2KKWA

Slas-micelle bound alpha-synuclein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
140
structure length
140
Chain Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-synuclein
publication title A combinatorial NMR and EPR approach for evaluating the structural ensemble of partially folded proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 39
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01387 Synuclein Synuclein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.700 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2kkwA01
1XQ8A 2KKWA
chains in the Genus database with same CATH superfamily
1GK9A 1WA8B 3H1LH 4Q20A 4W4KA 2BSKB 2DYSB 5KX5A 2W0FC 2WAMA 3F7VC 3OMAB 1G8MA 3EHBB 3GWOA 3CXCU 5IDJA 1PL0A 1VQ4V 1K5SA 1ZSPA 4MVMA 5KX5B 5KHGA 5H5NA 3CRQA 2Y4TA 3P30A 2F43G 4X1KA 4ZOLA 3LSQA 1F23A 3CX5F 1K73W 1U96A 4DK1A 1EZJA 1FFTB 3KKYA 1M90W 2WPDG 4X1KB 4ZOLB 1KQSU 2GTAA 3CE2A 4X9QA 1YSCA 3ZN1A 3K5LA 4H0LB 4O2AB 2V7QG 3O65A 2YEVA 3D8CA 4IYHA 3G6EV 1I94O 4UVAA 4GX5A 3ASOB 2PTMA 1GN6A 2DW4A 3A0RA 3ABMC 2VQEB 1Q90D 2AXTZ 2OT5A 4HYOA 4X65O 4YY3O 1N0JA 1PM9A 4NTYA 4LBEC 3HR0A 3JAKB 3QO7A 4LF6O 3K06A 5LYJA 1Y4MA 4H33A 3BVOA 3STZC 4JYBA 3FX7A 5IY5B 2ILMA 2UXBO 1XMOB 2ZDIC 4B3RB 1MNGA 1R1BA 2YXYA 1H2SB 5LYJB 4QE7A 4XDLA 3ZHRA 3T1CA 1HNXO 3AG1B 1VF5B 2Q9LA 1ZL8A 1YVWA 3OTFA 1COWG 4O4JA 4TOIA 4PDMA 3DTUB 1B06A 4DYLA 5LMUB 1I7FA 4JI6B 2AHZA 1ZL8B 3CHXA 3JASA 2WSSG 1HNWO 4O4JB 1J5EB 5L3BA 1CP9A 2KSDA 2AW9A 1AILA 4B3MO 1OCZC 2CAZC 5KAIZ 1E1RG 1K5QA 5FL7G 2YXLA 2FB5A 1CXZB 3LDCA 4JI5O 3D36A 3DXRA 3ZHVA 3JASB 1P49A 3ABLB 4WFAV 2WA3A 3OEEG 4JAAA 1RPRA 1O9GA 4LH6A 5KHHA 2DYRC 4JYCA 3B8MA 1FFXA 2IH3C 3CC7V 4DR5B 3BEHA 1YJ9V 1HNZO 4CBCA 3EXAA 1SQGA 2CTQA 1EZVH 4K0KO 1EBOA 4B3SO 1KD1W 3BPZA 4X66B 2Y0PA 1FFXB 2KKWA 4Z2WA 1MZFA 3LDDA 1M56C 1JFFB 2Y69C 2MW2B 1VF7A 3ZMSA 2DJVA 3SPGA 1B04A 1RFYA 1V55C 4GKKO 4O2BB 3T1HO 2PI5A 4UFZA 4D6TH 3JD2A 1BGYH 1XOUA 4DW1A 2CGOA 5K1PA 1XEQA 3MDSA 2LP7A 2R70A 4DR7B 4JI7O 4J7KA 2WLLA 4DR4O 1NVPD 4BIOA 2KB1A 1PV0A 2HVKC 3W7SA 4TV8A 4D7SA 4GLXA 4LF9B 2P90A 4I0XA 1QHTA 2Q69A 3CXHF 1WB7A 4TV8B 1FD9A 3E89A 2WLMA 3B40A 4YHHO 4B7EA 3RYFA 4JZ2A 2EILC 5BXZA 4IIJA 4NTXA 3OW2U 4CS4A 3C3SA 5IJ0A 2ZM6O 1S5LZ 1SA0A 3K08A 3P3PA 1BQZA 5CA0A 3ZHUA 3RYFB 2ZR3A 2QSAA 2A7WA 2FMLA 2JDIG 4IIJB 1S3JA 2F66C 4LNUB 3ABKB 3OR7C 4F6RA 2LW1A 5IJ0B 1SA0B 2RNBA 5H6RA 2NR5A 3ABUA 3MHHC 5JJEB 5TISZ 4DO2A 4B08A 3TGUH 4DV4O 1NQTA 3JYCA 1IURA 1G6UA 2UUCB 3AG3C 4E2LA 4F6RB 4X8AA 2UU9B 2EJRA 4TUYA 5IYCO 1R6TA 4DV3B 4CH5A 4ASUG 1QR9A 3HKEA 2QWNB 3OFNG 4GKJO 1GN4A 1TUEB 3RT3C 1SQQH 3LUTB 4LF5B 4K35A 3AEIA 5EK0A 4JI3B 1O9HA 2Q7EA 5CBHA 4JPRA 2GDSA 1XL6A 3UO3A 4J41A 4EKWA 1VF6A 4O4HA 3APQA 4PA7A 5J2UA 1N34O 1XMQB 3ZHQA 2Q7HA 4DR2B 5A9GA 2HKOA 2IJKA 2IJIA 2EINC 4IHJA 3PN1A 1AJNA 3RW0A 4DUYO 1OZ0A 2QM8A 2PUSA 1HR0B 4MTFA 1KBHA 5JJJB 3IGAC 3CEIA 3E8HA 2YSUB 5BY1A 1VP7A 3L70H 1NVPB 1MZEA 1JR9A 2Q8VA 3N2GB 2AZ0A 4LF7O 2N05A 4X1IB 5LHGA 1VQ6V 2EIKC 1LNQA 5DM6V 1AVMA 1OHHG 2IM9A 3C90A 2A0LA 4WFGA 2WA4A 3RFRA 1BHBA 2NN4A 2BE3A 1TA8A 3ZMVA 2Q67A 1Q3EA 3DSQA 4NR1A 2HR3A 5EBWC 4UCUA 3OMNB 4UCRA 3JAWA 1J95A 3JALA 1YJWV 2CTWA 1R3KC 3VBBA 1FXKA 2EIMC 4YJ3A 4FFKA 3JAWB 1KC8W 3JALB 1BMFG 1F7YA 5CBGA 1PNLA 2ZXWB 4TWKA 1KKCA 3VOUA 4YJ3B 3FYEB 1JPXA 2NLJC 3UKMA 2UXXA 4BAYA 1IX9A 4K8ZA 3JCZA 2A9HA 5ITZA 1R6NA 2HG5C 3QVNA 1QCEA 1OCRC 3W7XA 2ZCEA 2EJ7A 2QDOA 1GTOA 5CB4B 5B1AC 5JQGB 2P7TC 3BAAA 5EC1C 3OD4A 3RGBA 3CB2A 3DC5A 4NXNB 1XNRO 1G4YB 3KG2A 4J10A 4ZI7A 4MW8A 4HZ3A 3D3IA 3T1YO 4JTAB 5LP6A 4ZIBA 1P7BA 4DR3O 1W2BU 4HBNA 4B3TO 4AI8A 2OYQA 1ZLZA 2C2AA 1PL4A 2JGDA 1R3JC 5EIBD 5DEDA 4OGQB 2ZE8A 4FLXA 2DYSC 4CS3A 4DV1B 1BHAA 1US6A 1IBLB 4QGPA 3ZIAG 4I55A 3KCYA 4DV5B 4MT8A 2JGDB 4WFHA 3CSXA 1TAEA 3ZS8C 5EBLC 4RUEA 3MAQA 1FS0G 4LFCB 4GX1A 4QPJA 4GX2A 3JD4A 4I55B 5FPRA 1Y76B 1EM1A 1SZXA 4JYYA 5KA6A 4WF9V 1K7DA 4WFEA 2QM7A 2DE0X 2UXDO 4F4LA 5CMUA 4NB5A 4DV6O 1I5XA 4KHPO 1JVMA 4O4IA 4DV2B 1BL8A 4FK5C 4ZHQA 4U3FH 3C3TA 2A3QA 4H44B 4OXSA 4O4IB 2HJFC 3SPHA 2M7WA 2ZKOA 3JD3A 3F7YC 1PNKA 1SZTA 2H8PC 3ASOC 1KB9F 4JTCB 4JI1O 4ZHQB 1YEWA 3W7WA 4UVCA 4RQFA 1WJZA 3CC4V 4PA3A 3A8TA 2JS5A 1N4CA 2PYLA 1WAZA 4K3AA 2QTOA 4Z1MG 4JASA 4LWSA 2BTOA 3CJHA 5IY5C 1N33B 1WB8A 5D5PA 2JJ1G 4RO2A 4OPAA 2QR4A 3OMIB 2DWEC 2LGWA 2HVJC 3AG1C 1AJPA 4DV0B 4LWSB 3CJHB 4ICGA 3CRCA 5H9CA 4X62O 1XMOO 2JJ2G 3M7MX 5FLXN 1IXBA 2QWQB 1OJHA 3SR2C 5BMVA 1NZ6A 3GWKC 4AQYB 4DR6B 3HPLC 4DR1B 4DUZO 2P5OA 4KFMA 1M1KW 2EIJB 3CCSV 1W0JG 3L74H 4DV7B 4JYAO 5BMVB 1FKAO 2PI4A 2YIBA 3LNNA 4X64B 2GUZA 1H2LA 2WLNA 3ABLC 5EYPA 4I9WA 2BOBC 4UCVA 3RYHA 4FFBA 4MVRA 4HAMA 4FMTA 2OCCB 4UB8Z 