3CC7V

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cc7V00
1Q86W 1VQOV 3I56V 3G71V 1YHQV 3CC7V 4WFAV 1QVFU 1VQ6V 3CPWU 1YJ9V 1KC8W 3CCLV 1VQMV 1VQPV 3CCRV 1Q7YW 3G4SV 1K73W 1VQNV 1R73A 3CCUV 1YITV 3CC4V 1VQLV 2D3OW 3CMAV 3G6EV 4WCEV 1VQKV 1S72V 1VQ4V 2OTLV 3CCEV 3CCJV 3CMEV 1YJNV 1K9MW 1W2BU 3OW2U 1M1KW 3CD6V 1M90W 1N8RW 3I55V 3CCVV 1KD1W 4WFBV 1QVGU 1Q82W 3CCMV 3CCSV 2QEXV 2QA4V 3CC2V 2OTJV 3CCQV 1YIJV 1VQ8V 1KQSU 1VQ7V 1VQ5V 1VQ9V 4WF9V 1JJ2U 1K8AW 1YJWV 3CXCU 1YI2V 1NJIW 1Q81W 5DM6V
chains in the Genus database with same CATH superfamily
1SF9A 2QTOA 3JD1A 2K9PA 3B77A 2R9AA 3HPLC 3UM7A 1XQ8A 4UCTA 3WB0A 3CCUV 3WG7B 3T1HB 5GTHZ 3RVYA 5JVDB 1TVKB 2X6AA 1A32A 1X59A 2Q67A 3A0BZ 2Q5ZA 2ADQB 2V7QG 3K5OA 1JJ2U 2YIBA 3QF7A 1P49A 4GKJO 4GX2A 1GK9A 2KQXA 3BA8A 3DTUB 4JYBA 3BPZA 2BOBC 4QIWF 1Y74A 2XTAA 1N0JA 2PI5A 2ZKOA 1XL6A 2Q0OC 5FL7G 3M99B 3ABTA 2WLMA 4GKKO 1D2DA 2EX3A 3MDSA 4X1IB 3K57A 3ZRWA 2OIGA 4JI8O 3R66A 4MVOA 5EK0A 1MZFA 3K58A 4X1KA 3SPJA 3JALB 1R1BA 3JYCA 5H6QA 3CE2A 1MSDA 4I9QA 5TISZ 1N0NA 3LDCA 5GW7A 5JQGA 3I55V 4PI0A 1PNMA 4DV2B 3CCMV 4UCOA 1IXMA 1K3EA 5FNVA 1AP5A 1IBMO 1SZTA 2VQFB 1N4CA 1D5NA 3BHPA 3ZEDA 3ZJZA 1Q7YW 4R7CA 2XT9A 3S3WA 2ATKC 4CS2A 4GT1A 1FXKA 3EHBB 2IJHA 1HP8A 4OPHA 2Q7EA 1VEWA 3F5TA 2RN9A 2QA4V 1KQSU 3JD0A 4P9PA 3D3IA 1BSMA 2W0FC 1AJPA 2DW4A 4JYAO 2PZSA 3I56V 1QQCA 5IYBO 1EBOA 2ZM6O 4GZRB 4BW9A 4FLYA 3OMAB 3UT5B 3CB2A 4YHHB 2Q68A 1V54B 5KA5A 1H2NA 1SERA 1NKDA 2UU9O 2QM4A 1ZSPA 2XAQA 1PPJH 4KP4A 4RWUA 1GRJA 2Z3YA 4RQFA 4YJ2B 1AR5A 2WLHA 1PNLA 2EIMB 2P06A 1OJHA 2QWQB 4FK5C 4FM2A 1PL0A 2EZPA 2XAFA 1K4CC 2XNDG 5JWPA 1Q5OA 2EINC 4MTGA 2BSKA 5LHIA 1HWYA 3WB2A 5LBQA 1GH6A 3M7MX 4Z2WA 4AQYB 1EN5A 2Q8VA 3AK1A 1M93A 1R6NA 2JVDA 2CGNA 1AB3A 1MOFA 1DF4A 1NI8A 1EM1A 4DV5B 3O9OA 1K4DC 2X6CA 5KX5B 3G6EV 1GN2A 2E5LO 1QLEC 2JJ2G 4X66B 3ABKB 4KUMA 1AJQA 4H37A 1AR4A 3Q4HB 4X20A 2F4VO 4LR3A 2P67A 3W7SA 2YIAA 4DR3O 3ZRXA 3OEEG 1I7FA 3ZS8C 3RGBA 2EULA 1SESA 3A0RA 1KP2A 3CRQA 2WWWA 3W7UA 5LP6C 4CBCA 2CTQA 1HNXB 3P30A 3MHHC 1G6UA 4X62B 2OIEA 3ABMB 2CTRA 3IGAC 1Y66A 2A7WA 4K3AA 1B6QA 4B3MO 2PTMA 3ABLB 4DRXB 4FLWA 4JI0B 3QO5A 4JI6B 5B1BB 3CC7V 2DYSB 2Z0AA 1OZ0A 3OAAG 2XAHA 3SJCC 5KHIA 1OCCB 3RW0A 4DUYO 1TUEB 4PDLA 3JAKA 1JOYA 4UVBA 1HR0B 3CYOA 5JCOA 5IE9A 2WLLB 3CRMA 2JJ1G 5LHHA 4JV5B 4O4JA 3VOUA 2YI9A 4YIPA 1Z5WA 4X64B 1KC8W 2CTWA 1URFA 4WBNB 4MSWC 2YEVA 5H6RA 4DR6B 3OFNG 1GO3F 4FIPC 4ICGA 4GX0A 1VF6C 3NXSA 5B1AB 4JAUA 2QJ1A 4R6ZA 1PV0A 1SS3A 5IJ9A 4DV1B 3G71V 4FLVA 3LNMB 1YEWA 1GM8A 3HKDB 1PP9H 2UXBO 1MMMA 5CA0B 3L74H 4UCRA 2ZE8A 3E8BA 1VQ5V 4ZI7A 4RQEA 4WFEA 1IVSA 4LFCO 1Y4MA 2Y48A 5KMGB 4F6RA 1KUQA 4X65B 4WFGA 1VQNV 1XREA 4LF4B 1KBHA 4O2BA 3T4DA 1D5AA 5B1OA 2O57A 4JAAA 1CP9A 2NR5A 4TV8A 1SQGA 4G27B 4PA9A 3JSLA 3ZMSA 4LH7A 3IAYA 4EKWA 1JFFB 4RUFA 5LA6A 3RYFB 2DQ3A 4YY3O 4Z1MG 3G4SV 3HKCB 2RNBA 3P3PA 2Q6AA 3OUFA 4O4IA 1SQXH 1NQTA 3CRCA 3DXRB 4JTCB 1XHZA 3RYCA 1YVWA 4WFHA 2P22C 2E74B 4DW0A 2DJVA 3W7WA 2HHHB 4CH4A 3BA9A 4J7JA 4ASUG 2CGOA 2BTQA 5CBHA 2NLJC 2GUZB 4LFBO 1THZA 2XHBA 1L8DA 3IJ4A 3FAVB 3OTOB 2R9IA 1TA8A 1S3JA 2XUMA 2ZNJA 5FLXN 3CRRA 1H2SB 1H8HG 4UCVA 4JI2B 4DR4O 4B3TO 1YIJV 4I0XA 5D5QA 1Q81W 2JEUA 2RJZA 3OTFA 2QSAA 4BW5A 1IDSA 4H44B 1OCZC 4NXMO 3ZHSA 4TQDA 3ASNB 4JI4B 4J9YB 2IBZH 2PYJA 1W2BU 1M1KW 4LF6B 4JZGA 4K35A 1WPBA 2WA3A 3AEIA 5IYZA 3MAQA 1Y76A 5IJ0B 4O4LA 2HJDA 4FFBA 1N33B 3TK1A 1ZX3A 4JI6O 2F1MA 4OGQB 1XMOO 2QR4A 1ROPA 3OM3B 2Q69A 5BY1A 4MTFA 3E2EA 1VP7A 1QVFU 5JVDA 4O4HB 1TVKA 3X2QC 4JTAB 4H13B 5DN6G 1G8MA 5JCOC 4RAIA 3LNNA 4NR1A 1QNMA 3E86A 3ZMTA 5L3DA 1Y6XA 4JPRA 3T1YO 2FTKA 3FYEB 1M56B 2JEXA 1YJWV 2UUAO 1LUWA 3OGCC 2ZXWB 5KUKA 2AXTZ 2Q0AA 2XAJA 3HKEB 2A3QA 3JAWB 4P2ZA 1VQKV 4DV4O 2F23A 1V55B 4DV3O 1P7GA 4UCUA 4X1IA 4BIZA 3CD6V 5EYPB 2Y69C 4I5SA 1JVMA 4JI5B 3OEHG 2EIJC 3JALA 4DW1A 1E79G 1DF5A 4LC1A 5H9CA 3ZHUA 1TGOA 1L1FA 4QNHB 1VQPV 2IW5A 3VQYA 2GSMB 3FFQA 3AG3B 2GTSA 4LF7B 4LF9O 1YJNV 3GWOA 3DSQA 5KA6A 4ZOLB 4IT5A 1OCOC 3JASB 4DK1A 4DV0B 2AGAA 4DYLA 1KU9A 1YHQV 4LF5B 3SPGA 4IGGA 2QWRB 3ETDA 5JH7B 4PDRA 2Q9LA 2UXCO 3SJBC 3SYCA 3ZMUA 2ZDIA 4KHPO 1Q43A 3UT5A 2X7RB 2LQTA 1ZL8B 2HP8A 3JCUZ 2VRZA 1K73W 1BHAA 3SPIA 1HNWB 3AK3A 2ZD9A 1XILA 5B3SB 4LWSB 2A06H 4YJ2A 2WSSG 2PGGA 1JA8A 1EFRG 1R3JC 1WLEA 3CC4V 3SPCA 5BR8B 4NXNB 2Q4PA 3D36A 2Y4UA 1US6A 1FJGO 2AHYA 1NS1A 5B5EZ 4KL1A 1IBKO 4A5UB 2FYUH 1SQVH 3J7AU 2ITDC 1HNZO 4GX5A 1W59A 4CC6A 1IX9A 2LP7A 4P30A 5KX5A 2QE7G 2Q73A 2EZOA 1N34B 2GTAA 2YIBD 2VQEB 3C3TA 4OXSA 4CH5A 4MVZA 4OPAA 1P84F 3CMAV 3Q4HA 4GUNA 4OX9O 4DR7O 4MTOA 2HEPA 4XDKA 4LF8B 1N36O 3LDEA 1RM1C 3H1JH 4DR5B 4QGPA 2UUCO 3E89A 4K8XA 5LGTA 1E1QG 2OWOA 3B4SA 2DN9A 4DR1B 2JDIG 1S72V 3APOA 2QM8A 3TXQA 1YCIA 2UXDB 3AK2A 4DRXA 4FLXA 3K03A 3U10A 3JSNA 3DGEA 3U0ZA 1G4YB 5DM6V 3LSUA 1GN4A 4BWAA 2JS3A 2IH1C 4J80A 3MD0A 5IWAO 1FAFA 3T2MA 3ZHVA 2WLLA 4NYKA 2QKSA 5FPRA 4JI1B 4IL6Z 1LUVA 1HW7A 3JARB 2WPDG 3CWBH 4WBNA 1J5EB 5BXZA 1COWG 5C93A 3N27A 2EINB 3LSQA 1KKDA 1BT8A 3OGIB 5CBGA 3PJSK 4TUYB 4JI5O 1XNQB 1S0VA 4B3RB 4DV7O 4KXRA 4XDJA 4X88A 2YICA 4DUZB 4B3SB 3L70H 3FX7A 4MW8A 3SYOA 5EC1C 2P7TC 3FB8C 3RYHB 2LO1A 4FLTA 2M6YA 3HKDA 5LMUO 5LXTB 5CA0A 4DV0O 4JTDB 1YITV 5L3CA 1AVMA 4UXNA 4MVMA 4N21A 1XEQA 4JI7B 5KMGA 