3CC7V

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cc7V00
1VQ5V 4WF9V 3CCLV 2D3OW 1JJ2U 3CCSV 1VQLV 3CCQV 3G4SV 3CCJV 1YHQV 1Q82W 1VQOV 1KC8W 3CD6V 4WFBV 1N8RW 1K9MW 1YJ9V 1YIJV 1QVFU 3CCMV 2QA4V 3CMAV 3OW2U 1YI2V 1Q7YW 1QVGU 1M90W 1KD1W 1VQ9V 3CPWU 3CCEV 1K73W 1Q81W 3CCUV 3CC2V 1VQKV 3CXCU 4WFAV 1VQPV 3CC4V 1Q86W 1K8AW 1KQSU 3G6EV 1VQNV 1VQ7V 1S72V 1M1KW 1VQ4V 1VQ6V 1YJNV 1NJIW 3CMEV 4WCEV 1VQ8V 1VQMV 3CCRV 1YJWV 5DM6V 2OTJV 1W2BU 1YITV 3G71V 3CCVV 3CC7V 2QEXV 3I56V 1R73A 3I55V 2OTLV
chains in the Genus database with same CATH superfamily
4PHZA 4D7TA 1HP8A 4X1KA 3ZS8C 1AVMA 1S5JA 4LF4B 5B5EZ 1Y76B 4KP4A 4X65O 1NZ6A 3DC6A 4NXMO 4BW5A 5LGUA 2IW5A 2GUZA 1Y74B 2WAMA 4JI0B 4O4IB 5KX5A 2WWWA 4PA9A 2ILMA 4X8AA 2CTPA 2XAFA 3CCSV 4GUNA 1V55B 1AI4A 3D3IA 3ZHRA 1D2DA 4YJ2A 2PYJA 4LF5O 1XQ8A 4LFCO 1QU7A 5LMUB 2ETNA 5J2UA 3ZBHA 4O4LA 3VQWA 2E76B 1W2BU 2HLDG 1OCCB 3CCVV 2QEXV 3QO8A 3GWKC 4JAUA 4DK1A 3DGEA 1XL6A 3TXQA 3F5WC 3P30A 1KKCA 1EM1A 2E75B 1HWYA 2RMKB 1K8AW 2W6IG 2VQEO 4JI8O 5L3DA 1VF5B 3JAMN 2ZDIC 1K4DC 2HVKC 3SR2C 3T2MA 1BQZA 1O9GA 5LXTB 2GHYA 4DR1O 5FPRA 3CMAV 1Q7YW 5LHHA 3K9AA 2ATKC 5LA6A 4FLXA 2JJ2G 1VQNV 2GDSA 2X6BA 3HKDB 5LP6C 1AJQA 3CCRV 3K5OA 4FLZA 5IYCO 3A0HZ 4IHJA 2UU9O 3A2FA 5L3FA 2YI8A 3ZX6A 1TVKA 3ETGA 1BCCH 2HVJC 2Q67A 1P7BA 1Y67A 4Z1MG 1XREA 4IYIA 4X1KB 1N33O 3DTUB 5IE9A 3AK2A 2ADPA 3TCUA 4I50A 1M5IA 3HR0A 4PA6A 2GUZB 4JI1O 1E1QG 5KX5B 3NXSA 4LBEC 4GKJB 2K1EA 2D2CB 3VQYA 4GCZA 4YY3O 3ABLB 2QA4V 3VOUA 3HKCA 4MTXA 2XHBA 2JEUA 1SS3A 4DUZB 1VQKV 4KHPO 5C93A 4YJ2B 5KA5A 1H2MA 1BS3A 2LW7A 3F7YC 3MD0A 5J2UB 4X62O 4O4LB 3RN4A 2QJ1A 3E8BA 3CD6V 2QE7G 4JYYA 4XDLA 1VARA 2PGGA 3J81N 1NTZH 1ZTEA 1DLBA 1HDJA 2F93B 4UVAA 1HNXO 1KP3A 4UXNA 4B3SO 2IBZH 2QSAA 1BE3H 4WCEV 3VBBA 1G8MA 3L9DA 1N34B 2EIJB 4PDMA 1EFRG 1SRYA 2QKAA 3FX7A 3PJSK 1VQLV 1YHQV 5BR8B 4DR2O 3KKYA 4EFBA 2FL4A 3K5NA 1K73W 3IGAC 4OPHA 4FIPC 3LDCA 3P3PA 2AGAA 4J80A 2VRZA 4O2AA 4WFGA 5LA6B 1SZXA 4UCRA 1WP8A 3E8GA 3H01A 4JI2B 2QKCA 3SJAC 3B4SA 4IHJB 2PYLA 4LF6O 3OW2U 2BSKA 2ZIOA 1K5QA 2HP8A 1TVKB 4P2ZA 4LF6B 5L3GA 1N0NA 4B3TO 3AG3B 4X66O 5BY1A 4I50B 5A2QN 1CP9A 4JAVA 1D5AA 4JV5O 4K0KO 2JIZG 5H9CA 4LF8O 2OIEA 1S77D 1JJOA 5EIBC 1KECA 4NR1A 1K7DA 1NR7A 3DSQA 3ZRVA 2ZINA 3HKCB 4LNUA 2UUBO 4DR6O 3K3WA 3AK1A 4J7KA 2UUAO 1ROPA 4CH6A 5B1BC 4DR7O 4WF9V 1XUQA 5LMNO 4IIJA 1VQOV 2GSMB 5FNVA 2JK5C 4D7SA 3K57A 4JI4B 1MOFA 4DR4B 5F2VO 1KB9F 2BOCC 3FB6C 5L3EA 3AK3A 4LH7A 4PI2A 1GAXA 1KQSU 3LSQA 2DN9A 1F4NA 5KAFZ 1Q43A 3OM3B 1IXBA 1PNKA 3E2EA 2LFSA 1XBLA 4UVBA 1OCZC 2Z0AA 3EVKA 3BAAA 4ZIBA 5JQGA 4ZHQA 2YXYA 1AP5A 3E8FA 2YI9A 3BY6A 1RP3B 2EULA 1S3JA 1NVPD 1R6TA 3H1KH 4A5UB 4I0XA 1YJWV 1XILA 2YIDA 5CBFA 1SA0A 1K3EA 5JJEB 5BMVA 4O2AB 4WFHA 3RYHA 3LSSA 3AG7A 1OV9A 4PJ0Z 4H37A 1PNLA 1MSWD 2XASA 1YZBA 2VQFO 4JZGA 1P84F 2BSKB 2WLKA 4JTDB 2QM4A 4R7CA 4QPJA 5GW7A 1UFIA 1YXBA 2ZXWB 1SQPH 1V55C 3U0ZA 4ASUG 3BA9A 4Q6GA 2QGNA 3K0DA 2Y4UA 4EEQA 2ZE8A 3SYPA 5FPOA 3CSXA 2Z5UA 4LNUB 1VQMV 4I9WA 3G80A 4F6EA 2WA4A 5KUMA 4PA3A 3ZHUA 5C8YA 4PD4F 3RVZA 3QG5A 1IX9A 1FJGO 1NVPB 4ZOLA 3BPZA 1FFTB 2H8PC 2P67A 2IU0A 3CCMV 5KHJA 4DV1O 2NR5A 4IIJB 5FNVB 2W6JG 3DXRA 1BHAA 1WA8A 4JI6O 1N36B 3AG2B 3HKEA 4J10A 2ZCEA 5AG2A 1YCIA 3W7TA 4JYCA 2P4KA 1PD3A 1NU1H 1WAZA 3L70H 1B04A 1H2GA 3ZHSA 1UJWB 3QNEA 1DGSA 2UXCB 1GM9A 4O2BA 2XTAA 4MVQA 5JQGB 4ZHQB 1IBMO 2ZE7A 4W4KA 1R6NA 1KKDA 4FJCC 1BQ0A 4UUJC 5EYPA 4DV4B 4I0XB 2H94A 4Q20A 1SA0B 1TA8A 5BMVB 4BIOA 3RYHB 1GN4A 1ZX3A 1CEZA 1BSMA 1JX9A 1JQ0A 4UVCA 3L72H 1VP7A 1IURA 3TETA 4K8XA 2AHZA 1Y66A 4KUMA 3CX5F 1XMQB 2EX3A 1EN5A 4DV2O 2KKWA 1Q6IA 2AHYA 2JJ1G 3QO5A 4FM1A 4RUFA 5JWPA 2Q6AA 3OGIB 4I55A 5IYZA 4FM0A 5H6RA 1YJNV 1L0LH 3D3QA 3B09A 2B1GA 2YS8A 1BZKA 1I94O 2PTMA 2QWQB 1R3IC 1JMKC 1RSOA 3P32A 4WBNA 4DV7O 2O57A 4CH3A 2EZOA 5C8YB 1Q5OA 2GV9A 3OUSA 1SZTA 4ZKIA 4ZOLB 2BTOA 3KCYA 1FKAO 1WNSA 2EIJC 3K0GA 1XNRO 3CYOA 1IVSA 3L74H 3DXRB 1H2NA 5IJ9A 1WA8B 4UCSA 3RVYA 2P6JA 5B66Z 4PDRA 4IYHA 2B9ZA 3HKEB 2DQ3A 2CE4A 4UB8Z 1M4UA 3JD3A 4QIWF 3HKBA 3OMAB 5B1BB 2KG7A 4FLYA 2KQXA 2M6YA 4O2BB 4DV6B 4R50A 2A7WA 1AROP 3A0BZ 1J5EB 1VQ5V 2EJRA 1H2SB 5EYPB 4JF3A 2UXNA 5IWAO 4DV0O 4GX5A 4NTWA 3AG3C 4NYKA 1MMMA 1OCZB 3JARA 4DR5B 1FXKA 1AR4A 3SJQC 4BW9A 3TXSA 3AG4B 2JEXA 4UB6Z 1HR0B 1FXVA 1H8HG 1XI1A 2WLNA 5KAIZ 2L35A 3JYCA 3CCJV 4NVPA 5KUKA 1XMOB 1QLNA 1QVGU 2PY5A 3SJBC 2RQ6A 1DTOA 1G6UA 1M93A 3SDLA 1N32O 4X65B 4NXMB 2RNBA 3JALA 1M57C 3ICXA 5LOVA 4I55B 5IYZB 2Y69B 1SC5B 4WFFA 4P9OA 4FZ0A 3ABKB 2K9PA 4I9QA 2E5LO 1JOYA 1L1FA 1RSOB 3ZMSA 4WBNB 4YXWG 3OMIB 1W0KG 5JVDA 1I7FA 4LF5B 3BVOA 4JTAB 3T4DA 4X9QA 4LFCB 4MS2A 3ZMZA 5IJ9B 3B2EE 4FM2A 5K1XA 2YIBD 3F7VC 4EFEA 2OCCC 1ZUQA 2QWOB 3HKBB 4KXRA 4MTGA 2P90A 2KG7B 4JI3O 1XNQO 2LO1A 2VQEB 4TV9A 3BA8A 4JI8B 2V4DA 3CCQV 1UPGA 4DUYO 2QM7A 3STLC 2ZIMA 1FYJA 4QGPA 1AI5A 1V9PA 5LGNA 1LUVA 2ZXWC 4DR1B 1SQFA 2KSDA 2OYQA 4UCTA 2HJDA 3JARB 1FXKB 2UXBO 2CTWA 4NTXA 4GKKO 1ENVA 2Q8VA 4B3RO 3ML0A 4HBNA 3OR6C 3CCLV 1AJPA 4G2KA 1YIJV 1QVFU 1US6A 2UU9B 4JASA 1BT8A 1R6KA 2Q4PA 1M90W 1WB8A 1PPJH 3K58A 4X1IA 4CH5A 4DV5O 4U7NA 1N33B 4RUEA 1VMGA 3OTFA 1FS0G 4GX1A 1R3LC 1PKXA 1R73A 3JALB 4FMTA 5CBGA 5LOVB 1GMGA 5E1AC 1QR8A 2VWKA 1AILA 3E8HA 4I7ZB 4JI1B 3W7XA 3AG2C 1QCEA 5HFMA 