4HAMA

Crystal structure of transcriptional antiterminator from listeria monocytogenes egd-e
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
SNAMFTINTKSQLPIYEQIVQKIKEQVVKGVLQEGEKILSIREFASRIGVNPNTVSKAYQELERQEVIITVKGKGTFIANQTDKLSSPKKLAETRTKLKETILDLVYLGVNIEEIHKLADEYSQDIIGGDVVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Transcriptional Antiterminator from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords Lmo2241 protein
total genus 43
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hamA01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hamA02
4LGWA 1H9TA 3WG9A 5KK1A 1J9IA 1I5ZA 3ZMTA 2Q2EA 4I09A 1HKTA 1FYMA 2DBBA 1XMAA 4L9NA 2EK5A 5TRDA 1BM9A 1BBYA 4HDUA 2HZTA 1QQIA 1STZA 2JTVA 1LEAA 2R7FA 3HHHA 1IZ1A 1NHAA 2VN2A 1O7LA 3I4PA 2RV8A 4K2EA 4RAYA 5AIQA 3RKXA 1TNSA 4IRHA 3P9CA 4HZFA 3T0YA 1U6GA 1X3UA 2HYFA 1YQAA 3CUQB 4HBLA 4BHBA 1I27A 1XGNA 2KIFA 1O3QA 2P5VA 5BPDA 2QQ9A 3K69A 3AAFA 3KLNA 4F7ZA 2JZYA 2A3SA 3CTAA 3GEZA 1UHWA 3I0TA 2EA2A 1TNTA 4M9XA 2PEXA 4HW0A 1R23A 2QQAA 1U5TA 2A6EF 4HX8A 3JSPA 4L5IA 3LWFA 3F8NA 1KU9A 3W6JB 1BI0A 1YG2A 5AONA 1P4XA 2HKXA 5E18F 1OYYA 4MNUA 5F1RA 4QLCU 3TKYA 1EV7A 1P4WA 4ASNA 1SMYF 2FNPA 4GYIA 1D5VA 3HRTA 3GFIA 5EEHA 1TQIA 2M8EA 2UWMA 2PFBA 1FLIA 3QPHA 2FMYA 4BAYA 4EJWA 4AIHA 4ENKA 4P5OA 5J6XA 2AS5F 2VC0A 2DQLA 2H94A 5E1WA 1K79A 4N0BA 2DPUA 3U1DA 2J5PA 5DD4A 2PLYA 2F5FA 4GXOA 5F6FA 5CYVA 3V8JA 2HQRA 3ZMVA 3DP7A 3F21A 4OIRF 3E5QA 2E1NA 4I0AA 5D8LB 2YR2A 3OV8A 2D45A 1L0OC 3LQRA 1XGSA 3P9IA 3WTUC 3ROUA 1YFHA 1J5YA 2MLKA 1W5TA 2ZKZA 1VTNC 5FLXZ 1MJBA 2BBYA 4AD9A 1RUOA 1MDMB 4E70A 1O3TA 2QVOA 1FBUA 3Q5FA 3ZP5A 5JI6A 2GIVA 3CDHA 4L9VA 2F5CA 5FGMA 3J80Z 1O3RA 1G3TA 5ICGA 3E6DA 3TGNA 4ZH4F 2L02A 5LRSA 1ZRDA 3R60A 3DF8A 4U0YA 5DEQA 1XGMA 1D8JA 1HKQA 1G6NA 2Z5UA 1OYIA 4IRIA 4UUVA 2VT3A 4A0XA 1KU7A 1MZBA 1U8RA 1XN7A 2XRNA 5D5WB 4UNOA 4QWQA 3HSEA 5ILVA 2W84A 2EFOA 2RN7A 4WCGA 3COAC 3K2ZA 3I64A 3RJPA 2H6CA 2P90A 1CF7A 2C6YA 2HR3A 2ESHA 1B1BA 1S7OA 3LA2A 4CDGA 1T39A 3O2PE 3PFIA 1FZPB 4RB2C 1IN6A 1HSTA 4FX0A 2KKOA 2JSCA 2O61A 4OOIA 4NHJA 1P2FA 2DLLA 1CF7B 1MKMA 1R22A 1C0WA 3KP5A 2B0LA 1T98A 3EETA 2FMLA 1EH6A 2L01A 2XASA 1XMKA 5E17F 1FP2A 1S3JA 2FF4A 2MBFA 2DPDA 1V4RA 1D3YA 1XDSA 2NS0A 1BN5A 3BPXA 1J75A 1ZHFA 2WAMA 2DTRA 1RM1C 2OZ6A 1YS7A 3J7AO 1BJAA 1A04A 4A5NA 3HOTA 1E17A 3F8BA 3GF2A 5JVTA 3JTGA 3HRSA 3J81K 1XB4A 3SXYA 5D6EA 4LD5A 2YX7A 5DDGA 5H6RA 3WTTC 1ZRFA 1WRJA 5L3EA 3ZMDA 3GVAA 1E2XA 4HLXA 4EJOA 3MQ0A 3ISPA 5HS9A 1YO5C 1RNLA 2HEOA 2P6SA 4EM0B 1LQ1A 2LSOA 1MJ9A 4CICA 4FT8A 1UFMA 4BHCA 4M74A 1IXCA 3TQNA 1B59A 2EFWA 2OBPA 4IJAA 2KIMA 1R1VA 4OMZA 1HQCA 3WTSC 4I02A 2BEOA 5HS8A 4I98B 4UV8A 4G6DA 4Q5SF 3ERED 1IXSB 4A6EA 1YIOA 3S2WA 4G8XA 2DK5A 3MCZA 3LA3A 4NQWA 3BPVA 2KJBA 3HSRA 1QNTA 4HDVA 2Q8KA 1YYVA 5FB2A 5CA3A 2ZO4A 1FY7A 3CUQA 4NB5A 5L3BA 2D2WA 5LGTA 2XIGA 3KETA 3LAPA 5DCFA 1FYLA 4OIQF 1Z91A 2HWVA 3V4GA 1IN7A 4UVCA 3KP4A 2KIUA 4XSZF 2XAFA 3J81Z 2XROA 3RPUA 1B9NA 1R1TA 2HS5A 2Z9OA 4I0BA 5CVJA 4ZZLA 4Y13A 1OMIA 1ON1A 3E6BA 1YS6A 3Q9SA 4EQQA 4RB3C 1KYZA 3C1DA 5EEGA 2NAZA 5BMZA 2VOPA 1Z6TA 5ERIA 2EJRA 2KRFA 1USTA 3F22A 3KCCA 5JFRA 3I5UA 4O3MA 1HSJA 1HW1A 4HA8A 4L0YB 5J8FA 3VODA 5FO5A 1BIAA 4U0VA 3GUDA 2FBHA 4ZYHA 3G73A 5IT9K 2A69F 3DV8A 3J80K 4KN4X 3IRRA 3RYPA 2A5YB 1B4AA 3OOPA 1FT9A 3H92A 3F3XA 3TOBA 1UCRA 5ICCA 3HRMA 3KP6A 3SQNA 3GW2A 2IRFG 2WTEA 4XBFA 2WWYA 2RVCA 2MH9A 2STWA 5DUKA 1JE8A 4LJZF 5DCMA 3QU6A 3KZZA 4LG0A 1PP8F 2DW4A 3TDUC 1YTFB 2WC2A 2ZCWA 2CG4A 3GFJA 3F23A 3L00A 3FMQA 2NYXA 3L7WA 4O5VA 1QBJA 2XAHA 4Y17A 3WTVC 2F2EA 3B02A 2XVCA 3K1PA 5LGUA 2QBYB 3I53A 4CYDA 4WK8F 4EM1A 3V7SA 5FLXK 2E7XA 5DD8A 5DCMB 3VFZA 2X4HA 2P7CB 3TO6A 4GGGA 3V8KA 1YW9A 3M8EA 1Y0UA 5D4SA 2ZNYA 2VT2A 1SFEA 3K1NA 2O03A 4R1HA 4KN7X 3ZMSA 1I6XA 3F8FA 3SHFA 4BXUA 1UHMA 5CVRA 3ZN1A 3MEXA 2GZWA 5E20A 2E7WA 2K27A 2VBXA 2OQGA 3BOQA 4KMFA 3KP3A 2QLZA 1PP7U 3KP7A 3C18A 4EV0A 4HYEA 4ENNA 2GAUA 2NRAC 3WTXC 1ZH5A 4OU0A 1W7PA 2QENA 5K5QA 3FM3A 1FWZA 5BOXA 4Q47A 1USSA 1DUXC 1KGSA 4A5MA 1IRFA 5ILUA 