3AG1C 5LP6B 3L73H 1I94B 1HDJA 1YI2V 3P32A 2CH7A 4U7OA 2IJIA 2ZR3A 5A9GA 1M57C 1NVPD 3IC7A 1WPXA 1JCHA 3ETEA 3K9AA 5LMNB 2YUAA 1XMQB 4TQFA 3QO7A 2W0XA 3F7YC 4JASA 1JFFA 2P4VA 3LSSA 4FZ0A 4NB5A 3RYFA 2BE3A 4U3FH 5HFLA 1P4RA 2R70A 1RSOB 2HJFC 4JF3A 3HKCA 1BMFG 1XNRO 5JJJB 1SRYA 3DXRA 4YXWG 4LFAO 2VWKA 3FB6C 1S5LZ 4XDLA 1VQ4V 4UCSA 5KLVH 3CCEV 4AI8A 4NVPA 2GUZA 5LGUA 4E4EA 3T1HO 2Y0PA 3FAVA 4HNAB 1EZJA 1SC5B 1IURA 1NZ6A 4DXWA 2E75B 3SYQA 2E3CA 4BAYA 4IIJB 4CZZA 3WU2Z 2IH3C 3OD4A 1ZLZA 2KB1A 1MG1A 1VQ7V 4LCUC 3J81N 3CXCU 4C7UA 4QE9A 3VQXA 2GHYA 5CMUA 1WA8B 3ZCCA 4DR2B 4DR5O 5H2FZ 3RYIA 4DV6B 3K06A 5L3EA 2ZNIA 3IC9A 4PHZA 1SZXA 1F4NA 2V1DA 3A8TA 2CAZC 4L87A 5IJ0A 1KECA 3ETGA 5LHGA 2WLNA 2UXDO 2JGUA 3K3WA 3RBZA 4WFAV 5IY5B 1AILA 4D7TA 1FD9A 4DV2O 3TCUA 3GWKC 3QG5A 3ABUA 4J10A 2YXYA 4K0KB 5B1BC 3ZN0A 3K08A 1N32B 2UXNA 3ASOC 2DYSC 2VQFO 1OCCC 1NT2B 1YTFB 4O4HA 4BIUA 3HR0A 1VMGA 2YXLA 1GM7A 3AG4C 3W7XA 3A0HZ 4ZIBA 2DYRC 3ZHTA 1O9HA 3ZHRA 1FXKC 1J5EO 4X8AA 1FYJA 1YZBA 1IBLB 2CH7B 2KKWA 3I5DA 3UCSC 2W6JG 2JGDB 3BCCH 5C8YB 5EBMC 3H1KH 2X0LA 4YHHO 3HKEA 2A9HA 5J2UB 5B1AC 3JAWA 1Q86W 3KCYA 2EILC 1NTZH 5FPOA 3BVOA 1SKVA 5EYPA 3H1IH 4AILC 4HZ3A 3BFRA 5H5NA 3ZN1A 1ZUQA 1PNKA 5B1NA 1YSCA 1GAXA 4W4KA 3QO8A 4J42A 1N8RW 3B09A 3C3SA 5EC2C 1J95A 1OCZB 2B1GA 4MVSA 3SDLA 3N2GA 1BHBA 2H8PC 3CXHF 2ETNA 4TOIA 4NTWA 4ZOLA 4AQYO 3JASA 4IHJB 2N04A 3IFXA 1ENVA 2HVJC 3B8NA 2DWEC 3E8FA 4DV5O 3CX5F 2EJRA 1OHHG 1EN4A 1GN3A 3VQWA 1RPRA 4JZ2A 2X6BA 5LYJB 1NU1H 3L9DA 4X66O 1ZWIC 1WNSA 5J2TB 1JMKC 2DE0X 5CA3A 5JH7A 1VQMV 2RQ6A 2EJ7A 1YDXA 2CE4A 2HFEC 4B7EA 4F4LA 1AI4A 2LJ2A 1ZAUA 3L72H 1Q8IA 2IU3A 3X2QB 2DMXA 5BMVB 4LH6A 3LUTB 1ZL8A 1QCEA 3RYIB 4UB8Z 1HNXO 2ITCC 2LW1A 2ZT9B 3FB5C 2ZINA 4X62O 2QGNA 4PDVA 1I5XA 1W0KG 4LWSA 4O2AB 3ZHQA 1AR1B 1H38A 2ZR2A 3TETA 2DWDC 2OCCC 4JI0O 4TV9B 5BZBA 4I50B 4X1YB 4GKJB 2P90A 2XAGA 3VBBA 3STLC 1SA0B 1HR0O 2YXHA 4YJ3B 1JQ0A 5JJNB 2Y69B 4I7ZB 3KZIZ 1IZ3A 4GKKB 2JRIA 4JV5O 2DOSA 2EIJB 4JI8B 1JX9A 2P5OA 4Z1VA 4X64O 2OTJV 3SPHA 4DV6O 4RO2A 4DR6O 4PDMA 1Z5VA 3AG2C 1R6KA 3EXAA 1OCOB 3KCXA 1WAZA 3K04A 3R65A 1H2GA 3JAMN 2VS0A 1IBMB 3G80A 4ZHQB 4UV8A 1EZVH 3TJTA 2G38A 4DV1O 3CJHB 2EIKB 3PN1A 3W7TA 1Q3EA 3UQ8A 4K8ZA 4CS3A 5A2QN 2WLIB 2ZE7A 5CN0A 4L8JA 5LGNA 2ZIMA 4J41A 4IYIA 3N2GB 3G67A 4JYAB 3CP1A 2ZM6B 2PUSA 4X65O 4FJCC 1I08A 4LF4O 1VF7A 5CBFA 1BQZA 3P3NA 1GTOA 2M7WA 2UU9B 4FMTA 3HB3B 1M56C 4GX1A 1G1XB 4ZBMA 2QTSA 1M5IA 3JARA 1QLNA 5DEDA 1W0JG 2PY5A 4DO2A 1H2KA 2RCVA 5EZYB 1UPGA 4LBEC 4TUYA 4MVQA 3JATB 4D6TH 5JJEB 5LL6Y 2HHHO 3BABA 1U97A 2QWNB 1OCRC 1QR8A 2P4KA 3RYHA 1CPYA 2AW9A 3ZMVA 3OTOO 4NTXA 4B7KA 2QDOA 2V4DA 3FKSG 4DK0A 5LXTA 2ZIOA 1DLBA 2E5LB 3FD9A 3HKBB 1AI7A 4JI2O 2ZE5A 1FFTB 2F4VB 4FM1A 4DR3B 1RM1B 4H33A 2C2AA 2YI8A 2L35A 4NTYA 2HVKC 5LP6A 1BS3A 4GCZA 1B04A 5HFMA 1QVGU 1WP7A 3U11A 2KG7B 1Z2GA 1F51A 4JI4O 4J7KA 2PYLA 4LF6O 1UJWB 3N2KB 2R72A 3SGIA 5IDJA 4B3MB 4I4TB 1V9PA 4KFMA 1RSOA 2ZCEA 2K1EA 3UKMA 4WFBV 1N33O 4DUYB 3UO3A 5B3SC 1S77D 5E79Z 3OT7A 1SQPH 1CEZA 3E22B 4LNUB 5GONB 4YIOA 1EN6A 2BCCH 3STZC 3KKYA 3WB1A 4B08A 3E35A 3RWRD 3ETQA 4HNAA 4X9QA 3APQA 1JPXA 3WG7C 1F4MA 1VF6A 1R3KC 1WJZA 3D8CA 3E8GA 1GMGA 1FXVA 1K7DA 2MW2B 4IIJA 3ZMZA 1RFYA 1NH2B 1KYOF 1NR1A 2IU0A 4TWKA 1WB7A 1FXHA 3G6BA 4N23A 1FFXB 1SQFA 1R3LC 5CB4B 3SJQC 3CCQV 2L6LA 3OE7G 1WA8A 4FM0A 2ADPA 3FYIB 5E1AC 1S76D 2UXBB 4CS4A 4PELA 4G28B 1R73A 4PJ0Z 3AG1B 4ZKIA 1AJNA 1LNQA 3B2EE 4AHCA 2JK5C 1MA1A 1OV9A 2AHZA 4LFCB 4JAVA 2YC0A 3CCVV 1M57B 5K1PA 4XBFA 5F2VO 4CH3A 4EB6B 1Q90D 1M4UA 3DC6A 4LF7O 3K0GA 3QNEA 2H94A 1QLEB 2WA4A 2QM7A 4U3JB 3AG7A 1NR7A 1QHTA 1PL4A 2JIZG 4PD4F 4UFZA 1YTFD 4YY3B 4LF5O 2P6JA 4QPKA 2YSUB 3EVKA 4EFBA 1KB9F 5CA1B 4JI3B 1VIBA 5LOVB 4FZ1A 1VQOV 5L3GA 1AI6A 2CTPA 3CCRV 2CUGA 5KAFZ 3F5WC 2JGDA 5C8YA 2ZDIC 5J2UA 4LFBB 5EBWC 3E8HA 1HNWO 1VQ8V 1WB8A 3M8AA 1V54C 3UO2A 3H1LH 5IT9N 4I55A 1TUBA 3KG2A 1PKXA 3JCZA 3F7VC 2UUBB 2ZE6A 4DR4B 4B3TB 5KHHA 1BCCH 2Q7HA 4MVRA 5EBLC 5BR8O 2EIMC 2QWPB 4NXNO 2R9RB 2BOCC 1K5SA 1XDCA 5KAIZ 1VQ9V 1Y74B 3D36C 4NXMB 2Q7GA 3RFRA 2FMLA 5KHKA 4IHJA 4W4LA 2AZ2A 3OR6C 1GM9A 1PM9A 2GV9A 1XUQA 3ZRWB 2HLDG 3RVZA 2GBOA 1K9MW 1YF2A 5LYJA 1N34O 4X1KB 5J2TA 2VQEO 3CCSV 4FLUA 1JJOA 4E2LA 2HKOA 2LGWA 2PI4A 3TXSA 1BL8A 3ABKC 5JQGB 1O9GA 1XMOB 3ASOB 5FNVB 4LF8O 1ZTEA 1UFIA 5BMVA 2BTOA 4WFFA 5GTIZ 3AG4B 1MZEA 3H1HH 4LP8A 3JD2A 2DYRB 4CC5A 1S5HC 3BRCA 4DR1O 2RMKB 2N05A 4O2AA 1FXKB 3ABMC 1YJ9V 1DGSA 4PA3A 2GDSA 4TV9A 4UB6Z 4I50A 1BQ0A 2PF4E 3T1YB 4J9ZB 4CH6A 1K5QA 3S3XA 4X1YA 3ABLC 4H0LB 3QVNA 2UUAB 2D2CB 3TGUH 3ML0A 4UUJC 2FB5A 1SA0A 2EILB 3SYAA 4FVMA 1MABG 4YJ3A 4DV4B 3A2FA 1MNGA 4MT8A 4DV3B 3RT3C 1SQQH 2YDEA 1DK1A 1VQ6V 5AG2A 3ZBHA 4JI1O 2ILMA 3EFFK 3L71H 2B5UA 1XI1A 1XOUA 1VQLV 1I0HA 4IYHA 1I5YA 4J7ZA 3K59A 5KHJA 3JD3A 1NBMG 2VWJA 2FL4A 1XNQO 1Q82W 4B3RO 4GLXA 3T1CA 5DECA 2BSKB 4LF9B 4MVUA 4DUZO 4B3SO 4UVCA 4PI2A 4ZHQA 3H9VA 4TSFG 1NVPB 3CJHA 1LR1A 2LFSA 4EFEA 3THOA 2LGQA 1DTOA 4I55B 1TUBB 5IY5C 1KP3A 3CMEV 2YS8A 1PD3A 1RP3B 2LW7A 2WLIA 2B9ZA 2F95B 4JYCA 5IYDO 3ICXA 3O65A 1R6TA 4X20B 2W6IG 4Q20A 2UXCB 5IYCO 4NKGB 4JI7O 3QTCA 4D7SA 1MSWD 3ZRSA 4JI3O 1CXZB 3T4ZA 2ARHA 1I94O 4WCEV 4P9OA 4KHPB 2IJKA 4PV1B 4J11A 1M9NA 2Y4TA 3E83A 1QR9A 2DQ0A 1FKAO 