4HAMA

Crystal structure of transcriptional antiterminator from listeria monocytogenes egd-e
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
SNAMFTINTKSQLPIYEQIVQKIKEQVVKGVLQEGEKILSIREFASRIGVNPNTVSKAYQELERQEVIITVKGKGTFIANQTDKLSSPKKLAETRTKLKETILDLVYLGVNIEEIHKLADEYSQDIIGGDVVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Transcriptional Antiterminator from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords Lmo2241 protein
total genus 43
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hamA01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hamA02
4MQ9F 1IN6A 1B1BA 1J5YA 1Z6TA 1K79A 2MH9A 3R0AA 1EH6A 3WTVC 2XROA 1J59A 1RI7A 3KP2A 1P2FA 4JK1X 4KICA 1U78A 3R0JA 4BNCA 3E35A 3M8FA 2V1XA 4M9XA 1TNTA 3F3XA 4OMYA 1D5VA 2LKPA 3FM5A 5CA3A 2DTRA 2V9VA 1KU9A 1IXSB 2LF7A 4XSZF 5E17F 1MZBA 4KIGA 1IF1A 4AWXB 4L18B 1XGOA 1MDMA 1W7PA 4ZYDA 3MQ0A 5L3GA 2UXNA 4B8XA 2ADUA 2PMUA 4UVCA 1TNSA 2FXAA 2ESNA 2CG4A 2A3SA 1FZPB 2RN7A 3BDDA 1FC3A 2V79A 1XDSA 2DK5A 3WU0A 3WGIA 2FMLA 1B59A 2Q0OA 4R1HA 2FE3A 3H3UA 3TDUC 4A6DA 1STZA 5LBQA 1USTA 3VB2A 1ONVA 5E1XA 2ZXJA 1LDKB 4M71A 1YG2A 2QBYB 3IWFA 2Y0MA 4M6YA 1S7AA 2ZBKA 2EJRA 4N0BA 2CWEA 1YW8A 1TBXA 1ZRCA 3GFIA 5LGUA 5HOOA 1QGPA 4WXCA 4IXAA 4HV5A 2QENA 4N9HA 2KIFA 2P6TA 1Z1DA 3QAHA 2Y75A 3BJOA 1FPQA 2YX7A 2YX4A 4GCVA 4GYIA 3HYIA 4MEYF 2JTVA 2QLZA 3T1BA 3GWZA 2O3FA 5DCMB 4OIOF 1PP8F 3FMSA 1ZH5A 4RB2C 2PI0A 1K78B 5CVVA 2GQQA 2P8TA 1D8KA 2DO7A 2FF4A 5CLSA 1IN8A 2KRFA 2E7WA 2L54A 3LQRA 1XSXA 2ZFWA 4HX8A 3G3ZA 2QUFA 4DNCA 5ICEA 1O57A 1GXPA 1BIAA 1JHFA 3CUQC 4I2OA 3DEUA 5LRRA 2WV0A 3WODF 1RZ4A 3V8LA 2RV8A 2A61A 2A6EF 4UHTA 2AS5F 3ZMTA 4CZZA 2HQNA 3E6DA 3MAJA 4L0ZB 5HS9A 2A07F 1SD4A 3V4GA 1KQ9A 1FY7A 2HKOA 1FOKA 4LG0A 3KP5A 4R8HA 1CGPA 2P6SA 4EJOA 3FF5A 2EFWA 2TDXA 2XASA 4AD9A 4BHCA 2ETHA 2D45A 4UV8A 3GUDA 2CFXA 3HRTA 2P4WA 4HQEA 3SHFA 5LGTA 2F5FA 4MGRA 4KDPA 4HF1A 5E20A 2GAUA 2EWNA 2EK5A 2CW0F 3E6CC 4FX0A 1ZRDA 3HSRA 3MFKA 2IP2A 3CDHA 3I59B 2V1UA 5F1RA 2K02A 3IRRA 3RKYA 5LRSA 1ZGJA 4ESFA 1KU2A 3V8KA 5D8LB 3QRFF 3VEPA 1P4WA 2HOEA 1JGSA 3HUGA 1P6RA 1YTYA 3JAMZ 4YFXF 2DFIA 3DF8A 3FXUA 2VE9A 1WSUA 1DPUA 3PFIA 3RKWA 2YR2A 2EV0A 2HR3A 1G3TA 3K1PA 2ISZA 1Z6RA 4OU0A 2AXLA 4HZFA 5D6FA 2NS0A 2JT1A 1S29A 1Y0UA 4L9JA 2LSOA 1CF7B 2V6CA 2MLGA 3E5QA 1QQIA 1TLHB 3M9AA 5LEJA 2UXXA 2QM3A 2M87A 4MEXF 2ZJ2A 2LF8A 1FYKA 3BY6A 4HF2A 5H6RA 1FYMA 4L0YB 3BPVA 5CVIA 3CUQA 2CSOA 3AAFA 2BE5F 5ILVA 4AVPA 1OPCA 3DV8A 3ISPA 3FMRA 2F5DA 3P9IA 3RYPA 1U5TB 4ZH4F 5F6FA 2IW5A 1OYIA 3Q9SA 4BAYA 4LMYA 3E3VA 2M45A 1NHAA 3NQOA 2E7XA 1S7OA 2P5KA 1I5ZA 5FD5A 2L4AA 5D5VB 4YFNF 3R60A 5D4SA 2JPCA 1ULYA 1ZG5A 4ETSA 5HLIA 1HXDA 3IL2A 1RIOH 5DUIA 4ZZDA 3RIRA 1SFUA 1IAWA 4OMZA 4RGXA 2ZMEB 4L9TA 5TRDA 2LNBA 4PGHA 3D5LA 3QPHA 1J2XA 3F8CA 1F4KA 4I09A 1UFMA 2HKXA 5JI6A 1U5TC 3N97A 1B6AA 4M74A 4LLLA 2A68F 2IT0A 5HDGA 4P9FA 3RDIA 1Z9CA 1I1GA 3HSEA 2XRNA 5ERIA 3RPQA 1L0OC 4U88A 4Y15A 3JTGA 1BBYA 1SMYF 2JPBA 1RUNA 1PP7U 2PMHA 1W5SA 2GXBA 2QWWA 3JSOA 1IZ1A 1FT9A 2MD5A 1K78A 2MC3A 5E8GA 5DD8A 2VC0A 4ENMA 2M30A 3KETA 2OD5A 3IHUA 2FEZA 3TOBA 1NVPB 3KP7A 5IT3A 2ZNZA 3ECHA 1RM1C 3I0TA 2QQAA 2FRHA 5FFXA 2PBIA 5HS7A 3ZQ7A 1MDMB 3I53A 3HIFA 5JHUA 4KA4A 5LGNA 4I01A 5HDKA 5DCFA 3V7SA 2IA2A 4A6EA 3DPTA 2OZUA 2H6CA 4P55A 4FHTA 1QZYA 2Y48A 4AIHA 2NNNA 1ODDA 4LK0F 3ZMVA 1O7FA 3IC7A 4CDGA 2XVCA 1RNLA 3F8MA 4IRIA 3WTXC 5AIQA 5BS6A 1SD5A 3HRSA 2GA2A 1R22A 2QQ9A 5DYMA 3RJPA 3CTAA 3NEUA 4KIBA 3EQLF 3GW2A 2DBBA 2OBPA 2DU9A 1BI0A 2MBFA 2VXZA 2XV4S 2DPUA 1BI2A 3MZHA 3RYRA 3ERED 1DPRA 3VODA 5L3DA 3LA3A 3QOPA 1KU3A 1MJAA 3M1EA 4ESBA 3F23A 1HSJA 4B09A 3GLXA 3O3KA 2EA2A 5DCMA 1QO0D 1BC7C 4L5IA 2GWRA 1FX7A 2HEOA 5LHHA 3LQQA 4LFUA 1MKMA 2D1VA 2FA5A 2P5VA 3DKWA 5ED4A 4GO1A 2VONA 4G6DA 2MLKA 3MEXA 1MGTA 2D1HA 5H6QA 2J5PA 3TOAA 3E6BA 3T8TA 1PDNC 3COAC 4ZZLA 2W85A 1F1ZA 2HTJA 2VT2A 5AONA 1EH7A 3ZMDA 3ECOA 1W7PD 3I54A 4KMUX 2XAQA 1SD6A 1HQCA 3KZYA 1IN5A 4S05A 2VBZA 1YQAA 4G7ZF 2H27A 2NRAC 5GW7A 3CUQB 1BOAA 3MCZA 3W7WA 3M8EA 2H09A 3FHZA 4UNOA 4ZYGA 2VOPA 4DQ2A 2IPQX 3L00A 1R1UA 2ZCWA 4LLGF 4GYGA 4YFKF 3U9GA 4KN4X 2Q8KA 1XDUA 5CJ9A 1G3WA 4BYYA 2K4BA 4RAZA 5FD6A 1ON1A 3T8RA 1REPC 1GHCA 2EFOA 5LLQA 1B4AA 2DLLA 5CVJA 4D0PA 3J81K 3K9TA 2P90A 1TQIA 3WE3A 1WWXA 3WTYC 4I98B 4XBFA 3VFZA 4PGGA 4Q4ZF 2J5OA 3WTTC 4Q48A 4ENNA 4OINF 5EEHA 2VN2A 2W24A 2HS5A 1T39A 1IRFA 4IF4A 1FSHA 4G9YA 1Q1HA 2RVCA 4EJUA 3M7GA 2STTA 3EYIA 4AIJA 1BC8C 1OKRA 3EDPA 1AOYA 1WRJA 5J6XA 2HFHA 4HYEA 2M5WA 1F9NA 2LDUA 4LB5A 2FOKA 3Q9VA 3J81Z 1MJ9A 2XAHA 2Q2EA 3KE2A 1WI9A 2HZTA 5K5QA 2IA0A 3E6MA 3Q5FA 4RGUA 4LLNA 2NYXA 4P5OA 1A04A 1SFEA 3LAPA 2KJCA 4G6QA 4LB6B 3HTSB 1NH2B 4KUMA 4FX4A 4EVIA 1XMKA 1J0RA 1FSEA 3GF2A 3QU3A 2XAGA 3ZMUA 2A69F 4KMFA 3FM3A 4WK8F 6PAXA 5BPDA 3TKYA 3GZ6A 4CXFA 2XIGA 3V7CA 1DUXC 4A12A 3KEOA 2BV6A 4HLXA 2XKOA 1H9TA 3L7WA 1O7LA 5D6EA 2PLYA 3I71A 5EEGA 1G6NA 3D0SA 3H92A 1U5TA 2OA4A 3SXYA 1BI1A 3J7AO 1XSVA 2EV5A 4OIRF 3C7JA 4Q5SF 4QLCU 4WWCA 4HBLA 3F8BA 1JXSA 2G7UA 3QU6A 1ZRFA 3GFMA 4G7HF 4MTEA 2QBYA 4HW0A 3QP5A 1QNTA 