2KKWA

Slas-micelle bound alpha-synuclein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
140
structure length
140
Chain Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Alpha-synuclein
publication title A combinatorial NMR and EPR approach for evaluating the structural ensemble of partially folded proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01387 Synuclein Synuclein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.700 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2kkwA01
2KKWA 1XQ8A
chains in the Genus database with same CATH superfamily
1FFXB 4IGGA 3JARA 1IXBA 2HKOA 1OCZB 4L8JA 3THOA 3ABTA 5KMGB 2ZM6O 3FD9A 4RO2A 4UVAA 3VBBA 4JYCA 4F4LA 4UUJC 5LOVB 2XHBA 4DR5B 1IBKO 3E8HA 2UXDB 4B3RO 2ZE7A 4I9QA 3AK1A 4NTXA 3PJSK 5B1AC 1OCCB 4X1YB 3SYOA 2Q0AA 3K03A 1VIBA 2M7WA 1NH2B 1JOYA 3BEHA 2BSKA 3CE2A 2UUCO 3OR6C 3AK2A 4OPAA 4FM2A 4O4IB 5D5QA 1FAFA 3WU2Z 1VQNV 4FLZA 3APQA 4X64B 5LA6A 1PL0A 1AP6A 1MNGA 4R50A 3OM3B 3BPZA 3FYEB 1S5LZ 2YI8A 3ZJZA 2QEXV 1R3IC 3F5TA 1BZKA 2N04A 3N2KB 4NR1A 4LNUA 1YI2V 4MW8A 4I0XA 3CRRA 3UT5B 3UM7A 1SQVH 5H6RA 4OXSA 3KCXA 3TETA 3H1HH 1I5YA 5FNVA 1NT2B 2ODMA 4FLYA 2YC0A 1Z5VA 3BCCH 4AQYB 1AJQA 1ENVA 4GKJO 3H1IH 2ZR3A 3SPGA 5BY1A 4UVCA 5C93A 4NXNO 1G6UA 3ZEDA 4C7UA 4K8ZA 2CUGA 4XDKA 4ZBMA 2PY5A 1JCHA 5GW7A 2CGOA 3UQ8A 4K8XA 3FB6C 5LYJB 5CA0A 3DC5A 1VQLV 5TISZ 1AILA 1US6A 3CEIA 3H9VA 3CMEV 1L8DA 2Q8VA 1Y74B 3MDSA 5CN0A 4O4HB 1KYOF 1X59A 3BABA 5J2TA 5LL6Y 1HNZO 1ZSPA 1Q6UA 4BWAA 3U0ZA 1KBHA 4DV1O 4LBEC 4B3SB 3ABUA 1SS3A 2RNBA 4K35A 4UCUA 1GKFA 3Q4HA 5LHIA 1K97A 3JAKB 2JEXA 3KKYA 3OR7C 4LWSB 2ZINA 1Q7YW 3CC2V 2PYLA 3ZHVA 2AGAA 5LMNO 1XREA 4PV1B 1PKXA 4DR3O 2QGNA 4K3AA 4UFZA 1ZTEA 2CH7A 1RPRA 2LJ2A 2UXBB 4JYAB 3RYHB 1Q8IA 2WA3A 2X6AA 1XDCA 3JAMN 3O9OA 2WLLA 4JZ2A 1DLBA 2E3CA 4K0KB 4O2BA 1RM1B 4NXMO 2P4KA 1R6TA 3ABKC 2AXTZ 4KUMA 4B3MO 3ZRXA 2P4VA 1PD3A 1Q86W 4TV8B 3RT3C 1MABG 4JI3O 3U11A 3J81N 4FFBA 2DWDC 3TXQA 1S76D 4GZRB 5EZYA 1SRYA 2XUMA 4RUFA 1GM8A 2P6JA 4RUEA 3CSXA 4DUZB 4JPRA 1U97A 4DV0B 4CS3A 2IM9A 3J7AU 1GMGA 2B1GA 1MSDA 3GVMA 2DN9A 4DUYB 3ETDA 2CTQA 2GTSA 5DM6V 3E8BA 2F95B 3JARB 1N32B 1G8MA 2EILC 1S77D 1H2LA 4EFEA 5H5NA 4QNHB 3OGIB 3TCUA 4LF7O 3W7TA 1JA8A 4UCRA 1Z5WA 3A0HZ 1GN4A 3ABKB 4JAAA 5DEDA 1F23A 2QSAA 4BW5A 5BXZA 4DRXA 1VF5B 2ZR2A 2UXNA 1WAZA 4U3JA 4FM0A 2OWOA 3TGUH 2Q9LA 2ZNJA 4UCSA 4J11A 3CXHF 4BIUA 4J41A 3JCZA 5LXTA 4JI4B 5JJNB 2IU0A 1V54B 2FB5A 1O9HA 5HFLA 3ZMZA 4JI1O 5D5PA 4JTDB 5B3SC 2EINC 1BCCH 2GSMB 1COWG 2P67A 3HR0A 5LA6B 4DR6O 1R6NA 5JH7A 4F6RB 5IDJA 5FL7G 1TVKA 2V7QG 4LFBB 4WBNA 1SF9A 4B08A 2FTKA 3E22A 2X7RB 3T1YB 3UO3A 4LNUB 4FJCC 1K9MW 1NH2D 3JALB 3WB1A 1WA8B 3LUTB 1ZL8B 5L3CA 5IYCO 1XHXA 1WNSA 5BMVA 4LFAO 5FNVB 2ZIMA 2ZM6B 4G28B 3JASB 4X64O 4PDRA 4EEQA 4MT8A 4EFBA 1GK9A 1HDJA 3ZIAG 2QWRB 2Q0OC 1YEWA 2JJ1G 1IBKB 3RYIA 2L35A 1QLNA 3ZN0A 3G71V 3RYCA 3GWKC 4LR3A 1BQZA 1P4RA 1NTKH 2ZE6A 3EXAA 3ZMTA 3I56V 3E86A 4H33A 5BZBA 1BE3H 1N33B 1HNXB 1NJIW 1RSOA 3E35A 2AZ2A 2WA4A 3OMAB 2YEVA 2UUCB 2GUZA 3OD4A 3IAYA 4B3TO 3AG2B 3CCEV 4O2AA 4YY3O 2L6LA 5FPOA 2GV9A 2JDIG 1URFA 1M57C 3IC7A 1K4CC 1HR0O 5IJ9B 4AQYO 4MVUA 3Q4HB 4FVMA 3HKBA 1GN3A 5IY5B 1EFRG 4X88A 4MTGA 4P9PA 1VQOV 1PNLA 1AROP 1N36B 1IX9A 2HLDG 2HP8A 4DV3B 4H13B 2CH7B 1I94O 4YIOA 3W7XA 1TAEA 3CRAA 4G27B 4GCZA 2OTLV 2IJHA 3VQWA 4CS4A 2QM7A 4B3SO 4GKJB 4O2BB 4DV5O 1S5HC 4HNAA 4TWKA 5L3GA 1YHQV 4NXNB 3FB5C 2ZE5A 3FFQA 2EIKC 4W4LA 4PHZA 4DW1A 3MHHC 1EBOA 4FFBB 3AK3A 1E1RG 3SYCA 2YUAA 4X20A 1H2MA 3D3IA 3CCLV 2LGWA 1HNZB 2CAZC 1M1KW 3HB3B 3ABMB 4UCOA 4J9ZB 4FLUA 4DV1B 2Q7HA 2QWOB 3H1JH 4LCUC 1OZ0A 5LP6A 3FYIB 1BHBA 5JQGA 1NVPB 4B7EA 4WFFA 2ZD9A 3QO5A 5ITZB 1F4NA 1VQMV 1M9NA 1LUWA 1KC8W 5IJ0B 5LMNB 4RAIA 2E74B 1R3JC 4DR3B 4DK1A 3K58A 3DSQA 2OTJV 1QCEA 1OV9A 2F23A 4JYBA 3CMAV 1J5EO 2EIKB 3IFXA 4FFKA 1ZWIC 4PDVA 5GONB 4DRXB 2QWNB 5IYDO 4DUZO 3K0GA 4U3JB 3KG2A 5CMUA 2IH1C 4UVBA 3L75H 4NXMB 1QLEC 1AVMA 4FIPC 1K92A 1QNMA 2CE4A 2PGGA 3S3XA 1N32O 2HJFC 5KHGA 3CCRV 4B3MB 1H2KA 3LSUA 2JRIA 4JI3B 1JJOA 2LFRA 5FLXN 1F4MA 3O65A 4JI5B 5JH7B 4DR1O 4UXNA 3K5MA 2WAMA 3E22B 2OCHA 4R8CA 3CCSV 3QVNA 2JK5C 3B09A 1MA1A 2Q4PA 3RVZA 4JI7B 2DE0X 4JAUA 5B66Z 3L74H 4QE7A 1Y6XA 1FYJA 2JS3A 5EYPA 3W7UA 3NXSA 4MVRA 5BMVB 1AR1B 4WF9V 3CXCU 4J9YB 2Y69B 4LF7B 5JJEB 3N2GA 2BE3A 4CZZA 3SPIA 1WJZA 1WP8A 3RYIB 3RYCB 1EN4A 3CC4V 2K1EA 2OIEA 2H94A 1RSOB 4O4LA 1BS3A 3T4DA 4MVOA 2XOKG 5IE9A 3U10A 2DQ3A 2YEVB 5EIBC 2GUZB 2CTWA 2WPDG 4JI1B 3F7VC 2DYSB 4JTAB 2YI9A 3LSQA 4DR6B 3SYPA 3ZS8C 2HHHO 4GUNA 1AI4A 3OEHG 3HKBB 4ZOLA 2IJKA 2IJIA 4X8AA 3JYCA 1G1XB 3ICXA 3E8GA 3HKDA 1RFYA 2X6CA 4LF5B 2HR3A 4PA7A 2OT5A 5LBQA 2NNUA 2DMXA 