3CC7V

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cc7V00
3CCJV 1Q82W 1VQ4V 1YIJV 3G71V 2OTLV 2OTJV 1YJNV 2QEXV 1R73A 3CCUV 1S72V 1QVGU 3I55V 3G6EV 1YJ9V 3CMEV 1W2BU 3CPWU 1Q86W 1VQOV 4WFAV 1VQLV 1YI2V 1KQSU 1QVFU 4WF9V 1M1KW 1VQ6V 1VQMV 3CCMV 1K8AW 1VQ5V 3CCRV 3G4SV 3CXCU 1N8RW 1K9MW 3I56V 1YHQV 1JJ2U 3CC2V 3CD6V 1VQNV 4WCEV 1Q7YW 3CCVV 1YITV 3CMAV 1KD1W 1KC8W 1VQ8V 1VQ9V 1VQKV 3CC7V 3CCEV 1VQPV 3CCSV 5DM6V 1Q81W 2QA4V 2D3OW 1K73W 3CC4V 1YJWV 1M90W 3CCQV 3OW2U 1VQ7V 4WFBV 1NJIW 3CCLV
chains in the Genus database with same CATH superfamily
2QM7A 2IM9A 2Z0AA 4XDJA 2F93B 2ZQMA 2ODMA 4B3MO 1HNZB 1DF5A 1VF5B 4K8XA 4NXNB 3CC7V 4TUYA 1GRJA 4IIJB 3DGEA 2QTSA 4MTXA 3CJHB 3E86A 1AJQA 4FLXA 2UU9B 3CCJV 2EX3A 5B1OA 4HBNA 2E76B 3UT5A 3W7WA 5BMVA 5TISZ 2PUSA 1BE3H 3IC9A 5LA6A 4PA3A 2HEPA 2OIGA 1NJIW 4BAYA 1Q6HA 5EIBC 4G27B 2P90A 2E3CA 2WLLA 2LFRA 3AG3B 2ZM6O 5JQGA 3KCYA 1AI5A 3D3IA 3H1JH 4JI0O 3TXSA 5H2FZ 1JOYA 1EN5A 1H8HG 1MMMA 3EVKA 3VQWA 2QM8A 4DV5O 3BRCA 3ZMZA 3CEIA 4H37A 2AXTZ 3ASOB 4YY3B 4X9QA 3CWBH 3KG2A 4LNUA 1O9HA 1GAXA 2ZE8A 4RUFA 1H2NA 5GONA 2H3OA 3OUFA 1K73W 4RQEA 4X1YB 1RSOB 3AG3C 3GVMA 1WPXA 3C3SA 4MVRA 5IJ0B 3AG1C 1V55C 1S76D 3O65A 2YIAA 2VWJA 2CTPA 4DV0B 4I0XA 2EINB 1PP9H 4FVMA 3FAVB 4QPKA 1YZBA 4DUZO 4J42A 4EFEA 3CSXA 3HKBA 1JPXA 1LR1A 2OTLV 4OX9O 5ITZA 3U10A 1IZ3A 1YDXA 1IX9A 4MTOA 2IH3C 4PELA 4ZIBA 3JAMN 1SESA 4JTCB 1VQMV 4GZRB 4H33A 5BXZA 3JD1A 5IYZB 2Q4PA 1S3JA 2CGNA 1SQVH 4LF4B 4KUMA 1QU7A 2GV9A 2JGUA 5LGNA 3JD2A 2UUAB 1XNRO 1R3JC 3OMNB 3E22B 4IYIA 3K04A 1BHBA 2EINC 3SJBC 3RFRA 1MNGA 4LF9B 2QM4A 1I94B 2DOSA 1Y76A 4DW0A 3LNNA 1YTFD 2GTSA 1PNLA 5FPRA 4DV4O 5KHHA 1EZJA 3Q4HB 1S5LZ 2QDOA 2UXBO 2QSAA 3T1HO 2HVJC 2KKWA 4LWSB 1NR7A 4MVZA 2YIDA 1PL4A 4DR3O 4BW5A 2F66C 2F95B 4IHJA 4WFAV 5GTIZ 1P7BA 4Z1MG 1N4CA 2LQTA 4GT1A 1QR8A 5LYJA 1W0JG 2JK5C 2OWOA 1W0KG 1K4DC 3CE2A 3QO5A 4K8ZA 5IDJA 3ASNB 3B09A 3F7YC 3ZIAG 2OT5A 2WLNA 2EULA 4B3MB 2UXCO 4I4TB 3LDCA 2R72A 5J2UB 4GX0A 2LGWA 1WPBA 1YF2A 1THZA 1GO3F 4UCTA 3JASB 4YXWG 5L3DA 3FYEB 4MTGA 4DXWA 4HNAA 1BS3A 2ZDIA 1VF6A 2ZNJA 2FKXA 3G71V 1B04A 2W0FC 4JYBA 5CB4B 5EC2C 3UKMA 4BWAA 5KAFZ 3ZX6A 2LGQA 2YXYA 1KECA 3A2FA 1H2LA 3ASNC 5LP6A 3BCCH 3CCSV 3HR0A 1QCEA 2GUZA 5J9PC 4H13B 3H01A 5C93A 2ZM6B 2AW9A 5IJ9A 2Y69C 3P30A 4JI0B 1XQ8A 1WP8A 3RVYA 1GN2A 4DV5B 1FD9A 4F6RB 2DYSB 5LGTA 4C7UA 2FB5A 2ITDC 3H1HH 5LBQA 4B3SO 2F43G 2WLKA 1SQBH 1H2MA 4P2ZA 1L0NH 4UVBA 3JARB 1Z5VA 3AG7A 3SYCA 5H6QA 4CS4A 5EYPA 5B5EZ 4J9YB 3CRAA 3CB2A 4DRXA 5EZYB 1AROP 4IGGA 4JI7O 2BOBC 1BT8A 4CH4A 3JAWA 3CRRA 2QWNB 5KA6A 2IH1C 4J7KA 2GTAA 4EKWA 3IAYA 4HZ3A 2JVDA 2ZXWB 1QBZA 2DYSC 3AK2A 4DUZB 5CBGA 2ZR2A 4MVUA 4LP8A 5B3SC 3P3NA 2IBZH 2DYRB 2MK3A 2UXDO 4YJ2B 1GN4A 5H9CA 4OX9B 3OR7C 4WBNA 2QWQB 2N04A 2CGOA 5IYBO 1L1FA 1VIBA 3K79A 3T1YO 4CH3A 4ZI7A 1YHQV 2EIJB 3N2KB 1OCRB 1NBMG 2K9PA 3ZMTA 1WA8A 3BA9A 2EIKB 2UXNA 2XHBA 1XNRB 4MVQA 1XMOO 3O9OA 4MVSA 1ZLZA 1M90W 1R3KC 1R6TA 2YUAA 1SA0A 4UUJC 2IJIA 3OMAB 4B7EA 4TUYB 1D5AA 3JCZA 1JX9A 5JCOC 4WFGA 2CTQA 4DV4B 4FM2A 2HJFC 2XNDG 2X6AA 2UXBB 2A79B 2Q0AA 3T1HB 2PY5A 5C8YB 4U3JA 3UT5B 1NZ6A 1HNXO 2CTRA 4DR3B 1BSMA 4O2BA 4EEQA 1K5SA 3OR6C 1W2BU 1OCRC 2PGGA 1AJPA 2EIKC 3IJ4A 1CXZB 1K9MW 1URFA 1XMQO 4O4IA 1VQKV 2BSKA 4R7CA 1SKVA 4QE7A 5JQGB 2HP8A 4O4HA 3M8AA 1Q90D 1DF4A 3CCQV 2WA4A 4NTWA 2UXCB 2ZT9B 4UCSA 4B3RO 4X88A 3RT3C 4X20B 1S5HC 2BTQB 1VEWA 2ZIMA 1OCZB 3LDDA 1KB9F 5KHKA 4DV1O 3H9VA 3CHXA 5GW7A 4DR7O 2DWDC 3ETDA 1YI2V 1K3EA 2CTWA 1ZUQA 2Q9LA 2AHZA 1Y6XA 2JEXA 1Q81W 3CRMA 2RMKB 4DR6O 3A0HZ 2AZ2A 3WG7B 2HJDA 3HKCA 1R73A 2YXHA 1Y67A 5IYCO 3HKBB 5LHIA 3UM7A 2YXLA 5H5NA 5ITZB 1B06A 3ETEA 4B3SB 1KP2A 2XAFA 3FD9A 1XL6A 3D36A 1ORQC 3QF7A 1J95A 3E8FA 1JFFA 2WWWA 5IE9A 1VQ4V 3HKEA 5EBLC 1WJZA 1M4UA 2P67A 4Q6GA 1Q6UA 3WB0A 1HR0O 4K0KO 4JI7B 2ZE6A 1K33A 1N33O 2WA3A 4JI2O 1N36O 1SERA 3S3WA 2ILMA 2YIBA 4FFBB 4Z2WA 3ABTA 4MS2A 4ZHQA 1AR1B 5BZBA 3DXRA 3QVNA 2FMLA 4JYCA 2JJ1G 1GTOA 2Q5ZA 1HWYA 1HNWO 3ABLB 1N0JA 4L87A 4JAAA 3X2QC 4Z1VA 3N2GB 1YEWA 3ZHQA 2UXDB 3M99B 4CH5A 2L6LA 4JAUA 1PL0A 1BGYH 2R9RB 4FM0A 2Q8VA 3T1YB 2XUMA 4RO2A 1AVMA 2Y4UA 4DW1A 3LSUA 3SYOA 4X1IA 1D2DA 4BIUA 5LXTB 1EN4A 1EN6A 2Y0IA 2UXXA 4TV9B 4YIOA 3CCVV 4J80A 3H1LH 1XMOB 4NTYA 5CA0B 2V1DA 2XT9A 4W4LA 3T1CA 5LGUA 2ADPA 3ABLC 5E79Z 4O4LA 2QWPB 3HKDB 2OIEA 4HNAB 5JJJB 2YICA 1EFRG 1ROPA 2R70A 4JI6O 1HDJA 3W7UA 3DTUB 1HNXB 1BHAA 5LMUB 3BA8A 1CEZA 2XAQA 4DUYO 4DV6O 5LOVB 5JVDA 5LL6Y 4JAVA 4OXSA 5K1PA 5KMGA 5LP6B 5L3BA 1JCHA 1NQTA 1XMQB 1WB7A 2GUZB 2JEUA 2LP7A 3AG1B 1V55B 4OPHA 1RPRA 1JQ0A 3E89A 5FLXN 1VARA 4ICGA 3L75H 3JATB 3RW0A 1NS1A 2P06A 1TAEA 1IBMO 1BCCH 1Q6IA 2AHYA 3SYPA 1SRYA 4B3RB 4GKKO 2ZDIC 3E8BA 1CPYA 1VF6C 3LNMB 1ZSPA 1FKAO 2ATKC 4NXMO 1K34A 3CRCA 4U7OA 1N8RW 2NR5A 1WB8A 4FK5C 1U97A 3CMAV 4I55A 3RYIA 5L3CA 1T5EA 4DV1B 4O4JA 4ZBMA 1YTFB 1TA8A 4JI3O 5DECA 4DR7B 5LP6C 1FYJA 2M7WA 3ICXA 4I50A 3SGIA 5E1AC 4DRXB 1WAZA 3MD0A 4L8JA 3MAQA 4PV1B 3FFQA 5KA5A 3JAWB 2ADQB 4R6ZA 1M56C 4RWUA 4JI8O 5KX5A 1VQ8V 4DR6B 2ZE7A 1NH2D 3ZJZA 5JWPA 1I0HA 2E5LO 2H94A 4ZOLA 2W6IG 4PHZA 4RUEA 2LO1A 2YDEA 3CPWU 4AQYO 3W7XA 1IXBA 1SETA 3K5MA 4FLTA 4U7NA 3APOA 3ZRXA 4FPPA 1IVSA 2RNBA 3G67A 1XDCA 4KP4A 3U11A 3AG4B 4H44B 1ENVA 1Q43A 1H2KA 3G80A 