4HNAA 4LFAB 3X2QB 4NKGB 1VQ8V 3OE7G 3D36C 2GUZB 1KKDA 5EYPB 4MVSA 2OIEA 4PA9A 1NR7A 4FFBB 3E8FA 1HWYA 2W6IG 3CYOA 1QR8A 1ORQC 4HNAB 3U10A 3JARA 4PDVA 3ZMZA 5EZYA 4TV9A 4QE9A 2Q0AA 4GZRB 4LF4O 2W6JG 2UXNA 1FYJA 3QO5A 2QKCA 3QTCA 4UXNA 2RQ6A 4EEQA 3K5NA 3JARB 5EZYB 1IBKO 2OTLV 1ZAUA 1JCHA 2DOSA 1K97A 2ARHA 1JQ0A 3W7TA 1SETA 5LHIA 1R6KA 1GM8A 2DMXA 3BCCH 2VQFB 4FM0A 4UCSA 3ABTA 3G71V 5LMNB 2E5LB 1VARA 2P6JA 2UUAO 1BT8A 2YEVB 2ITCC 2IU3A 3FD9A 2JIZG 5LGTA 1DLBA 4JI8B 3RVYA 1H2GA 1S77D 2VWKA 3SPCA 1LUWA 3H1JH 2GHYA 2ZIMA 5JH7A 1IDSA 1XREA 3AG2B 4JTDB 2QTSA 2UXCB 3JD0A 2LO1A 1BSMA 2QJ1A 1VQPV 5BR8B 3HB3B 2QWRB 3OT7A 3FAVA 1V54B 1X59A 1S5HC 1L8DA 4UB6Z 5J2TA 2XHBA 4LH7A 2XNDG 3WB2A 4RUFA 5F2VO 3BY6A 2JS3A 1Q6UA 3FAVB 3HKCA 3TJTA 2CTPA 4P2ZA 3ABKC 1Q81W 2Q4PA 5J2TB 3TCUA 3K57A 1Q86W 1FXVA 2VRZA 4FLUA 1GN2A 2JK5C 1K3EA 1XI1A 1FJGO 2Z5UA 1Q82W 1VMGA 3DXRB 4AHCA 1AJQA 3JSNA 5L3GA 1VQ5V 2B9ZA 4D7TA 1IZ3A 2YI9A 1OCCB 4DV3O 1GM7A 2QWOB 3M99B 5B3SB 3KZIZ 1GM9A 5C8YA 1MG1A 5LGNA 4LF5O 3SPJA 1G1XB 4I5SA 1F4MA 5LGUA 2ZT9B 2YS8A 3STLC 1DTOA 4FLVA 3L75H 3E8BA 1VF6C 5C8YB 1XMQO 1SESA 4GCZA 1N36O 3OGIB 1X4TA 2F93B 2IH1C 5IWAB 1SQPH 4FLZA 1YIJV 1AI7A 4NVPA 5IYDO 1VQKV 3FB6C 4BR6A 2AGAA 4I7ZB 1HR0O 2QEXV 5EBMC 1I94B 4FM2A 3ZCCA 1N32B 1KU9A 3L73H 3CCQV 2RN9A 3CWBH 1Q6IA 2WWWA 4LF8O 4X65B 4YY3B 1XL4A 4B7KA 2WLLB 4YIPA 2N74A 1AB3A 3K79A 3T4ZA 1Z5VA 3SYCA 4PI0A 3CCLV 1YXBA 2Y4UA 2Q73A 3TXQA 4TQFA 5L3EA 3HKDA 1GKFA 5LBQA 2L35A 3K04A 5FNVA 3N27A 1XNQB 3R65A 3OTOO 2ZDIA 1UFIA 4I0XB 4NXMB 2UXBB 1UJWB 1W0KG 5LHHA 2CDYA 2R9AA 4QIWF 1Y74A 2HJDA 2ZR2A 4J11A 1HNXB 4IGGA 5FNVB 3B2EE 3IFXA 2WLIA 4J9ZB 4PI2A 2B1GA 4YIOA 4BIZA 5KUKA 5B1BB 1H2MA 4XBFA 5KAFZ 3IAYA 1Y74B 2ZE7A 5IT9N 3UO2A 2RMKB 1HNWB 1ENVA 3E22A 2WLIB 1YHQV 5CA0B 2ZXWC 4L8JA 2W0XA 4B3MB 4JI5B 3K58A 3RN4A 4J42A 3JCUZ 3E22B 4FPPA 2UUBO 5H6QA 5CA1A 1HNZB 2QWPB 1TUBA 3D3QA 3JD1A 4TUYB 2YIDA 3ASNB 4K0KB 4JAVA 4B3SB 1M9NA 3HKEB 4OX9O 3TK1A 1YF2A 5CA1B 2PY5A 1PD3A 1QLEB 5C93A 1U97A 2P06A 1I08A 2ADQB 2VS0A 1ZX3A 2F4VO 1H8HG 3K0GA 4UCOA 4O4HB 1JX9A 5J2UB 3T1HB 4P9PA 1GO3F 4IHJB 2CH7A 2V1DA 3DC6A 4PD4F 4I9QA 5LXTA 1ZWIC 3L9DA 2YUAA 2X6BA 1KECA 1D5AA 4BIUA 4JI2B 4DV1O 4JI7B 3CCVV 4DR4B 1P84F 4UV9A 5GTIZ 4RQEA 4JF3A 2PGGA 3CCJV 2CH7B 3CCEV 2WLKA 2P4VA 4P9OA 3ZMTA 5LXTB 2E74B 5KA5A 1ZUQA 1IVSA 2Y48A 1CEZA 1JA8A 1VQMV 2P67A 1S72V 1MMMA 2QE7G 1MSWD 1M93A 5E79Z 3ZEDA 2CE4A 1RP3B 4EB6A 3QNEA 3WG7B 3H1HH 1AR5A 4YHHB 1CPYA 1GRJA 1NTKH 1OV9A 3WB0A 3EFFK 3J80N 4EB6B 4JI0O 4XDKA 5KMGA 2ZM6B 2QA4V 2HFEC 1SS3A 2EILB 3G4SV 3RVZA 2L6LA 3RBZA 2DQ3A 1K4CC 3RYCA 1FXKB 1Q5OA 4UUJC 5KMGB 1NJIW 3K0DA 4W4LA 3P3NA 4DV4B 2JEXA 1FXHA 4PDLA 1B3QA 2NNUA 4YJ2A 3RYCB 3ZRXA 5B1OA 1B6QA 4J80A 3FB5C 1XHXA 3G80A 1LUVA 1VIBA 1RPOA 1YCIA 5ITZB 1XBLA 4KP4A 2RJZA 2YI8A 4YJ2B 5GONA 2B5UA 4YXWG 2A79B 3BHPA 1Y66A 2AHYA 3FYIB 4DV0O 4FLWA 1IBMO 2ZQMA 5GONB 2EIJC 4GT1A 5EIBC 4LFBB 1S0VA 4JV5O 3CCUV 3ETEA 1MSDA 4AQYO 4DR6O 1PKXA 4ZI7B 3H1KH 3N2KA 1SQBH 2XOKG 5LP6B 1TGOA 1BZKA 1I5YA 2KG7A 1Y67A 2H3OA 2DWDC 2OCCC 1MOFA 3X2QC 1EN5A 4LF7B 4U7OA 3N2KB 3I55V 3E83A 1NBMG 3CS5A 2FKXA 1FPOA 2KG7B 1YZBA 2YIBD 2D3OW 2XAGA 3ZX6A 4LFAO 2M6YA 4CH3A 5K1XA 2JEUA 1R73A 1RM1B 2Y0IA 4JI4B 1H8EG 1NH2D 1N8RW 1BQ0A 2YICA 4BW5A 3K3WA 4FJCC 3OR6C 5KLVH 1P7GA 1AR1B 4G28B 1DF4A 5CBFA 2R72A 1JMKC 1M4UA 4PJ0Z 3IC9A 2Q6AA 2DN9A 1KMIZ 3IJ4A 3OUFA 3SJQC 5B66Z 3SGIA 5J9PC 2XASA 1MABG 2Q7GA 3E8GA 2OTJV 5B5EZ 1AP6A 2Z0AA 2EZOA 4MS2A 5LMNO 3ZHTA 2EBOA 2HHHB 5HFLA 2VQEO 4MW3A 1XILA 1H2KA 3UQ8A 1QLNA 3CD6V 4U3JA 4JI8O 2XAQA 4DW0A 3SDLA 3AG2C 4KUMA 3AK3A 3K59A 1GH6A 1SQVH 1DGSA 3RYIA 4R7CA 4U3JB 3L72H 3S3WA 1V54C 4B3RO 2KQXA 1K33A 3MD0A 1E1QG 3CMAV 3THOA 4CZZA 4DK0A 2LFRA 2LW7A 3RYIB 2RDCA 4X89A 4TSFG 1QQCA 1YJNV 1BE3H 3U11A 1XNRB 1PNMA 2X6AA 5LMUO 4JI6O 2R9IA 1QNMA 1Y6XA 1YDXA 4FIPC 4JZGA 1OCOB 3U0ZA 1WA8A 4RAIA 1J5EO 2MK3A 4B3TB 4G2KA 3CMEV 1Z5WA 2EZPA 3NXSA 2HLDG 5KHJA 2OWOA 1NTZH 2O57A 3BA9A 3NR7A 3RYHB 4F6EA 1NH2B 3ML0A 1TVKA 5IJ9A 2IU0A 4DR5O 4WFBV 1OCCC 1Q6HA 4CC5A 3JSLA 4G27B 2EX3A 1L1FA 2P22C 5GW7A 5B1NA 5B3SC 2X7RB 3CP1A 4FLYA 1KP3A 1TVKB 5IJ9B 3IC7A 4X66O 2UXDB 2LGQA 4FZ0A 4PHZA 4DV6B 4PA6A 2ZE6A 4TV9B 3CCMV 1H38A 4KHPB 5L3DA 3W7UA 2YDEA 1XUQA 1H2NA 4O2AA 4DRXA 1QBZA 2PYJA 1AI6A 2ETNA 2GV9A 4I50A 5JCOA 5IWAO 3K5OA 4UVBA 4MVUA 3UM7A 1ZTEA 3VQWA 4MVOA 4JI1B 1NS1A 3M8AA 5L3CA 3A0BZ 4DRXB 4N23A 4DR7O 1WLEA 3ZN0A 2LFSA 4I50B 1N32O 4KL1A 3T2MA 4WBNA 3JAKA 1NTMH 3ETGA 1AP5A 4LC1A 3JAMN 2OIGA 2LQTA 2BTQA 5JVDA 4LF9O 1PPJH 2F23A 4J7JA 1L0NH 2FL4A 4WBNB 1W59A 5JH7B 4C7UA 3B77A 2BTQB 1HW7A 1XNQO 4O4LA 1E79G 5JVDB 1WPXA 2R9RB 3FB7C 4X62B 1JJ2U 4NXMO 3G67A 3APOA 