5B1AB 2UUCB 2WLLB 2WLNA 3FYEB 1NQTA 2JGUA 4FVMA 4TQDA 3MHSC 3CCSV 1BGYH 5LGNA 1Y76B 3N2GB 1VF6A 4D7SA 2ZNJA 2UXXA 3VQXA 4DV7O 2ARHA 4G28B 4J11A 1AR5A 1AI5A 1EN6A 2DOSA 3P30A 4LNUA 5KAFZ 3BA8A 3L73H 2JJ2G 1L8DA 4U3FH 4HNAB 4FMTA 1U97A 3VQVA 4IYIA 1ZL8B 3JASA 1L1FA 2DMXA 2JVDA 4O2BA 3CMAV 3OR6C 5LGTA 1W0JG 5LOVA 2A3QA 4UB6Z 1KKDA 1NZ6A 3SYOA 4B3RB 3AG3C 4NXNO 1H2GA 4CH3A 2DWDC 2VRZA 2KSDA 4IYHA 2N05A 1ZLZA 3O9OA 5EBWC 1Q6IA 4BW5A 3ZJZA 1R1BA 3WU2Z 2OTLV 1YJWV 3CX5F 5KX5B 4AILC 2XOKG 3PN1A 1ZAUA 3JALB 4NVPA 3ZHSA 1YSCA 3I5DA 5FPOA 3JAMN 1S5JA 2AZ0A 1FKAO 4EEQA 4UB8Z 5FPRA 1SKVA 1KP2A 4EFBA 2F1MA 4ZKIA 2QWQB 1FYJA 4YY3B 5J2UB 2UUBO 1M90W 1GAXA 1HNZB 3E22B 5IJ9A 1S76D 3ZS8C 1QLNA 1O9GA 4JI0B 2EZOA 1G6UA 4X64B 2CTWA 3JYCA 2A9HA 2P06A 5EBMC 4NKGB 1V54B 4AHCA 2CDYA 4DUYO 1KU9A 2ZE6A 5LA6B 2OWOA 1QHTA 3ZMVA 2WLJA 3K5NA 5EYPB 3JARB 4NXMB 1WAZA 5IYDO 3TGUH 3K06A 3VQYA 1OV9A 1Y66A 2Y69C 2IH1C 1NU1H 2OIGA 3A2FA 1FFXB 5KHJA 4TV9A 3MDSA 4P30A 3ZHQA 4TOIA 4LP8A 5GONB 1B6QA 4A5UB 3DSQA 2O57A 1H2MA 1F4MA 1Q5OA 1XEQA 2QJ1A 2LGWA 3AG2B 2IBZH 4QPKA 1DLBA 3G71V 2DQ0A 3T1HB 2A7WA 3TK1A 2Z0AA 3JAWB 2V4DA 3ABTA 4LR3A 4PHZA 2ODMA 3ZMTA 4IT5A 4J7JA 5IWAB 5FLXN 3FB7C 1OCRC 2QTSA 3WFVA 4X8AA 4DRXA 1YF2A 5LYJA 1ZSPA 4G2KA 5KLVH 1XL6A 1ZX3A 1IBLO 1H38A 4PI0A 1QBZA 4O2AA 4LNUB 4J7ZA 4DR1O 3E2EA 3F5WC 2QKSA 1N32O 5K1XA 3QVNA 5EC1C 3JASB 4DV3B 2HHHO 1QU7A 1OCCB 4O2BB 4GKKO 2Y0PA 5LOVB 1K92A 3WB1A 3STZC 1RPRA 4TV8A 4YHHO 4JASA 2YXHA 1NR1A 4FZ1A 2PYJA 4DV5B 3FYIB 2QA4V 2Y48A 4JV5O 2ZE5A 4HYOA 3QO8A 3BFRA 3FKSG 4FM2A 4IGGA 3CMEV 3A8TA 4X62O 5L3BA 2YXYA 3K9SA 4DV0B 1D2DA 4GCZA 3L9DA 4WFEA 2WLHA 4R6ZA 5LMNB 2R70A 3D36C 2Q4PA 3BRCA 4DR5O 2EIKB 3OTOO 5H5NA 3SJBC 2R9RB 1BS3A 5IJ9B 3ZHUA 3U11A 4DW1A 4J80A 5CB4A 5H2FZ 3E8GA 4OX9B 4CH4A 2YIDA 3ABLC 4CBCA 1G4YB 2N04A 1PM9A 4OGQB 2FKXA 2CH7A 3ETEA 1VQ4V 2HVJC 4GX2A 1HW7A 2DQ3A 3ZMZA 4JYCA 5LHHA 4MTOA 1U96A 5A2QN 1CXZB 4PA3A 5LP6A 4X1IA 2EINB 1HNXO 3LSSA 4TV9B 4JZ2A 4JI3O 1MMMA 2V7QG 4NTXA 2LW7A 3JCZA 1E1QG 4QE9A 4LF9B 3CC7V 4YIOA 4LBEC 4DR4O 3CCRV 2HFEC 1R3KC 1HDJA 1MG1A 3K08A 1VQ9V 3WG7C 4LFBO 4MT8A 3W7WA 4XDJA 5KAIZ 4MS2A 4DK0A 4DR6O 4LH6A 3K0DA 4I9QA 4DR3O 4RO2A 4JI6B 3ZHVA 2RJZA 5FL7G 1YTFD 1SF9A 2UXBB 3L70H 4LC1A 3RGBA 4DUZB 1YCIA 1YJ9V 2E5LB 4NYKA 1FJGB 4DRXB 1MABG 1XNQO 2YUAA 1VF7A 5LYJB 5HFMA 3P32A 1UPGA 3ZMUA 2EJ7A 2VQEB 2KB1A 1P7BA 3BPZA 4PDLA 3K3WA 4O2AB 1I08A 4LF8B 4O4JA 2HEPA 4PELA 1GK9A 3FAVA 1RM1C 4N23A 1EZVH 1H2KA 1K7DA 1V55B 1NS1A 4JI5O 4DV2O 3S3WA 4QGPA 2CTRA 4WF9V 1XI1A 1XILA 4TV8B 2P90A 5LXTA 4GLXA 3OD4A 3QO5A 5KHIA 1TGOA 3SYCA 4JI7B 2NNUA 5EIBD 2WWWA 2UXCB 4GZRB 3DXRA 3M8AA 3ZEDA 1IBMO 2P4VA 1PL0A 2Q69A 4UCTA 1IXBA 2UU9O 1PP9H 3BCCH 4ZIBA 3CC4V 2ZR2A 1D5AA 3K04A 4X9QA 1Q7YW 4FLZA 3AG4C 4PV1B 1Y74A 3EFFK 2YS8A 4CC5A 2WSSG 4X65O 2P22C 1H2LA 1O9HA 2LFSA 2QE7G 5CB4B 3T1YO 1EN4A 4R50A 1VQ7V 1YIJV 3UKMA 2OYQA 1ZWIC 3ZRSA 4YJ3A 1R6TA 2VWKA 4H0LB 1F7YA 3A0BZ 3AG1C 3GWOA 1BSMA 2CH7B 1LNQA 1FXVA 4UV8A 2X6BA 4B3SO 2HVKC 2IJKA 3FB6C 4CC6A 3G4SV 1S5LZ 2ZR3A 5LP6B 4B08A 2UXDO 3IC7A 2A0LA 2W0XA 1URFA 4X1IB 