1IZ3A 2JS3A 4B3MO 4JZ2A 4YY3B 4CZZA 2HKOA 1H8EG 3FD9A 2ITDC 5JVDB 3M99B 4YHHO 4KHPB 4JGSA 3JASA 1DK1A 2FKXA 2Q7EA 1SQVH 2BCCH 1WPBA 2LGWA 4FLWA 1W59A 4X62B 4FZ1A 2EIMB 1CXZB 1XL4A 5EK0A 4OGQB 1JVMA 1Z5WA 1HNXB 2F4VO 4B3SB 1RPOA 4WFEA 4MVSA 5EBLC 1VQ7V 2QTOA 4TV9B 3SPJA 1N8RW 4J42A 2ZR2A 3JSLA 3SYAA 4YJ3A 4DR2B 1Q86W 4JPRA 5LHGA 2XNDG 3JD2A 2C2AA 1KU9A 4LF7O 1M9NA 3FAVA 4J9YB 5CA0A 1KYOF 1IXMA 1HNWO 4FK5C 1GN2A 3LDEA 4X89A 3W7SA 1GKFA 1RM1B 3T1YO 2A06H 2WLJA 4AQYO 2EBOA 3CP1A 1ZWIC 4X1IB 4KFMA 2ZM6O 2X6CA 1P4RA 4JYAO 4L87A 5KMGA 3OE7G 4B3TB 4U7OA 4X66B 3CE2A 3K08A 1L8DA 3JAWA 4JV5B 1O9HA 4K0KB 3OFNG 2EILC 4LF8B 2XAHA 4H13B 1W0JG 1M1KW 1IBLO 1GN6A 2UUBB 3H1JH 4DR6B 1LNQA 2OT5A 4GYCB 4H0LB 3AG1B 4HNAA 3JASB 1M57B 5JH7A 3BCCH 2UUAB 4QPKA 4DR7B 3X2QB 1M56B 5LMNB 2YICA 3M8AA 1QR9A 1THZA 1YEWA 4J7JA 3OR7C 4GLXA 3ZCCA 1X4TA 4FPPA 4B7KA 4AHCA 4W4LA 2HEPA 2IH3C 4B08A 4CC6A 3G4SV 1FPOA 2RCVA 3WB2A 3CRAA 1GN3A 4OXSA 3PN1A 3AG4C 1OZ0A 4N21A 3ASNB 3G6EV 3E83A 3SJCC 1PM9A 2OCCB 4FFBA 4YJ3B 1AR1B 1SERA 4GX0A 1NR1A 1I5XA 3ZHTA 2N05A 2CUGA 2W0FC 1MNGA 3K5LA 1G1XB 1IBKO 1I5YA 4TSFG 4EKWA 1P49A 3FAVB 5CA0B 4PA7A 4Z1VA 3CEIA 1SESA 3CJHA 3SPHA 3SGIA 4QE9A 2FYUH 1AI7A 1YVWA 2Y69C 4NKGB 3CXHF 3H1LH 3M7MX 1JR9A 3N2GA 2DYRB 1S72V 4TQFA 3ABKC 2VQFB 4LH6A 1R3JC 1OHHG 3E35A 5KMGB 4WFBV 1YJ9V 2BTQA 4I4TA 1NTKH 3JAWB 1URFA 1Q8IA 1PL4A 5B1OA 1VF6A 2CDYA 3CHXA 1WJZA 3UT5A 4K3AA 3W7UA 4N23A 4DR3O 1Q6HA 3ZN0A 4TT3G 3T4ZA 4PA4A 3J7AU 4BWAA 4LFBO 4FLTA 4HNAB 1GK9A 3TGUH 5JH7B 4X64O 1FJGB 1I0HA 1EZJA 2YXLA 2B1IA 3JATA 2KB1A 3EHBB 3QTCA 1F23A 4DV1B 4NXNO 4UV9A 2NLJC 4MT8A 4JI6B 5BXZA 1Y4MA 2FTKA 4MW3A 3OGCC 3K03A 2HJFC 1T5EA 1ZAUA 4BIUA 4LF9O 2Z3YA 2F23A 1FXKC 4J9ZB 2P4VA 2WPDG 2XUMA 2N04A 2X7RB 4DO2A 1NJIW 4OX9O 2B5UA 4RWUA 1VQ8V 1IBMB 3EXAA 2P06A 1FD9A 2R9IA 1DF5A 2UXDO 1QNMA 1CPYA 4FFBB 3EFFK 3HPLC 4ZBMA 3BEHA 3MDSA 1PP9H 3WB0A 2QTSA 1OCOB 2V7QG 2XAGA 3ZJZA 3SPCA 2WLHA 1KD1W 1PL0A 4BR6A 1SQXH 5LBQA 3S3WA 2EINC 3CJHB 2MK3A 4HZ3A 3JAKA 5LYJA 1K34A 1LUWA 3O65A 4MTFA 5B3SB 2A79B 1NS1A 1N4CA 3E89A 3N2GB 3K59A 1KP2A 2FMLA 3T1HO 1EZVH 3ZEDA 5B1AB 1Q82W 3IJ4A 2QWPB 4KL1A 1X59A 2YDEA 4DRXA 4DV2B 1KUQA 3LUTB 5J2TA 2ODMA 2HHHO 2BTQB 4I4TB 4XDKA 3OTOO 2X6AA 4F4LA 4TQDA 3UCSC 4MVUA 1JCHA 3FB5C 1H2KA 2NNUA 5H2FZ 4IGGA 3Q4HA 2WLMA 3B8NA 4OPAA 1MZFA 1B06A 1L0NH 1XOUA 5GTIZ 2EIMC 3UT5B 4IL6Z 4RO2A 1I94B 3CRRA 1B3QA 4E4EA 4HAMA 2IU3A 4MSWC 5FL7G 4DV7B 1OCRB 3CCUV 3BABA 3MHSC 2XAQA 3LNMB 1K92A 1NBMG 3HB3B 1YF2A 2EILB 1EBOA 3JATB 1XNRB 5EC2C 4JI5O 3BFRA 2Q68A 5K1PA 4JAAA 4ZI7A 5CA3A 2Q0OC 2ARHA 1KBHA 4JYBA 3ZRWA 2YIAA 3CB2A 3ZN1A 2DW4A 3LDDA 3CC7V 1HNZO 2CTRA 4ICGA 1RM1C 3IAYA 1VF7A 2PF4E 4DV3O 4DXWA 2LW1A 4LWSA 3ASOB 3GB7C 1YI2V 2UUCO 4GZRB 5KLVH 5IWAB 4DV0B 2XAJA 3CC4V 1E1RG 2LGQA 4TOIA 3SYCA 2Q7HA 3CRQA 1YITV 1S76D 5LYJB 3JAKB 1ZSPA 3ZRXA 1AP6A 4CBCA 5D5PA 1GRJA 4TUYA 2QDOA 5CA1A 1Q6UA 2AZ2A 3CPWU 2BE3A 3APQA 5B1NA 4C7UA 4LFAO 2YIBA 4DYLA 4K8ZA 5KHIA 2G38A 3UO3A 4DRXB 2OCHA 1GTOA 1VQ4V 3AG1C 5J2TB 3L75H 1VEWA 2R70A 3BRCA 2EJ7A 1BL8A 4UCUA 1H2LA 1R3KC 1N32B 4U3JA 3N2KA 3RYIA 2PUSA 3X2QC 3Q4HB 1M56C 1QHTA 4LF4O 1SF9A 1ORQC 2IJHA 5E79Z 4CS3A 4JI0O 1F7YA 2E5LB 5LHIA 2EIKB 3UO2A 1N0JA 1OJHA 4UV8A 3MAQA 1MABG 2DYSC 4TWKA 4DK0A 3SPIA 1SQQH 2CGNA 2GBOA 1QQCA 3WFVA 4RQEA 2JDIG 3ASNC 1MA1A 3R66A 2JRIA 5LMUO 2Q73A 4U3FH 1COWG 2YC0A 1VQ6V 2P22C 2WSSG 2ZR3A 1TUBA 4BAYA 5KHGA 4ZI7B 5GTHZ 5L3CA 4JI3B 3ZRWB 4QJFB 1XNQB 2AXTZ 3UM7A 3CRCA 1NH2D 1SETA 2IM9A 4MW8A 2DYRC 1GM7A 2WA3A 4DUYB 3FYEB 2ZT9B 4LWSB 4XDJA 1AR5A 3GVMA 5EZYA 2JS5A 1Z2GA 5HFLA 4Z2WA 3I55V 3FFQA 5IY5C 1XHZA 2UXBB 2F43G 4GKKB 4MVRA 2X0LA 4B3RB 3RW0A 3F5TA 4TUYB 5CA1B 2DE0X 3RYFA 1TAEA 5CN0A 3C90A 5IJ0A 5JJJB 2Q69A 3CMEV 1WLEA 3N27A 2R72A 2BOBC 4DV5B 4PELA 2EINB 3WG7B 4R6ZA 4XBFA 1JPXA 4U3JB 3KG2A 3N2KB 1J95A 3RYIB 4D6TH 2LP7A 5KA6A 4P30A 3VQXA 4J11A 2YUAA 2YXHA 4B3MB 1WPXA 2CAZC 4UFZA 1NH2B 4GKJO 4B7EA 3C3SA 1V54B 3UKMA 3H9VA 4YHHB 4X1YA 3RBZA 4FLUA 4PV1B 4TV8A 1R1BA 1MG1A 2YSUB 3ZMVA 4DUZO 4QNHB 3L73H 2MW2B 2DMXA 3OD4A 3L71H 4LP8A 3IFXA 2VWJA 1EN6A 2FB5A 1H38A 1OCOC 1FFXA 2A3QA 1TUBB 3U11A 2Q5ZA 4J41A 2F4VB 3T1CA 4GT1A 2HG5C 4AILC 1Q90D 1RFYA 5B3SC 2E3CA 3K79A 3TK1A 1N34O 2LQTA 1U96A 2QWRB 1HW7A 5B1AC 2PI5A 5BR8O 5EZYB 2PI4A 4O4HA 4YIOA 2JGDA 4LF7B 4FVMA 3SYOA 4X20A 2HFEC 4QE7A 3THOA 3TJTA 2A0LA 3SPGA 1HNWB 1VF6C 1TUEB 1YDXA 2DQ0A 1NKDA 5IDJA 1G4YB 3T1YB 3RYFB 2CGOA 4AQYB 3MHHC 4JI2O 5TISZ 5IJ0B 5KHKA 2ZM6B 1YTFD 3DC5A 4R8CA 5JJNB 1OCRC 4NB5A 3RFRA 2ZDIA 3JD0A 3K5MA 3P3NA 2CK3G 1RPRA 1EN4A 4JYAB 3E22A 2Y0IA 3RT3C 3APOA 4I5SA 4IT5A 3CRMA 1B6QA 1NQTA 1YSCA 2OWOA 3RYCA 3I5DA 3ETDA 5H5NA 3ZMTA 2RN9A 2W0XA 3JCUZ 2XT9A 2RDCA 5LP6A 1QLEB 1IBLB 1F4MA 4O4JA 4X1YB 1P7GA 3QO7A 4TV8B 1AB3A 3OT7A 2Q0AA 3K9SA 2L6LA 1VIBA 4RAIA 5J9PC 3ASOC 2UXXA 5KHHA 1GH6A 1BGYH 4H33A 4JI4O 1FFXB 4DR4O 4BIZA 2DYSB 1KC8W 1GO3F 3FB8C 2Q7GA 2GTAA 3H1HH 2DWDC 2ZD9A 4HYOA 5D5QA 4GX2A 3B77A 3BHPA 3ETQA 4J7ZA 1YTFB 3OUFA 1MZEA 1WN7A 2ZE5A 3ABTA 3ABMC 2A9HA 2YEVA 2ADQB 3NR7A 5JCOC 4JTCB 1S5LZ 1SQBH 2CTQA 4FLVA 3D36C 4O4HB 3U10A 2JGDB 1IBKB 1Y6XA 2IJIA 3CXCU 2F1MA 4X20B 3QVNA 5ITZA 1JFFA 3RWRD 3B8MA 3FYIB 5EC1C 3W7WA 3ZMUA 2ZKOA 1GM8A 2CH7A 2EIKC 4E2LA 4PDLA 4H44B 