4LF7O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf7O00
1FJGO 4JI0O 4LF9O 1HNXO 5LL6Y 1IBMO 2UXCO 4B3MO 1N32O 5BY1A 4X65O 3F5TA 4A5UB 5LMUO 3R66A 2UXDO 5FLXN 4OPAA 1R6TA 1DK1A 4LF8O 1XNQO 5LMNO 1N36O 3T1YO 4GKKO 1D2DA 3SDLA 1HNWO 2UUBO 5BXZA 4DV2O 1KUQA 1YZBA 4YHHO 2HHHO 4JI8O 2E5LO 1NS1A 4LFCO 4DR4O 4DV7O 1IBLO 2UU9O 4K0KO 4X64O 4AQYO 1IBKO 1F7YA 4JV5O 2UUAO 3RT3C 1XNRO 4B3RO 4DV6O 4JI4O 4DV3O 3J7AU 2DJVA 4X66O 1FKAO 3T1HO 4JI2O 4YY3O 2FKXA 4DV1O 1R1BA 5IWAO 4DR2O 1XMOO 4DR6O 2VQFO 2UUCO 4DR5O 1HR0O 4JI3O 4LF4O 5A2QN 4JI5O 4DUZO 3O65A 4GKJO 1J5EO 2ZM6O 5BR8O 3J81N 4LF7O 2VQEO 4DR3O 2ZKOA 4X62O 4DUYO 1I94O 1XEQA 4OX9O 4DV4O 4LF5O 5IT9N 4DV5O 1X59A 1AILA 4DR7O 4LF6O 2AGAA 3M8AA 4KHPO 5H5NA 2N74A 1A32A 4LFAO 4NXNO 2DOSA 4B3SO 2LW7A 4DR1O 2F4VO 4JYAO 4LFBO 1G1XB 4JI6O 1FYJA 4NXMO 1N33O 4JI7O 2UXBO 4B3TO 3J80N 4OPHA 1XMQO 2Z0AA 1AB3A 1N34O 1HNZO 4JI1O 3OTOO 3JAMN 4DV0O 2JRIA
chains in the Genus database with same CATH superfamily
1FJGO 3RVZA 3IGAC 4ZI7A 3D36C 2F66C 1SQPH 4C7UA 4JAAA 2YIBA 3AG3B 1XUQA 1BE3H 1I08A 4PDLA 4LFCB 1IZ3A 2ZE5A 3E2EA 3DGEA 3W7XA 3SYPA 5CA0B 1ZX3A 1Y76A 4YJ2B 1SA0A 3ZHUA 1M5IA 4LH6A 2WLLB 3SJAC 5FNVB 2EILC 2M6YA 1NS1A 2Q67A 2A3QA 4DUZB 4J41A 3A0HZ 4CBCA 1S72V 3ZHVA 2JEXA 3PJSK 4G2KA 1HP8A 5GONA 3JALA 3BAAA 3T1HB 4NTWA 4FLZA 1OCZC 1B04A 3FYIB 3JAKA 4IIJB 4RWUA 4FMTA 1MA1A 4X8AA 3K04A 4LFAB 1FFXA 2OT5A 1GN2A 4R6ZA 1OCCC 4FFBB 5JH7B 4JAVA 4PELA 1IXBA 2ZCEA 2IU0A 2CTWA 4NYKA 3K5LA 3IC7A 3M8AA 1KKCA 5FPRA 2DOSA 4TWKA 3K9SA 1PV0A 1Y67A 3CCVV 1PKXA 5GTIZ 3W7TA 4OPHA 2ADQB 1HNZO 4NR1A 4I4TB 3CCJV 1HNWB 2Q4PA 2HG5C 3JD1A 1YF2A 4GX2A 3DC6A 4DK1A 2PI4A 4TOIA 1RM1C 1N32O 5BY1A 3ABTA 1CEZA 3JARA 1FXKB 5LMUO 2A0LA 3K3WA 2EIJC 3AG1B 4X1YB 2HFEC 4DV6B 3M99B 1G4YB 2LGQA 3OR6C 3FB5C 4E4EA 1V54B 4UB8Z 4YY3B 4GUNA 4DV1B 1FFTB 4U3JB 4RUEA 1K5SA 2KG7A 3AG2C 1TUBA 3ZMTA 3UO2A 2HVJC 2IJJA 4DR3B 4QE7A 3C3TA 3T1HO 4J10A 1US6A 1S76D 1ORQC 4DV3B 5EZYA 4TV9A 1XMOO 1IXMA 2VQFO 5JCOA 4DXWA 3ZJZA 2XT9A 3ASOC 2Q73A 3ABMB 4LF6B 4LWSA 4KHPB 3ABKC 3JD0A 5BR8O 2IM9A 3TGUH 5KX5B 4PD4F 1MNGA 3HKEB 3DTUB 5B1BB 4B7KA 1Q6HA 4JYAB 1K9MW 3A0BZ 3WB1A 1K33A 3OMIB 3BFRA 1VEWA 3KKYA 4J7KA 4BIOA 1AJPA 2YI9A 2ZR3A 3CSXA 4J7ZA 2L35A 5KUMA 3IAYA 3DXRB 3CCSV 5CA3A 1G6UA 2DW4A 1OCOB 3X2QC 4E2LA 2DYRC 1GN3A 1GRJA 1S5JA 2R72A 4GKKB 1D5NA 2GUZB 5LXTB 1Q5OA 3F5WC 3GB7C 3K58A 4QPKA 1SZXA 2E74B 4DV2B 1VARA 1KECA 4K8XA 1E79G 4L8JA 2Z3YA 2DWDC 3CD6V 4X89A 2UU9B 5J2TB 2AHYA 3JSLA 2ZINA 2EX3A 3OGCC 4MSWC 2FB5A 3UQ8A 4IHJB 4I55B 2P4KA 4YIPA 2OCHA 3ABLC 5IWAB 4XDLA 4I50B 1WP8A 3OM3B 4YHHB 3F7VC 4LCUC 4DV3O 1K7DA 1OZ0A 5JQGA 3W7WA 4DO2A 3LNNA 4PA9A 1Y4MA 4OXSA 1M57C 3CWBH 1KB9F 3B4SA 3ZIAG 2FTKA 2PY5A 3N2GB 3RYCB 5FL7G 1SZTA 5DM6V 3ZRXA 1X4TA 1KKDA 1B6QA 4GKJB 1WAZA 3RVYA 1S5LZ 3G6EV 4UCUA 3CRRA 1H8EG 2YIBD 3ZRWB 4PA7A 2UXBB 4DYLA 5EYPB 3SPCA 4CS2A 3ETDA 1H2GA 5H5NA 2QSAA 1YJ9V 4MS2A 3K9AA 3OTOB 2ZE7A 4DV0B 1P49A 2ATKC 3ASNB 4UV9A 2YXYA 2P22C 5JJJB 4EKWA 3IFXA 3MHSC 1NTMH 1AI4A 1Q86W 4I9WA 4HBNA 5L3EA 2OWOA 4RO2A 2RDCA 4JZGA 3MHHC 2LFSA 3E35A 2IH3C 4LF8B 1XNQB 1N36B 2B1GA 1M56C 1J95A 1GO3F 4J42A 2UXCO 2RCVA 5KHIA 1VQKV 2GSMB 1K3EA 2HHHB 5DECA 1MG1A 4MVUA 5HFMA 1KC8W 3CC4V 1ZWIC 4DRXA 1VQ6V 1PL4A 1XHXA 3JD2A 3HKCA 3LSUA 4CH4A 4JPRA 5LP6A 4X20B 4YHHO 4DR6B 2UUCB 1LUVA 2ETNA 3CB2A 2VS0A 2OTJV 3CE2A 5LA6B 2NNUA 5H2FZ 2E75B 3EVKA 4B3RO 4Q20A 4LR3A 1TUEB 4TUYB 1NH2D 4U7OA 4X1KA 3ZMUA 3OEEG 5B5EZ 3SPIA 5JVDA 4NKGB 1N4CA 3ZCCA 2JK5C 2FKXA 2JS5A 2HVKC 4O4IA 3UT5A 3FFQA 4GZRB 4MVZA 1SS3A 2A7WA 2FYUH 3AG4C 4GKJO 3RYFB 3LDCA 3OR7C 5IY5C 5IYDO 3ETGA 5LHHA 3K03A 3B8MA 1QR9A 1TVKB 4QPJA 2K9PA 2F4VB 3OW2U 3GWOA 4YJ2A 2JDIG 3CJHB 4AHCA 4X1IA 1XILA 2WWWA 1OCZB 5BMVA 3SYQA 3SJQC 2H3OA 3SPGA 1EN5A 3A2FA 2EZPA 1AP5A 1OCCB 1YEWA 3KCXA 5F2VO 3WU2Z 4ZOLA 4JI6O 4B3MB 1W0KG 1RP3B 3ZRVA 1IX9A 2PZSA 1GKFA 1N0NA 3JYCA 3M7MX 3N2KA 3LDDA 4IIJA 2W6JG 5BZBA 4H37A 4TQDA 2BTQB 5EBWC 3HKBA 2QDOA 4GX5A 4I7ZB 5L3GA 2DN9A 3WG7C 2JGDB 1AROP 2OIEA 3L75H 3CCLV 2ZNJA 1BCCH 1CPYA 3SDLA 1EM1A 1WPXA 1YZBA 1RM1B 3L74H 4EB6A 2L6LA 1F7YA 1YSCA 1VQ8V 3FAVB 4JI4O 1EFRG 2EIJB 1LR1A 3RYHB 3THOA 1QU7A 1R3LC 5C8YB 2R9IA 4JV5B 1I94B 