4GGGA 1HW1A 1H9GA 1ON2A 4P9UA 1KQ0A 5DUKA 1LB2A 2EA4A 3LWFA 4IPAA 2KIMA 3MZYA 1P4AA 1XGMA 5E18F 3LAJA 4WXHA 4L5JA 3DQVC 1DP7P 2NNYA 4M9ZA 3F72A 3E5UA 4UUVA 2EB7A 4A2UA 2XUBA 4MTDA 4LJZF 3R6SA 1ZREA 4MNUA 4OIPF 1DDNA 4M72A 1ZLJA 3KP3A 1LVAA 1TQPA 2YSRA 4RB1A 1H0MA 1YFHA 5D5UB 3TO9A 2GZWA 3W6KB 3KCCA 5KVRA 2Z5UA 3C3WA 3HOSA 3BPXA 4KNYA 3KZZA 3J80K 1YS7A 1K6OA 2V1DA 4RGRA 2RNJA 1UHMA 3L09A 2M1BA 3DFGA 2PEXA 3F6VA 4AIKA 2FBKA 4JQFA 3HRMA 4MHGA 3TO7A 1HKSA 3I5UA 2W84A 3OV8A 4G7OF 4LG0B 3GFJA 3WTUC 1XMAA 1TW3A 3HSFA 3FXRA 5DV5A 2BYVE 2OAZA 1GXQA 1YIOA 1TQMA 4EM2A 3W7TA 5D5XB 1I6XA 2FBIA 3C1DA 3VOEA 1FBUA 1IN7A 3ELKA 4M73A 3T0YA 2FMYA 4QWQA 2HGCA 2HTSA 2QYOA 4RAYA 5TJJA 4EJWA 4Z2YA 2VBXA 1YYVA 1E17A 4IHTA 1W5TA 2XKPA 4G8XA 4IRHA 3HRUA 3OOPA 4ENJA 2O6GE 3JAMK 3PQJA 4WXDA 3DP7A 3K1MA 1I27A 5DEQA 1LEAA 1ZG3A 5JR3A 3ZPLA 4HDVA 5D4RA 4EJVA 2FBHA 4KYWA 2VC1A 4BH9A 1JE8A 5LHIA 3FMQA 1BJAA 3F8NA 2QQBA 3KEQA 4CO8A 2BGCA 4PCQA 4UXNA 1B9MA 2XHKA 3IRQA 4ZYEA 2RDPA 5F64A 2ZNYA 4HOBA 2HYGD 1O3SA 1U2WA 1USSA 1FBQA 3QP6A 4U7BA 4IHSA 1V3FA 2OQRA 3RPUA 3D3IA 3JW4A 2L02A 2G9WA 1KYZA 2JSCA 4K2EA 1LQ1A 1ZN2A 4UVBA 2M8EA 5A2QK 1B9NA 4HF0A 3QPTA 1HW5A 1YS6A 1SD7A 3WG9A 4ESJA 4KT5C 4F7ZA 3KLOA 1HKQA 1SFXA 3DPLC 3H3ZA 5IT9K 4NB5A 4M6XA 4A0YA 5JVTA 4HA8A 3DXJF 3SQNA 4WCGA 1XD7A 3FWEA 4IVNA 1BIBA 2FNPA 5ICGA 4BHPA 1KYWA 5JFRA 2DQRA 5L3BA 1EH8A 5AIPA 1C0WA 1OR7A 3S2WA 3W6JB 5K1YA 1IUYA 1R23A 4S04A 3P7NA 5DD4A 1T6SA 3L9FA 3ROUA 1J7KA 4YG2F 2UWMA 2YPRA 4CHUA 3F8FA 1IXCA 3HHHA 2C6YA 4ENKA 3BROA 1ZGAA 2CQKA 3GYHX 1YW9A 4O6JA 2R3SA 1V4RA 1UHWA 1HKTA 2XAFA 2W25A 4Q47A 5ILSA 4EM1A 3HOTA 2HDCA 1UCRA 2JRTA 3U1DA 1OYWA 2H94A 4LGWA 5HVQC 4EQQA 1ZG1A 2JZYA 2P7VB 2CGPA 1FBSA 5FO5A 3E5XA 2HQRA 2ESHA 5ILUA 4A0XA 3TGNA 2WTEA 5A2QZ 1R1VA 1J9IA 1YLFA 2L4MA 2O03A 2VOOA 1XN7A 1VTNC 2HYFA 4XRFA 1HBXG 1S6LA 1YO5C 3I64A 2ZO4A 4HLYA 1KGSA 3GZ5A 3HTUA 3V7RA 3FZVA 2R7FA 3L2CA 5LHGA 3RKXA 2KKOA 2OU2A 2O8XA 3KLNA 1E2XA 1ZAOA 4Y17A 2STWA 4U0WA 3CO6C 5L3EA 1LEBA 1F5TA 5CYVA 3N4MA 2GXGA 3IKTA 4OOIA 2DPDA 4XSXF 3NRVA 2BEOA 3SZTA 3CLOA 4HV6A 5HLHA 2XAJA 1U3EM 4EGZA 5BOXA 4PDKA 4RB0A 3SFZA 3T5XA 2OQGA 3P9KA 4A5MA 1R7JA 3ABUA 4I0BA 3W7XA 5K5OA 2F2EA 3EUHA 3W7UA 2EFQA 3JSPA 4EV0A 2MA3A 1YTFB 5IT9Z 5ICCA 1EV7A 1IN4A 3WGGA 4KN7X 5HS8A 1L3LA 1IW7F 2PJPA 1Z91A 1LNWA 3BJ6A 1ZYRF 5CVRA 3CJNA 3WE2A 2NAZA 3ZN1A 2GIVA 1FP2A 4IRGA 1FWZA 2Z99A 1RUOA 3ZN0A 1J75A 1O3RA 4G94A 2CO5A 3REOA 1FYLA 2X0LA 3TDZC 3LA2A 1S3JA 5E1ZB 3J80Z 4EJTA 2G7HA 1P92A 2DK8A 3WTWC 1FP1D 1WQ2A 2KIUA 4CYDA 1QPMA 4UVAA 3FX3A 4YIFA 4NQWA 4FT8A 4U0VA 5L3FA 3WTSC 4KFCA 3WU1B 1UB9A 2VBWA 4RGSA 2DW4A 1K7AA 1IRGA 1BI3A 5K5RA 5HDNA 2K86A 1QZZA 2FNAA 3LA7A 2F5CA 2ZMEA 2RGVA 3BOQA 1XCBA 2IJLA 1FNNA 4UV9A 1ZARA 2MH2A 2DQLA 3ZMSA 5BQTA 1HSTA 3C18A 3R61A 2F5EA 1XGNA 3R4KA 3WTZA 3O6BB 4U7DA 1KA8A 3HHGA 3CO7C 1G4DA 4GXOA 1KQ8A 1O3QA 2FQ3A 1SAXA 2IRFG 1HW2A 1WKMA 1R5GA 3K0LA 2Z33A 4LD5A 5FFZA 2YU3A 2QVOA 4Y13A 1U6GA 4ZYHA 1W4MA 4O3MA 1T38A 3FXQA 4RB3C 4IJAA 1W7PB 1KU7A 3BZ6A 4BQAA 3GXOA 1GVJA 5BMZA 1YW7A 3W7SA 3WGHA 2KJBA 3B73A 4EMSA 4BXUA 3ZP5A 3KFWX 2IVMA 2D2WA 2PFBA 2PQ8A 5HLGA 3ULQB 4XLNF 3ZMZA 4H0EA 1X3UA 3KP4A 2GA1A 3IWZA 5E8IA 1LJ9A 2RQPA 4WF2A 4HX7A 1R00A 5KK1A 4E70A 1QBJA 2K27A 4HAMA 4OIQF 3TO6A 4U0YA 5E1WA 2B0LA 1D8JA 4LK1F 3G73A 1AWCA 3IKVA 2WWYA 1R5HA 3K2ZA 3SZPA 3TQNA 2QZ8A 3GVAA 1R36A 4O5VA 2RKHA 1G3SA 3EETA 5D5WB 3I4PA 2COMA 5DDGA 1OYYA 3BP8A 5L3CA 1TTYA 2W57A 1OMIA 5H20A 1XB4A 4EGYA 1FLIA 2O61A 2DAOA 2EFNA 4HDUA 3ABTA 2FSWA 1SMTA 3RI4A 1D3YA 3LSTA 2WAMA 2X4HA 1R1TA 4WX9A 4XLPF 2K7LA 1TW2A 5ICFA 1T98A 2FU4A 3LFKA 2XGXA 1PUEE 4A0ZA 2PG4A 1CF7A 1R58A 1LDJA 4MQVA 4NHJA 3F6OA 1G3YA 3F22A 1ZLKA 2ACJA 3P9CA 4P96A 3MWMA 4PZJA 1XCVA 4HX4A 1XGSA 2CYYA 2HWVA 1BM9A 1XSDA 1Z05A 2DT5A 4HQMA 4I0AA 3BJAA 3CUOA 1JHHA 1ZHFA 3ML6A 2ZKZA 3K69A 4RS8A 4N9IA 1P4XA 5LEKA 3GFLA 1U8RA 2VBYA 1IXRC 2BBYA 3B02A 2R7DA 3F21A 2A5YB 3GEZA 1I1SA 1T2KA 5BPIA 2P7CB 4I7HA 3PQKA 3O2PE 4I02A 5CVUA 3RTRA 4L9VA 3GO5A 1MD0A 5J8FA 2L01A 3E97A 5FLXK 2OZ6A 5FLXZ 1Z7UA 4BHBA 2VE8A 3EYYA 3V8JA 2K4JA 2ISYA 4L9NA 5D8KB 4YIIA 3I59A 2PN6A 3K1NA 4ON0A 2P5LC 2E1CA 2DI3A 4EM0B 1LDDA 2EFPA 2VT3A 2WC2A 4A5NA 2E1NA 3U2RA 2EV6A 2IA1A 2A6HF 4JBAA 2RC4A 4KIFA 2Z3YA 3GX4X 4R79A 2L3DA 3KP6A 1O3TA 2UZKA 3BWGA 2ELHA 4CICA 1S8NA 2VODA 1BN5A 2H6BA 2Z9OA 5J8CA 1T0FA 5FB2A 4TV7A 3JTHA 1MJBA 4CGZA 3I58A 2O0YA 4ASNA 4M9SA 5FGMA
chains in the Genus database with same CATH superfamily