3ZHTA 4W4LA 5B1OA 3CRRA 1N0JA 3W7UA 4TQFA 4L87A 3OT7A 2E3CA 3E8HA 1FS0G 1RP3B 4DR7O 1E1RG 2W6JG 4P2ZA 2YSUB 4K35A 1L0NH 1AI4A 4LF6O 1FXHA 2QM7A 4MTGA 1ZTEA 2RMKB 3HKBA 3UCSC 3N2KA 1N4CA 1QVGU 1E79G 1AR1B 1I0HA 3H1JH 4LCUC 4Q6GA 5LMUO 3TJTA 4F4LA 4O4JB 3FAVB 3L75H 3ETGA 4UVBA 1EBOA 1X59A 1F51A 1BE3H 1K3EA 3OMNB 1X4TA 3ZCCA 1CEZA 2H8PC 1GN4A 1RPOA 2ILMA 4JTCB 2EILB 3SPCA 4KHPO 2JDIG 2B5UA 5DM6V 5LXTB 4DV7B 1NH2B 1IBKO 1GN2A 4YJ2A 4GX0A 3K5LA 3K59A 1FXKA 2YEVA 1OCZC 3JCUZ 3DXRB 1SETA 5BR8O 3ABUA 4FPPA 4FLUA 3ASOC 4G27B 4FFBA 5H6RA 4R7CA 5IDJA 1COWG 2LP7A 3RVZA 2XASA 1TA8A 1VQOV 4LF5B 3SYPA 1WNSA 1S3JA 1M93A 1OCOB 1Y74B 3CCLV 5D5PA 2DE0X 1S77D 2P7TC 5C8YA 1M57B 2YIBA 3LSUA 4DK1A 1JPXA 2HP8A 1SQXH 4OPHA 1Q8IA 3BY6A 2XNDG 4RWUA 4YJ3B 2C2AA 4DW0A 2ZM6B 1UJWB 2ZNIA 3DC5A 2UUAB 1K97A 2WAMA 1XBLA 1KKCA 1Z2GA 3N27A 2R9AA 4NTWA 4LF4O 4JI1B 1HNWO 3OTFA 1J5EO 3HPLC 2EJRA 3OFNG 1BMFG 1AVMA 2PYLA 4TWKA 5EIBC 1BHAA 3THOA 3OGCC 3J80N 1XMOO 1D5NA 3ASNC 3CPWU 3H1HH 2LJ2A 5TISZ 5HFLA 4DUYB 2DYRB 1S72V 3HKEA 1BQZA 1A32A 1JMKC 2XTAA 1GH6A 3ZIAG 1QLEC 2QEXV 4PJ0Z 3RVYA 1M1KW 3JD4A 2AGAA 2JS3A 1PPJH 4DV6O 1P49A 2DYSC 2UUCO 3RYIA 1R3JC 1G8MA 1B04A 3FFQA 3HKBB 3N2KB 2FTKA 3P3PA 3B77A 3H01A 2DW4A 3W7XA 1THZA 3I55V 5B1AC 2DJVA 5H6QA 3G80A 2CGNA 2FMLA 2X0LA 3BAAA 1YITV 1XNRB 4JI8O 5B1BB 2ZIOA 4QE7A 2CTQA 2ZE8A 1K9MW 1WPBA 1XMQB 1WB8A 2CGOA 5E79Z 2Q0OC 2ZINA 3AK3A 1BT8A 4B3RO 1Q3EA 1AROP 4FLTA 2QWRB 4YJ2B 3LNMB 5L3EA 2N74A 1N32B 1XHXA 1YVWA 3H1KH 1FXKB 2EIMB 3SYQA 2YEVB 4EFEA 2JEUA 4MVOA 5GTHZ 1BCCH 5JWPA 2HHHB 4DV4O 1BL8A 1T5EA 3JD3A 5EBLC 2R72A 4FM0A 4FFBB 1QVFU 4DR2O 2X7RB 1R3LC 2AZ2A 3M99B 1MSWD 4TUYA 2E75B 3SPJA 4GYCB 1SC5B 1WPXA 5L3CA 2LFRA 1HR0B 4WFHA 4X1YA 1VQNV 3X2QB 2P4KA 3CHXA 5DEDA 5C8YB 5EK0A 1HNZO 4JI0O 4JTDB 1WN7A 4LFAB 4L8JA 3U10A 3E83A 3BHPA 1PD3A 2ZDIA 2BOBC 1GMGA 3OTOB 1I94B 4NXMO 5CMUA 2CTPA 3OEHG 4JYAO 5CBFA 4JYBA 2BE3A 5KMGA 1DF5A 5BMVA 5L3GA 1V54C 2QWNB 2NN4A 3FB5C 2B1IA 4UVCA 1R73A 4MSWC 2AW9A 1B3QA 3HKEB 3BEHA 3G6EV 2FB5A 4BIOA 4DYLA 1SESA 3CB2A 3HKCA 1M56B 1QNMA 5GW7A 2P67A 1K34A 1SA0A 2HJDA 5JCOC 3FB8C 3R65A 1IXMA 1L0LH 1GM9A 3B2EE 4W4KA 4X1KA 5AG2A 3CCJV 1NJIW 4GKJO 1VQPV 3OEEG 5JJNB 1Q6UA 3CE2A 3RYIB 1H2SB 2HKOA 2X6CA 2JEXA 4DXWA 4B3MB 3ZX6A 1YDXA 2KKWA 5IWAO 4LF7B 4PA7A 3ML0A 3BABA 3AG2C 4K3AA 1Z5WA 3E89A 4UUJC 1XUQA 4I50A 1PKXA 2AXTZ 2E76B 1S5HC 2GBOA 5JVDA 3VOUA 3RW0A 2PTMA 2ZKOA 1VF6C 2WLKA 4H13B 4DO2A 2F93B 4H37A 2Q9LA 3OE7G 1XNQB 5GTIZ 3F7YC 4X20A 1NTKH 3H1LH 3NXSA 4DV5O 4K8XA 5B3SB 1Z5VA 1VF5B 3ABMB 4AQYB 2IU3A 1PNLA 4GUNA 3IJ4A 1OJHA 3JATA 3CRMA 4FFKA 1CPYA 4QJFB 1NR7A 5IY5B 4MVUA 3ZMSA 2PUSA 4DV0O 4TUYB 1TUBA 4LWSA 4KFMA 2IW5A 5LMNO 3ZRVA 1Q81W 3KCYA 3D8CA 2PI5A 4X1YB 1R6KA 2YI8A 5JH7A 1AR4A 5BY1A 2F23A 1MOFA 2IJJA 4FZ0A 4X88A 3W7TA 3CXCU 3P3NA 4CH6A 1PV0A 4H44B 4OX9O 4JI2B 1K8AW 3C3TA 1DGSA 2QR4A 2EIKC 1SZTA 4X65B 2ZCEA 3T2MA 3IAYA 2PGGA 1N33B 1JJ2U 4FJCC 1JJOA 3UM7A 5KMGB 5C93A 4WBNA 5BMVB 1VQ6V 1XOUA 1BQ0A 2NLJC 4I5SA 3K58A 3G6BA 4CZZA 3JD0A 1Q86W 4N21A 4MVSA 1YXBA 3HKCB 1KP3A 4XDKA 3MAQA 4B3SB 1JVMA 4FM1A 5BZBA 