5IY5B 3E22B 1D5NA 5IYDO 3JCZA 3WU2Z 4L8JA 3G6BA 3C3TA 4G27B 2Y0PA 5DM6V 4YIPA 3RYCB 1K4CC 1JJ2U 5DECA 5LP6B 4EB6A 4DR3B 1K9MW 4K35A 4P9PA 2WLLA 1K97A 3CCEV 4O4JB 3D8CA 3SYQA 1OCCC 3CC2V 4LFBB 1VQPV 3K04A 4PI0A 1PV0A 2ITCC 4X64B 3OAAG 2F66C 1XDCA 5GONA 4NXNB 2QM8A 4DW1A 2P5OA 5CB4A 3A0RA 4CS4A 2Q9LA 3E86A 3H1IH 1N36O 1VQ9V 2LJ2A 3LNNA 3KCXA 4CS2A 3STZC 4LF9B 2ZQMA 4RQFA 4FFKA 1E79G 1AJNA 1XHXA 2H3OA 5H6QA 1NI8A 2QWNB 5EBMC 3CWBH 1PNMA 4OX9B 3AEIA 2UXCO 4MVOA 2EZPA 5CMUA 3ZHQA 2YEVB 2UXDB 1I08A 4F6RA 1FXHA 2ZNIA 3JD4A 3RGBA 1ZL8A 3OEEG 3IC9A 3WG7C 1LR1A 4DV4O 1U97A 4PDVA 5EBWC 4CC5A 4MVMA 5ITZB 1JFFB 2JVDA 1IDSA 5EIBD 2D3OW 5IYBO 5LGTA 3WB1A 1NT2B 1JA8A 5JCOA 1SKVA 3T1HB 2Y48A 2Y4TA 1SQGA 5CBHA 1Z5VA 5DN6G 2CH7B 3D36A 2E74B 2VS0A 5DEDA 1V54C 1S5HC 5IT9N 2WLIA 3VQVA 2DOSA 2GTSA 2XOKG 1XMQO 2ZNJA 3ZRSA 2HHHB 3OTOB 2OTJV 3A8TA 4NTYA 3ABLC 1WP7A 4JI7O 2LFRA 4JI7B 1Y76A 3LSUA 3G67A 3JSNA 4MVZA 4CH4A 1BMFG 5BZBA 1Y74A 4EB6B 4X88A 1AI6A 3ZHVA 1Q81W 4O4IA 4WFAV 2HR3A 3GWOA 4ABMA 2WLLB 3IC7A 2PZSA 2QKSA 4AI8A 5FLXN 3G71V 2IH1C 2JGUA 2R9AA 3I56V 2M7WA 3OEHG 5GONB 3S3XA 2F95B 1S0VA 4JI5B 5CB4B 4DW0A 3R65A 3KZIZ 3ABUA 2IJKA 2DJVA 3K06A 2DWEC 1TGOA 2AZ0A 1K33A 5A9GA 3CS5A 2V1DA 1HNZB 1ZLZA 1WB7A 1MSDA 1FAFA 2NN4A 2AW9A 4DV6O 4DV3B 1BHBA 1XEQA 4F6RB 1QBZA 5L3BA 2UUCB 2N74A 3FKSG 1F51A 1ZL8B 4UCVA 1J5EO 4LCUC 1K5SA 2IJJA 4LC1A 5LXTA 2OTLV 5LL6Y 1KMIZ 3O9OA 3ZIAG 3JD1A 3J80N 1A32A 4DR5O 2RJZA 3ABMB 2ZE6A 3OMNB 3UQ8A 3QF7A 1Q3EA 2QR4A 3B40A 1DF4A 4UCOA 3HKDA 3FB7C 4LR3A 1QLEC 1HR0O 2P7TC 1NTMH 2R9RB 3ETEA 4MTOA 4LFAB 2OIGA 2WLIB 4G28B 1XMOO
chains in the Genus database with same CATH topology
2H94A 4Q20A 3RBZA 3G4SV 3ZMVA 2YSUB 1MG1A 4QNHB 1CEZA 4KP4A 4OXSA 3AG4C 4BW5A 1JX9A 1JQ0A 1OZ0A 4N21A 4UVCA 4LP8A 5LGUA 2IW5A 3ASNB 2WAMA 3IFXA 3G6EV 3E83A 3TETA 2AHZA 2OCCB 1Y66A 4KUMA 1AR1B 2WWWA 1H38A 1OCOC 1SERA 4GX0A 4PA9A 1NR1A 4X8AA 1I5XA 2XAFA 3CCSV 2W0FC 3T1CA 4GT1A 1V55B 2HG5C 1I5YA 4TSFG 4EKWA 2AHYA 2JJ1G 1AI4A 3D3IA 3QO5A 4PA7A 1SESA 3SPHA 4RUFA 4QE9A 1AI7A 5B3SC 2Q6AA 2Y69C 5H6RA 1S72V 3K79A 3TK1A 2DYRB 1YJNV 3ABKC 2B1GA 5B1AC 1W2BU 2PI5A 2HLDG 1OCCB 3CCVV 2QEXV 3QO8A 1R3JC 1R3IC 3P32A 1OHHG 4JAUA 2PI4A 3E35A 3DGEA 4WFBV 1XL6A 2EZOA 1YJ9V 3SYOA 3OUSA 1SZTA 3F5WC 3P30A 4ZKIA 2HFEC 4QE7A 2A0LA 1HWYA 3SPGA 1K8AW 2W6IG 1TUEB 2DQ0A 2EIJC 1NKDA 5IDJA 3K0GA 3CYOA 5B1OA 1G4YB 5L3DA 3RVYA 2P6JA 4PDRA 3MHHC 3W7UA 2DQ3A 4N23A 2ZDIC 1K4DC 2HVKC 1YTFD 4R8CA 1OCRC 2ZDIA 3JD0A 3T2MA 4TT3G 3T4ZA 3ZN0A 4PA4A 2CK3G 1RPRA 3JD3A 4QIWF 2GHYA 3OMAB 3CMAV 1Q7YW 1GK9A 5LHHA 3K9AA 4I5SA 5B1BB 1B6QA 1EZJA 2ATKC 1NQTA 1VQNV 1YSCA 2JJ2G 2B1IA 2KB1A 3EHBB 1F23A 3ETDA 3ZMTA 2X6BA 4UV9A 2NLJC 4R50A 1AJQA 4MT8A 3CCRV 1Y4MA 1AROP 1QLEB 2FTKA 3OGCC 4MW3A 5IYCO 3K03A 1VQ5V 2EJRA 2HJFC 5L3FA 1F4MA 3ETGA 4JF3A 2HVJC 2Q67A 2UXNA 4BIUA 1P7BA 4Z1MG 2Z3YA 4GX5A 1FXKC 3AG3C 3QO7A 1OCZB 1FXKA 4J9ZB 3DTUB 2WPDG 3SJQC 3TCUA 2X7RB 4DO2A 1NJIW 2B5UA 4RAIA 3AG4B 4PA6A 1VQ8V 2JEXA 1FXVA 1H8HG 5J9PC 2R9IA 1E1QG 1DF5A 2UXXA 2WLNA 3ASOC 1CPYA 4H33A 3EFFK 3HPLC 4ZBMA 3JYCA 3NXSA 4LBEC 3BEHA 2K1EA 3CCJV 4BIZA 2DYSB 1KC8W 1OCOB 5KUKA 2V7QG 1GO3F 2XAGA 3FB8C 4GCZA 3ABLB 1QLNA 3ZJZA 3VOUA 3SPCA 2QA4V 1QVGU 2WLHA 2DWDC 1PL0A 2ZD9A 4HYOA 1KD1W 4MTXA 2JEUA 4GX2A 5LBQA 1VQKV 3B77A 1DTOA 5C93A 2EINC 5KA5A 1YTFB 2MK3A 3OUFA 4HZ3A 1K34A 1M57C 3F7YC 3MD0A 4MTFA 5B3SB 2A79B 2Y69B 3ABMC 3ABTA 3E89A 2A9HA 4WFFA 2YEVA 4P9OA 1KP2A 4JTCB 3ABKB 3E8BA 5B1AB 1Q82W 3CD6V 2QE7G 4XDLA 1L1FA 1JOYA 3ZMSA 4YXWG 3LUTB 3OMIB 1DLBA 1W0KG 2IJIA 4UVAA 3CXCU 1KP3A 4UXNA 4XDKA 2X6AA 4F4LA 4MVUA 4JTAB 1JCHA 3FB5C 3T4DA 4WCEV 2NNUA 3VBBA 1G8MA 3B8MA 2WLMA 3B8NA 3FYIB 2EIJB 4PDMA 4MS2A 5EC1C 3ZMZA 3ZMUA 1EFRG 2EIMC 3W7WA 1SRYA 4RO2A 3PJSK 1VQLV 1YHQV 1GM8A 3F7VC 2EIKC 4E2LA 4HAMA 2OCCC 2IU3A 4MSWC 4PDLA 5FL7G 1OCRB 5IY5B 1K73W 3IGAC 3CCUV 4FIPC 5IYDO 3JCZA 3LDCA 3MHSC 2XAQA 4MTGA 2P90A 3LNMB 1K92A 1NBMG 3HB3B 4G27B 2EILB 4WFGA 1EBOA 5DM6V 5EC2C 3E8GA 3H01A 1K4CC 1JJ2U 3CCQV 2Q68A 2QM7A 1K9MW 3STLC 4P9PA 3OW2U 2WLLA 1AI5A 1K97A 5LGNA 1K5QA 3CCEV 2ZXWC 4P2ZA 3SYQA 1OCCC 3CC2V 5L3GA 1VQPV 5CA3A 3K04A 2ITCC 3OAAG 1FXKB 4JYBA 3AG3B 3ZRWA 3ZN1A 2DW4A 3LDDA 1CP9A 3CC7V 1ENVA 4JAVA 2QM8A 3ML0A 3OR6C 3CCLV 2JIZG 5H9CA 1RM1C 1S77D 1AJPA 4G2KA 4DXWA 3A0RA 1KECA 1YIJV 1QVFU 3ASOB 3E86A 1K7DA 4JASA 3GB7C 1R6KA 1YI2V 1NR7A 3ZRVA 1M90W 1VQ9V 3STZC 3CC4V 2ZQMA 2XAJA 3K3WA 4RQFA 1E1RG 4U7NA 1E79G 1AJNA 3SYCA 4RUEA 1FS0G 4GX1A 5H6QA 1R3LC 1YITV 1S76D 5EBMC 1PKXA 1PNMA 1R73A 1ROPA 4FMTA 5B1BC 3ZRXA 4CBCA 5CBGA 1GMGA 4WF9V 5E1AC 3AEIA 1QR8A 4MVOA 2EZPA 3E8HA 5CMUA 1VQOV 2GSMB 2JK5C 2YEVB 3W7XA 3AG2C 1MOFA 1QCEA 5HFMA 1FXHA 3CPWU 3JD4A 5B1NA 2BOCC 3FB6C 5L3EA 4CZZA 2HKOA 1KQSU 3OEEG 1H8EG 1GTOA 3LSQA 2ITDC 1VQ4V 3AG1C 3WG7C 1F4NA 3M99B 4PDVA 1BL8A 3OM3B 4JGSA 5EBWC 1PNKA 1R3KC 4MVMA 3E2EA 2LFSA 3X2QC 4UVBA 2D3OW 1M56C 1OCZC 5IYBO 5LGTA 1ORQC 2IJHA 3E8FA 2EIMB 2Y48A 3BY6A 5CBHA 1XL4A 5DN6G 5EK0A 1S3JA 3D36A 5LHIA 1NVPD 1V54C 1S5HC 2WLIA 2EIKB 1JVMA 2XOKG 4UV8A 3ZRSA 1MABG 2DYSC 1YJWV 5CBFA 1RPOA 2OTJV 4WFEA 4TWKA 3ABLC 1K3EA 4MVSA 5EBLC 3SPIA 1VQ7V 2QTOA 4WFHA 3LSSA 2LFRA 3WFVA 4RQEA 3SPJA 1N8RW 2JDIG 3ASNC 4H37A 4MVZA 1BMFG 1PNLA 5BZBA 4X88A 1AI6A 