4MQ9F 3OYBA 3O65A 1XX5A 3GTPJ 2AO9A 2L35A 1IN6A 1B1BA 2I5UA 1A32A 3FX7A 2ID3A 4GX2A 1J5YA 1Z6TA 1K79A 2MH9A 5HNFA 3OGIB 4DR4O 4XR6A 3R0AA 1AI6A 2IM9A 1YJNV 1KD1W 1S77D 2XF7A 2CUEA 1NI8A 1EH6A 3WTVC 4FLXA 1WGXA 2XROA 4K8XA 1ETOA 4CZCA 1NTZH 2K9SA 1SAUA 2DT7B 1RI7A 3KP2A 1J59A 2QDOA 1P2FA 4JK1X 2HPIA 4KICA 4I76A 3WFVA 1U78A 1K3EA 3R0JA 4BDZA 4A3KJ 4BNCA 3E35A 3JAKA 5H2FZ 1AR1B 3CPWU 1VQ7V 3OIOA 1T56A 4DR7O 5FROA 3M8FA 4QTRA 3CC2I 2R92J 4EB6B 5LXTB 2V1XA 1CQTA 1Q86W 4ZOLA 2A7WA 4M9XA 2GBYA 4NXNO 1TNTA 4RLQA 1E1RG 1WJ5A 3F3XA 1CPYA 4OMYA 2ZNJA 2KB1A 3PO3J 1D5VA 2LKPA 3AEIA 3FM5A 5CA3A 5FNVA 2DTRA 2JK3A 2V9VA 1UJWB 1KU9A 1VF7A 2EQRA 2FD5A 2V9PA 1IXSB 4ZC3A 2LF7A 2ICWG 4XSZF 3SZGA 2LMDA 4QIWF 1PYVA 5E17F 1MZBA 5LP6B 4KIGA 3JR9A 1Y8QB 1JX9A 1KKCA 1IF1A 4AWXB 1I3QJ 1XGOA 4L18B 1MDMA 1AU7A 1P4RA 1W5CC 3U11A 2Y30A 2Y69C 5DEDA 4JI4O 1W7PA 4ZYDA 1Z77A 3MQ0A 3HKDA 2ZR3A 2ECCA 3FXOA 3E83A 3T4ZA 4DR3B 4B3RO 2DFEA 2F5VA 5L3GA 1U97A 2DMQA 2UXNA 2YIAA 4B8XA 2BVMA 5JJEB 2ADUA 5M3FJ 4YIRX 3SJQC 5HFMA 2VWJA 1M57C 2LO1A 2X6CA 4C7UA 3I4MJ 1VQ6I 2PMUA 5GPCA 5FRNA 1D5YA 3W2VA 2WY8Q 3CJTB 3IAS2 3DEEA 4UVCA 1TNSA 2FXAA 4E7ZA 5FKMA 2ESNA 2K9QA 5CKTA 5DN6G 2CG4A 2A3SA 3CCQV 2ZB9A 3E8FA 4FQGA 1IURA 2LD5A 3PUFA 1FZPB 2RN7A 3K5NA 4J00A 2BOCC 1LUVA 3BDDA 4JI8O 2GLOA 1FMWA 1TT5B 4TOIA 1WH7A 1FC3A 1HDPA 2V79A 4RM3A 1XDSA 2VKEA 2ZDIC 2DK5A 1SKVA 3WU0A 3WGIA 1AI7A 2QM4A 2KMUA 2LH9A 4DZJA 2JJ2G 2NNUA 2FMLA 1B59A 2R93J 1GM8A 2Q0OA 4IL6C 4A3GJ 1TVKB 4R1HA 2FE3A 3H3UA 1TWGJ 3TDUC 2WLMA 2ZE6A 3SDBA 4A6DA 2D2CB 1R6KA 1STZA 3BTLA 1HLVA 2P7TC 1K61A 3CCVV 4WFBV 1VP7A 5LBQA 2Z16A 1USTA 2I10A 3VB2A 3CDLA 1ONVA 5E1XA 2ZXJA 4HNVA 2VWKA 1LDKB 3M7MX 2JSPA 1TL8A 5KX5A 3RYCB 4M71A 1YG2A 2RQQA 2XB0X 5EDNA 1WLEA 2QBYB 4ASUG 2LJ2A 3IWFA 1X59A 1DGWY 1E0EA 2Y0MA 4M6YA 2K9NA 2KQRA 1AI4A 2QSFX 1XL4A 1B72B 4DUZB 1W1WE 3PM1A 1S7AA 5B1AC 3BEHA 4CS3A 3H9JA 3SGIA 4DR5B 3QO7A 2ZBKA 2EJRA 4N0BA 4XOTA 2CWEA 1ITYA 5B3SB 3C2HA 1KP3A 3BTJA 1E3HA 1YW8A 4O2BB 1TBXA 1ZRCA 4K0KB 2ZQMA 4V19K 3GFIA 4JI7B 2F4MB 5LGUA 5HOOA 1QGPA 2YUAA 3G67A 2LKXA 1WN7A 1V54H 5LA6B 4WXCA 4IXAA 3M3YJ 3UKMA 1LKXA 2D3OW 4GKKO 3OS2A 4HV5A 1FTTA 4YHHO 2QENA 4N9HA 3ASOB 2KIFA 3QPLA 3JALA 4CSWA 4DV1B 4LF4B 2Q9LA 2P6TA 4B44A 1Z1DA 2NXNB 1SZTA 4LF6B 3GTKJ 2JMWA 3QAHA 4NTYA 5J2TA 2Y75A 3EUKL 2E2HJ 3BJOA 2PF4E 4RAIA 1FPQA 3W2AA 4YY3O 2YX7A 3JRIA 3A2KA 2YX4A 2JIZG 4GCVA 1FS0G 5TGTA 4GYIA 3HYIA 4O4IA 2JJ7A 4DW1A 4MEYF 1IBMO 3IUOA 3G1LA 4PSXA 2EIJH 2JTVA 4U7NA 4CYCA 2QLZA 2HU9A 3H3VK 3T1BA 2LY9A 1YDXA 2E75B 3GWZA 3HL2A 3L2RA 2O3FA 5DCMB 2QEXI 3DXRB 4OIOF 1IRZA 1PP8F 3IGAC 1UMQA 3H5NA 1QCEA 2AHYA 3RYIA 1A5JA 3K4CA 1WJDA 3FMSA 1TUBB 2Q73A 1TUEB 3BFRA 4KFMA 1ZH5A 3SYCA 2BW3B 4DV0O 4RB2C 3N2GA 2CUGA 2PI0A 1K78B 5CVVA 4JTAB 3D36A 2M34A 1H2GA 3Q4HA 1TWHJ 2GQQA 4CS4A 3PSIA 2P8TA 5E79Z 1D8KA 2DO7A 3MZ8A 2CW7A 3F5WC 2FF4A 5CLSA 3CD6I 2RNGA 1IN8A 4TUYB 1YCIA 2A9HA 3RVYA 2CH0A 2F4VO 3JATB 3IAM2 2X1CA 2KRFA 4X64B 2E7WA 1BL0A 2KT0A 2L54A 1XSXA 1IUFA 3LQRA 1FFXA 2BTQB 3A0RA 2KHMA 2ZFWA 4HX8A 3T1YO 1GVDA 3OEHG 2LTPA 1FFTB 3G3ZA 2QUFA 1KB9F 1R1BA 3J7YJ 4DNCA 2Q8VA 5ICEA 1O57A 1GXPA 1VQ6V 1BZKA 3VOUA 4PJJA 3P32A 4ITVA 2QTOA 3Q0VA 2EINB 4FLYA 4BIUA 4JI8B 1AVMA 1BIAA 5GTIZ 2Y31A 2F93B 1QVFU 2JA5J 1JHFA 3CUQC 9ANTA 4DUYO 4I2OA 1NG6A 3DEUA 5LRRA 1K83J 4NDLA 5BR8O 2KSDA 2WV0A 2E19A 4QJFB 5BY1A 3WODF 2HYJA 1NKDA 1RZ4A 3V8LA 2UUBO 2RV8A 5IOYA 2E1MC 2A61A 2A6EF 2OWOA 3BCBA 4UHTA 2AS5F 3G6BA 3ZMTA 4CZZA 2UUAB 5EF6A 3UNGC 3S3OA 2HQNA 3E6DA 3CSXA 1FKAO 4MIMA 3VYTB 4A69C 1D0YA 4PELA 4LBEC 2DYSH 1MSFC 3GZNB 4W4KA 4DJAA 3MAJA 4L0ZB 1W59A 3K0GA 3PNYA 5HS9A 4XDJA 3CC7V 2A07F 4I4TA 3H0DA 1QLEC 2WBMA 3CC4I 1VF5B 5J1YA 1M9NA 1SD4A 3V4GA 3S2DJ 1KQ9A 1D5AA 3K5OA 5LMNO 1GM7A 1FY7A 3BQZA 1BE3H 5LXTA 2HKOA 3VQWA 1FOKA 2JUGA 4LG0A 1R9TJ 2NVUB 2ARHA 3KP5A 4R8HA 3LOCA 1CGPA 4MTXA 2DJVA 3CMEI 4C2TA 2X6OA 3CC7I 2P6SA 4EJOA 1B3QA 3DKXA 1X1CA 3FF5A 3K4NA 1CP9A 1FXKB 2B7EA 1GN4A 1MA1A 2EFWA 2QWQB 3BG6A 3L9DA 2QA4V 2TDXA 3T1CA 5GTHC 5K7FA 4M3BA 2M4KA 2XASA 4AD9A 4BHCA 2ETHA 4Y7NJ 2VS0A 4JI3B 4JYAO 3BG9A 5KNLA 2NS7A 2D45A 4UV8A 5K7ZA 2V4DA 4JTDB 3GUDA 4CCLA 4G28B 1H8HG 3K70C 4IIJB 4UY8I 4X89A 3TXSA 4CCKA 3JRFA 2IXSA 4ZHQB 5IYCO 2UXDB 3ETEA 1DU0A 2CFXA 3HRTA 1P84F 2P4WA 2R5YA 2UXCO 4EFBA 4HQEA 4B43A 1QNMA 4UB8Z 5B1BH 2NVYJ 4FVMA 4J9YB 1WPKA 3SHFA 1W0UA 4ZBMA 2X6WA 4FE7A 5LGTA 4PDMA 2F5FA 3F0CA 4MGRA 4A3MJ 4HF1A 4KDPA 2LFRA 5E20A 2L6LA 4D7SA 2GAUA 2EWNA 1JCHA 1IBKO 3S93A 5J1RA 2QR4A 2EK5A 2CW0F 4HRIA 1MG1A 1F4NA 4CH3A 2DXIA 3E6CC 2LC2A 4FX0A 1ZRDA 1I08A 4RQEA 3HSRA 3P3PA 3MFKA 3RVZA 3S3NA 2IP2A 3CDHA 2Q68A 3FXJA 3I59B 3Q3SA 2CQNA 2V1UA 2BOBC 5CBHA 1ZL8A 5KLVH 3J7ZI 2DMTA 3WU2Z 4UCVA 1YSCA 1MBJA 1K73W 2WAEA 4O4HB 4WBNB 1WCMJ 3QOEA 5F1RA 1SC7A 1JUSA 2K02A 2Y4TA 3IRRA 4LIUA 3C2GA 2O5RA 1YOVB 2VPRA 1LE8B 4YJ2B 1WH5A 3CD6V 3RKYA 3H1LH 2RNBA 2F43G 5LRSA 1ZGJA 4ESFA 3ZIAG 1KU2A 5DM7F 3CCJI 2LQTA 2JGUA 2R4GA 3V8KA 3S1MJ 1E3PA 2X48A 4MTGA 5D8LB 2L7FP 4E7LA 3QRFF 4MLOA 3VEPA 1P4WA 2HOEA 1JGSA 5KAFC 3F7VC 4GX5A 2LK2A 3OR2C 3H01A 3HUGA 4MTOA 4PA4A 4BS9A 1P6RA 5CBFA 1X1PA 1QVGU 4ANJA 3H35A 2CW8A 1YTYA 2KPMA 1R5ID 3T1HO 3JAMZ 2EULA 4NNJA 4YFXF 2DFIA 2FB5A 3DF8A 1PUFA 3BA9A 1TZLA 3FXUA 4DYRA 2HG5C 3ZBHA 2Y9ZA 4PSWA 2ADPA 2VE9A 1WSUA 3LUTB 1DPUA 3PFIA 2VKDA 3K9SA 5IYDO 2OTJV 4GX0A 3RKWA 4P9PA 4ABMA 2A05A 3AG4H 3SYQA 2YR2A 2EV0A 2YC0A 3U0ZA 1G1XB 2EIJC 2HR3A 4XQFA 5EGOA 4KXRA 3FKSG 1LFBA 1G3TA 1K6YA 3JREA 3K1PA 1Z6RA 4IO9F 3FDYA 2AXLA 4OU0A 2ISZA 4HZFA 5D6FA 3JALB 1EN5A 4JYBA 2NS0A 2Y9YA 1V55H 2JT1A 2MG4A 3RYHB 2NOGA 4KHPB 1S29A 1UHSA 3BR5A 4Q6GA 