4XDKA 4ZI7B 1G4YB 1F4MA 2RCVA 5KAIZ 3WU2Z 1KUQA 4X1KA 3CCUV 1FXHA 1W59A 1NR1A 4JV5O 1NI8A 4KXRA 2WAMA 3JALB 1HR0B 4K0KB 3E8GA 1N33B 4JI2B 1N36B 1PNKA 4PA6A 1KKDA 2NNUA 2P4VA 1LNQA 3QG5A 1VQ7V 2WLIB 2W6JG 5L3GA 2CUGA 2X7RB 4WFFA 2E75B 4PD4F 3ZEDA 1JR9A 2CH7A 3B40A 1VQ5V 5IY5C 2XOKG 2CE4A 2B1IA 3IFXA 1S5JA 3AG4C 2CDYA 4DK0A 3E83A 1B6QA 3CC4V 3DC5A 4FMTA 1FXKB 4GKJO 3JAKA 3BEHA 2N74A 1BQ0A 4F6EA 1XI1A 3VQVA 4LFAO 3ZRSA 1M9NA 1BMFG 2BSKB 2Z5UA 3GB7C 1QVFU 2B9ZA 1ZX3A 1M1KW 3OMIB 4CBCA 4TWKA 3RYHA 3HPLC 2Y69B 4TV8A 3TETA 1AR4A 3CX5F 5B66Z 3EHBB 2RDCA 1D5NA 5DEDA 2EBOA 3ZN1A 3K08A 5AG2A 1OJHA 1L0LH 3W7TA 4B3TO 3KZIZ 3R66A 3TXQA 3BHPA 1MOFA 3E8HA 2ARHA 1K8AW 1R1BA 3L9DA 4JI6B 3JD4A 2DJVA 2Q7EA 1FXKC 4TOIA 2OCCC 3K57A 3SJQC 4DUYB 2B5UA 1G8MA 2PI5A 3SPGA 5JH7B 3OGIB 1TUBA 2NLJC 2V4DA 3ZHSA 2Q0OC 4J9ZB 1E1QG 4JYAO 4W4KA 3T2MA 3K3WA 3L72H 4DR5O 3FKSG 3PN1A 4UVAA 1N32O 4HYOA 4DV2O 4P30A 2RJZA 3HKCB 3SPJA 1KMIZ 4X64O 3ABKB 4YJ3B 3THOA 3ZRWB 3QNEA 2D3OW 1IBMB 2VQFO 2PI4A 2KG7A 2PYLA 5LHHA 5B3SB 4GKKB 4NXMB 1F4NA 2L35A 5EBMC 2H8PC 1Q5OA 4FM1A 3HB3B 3B77A 1JFFB 1KYOF 3J80N 4OPAA 3AEIA 2XAGA 4ASUG 1OCCC 1KD1W 4JI3B 2P6JA 1VQPV 1XL4A 4UV9A 3BY6A 2JGDB 4WFBV 3UCSC 4IT5A 1YIJV 3RWRD 3K06A 2YEVB 4DR4O 1FS0G 3C90A 2Y4TA 5KLVH 4JPRA 5FNVB 4CC5A 1RSOA 3M7MX 3D8CA 5CA3A 3ABKC 1IXMA 2IJKA 3STLC 4JI8B 5IYDO 1P49A 1TGOA 5IJ0A 2EZOA 4ZHQB 3DXRB 2E5LB 3OGCC 1QNMA 2CAZC 3D36C 3FAVA 1ZL8B 2LFSA 2V7QG 4AQYB 3UO2A 1TUEB 4UCUA 1K97A 3WFVA 2EJRA 3RN4A 5LMNO 3CXCU 4EB6B 2ZNIA 2O57A 1NU1H 2QE7G 3LDEA 4I9WA 1JA8A 4NTXA 4X1IB 5IYZA 1UJWB 1COWG 4DV3O 1IURA 1DTOA 1OCOB 1EZVH 2KB1A 4JV5B 3I55V 3JSNA 3KKYA 1M57B 4AILC 5KUKA 3E22A 5HFMA 2XAJA 3WB2A 4FFKA 1PPJH 2QKSA 5CA1A 2GDSA 1VQ9V 2DE0X 3SPIA 1AI6A 4PDLA 2UUBO 1CP9A 1H38A 2QWRB 5BMVB 1J5EO 3JD3A 1S77D 2UU9O 3Q4HA 3CRQA 2GBOA 4K35A 2YIBD 4CS2A 1NTZH 1VQ6V 4LWSA 5LA6B 3CCMV 3CP1A 4PDRA 3ZHVA 3GWOA 1R6NA 4PA7A 3TGUH 5KUMA 3ML0A 1OCOC 4LH7A 5HFLA 4GKJB 2WLLB 1N34O 2DQ3A 2DWEC 5IWAO 2A7WA 1M57C 1K5QA 4LFAB 4DO2A 4LF6O 4JI4O 3B8MA 2ZIOA 3J81N 3NXSA 5B1AC 4J11A 4GLXA 3H1KH 3T4ZA 4LFCO 1YITV 3L74H 1SS3A 2B1GA 4I4TA 1FFXA 3OTOO 4B3TB 5J2UA 4LNUB 4IL6Z 5B1NA 3P3PA 5KHIA 3A0RA 4J7JA 3JASA 3RYCA 4I55B 4MSWC 5GONB 2ZINA 5LHGA 2W0XA 4I50B 5CB4A 1Q3EA 3RVZA 3F5WC 3OE7G 1FAFA 2C2AA 2FYUH 4PDMA 1SQQH 4PI2A 2IJJA 2GHYA 4JYAB 2RQ6A 2R9AA 4I0XB 2QEXV 4DR5B 1MZEA 1N32B 4DV2B 3AK3A 4X64B 3E2EA 5JJNB 1KBHA 1M5IA 3RYFA 2PTMA 2VQFB 2AZ0A 3LUTB 4U3FH 3X2QB 4UXNA 3L73H 4UFZA 3SPCA 3QO8A 2XASA 2OYQA 1GM7A 4DV7O 2WLHA 1G6UA 1QQCA 1Q8IA 1AP5A 1Y66A 3FB5C 4AI8A 4BR6A 1GN6A 3CCRV 3ZMSA 1GKFA 1HW7A 4E2LA 1FFTB 1P84F 4X1KB 2KSDA 1KC8W 4TQDA 4GX2A 4DR2O 4FJCC 3GWKC 2WPDG 5CN0A 3K5NA 3CCLV 2DMXA 4DR4B 1Y76B 5EZYA 1X59A 1KP3A 4GYCB 4FZ1A 1XUQA 4WF9V 2F23A 4X66O 3ETQA 3OEEG 4DK1A 2JDIG 2A9HA 4IHJB 4CC6A 2A3QA 5GTHZ 1GM9A 1PD3A 1PNMA 3J7AU 4WFEA 5LYJB 3JCUZ 5LMNB 1QLEB 1KQSU 1AP6A 1XREA 4GUNA 3DC6A 4PA9A 2HKOA 1RFYA 1K7DA 3K5LA 4DV3B 2WLMA 4N21A 4ABMA 4JZGA 1UPGA 1KU9A 4FZ0A 3N2KA 2N05A 3RYHB 1EBOA 4TV8B 3JD0A 3FX7A 1M93A 1BQZA 3IC7A 4Q20A 1P7GA 2D2CB 1B3QA 1US6A 4A5UB 3OTFA 4WCEV 4CS3A 3B8NA 2UUBB 3WB1A 1SC5B 1J5EB 1SZXA 3ZS8C 3FB7C 5CBFA 1QLEC 1XNQO 2Z3YA 1NH2B 4X65O 1IBLO 1MSDA 5C8YA 4LF8O 1I08A 4YHHO 4MW8A 2ETNA 1TUBB 1NTKH 1SQPH 1SQFA 4G28B 1N34B 4F4LA 5IWAB 5IJ9B 3OM3B 4JZ2A 2IJHA 3ZHUA 1YXBA 4NR1A 4LF6B 4JI4B 1M56B 2QKCA 4FLVA 3CS5A 4KFMA 4B7KA 1WP7A 4KHPO 4G2KA 2UUCO 1IDSA 2KG7B 4MW3A 4LFCB 4AHCA 4XBFA 4K3AA 1LUWA 1NVPD 3NR7A 1K92A 1AB3A 3OTOB 3BAAA 3ZMUA 4UCRA 2HR3A 4X62O 1VP7A 4QE9A 1V9PA 1F7YA 4X20A 2EIMB 3CXHF 2ZKOA 1PV0A 3VOUA 4LH6A 2BTQA 3F7VC 1XILA 5KHJA 3BVOA 2XAHA 5EYPB 5EIBD 1QVGU 2P5OA 2M6YA 1IBKO 2VWKA 1A32A 5L3FA 4LF7O 4HAMA 5F2VO 3OUSA 2K1EA 2QWOB 1FJGO 4DYLA 3ZHRA 2NN4A 1VF7A 4I7ZB 1R3LC 1ZTEA 4O2AA 3D3QA 1Q86W 1VQLV 4I9QA 3BPZA 3A8TA 2EIMC 4X89A 4WBNB 1NKDA 3FB8C 2HFEC 4TT3G 2JRIA 4JI1O 3SDLA 3K59A 2HHHO 3ASOC 5IY5B 3UO3A 4DV7B 2IU3A 3H1IH 1TVKA 1AI4A 5DN6G 4GX5A 2JJ2G 1YSCA 1R6KA 1WA8B 1DGSA 4FLZA 1XBLA 2YC0A 3B4SA 2P22C 3K9SA 2F4VO 1MZFA 3L71H 4NB5A 3CD6V 1JJ2U 2ITCC 2YS8A 1LUVA 4DR2B 1SA0B 4XDLA 1GN3A 1DLBA 4P9PA 1Y74A 2Q6AA 4RQFA 3VQXA 2FL4A 4FIPC 1HNWB 1BL8A 2QR4A 5CA1B 2BCCH 1O9GA 4X66B 3LSSA 2YI9A 2HLDG 4U3JB 4FFBA 3OEHG 4O2BB 4LC1A 1GK9A 1DK1A 3N2GA 2OCCB 2YI8A 4JTDB 4FLWA 3CC2V 4NKGB 2A0LA 3G6EV 4BW9A 4BIZA 4O4IB 2CK3G 4MT8A 4O4HB 4PA4A 5J2TA 4B08A 3G6BA 2VQEO 1ZWIC 1AILA 2EILB 1OZ0A 4FLUA 5LXTA 3MHSC 2VS0A 4PJ0Z 4TV9A 2BTOA 3OFNG 4P9OA 3SYQA 1JMKC 5CA0A 3K58A 1FFXB 2JIZG 4WFHA 3L70H 1XHXA 4IIJA 4EFBA 2PYJA 3CJHA 1OV9A 4UVCA 3RYCB 3HKDA 4RAIA 3SJAC 4DV6B 1YJWV 1XNQB 3S3XA 4X65B 1IBLB 1OCCB 4LF8B 4YHHB 4LFBO 3K5OA 3AK1A 1AJNA 2LW7A 5LOVA 3PJSK 2EILC 1SQGA 4TSFG 3LSQA 3K0GA 2BOCC 4DR1O 1H8EG 4KHPB 2Q7GA 2VRZA 1SF9A 2Q73A 3QO7A 3RYFB 2QKAA 4JYYA 2UUCB 2P4KA 1Y4MA 1H2SB 2XTAA 3JATA 1XHZA 2KQXA 4D7SA 3ZHTA 4CZZA 1WN7A 5A2QN 5H6RA 1XEQA 5BR8O 5FL7G 4X62B 1XOUA 1VMGA 3HKEB 3OD4A 3QTCA 3JYCA 1JVMA 1GH6A 2PZSA 4LBEC 1ZAUA 5EC1C 1E1RG 1X4TA 2JS5A 2GSMB 1IBKB 1YJ9V 3OT7A 3ZRVA 4E4EA 4LF7B 3SYAA 4LF5O 3R65A 4X1YA 5FPOA 1FJGB 3BFRA 3P32A 3TK1A 4PDVA 2ZCEA 3VBBA 4QJFB 1Q7YW 4JF3A 3I5DA 4QGPA 1MA1A 1MG1A 4MTFA 2QA4V 3SPHA 1OHHG 4IYHA 