1A32A 4UV8A 3SYQA 1KYOF 1URFA 5B1BC 2ADPA 3BA8A 4OPHA 3B8NA 3OM3B 1JOYA 3S3XA 4O4LB 4K8XA 4MVZA 4DUZB 3AG4B 1ROPA 3H1IH 2YXHA 4X88A 5JJNB 4JYAB 2XTAA 3HKCB 3WU2Z 4EFEA 1M57B 2A06H 1SRYA 1GN3A 3OAAG 4DXWA 2ZNJA 1THZA 4FLTA 3ZRSA 2UUCO 1K9MW 3R66A 2UU9O 4NYKA 4CH4A 3QF7A 3I56V 1R3IC 4IL6Z 2N04A 4J9YB 3ASNC 3FB8C 2XUMA 2E76B 1JFFA 4LF4B 3SJAC 3GVMA 4JI3O 1QLEC 4PDRA 3LSUA 3QG5A 2B1IA 4A5UB 5LA6A 3WFVA 2Q5ZA 5HFMA 1IBKB 4DR2O 4O2BA 1SQFA 4J7ZA 1P4RA 1K34A 3LNMB 4L87A 4CC6A 5LA6B 2ODMA 3ZMUA 2UUAB 3UT5A 4ABMA 1NKDA 3ZRWA 3WB1A 4QNHB 2QKAA 4JI2O 3ABMB 4LF6B 1UPGA 1YITV 1K8AW 3T4DA 3UT5B 2CK3G 2V4DA 2WLHA 4N21A 3ZRWB 4BWAA 3G6BA 1D5NA 3ICXA 5IE9A 3WG7C 2CUGA 1K92A 2F1MA 3HKDB 1Z2GA 2QM4A 1JJOA 3OGCC 3RWRD 1I0HA 2HEPA 4LP8A 4LNUA 3P32A 1R3LC 1AROP 3L71H 1QVGU 1FXKC 1AI5A 1D2DA 5LOVA 1SC5B 2GBOA 3LSSA 2ITDC 2F95B 1WP7A 4FZ1A 2XAFA 5BZBA 1OCZB 4FVMA 1FJGB 2XT9A 1SF9A 1Q8IA 5LOVB 5D5QA 4U7NA 2ZINA 3CCRV 2DYRB 3B4SA 3O9OA 4EFBA 2E75B 2RCVA 3H01A 4IT5A 2AZ2A 2Q0OC 2HP8A 4GYCB 2XAHA 1TUBB 3H9VA 4TQDA 5CN0A 3A0HZ 4UCTA 5E1AC 1HP8A 1WN7A 1M56B 4BW9A 5KHIA 4NXNO 3TXSA 2IJHA 2Y69B 4GKKB 4FM1A 3E86A 1NU1H 3SYAA 1T5EA 4TT3G 2BCCH 5LP6C 1N36B 4LFBO 3E2EA 2XAJA 4LR3A 1GAXA 1BS3A 1V55B 3N2GA 4X1IA 3SYPA 1WPBA 1IBLO 5IYBO 3CRRA 4DV5O 3I5DA 4MSWC 4PA4A 3E35A 1F4NA 4MTGA 3AK1A 4LF8B 5IYZA 3ETQA 1RM1C 3CC2V 4JAUA 4LFCO 2ZE5A 3VQXA 3BFRA 2FTKA 3FKSG 1QVFU 1KUQA 1AI4A 5IYZB 4JI4O 2H94A 1FAFA 1S5JA 5AG2A 3OTOB 3KCXA 5FPOA 4DV2O 4PV1B 3J7AU 2E3CA 3BABA 2D2CB 2QKSA 1NI8A 4Z1VA 4H13B 1K4DC 5KUMA 4R8CA 2P4KA 4X1YA 2IJJA 3OEHG 4ZKIA 1BCCH 2K1EA 3ETDA 1VEWA 4NTWA 4MVQA 5CA3A 1XDCA 1EN6A 3JATA 2PZSA 4X1YB 1VQOV 4E4EA 4GX0A 2HHHO 5A2QN 4I4TA 3LDEA 3K9SA 1VQ7V 3OUSA 2IBZH 2UUBB 3AG3B 1N0NA 4QJFB 1N33O 5GTHZ 3JATB 1Q43A 4GKJB 5CB4A 1Q7YW 1YTFD 2ZIOA 4I4TB 5JQGA 2K9PA 2FYUH 1L0LH 2X0LA 1HDJA 2BOCC 2CGNA 4LCUC 4ZBMA 4CH6A 4OX9B 5L3FA 1N34B 1VQNV 3BRCA 4PELA 1DF5A 4H37A 5EC2C 3GB7C 4CS2A 3Q4HA 4R6ZA 4DR1O 2F4VB 2QGNA 2YIAA 1OCOC 3PJSK 4XDJA 4DUYB 4DV7O 2JRIA 3B09A 2EINB 3K9AA 4WCEV 3AK2A 4X64O 3Q4HB 1IXMA 3SYOA 5DN6G 3SPIA 2ZNIA 3SJBC 1V9PA 2GSMB 2LJ2A 1SKVA 2EIKB 1Y76A 3AG7A 3CPWU 2GTSA 1WP8A 2CTRA 3EVKA 4MTOA 2JVDA 1NT2B 1GMGA 3HKBA 5KHKA 2IW5A 1F51A 1LR1A 1VQLV 1WNSA 4MTXA 1QU7A 3VQYA 1M5IA 3ZHSA 3HKBB 3ZBHA 3QO8A 4WFFA 4X20A 2Q68A 2Z3YA 5DECA 3ZJZA 5H2FZ 2JGUA 3K5MA 4QPKA 1MA1A 1EN4A 3UCSC 1XQ8A 2PF4E 3DGEA 4X20B 4JI0B 1PP9H 1VQ9V 4P30A 3F5WC 2VQFO 3SJCC 3A2FA 2E5LO 2EIMB 3CRMA 5JCOC 4IYIA 1S76D 3ZRVA 4JGSA 1XHZA 4RWUA 4AILC 3VQVA 4KXRA 1YTFB 2DQ0A 5LL6Y 3F5TA 2ZD9A 2UXCO 1RSOA 1DK1A 2OCHA 2ATKC 2YC0A 1AR4A 5BR8O 1YI2V 1OCRB 2EULA 1EFRG 5B1AB 4GUNA 1SQXH 5JWPA 1RSOB 4Q6GA 4R50A 3MHSC 3FFQA 3T1YB 1IBMB 2X6CA 3AG4C 3CRAA 2G38A 4DR3B 1NR1A 4JV5B 3K03A 3J81N 1SERA 2VWJA 2BSKA 3TETA 1M57C 2WLJA 1KP2A
chains in the Genus database with same CATH topology
4B3SB 4CH4A 4ZI7A 3QF7A 3HKEB 5LP6A 4ZIBA 5CA1B 2PY5A 4HBNA 5KX5A 2OYQA 4UCOA 5EIBD 1JFFA 4LF4B 3SJAC 4FLXA 4CS3A 4DV1B 1IBLB 4O4HB 3QG5A 5J2UB 4I55A 4DV5B 5KX5B 5KHGA 3T1HB 5LA6A 3CSXA 1IBKB 1TAEA 4IHJB 3ZS8C 3MAQA 4O2BA 1SQFA 4LFCB 4I9QA 4X1KA 4ZOLA 5FPRA 4I55B 5LXTA 1D5AA 4JI2B 4DK1A 4JI7B 4CC6A 5LA6B 4DR4B 2PGGA 4X1KB 4ZOLB 2UUAB 5LXTB 3UT5A 3K5LA 4O4IA 3WB1A 4DV2B 4O2AB 4ZHQA 4LF6B 1M93A 3ZEDA 2PTMA 3UT5B 4EB6A 2V4DA 4O4IB 4YHHB 2VQEB 4BWAA 4K0KB 3ICXA 4ZHQB 1YEWA 3WB0A 2F1MA 3HKDB 4EB6B 5KMGA 3JAKB 2ZM6B 5LYJA 2JS5A 2QM4A 2PYLA 1JJOA 3RWRD 1XMOB 2HEPA 3RYCA 4B3RB 1Q5OA 5KMGB 4LNUA 1H2SB 2BTOA 5LYJB 1N33B 5D5PA 3OTFA 4O4JA 4DV4B 4TOIA 5LOVA 4YJ2A 3RYCB 2F95B 4DV0B 5LMUB 1I7FA 4JI6B 3CHXA 3JASA 3M7MX 4FVMA 1FJGB 1XHXA 4O4JB 1J5EB 3SR2C 5ITZB 5BMVA 1Q8IA 5LOVB 2RJZA 2YI8A 4YJ2B 5D5QA 5GONA 4AQYB 4DR6B 2CAZC 2ZINA 4DR1B 2P5OA 2YXLA 3BHPA 4EFBA 3JASB 1P49A 4DV7B 4LH6A 1O9GA 5BMVB 5KHHA 4FLWA 2YIBA 5GONB 3LNNA 4X64B 4GYCB 5EIBC 4LFBB 5EYPA 1TUBB 1FFXA 4TQDA 4UCVA 3RYHA 4UCTA 4DR5B 4FFBA 4ZI7B 1SQGA 3N2KA 1WN7A 4HNAA 4LFAB 4BW9A 5LP6B 5KHIA 1TGOA 5EYPB 3BPZA 4X66B 4FM1A 4GKKB 1FFXB 2KKWA 4FFBB 1T5EA 5LP6C 1N36B 4LF7B 1JFFB 3N2KB 4LR3A 4HNAB 3U10A 3JARA 5EZYA 4TV9A 3N2GA 2Q0AA 1VF7A 2YIBD 4X1IA 1WPBA 4CH3A 5K1XA 3QTCA 1B04A 2RQ6A 4JI4B 4O2BB 4EEQA 4UFZA 3K5NA 3JARB 5EZYB 4LF8B 5IYZA 3ETQA 1ZAUA 5K1PA 2R70A 3VQXA 2R72A 1JMKC 1M4UA 4DR7B 2VQFB 4FM0A 4UCSA 5IYZB 5LMNB 1S5JA 2E5LB 3OTOB 4TV8A 1KMIZ 5FPOA 4D7SA 3BABA 2E3CA 3SGIA 4GLXA 4LF9B 4JI8B 2Q7GA 1QHTA 2VWKA 4TV8B 2HHHB 4X1YA 2ZIMA 3RYFA 5JH7A 2UXCB 4IIJA 3UQ8A 4CS4A 4U3JA 2QJ1A 5BR8B 5IJ0A 1SA0A 3K59A 3JATA 2PZSA 4X1YB 5CA0A 3RYFB 1L8DA 5J2TA 1DGSA 3RYIA 4IIJB 2XHBA 2F66C 4LH7A 4LNUB 3WB2A 4I4TA 4U3JB 4F6RA 5IJ0B 2UUBB 1SA0B 3HKCA 3JATB 