1V9PA 1N33O 1HNXO 5LP6C 4X65O 1O9GA 1SKVA 2VRZA 3A0RA 4P30A 3TXSA 3BHPA 4LFAB 4CS2A 1S72V 1EN5A 3L72H 2Q6AA 3JAWA 5L3FA 1X4TA 3AG4B 2EX3A 1VMGA 1HW7A 4UV8A 4DV6B 4HNAB 1VQ5V 5C8YA 4AI8A 1G4YB 4X66O 2Y48A 1QU7A 1HP8A 2AW9A 1IVSA 1FXKC 4J7JA 3P3PA 4KL1A 1N36O 1BGYH 3EHBB 4HBNA 4LF8O 4X20B 3RFRA 4DV3O 5FPRA 2W6IG 1VP7A 4B3TB 1NZ6A 3OTFA 4PI2A 5IT9N 3SR2C 3CD6V 5B1AB 3OEEG 2JJ2G 4IT5A 3AG1C 1BSMA 2MW2B 4YY3B 1LNQA 5LP6B 3G6BA 4GT1A 1HR0B 3CRQA 5JQGB 4PI0A 2ZT9B 3OAAG 2F43G 3MD0A 4J80A 1S0VA 3D36A 4UB8Z 2P22C 1DGSA 4YJ3B 1SQQH 2ILMA 2CDYA 1THZA 1EM1A 2A06H 1IXMA 1QHTA 4CH6A 4Z2WA 3SJBC 3CCUV 3K59A 1I94B 2BTQA 4WCEV 1MZEA 1R1BA 1NVPD 2FKXA 4AILC 3G67A 3R65A 2UXXA 5KAFZ 1I0HA 3W7WA 4Q20A 4DV5B 2LFSA 5CA1A 3OUSA 1QQCA 2HVJC 3KCYA 4GLXA 1XUQA 1ZX3A 4X1KB 5EK0A 4KXRA 3SPCA 5KHJA 2LQTA 1GM9A 1ZLZA 1AJPA 2WLHA 3VQYA 2KSDA 3ASOC 1DTOA 2F93B 2QTOA 2LW1A 4DV4O 1FS0G 3UO2A 1OCRC 3TJTA 2GDSA 1YJWV 1V55C 2RCVA 3MHSC 4FK5C 5KA6A 1W0JG 2ETNA 2ZQMA 1MOFA 2YXYA 3ZN1A 3ZHTA 4FLTA 2PYJA 1GTOA 3N2GB 3P32A 1P84F 1OCOC 1L0NH 3ABLC 4JI5O 2YIBA 1P49A 1J5EB 3ZHRA 4NTYA 1QR8A 4DO2A 5K1PA 2R9AA 2EIMC 4OGQB 2BOCC 1PPJH 1AP5A 2WLIA 5LHGA 4LFCB 5A2QN 4JI7O 1GH6A 3ASOB 4O4LB 2EIJC 4NVPA 1LUVA 3CPWU 3RVYA 2YS8A 1WPBA 4QPKA 1W0KG 2ZCEA 1SQBH 1HWYA 2YICA 3QNEA 1U96A 1KP2A 3HKCA 4X1IA 3ML0A 4DR1B 1MMMA 2QKCA 1SETA 4ZOLB 1I08A 2NLJC 1Q81W 4TV9A 1HNWB 3R66A 4D7TA 4F6EA 1L1FA 1ORQC 1A32A 4W4KA 1FKAO 1FJGO 2VWKA 3DGEA 3LNNA 3FX7A 3B8MA 2BSKB 1JX9A 2ZDIC 4PA4A 5HFMA 3D36C 4JI6B 3SJQC 3OGCC 3JAWB 2D3OW 2JIZG 1PP9H 1XBLA 3ZCCA 1XMQO 2W6JG 2W0XA 2XASA 4JV5O 2EILB 4IHJA 4ZI7A 5GTHZ 1H2SB 4LF5O 1KMIZ 5H9CA 2HFEC 3K5NA 3JCUZ 5EBMC 4CH3A 4I0XB 4ABMA 2VQFB 3CCJV 2Q67A 3ZMVA 1YJ9V 2UUBO 1XILA 1JMKC 1YSCA 1FXHA 1VQKV 4X9QA 4DR2B 1NS1A 3CYOA 2PI4A 3I55V 1OHHG 2Z3YA 3T4ZA 3SJCC 1VQ8V 1NU1H 2HHHB 4DV6O 4BIZA 4P2ZA 4OX9O 2JGDA 4YIPA 4JZGA 3C3SA 3HKEA 5B3SB 2EINB 5BR8O 3QF7A 1SZTA 4ZHQA 3CCQV 3E2EA 2CTPA 2RJZA 5CA0B 4X65B 1UPGA 4IYHA 1XMOB 1KUQA 3AEIA 4BW9A 2R70A 2BTQB 5J2TB 4TSFG 1FFTB 4IIJA 3B77A 1S5JA 2O57A 5IWAO 1YZBA 2C2AA 2OCCC 1XNRB 2ADPA 1H8HG 3OW2U 1IZ3A 1XL4A 2NR5A 1XL6A 1GO3F 1AR4A 1NI8A 1FFXA 4X66B 3H01A 2A7WA 3CCMV 2A0LA 2WLKA 1XQ8A 1AI5A 1K5SA 3F7YC 5B1OA 4GX2A 3CRMA 5JWPA 1I5XA 1RPOA 2BCCH 3K9SA 1CP9A 4LF8B 2F4VO 1I7FA 2N74A 3IGAC 1RP3B 5LOVA 1QVFU 4WFGA 3BVOA 1NR7A 2WLLB 1K33A 2E76B 1H8EG 4X1YA 3WG7C 4TQFA 3OMNB 2JGUA 3OTOO 4XDLA 1N34O 3OE7G 4EB6A 2ZKOA 2Z5UA 2DOSA 2B1IA 2HG5C 1VARA 4O4IA 4MW3A 1M57B 3C90A 4WFAV 4UCTA 5EZYB 1AI7A 2VQEO 1KECA 3GB7C 3OUFA 3JATA 5IYZA 3WB2A 2JS5A 4ZIBA 3L71H 3RWRD 1N8RW 2V4DA 3SPHA 3BAAA 5E79Z 2W0FC 1NKDA 1K34A 4JI0B 1SZXA 2PTMA 5KX5A 5KHIA 3UT5A 4I9WA 1Q6HA 3H1LH 1Q43A 4IL6Z 1BMFG 4CC6A 4PDLA 2M6YA 2H8PC 5H2FZ 3WG7B 4FLXA 2QWQB 3JD2A 4DV4B 1NTZH 4TV9B 1H2NA 2QJ1A 1KU9A 1LR1A 5EC2C 2Z0AA 3JD3A 1JFFA 3CX5F 1FXKA 4RQEA 4LFCO 1YDXA 5LXTB 4NTWA 5KLVH 2IBZH 3ZRVA 4QJFB 4LH7A 4DK0A 2ZNIA 4E2LA 3ZMUA 4O4HA 4X89A 2UXCO 4J7KA 5LGNA 3ZHQA 4LF4O 2N05A 4U7NA 2FL4A 4JYYA 5CBHA 5JCOA 5J2UA 1J95A 1VEWA 3F5WC 4ZKIA 1TVKB 3BA9A 2GBOA 1YITV 4WBNB 1E1QG 3SDLA 4Q6GA 4MS2A 4ZI7B 5CA3A 3EFFK 3JAKA 3SJAC 1HNWO 2BTOA 1GRJA 1PV0A 2BOBC 2JVDA 2DQ0A 5K1XA 4XDJA 1SESA 1VQ9V 4O4JA 3VQVA 2FYUH 2IJJA 1R73A 3B40A 1WB8A 4JI6O 4U7OA 1OCZC 2HEPA 3L73H 1MSWD 2Y0PA 1NQTA 1GM7A 1Q6IA 3CJHA 1QLEB 2Q68A 2GTAA 2WSSG 2P7TC 3HKEB 3G4SV 2QKSA 2IW5A 4LF9O 2ITCC 4ZHQB 5KAIZ 2R9IA 2OYQA 4BAYA 4HZ3A 2A79B 4PA9A 1FJGB 3T1CA 3ZHUA 2VQFO 4LC1A 1W2BU 3T1HO 1BT8A 4E4EA 5CB4A 4IIJB 2YXLA 3QO7A 1PL4A 3A0BZ 4DR2O 1R3KC 4KFMA 4O2AB 1Y67A 2P06A 4HYOA 2UUAO 2YIAA 1XMQB 3OMIB 2KKWA 1KP3A 3I5DA 4JV5B 1B06A 1N4CA 1ROPA 3ETQA 4X62O 1VQ4V 3M7MX 1UFIA 3CWBH 3STZC 3D8CA 4MTFA 4GYCB 4EKWA 1WP7A 3AG7A 3OFNG 3K57A 1JQ0A 1WN7A 2CK3G 1XMOO 4DV7B 1SA0A 1IDSA 2UUBB 4TT3G 1BHAA 4FLVA 4N21A 2F66C 4BR6A 1YVWA 3QO8A 4MTXA 1XNRO 3TK1A 4OX9B 3BRCA 3LDCA 4EB6B 5BR8B 3N27A 3C3TA 4N23A 1VQ7V 3JD1A 4LP8A 5CBGA 3DC6A 3JATB 4F6RA 5IYZB 4LF6B 2IU3A 4WFEA 1GAXA 4I4TA 4I50A 2QA4V 2YXHA 1IURA 4GKKO 1WB7A 5IYBO 5EC1C 2P5OA 5IWAB 3CB2A 1MZFA 1XOUA 4TUYA 1KKDA 1S3JA 5JCOC 3JALA 4YHHB 1WA8A 5KX5B 1YIJV 1ZL8A 2ZDIA 4JI8O 3VQXA 4L87A 2YIBD 2PZSA 2ZXWC 5AG2A 1QVGU 1N0NA 3ZX6A 3RYFA 1SQPH 3RGBA 1DF5A 2R72A 3JASA 2F4VB 2WLJA 5F2VO 3LNMB 3D3QA 3CHXA 1M93A 3ASNC 1UJWB 2LO1A 1JFFB 2AZ0A 1NR1A 1FXKB 2XAGA 4JAVA 1KD1W 4NB5A 2Q69A 1XNQO 2Q7GA 3DTUB 4JI0O 3QTCA 4A5UB 3OTOB 3M99B 1K5QA 2EJRA 2E75B 3L70H 2EZOA 4DV2O 1N34B 1RM1C 4R6ZA 1AI6A 2WLMA 3T2MA 3AG1B 2IH3C 3B2EE 5EBLC 5KA5A 5J2UB 5KHHA 3SYQA 2VQEB 3ZRWA 2AHZA 1IBMO 2G38A 5IJ9A 1OJHA 1Y76A 3CCVV 1EN6A 3SGIA 2ZXWB 5LGUA 1TGOA 1VF6A 1YTFD 5B5EZ 