2ILMA 2NR5A 3LNMB 3H01A 3K59A 1WN7A 3BA9A 4U7NA 4I4TA 4D6TH 3D8CA 1VQOV 3ZX6A 2QWPB 5B3SC 1VQ5V 1YTFB 1DGSA 1ZL8A 3QO5A 1QVFU 3AG2B 1AVMA 2X6BA 1XEQA 3CCMV 1BHAA 4O2AB 4UVCA 3AK2A 3CCEV 1Y74B 4JAUA 3SYOA 2BSKA 3STZC 3MAQA 2YC0A 1QVGU 4DW0A 4DR7O 2Q9LA 3ASOB 1XMQB 4JI1B 1S0VA 3LDEA 5CBFA 2QTSA 3QG5A 3ABUA 3OD4A 1KD1W 2ZIMA 1HNXB 1URFA 4B7EA 4P9OA 3JASB 1TA8A 2XHBA 4FVMA 1YIJV 4LFBB 2IH1C 4MVSA 4N21A 1WJZA 1G8MA 1JFFB 3B40A 2QM7A 4YJ3B 4FFKA 4MTOA 1L0LH 3FB6C 3OMAB 4JI0O 2AXTZ 2ZE8A 1BQZA 4PA3A 5C93A 3GVMA 2ARHA 5IE9A 1QQCA 3P3PA 4PDVA 4TT3G 2UUAB 1JR9A 3X2QB 3E8BA 2DYRB 5LMNO 3CC2V 1WLEA 4X66B 4RUFA 5B1AB 1Z2GA 5ITZA 4JI2B 2HJDA 1NTKH 3APQA 1YI2V 4JI8O 2H8PC 1PNKA 3K5OA 4FLVA 4DV7O 4DR5B 1IBLO 4K0KO 4X64O 4JV5O 2EZOA 4NTXA 4NVPA 1NVPD 2YEVB 3E22A 1XNRO 3RBZA 5IJ9B 4LF7B 5KA5A 2VQEB 2DJVA 1VQPV 1H2LA 1L8DA 1RSOA 4WFEA 5KA6A 3L9DA 1VMGA 3QO8A 3T1CA 5JCOC 3ABLB 4JI3O 3O65A 1EN4A 3SR2C 1J5EO 2DQ0A 1VF7A 2W0FC 4I0XA 4X62O 3AG7A 4MVMA 4I9QA 1K34A 4DV5O 3CCRV 1X59A 5LHIA 2D3OW 4OGQB 3RW0A 2OIGA 4B3TB 2WSSG 2JIZG 2N74A 1W2BU 4I55A 1W0JG 1U96A 3JAWA 5DN6G 5H9CA 4LFBO 1G1XB 5K1XA 3W7UA 4NXMO 4XBFA 4LNUA 3CPWU 5KMGA 1H38A 1SC5B 1JPXA 4I5SA 2A06H 4JZ2A 4TQFA 2F93B 4MVQA 3TXQA 3T1YB 1UPGA 3N2GA 2ODMA 3JSNA 1B3QA 2Y48A 2E5LB 1JVMA 2B9ZA 3R66A 2ADPA 4AQYB 2YDEA 3A8TA 2Q7HA 1R6TA 1DK1A 3E86A 2D2CB 3E8HA 1N8RW 2ITDC 3D3IA 4U3FH 2QM8A 1M56B 2YICA 1Q8IA 2CE4A 4BAYA 1K5QA 3P30A 5LOVA 4LFCO 4W4KA 1XQ8A 5L3FA 2BOCC 3CCUV 3BA8A 3KG2A 3BPZA 5IYBO 4DV4B 1QHTA 2EIKC 1S3JA 4O4LB 1M1KW 3CMAV 3OTFA 2IJKA 4QGPA 3Q4HB 1V55C 2A79B 1QCEA 2X6AA 2PF4E 5A2QN 4DUZO 1ZTEA 4F6RA 5IYZB 2C2AA 1JOYA 2Q68A 3CRMA 2ZKOA 2AW9A 4H44B 2DQ3A 1S77D 4QJFB 3QTCA 1JCHA 2E76B 4CH5A 1SESA 4R8CA 5EIBC 2WPDG 3BVOA 4LFAO 1ROPA 1WA8A 4PHZA 3AG4B 4WBNB 4J11A 1P7BA 4O2BB 1ZLZA 1NR7A 5KAFZ 2LW1A 2QE7G 2QTOA 3H1HH 3CCQV 1F51A 2ZD9A 2ZQMA 1RFYA 2UXDB 4KUMA 1K4CC 1MZEA 1NBMG 3CS5A 1Y6XA 1IVSA 2WLHA 1IDSA 3RYIB 2MW2B 2W0XA 5LL6Y 1VQMV 4PA6A 3RYFA 5JWPA 3L73H 4GLXA 3F7YC 1Q3EA 4DR4B 1AJNA 5FPOA 4X65B 1ZSPA 3VQWA 2N04A 1HNWO 2Q8VA 2XASA 1QLEC 3BRCA 4MTXA 2CGNA 3U0ZA 2NN4A 5LP6C 2F43G 4DR2B 4JTDB 4ICGA 2AHZA 3B2EE 1HWYA 3K0DA 3ZEDA 4UFZA 4DV6O 1AR4A 3WG7B 3B8NA 1Y76B 3HR0A 1XDCA 4UCRA 4CH6A 1QR8A 3CXHF 4YY3O 4ZHQB 1SA0B 4DV1O 4BIZA 4K8ZA 3NR7A 4GX1A 4WCEV 4MT8A 1PNMA 4FK5C 4PI2A 2IJIA 5D5PA 2XAHA 1TGOA 5KHKA 2IJHA 4GYCB 4DR3O 3AG3C 4NXNB 4B3SB 5CB4A 1DLBA 3C3SA 5A9GA 5GONB 3JALB 3HKDA 3B09A 4LF6O 1NJIW 4KHPO 2ZE6A 2XAFA 1NU1H 3JAKB 3ZRSA 2F1MA 2OCCC 3CP1A 2DYSC 1K4DC 4JF3A 1FFXB 4HNAA 2O57A 4JYAO 4BIUA 2CGOA 3E8FA 1XHZA 2BE3A 4QIWF 3JATA 1K73W 3L72H 5C8YA 1FXVA 2YIAA 4CC6A 3DSQA 1OCRB 4MVRA 1CP9A 1KP3A 2FMLA 1IURA 2P5OA 1NH2B 5IJ0A 3L70H 5K1PA 2JS3A 2VWJA 2ZNIA 2P90A 2UUBB 2EINB 4D7SA 4WFHA 4X65O 2EULA 2ZR2A 1I5XA 3H1KH 1LNQA 2QWRB 1JJOA 4O2AA 3BHPA 4OPAA 1E1RG 2QWNB 3ML0A 4GKKO 3CYOA 2CH7A 4UVAA 4DV2O 2ZT9B 3TJTA 4DW1A 1KBHA 2Y69C 1S5HC 1P4RA 2UU9O 3A0RA 4J9ZB 4J9YB 1SRYA 4GCZA 4MTFA 4TV8B 3ZMSA 2XOKG 4DUYB 1DF5A 2PUSA 3ZBHA 2PYLA 4P30A 5KHGA 4LF5B 5J2UA 1R1BA 5IWAO 3L71H 2XAJA 4BWAA 1TUBB 3J81N 2F95B 2HJFC 4LF4B 3T2MA 1GTOA 4JYYA 1K8AW 3AG1C 2Z5UA 4FM2A 5EZYB 1N33B 4JI7B 4TV9B 2QM4A 2ZXWC 4LBEC 2QEXV 2KQXA 4FIPC 4LWSB 2EILB 5KLVH 3ZN1A 2P67A 1IBMB 3DC5A 2UXBO 3FX7A 1P7GA 1QNMA 1OHHG 5CA0A 2H94A 2VWKA 2Q0AA 3OTOO 3CEIA 2Q0OC 4DV0O 3JCUZ 1YCIA 4QE9A 4WF9V 3OT7A 1GM9A 2Y0IA 1BT8A 2QJ1A 2WLLA 2ZDIA 4FLYA 4YIOA 5FNVA 3MD0A 1Q6UA 5LGUA 4A5UB 3QF7A 5J9PC 2UXXA 1IBKB 2HEPA 1EN6A 4LF8O 3ZHTA 1XNQO 2N05A 1ZAUA 3STLC 1N36O 4UCOA 4K3AA 1GM8A 4MW8A 1KUQA 3G71V 4IYHA 3WB2A 2HHHO 3BABA 4GT1A 4XDJA 5L3DA 5CMUA 2IW5A 2LJ2A 1F23A 2YSUB 4FFBA 5JH7A 4R50A 5CA1B 3ICXA 3CMEV 3N27A 3SYCA 3JD4A 1UFIA 1JX9A 4DR6O 3OE7G 5EBLC 2UUCO 4CS3A 2JJ1G 4LF4O 2DMXA 3K08A 4YXWG 1BS3A 3FD9A 1AI6A 1NR1A 2WLIB 3SPHA 3FB8C 2EIMC 5JQGB 3GWKC 4DR1B 4UCSA 4O4JB 1VF6C 2Y4UA 2KSDA 4HYOA 1V55B 1HW7A 1GH6A 2HLDG 1VF5B 1R6KA 3S3XA 2BTOA 3P3NA 2QKAA 1FJGB 2F4VO 4FZ0A 1WP7A 3APOA 3W7SA 3G80A 2QKSA 1FXKA 4ZKIA 5B1NA 2GTAA 3P32A 2QWOB 4RAIA 3J80N 4X1YA 2Z0AA 1WB7A 3BCCH 4GX0A 3JAMN 1NVPB 3B77A 4FZ1A 3H9VA 1E1QG 4IL6Z 3ABKB 4U3JA 4B3MO 1XBLA 3K79A 3LSSA 