3THOA 5JJEB 1Q43A 4DK0A 4B08A 4GKJB 5CB4A 5J2TB 3RYIB 3K57A 1G6UA 2ZIOA 4I4TB 2UUCB 5JQGA 1QQCA 3U11A 4F6RB 4FLUA 1XNRB 2UU9B 4CH6A 4TUYA 4OX9B 4DV3B 1XI1A 3U0ZA 1N34B 4CH5A 3BRCA 4B3TB 3HKEA 1Z5WA 4CS2A 4AHCA 2F4VB 2YIAA 3JSNA 5KHJA 4LF5B 4DUYB 2OWOA 4JI3B 1O9HA 2Q7EA 4D7TA 3BA9A 2YI9A 3RYHB 4O4HA 5J2UA 1XMQB 2Q7HA 4DR2B 1TVKA 5IJ9A 2ZNIA 5C8YA 4IHJA 3PN1A 3SJBC 4CC5A 3JSLA 1V9PA 2EX3A 2P22C 2PUSA 1HR0B 1SKVA 5JJJB 4FLYA 1TVKB 5IJ9B 2UXDB 4FLVA 4PHZA 4DV6B 2JVDA 4TV9B 4KHPB 3N2GB 1NT2B 3HKBA 5C8YB 5KHKA 1X4TA 2F93B 4X1IB 5IWAB 4FLZA 4NVPA 1WNSA 3VQYA 4O2AA 1M5IA 1I94B 4FM2A 2IM9A 3HKBB 4DRXA 1N32B 1KU9A 4X20A 2PYJA 3RFRA 2GV9A 5JCOA 4I50A 3K5OA 4X65B 4YY3B 3VQWA 4JI1B 2JGUA 3K5MA 1TA8A 4DRXB 1Q3EA 1Z5VA 4PI0A 1XQ8A 3DSQA 4X20B 4JI0B 4TQFA 4I50B 3SJCC 4KL1A 3HKDA 4UCUA 4UCRA 5FNVA 3JAKA 4WBNA 3A2FA 1XNQB 3JAWA 4NXMB 2UXBB 3JALA 5JCOC 2BTQA 2R9AA 5JVDA 1HNXB 4YJ3A 1XHZA 5FNVB 3B2EE 4WBNB 4AILC 3JAWB 4PI2A 3VQVA 3JALB 5JH7B 2BTQB 1HW7A 4O4LA 5JVDB 3IAYA 4X62B 4YJ3B 1RSOA 1HNWB 3E22A 5CA0B 3BA8A 4L8JA 4B3MB 4O4LB 4K8ZA 4K8XA 5ITZA 4DUZB 4JI5B 3K58A 4Q6GA 5JJNB 2ZCEA 4JYAB 3E22B 3HKCB 3FFQA 3T1YB 4EFEA 1IBMB 5CB4B 4DR3B 4JV5B 5JQGB 3BAAA 2ZNJA 2VWJA 5CA1A 3RGBA 4FLTA 1HNZB 3CB2A 1TUBA 4TUYB 4NXNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XQ8 A;  2KKW A; 
#chains in the Genus database with same CATH topology
 1GK9 A;  1WA8 B;  3H1L H;  4Q20 A;  4W4K A;  2BSK B;  2DYS B;  5KX5 A;  2W0F C;  2WAM A;  3F7V C;  3OMA B;  1G8M A;  3EHB B;  3GWO A;  3CXC U;  5IDJ A;  1PL0 A;  1VQ4 V;  1K5S A;  1ZSP A;  4MVM A;  5KX5 B;  5KHG A;  5H5N A;  3CRQ A;  2Y4T A;  3P30 A;  2F43 G;  4X1K A;  4ZOL A;  3LSQ A;  1F23 A;  3CX5 F;  1K73 W;  1U96 A;  4DK1 A;  1EZJ A;  1FFT B;  3KKY A;  1M90 W;  2WPD G;  4X1K B;  4ZOL B;  1KQS U;  2GTA A;  3CE2 A;  4X9Q A;  1YSC A;  3ZN1 A;  3K5L A;  4H0L B;  4O2A B;  2V7Q G;  3O65 A;  2YEV A;  3D8C A;  4IYH A;  3G6E V;  1I94 O;  4UVA A;  4GX5 A;  3ASO B;  2PTM A;  1GN6 A;  2DW4 A;  3A0R A;  3ABM C;  2VQE B;  1Q90 D;  2AXT Z;  2OT5 A;  4HYO A;  4X65 O;  4YY3 O;  1N0J A;  1PM9 A;  4NTY A;  4LBE C;  3HR0 A;  3JAK B;  3QO7 A;  4LF6 O;  3K06 A;  5LYJ A;  1Y4M A;  4H33 A;  3BVO A;  3STZ C;  4JYB A;  3FX7 A;  5IY5 B;  2ILM A;  2UXB O;  1XMO B;  2ZDI C;  4B3R B;  1MNG A;  1R1B A;  2YXY A;  1H2S B;  5LYJ B;  4QE7 A;  4XDL A;  3ZHR A;  3T1C A;  1HNX O;  3AG1 B;  1VF5 B;  2Q9L A;  1ZL8 A;  1YVW A;  3OTF A;  1COW G;  4O4J A;  4TOI A;  4PDM A;  3DTU B;  1B06 A;  4DYL A;  5LMU B;  1I7F A;  4JI6 B;  2AHZ A;  1ZL8 B;  3CHX A;  3JAS A;  2WSS G;  1HNW O;  4O4J B;  1J5E B;  5L3B A;  1CP9 A;  2KSD A;  2AW9 A;  1AIL A;  4B3M O;  1OCZ C;  2CAZ C;  5KAI Z;  1E1R G;  1K5Q A;  5FL7 G;  2YXL A;  2FB5 A;  1CXZ B;  3LDC A;  4JI5 O;  3D36 A;  3DXR A;  3ZHV A;  3JAS B;  1P49 A;  3ABL B;  4WFA V;  2WA3 A;  3OEE G;  4JAA A;  1RPR A;  1O9G A;  4LH6 A;  5KHH A;  2DYR C;  4JYC A;  3B8M A;  1FFX A;  2IH3 C;  3CC7 V;  4DR5 B;  3BEH A;  1YJ9 V;  1HNZ O;  4CBC A;  3EXA A;  1SQG A;  2CTQ A;  1EZV H;  4K0K O;  1EBO A;  4B3S O;  1KD1 W;  3BPZ A;  4X66 B;  2Y0P A;  1FFX B;  2KKW A;  4Z2W A;  1MZF A;  3LDD A;  1M56 C;  1JFF B;  2Y69 C;  2MW2 B;  1VF7 A;  3ZMS A;  2DJV A;  3SPG A;  1B04 A;  1RFY A;  1V55 C;  4GKK O;  4O2B B;  3T1H O;  2PI5 A;  4UFZ A;  4D6T H;  3JD2 A;  1BGY H;  1XOU A;  4DW1 A;  2CGO A;  5K1P A;  1XEQ A;  3MDS A;  2LP7 A;  2R70 A;  4DR7 B;  4JI7 O;  4J7K A;  2WLL A;  4DR4 O;  1NVP D;  4BIO A;  2KB1 A;  1PV0 A;  2HVK C;  3W7S A;  4TV8 A;  4D7S A;  4GLX A;  4LF9 B;  2P90 A;  4I0X A;  1QHT A;  2Q69 A;  3CXH F;  1WB7 A;  4TV8 B;  1FD9 A;  3E89 A;  2WLM A;  3B40 A;  4YHH O;  4B7E A;  3RYF A;  4JZ2 A;  2EIL C;  5BXZ A;  4IIJ A;  4NTX A;  3OW2 U;  4CS4 A;  3C3S A;  5IJ0 A;  2ZM6 O;  1S5L Z;  1SA0 A;  3K08 A;  3P3P A;  1BQZ A;  5CA0 A;  3ZHU A;  3RYF B;  2ZR3 A;  2QSA A;  2A7W A;  2FML A;  2JDI G;  4IIJ B;  1S3J A;  2F66 C;  4LNU B;  3ABK B;  3OR7 C;  4F6R A;  2LW1 A;  5IJ0 B;  1SA0 B;  2RNB A;  5H6R A;  2NR5 A;  3ABU A;  3MHH C;  5JJE B;  5TIS Z;  4DO2 A;  4B08 A;  3TGU H;  4DV4 O;  1NQT A;  3JYC A;  1IUR A;  1G6U A;  2UUC B;  3AG3 C;  4E2L A;  4F6R B;  4X8A A;  2UU9 B;  2EJR A;  4TUY A;  5IYC O;  1R6T A;  4DV3 B;  4CH5 A;  4ASU G;  1QR9 A;  3HKE A;  2QWN B;  3OFN G;  4GKJ O;  1GN4 A;  1TUE B;  3RT3 C;  1SQQ H;  3LUT B;  4LF5 B;  4K35 A;  3AEI A;  5EK0 A;  4JI3 B;  1O9H A;  2Q7E A;  5CBH A;  4JPR A;  2GDS A;  1XL6 A;  3UO3 A;  4J41 A;  4EKW A;  1VF6 A;  4O4H A;  3APQ A;  4PA7 A;  5J2U A;  1N34 O;  1XMQ B;  3ZHQ A;  2Q7H A;  4DR2 B;  5A9G A;  2HKO A;  2IJK A;  2IJI A;  2EIN C;  4IHJ A;  3PN1 A;  1AJN A;  3RW0 A;  