1XNRO 3VYSB 1Y0UA 4HNAA 1BR1A 4L9JA 3G2BA 2W7NA 2IJIA 4II3A 2G38A 2W0FC 2LSOA 4XIDA 1OCOB 4BBSJ 3CF2A 1CF7B 3OW2U 2V6CA 4DZPA 2IS2A 2MLGA 3E5QA 2VUMJ 2JS3A 1QQIA 4BWAA 1NS1A 4CC5A 1N32B 4D5CA 4NKGB 1TLHB 2VPLA 2EIMB 3M9AA 5LEJA 4PHZA 1K8AW 1FJGB 1FD9A 2CS3A 1K92A 2UXXA 2QM3A 5F0FA 4NUBA 5EZGA 2M87A 4KITB 5CQGA 3K0DA 2LGQA 4I9WA 4MEXF 2ZJ2A 2LF8A 1GT0C 2Q0OC 3OS0A 1FYKA 1SANA 2X1DA 1VFCA 3BY6A 4JI6O 4HF2A 3LDCA 2QF7A 2VQCA 2WLKA 3CS5A 3G71I 1XMQB 1PNLA 2FUG2 5H6RA 1Z3YA 4GUNA 4DBRA 2B63J 1FYMA 3B6AA 4L0YB 2DYSB 5J9PC 4X1IB 3K59A 1FOWA 2YU9J 3BPVA 1PL0A 5CVIA 3MD0A 2VQFB 3VSLA 4JI2O 3CCLI 3CUQA 3HJEA 2LBFA 3OAAG 1BR4A 1O4XA 2UU9B 3ESWB 1ZQ3P 2CSOA 3BTCA 3TP0A 1KYOF 3K03A 3QQAA 3AAFA 5F08A 3SPGA 1SQVH 3OM3B 4PI2A 2BE5F 3FFQA 5ILVA 3I56V 4AVPA 3K10A 1OPCA 3OGCC 1ZR2A 3DV8A 2XNDG 4LFAO 1TAEA 3ISPA 3FMRA 3S16J 3CJQB 3E8GA 2F5DA 1WP8A 4BE1A 1P7BA 1HCRA 4OPHA 4DUZO 2Q0AA 3CCVI 4HG2A 5IYCJ 4PFPA 3OYIA 3B40A 3P9IA 4DYLA 2CJJA 1ETXA 2UXBO 3RYPA 4LF5O 1V5FA 3HKBB 1U5TB 3X2QH 1T8IA 4ZH4F 5F6FA 3QF7A 2CRGA 1JUPA 1MH4A 2IW5A 1RRJA 3HOWJ 1OYIA 3Q9SA 4IOCF 1Y39A 4I4TB 4PK4A 4QGPA 1IVSA 4BAYA 3BR1A 2XHBA 4LMYA 1M56C 4F6EA 3E3VA 2K9PA 1QU3A 1Q82W 2M45A 1NHAA 3NQOA 2Y0IA 2YEVB 2E7XA 1S7OA 3N2KA 2IU3A 5IJ9A 4YHHB 4LF4O 3F9KA 4RA2A 1D1AA 2P5KA 1I5ZA 5EZHA 5DTDA 5LMUB 1H38A 4KJZA 4H4KC 5FD5A 2DA2A 4E4EA 1IBLB 2L4AA 2VIXA 5D5VB 4NC8A 2FX0A 2X51A 4YFNF 4A3IJ 1VQ8I 3NWTA 3CYOA 3ZHQA 1QA6A 3R60A 2DA6A 2DT6A 5D4SA 5M5WJ 2XGDA 5F04A 1OCZB 4I9QA 4BIZA 2JPCA 1IGNA 1ULYA 1ZG5A 4U3JA 4ZKIA 1PM9A 2BCCH 1JKRC 2VQLA 2ZJPF 4BDYA 4ETSA 4F3QA 5HLIA 4K3AA 1HXDA 5GAHJ 3BG5A 4BY1J 4Q20A 3IL2A 1X58A 1RIOH 5DUIA 3FBIB 2M7AA 3A2FA 1TWAJ 2RJZA 4ZZDA 2F4VB 3RIRA 1SFUA 1NK2P 1X1DA 4P30A 1IAWA 3CF5F 3PN1A 1B72A 2PTMA 3TW7A 4OMZA 4RGXA 5LL6Y 2ZMEB 1HDDC 4L9TA 4PDVA 2UXBB 3G80A 1VQ4I 3L71H 3U10A 4BUPA 5C3EJ 2Z0AA 3AK3A 3PIPF 1QVUA 1DLBA 5TRDA 3WG7C 4C2UA 1X4TA 3E22B 4C3HJ 3HOYJ 2LNBA 4PGHA 3D5LA 4XLAA 2F48A 3QPHA 2L2OA 4PD4F 5B1AH 2EX3A 2I8DA 3NR7A 1J2XA 3F8CA 1F4KA 2R7VA 4RUEA 1SQXH 4I09A 1UFMA 2Y0SA 2X7RB 1FXKC 2HKXA 5JI6A 3J7AU 1WPXA 2CQQA 1U5TC 2L9NA 3N97A 1B6AA 3HB3B 5J4YA 4R50A 2KZGA 4M74A 4LLLA 2A68F 4FM2A 1JJ6C 1SVLA 3K57A 2IT0A 5HDGA 1V5GA 2RREA 4P9FA 2UUBB 3RDIA 1VQ5V 5LYJB 3QO5A 1D1BA 1Z9CA 2BXYA 1I1GA 3HSEA 2XRNA 4HSTA 3NWSA 1L0OC 3ABLH 4U88A 4Y15A 5ERIA 3RPQA 3KYLA 1HW7A 1QLEB 2M7BA 3JTGA 1BBYA 2Q2EB 2JS5A 4XOPA 2LP7A 4RDUA 1SMYF 2JPBA 2DQ0A 2GHYA 3BVOA 2PMZA 3QVNA 1I94B 1RUNA 4HSRA 1PP7U 4UCSA 2VASA 3D36C 3JRDA 1XS9A 4F52A 2PMHA 1W5SA 2GXBA 4IZZA 2QWWA 3CCLV 3VYRB 3JSOA 1IZ1A 1AKHB 1FT9A 3VWBA 3TJTA 1AROP 2MD5A 2B5UA 1K78A 4JASA 3A1YA 2BXZA 5EG0A 3DCFA 4M3DA 3B4SA 3CE2A 4OX9O 3Q4HB 3DTIA 2Y0PA 1N33O 2MC3A 3WB2A 4D6TH 4JI0B 5E8GA 4PFOA 2Y2ZA 2LYCA 4YEJA 5DD8A 2VC0A 3RCOA 4ENMA 2EBOA 3OUFA 2M30A 3KETA 2OD5A 4BW9A 3A8TA 1XI1A 3IHUA 4RAFA 2FKXA 1B8IA 2JGDB 1FFXB 3BCCH 3CHXA 5H2FC 2P67A 5EGOB 5IY5H 3QYEA 3IH3A 3AG7A 3HM5A 3FB7C 4TWKA 2E1OA 2X6YA 4L8JA 2FEZA 4M6VA 3LSGA 3HC7A 3TOBA 4Z1MG 1NVPB 3CMEV 1R3JC 1OCOH 1OCRC 4H44B 5BMVB 1LNQA 3L2WA 2YSUB 1YI2V 4DUYB 2QCOA 3KP7A 2LLKA 4XNFA 4FZ1A 3H9VA 4JP0A 3CLQA 4M3FA 3DTUB 3QYFA 4B3SO 1OCOC 5IT3A 5FNVB 3IP4B 3ETGA 4PV1B 2ZNZA 3ECHA 3OMIB 1RM1C 3I0TA 1XPXA 1BMFG 2QQAA 4YJ3B 3J80N 2LOOA 1AR5A 1X3ZB 2FRHA 4D9JA 1VIBA 4DV1O 2K3FA 2ZFUA 5FFXA 1HR0B 2PBIA 5HS7A 1AP6A 3ZQ7A 5ITZA 1MDMB 1LFPA 3I53A 4BJ5C 2QKCA 4UCOA 2ODMA 3HIFA 5JHUA 1HA8A 4KA4A 3BR6A 4J19A 4TSFG 2OJED 1SQFA 2KLOA 3M8JA 3M1CA 1OJHA 2YI9A 1GK9A 2EZKA 4QE7A 3UQ8A 1K33A 5LGNA 3HPGA 2QE7G 3CRRA 3L73H 3GWOA 4PJNA 5CB4B 3JD1A 1RFYA 5KHJA 2DA7A 4I01A 2L9VA 4QSHA 5DCFA 4DW6A 5HDKA 5JCOA 3V7SA 2IA2A 1RR7A 3ASOC 4E7SA 1SVOA 3E86A 4DOZA 2CTRA 5E3MA 4A6EA 2VQEB 1P7IA 3DPTA 2OZUA 3LSJA 2H6CA 1PJRA 4NXMO 4P55A 4FHTA 4A3FJ 1QZYA 4HPQA 2Y48A 2NVQJ 4FASD 3JRGA 1XNQB 1GN2A 2Q1ZB 4AIHA 1AJNA 1UPGA 1H2KA 2AGAA 2NNNA 2EJ7A 4NR1A 2HVJC 2IEKA 4TV8A 1ODDA 4MVMA 5EBWC 5B66Z 2QKSA 1AI5A 1EKEA 4LK0F 3ZMVA 1T33A 2GTAA 5KAFZ 1O7FA 3IC7A 2JDIG 1R3LC 4IHJA 1N77A 2E60A 5H5NA 4CDGA 2ECBA 3HOXJ 3RKQA 2XVCA 4J01A 3ABLC 1RNLA 4RO2A 4DV5O 3SJCC 4FZ0A 3F8MA 4IRIA 3FKIJ 1IX9A 2CGOA 3WTXC 5AIQA 1HOMA 3QNEA 2XOKG 2R5ZA 4NTXA 2JVDA 5BS6A 1FEXA 2HHHO 2P6JA 1T5EA 2M2EA 2VKHA 3MD2A 2H1KA 5F27A 1SD5A 1OCCB 2CFOA 3CCUV 3GTLJ 3HRSA 2NLJC 1VARA 1K9MW 2LFSA 2YEVA 1KC8W 3MAQA 2KDZA 3CMYA 2GA2A 5C4JJ 3AG4C 5IWAO 4KT6A 1R22A 2QQ9A 5DYMA 3RJPA 3CTAA 4B3AA 1TGOA 4D7TA 3NEUA 5DM6F 4KIBA 3OUSA 3EQLF 4X65B 1FIAA 3GW2A 4JGSA 4MO7A 4O2BA 2DTZA 2DBBA 4N4OB 4IHWA 2GBOA 4LWSA 1S72I 2OBPA 1Q8IA 2DU9A 3DTEA 4AU7A 3RW0A 3FB5C 1Q6UA 1BI0A 2ITDC 3OYFA 4DR3O 2MBFA 3JASA 2ZJRF 3BT9A 4LH7A 1LE8A 1D0XA 4YJ2A 2VXZA 2XV4S 2DPUA 1U96A 1BI2A 3MZHA 3F5TA 2EILB 5KX5B 3RYRA 3ERED 1MIJA 3K9AA 3K4JA 3B2EE 5J2TB 2HXOA 1PL4A 3OSFA 1LPQA 1ENHA 1DPRA 2ZXIA 3VODA 3HUGB 5L3DA 1Y74B 1AJPA 1NR1A 3LA3A 1V55B 3K04A 4IHVA 2JK5C 1QPIA 1WJZA 1T95A 3QOPA 1KU3A 1MJAA 3M1EA 4ESBA 3FXMA 1MSEC 1PVEA 5CMUA 4B48A 4BQQA 3F23A 2X1EA 2Y69B 1HSJA 3QODA 4B09A 4XLCA 3GLXA 3O3KA 2E1MB 