1CPYA 1XI1A 3K9AA 3MAQA 4FPPA 3APOA 5EBWC 4PA6A 5EYPB 1R6KA 2QM8A 3CP1A 2LW7A 4MVQA 4FZ0A 4O4JB 1AJNA 3ASNB 2EJ7A 4FZ1A 2XAHA 2ZIOA 1PNKA 5H6QA 2Y0IA 4D6TH 3CJHB 4J42A 2Q5ZA 1QBZA 4B7KA 1M56C 3AG3C 3JSNA 4P9OA 4CBCA 1VQ6V 2CTRA 2NN4A 4RQFA 1SQGA 1F7YA 3JD4A 1NBMG 5CB4B 3UCSC 4PELA 1OCRB 2UXCB 1V54C 1FXVA 4LF4B 1V55B 2RQ6A 4MTOA 4PDMA 1WPXA 2QTSA 2WWWA 4I7ZB 4CH5A 4XBFA 2HJDA 2XNDG 2XAFA 4ASUG 2Y4TA 4R7CA 4FLWA 3HKDB 5B1NA 4PA3A 5A9GA 1K8AW 5ITZA 2UU9O 4RWUA 3IJ4A 2D2CB 1OCOB 5L3BA 4JI2O 3ABLB 1TA8A 5IJ0A 1FD9A 1Q5OA 2CGNA 2HVKC 4DR7B 1SA0B 1Y66A 1P7GA 1BL8A 4DR4O 1M56B 2EIMB 5GONA 3AG3B 1YF2A 2PI5A 4GX5A 3S3WA 1F51A 3EVKA 4GX1A 1SQXH 3ETEA 2EIJB 4KHPB 4DW0A 1DK1A 5L3EA 5LMUO 4Z1VA 3B4SA 5C8YB 4J10A 3FAVA 4FM1A 4YJ2A 4LF9B 3DXRA 1DF4A 4H0LB 1TUBA 2JEUA 5JJJB 1XHZA 3LDDA 4QE9A 1VF7A 1KKCA 3ZMSA 1IBLB 1BQ0A 3BFRA 2P90A 4DV7O 3T1HB 4I4TB 4I50B 2KG7A 2H3OA 4DR5O 3E83A 4LH6A 5KUMA 3UKMA 1AB3A 2UXDO 5EIBD 5JVDA 4GX0A 3E8FA 4I55A 4TUYB 2E5LB 2UUAB 3AG2C 5LHHA 2LP7A 2XTAA 5B1BC 4X62B 1WLEA 2QM4A 4IYIA 4DYLA 3CC7V 2DYRC 3RYFB 1VF6C 5IY5C 1KQSU 3M8AA 3KZIZ 4WFHA 1K4DC 5DECA 5J9PC 2KQXA 4ICGA 2QE7G 2FMLA 1B6QA 2B9ZA 4AHCA 2V1DA 4LF6O 2ATKC 3PN1A 2QR4A 2MK3A 4B3RB 2B5UA 4YXWG 5LGTA 3W7SA 4FMTA 2QKAA 1JPXA 4MVMA 2R9RB 5CA1B 2QDOA 3G6EV 4YHHO 1KB9F 1JR9A 2Q7EA 3CS5A 4NKGB 5DN6G 3B8NA 4TQDA 1YCIA 2VS0A 2X0LA 4MSWC 4QPJA 2GHYA 2Y4UA 3K04A 2WLNA 1H38A 4KP4A 4PD4F 3ZRWB 5KMGA 5B1BB 1Y76B 4HAMA 4GKKB 3K5OA 2AHYA 2DYRB 2ADQB 2YIDA 1D2DA 1SERA 3ABMC 3GWOA 1M90W 3NR7A 1Q82W 3X2QC 4JI8B 2ARHA 1EZVH 2EZPA 1FPOA 5GTIZ 3BA8A 3HPLC 1EZJA 4TOIA 1YXBA 2OCCB 4UCVA 2RMKB 4Z1MG 2RDCA 3RN4A 1PNMA 5KHKA 2OIGA 1B04A 3G80A 3K06A 4QGPA 1R3LC 3P30A 2EULA 4BIOA 2WLIB 3N2KA 1PM9A 1XNQB 1TUEB 4D7SA 2A9HA 4MVZA 4DV2B 4JGSA 4NYKA 2PUSA 1Y4MA 3LSSA 1Z2GA 2UXBO 2YDEA 3H1KH 4JYAO 3HKCB 4DXWA 4X1IB 4CC5A 3X2QB 1IBMB 4QIWF 4K0KO 5L3DA 2KB1A 5E1AC 3RBZA 3L9DA 3K79A 1K7DA 4YJ3A 1Q3EA 4OPHA 3K08A 1YJNV 1P7BA 2PF4E 5LYJA 2XT9A 3LDEA 1YTFB 1B3QA 1CEZA 3BY6A 1Y74A 3ETGA 1JVMA 3SPJA 2DJVA 1ZAUA 1VQPV 4H37A 3ZHSA 1M4UA 1CXZB 2EBOA 2ZE8A 4DV0O 4WFBV 2Y69C 2QWPB 3QG5A 5KUKA 3A2FA 1SQFA 4IHJB 3FAVB 4DUYO 4J7ZA 4YJ2B 4UB6Z 3DXRB 4LWSA 1TUBB 4X1KA 3STLC 3K5LA 4CH4A 4G2KA 3A8TA 2LGQA 1K73W 2X6BA 1H2GA 3K3WA 5CBFA 2Q73A 1NTMH 4DR7O 3ZBHA 3JSLA 1K3EA 1SC5B 2KG7B 3FB7C 3P3NA 3ZRSA 4H44B 2RN9A 2F1MA 1M5IA 5JVDB 3CRCA 4I55B 2DYSC 3IC9A 2XAJA 4JF3A 2A3QA 3RYHA 4KHPO 2ITDC 1Q90D 2JGDB 4JI4O 3JD0A 2K9PA 2UU9B 2DWEC 1ZUQA 4MVSA 3E89A 1MG1A 3SYAA 4JI2B 4JTCB 4TV8A 3OT7A 4I5SA 1GN6A 2VWJA 1XEQA 1IBLO 1OCCC 1JJ2U 4PJ0Z 1D5NA 1W59A 1E79G 3K0DA 1AR5A 1QR9A 3J80N 4LFBO 3VOUA 4DR4B 4UV9A 3RW0A 1T5EA 3FB8C 2DW4A 2XAQA 1D5AA 3T1YO 3FKSG 3WB0A 1GN2A 4U3FH 4JASA 3WFVA 1N0JA 2E5LO 5LMUB 2YSUB 3AG4C 1L0LH
chains in the Genus database with same CATH topology
1HNZB 1FFXB 2VQEB 2CAZC 3K5NA 3JARA 4UCOA 5IJ9A 4FLUA 4DV1B 4CH3A 4L8JA 2Q7HA 3SGIA 5LP6A 2VQFB 3THOA 1TGOA 5JQGA 1JMKC 5KMGB 1XI1A 4DR2B 3MAQA 5ITZB 5EYPB 5LOVB 2XHBA 4DR5B 3SJCC 4O4JB 2UXDB 2HHHB 5IJ0B 5LMNB 4I9QA 4DR3B 2ZIOA 3HKEA 4DK1A 3K58A 3DSQA 4X1YB 2Q0AA 3QF7A 5GONB 4DRXB 4ZHQA 4U3JB 2RJZA 5CA0B 4X65B 1XMOB 4FM2A 4BW9A 4O4IB 2R70A 5D5QA 2BTQB 5J2TB 4NXMB 3JSNA 4FLZA 4IIJA 4X64B 2PGGA 5LA6A 1S5JA 5KHGA 1SQGA 4B3MB 3BPZA 2YI8A 1XNRB 5CB4B 4JI3B 1JJOA 3N2KB 2UXCB 4LNUA 4JI5B 5JH7B 4LF4B 1FFXA 4X66B 2RQ6A 3K5MA 1XQ8A 3E22B 3UT5B 4CH5A 4JI7B 4FLWA 4LF8B 3HKDB 5FNVA 1I7FA 5ITZA 5EYPA 5LOVA 1NT2B 4FLYA 1Z5VA 4AQYB 1TA8A 5BMVB 5IJ0A 1Q5OA 4DR7B 1SA0B 1G6UA 3ZEDA 4LF7B 5JJEB 4K8ZA 4X1YA 3N2GA 4TQFA 2PY5A 2JGUA 5GONA 3UQ8A 4K8XA 4EB6A 5LYJB 5CA0A 3RYIB 4KHPB 3RYCB 1L8DA 5C8YB 4O4IA 4O4HB 3BABA 5J2TA 4UCTA 5EZYB 4FM1A 4BWAA 3U0ZA 4YJ2A 3JATA 5IYZA 4LF9B 4O4LA 3WB2A 1XHZA 2JS5A 5JJJB 1TUBA 3U10A 4B3SB 4ZIBA 5EIBC 3RWRD 4UCUA 1VF7A 1IBLB 4JI1B 2V4DA 3BAAA 3JAKB 2YI9A 4JI0B 3T1HB 2ZINA 4I4TB 4I50B 4DR6B 2PTMA 5KX5A 2PYLA 5KHIA 4LH6A 3UT5A 3ZS8C 5EIBD 5JVDA 3HKBB 4I55A 4TUYB 4ZOLA 1Q43A 2E5LB 2UUAB 4CC6A 3ICXA 3HKDA 4LF5B 4UFZA 4X62B 4FLXA 1V9PA 2UXBB 2QM4A 4JYAB 4DV4B 5LP6C 3RYHB 1Q8IA 1O9GA 3RYFB 4TV9B 1SKVA 2QJ1A 1KU9A 2E3CA 4K0KB 4O2BA 1JFFA 3BHPA 4LFAB 4CS2A 3JAWA 4AHCA 5LXTB 1X4TA 3PN1A 4LH7A 2EX3A 4TV8B 4B3RB 1HW7A 4DV6B 4HNAB 4DK0A 2ZNIA 5C8YA 3U11A 4O4HA 4FFBA 5EZYA 5CA1B 5JCOA 2Q7EA 5J2UA 3CSXA 4DUZB 1TVKB 3BA9A 4WBNB 4DV0B 4Q6GA 4CS3A 4ZI7B 2IM9A 4KL1A 4TQDA 4HBNA 3JAKA 4X20B 3RFRA 3SJAC 2BTOA 5FPRA 4DUYB 4B3TB 5KMGA 2F95B 3JARB 1N32B 3OTFA 4PI2A 2JVDA 3SR2C 5K1XA 4YY3B 4EFEA 5LP6B 4GKKB 3K5OA 1HR0B 4O4JA 3VQVA 5JQGB 4PI0A 4UCRA 1Z5WA 2P22C 2HEPA 1DGSA 4YJ3B 4JI8B 4DRXA 4U3JA 4FM0A 2OWOA 3BA8A 2ZNJA 4UCSA 3HKEB 