1BE3H 5LMNO 3BAAA 3K5LA 1XMQO 2QKCA 2OCCB 1R3IC 3H01A 5EIBD 4FLZA 1H2LA 5EZYA 3NR7A 4U7NA 1NTKH 3OW2U 1Q6IA 2UUBO 1KD1W 4HYOA 3JATA 3JAKB 4HAMA 1FJGB 1K33A 5KUMA 1IBKB 3K5NA 5L3FA 1T5EA 1GN6A 4O4JB 1HNZB 3OUSA 1VARA 2RDCA 1Q6HA 1P7BA 1IXBA 1Y67A 2YEVB 3AG2B 3HKBA 3ZIAG 5ITZA 3JD4A 1K34A 1F7YA 4OX9B 4DR7B 2E76B 1TAEA 1BZKA 1N36B 4UV9A 5IJ9B 2FKXA 2UUCB 2KG7A 1X4TA 3DC5A 3LDDA 4GYCB 3CCJV 4I9WA 1JR9A 2UXXA 2N74A 1L0LH 4DR2O 3RN4A 3N2KA 3ASNC 1Q6UA 3GVMA 1QBZA 4I4TA 3SR2C 3BEHA 4PA4A 4ZI7B 2WAMA 1K92A 2JS5A 3B8MA 3ZX6A 1ORQC 2Z5UA 4PA7A 3OMNB 4BR6A 4F6RB 5J9PC 2QWOB 2ODMA 3CS5A 4EEQA 4O2BB 3E22A 4X89A 4LNUA 2QEXV 2F43G 5GONA 3CC2V 3MHSC 5IWAB 1H2MA 4HBNA 4BIOA 1F23A 4K0KO 4TV8B 3ZRVA 2WLKA 4MS2A 1N32O 4FPPA 2IM9A 3K0DA 4F6EA 3CCLV 4RUEA 1S5JA 5LA6B 1K97A 2OT5A 1KKCA 1RPOA 5L3BA 4QJFB 4JGSA 2F93B 3SYPA 2KSDA 4JYYA 3VQVA 3K5MA 2IJJA 3OMIB 1XL4A 4O4IB 2QKAA 4DV7B 2A0LA 1IBLO 3RYCB 1NH2D 1OCRB 1AI5A 1BGYH 1B06A 3CPWU 5K1XA 1B3QA 1FFXA 4MTXA 3WFVA 2HR3A 2HG5C 1WP8A 4MW3A 4ABMA 2BTQB 2D3OW 4Q6GA 5CB4A 3FB7C 5KHGA 2NNUA 1YXBA 2ZXWC 1M90W 5B66Z 2NN4A 2CDYA 3C90A 2A79B 2OCHA 5LMUB 2LFRA 2MK3A 4QPJA 1GKFA 2XASA 4WF9V 1V55C 1AP6A 1VF5B 1NJIW 3BY6A 4UVAA 2EIKC 3J80N 2AZ0A 3CHXA 1H8EG 1XBLA 4I0XB 2XOKG 2F66C 2OYQA 2B1IA 2ZQMA 1SQBH 2CK3G 1KMIZ 4EB6A 3K79A 3SJAC 4R8CA 3K9SA 2H3OA 3AG3C 1FPOA 1WN7A 3OR7C 3GB7C 2EBOA 4U3JA 1K8AW 4PA6A 1QU7A 1L0NH 3CSXA 2Y0IA 5ITZB 1NTMH 3L75H 2YIDA 5IYZB 3D3QA 4TT3G 1SETA 1XHXA 1FS0G 5D5PA 3CRAA 2OTLV 1Y76B 4G2KA 5CA1A 1XNRB 4QE7A 1E1RG 5LOVA 4O4LB 4FFBB 4LFAB 5EIBC 3CEIA 1U96A 4FFKA 3B40A 4R50A 2WLJA 1AROP
chains in the Genus database with same CATH topology
2QTOA 3JD1A 1VQOV 1QVFU 5L3GA 3X2QC 1AI6A 3B77A 2DYRC 3HPLC 4JTAB 3CCRV 3UM7A 3F5WC 3CCUV 5DN6G 3WG7B 1FXKC 1G8MA 4X8AA 4RAIA 3RVYA 2X6AA 3E86A 2Q67A 2ZDIC 2V7QG 3ZMTA 2W6JG 5L3DA 5EBWC 3E8HA 4JPRA 1VQ8V 5EBMC 2FTKA 3FYEB 1JJ2U 1M56B 2JEXA 1V54C 1YJWV 2X0LA 2A9HA 5B1AC 1Q86W 3OGCC 2EILC 3KG2A 1PKXA 2ZXWB 3JCZA 5KUKA 3F7VC 4GX2A 1GK9A 3DTUB 2XAJA 4JYBA 4HZ3A 4P2ZA 2BOBC 4MVRA 3ZN1A 1VQKV 4QIWF 5EBLC 1V55B 2EIMC 1PNKA 2PI5A 1YSCA 2R9RB 1XL6A 5B1NA 4BIZA 2BOCC 5FL7G 1K5SA 3M99B 3QO8A 1N8RW 2Y69C 3CD6V 4I5SA 3ABTA 1JVMA 2WLMA 1VQ9V 3OEHG 5EC2C 1J95A 1OCZB 2B1GA 2EIJC 3ZRWA 4MVSA 1E79G 1BHBA 1DF5A 4LC1A 4MVOA 5H9CA 5EK0A 2H8PC 3OR6C 1L1FA 4QNHB 1VQPV 1GM9A 3SPJA 3ZRWB 2IW5A 2GSMB 3JYCA 5H6QA 3AG3B 2HLDG 3RVZA 1K9MW 1YJNV 3IFXA 1ENVA 3GWOA 2HVJC 3B8NA 2DWEC 5KA6A 3E8FA 1OCOC 3LDCA 5GW7A 3I55V 2EJRA 1OHHG 1PNMA 3CCMV 3CCSV 1RPRA 4E2LA 1IXMA 1K3EA 2HKOA 2X6BA 2PI4A 1BL8A 3ABKC 1SZTA 1ZWIC 1YHQV 5CA3A 3ASOB 3ZJZA 1VQMV 3SPGA 1Q7YW 4R7CA 2HFEC 4WFFA 4F4LA 1AI4A 2ATKC 3ETDA 3AG4B 1FXKA 3EHBB 4GT1A 4PDRA 2IJHA 4LP8A 2IU3A 3X2QB 3JD2A 2DYRB 3LUTB 2QA4V 1QCEA 1S5HC 3SYCA 3ZMUA 2ZDIA 1KQSU 1FXKB 2ITCC 3JD0A 3D3IA 4P9PA 2W0FC 1AJPA 2DW4A 3FB5C 2X7RB 3I56V 3ABMC 4PDVA 1EBOA 5IYBO 1I5XA 1YJ9V 1W0KG 4PA3A 1H38A 1AR1B 1K73W 1BHAA 2ZR2A 3SPIA 4J9ZB 1K5QA 3OMAB 3ABLC 3TETA 2DWDC 2ZD9A 2Q68A 1V54B 2OCCC 5KA5A 5B3SB 1SERA 5BZBA 1NKDA 3ML0A 4UUJC 2EILB 3SYAA 2WSSG 2XAQA 1MABG 2P90A 4KP4A 2XAGA 1EFRG 1R3JC 3VBBA 1WLEA 2Z3YA 3CC4V 3SPCA 4MT8A 4RQFA 3STLC 2WLHA 1PNLA 2EIMB 3D36A 1VQ6V 1JQ0A 3EFFK 2Y69B 2AHYA 2B5UA 4FK5C 1VQLV 1PL0A 2EZPA 2XAFA 1K4CC 2XNDG 1I5YA 1YIJV 2EINC 2EIJB 4MTGA 1JX9A 3JD3A 1NBMG 5LHIA 1HWYA 5LBQA 1Q82W 2ITDC 2OTJV 3SPHA 4GX5A 4RO2A 3T1CA 2LP7A 4P30A 4PDMA 1R6NA 2QE7G 1MOFA 2EZOA 3AG2C 1DF4A 4MVUA 1R6KA 4UVCA 1OCOB 4TSFG 1NVPB 1K4DC 2X6CA 2LFSA 3K04A 4MVZA 4OXSA 3R65A 3CMAV 1H2GA 3G6EV 1DTOA 5IY5C 3CMEV 1KP3A 1QLEC 2JJ2G 4UV8A 4MTOA 3ABKB 1PD3A 4KUMA 1AJQA 2EIKB 4H37A 4XDKA 3W7TA 2WLIA 3LDEA 2P67A 3W7SA 1RM1C 3ZRXA 3OEEG 4JYCA 5IYDO 3E89A 5LGTA 1E1QG 2W6IG 2WLIB 4Q20A 5IYCO 1SESA 5CN0A 3A0RA 1KP2A 2WWWA 5LGNA 1MSWD 3W7UA 3ZRSA 4CBCA 3T4ZA 2JDIG 4WCEV 1S72V 4P9OA 2QM8A 2IJKA 3P30A 3MHHC 1M9NA 3E83A 3CP1A 3K03A 3ABMB 1QR9A 3IGAC 1Y66A 2DQ0A 4FJCC 1B6QA 3DGEA 5CBFA 1G4YB 3ABLB 5DM6V 3QO5A 2OCCB 1GTOA 2M7WA 1R3IC 5B1BB 3CC7V 4FMTA 3HB3B 3H01A 2DYSB 1OZ0A 3OAAG 2XAHA 2IH1C 1M56C 4GX1A 1OCCB 3RW0A 3MD0A 4ZBMA 1TUEB 4PDLA 1JOYA 3T2MA 4UVBA 2WLLA 1QLNA 4U7NA 3OW2U 2QKSA 1W0JG 3CYOA 1KD1W 4HYOA 4DO2A 4HAMA 2WLLB 1K33A 5KUMA 2JJ1G 2WPDG 5LHHA 4LBEC 4MVQA 1COWG 5C93A 3VOUA 2EINB 5L3FA 3LSQA 1KKDA 1KC8W 5CBGA 3PJSK 1S0VA 4MSWC 2YEVA 5H6RA 3OUSA 3OFNG 1GO3F 1OCRC 4FIPC 4GX0A 1QR8A 1P7BA 4XDJA 4X88A 3NXSA 3AG2B 2YEVB 4JAUA 5B1AB 1CPYA 4MW8A 4R6ZA 3SYOA 3ZMVA 5EC1C 3ZIAG 3JD4A 2P7TC 1K34A 3FKSG 3FB8C 1DLBA 3G71V 1AI7A 1FFTB 4UV9A 3LNMB 1YITV 4JTDB 5L3CA 1RM1B 4H33A 2C2AA 4MVMA 1GM8A 4UXNA 3LDDA 3CCJV 2HVKC 4N21A 4I9WA 4GCZA 2UXXA 5HFMA 1QVGU 3AG1C 3E8BA 1VQ5V 3ASNC 4RQEA 4WFEA 1F51A 1YI2V 1QBZA 3P32A 1Y4MA 2Y48A 4U7OA 2IJIA 2ZR3A 3BEHA 1M57C 1UJWB 1NVPD 3IC7A 4PA4A 2WAMA 1WPXA 4WFGA 1VQNV 1K92A 1JCHA 5IDJA 3ETEA 3K9AA 3T4DA 3B8MA 5B1OA 1ORQC 2Z5UA 4KFMA 3OMNB 4PA7A 3QO7A 4JASA 3F7YC 1CP9A 5J9PC 2K1EA 3UKMA 4WFBV 3LSSA 4G27B 4X89A 2QEXV 2F43G 4PA9A 3CC2V 3MHSC 5HFLA 3ZMSA 1P4RA 5B3SC 2HJFC 1F23A 4JF3A 3ZRVA 4EKWA 1BMFG 2WLKA 1S77D 4MS2A 4RUFA 4FPPA 1CEZA 2DQ3A 1SRYA 3K0DA 4Z1MG 3CCLV 4YXWG 3G4SV 3FB6C 4RUEA 1K97A 2OT5A 3STZC 5L3BA 1RPOA 4XDLA 2Q6AA 4QJFB 3OUFA 4JGSA 1VQ4V 