4DUY O;  1OZ0 A;  2QM8 A;  2PUS A;  1HR0 B;  4MTF A;  1KBH A;  5JJJ B;  3IGA C;  3CEI A;  3E8H A;  2YSU B;  5BY1 A;  1VP7 A;  3L70 H;  1NVP B;  1MZE A;  1JR9 A;  2Q8V A;  3N2G B;  2AZ0 A;  4LF7 O;  2N05 A;  4X1I B;  5LHG A;  1VQ6 V;  2EIK C;  1LNQ A;  5DM6 V;  1AVM A;  1OHH G;  2IM9 A;  3C90 A;  2A0L A;  4WFG A;  2WA4 A;  3RFR A;  1BHB A;  2NN4 A;  2BE3 A;  1TA8 A;  3ZMV A;  2Q67 A;  1Q3E A;  3DSQ A;  4NR1 A;  2HR3 A;  5EBW C;  4UCU A;  3OMN B;  4UCR A;  3JAW A;  1J95 A;  3JAL A;  1YJW V;  2CTW A;  1R3K C;  3VBB A;  1FXK A;  2EIM C;  4YJ3 A;  4FFK A;  3JAW B;  1KC8 W;  3JAL B;  1BMF G;  1F7Y A;  5CBG A;  1PNL A;  2ZXW B;  4TWK A;  1KKC A;  3VOU A;  4YJ3 B;  3FYE B;  1JPX A;  2NLJ C;  3UKM A;  2UXX A;  4BAY A;  1IX9 A;  4K8Z A;  3JCZ A;  2A9H A;  5ITZ A;  1R6N A;  2HG5 C;  3QVN A;  1QCE A;  1OCR C;  3W7X A;  2ZCE A;  2EJ7 A;  2QDO A;  1GTO A;  5CB4 B;  5B1A C;  5JQG B;  2P7T C;  3BAA A;  5EC1 C;  3OD4 A;  3RGB A;  3CB2 A;  3DC5 A;  4NXN B;  1XNR O;  1G4Y B;  3KG2 A;  4J10 A;  4ZI7 A;  4MW8 A;  4HZ3 A;  3D3I A;  3T1Y O;  4JTA B;  5LP6 A;  4ZIB A;  1P7B A;  4DR3 O;  1W2B U;  4HBN A;  4B3T O;  4AI8 A;  2OYQ A;  1ZLZ A;  2C2A A;  1PL4 A;  2JGD A;  1R3J C;  5EIB D;  5DED A;  4OGQ B;  2ZE8 A;  4FLX A;  2DYS C;  4CS3 A;  4DV1 B;  1BHA A;  1US6 A;  1IBL B;  4QGP A;  3ZIA G;  4I55 A;  3KCY A;  4DV5 B;  4MT8 A;  2JGD B;  4WFH A;  3CSX A;  1TAE A;  3ZS8 C;  5EBL C;  4RUE A;  3MAQ A;  1FS0 G;  4LFC B;  4GX1 A;  4QPJ A;  4GX2 A;  3JD4 A;  4I55 B;  5FPR A;  1Y76 B;  1EM1 A;  1SZX A;  4JYY A;  5KA6 A;  4WF9 V;  1K7D A;  4WFE A;  2QM7 A;  2DE0 X;  2UXD O;  4F4L A;  5CMU A;  4NB5 A;  4DV6 O;  1I5X A;  4KHP O;  1JVM A;  4O4I A;  4DV2 B;  1BL8 A;  4FK5 C;  4ZHQ A;  4U3F H;  3C3T A;  2A3Q A;  4H44 B;  4OXS A;  4O4I B;  2HJF C;  3SPH A;  2M7W A;  2ZKO A;  3JD3 A;  3F7Y C;  1PNK A;  1SZT A;  2H8P C;  3ASO C;  1KB9 F;  4JTC B;  4JI1 O;  4ZHQ B;  1YEW A;  3W7W A;  4UVC A;  4RQF A;  1WJZ A;  3CC4 V;  4PA3 A;  3A8T A;  2JS5 A;  1N4C A;  2PYL A;  1WAZ A;  4K3A A;  2QTO A;  4Z1M G;  4JAS A;  4LWS A;  2BTO A;  3CJH A;  5IY5 C;  1N33 B;  1WB8 A;  5D5P A;  2JJ1 G;  4RO2 A;  4OPA A;  2QR4 A;  3OMI B;  2DWE C;  2LGW A;  2HVJ C;  3AG1 C;  1AJP A;  4DV0 B;  4LWS B;  3CJH B;  4ICG A;  3CRC A;  5H9C A;  4X62 O;  1XMO O;  2JJ2 G;  3M7M X;  5FLX N;  1IXB A;  2QWQ B;  1OJH A;  3SR2 C;  5BMV A;  1NZ6 A;  3GWK C;  4AQY B;  4DR6 B;  3HPL C;  4DR1 B;  4DUZ O;  2P5O A;  4KFM A;  1M1K W;  2EIJ B;  3CCS V;  1W0J G;  3L74 H;  4DV7 B;  4JYA O;  5BMV B;  1FKA O;  2PI4 A;  2YIB A;  3LNN A;  4X64 B;  2GUZ A;  1H2L A;  2WLN A;  3ABL C;  5EYP A;  4I9W A;  2BOB C;  4UCV A;  3RYH A;  4FFB A;  4MVR A;  4HAM A;  4FMT A;  2OCC B;  4UB8 Z;  4HNA A;  4LFA B;  3X2Q B;  4NKG B;  1VQ8 V;  3OE7 G;  3D36 C;  2GUZ B;  1KKD A;  5EYP B;  4MVS A;  2OIE A;  4PA9 A;  1NR7 A;  4FFB B;  3E8F A;  1HWY A;  2W6I G;  3CYO A;  1QR8 A;  1ORQ C;  4HNA B;  3U10 A;  3JAR A;  4PDV A;  3ZMZ A;  5EZY A;  4TV9 A;  4QE9 A;  2Q0A A;  4GZR B;  4LF4 O;  2W6J G;  2UXN A;  1FYJ A;  3QO5 A;  2QKC A;  3QTC A;  4UXN A;  2RQ6 A;  4EEQ A;  3K5N A;  3JAR B;  5EZY B;  1IBK O;  2OTL V;  1ZAU A;  1JCH A;  2DOS A;  1K97 A;  2ARH A;  1JQ0 A;  3W7T A;  1SET A;  5LHI A;  1R6K A;  1GM8 A;  2DMX A;  3BCC H;  2VQF B;  4FM0 A;  4UCS A;  3ABT A;  3G71 V;  5LMN B;  2E5L B;  1VAR A;  2P6J A;  2UUA O;  1BT8 A;  2YEV B;  2ITC C;  2IU3 A;  3FD9 A;  2JIZ G;  5LGT A;  1DLB A;  4JI8 B;  3RVY A;  1H2G A;  1S77 D;  2VWK A;  3SPC A;  1LUW A;  3H1J H;  2GHY A;  2ZIM A;  5JH7 A;  1IDS A;  1XRE A;  3AG2 B;  4JTD B;  2QTS A;  2UXC B;  3JD0 A;  2LO1 A;  1BSM A;  2QJ1 A;  1VQP V;  5BR8 B;  3HB3 B;  2QWR B;  3OT7 A;  3FAV A;  1V54 B;  1X59 A;  1S5H C;  1L8D A;  4UB6 Z;  5J2T A;  2XHB A;  4LH7 A;  2XND G;  3WB2 A;  4RUF A;  5F2V O;  3BY6 A;  2JS3 A;  1Q6U A;  3FAV B;  3HKC A;  3TJT A;  2CTP A;  4P2Z A;  3ABK C;  1Q81 W;  2Q4P A;  5J2T B;  3TCU A;  3K57 A;  1Q86 W;  1FXV A;  2VRZ A;  4FLU A;  1GN2 A;  2JK5 C;  1K3E A;  1XI1 A;  1FJG O;  2Z5U A;  1Q82 W;  1VMG A;  3DXR B;  4AHC A;  1AJQ A;  3JSN A;  5L3G A;  1VQ5 V;  2B9Z A;  4D7T A;  1IZ3 A;  2YI9 A;  1OCC B;  4DV3 O;  1GM7 A;  2QWO B;  3M99 B;  5B3S B;  3KZI Z;  1GM9 A;  5C8Y A;  1MG1 A;  5LGN A;  4LF5 O;  3SPJ A;  1G1X B;  4I5S A;  1F4M A;  5LGU A;  2ZT9 B;  2YS8 A;  3STL C;  1DTO A;  4FLV A;  3L75 H;  3E8B A;  1VF6 C;  5C8Y B;  1XMQ O;  1SES A;  4GCZ A;  1N36 O;  3OGI B;  1X4T A;  2F93 B;  2IH1 C;  5IWA B;  1SQP H;  4FLZ A;  1YIJ V;  1AI7 A;  4NVP A;  5IYD O;  1VQK V;  3FB6 C;  4BR6 A;  2AGA A;  4I7Z B;  1HR0 O;  2QEX V;  5EBM C;  1I94 B;  4FM2 A;  3ZCC A;  1N32 B;  