1Q81W 2ZR2A 1MSWD 2XASA 4WFAV 2HR3A 3GWOA 3SYAA 1Q86W 2WLKA 4JPRA 2WLLB 5LHGA 4JTDB 1COWG 4R7CA 5GW7A 2WSSG 4QPJA 2ZR3A 4BAYA 1VQ6V 2XNDG 3JD2A 3IC7A 2QKSA 1V55C 2ZXWB 2C2AA 3G71V 2IH1C 5L3CA 4ASUG 3I56V 3ZRWB 4QJFB 1M9NA 2M7WA 3K0DA 4J9YB 3OEHG 3UM7A 1NH2D 1SETA 4MW8A 1S0VA 1IXMA 4FK5C 2DYRC 1GM7A 3LDEA 4X89A 3W7SA 1GKFA 3FYEB 3R65A 3SYPA 4XDJA 1RM1B 3ABUA 2WLJA 2IJKA 2EBOA 2Z5UA 3CP1A 1ZWIC 3K06A 5HFLA 4KFMA 2DWEC 1VQMV 2X6CA 4I9WA 1P4RA 4L87A 3OE7G 5KUMA 3I55V 4PA3A 5IY5C 4U7OA 3RVZA 2F43G 3K08A 1K33A 1NVPB 4MVRA 2V1DA 2X0LA 1FFTB 2H8PC 2P67A 2IU0A 3OFNG 3CCMV 2EILC 2XAHA 3RW0A 2W6JG 1BHBA 1BHAA 1QBZA 3AG2B 5L3BA 1W0JG 5CN0A 1M1KW 3FKSG 2Q69A 3CMEV 1F51A 1WLEA 3W7TA 4JYCA 4LCUC 2BOBC 1LNQA 1K5SA 2OT5A 1PD3A 2IJJA 4LC1A 2OTLV 3AG1B 2EINB 4PELA 3WG7B 4R6ZA 4XBFA 1JPXA 3ZIAG 1M57B 3JD1A 1H2GA 3KG2A 1J95A 1UJWB 2LP7A 3QNEA 5KA6A 3ABMB 4QPKA 3OMNB 3X2QB 1GM9A 4P30A 1M56B 4MVQA 1DF4A 3FB7C 1QLEC 2P7TC 2R9RB 1QR9A 1WPXA 3ETEA 4MTOA 1THZA 1R6NA 3OR7C 1NH2B 1KKDA 4FJCC 3ZCCA 2WLIB 4FPPA 1V54B 4UUJC 3UKMA 4G28B 2IH3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 V;  4WF9 V;  3CCL V;  2D3O W;  1JJ2 U;  3CCS V;  1VQL V;  3CCQ V;  3G4S V;  3CCJ V;  1YHQ V;  1Q82 W;  1VQO V;  1KC8 W;  3CD6 V;  4WFB V;  1N8R W;  1K9M W;  1YJ9 V;  1YIJ V;  1QVF U;  3CCM V;  2QA4 V;  3CMA V;  3OW2 U;  1YI2 V;  1Q7Y W;  1QVG U;  1M90 W;  1KD1 W;  1VQ9 V;  3CPW U;  3CCE V;  1K73 W;  1Q81 W;  3CCU V;  3CC2 V;  1VQK V;  3CXC U;  4WFA V;  1VQP V;  3CC4 V;  1Q86 W;  1K8A W;  1KQS U;  3G6E V;  1VQN V;  1VQ7 V;  1S72 V;  1M1K W;  1VQ4 V;  1VQ6 V;  1YJN V;  1NJI W;  3CME V;  4WCE V;  1VQ8 V;  1VQM V;  3CCR V;  1YJW V;  5DM6 V;  2OTJ V;  1W2B U;  1YIT V;  3G71 V;  3CCV V;  3CC7 V;  2QEX V;  3I56 V;  1R73 A;  3I55 V;  2OTL V; 
#chains in the Genus database with same CATH topology
 4PHZ A;  4D7T A;  1HP8 A;  4X1K A;  3ZS8 C;  1AVM A;  1S5J A;  4LF4 B;  5B5E Z;  1Y76 B;  4KP4 A;  4X65 O;  1NZ6 A;  3DC6 A;  4NXM O;  4BW5 A;  5LGU A;  2IW5 A;  2GUZ A;  1Y74 B;  2WAM A;  4JI0 B;  4O4I B;  5KX5 A;  2WWW A;  4PA9 A;  2ILM A;  4X8A A;  2CTP A;  2XAF A;  3CCS V;  4GUN A;  1V55 B;  1AI4 A;  3D3I A;  3ZHR A;  1D2D A;  4YJ2 A;  2PYJ A;  4LF5 O;  1XQ8 A;  4LFC O;  1QU7 A;  5LMU B;  2ETN A;  5J2U A;  3ZBH A;  4O4L A;  3VQW A;  2E76 B;  1W2B U;  2HLD G;  1OCC B;  3CCV V;  2QEX V;  3QO8 A;  3GWK C;  4JAU A;  4DK1 A;  3DGE A;  1XL6 A;  3TXQ A;  3F5W C;  3P30 A;  1KKC A;  1EM1 A;  2E75 B;  1HWY A;  2RMK B;  1K8A W;  2W6I G;  2VQE O;  4JI8 O;  5L3D A;  1VF5 B;  3JAM N;  2ZDI C;  1K4D C;  2HVK C;  3SR2 C;  3T2M A;  1BQZ A;  1O9G A;  5LXT B;  2GHY A;  4DR1 O;  5FPR A;  3CMA V;  1Q7Y W;  5LHH A;  3K9A A;  2ATK C;  5LA6 A;  4FLX A;  2JJ2 G;  1VQN V;  2GDS A;  2X6B A;  3HKD B;  5LP6 C;  1AJQ A;  3CCR V;  3K5O A;  4FLZ A;  5IYC O;  3A0H Z;  4IHJ A;  2UU9 O;  3A2F A;  5L3F A;  2YI8 A;  3ZX6 A;  1TVK A;  3ETG A;  1BCC H;  2HVJ C;  2Q67 A;  1P7B A;  1Y67 A;  4Z1M G;  1XRE A;  4IYI A;  4X1K B;  1N33 O;  3DTU B;  5IE9 A;  3AK2 A;  2ADP A;  3TCU A;  4I50 A;  1M5I A;  3HR0 A;  4PA6 A;  2GUZ B;  4JI1 O;  1E1Q G;  5KX5 B;  3NXS A;  4LBE C;  4GKJ B;  2K1E A;  2D2C B;  3VQY A;  4GCZ A;  4YY3 O;  3ABL B;  2QA4 V;  3VOU A;  3HKC A;  4MTX A;  2XHB A;  2JEU A;  1SS3 A;  4DUZ B;  1VQK V;  4KHP O;  5C93 A;  4YJ2 B;  5KA5 A;  1H2M A;  1BS3 A;  2LW7 A;  3F7Y C;  3MD0 A;  5J2U B;  4X62 O;  4O4L B;  3RN4 A;  2QJ1 A;  3E8B A;  3CD6 V;  2QE7 G;  4JYY A;  4XDL A;  1VAR A;  2PGG A;  3J81 N;  1NTZ H;  1ZTE A;  1DLB A;  1HDJ A;  2F93 B;  4UVA A;  1HNX O;  1KP3 A;  4UXN A;  4B3S O;  2IBZ H;  2QSA A;  1BE3 H;  4WCE V;  3VBB A;  1G8M A;  3L9D A;  1N34 B;  2EIJ B;  4PDM A;  1EFR G;  1SRY A;  2QKA A;  3FX7 A;  3PJS K;  1VQL V;  1YHQ V;  5BR8 B;  4DR2 O;  3KKY A;  4EFB A;  2FL4 A;  3K5N A;  1K73 W;  3IGA C;  4OPH A;  4FIP C;  3LDC A;  3P3P A;  2AGA A;  4J80 A;  2VRZ A;  4O2A A;  4WFG A;  5LA6 B;  1SZX A;  4UCR A;  1WP8 A;  3E8G A;  3H01 A;  4JI2 B;  2QKC A;  3SJA C;  3B4S A;  4IHJ B;  2PYL A;  4LF6 O;  3OW2 U;  2BSK A;  2ZIO A;  1K5Q A;  2HP8 A;  1TVK B;  4P2Z A;  4LF6 B;  5L3G A;  1N0N A;  4B3T O;  3AG3 B;  4X66 O;  5BY1 A;  4I50 B;  5A2Q N;  1CP9 A;  4JAV A;  1D5A A;  4JV5 O;  4K0K O;  2JIZ G;  5H9C A;  4LF8 O;  2OIE A;  1S77 D;  1JJO A;  5EIB C;  1KEC A;  4NR1 A;  1K7D A;  1NR7 A;  3DSQ A;  3ZRV A;  2ZIN A;  3HKC B;  4LNU A;  2UUB O;  4DR6 O;  3K3W A;  3AK1 A;  4J7K A;  2UUA O;  1ROP A;  4CH6 A;  5B1B C;  4DR7 O;  4WF9 V;  1XUQ A;  5LMN O;  4IIJ A;  1VQO V;  2GSM B;  5FNV A;  2JK5 C;  4D7S A;  3K57 A;  4JI4 B;  1MOF A;  4DR4 B;  5F2V O;  1KB9 F;  2BOC C;  3FB6 C;  5L3E A;  3AK3 A;  4LH7 A;  4PI2 A;  1GAX A;  1KQS U;  3LSQ A;  2DN9 A;  1F4N A;  5KAF Z;  1Q43 A;  3OM3 B;  1IXB A;  1PNK A;  3E2E A;  2LFS A;  1XBL A;  4UVB A;  1OCZ C;  2Z0A A;  3EVK A;  3BAA A;  4ZIB A;  5JQG A;  4ZHQ A;  2YXY A;  1AP5 A;  3E8F A;  2YI9 A;  3BY6 A;  1RP3 B;  2EUL A;  1S3J A;  1NVP D;  1R6T A;  3H1K H;  4A5U B;  4I0X A;  1YJW V;  1XIL A;  2YID A;  5CBF A;  1SA0 A;  1K3E A;  5JJE B;  5BMV A;  4O2A B;  4WFH A;  3RYH A;  3LSS A;  3AG7 A;  1OV9 A;  4PJ0 Z;  4H37 A;  1PNL A;  1MSW D;  2XAS A;  1YZB A;  2VQF O;  4JZG A;  1P84 F;  2BSK B;  