2EA2A 4FLUA 5DCMA 1GN3A 2TCTA 3SR2C 1QO0D 4PA6A 4YXWG 1BC7C 3RYIB 3I55V 1SESA 4BE2A 1IDZA 1K4DC 4L5IA 4JI3O 4JYAB 3FK7A 2GWRA 4MVOA 3T1HB 1BHAA 1FX7A 5GTHZ 2VQHA 5LHHA 2HEOA 2XSDC 3LQQA 2YS9A 4LFUA 4BKXA 3AG2H 4JOMA 3OYGA 5B5EZ 1MKMA 2D1VA 3DKWA 2FA5A 2P5VA 5ED4A 3HOUJ 4JTCB 3ZOBA 3H5RA 4G6TB 4GO1A 4M3GA 5KHGA 2VONA 4G6DA 1JPXA 3JAWA 1H2MA 4LR3A 2MLKA 3MEXA 1MGTA 1T0FC 3OYJA 2BY3A 2D1HA 2N74A 5H6QA 2J5PA 3TOAA 5BZBA 3E6BA 4DR1O 1NR7A 4FISA 3T8TA 3I56I 1PDNC 2ID6A 1SQBH 2KFDA 2HDWA 3TCUA 3COAC 2A3QA 4BGDA 2W85A 4D7NA 1F1ZA 4ZZLA 2XDVA 2HTJA 2PJRB 2VT2A 1M5IA 2IH1C 4OAZA 1QHHD 4I0XB 4BJTA 1VQOV 5AONA 2E5ZA 2K1EA 1YI2I 1EH7A 3A0HZ 3H1JH 3ZMDA 4UUSB 3OT7A 2E5NA 1KUQA 3ECOA 1URFA 1W7PD 2W00A 1VQPI 1VQKV 1O9GA 3I54A 4KMUX 2XAQA 2WLLB 1SD6A 1HQCA 4JI0O 3KZYA 3RYFA 1TWFJ 1IN5A 1N75A 4S05A 2W4SA 1X2NA 2RMKB 3WU2C 4O2AA 2LP0A 2VBZA 5FLMJ 2LR8A 1YQAA 3BZCA 3K4LA 4G7ZF 1B8IB 2H27A 5CPRB 1IDYA 2NRAC 1Z5WA 2RCVA 1VQPV 2E36A 2Q5ZA 3AK2A 1JGGA 4FIPC 5B1OA 5GW7A 3CUQB 1XDCA 1XL6A 1BOAA 2LBFB 3JSLA 3MCZA 1I94O 3W7WA 2V9KA 1MMSA 1NU1H 3M8EA 2EZLA 2H09A 3FHZA 3QPSA 1M1EB 4UNOA 4ZYGA 2VOPA 1JR9A 4B3MO 4DQ2A 3TL4X 4GRIA 3H1CA 2IPQX 3L00A 1R1UA 2ZCWA 4LLGF 1GM9A 2LY1A 3MDSA 3VDXA 4DR6O 2CQ7A 3E89A 4X64O 3IV5A 4K8ZA 4YJ3A 4GYGA 4YFKF 2ZSHB 1WJAA 3U9GA 2X6XA 4LF7O 1SF9A 1YX5A 1BJZA 1JKPC 4KN4X 2Q8KA 1YRNA 4LG3A 1UAAA 1I5XA 1XDUA 4RUFA 2NOJB 2HQ5A 4XL9A 5CJ9A 1G3WA 3MKLA 4BYYA 3ASOH 2XUMA 1BHBA 1MZFA 2K4BA 3FBNB 4RAZA 1AP5A 5FD6A 1JKOC 1ON1A 2MABA 3T8RA 4X20A 2HHHB 1REPC 5K1XA 1I3AA 4AM3A 1GHCA 1DF5A 1SFOJ 2WSSG 1NTCA 2CUFA 2JQ7A 2EFOA 1J5EB 1QR8A 3C3SA 3OL3A 1B4AA 2DLLA 5LLQA 5CVJA 4CCMA 3AG3B 3JARB 1M1KW 4D0PA 5IJ9B 3IH2A 4XN3A 2ZC2A 2VJIA 2LRDA 3J81K 3K9TA 2P90A 1MNEA 1IO2A 1TQIA 1E1QG 1DTOA 4DV3B 5JLXA 4FLWA 1S9HA 3SJAC 4ZYAA 2DJNA 2IAIA 4X66O 4XKBA 3WE3A 1WWXA 1YZBA 2HFEC 3WTYC 4I98B 4XBFA 3CP8A 3TEDA 3CCUI 4U3JB 1W0JG 1GRJA 2WAFA 3VFZA 3DLLF 3APOA 4PGGA 4XONA 4Q4ZF 2J5OA 1ZSPA 3AG2C 3WTTC 2OIEA 4Q48A 4FLTA 4ENNA 4OINF 5EEHA 3NXSA 2Q7HA 3D1NI 2VN2A 1XILA 2W24A 1P9QC 2IS1A 3AG4B 1FAFA 2HS5A 2ADQB 1T39A 1GN6A 1MMAA 2MYSA 5J4VA 5E3NA 3ABKC 1IRFA 4Y52J 4IF4A 5HODA 1FSHA 4G9YA 2HZDA 2YDEA 1Q1HA 1FTZA 3BABA 2W0XA 2LW7A 2HDDA 4DR4B 2RVCA 4EJUA 1FOXA 3M7GA 2STTA 4PUSA 3EYIA 2H3OA 1JUMA 4AIJA 1RC9A 4E4HA 3JCUZ 2WWWA 3CRCA 3CC4V 1VF9A 1X2MA 4BXXJ 5AG2A 4EEFG 3FISA 1BC8C 1VQNV 1OKRA 4LIVA 3JD4A 3EDPA 2QKMB 2CQXA 3VBBA 1AOYA 1WRJA 3S3XA 5J6XA 3VQXA 4B1RA 5IYDJ 2K3PA 2QWPB 1D5NA 1EF4A 3LSUA 4H0LB 2HFHA 2UUCB 4MVRA 4HYEA 2FYUH 2M5WA 3ABKB 1F9NA 2LDUA 5D5PA 1DF4A 4LB5A 2FOKA 3Q9VA 3J81Z 1MJ9A 4X9QA 4WCEV 2KISA 5F0CA 2XAHA 2Q2EA 3KE2A 1WI9A 3X2QC 3HKZA 2QM7A 2HZTA 5K5QA 2IA0A 3AG2B 2X85A 4IKFA 4KHPO 3PO2J 3TBIA 1EFRG 3E6MA 3Q5FA 2XC7A 1JA8A 4WFAV 4LNUA 4XORA 5IP6A 4RGUA 4LLNA 1BT8A 3OR7C 3OEEG 4I55A 2NYXA 2XGEA 1BSMA 2XGCA 4P5OA 1QHGA 2DYRB 1LUJB 1A04A 3HKEA 5K1PA 1SFEA 3LAPA 2QM8A 5IYZA 5EG0B 4J7ZA 2JA2A 4LITA 4Y3OA 4EB6A 2W6JG 2KJCA 4G6QA 4LB6B 4AYBA 4HNUA 2MGQA 3HTSB 1NH2B 4KUMA 4FX4A 5LMUO 1DU6A 1ZUQA 4UCTA 4O4LB 4EVIA 4XM3A 1XMKA 4WFEA 2HOSA 1TC3C 3LL7A 3A0BC 3WHBA 3EXAA 1J0RA 1FSEA 3GF2A 3CMAI 1WA8B 2QWNB 3QU3A 2XAGA 1FPOA 3JD3A 3ZMUA 5KAIC 2M0MA 2A69F 4KMFA 1SETA 1VQKI 3FM3A 4WK8F 4E7JA 6PAXA 1Q43A 2ZIMA 1L1FA 5BPDA 5IJ0A 5LOVA 3TKYA 3GZ6A 1SS3A 3JD2A 3BZKA 4R6ZA 4CXFA 3LDDA 1OCRB 3GTGJ 4QNHB 2XIGA 3V7CA 2R7RA 3OSGA 3IAYA 2HXIA 4OAYA 1ETWA 1DUXC 4W4LA 3JRCA 3L75H 5EBLC 2Q7EA 4TQFA 2JRIA 2EH3A 1WJFA 4LF7B 4JI2B 4A12A 3KEOA 3HPLC 2BV6A 4HLXA 4CS2A 5IY5C 1HNZB 2PJRA 4LWSB 2TRTA 5JH7A 4C9YA 3S1NJ 1Q6IA 2XKOA 2JWTA 2UUAO 4NC6A 4PA7A 3OL4A 5IP9J 2AZ2A 2WAQN 2Z2SB 1H9TA 2BZTA 2HVQA 2MD0A 1N36B 2P5OA 3L7WA 2YIDA 1O7LA 5D6EA 1YITI 2PLYA 1N78A 1U0JA 3I71A 5EEGA 4UFZA 4WFGA 3CC2V 2IU0A 1G6NA 1W2BU 5IWAB 3D0SA 1TA8A 1S0VA 4A5UB 3H92A 2ME6A 3OYEA 3HKBA 1U5TA 4PDLA 2OA4A 4AIDA 3SXYA 4HBNA 2AQEA 2NR5A 1BI1A 3OS1A 3J7AO 5CN0A 1VQ4V 1XSVA 3D3QA 2EV5A 1DP3A 3ZS8C 3OOUA 4OIRF 3FB6C 1YITV 3C7JA 2BY0A 1WPBA 1I6HJ 3VSKA 4Q5SF 4QLCU 2AQFA 1IXBA 1O9HA 4PA9A 3OR1C 2PY5A 4MFEA 1N32O 4WWCA 4IOAF 4HBLA 3ABMC 3N2KB 3ZHSA 3F8BA 4IHXA 3S32A 1OZ0A 1YVWA 4FJCC 1TT0A 5J2UB 3ZHRA 4G2KA 3OTFA 4IX7A 2D5VA 2G7UA 1JXSA 3QU6A 1ZRFA 2W6IG 3KZIC 2HNHA 3GFMA 3LSIA 4G7HF 3ML0A 3JSNA 4MTEA 3M99B 1XNRB 2QBYA 4HW0A 4JX6A 2ZCEA 5F2VO 5EYPB 3UM7A 3QP5A 1QNTA 4F6RB 4IHJB 4GGGA 1VQ5I 1HW1A 4NXMB 1LR1A 5TISZ 1H9GA 1ON2A 4FE4A 4P9UA 1BQ0A 2BTOA 1KQ0A 5DUKA 1F7YA 1XNQO 5IE9A 4N23A 2YICA 2UU9O 2MW2B 1LB2A 1YX3A 4BU2A 5KUMA 2EA4A 1X1BA 3LWFA 4IPAA 3GTOJ 2QTSA 4DV7O 3PSFA 2KIMA 3QO8A 3MZYA 1P4AA 1K34A 2GDSA 4I5SA 3STLC 3UKGA 2DYRH 4AQYO 1VQ8V 1XGMA 5E18F 2JVHA 3LAJA 4B7EA 4F4LA 4C2MJ 1OFCX 4WXHA 4QE9A 2ELKA 3TP3A 2R7WA 1JJ2U 4DRXA 4L5JA 4JPRA 4G12A 1P7JA 4LF9B 4J41A 4LFCO 3JD0A 3DQVC 4FFBB 1DP7P 2FJ1A 1OCCC 5JVDB 3U21A 4YIPA 2NNYA 1ZELA 2JUCA 4M9ZA 1G8MA 3JASB 1G4YB 2M4GA 1IV8A 3F72A 1XHZA 3E5UA 4UUJC 4UUVA 2CE4A 2EB7A 2QSAA 3BTIA 3EHBB 3DPUA 4QPKA 1VQNI 1B6QA 1VQMV 4A2UA 4IGGA 1R71A 2XUBA 2HI3A 1BL8A 3G1OA 1WJCA 4LJZF 3NAUA 