3VBBA 2R70A 1BHBA 4F4LA 4ABMA 5HFLA 4UB6Z 3TCUA 4JTCB 1M93A 4MVOA 1PD3A 2QR4A 2G38A 3IC9A 4JTAB 2YXHA 2WLMA 4X88A 1L1FA 1VQNV 3RT3C 2CUGA 5KX5A 2QKCA 2QWQB 3HKEA 1WNSA 4WFGA 4ASUG 1PL0A 4DRXB 1QLEB 3HKCB 3LSQA 1MSDA 1PM9A 4DK0A 5LYJB 1MABG 5LP6B 2OYQA 1AR1B 5TISZ 1JA8A 4UVBA 5EC2C 3PN1A 3WB0A 1HR0B 5EIBD 1I94O 4X1KB 1M4UA 3DXRA 1YDXA 5E1AC 4Q6GA 3T4DA 4O4IB 2F23A 3UT5B 4JYCA 2LP7A 1HNZB 4IYIA 2GUZA 1H2MA 2FL4A 5LXTA 2AZ2A 2Q69A 4N23A 2V1DA 1VQLV 3OUFA 1ENVA 1FPOA 2RMKB 1I7FA 1UJWB 2B5UA 1N32B 4UV8A 5JJNB 1VIBA 5J2TA 3UO3A 1JJ2U 5LMUB 1VF6A 3RGBA 1XMQO 1KYOF 3UM7A 2IBZH 4ZHQA 4X1IB 4JI1O 4X9QA 5BMVB 1M57B 4PJ0Z 2X6CA 2OCCB 1MOFA 3ETQA 2DYSB 2AZ0A 4IHJA 3EXAA 1HNXO 3RFRA 1BMFG 1COWG 4I50A 3G4SV 5H6QA 4ZOLB 3WFVA 3K5NA 1FD9A 1JMKC 2Q7GA 4O4HB 3FKSG 3N2KB 3RYCA 1XMOB 2VQFB 4JASA 1OV9A 2RNBA 3HKBB 1HDJA 2UUAO 1Q90D 2Q6AA 5BR8B 5GW7A 1SQBH 4X66O 1SQGA 2ZIOA 4UUJC 4JI2O 3CC7V 3ZRWA 2WLKA 5EK0A 2K1EA 1EBOA 5EYPA 4DR5O 2Y69B 1HR0O 4Z1MG 3HB3B 2CTRA 4EB6B 2XTAA 1EZVH 4LF7O 2VQEO 1RPOA 3TETA 2ITCC 1L0NH 3R65A 1O9GA 4UCVA 1YXBA 4JGSA 4G27B 1VQ4V 4NB5A 2CK3G 1R3IC 1QLNA 3CHXA 2CAZC 1ZL8B 1H2SB 1SQQH 1WPBA 1M9NA 4W4LA 4RQFA 3K06A 1M90W 4TV8A 4UXNA 3ZS8C 1SQFA 4IT5A 4B3TO 2BSKB 2ZXWB 4LC1A 2JRIA 2IU3A 4X20A 2R9AA 3AEIA 3D36A 4BR6A 3BEHA 1FXHA 5IY5B 1T5EA 4LF9B 5LA6A 2CDYA 2V7QG 4TUYA 3T4ZA 4K35A 3T1YO 1D2DA 4EFBA 5IYCO 3K5MA 3LUTB 2X0LA 1AR5A 4KP4A 1I5YA 1BSMA 5CBGA 4KXRA 1NT2B 5LGTA 2E5LO 2LFRA 4WFFA 1PPJH 3U10A 5B1OA 1AJQA 4AQYO 1TAEA 2EJRA 2JVDA 5EBMC 1GK9A 1VP7A 3AK1A 3J7AU 5CN0A 1F4NA 1TVKA 5B66Z 4QNHB 5ITZB 2PYJA 1CXZB 3CJHA 2GHYA 4L87A 1OJHA 3CX5F 3BY6A 4ZI7B 3E22B 1Q43A 3OUSA 1B06A 4DV4O 1RSOB 3C90A 3EFFK 4R7CA 3VOUA 4FLXA 4PDMA 5B1AC 2A9HA 1H8HG 4MTGA 4RQEA 3G67A 4WFBV 4HAMA 5LGNA 5LHGA 3SYAA 4I0XB 2EJ7A 5H6RA 4J80A 3ZHSA 2BTQA 3HPLC 1YITV 2UXCB 2EIMB 3KCYA 3I55V 5CA1A 1MMMA 2LO1A 2JGDA 3OMNB 2OTLV 3D3QA 1JQ0A 5D5QA 5IDJA 4FLUA 3TXSA 4LF9O 1N34B 5B3SB 1R3JC 2BOBC 2ZDIC 4AI8A 2NLJC 3K0GA 3JAWB 2WLIA 5JJEB 3VQVA 4LNUB 3FAVA 2UXDO 2YS8A 3VQYA 5KMGB 3RYHA 5FLXN 4O4JA 2Y0PA 4B3RB 4LP8A 3ZMZA 2P06A 5BXZA 1YJWV 1W59A 2B1IA 5CBHA 2WLNA 1GN4A 3IJ4A 1H2KA 4F6EA 3QNEA 4DR4O 2RQ6A 2QGNA 1O9HA 1SQVH 3UKMA 3OGIB 2HP8A 4D7TA 5L3BA 4JYBA 1D5AA 3I5DA 3SPJA 1SQXH 1NKDA 3VQXA 3MDSA 1Y74A 3SGIA 4DR2O 3ZHQA 4ZIBA 2KB1A 2P6JA 5LOVB 2DWEC 4EEQA 3UCSC 2Q5ZA 1K97A 3JARB 4JI5B 2X7RB 1RPRA 2ZM6B 2DE0X 4JI6B 3JASA 2MK3A 1BQ0A 4FPPA 1R3KC 2AGAA 2XUMA 2YI8A 1JFFA 4YJ3A 2WLJA 1VQ9V 1U97A 4F6RB 4NXNO 4B3SO 4CH3A 3JCZA 1R73A 3H1IH 2KG7B 4BW5A 2GV9A 1Q6IA 1H2NA 1NZ6A 2V4DA 1KP2A 4P2ZA 3QVNA 1FXKC 1MZFA 4P9PA 2WA3A 1F4MA 3E89A 4FJCC 3ZHRA 1SKVA 1QBZA 4PDRA 1N34O 2RN9A 1KMIZ 1V54C 1THZA 2Y4TA 5LYJA 1NI8A 2E3CA 1WA8B 2HKOA 2XNDG 2YUAA 4EFEA 1LUWA 3U11A 4CS4A 3E8GA 2BCCH 3SJCC 1BGYH 1SETA 3CRCA 4AILC 1SERA 3F5TA 2YEVA 5KHJA 5IJ9A 3RWRD 4G28B 2WAMA 3FB7C 2XAGA 4JI4B 2HR3A 2YXLA 2UUBO 1BZKA 3SJBC 1XOUA 5DEDA 1XL6A 1WB8A 3ABMC 5E79Z 4IGGA 1PNLA 1Z5WA 2M7WA 3CRQA 1I0HA 5B1BC 5KUKA 1FKAO 3G6BA 4Z2WA 2CTQA 3ZMVA 4HZ3A 4DR7B 2WA4A 4JI5O 2KKWA 2ZM6O 1FS0G 3E83A 1Z5VA 4DUYO 1YVWA 5L3CA 4FM1A 3ZN0A 4LF5O 3CXCU 5IT9N 2QA4V 4CZZA 1SF9A 1NQTA 4OX9B 1OCOC 2PGGA 1AILA 4FLTA 4O4HA 4PV1B 3EHBB 1FAFA 2LQTA 2JJ2G 2JGUA 2Q7EA 4H33A 2LW7A 4JI0B 1GN6A 1FYJA 5CB4B 1N33O 4JI7O 1MSWD 4Z1VA 3HKDB 1AP6A 1DTOA 2EIKB 4PA4A 1Q7YW 3O9OA 4H0LB 1AB3A 1XREA 2P4VA 2EBOA 5LMNB 1YHQV 2LGWA 3JD3A 4HNAB 1IBMO 3CRAA 2UXNA 1GAXA 4JI8B 4ZBMA 3JATB 1V9PA 1K92A 4KFMA 1KU9A 4DV7B 4FLWA 1IBLB 4K0KB 4X64B 2GTSA 1XNRB 1Q81W 3FYEB 4MW3A 2CTPA 3KZIZ 3K57A 4TSFG 4O4LA 4FM0A 5IJ0B 2YIDA 3Q4HA 3H1LH 3OEHG 3RN4A 5IYZA 1IBKO 4JI3B 3OAAG 1NTZH 1J5EB 1YJNV 4UCTA 4X62B 3QO7A 1R6NA 5GTHZ 3H1JH 1OCRC 2PTMA 1VQ7V 2CH7B 2RJZA 4H13B 4DV5B 1P84F 1XL4A 1GMGA 4J7JA 2P7TC 4BW9A 3NXSA 1Y66A 4WBNA 5AG2A 2PI5A 4PI0A 4O2BA 5KAIZ 2EINC 3ASNC 3I56V 4OX9O 3TK1A 1AI5A 2R9RB 4B08A 4NXMB 5J2UB 1EZJA 1DF4A 2VRZA 2GBOA 1A32A 1N0JA 1XI1A 1ZUQA 3RYIA 4XDKA 5LBQA 1GM7A 2JEUA 1AI7A 4NTYA 4DR1O 3ETEA 4LH7A 1PP9H 3AK3A 3S3WA 2W6IG 5EC1C 4WFAV 4KL1A 1YTFD 2XAQA 5KHHA 5JVDB 3OFNG 4CC5A 1BL8A 1KQSU 1Q82W 2GDSA
chains in the Genus database with same CATH topology