4Q4ZF 2DT5A 4IHSA 5H6QA 4CGZA 2ACJA 4N9HA 2CYYA 1BIBA 1SD7A 3JSOA 5L3GA 1ZGAA 2PBIA 4S04A 2HQNA 2JRTA 1YW8A 1F5TA 2ISYA 2XKOA 1K78A 4MGRA 2IPQX 1R1UA 3FZVA 4LB6B 5LHGA 1R58A 1DPUA 3HSFA 1XSXA 5LEKA 4OMYA 5D5VB 3R6SA 4N9IA 2GXBA 3M7GA 4B8XA 3NQOA 1KU2A 5FFXA 2X0LA 1KQ9A 2M30A 5A2QK 3WTYC 4GO1A 2DK8A 2ZXJA 3CO6C 3F72A 1NH2B 2XGXA 2TDXA 4IRGA 3ZN0A 1O3SA 2ZMEB 2VONA 4XLPF 3LA7A 2Z3YA 4P55A 2LF7A 1MD0A 1F1ZA 3RYRA 3MZYA 3KP2A 1OYWA 1ZYRF 4HLYA 5HDGA 4YIIA 4YIFA 2IA2A 2D1VA 3RKYA 5BS6A 2P4WA 1R5GA 5HLGA 1SFUA 1KA8A 4FHTA 2GWRA 1SD6A 1U5TB 4G7HF 3D5LA 4L18B 3Q9VA 2RNJA 4ON0A 1JHFA 2BGCA 4ESBA 5HDKA 4M9SA 2HOEA 3M9AA 2E1CA 1ZG1A 3QU3A 1J59A 4WXCA 1B9MA 3T8RA 2LF8A 1YLFA 1IAWA 3DPLC 1AWCA 2AXLA 2XV4S 5D8KB 3GO5A 5ICFA 3E97A 2UXNA 4KNYA 4EMSA 4M72A 1WQ2A 1EH7A 3KEQA 2O6GE 1IUYA 1LEBA 1G3YA 1O57A 3WE3A 3K9TA 2M5WA 2IP2A 1QO0D 1REPC 1BC8C 1T38A 3IWZA 2V9VA 2NNNA 5L3FA 2P6TA 2WV0A 2GXGA 1TTYA 4LLLA 3RPQA 3FWEA 4U7DA 2EFQA 4LFUA 1SMTA 4HV5A 2VE9A 3MZHA 3KE2A 2XKPA 3VOEA 4PGHA 3H3ZA 3WU0A 4P96A 2L54A 1KU3A 4ENJA 3T8TA 4R8HA 3H3UA 2VODA 1DPRA 3EYIA 3JTHA 2JPBA 2G7UA 2DU9A 5HDNA 4IPAA 2QBYA 3L9FA 2A61A 4Q48A 3FXQA 2L4AA 2OU2A 4L9TA 1FBSA 4AVPA 3CLOA 3N97A 4MQVA 1HKSA 5BQTA 2FEZA 3IKVA 3R61A 1FSHA 5K5RA 1WSUA 5IT9Z 3LQQA 2R3SA 4WXHA 1DDNA 1SD5A 4MTDA 3T5XA 2VE8A 1FYKA 1XSVA 4I2OA 4BQAA 3W7SA 3U9GA 1ZLJA 1PUEE 2YSRA 4HF1A 3FF5A 4LB5A 5CVIA 1K6OA 1W4MA 4XSXF 4GYGA 2JT1A 3TO9A 2ZNZA 5D6FA 3K0LA 1J2XA 5LHIA 4EJVA 1FSEA 4I7HA 5ICEA 4KFCA 4PCQA 4Z2YA 3ML6A 5L3DA 3HTUA 5CJ9A 4LK0F 2P5KA 2QQBA 3LAJA 1P4AA 1LDJA 4M71A 2ZBKA 4EJTA 3W7UA 2V79A 1G3SA 4M6XA 3GZ5A 1OKRA 2OAZA 4EGZA 1K78B 2ETHA 1S7AA 5F64A 4TV7A 5AIPA 4AWXB 4EM2A 3RKWA 1ZN2A 5HOOA 3E3VA 2JPCA 2Z99A 3E6MA 4HX7A 5E1ZB 5KVRA 3NRVA 5LGNA 1RUNA 3V7RA 5CVVA 4IF4A 1S6LA 4AIJA 5J8CA 3BJOA 3E35A 1WWXA 5GW7A 4YFNF 3KZYA 2A07F 5A2QZ 2QWWA 2M87A 2Q0OA 5HS7A 2PMHA 2CGPA 1MGTA 3RTRA 2EFPA 3CUOA 3BWGA 5LRRA 3DPTA 2RQPA 1W7PD 1P92A 2O3FA 2J5OA 2FU4A 1IRGA 4CO8A 4UXNA 2CWEA 1U78A 4KIBA 3FXRA 3DQVC 5LHHA 1FNNA 4KIGA 4RS8A 2HTJA 3I71A 4HF2A 2P8TA 4G94A 1BI1A 1HW2A 3FHZA 3PQJA 2LNBA 2PQ8A 2EB7A 1OPCA 4KDPA 2QUFA 1F9NA 2DAOA 3F6OA 1CGPA 4MEYF 3D0SA 5CLSA 4B09A 2EFNA 2Y75A 3SZTA 3CO7C 3F8MA 3EYYA 3E5XA 3TDZC 3VB2A 2R7DA 3M1EA 1BI3A 3QPTA 2XHKA 1I1SA 2RGVA 3BJAA 1ODDA 3VEPA 1SAXA 4HX4A 4UHTA 3RIRA 2QYOA 2F5DA 2EV5A 2OD5A 2F5EA 2D1HA 1FPQA 3LFKA 4GCVA 4A6DA 2HYGD 4RGXA 3V7CA 2OQRA 3FMRA 3ULQB 2BV6A 3IRQA 2W85A 4IXAA 4IHTA 4MTEA 2H6BA 4Y15A 1GVJA 3KEOA 4OINF 1W5SA 4I01A 1F4KA 2QZ8A 1U3EM 1FBQA 1LDDA 4AIKA 3IKTA 1J7KA 2RDPA 2Y48A 1ONVA 5K1YA 1S29A 3HHGA 2EWNA 1RI7A 1BOAA 3IHUA 1H0MA 1KQ0A 3BP8A 4WF2A 3I58A 1OR7A 1FC3A 1ZARA 4KT5C 3MFKA 5CVUA 1S8NA 2GQQA 3HIFA 4M73A 1J0RA 4KA4A 4H0EA 4R79A 2DO7A 1R36A 3ECOA 4JBAA 2KJCA 2YPRA 3DFGA 5DYMA 5DV5A 4EVIA 1XCBA 3ABTA 4LK1F 4ZYGA 3I54A 3WGHA 4JQFA 2VC1A 1K7AA 1O7FA 3BZ6A 1TBXA 1DP7P 3BDDA 2PN6A 4YG2F 2COMA 3BY6A 1XD7A 3KFWX 2XUBA 1ULYA 2ELHA 3QRFF 2DFIA 3P7NA 3R0AA 4MHGA 3G3ZA 1MDMA 4PGGA 2CFXA 1QGPA 2MC3A 1IF1A 2A68F 1HXDA 1G3WA 3I59A 4BYYA 4O6JA 4ZZDA 1TW3A 4LG0B 4G7OF 3E6CC 4YFKF 4HQEA 3QP5A 3TO7A 2FBIA 1T2KA 3JAMK 1ZLKA 2W57A 2STTA 1IXRC 2L3DA 1D8KA 3ECHA 3QP6A 2ISZA 1SD4A 5FD6A 4OIPF 5D4RA 1IN5A 3DEUA 2CO5A 4LMYA 2EA4A 3U2RA 2CQKA 2K7LA 2MD5A 3GFMA 2FXAA 1TQPA 4CHUA 3O3KA 2LDUA 2FRHA 1XDUA 4JK1X 2BE5F 4M9ZA 2K4BA 1QZYA 2V1UA 3W7XA 3T1BA 2PG4A 3WODF 4M6YA 4WX9A 1TW2A 1Z6RA 2VBYA 2PMUA 3FX3A 3L2CA 5H20A 2IW5A 4RAZA 3RI4A 3FXUA 5LBQA 2ADUA 2G9WA 4CXFA 1W7PB 2V6CA 1FP1D 3F6VA 2QM3A 5K5OA 1LB2A 1QZZA 1T6SA 5ED4A 1KYWA 3WU1B 1HW5A 3REOA 2UXXA 3HOSA 2Z33A 2VBZA 3B73A 4KYWA 3KLOA 3DXJF 2OZUA 1WI9A 3IC7A 3EUHA 2V1XA 1Z05A 5IT3A 4OIOF 6PAXA 1AOYA 2HTSA 2XAGA 1Q1HA 4MQ9F 4G9YA 2HDCA 5LEJA 1BI2A 3JAMZ 4CZZA 3GZ6A 1NVPB 4ESJA 2O8XA 3DKWA 5HVQC 3EDPA 1GXPA 3EQLF 1HBXG 3O6BB 4RGSA 4HOBA 4ESFA 1B6AA 3E5UA 4BH9A 2FNAA 4WWCA 2ZMEA 4DQ2A 4A0ZA 3WE2A 4S05A 1T0FA 2ZFWA 2XAQA 3C7JA 4IVNA 3MWMA 4UVBA 2IJLA 2BYVE 1LJ9A 2EV6A 1R00A 4WXDA 3V8LA 2IT0A 1GXQA 2HFHA 1XCVA 3C3WA 5FFZA 