3CCEV 3E35A 1NQTA 4JTCB 3SYPA 4WFHA 2IJJA 3OMIB 1JPXA 3WG7C 5LGUA 3W7WA 1F4MA 1XL4A 1R3KC 2A0LA 3E8GA 1GMGA 4ASUG 1EZJA 1FXVA 1NH2D 1K7DA 1OCRB 5CBHA 1AI5A 2NLJC 3ZMZA 1NH2B 1THZA 4DXWA 3CPWU 1NR1A 4MTXA 3SYQA 3WFVA 2HR3A 2HG5C 2R9IA 4MW3A 2IU0A 2D3OW 4TWKA 1FXHA 4BAYA 3FB7C 1S3JA 2NNUA 4CZZA 4N23A 2ZXWC 1M90W 2IH3C 2A79B 1H8HG 1R3LC 2LFRA 3SJQC 2MK3A 2KB1A 4QPJA 3CCQV 1GKFA 1MG1A 3OE7G 1VQ7V 2XASA 4LCUC 4WF9V 1V55C 3CXCU 1NJIW 3BY6A 3FYIB 1Q81W 2JEUA 4UVAA 4QE9A 2EIKC 2GHYA 5E1AC 1S76D 1H8EG 4PELA 4BW5A 5CMUA 3ZCCA 2XOKG 4G28B 1R73A 1OCZC 3AG1B 4ZKIA 2B1IA 3K06A 3ASNB 2ZQMA 4J9YB 1AJNA 1LNQA 5L3EA 1W2BU 2CK3G 2JK5C 2AHZA 1M1KW 3K79A 4JAVA 3CCVV 1F4NA 1M57B 4R8CA 2V1DA 3AG3C 3AEIA 4XBFA 3W7XA 3OR7C 4L87A 1KECA 3GB7C 2EBOA 3ETGA 5LHGA 2WLNA 1K8AW 3K0GA 4PA6A 3K3WA 3RBZA 3QNEA 2H94A 4WFAV 5IY5B 1QLEB 2QM7A 3TCUA 1NR7A 4TT3G 1SETA 3ABUA 1FS0G 3TK1A 2OTLV 2JIZG 5B1BC 4G2KA 3K08A 3ZN0A 2UXNA 4QE7A 1E1RG 3ASOC 2DYSC 1YTFD 1OCCC 1ROPA 3OM3B 2P6JA 4QPKA 2YSUB 2Q69A 1YTFB 4BIUA 4MTFA 3E2EA 4R50A 1GM7A 2WLJA 3AG4C 1AROP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 W;  1VQO V;  3I56 V;  3G71 V;  1YHQ V;  3CC7 V;  4WFA V;  1QVF U;  1VQ6 V;  3CPW U;  1YJ9 V;  1KC8 W;  3CCL V;  1VQM V;  1VQP V;  3CCR V;  1Q7Y W;  3G4S V;  1K73 W;  1VQN V;  1R73 A;  3CCU V;  1YIT V;  3CC4 V;  1VQL V;  2D3O W;  3CMA V;  3G6E V;  4WCE V;  1VQK V;  1S72 V;  1VQ4 V;  2OTL V;  3CCE V;  3CCJ V;  3CME V;  1YJN V;  1K9M W;  1W2B U;  3OW2 U;  1M1K W;  3CD6 V;  1M90 W;  1N8R W;  3I55 V;  3CCV V;  1KD1 W;  4WFB V;  1QVG U;  1Q82 W;  3CCM V;  3CCS V;  2QEX V;  2QA4 V;  3CC2 V;  2OTJ V;  3CCQ V;  1YIJ V;  1VQ8 V;  1KQS U;  1VQ7 V;  1VQ5 V;  1VQ9 V;  4WF9 V;  1JJ2 U;  1K8A W;  1YJW V;  3CXC U;  1YI2 V;  1NJI W;  1Q81 W;  5DM6 V; 
#chains in the Genus database with same CATH topology
 1SF9 A;  2QTO A;  3JD1 A;  2K9P A;  3B77 A;  2R9A A;  3HPL C;  3UM7 A;  1XQ8 A;  4UCT A;  3WB0 A;  3CCU V;  3WG7 B;  3T1H B;  5GTH Z;  3RVY A;  5JVD B;  1TVK B;  2X6A A;  1A32 A;  1X59 A;  2Q67 A;  3A0B Z;  2Q5Z A;  2ADQ B;  2V7Q G;  3K5O A;  1JJ2 U;  2YIB A;  3QF7 A;  1P49 A;  4GKJ O;  4GX2 A;  1GK9 A;  2KQX A;  3BA8 A;  3DTU B;  4JYB A;  3BPZ A;  2BOB C;  4QIW F;  1Y74 A;  2XTA A;  1N0J A;  2PI5 A;  2ZKO A;  1XL6 A;  2Q0O C;  5FL7 G;  3M99 B;  3ABT A;  2WLM A;  4GKK O;  1D2D A;  2EX3 A;  3MDS A;  4X1I B;  3K57 A;  3ZRW A;  2OIG A;  4JI8 O;  3R66 A;  4MVO A;  5EK0 A;  1MZF A;  3K58 A;  4X1K A;  3SPJ A;  3JAL B;  1R1B A;  3JYC A;  5H6Q A;  3CE2 A;  1MSD A;  4I9Q A;  5TIS Z;  1N0N A;  3LDC A;  5GW7 A;  5JQG A;  3I55 V;  4PI0 A;  1PNM A;  4DV2 B;  3CCM V;  4UCO A;  1IXM A;  1K3E A;  5FNV A;  1AP5 A;  1IBM O;  1SZT A;  2VQF B;  1N4C A;  1D5N A;  3BHP A;  3ZED A;  3ZJZ A;  1Q7Y W;  4R7C A;  2XT9 A;  3S3W A;  2ATK C;  4CS2 A;  4GT1 A;  1FXK A;  3EHB B;  2IJH A;  1HP8 A;  4OPH A;  2Q7E A;  1VEW A;  3F5T A;  2RN9 A;  2QA4 V;  1KQS U;  3JD0 A;  4P9P A;  3D3I A;  1BSM A;  2W0F C;  1AJP A;  2DW4 A;  4JYA O;  2PZS A;  3I56 V;  1QQC A;  5IYB O;  1EBO A;  2ZM6 O;  4GZR B;  4BW9 A;  4FLY A;  3OMA B;  3UT5 B;  3CB2 A;  4YHH B;  2Q68 A;  1V54 B;  5KA5 A;  1H2N A;  1SER A;  1NKD A;  2UU9 O;  2QM4 A;  1ZSP A;  2XAQ A;  1PPJ H;  4KP4 A;  4RWU A;  1GRJ A;  2Z3Y A;  4RQF A;  4YJ2 B;  1AR5 A;  2WLH A;  1PNL A;  2EIM B;  2P06 A;  1OJH A;  2QWQ B;  4FK5 C;  4FM2 A;  1PL0 A;  2EZP A;  2XAF A;  1K4C C;  2XND G;  5JWP A;  1Q5O A;  2EIN C;  4MTG A;  2BSK A;  5LHI A;  1HWY A;  3WB2 A;  5LBQ A;  1GH6 A;  3M7M X;  4Z2W A;  4AQY B;  1EN5 A;  2Q8V A;  3AK1 A;  1M93 A;  1R6N A;  2JVD A;  2CGN A;  1AB3 A;  1MOF A;  1DF4 A;  1NI8 A;  1EM1 A;  4DV5 B;  3O9O A;  1K4D C;  2X6C A;  5KX5 B;  3G6E V;  1GN2 A;  2E5L O;  1QLE C;  2JJ2 G;  4X66 B;  3ABK B;  4KUM A;  1AJQ A;  4H37 A;  1AR4 A;  3Q4H B;  4X20 A;  2F4V O;  4LR3 A;  2P67 A;  3W7S A;  2YIA A;  4DR3 O;  3ZRX A;  3OEE G;  1I7F A;  3ZS8 C;  3RGB A;  2EUL A;  1SES A;  3A0R A;  1KP2 A;  3CRQ A;  2WWW A;  3W7U A;  5LP6 C;  4CBC A;  2CTQ A;  1HNX B;  3P30 A;  3MHH C;  1G6U A;  4X62 B;  2OIE A;  3ABM B;  2CTR A;  3IGA C;  1Y66 A;  2A7W A;  4K3A A;  1B6Q A;  4B3M O;  2PTM A;  3ABL B;  4DRX B;  4FLW A;  4JI0 B;  3QO5 A;  4JI6 B;  5B1B B;  3CC7 V;  2DYS B;  2Z0A A;  1OZ0 A;  3OAA G;  2XAH A;  3SJC C;  5KHI A;  1OCC B;  3RW0 A;  4DUY O;  1TUE B;  4PDL A;  3JAK A;  1JOY A;  4UVB A;  1HR0 B;  3CYO A;  5JCO A;  5IE9 A;  2WLL B;  3CRM A;  2JJ1 G;  5LHH A;  4JV5 B;  4O4J A;  3VOU A;  2YI9 A;  4YIP A;  1Z5W A;  4X64 B;  1KC8 W;  2CTW A;  1URF A;  4WBN B;  4MSW C;  2YEV A;  5H6R A;  4DR6 B;  3OFN G;  1GO3 F;  4FIP C;  4ICG A;  4GX0 A;  1VF6 C;  3NXS A;  5B1A B;  4JAU A;  2QJ1 A;  4R6Z A;  1PV0 A;  1SS3 A;  5IJ9 A;  4DV1 B;  3G71 V;  4FLV A;  3LNM B;  1YEW A;  1GM8 A;  3HKD B;  1PP9 H;  2UXB O;  1MMM A;  5CA0 B;  3L74 H;  4UCR A;  2ZE8 A;  3E8B A;  1VQ5 V;  4ZI7 A;  4RQE A;  4WFE A;  1IVS A;  4LFC O;  1Y4M A;  2Y48 A;  5KMG B;  4F6R A;  1KUQ A;  4X65 B;  4WFG A;  1VQN V;  1XRE A;  4LF4 B;  1KBH A;  4O2B A;  3T4D A;  1D5A A;  5B1O A;  2O57 A;  4JAA A;  1CP9 A;  2NR5 A;  4TV8 A;  1SQG A;  4G27 B;  4PA9 A;  3JSL A;  3ZMS A;  4LH7 A;  3IAY A;  4EKW A;  1JFF B;  4RUF A;  5LA6 A;  3RYF B;  