2A06H 3DSQA 4JTAB 2DQ0A 2X6CA 4MVMA 2P7TC 4JI5O 4FLYA 4J10A 4D6TH 1F51A 1KKCA 3ZN0A 4JI1B 2Y0PA 4NYKA 4N23A 1QR9A 4X8AA 2LW1A 2HHHB 5DM6V 2BE3A 4KL1A 4TQFA 4PI0A 4ZKIA 1GMGA 5D5PA 4QPJA 1SZTA 2G38A 3ZCCA 3IGAC 2YSUB 2F4VB 1EM1A 1QHTA 5B1BB 3EXAA 1NTMH 1Z5WA 2JS3A 3C3TA 1WNSA 3EFFK 3ZMVA 2DW4A 3ZBHA 1HNZO 5CMUA 1G1XB 5B1AB 4O4LB 4QIWF 4OGQB 1FPOA 3JALA 4NXNO 3U0ZA 1U96A 3K03A 2ZXWC 1I7FA 2RN9A 2Q68A 1P4RA 1Q82W 2OTJV 3ETGA 1R3IC 3CMEV 2DYRC 2ZR3A 2WLIA 4LR3A 2R9IA 5JVDB 3STZC 5A9GA 4LCUC 1RPOA 5K1XA 4UCVA 5KMGB 4GX1A 2OCHA 2WSSG 3TCUA 4H0LB 5LMUO 5B1BC 3K9AA 1E79G 1N0NA 3RGBA 1AR5A 4I5SA 1QLNA 1WLEA 2EIJC 1L8DA 2LJ2A 1FXKA 1H2GA 3W7SA 2VQEB 4UCOA 3KCXA 2HG5C 3K0DA 2F1MA 4R50A 5D5QA 3ABUA 2AGAA 1HP8A 4JASA 1UFIA 3AG2B 3RYIB 1YVWA 3FYIB 4UB6Z 4O4JB 3TJTA 3F5TA 4YY3O 2EJ7A 4JGSA 5L3EA 1V54B 2X6BA 4R8CA 2WLJA 2Q7HA 3CCEV 1F23A 3JSLA 4LFBB 2ZE5A 5KX5B 3T4DA 5JH7A 5IT9N 2X0LA 4QNHB 2Q69A 3N27A 4CH6A 3G4SV 2EZPA 4YIPA 4ZOLB 1FXVA 4DR1B 2IW5A 3OAAG 2QGNA 4DV0O 4O2AB 3VQYA 3AG2C 1I5XA 1K4CC 1Z2GA 1MSWD 3MHHC 4J7ZA 4UB8Z 4F6RA 1BZKA 5KHGA 1YJNV 4YJ3A 3ZRWA 1SQXH 1GM8A 2Y48A 2IU0A 1OCZC 2Q67A 5BR8B 1V54C 3ABMB 3B2EE 1TVKB 1JJOA 1RP3B 3RBZA 3JARA 2FTKA 1MABG 4LF4O 3CYOA 1YCIA 2HVKC 2UUAO 3APQA 3MDSA 4LF5B 1S72V 3SJCC 1RM1B 1Y74B 2JGDA 3E35A 3BABA 3I56V 5JJEB 1VQNV 2YEVA 4LF9O 1I94O 3WG7C 1PKXA 3UQ8A 5FNVA 4J41A 2ZD9A 1AI7A 2CH7B 3OW2U 4JI5B 2MW2B 4UV8A 3A0BZ 3ABMC 2DN9A 4GCZA 2QJ1A 5EBWC 1NT2B 5JCOA 5CBHA 1VQOV 4BIOA 2QTOA 4YJ2A 1ZL8A 2PF4E 4MVOA 1PM9A 3JAKB 5EK0A 4D7TA 3SR2C 3FB6C 1NVPB 1I5YA 4NVPA 4EB6A 1RM1C 1S0VA 2E74B 5BY1A 5J2TB
chains in the Genus database with same CATH topology
2QM7A 5DN6G 4GX5A 2JJ2G 1YSCA 1F4NA 5EBMC 1R6KA 2H8PC 4XDJA 3HB3B 4X88A 3B77A 2ZQMA 1S5HC 1DF5A 3AEIA 3CD6V 1JJ2U 2XAGA 4ASUG 1OCCC 2ITCC 1OCZB 1KD1W 3LDDA 4XDLA 2P6JA 3CC7V 1VQPV 4P9PA 1DLBA 1XL4A 3DGEA 2Q6AA 4MTXA 4UV9A 3BY6A 3E86A 4RQFA 4WFBV 1AJQA 4FIPC 5GW7A 3CCJV 1YIJV 1BL8A 5B1OA 3K06A 2YEVB 1FS0G 2DWDC 3ETDA 1YI2V 1K3EA 4JPRA 3W7WA 3LSSA 2HLDG 5CA3A 3ABKC 3OEHG 1IXMA 2IJKA 3STLC 5IYDO 2AHZA 4LC1A 2EZOA 1GK9A 3OGCC 2JEXA 1Q81W 4PA3A 2OCCB 4JTDB 1NJIW 4BAYA 3WG7B 2LFSA 3CC2V 2V7QG 4G27B 2P90A 1R73A 2A0LA 3G6EV 1TUEB 2WLLA 3AG3B 2LFRA 5IYCO 4BIZA 2CK3G 5LHIA 3UM7A 1K97A 3WFVA 1AI5A 2EJRA 3D3IA 4MT8A 4PA4A 3CXCU 1ZWIC 1JOYA 1H8HG 3ETEA 1KP2A 2EILB 1OZ0A 2QM8A 2XAFA 1XL6A 3D36A 1ORQC 1J95A 3E8FA 3ZMZA 2QE7G 3LDEA 4I9WA 1UJWB 2WWWA 3MHSC 1COWG 4H37A 1DTOA 1OCOB 2KB1A 1VQ4V 5EBLC 3OFNG 3ASOB 4P9OA 3SYQA 3I55V 1M57B 2JIZG 3KG2A 2P67A 4WFHA 5KUKA 5HFMA 2XAJA 4UVCA 2QKSA 4RUFA 4RAIA 1K33A 1VQ9V 1SERA 3OUFA 3SPIA 1K73W 1YJWV 1AI6A 4PDLA 4RQEA 1OCCB 1CP9A 1H38A 3AG3C 1WPXA 4MVRA 3JD3A 3ABTA 1S77D 4MS2A 1AR1B 5BZBA 4JYCA 3AG1C 1V55C 2JJ1G 1AJNA 1GTOA 1HWYA 1S76D 3ABLB 4L87A 1VQ6V 3PJSK 3X2QC 3CCMV 2EILC 3CP1A 4PDRA 3GWOA 1R6NA 2EINB 4PA7A 4TSFG 4QPKA 5KUMA 3LSQA 3M99B 3ML0A 3K0GA 2BOCC 1OCOC 5HFLA 1JPXA 1PL0A 2DQ3A 2WLLB 4JAUA 2DWEC 2R9RB 1M57C 1H8EG 1K5QA 2OTLV 3QO7A 4DO2A 1Y4MA 4MTOA 2IH3C 3B8MA 4PELA 3NXSA 4RO2A 4CZZA 5B1AC 1SESA 4JTCB 3SYOA 1VQMV 5H6RA 4H33A 3JD1A 4BIUA 5FL7G 2UXXA 3T4ZA 1S3JA 3CCVV 1YITV 4KUMA 2B1GA 3JYCA 1JVMA 5LGNA 3JD2A 2V1DA 1R3JC 3T1CA 4LBEC 5LGUA 3OMNB 5B1NA 3ABLC 3A0RA 5EC1C 1E1RG 3K04A 2GSMB 1YJ9V 1BHBA 3ZRVA 2EINC 4MSWC 3SYAA 5LHGA 3R65A 1EFRG 1ROPA 3P32A 3TK1A 4PDVA 3VBBA 4QJFB 1Q7YW 1YTFD 3RVZA 4JF3A 1PNLA 1EZJA 3F5WC 3DTUB 3W7UA 1MG1A 1BHAA 4MTFA 3OE7G 1CEZA 2QA4V 3SPHA 2C2AA 1OHHG 2HVJC 2XAQA 4PDMA 2IJJA 4JTAB 2GHYA 2DQ0A 2X6CA 1NR7A 4JAVA 4MVMA 2P7TC 4MVZA 4OXSA 4BW5A 2QEXV 5L3BA 4WFAV 1JCHA 1F51A 1P7BA 4Z1MG 1NQTA 2JEUA 3ZN0A 2LP7A 4GT1A 1QR8A 3E2EA 1W0JG 3AG1B 1V55B 2JK5C 4N23A 1QR9A 4X8AA 1W0KG 1K4DC 1RPRA 1JQ0A 3LUTB 3E89A 3QO5A 3X2QB 4UXNA 3RW0A 5DM6V 5IDJA 3SPCA 3ASNB 3QO8A 3F7YC 2XASA 4ZKIA 1GMGA 3ZIAG 4QPJA 1SZTA 1GM7A 2OT5A 2AHYA 3SYPA 1SRYA 3ZCCA 2WLHA 3IGAC 2YSUB 2ZDIC 2WLNA 1CPYA 3E8BA 3LNMB 2ATKC 5B1BB 1K34A 1Y66A 3FB5C 3LDCA 4GX0A 4U7OA 3EFFK 1GKFA 3ZMSA 3ZMVA 3CCRV 4E2LA 1N8RW 1FFTB 2DW4A 4FK5C 5CMUA 1THZA 3CMAV 1GO3F 5B1AB 5L3CA 1KC8W 4YXWG 4QIWF 5L3DA 4ZBMA 3FYEB 4MTGA 1YTFB 4DXWA 4GX2A 4FJCC 2WPDG 5CN0A 2ZDIA 2M7WA 2ZXWC 3K03A 3CCLV 2Q68A 1P4RA 1Q82W 2OTJV 3G71V 3ETGA 1R3IC 2W0FC 5E1AC 1KP3A 4JYBA 3MD0A 5EC2C 3UKMA 3CMEV 4WF9V 2DYRC 2ZR3A 2WLIA 2R9IA 1KECA 5KA5A 3STZC 3ASNC 3OEEG 4R6ZA 2JDIG 4LCUC 1M56C 1RPOA 1VQ8V 3CCSV 1QCEA 4GX1A 3TCUA 2A9HA 2WSSG 3ZJZA 1NH2D 2H94A 1GM9A 5B1BC 1PD3A 1PNMA 3K9AA 5J9PC 4WFEA 3H01A 5C93A 1E79G 2W6IG 4I5SA 4RUEA 1QLNA 1WLEA 2EIJC 2Y69C 3CPWU 3P30A 3W7XA 1SETA 1KQSU 1QLEB 1FXKA 1H2GA 3W7SA 4PA9A 2HKOA 4U7NA 3RVYA 2HG5C 3ZRXA 4FPPA 1K7DA 3K0DA 2DYSB 5LGTA 4R50A 2WLMA 4N21A 4KP4A 2ITDC 3ABUA 5LBQA 2F43G 3AG4B 1ENVA 2WLKA 4XDKA 1G4YB 1EBOA 1F4MA 4JASA 3AG2B 4P2ZA 3CCUV 4UVBA 3JD0A 1FXHA 1NR1A 3FYIB 3SYCA 3IC7A 4Q20A 2WAMA 3E8GA 5H6QA 4JGSA 5L3EA 4WCEV 4J9YB 1V54B 2X6BA 4R8CA 2WLJA 1AROP 1PNKA 4PA6A 3CCEV 3B8NA 1KKDA 2BOBC 2NNUA 1F23A 1LNQA 3FB7C 5CBFA 1VQ7V 2WLIB 2W6JG 1QLEC 5L3GA 2Z3YA 1NH2B 2X7RB 4WFFA 5KA6A 2IH1C 4EKWA 4HZ3A 3T4DA 2ZXWB 1QBZA 2X0LA 2DYSC 4QNHB 1VQ5V 4MW8A 2Q69A 3G4SV 5IY5C 5CBGA 2EZPA 2XOKG 2B1IA 2ZR2A 3IFXA 1FXVA 4MVUA 3AG4C 2IW5A 4LP8A 5B3SC 3OAAG 4G28B 