3W6KB 2CW0F 3GFLA 1TLHB 1EH8A 2W25A 2O0YA 3MAJA 3ABUA 5E1XA 4ETSA 2H27A 4HF0A 1TQMA 2VBWA 4EGYA 1WKMA 1ZRCA 1ZG3A 5LLQA 5E8GA 5D5UB 2NNYA 3R0JA 2FQ3A 4XRFA 1IN8A 3JW4A 4DNCA 4UV9A 2G7HA 3GWZA 3HUGA 2K02A 3PQKA 4RB0A 3K1MA 4ZYDA 4A12A 1ZAOA 2MA3A 4ENMA 5JHUA 3ELKA 2FSWA 3HYIA 5E8IA 2YX4A 2A6HF 2LKPA 4A2UA 2ZJ2A 4P9FA 5D5XB 1LDKB 4L9JA 3NEUA 1MJAA 5BPIA 2HGCA 2MLGA 3RDIA 4U88A 1ZREA 3CJNA 1IN4A 4KIFA 4LLGF 4YFXF 4KICA 3F8CA 1U2WA 1FX7A 3HTSB 2GA2A 1U5TC 3CUQC 2XAJA 4EJUA 1FOKA 3GYHX 1ON2A 3IL2A 5DUIA 3HRUA 2RKHA 2MH2A 1JHHA 3WGGA 1Z1DA 2EV0A 2OA4A 2Y0MA 3LSTA 3N4MA 4MEXF 4RB1A 2HKOA 2VXZA 3QAHA 3WTWC 1PDNC 3I59B 4PZJA 2CSOA 5L3CA 2IVMA 3IWFA 3GX4X 2GA1A 1I1GA 4HQMA 1BC7C 5ILSA 3L09A 1YTYA 2PI0A 4HAMA 1JXSA 3ZPLA 5HLIA 3W7TA 4G6QA 4PDKA 1V3FA 4U7BA 1ZG5A 2M45A 2FA5A 4U0WA 2W24A 5HLHA 3TOAA 4KUMA 2ESNA 1L3LA 2RC4A 3M8FA 1GHCA 1P6RA 2DI3A 3WTZA 1R5HA 2PJPA 2M1BA 2P7VB 4RGRA 2P5LC 1XGOA 2K4JA 2K86A 3QOPA 3BROA 1YW7A 3ZQ7A 1R7JA 4LLNA 1IW7F 2FOKA 1Z9CA 2IA0A 1H9GA 4P9UA 1KQ8A 3GXOA 2L4MA 1UB9A 1G4DA 1Z7UA 1SFXA 4KMUX 2UZKA 2YU3A 1RIOH 3P9KA 1XSDA 4D0PA 4BHPA 4XLNF 3R4KA 1JGSA 3WGIA 3D3IA 4L0ZB 2IA1A 3FMSA 4UVAA 4ZYEA 2DQRA 3BJ6A 2FE3A 4G7ZF 1LVAA 4HV6A 3FM5A 2H09A 5FD5A 1ZGJA 3SZPA 1RZ4A 3ZMZA 2VOOA 4FX4A 3SFZA 2FBKA 2V1DA 1QPMA 4BNCA 4RGUA 3ZMUA 1LNWA 5TJJA 3GLXA 5JR3A 3W7WA 4A0YA 4L5JA
chains in the Genus database with same CATH superfamily
2GSMB 3OGIB 3JCUC 3CCSI 1K73W 4LGWA 4W97A 3PJRA 1H9TA 5H2FZ 3WG9A 4O4IB 5KK1A 1F4MA 1MNGA 1J9IA 3BLYA 1I5ZA 5DM7F 2LKSA 3ZMTA 1WA8A 2E75B 5D5PA 1BQZA 2Q2EA 3S93A 2EZKA 2HEPA 4X66O 1D2DA 4I09A 1HKTA 3RYFB 5B66C 2HDDA 3OYLA 4JI1O 5H5NA 5E3LA 1JGGA 1FYMA 2R7OA 1F23A 4KHPB 2DBBA 4M3EA 1K83J 1XMAA 2GOMA 4L9NA 5FL7G 1CQTA 2EK5A 2K5CA 5JVDA 3PFYA 3CCMI 5TRDA 1YI2I 2LFSA 1BM9A 1BBYA 4HDUA 1WJBA 1IV8A 2HZTA 2IAIA 1QQIA 2B1GA 4KP4A 1STZA 4JZGA 1JT0A 4N23A 2JTVA 1LEAA 4KL1A 3WG7B 4CS3A 2JDIG 2YXYA 4IHWA 3EFFK 1FKAO 2R7FA 3A03A 1IZ1A 3HHHA 3SJMA 2Q1ZB 1OFCX 1NHAA 2DA7A 4K35A 3OYDA 2VN2A 4A3EJ 1XILA 3ASOC 2HXIA 1MMAA 1F7YA 2JK3A 1XMQB 5IYDJ 2YSUB 1O7LA 3I4PA 2RV8A 4K2EA 4RAYA 5AIQA 3FB5C 4DV3O 3ZQLA 2DYRH 3RKXA 1HDDC 4JI7O 2CUEA 1TNSA 3NAUA 4IRHA 5J40A 4BY7J 3LDCA 1AB3A 1RSOA 2HXOA 3P9CA 1FXKB 1JR9A 2Q69A 3JRBA 4B7KA 3SYAA 1QLEB 4ZI7A 4HZFA 3T0YA 1N25A 1U6GA 4PUSA 1LFUP 3FFQA 3JAWB 1X3UA 4JI3B 2HYFA 1YQAA 3CUQB 4HBLA 4BEHB 1VF9A 4BHBA 1OV9A 2WLIB 2DMXA 1I27A 5EYPB 4JP0A 4O4JA 3M8JA 2OIGA 4RUEA 3G1LA 3ZHUA 1XGNA 3IV5A 1X1DA 1R3KC 1JKQC 3I55I 4ZHQB 5C4JJ 1AHDP 2KIFA 1O3QA 4I4TB 3QF7A 4NXMO 2P5VA 2UU9O 1JTYA 3AAFA 2QQ9A 3K69A 5IYBJ 3CCEI 3LSMA 5BPDA 3KLNA 3H1HH 2Y30A 3KYCB 4F7ZA 2VQEB 2JZYA 1QA6A 3E2EA 4DRXA 2A3SA 3CTAA 3S3OA 3GEZA 1UHWA 3I0TA 2HI3A 3D5RC 3CMEI 2EA2A 3KYDB 1TNTA 2LFBA 4PI2A 4M9XA 4PFPA 3U11A 5GAEJ 1V55B 1MNMC 2PEXA 4BUPA 1G4YB 1K7DA 2BSKA 4WFAV 3VSLA 4HW0A 3P3PA 1R23A 4X65O 3K0GA 2QQAA 3CDIA 1U5TA 2A6EF 2KDZA 2FUG2 4HX8A 3JSPA 2B9SA 1PD3A 4L5IA 2WLIA 3K0DA 4JI2B 3LWFA 3KIOA 1TT0A 4XDLA 4FLYA 3F8NA 2LW1A 3ABKH 4WFEA 5GONA 4LF8B 2IGNA 2WA4A 2UU9B 1KU9A 4ZHQA 1HDJA 3W6JB 1BI0A 1AI6A 2VKDA 2O9LA 4PK4A 2V6EA 4YIOA 1YG2A 4LF7O 2VKVA 5AONA 1OZ0A 1GV5A 3KKYA 2HNHA 4XDKA 1SF9A 4PJ0Z 3HGGA 4A3BJ 2B5UA 1P4XA 2IJKA 4LH6A 2GLOA 4MTXA 2HKXA 4LP8A 5E18F 3BA8A 1I94O 3LSJA 1OYYA 3BQYA 4MNUA 5F1RA 1N78A 1PYVA 5CBHA 4WCEV 2LTPA 1JKOC 4QLCU 1O9HA 2JJ1G 3M99B 4UCTA 4FLZA 1TUEB 1I6HJ 3K04A 3ZHQA 3TKYA 2B9ZA 4HNVA 4IHJA 3WB1A 3OSGA 1EV7A 4GKKB 1P4WA 5B5EC 1VQLV 4CCMA 5TGTA 4ITVA 4ASNA 3LSPA 2PI5A 1SMYF 2FNPA 3CD6I 4GYIA 1XMQO 1D5VA 2E5ZA 3HRTA 1IBLO 1WJFA 2BW3A 5EEHA 3GMEA 1TQIA 2F6CA 2X6OA 3GFIA 1N4CA 1P7JA 3CC7V 4LF7B 2DWDC 2VQLA 3VYSB 5FJ8J 3S32A 2CTRA 3FB6C 2M8EA 5TISC 1JPXA 2UWMA 3E8HA 3BRCA 2PFBA 3APQA 2EIMH 3BPZA 3M8AA 2CV1A 5HFLA 4DW1A 1FLIA 3PNTA 1NR1A 3QPHA 1TWAJ 2AQFA 2FQ4A 2L9NA 3EUHC 1Q3EA 4WF9V 2Y69C 2FMYA 2ZD9A 2X48A 4A3IJ 4BAYA 4EJWA 4BDYA 4D7NA 3BR5A 2P06A 4AIHA 2HVRA 4DK0A 4ENKA 3IP4B 3RVZA 1KUQA 2HVJC 4CH6A 4JV5O 4MTGA 1S9HA 4P5OA 1S0VA 5GTHC 3RWRD 3FAVA 5J6XA 3OM3B 4M3DA 4JZ2A 