4TOIA 4UCVA 1QHTA 4CH6A 3SJBC 5LXTA 3K59A 4JI4B 1I94B 2BTQA 4ZHQB 5KHKA 1B04A 5JJNB 2OYQA 1O9HA 1FJGB 4AILC 5D5PA 4DV5B 5CA1A 5CB4A 4IIJB 5LA6B 3N2KA 1QQCA 2YXLA 4GLXA 5JH7A 4F6RB 1XNQB 4D7SA 1TVKA 4O2AB 4LFBB 4WBNA 4X1KB 4B08A 4DV2B 2YIAA 3E22A 5KHJA 1XMQB 2KKWA 3T1YB 2PUSA 4LNUB 4JV5B 3VQYA 3JALB 3ETQA 3WB1A 2F93B 3M7MX 3HKCB 4X1IB 4CC5A 4GYCB 1XHXA 1IBMB 1WNSA 3K57A 1WN7A 5BMVA 5FNVB 4DV7B 1SA0A 2UUBB 2ZIMA 2ZM6B 4YJ3A 1Q3EA 3JASB 4FLVA 4EEQA 2F66C 4EFBA 5LYJA 4FLTA 1YEWA 1IBKB 3RYIA 2PYJA 3N2GB 3RYCA 4LR3A 4OX9B 3BRCA 1ZAUA 4EB6B 2YIBA 1N33B 1HNXB 1M4UA 5BR8B 1P49A 1J5EB 1RSOA 3QG5A 5K1PA 3A2FA 2R9AA 1SQFA 2UUCB 4IHJB 3IAYA 4LFCB 4YJ2B 3JATB 4F6RA 5IYZB 4LF6B 4O4LB 4O2AA 1TUBB 4I4TA 4I50A 4NVPA 4X1KA 5FPOA 2GV9A 3K5LA 4CH4A 1WPBA 2P5OA 5IJ9B 5IWAB 3CB2A 4FVMA 3HKBA 4TUYA 5JCOC 2ZCEA 3JALA 3JSLA 4YHHB 5KX5B 3HKCA 4X1IA 4DR1B 2F1MA 1M5IA 5JVDB 3VQXA 4I55B 4ZOLB 2YIBD 2PZSA 1N36B 3RYHA 3RYFA 4TV9A 4DV3B 1HNWB 4D7TA 3RGBA 2R72A 1TAEA 3JASA 2F4VB 2UU9B 3CHXA 1M93A 3VQWA 2VWKA 3LNNA 4JI2B 4CS4A 4GKJB 4TV8A 4O2BB 4HNAA 1JFFB 2VWJA 4NXNB 4JI6B 3JAWB 3FFQA 2Q7GA 3QTCA 4DR4B 3OTOB 1T5EA 1N34B 4PHZA 1D5AA 4FFBB 3WB0A 4IHJA 4ZI7A 3B2EE 5LMUB 1H2SB 4X20A 5J2UB 1KMIZ 5KHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKW A;  1XQ8 A; 
#chains in the Genus database with same CATH topology
 1FFX B;  4IGG A;  3JAR A;  1IXB A;  2HKO A;  1OCZ B;  4L8J A;  3THO A;  3ABT A;  5KMG B;  2ZM6 O;  3FD9 A;  4RO2 A;  4UVA A;  3VBB A;  4JYC A;  4F4L A;  4UUJ C;  5LOV B;  2XHB A;  4DR5 B;  1IBK O;  3E8H A;  2UXD B;  4B3R O;  2ZE7 A;  4I9Q A;  3AK1 A;  4NTX A;  3PJS K;  5B1A C;  1OCC B;  4X1Y B;  3SYO A;  2Q0A A;  3K03 A;  1VIB A;  2M7W A;  1NH2 B;  1JOY A;  3BEH A;  2BSK A;  3CE2 A;  2UUC O;  3OR6 C;  3AK2 A;  4OPA A;  4FM2 A;  4O4I B;  5D5Q A;  1FAF A;  3WU2 Z;  1VQN V;  4FLZ A;  3APQ A;  4X64 B;  5LA6 A;  1PL0 A;  1AP6 A;  1MNG A;  4R50 A;  3OM3 B;  3BPZ A;  3FYE B;  1S5L Z;  2YI8 A;  3ZJZ A;  2QEX V;  1R3I C;  3F5T A;  1BZK A;  2N04 A;  3N2K B;  4NR1 A;  4LNU A;  1YI2 V;  4MW8 A;  4I0X A;  3CRR A;  3UT5 B;  3UM7 A;  1SQV H;  5H6R A;  4OXS A;  3KCX A;  3TET A;  3H1H H;  1I5Y A;  5FNV A;  1NT2 B;  2ODM A;  4FLY A;  2YC0 A;  1Z5V A;  3BCC H;  4AQY B;  1AJQ A;  1ENV A;  4GKJ O;  3H1I H;  2ZR3 A;  3SPG A;  5BY1 A;  4UVC A;  5C93 A;  4NXN O;  1G6U A;  3ZED A;  4C7U A;  4K8Z A;  2CUG A;  4XDK A;  4ZBM A;  2PY5 A;  1JCH A;  5GW7 A;  2CGO A;  3UQ8 A;  4K8X A;  3FB6 C;  5LYJ B;  5CA0 A;  3DC5 A;  1VQL V;  5TIS Z;  1AIL A;  1US6 A;  3CEI A;  3H9V A;  3CME V;  1L8D A;  2Q8V A;  1Y74 B;  3MDS A;  5CN0 A;  4O4H B;  1KYO F;  1X59 A;  3BAB A;  5J2T A;  5LL6 Y;  1HNZ O;  1ZSP A;  1Q6U A;  4BWA A;  3U0Z A;  1KBH A;  4DV1 O;  4LBE C;  4B3S B;  3ABU A;  1SS3 A;  2RNB A;  4K35 A;  4UCU A;  1GKF A;  3Q4H A;  5LHI A;  1K97 A;  3JAK B;  2JEX A;  3KKY A;  3OR7 C;  4LWS B;  2ZIN A;  1Q7Y W;  3CC2 V;  2PYL A;  3ZHV A;  2AGA A;  5LMN O;  1XRE A;  4PV1 B;  1PKX A;  4DR3 O;  2QGN A;  4K3A A;  4UFZ A;  1ZTE A;  2CH7 A;  1RPR A;  2LJ2 A;  2UXB B;  4JYA B;  3RYH B;  1Q8I A;  2WA3 A;  2X6A A;  1XDC A;  3JAM N;  3O9O A;  2WLL A;  4JZ2 A;  1DLB A;  2E3C A;  4K0K B;  4O2B A;  1RM1 B;  4NXM O;  2P4K A;  1R6T A;  3ABK C;  2AXT Z;  4KUM A;  4B3M O;  3ZRX A;  2P4V A;  1PD3 A;  1Q86 W;  4TV8 B;  3RT3 C;  1MAB G;  4JI3 O;  3U11 A;  3J81 N;  4FFB A;  2DWD C;  3TXQ A;  1S76 D;  4GZR B;  5EZY A;  1SRY A;  2XUM A;  4RUF A;  1GM8 A;  2P6J A;  4RUE A;  3CSX A;  4DUZ B;  4JPR A;  1U97 A;  4DV0 B;  4CS3 A;  2IM9 A;  3J7A U;  1GMG A;  2B1G A;  1MSD A;  3GVM A;  2DN9 A;  4DUY B;  3ETD A;  2CTQ A;  2GTS A;  5DM6 V;  3E8B A;  2F95 B;  3JAR B;  1N32 B;  1G8M A;  2EIL C;  1S77 D;  1H2L A;  4EFE A;  5H5N A;  4QNH B;  3OGI B;  3TCU A;  4LF7 O;  3W7T A;  1JA8 A;  4UCR A;  1Z5W A;  3A0H Z;  1GN4 A;  3ABK B;  4JAA A;  5DED A;  1F23 A;  2QSA A;  4BW5 A;  5BXZ A;  4DRX A;  1VF5 B;  2ZR2 A;  2UXN A;  1WAZ A;  4U3J A;  4FM0 A;  2OWO A;  3TGU H;  2Q9L A;  2ZNJ A;  4UCS A;  4J11 A;  3CXH F;  4BIU A;  4J41 A;  3JCZ A;  5LXT A;  4JI4 B;  5JJN B;  2IU0 A;  1V54 B;  2FB5 A;  1O9H A;  5HFL A;  3ZMZ A;  4JI1 O;  5D5P A;  4JTD B;  5B3S C;  2EIN C;  1BCC H;  2GSM B;  1COW G;  2P67 A;  3HR0 A;  5LA6 B;  4DR6 O;  1R6N A;  5JH7 A;  4F6R B;  5IDJ A;  5FL7 G;  1TVK A;  2V7Q G;  4LFB B;  4WBN A;  1SF9 A;  4B08 A;  2FTK A;  3E22 A;  2X7R B;  3T1Y B;  3UO3 A;  4LNU B;  4FJC C;  1K9M W;  1NH2 D;  3JAL B;  3WB1 A;  1WA8 B;  3LUT B;  1ZL8 B;  5L3C A;  5IYC O;  1XHX A;  1WNS A;  5BMV A;  4LFA O;  5FNV B;  2ZIM A;  2ZM6 B;  4G28 B;  3JAS B;  4X64 O;  4PDR A;  4EEQ A;  4MT8 A;  4EFB A;  1GK9 A;  