3E83A 2DYRB 1B6QA 4F4LA 2MK3A 3CC4V 3AG2C 3OM3B 4FMTA 2IJHA 1I5XA 5H9CA 1K4CC 1FXKB 3OR7C 1MSWD 3MHHC 3BEHA 1M56B 4KFMA 1YJNV 3ZRWA 3ZRSA 5IYBO 1GM8A 1M9NA 2Y48A 4G2KA 2IU0A 1BMFG 2Z5UA 3GB7C 1L1FA 1OCZC 2Q67A 1QVFU 3K79A 1V54C 3ABMB 3OMIB 1M1KW 4MW3A 4XBFA 4CBCA 4TWKA 1YHQV 1K92A 1NVPD 2EIJB 3HPLC 2Y69B 1OCRB 1NBMG 3TETA 3RBZA 3ZMTA 2EIKB 3ZMUA 2UXNA 2HR3A 3EHBB 2FTKA 4MVQA 4QE9A 1MABG 2EBOA 3ZN1A 3CYOA 2EIMB 3K08A 4MVSA 1M90W 3VOUA 3W7TA 2HVKC 3F7VC 1R3KC 2XAHA 1MOFA 3E8HA 1S72V 1QVGU 4UUJC 1RM1B 2IJIA 3OMAB 3JCZA 1K8AW 1JX9A 3E35A 5L3FA 4HAMA 4WFGA 3I56V 3JD4A 2HJFC 1VQNV 3OUSA 2XNDG 2YEVA 2K1EA 1FXKC 2X6AA 2OCCC 3WG7C 2A79B 3SJQC 1PKXA 2B5UA 1G8MA 2PI5A 2ZD9A 3SPGA 1AI7A 3OW2U 1R3LC 2NLJC 4UV8A 3ABMC 4GCZA 1K5SA 1E1QG 3OR6C 4J9ZB 5EBWC 1W2BU 5CBHA 3T2MA 1Q86W 1VQOV 1VQLV 1OCRC 3K3WA 1AJPA 2QTOA 2EIKC 3FKSG 4UVAA 1K9MW 4MVOA 4HYOA 2EIMC 4X89A 5EK0A 1NKDA 3FB8C 4P30A 2HFEC 3SPJA 4TT3G 3ABKB 3FB6C 3ZRWB 1VQKV 4R7CA 1NVPB 3QNEA 4QE7A 2D3OW 3ASOC 5IY5B 2PI4A 1I5YA 5LHHA 1DF4A 3CCQV 1RM1C 2IU3A 1S0VA 5B3SB 1AI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ V;  1Q82 W;  1VQ4 V;  1YIJ V;  3G71 V;  2OTL V;  2OTJ V;  1YJN V;  2QEX V;  1R73 A;  3CCU V;  1S72 V;  1QVG U;  3I55 V;  3G6E V;  1YJ9 V;  3CME V;  1W2B U;  3CPW U;  1Q86 W;  1VQO V;  4WFA V;  1VQL V;  1YI2 V;  1KQS U;  1QVF U;  4WF9 V;  1M1K W;  1VQ6 V;  1VQM V;  3CCM V;  1K8A W;  1VQ5 V;  3CCR V;  3G4S V;  3CXC U;  1N8R W;  1K9M W;  3I56 V;  1YHQ V;  1JJ2 U;  3CC2 V;  3CD6 V;  1VQN V;  4WCE V;  1Q7Y W;  3CCV V;  1YIT V;  3CMA V;  1KD1 W;  1KC8 W;  1VQ8 V;  1VQ9 V;  1VQK V;  3CC7 V;  3CCE V;  1VQP V;  3CCS V;  5DM6 V;  1Q81 W;  2QA4 V;  2D3O W;  1K73 W;  3CC4 V;  1YJW V;  1M90 W;  3CCQ V;  3OW2 U;  1VQ7 V;  4WFB V;  1NJI W;  3CCL V; 
#chains in the Genus database with same CATH topology
 2QM7 A;  2IM9 A;  2Z0A A;  4XDJ A;  2F93 B;  2ZQM A;  2ODM A;  4B3M O;  1HNZ B;  1DF5 A;  1VF5 B;  4K8X A;  4NXN B;  3CC7 V;  4TUY A;  1GRJ A;  4IIJ B;  3DGE A;  2QTS A;  4MTX A;  3CJH B;  3E86 A;  1AJQ A;  4FLX A;  2UU9 B;  3CCJ V;  2EX3 A;  5B1O A;  4HBN A;  2E76 B;  3UT5 A;  3W7W A;  5BMV A;  5TIS Z;  2PUS A;  1BE3 H;  3IC9 A;  5LA6 A;  4PA3 A;  2HEP A;  2OIG A;  1NJI W;  4BAY A;  1Q6H A;  5EIB C;  4G27 B;  2P90 A;  2E3C A;  2WLL A;  2LFR A;  3AG3 B;  2ZM6 O;  5JQG A;  3KCY A;  1AI5 A;  3D3I A;  3H1J H;  4JI0 O;  3TXS A;  5H2F Z;  1JOY A;  1EN5 A;  1H8H G;  1MMM A;  3EVK A;  3VQW A;  2QM8 A;  4DV5 O;  3BRC A;  3ZMZ A;  3CEI A;  4H37 A;  2AXT Z;  3ASO B;  4YY3 B;  4X9Q A;  3CWB H;  3KG2 A;  4LNU A;  1O9H A;  1GAX A;  2ZE8 A;  4RUF A;  1H2N A;  5GON A;  2H3O A;  3OUF A;  1K73 W;  4RQE A;  4X1Y B;  1RSO B;  3AG3 C;  3GVM A;  1WPX A;  3C3S A;  4MVR A;  5IJ0 B;  3AG1 C;  1V55 C;  1S76 D;  3O65 A;  2YIA A;  2VWJ A;  2CTP A;  4DV0 B;  4I0X A;  2EIN B;  1PP9 H;  4FVM A;  3FAV B;  4QPK A;  1YZB A;  4DUZ O;  4J42 A;  4EFE A;  3CSX A;  3HKB A;  1JPX A;  1LR1 A;  2OTL V;  4OX9 O;  5ITZ A;  3U10 A;  1IZ3 A;  1YDX A;  1IX9 A;  4MTO A;  2IH3 C;  4PEL A;  4ZIB A;  3JAM N;  1SES A;  4JTC B;  1VQM V;  4GZR B;  4H33 A;  5BXZ A;  3JD1 A;  5IYZ B;  2Q4P A;  1S3J A;  2CGN A;  1SQV H;  4LF4 B;  4KUM A;  1QU7 A;  2GV9 A;  2JGU A;  5LGN A;  3JD2 A;  2UUA B;  1XNR O;  1R3J C;  3OMN B;  3E22 B;  4IYI A;  3K04 A;  1BHB A;  2EIN C;  3SJB C;  3RFR A;  1MNG A;  4LF9 B;  2QM4 A;  1I94 B;  2DOS A;  1Y76 A;  4DW0 A;  3LNN A;  1YTF D;  2GTS A;  1PNL A;  5FPR A;  4DV4 O;  5KHH A;  1EZJ A;  3Q4H B;  1S5L Z;  2QDO A;  2UXB O;  2QSA A;  3T1H O;  2HVJ C;  2KKW A;  4LWS B;  1NR7 A;  4MVZ A;  2YID A;  1PL4 A;  4DR3 O;  4BW5 A;  2F66 C;  2F95 B;  4IHJ A;  4WFA V;  5GTI Z;  1P7B A;  4Z1M G;  1N4C A;  2LQT A;  4GT1 A;  1QR8 A;  5LYJ A;  1W0J G;  2JK5 C;  2OWO A;  1W0K G;  1K4D C;  3CE2 A;  3QO5 A;  4K8Z A;  5IDJ A;  3ASN B;  3B09 A;  3F7Y C;  3ZIA G;  2OT5 A;  2WLN A;  2EUL A;  4B3M B;  2UXC O;  4I4T B;  3LDC A;  2R72 A;  5J2U B;  4GX0 A;  2LGW A;  1WPB A;  1YF2 A;  1THZ A;  1GO3 F;  4UCT A;  3JAS B;  4YXW G;  5L3D A;  3FYE B;  4MTG A;  4DXW A;  4HNA A;  1BS3 A;  2ZDI A;  1VF6 A;  2ZNJ A;  2FKX A;  3G71 V;  1B04 A;  2W0F C;  4JYB A;  5CB4 B;  5EC2 C;  3UKM A;  4BWA A;  5KAF Z;  3ZX6 A;  2LGQ A;  2YXY A;  1KEC A;  3A2F A;  1H2L A;  3ASN C;  5LP6 A;  3BCC H;  3CCS V;  3HR0 A;  1QCE A;  2GUZ A;  5J9P C;  4H13 B;  3H01 A;  5C93 A;  2ZM6 B;  2AW9 A;  5IJ9 A;  2Y69 C;  3P30 A;  4JI0 B;  1XQ8 A;  1WP8 A;  3RVY A;  1GN2 A;  4DV5 B;  1FD9 A;  4F6R B;  2DYS B;  5LGT A;  4C7U A;  2FB5 A;  2ITD C;  3H1H H;  5LBQ A;  4B3S O;  2F43 G;  2WLK A;  1SQB H;  1H2M A;  4P2Z A;  1L0N H;  4UVB A;  3JAR B;  1Z5V A;  3AG7 A;  3SYC A;  5H6Q A;  4CS4 A;  5EYP A;  5B5E Z;  4J9Y B;  3CRA A;  3CB2 A;  4DRX A;  5EZY B;  1ARO P;  4IGG A;  4JI7 O;  2BOB C;  1BT8 A;  4CH4 A;  3JAW A;  3CRR A;  2QWN B;  5KA6 A;  2IH1 C;  4J7K A;  2GTA A;  4EKW A;  3IAY A;  4HZ3 A;  2JVD A;  2ZXW B;  1QBZ A;  2DYS C;  3AK2 A;  4DUZ B;  5CBG A;  2ZR2 A;  4MVU A;  4LP8 A;  5B3S C;  3P3N A;  2IBZ H;  2DYR B;  2MK3 A;  2UXD O;  4YJ2 B;  1GN4 A;  5H9C A;  4OX9 B;  3OR7 C;  4WBN A;  2QWQ B;  2N04 A;  2CGO A;  5IYB O;  1L1F A;  1VIB A;  3K79 A;  3T1Y O;  4CH3 A;  4ZI7 A;  1YHQ V;  