3VYUB 3NWSA 3PM1A 2AS5F 2AHZA 2EZOA 1JUSA 1H8EG 4OAYA 3O65A 4BWAA 5J4YA 1I50J 1FSHA 2FOWA 2DQLA 2VC0A 3BZKA 2R5YA 1Q7YW 4FLVA 2H94A 4GX2A 4BW5A 5E1WA 1K79A 2LBFB 3RN4A 4X1IB 4N0BA 1EZJA 3ASNH 1ETYA 4A3FJ 2DPUA 2KMUA 3CZ6A 5M3MJ 3U1DA 4NC8A 5C3EJ 2K9SA 3UKGA 2J5PA 3PUFA 5DD4A 1HNZO 4KXRA 2WLMA 3RZOJ 4PV1B 2PLYA 3WHBA 2CTWA 3OTOB 1HR0O 4UUSB 1A31A 2F5FA 4GXOA 2JRMA 5F6FA 2F48A 1UG2A 2X6AA 4K8XA 1MBHA 2AHQA 5CYVA 1D1AA 3V8JA 3HPGA 5GP9A 3JCZA 2HQRA 1WJAA 1X19A 3ZMVA 2B1IA 3DP7A 3OMNB 1M57B 3HOZJ 1EJ9A 2ZE8A 4DR3B 4ICGA 2VIXA 1P7BA 3OMIB 3F21A 4OIRF 1X4TA 5B3SC 3H3VK 1AP6A 2DQ3A 3RFRA 2XPUA 3SFIA 3E5QA 2E1NA 4I0AA 4IT5A 1CEZA 4B3SO 4TSFG 4IHXA 1PNLA 5FPOA 1HF0A 2WSSG 5D8LB 3G2BA 2YR2A 3OV8A 3CESA 4PA4A 2KRCA 2D45A 1WH7A 4LF5O 1K4DC 4MSWC 1OLTA 1L0OC 3LQRA 1X2MA 3DEEA 2F66C 2RJZA 2QA4I 5KLVH 1XGSA 3P9IA 2ZXHA 4Y7NJ 3WTUC 3G1MA 4JI4B 3CXCU 4Y4RA 2CGNA 3ROUA 1YFHA 2JN6A 1WZ2A 3WG7C 1J5YA 4JI8B 2MLKA 1RM1B 1W5TA 2ZKZA 1VTNC 2YXHA 1QLNA 4JF3A 5FLXZ 3H5AA 1MJBA 2OPTA 1D1BA 2BBYA 5F04A 5KAIZ 4DR6B 2ADQB 2NS7A 3IH4A 4AD9A 3DC6A 1RUOA 4YJ2B 1MDMB 3D36C 4FZ0A 4E70A 1O3TA 5EBMC 4DV5O 4CCOA 2QVOA 1FBUA 3Q5FA 4ZYAA 1TVKA 3ZP5A 4D7SA 4CCKA 1YJ9I 5JI6A 3HDDA 3ABMC 5J2TB 4QPJA 2Q73A 4I6ZA 2GIVA 3CDHA 4PDVA 3PSIA 4NTYA 4L9VA 2VQFO 4ZDOA 2F5CA 5FGMA 1X58A 4UCRA 3J80Z 1O3RA 1GT0C 4DV7B 1G3TA 5ICGA 4YIPA 5LOVA 3C2GA 2I10A 3BG3A 1MMGA 3E6DA 3TGNA 4ZH4F 1AU7A 2ZE6A 2L02A 3A0HC 5LRSA 4GX0A 1ZRDA 2JVGA 2K9MA 2DA4A 4BY1J 3SYCA 2VL8A 4B3TO 4EEFG 1BA5A 4O2AA 4E7HA 2RCVA 3R60A 4X64O 3DF8A 4JGSA 4U0YA 3PO2J 3IC9A 5DEQA 1XGMA 2X6CA 3AG1B 4XR6A 3EVKA 1N77A 1D8JA 4PA6A 1HKQA 2L7ZA 1G6NA 3NWTA 3G71I 5KMGB 3UKMA 3Q0UA 2Z5UA 4HBNA 1OCOC 1Q6UA 1JJ2U 1PUFA 4U7OA 1XREA 2MC4A 1OYIA 5JJJB 1MMNA 4IRIA 1VF5B 3AG3C 1O4XA 4UUVA 2VT3A 3A0BC 3HOUJ 4A0XA 1KU7A 1MZBA 1U8RA 5CB4B 1XN7A 3K4KA 2JIZG 3D36A 1VQ5I 2XRNA 1X59A 3JCUZ 4PDRA 4FCYA 3GWKC 5D5WB 4UNOA 4QWQA 3HSEA 1MH4A 3FX7A 5ILVA 3F9KA 4UB6Z 2W84A 4K0KB 2L2OA 2EFOA 1ZLZA 2C2AA 1LR1A 2YIAA 1Y0NA 2GDSA 2RN7A 3AFHA 1V5GA 3MMYB 4WCGA 1YTFD 2QR4A 4O2AB 1FIPA 3HB9A 1S72I 4XQFA 3COAC 3RSNA 2PMZN 5K1XA 3K2ZA 3ABLH 3I64A 1NI8A 3DU5A 4ABZA 3RJPA 2H6CA 2P90A 4I55A 1CF7A 3CMMA 2V7FA 3HM5A 2C6YA 1YCIA 5JLWA 2HR3A 2DXIA 2ESHA 1B1BA 1S7OA 1UJ8A 3THOA 3DU6A 3OYGA 3LA2A 3OIQA 5IT9N 4G28B 4CDGA 1VQLI 1G8XA 1T39A 3JASA 3O2PE 3A4CA 4DYQA 4EFEA 3RKQA 2EZHA 3HOYJ 5JLXA 3PFIA 1B06A 3RGBA 3PNVA 1FZPB 2CRGA 2JSPA 4RB2C 1IN6A 3GTQJ 3BR2A 2OYQA 1LFBA 1HSTA 4FX0A 1VP7A 2KKOA 4J01A 2R7UA 1XMXA 3BG5A 4FQGA 1HW7A 4OPHA 3VPRA 1SRYA 2JSCA 4I9WA 4JAAA 2O61A 2HQAA 4L87A 4OOIA 4NHJA 1P2FA 1KP2A 4FE4A 3S1QJ 4ANJA 4O2BB 2HU9A 3FYEB 4X65B 1GLNA 1X4PA 5GAGJ 1WB7A 1Y76B 4L8JA 5IJ9B 3ZRGA 4CH4A 3HR0A 5EZHA 5E3NA 3B09A 3TGUH 1YIJV 2LK2A 3OL3A 4TT3G 4XLCA 3BHPA 3STLC 2DLLA 1CF7B 1MKMA 1R22A 3CCYA 1C0WA 4CH3A 2OTLV 3KP5A 1YHQI 1TWCJ 2B0LA 2IS4A 1Z7LA 1T98A 3EETA 4YELA 1G8MA 2FMLA 1AI7A 3PUBA 1EH6A 1NBMG 2L01A 3JASB 3E0JB 2XASA 1NT2B 1XMKA 3DBHB 5E17F 2LY9A 1Y74B 3AG3B 1FP2A 1S3JA 2E2JJ 2FF4A 3SJAC 3TP0A 3SPIA 4YIRX 2GV9A 2Y69B 2HVQA 5LA6B 4JTAB 1EKEA 4UUTA 2MBFA 5FROA 2DPDA 2AW9A 1V4RA 1D3YA 4BEHA 2XF5A 4DUZB 2Q7EA 1XDSA 2E35A 2NS0A 1BN5A 1H2NA 1SA0B 2CTQA 4YXWG 5CN0A 4GRIA 3OEHG 4O4JB 3BPXA 4FLWA 1GKFA 1J75A 1RPRA 2LGQA 3DBLB 1S5HC 4JI5B 3E22B 2ZB9A 1XBLA 1WP7A 1ZHFA 2WAMA 1YOVB 4XDJA 4NNJA 2DTRA 3J7AY 3D8CA 2V7QG 1RM1C 2OZ6A 1YS7A 2JA2A 3J7AO 3A01A 3HKBB 1BJAA 1IUFA 1A04A 4O4HA 4LF8O 4A93J 2ZM6B 2EILB 3HBLA 4A5NA 5EEAA 4JI1B 4DRXB 4X62O 3HOTA 5HFMA 2V9KA 1E17A 3F8BA 2CAZC 2P4VA 3H9VA 3ESWB 5KAFZ 2ZDIC 1NH2D 1X3ZB 3GF2A 3U21A 5CBFA 1WP8A 2MABA 2N04A 3FXOA 3IH3A 5JVTA 3K9AA 3JTGA 3TEDA 5IJ0B 3EUKL 2BSKB 3HRSA 3J81K 1VQ8I 1MW7A 5GPCA 1NK2P 1XB4A 3SXYA 5D6EA 1WN7A 5LA6A 2HPMA 4LD5A 2YX7A 5LL6Y 2F4VB 4DV6B 3OR2C 5DDGA 3J7YJ 5FLXN 1QCEA 5H6RA 3WTTC 1ZRFA 3JRAA 1PP9H 1WRJA 4GX5A 1V55C 1X1BA 2D2CB 4XLEA 2HJFC 2ZR3A 1N8RW 3BVOA 3QO8A 5L3EA 5GONB 3ZMDA 3WU2Z 4LF4O 3GVAA 1E2XA 4HLXA 1EBOA 2QKCA 3HOXJ 4EJOA 2WLLA 3MQ0A 3ISPA 5HS9A 1YO5C 1RNLA 2HEOA 4JYCA 