1HDJ A;  3ZIA G;  2QWR B;  2Q0O C;  1YEW A;  2JJ1 G;  1IBK B;  3RYI A;  2L35 A;  1QLN A;  3ZN0 A;  3G71 V;  3RYC A;  3GWK C;  4LR3 A;  1BQZ A;  1P4R A;  1NTK H;  2ZE6 A;  3EXA A;  3ZMT A;  3I56 V;  3E86 A;  4H33 A;  5BZB A;  1BE3 H;  1N33 B;  1HNX B;  1NJI W;  1RSO A;  3E35 A;  2AZ2 A;  2WA4 A;  3OMA B;  2YEV A;  2UUC B;  2GUZ A;  3OD4 A;  3IAY A;  4B3T O;  3AG2 B;  3CCE V;  4O2A A;  4YY3 O;  2L6L A;  5FPO A;  2GV9 A;  2JDI G;  1URF A;  1M57 C;  3IC7 A;  1K4C C;  1HR0 O;  5IJ9 B;  4AQY O;  4MVU A;  3Q4H B;  4FVM A;  3HKB A;  1GN3 A;  5IY5 B;  1EFR G;  4X88 A;  4MTG A;  4P9P A;  1VQO V;  1PNL A;  1ARO P;  1N36 B;  1IX9 A;  2HLD G;  2HP8 A;  4DV3 B;  4H13 B;  2CH7 B;  1I94 O;  4YIO A;  3W7X A;  1TAE A;  3CRA A;  4G27 B;  4GCZ A;  2OTL V;  2IJH A;  3VQW A;  4CS4 A;  2QM7 A;  4B3S O;  4GKJ B;  4O2B B;  4DV5 O;  1S5H C;  4HNA A;  4TWK A;  5L3G A;  1YHQ V;  4NXN B;  3FB5 C;  2ZE5 A;  3FFQ A;  2EIK C;  4W4L A;  4PHZ A;  4DW1 A;  3MHH C;  1EBO A;  4FFB B;  3AK3 A;  1E1R G;  3SYC A;  2YUA A;  4X20 A;  1H2M A;  3D3I A;  3CCL V;  2LGW A;  1HNZ B;  2CAZ C;  1M1K W;  3HB3 B;  3ABM B;  4UCO A;  4J9Z B;  4FLU A;  4DV1 B;  2Q7H A;  2QWO B;  3H1J H;  4LCU C;  1OZ0 A;  5LP6 A;  3FYI B;  1BHB A;  5JQG A;  1NVP B;  4B7E A;  4WFF A;  2ZD9 A;  3QO5 A;  5ITZ B;  1F4N A;  1VQM V;  1M9N A;  1LUW A;  1KC8 W;  5IJ0 B;  5LMN B;  4RAI A;  2E74 B;  1R3J C;  4DR3 B;  4DK1 A;  3K58 A;  3DSQ A;  2OTJ V;  1QCE A;  1OV9 A;  2F23 A;  4JYB A;  3CMA V;  1J5E O;  2EIK B;  3IFX A;  4FFK A;  1ZWI C;  4PDV A;  5GON B;  4DRX B;  2QWN B;  5IYD O;  4DUZ O;  3K0G A;  4U3J B;  3KG2 A;  5CMU A;  2IH1 C;  4UVB A;  3L75 H;  4NXM B;  1QLE C;  1AVM A;  4FIP C;  1K92 A;  1QNM A;  2CE4 A;  2PGG A;  3S3X A;  1N32 O;  2HJF C;  5KHG A;  3CCR V;  4B3M B;  1H2K A;  3LSU A;  2JRI A;  4JI3 B;  1JJO A;  2LFR A;  5FLX N;  1F4M A;  3O65 A;  4JI5 B;  5JH7 B;  4DR1 O;  4UXN A;  3K5M A;  2WAM A;  3E22 B;  2OCH A;  4R8C A;  3CCS V;  3QVN A;  2JK5 C;  3B09 A;  1MA1 A;  2Q4P A;  3RVZ A;  4JI7 B;  2DE0 X;  4JAU A;  5B66 Z;  3L74 H;  4QE7 A;  1Y6X A;  1FYJ A;  2JS3 A;  5EYP A;  3W7U A;  3NXS A;  4MVR A;  5BMV B;  1AR1 B;  4WF9 V;  3CXC U;  4J9Y B;  2Y69 B;  4LF7 B;  5JJE B;  3N2G A;  2BE3 A;  4CZZ A;  3SPI A;  1WJZ A;  1WP8 A;  3RYI B;  3RYC B;  1EN4 A;  3CC4 V;  2K1E A;  2OIE A;  2H94 A;  1RSO B;  4O4L A;  1BS3 A;  3T4D A;  4MVO A;  2XOK G;  5IE9 A;  3U10 A;  2DQ3 A;  2YEV B;  5EIB C;  2GUZ B;  2CTW A;  2WPD G;  4JI1 B;  3F7V C;  2DYS B;  4JTA B;  2YI9 A;  3LSQ A;  4DR6 B;  3SYP A;  3ZS8 C;  2HHH O;  4GUN A;  1AI4 A;  3OEH G;  3HKB B;  4ZOL A;  2IJK A;  2IJI A;  4X8A A;  3JYC A;  1G1X B;  3ICX A;  3E8G A;  3HKD A;  1RFY A;  2X6C A;  4LF5 B;  2HR3 A;  4PA7 A;  2OT5 A;  5LBQ A;  2NNU A;  2DMX A;  1V9P A;  1N33 O;  1HNX O;  5LP6 C;  4X65 O;  1O9G A;  1SKV A;  2VRZ A;  3A0R A;  4P30 A;  3TXS A;  3BHP A;  4LFA B;  4CS2 A;  1S72 V;  1EN5 A;  3L72 H;  2Q6A A;  3JAW A;  5L3F A;  1X4T A;  3AG4 B;  2EX3 A;  1VMG A;  1HW7 A;  4UV8 A;  4DV6 B;  4HNA B;  1VQ5 V;  5C8Y A;  4AI8 A;  1G4Y B;  4X66 O;  2Y48 A;  1QU7 A;  1HP8 A;  2AW9 A;  1IVS A;  1FXK C;  4J7J A;  3P3P A;  4KL1 A;  1N36 O;  1BGY H;  3EHB B;  4HBN A;  4LF8 O;  4X20 B;  3RFR A;  4DV3 O;  5FPR A;  2W6I G;  1VP7 A;  4B3T B;  1NZ6 A;  3OTF A;  4PI2 A;  5IT9 N;  3SR2 C;  3CD6 V;  5B1A B;  3OEE G;  2JJ2 G;  4IT5 A;  3AG1 C;  1BSM A;  2MW2 B;  4YY3 B;  1LNQ A;  5LP6 B;  3G6B A;  4GT1 A;  1HR0 B;  3CRQ A;  5JQG B;  4PI0 A;  2ZT9 B;  3OAA G;  2F43 G;  3MD0 A;  4J80 A;  1S0V A;  3D36 A;  4UB8 Z;  2P22 C;  1DGS A;  4YJ3 B;  1SQQ H;  2ILM A;  2CDY A;  1THZ A;  1EM1 A;  2A06 H;  1IXM A;  1QHT A;  4CH6 A;  4Z2W A;  3SJB C;  3CCU V;  3K59 A;  1I94 B;  2BTQ A;  4WCE V;  1MZE A;  1R1B A;  1NVP D;  2FKX A;  4AIL C;  3G67 A;  3R65 A;  2UXX A;  5KAF Z;  1I0H A;  3W7W A;  4Q20 A;  4DV5 B;  2LFS A;  5CA1 A;  3OUS A;  1QQC A;  2HVJ C;  3KCY A;  4GLX A;  1XUQ A;  1ZX3 A;  4X1K B;  5EK0 A;  4KXR A;  3SPC A;  5KHJ A;  2LQT A;  1GM9 A;  1ZLZ A;  1AJP A;  2WLH A;  3VQY A;  2KSD A;  3ASO C;  1DTO A;  2F93 B;  2QTO A;  2LW1 A;  4DV4 O;  1FS0 G;  3UO2 A;  1OCR C;  3TJT A;  2GDS A;  1YJW V;  1V55 C;  2RCV A;  3MHS C;  4FK5 C;  5KA6 A;  1W0J G;  2ETN A;  2ZQM A;  1MOF A;  2YXY A;  3ZN1 A;  3ZHT A;  4FLT A;  2PYJ A;  1GTO A;  3N2G B;  3P32 A;  1P84 F;  1OCO C;  1L0N H;  3ABL C;  4JI5 O;  2YIB A;  1P49 A;  1J5E B;  3ZHR A;  4NTY A;  1QR8 A;  4DO2 A;  5K1P A;  2R9A A;  2EIM C;  4OGQ B;  2BOC C;  1PPJ H;  1AP5 A;  2WLI A;  5LHG A;  4LFC B;  5A2Q N;  4JI7 O;  1GH6 A;  3ASO B;  4O4L B;  2EIJ C;  4NVP A;  1LUV A;  3CPW U;  3RVY A;  2YS8 A;  1WPB