2WLK A;  4JTD B;  2QM4 A;  4R7C A;  4QPJ A;  5GW7 A;  1UFI A;  1YXB A;  2ZXW B;  1SQP H;  1V55 C;  3U0Z A;  4ASU G;  3BA9 A;  4Q6G A;  2QGN A;  3K0D A;  2Y4U A;  4EEQ A;  2ZE8 A;  3SYP A;  5FPO A;  3CSX A;  2Z5U A;  4LNU B;  1VQM V;  4I9W A;  3G80 A;  4F6E A;  2WA4 A;  5KUM A;  4PA3 A;  3ZHU A;  5C8Y A;  4PD4 F;  3RVZ A;  3QG5 A;  1IX9 A;  1FJG O;  1NVP B;  4ZOL A;  3BPZ A;  1FFT B;  2H8P C;  2P67 A;  2IU0 A;  3CCM V;  5KHJ A;  4DV1 O;  2NR5 A;  4IIJ B;  5FNV B;  2W6J G;  3DXR A;  1BHA A;  1WA8 A;  4JI6 O;  1N36 B;  3AG2 B;  3HKE A;  4J10 A;  2ZCE A;  5AG2 A;  1YCI A;  3W7T A;  4JYC A;  2P4K A;  1PD3 A;  1NU1 H;  1WAZ A;  3L70 H;  1B04 A;  1H2G A;  3ZHS A;  1UJW B;  3QNE A;  1DGS A;  2UXC B;  1GM9 A;  4O2B A;  2XTA A;  4MVQ A;  5JQG B;  4ZHQ B;  1IBM O;  2ZE7 A;  4W4K A;  1R6N A;  1KKD A;  4FJC C;  1BQ0 A;  4UUJ C;  5EYP A;  4DV4 B;  4I0X B;  2H94 A;  4Q20 A;  1SA0 B;  1TA8 A;  5BMV B;  4BIO A;  3RYH B;  1GN4 A;  1ZX3 A;  1CEZ A;  1BSM A;  1JX9 A;  1JQ0 A;  4UVC A;  3L72 H;  1VP7 A;  1IUR A;  3TET A;  4K8X A;  2AHZ A;  1Y66 A;  4KUM A;  3CX5 F;  1XMQ B;  2EX3 A;  1EN5 A;  4DV2 O;  2KKW A;  1Q6I A;  2AHY A;  2JJ1 G;  3QO5 A;  4FM1 A;  4RUF A;  5JWP A;  2Q6A A;  3OGI B;  4I55 A;  5IYZ A;  4FM0 A;  5H6R A;  1YJN V;  1L0L H;  3D3Q A;  3B09 A;  2B1G A;  2YS8 A;  1BZK A;  1I94 O;  2PTM A;  2QWQ B;  1R3I C;  1JMK C;  1RSO A;  3P32 A;  4WBN A;  4DV7 O;  2O57 A;  4CH3 A;  2EZO A;  5C8Y B;  1Q5O A;  2GV9 A;  3OUS A;  1SZT A;  4ZKI A;  4ZOL B;  2BTO A;  3KCY A;  1FKA O;  1WNS A;  2EIJ C;  3K0G A;  1XNR O;  3CYO A;  1IVS A;  3L74 H;  3DXR B;  1H2N A;  5IJ9 A;  1WA8 B;  4UCS A;  3RVY A;  2P6J A;  5B66 Z;  4PDR A;  4IYH A;  2B9Z A;  3HKE B;  2DQ3 A;  2CE4 A;  4UB8 Z;  1M4U A;  3JD3 A;  4QIW F;  3HKB A;  3OMA B;  5B1B B;  2KG7 A;  4FLY A;  2KQX A;  2M6Y A;  4O2B B;  4DV6 B;  4R50 A;  2A7W A;  1ARO P;  3A0B Z;  1J5E B;  1VQ5 V;  2EJR A;  1H2S B;  5EYP B;  4JF3 A;  2UXN A;  5IWA O;  4DV0 O;  4GX5 A;  4NTW A;  3AG3 C;  4NYK A;  1MMM A;  1OCZ B;  3JAR A;  4DR5 B;  1FXK A;  1AR4 A;  3SJQ C;  4BW9 A;  3TXS A;  3AG4 B;  2JEX A;  4UB6 Z;  1HR0 B;  1FXV A;  1H8H G;  1XI1 A;  2WLN A;  5KAI Z;  2L35 A;  3JYC A;  3CCJ V;  4NVP A;  5KUK A;  1XMO B;  1QLN A;  1QVG U;  2PY5 A;  3SJB C;  2RQ6 A;  1DTO A;  1G6U A;  1M93 A;  3SDL A;  1N32 O;  4X65 B;  4NXM B;  2RNB A;  3JAL A;  1M57 C;  3ICX A;  5LOV A;  4I55 B;  5IYZ B;  2Y69 B;  1SC5 B;  4WFF A;  4P9O A;  4FZ0 A;  3ABK B;  2K9P A;  4I9Q A;  2E5L O;  1JOY A;  1L1F A;  1RSO B;  3ZMS A;  4WBN B;  4YXW G;  3OMI B;  1W0K G;  5JVD A;  1I7F A;  4LF5 B;  3BVO A;  4JTA B;  3T4D A;  4X9Q A;  4LFC B;  4MS2 A;  3ZMZ A;  5IJ9 B;  3B2E E;  4FM2 A;  5K1X A;  2YIB D;  3F7V C;  4EFE A;  2OCC C;  1ZUQ A;  2QWO B;  3HKB B;  4KXR A;  4MTG A;  2P90 A;  2KG7 B;  4JI3 O;  1XNQ O;  2LO1 A;  2VQE B;  4TV9 A;  3BA8 A;  4JI8 B;  2V4D A;  3CCQ V;  1UPG A;  4DUY O;  2QM7 A;  3STL C;  2ZIM A;  1FYJ A;  4QGP A;  1AI5 A;  1V9P A;  5LGN A;  1LUV A;  2ZXW C;  4DR1 B;  1SQF A;  2KSD A;  2OYQ A;  4UCT A;  2HJD A;  3JAR B;  1FXK B;  2UXB O;  2CTW A;  4NTX A;  4GKK O;  1ENV A;  2Q8V A;  4B3R O;  3ML0 A;  4HBN A;  3OR6 C;  3CCL V;  1AJP A;  4G2K A;  1YIJ V;  1QVF U;  1US6 A;  2UU9 B;  4JAS A;  1BT8 A;  1R6K A;  2Q4P A;  1M90 W;  1WB8 A;  1PPJ H;  3K58 A;  4X1I A;  4CH5 A;  4DV5 O;  4U7N A;  1N33 B;  4RUE A;  1VMG A;  3OTF A;  1FS0 G;  4GX1 A;  1R3L C;  1PKX A;  1R73 A;  3JAL B;  4FMT A;  5CBG A;  5LOV B;  1GMG A;  5E1A C;  1QR8 A;  2VWK A;  1AIL A;  3E8H A;  4I7Z B;  4JI1 B;  3W7X A;  3AG2 C;  1QCE A;  5HFM A;  1IZ3 A;  2JS3 A;  4B3M O;  4JZ2 A;  4YY3 B;  4CZZ A;  2HKO A;  1H8E G;  3FD9 A;  2ITD C;  5JVD B;  3M99 B;  4YHH O;  4KHP B;  4JGS A;  3JAS A;  1DK1 A;  2FKX A;  2Q7E A;  1SQV H;  2BCC H;  1WPB A;  2LGW A;  4FLW A;  1W59 A;  4X62 B;  4FZ1 A;  2EIM B;  1CXZ B;  1XL4 A;  5EK0 A;  4OGQ B;  1JVM A;  1Z5W A;  1HNX B;  2F4V O;  4B3S B;  1RPO A;  4WFE A;  4MVS A;  5EBL C;  1VQ7 V;  2QTO A;  4TV9 B;  3SPJ A;  1N8R W;  4J42 A;  2ZR2 A;  3JSL A;  3SYA A;  4YJ3 A;  4DR2 B;  1Q86 W;  4JPR A;  5LHG A;  2XND G;  3JD2 A;  2C2A A;  1KU9 A;  4LF7 O;  1M9N A;  3FAV A;  4J9Y B;  5CA0 A;  1KYO F;  1IXM A;  1HNW O;  4FK5 C;  1GN2 A;  3LDE A;  4X89 A;  3W7S A;  1GKF A;  1RM1 B;  3T1Y O;  2A06 H;  2WLJ A;  4AQY O;  2EBO A;  3CP1 A;  1ZWI C;  4X1I B;  4KFM A;  2ZM6 O;  2X6C A;  1P4R A;  4JYA O;  4L87 A;  5KMG A;  3OE7 G;  4B3T B;  4U7O A;  4X66 B;  3CE2 A;  3K08 A;  1L8D A;  3JAW A;  4JV5 B;  1O9H A;  4K0K B;  3OFN G;  2EIL C;  4LF8 B;  2XAH A;  4H13 B;  1W0J G;  1M1K W;  1IBL O;  1GN6 A;  2UUB B;  3H1J H;  4DR6 B;  1LNQ A;  2OT5 A;  4GYC B;  4H0L B;  3AG1 B;  4HNA A;  3JAS B;  1M57 B;  5JH7 A;  3BCC H;  2UUA B;  4QPK A;  4DR7 B;  3X2Q B;  1M56 B;  5LMN B;  2YIC A;  3M8A A;  1QR9 A;  1THZ A;  1YEW A;  4J7J A;  3OR7 C;  4GLX A;  3ZCC A;  1X4T A;  4FPP A;  4B7K A;  4AHC A;  4W4L A;  2HEP A;  2IH3 C;  4B08 A;  4CC6 A;  3G4S V;  1FPO A;  2RCV A;  3WB2 A;  3CRA A;  1GN3 A;  4OXS A;  3PN1 A;  3AG4 C;  1OZ0 A;  4N21 A;  3ASN B;  3G6E V;  3E83 A;  3SJC C;  1PM9 A;  2OCC B;  4FFB A;  4YJ3 B;  1AR1 B;  1SER A;  4GX0 A;  1NR1 A;  1I5X A;  3ZHT A;  2N05 A;  2CUG A;  2W0F