5JQGB 2P6SA 4HSRA 4J11A 2ZXWH 3E1SA 4EM0B 1LQ1A 2UUCB 1IRXA 2LSOA 4G12A 1MJ9A 1WJEA 2ZE7A 5IOZA 1YE9A 4CICA 1GN3A 3L9DA 1ZX3A 2XPVA 3SDLA 2VPRA 4S0HB 1T5EA 4FT8A 1UFMA 2BVLA 4BHCA 3H0DA 1E1QG 2ITCC 4C3IJ 3ABKC 1AJQA 3FK6A 3OR7C 3K2AA 3GCMA 4NQWB 3F7YC 3VYTB 4M74A 2F4VO 2NS8A 4DW6A 1IXCA 3E89A 1MNEA 3TQNA 4AYBA 1LE8B 1B59A 3D5SC 3JRIA 3MN2A 5C44J 4I0XB 1AI5A 4PA7A 3JD1A 2EFWA 2Y0SN 3DCFA 2OBPA 1GTOA 2XSJC 4IJAA 4E4EA 5KHKA 2ZC2A 2KIMA 4D5CA 1R1VA 4OMZA 4PJNA 1VQ4I 1HQCA 3CF2A 3DLLF 5BXZA 3WTSC 1WA8B 3G1OA 3B4SA 4I02A 4BACA 4MS2A 4DR6O 2BEOA 1Z0XA 4YHHB 5HS8A 4I98B 2CDYA 4UV8A 2Z2SB 4G6DA 3QOEA 4CC5A 4Q5SF 3ERED 3E8GA 3BR1A 5KHIA 3H5RA 1IXSB 1NG6A 3UNGC 2R7RA 1M5IA 2UUAO 4MVOA 4KFMA 4A6EA 1SKVA 1H8AC 4IYHA 1YIOA 3OUFA 1Q82W 3SEZA 3IFXA 3S2WA 4G8XA 2DK5A 2NNUA 3MCZA 1TUBA 4J7KA 4MTOA 2XT9A 3LA3A 3W6VA 2NVQJ 2R5YB 4NQWA 5IP7J 1SQXH 3L2UA 1NQTA 3BAAA 3A0BZ 1WH5A 3BPVA 2KJBA 3X2QH 4MO7A 3A2KA 3HOWJ 4C2TA 3G4SV 4C2MJ 3CMAV 1FTTA 3HSRA 4X1IA 4RUFA 1QNTA 1OCOH 1WVRA 2KT0A 1AKHB 4HDVA 2HLDG 5KX5B 4WFBV 4X62B 2Q8KA 3O8GA 2Q0OC 2O5RA 3PN1A 1YYVA 2E5NA 2QWQB 5FB2A 1XHXA 1S76D 4LIUA 2LP7A 3L1PA 2XGEA 4BR6A 5CA3A 4PA9A 1SQPH 2ZO4A 4MT8A 3K59A 4NXNO 2DDBA 1FY7A 3BG9A 4IQJA 1FFTB 4DR4B 3CUQA 1IDYA 2ZCEA 3MDSA 4R7CA 4NB5A 1MG1A 4ZTFA 1WHUA 2BOBC 2JRIA 4JYYA 2QA4V 2DOAA 4F91B 4G6TB 5L3BA 3S3WA 5F2VO 2X1CA 2D2WA 4DZJA 5J3LA 3S2DJ 4CA0A 1FFXA 4IYIA 2M4KA 5LGTA 3P32A 2XIGA 3KETA 4RAIA 2RAEA 1QRYA 3FIWA 2JA8J 4C3JJ 1QPIA 3LAPA 5DCFA 1WCMJ 1FYLA 2JS5A 4EFBA 4OIQF 1Z91A 2CUJA 1UAAA 2F4OB 3K5NA 2HWVA 5KCMA 3V4GA 4BQOA 1IN7A 1JMKC 3L2VA 4UVCA 2VJJA 2IU0A 3KP4A 3RYHB 3H9QA 3OMAB 2VI6A 5F0CA 1W0TA 1VQ6V 2KIUA 1X1PA 2OTLI 1D5AA 4XSZF 2XAFA 3J81Z 2XROA 3PJSK 2ZNIA 3A2FA 1TWGJ 4RO2A 3RPUA 3GVMA 1B9NA 1R1TA 2CU7A 2HS5A 2Z9OA 2QDOA 4I0BA 5CVJA 2O7OA 3CC2I 4ZZLA 1FOXA 3N2KA 4Y13A 1OMIA 1IV6A 1NKDA 1ON1A 3E6BA 1YS6A 3OOUA 3Q9SA 4EQQA 2EH3A 2P0WA 3JRDA 4RB3C 1KYZA 3C1DA 5EEGA 3K06A 4DJAA 1NU1H 2NAZA 5BMZA 2VOPA 2O57A 5EZYA 1Z6TA 5ERIA 1MBKA 1OCCC 2EJRA 1U8BA 2KRFA 1USTA 4YJ2A 3F22A 3KCCA 5JFRA 3I5UA 4O3MA 2PY5A 3MKYB 2Q9LA 4GYCB 5GTHZ 4BIOA 1SC7A 1TVKB 1VQOV 3L73H 1GM8A 1N0NA 1M57C 1FMWA 1BJZA 3W2VA 3JALA 2WA3A 3HJEA 4DR1B 1R6NA 1HSJA 1HW1A 2M4GA 4HA8A 4XMYA 5B3SH 4L0YB 1GUUA 4DYLA 3ZRXA 4JI5O 3U1KA 1JUMA 5J8FA 3N2GB 3VODA 2GOXB 2H1LA 5FO5A 3TETA 3SPHA 2Q7HA 4LBEC 1BIAA 4U0VA 5FKKA 5B1NA 3GUDA 2FBHA 2H3OA 5B1AB 4F4LA 5KHDA 5KAFC 4ZYHA 1XQ8A 4FIPC 1AJPA 4IHJB 4TQDA 1XI1A 3BEHA 1YF2A 3N27A 3G73A 2QTSA 5IT9K 2A69F 2ZJPF 1KD1W 3DV8A 3ZRWA 2E74B 3QPLA 1IZ3A 3J80K 4KN4X 3IRRA 4CUGA 2IS2A 1SZTA 2IS6A 3BCCH 3E8BA 3RYPA 1MMSA 1I3AA 1MOFA 2A5YB 3HL2A 4GCZA 1B4AA 2L7MP 3OOPA 1FT9A 4H0LB 2BXZA 2UV1A 4DV0B 1N33O 4JX6A 2P81A 3H92A 5F08A 5DECA 4MVRA 3RW0A 4IL6C 4XORA 3F3XA 4FK5C 4LH7A 4X89A 4RA2A 3AG4C 3TOBA 2JVHA 2YUSA 2ZDIA 4GKJO 1UCRA 5ICCA 3QYEA 3HRMA 3KP6A 1O9GA 3SQNA 3GW2A 2JS3A 1U96A 1RFYA 2IRFG 2ECBA 1EN6A 1XUQA 4P9PA 4DV4B 2WTEA 2GUZA 4XBFA 5CA1B 1K9MW 2WWYA 2UXBO 2VRZA 2AO9A 2RVCA 2MH9A 2PJRB 2STWA 2R0QC 5DUKA 3PL8A 3M4OJ 1JE8A 1DP3A 1IDZA 1BMFG 3ETQA 3OT7A 3ZJZA 3IUOA 4LJZF 2GTSA 2BHZA 5EZGA 3OAAG 2DFEA 5DCMA 3QU6A 2K9NA 3ABMB 4CBCA 1DF5A 3KZZA 4LG0A 3DPUA 1PP8F 2LREA 3GB7C 2DW4A 4DV5B 3DTKA 3TDUC 1YTFB 2WC2A 2ZCWA 4H4KC 2LBFA 4YY3B 2CG4A 1JJ8C 3L72H 3GFJA 3F23A 4WFFA 1DU6A 5FPRA 1I0HA 4LOCA 2K9QA 1RKTA 3L00A 4II3A 3FBIB 2CQ7A 3CCQI 2OTJI 2PX9A 3FMQA 1AR5A 2NYXA 4PJLA 3I5DA 4B47A 4X1YB 5GTIZ 3BA9A 3L7WA 5IYBO 4O5VA 1QBJA 2XAHA 3T4ZA 1FIAA 3ASNB 2ZM6O 4Y17A 1MIJA 3LSGA 4ZDPA 4KISA 2Q68A 3WTVC 1FS0G 2F2EA 5LMNO 3B02A 4H44B 1K4SA 2XVCA 1K5SA 2ELJA 1E79G 3AKZA 4JYKA 3IJ4A 1ORKA 3K1PA 5LGUA 4U3JA 3K7AJ 2QBYB 3I53A 3RVYA 2LJ2A 2G0EA 3GTLJ 3CRQA 4JI0B 1ETKA 1RETA 3ABMH 4CYDA 4WK8F 2IH3C 2JGUA 4EM1A 3HKDB 3V7SA 5FLXK 3D3QA 5B1OA 1N36B 1XNQO 2E7XA 1AJNA 1QR9A 4J10A 5DD8A 5DCMB 3VFZA 2X4HA 2P7CB 4QGPA 3DLAA 2E3CA 4NR1A 3G4SI 3LNMB 4M3FA 5IOYA 2E76B 1LVKA 1A6IA 2KKWA 2ZQMA 3TO6A 1JX9A 4GGGA 3V8KA 1K3EA 1GN6A 1YW9A 1MZFA 3OWTA 3ML0A 3G67A 3M8EA 4BXFA 2Y0IA 