2EIJ B;  3N2K B;  1OCR B;  1NBM G;  2K9P A;  3ZMT A;  1WA8 A;  3BA9 A;  2EIK B;  2UXN A;  2XHB A;  1XNR B;  4MVQ A;  1XMO O;  3O9O A;  4MVS A;  1ZLZ A;  1M90 W;  1R3K C;  1R6T A;  2YUA A;  1SA0 A;  4UUJ C;  2IJI A;  3OMA B;  4B7E A;  4TUY B;  1D5A A;  3JCZ A;  1JX9 A;  5JCO C;  4WFG A;  2CTQ A;  4DV4 B;  4FM2 A;  2HJF C;  2XND G;  2X6A A;  2UXB B;  2A79 B;  2Q0A A;  3T1H B;  2PY5 A;  5C8Y B;  4U3J A;  3UT5 B;  1NZ6 A;  1HNX O;  2CTR A;  4DR3 B;  1BSM A;  4O2B A;  4EEQ A;  1K5S A;  3OR6 C;  1W2B U;  1OCR C;  2PGG A;  1AJP A;  2EIK C;  3IJ4 A;  1CXZ B;  1K9M W;  1URF A;  1XMQ O;  4O4I A;  1VQK V;  2BSK A;  4R7C A;  1SKV A;  4QE7 A;  5JQG B;  2HP8 A;  4O4H A;  3M8A A;  1Q90 D;  1DF4 A;  3CCQ V;  2WA4 A;  4NTW A;  2UXC B;  2ZT9 B;  4UCS A;  4B3R O;  4X88 A;  3RT3 C;  4X20 B;  1S5H C;  2BTQ B;  1VEW A;  2ZIM A;  1OCZ B;  3LDD A;  1KB9 F;  5KHK A;  4DV1 O;  3H9V A;  3CHX A;  5GW7 A;  4DR7 O;  2DWD C;  3ETD A;  1YI2 V;  1K3E A;  2CTW A;  1ZUQ A;  2Q9L A;  2AHZ A;  1Y6X A;  2JEX A;  1Q81 W;  3CRM A;  2RMK B;  4DR6 O;  3A0H Z;  2AZ2 A;  3WG7 B;  2HJD A;  3HKC A;  1R73 A;  2YXH A;  1Y67 A;  5IYC O;  3HKB B;  5LHI A;  3UM7 A;  2YXL A;  5H5N A;  5ITZ B;  1B06 A;  3ETE A;  4B3S B;  1KP2 A;  2XAF A;  3FD9 A;  1XL6 A;  3D36 A;  1ORQ C;  3QF7 A;  1J95 A;  3E8F A;  1JFF A;  2WWW A;  5IE9 A;  1VQ4 V;  3HKE A;  5EBL C;  1WJZ A;  1M4U A;  2P67 A;  4Q6G A;  1Q6U A;  3WB0 A;  1HR0 O;  4K0K O;  4JI7 B;  2ZE6 A;  1K33 A;  1N33 O;  2WA3 A;  4JI2 O;  1N36 O;  1SER A;  3S3W A;  2ILM A;  2YIB A;  4FFB B;  4Z2W A;  3ABT A;  4MS2 A;  4ZHQ A;  1AR1 B;  5BZB A;  3DXR A;  3QVN A;  2FML A;  4JYC A;  2JJ1 G;  1GTO A;  2Q5Z A;  1HWY A;  1HNW O;  3ABL B;  1N0J A;  4L87 A;  4JAA A;  3X2Q C;  4Z1V A;  3N2G B;  1YEW A;  3ZHQ A;  2UXD B;  3M99 B;  4CH5 A;  2L6L A;  4JAU A;  1PL0 A;  1BGY H;  2R9R B;  4FM0 A;  2Q8V A;  3T1Y B;  2XUM A;  4RO2 A;  1AVM A;  2Y4U A;  4DW1 A;  3LSU A;  3SYO A;  4X1I A;  1D2D A;  4BIU A;  5LXT B;  1EN4 A;  1EN6 A;  2Y0I A;  2UXX A;  4TV9 B;  4YIO A;  3CCV V;  4J80 A;  3H1L H;  1XMO B;  4NTY A;  5CA0 B;  2V1D A;  2XT9 A;  4W4L A;  3T1C A;  5LGU A;  2ADP A;  3ABL C;  5E79 Z;  4O4L A;  2QWP B;  3HKD B;  2OIE A;  4HNA B;  5JJJ B;  2YIC A;  1EFR G;  1ROP A;  2R70 A;  4JI6 O;  1HDJ A;  3W7U A;  3DTU B;  1HNX B;  1BHA A;  5LMU B;  3BA8 A;  1CEZ A;  2XAQ A;  4DUY O;  4DV6 O;  5LOV B;  5JVD A;  5LL6 Y;  4JAV A;  4OXS A;  5K1P A;  5KMG A;  5LP6 B;  5L3B A;  1JCH A;  1NQT A;  1XMQ B;  1WB7 A;  2GUZ B;  2JEU A;  2LP7 A;  3AG1 B;  1V55 B;  4OPH A;  1RPR A;  1JQ0 A;  3E89 A;  5FLX N;  1VAR A;  4ICG A;  3L75 H;  3JAT B;  3RW0 A;  1NS1 A;  2P06 A;  1TAE A;  1IBM O;  1BCC H;  1Q6I A;  2AHY A;  3SYP A;  1SRY A;  4B3R B;  4GKK O;  2ZDI C;  3E8B A;  1CPY A;  1VF6 C;  3LNM B;  1ZSP A;  1FKA O;  2ATK C;  4NXM O;  1K34 A;  3CRC A;  4U7O A;  1N8R W;  2NR5 A;  1WB8 A;  4FK5 C;  1U97 A;  3CMA V;  4I55 A;  3RYI A;  5L3C A;  1T5E A;  4DV1 B;  4O4J A;  4ZBM A;  1YTF B;  1TA8 A;  4JI3 O;  5DEC A;  4DR7 B;  5LP6 C;  1FYJ A;  2M7W A;  3ICX A;  4I50 A;  3SGI A;  5E1A C;  4DRX B;  1WAZ A;  3MD0 A;  4L8J A;  3MAQ A;  4PV1 B;  3FFQ A;  5KA5 A;  3JAW B;  2ADQ B;  4R6Z A;  1M56 C;  4RWU A;  4JI8 O;  5KX5 A;  1VQ8 V;  4DR6 B;  2ZE7 A;  1NH2 D;  3ZJZ A;  5JWP A;  1I0H A;  2E5L O;  2H94 A;  4ZOL A;  2W6I G;  4PHZ A;  4RUE A;  2LO1 A;  2YDE A;  3CPW U;  4AQY O;  3W7X A;  1IXB A;  1SET A;  3K5M A;  4FLT A;  4U7N A;  3APO A;  3ZRX A;  4FPP A;  1IVS A;  2RNB A;  3G67 A;  1XDC A;  4KP4 A;  3U11 A;  3AG4 B;  4H44 B;  1ENV A;  1Q43 A;  1H2K A;  3G80 A;  4XDK A;  4ZI7 B;  1G4Y B;  1F4M A;  2RCV A;  5KAI Z;  3WU2 Z;  1KUQ A;  4X1K A;  3CCU V;  1FXH A;  1W59 A;  1NR1 A;  4JV5 O;  1NI8 A;  4KXR A;  2WAM A;  3JAL B;  1HR0 B;  4K0K B;  3E8G A;  1N33 B;  4JI2 B;  1N36 B;  1PNK A;  4PA6 A;  1KKD A;  2NNU A;  2P4V A;  1LNQ A;  3QG5 A;  1VQ7 V;  2WLI B;  2W6J G;  5L3G A;  2CUG A;  2X7R B;  4WFF A;  2E75 B;  4PD4 F;  3ZED A;  1JR9 A;  2CH7 A;  3B40 A;  1VQ5 V;  5IY5 C;  2XOK G;  2CE4 A;  2B1I A;  3IFX A;  1S5J A;  3AG4 C;  2CDY A;  4DK0 A;  3E83 A;  1B6Q A;  3CC4 V;  3DC5 A;  4FMT A;  1FXK B;  4GKJ O;  3JAK A;  3BEH A;  2N74 A;  1BQ0 A;  4F6E A;  1XI1 A;  3VQV A;  4LFA O;  3ZRS A;  1M9N A;  1BMF G;  2BSK B;  2Z5U A;  3GB7 C;  1QVF U;  2B9Z A;  1ZX3 A;  1M1K W;  3OMI B;  4CBC A;  4TWK A;  3RYH A;  3HPL C;  2Y69 B;  4TV8 A;  3TET A;  1AR4 A;  3CX5 F;  5B66 Z;  3EHB B;  2RDC A;  1D5N A;  5DED A;  2EBO A;  3ZN1 A;  3K08 A;  5AG2 A;  1OJH A;  1L0L H;  3W7T A;  4B3T O;  3KZI Z;  3R66 A;  3TXQ A;  3BHP A;  1MOF A;  3E8H A;  2ARH A;  1K8A W;  1R1B A;  3L9D A;  4JI6 B;  3JD4 A;  2DJV A;  2Q7E A;  1FXK C;  4TOI A;  2OCC C;  3K57 A;  3SJQ C;  4DUY B;  2B5U A;  1G8M A;  2PI5 A;  3SPG A;  5JH7 B;  3OGI B;  1TUB A;  2NLJ C;  2V4D A;  3ZHS A;  2Q0O C;  4J9Z B;  1E1Q G;  4JYA O;  4W4K A;  3T2M A;  3K3W A;  3L72 H;  4DR5 O;  3FKS G;  3PN1 A;  4UVA A;  1N32 O;  4HYO A;  4DV2 O;  4P30 A;  2RJZ A;  3HKC B;  3SPJ A;  1KMI Z;  4X64 O;  3ABK B;  4YJ3 B;  3THO A;  3ZRW B;  3QNE A;  2D3O W;  1IBM B;  2VQF O;  2PI4 A;  2KG7 A;  2PYL A;  5LHH A;  5B3S B;  4GKK B;  4NXM B;  1F4N A;  2L35 A;  5EBM C;  2H8P C;  1Q5O A;  4FM1 