A;  4QPK A;  1W0K G;  2ZCE A;  1SQB H;  1HWY A;  2YIC A;  3QNE A;  1U96 A;  1KP2 A;  3HKC A;  4X1I A;  3ML0 A;  4DR1 B;  1MMM A;  2QKC A;  1SET A;  4ZOL B;  1I08 A;  2NLJ C;  1Q81 W;  4TV9 A;  1HNW B;  3R66 A;  4D7T A;  4F6E A;  1L1F A;  1ORQ C;  1A32 A;  4W4K A;  1FKA O;  1FJG O;  2VWK A;  3DGE A;  3LNN A;  3FX7 A;  3B8M A;  2BSK B;  1JX9 A;  2ZDI C;  4PA4 A;  5HFM A;  3D36 C;  4JI6 B;  3SJQ C;  3OGC C;  3JAW B;  2D3O W;  2JIZ G;  1PP9 H;  1XBL A;  3ZCC A;  1XMQ O;  2W6J G;  2W0X A;  2XAS A;  4JV5 O;  2EIL B;  4IHJ A;  4ZI7 A;  5GTH Z;  1H2S B;  4LF5 O;  1KMI Z;  5H9C A;  2HFE C;  3K5N A;  3JCU Z;  5EBM C;  4CH3 A;  4I0X B;  4ABM A;  2VQF B;  3CCJ V;  2Q67 A;  3ZMV A;  1YJ9 V;  2UUB O;  1XIL A;  1JMK C;  1YSC A;  1FXH A;  1VQK V;  4X9Q A;  4DR2 B;  1NS1 A;  3CYO A;  2PI4 A;  3I55 V;  1OHH G;  2Z3Y A;  3T4Z A;  3SJC C;  1VQ8 V;  1NU1 H;  2HHH B;  4DV6 O;  4BIZ A;  4P2Z A;  4OX9 O;  2JGD A;  4YIP A;  4JZG A;  3C3S A;  3HKE A;  5B3S B;  2EIN B;  5BR8 O;  3QF7 A;  1SZT A;  4ZHQ A;  3CCQ V;  3E2E A;  2CTP A;  2RJZ A;  5CA0 B;  4X65 B;  1UPG A;  4IYH A;  1XMO B;  1KUQ A;  3AEI A;  4BW9 A;  2R70 A;  2BTQ B;  5J2T B;  4TSF G;  1FFT B;  4IIJ A;  3B77 A;  1S5J A;  2O57 A;  5IWA O;  1YZB A;  2C2A A;  2OCC C;  1XNR B;  2ADP A;  1H8H G;  3OW2 U;  1IZ3 A;  1XL4 A;  2NR5 A;  1XL6 A;  1GO3 F;  1AR4 A;  1NI8 A;  1FFX A;  4X66 B;  3H01 A;  2A7W A;  3CCM V;  2A0L A;  2WLK A;  1XQ8 A;  1AI5 A;  1K5S A;  3F7Y C;  5B1O A;  4GX2 A;  3CRM A;  5JWP A;  1I5X A;  1RPO A;  2BCC H;  3K9S A;  1CP9 A;  4LF8 B;  2F4V O;  1I7F A;  2N74 A;  3IGA C;  1RP3 B;  5LOV A;  1QVF U;  4WFG A;  3BVO A;  1NR7 A;  2WLL B;  1K33 A;  2E76 B;  1H8E G;  4X1Y A;  3WG7 C;  4TQF A;  3OMN B;  2JGU A;  3OTO O;  4XDL A;  1N34 O;  3OE7 G;  4EB6 A;  2ZKO A;  2Z5U A;  2DOS A;  2B1I A;  2HG5 C;  1VAR A;  4O4I A;  4MW3 A;  1M57 B;  3C90 A;  4WFA V;  4UCT A;  5EZY B;  1AI7 A;  2VQE O;  1KEC A;  3GB7 C;  3OUF A;  3JAT A;  5IYZ A;  3WB2 A;  2JS5 A;  4ZIB A;  3L71 H;  3RWR D;  1N8R W;  2V4D A;  3SPH A;  3BAA A;  5E79 Z;  2W0F C;  1NKD A;  1K34 A;  4JI0 B;  1SZX A;  2PTM A;  5KX5 A;  5KHI A;  3UT5 A;  4I9W A;  1Q6H A;  3H1L H;  1Q43 A;  4IL6 Z;  1BMF G;  4CC6 A;  4PDL A;  2M6Y A;  2H8P C;  5H2F Z;  3WG7 B;  4FLX A;  2QWQ B;  3JD2 A;  4DV4 B;  1NTZ H;  4TV9 B;  1H2N A;  2QJ1 A;  1KU9 A;  1LR1 A;  5EC2 C;  2Z0A A;  3JD3 A;  1JFF A;  3CX5 F;  1FXK A;  4RQE A;  4LFC O;  1YDX A;  5LXT B;  4NTW A;  5KLV H;  2IBZ H;  3ZRV A;  4QJF B;  4LH7 A;  4DK0 A;  2ZNI A;  4E2L A;  3ZMU A;  4O4H A;  4X89 A;  2UXC O;  4J7K A;  5LGN A;  3ZHQ A;  4LF4 O;  2N05 A;  4U7N A;  2FL4 A;  4JYY A;  5CBH A;  5JCO A;  5J2U A;  1J95 A;  1VEW A;  3F5W C;  4ZKI A;  1TVK B;  3BA9 A;  2GBO A;  1YIT V;  4WBN B;  1E1Q G;  3SDL A;  4Q6G A;  4MS2 A;  4ZI7 B;  5CA3 A;  3EFF K;  3JAK A;  3SJA C;  1HNW O;  2BTO A;  1GRJ A;  1PV0 A;  2BOB C;  2JVD A;  2DQ0 A;  5K1X A;  4XDJ A;  1SES A;  1VQ9 V;  4O4J A;  3VQV A;  2FYU H;  2IJJ A;  1R73 A;  3B40 A;  1WB8 A;  4JI6 O;  4U7O A;  1OCZ C;  2HEP A;  3L73 H;  1MSW D;  2Y0P A;  1NQT A;  1GM7 A;  1Q6I A;  3CJH A;  1QLE B;  2Q68 A;  2GTA A;  2WSS G;  2P7T C;  3HKE B;  3G4S V;  2QKS A;  2IW5 A;  4LF9 O;  2ITC C;  4ZHQ B;  5KAI Z;  2R9I A;  2OYQ A;  4BAY A;  4HZ3 A;  2A79 B;  4PA9 A;  1FJG B;  3T1C A;  3ZHU A;  2VQF O;  4LC1 A;  1W2B U;  3T1H O;  1BT8 A;  4E4E A;  5CB4 A;  4IIJ B;  2YXL A;  3QO7 A;  1PL4 A;  3A0B Z;  4DR2 O;  1R3K C;  4KFM A;  4O2A B;  1Y67 A;  2P06 A;  4HYO A;  2UUA O;  2YIA A;  1XMQ B;  3OMI B;  2KKW A;  1KP3 A;  3I5D A;  4JV5 B;  1B06 A;  1N4C A;  1ROP A;  3ETQ A;  4X62 O;  1VQ4 V;  3M7M X;  1UFI A;  3CWB H;  3STZ C;  3D8C A;  4MTF A;  4GYC B;  4EKW A;  1WP7 A;  3AG7 A;  3OFN G;  3K57 A;  1JQ0 A;  1WN7 A;  2CK3 G;  1XMO O;  4DV7 B;  1SA0 A;  1IDS A;  2UUB B;  4TT3 G;  1BHA A;  4FLV A;  4N21 A;  2F66 C;  4BR6 A;  1YVW A;  3QO8 A;  4MTX A;  1XNR O;  3TK1 A;  4OX9 B;  3BRC A;  3LDC A;  4EB6 B;  5BR8 B;  3N27 A;  3C3T A;  4N23 A;  1VQ7 V;  3JD1 A;  4LP8 A;  5CBG A;  3DC6 A;  3JAT B;  4F6R A;  5IYZ B;  4LF6 B;  2IU3 A;  4WFE A;  1GAX A;  4I4T A;  4I50 A;  2QA4 V;  2YXH A;  1IUR A;  4GKK O;  1WB7 A;  5IYB O;  5EC1 C;  2P5O A;  5IWA B;  3CB2 A;  1MZF A;  1XOU A;  4TUY A;  1KKD A;  1S3J A;  5JCO C;  3JAL A;  4YHH B;  1WA8 A;  5KX5 B;  1YIJ V;  1ZL8 A;  2ZDI A;  4JI8 O;  3VQX A;  4L87 A;  2YIB D;  2PZS A;  2ZXW C;  5AG2 A;  1QVG U;  1N0N A;  3ZX6 A;  3RYF A;  1SQP H;  3RGB A;  1DF5 A;  2R72 A;  3JAS A;  2F4V B;  2WLJ A;  5F2V O;  3LNM B;  3D3Q A;  3CHX A;  1M93 A;  3ASN C;  1UJW B;  2LO1 A;  1JFF B;  2AZ0 A;  1NR1 A;  1FXK B;  2XAG A;  4JAV