4MTDA 2EZIA 3R6SA 3ZCOA 1GV2A 3CMAV 1ZREA 4FLVA 2BW3A 4MNUA 4OIPF 1DDNA 4M72A 2ZE5A 1ZLJA 4QPOA 3CCSI 3KP3A 1YTFD 3CJRB 1LVAA 5FRMA 3VYUB 2EIKB 2X6BA 1TQPA 1Y76A 2YSRA 2WV1A 1R49A 3ZHTA 2R9RB 1OR7C 1FIPA 3Q0WA 4BQNA 1UFIA 2GUZA 1SRYA 3HKCA 1Q6HA 4V2GA 4RB1A 1H0MA 1ZR4A 2EBIA 1YFHA 3JATA 3OIQA 1D2DA 1Q1VA 3RPUD 4CH7A 5JQGB 3K3WA 4FLZA 5D5UB 2BTQA 3TO9A 2GZWA 3W6KB 4J7KA 1YEWA 3ZCCA 3KCCA 4UB6C 5KVRA 2ZSIB 1PNKA 1N33B 2Z5UA 5EIBD 2GXAA 2JA8J 1NVPD 2L7KA 2WADA 4E6KG 4CH4A 4C3JJ 3C3WA 1EA3A 3HOSA 3ABLB 3JYCA 3BAAA 1FOYA 3EUAA 1W36C 2V6EA 3L74H 3O9OA 4P9OA 1MBGA 5KA5A 2EPFA 1R73A 3SYTA 3BPXA 4ZI7A 2JGDA 4ICGA 4KNYA 3KZZA 1M57B 3J80K 2AHQA 3TMOA 3CCEI 2VQFO 1YS7A 1UJ8A 1TP4A 2V1DA 1MBHA 4RGRA 1K6OA 4JZGA 5JWPA 2RNJA 1B06A 1VQLV 3EVKA 2AZ0A 5GAGJ 4XDKA 1S72V 1UHMA 3L09A 3LSSA 4PJLA 2CUZA 1BA5A 2M1BA 3DFGA 2PEXA 3F6VA 3U1KA 5F1JA 2E3CA 4JI1O 4JI4B 1R6RA 1YHQI 2K85A 4UUSA 1NK3P 4AIKA 2FBKA 1XUQA 4B3SB 4JQFA 3HRMA 4MHGA 4F91B 3TO7A 1HKSA 3I5UA 3C2BA 1WP7A 3S3MA 2W84A 5HLTA 3DBRB 3OV8A 4G7OF 4LG0B 1XOUA 2ATKC 3K70D 2WLLA 3GFJA 3WTUC 3OYCA 3JCZA 1XMAA 1TW3A 3HSFA 5KHHA 3FXRA 5DV5A 4J10A 5C8YA 4RLFA 1WB7A 2BYVE 2OAZA 2PGGA 3OYHA 1YHQV 5E3LA 1GXQA 3E8HA 1YIOA 1TQMA 1GV5A 4EM2A 1BOBA 1JTYA 4FTHA 1A36A 4H13B 4O4JB 3W7TA 2JEXA 3E7LA 5D5XB 3SJMA 3P5JA 1I6XA 2FBIA 3CZ6A 3C1DA 3P30A 1WFXA 4IIJA 2LVSA 1NH3A 4M3EA 5CB4A 3OTOB 4R7CA 3VOEA 1N8RW 1A31A 1S5JA 4J9ZB 3A03A 1FBUA 2YI8A 3RZOJ 3ZX6A 1IN7A 4XK4A 1HNXB 3ELKA 2G0EA 3CDIA 1SQPH 4M73A 3H0GJ 3T0YA 2E5LB 4D5FA 1RSOB 3TK1A 1YF2A 2FMYA 3SEQA 5IT9N 4QWQA 1S7EA 5B1BB 4LH6A 3ZRSA 4IYIA 1YJWI 4CC6A 4IEJA 2HGCA 2HTSA 3ABKH 2QYOA 1YRNB 1NTMH 4RAYA 3CCRV 5JH7B 5TJJA 1D1CA 4EJWA 1PPJH 2VL8A 4TV8B 2ZXHA 3AG3C 4Z2YA 2CV1A 2DA3A 5BNGA 3MMYB 3OYDA 2QGUA 3JCUC 4Z1VA 3HKDB 1Y8RB 2B1IA 2VBXA 1YYVA 3LMMA 1E17A 4IHTA 1OCPA 1W5TA 3HZJA 1NTKH 2XKPA 2IJKA 4AYBN 4G8XA 4IRHA 3HRUA 4L5EA 4X1EA 1ZL8B 4J42A 2BE3A 3OOPA 1EN4A 5B5EC 2CTWA 3KPHA 4DV3O 4ENJA 2HVSA 2O6GE 3JAMK 3OYAA 1SQQH 3F7YC 4O4HA 3PQJA 1Z2GA 4WXDA 1IDSA 4GCZA 3CCSV 3DP7A 3K1MA 3M8AA 1YJ9V 2ZNIA 2BHZA 3LDEA 1I27A 5DEQA 3CB2A 1LEAA 1ZG3A 5JR3A 3FIWA 1Y66A 2FL4A 4XRMA 4HDVA 2HPMA 3ZPLA 1XMOB 5D4RA 1E3OC 3CQZJ 5J40A 2PYJA 4EJVA 3S14J 1RPOA 2FBHA 3BR2A 4KYWA 1ETYA 2VC1A 3ASNC 1H2SB 2RAEA 4BH9A 5IOZA 4FK5C 4LFAB 3RSNA 1JE8A 3I9V2 5LHIA 3FMQA 3JRBA 1BJAA 4I50A 3F8NA 2QQBA 1WB8A 3KEQA 4CO8A 1XEQA 2BGCA 4PCQA 4J11A 4UXNA 1B9MA 2XHKA 4JAAA 3CXCU 4NC7A 2R7UA 3IRQA 4ZYEA 2E35A 2L9RA 2RDPA 1OCCH 1VQMI 2B9ZA 4AI8A 5F64A 3RYCA 2Q7GA 3IH4A 5FKOA 2ZNYA 1NZ6A 4A3BJ 3CCEV 2R72A 1BQZA 2O9LA 2HVKC 3MKZA 2KP6A 1LVKA 4HOBA 1ZAUA 2HYGD 5M5XJ 2COBA 4F93B 2CMPA 3CJHB 3KCXA 1O3SA 2A6TA 4JI6B 3E2EA 1U2WA 4PJ0C 1USSA 1FBQA 3QP6A 2QKLB 1IBLO 4U7BA 4IHSA 2DQ3A 1W0TA 1JQ0A 1V3FA 1MMNA 2OQRA 1XBLA 2XT9A 3GWKC 2XSJC 3RPUA 2A79B 3D3IA 4EFEA 1G6UA 1HNXO 1QQCA 4HNAB 3JW4A 2L02A 4FFBA 1V55C 2QSHX 1KYZA 2G9WA 2WAQA 3DKYA 1M56B 2M6YA 2JSCA 1VI0A 4K2EA 1UZCA 3AG3H 1ZN2A 2R0QC 1LQ1A 4UVBA 2M8EA 1MMDA 5A2QK 1J95A 1B9NA 4G27B 4HF0A 1QVTA 5C93A 3CCJV 1HNWB 1D0ZA 3QPTA 1HW5A 3APQA 1SA0A 4UCUA 1YS6A 4A3LJ 1SD7A 4GLXA 4N4NB 2MW8A 3A01B 3WG9A 4ESJA 1QBZA 4BW5A 4KT5C 4F7ZA 2ZE8A 1L0NH 5JJJB 1OCZC 4X66B 2CTPA 4QPJA 3KEYA 3UCSC 3KLOA 1HKQA 3D5SC 3HKEB 3JAWB 1J5EO 1SFXA 3STZC 3N05A 3FKJA 3DPLC 4IHYA 3H3ZA 1Y76B 4A3CJ 2DFFA 5IYZB 5IT9K 4LF5B 3RZDJ 2GUZB 3HKCB 1KONA 2Y0SN 4NB5A 4M6XA 1I0HA 4AILC 2F66C 1FMVA 1VQLI 4A0YA 1MMMA 4JAUA 1K97A 3OR6C 1M4UA 2CUJA 5JVTA 2VI6A 2P06A 3DXRA 2IGKA 4HA8A 4O4LA 2K9MA 4DV6O 2GIZA 3DXJF 1OCTC 3SQNA 3CESA 3A4CA 4X1YB 3HOZJ 4WCGA 2OCCC 1US6A 1XD7A 1U9NA 3LSHA 2ZXWB 3FWEA 1BW5A 2BHYA 4IVNA 3K06A 1F36A 1ENVA 5IJ0B 2R7ZJ 2K40A 1BIBA 2O8KA 2FNPA 3GTJJ 1QZEA 2LFBA 5ICGA 2ZT9B 4GT1A 4BHPA 1KYWA 3G4SI 4O2AB 1IBMB 3KZIZ 5JFRA 2NVTJ 1X4PA 2DQRA 1A35A 5L3BA 1MNGA 3K79A 4ZI7B 1EH8A 2N05A 3FHNA 5AIPA 1C0WA 3H1IH 3OFNG 1OR7A 3S2WA 2KKWA 3W6JB 1Q5OA 5K1YA 2KG7B 1IUYA 1R23A 3BQYA 4C30A 5B66C 1Q90D 5LFAA 2DCEA 4S04A 2KRCA 3P7NA 4DIQA 1S5LC 4LOCA 1A6IA 5DD4A 4UUTA 4W97A 4IYHA 3VQYA 1T6SA 1GDTA 1M93A 1XG1A 1OISA 4LFBO 4U3FH 3L9FA 3LSKA 3ROUA 1SC5B 2WLIA 1XMXA 1K5SA 2L7ZA 4DR7B 2P0WA 4QPQA 1J7KA 4YG2F 4J80A 2L0KA 3S8PA 2OC6A 3S15J 2UWMA 3C90A 4X88A 3BA8A 5JLWA 2GTSA 3ZRWB 1R4NB 3I55I 1VNDA 2BOLA 2YPRA 4CHUA 1MBFA 3F8FA 1RM1B 3ZXSA 2EIJB 2Q69A 3R66A 1JOYA 1IXCA 3HHHA 2C6YA 3UO3A 1MNDA 3DGEA 2R7TA 4O4JA 4ZTFA 1OJLA 3BROA 1ZGAA 4ENKA 3T1YB 1LFUP 5F0HA 1OCZH 3ZQGA 1GKFA 4DR1B 4FPPA 2CQKA 5EIBC 1NH2D 3GYHX 2PX9A 1YW9A 4O6JA 4MVZA 1F43A 4GYCB 3TXQA 5J2UA 1QR9A 2R3SA 3OYLA 2LW1A 1V4RA 2XPVA 3FAVA 1HDJA 1UHWA 1HKTA 1HWYA 2VLAA 2XAFA 1COWG 2W25A 4IT5A 1FXKA 4Q47A 5ILSA 1RKWA 3ICXA 1WHUA 3FK6A 4NQWB 4I6ZA 4JYCA 4F6RA 1V54C 4EM1A 3HOTA 4A3EJ 2CAZC 3DWLE 3B8NA 1L0LH 3S3WA 3UT5A 3EUHC 3FD9A 2HDCA 2WA3A 4MVUA 1ZGWA 1UCRA 2JRTA 3ETDA 3U1DA 3CCMV 1FJGO 1OYWA 3EPZA 1BS3A 2H94A 3HG9A 1XHXA 2DOSA 2O57A 3ZQFA 4A3JJ 1YJNI 1ETQA 4LGWA 5HVQC 4AQYB 4XLEA 3SPHA 2QWOB 1MBKA 3Q0UA 1JI8A 4EQQA 1ZG1A 1B04A 1VEWA 2JZYA 2P7VB 2CGPA 2K9LA 5LMNB 