C;  1MNG A;  3K5L A;  1G1X B;  1IBK O;  1I5Y A;  4TSF G;  4EKW A;  1P49 A;  3FAV B;  5CA0 B;  4PA7 A;  4Z1V A;  3CEI A;  1SES A;  3CJH A;  3SPH A;  3SGI A;  4QE9 A;  2FYU H;  1AI7 A;  1YVW A;  2Y69 C;  4NKG B;  3CXH F;  3H1L H;  3M7M X;  1JR9 A;  3N2G A;  2DYR B;  1S72 V;  4TQF A;  3ABK C;  2VQF B;  4LH6 A;  1R3J C;  1OHH G;  3E35 A;  5KMG B;  4WFB V;  1YJ9 V;  2BTQ A;  4I4T A;  1NTK H;  3JAW B;  1URF A;  1Q8I A;  1PL4 A;  5B1O A;  1VF6 A;  2CDY A;  3CHX A;  1WJZ A;  3UT5 A;  4K3A A;  3W7U A;  4N23 A;  4DR3 O;  1Q6H A;  3ZN0 A;  4TT3 G;  3T4Z A;  4PA4 A;  3J7A U;  4BWA A;  4LFB O;  4FLT A;  4HNA B;  1GK9 A;  3TGU H;  5JH7 B;  4X64 O;  1FJG B;  1I0H A;  1EZJ A;  2YXL A;  2B1I A;  3JAT A;  2KB1 A;  3EHB B;  3QTC A;  1F23 A;  4DV1 B;  4NXN O;  4UV9 A;  2NLJ C;  4MT8 A;  4JI6 B;  5BXZ A;  1Y4M A;  2FTK A;  4MW3 A;  3OGC C;  3K03 A;  2HJF C;  1T5E A;  1ZAU A;  4BIU A;  4LF9 O;  2Z3Y A;  2F23 A;  1FXK C;  4J9Z B;  2P4V A;  2WPD G;  2XUM A;  2N04 A;  2X7R B;  4DO2 A;  1NJI W;  4OX9 O;  2B5U A;  4RWU A;  1VQ8 V;  1IBM B;  3EXA A;  2P06 A;  1FD9 A;  2R9I A;  1DF5 A;  2UXD O;  1QNM A;  1CPY A;  4FFB B;  3EFF K;  3HPL C;  4ZBM A;  3BEH A;  3MDS A;  1PP9 H;  3WB0 A;  2QTS A;  1OCO B;  2V7Q G;  2XAG A;  3ZJZ A;  3SPC A;  2WLH A;  1KD1 W;  1PL0 A;  4BR6 A;  1SQX H;  5LBQ A;  3S3W A;  2EIN C;  3CJH B;  2MK3 A;  4HZ3 A;  3JAK A;  5LYJ A;  1K34 A;  1LUW A;  3O65 A;  4MTF A;  5B3S B;  2A79 B;  1NS1 A;  1N4C A;  3E89 A;  3N2G B;  3K59 A;  1KP2 A;  2FML A;  3T1H O;  1EZV H;  3ZED A;  5B1A B;  1Q82 W;  3IJ4 A;  2QWP B;  4KL1 A;  1X59 A;  2YDE A;  4DRX A;  4DV2 B;  1KUQ A;  3LUT B;  5J2T A;  2ODM A;  2HHH O;  2BTQ B;  4I4T B;  4XDK A;  3OTO O;  2X6A A;  4F4L A;  4TQD A;  3UCS C;  4MVU A;  1JCH A;  3FB5 C;  1H2K A;  2NNU A;  5H2F Z;  4IGG A;  3Q4H A;  2WLM A;  3B8N A;  4OPA A;  1MZF A;  1B06 A;  1L0N H;  1XOU A;  5GTI Z;  2EIM C;  3UT5 B;  4IL6 Z;  4RO2 A;  1I94 B;  3CRR A;  1B3Q A;  4E4E A;  4HAM A;  2IU3 A;  4MSW C;  5FL7 G;  4DV7 B;  1OCR B;  3CCU V;  3BAB A;  3MHS C;  2XAQ A;  3LNM B;  1K92 A;  1NBM G;  3HB3 B;  1YF2 A;  2EIL B;  1EBO A;  3JAT B;  1XNR B;  5EC2 C;  4JI5 O;  3BFR A;  2Q68 A;  5K1P A;  4JAA A;  4ZI7 A;  5CA3 A;  2Q0O C;  2ARH A;  1KBH A;  4JYB A;  3ZRW A;  2YIA A;  3CB2 A;  3ZN1 A;  2DW4 A;  3LDD A;  3CC7 V;  1HNZ O;  2CTR A;  4ICG A;  1RM1 C;  3IAY A;  1VF7 A;  2PF4 E;  4DV3 O;  4DXW A;  2LW1 A;  4LWS A;  3ASO B;  3GB7 C;  1YI2 V;  2UUC O;  4GZR B;  5KLV H;  5IWA B;  4DV0 B;  2XAJ A;  3CC4 V;  1E1R G;  2LGQ A;  4TOI A;  3SYC A;  2Q7H A;  3CRQ A;  1YIT V;  1S76 D;  5LYJ B;  3JAK B;  1ZSP A;  3ZRX A;  1AP6 A;  4CBC A;  5D5P A;  1GRJ A;  4TUY A;  2QDO A;  5CA1 A;  1Q6U A;  2AZ2 A;  3CPW U;  2BE3 A;  3APQ A;  5B1N A;  4C7U A;  4LFA O;  2YIB A;  4DYL A;  4K8Z A;  5KHI A;  2G38 A;  3UO3 A;  4DRX B;  2OCH A;  1GTO A;  1VQ4 V;  3AG1 C;  5J2T B;  3L75 H;  1VEW A;  2R70 A;  3BRC A;  2EJ7 A;  1BL8 A;  4UCU A;  1H2L A;  1R3K C;  1N32 B;  4U3J A;  3N2K A;  3RYI A;  2PUS A;  3X2Q C;  3Q4H B;  1M56 C;  1QHT A;  4LF4 O;  1SF9 A;  1ORQ C;  2IJH A;  5E79 Z;  4CS3 A;  4JI0 O;  1F7Y A;  2E5L B;  5LHI A;  2EIK B;  3UO2 A;  1N0J A;  1OJH A;  4UV8 A;  3MAQ A;  1MAB G;  2DYS C;  4TWK A;  4DK0 A;  3SPI A;  1SQQ H;  2CGN A;  2GBO A;  1QQC A;  3WFV A;  4RQE A;  2JDI G;  3ASN C;  1MA1 A;  3R66 A;  2JRI A;  5LMU O;  2Q73 A;  4U3F H;  1COW G;  2YC0 A;  1VQ6 V;  2P22 C;  2WSS G;  2ZR3 A;  1TUB A;  4BAY A;  5KHG A;  4ZI7 B;  5GTH Z;  5L3C A;  4JI3 B;  3ZRW B;  4QJF B;  1XNQ B;  2AXT Z;  3UM7 A;  3CRC A;  1NH2 D;  1SET A;  2IM9 A;  4MW8 A;  2DYR C;  1GM7 A;  2WA3 A;  4DUY B;  3FYE B;  2ZT9 B;  4LWS B;  4XDJ A;  1AR5 A;  3GVM A;  5EZY A;  2JS5 A;  1Z2G A;  5HFL A;  4Z2W A;  3I55 V;  3FFQ A;  5IY5 C;  1XHZ A;  2UXB B;  2F43 G;  4GKK B;  4MVR A;  2X0L A;  4B3R B;  3RW0 A;  3F5T A;  4TUY B;  5CA1 B;  2DE0 X;  3RYF A;  1TAE A;  5CN0 A;  3C90 A;  5IJ0 A;  5JJJ B;  2Q69 A;  3CME V;  1WLE A;  3N27 A;  2R72 A;  2BOB C;  4DV5 B;  4PEL A;  2EIN B;  3WG7 B;  4R6Z A;  4XBF A;  1JPX A;  4U3J B;  3KG2 A;  3N2K B;  1J95 A;  3RYI B;  4D6T H;  2LP7 A;  5KA6 A;  4P30 A;  3VQX A;  4J11 A;  2YUA A;  2YXH A;  4B3M B;  1WPX A;  2CAZ C;  4UFZ A;  1NH2 B;  4GKJ O;  4B7E A;  3C3S A;  1V54 B;  3UKM A;  3H9V A;  4YHH B;  4X1Y A;  3RBZ A;  4FLU A;  4PV1 B;  4TV8 A;  1R1B A;  1MG1 A;  2YSU B;  3ZMV A;  4DUZ O;  4QNH B;  3L73 H;  2MW2 B;  2DMX A;  3OD4 A;  3L71 H;  4LP8 A;  3IFX A;  2VWJ A;  1EN6 A;  2FB5 A;  1H38 A;  1OCO C;  1FFX A;  2A3Q A;  1TUB B;  3U11 A;  2Q5Z A;  4J41 A;  2F4V B;  3T1C A;  4GT1 A;  2HG5 C;  4AIL C;  1Q90 D;  1RFY A;  5B3S C;  2E3C A;  3K79 A;  3TK1 A;  1N34 O;  2LQT A;  1U96 A;  2QWR B;  1HW7 A;  5B1A C;  2PI5 A;  5BR8 O;  5EZY B;  2PI4 A;  4O4H A;  4YIO A;  2JGD A;  4LF7 B;  4FVM A;  3SYO A;  4X20 A;  2HFE C;  4QE7 A;  3THO A;  3TJT A;  2A0L A;  3SPG A;  1HNW B;  1VF6 C;  1TUE B;  1YDX A;  2DQ0 A;  1NKD A;  5IDJ A;  1G4Y B;  3T1Y B;  3RYF B;  2CGO A;  4AQY B;  3MHH C;  4JI2 O;  5TIS Z;  5IJ0 B;  5KHK A;  2ZM6 B;  1YTF D;  3DC5 A;  4R8C A;  5JJN B;  1OCR C;  4NB5 A;  3RFR A;  2ZDI A;  3JD0 A;  3K5M A;  3P3N A;  2CK3 G;  1RPR A;  1EN4 A;  4JYA B;  3E22 A;  2Y0I A;  