2OCCH 1YHQV 1Y0UA 1H89C 1XTAA 3K4NA 1Z5VA 5D4SA 4LF5B 3L74H 5IJ9A 3CMAI 4OXSA 2ZNYA 2VT2A 1SFEA 3QQAA 3K1NA 2O03A 3CRRA 4IGGA 4R1HA 4KN7X 1VZ0A 3ZMSA 1I6XA 3F8FA 3L2QA 3SHFA 4RM2A 4BXUA 4TUYA 1UHMA 1R49A 4KHPO 3CJTB 2M7WA 1GN4A 4NKGB 5CVRA 3ZN1A 4DZPA 1ZWIC 3L71H 3MEXA 2GZWA 1NS1A 3HKDA 3CCJV 5E20A 2DFHA 3SJQC 1QZEA 2E7WA 4UB8C 2K27A 2JA7J 2VBXA 2OQGA 4D7MA 1Z77A 3VWBA 2CH7B 3BOQA 2KHMA 3CCEV 3KP3A 4KMFA 2EILC 2QLZA 4E7LA 2ZMEC 2Y0PA 1YITV 1PP7U 3KP7A 3C18A 3U0ZA 2EIKH 5EC2C 1K6YA 4EV0A 4RQEA 4E7JA 1D0YA 1DLBA 4HYEA 4ENNA 3CYOA 5JHFA 2GAUA 2V9PA 3WTXC 2NRAC 1ZH5A 2KG7A 3CCMV 1HNWB 4OU0A 1W7PA 2M2EA 3LUTB 4PDLA 4M3BA 3BTCA 5K7FA 4BXXJ 2Y9ZA 2QENA 5K5QA 3FM3A 1Q81W 2DWEC 1FWZA 2HOAA 2KPMA 2CQNA 4LITA 4Q47A 2WBMA 5E3MA 5BOXA 5B1BH 1USSA 1QU7A 1WJZA 2LY1A 1DUXC 3K4JA 1LNQA 3CRMA 1FYJA 9ANTA 1MBFA 4N4NB 1KGSA 1SVLA 4XLFA 4LR3A 4A5MA 3W2WA 1IRFA 4AI8A 5ILUA 4Q4ZF 2DT5A 4EB6A 5JH7B 1TT5B 3FXMA 4KT6A 4IHSA 1WNSA 5IJ0A 5H6QA 3G6EV 4CGZA 2CK3G 2KZGA 3OYMA 1NZ6A 4ZIBA 1MH3A 3ASOH 2WLKA 2ACJA 3K5OA 4FTHA 4N9HA 2CYYA 5FLMJ 2FKXA 1T8IA 4X8AA 1BIBA 1AI4A 1SD7A 4JV5B 3JSOA 1APLC 1BOBA 5L3GA 1LKXA 2BVMA 1ZGAA 3NARA 2PBIA 4S04A 3V42A 2HQNA 2JRTA 2EIKB 1YW8A 2CUZA 2WLLB 1F5TA 2ISYA 2R9RB 1IBLB 1WI3A 2XKOA 4N21A 1K78A 1VI0A 4W4LA 4MGRA 2IPQX 2DMPA 4PA3A 1ENHA 2NVXJ 1R1UA 2QM8A 1ETOA 1NTCA 4V2GA 2BTQA 3FZVA 4LB6B 4X20A 2XF7A 2L9RA 4OWRB 5LHGA 1R58A 1DPUA 1XNQB 1OCRB 4WBNA 3ZRSA 1P7IA 3DTEA 4A3GJ 3HSFA 1XSXA 4I76A 4DGWB 1EM1A 1XC5A 5LEKA 2FX0A 5JVDB 4JI0O 4OMYA 4LFBB 5D5VB 3HEFA 1GVDA 3R6SA 3CS5A 3K79A 3P3NA 4N9IA 4D6TH 4D9JA 3M07A 5H2FC 5EF6A 2BHYA 3M7GA 2GXBA 4B8XA 1A35A 2DE0X 3NQOA 3LSUA 1KU2A 1UJWB 5FFXA 2X0LA 1IC8A 4Y52J 1JQ0A 2KQRA 5B1AC 1KQ9A 1MBJA 2L7FP 2M30A 5A2QK 3WTYC 1XG1A 4GO1A 2ZXJA 2DK8A 2XPWA 5B1AH 4F92B 3OGCC 3ZIAG 4DV7O 4FLUA 3CO6C 3F72A 1P84F 4X0GA 3ETGA 3JD3A 2XGXA 2QKAA 2TDXA 4MLOA 3CCUV 4O4LB 1NH2B 5H9CA 4IRGA 3ZN0A 1O3SA 2JA6J 2ZMEB 2VONA 1FMVA 2BY0A 3TW6A 1FD9A 1QVFU 4XLPF 1W36C 3LA7A 4GKJB 4TV9A 4ZI7B 5KNLA 3JAWA 2Z3YA 4P55A 2LF7A 5F1JA 3KG2A 1MD0A 3S1MJ 3JD4A 3NR7A 4B08A 2DYRC 1F1ZA 5KA5A 3RYRA 2RMKB 3LSQA 3MZYA 3KP2A 3W2AA 4LFBO 1OYWA 3E83A 3Q3SA 4O2BA 4G27B 4YJ3A 1ZYRF 4HLYA 5HDGA 2B63J 4YIIA 4YIFA 2IA2A 3PNYA 2ZSHB 4FE7A 2D1VA 1TUBB 2AQEA 3K9SA 2QJ1A 5BY1A 5GADJ 4E4HA 3RKYA 5BS6A 3I4MJ 3L70H 1US6A 1Y8RB 2FYUH 3B8NA 2P4WA 4IL6Z 3K70D 4HNAA 2EIJH 2P7TC 2DT6A 3J81N 1K5QA 1R5GA 2OV7A 3TXSA 4HNTA 4I99C 3PO3J 4QPKA 5KX5A 5HLGA 1K34A 1SFUA 1KBHA 3TL4X 1YX3A 3CLQA 1KA8A 4FHTA 2GWRA 2KDOA 2ME0A 3RCOA 1SD6A 2IH1C 1MMMA 1OCPA 4RMNA 4UFZA 3HKCA 3MKZA 3E86A 2ADPA 4L5EA 3WFVA 1A6QA 1VNDA 2A0LA 1M1KW 2QSGX 1U5TB 4BIZA 4G7HF 1VIBA 5B1BC 1T56A 1HLVA 2HHHB 3JARB 1GRJA 1AILA 4PDMA 2WAEA 5IYCJ 2ITDC 3O9OA 1XX5A 3D5LA 1FAFA 3FXKA 5DM6F 1MBGA 1OCTC 2UXBB 1FJLA 2X6BA 1VMGA 3Q9VA 4ON0A 2RNJA 2QKLB 4L18B 2ZIMA 1D5NA 3OFNG 1JHFA 1OHHG 2BGCA 4ESBA 4X1KA 5DN6G 5HDKA 1VARA 4M9SA 1Q8IA 3K70C 3I9V2 3H1KH 3C2HA 3WB2A 3FHNA 4JI7B 2KFDA 2KQXA 3LSSA 3CJQB 5KHGA 1SQGA 2HOEA 2X6YA 5KHHA 5HLTA 4X64B 3M9AA 3T1YB 1B72B 2NVYJ 3JRGA 2E1CA 2DOSA 2KRHA 1V5EA 4AVZA 3F0CA 1ZG1A 2GM4A 1OR7C 4DIQA 3N2KB 3OTOO 2WADA 1N34O 1HR0B 4HNUA 2UXCB 4ZDLA 4A3LJ 2R7SA 3QU3A 1J59A 1ENVA 4DUYO 4WXCA 3ZQHA 1B9MA 2WV1A 2CJJA 3T8RA 2LF8A 1YLFA 2JWTA 1IAWA 3DPLC 2CQXA 1AWCA 2X7RB 3VQWA 1WAZA 1HC8A 1YJ9V 2O8KA 5F27A 2AXLA 2DTZA 2XV4S 3X2QB 5D8KB 3GO5A 4LWSA 2OJED 5ICFA 1R4MB 2QWRB 2K3FA 5GTIC 2GHYA 3G71V 1SAUA 2F4IA 3CC7I 1AVMA 1OCZB 1Y6XA 2XNDG 1YJWV 3OYKA 5DTDA 3E97A 2UXNA 3SDGA 4KNYA 4XNFA 4EMSA 2WWWA 4M72A 3N2GA 3LSIA 2ATKC 2EBIA 2UXDO 1WQ2A 3B6AA 3FAVB 3HGYA 2QGNA 4RWUA 4LF4B 1EH7A 1PL4A 4DV0O 1YXBA 3EXAA 3KEQA 1BQ0A 1MSFC 2O6GE 1FTZA 3CEIA 1SESA 4PJ0C 3M1CA 2BOCC 3S3XA 1NG7A 1IUYA 3Q0WA 1LEBA 5D5QA 1G3YA 1O57A 3WE3A 1B8IB 5EC1C 3K9TA 5J4VA 2M5WA 2CGOA 2JMWA 4J00A 3CRCA 2A05A 2UUBB 4JX4A 2IP2A 2X1DA 2LY2A 3ZXSA 4E7ZA 3APOA 3KCYA 1QO0D 1REPC 1H2SB 1BC8C 2L6LA 1T38A 3IWZA 1Y67A 5EDNA 2QWOB 2YS9A 2V9VA 4DR7B 1H2KA 3ZHTA 2W4SA 3PIPF 2FD5A 2ODMA 2M0MA 4JX5A 1SQQH 