A;  1KD1 W;  4NB5 A;  2Q69 A;  1XNQ O;  2Q7G A;  3DTU B;  4JI0 O;  3QTC A;  4A5U B;  3OTO B;  3M99 B;  1K5Q A;  2EJR A;  2E75 B;  3L70 H;  2EZO A;  4DV2 O;  1N34 B;  1RM1 C;  4R6Z A;  1AI6 A;  2WLM A;  3T2M A;  3AG1 B;  2IH3 C;  3B2E E;  5EBL C;  5KA5 A;  5J2U B;  5KHH A;  3SYQ A;  2VQE B;  3ZRW A;  2AHZ A;  1IBM O;  2G38 A;  5IJ9 A;  1OJH A;  1Y76 A;  3CCV V;  1EN6 A;  3SGI A;  2ZXW B;  5LGU A;  1TGO A;  1VF6 A;  1YTF D;  5B5E Z;  1CPY A;  1XI1 A;  3K9A A;  3MAQ A;  4FPP A;  3APO A;  5EBW C;  4PA6 A;  5EYP B;  1R6K A;  2QM8 A;  3CP1 A;  2LW7 A;  4MVQ A;  4FZ0 A;  4O4J B;  1AJN A;  3ASN B;  2EJ7 A;  4FZ1 A;  2XAH A;  2ZIO A;  1PNK A;  5H6Q A;  2Y0I A;  4D6T H;  3CJH B;  4J42 A;  2Q5Z A;  1QBZ A;  4B7K A;  1M56 C;  3AG3 C;  3JSN A;  4P9O A;  4CBC A;  1VQ6 V;  2CTR A;  2NN4 A;  4RQF A;  1SQG A;  1F7Y A;  3JD4 A;  1NBM G;  5CB4 B;  3UCS C;  4PEL A;  1OCR B;  2UXC B;  1V54 C;  1FXV A;  4LF4 B;  1V55 B;  2RQ6 A;  4MTO A;  4PDM A;  1WPX A;  2QTS A;  2WWW A;  4I7Z B;  4CH5 A;  4XBF A;  2HJD A;  2XND G;  2XAF A;  4ASU G;  2Y4T A;  4R7C A;  4FLW A;  3HKD B;  5B1N A;  4PA3 A;  5A9G A;  1K8A W;  5ITZ A;  2UU9 O;  4RWU A;  3IJ4 A;  2D2C B;  1OCO B;  5L3B A;  4JI2 O;  3ABL B;  1TA8 A;  5IJ0 A;  1FD9 A;  1Q5O A;  2CGN A;  2HVK C;  4DR7 B;  1SA0 B;  1Y66 A;  1P7G A;  1BL8 A;  4DR4 O;  1M56 B;  2EIM B;  5GON A;  3AG3 B;  1YF2 A;  2PI5 A;  4GX5 A;  3S3W A;  1F51 A;  3EVK A;  4GX1 A;  1SQX H;  3ETE A;  2EIJ B;  4KHP B;  4DW0 A;  1DK1 A;  5L3E A;  5LMU O;  4Z1V A;  3B4S A;  5C8Y B;  4J10 A;  3FAV A;  4FM1 A;  4YJ2 A;  4LF9 B;  3DXR A;  1DF4 A;  4H0L B;  1TUB A;  2JEU A;  5JJJ B;  1XHZ A;  3LDD A;  4QE9 A;  1VF7 A;  1KKC A;  3ZMS A;  1IBL B;  1BQ0 A;  3BFR A;  2P90 A;  4DV7 O;  3T1H B;  4I4T B;  4I50 B;  2KG7 A;  2H3O A;  4DR5 O;  3E83 A;  4LH6 A;  5KUM A;  3UKM A;  1AB3 A;  2UXD O;  5EIB D;  5JVD A;  4GX0 A;  3E8F A;  4I55 A;  4TUY B;  2E5L B;  2UUA B;  3AG2 C;  5LHH A;  2LP7 A;  2XTA A;  5B1B C;  4X62 B;  1WLE A;  2QM4 A;  4IYI A;  4DYL A;  3CC7 V;  2DYR C;  3RYF B;  1VF6 C;  5IY5 C;  1KQS U;  3M8A A;  3KZI Z;  4WFH A;  1K4D C;  5DEC A;  5J9P C;  2KQX A;  4ICG A;  2QE7 G;  2FML A;  1B6Q A;  2B9Z A;  4AHC A;  2V1D A;  4LF6 O;  2ATK C;  3PN1 A;  2QR4 A;  2MK3 A;  4B3R B;  2B5U A;  4YXW G;  5LGT A;  3W7S A;  4FMT A;  2QKA A;  1JPX A;  4MVM A;  2R9R B;  5CA1 B;  2QDO A;  3G6E V;  4YHH O;  1KB9 F;  1JR9 A;  2Q7E A;  3CS5 A;  4NKG B;  5DN6 G;  3B8N A;  4TQD A;  1YCI A;  2VS0 A;  2X0L A;  4MSW C;  4QPJ A;  2GHY A;  2Y4U A;  3K04 A;  2WLN A;  1H38 A;  4KP4 A;  4PD4 F;  3ZRW B;  5KMG A;  5B1B B;  1Y76 B;  4HAM A;  4GKK B;  3K5O A;  2AHY A;  2DYR B;  2ADQ B;  2YID A;  1D2D A;  1SER A;  3ABM C;  3GWO A;  1M90 W;  3NR7 A;  1Q82 W;  3X2Q C;  4JI8 B;  2ARH A;  1EZV H;  2EZP A;  1FPO A;  5GTI Z;  3BA8 A;  3HPL C;  1EZJ A;  4TOI A;  1YXB A;  2OCC B;  4UCV A;  2RMK B;  4Z1M G;  2RDC A;  3RN4 A;  1PNM A;  5KHK A;  2OIG A;  1B04 A;  3G80 A;  3K06 A;  4QGP A;  1R3L C;  3P30 A;  2EUL A;  4BIO A;  2WLI B;  3N2K A;  1PM9 A;  1XNQ B;  1TUE B;  4D7S A;  2A9H A;  4MVZ A;  4DV2 B;  4JGS A;  4NYK A;  2PUS A;  1Y4M A;  3LSS A;  1Z2G A;  2UXB O;  2YDE A;  3H1K H;  4JYA O;  3HKC B;  4DXW A;  4X1I B;  4CC5 A;  3X2Q B;  1IBM B;  4QIW F;  4K0K O;  5L3D A;  2KB1 A;  5E1A C;  3RBZ A;  3L9D A;  3K79 A;  1K7D A;  4YJ3 A;  1Q3E A;  4OPH A;  3K08 A;  1YJN V;  1P7B A;  2PF4 E;  5LYJ A;  2XT9 A;  3LDE A;  1YTF B;  1B3Q A;  1CEZ A;  3BY6 A;  1Y74 A;  3ETG A;  1JVM A;  3SPJ A;  2DJV A;  1ZAU A;  1VQP V;  4H37 A;  3ZHS A;  1M4U A;  1CXZ B;  2EBO A;  2ZE8 A;  4DV0 O;  4WFB V;  2Y69 C;  2QWP B;  3QG5 A;  5KUK A;  3A2F A;  1SQF A;  4IHJ B;  3FAV B;  4DUY O;  4J7Z A;  4YJ2 B;  4UB6 Z;  3DXR B;  4LWS A;  1TUB B;  4X1K A;  3STL C;  3K5L A;  4CH4 A;  4G2K A;  3A8T A;  2LGQ A;  1K73 W;  2X6B A;  1H2G A;  3K3W A;  5CBF A;  2Q73 A;  1NTM H;  4DR7 O;  3ZBH A;  3JSL A;  1K3E A;  1SC5 B;  2KG7 B;  3FB7 C;  3P3N A;  3ZRS A;  4H44 B;  2RN9 A;  2F1M A;  1M5I A;  5JVD B;  3CRC A;  4I55 B;  2DYS C;  3IC9 A;  2XAJ A;  4JF3 A;  2A3Q A;  3RYH A;  4KHP O;  2ITD C;  1Q90 D;  2JGD B;  4JI4 O;  3JD0 A;  2K9P A;  2UU9 B;  2DWE C;  1ZUQ A;  4MVS A;  3E89 A;  1MG1 A;  3SYA A;  4JI2 B;  4JTC B;  4TV8 A;  3OT7 A;  4I5S A;  1GN6 A;  2VWJ A;  1XEQ A;  1IBL O;  1OCC C;  1JJ2 U;  4PJ0 Z;  1D5N A;  1W59 A;  1E79 G;  3K0D A;  1AR5 A;  1QR9 A;  3J80 N;  4LFB O;  3VOU A;  4DR4 B;  4UV9 A;  3RW0 A;  1T5E A;  3FB8 C;  2DW4 A;  2XAQ A;  1D5A A;  3T1Y O;  3FKS G;  3WB0 A;  1GN2 A;  4U3F H;  4JAS A;  3WFV A;  1N0J A;  2E5L O;  5LMU B;  2YSU B;  3AG4 C;  1L0L H; 
#chains in the Genus database with same CATH homology