3QO7A 4LF9O 3OUFA 4MTXA 2VQFB 1SA0B 1AP6A 1XDCA 2Y4UA 1VIBA 3A0HZ 2EINC 4E4EA 4X1KB 4Z2WA 1SERA 4JI6O 4WFGA 3FX7A 4JAUA 1AI7A 3E86A 3ABKB 1GN3A 4FK5C 2UXBO 1VQ5V 1NH2D 4DUZO 3K03A 4O4LA 5IT9N 4Z1MG 3VBBA 2ZXWB 4K0KB 3APOA 1Q90D 5H9CA 2F4VB 2YICA 4ZBMA 4UCRA 2E5LO 4MTFA 1EM1A 2EIJB 3CD6V 5F2VO 4IHJA 2FL4A 3OM3B 2YDEA 2IM9A 1MSDA 1SQGA 1P4RA 4I50B 1M4UA 1Y4MA 2QKAA 4LF8O 4F6EA 2RQ6A 2AHYA 2XT9A 5JVDB 3HKDA 1WB7A 1WLEA 3KZIZ 1EN5A 4JYYA 4UCOA 2M7WA 3CRQA 5KUMA 3LDEA 1VP7A 5CA0A 4X20B 1QCEA 3OMAB 4H33A 2JGDA 4ASUG 5L3FA 5LMUB 1KD1W 1NI8A 3OAAG 1JCHA 4JI7O 3KKYA 2W0FC 4YIPA 2UXCO 1V55C 3JATB 2BSKA 5J9PC 1NT2B 4JZGA 2DN9A 4MVZA 1SQQH 2ZD9A 1GKFA 2P6JA 1YTFB 4KHPB 1TUBB 1US6A 4LWSB 5FNVA 3CEIA 1KQSU 4P9OA 3K5OA 3UO2A 1IBKB 4UXNA 3QG5A 2QGNA 2Z5UA 2GDSA 4B3TB 4I4TA 5JH7B 4JF3A 2YIAA 4DV1B 3HR0A 1JX9A 1LR1A 5CN0A 3T4ZA 1GM7A 4LFCB 1N36O 1JR9A 1MA1A 2IU0A 2Q73A 4KXRA 4J42A 1PNMA 4FIPC
chains in the Genus database with same CATH topology
2CH7A 3ZX6A 1QU7A 3G67A 3G6BA 2CH7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CH7 A;  3ZX6 A;  1QU7 A;  3G67 A;  3G6B A;  2CH7 B; 
#chains in the Genus database with same CATH topology
 3AK1 A;  3CRC A;  1KEC A;  2LQT A;  1UFI A;  1R6N A;  1W59 A;  4RUE A;  1CP9 A;  1NVP B;  2X6A A;  2WA3 A;  2QWP B;  1RSO A;  2PY5 A;  5D5Q A;  4CS4 A;  4WBN B;  2A79 B;  3D3I A;  3SPI A;  4Z1V A;  2QSA A;  4TT3 G;  2Y4T A;  3AG3 B;  3JD2 A;  5CBH A;  4LF4 B;  2B9Z A;  1J5E B;  4QNH B;  3OUS A;  2Q7G A;  5LP6 C;  3AEI A;  2QM4 A;  1XMO B;  4PDV A;  2OCC C;  2ZE7 A;  4NXN B;  1XHZ A;  2ADQ B;  2EZP A;  2BTQ A;  1H8H G;  3M7M X;  4MVR A;  1AJP A;  1K73 W;  2IJH A;  4ZI7 A;  1NBM G;  3D36 A;  1Y6X A;  4O4L B;  3ZHR A;  2KQX A;  3TET A;  1S0V A;  4OXS A;  2Q67 A;  4ZHQ A;  2M6Y A;  4IHJ B;  3CCM V;  2RDC A;  3CRA A;  4C7U A;  4I7Z B;  3K79 A;  4BWA A;  3CYO A;  1DK1 A;  4MVM A;  4X66 O;  2HG5 C;  3HKD B;  3UT5 A;  1JOY A;  1WA8 A;  1W2B U;  2WLI A;  3L72 H;  3CCV V;  1SQP H;  2PI4 A;  4XDL A;  2VWJ A;  4O4H A;  2UUB B;  4EKW A;  5CA0 B;  1QR8 A;  2Q7H A;  4AI8 A;  2JRI A;  2JGD B;  3CCU V;  2YIB D;  1N34 O;  2Y69 B;  1GM8 A;  4B7K A;  2VS0 A;  4X89 A;  4UCS A;  4HAM A;  1SZX A;  4JI8 B;  3SJC C;  2BSK B;  3B09 A;  4J10 A;  2EIL C;  1B06 A;  3ZRX A;  1HP8 A;  1R3I C;  1FD9 A;  1LUV A;  3C90 A;  2OT5 A;  3SDL A;  4E2L A;  3GB7 C;  5FNV B;  5KUK A;  4BIU A;  3UO3 A;  5KA5 A;  3LUT B;  4LF5 O;  4GX5 A;  1JFF A;  5EZY A;  3B40 A;  5LHI A;  1AIL A;  4CS3 A;  1TUE B;  3ZBH A;  2BCC H;  4I4T B;  4JI4 O;  3HB3 B;  4I0X A;  4UCU A;  1OZ0 A;  4U3J A;  5ITZ A;  2GHY A;  4DV4 B;  1N8R W;  4HBN A;  4KUM A;  5KA6 A;  4J9Z B;  4FLX A;  5IYZ A;  4DR2 B;  4WFB V;  3IFX A;  1K5S A;  2K9P A;  1OCR B;  3I56 V;  1VQ8 V;  1OCO C;  3GVM A;  2ZM6 O;  3OMI B;  2YI9 A;  3TXS A;  4PI2 A;  2UUA O;  1K5Q A;  1Y67 A;  1VQM V;  2QDO A;  5BXZ A;  4JI1 O;  1M57 C;  1RSO B;  4GX1 A;  2XHB A;  3G67 A;  3ZN0 A;  1GTO A;  1M5I A;  4CS2 A;  4RQE A;  5DEC A;  3B8M A;  4D7T A;  3NR7 A;  3EXA A;  1IBL B;  4KL1 A;  3RYC A;  3JSN A;  1YI2 V;  3RT3 C;  