2DQ3 A;  4YY3 O;  4Z1M G;  3G4S V;  3HKC B;  2RNB A;  3P3P A;  2Q6A A;  3OUF A;  4O4I A;  1SQX H;  1NQT A;  3CRC A;  3DXR B;  4JTC B;  1XHZ A;  3RYC A;  1YVW A;  4WFH A;  2P22 C;  2E74 B;  4DW0 A;  2DJV A;  3W7W A;  2HHH B;  4CH4 A;  3BA9 A;  4J7J A;  4ASU G;  2CGO A;  2BTQ A;  5CBH A;  2NLJ C;  2GUZ B;  4LFB O;  1THZ A;  2XHB A;  1L8D A;  3IJ4 A;  3FAV B;  3OTO B;  2R9I A;  1TA8 A;  1S3J A;  2XUM A;  2ZNJ A;  5FLX N;  3CRR A;  1H2S B;  1H8H G;  4UCV A;  4JI2 B;  4DR4 O;  4B3T O;  1YIJ V;  4I0X A;  5D5Q A;  1Q81 W;  2JEU A;  2RJZ A;  3OTF A;  2QSA A;  4BW5 A;  1IDS A;  4H44 B;  1OCZ C;  4NXM O;  3ZHS A;  4TQD A;  3ASN B;  4JI4 B;  4J9Y B;  2IBZ H;  2PYJ A;  1W2B U;  1M1K W;  4LF6 B;  4JZG A;  4K35 A;  1WPB A;  2WA3 A;  3AEI A;  5IYZ A;  3MAQ A;  1Y76 A;  5IJ0 B;  4O4L A;  2HJD A;  4FFB A;  1N33 B;  3TK1 A;  1ZX3 A;  4JI6 O;  2F1M A;  4OGQ B;  1XMO O;  2QR4 A;  1ROP A;  3OM3 B;  2Q69 A;  5BY1 A;  4MTF A;  3E2E A;  1VP7 A;  1QVF U;  5JVD A;  4O4H B;  1TVK A;  3X2Q C;  4JTA B;  4H13 B;  5DN6 G;  1G8M A;  5JCO C;  4RAI A;  3LNN A;  4NR1 A;  1QNM A;  3E86 A;  3ZMT A;  5L3D A;  1Y6X A;  4JPR A;  3T1Y O;  2FTK A;  3FYE B;  1M56 B;  2JEX A;  1YJW V;  2UUA O;  1LUW A;  3OGC C;  2ZXW B;  5KUK A;  2AXT Z;  2Q0A A;  2XAJ A;  3HKE B;  2A3Q A;  3JAW B;  4P2Z A;  1VQK V;  4DV4 O;  2F23 A;  1V55 B;  4DV3 O;  1P7G A;  4UCU A;  4X1I A;  4BIZ A;  3CD6 V;  5EYP B;  2Y69 C;  4I5S A;  1JVM A;  4JI5 B;  3OEH G;  2EIJ C;  3JAL A;  4DW1 A;  1E79 G;  1DF5 A;  4LC1 A;  5H9C A;  3ZHU A;  1TGO A;  1L1F A;  4QNH B;  1VQP V;  2IW5 A;  3VQY A;  2GSM B;  3FFQ A;  3AG3 B;  2GTS A;  4LF7 B;  4LF9 O;  1YJN V;  3GWO A;  3DSQ A;  5KA6 A;  4ZOL B;  4IT5 A;  1OCO C;  3JAS B;  4DK1 A;  4DV0 B;  2AGA A;  4DYL A;  1KU9 A;  1YHQ V;  4LF5 B;  3SPG A;  4IGG A;  2QWR B;  3ETD A;  5JH7 B;  4PDR A;  2Q9L A;  2UXC O;  3SJB C;  3SYC A;  3ZMU A;  2ZDI A;  4KHP O;  1Q43 A;  3UT5 A;  2X7R B;  2LQT A;  1ZL8 B;  2HP8 A;  3JCU Z;  2VRZ A;  1K73 W;  1BHA A;  3SPI A;  1HNW B;  3AK3 A;  2ZD9 A;  1XIL A;  5B3S B;  4LWS B;  2A06 H;  4YJ2 A;  2WSS G;  2PGG A;  1JA8 A;  1EFR G;  1R3J C;  1WLE A;  3CC4 V;  3SPC A;  5BR8 B;  4NXN B;  2Q4P A;  3D36 A;  2Y4U A;  1US6 A;  1FJG O;  2AHY A;  1NS1 A;  5B5E Z;  4KL1 A;  1IBK O;  4A5U B;  2FYU H;  1SQV H;  3J7A U;  2ITD C;  1HNZ O;  4GX5 A;  1W59 A;  4CC6 A;  1IX9 A;  2LP7 A;  4P30 A;  5KX5 A;  2QE7 G;  2Q73 A;  2EZO A;  1N34 B;  2GTA A;  2YIB D;  2VQE B;  3C3T A;  4OXS A;  4CH5 A;  4MVZ A;  4OPA A;  1P84 F;  3CMA V;  3Q4H A;  4GUN A;  4OX9 O;  4DR7 O;  4MTO A;  2HEP A;  4XDK A;  4LF8 B;  1N36 O;  3LDE A;  1RM1 C;  3H1J H;  4DR5 B;  4QGP A;  2UUC O;  3E89 A;  4K8X A;  5LGT A;  1E1Q G;  2OWO A;  3B4S A;  2DN9 A;  4DR1 B;  2JDI G;  1S72 V;  3APO A;  2QM8 A;  3TXQ A;  1YCI A;  2UXD B;  3AK2 A;  4DRX A;  4FLX A;  3K03 A;  3U10 A;  3JSN A;  3DGE A;  3U0Z A;  1G4Y B;  5DM6 V;  3LSU A;  1GN4 A;  4BWA A;  2JS3 A;  2IH1 C;  4J80 A;  3MD0 A;  5IWA O;  1FAF A;  3T2M A;  3ZHV A;  2WLL A;  4NYK A;  2QKS A;  5FPR A;  4JI1 B;  4IL6 Z;  1LUV A;  1HW7 A;  3JAR B;  2WPD G;  3CWB H;  4WBN A;  1J5E B;  5BXZ A;  1COW G;  5C93 A;  3N27 A;  2EIN B;  3LSQ A;  1KKD A;  1BT8 A;  3OGI B;  5CBG A;  3PJS K;  4TUY B;  4JI5 O;  1XNQ B;  1S0V A;  4B3R B;  4DV7 O;  4KXR A;  4XDJ A;  4X88 A;  2YIC A;  4DUZ B;  4B3S B;  3L70 H;  3FX7 A;  4MW8 A;  3SYO A;  5EC1 C;  2P7T C;  3FB8 C;  3RYH B;  2LO1 A;  4FLT A;  2M6Y A;  3HKD A;  5LMU O;  5LXT B;  5CA0 A;  4DV0 O;  4JTD B;  1YIT V;  5L3C A;  1AVM A;  4UXN A;  4MVM A;  4N21 A;  1XEQ A;  4JI7 B;  5KMG A;  3AG1 C;  5LP6 B;  3L73 H;  1I94 B;  1HDJ A;  1YI2 V;  3P32 A;  2CH7 A;  4U7O A;  2IJI A;  2ZR3 A;  5A9G A;  1M57 C;  1NVP D;  3IC7 A;  1WPX A;  1JCH A;  3ETE A;  3K9A A;  5LMN B;  2YUA A;  1XMQ B;  4TQF A;  3QO7 A;  2W0X A;  3F7Y C;  4JAS A;  1JFF A;  2P4V A;  3LSS A;  4FZ0 A;  4NB5 A;  3RYF A;  2BE3 A;  4U3F H;  5HFL A;  1P4R A;  2R70 A;  1RSO B;  2HJF C;  4JF3 A;  3HKC A;  1BMF G;  1XNR O;  5JJJ B;  1SRY A;  3DXR A;  4YXW G;  4LFA O;  2VWK A;  3FB6 C;  1S5L Z;  4XDL A;  1VQ4 V;  4UCS A;  5KLV H;  3CCE V;  4AI8 A;  4NVP A;  2GUZ A;  5LGU A;  4E4E A;  3T1H O;  2Y0P A;  3FAV A;  4HNA B;  1EZJ A;  1SC5 B;  1IUR A;  1NZ6 A;  4DXW A;  2E75 B;  3SYQ A;  2E3C A;  4BAY A;  4IIJ B;  4CZZ A;  3WU2 Z;  2IH3 C;  3OD4 A;  1ZLZ A;  2KB1 A;  1MG1 A;  1VQ7 V;  4LCU C;  3J81 N;  3CXC U;  4C7U A;  4QE9 A;  3VQX A;  2GHY A;  5CMU A;  1WA8 B;  3ZCC A;  4DR2 B;  4DR5 O;  5H2F Z;  3RYI A;  4DV6 B;  3K06 A;  5L3E A;  2ZNI A;  3IC9 A;  4PHZ A;  1SZX A;  1F4N A;  2V1D A;  3A8T A;  2CAZ C;  4L87 A;  5IJ0 A;  1KEC A;  3ETG A;  5LHG A;  2WLN A;  2UXD O;  2JGU A;  3K3W A;  3RBZ A;  4WFA V;  5IY5 B;  1AIL A;  4D7T A;  1FD9 A;  4DV2 O;  3TCU A;  3GWK C;  3QG5 A;  3ABU A;  4J10 A;  2YXY A;  4K0K B;  5B1B C;  3ZN0 A;  3K08 A;  1N32 B;  2UXN A;  3ASO C;  2DYS C;  2VQF O;  1OCC C;  1NT2 B;  1YTF B;  4O4H A;  4BIU A;  3HR0 A;  1VMG A;  2YXL A;  1GM7 A;  3AG4 C;  3W7X A;  3A0H Z;  4ZIB A;  2DYR C;  3ZHT A;  1O9H A;  3ZHR A;  1FXK C;  1J5E O;  4X8A A;  1FYJ A;  1YZB A;  1IBL B;  2CH7 B;  2KKW A;  3I5D A;  3UCS C;  2W6J G;  2JGD B;  3BCC H;  5C8Y B;  5EBM C;  3H1K H;  2X0L