1FJGO 4JI0O 4LF9O 1HNXO 5LL6Y 1IBMO 2UXCO 4B3MO 1N32O 5BY1A 4X65O 3F5TA 4A5UB 5LMUO 3R66A 2UXDO 5FLXN 4OPAA 1R6TA 1DK1A 4LF8O 1XNQO 5LMNO 1N36O 3T1YO 4GKKO 1D2DA 3SDLA 1HNWO 2UUBO 5BXZA 4DV2O 1KUQA 1YZBA 4YHHO 2HHHO 4JI8O 2E5LO 1NS1A 4LFCO 4DR4O 4DV7O 1IBLO 2UU9O 4K0KO 4X64O 4AQYO 1IBKO 1F7YA 4JV5O 2UUAO 3RT3C 1XNRO 4B3RO 4DV6O 4JI4O 4DV3O 3J7AU 2DJVA 4X66O 1FKAO 3T1HO 4JI2O 4YY3O 2FKXA 4DV1O 1R1BA 5IWAO 4DR2O 1XMOO 4DR6O 2VQFO 2UUCO 4DR5O 1HR0O 4JI3O 4LF4O 5A2QN 4JI5O 4DUZO 3O65A 4GKJO 1J5EO 2ZM6O 5BR8O 3J81N 4LF7O 2VQEO 4DR3O 2ZKOA 4X62O 4DUYO 1I94O 1XEQA 4OX9O 4DV4O 4LF5O 5IT9N 4DV5O 1X59A 1AILA 4DR7O 4LF6O 2AGAA 3M8AA 4KHPO 5H5NA 2N74A 1A32A 4LFAO 4NXNO 2DOSA 4B3SO 2LW7A 4DR1O 2F4VO 4JYAO 4LFBO 1G1XB 4JI6O 1FYJA 4NXMO 1N33O 4JI7O 2UXBO 4B3TO 3J80N 4OPHA 1XMQO 2Z0AA 1AB3A 1N34O 1HNZO 4JI1O 3OTOO 3JAMN 4DV0O 2JRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG O;  4JI0 O;  4LF9 O;  1HNX O;  5LL6 Y;  1IBM O;  2UXC O;  4B3M O;  1N32 O;  5BY1 A;  4X65 O;  3F5T A;  4A5U B;  5LMU O;  3R66 A;  2UXD O;  5FLX N;  4OPA A;  1R6T A;  1DK1 A;  4LF8 O;  1XNQ O;  5LMN O;  1N36 O;  3T1Y O;  4GKK O;  1D2D A;  3SDL A;  1HNW O;  2UUB O;  5BXZ A;  4DV2 O;  1KUQ A;  1YZB A;  4YHH O;  2HHH O;  4JI8 O;  2E5L O;  1NS1 A;  4LFC O;  4DR4 O;  4DV7 O;  1IBL O;  2UU9 O;  4K0K O;  4X64 O;  4AQY O;  1IBK O;  1F7Y A;  4JV5 O;  2UUA O;  3RT3 C;  1XNR O;  4B3R O;  4DV6 O;  4JI4 O;  4DV3 O;  3J7A U;  2DJV A;  4X66 O;  1FKA O;  3T1H O;  4JI2 O;  4YY3 O;  2FKX A;  4DV1 O;  1R1B A;  5IWA O;  4DR2 O;  1XMO O;  4DR6 O;  2VQF O;  2UUC O;  4DR5 O;  1HR0 O;  4JI3 O;  4LF4 O;  5A2Q N;  4JI5 O;  4DUZ O;  3O65 A;  4GKJ O;  1J5E O;  2ZM6 O;  5BR8 O;  3J81 N;  4LF7 O;  2VQE O;  4DR3 O;  2ZKO A;  4X62 O;  4DUY O;  1I94 O;  1XEQ A;  4OX9 O;  4DV4 O;  4LF5 O;  5IT9 N;  4DV5 O;  1X59 A;  1AIL A;  4DR7 O;  4LF6 O;  2AGA A;  3M8A A;  4KHP O;  5H5N A;  2N74 A;  1A32 A;  4LFA O;  4NXN O;  2DOS A;  4B3S O;  2LW7 A;  4DR1 O;  2F4V O;  4JYA O;  4LFB O;  1G1X B;  4JI6 O;  1FYJ A;  4NXM O;  1N33 O;  4JI7 O;  2UXB O;  4B3T O;  3J80 N;  4OPH A;  1XMQ O;  2Z0A A;  1AB3 A;  1N34 O;  1HNZ O;  4JI1 O;  3OTO O;  3JAM N;  4DV0 O;  2JRI A; 
#chains in the Genus database with same CATH topology
 1FJG O;  3RVZ A;  3IGA C;  4ZI7 A;  3D36 C;  2F66 C;  1SQP H;  4C7U A;  4JAA A;  2YIB A;  3AG3 B;  1XUQ A;  1BE3 H;  1I08 A;  4PDL A;  4LFC B;  1IZ3 A;  2ZE5 A;  3E2E A;  3DGE A;  3W7X A;  3SYP A;  5CA0 B;  1ZX3 A;  1Y76 A;  4YJ2 B;  1SA0 A;  3ZHU A;  1M5I A;  4LH6 A;  2WLL B;  3SJA C;  5FNV B;  2EIL C;  2M6Y A;  1NS1 A;  2Q67 A;  2A3Q A;  4DUZ B;  4J41 A;  3A0H Z;  4CBC A;  1S72 V;  3ZHV A;  2JEX A;  3PJS K;  4G2K A;  1HP8 A;  5GON A;  3JAL A;  3BAA A;  3T1H B;  4NTW A;  4FLZ A;  1OCZ C;  1B04 A;  3FYI B;  3JAK A;  4IIJ B;  4RWU A;  4FMT A;  1MA1 A;  4X8A A;  3K04 A;  4LFA B;  1FFX A;  2OT5 A;  1GN2 A;  4R6Z A;  1OCC C;  4FFB B;  5JH7 B;  4JAV A;  4PEL A;  1IXB A;  2ZCE A;  2IU0 A;  2CTW A;  4NYK A;  3K5L A;  3IC7 A;  3M8A A;  1KKC A;  5FPR A;  2DOS A;  4TWK A;  3K9S A;  1PV0 A;  1Y67 A;  3CCV V;  1PKX A;  5GTI Z;  3W7T A;  4OPH A;  2ADQ B;  1HNZ O;  4NR1 A;  4I4T B;  3CCJ V;  1HNW B;  2Q4P A;  2HG5 C;  3JD1 A;  1YF2 A;  4GX2 A;  3DC6 A;  4DK1 A;  2PI4 A;  4TOI A;  1RM1 C;  1N32 O;  5BY1 A;  3ABT A;  1CEZ A;  3JAR A;  1FXK B;  5LMU O;  2A0L A;  3K3W A;  2EIJ C;  3AG1 B;  4X1Y B;  2HFE C;  4DV6 B;  3M99 B;  1G4Y B;  2LGQ A;  3OR6 C;  3FB5 C;  4E4E A;  1V54 B;  4UB8 Z;  4YY3 B;  4GUN A;  4DV1 B;  1FFT B;  4U3J B;  4RUE A;  1K5S A;  2KG7 A;  3AG2 C;  1TUB A;  3ZMT A;  3UO2 A;  2HVJ C;  2IJJ A;  4DR3 B;  4QE7 A;  3C3T A;  3T1H O;  4J10 A;  1US6 A;  1S76 D;  1ORQ C;  4DV3 B;  5EZY A;  4TV9 A;  1XMO O;  1IXM A;  2VQF O;  5JCO A;  4DXW A;  3ZJZ A;  2XT9 A;  3ASO C;  2Q73 A;  3ABM B;  4LF6 B;  4LWS A;  4KHP B;  3ABK C;  3JD0 A;  5BR8 O;  2IM9 A;  3TGU H;  5KX5 B;  4PD4 F;  1MNG A;  3HKE B;  3DTU B;  5B1B B;  4B7K A;  1Q6H A;  4JYA B;  1K9M W;  3A0B Z;  3WB1 A;  1K33 A;  3OMI B;  3BFR A;  1VEW A;  3KKY A;  4J7K A;  4BIO A;  1AJP A;  2YI9 A;  2ZR3 A;  3CSX A;  4J7Z A;  2L35 A;  5KUM A;  3IAY A;  3DXR B;  3CCS V;  5CA3 A;  