3RT3 C;  3APO A;  4I5S A;  4IT5 A;  3CRM A;  1B6Q A;  1NQT A;  1YSC A;  2OWO A;  3RYC A;  3I5D A;  3ETD A;  5H5N A;  3ZMT A;  2RN9 A;  2W0X A;  3JCU Z;  2XT9 A;  2RDC A;  5LP6 A;  1QLE B;  1IBL B;  1F4M A;  4O4J A;  4X1Y B;  1P7G A;  3QO7 A;  4TV8 B;  1AB3 A;  3OT7 A;  2Q0A A;  3K9S A;  2L6L A;  1VIB A;  4RAI A;  5J9P C;  3ASO C;  2UXX A;  5KHH A;  1GH6 A;  1BGY H;  4H33 A;  4JI4 O;  1FFX B;  4DR4 O;  4BIZ A;  2DYS B;  1KC8 W;  1GO3 F;  3FB8 C;  2Q7G A;  2GTA A;  3H1H H;  2DWD C;  2ZD9 A;  4HYO A;  5D5Q A;  4GX2 A;  3B77 A;  3BHP A;  3ETQ A;  4J7Z A;  1YTF B;  3OUF A;  1MZE A;  1WN7 A;  2ZE5 A;  3ABT A;  3ABM C;  2A9H A;  2YEV A;  2ADQ B;  3NR7 A;  5JCO C;  4JTC B;  1S5L Z;  1SQB H;  2CTQ A;  4FLV A;  3D36 C;  4O4H B;  3U10 A;  2JGD B;  1IBK B;  1Y6X A;  2IJI A;  3CXC U;  2F1M A;  4X20 B;  3QVN A;  5ITZ A;  1JFF A;  3RWR D;  3B8M A;  3FYI B;  5EC1 C;  3W7W A;  3ZMU A;  2ZKO A;  1GM8 A;  2CH7 A;  2EIK C;  4E2L A;  4PDL A;  4H44 B;  5IY5 B;  3E22 B;  1D5N A;  5IYD O;  3JCZ A;  3WU2 Z;  4L8J A;  3G6B A;  3C3T A;  4G27 B;  2Y0P A;  5DM6 V;  4YIP A;  3RYC B;  1K4C C;  1JJ2 U;  5DEC A;  5LP6 B;  4EB6 A;  4DR3 B;  1K9M W;  4K35 A;  4P9P A;  2WLL A;  1K97 A;  3CCE V;  4O4J B;  3D8C A;  3SYQ A;  1OCC C;  3CC2 V;  4LFB B;  1VQP V;  3K04 A;  4PI0 A;  1PV0 A;  2ITC C;  4X64 B;  3OAA G;  2F66 C;  1XDC A;  5GON A;  4NXN B;  2QM8 A;  4DW1 A;  2P5O A;  5CB4 A;  3A0R A;  4CS4 A;  2Q9L A;  3E86 A;  3H1I H;  1N36 O;  1VQ9 V;  2LJ2 A;  3LNN A;  3KCX A;  4CS2 A;  3STZ C;  4LF9 B;  2ZQM A;  4RQF A;  4FFK A;  1E79 G;  1AJN A;  1XHX A;  2H3O A;  5H6Q A;  1NI8 A;  2QWN B;  5EBM C;  3CWB H;  1PNM A;  4OX9 B;  3AEI A;  2UXC O;  4MVO A;  2EZP A;  5CMU A;  3ZHQ A;  2YEV B;  2UXD B;  1I08 A;  4F6R A;  1FXH A;  2ZNI A;  3JD4 A;  3RGB A;  1ZL8 A;  3OEE G;  3IC9 A;  3WG7 C;  1LR1 A;  4DV4 O;  1U97 A;  4PDV A;  5EBW C;  4CC5 A;  4MVM A;  5ITZ B;  1JFF B;  2JVD A;  1IDS A;  5EIB D;  2D3O W;  5IYB O;  5LGT A;  3WB1 A;  1NT2 B;  1JA8 A;  5JCO A;  1SKV A;  3T1H B;  2Y48 A;  2Y4T A;  1SQG A;  5CBH A;  1Z5V A;  5DN6 G;  2CH7 B;  3D36 A;  2E74 B;  2VS0 A;  5DED A;  1V54 C;  1S5H C;  5IT9 N;  2WLI A;  3VQV A;  2DOS A;  2GTS A;  2XOK G;  1XMQ O;  2ZNJ A;  3ZRS A;  2HHH B;  3OTO B;  2OTJ V;  3A8T A;  4NTY A;  3ABL C;  1WP7 A;  4JI7 O;  2LFR A;  4JI7 B;  1Y76 A;  3LSU A;  3G67 A;  3JSN A;  4MVZ A;  4CH4 A;  1BMF G;  5BZB A;  1Y74 A;  4EB6 B;  4X88 A;  1AI6 A;  3ZHV A;  1Q81 W;  4O4I A;  4WFA V;  2HR3 A;  3GWO A;  4ABM A;  2WLL B;  3IC7 A;  2PZS A;  2QKS A;  4AI8 A;  5FLX N;  3G71 V;  2IH1 C;  2JGU A;  2R9A A;  3I56 V;  2M7W A;  3OEH G;  5GON B;  3S3X A;  2F95 B;  1S0V A;  4JI5 B;  5CB4 B;  4DW0 A;  3R65 A;  3KZI Z;  3ABU A;  2IJK A;  2DJV A;  3K06 A;  2DWE C;  1TGO A;  2AZ0 A;  1K33 A;  5A9G A;  3CS5 A;  2V1D A;  1HNZ B;  1ZLZ A;  1WB7 A;  1MSD A;  1FAF A;  2NN4 A;  2AW9 A;  4DV6 O;  4DV3 B;  1BHB A;  1XEQ A;  4F6R B;  1QBZ A;  5L3B A;  2UUC B;  2N74 A;  3FKS G;  1F51 A;  1ZL8 B;  4UCV A;  1J5E O;  4LCU C;  1K5S A;  2IJJ A;  4LC1 A;  5LXT A;  2OTL V;  5LL6 Y;  1KMI Z;  3O9O A;  3ZIA G;  3JD1 A;  3J80 N;  1A32 A;  4DR5 O;  2RJZ A;  3ABM B;  2ZE6 A;  3OMN B;  3UQ8 A;  3QF7 A;  1Q3E A;  2QR4 A;  3B40 A;  1DF4 A;  4UCO A;  3HKD A;  3FB7 C;  4LR3 A;  1QLE C;  1HR0 O;  2P7T C;  1NTM H;  2R9R B;  3ETE A;  4MTO A;  4LFA B;  2OIG A;  2WLI B;  4G28 B;  1XMO O; 
#chains in the Genus database with same CATH homology
 2H94 A;  4Q20 A;  3RBZ A;  3G4S V;  3ZMV A;  2YSU B;  1MG1 A;  4QNH B;  1CEZ A;  4KP4 A;  4OXS A;  3AG4 C;  4BW5 A;  1JX9 A;  1JQ0 A;  1OZ0 A;  4N21 A;  4UVC A;  4LP8 A;  5LGU A;  2IW5 A;  3ASN B;  2WAM A;  3IFX A;  3G6E V;  3E83 A;  3TET A;  2AHZ A;  2OCC B;  1Y66 A;  4KUM A;  1AR1 B;  2WWW A;  1H38 A;  1OCO C;  1SER A;  4GX0 A;  4PA9 A;  1NR1 A;  4X8A A;  1I5X A;  2XAF A;  3CCS V;  2W0F C;  3T1C A;  4GT1 A;  1V55 B;  2HG5 C;  1I5Y A;  4TSF G;  4EKW A;  2AHY A;  2JJ1 G;  1AI4 A;  3D3I A;  3QO5 A;  4PA7 A;  1SES A;  3SPH A;  4RUF A;  4QE9 A;  1AI7 A;  5B3S C;  2Q6A A;  2Y69 C;  5H6R A;  1S72 V;  3K79 A;  3TK1 A;  2DYR B;  1YJN V;  3ABK C;  2B1G A;  5B1A C;  1W2B U;  2PI5 A;  2HLD G;  1OCC B;  3CCV V;  2QEX V;  3QO8 A;  1R3J C;  1R3I C;  3P32 A;  1OHH G;  4JAU A;  2PI4 A;  3E35 A;  3DGE A;  4WFB V;  1XL6 A;  2EZO A;  1YJ9 V;  3SYO A;  3OUS A;  1SZT A;  3F5W C;  3P30 A;  4ZKI A;  2HFE C;  4QE7 A;  2A0L A;  1HWY A;  3SPG A;  1K8A W;  2W6I G;  1TUE B;  2DQ0 A;  2EIJ C;  1NKD A;  5IDJ A;  3K0G A;  3CYO A;  5B1O A;  1G4Y B;  5L3D A;  3RVY A;  2P6J A;  4PDR A;  3MHH C;  3W7U A;  2DQ3 A;  4N23 A;  2ZDI C;  1K4D C;  2HVK C;  1YTF D;  4R8C A;  1OCR C;  2ZDI A;  3JD0 A;  3T2M A;  4TT3 G;  3T4Z A;  3ZN0 A;  4PA4 A;  2CK3 G;  1RPR A;  3JD3 A;  4QIW F;  2GHY A;  3OMA B;  3CMA V;  1Q7Y W;  1GK9 A;  5LHH A;  3K9A A;  4I5S A;  5B1B B;  1B6Q A;  1EZJ A;  2ATK C;  1NQT A;  1VQN V;  1YSC A;  2JJ2 G;  2B1I A;  2KB1 A;  3EHB B;  1F23 A;  3ETD A;  3ZMT A;  2X6B A;  4UV9 A;  2NLJ C;  4R50 A;  1AJQ A;  4MT8 A;  3CCR V;  1Y4M A;  1ARO P;  1QLE B;  2FTK A;  3OGC C;  4MW3 A;  5IYC O;  3K03 A;  1VQ5 V;  2EJR A;  2HJF C;  5L3F A;  1F4M A;  3ETG A;  4JF3 A;  2HVJ C;  2Q67 A;  2UXN A;  4BIU A;  