2NNNA 3HG9A 5L3FA 2P6TA 1VQ9I 2EPFA 2WV0A 4U3JB 1PM9A 2GXGA 1TTYA 4LLLA 3RPQA 2BCCH 2E5LB 1N33B 1QQCA 3FWEA 2Q8VA 3LL7A 2EFQA 4U7DA 4UUSA 1VQMI 4LFUA 1TC3C 1SMTA 4HV5A 1Y39A 4MFEA 3ONQA 3ZQGA 2VE9A 3CF5F 3MZHA 1DQUA 3CCUI 3G6BA 3BZCA 3KE2A 3C3TA 1YZBA 4MW3A 4XK4A 2XKPA 1D5YA 3VOEA 2YXLA 3DXRB 4DR4O 3OYAA 2VWKA 5C93A 2ILMA 4HZ3A 4PGHA 3A1YA 3DEWA 3H3ZA 4P96A 2L54A 3WU0A 3S3NA 2R5ZB 2ZXWB 4ABMA 2R9IA 5IWAO 5LMNB 1S77D 2W6IG 1EZVH 3GTJJ 4NTWA 1KU3A 4NC7A 4CCJA 4C9YA 4J19A 4ENJA 4IHYA 3T8TA 4F52A 4AM3A 1WJ5A 2LQTA 1AKHA 4R8HA 2DA5A 5LMUB 2DOEA 5GPAA 4GT1A 2DJIA 2NVTJ 5IYDO 1TAEA 3H3UA 4ZJZA 2JUGA 2VODA 2Y31A 4YY3O 2VQEO 4PSWA 2H8WA 3ZQIA 1DPRA 3EYIA 5B3SB 3JTHA 3A0RA 4P2ZA 4F6RA 2JPBA 2G7UA 4NC6A 1WLEA 2YDEA 3MAQA 3OR6C 4BBRJ 3OS2A 2DU9A 5HDNA 3JREA 3LSKA 4IPAA 1LPQA 2QBYA 3L75H 1V54C 3TP3A 1A36A 3FD9A 2QWPB 2R70A 1T08B 4B3XA 1BS3A 2WPDG 3MKLA 2F95B 1BHAA 2EILH 3ZHRA 2EQRA 2R7ZJ 1FEXA 3L9FA 3DXRA 1R73A 2A61A 3OTFA 4Q48A 1SFOJ 4DUYB 2PUSA 1HNXO 5LP6A 3FXQA 2HOSA 1MNDA 1I5XA 3SEQA 2R92J 4LF9B 2L4AA 3K4BA 3H5NA 1M1EB 3RYHA 1SFKA 4NYKA 2OU2A 2R93J 4DV3B 3S8PA 4L9TA 3VDXA 1IX9A 1FBSA 1ZSPA 3MD0A 3UCSC 3FDYA 4AVPA 1AROP 4NVPA 3CLOA 2BZTA 3S1RJ 3N97A 4MQVA 1Z3YA 1DGSA 1HKSA 2VQHA 1W1WE 2BOLA 2FEZA 3IKVA 3R61A 5BQTA 5K5RA 1WSUA 3LQQA 5IT9Z 2R3SA 1SETA 4CC6A 4WXHA 4BGDA 1DDNA 1SD5A 4V19K 1R6TA 5LFAA 4MTDA 3T5XA 1ERDA 2OCCC 1I94B 2VE8A 1FYKA 3H1IH 4JI6O 4IX7A 1XSVA 4QSHA 1NTZH 1ACIA 2P22C 3HKEB 4DR5B 4FLXA 1IBKB 2PYLA 5KMGA 4I2OA 4BQAA 3W7SA 1UZCA 2YIDA 3U9GA 1IXBA 4MTFA 1SANA 1ZLJA 3DKXA 4C30A 1PUEE 2YSRA 5CKTA 3CRAA 2GXAA 4HF1A 4R8CA 1SVOA 1H2LA 2K9PA 2FB5A 3FF5A 4LB5A 5IDJA 3HZJA 1DF4A 5CVIA 1K6OA 2HQ5A 2CV2A 3BC8A 4XLAA 1W4MA 4A3KJ 1UELB 2GBOA 1VQ5V 2QSFX 4XSXF 3BFRA 4GYGA 3MKWB 2JT1A 1RP3B 2PMZA 3TO9A 3CP1A 4OPAA 3MHSC 4LG3A 4H37A 2ZNZA 5D6FA 1QR8A 3OYNA 3K0LA 2QEXV 1CPYA 1J2XA 5LHIA 2A3QA 3JRCA 2VPLA 4EJVA 2Y9YA 2QQ8A 1FSEA 3VOUA 1H2MA 4I7HA 2EJ7A 1BL0A 3UR3C 4BS9A 3ABLB 4DR2O 3I56V 1TWHJ 1K97A 5ICEA 4RLQA 3HOVJ 1NTKH 3T4DA 4KFCA 4AQYB 4PCQA 3VSKA 5EG0A 2E2HJ 1J95A 4Z2YA 3ZQQA 3ML6A 4QE7A 2WAQA 2HFEC 4BDZA 5L3DA 3HTUA 2E60A 2XF6A 2L9SA 4LK0F 5CJ9A 2H8PC 2RQ6A 2Z0AA 2P5KA 2QQBA 3LAJA 1QLEC 2LKXA 3LNNA 4FJCC 4CH5A 2XGCA 3CQZJ 1P4AA 1KKDA 1LDJA 3SJCC 4E7KA 4M71A 1V9PA 2LW7A 2OCCB 1ZUQA 4D1QA 2ZBKA 3H01A 4ZTJA 1MBEA 3MD2A 2EZIA 4EJTA 3W7UA 3KZIZ 5EBWC 2V79A 1G3SA 1FXVA 2PJRA 2EZLA 4M6XA 3GZ5A 3PIOF 1OKRA 2OAZA 4DBRA 3CCJI 1ZR2A 3K4MA 2BE3A 1SC5B 1WFXA 1ZK8A 2W48A 4EGZA 3B2EE 1K78B 1S7AA 2ETHA 2EX3A 3C2BA 1QHGA 4I9QA 3AG7A 5IYCO 3TW7A 4Z1VA 1LFPA 5F64A 3AG2C 4ZOLA 1P4RA 1I3QJ 2BTQB 4TV7A 3H9JA 1VQMV 5AIPA 3GLLA 1BR2A 4AWXB 2DCEA 4EM2A 3RKWA 3FYIB 2D3OW 1ZN2A 5DS9A 2VUMJ 1OJHA 2YU9J 1Y76A 2YEVA 1XHZA 1RR8C 2PF4E 1UMQA 5HOOA 4X1YA 3QODA 3E3VA 1PPJH 4IOAF 2JPCA 2Z99A 3BT9A 3BCBA 2IM9A 3T2MA 3OW2U 3I3LA 3E6MA 4HX7A 1MSDA 3E7LA 1N0JA 1W59A 4PHZA 4XN0A 5E1ZB 4MFDA 3QG5A 5KVRA 3NRVA 3EPZA 3AG2B 5LGNA 1BR1A 1R6RA 3V7RA 5CVVA 4IF4A 3ZQFA 3RPUD 1W0UA 1RUNA 2IJJA 1S6LA 2Y4TA 5CBGA 2E1OA 5J8CA 4AIJA 2ZT9B 4GLXA 4AILC 3BJOA 4B3AA 1ZGWA 2CH0A 2IBDA 3E35A 1WWXA 2CTPA 4O4IA 5GW7A 3JR9A 1VF6A 1R71A 3KX2A 1Y74A 2PZSA 4YFNF 3KZYA 2A07F 5BMVA 5A2QZ 4JAUA 2YC0A 3K08A 4JPRA 2BY2A 1R3IC 4JYAO 2QWWA 2PTMA 2M87A 2Q0OA 2LC2A 2PMHA 5HS7A 3X2QC 2CGPA 1SA0A 3FB7C 5BZBA 3VBBA 2A79B 2QKSA 1MGTA 2LVSA 4PSXA 3RTRA 2EFPA 2AGAA 2ZXIA 2X1EA 3CUOA 3BWGA 5LRRA 3E22A 1YI2V 2ZJQF 3DPTA 3U10A 5EYRA 2RQPA 1W7PD 2DFFA 4YRVA 2FJ1A 1J5EO 3CCVI 1P92A 2O3FA 5KA6A 2DMTA 5LMUO 2J5OA 4F55A 1V54B 2WLHA 3A01B 1X2NA 2FU4A 3HKBA 2DA2A 1J09A 3CJRB 1IRGA 4CO8A 4UXNA 2CWEA 1U78A 3BABA 4KIBA 2LD5A 3FXRA 3DQVC 3HKZN 3DSQA 2K1EA 4DV4O 2YICA 5LHHA 1FNNA 4JYAB 2YI8A 4A3DJ 4WFGA 3ICXA 4XRSG 2CW7A 3OY9A 2YUAA 1OCRH 4KIGA 1VQ6I 5DEDA 1Y1WJ 2LLKA 2IS1A 5DM6V 2I8DA 4RS8A 2HTJA 3DKYA 1RSOB 3I71A 1Q86W 5KHJA 2CH7A 2ME6A 2R7VA 2EZPA 2ZIOA 4HF2A 1M9NA 2FTKA 4JYBA 2DODA 3H9GA 1NTMH 1S7EA 1AP5A 2P8TA 4G94A 3K6GA 1YRNA 5FNVB 3OSFA 1BI1A 1ZTRA 4HSTA 1HW2A 2CFOA 1B3QA 4UY8I 4H13B 2CMPA 4IZZA 2KG7B 