5CA1 A;  1AB3 A;  4DR1 B;  3A0R A;  4P9P A;  2H94 A;  4JTA B;  1VQK V;  4ZOL A;  1XQ8 A;  4I9W A;  3SGI A;  4JYA B;  5LL6 Y;  5L3D A;  4GKK B;  4J41 A;  3RWR D;  3GWK C;  3Q4H A;  3T1C A;  4YHH B;  3J7A U;  2DYR C;  2BTQ B;  2XAG A;  3VQW A;  3J81 N;  2GV9 A;  1VEW A;  4JV5 B;  2BOC C;  1LUW A;  4ZI7 B;  3QTC A;  5IE9 A;  5IJ0 A;  2XAH A;  2D2C B;  4R8C A;  5A9G A;  5E1A C;  3OGI B;  4YY3 O;  4ZHQ B;  4X62 B;  3IC9 A;  2XAQ A;  2A06 H;  1K33 A;  1EZJ A;  1YEW A;  2ZT9 B;  5LGU A;  5B66 Z;  4X64 O;  2YC0 A;  2KG7 A;  4BIZ A;  4GKJ B;  3F5T A;  4PDR A;  1YZB A;  4MW8 A;  2CK3 G;  3ABL B;  1XRE A;  3O65 A;  3UT5 B;  3KCX A;  1DF4 A;  3OW2 U;  1XNR O;  1WA8 B;  2RNB A;  5CA3 A;  2WLI B;  4DR5 B;  4O4H B;  1ORQ C;  2Z3Y A;  4U7N A;  4O4I A;  3L71 H;  2MK3 A;  1XMQ O;  4KP4 A;  1AJQ A;  1NTM H;  3CS5 A;  1MNG A;  3SPG A;  1AI6 A;  5B1B C;  1TVK A;  1W0K G;  3RYF A;  3L74 H;  1H2N A;  1ROP A;  1RFY A;  1P7G A;  2Q6A A;  3WG7 B;  3K5M A;  2G38 A;  1JFF B;  5EZY B;  1IUR A;  2R9I A;  1FXK C;  2EIM C;  4EB6 A;  1HNX B;  4FLW A;  2B1G A;  3T1H O;  2V1D A;  4JI3 B;  4I0X B;  1SRY A;  1SQV H;  1HR0 O;  4UFZ A;  4U3J B;  5ITZ B;  2QWO B;  1YHQ V;  2Q68 A;  4DR4 B;  5IYZ B;  4LFB B;  3C3S A;  1QQC A;  3BVO A;  2Y0I A;  4DR6 B;  1WJZ A;  1K4D C;  3ZN1 A;  4DR3 B;  4LFA O;  2P5O A;  2LGQ A;  2XAF A;  5J2T A;  3W7S A;  5CBG A;  3X2Q C;  2HR3 A;  1KBH A;  2EBO A;  1Q82 W;  1JA8 A;  1TAE A;  1RM1 B;  1I94 O;  5KHG A;  3STL C;  3E8B A;  5B1N A;  4DV3 O;  3LNN A;  2Q5Z A;  1Q43 A;  4WFA V;  3RYC B;  2WLM A;  5CA1 B;  3QNE A;  1IZ3 A;  4F6R A;  1FFT B;  2QTO A;  4ZOL B;  3PJS K;  2IJI A;  1OCC C;  4JPR A;  4JGS A;  5JJJ B;  1M9N A;  2K1E A;  3D3Q A;  3SPH A;  4JI5 B;  1QR9 A;  4DV2 B;  1KMI Z;  3CXH F;  3U0Z A;  5B5E Z;  2L6L A;  3Q4H B;  1ZUQ A;  3RYH A;  1IVS A;  2OIE A;  2L35 A;  1M56 C;  3AG4 B;  2GUZ A;  3ZRW A;  5IJ0 B;  4NB5 A;  1KC8 W;  2JJ1 G;  4B3M O;  3B4S A;  1IBM B;  3CWB H;  4LF7 O;  2UU9 B;  1ENV A;  4PA4 A;  2ITD C;  4PD4 F;  5IYC O;  3AK2 A;  2KG7 B;  2HJF C;  4IL6 Z;  2AHZ A;  2H3O A;  3QF7 A;  3ETD A;  4BAY A;  4IIJ A;  2CAZ C;  1VMG A;  3AG1 B;  1I7F A;  3CJH A;  3SYA A;  2Q8V A;  3JAK A;  2E74 B;  2BTO A;  4O4I B;  3T1Y B;  1PNK A;  3E35 A;  2EX3 A;  4BR6 A;  4TSF G;  3RBZ A;  1GN6 A;  1V9P A;  2FYU H;  1OHH G;  4FLV A;  2F95 B;  4RQF A;  4AQY O;  1TVK B;  4UVA A;  3RYF B;  3TXQ A;  4QPJ A;  3ICX A;  3DC6 A;  2WA4 A;  3T4D A;  4ICG A;  1NVP D;  3H9V A;  2RN9 A;  3RN4 A;  2UXD B;  3OR7 C;  5B3S C;  2DWE C;  3ABM C;  4EB6 B;  3CCE V;  4OPA A;  1AP5 A;  1SQF A;  4BW9 A;  4UCV A;  5IY5 C;  3CCQ V;  3TCU A;  5KHK A;  3APQ A;  1F4N A;  5JQG A;  1FJG O;  1KB9 F;  2D3O W;  1EFR G;  1IX9 A;  4DR7 B;  5K1P A;  4JI2 O;  5J2T B;  2VQE O;  1I5Y A;  3CSX A;  2OCH A;  4LF6 B;  2LW1 A;  3SJQ C;  4I55 A;  1K4C C;  2WLL A;  1N33 O;  4PA9 A;  2UXN A;  2ZIM A;  3EVK A;  1N36 B;  3FD9 A;  1Y76 A;  3AG7 A;  3N2G A;  1MZF A;  3B8N A;  2QM8 A;  2CUG A;  2EUL A;  2ZDI C;  1I5X A;  2WPD G;  4D6T H;  1WP8 A;  4PDM A;  3MHH C;  3WB0 A;  4F6R B;  3F7V