1KU9 A;  3L73 H;  3CCQ V;  2RN9 A;  3CWB H;  1Q6I A;  2WWW A;  4LF8 O;  4X65 B;  4YY3 B;  1XL4 A;  4B7K A;  2WLL B;  4YIP A;  2N74 A;  1AB3 A;  3K79 A;  3T4Z A;  1Z5V A;  3SYC A;  4PI0 A;  3CCL V;  1YXB A;  2Y4U A;  2Q73 A;  3TXQ A;  4TQF A;  5L3E A;  3HKD A;  1GKF A;  5LBQ A;  2L35 A;  3K04 A;  5FNV A;  3N27 A;  1XNQ B;  3R65 A;  3OTO O;  2ZDI A;  1UFI A;  4I0X B;  4NXM B;  2UXB B;  1UJW B;  1W0K G;  5LHH A;  2CDY A;  2R9A A;  4QIW F;  1Y74 A;  2HJD A;  2ZR2 A;  4J11 A;  1HNX B;  4IGG A;  5FNV B;  3B2E E;  3IFX A;  2WLI A;  4J9Z B;  4PI2 A;  2B1G A;  4YIO A;  4BIZ A;  5KUK A;  5B1B B;  1H2M A;  4XBF A;  5KAF Z;  3IAY A;  1Y74 B;  2ZE7 A;  5IT9 N;  3UO2 A;  2RMK B;  1HNW B;  1ENV A;  3E22 A;  2WLI B;  1YHQ V;  5CA0 B;  2ZXW C;  4L8J A;  2W0X A;  4B3M B;  4JI5 B;  3K58 A;  3RN4 A;  4J42 A;  3JCU Z;  3E22 B;  4FPP A;  2UUB O;  5H6Q A;  5CA1 A;  1HNZ B;  2QWP B;  1TUB A;  3D3Q A;  3JD1 A;  4TUY B;  2YID A;  3ASN B;  4K0K B;  4JAV A;  4B3S B;  1M9N A;  3HKE B;  4OX9 O;  3TK1 A;  1YF2 A;  5CA1 B;  2PY5 A;  1PD3 A;  1QLE B;  5C93 A;  1U97 A;  2P06 A;  1I08 A;  2ADQ B;  2VS0 A;  1ZX3 A;  2F4V O;  1H8H G;  3K0G A;  4UCO A;  4O4H B;  1JX9 A;  5J2U B;  3T1H B;  4P9P A;  1GO3 F;  4IHJ B;  2CH7 A;  2V1D A;  3DC6 A;  4PD4 F;  4I9Q A;  5LXT A;  1ZWI C;  3L9D A;  2YUA A;  2X6B A;  1KEC A;  1D5A A;  4BIU A;  4JI2 B;  4DV1 O;  4JI7 B;  3CCV V;  4DR4 B;  1P84 F;  4UV9 A;  5GTI Z;  4RQE A;  4JF3 A;  2PGG A;  3CCJ V;  2CH7 B;  3CCE V;  2WLK A;  2P4V A;  4P9O A;  3ZMT A;  5LXT B;  2E74 B;  5KA5 A;  1ZUQ A;  1IVS A;  2Y48 A;  1CEZ A;  1JA8 A;  1VQM V;  2P67 A;  1S72 V;  1MMM A;  2QE7 G;  1MSW D;  1M93 A;  5E79 Z;  3ZED A;  2CE4 A;  1RP3 B;  4EB6 A;  3QNE A;  3WG7 B;  3H1H H;  1AR5 A;  4YHH B;  1CPY A;  1GRJ A;  1NTK H;  1OV9 A;  3WB0 A;  3EFF K;  3J80 N;  4EB6 B;  4JI0 O;  4XDK A;  5KMG A;  2ZM6 B;  2QA4 V;  2HFE C;  1SS3 A;  2EIL B;  3G4S V;  3RVZ A;  2L6L A;  3RBZ A;  2DQ3 A;  1K4C C;  3RYC A;  1FXK B;  1Q5O A;  4UUJ C;  5KMG B;  1NJI W;  3K0D A;  4W4L A;  3P3N A;  4DV4 B;  2JEX A;  1FXH A;  4PDL A;  1B3Q A;  2NNU A;  4YJ2 A;  3RYC B;  3ZRX A;  5B1O A;  1B6Q A;  4J80 A;  3FB5 C;  1XHX A;  3G80 A;  1LUV A;  1VIB A;  1RPO A;  1YCI A;  5ITZ B;  1XBL A;  4KP4 A;  2RJZ A;  2YI8 A;  4YJ2 B;  5GON A;  2B5U A;  4YXW G;  2A79 B;  3BHP A;  1Y66 A;  2AHY A;  3FYI B;  4DV0 O;  4FLW A;  1IBM O;  2ZQM A;  5GON B;  2EIJ C;  4GT1 A;  5EIB C;  4LFB B;  1S0V A;  4JV5 O;  3CCU V;  3ETE A;  1MSD A;  4AQY O;  4DR6 O;  1PKX A;  4ZI7 B;  3H1K H;  3N2K A;  1SQB H;  2XOK G;  5LP6 B;  1TGO A;  1BZK A;  1I5Y A;  2KG7 A;  1Y67 A;  2H3O A;  2DWD C;  2OCC C;  1MOF A;  3X2Q C;  1EN5 A;  4LF7 B;  4U7O A;  3N2K B;  3I55 V;  3E83 A;  1NBM G;  3CS5 A;  2FKX A;  1FPO A;  2KG7 B;  1YZB A;  2YIB D;  2D3O W;  2XAG A;  3ZX6 A;  4LFA O;  2M6Y A;  4CH3 A;  5K1X A;  2JEU A;  1R73 A;  1RM1 B;  2Y0I A;  4JI4 B;  1H8E G;  1NH2 D;  1N8R W;  1BQ0 A;  2YIC A;  4BW5 A;  3K3W A;  4FJC C;  3OR6 C;  5KLV H;  1P7G A;  1AR1 B;  4G28 B;  1DF4 A;  5CBF A;  2R72 A;  1JMK C;  1M4U A;  4PJ0 Z;  3IC9 A;  2Q6A A;  2DN9 A;  1KMI Z;  3IJ4 A;  3OUF A;  3SJQ C;  5B66 Z;  3SGI A;  5J9P C;  2XAS A;  1MAB G;  2Q7G A;  3E8G A;  2OTJ V;  5B5E Z;  1AP6 A;  2Z0A A;  2EZO A;  4MS2 A;  5LMN O;  3ZHT A;  2EBO A;  2HHH B;  5HFL A;  2VQE O;  4MW3 A;  1XIL A;  1H2K A;  3UQ8 A;  1QLN A;  3CD6 V;  4U3J A;  4JI8 O;  2XAQ A;  4DW0 A;  3SDL A;  3AG2 C;  4KUM A;  3AK3 A;  3K59 A;  1GH6 A;  1SQV H;  1DGS A;  3RYI A;  4R7C A;  4U3J B;  3L72 H;  3S3W A;  1V54 C;  4B3R O;  2KQX A;  1K33 A;  3MD0 A;  1E1Q G;  3CMA V;  3THO A;  4CZZ A;  4DK0 A;  2LFR A;  2LW7 A;  3RYI B;  2RDC A;  4X89 A;  4TSF G;  1QQC A;  1YJN V;  1BE3 H;  3U11 A;  1XNR B;  1PNM A;  2X6A A;  5LMU O;  4JI6 O;  2R9I A;  1QNM A;  1Y6X A;  1YDX A;  4FIP C;  4JZG A;  1OCO B;  3U0Z A;  1WA8 A;  4RAI A;  1J5E O;  2MK3 A;  4B3T B;  4G2K A;  3CME V;  1Z5W A;  2EZP A;  3NXS A;  2HLD G;  5KHJ A;  2OWO A;  1NTZ H;  2O57 A;  3BA9 A;  3NR7 A;  3RYH B;  4F6E A;  1NH2 B;  3ML0 A;  1TVK A;  5IJ9 A;  2IU0 A;  4DR5 O;  4WFB V;  1OCC C;  1Q6H A;  4CC5 A;  3JSL A;  4G27 B;  2EX3 A;  1L1F A;  2P22 C;  5GW7 A;  5B1N A;  5B3S C;  2X7R B;  3CP1 A;  4FLY A;  1KP3 A;  1TVK B;  5IJ9 B;  3IC7 A;  4X66 O;  2UXD B;  2LGQ A;  4FZ0 A;  4PHZ A;  4DV6 B;  4PA6 A;  2ZE6 A;  4TV9 B;  3CCM V;  1H38 A;  4KHP B;  5L3D A;  3W7U A;  2YDE A;  1XUQ A;  1H2N A;  4O2A A;  4DRX A;  1QBZ A;  2PYJ A;  1AI6 A;  2ETN A;  2GV9 A;  4I50 A;  5JCO A;  5IWA O;  3K5O A;  4UVB A;  4MVU A;  3UM7 A;  1ZTE A;  3VQW A;  4MVO A;  4JI1 B;  1NS1 A;  3M8A A;  5L3C A;  3A0B Z;  4DRX B;  4N23 A;  4DR7 