1G6U A;  2DW4 A;  1OCO B;  3X2Q C;  4E2L A;  2DYR C;  1GN3 A;  1GRJ A;  1S5J A;  2R72 A;  4GKK B;  1D5N A;  2GUZ B;  5LXT B;  1Q5O A;  3F5W C;  3GB7 C;  3K58 A;  4QPK A;  1SZX A;  2E74 B;  4DV2 B;  1VAR A;  1KEC A;  4K8X A;  1E79 G;  4L8J A;  2Z3Y A;  2DWD C;  3CD6 V;  4X89 A;  2UU9 B;  5J2T B;  2AHY A;  3JSL A;  2ZIN A;  2EX3 A;  3OGC C;  4MSW C;  2FB5 A;  3UQ8 A;  4IHJ B;  4I55 B;  2P4K A;  4YIP A;  2OCH A;  3ABL C;  5IWA B;  4XDL A;  4I50 B;  1WP8 A;  3OM3 B;  4YHH B;  3F7V C;  4LCU C;  4DV3 O;  1K7D A;  1OZ0 A;  5JQG A;  3W7W A;  4DO2 A;  3LNN A;  4PA9 A;  1Y4M A;  4OXS A;  1M57 C;  3CWB H;  1KB9 F;  3B4S A;  3ZIA G;  2FTK A;  2PY5 A;  3N2G B;  3RYC B;  5FL7 G;  1SZT A;  5DM6 V;  3ZRX A;  1X4T A;  1KKD A;  1B6Q A;  4GKJ B;  1WAZ A;  3RVY A;  1S5L Z;  3G6E V;  4UCU A;  3CRR A;  1H8E G;  2YIB D;  3ZRW B;  4PA7 A;  2UXB B;  4DYL A;  5EYP B;  3SPC A;  4CS2 A;  3ETD A;  1H2G A;  5H5N A;  2QSA A;  1YJ9 V;  4MS2 A;  3K9A A;  3OTO B;  2ZE7 A;  4DV0 B;  1P49 A;  2ATK C;  3ASN B;  4UV9 A;  2YXY A;  2P22 C;  5JJJ B;  4EKW A;  3IFX A;  3MHS C;  1NTM H;  1AI4 A;  1Q86 W;  4I9W A;  4HBN A;  5L3E A;  2OWO A;  4RO2 A;  2RDC A;  4JZG A;  3MHH C;  2LFS A;  3E35 A;  2IH3 C;  4LF8 B;  1XNQ B;  1N36 B;  2B1G A;  1M56 C;  1J95 A;  1GO3 F;  4J42 A;  2UXC O;  2RCV A;  5KHI A;  1VQK V;  2GSM B;  1K3E A;  2HHH B;  5DEC A;  1MG1 A;  4MVU A;  5HFM A;  1KC8 W;  3CC4 V;  1ZWI C;  4DRX A;  1VQ6 V;  1PL4 A;  1XHX A;  3JD2 A;  3HKC A;  3LSU A;  4CH4 A;  4JPR A;  5LP6 A;  4X20 B;  4YHH O;  4DR6 B;  2UUC B;  1LUV A;  2ETN A;  3CB2 A;  2VS0 A;  2OTJ V;  3CE2 A;  5LA6 B;  2NNU A;  5H2F Z;  2E75 B;  3EVK A;  4B3R O;  4Q20 A;  4LR3 A;  1TUE B;  4TUY B;  1NH2 D;  4U7O A;  4X1K A;  3ZMU A;  3OEE G;  5B5E Z;  3SPI A;  5JVD A;  4NKG B;  1N4C A;  3ZCC A;  2JK5 C;  2FKX A;  2JS5 A;  2HVK C;  4O4I A;  3UT5 A;  3FFQ A;  4GZR B;  4MVZ A;  1SS3 A;  2A7W A;  2FYU H;  3AG4 C;  4GKJ O;  3RYF B;  3LDC A;  3OR7 C;  5IY5 C;  5IYD O;  3ETG A;  5LHH A;  3K03 A;  3B8M A;  1QR9 A;  1TVK B;  4QPJ A;  2K9P A;  2F4V B;  3OW2 U;  3GWO A;  4YJ2 A;  2JDI G;  3CJH B;  4AHC A;  4X1I A;  1XIL A;  2WWW A;  1OCZ B;  5BMV A;  3SYQ A;  3SJQ C;  2H3O A;  3SPG A;  1EN5 A;  3A2F A;  2EZP A;  1AP5 A;  1OCC B;  1YEW A;  3KCX A;  5F2V O;  3WU2 Z;  4ZOL A;  4JI6 O;  4B3M B;  1W0K G;  1RP3 B;  3ZRV A;  1IX9 A;  2PZS A;  1GKF A;  1N0N A;  3JYC A;  3M7M X;  3N2K A;  3LDD A;  4IIJ A;  2W6J G;  5BZB A;  4H37 A;  4TQD A;  2BTQ B;  5EBW C;  3HKB A;  2QDO A;  4GX5 A;  4I7Z B;  5L3G A;  2DN9 A;  3WG7 C;  2JGD B;  1ARO P;  2OIE A;  3L75 H;  3CCL V;  2ZNJ A;  1BCC H;  1CPY A;  3SDL A;  1EM1 A;  1WPX A;  1YZB A;  1RM1 B;  3L74 H;  4EB6 A;  2L6L A;  1F7Y A;  1YSC A;  1VQ8 V;  3FAV B;  4JI4 O;  1EFR G;  2EIJ B;  1LR1 A;  3RYH B;  3THO A;  1QU7 A;  1R3L C;  5C8Y B;  2R9I A;  4JV5 B;  1I94 B;  2ILM A;  2NR5 A;  3LNM B;  3H01 A;  3K59 A;  1WN7 A;  3BA9 A;  4U7N A;  4I4T A;  4D6T H;  3D8C A;  1VQO V;  3ZX6 A;  2QWP B;  5B3S C;  1VQ5 V;  1YTF B;  1DGS A;  1ZL8 A;  3QO5 A;  1QVF U;  3AG2 B;  1AVM A;  2X6B A;  1XEQ A;  3CCM V;  1BHA A;  4O2A B;  4UVC A;  3AK2 A;  3CCE V;  1Y74 B;  4JAU A;  3SYO A;  2BSK A;  3STZ C;  3MAQ A;  2YC0 A;  1QVG U;  4DW0 A;  4DR7 O;  2Q9L A;  3ASO B;  1XMQ B;  4JI1 B;  1S0V A;  3LDE A;  5CBF A;  2QTS A;  3QG5 A;  3ABU A;  3OD4 A;  1KD1 W;  2ZIM A;  1HNX B;  1URF A;  4B7E A;  4P9O A;  3JAS B;  1TA8 A;  2XHB A;  4FVM A;  1YIJ V;  4LFB B;  2IH1 C;  4MVS A;  4N21 A;  1WJZ A;  1G8M A;  1JFF B;  3B40 A;  2QM7 A;  4YJ3 B;  4FFK A;  4MTO A;  1L0L H;  3FB6 C;  3OMA B;  4JI0 O;  2AXT Z;  2ZE8 A;  1BQZ A;  4PA3 A;  5C93 A;  3GVM A;  2ARH A;  5IE9 A;  1QQC A;  3P3P A;  4PDV A;  4TT3 G;  2UUA B;  1JR9 A;  3X2Q B;  3E8B A;  2DYR B;  5LMN O;  3CC2 V;  1WLE A;  4X66 B;  4RUF A;  5B1A B;  1Z2G A;  5ITZ A;  4JI2 B;  2HJD A;  1NTK H;  3APQ A;  1YI2 V;  4JI8 O;  2H8P C;  1PNK A;  3K5O A;  4FLV A;  4DV7 O;  4DR5 B;  1IBL O;  4K0K O;  4X64 O;  4JV5 O;  2EZO A;  4NTX A;  4NVP A;  1NVP D;  2YEV B;  3E22 A;  1XNR O;  3RBZ A;  5IJ9 B;  4LF7 B;  5KA5 A;  2VQE B;  2DJV A;  1VQP V;  1H2L A;  1L8D A;  1RSO A;  4WFE A;  5KA6 A;  3L9D