C;  3KG2 A;  1H8E G;  5EC2 C;  4HNA A;  2PZS A;  4K8Z A;  4RUF A;  1BHB A;  1XL4 A;  2JK5 C;  1ZL8 A;  1OCZ B;  2VQF O;  1AJN A;  5IYB O;  3ASO B;  3UQ8 A;  4MVQ A;  4JAA A;  3CC2 V;  3WB2 A;  1KYO F;  3RYH B;  2OCC B;  2OTJ V;  3MD0 A;  3IGA C;  4LH7 A;  1VQL V;  2GUZ B;  3ZRW B;  4QIW F;  2GTS A;  5BR8 B;  4K0K O;  5KX5 A;  2F4V O;  2F66 C;  3ETQ A;  4PA6 A;  4J9Y B;  3BA9 A;  3JAL A;  3LSQ A;  1P84 F;  2GSM B;  3CP1 A;  2YXL A;  3ABK C;  3K57 A;  2Q0A A;  2MW2 B;  3H1I H;  1F23 A;  4IIJ B;  5LBQ A;  1FPO A;  2ZXW C;  1Q6H A;  3S3X A;  5JJE B;  2ZQM A;  1HWY A;  3RFR A;  3CJH B;  3JSL A;  3EHB B;  3R66 A;  4ABM A;  3DTU B;  2XAJ A;  3JAK B;  3LDD A;  2EIJ C;  5J2U A;  3E22 A;  1VAR A;  4RAI A;  1MZE A;  4B7E A;  3SR2 C;  1NTZ H;  3E8F A;  4U7O A;  2XUM A;  2NR5 A;  3LDC A;  1YJN V;  4FLY A;  4YXW G;  1GRJ A;  4X66 B;  3ASN B;  1SQB H;  1NKD A;  5LA6 A;  1JQ0 A;  1PL4 A;  5LHG A;  2Q7E A;  2IH3 C;  5KHH A;  1HNW B;  5EYP A;  1GO3 F;  3JAR A;  2HLD G;  2JS5 A;  1FAF A;  3SJA C;  4NTY A;  5DN6 G;  2JIZ G;  2F43 G;  4MW3 A;  1G1X B;  1QLE B;  4HZ3 A;  3DGE A;  4NR1 A;  2LO1 A;  1N34 B;  4WCE V;  5JCO A;  1SS3 A;  1DTO A;  2W6I G;  1WP7 A;  4J7K A;  2GTA A;  1FFX A;  3K0G A;  4B3T O;  2CE4 A;  3K9A A;  3JD1 A;  2ETN A;  1N0N A;  4DV1 O;  2DYS B;  4CH5 A;  1BZK A;  5GON A;  4JAV A;  1IDS A;  5JQG B;  4UV9 A;  2QKC A;  1KUQ A;  4LFC O;  1J95 A;  4XBF A;  2PF4 E;  4GT1 A;  2ITC C;  2ATK C;  2RCV A;  4JI4 B;  4WFF A;  4DV6 B;  3JAW A;  4Q20 A;  2ADP A;  4I55 B;  5B1A B;  2UUC B;  2WLL B;  2WLN A;  3FYE B;  1NQT A;  2JGU A;  4FVM A;  4TQD A;  3MHS C;  3CCS V;  1BGY H;  5LGN A;  1Y76 B;  3N2G B;  1VF6 A;  4D7S A;  2ZNJ A;  2UXX A;  3VQX A;  4DV7 O;  2ARH A;  4G28 B;  4J11 A;  1AR5 A;  1AI5 A;  1EN6 A;  2DOS A;  3P30 A;  4LNU A;  5KAF Z;  3BA8 A;  3L73 H;  2JJ2 G;  1L8D A;  4U3F H;  4HNA B;  4FMT A;  1U97 A;  3VQV A;  4IYI A;  1ZL8 B;  3JAS A;  1L1F A;  2DMX A;  2JVD A;  4O2B A;  3CMA V;  3OR6 C;  5LGT A;  1W0J G;  5LOV A;  2A3Q A;  4UB6 Z;  1KKD A;  1NZ6 A;  3SYO A;  4B3R B;  3AG3 C;  4NXN O;  1H2G A;  4CH3 A;  2DWD C;  2VRZ A;  2KSD A;  4IYH A;  2N05 A;  1ZLZ A;  3O9O A;  5EBW C;  1Q6I A;  4BW5 A;  3ZJZ A;  1R1B A;  3WU2 Z;  2OTL V;  1YJW V;  3CX5 F;  5KX5 B;  4AIL C;  2XOK G;  3PN1 A;  1ZAU A;  3JAL B;  4NVP A;  3ZHS A;  1YSC A;  3I5D A;  5FPO A;  3JAM N;  1S5J A;  2AZ0 A;  1FKA O;  4EEQ A;  4UB8 Z;  5FPR A;  1SKV A;  1KP2 A;  4EFB A;  2F1M A;  4ZKI A;  2QWQ B;  1FYJ A;  4YY3 B;  5J2U B;  2UUB O;  1M90 W;  1GAX A;  1HNZ B;  3E22 B;  5IJ9 A;  1S76 D;  3ZS8 C;  1QLN A;  1O9G A;  4JI0 B;  2EZO A;  1G6U A;  4X64 B;  2CTW A;  3JYC A;  2A9H A;  2P06 A;  5EBM C;  4NKG B;  1V54 B;  4AHC A;  2CDY A;  4DUY O;  1KU9 A;  2ZE6 A;  5LA6 B;  2OWO A;  1QHT A;  3ZMV A;  2WLJ A;  3K5N A;  5EYP B;  3JAR B;  4NXM B;  1WAZ A;  5IYD O;  3TGU H;  3K06 A;  3VQY A;  1OV9 A;  1Y66 A;  2Y69 C;  2IH1 C;  1NU1 H;  2OIG A;  3A2F A;  1FFX B;  5KHJ A;  4TV9 A;  3MDS A;  4P30 A;  3ZHQ A;  4TOI A;  4LP8 A;  5GON B;  1B6Q A;  4A5U B;  3DSQ A;  2O57 A;  1H2M