O;  1WLE A;  3ZN0 A;  2LFS A;  4I50 B;  1N32 O;  4KL1 A;  3T2M A;  4WBN A;  3JAK A;  1NTM H;  3ETG A;  1AP5 A;  4LC1 A;  3JAM N;  2OIG A;  2LQT A;  2BTQ A;  5JVD A;  4LF9 O;  1PPJ H;  2F23 A;  4J7J A;  1L0N H;  2FL4 A;  4WBN B;  1W59 A;  5JH7 B;  4C7U A;  3B77 A;  2BTQ B;  1HW7 A;  1XNQ O;  4O4L A;  1E79 G;  5JVD B;  1WPX A;  2R9R B;  3FB7 C;  4X62 B;  1JJ2 U;  4NXM O;  3G67 A;  3APO A;  1A32 A;  4UV8 A;  3SYQ A;  1KYO F;  1URF A;  5B1B C;  2ADP A;  3BA8 A;  4OPH A;  3B8N A;  3OM3 B;  1JOY A;  3S3X A;  4O4L B;  4K8X A;  4MVZ A;  4DUZ B;  3AG4 B;  1ROP A;  3H1I H;  2YXH A;  4X88 A;  5JJN B;  4JYA B;  2XTA A;  3HKC B;  3WU2 Z;  4EFE A;  1M57 B;  2A06 H;  1SRY A;  1GN3 A;  3OAA G;  4DXW A;  2ZNJ A;  1THZ A;  4FLT A;  3ZRS A;  2UUC O;  1K9M W;  3R66 A;  2UU9 O;  4NYK A;  4CH4 A;  3QF7 A;  3I56 V;  1R3I C;  4IL6 Z;  2N04 A;  4J9Y B;  3ASN C;  3FB8 C;  2XUM A;  2E76 B;  1JFF A;  4LF4 B;  3SJA C;  3GVM A;  4JI3 O;  1QLE C;  4PDR A;  3LSU A;  3QG5 A;  2B1I A;  4A5U B;  5LA6 A;  3WFV A;  2Q5Z A;  5HFM A;  1IBK B;  4DR2 O;  4O2B A;  1SQF A;  4J7Z A;  1P4R A;  1K34 A;  3LNM B;  4L87 A;  4CC6 A;  5LA6 B;  2ODM A;  3ZMU A;  2UUA B;  3UT5 A;  4ABM A;  1NKD A;  3ZRW A;  3WB1 A;  4QNH B;  2QKA A;  4JI2 O;  3ABM B;  4LF6 B;  1UPG A;  1YIT V;  1K8A W;  3T4D A;  3UT5 B;  2CK3 G;  2V4D A;  2WLH A;  4N21 A;  3ZRW B;  4BWA A;  3G6B A;  1D5N A;  3ICX A;  5IE9 A;  3WG7 C;  2CUG A;  1K92 A;  2F1M A;  3HKD B;  1Z2G A;  2QM4 A;  1JJO A;  3OGC C;  3RWR D;  1I0H A;  2HEP A;  4LP8 A;  4LNU A;  3P32 A;  1R3L C;  1ARO P;  3L71 H;  1QVG U;  1FXK C;  1AI5 A;  1D2D A;  5LOV A;  1SC5 B;  2GBO A;  3LSS A;  2ITD C;  2F95 B;  1WP7 A;  4FZ1 A;  2XAF A;  5BZB A;  1OCZ B;  4FVM A;  1FJG B;  2XT9 A;  1SF9 A;  1Q8I A;  5LOV B;  5D5Q A;  4U7N A;  2ZIN A;  3CCR V;  2DYR B;  3B4S A;  3O9O A;  4EFB A;  2E75 B;  2RCV A;  3H01 A;  4IT5 A;  2AZ2 A;  2Q0O C;  2HP8 A;  4GYC B;  2XAH A;  1TUB B;  3H9V A;  4TQD A;  5CN0 A;  3A0H Z;  4UCT A;  5E1A C;  1HP8 A;  1WN7 A;  1M56 B;  4BW9 A;  5KHI A;  4NXN O;  3TXS A;  2IJH A;  2Y69 B;  4GKK B;  4FM1 A;  3E86 A;  1NU1 H;  3SYA A;  1T5E A;  4TT3 G;  2BCC H;  5LP6 C;  1N36 B;  4LFB O;  3E2E A;  2XAJ A;  4LR3 A;  1GAX A;  1BS3 A;  1V55 B;  3N2G A;  4X1I A;  3SYP A;  1WPB A;  1IBL O;  5IYB O;  3CRR A;  4DV5 O;  3I5D A;  4MSW C;  4PA4 A;  3E35 A;  1F4N A;  4MTG A;  3AK1 A;  4LF8 B;  5IYZ A;  3ETQ A;  1RM1 C;  3CC2 V;  4JAU A;  4LFC O;  2ZE5 A;  3VQX A;  3BFR A;  2FTK A;  3FKS G;  1QVF U;  1KUQ A;  1AI4 A;  5IYZ B;  4JI4 O;  2H94 A;  1FAF A;  1S5J A;  5AG2 A;  3OTO B;  3KCX A;  5FPO A;  4DV2 O;  4PV1 B;  3J7A U;  2E3C A;  3BAB A;  2D2C B;  2QKS A;  1NI8 A;  4Z1V A;  4H13 B;  1K4D C;  5KUM A;  4R8C A;  2P4K A;  4X1Y A;  2IJJ A;  3OEH G;  4ZKI A;  1BCC H;  2K1E A;  3ETD A;  1VEW A;  4NTW A;  4MVQ A;  5CA3 A;  1XDC A;  1EN6 A;  3JAT A;  2PZS A;  4X1Y B;  1VQO V;  4E4E A;  4GX0 A;  2HHH O;  5A2Q N;  4I4T A;  3LDE A;  3K9S A;  1VQ7 V;  3OUS A;  2IBZ H;  2UUB B;  3AG3 B;  1N0N A;  4QJF B;  1N33 O;  5GTH Z;  3JAT B;  1Q43 A;  4GKJ B;  5CB4 A;  1Q7Y W;  1YTF D;  2ZIO A;  4I4T B;  5JQG A;  2K9P A;  2FYU H;  1L0L H;  2X0L A;  1HDJ A;  2BOC C;  2CGN A;  4LCU C;  4ZBM A;  4CH6 A;  4OX9 B;  5L3F A;  1N34 B;  1VQN V;  3BRC A;  4PEL A;  1DF5 A;  4H37 A;  5EC2 C;  3GB7 C;  4CS2 A;  3Q4H A;  4R6Z A;  4DR1 O;  2F4V B;  2QGN A;  2YIA A;  1OCO C;  3PJS K;  4XDJ A;  4DUY B;  4DV7 O;  2JRI A;  3B09 A;  2EIN B;  3K9A A;  4WCE V;  3AK2 A;  4X64 O;  3Q4H B;  1IXM A;  3SYO A;  5DN6 G;  3SPI A;  2ZNI A;  3SJB C;  1V9P A;  2GSM B;  2LJ2 A;  1SKV A;  2EIK B;  1Y76 A;  3AG7 A;  3CPW U;  2GTS A;  1WP8 A;  2CTR A;  3EVK A;  4MTO A;  2JVD A;  1NT2 B;  1GMG A;  3HKB A;  5KHK A;  2IW5 A;  1F51 A;  1LR1 A;  1VQL V;  1WNS A;  4MTX A;  1QU7 A;  3VQY A;  1M5I A;  3ZHS A;  3HKB B;  3ZBH A;  3QO8 A;  4WFF A;  4X20 A;  2Q68 A;  2Z3Y A;  5DEC A;  3ZJZ A;  5H2F Z;  2JGU A;  3K5M A;  4QPK A;  1MA1 A;  1EN4 A;  3UCS C;  1XQ8 A;  2PF4 E;  3DGE A;  4X20 B;  4JI0 B;  1PP9 H;  1VQ9 V;  4P30 A;  3F5W C;  2VQF O;  3SJC C;  3A2F A;  2E5L O;  2EIM B;  3CRM A;  5JCO C;  4IYI A;  1S76 D;  3ZRV A;  4JGS A;  1XHZ A;  4RWU A;  4AIL C;  3VQV A;  4KXR A;  1YTF B;  2DQ0 A;  5LL6 Y;  3F5T A;  2ZD9 A;  2UXC O;  1RSO A;  1DK1 A;  2OCH A;  2ATK C;  2YC0 A;  1AR4 A;  5BR8 O;  1YI2 V;  1OCR B;  2EUL A;  1EFR G;  5B1A B;  4GUN A;  1SQX H;  5JWP A;  1RSO B;  4Q6G A;  4R50 A;  3MHS C;  3FFQ A;  3T1Y B;  1IBM B;  2X6C A;  3AG4 C;  3CRA A;  2G38 A;  4DR3 B;  1NR1 A;  4JV5 B;  3K03 A;  3J81 N;  1SER A;  2VWJ A;  2BSK A;  3TET A;  1M57 C;  2WLJ A;  1KP2 A; 