1FBSA 2JVGA 4UB6Z 5JJNB 5FO5A 5J1UA 2QSGX 4CH5A 3ASNH 2Y4UA 2ZD9A 3E5XA 2HQRA 2ESHA 5FKNA 5ILUA 1JVMA 1PNMA 3ABMH 4A0XA 4YY3B 3TGNA 4AUXA 4X6AJ 1G2HA 2HJFC 1UELB 2LGWA 1I50J 4IL6Z 2WTEA 3MVPA 1R1VA 5A2QZ 2HOTA 3DTKA 1F4MA 5LYJA 4JZ2A 1J9IA 2ITCC 2K5CA 2AXTC 1YLFA 1G59A 2L4MA 1MBEA 5EK0A 3SYPA 5FL7G 2UUZA 3OWTA 2ZKOA 2E71A 2O03A 2VOOA 3G6EV 4YRVA 1XN7A 1VTNC 4KP4A 2DMPA 1ZX3A 2HYFA 4TT3G 1Z0XA 2XRLA 4WBNA 3SEZA 4XRFA 4XICA 2QQ8A 1HBXG 1AKHA 3GTQJ 1NQTA 1S6LA 1YO5C 3ZRGA 2L9SA 3BG3A 3OE7G 3I64A 5CA0B 4IQJA 4E2LA 1DGSA 2IBDA 1FXHA 2A06H 4NBQA 1N34B 3ZHUA 2ZO4A 4HLYA 1KGSA 3G6EI 1S5HC 3LNNA 3GZ5A 3HTUA 5C4XJ 5GADJ 3PJRA 1NJIW 3V7RA 3FZVA 1YE9A 3A0HC 1OQYA 1SFKA 1E79G 2OCCB 4I99C 2R7FA 3L2CA 1IBKB 1SZXA 2V1NA 5LHGA 3RKXA 1THZA 3FB8C 1ORQC 2BSKB 1W36D 3E0JB 3CJHA 2KKOA 2OU2A 1BGYH 2RN9A 4TV9B 2O8XA 4YELA 3BG7A 3K58A 3AFHA 3KLNA 4XLFA 5BMVA 1E2XA 1ZAOA 4Y17A 5GONB 1DGRM 2STWA 4U0WA 2IH3C 3CRQA 3CO6C 5L3EA 1LEBA 1F5TA 1JMKC 4MVSA 5CYVA 3N4MA 1IZ3A 3HGYA 4MW3A 4WFFA 4BJ6C 2GXGA 4PI0A 2NVXJ 3IKTA 2OCEA 4OOIA 4H33A 1WI3A 1JJOA 2DPDA 1WA8A 1JFFB 2Z1DA 4XSXF 1Q3EA 3NRVA 3CXHF 2VQEO 2BEOA 3SZTA 3W3CA 3CLOA 2JJ1G 4HV6A 4TQDA 1Y6IA 3OMYA 5HLHA 4XRSA 1ACIA 1NBMG 4BE0A 1PV0A 1SA0B 3S1QJ 2RDCA 2XAJA 2HOAA 1U3EM 5LOVB 2H8RA 3MHSC 4RB0A 4PDKA 4EGZA 5BOXA 2HP8A 3C3TA 3GB7C 5ITZB 3SFZA 4U7OA 4CCOA 1NT2B 4P2ZA 3T5XA 4RAGA 4DBQA 1FJLA 2OQGA 3P9KA 4BEHA 3KG2A 4DR6B 3J7AY 4A5MA 5CA1A 2QGNA 2R7XA 4CCJA 2EILC 3WG7B 5EZYB 1OLTA 1MOFA 2C2AA 2F4IA 2DN0A 1Z7LA 1R7JA 2E34A 3ABUA 4I0BA 3W7XA 1YIJV 1N34O 4XRSG 4ZOLB 3GCMA 4ABZA 5K5OA 2M9HA 2CGNA 5H9CA 1U9OA 2F2EA 4PA3A 3EUHA 3W7UA 4DGWB 4JI7O 3BR3A 4DV7B 4RMNA 1BR2A 2XTAA 3ZR8X 2EFQA 2YIBD 3JRHA 4HNTA 3JSPA 4EV0A 2MA3A 3L1PA 3PNVA 3ZQCA 3HBLA 2O7OA 2ETNA 3OMAB 4LP8A 5IT9Z 1YTFB 2OTLV 3K08A 5A2QN 5ICCA 3CCMI 3SFIA 1Y56A 3AKZA 4JF3A 1EV7A 2FTKA 1IN4A 2CU7A 3WGGA 4EKWA 1WJBA 4NVPA 2F4OB 4OPAA 4KN7X 1GH6A 2GM4A 2A5WA 5EJCA 5HS8A 3ZHVA 2E5LO 1VMGA 1L3LA 1CEZA 4X1IA 2WA4A 4CA0A 1IW7F 2PJPA 2DFHA 1RSOA 1Z91A 4B4CA 5IPAA 1LNWA 2YXYA 4MW8A 4NYKA 3BJ6A 1ZYRF 3A02A 5CVRA 4EATA 3MKWB 3AG1C 2MFZA 3H9QA 3CJNA 2DWEC 4X0GA 2ZDIA 3WE2A 4DV6B 2NAZA 2BY2A 2LY2A 3H36A 2GIVA 3ZN1A 1FP2A 4IRGA 5B1BC 5IDJA 3I5DA 1FWZA 4LFBB 2Z99A 1RUOA 3ZN0A 2DA5A 1J75A 5EYPA 1O3RA 1VQ7I 4G94A 4QIWN 3OD4A 2X9DA 4B08A 3H9GA 1H8AC 1X4OA 3L2UA 1POGA 3BHPA 2ZR2A 2VJJA 5M5YJ 4JAVA 2CO5A 4FFKA 3REOA 2VJ4A 3FXKA 4LF6O 1FYLA 2AHZA 1RR8C 1ZKGA 2X0LA 2ZM6O 4DV4B 4B7KA 3TDZC 1DQUA 3OYMA 3LA2A 1TVKA 2YXLA 4DO2A 1S3JA 1R3IC 2VQGA 2UXDO 4LF8B 2IJJA 5E1ZB 3J80Z 4EJTA 3HOVJ 1M90W 2G7HA 4ZJZA 2EIMH 1HNZO 3B8MA 2UV1A 1P92A 1XTAA 1QU7A 4EEQA 2IGNA 2DK8A 3WTWC 3WB0A 1L8DA 1FP1D 3FYIB 5KHIA 2IS4A 1WQ2A 1GUUA 2KIUA 4CYDA 3FAVB 1QPMA 4X62B 4UVAA 5FKLA 2DA4A 3HR0A 4E7IA 4FMTA 4DRXB 5EEAA 4U87A 2R9IA 3FX3A 1VQ9I 4YIFA 1P49A 1WVRA 4NQWA 1Y74A 3H1HH 5JVDA 3ERMA 2ME0A 3BR0A 4FT8A 4U0VA 5L3FA 3WTSC 4LC1A 4I50B 4KFCA 3RN4A 3BCAA 3UT5B 3WU1B 3SYOA 2XPUA 2CDYA 1K4SA 2WLNA 1UB9A 2ZJQF 2A0LA 3RT3C 4NXNB 4R8CA 4F55A 2VBWA 5FPOA 1UG0A 1KBHA 4RGSA 2DW4A 1K7AA 1IRGA 3SDLA 1MSWD 1T08B 3LNQA 3K4MA 3CCQI 3ZQLA 1CXZB 1BI3A 1YJWV 3AK1A 2F6CA 2OYQA 5K5RA 5DECA 5HDNA 2K86A 3OY9A 2DMUA 5KHKA 1QZZA 5J47A 2FNAA 3LA7A 1R6TA 2Q67A 3ABMB 2F5CA 2ZMEA 1LUWA 2RGVA 3BOQA 4DR2B 4AHCA 5B3SC 1XCBA 2OPTA 4H37A 2GOXB 1K7DA 2IJLA 4N21A 4ZDLA 3A0BZ 5B1AB 1FNNA 4UV9A 4LF8O 1KZHA 3E22A 3WB1A 1MABG 5JQGA 1ZARA 2MH2A 4YIOA 5LD2C 2DQLA 3K7AJ 4AVZA 4FETA 4W1UA 1XREA 3KKYA 3SDGA 2DOFA 3ZMSA 5KAIZ 4DXWA 4JI5O 5BQTA 2E76B 1HSTA 2QA4I 3GTMJ 4JI5B 3HKZN 1F51A 2PI5A 1ERDA 3PJSK 4X1KA 3C18A 2ZXWC 1S76D 5FLVA 3R61A 2F5EA 3VPRA 3RQIA 1XGNA 3R4KA 1YJ9I 4I0XA 3WTZA 1N0JA 3DBLB 4C3IJ 3ETQA 3O6BB 2ZXWH 4U7DA 2HQAA 3S2HJ 2YS8A 1H2NA 3O8HA 2F23A 1KA8A 1JT0A 3LSMA 3HHGA 2PYLA 5CA0A 2XF5A 2PUSA 4DV5B 4Y4RA 4B3TO 2P22C 1K4CC 3CO7C 1OV9A 1G4DA 5EBMC 3AG1H 4CH6A 4GXOA 3RYFB 1KQ8A 5E79C 1O3QA 1Y0NA 2FQ3A 4TUYA 3HPHA 2IGOA 4JX5A 3FYEB 3HB9A 3H5AA 4ZDPA 1SAXA 1N0NA 4CUGA 4II2A 4DK0A 2IRFG 2WA0A 2V7QG 1EJ9A 1RKTA 2OV7A 2M7WA 3CEIA 1HW2A 3CP2A 1WKMA 2YXHA 4X1YA 1R5GA 3JAKB 4JI1B 1Y6XA 3K0LA 2Z33A 1TWCJ 4LD5A 3TW6A 2WB1N 3B09A 5FFZA 2KIQA 2YU3A 3UR3C 5B1NA 3ZJZA 2QVOA 4Y13A 3HDDA 1U6GA 1V5EA 3T2MA 4ZYHA 3SPJA 1YIJI 4FM0A 2PMZN 1W4MA 5C8YB 2OT5A 3IFXA 4O3MA 1T38A 5GP9A 5C44J 3OYNA 1PKXA 3FXQA 2ILMA 4RBOA 2W1OA 4RB3C 1X19A 2ELJA 3ZRXA 4JV5B 3HXLA 4GKKB 4JV5O 2JA7J 1XC5A 4IJAA 2KG7A 5LP6A 2ZMEC 2OTLI 1VQOI 2QEXV 4P1WA 2CH7A 5DS9A 1KQSU 2WLHA 5JCOC 4OGQB 2CTQA 1DK1A 4K0KO 1AJQA 4X20B 4Y33A 2N8GA 1W7PB 1KU7A 1PD3A 2BVLA 4BEHB 1H88C 3S17J 3BZ6A 3S1RJ 2EIKC 4BQAA 3D8CA 3GXOA 5TISC 3O8GA 1GVJA 2KDOA 2EZPA 5EZYA 1GLNA 1AR4A 5BMZA 2EZOA 4J7JA 1YW7A 2MSYA 3GLLA 2M3AA 4Z2WA 3W7SA 5EC1C 4FM1A 3BLYA 5J3LA 3WGHA 2KJBA 5IYBJ 3JRAA 3B73A 4EMSA 2WPDG 4HYOA 4DV4O 4BXUA 4RQFA 2BY1A 2DA1A 3ZP5A 1IC8A 3KFWX 3KIOA 3JAMN 2IBZH 1X1AA 1Q7YW 2IVMA 2D2WA 2PFBA 2PQ8A 5HLGA 2F1MA 4Z6YA 3DC5A 1HNWO 5K7HA 3L2VA 3DU5A 3ULQB 1MSDA 2LREA 4XLNF 3ZMZA 2R70A 3HEFA 3ONQA 2P4KA 3CRAA 4XKWA 4XLHA 