A;  1F4M A;  1Q5O A;  1XEQ A;  2QJ1 A;  2LGW A;  3AG2 B;  2IBZ H;  4QPK A;  1DLB A;  3G71 V;  2DQ0 A;  3T1H B;  2A7W A;  3TK1 A;  2Z0A A;  3JAW B;  2V4D A;  3ABT A;  4LR3 A;  4PHZ A;  2ODM A;  3ZMT A;  4IT5 A;  4J7J A;  5IWA B;  5FLX N;  3FB7 C;  1OCR C;  2QTS A;  3WFV A;  4X8A A;  4DRX A;  1YF2 A;  5LYJ A;  1ZSP A;  4G2K A;  5KLV H;  1XL6 A;  1ZX3 A;  1IBL O;  1H38 A;  4PI0 A;  1QBZ A;  4O2A A;  4LNU B;  4J7Z A;  4DR1 O;  3E2E A;  3F5W C;  2QKS A;  1N32 O;  5K1X A;  3QVN A;  5EC1 C;  3JAS B;  4DV3 B;  2HHH O;  1QU7 A;  1OCC B;  4O2B B;  4GKK O;  2Y0P A;  5LOV B;  1K92 A;  3WB1 A;  3STZ C;  1RPR A;  4TV8 A;  4YHH O;  4JAS A;  2YXH A;  1NR1 A;  4FZ1 A;  2PYJ A;  4DV5 B;  3FYI B;  2QA4 V;  2Y48 A;  4JV5 O;  2ZE5 A;  4HYO A;  3QO8 A;  3BFR A;  3FKS G;  4FM2 A;  4IGG A;  3CME V;  3A8T A;  4X62 O;  5L3B A;  2YXY A;  3K9S A;  4DV0 B;  1D2D A;  4GCZ A;  3L9D A;  4WFE A;  2WLH A;  4R6Z A;  5LMN B;  2R70 A;  3D36 C;  2Q4P A;  3BRC A;  4DR5 O;  2EIK B;  3OTO O;  5H5N A;  3SJB C;  2R9R B;  1BS3 A;  5IJ9 B;  3ZHU A;  3U11 A;  4DW1 A;  4J80 A;  5CB4 A;  5H2F Z;  3E8G A;  4OX9 B;  4CH4 A;  2YID A;  3ABL C;  4CBC A;  1G4Y B;  2N04 A;  1PM9 A;  4OGQ B;  2FKX A;  2CH7 A;  3ETE A;  1VQ4 V;  2HVJ C;  4GX2 A;  1HW7 A;  2DQ3 A;  3ZMZ A;  4JYC A;  5LHH A;  4MTO A;  1U96 A;  5A2Q N;  1CXZ B;  4PA3 A;  5LP6 A;  4X1I A;  2EIN B;  1HNX O;  3LSS A;  4TV9 B;  4JZ2 A;  4JI3 O;  1MMM A;  2V7Q G;  4NTX A;  2LW7 A;  3JCZ A;  1E1Q G;  4QE9 A;  4LF9 B;  3CC7 V;  4YIO A;  4LBE C;  4DR4 O;  3CCR V;  2HFE C;  1R3K C;  1HDJ A;  1MG1 A;  3K08 A;  1VQ9 V;  3WG7 C;  4LFB O;  4MT8 A;  3W7W A;  4XDJ A;  5KAI Z;  4MS2 A;  4DK0 A;  4DR6 O;  4LH6 A;  3K0D A;  4I9Q A;  4DR3 O;  4RO2 A;  4JI6 B;  3ZHV A;  2RJZ A;  5FL7 G;  1YTF D;  1SF9 A;  2UXB B;  3L70 H;  4LC1 A;  3RGB A;  4DUZ B;  1YCI A;  1YJ9 V;  2E5L B;  4NYK A;  1FJG B;  4DRX B;  1MAB G;  1XNQ O;  2YUA A;  1VF7 A;  5LYJ B;  5HFM A;  3P32 A;  1UPG A;  3ZMU A;  2EJ7 A;  2VQE B;  2KB1 A;  1P7B A;  3BPZ A;  4PDL A;  3K3W A;  4O2A B;  1I08 A;  4LF8 B;  4O4J A;  2HEP A;  4PEL A;  1GK9 A;  3FAV A;  1RM1 C;  4N23 A;  1EZV H;  1H2K A;  1K7D A;  1V55 B;  1NS1 A;  4JI5 O;  4DV2 O;  3S3W A;  4QGP A;  2CTR A;  4WF9 V;  1XI1 A;  1XIL A;  4TV8 B;  2P90 A;  5LXT A;  4GLX A;  3OD4 A;  3QO5 A;  5KHI A;  1TGO A;  3SYC A;  4JI7 B;  2NNU A;  5EIB D;  2WWW A;  2UXC B;  4GZR B;  3DXR A;  3M8A A;  3ZED A;  1IBM O;  2P4V A;  1PL0 A;  2Q69 A;  4UCT A;  1IXB A;  2UU9 O;  1PP9 H;  3BCC H;  4ZIB A;  3CC4 V;  2ZR2 A;  1D5A A;  3K04 A;  4X9Q A;  1Q7Y W;  4FLZ A;  3AG4 C;  4PV1 B;  1Y74 A;  3EFF K;  2YS8 A;  4CC5 A;  2WSS G;  4X65 O;  2P22 C;  1H2L A;  1O9H A;  2LFS A;  2QE7 G;  5CB4 B;  3T1Y O;  1EN4 A;  4R50 A;  1VQ7 V;  1YIJ V;  3UKM A;  2OYQ A;  1ZWI C;  3ZRS A;  4YJ3 A;  1R6T A;  2VWK A;  4H0L B;  1F7Y A;  3A0B Z;  3AG1 C;  3GWO A;  1BSM A;  2CH7 B;  1LNQ A;  1FXV A;  4UV8 A;  2X6B A;  4B3S O;  2HVK C;  2IJK A;  3FB6 C;  4CC6 A;  3G4S V;  1S5L Z;  2ZR3 A;  5LP6 B;  4B08 A;  2UXD O;  3IC7 A;  2A0L A;  2W0X A;  1URF A;  4X1I B;  3ZHT A;  