A;  4YHH O;  3HKE A;  2A9H A;  5J2U B;  5B1A C;  3JAW A;  1Q86 W;  3KCY A;  2EIL C;  1NTZ H;  5FPO A;  3BVO A;  1SKV A;  5EYP A;  3H1I H;  4AIL C;  4HZ3 A;  3BFR A;  5H5N A;  3ZN1 A;  1ZUQ A;  1PNK A;  5B1N A;  1YSC A;  1GAX A;  4W4K A;  3QO8 A;  4J42 A;  1N8R W;  3B09 A;  3C3S A;  5EC2 C;  1J95 A;  1OCZ B;  2B1G A;  4MVS A;  3SDL A;  3N2G A;  1BHB A;  2H8P C;  3CXH F;  2ETN A;  4TOI A;  4NTW A;  4ZOL A;  4AQY O;  3JAS A;  4IHJ B;  2N04 A;  3IFX A;  1ENV A;  2HVJ C;  3B8N A;  2DWE C;  3E8F A;  4DV5 O;  3CX5 F;  2EJR A;  1OHH G;  1EN4 A;  1GN3 A;  3VQW A;  1RPR A;  4JZ2 A;  2X6B A;  5LYJ B;  1NU1 H;  3L9D A;  4X66 O;  1ZWI C;  1WNS A;  5J2T B;  1JMK C;  2DE0 X;  5CA3 A;  5JH7 A;  1VQM V;  2RQ6 A;  2EJ7 A;  1YDX A;  2CE4 A;  2HFE C;  4B7E A;  4F4L A;  1AI4 A;  2LJ2 A;  1ZAU A;  3L72 H;  1Q8I A;  2IU3 A;  3X2Q B;  2DMX A;  5BMV B;  4LH6 A;  3LUT B;  1ZL8 A;  1QCE A;  3RYI B;  4UB8 Z;  1HNX O;  2ITC C;  2LW1 A;  2ZT9 B;  3FB5 C;  2ZIN A;  4X62 O;  2QGN A;  4PDV A;  1I5X A;  1W0K G;  4LWS A;  4O2A B;  3ZHQ A;  1AR1 B;  1H38 A;  2ZR2 A;  3TET A;  2DWD C;  2OCC C;  4JI0 O;  4TV9 B;  5BZB A;  4I50 B;  4X1Y B;  4GKJ B;  2P90 A;  2XAG A;  3VBB A;  3STL C;  1SA0 B;  1HR0 O;  2YXH A;  4YJ3 B;  1JQ0 A;  5JJN B;  2Y69 B;  4I7Z B;  3KZI Z;  1IZ3 A;  4GKK B;  2JRI A;  4JV5 O;  2DOS A;  2EIJ B;  4JI8 B;  1JX9 A;  2P5O A;  4Z1V A;  4X64 O;  2OTJ V;  3SPH A;  4DV6 O;  4RO2 A;  4DR6 O;  4PDM A;  1Z5V A;  3AG2 C;  1R6K A;  3EXA A;  1OCO B;  3KCX A;  1WAZ A;  3K04 A;  3R65 A;  1H2G A;  3JAM N;  2VS0 A;  1IBM B;  3G80 A;  4ZHQ B;  4UV8 A;  1EZV H;  3TJT A;  2G38 A;  4DV1 O;  3CJH B;  2EIK B;  3PN1 A;  3W7T A;  1Q3E A;  3UQ8 A;  4K8Z A;  4CS3 A;  5A2Q N;  2WLI B;  2ZE7 A;  5CN0 A;  4L8J A;  5LGN A;  2ZIM A;  4J41 A;  4IYI A;  3N2G B;  3G67 A;  4JYA B;  3CP1 A;  2ZM6 B;  2PUS A;  4X65 O;  4FJC C;  1I08 A;  4LF4 O;  1VF7 A;  5CBF A;  1BQZ A;  3P3N A;  1GTO A;  2M7W A;  2UU9 B;  4FMT A;  3HB3 B;  1M56 C;  4GX1 A;  1G1X B;  4ZBM A;  2QTS A;  1M5I A;  3JAR A;  1QLN A;  5DED A;  1W0J G;  2PY5 A;  4DO2 A;  1H2K A;  2RCV A;  5EZY B;  1UPG A;  4LBE C;  4TUY A;  4MVQ A;  3JAT B;  4D6T H;  5JJE B;  5LL6 Y;  2HHH O;  3BAB A;  1U97 A;  2QWN B;  1OCR C;  1QR8 A;  2P4K A;  3RYH A;  1CPY A;  2AW9 A;  3ZMV A;  3OTO O;  4NTX A;  4B7K A;  2QDO A;  2V4D A;  3FKS G;  4DK0 A;  5LXT A;  2ZIO A;  1DLB A;  2E5L B;  3FD9 A;  3HKB B;  1AI7 A;  4JI2 O;  2ZE5 A;  1FFT B;  2F4V B;  4FM1 A;  4DR3 B;  1RM1 B;  4H33 A;  2C2A A;  2YI8 A;  2L35 A;  4NTY A;  2HVK C;  5LP6 A;  1BS3 A;  4GCZ A;  1B04 A;  5HFM A;  1QVG U;  1WP7 A;  3U11 A;  2KG7 B;  1Z2G A;  1F51 A;  4JI4 O;  4J7K A;  2PYL A;  4LF6 O;  1UJW B;  3N2K B;  2R72 A;  3SGI A;  5IDJ A;  4B3M B;  4I4T B;  1V9P A;  4KFM A;  1RSO A;  2ZCE A;  2K1E A;  3UKM A;  4WFB V;  1N33 O;  4DUY B;  3UO3 A;  5B3S C;  1S77 D;  5E79 Z;  3OT7 A;  1SQP H;  1CEZ A;  3E22 B;  4LNU B;  5GON B;  4YIO A;  1EN6 A;  2BCC H;  3STZ C;  3KKY A;  3WB1 A;  4B08 A;  3E35 A;  3RWR D;  3ETQ A;  4HNA A;  4X9Q A;  3APQ A;  1JPX A;  3WG7 C;  1F4M A;  1VF6 A;  1R3K C;  1WJZ A;  3D8C A;  3E8G A;  1GMG A;  1FXV A;  1K7D A;  2MW2 B;  4IIJ A;  3ZMZ A;  1RFY A;  1NH2 B;  1KYO F;  1NR1 A;  2IU0 A;  4TWK A;  1WB7 A;  1FXH A;  3G6B A;  4N23 A;  1FFX B;  1SQF A;  1R3L C;  5CB4 B;  3SJQ C;  3CCQ V;  2L6L A;  3OE7 G;  1WA8 A;  4FM0 A;  2ADP A;  3FYI B;  5E1A C;  1S76 D;  2UXB B;  4CS4 A;  4PEL A;  4G28 B;  1R73 A;  4PJ0 Z;  3AG1 B;  4ZKI A;  1AJN A;  1LNQ A;  3B2E E;  4AHC A;  2JK5 C;  1MA1 A;  1OV9 A;  2AHZ A;  4LFC B;  4JAV A;  2YC0 A;  3CCV V;  1M57 B;  5K1P A;  4XBF A;  5F2V O;  4CH3 A;  4EB6 B;  1Q90 D;  1M4U A;  3DC6 A;  4LF7 O;  3K0G A;  3QNE A;  2H94 A;  1QLE B;  2WA4 A;  2QM7 A;  4U3J B;  3AG7 A;  1NR7 A;  1QHT A;  1PL4 A;  2JIZ G;  4PD4 F;  4UFZ A;  1YTF D;  4YY3 B;  4LF5 O;  2P6J A;  4QPK A;  2YSU B;  3EVK A;  4EFB A;  1KB9 F;  5CA1 B;  4JI3 B;  1VIB A;  5LOV B;  4FZ1 A;  1VQO V;  5L3G A;  1AI6 A;  2CTP A;  3CCR V;  2CUG A;  5KAF Z;  3F5W C;  2JGD A;  5C8Y A;  2ZDI C;  5J2U A;  4LFB B;  5EBW C;  3E8H A;  1HNW O;  1VQ8 V;  1WB8 A;  3M8A A;  1V54 C;  3UO2 A;  3H1L H;  5IT9 N;  4I55 A;  1TUB A;  3KG2 A;  1PKX A;  3JCZ A;  3F7V C;  2UUB B;  2ZE6 A;  4DR4 B;  4B3T B;  5KHH A;  1BCC H;  2Q7H A;  4MVR A;  5EBL C;  5BR8 O;  2EIM C;  2QWP B;  4NXN O;  2R9R B;  2BOC C;  1K5S A;  1XDC A;  5KAI Z;  1VQ9 V;  1Y74 B;  3D36 C;  4NXM B;  2Q7G A;  3RFR A;  2FML A;  5KHK A;  4IHJ A;  4W4L A;  2AZ2 A;  3OR6 C;  1GM9 A;  1PM9 A;  2GV9 A;  1XUQ A;  3ZRW B;  2HLD G;  3RVZ A;  2GBO A;  1K9M W;  1YF2 A;  5LYJ A;  1N34 O;  4X1K B;  5J2T A;  2VQE O;  3CCS V;  4FLU A;  1JJO A;  4E2L A;  2HKO A;  2LGW A;  2PI4 A;  3TXS A;  1BL8 A;  3ABK C;  5JQG B;  1O9G A;  1XMO B;  3ASO B;  5FNV B;  4LF8 O;  1ZTE A;  1UFI A;  5BMV A;  2BTO A;  4WFF A;  5GTI Z;  3AG4 B;  1MZE A;  3H1H H;  4LP8 A;  3JD2 A;  2DYR B;  4CC5 A;  1S5H C;  3BRC A;  4DR1 O;  2RMK B;  2N05 A;  4O2A A;  1FXK B;  3ABM C;  1YJ9 V;  1DGS A;  4PA3 A;  2GDS A;  4TV9 A;  4UB6 Z;  4I50 A;  1BQ0 A;  2PF4 E;  3T1Y B;  4J9Z B;  4CH6 A;  1K5Q A;  3S3X A;  4X1Y A;  3ABL C;  4H0L B;  3QVN A;  2UUA B;  2D2C B;  3TGU H;  3ML0 A;  4UUJ C;  2FB5 A;  