A;  1VMG A;  3QO8 A;  3T1C A;  5JCO C;  3ABL B;  4JI3 O;  3O65 A;  1EN4 A;  3SR2 C;  1J5E O;  2DQ0 A;  1VF7 A;  2W0F C;  4I0X A;  4X62 O;  3AG7 A;  4MVM A;  4I9Q A;  1K34 A;  4DV5 O;  3CCR V;  1X59 A;  5LHI A;  2D3O W;  4OGQ B;  3RW0 A;  2OIG A;  4B3T B;  2WSS G;  2JIZ G;  2N74 A;  1W2B U;  4I55 A;  1W0J G;  1U96 A;  3JAW A;  5DN6 G;  5H9C A;  4LFB O;  1G1X B;  5K1X A;  3W7U A;  4NXM O;  4XBF A;  4LNU A;  3CPW U;  5KMG A;  1H38 A;  1SC5 B;  1JPX A;  4I5S A;  2A06 H;  4JZ2 A;  4TQF A;  2F93 B;  4MVQ A;  3TXQ A;  3T1Y B;  1UPG A;  3N2G A;  2ODM A;  3JSN A;  1B3Q A;  2Y48 A;  2E5L B;  1JVM A;  2B9Z A;  3R66 A;  2ADP A;  4AQY B;  2YDE A;  3A8T A;  2Q7H A;  1R6T A;  1DK1 A;  3E86 A;  2D2C B;  3E8H A;  1N8R W;  2ITD C;  3D3I A;  4U3F H;  2QM8 A;  1M56 B;  2YIC A;  1Q8I A;  2CE4 A;  4BAY A;  1K5Q A;  3P30 A;  5LOV A;  4LFC O;  4W4K A;  1XQ8 A;  5L3F A;  2BOC C;  3CCU V;  3BA8 A;  3KG2 A;  3BPZ A;  5IYB O;  4DV4 B;  1QHT A;  2EIK C;  1S3J A;  4O4L B;  1M1K W;  3CMA V;  3OTF A;  2IJK A;  4QGP A;  3Q4H B;  1V55 C;  2A79 B;  1QCE A;  2X6A A;  2PF4 E;  5A2Q N;  4DUZ O;  1ZTE A;  4F6R A;  5IYZ B;  2C2A A;  1JOY A;  2Q68 A;  3CRM A;  2ZKO A;  2AW9 A;  4H44 B;  2DQ3 A;  1S77 D;  4QJF B;  3QTC A;  1JCH A;  2E76 B;  4CH5 A;  1SES A;  4R8C A;  5EIB C;  2WPD G;  3BVO A;  4LFA O;  1ROP A;  1WA8 A;  4PHZ A;  3AG4 B;  4WBN B;  4J11 A;  1P7B A;  4O2B B;  1ZLZ A;  1NR7 A;  5KAF Z;  2LW1 A;  2QE7 G;  2QTO A;  3H1H H;  3CCQ V;  1F51 A;  2ZD9 A;  2ZQM A;  1RFY A;  2UXD B;  4KUM A;  1K4C C;  1MZE A;  1NBM G;  3CS5 A;  1Y6X A;  1IVS A;  2WLH A;  1IDS A;  3RYI B;  2MW2 B;  2W0X A;  5LL6 Y;  1VQM V;  4PA6 A;  3RYF A;  5JWP A;  3L73 H;  4GLX A;  3F7Y C;  1Q3E A;  4DR4 B;  1AJN A;  5FPO A;  4X65 B;  1ZSP A;  3VQW A;  2N04 A;  1HNW O;  2Q8V A;  2XAS A;  1QLE C;  3BRC A;  4MTX A;  2CGN A;  3U0Z A;  2NN4 A;  5LP6 C;  2F43 G;  4DR2 B;  4JTD B;  4ICG A;  2AHZ A;  3B2E E;  1HWY A;  3K0D A;  3ZED A;  4UFZ A;  4DV6 O;  1AR4 A;  3WG7 B;  3B8N A;  1Y76 B;  3HR0 A;  1XDC A;  4UCR A;  4CH6 A;  1QR8 A;  3CXH F;  4YY3 O;  4ZHQ B;  1SA0 B;  4DV1 O;  4BIZ A;  4K8Z A;  3NR7 A;  4GX1 A;  4WCE V;  4MT8 A;  1PNM A;  4FK5 C;  4PI2 A;  2IJI A;  5D5P A;  2XAH A;  1TGO A;  5KHK A;  2IJH A;  4GYC B;  4DR3 O;  3AG3 C;  4NXN B;  4B3S B;  5CB4 A;  1DLB A;  3C3S A;  5A9G A;  5GON B;  3JAL B;  3HKD A;  3B09 A;  4LF6 O;  1NJI W;  4KHP O;  2ZE6 A;  2XAF A;  1NU1 H;  3JAK B;  3ZRS A;  2F1M A;  2OCC C;  3CP1 A;  2DYS C;  1K4D C;  4JF3 A;  1FFX B;  4HNA A;  2O57 A;  4JYA O;  4BIU A;  2CGO A;  3E8F A;  1XHZ A;  2BE3 A;  4QIW F;  3JAT A;  1K73 W;  3L72 H;  5C8Y A;  1FXV A;  2YIA A;  4CC6 A;  3DSQ A;  1OCR B;  4MVR A;  1CP9 A;  1KP3 A;  2FML A;  1IUR A;  2P5O A;  1NH2 B;  5IJ0 A;  3L70 H;  5K1P A;  2JS3 A;  2VWJ A;  2ZNI A;  2P90 A;  2UUB B;  2EIN B;  4D7S A;  4WFH A;  4X65 O;  2EUL A;  2ZR2 A;  1I5X A;  3H1K H;  1LNQ A;  2QWR B;  1JJO A;  4O2A A;  3BHP A;  4OPA A;  1E1R G;  2QWN B;  3ML0 A;  4GKK O;  3CYO A;  2CH7 A;  4UVA A;  4DV2 O;  2ZT9 B;  3TJT A;  4DW1 A;  1KBH A;  2Y69 C;  1S5H C;  1P4R A;  2UU9 O;  3A0R A;  4J9Z B;  4J9Y B;  1SRY A;  4GCZ A;  4MTF A;  4TV8 B;  3ZMS A;  2XOK G;  4DUY B;  1DF5 A;  2PUS A;  3ZBH A;  2PYL A;  4P30 A;  5KHG A;  4LF5 B;  5J2U A;  1R1B A;  5IWA O;  3L71 H;  2XAJ A;  4BWA A;  1TUB B;  3J81 N;  2F95 B;  2HJF C;  4LF4 B;  3T2M A;  1GTO A;  4JYY A;  1K8A W;  3AG1 C;  2Z5U A;  4FM2 A;  5EZY B;  1N33 B;  4JI7 B;  4TV9 B;  2QM4 A;  2ZXW C;  4LBE C;  2QEX V;  2KQX A;  4FIP C;  4LWS B;  2EIL B;  5KLV H;  3ZN1 A;  2P67 A;  1IBM B;  3DC5 A;  2UXB O;  3FX7 A;  1P7G A;  1QNM A;  1OHH G;  5CA0 A;  2H94 A;  2VWK A;  2Q0A A;  3OTO O;  3CEI A;  2Q0O C;  4DV0 O;  3JCU Z;  1YCI A;  4QE9 A;  4WF9 V;  3OT7 A;  1GM9 A;  2Y0I A;  1BT8 A;  2QJ1 A;  2WLL A;  2ZDI A;  4FLY A;  4YIO A;  5FNV A;  3MD0 A;  1Q6U A;  5LGU A;  4A5U B;  3QF7 A;  5J9P C;  2UXX A;  1IBK B;  2HEP A;  1EN6 A;  4LF8 O;  3ZHT A;  1XNQ O;  2N05 A;  1ZAU A;  3STL C;  1N36 O;  4UCO A;  4K3A A;  1GM8 A;  4MW8 A;  1KUQ A;  3G71 V;  4IYH A;  3WB2 A;  2HHH O;  3BAB A;  4GT1 A;  4XDJ A;  5L3D A;  5CMU A;  2IW5 A;  2LJ2 A;  1F23 A;  