A;  3HB3 B;  3B77 A;  1JFF B;  1KYO F;  3J80 N;  4OPA A;  3AEI A;  2XAG A;  4ASU G;  1OCC C;  1KD1 W;  4JI3 B;  2P6J A;  1VQP V;  1XL4 A;  4UV9 A;  3BY6 A;  2JGD B;  4WFB V;  3UCS C;  4IT5 A;  1YIJ V;  3RWR D;  3K06 A;  2YEV B;  4DR4 O;  1FS0 G;  3C90 A;  2Y4T A;  5KLV H;  4JPR A;  5FNV B;  4CC5 A;  1RSO A;  3M7M X;  3D8C A;  5CA3 A;  3ABK C;  1IXM A;  2IJK A;  3STL C;  4JI8 B;  5IYD O;  1P49 A;  1TGO A;  5IJ0 A;  2EZO A;  4ZHQ B;  3DXR B;  2E5L B;  3OGC C;  1QNM A;  2CAZ C;  3D36 C;  3FAV A;  1ZL8 B;  2LFS A;  2V7Q G;  4AQY B;  3UO2 A;  1TUE B;  4UCU A;  1K97 A;  3WFV A;  2EJR A;  3RN4 A;  5LMN O;  3CXC U;  4EB6 B;  2ZNI A;  2O57 A;  1NU1 H;  2QE7 G;  3LDE A;  4I9W A;  1JA8 A;  4NTX A;  4X1I B;  5IYZ A;  1UJW B;  1COW G;  4DV3 O;  1IUR A;  1DTO A;  1OCO B;  1EZV H;  2KB1 A;  4JV5 B;  3I55 V;  3JSN A;  3KKY A;  1M57 B;  4AIL C;  5KUK A;  3E22 A;  5HFM A;  2XAJ A;  3WB2 A;  4FFK A;  1PPJ H;  2QKS A;  5CA1 A;  2GDS A;  1VQ9 V;  2DE0 X;  3SPI A;  1AI6 A;  4PDL A;  2UUB O;  1CP9 A;  1H38 A;  2QWR B;  5BMV B;  1J5E O;  3JD3 A;  1S77 D;  2UU9 O;  3Q4H A;  3CRQ A;  2GBO A;  4K35 A;  2YIB D;  4CS2 A;  1NTZ H;  1VQ6 V;  4LWS A;  5LA6 B;  3CCM V;  3CP1 A;  4PDR A;  3ZHV A;  3GWO A;  1R6N A;  4PA7 A;  3TGU H;  5KUM A;  3ML0 A;  1OCO C;  4LH7 A;  5HFL A;  4GKJ B;  2WLL B;  1N34 O;  2DQ3 A;  2DWE C;  5IWA O;  2A7W A;  1M57 C;  1K5Q A;  4LFA B;  4DO2 A;  4LF6 O;  4JI4 O;  3B8M A;  2ZIO A;  3J81 N;  3NXS A;  5B1A C;  4J11 A;  4GLX A;  3H1K H;  3T4Z A;  4LFC O;  1YIT V;  3L74 H;  1SS3 A;  2B1G A;  4I4T A;  1FFX A;  3OTO O;  4B3T B;  5J2U A;  4LNU B;  4IL6 Z;  5B1N A;  3P3P A;  5KHI A;  3A0R A;  4J7J A;  3JAS A;  3RYC A;  4I55 B;  4MSW C;  5GON B;  2ZIN A;  5LHG A;  2W0X A;  4I50 B;  5CB4 A;  1Q3E A;  3RVZ A;  3F5W C;  3OE7 G;  1FAF A;  2C2A A;  2FYU H;  4PDM A;  1SQQ H;  4PI2 A;  2IJJ A;  2GHY A;  4JYA B;  2RQ6 A;  2R9A A;  4I0X B;  2QEX V;  4DR5 B;  1MZE A;  1N32 B;  4DV2 B;  3AK3 A;  4X64 B;  3E2E A;  5JJN B;  1KBH A;  1M5I A;  3RYF A;  2PTM A;  2VQF B;  2AZ0 A;  3LUT B;  4U3F H;  3X2Q B;  4UXN A;  3L73 H;  4UFZ A;  3SPC A;  3QO8 A;  2XAS A;  2OYQ A;  1GM7 A;  4DV7 O;  2WLH A;  1G6U A;  1QQC A;  1Q8I A;  1AP5 A;  1Y66 A;  3FB5 C;  4AI8 A;  4BR6 A;  1GN6 A;  3CCR V;  3ZMS A;  1GKF A;  1HW7 A;  4E2L A;  1FFT B;  1P84 F;  4X1K B;  2KSD A;  1KC8 W;  4TQD A;  4GX2 A;  4DR2 O;  4FJC C;  3GWK C;  2WPD G;  5CN0 A;  3K5N A;  3CCL V;  2DMX A;  4DR4 B;  1Y76 B;  5EZY A;  1X59 A;  1KP3 A;  4GYC B;  4FZ1 A;  1XUQ A;  4WF9 V;  2F23 A;  4X66 O;  3ETQ A;  3OEE G;  4DK1 A;  2JDI G;  2A9H A;  4IHJ B;  4CC6 A;  2A3Q A;  5GTH Z;  1GM9 A;  1PD3 A;  1PNM A;  3J7A U;  4WFE A;  5LYJ B;  3JCU Z;  5LMN B;  1QLE B;  1KQS U;  1AP6 A;  1XRE A;  4GUN A;  3DC6 A;  4PA9 A;  2HKO A;  1RFY A;  1K7D A;  3K5L A;  4DV3 B;  2WLM A;  4N21 A;  4ABM A;  4JZG A;  1UPG A;  1KU9 A;  4FZ0 A;  3N2K A;  2N05 A;  3RYH B;  1EBO A;  4TV8 B;  3JD0 A;  3FX7 A;  1M93 A;  1BQZ A;  3IC7 A;  4Q20 A;  1P7G A;  2D2C B;  1B3Q A;  1US6 A;  4A5U B;  3OTF A;  4WCE V;  4CS3 A;  3B8N A;  2UUB B;  3WB1 A;  1SC5 B;  1J5E B;  1SZX A;  3ZS8 C;  3FB7 C;  5CBF A;  1QLE C;  1XNQ O;  2Z3Y A;  1NH2 B;  4X65 O;  1IBL O;  1MSD A;  5C8Y A;  4LF8 O;  1I08 A;  4YHH O;  4MW8 A;  2ETN A;  1TUB B;  1NTK H;  1SQP H;  1SQF A;  4G28 B;  1N34 B;  4F4L A;  5IWA B;  5IJ9 B;  3OM3 B;  4JZ2 A;  2IJH A;  3ZHU A;  1YXB A;  4NR1 A;  4LF6 B;  4JI4 B;  1M56 B;  2QKC A;  4FLV A;  3CS5 A;  4KFM A;  4B7K A;  1WP7 A;  4KHP O;  4G2K A;  2UUC O;  1IDS A;  2KG7 B;  4MW3 A;  4LFC B;  4AHC A;  4XBF A;  4K3A A;  1LUW A;  1NVP D;  3NR7 A;  1K92 A;  1AB3 A;  3OTO B;  3BAA A;  3ZMU A;  4UCR A;  2HR3 A;  4X62 O;  1VP7 A;  4QE9 A;  1V9P A;  1F7Y A;  4X20 A;  2EIM B;  3CXH F;  2ZKO A;  1PV0 A;  3VOU A;  4LH6 A;  2BTQ A;  3F7V C;  1XIL A;  5KHJ A;  3BVO A;  2XAH A;  5EYP B;  5EIB D;  1QVG U;  2P5O A;  2M6Y A;  1IBK O;  2VWK A;  1A32 A;  5L3F A;  4LF7 O;  4HAM A;  5F2V O;  3OUS A;  2K1E A;  2QWO B;  1FJG O;  4DYL A;  3ZHR A;  2NN4 A;  1VF7 A;  4I7Z B;  1R3L C;  1ZTE A;  4O2A A;  3D3Q A;  1Q86 W;  1VQL V;  4I9Q A;  3BPZ A;  3A8T A;  2EIM C;  4X89 A;  4WBN B;  1NKD A;  3FB8 C;  2HFE C;  4TT3 G;  2JRI A;  4JI1 O;  3SDL A;  3K59 A;  2HHH O;  3ASO C;  5IY5 B;  3UO3 A;  4DV7 B;  2IU3 A;  3H1I H;  1TVK A;  1AI4 A;  5DN6 G;  4GX5 A;  2JJ2 G;  1YSC A;  1R6K A;  1WA8 B;  1DGS A;  4FLZ A;  1XBL A;  2YC0 A;  3B4S A;  2P22 C;  3K9S A;  2F4V O;  1MZF A;  3L71 H;  4NB5 A;  3CD6 V;  1JJ2 U;  2ITC C;  2YS8 A;  1LUV A;  4DR2 B;  1SA0 B;  4XDL A;  1GN3 A;  1DLB A;  4P9P A;  1Y74 A;  2Q6A A;  4RQF A;  3VQX A;  2FL4 A;  4FIP C;  1HNW B;  1BL8 A;  2QR4 A;  5CA1 B;  2BCC H;  1O9G A;  4X66 B;  3LSS A;  2YI9 A;  2HLD G;  4U3J B;  4FFB A;  3OEH G;  4O2B B;  4LC1 A;  1GK9 A;  1DK1 A;  3N2G A;  2OCC B;  2YI8 A;  4JTD B;  4FLW A;  3CC2 V;  4NKG B;  2A0L A;  3G6E V;  4BW9 A;  4BIZ A;  4O4I B;  2CK3 G;  4MT8 A;  4O4H B;  4PA4 A;  5J2T A;  4B08 A;  3G6B A;  2VQE O;  1ZWI C;  1AIL A;  2EIL B;  1OZ0 A;  4FLU A;  5LXT A;  3MHS C;  2VS0 A;  4PJ0 Z;  4TV9 A;  2BTO A;  3OFN G;  4P9O A;  3SYQ A;  1JMK C;  5CA0 A;  3K58 A;  1FFX B;  2JIZ G;  4WFH A;  3L70 H;  1XHX A;  4IIJ A;  4EFB A;  