4W4L A;  5B1O A;  3CRR A;  1N0J A;  3W7U A;  4TQF A;  4L87 A;  3OT7 A;  2E3C A;  3E8H A;  1FS0 G;  1RP3 B;  4DR7 O;  1E1R G;  2W6J G;  4P2Z A;  2YSU B;  4K35 A;  1L0N H;  1AI4 A;  4LF6 O;  1FXH A;  2QM7 A;  4MTG A;  1ZTE A;  2RMK B;  3HKB A;  3UCS C;  3N2K A;  1N4C A;  1QVG U;  1E79 G;  1AR1 B;  1I0H A;  3H1J H;  4LCU C;  4Q6G A;  5LMU O;  3TJT A;  4F4L A;  4O4J B;  3FAV B;  3L75 H;  3ETG A;  4UVB A;  1EBO A;  1X59 A;  1F51 A;  1BE3 H;  1K3E A;  3OMN B;  1X4T A;  3ZCC A;  1CEZ A;  2H8P C;  1GN4 A;  1RPO A;  2ILM A;  4JTC B;  2EIL B;  3SPC A;  4KHP O;  2JDI G;  2B5U A;  5DM6 V;  5LXT B;  4DV7 B;  1NH2 B;  1IBK O;  1GN2 A;  4YJ2 A;  4GX0 A;  3K5L A;  3K59 A;  1FXK A;  2YEV A;  1OCZ C;  3JCU Z;  3DXR B;  1SET A;  5BR8 O;  3ABU A;  4FPP A;  4FLU A;  3ASO C;  4G27 B;  4FFB A;  5H6R A;  4R7C A;  5IDJ A;  1COW G;  2LP7 A;  3RVZ A;  2XAS A;  1TA8 A;  1VQO V;  4LF5 B;  3SYP A;  1WNS A;  1S3J A;  1M93 A;  1OCO B;  1Y74 B;  3CCL V;  5D5P A;  2DE0 X;  1S77 D;  2P7T C;  5C8Y A;  1M57 B;  2YIB A;  3LSU A;  4DK1 A;  1JPX A;  2HP8 A;  1SQX H;  4OPH A;  1Q8I A;  3BY6 A;  2XND G;  4RWU A;  4YJ3 B;  2C2A A;  4DW0 A;  2ZM6 B;  1UJW B;  2ZNI A;  3DC5 A;  2UUA B;  1K97 A;  2WAM A;  1XBL A;  1KKC A;  1Z2G A;  3N27 A;  2R9A A;  4NTW A;  4LF4 O;  4JI1 B;  1HNW O;  3OTF A;  1J5E O;  3HPL C;  2EJR A;  3OFN G;  1BMF G;  1AVM A;  2PYL A;  4TWK A;  5EIB C;  1BHA A;  3THO A;  3OGC C;  3J80 N;  1XMO O;  1D5N A;  3ASN C;  3CPW U;  3H1H H;  2LJ2 A;  5TIS Z;  5HFL A;  4DUY B;  2DYR B;  1S72 V;  3HKE A;  1BQZ A;  1A32 A;  1JMK C;  2XTA A;  1GH6 A;  3ZIA G;  1QLE C;  2QEX V;  4PJ0 Z;  3RVY A;  1M1K W;  3JD4 A;  2AGA A;  2JS3 A;  1PPJ H;  4DV6 O;  1P49 A;  2DYS C;  2UUC O;  3RYI A;  1R3J C;  1G8M A;  1B04 A;  3FFQ A;  3HKB B;  3N2K B;  2FTK A;  3P3P A;  3B77 A;  3H01 A;  2DW4 A;  3W7X A;  1THZ A;  3I55 V;  5B1A C;  2DJV A;  5H6Q A;  3G80 A;  2CGN A;  2FML A;  2X0L A;  3BAA A;  1YIT V;  1XNR B;  4JI8 O;  5B1B B;  2ZIO A;  4QE7 A;  2CTQ A;  2ZE8 A;  1K9M W;  1WPB A;  1XMQ B;  1WB8 A;  2CGO A;  5E79 Z;  2Q0O C;  2ZIN A;  3AK3 A;  1BT8 A;  4B3R O;  1Q3E A;  1ARO P;  4FLT A;  2QWR B;  4YJ2 B;  3LNM B;  5L3E A;  2N74 A;  1N32 B;  1XHX A;  1YVW A;  3H1K H;  1FXK B;  2EIM B;  3SYQ A;  2YEV B;  4EFE A;  2JEU A;  4MVO A;  5GTH Z;  1BCC H;  5JWP A;  2HHH B;  4DV4 O;  1BL8 A;  1T5E A;  3JD3 A;  5EBL C;  2R72 A;  4FM0 A;  4FFB B;  1QVF U;  4DR2 O;  2X7R B;  1R3L C;  2AZ2 A;  3M99 B;  1MSW D;  4TUY A;  2E75 B;  3SPJ A;  4GYC B;  1SC5 B;  1WPX A;  5L3C A;  2LFR A;  1HR0 B;  4WFH A;  4X1Y A;  1VQN V;  3X2Q B;  2P4K A;  3CHX A;  5DED A;  5C8Y B;  5EK0 A;  1HNZ O;  4JI0 O;  4JTD B;  1WN7 A;  4LFA B;  4L8J A;  3U10 A;  3E83 A;  3BHP A;  1PD3 A;  2ZDI A;  2BOB C;  1GMG A;  3OTO B;  1I94 B;  4NXM O;  5CMU A;  2CTP A;  3OEH G;  4JYA O;  5CBF A;  4JYB A;  2BE3 A;  5KMG A;  1DF5 A;  5BMV A;  5L3G A;  1V54 C;  2QWN B;  2NN4 A;  3FB5 C;  2B1I A;  4UVC A;  1R73 A;  4MSW C;  2AW9 A;  1B3Q A;  3HKE B;  3BEH A;  3G6E V;  2FB5 A;  4BIO A;  4DYL A;  1SES A;  3CB2 A;  3HKC A;  1M56 B;  1QNM