2YSU B;  4FFB A;  5JH7 A;  4R50 A;  5CA1 B;  3ICX A;  3CME V;  3N27 A;  3SYC A;  3JD4 A;  1UFI A;  1JX9 A;  4DR6 O;  3OE7 G;  5EBL C;  2UUC O;  4CS3 A;  2JJ1 G;  4LF4 O;  2DMX A;  3K08 A;  4YXW G;  1BS3 A;  3FD9 A;  1AI6 A;  1NR1 A;  2WLI B;  3SPH A;  3FB8 C;  2EIM C;  5JQG B;  3GWK C;  4DR1 B;  4UCS A;  4O4J B;  1VF6 C;  2Y4U A;  2KSD A;  4HYO A;  1V55 B;  1HW7 A;  1GH6 A;  2HLD G;  1VF5 B;  1R6K A;  3S3X A;  2BTO A;  3P3N A;  2QKA A;  1FJG B;  2F4V O;  4FZ0 A;  1WP7 A;  3APO A;  3W7S A;  3G80 A;  2QKS A;  1FXK A;  4ZKI A;  5B1N A;  2GTA A;  3P32 A;  2QWO B;  4RAI A;  3J80 N;  4X1Y A;  2Z0A A;  1WB7 A;  3BCC H;  4GX0 A;  3JAM N;  1NVP B;  3B77 A;  4FZ1 A;  3H9V A;  1E1Q G;  4IL6 Z;  3ABK B;  4U3J A;  4B3M O;  1XBL A;  3K79 A;  3LSS A;  3VBB A;  2R70 A;  1BHB A;  4F4L A;  4ABM A;  5HFL A;  4UB6 Z;  3TCU A;  4JTC B;  1M93 A;  4MVO A;  1PD3 A;  2QR4 A;  2G38 A;  3IC9 A;  4JTA B;  2YXH A;  2WLM A;  4X88 A;  1L1F A;  1VQN V;  3RT3 C;  2CUG A;  5KX5 A;  2QKC A;  2QWQ B;  3HKE A;  1WNS A;  4WFG A;  4ASU G;  1PL0 A;  4DRX B;  1QLE B;  3HKC B;  3LSQ A;  1MSD A;  1PM9 A;  4DK0 A;  5LYJ B;  1MAB G;  5LP6 B;  2OYQ A;  1AR1 B;  5TIS Z;  1JA8 A;  4UVB A;  5EC2 C;  3PN1 A;  3WB0 A;  1HR0 B;  5EIB D;  1I94 O;  4X1K B;  1M4U A;  3DXR A;  1YDX A;  5E1A C;  4Q6G A;  3T4D A;  4O4I B;  2F23 A;  3UT5 B;  4JYC A;  2LP7 A;  1HNZ B;  4IYI A;  2GUZ A;  1H2M A;  2FL4 A;  5LXT A;  2AZ2 A;  2Q69 A;  4N23 A;  2V1D A;  1VQL V;  3OUF A;  1ENV A;  1FPO A;  2RMK B;  1I7F A;  1UJW B;  2B5U A;  1N32 B;  4UV8 A;  5JJN B;  1VIB A;  5J2T A;  3UO3 A;  1JJ2 U;  5LMU B;  1VF6 A;  3RGB A;  1XMQ O;  1KYO F;  3UM7 A;  2IBZ H;  4ZHQ A;  4X1I B;  4JI1 O;  4X9Q A;  5BMV B;  1M57 B;  4PJ0 Z;  2X6C A;  2OCC B;  1MOF A;  3ETQ A;  2DYS B;  2AZ0 A;  4IHJ A;  3EXA A;  1HNX O;  3RFR A;  1BMF G;  1COW G;  4I50 A;  3G4S V;  5H6Q A;  4ZOL B;  3WFV A;  3K5N A;  1FD9 A;  1JMK C;  2Q7G A;  4O4H B;  3FKS G;  3N2K B;  3RYC A;  1XMO B;  2VQF B;  4JAS A;  1OV9 A;  2RNB A;  3HKB B;  1HDJ A;  2UUA O;  1Q90 D;  2Q6A A;  5BR8 B;  5GW7 A;  1SQB H;  4X66 O;  1SQG A;  2ZIO A;  4UUJ C;  4JI2 O;  3CC7 V;  3ZRW A;  2WLK A;  5EK0 A;  2K1E A;  1EBO A;  5EYP A;  4DR5 O;  2Y69 B;  1HR0 O;  4Z1M G;  3HB3 B;  2CTR A;  4EB6 B;  2XTA A;  1EZV H;  4LF7 O;  2VQE O;  1RPO A;  3TET A;  2ITC C;  1L0N H;  3R65 A;  1O9G A;  4UCV A;  1YXB A;  4JGS A;  4G27 B;  1VQ4 V;  4NB5 A;  2CK3 G;  1R3I C;  1QLN A;  3CHX A;  2CAZ C;  1ZL8 B;  1H2S B;  1SQQ H;  1WPB A;  1M9N A;  4W4L A;  4RQF A;  3K06 A;  1M90 W;  4TV8 A;  4UXN A;  3ZS8 C;  1SQF A;  4IT5 A;  4B3T O;  2BSK B;  2ZXW B;  4LC1 A;  2JRI A;  2IU3 A;  4X20 A;  2R9A A;  3AEI A;  3D36 A;  4BR6 A;  3BEH A;  1FXH A;  5IY5 B;  1T5E A;  4LF9 B;  5LA6 A;  2CDY A;  2V7Q G;  4TUY A;  3T4Z A;  4K35 A;  3T1Y O;  1D2D A;  4EFB A;  5IYC O;  3K5M A;  3LUT B;  2X0L A;  1AR5 A;  4KP4 A;  1I5Y A;  1BSM A;  5CBG A;  4KXR A;  1NT2 B;  5LGT A;  2E5L O;  2LFR A;  4WFF A;  1PPJ H;  3U10 A;  5B1O A;  1AJQ A;  4AQY O;  1TAE A;  2EJR A;  2JVD A;  5EBM C;  1GK9 A;  1VP7 A;  3AK1 A;  3J7A U;  5CN0 A;  1F4N A;  1TVK A;  5B66 Z;  4QNH B;  5ITZ B;  2PYJ A;  1CXZ B;  3CJH A;  2GHY A;  4L87 A;  1OJH A;  3CX5 F;  3BY6 A;  4ZI7 B;  3E22 B;  1Q43 A;  3OUS A;  1B06 A;  4DV4 O;  1RSO B;  3C90 A;  3EFF K;  4R7C A;  3VOU A;  4FLX A;  4PDM A;  5B1A C;  2A9H A;  1H8H G;  4MTG A;  4RQE A;  3G67 A;  4WFB V;  4HAM A;  5LGN A;  5LHG A;  3SYA A;  4I0X B;  2EJ7 A;  5H6R A;  4J80 A;  3ZHS A;  2BTQ A;  3HPL C;  1YIT V;  2UXC B;  2EIM B;  3KCY A;  3I55 V;  5CA1 A;  1MMM A;  2LO1 A;  2JGD A;  3OMN B;  2OTL V;  3D3Q A;  1JQ0 A;  5D5Q A;  5IDJ A;  4FLU A;  3TXS A;  4LF9 O;  1N34 B;  5B3S B;  1R3J C;  2BOB C;  2ZDI C;  4AI8 A;  2NLJ C;  3K0G A;  3JAW B;  2WLI A;  5JJE B;  3VQV A;  4LNU B;  3FAV A;  2UXD O;  2YS8 A;  3VQY A;  5KMG B;  3RYH A;  5FLX N;  4O4J A;  2Y0P A;  4B3R B;  4LP8 A;  3ZMZ A;  2P06 A;  5BXZ A;  1YJW V;  1W59 A;  2B1I A;  5CBH A;  2WLN A;  1GN4 A;  3IJ4 A;  1H2K A;  4F6E A;  3QNE A;  4DR4 O;  2RQ6 A;  2QGN A;  1O9H A;  1SQV H;  3UKM A;  3OGI B;  2HP8 A;  4D7T A;  5L3B A;  4JYB A;  1D5A A;  3I5D A;  3SPJ A;  1SQX H;  