2PYJ A;  3CJH A;  1OV9 A;  4UVC A;  3RYC B;  3HKD A;  4RAI A;  3SJA C;  4DV6 B;  1YJW V;  1XNQ B;  3S3X A;  4X65 B;  1IBL B;  1OCC B;  4LF8 B;  4YHH B;  4LFB O;  3K5O A;  3AK1 A;  1AJN A;  2LW7 A;  5LOV A;  3PJS K;  2EIL C;  1SQG A;  4TSF G;  3LSQ A;  3K0G A;  2BOC C;  4DR1 O;  1H8E G;  4KHP B;  2Q7G A;  2VRZ A;  1SF9 A;  2Q73 A;  3QO7 A;  3RYF B;  2QKA A;  4JYY A;  2UUC B;  2P4K A;  1Y4M A;  1H2S B;  2XTA A;  3JAT A;  1XHZ A;  2KQX A;  4D7S A;  3ZHT A;  4CZZ A;  1WN7 A;  5A2Q N;  5H6R A;  1XEQ A;  5BR8 O;  5FL7 G;  4X62 B;  1XOU A;  1VMG A;  3HKE B;  3OD4 A;  3QTC A;  3JYC A;  1JVM A;  1GH6 A;  2PZS A;  4LBE C;  1ZAU A;  5EC1 C;  1E1R G;  1X4T A;  2JS5 A;  2GSM B;  1IBK B;  1YJ9 V;  3OT7 A;  3ZRV A;  4E4E A;  4LF7 B;  3SYA A;  4LF5 O;  3R65 A;  4X1Y A;  5FPO A;  1FJG B;  3BFR A;  3P32 A;  3TK1 A;  4PDV A;  2ZCE A;  3VBB A;  4QJF B;  1Q7Y W;  4JF3 A;  3I5D A;  4QGP A;  1MA1 A;  1MG1 A;  4MTF A;  2QA4 V;  3SPH A;  1OHH G;  4IYH A;  2A06 H;  3DSQ A;  4JTA B;  2DQ0 A;  2X6C A;  4MVM A;  2P7T C;  4JI5 O;  4FLY A;  4J10 A;  4D6T H;  1F51 A;  1KKC A;  3ZN0 A;  4JI1 B;  2Y0P A;  4NYK A;  4N23 A;  1QR9 A;  4X8A A;  2LW1 A;  2HHH B;  5DM6 V;  2BE3 A;  4KL1 A;  4TQF A;  4PI0 A;  4ZKI A;  1GMG A;  5D5P A;  4QPJ A;  1SZT A;  2G38 A;  3ZCC A;  3IGA C;  2YSU B;  2F4V B;  1EM1 A;  1QHT A;  5B1B B;  3EXA A;  1NTM H;  1Z5W A;  2JS3 A;  3C3T A;  1WNS A;  3EFF K;  3ZMV A;  2DW4 A;  3ZBH A;  1HNZ O;  5CMU A;  1G1X B;  5B1A B;  4O4L B;  4QIW F;  4OGQ B;  1FPO A;  3JAL A;  4NXN O;  3U0Z A;  1U96 A;  3K03 A;  2ZXW C;  1I7F A;  2RN9 A;  2Q68 A;  1P4R A;  1Q82 W;  2OTJ V;  3ETG A;  1R3I C;  3CME V;  2DYR C;  2ZR3 A;  2WLI A;  4LR3 A;  2R9I A;  5JVD B;  3STZ C;  5A9G A;  4LCU C;  1RPO A;  5K1X A;  4UCV A;  5KMG B;  4GX1 A;  2OCH A;  2WSS G;  3TCU A;  4H0L B;  5LMU O;  5B1B C;  3K9A A;  1E79 G;  1N0N A;  3RGB A;  1AR5 A;  4I5S A;  1QLN A;  1WLE A;  2EIJ C;  1L8D A;  2LJ2 A;  1FXK A;  1H2G A;  3W7S A;  2VQE B;  4UCO A;  3KCX A;  2HG5 C;  3K0D A;  2F1M A;  4R50 A;  5D5Q A;  3ABU A;  2AGA A;  1HP8 A;  4JAS A;  1UFI A;  3AG2 B;  3RYI B;  1YVW A;  3FYI B;  4UB6 Z;  4O4J B;  3TJT A;  3F5T A;  4YY3 O;  2EJ7 A;  4JGS A;  5L3E A;  1V54 B;  2X6B A;  4R8C A;  2WLJ A;  2Q7H A;  3CCE V;  1F23 A;  3JSL A;  4LFB B;  2ZE5 A;  5KX5 B;  3T4D A;  5JH7 A;  5IT9 N;  2X0L A;  4QNH B;  2Q69 A;  3N27 A;  4CH6 A;  3G4S V;  2EZP A;  4YIP A;  4ZOL B;  1FXV A;  4DR1 B;  2IW5 A;  3OAA G;  2QGN A;  4DV0 O;  4O2A B;  3VQY A;  3AG2 C;  1I5X A;  1K4C C;  1Z2G A;  1MSW D;  3MHH C;  4J7Z A;  4UB8 Z;  4F6R A;  1BZK A;  5KHG A;  1YJN V;  4YJ3 A;  3ZRW A;  1SQX H;  1GM8 A;  2Y48 A;  2IU0 A;  1OCZ C;  2Q67 A;  5BR8 B;  1V54 C;  3ABM B;  3B2E E;  1TVK B;  1JJO A;  1RP3 B;  3RBZ A;  3JAR A;  2FTK A;  1MAB G;  4LF4 O;  3CYO A;  1YCI A;  2HVK C;  2UUA O;  3APQ A;  3MDS A;  4LF5 B;  1S72 V;  3SJC C;  1RM1 B;  1Y74 B;  2JGD A;  3E35 A;  3BAB A;  3I56 V;  5JJE B;  1VQN V;  2YEV A;  4LF9 O;  1I94 O;  3WG7 C;  1PKX A;  3UQ8 A;  5FNV A;  4J41 A;  2ZD9 A;  1AI7 A;  2CH7 B;  3OW2 U;  4JI5 B;  2MW2 B;  4UV8 A;  3A0B Z;  3ABM C;  2DN9 A;  4GCZ A;  2QJ1 A;  5EBW C;  1NT2 B;  5JCO A;  5CBH A;  1VQO V;  4BIO A;  2QTO A;  4YJ2 A;  1ZL8 A;  2PF4 E;  4MVO A;  1PM9 A;  3JAK B;  5EK0 A;  4D7T A;  3SR2 C;  3FB6 C;  1NVP B;  1I5Y A;  4NVP A;  4EB6 A;  1RM1 C;  1S0V A;  2E74 B;  5BY1 A;  5J2T B; 
#chains in the Genus database with same CATH homology
 2QM7 A;  5DN6 G;  4GX5 A;  2JJ2 G;  1YSC A;  1F4N A;  5EBM C;  1R6K A;  2H8P C;  4XDJ A;  3HB3 B;  4X88 A;  3B77 A;  2ZQM A;  1S5H C;  1DF5 A;  3AEI A;  3CD6 V;  1JJ2 U;  2XAG A;  4ASU G;  1OCC C;  2ITC C;  1OCZ B;  1KD1 W;  3LDD A;  4XDL A;  2P6J A;  3CC7 V;  1VQP V;  4P9P A;  1DLB A;  1XL4 A;  3DGE A;  2Q6A A;  4MTX A;  4UV9 A;  3BY6 A;  3E86 A;  4RQF A;  4WFB V;  1AJQ A;  4FIP C;  5GW7 A;  3CCJ V;  1YIJ V;  1BL8 A;  5B1O A;  3K06 A;  2YEV B;  1FS0 G;  2DWD C;  3ETD A;  1YI2 V;  1K3E A;  4JPR A;  3W7W A;  3LSS A;  2HLD G;  5CA3 A;  3ABK C;  3OEH G;  1IXM A;  2IJK A;  3STL C;  5IYD O;  2AHZ A;  4LC1 A;  2EZO A;  1GK9 A;  3OGC C;  2JEX A;  1Q81 W;  4PA3 A;  2OCC B;  4JTD B;  1NJI W;  4BAY A;  3WG7 B;  2LFS A;  3CC2 V;  2V7Q G;  4G27 B;  2P90 A;  1R73 A;  2A0L A;  3G6E V;  1TUE B;  2WLL A;  3AG3 B;  2LFR A;  5IYC O;  4BIZ A;  2CK3 G;  5LHI A;  3UM7 A;  1K97 A;  3WFV A;  1AI5 A;  2EJR A;  3D3I A;  4MT8 A;  4PA4 A;  3CXC U;  1ZWI C;  1JOY A;  1H8H G;  3ETE A;  1KP2 A;  2EIL B;  1OZ0 A;  2QM8 A;  2XAF A;  1XL6 A;  3D36 A;  1ORQ C;  1J95 A;  3E8F A;  3ZMZ A;  2QE7 G;  3LDE A;  4I9W A;  1UJW B;  2WWW A;  3MHS C;  1COW G;  4H37 A;  1DTO A;  1OCO B;  2KB1 A;  1VQ4 V;  5EBL C;  3OFN G;  3ASO B;  4P9O A;  3SYQ A;  3I55 V;  1M57 B;  2JIZ G;  3KG2 A;  2P67 A;  4WFH A;  5KUK A;  5HFM A;  2XAJ A;  4UVC A;  2QKS A;  4RUF A;  4RAI A;  1K33 A;  1VQ9 V;  1SER A;  3OUF A;  3SPI A;  1K73 W;  1YJW V;  1AI6 A;  4PDL A;  4RQE A;  1OCC B;  1CP9 A;  1H38 A;  3AG3 C;  1WPX A;  4MVR A;  3JD3 A;  3ABT A;  1S77 D;  4MS2 A;  1AR1 B;  5BZB A;  4JYC A;  3AG1 C;  1V55 C;  2JJ1 G;  1AJN A;  1GTO A;  1HWY A;  1S76 D;  3ABL B;  4L87 A;  1VQ6 V;  3PJS K;  3X2Q C;  3CCM V;  2EIL C;  3CP1 A;  4PDR A;  