1WNSA 2OCHA 4H0EA 3SPIA 1X3UA 3KP4A 4HEA2 1IRXA 4ZHQA 1J09A 3PNTA 3BC8A 2EZHA 2VB6A 5KCMA 1EN6A 2GA1A 3E8BA 1KMIZ 1RETA 2R5YB 3IWZA 5E8IA 1IJWC 2X6AA 1LJ9A 2RQPA 3W2WA 5DM6V 5KMGA 1Z67A 4UB8C 4WF2A 2WY7Q 4HX7A 1R00A 3LSRA 2B9SA 3CP1A 5KK1A 3G1MA 4E70A 1QBJA 2EIMC 4B3XA 1AB3A 3QTCA 2K27A 1HC8A 4HAMA 2OIGA 1XMOO 2DJIA 1Q81W 3OMNB 3KX2A 2EINC 5GTIC 3G4SV 4OIQF 1PP9H 2JA6J 3TO6A 4U0YA 5IP7J 5E1WA 4KISA 3BPZA 4MT8A 4LFCB 2B0LA 2LG4A 3TGUH 3ZEDA 2XAUA 3E1SA 1D8JA 3WHCA 3LNMB 3K2AA 4LK1F 5CBGA 4XN0A 3G73A 3IKVA 1AWCA 2WWYA 1R5HA 3K2ZA 3SZPA 2JEUA 3PUBA 3TQNA 2QZ8A 1WAZA 3GVAA 1QHTA 3L70H 2PI4A 1R36A 1ZTRA 2L5QA 4S0HB 2P4VA 4O5VA 4DR2O 3ZGKA 1I39A 2RKHA 2DDAA 4F92B 2HJDA 3WG7H 1G3SA 5GAEJ 1HF0A 3EETA 2R5ZB 5D5WB 1W0KG 3GBGA 4BBRJ 2DYSC 2NN4A 3ZQHA 2JN6A 4MTFA 5BXZA 3I4PA 2COMA 5DDGA 1OYYA 3BP8A 3I4NJ 5LA6A 4DV0B 5L3CA 2XPWA 2RQ6A 4GKJO 1IG7A 1TTYA 2DMXA 3LSPA 3FXLA 5JHFA 2DODA 2W57A 3DSQA 4L87A 2IGMA 4MFDA 4PJ0Z 5KA6A 1R4MB 3THOA 1OMIA 3IJ4A 5H20A 1XB4A 1MNMC 2KQXA 1S5LZ 3M4OJ 3K4KA 4FCYA 4EGYA 1Y4MA 4LNUB 4BR6A 1FLIA 4CBCA 5EC2C 3MN2A 3PIOF 2O61A 4I55B 3SPCA 4ZDOA 1SEUA 2DYRC 3DEWA 4O4IB 2VRZA 2DAOA 2EFNA 4HDUA 1EZVH 3B77A 1Y67A 3ABTA 2FSWA 1SMTA 3CCRI 3RI4A 1D3YA 4B3TB 4CYCB 3LSTA 1MMGA 4XMYA 1MZEA 3QYBA 3RBZA 4GKJB 1ETKA 2WAMA 1XMQO 1P7GA 3ZRVA 1V54B 3HGGA 2X4HA 4MS2A 1R1TA 4AC0A 4BIOA 4WX9A 1QLNA 4XLPF 4GFBA 2K7LA 1R6NA 3A01A 2ZIOA 1TW2A 2FQ4A 2PZSA 3VQVA 5ICFA 2JRMA 2R7QA 1RPRA 1T98A 2H1LA 4GZRB 1N36O 3KCYA 3NARA 2FU4A 2BSKA 2QKAA 2DN9A 3LFKA 2F95B 3AL0C 2LKSA 2KZVA 2XGXA 4BY7J 5HNHA 4MVQA 4X65O 1ETVA 2R9AA 2VJ5A 2WB1A 1AILA 1RESA 4LF9O 4RM2A 1PUEE 4A0ZA 3DBHB 4XDLA 4BACA 2CK3G 4A93J 2PG4A 1UG2A 2W48A 1CF7A 3RFRA 1R58A 1LDJA 4A3DJ 1JFFA 1Y1WJ 4MQVA 4NHJA 5KHDA 2WLJA 3MHHC 4HZ3A 4X1KB 3F6OA 4ZIBA 2E74B 1G3YA 3F22A 1ZLKA 3K4BA 2ACJA 4ZTJA 1RPWA 3P9CA 3L72H 4P96A 3MWMA 4PZJA 3EFFK 2H8WA 2XF6A 1XCVA 4HX4A 1F23A 1XGSA 2V7FA 2HLDG 5FLXN 1MW7A 2CYYA 2HWVA 5CA1B 3MKYB 3H1KH 1BM9A 1XSDA 4OX9B 2VXDA 1ZK8A 1Z05A 4B47A 4BXFA 2DT5A 4DK1A 4HQMA 4JX4A 4I0AA 3BJAA 2GOMA 1RP3B 3L2QA 3CUOA 1JHHA 4NTWA 5A9GA 2E2JJ 1ZHFA 3ML6A 2NS8A 1EBOA 1ORKA 3N27A 3X2QB 3PFYA 2ZKZA 1Z21A 2UXCB 2V4JC 3K69A 4RS8A 2EILH 3K6GA 4N9IA 4BL0B 2YIBA 1QRYA 4B3RB 3RQ4A 5E3OA 4JYYA 2AXTZ 1P4XA 1FYJA 4DW0A 5LEKA 3GFLA 1U8RA 1GAXA 2OCCH 2VKVA 1EM1A 4DYCA 2VBYA 1AA7A 2EIKH 4K35A 3ZRWA 4DV2O 3CCYA 3QWLA 2FOWA 2ZE7A 3P3NA 1IXRC 2BBYA 3B02A 4D1QA 3OIPA 4E7KA 2OUMA 2WLIB 1WJEA 3GMEA 1I7FA 4XKCA 1SQGA 5HFLA 2R7DA 1GTOA 4LCUC 2XB5A 3KYDB 2HVRA 1ZLZA 3I3LA 1HP8A 1H2LA 2CH7B 3F21A 2A5YB 1NG7A 4MSWC 4PJMA 1ZTEA 5E1AC 3GEZA 5M3MJ 3DU6A 5D5QA 3OTOO 1I1SA 1T2KA 4X8AA 1VQ9V 5BPIA 3OYKA 2P7CB 3RWRD 4I7HA 3PQKA 2DOEA 3K5MA 3O2PE 4I02A 5CVUA 3RTRA 1KECA 2ZINA 1JT6A 4L9VA 3GO5A 1H8EG 1MD0A 5J8FA 2L01A 3E97A 2OTJI 1KP2A 1JJ8C 2N04A 4DYQA 2H8PC 4GDFA 3B6CA 4CCNA 2Q4PA 1GMGA 2YUSA 1OHHG 1YXBA 5FLXK 2MK3A 2M8GX 2OZ6A 3CRMA 2CV0A 5FLXZ 5FKKA 1KKDA 4WFHA 1Z7UA 4IQ4A 4BHBA 1N4CA 2QWRB 2VE8A 3EYYA 3KYCB 5B3SH 3UO2A 3CWBH 1H89C 3M07A 3V8JA 3J81N 2K4JA 1V9PA 2ISYA 2EINH 2DE0X 4L9NA 5D8KB 2E2IJ 3GVMA 2DWDC 1BW6A 4YIIA 3QG5A 3I59A 3ZQQA 1WZ2A 1A6QA 2PN6A 1K4TA 3K1NA 3JARA 5IYBO 1GO3F 4WF9V 2DMNA 4ON0A 2P5LC 2E1CA 4I7ZB 5LP6C 2KRHA 4X62O 4UCRA 1SERA 2IS6A 2DI3A 4EM0B 1Z3XA 1SVMA 2KL4A 5JVGF 1IXMA 3LSQA 4DV2B 5KUKA 4OWRB 1Z5VA 3AL0B 4GX1A 4RWUA 4BQOA 2MC4A 3ZQIA 1LDDA 3SJBC 5KMGB 1IV6A 2IJHA 1Y1VJ 4KL1A 2GV9A 2DDBA 2EFPA 2VT3A 2WC2A 2R7OA 3D5RC 4A5NA 2E1NA 1G8XA 5GPAA 2EV6A 2IA1A 4JBAA 2A6HF 3U2RA 2GSMB 3DLAA 2AW9A 2RC4A 4KIFA 3R65A 4PDRA 2Z3YA 4OXSA 3LFUA 3BRCA 1HR0O 3GX4X 1FXVA 4V2FA 2Q6AA 4XKVA 1JKQC 4R79A 5FPRA 2L3DA 3T4DA 3G71V 1TUBA 3KP6A 5EYRA 1AHDP 2L7MP 3N2GB 1O3TA 1R3KC 3ASNB 2W82A 4D7MA 2UZKA 3BWGA 1BCCH 2P81A 2ELHA 1PUFB 4CICA 3K5LA 1JTXA 1S8NA 2Y69H 2B1GA 2DOAA 3CX5F 3IC9A 4DR5O 1U8BA 2VODA 1BN5A 2H6BA 2Z9OA 1XQ8A 5J8CA 1MH3A 1T0FA 5FB2A 5CQEA 3W6VA 2QJ1A 1I5YA 2UUCO 4TV7A 1VF6C 2R7SA 3AG1B 2V26A 3JTHA 1MJBA 1K5QA 2CV2A 4E7HA 1OCRH 1ROPA 2OF7A 4CGZA 1VF6A 3CMMA 2HEPA 4TV9A 1X3WB 3DC6A 3I58A 5IY5B 3RYHA 2O0YA 4ASNA 4JYKA 3SYAA 3RGBA 1ZWIC 2M0CA 3TETA 4M9SA 3V42A 2ZM6B 5GONA 4B3MB 1APLC 5FGMA 5BR8B 5FJ8J 1N25A 3PL8A 1VZ0A 1EZJA
chains in the Genus database with same CATH topology
4MQ9F 1IN6A 1B1BA 4GX2A 1J5YA 1Z6TA 1K79A 2MH9A 3R0AA 1AI6A 1KD1W 1YJNV 1S77D 1EH6A 3WTVC 2XROA 2QM7A 1J59A 1RI7A 3KP2A 1P2FA 4JK1X 4KICA 3WFVA 1U78A 1K3EA 3R0JA 4BNCA 3E35A 1VQ7V 1AR1B 3CPWU 3M8FA 2V1XA 1Q86W 4M9XA 1TNTA 1E1RG 1CPYA 3F3XA 4OMYA 3AEIA 2KB1A 1D5VA 2LKPA 3FM5A 5CA3A 2DTRA 2V9VA 1UJWB 1KU9A 1IXSB 2LF7A 4XSZF 4QIWF 5E17F 1MZBA 4KIGA 1JX9A 1IF1A 4AWXB 4L18B 1XGOA 1MDMA 1P4RA 2Y69C 1W7PA 4ZYDA 3MQ0A 2ZR3A 3E83A 3T4ZA 5L3GA 2UXNA 4B8XA 2ADUA 3SJQC 5HFMA 1M57C 2X6CA 2PMUA 4UVCA 1TNSA 2FXAA 5DN6G 2ESNA 3CCQV 2CG4A 2A3SA 3E8FA 1FZPB 2RN7A 2BOCC 3BDDA 1FC3A 2V79A 1XDSA 2ZDIC 2DK5A 3WU0A 3WGIA 1AI7A 2JJ2G 2NNUA 2FMLA 1B59A 1GM8A 2Q0OA 4R1HA 2FE3A 3H3UA 3TDUC 2WLMA 4A6DA 1R6KA 1STZA 2P7TC 3CCVV 4WFBV 5LBQA 1USTA 3VB2A 1ONVA 5E1XA