1NKD A;  3VQX A;  3MDS A;  1Y74 A;  3SGI A;  4DR2 O;  3ZHQ A;  4ZIB A;  2KB1 A;  2P6J A;  5LOV B;  2DWE C;  4EEQ A;  3UCS C;  2Q5Z A;  1K97 A;  3JAR B;  4JI5 B;  2X7R B;  1RPR A;  2ZM6 B;  2DE0 X;  4JI6 B;  3JAS A;  2MK3 A;  1BQ0 A;  4FPP A;  1R3K C;  2AGA A;  2XUM A;  2YI8 A;  1JFF A;  4YJ3 A;  2WLJ A;  1VQ9 V;  1U97 A;  4F6R B;  4NXN O;  4B3S O;  4CH3 A;  3JCZ A;  1R73 A;  3H1I H;  2KG7 B;  4BW5 A;  2GV9 A;  1Q6I A;  1H2N A;  1NZ6 A;  2V4D A;  1KP2 A;  4P2Z A;  3QVN A;  1FXK C;  1MZF A;  4P9P A;  2WA3 A;  1F4M A;  3E89 A;  4FJC C;  3ZHR A;  1SKV A;  1QBZ A;  4PDR A;  1N34 O;  2RN9 A;  1KMI Z;  1V54 C;  1THZ A;  2Y4T A;  5LYJ A;  1NI8 A;  2E3C A;  1WA8 B;  2HKO A;  2XND G;  2YUA A;  4EFE A;  1LUW A;  3U11 A;  4CS4 A;  3E8G A;  2BCC H;  3SJC C;  1BGY H;  1SET A;  3CRC A;  4AIL C;  1SER A;  3F5T A;  2YEV A;  5KHJ A;  5IJ9 A;  3RWR D;  4G28 B;  2WAM A;  3FB7 C;  2XAG A;  4JI4 B;  2HR3 A;  2YXL A;  2UUB O;  1BZK A;  3SJB C;  1XOU A;  5DED A;  1XL6 A;  1WB8 A;  3ABM C;  5E79 Z;  4IGG A;  1PNL A;  1Z5W A;  2M7W A;  3CRQ A;  1I0H A;  5B1B C;  5KUK A;  1FKA O;  3G6B A;  4Z2W A;  2CTQ A;  3ZMV A;  4HZ3 A;  4DR7 B;  2WA4 A;  4JI5 O;  2KKW A;  2ZM6 O;  1FS0 G;  3E83 A;  1Z5V A;  4DUY O;  1YVW A;  5L3C A;  4FM1 A;  3ZN0 A;  4LF5 O;  3CXC U;  5IT9 N;  2QA4 V;  4CZZ A;  1SF9 A;  1NQT A;  4OX9 B;  1OCO C;  2PGG A;  1AIL A;  4FLT A;  4O4H A;  4PV1 B;  3EHB B;  1FAF A;  2LQT A;  2JJ2 G;  2JGU A;  2Q7E A;  4H33 A;  2LW7 A;  4JI0 B;  1GN6 A;  1FYJ A;  5CB4 B;  1N33 O;  4JI7 O;  1MSW D;  4Z1V A;  3HKD B;  1AP6 A;  1DTO A;  2EIK B;  4PA4 A;  1Q7Y W;  3O9O A;  4H0L B;  1AB3 A;  1XRE A;  2P4V A;  2EBO A;  5LMN B;  1YHQ V;  2LGW A;  3JD3 A;  4HNA B;  1IBM O;  3CRA A;  2UXN A;  1GAX A;  4JI8 B;  4ZBM A;  3JAT B;  1V9P A;  1K92 A;  4KFM A;  1KU9 A;  4DV7 B;  4FLW A;  1IBL B;  4K0K B;  4X64 B;  2GTS A;  1XNR B;  1Q81 W;  3FYE B;  4MW3 A;  2CTP A;  3KZI Z;  3K57 A;  4TSF G;  4O4L A;  4FM0 A;  5IJ0 B;  2YID A;  3Q4H A;  3H1L H;  3OEH G;  3RN4 A;  5IYZ A;  1IBK O;  4JI3 B;  3OAA G;  1NTZ H;  1J5E B;  1YJN V;  4UCT A;  4X62 B;  3QO7 A;  1R6N A;  5GTH Z;  3H1J H;  1OCR C;  2PTM A;  1VQ7 V;  2CH7 B;  2RJZ A;  4H13 B;  4DV5 B;  1P84 F;  1XL4 A;  1GMG A;  4J7J A;  2P7T C;  4BW9 A;  3NXS A;  1Y66 A;  4WBN A;  5AG2 A;  2PI5 A;  4PI0 A;  4O2B A;  5KAI Z;  2EIN C;  3ASN C;  3I56 V;  4OX9 O;  3TK1 A;  1AI5 A;  2R9R B;  4B08 A;  4NXM B;  5J2U B;  1EZJ A;  1DF4 A;  2VRZ A;  2GBO A;  1A32 A;  1N0J A;  1XI1 A;  1ZUQ A;  3RYI A;  4XDK A;  5LBQ A;  1GM7 A;  2JEU A;  1AI7 A;  4NTY A;  4DR1 O;  3ETE A;  4LH7 A;  1PP9 H;  3AK3 A;  3S3W A;  2W6I G;  5EC1 C;  4WFA V;  4KL1 A;  1YTF D;  2XAQ A;  5KHH A;  5JVD B;  3OFN G;  4CC5 A;  1BL8 A;  1KQS U;  1Q82 W;  2GDS A; 
#chains in the Genus database with same CATH homology
 1FJG O;  4JI0 O;  4LF9 O;  1HNX O;  5LL6 Y;  1IBM O;  2UXC O;  4B3M O;  1N32 O;  5BY1 A;  4X65 O;  3F5T A;  4A5U B;  5LMU O;  3R66 A;  2UXD O;  5FLX N;  4OPA A;  1R6T A;  1DK1 A;  4LF8 O;  1XNQ O;  5LMN O;  1N36 O;  3T1Y O;  4GKK O;  1D2D A;  3SDL A;  1HNW O;  2UUB O;  5BXZ A;  4DV2 O;  1KUQ A;  1YZB A;  4YHH O;  2HHH O;  4JI8 O;  2E5L O;  1NS1 A;  4LFC O;  4DR4 O;  4DV7 O;  1IBL O;  2UU9 O;  4K0K O;  4X64 O;  4AQY O;  1IBK O;  1F7Y A;  4JV5 O;  2UUA O;  3RT3 C;  1XNR O;  4B3R O;  4DV6 O;  4JI4 O;  4DV3 O;  3J7A U;  2DJV A;  4X66 O;  1FKA O;  3T1H O;  4JI2 O;  4YY3 O;  2FKX A;  4DV1 O;  1R1B A;  5IWA O;  4DR2 O;  1XMO O;  4DR6 O;  2VQF O;  2UUC O;  4DR5 O;  1HR0 O;  4JI3 O;  4LF4 O;  5A2Q N;  4JI5 O;  4DUZ O;  3O65 A;  4GKJ O;  1J5E O;  2ZM6 O;  5BR8 O;  3J81 N;  4LF7 O;  2VQE O;  4DR3 O;  2ZKO A;  4X62 O;  4DUY O;  1I94 O;  1XEQ A;  4OX9 O;  4DV4 O;  4LF5 O;  5IT9 N;  4DV5 O;  1X59 A;  1AIL A;  4DR7 O;  4LF6 O;  2AGA A;  3M8A A;  4KHP O;  5H5N A;  2N74 A;  1A32 A;  4LFA O;  4NXN O;  2DOS A;  4B3S O;  2LW7 A;  4DR1 O;  2F4V O;  4JYA O;  4LFB O;  1G1X B;  4JI6 O;  1FYJ A;  4NXM O;  1N33 O;  4JI7 O;  2UXB O;  4B3T O;  3J80 N;  4OPH A;  1XMQ O;  2Z0A A;  1AB3 A;  1N34 O;  1HNZ O;  4JI1 O;  3OTO O;  3JAM N;  4DV0 O;  2JRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...