 1HNZ B;  1FFX B;  2VQE B;  2CAZ C;  3K5N A;  3JAR A;  4UCO A;  5IJ9 A;  4FLU A;  4DV1 B;  4CH3 A;  4L8J A;  2Q7H A;  3SGI A;  5LP6 A;  2VQF B;  3THO A;  1TGO A;  5JQG A;  1JMK C;  5KMG B;  1XI1 A;  4DR2 B;  3MAQ A;  5ITZ B;  5EYP B;  5LOV B;  2XHB A;  4DR5 B;  3SJC C;  4O4J B;  2UXD B;  2HHH B;  5IJ0 B;  5LMN B;  4I9Q A;  4DR3 B;  2ZIO A;  3HKE A;  4DK1 A;  3K58 A;  3DSQ A;  4X1Y B;  2Q0A A;  3QF7 A;  5GON B;  4DRX B;  4ZHQ A;  4U3J B;  2RJZ A;  5CA0 B;  4X65 B;  1XMO B;  4FM2 A;  4BW9 A;  4O4I B;  2R70 A;  5D5Q A;  2BTQ B;  5J2T B;  4NXM B;  3JSN A;  4FLZ A;  4IIJ A;  4X64 B;  2PGG A;  5LA6 A;  1S5J A;  5KHG A;  1SQG A;  4B3M B;  3BPZ A;  2YI8 A;  1XNR B;  5CB4 B;  4JI3 B;  1JJO A;  3N2K B;  2UXC B;  4LNU A;  4JI5 B;  5JH7 B;  4LF4 B;  1FFX A;  4X66 B;  2RQ6 A;  3K5M A;  1XQ8 A;  3E22 B;  3UT5 B;  4CH5 A;  4JI7 B;  4FLW A;  4LF8 B;  3HKD B;  5FNV A;  1I7F A;  5ITZ A;  5EYP A;  5LOV A;  1NT2 B;  4FLY A;  1Z5V A;  4AQY B;  1TA8 A;  5BMV B;  5IJ0 A;  1Q5O A;  4DR7 B;  1SA0 B;  1G6U A;  3ZED A;  4LF7 B;  5JJE B;  4K8Z A;  4X1Y A;  3N2G A;  4TQF A;  2PY5 A;  2JGU A;  5GON A;  3UQ8 A;  4K8X A;  4EB6 A;  5LYJ B;  5CA0 A;  3RYI B;  4KHP B;  3RYC B;  1L8D A;  5C8Y B;  4O4I A;  4O4H B;  3BAB A;  5J2T A;  4UCT A;  5EZY B;  4FM1 A;  4BWA A;  3U0Z A;  4YJ2 A;  3JAT A;  5IYZ A;  4LF9 B;  4O4L A;  3WB2 A;  1XHZ A;  2JS5 A;  5JJJ B;  1TUB A;  3U10 A;  4B3S B;  4ZIB A;  5EIB C;  3RWR D;  4UCU A;  1VF7 A;  1IBL B;  4JI1 B;  2V4D A;  3BAA A;  3JAK B;  2YI9 A;  4JI0 B;  3T1H B;  2ZIN A;  4I4T B;  4I50 B;  4DR6 B;  2PTM A;  5KX5 A;  2PYL A;  5KHI A;  4LH6 A;  3UT5 A;  3ZS8 C;  5EIB D;  5JVD A;  3HKB B;  4I55 A;  4TUY B;  4ZOL A;  1Q43 A;  2E5L B;  2UUA B;  4CC6 A;  3ICX A;  3HKD A;  4LF5 B;  4UFZ A;  4X62 B;  4FLX A;  1V9P A;  2UXB B;  2QM4 A;  4JYA B;  4DV4 B;  5LP6 C;  3RYH B;  1Q8I A;  1O9G A;  3RYF B;  4TV9 B;  1SKV A;  2QJ1 A;  1KU9 A;  2E3C A;  4K0K B;  4O2B A;  1JFF A;  3BHP A;  4LFA B;  4CS2 A;  3JAW A;  4AHC A;  5LXT B;  1X4T A;  3PN1 A;  4LH7 A;  2EX3 A;  4TV8 B;  4B3R B;  1HW7 A;  4DV6 B;  4HNA B;  4DK0 A;  2ZNI A;  5C8Y A;  3U11 A;  4O4H A;  4FFB A;  5EZY A;  5CA1 B;  5JCO A;  2Q7E A;  5J2U A;  3CSX A;  4DUZ B;  1TVK B;  3BA9 A;  4WBN B;  4DV0 B;  4Q6G A;  4CS3 A;  4ZI7 B;  2IM9 A;  4KL1 A;  4TQD A;  4HBN A;  3JAK A;  4X20 B;  3RFR A;  3SJA C;  2BTO A;  5FPR A;  4DUY B;  4B3T B;  5KMG A;  2F95 B;  3JAR B;  1N32 B;  3OTF A;  4PI2 A;  2JVD A;  3SR2 C;  5K1X A;  4YY3 B;  4EFE A;  5LP6 B;  4GKK B;  3K5O A;  1HR0 B;  4O4J A;  3VQV A;  5JQG B;  4PI0 A;  4UCR A;  1Z5W A;  2P22 C;  2HEP A;  1DGS A;  4YJ3 B;  4JI8 B;  4DRX A;  4U3J A;  4FM0 A;  2OWO A;  3BA8 A;  2ZNJ A;  4UCS A;  3HKE B;  4TOI A;  4UCV A;  1QHT A;  4CH6 A;  3SJB C;  5LXT A;  3K59 A;  4JI4 B;  1I94 B;  2BTQ A;  4ZHQ B;  5KHK A;  1B04 A;  5JJN B;  2OYQ A;  1O9H A;  1FJG B;  4AIL C;  5D5P A;  4DV5 B;  5CA1 A;  5CB4 A;  4IIJ B;  5LA6 B;  3N2K A;  1QQC A;  2YXL A;  4GLX A;  5JH7 A;  4F6R B;  1XNQ B;  4D7S A;  1TVK A;  4O2A B;  4LFB B;  4WBN A;  4X1K B;  4B08 A;  4DV2 B;  2YIA A;  3E22 A;  5KHJ A;  1XMQ B;  2KKW A;  3T1Y B;  2PUS A;  4LNU B;  4JV5 B;  3VQY A;  3JAL B;  3ETQ A;  3WB1 A;  2F93 B;  3M7M X;  3HKC B;  4X1I B;  4CC5 A;  4GYC B;  1XHX A;  1IBM B;  1WNS A;  3K57 A;  1WN7 A;  5BMV A;  5FNV B;  4DV7 B;  1SA0 A;  2UUB B;  2ZIM A;  2ZM6 B;  4YJ3 A;  1Q3E A;  3JAS B;  4FLV A;  4EEQ A;  2F66 C;  4EFB A;  5LYJ A;  4FLT A;  1YEW A;  1IBK B;  3RYI A;  2PYJ A;  3N2G B;  3RYC A;  4LR3 A;  4OX9 B;  3BRC A;  1ZAU A;  4EB6 B;  2YIB A;  1N33 B;  1HNX B;  1M4U A;  5BR8 B;  1P49 A;  1J5E B;  1RSO A;  3QG5 A;  5K1P A;  3A2F A;  2R9A A;  1SQF A;  2UUC B;  4IHJ B;  3IAY A;  4LFC B;  4YJ2 B;  3JAT B;  4F6R A;  5IYZ B;  4LF6 B;  4O4L B;  4O2A A;  1TUB B;  4I4T A;  4I50 A;  4NVP A;  4X1K A;  5FPO A;  2GV9 A;  3K5L A;  4CH4 A;  1WPB A;  2P5O A;  5IJ9 B;  5IWA B;  3CB2 A;  4FVM A;  3HKB A;  4TUY A;  5JCO C;  2ZCE A;  3JAL A;  3JSL A;  4YHH B;  5KX5 B;  3HKC A;  4X1I A;  4DR1 B;  2F1M A;  1M5I A;  5JVD B;  3VQX A;  4I55 B;  4ZOL B;  2YIB D;  2PZS A;  1N36 B;  3RYH A;  3RYF A;  4TV9 A;  4DV3 B;  1HNW B;  4D7T A;  3RGB A;  2R72 A;  1TAE A;  3JAS A;  2F4V B;  2UU9 B;  3CHX A;  1M93 A;  3VQW A;  2VWK A;  3LNN A;  4JI2 B;  4CS4 A;  4GKJ B;  4TV8 A;  4O2B B;  4HNA A;  1JFF B;  2VWJ A;  4NXN B;  4JI6 B;  3JAW B;  3FFQ A;  2Q7G A;  3QTC A;  4DR4 B;  3OTO B;  1T5E A;  1N34 B;  4PHZ A;  1D5A A;  4FFB B;  3WB0 A;  4IHJ A;  4ZI7 A;  3B2E E;  5LMU B;  1H2S B;  4X20 A;  5J2U B;  1KMI Z;  5KHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...