1P7B A;  4Z1M G;  2Z3Y A;  4GX5 A;  1FXK C;  3AG3 C;  3QO7 A;  1OCZ B;  1FXK A;  4J9Z B;  3DTU B;  2WPD G;  3SJQ C;  3TCU A;  2X7R B;  4DO2 A;  1NJI W;  2B5U A;  4RAI A;  3AG4 B;  4PA6 A;  1VQ8 V;  2JEX A;  1FXV A;  1H8H G;  5J9P C;  2R9I A;  1E1Q G;  1DF5 A;  2UXX A;  2WLN A;  3ASO C;  1CPY A;  4H33 A;  3EFF K;  3HPL C;  4ZBM A;  3JYC A;  3NXS A;  4LBE C;  3BEH A;  2K1E A;  3CCJ V;  4BIZ A;  2DYS B;  1KC8 W;  1OCO B;  5KUK A;  2V7Q G;  1GO3 F;  2XAG A;  3FB8 C;  4GCZ A;  3ABL B;  1QLN A;  3ZJZ A;  3VOU A;  3SPC A;  2QA4 V;  1QVG U;  2WLH A;  2DWD C;  1PL0 A;  2ZD9 A;  4HYO A;  1KD1 W;  4MTX A;  2JEU A;  4GX2 A;  5LBQ A;  1VQK V;  3B77 A;  1DTO A;  5C93 A;  2EIN C;  5KA5 A;  1YTF B;  2MK3 A;  3OUF A;  4HZ3 A;  1K34 A;  1M57 C;  3F7Y C;  3MD0 A;  4MTF A;  5B3S B;  2A79 B;  2Y69 B;  3ABM C;  3ABT A;  3E89 A;  2A9H A;  4WFF A;  2YEV A;  4P9O A;  1KP2 A;  4JTC B;  3ABK B;  3E8B A;  5B1A B;  1Q82 W;  3CD6 V;  2QE7 G;  4XDL A;  1L1F A;  1JOY A;  3ZMS A;  4YXW G;  3LUT B;  3OMI B;  1DLB A;  1W0K G;  2IJI A;  4UVA A;  3CXC U;  1KP3 A;  4UXN A;  4XDK A;  2X6A A;  4F4L A;  4MVU A;  4JTA B;  1JCH A;  3FB5 C;  3T4D A;  4WCE V;  2NNU A;  3VBB A;  1G8M A;  3B8M A;  2WLM A;  3B8N A;  3FYI B;  2EIJ B;  4PDM A;  4MS2 A;  5EC1 C;  3ZMZ A;  3ZMU A;  1EFR G;  2EIM C;  3W7W A;  1SRY A;  4RO2 A;  3PJS K;  1VQL V;  1YHQ V;  1GM8 A;  3F7V C;  2EIK C;  4E2L A;  4HAM A;  2OCC C;  2IU3 A;  4MSW C;  4PDL A;  5FL7 G;  1OCR B;  5IY5 B;  1K73 W;  3IGA C;  3CCU V;  4FIP C;  5IYD O;  3JCZ A;  3LDC A;  3MHS C;  2XAQ A;  4MTG A;  2P90 A;  3LNM B;  1K92 A;  1NBM G;  3HB3 B;  4G27 B;  2EIL B;  4WFG A;  1EBO A;  5DM6 V;  5EC2 C;  3E8G A;  3H01 A;  1K4C C;  1JJ2 U;  3CCQ V;  2Q68 A;  2QM7 A;  1K9M W;  3STL C;  4P9P A;  3OW2 U;  2WLL A;  1AI5 A;  1K97 A;  5LGN A;  1K5Q A;  3CCE V;  2ZXW C;  4P2Z A;  3SYQ A;  1OCC C;  3CC2 V;  5L3G A;  1VQP V;  5CA3 A;  3K04 A;  2ITC C;  3OAA G;  1FXK B;  4JYB A;  3AG3 B;  3ZRW A;  3ZN1 A;  2DW4 A;  3LDD A;  1CP9 A;  3CC7 V;  1ENV A;  4JAV A;  2QM8 A;  3ML0 A;  3OR6 C;  3CCL V;  2JIZ G;  5H9C A;  1RM1 C;  1S77 D;  1AJP A;  4G2K A;  4DXW A;  3A0R A;  1KEC A;  1YIJ V;  1QVF U;  3ASO B;  3E86 A;  1K7D A;  4JAS A;  3GB7 C;  1R6K A;  1YI2 V;  1NR7 A;  3ZRV A;  1M90 W;  1VQ9 V;  3STZ C;  3CC4 V;  2ZQM A;  2XAJ A;  3K3W A;  4RQF A;  1E1R G;  4U7N A;  1E79 G;  1AJN A;  3SYC A;  4RUE A;  1FS0 G;  4GX1 A;  5H6Q A;  1R3L C;  1YIT V;  1S76 D;  5EBM C;  1PKX A;  1PNM A;  1R73 A;  1ROP A;  4FMT A;  5B1B C;  3ZRX A;  4CBC A;  5CBG A;  1GMG A;  4WF9 V;  5E1A C;  3AEI A;  1QR8 A;  4MVO A;  2EZP A;  3E8H A;  5CMU A;  1VQO V;  2GSM B;  2JK5 C;  2YEV B;  3W7X A;  3AG2 C;  1MOF A;  1QCE A;  5HFM A;  1FXH A;  3CPW U;  3JD4 A;  5B1N A;  2BOC C;  3FB6 C;  5L3E A;  4CZZ A;  2HKO A;  1KQS U;  3OEE G;  1H8E G;  1GTO A;  3LSQ A;  2ITD C;  1VQ4 V;  3AG1 C;  3WG7 C;  1F4N A;  3M99 B;  4PDV A;  1BL8 A;  3OM3 B;  4JGS A;  5EBW C;  1PNK A;  1R3K C;  4MVM A;  3E2E A;  2LFS A;  3X2Q C;  4UVB A;  2D3O W;  1M56 C;  1OCZ C;  5IYB O;  5LGT A;  1ORQ C;  2IJH A;  3E8F A;  2EIM B;  2Y48 A;  3BY6 A;  5CBH A;  1XL4 A;  5DN6 G;  5EK0 A;  1S3J A;  3D36 A;  5LHI A;  1NVP D;  1V54 C;  1S5H C;  2WLI A;  2EIK B;  1JVM A;  2XOK G;  4UV8 A;  3ZRS A;  1MAB G;  2DYS C;  1YJW V;  5CBF A;  1RPO A;  2OTJ V;  4WFE A;  4TWK A;  3ABL C;  1K3E A;  4MVS A;  5EBL C;  3SPI A;  1VQ7 V;  2QTO A;  4WFH A;  3LSS A;  2LFR A;  3WFV A;  4RQE A;  3SPJ A;  1N8R W;  2JDI G;  3ASN C;  4H37 A;  4MVZ A;  1BMF G;  1PNL A;  5BZB A;  4X88 A;  1AI6 A;  1Q81 W;  2ZR2 A;  1MSW D;  2XAS A;  4WFA V;  2HR3 A;  3GWO A;  3SYA A;  1Q86 W;  2WLK A;  4JPR A;  2WLL B;  5LHG A;  4JTD B;  1COW G;  4R7C A;  5GW7 A;  2WSS G;  4QPJ A;  2ZR3 A;  4BAY A;  1VQ6 V;  2XND G;  3JD2 A;  3IC7 A;  2QKS A;  1V55 C;  2ZXW B;  2C2A A;  3G71 V;  2IH1 C;  5L3C A;  4ASU G;  3I56 V;  3ZRW B;  4QJF B;  1M9N A;  2M7W A;  3K0D A;  4J9Y B;  3OEH G;  3UM7 A;  1NH2 D;  1SET A;  4MW8 A;  1S0V A;  1IXM A;  4FK5 C;  2DYR C;  1GM7 A;  3LDE A;  4X89 A;  3W7S A;  1GKF A;  3FYE B;  3R65 A;  3SYP A;  4XDJ A;  1RM1 B;  3ABU A;  2WLJ A;  2IJK A;  2EBO A;  2Z5U A;  3CP1 A;  1ZWI C;  3K06 A;  5HFL A;  4KFM A;  2DWE C;  1VQM V;  2X6C A;  4I9W A;  1P4R A;  4L87 A;  3OE7 G;  5KUM A;  3I55 V;  4PA3 A;  5IY5 C;  4U7O A;  3RVZ A;  2F43 G;  3K08 A;  1K33 A;  1NVP B;  4MVR A;  2V1D A;  2X0L A;  1FFT B;  2H8P C;  2P67 A;  2IU0 A;  3OFN G;  3CCM V;  2EIL C;  2XAH A;  3RW0 A;  2W6J G;  1BHB A;  1BHA A;  1QBZ A;  3AG2 B;  5L3B A;  1W0J G;  5CN0 A;  1M1K W;  3FKS G;  2Q69 A;  3CME V;  1F51 A;  1WLE A;  3W7T A;  4JYC A;  4LCU C;  2BOB C;  1LNQ A;  1K5S A;  2OT5 A;  1PD3 A;  2IJJ A;  4LC1 A;  2OTL V;  3AG1 B;  2EIN B;  4PEL A;  3WG7 B;  4R6Z A;  4XBF A;  1JPX A;  3ZIA G;  1M57 B;  3JD1 A;  1H2G A;  3KG2 A;  1J95 A;  1UJW B;  2LP7 A;  3QNE A;  5KA6 A;  3ABM B;  4QPK A;  3OMN B;  3X2Q B;  1GM9 A;  4P30 A;  1M56 B;  4MVQ A;  1DF4 A;  3FB7 C;  1QLE C;  2P7T C;  2R9R B;  1QR9 A;  1WPX A;  3ETE A;  4MTO A;  1THZ A;  1R6N A;  3OR7 C;  1NH2 B;  1KKD A;  4FJC C;  3ZCC A;  2WLI B;  4FPP A;  1V54 B;  4UUJ C;  3UKM A;  4G28 B;  2IH3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...