3GWO A;  1R6N A;  2EIN B;  4PA7 A;  4TSF G;  4QPK A;  5KUM A;  3LSQ A;  3M99 B;  3ML0 A;  3K0G A;  2BOC C;  1OCO C;  5HFL A;  1JPX A;  1PL0 A;  2DQ3 A;  2WLL B;  4JAU A;  2DWE C;  2R9R B;  1M57 C;  1H8E G;  1K5Q A;  2OTL V;  3QO7 A;  4DO2 A;  1Y4M A;  4MTO A;  2IH3 C;  3B8M A;  4PEL A;  3NXS A;  4RO2 A;  4CZZ A;  5B1A C;  1SES A;  4JTC B;  3SYO A;  1VQM V;  5H6R A;  4H33 A;  3JD1 A;  4BIU A;  5FL7 G;  2UXX A;  3T4Z A;  1S3J A;  3CCV V;  1YIT V;  4KUM A;  2B1G A;  3JYC A;  1JVM A;  5LGN A;  3JD2 A;  2V1D A;  1R3J C;  3T1C A;  4LBE C;  5LGU A;  3OMN B;  5B1N A;  3ABL C;  3A0R A;  5EC1 C;  1E1R G;  3K04 A;  2GSM B;  1YJ9 V;  1BHB A;  3ZRV A;  2EIN C;  4MSW C;  3SYA A;  5LHG A;  3R65 A;  1EFR G;  1ROP A;  3P32 A;  3TK1 A;  4PDV A;  3VBB A;  4QJF B;  1Q7Y W;  1YTF D;  3RVZ A;  4JF3 A;  1PNL A;  1EZJ A;  3F5W C;  3DTU B;  3W7U A;  1MG1 A;  1BHA A;  4MTF A;  3OE7 G;  1CEZ A;  2QA4 V;  3SPH A;  2C2A A;  1OHH G;  2HVJ C;  2XAQ A;  4PDM A;  2IJJ A;  4JTA B;  2GHY A;  2DQ0 A;  2X6C A;  1NR7 A;  4JAV A;  4MVM A;  2P7T C;  4MVZ A;  4OXS A;  4BW5 A;  2QEX V;  5L3B A;  4WFA V;  1JCH A;  1F51 A;  1P7B A;  4Z1M G;  1NQT A;  2JEU A;  3ZN0 A;  2LP7 A;  4GT1 A;  1QR8 A;  3E2E A;  1W0J G;  3AG1 B;  1V55 B;  2JK5 C;  4N23 A;  1QR9 A;  4X8A A;  1W0K G;  1K4D C;  1RPR A;  1JQ0 A;  3LUT B;  3E89 A;  3QO5 A;  3X2Q B;  4UXN A;  3RW0 A;  5DM6 V;  5IDJ A;  3SPC A;  3ASN B;  3QO8 A;  3F7Y C;  2XAS A;  4ZKI A;  1GMG A;  3ZIA G;  4QPJ A;  1SZT A;  1GM7 A;  2OT5 A;  2AHY A;  3SYP A;  1SRY A;  3ZCC A;  2WLH A;  3IGA C;  2YSU B;  2ZDI C;  2WLN A;  1CPY A;  3E8B A;  3LNM B;  2ATK C;  5B1B B;  1K34 A;  1Y66 A;  3FB5 C;  3LDC A;  4GX0 A;  4U7O A;  3EFF K;  1GKF A;  3ZMS A;  3ZMV A;  3CCR V;  4E2L A;  1N8R W;  1FFT B;  2DW4 A;  4FK5 C;  5CMU A;  1THZ A;  3CMA V;  1GO3 F;  5B1A B;  5L3C A;  1KC8 W;  4YXW G;  4QIW F;  5L3D A;  4ZBM A;  3FYE B;  4MTG A;  1YTF B;  4DXW A;  4GX2 A;  4FJC C;  2WPD G;  5CN0 A;  2ZDI A;  2M7W A;  2ZXW C;  3K03 A;  3CCL V;  2Q68 A;  1P4R A;  1Q82 W;  2OTJ V;  3G71 V;  3ETG A;  1R3I C;  2W0F C;  5E1A C;  1KP3 A;  4JYB A;  3MD0 A;  5EC2 C;  3UKM A;  3CME V;  4WF9 V;  2DYR C;  2ZR3 A;  2WLI A;  2R9I A;  1KEC A;  5KA5 A;  3STZ C;  3ASN C;  3OEE G;  4R6Z A;  2JDI G;  4LCU C;  1M56 C;  1RPO A;  1VQ8 V;  3CCS V;  1QCE A;  4GX1 A;  3TCU A;  2A9H A;  2WSS G;  3ZJZ A;  1NH2 D;  2H94 A;  1GM9 A;  5B1B C;  1PD3 A;  1PNM A;  3K9A A;  5J9P C;  4WFE A;  3H01 A;  5C93 A;  1E79 G;  2W6I G;  4I5S A;  4RUE A;  1QLN A;  1WLE A;  2EIJ C;  2Y69 C;  3CPW U;  3P30 A;  3W7X A;  1SET A;  1KQS U;  1QLE B;  1FXK A;  1H2G A;  3W7S A;  4PA9 A;  2HKO A;  4U7N A;  3RVY A;  2HG5 C;  3ZRX A;  4FPP A;  1K7D A;  3K0D A;  2DYS B;  5LGT A;  4R50 A;  2WLM A;  4N21 A;  4KP4 A;  2ITD C;  3ABU A;  5LBQ A;  2F43 G;  3AG4 B;  1ENV A;  2WLK A;  4XDK A;  1G4Y B;  1EBO A;  1F4M A;  4JAS A;  3AG2 B;  4P2Z A;  3CCU V;  4UVB A;  3JD0 A;  1FXH A;  1NR1 A;  3FYI B;  3SYC A;  3IC7 A;  4Q20 A;  2WAM A;  3E8G A;  5H6Q A;  4JGS A;  5L3E A;  4WCE V;  4J9Y B;  1V54 B;  2X6B A;  4R8C A;  2WLJ A;  1ARO P;  1PNK A;  4PA6 A;  3CCE V;  3B8N A;  1KKD A;  2BOB C;  2NNU A;  1F23 A;  1LNQ A;  3FB7 C;  5CBF A;  1VQ7 V;  2WLI B;  2W6J G;  1QLE C;  5L3G A;  2Z3Y A;  1NH2 B;  2X7R B;  4WFF A;  5KA6 A;  2IH1 C;  4EKW A;  4HZ3 A;  3T4D A;  2ZXW B;  1QBZ A;  2X0L A;  2DYS C;  4QNH B;  1VQ5 V;  4MW8 A;  2Q69 A;  3G4S V;  5IY5 C;  5CBG A;  2EZP A;  2XOK G;  2B1I A;  2ZR2 A;  3IFX A;  1FXV A;  4MVU A;  3AG4 C;  2IW5 A;  4LP8 A;  5B3S C;  3OAA G;  4G28 B;  3E83 A;  2DYR B;  1B6Q A;  4F4L A;  2MK3 A;  3CC4 V;  3AG2 C;  3OM3 B;  4FMT A;  2IJH A;  1I5X A;  5H9C A;  1K4C C;  1FXK B;  3OR7 C;  1MSW D;  3MHH C;  3BEH A;  1M56 B;  4KFM A;  1YJN V;  3ZRW A;  3ZRS A;  5IYB O;  1GM8 A;  1M9N A;  2Y48 A;  4G2K A;  2IU0 A;  1BMF G;  2Z5U A;  3GB7 C;  1L1F A;  1OCZ C;  2Q67 A;  1QVF U;  3K79 A;  1V54 C;  3ABM B;  3OMI B;  1M1K W;  4MW3 A;  4XBF A;  4CBC A;  4TWK A;  1YHQ V;  1K92 A;  1NVP D;  2EIJ B;  3HPL C;  2Y69 B;  1OCR B;  1NBM G;  3TET A;  3RBZ A;  3ZMT A;  2EIK B;  3ZMU A;  2UXN A;  2HR3 A;  3EHB B;  2FTK A;  4MVQ A;  4QE9 A;  1MAB G;  2EBO A;  3ZN1 A;  3CYO A;  2EIM B;  3K08 A;  4MVS A;  1M90 W;  3VOU A;  3W7T A;  2HVK C;  3F7V C;  1R3K C;  2XAH A;  1MOF A;  3E8H A;  1S72 V;  1QVG U;  4UUJ C;  1RM1 B;  2IJI A;  3OMA B;  3JCZ A;  1K8A W;  1JX9 A;  3E35 A;  5L3F A;  4HAM A;  4WFG A;  3I56 V;  3JD4 A;  2HJF C;  1VQN V;  3OUS A;  2XND G;  2YEV A;  2K1E A;  1FXK C;  2X6A A;  2OCC C;  3WG7 C;  2A79 B;  3SJQ C;  1PKX A;  2B5U A;  1G8M A;  2PI5 A;  2ZD9 A;  3SPG A;  1AI7 A;  3OW2 U;  1R3L C;  2NLJ C;  4UV8 A;  3ABM C;  4GCZ A;  1K5S A;  1E1Q G;  3OR6 C;  4J9Z B;  5EBW C;  1W2B U;  5CBH A;  3T2M A;  1Q86 W;  1VQO V;  1VQL V;  1OCR C;  3K3W A;  1AJP A;  2QTO A;  2EIK C;  3FKS G;  4UVA A;  1K9M W;  4MVO A;  4HYO A;  2EIM C;  4X89 A;  5EK0 A;  1NKD A;  3FB8 C;  4P30 A;  2HFE C;  3SPJ A;  4TT3 G;  3ABK B;  3FB6 C;  3ZRW B;  1VQK V;  4R7C A;  1NVP B;  3QNE A;  4QE7 A;  2D3O W;  3ASO C;  5IY5 B;  2PI4 A;  1I5Y A;  5LHH A;  1DF4 A;  3CCQ V;  1RM1 C;  2IU3 A;  1S0V A;  5B3S B;  1AI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...