1SA0 A;  2EIL B;  3SYA A;  4FVM A;  1MAB G;  4YJ3 A;  4DV4 B;  3A2F A;  1MNG A;  4MT8 A;  4DV3 B;  3RT3 C;  1SQQ H;  2YDE A;  1DK1 A;  1VQ6 V;  5AG2 A;  3ZBH A;  4JI1 O;  2ILM A;  3EFF K;  3L71 H;  2B5U A;  1XI1 A;  1XOU A;  1VQL V;  1I0H A;  4IYH A;  1I5Y A;  4J7Z A;  3K59 A;  5KHJ A;  3JD3 A;  1NBM G;  2VWJ A;  2FL4 A;  1XNQ O;  1Q82 W;  4B3R O;  4GLX A;  3T1C A;  5DEC A;  2BSK B;  4LF9 B;  4MVU A;  4DUZ O;  4B3S O;  4UVC A;  4PI2 A;  4ZHQ A;  3H9V A;  4TSF G;  1NVP B;  3CJH A;  1LR1 A;  2LFS A;  4EFE A;  3THO A;  2LGQ A;  1DTO A;  4I55 B;  1TUB B;  5IY5 C;  1KP3 A;  3CME V;  2YS8 A;  1PD3 A;  1RP3 B;  2LW7 A;  2WLI A;  2B9Z A;  2F95 B;  4JYC A;  5IYD O;  3ICX A;  3O65 A;  1R6T A;  4X20 B;  2W6I G;  4Q20 A;  2UXC B;  5IYC O;  4NKG B;  4JI7 O;  3QTC A;  4D7S A;  1MSW D;  3ZRS A;  4JI3 O;  1CXZ B;  3T4Z A;  2ARH A;  1I94 O;  4WCE V;  4P9O A;  4KHP B;  2IJK A;  4PV1 B;  4J11 A;  1M9N A;  2Y4T A;  3E83 A;  1QR9 A;  2DQ0 A;  1FKA O;  1BE3 H;  5LMN O;  3BAA A;  3K5L A;  1XMQ O;  2QKC A;  2OCC B;  1R3I C;  3H01 A;  5EIB D;  4FLZ A;  1H2L A;  5EZY A;  3NR7 A;  4U7N A;  1NTK H;  3OW2 U;  1Q6I A;  2UUB O;  1KD1 W;  4HYO A;  3JAT A;  3JAK B;  4HAM A;  1FJG B;  1K33 A;  5KUM A;  1IBK B;  3K5N A;  5L3F A;  1T5E A;  1GN6 A;  4O4J B;  1HNZ B;  3OUS A;  1VAR A;  2RDC A;  1Q6H A;  1P7B A;  1IXB A;  1Y67 A;  2YEV B;  3AG2 B;  3HKB A;  3ZIA G;  5ITZ A;  3JD4 A;  1K34 A;  1F7Y A;  4OX9 B;  4DR7 B;  2E76 B;  1TAE A;  1BZK A;  1N36 B;  4UV9 A;  5IJ9 B;  2FKX A;  2UUC B;  2KG7 A;  1X4T A;  3DC5 A;  3LDD A;  4GYC B;  3CCJ V;  4I9W A;  1JR9 A;  2UXX A;  2N74 A;  1L0L H;  4DR2 O;  3RN4 A;  3N2K A;  3ASN C;  1Q6U A;  3GVM A;  1QBZ A;  4I4T A;  3SR2 C;  3BEH A;  4PA4 A;  4ZI7 B;  2WAM A;  1K92 A;  2JS5 A;  3B8M A;  3ZX6 A;  1ORQ C;  2Z5U A;  4PA7 A;  3OMN B;  4BR6 A;  4F6R B;  5J9P C;  2QWO B;  2ODM A;  3CS5 A;  4EEQ A;  4O2B B;  3E22 A;  4X89 A;  4LNU A;  2QEX V;  2F43 G;  5GON A;  3CC2 V;  3MHS C;  5IWA B;  1H2M A;  4HBN A;  4BIO A;  1F23 A;  4K0K O;  4TV8 B;  3ZRV A;  2WLK A;  4MS2 A;  1N32 O;  4FPP A;  2IM9 A;  3K0D A;  4F6E A;  3CCL V;  4RUE A;  1S5J A;  5LA6 B;  1K97 A;  2OT5 A;  1KKC A;  1RPO A;  5L3B A;  4QJF B;  4JGS A;  2F93 B;  3SYP A;  2KSD A;  4JYY A;  3VQV A;  3K5M A;  2IJJ A;  3OMI B;  1XL4 A;  4O4I B;  2QKA A;  4DV7 B;  2A0L A;  1IBL O;  3RYC B;  1NH2 D;  1OCR B;  1AI5 A;  1BGY H;  1B06 A;  3CPW U;  5K1X A;  1B3Q A;  1FFX A;  4MTX A;  3WFV A;  2HR3 A;  2HG5 C;  1WP8 A;  4MW3 A;  4ABM A;  2BTQ B;  2D3O W;  4Q6G A;  5CB4 A;  3FB7 C;  5KHG A;  2NNU A;  1YXB A;  2ZXW C;  1M90 W;  5B66 Z;  2NN4 A;  2CDY A;  3C90 A;  2A79 B;  2OCH A;  5LMU B;  2LFR A;  2MK3 A;  4QPJ A;  1GKF A;  2XAS A;  4WF9 V;  1V55 C;  1AP6 A;  1VF5 B;  1NJI W;  3BY6 A;  4UVA A;  2EIK C;  3J80 N;  2AZ0 A;  3CHX A;  1H8E G;  1XBL A;  4I0X B;  2XOK G;  2F66 C;  2OYQ A;  2B1I A;  2ZQM A;  1SQB H;  2CK3 G;  1KMI Z;  4EB6 A;  3K79 A;  3SJA C;  4R8C A;  3K9S A;  2H3O A;  3AG3 C;  1FPO A;  1WN7 A;  3OR7 C;  3GB7 C;  2EBO A;  4U3J A;  1K8A W;  4PA6 A;  1QU7 A;  1L0N H;  3CSX A;  2Y0I A;  5ITZ B;  1NTM H;  3L75 H;  2YID A;  5IYZ B;  3D3Q A;  4TT3 G;  1SET A;  1XHX A;  1FS0 G;  5D5P A;  3CRA A;  2OTL V;  1Y76 B;  4G2K A;  5CA1 A;  1XNR B;  4QE7 A;  1E1R G;  5LOV A;  4O4L B;  4FFB B;  4LFA B;  5EIB C;  3CEI A;  1U96 A;  4FFK A;  3B40 A;  4R50 A;  2WLJ A;  1ARO P; 
#chains in the Genus database with same CATH homology
 2QTO A;  3JD1 A;  1VQO V;  1QVF U;  5L3G A;  3X2Q C;  1AI6 A;  3B77 A;  2DYR C;  3HPL C;  4JTA B;  3CCR V;  3UM7 A;  3F5W C;  3CCU V;  5DN6 G;  3WG7 B;  1FXK C;  1G8M A;  4X8A A;  4RAI A;  3RVY A;  2X6A A;  3E86 A;  2Q67 A;  2ZDI C;  2V7Q G;  3ZMT A;  2W6J G;  5L3D A;  5EBW C;  3E8H A;  4JPR A;  1VQ8 V;  5EBM C;  2FTK A;  3FYE B;  1JJ2 U;  1M56 B;  2JEX A;  1V54 C;  1YJW V;  2X0L A;  2A9H A;  5B1A C;  1Q86 W;  3OGC C;  2EIL C;  3KG2 A;  1PKX A;  2ZXW B;  3JCZ A;  5KUK A;  3F7V C;  4GX2 A;  1GK9 A;  3DTU B;  2XAJ A;  4JYB A;  4HZ3 A;  4P2Z A;  2BOB C;  4MVR A;  3ZN1 A;  1VQK V;  4QIW F;  5EBL C;  1V55 B;  2EIM C;  1PNK A;  2PI5 A;  1YSC A;  2R9R B;  1XL6 A;  5B1N A;  4BIZ A;  2BOC C;  5FL7 G;  1K5S A;  3M99 B;  3QO8 A;  1N8R W;  2Y69 C;  3CD6 V;  4I5S A;  3ABT A;  1JVM A;  2WLM A;  1VQ9 V;  3OEH G;  5EC2 C;  1J95 A;  1OCZ B;  2B1G A;  2EIJ C;  3ZRW A;  4MVS A;  1E79 G;  1BHB A;  1DF5 A;  4LC1 A;  4MVO A;  5H9C A;  5EK0 A;  2H8P C;  3OR6 C;  1L1F A;  4QNH B;  1VQP V;  1GM9 A;  3SPJ A;  3ZRW B;  2IW5 A;  2GSM B;  3JYC A;  5H6Q A;  3AG3 B;  2HLD G;  3RVZ A;  1K9M W;  1YJN V;  3IFX A;  1ENV A;  3GWO A;  2HVJ C;  3B8N A;  2DWE C;  5KA6 A;  3E8F A;  1OCO C;  3LDC A;  5GW7 A;  3I55 V;  2EJR A;  1OHH G;  1PNM A;  3CCM V;  3CCS V;  1RPR A;  4E2L A;  1IXM A;  1K3E A;  2HKO A;  2X6B A;  2PI4 A;  1BL8 A;  3ABK C;  1SZT A;  1ZWI C;  1YHQ V;  5CA3 A;  3ASO B;  3ZJZ A;  1VQM V;  3SPG A;  1Q7Y W;  4R7C A;  2HFE C;  4WFF A;  4F4L A;  1AI4 A;  2ATK C;  3ETD A;  3AG4 B;  1FXK A;  3EHB B;  4GT1 A;  4PDR A;  2IJH A;  4LP8 A;  2IU3 A;  3X2Q B;  3JD2 A;  2DYR B;  3LUT B;  2QA4 V;  1QCE A;  1S5H C;  3SYC A;  3ZMU A;  2ZDI A;  1KQS U;  1FXK B;  2ITC C;  3JD0 A;  3D3I A;  4P9P A;  2W0F C;  1AJP