#chains in the Genus database with same CATH homology
 4B3S B;  4CH4 A;  4ZI7 A;  3QF7 A;  3HKE B;  5LP6 A;  4ZIB A;  5CA1 B;  2PY5 A;  4HBN A;  5KX5 A;  2OYQ A;  4UCO A;  5EIB D;  1JFF A;  4LF4 B;  3SJA C;  4FLX A;  4CS3 A;  4DV1 B;  1IBL B;  4O4H B;  3QG5 A;  5J2U B;  4I55 A;  4DV5 B;  5KX5 B;  5KHG A;  3T1H B;  5LA6 A;  3CSX A;  1IBK B;  1TAE A;  4IHJ B;  3ZS8 C;  3MAQ A;  4O2B A;  1SQF A;  4LFC B;  4I9Q A;  4X1K A;  4ZOL A;  5FPR A;  4I55 B;  5LXT A;  1D5A A;  4JI2 B;  4DK1 A;  4JI7 B;  4CC6 A;  5LA6 B;  4DR4 B;  2PGG A;  4X1K B;  4ZOL B;  2UUA B;  5LXT B;  3UT5 A;  3K5L A;  4O4I A;  3WB1 A;  4DV2 B;  4O2A B;  4ZHQ A;  4LF6 B;  1M93 A;  3ZED A;  2PTM A;  3UT5 B;  4EB6 A;  2V4D A;  4O4I B;  4YHH B;  2VQE B;  4BWA A;  4K0K B;  3ICX A;  4ZHQ B;  1YEW A;  3WB0 A;  2F1M A;  3HKD B;  4EB6 B;  5KMG A;  3JAK B;  2ZM6 B;  5LYJ A;  2JS5 A;  2QM4 A;  2PYL A;  1JJO A;  3RWR D;  1XMO B;  2HEP A;  3RYC A;  4B3R B;  1Q5O A;  5KMG B;  4LNU A;  1H2S B;  2BTO A;  5LYJ B;  1N33 B;  5D5P A;  3OTF A;  4O4J A;  4DV4 B;  4TOI A;  5LOV A;  4YJ2 A;  3RYC B;  2F95 B;  4DV0 B;  5LMU B;  1I7F A;  4JI6 B;  3CHX A;  3JAS A;  3M7M X;  4FVM A;  1FJG B;  1XHX A;  4O4J B;  1J5E B;  3SR2 C;  5ITZ B;  5BMV A;  1Q8I A;  5LOV B;  2RJZ A;  2YI8 A;  4YJ2 B;  5D5Q A;  5GON A;  4AQY B;  4DR6 B;  2CAZ C;  2ZIN A;  4DR1 B;  2P5O A;  2YXL A;  3BHP A;  4EFB A;  3JAS B;  1P49 A;  4DV7 B;  4LH6 A;  1O9G A;  5BMV B;  5KHH A;  4FLW A;  2YIB A;  5GON B;  3LNN A;  4X64 B;  4GYC B;  5EIB C;  4LFB B;  5EYP A;  1TUB B;  1FFX A;  4TQD A;  4UCV A;  3RYH A;  4UCT A;  4DR5 B;  4FFB A;  4ZI7 B;  1SQG A;  3N2K A;  1WN7 A;  4HNA A;  4LFA B;  4BW9 A;  5LP6 B;  5KHI A;  1TGO A;  5EYP B;  3BPZ A;  4X66 B;  4FM1 A;  4GKK B;  1FFX B;  2KKW A;  4FFB B;  1T5E A;  5LP6 C;  1N36 B;  4LF7 B;  1JFF B;  3N2K B;  4LR3 A;  4HNA B;  3U10 A;  3JAR A;  5EZY A;  4TV9 A;  3N2G A;  2Q0A A;  1VF7 A;  2YIB D;  4X1I A;  1WPB A;  4CH3 A;  5K1X A;  3QTC A;  1B04 A;  2RQ6 A;  4JI4 B;  4O2B B;  4EEQ A;  4UFZ A;  3K5N A;  3JAR B;  5EZY B;  4LF8 B;  5IYZ A;  3ETQ A;  1ZAU A;  5K1P A;  2R70 A;  3VQX A;  2R72 A;  1JMK C;  1M4U A;  4DR7 B;  2VQF B;  4FM0 A;  4UCS A;  5IYZ B;  5LMN B;  1S5J A;  2E5L B;  3OTO B;  4TV8 A;  1KMI Z;  5FPO A;  4D7S A;  3BAB A;  2E3C A;  3SGI A;  4GLX A;  4LF9 B;  4JI8 B;  2Q7G A;  1QHT A;  2VWK A;  4TV8 B;  2HHH B;  4X1Y A;  2ZIM A;  3RYF A;  5JH7 A;  2UXC B;  4IIJ A;  3UQ8 A;  4CS4 A;  4U3J A;  2QJ1 A;  5BR8 B;  5IJ0 A;  1SA0 A;  3K59 A;  3JAT A;  2PZS A;  4X1Y B;  5CA0 A;  3RYF B;  1L8D A;  5J2T A;  1DGS A;  3RYI A;  4IIJ B;  2XHB A;  2F66 C;  4LH7 A;  4LNU B;  3WB2 A;  4I4T A;  4U3J B;  4F6R A;  5IJ0 B;  2UUB B;  1SA0 B;  3HKC A;  3JAT B;  3THO A;  5JJE B;  1Q43 A;  4DK0 A;  4B08 A;  4GKJ B;  5CB4 A;  5J2T B;  3RYI B;  3K57 A;  1G6U A;  2ZIO A;  4I4T B;  2UUC B;  5JQG A;  1QQC A;  3U11 A;  4F6R B;  4FLU A;  1XNR B;  2UU9 B;  4CH6 A;  4TUY A;  4OX9 B;  4DV3 B;  1XI1 A;  3U0Z A;  1N34 B;  4CH5 A;  3BRC A;  4B3T B;  3HKE A;  1Z5W A;  4CS2 A;  4AHC A;  2F4V B;  2YIA A;  3JSN A;  5KHJ A;  4LF5 B;  4DUY B;  2OWO A;  4JI3 B;  1O9H A;  2Q7E A;  4D7T A;  3BA9 A;  2YI9 A;  3RYH B;  4O4H A;  5J2U A;  1XMQ B;  2Q7H A;  4DR2 B;  1TVK A;  5IJ9 A;  2ZNI A;  5C8Y A;  4IHJ A;  3PN1 A;  3SJB C;  4CC5 A;  3JSL A;  1V9P A;  2EX3 A;  2P22 C;  2PUS A;  1HR0 B;  1SKV A;  5JJJ B;  4FLY A;  1TVK B;  5IJ9 B;  2UXD B;  4FLV A;  4PHZ A;  4DV6 B;  2JVD A;  4TV9 B;  4KHP B;  3N2G B;  1NT2 B;  3HKB A;  5C8Y B;  5KHK A;  1X4T A;  2F93 B;  4X1I B;  5IWA B;  4FLZ A;  4NVP A;  1WNS A;  3VQY A;  4O2A A;  1M5I A;  1I94 B;  4FM2 A;  2IM9 A;  3HKB B;  4DRX A;  1N32 B;  1KU9 A;  4X20 A;  2PYJ A;  3RFR A;  2GV9 A;  5JCO A;  4I50 A;  3K5O A;  4X65 B;  4YY3 B;  3VQW A;  4JI1 B;  2JGU A;  3K5M A;  1TA8 A;  4DRX B;  1Q3E A;  1Z5V A;  4PI0 A;  1XQ8 A;  3DSQ A;  4X20 B;  4JI0 B;  4TQF A;  4I50 B;  3SJC C;  4KL1 A;  3HKD A;  4UCU A;  4UCR A;  5FNV A;  3JAK A;  4WBN A;  3A2F A;  1XNQ B;  3JAW A;  4NXM B;  2UXB B;  3JAL A;  5JCO C;  2BTQ A;  2R9A A;  5JVD A;  1HNX B;  4YJ3 A;  1XHZ A;  5FNV B;  3B2E E;  4WBN B;  4AIL C;  3JAW B;  4PI2 A;  3VQV A;  3JAL B;  5JH7 B;  2BTQ B;  1HW7 A;  4O4L A;  5JVD B;  3IAY A;  4X62 B;  4YJ3 B;  1RSO A;  1HNW B;  3E22 A;  5CA0 B;  3BA8 A;  4L8J A;  4B3M B;  4O4L B;  4K8Z A;  4K8X A;  5ITZ A;  4DUZ B;  4JI5 B;  3K58 A;  4Q6G A;  5JJN B;  2ZCE A;  4JYA B;  3E22 B;  3HKC B;  3FFQ A;  3T1Y B;  4EFE A;  1IBM B;  5CB4 B;  4DR3 B;  4JV5 B;  5JQG B;  3BAA A;  2ZNJ A;  2VWJ A;  5CA1 A;  3RGB A;  4FLT A;  1HNZ B;  3CB2 A;  1TUB A;  4TUY B;  4NXN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...