A;  5GW7 A;  2P67 A;  1K34 A;  1SA0 A;  2HJD A;  5JCO C;  3FB8 C;  3R65 A;  1IXM A;  1L0L H;  1GM9 A;  3B2E E;  4W4K A;  4X1K A;  5AG2 A;  3CCJ V;  1NJI W;  4GKJ O;  1VQP V;  3OEE G;  5JJN B;  1Q6U A;  3CE2 A;  3RYI B;  1H2S B;  2HKO A;  2X6C A;  2JEX A;  4DXW A;  4B3M B;  3ZX6 A;  1YDX A;  2KKW A;  5IWA O;  4LF7 B;  4PA7 A;  3ML0 A;  3BAB A;  3AG2 C;  4K3A A;  1Z5W A;  3E89 A;  4UUJ C;  1XUQ A;  4I50 A;  1PKX A;  2AXT Z;  2E76 B;  1S5H C;  2GBO A;  5JVD A;  3VOU A;  3RW0 A;  2PTM A;  2ZKO A;  1VF6 C;  2WLK A;  4H13 B;  4DO2 A;  2F93 B;  4H37 A;  2Q9L A;  3OE7 G;  1XNQ B;  5GTI Z;  3F7Y C;  4X20 A;  1NTK H;  3H1L H;  3NXS A;  4DV5 O;  4K8X A;  5B3S B;  1Z5V A;  1VF5 B;  3ABM B;  4AQY B;  2IU3 A;  1PNL A;  4GUN A;  3IJ4 A;  1OJH A;  3JAT A;  3CRM A;  4FFK A;  1CPY A;  4QJF B;  1NR7 A;  5IY5 B;  4MVU A;  3ZMS A;  2PUS A;  4DV0 O;  4TUY B;  1TUB A;  4LWS A;  4KFM A;  2IW5 A;  5LMN O;  3ZRV A;  1Q81 W;  3KCY A;  3D8C A;  2PI5 A;  4X1Y B;  1R6K A;  2YI8 A;  5JH7 A;  1AR4 A;  5BY1 A;  2F23 A;  1MOF A;  2IJJ A;  4FZ0 A;  4X88 A;  3W7T A;  3CXC U;  3P3N A;  4CH6 A;  1PV0 A;  4H44 B;  4OX9 O;  4JI2 B;  1K8A W;  3C3T A;  1DGS A;  2QR4 A;  2EIK C;  1SZT A;  4X65 B;  2ZCE A;  3T2M A;  3IAY A;  2PGG A;  1N33 B;  1JJ2 U;  4FJC C;  1JJO A;  3UM7 A;  5KMG B;  5C93 A;  4WBN A;  5BMV B;  1VQ6 V;  1XOU A;  1BQ0 A;  2NLJ C;  4I5S A;  3K58 A;  3G6B A;  4CZZ A;  3JD0 A;  1Q86 W;  4N21 A;  4MVS A;  1YXB A;  3HKC B;  1KP3 A;  4XDK A;  3MAQ A;  4B3S B;  1JVM A;  4FM1 A;  5BZB A;  3QO7 A;  4LF9 O;  3OUF A;  4MTX A;  2VQF B;  1SA0 B;  1AP6 A;  1XDC A;  2Y4U A;  1VIB A;  3A0H Z;  2EIN C;  4E4E A;  4X1K B;  4Z2W A;  1SER A;  4JI6 O;  4WFG A;  3FX7 A;  4JAU A;  1AI7 A;  3E86 A;  3ABK B;  1GN3 A;  4FK5 C;  2UXB O;  1VQ5 V;  1NH2 D;  4DUZ O;  3K03 A;  4O4L A;  5IT9 N;  4Z1M G;  3VBB A;  2ZXW B;  4K0K B;  3APO A;  1Q90 D;  5H9C A;  2F4V B;  2YIC A;  4ZBM A;  4UCR A;  2E5L O;  4MTF A;  1EM1 A;  2EIJ B;  3CD6 V;  5F2V O;  4IHJ A;  2FL4 A;  3OM3 B;  2YDE A;  2IM9 A;  1MSD A;  1SQG A;  1P4R A;  4I50 B;  1M4U A;  1Y4M A;  2QKA A;  4LF8 O;  4F6E A;  2RQ6 A;  2AHY A;  2XT9 A;  5JVD B;  3HKD A;  1WB7 A;  1WLE A;  3KZI Z;  1EN5 A;  4JYY A;  4UCO A;  2M7W A;  3CRQ A;  5KUM A;  3LDE A;  1VP7 A;  5CA0 A;  4X20 B;  1QCE A;  3OMA B;  4H33 A;  2JGD A;  4ASU G;  5L3F A;  5LMU B;  1KD1 W;  1NI8 A;  3OAA G;  1JCH A;  4JI7 O;  3KKY A;  2W0F C;  4YIP A;  2UXC O;  1V55 C;  3JAT B;  2BSK A;  5J9P C;  1NT2 B;  4JZG A;  2DN9 A;  4MVZ A;  1SQQ H;  2ZD9 A;  1GKF A;  2P6J A;  1YTF B;  4KHP B;  1TUB B;  1US6 A;  4LWS B;  5FNV A;  3CEI A;  1KQS U;  4P9O A;  3K5O A;  3UO2 A;  1IBK B;  4UXN A;  3QG5 A;  2QGN A;  2Z5U A;  2GDS A;  4B3T B;  4I4T A;  5JH7 B;  4JF3 A;  2YIA A;  4DV1 B;  3HR0 A;  1JX9 A;  1LR1 A;  5CN0 A;  3T4Z A;  1GM7 A;  4LFC B;  1N36 O;  1JR9 A;  1MA1 A;  2IU0 A;  2Q73 A;  4KXR A;  4J42 A;  1PNM A;  4FIP C; 
#chains in the Genus database with same CATH homology
 2CH7 A;  3ZX6 A;  1QU7 A;  3G67 A;  3G6B A;  2CH7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...