A;  2DW4 A;  3FB5 C;  2X7R B;  3I56 V;  3ABM C;  4PDV A;  1EBO A;  5IYB O;  1I5X A;  1YJ9 V;  1W0K G;  4PA3 A;  1H38 A;  1AR1 B;  1K73 W;  1BHA A;  2ZR2 A;  3SPI A;  4J9Z B;  1K5Q A;  3OMA B;  3ABL C;  3TET A;  2DWD C;  2ZD9 A;  2Q68 A;  1V54 B;  2OCC C;  5KA5 A;  5B3S B;  1SER A;  5BZB A;  1NKD A;  3ML0 A;  4UUJ C;  2EIL B;  3SYA A;  2WSS G;  2XAQ A;  1MAB G;  2P90 A;  4KP4 A;  2XAG A;  1EFR G;  1R3J C;  3VBB A;  1WLE A;  2Z3Y A;  3CC4 V;  3SPC A;  4MT8 A;  4RQF A;  3STL C;  2WLH A;  1PNL A;  2EIM B;  3D36 A;  1VQ6 V;  1JQ0 A;  3EFF K;  2Y69 B;  2AHY A;  2B5U A;  4FK5 C;  1VQL V;  1PL0 A;  2EZP A;  2XAF A;  1K4C C;  2XND G;  1I5Y A;  1YIJ V;  2EIN C;  2EIJ B;  4MTG A;  1JX9 A;  3JD3 A;  1NBM G;  5LHI A;  1HWY A;  5LBQ A;  1Q82 W;  2ITD C;  2OTJ V;  3SPH A;  4GX5 A;  4RO2 A;  3T1C A;  2LP7 A;  4P30 A;  4PDM A;  1R6N A;  2QE7 G;  1MOF A;  2EZO A;  3AG2 C;  1DF4 A;  4MVU A;  1R6K A;  4UVC A;  1OCO B;  4TSF G;  1NVP B;  1K4D C;  2X6C A;  2LFS A;  3K04 A;  4MVZ A;  4OXS A;  3R65 A;  3CMA V;  1H2G A;  3G6E V;  1DTO A;  5IY5 C;  3CME V;  1KP3 A;  1QLE C;  2JJ2 G;  4UV8 A;  4MTO A;  3ABK B;  1PD3 A;  4KUM A;  1AJQ A;  2EIK B;  4H37 A;  4XDK A;  3W7T A;  2WLI A;  3LDE A;  2P67 A;  3W7S A;  1RM1 C;  3ZRX A;  3OEE G;  4JYC A;  5IYD O;  3E89 A;  5LGT A;  1E1Q G;  2W6I G;  2WLI B;  4Q20 A;  5IYC O;  1SES A;  5CN0 A;  3A0R A;  1KP2 A;  2WWW A;  5LGN A;  1MSW D;  3W7U A;  3ZRS A;  4CBC A;  3T4Z A;  2JDI G;  4WCE V;  1S72 V;  4P9O A;  2QM8 A;  2IJK A;  3P30 A;  3MHH C;  1M9N A;  3E83 A;  3CP1 A;  3K03 A;  3ABM B;  1QR9 A;  3IGA C;  1Y66 A;  2DQ0 A;  4FJC C;  1B6Q A;  3DGE A;  5CBF A;  1G4Y B;  3ABL B;  5DM6 V;  3QO5 A;  2OCC B;  1GTO A;  2M7W A;  1R3I C;  5B1B B;  3CC7 V;  4FMT A;  3HB3 B;  3H01 A;  2DYS B;  1OZ0 A;  3OAA G;  2XAH A;  2IH1 C;  1M56 C;  4GX1 A;  1OCC B;  3RW0 A;  3MD0 A;  4ZBM A;  1TUE B;  4PDL A;  1JOY A;  3T2M A;  4UVB A;  2WLL A;  1QLN A;  4U7N A;  3OW2 U;  2QKS A;  1W0J G;  3CYO A;  1KD1 W;  4HYO A;  4DO2 A;  4HAM A;  2WLL B;  1K33 A;  5KUM A;  2JJ1 G;  2WPD G;  5LHH A;  4LBE C;  4MVQ A;  1COW G;  5C93 A;  3VOU A;  2EIN B;  5L3F A;  3LSQ A;  1KKD A;  1KC8 W;  5CBG A;  3PJS K;  1S0V A;  4MSW C;  2YEV A;  5H6R A;  3OUS A;  3OFN G;  1GO3 F;  1OCR C;  4FIP C;  4GX0 A;  1QR8 A;  1P7B A;  4XDJ A;  4X88 A;  3NXS A;  3AG2 B;  2YEV B;  4JAU A;  5B1A B;  1CPY A;  4MW8 A;  4R6Z A;  3SYO A;  3ZMV A;  5EC1 C;  3ZIA G;  3JD4 A;  2P7T C;  1K34 A;  3FKS G;  3FB8 C;  1DLB A;  3G71 V;  1AI7 A;  1FFT B;  4UV9 A;  3LNM B;  1YIT V;  4JTD B;  5L3C A;  1RM1 B;  4H33 A;  2C2A A;  4MVM A;  1GM8 A;  4UXN A;  3LDD A;  3CCJ V;  2HVK C;  4N21 A;  4I9W A;  4GCZ A;  2UXX A;  5HFM A;  1QVG U;  3AG1 C;  3E8B A;  1VQ5 V;  3ASN C;  4RQE A;  4WFE A;  1F51 A;  1YI2 V;  1QBZ A;  3P32 A;  1Y4M A;  2Y48 A;  4U7O A;  2IJI A;  2ZR3 A;  3BEH A;  1M57 C;  1UJW B;  1NVP D;  3IC7 A;  4PA4 A;  2WAM A;  1WPX A;  4WFG A;  1VQN V;  1K92 A;  1JCH A;  5IDJ A;  3ETE A;  3K9A A;  3T4D A;  3B8M A;  5B1O A;  1ORQ C;  2Z5U A;  4KFM A;  3OMN B;  4PA7 A;  3QO7 A;  4JAS A;  3F7Y C;  1CP9 A;  5J9P C;  2K1E A;  3UKM A;  4WFB V;  3LSS A;  4G27 B;  4X89 A;  2QEX V;  2F43 G;  4PA9 A;  3CC2 V;  3MHS C;  5HFL A;  3ZMS A;  1P4R A;  5B3S C;  2HJF C;  1F23 A;  4JF3 A;  3ZRV A;  4EKW A;  1BMF G;  2WLK A;  1S77 D;  4MS2 A;  4RUF A;  4FPP A;  1CEZ A;  2DQ3 A;  1SRY A;  3K0D A;  4Z1M G;  3CCL V;  4YXW G;  3G4S V;  3FB6 C;  4RUE A;  1K97 A;  2OT5 A;  3STZ C;  5L3B A;  1RPO A;  4XDL A;  2Q6A A;  4QJF B;  3OUF A;  4JGS A;  1VQ4 V;  3CCE V;  3E35 A;  1NQT A;  4JTC B;  3SYP A;  4WFH A;  2IJJ A;  3OMI B;  1JPX A;  3WG7 C;  5LGU A;  3W7W A;  1F4M A;  1XL4 A;  1R3K C;  2A0L A;  3E8G A;  1GMG A;  4ASU G;  1EZJ A;  1FXV A;  1NH2 D;  1K7D A;  1OCR B;  5CBH A;  1AI5 A;  2NLJ C;  3ZMZ A;  1NH2 B;  1THZ A;  4DXW A;  3CPW U;  1NR1 A;  4MTX A;  3SYQ A;  3WFV A;  2HR3 A;  2HG5 C;  2R9I A;  4MW3 A;  2IU0 A;  2D3O W;  4TWK A;  1FXH A;  4BAY A;  3FB7 C;  1S3J A;  2NNU A;  4CZZ A;  4N23 A;  2ZXW C;  1M90 W;  2IH3 C;  2A79 B;  1H8H G;  1R3L C;  2LFR A;  3SJQ C;  2MK3 A;  2KB1 A;  4QPJ A;  3CCQ V;  1GKF A;  1MG1 A;  3OE7 G;  1VQ7 V;  2XAS A;  4LCU C;  4WF9 V;  1V55 C;  3CXC U;  1NJI W;  3BY6 A;  3FYI B;  1Q81 W;  2JEU A;  4UVA A;  4QE9 A;  2EIK C;  2GHY A;  5E1A C;  1S76 D;  1H8E G;  4PEL A;  4BW5 A;  5CMU A;  3ZCC A;  2XOK G;  4G28 B;  1R73 A;  1OCZ C;  3AG1 B;  4ZKI A;  2B1I A;  3K06 A;  3ASN B;  2ZQM A;  4J9Y B;  1AJN A;  1LNQ A;  5L3E A;  1W2B U;  2CK3 G;  2JK5 C;  2AHZ A;  1M1K W;  3K79 A;  4JAV A;  3CCV V;  1F4N A;  1M57 B;  4R8C A;  2V1D A;  3AG3 C;  3AEI A;  4XBF A;  3W7X A;  3OR7 C;  4L87 A;  1KEC A;  3GB7 C;  2EBO A;  3ETG A;  5LHG A;  2WLN A;  1K8A W;  3K0G A;  4PA6 A;  3K3W A;  3RBZ A;  3QNE A;  2H94 A;  4WFA V;  5IY5 B;  1QLE B;  2QM7 A;  3TCU A;  1NR7 A;  4TT3 G;  1SET A;  3ABU A;  1FS0 G;  3TK1 A;  2OTL V;  2JIZ G;  5B1B C;  4G2K A;  3K08 A;  3ZN0 A;  2UXN A;  4QE7 A;  1E1R G;  3ASO C;  2DYS C;  1YTF D;  1OCC C;  1ROP A;  3OM3 B;  2P6J A;  4QPK A;  2YSU B;  2Q69 A;  1YTF B;  4BIU A;  4MTF A;  3E2E A;  4R50 A;  1GM7 A;  2WLJ A;  3AG4 C;  1ARO P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...