3FHZA 2IGOA 4DYCA 1QBZA 2LO1A 1F36A 4I4TA 1DTOA 3PQJA 1N32B 1URFA 2NXNB 1RPOA 4JI4O 3HB3B 2F23A 5E79C 2ICWG 1DGRM 1Z3XA 1GN2A 2L5QA 2LNBA 2JEXA 4OX9O 2PQ8A 1FOYA 1OPCA 2EB7A 2M7AA 3OUSA 3AG1H 2DN0A 4DR1O 3TBIA 4KDPA 3ZS8C 2YI9A 5E3OA 2VJ4A 5M5YJ 2B7EA 2DMQA 2QUFA 1F9NA 2DAOA 2VKEA 1V55H 4XKBA 3RYCA 2XSDC 1KMIZ 3F6OA 1CGPA 2NVUB 3MVPA 2L7KA 5J1RA 1XDCA 3OIPA 4MEYF 3SJBC 1JOYA 1LE8A 3D0SA 5CLSA 3RZDJ 1VQNI 2IBZH 3GTGJ 3OYBA 4B09A 1YDXA 5JCOA 2EFNA 2Y75A 3SZTA 4BQNA 2F5VA 2VS0A 2L9VA 4HPQA 3L2RA 1MSWD 1BGYH 1YVWA 3I56I 2Y4UA 3BTJA 3CO7C 1E0EA 1THZA 5J2UB 4A5UB 4NTXA 4B43A 3OEEG 1GAXA 3F8MA 1G59A 3EYYA 3E5XA 1FXHA 1M4UA 3TDZC 3VB2A 1U9OA 1WPKA 3H0GJ 2LR8A 3MZ8A 4A3MJ 1VFCA 1ZKGA 2R7DA 3M1EA 5CQGA 1BI3A 2XB0X 2XHBA 3QPTA 2E36A 2XHKA 5IY5H 4B4CA 3BG6A 1ITYA 3QWLA 3SYOA 4DUZO 1I1SA 4QPOA 2RGVA 1VQ7I 3AK3A 4K8ZA 4P30A 3BJAA 1ODDA 3VEPA 1PL0A 3IAYA 2JUCA 2WB1A 4HX4A 4UHTA 1MMDA 3RIRA 1SAXA 4HEA2 4XKWA 1K92A 2BTOA 2QYOA 2F4MB 2F5DA 2XGDA 4IO9F 4G2KA 2OWOA 2EV5A 2OD5A 3RQIA 4FFBA 2F5EA 4MVMA 1JFFA 2D1HA 1FPQA 1EFRG 3TXQA 3LFKA 4GCVA 4A6DA 2HYGD 4CYCA 3OR1C 4JASA 4RGXA 2Q7GA 1OCZC 3RYCB 3V7CA 5JWPA 2OQRA 3FMRA 3ULQB 3UO2A 3J7AU 2BV6A 3IRQA 2E34A 2W85A 4IXAA 3R66A 4IHTA 4MTEA 2OF7A 2H6BA 4QTRA 4Y15A 1FXKC 2DQ0A 1GVJA 3KEOA 4MVSA 1WJCA 1RRJA 2HZDA 4OINF 1N34B 3SYTA 1W5SA 3LFUA 2HOTA 4O4LA 1OCRC 4I01A 3GBGA 1F4KA 2ARHA 4A69C 3ABLC 2KZVA 3OS1A 3Q0VA 1P49A 2ZXWC 4I5SA 2KIQA 2QZ8A 3VYRB 3T1YO 2W82A 4EATA 2XDVA 1U3EM 3HC7A 4TV9B 4ZBMA 1BL8A 3CPWU 1FBQA 1QHTA 1BT8A 3JATA 1XOUA 1PJRA 5HNHA 1YX5A 1LDDA 1TA8A 4AIKA 4M6VA 3IKTA 2V26A 3F5TA 4K0KO 1J7KA 2RDPA 2Y48A 3K10A 1ONVA 4BJ5C 1S29A 3H36A 5K1YA 3HHGA 1FFXB 3OL4A 2Q67A 2QSAA 3AG4B 2EWNA 3CCQV 1VQPI 1RI7A 4IHVA 1SS3A 1VQKI 4YJ3B 3SPGA 5IWAB 2A5WA 1G2HA 4W1UA 1KQSU 1JUPA 1BOAA 2IGKA 4XRMA 1TP4A 3FB8C 3K03A 3ZHSA 3T1HO 3B40A 2DYSB 2A6TA 1ORQC 3IHUA 1H0MA 4HNAB 4JTCB 1X1CA 1KQ0A 3AG3H 1SERA 3BP8A 3J80N 4C2UA 1W0KG 4WF2A 2RQQA 3I58A 1WPXA 2AXTZ 1L1FA 3SYPA 1OR7A 1FC3A 4CCNA 4BW9A 1ZARA 3S16J 4KT5C 3MFKA 5CVUA 4UCVA 4XOTA 5BR8O 2HG5C 4H33A 1S8NA 2GQQA 3DTIA 3VQXA 3IH2A 2QGUA 2GBYA 3TMOA 4BQQA 3HIFA 2EINH 3GZNB 4M73A 3KYLA 1I7FA 3OD4A 1J0RA 4B3RB 4KA4A 4X88A 3JARA 4H0EA 4R79A 2R7WA 2UUBO 1KKCA 1BZKA 2DO7A 1R36A 4XIDA 1X4OA 4DW0A 4LF6O 3A02A 3CCSV 1WJDA 3ECOA 3AG4H 4JBAA 4TQFA 1UG0A 1R3JC 2KJCA 2YPRA 3DFGA 4X1KB 1IBMO 5DYMA 1VQOI 5K7HA 5DV5A 1F4NA 1IJWC 1HCRA 5TISZ 4DV6O 1Q6IA 1ETXA 1A5JA 4FPPA 4I7ZB 5LXTA 4B3MO 2XUMA 4EVIA 1XCBA 3ABTA 1JVMA 4LK1F 3DWLE 3I54A 3WGHA 4JQFA 4ZYGA 3LDDA 1BW6A 2JQ7A 2VC1A 2NR5A 4WFHA 1K7AA 1O7FA 3BZ6A 2M7BA 1TBXA 1DP7P 1OCOB 3KZIC 3S17J 4CZCA 3BDDA 2AZ2A 1HP8A 1R1BA 4KITB 1L0NH 3WG7H 4Y3OA 3CMYA 2PN6A 3ZRWB 5ITZA 1HNZB 4QPQA 4IIJB 3SPCA 4YG2F 3MHHC 2COMA 3BY6A 4AC0A 4RAGA 4ZKIA 1XD7A 1PNMA 5EBLC 4MVUA 3KFWX 1IRZA 2XUBA 1ULYA 3HKEA 4FZ1A 2ELHA 3DBRB 4JI8O 3QRFF 2DFIA 3P7NA 3R0AA 2COBA 2QM4A 4MHGA 4U3FH 4X6AJ 1BSMA 3G3ZA 3BR3A 5IP9J 2IXSA 1MDMA 2CS3A 1L8DA 2MK3A 4LWSB 4PGGA 5EGOA 2CFXA 1QGPA 2MC3A 1X1AA 2L0KA 1IF1A 2A68F 1HXDA 1G3WA 1MA1A 4BIUA 2DMNA 4DR3O 1ETQA 1IXMA 4ASUG 4QJFB 3I59A 4BYYA 2QKMB 5J1YA 2VJ5A 3STZC 2OTJV 4O6JA 3NXSA 3CHXA 2ELKA 2MW8A 3A0HZ 5LOVB 2UXDB 1S5LC 4ZZDA 2W7NA 1TW3A 4LG0B 2E1MB 4G7OF 3E6CC 4YFKF 4HQEA 2QM7A 4FM2A 3LNQA 4Z2WA 3QP5A 4Q20A 1TZLA 3FKJA 1HA8A 1JT6A 1B8IA 3TO7A 2DJVA 1TWFJ 2QE7G 2YS8A 3OIOA 2FBIA 1T2KA 3JAMK 2ZSIB 1Y66A 3JYCA 1ZLKA 1IO2A 3BQZA 2W57A 3SYQA 2STTA 3G80A 1IXRC 2L3DA 2OC6A 1XS9A 2EIJB 1D8KA 3ECHA 3OYCA 3QP6A 3S3MA 4NDLA 2ISZA 1B6QA 2Q4PA 1SD4A 4LIVA 3CMEV 3GTOJ 1ROPA 5FD6A 2W1OA 5B1BB 4OIPF 5EGOB 5D4RA 1IN5A 2CV0A 3DEUA 4FFKA 5EJCA 2CO5A 1V5FA 3J7ZI 1OCZH 4RBOA 5FLVA 1GM9A 4JOMA 1YEWA 3HXLA 4LMYA 3B77A 1YSCA 2EA4A 3H35A 1D0ZA 3U2RA 3DTUB 1R9TJ 2EINC 4JAVA 2CQKA 2K7LA 4BE2A 3DGEA 2MD5A 4J41A 3RYFA 3GFMA 1T33A 1U9NA 2DOFA 2FXAA 1TQPA 4FASD 4CHUA 1SZXA 2EULA 4GX1A 4X66B 3O3KA 2LDUA 2FRHA 1HDPA 2XC7A 1Z2GA 1XDUA 3BCAA 4FISA 4JK1X 5KAIC 5FRNA 4LF6B 3OYIA 2HVSA 1QNMA 4J7ZA 3W3CA 5J9PC 1S72V 3CCLI 1IDSA 2FL4A 1EN5A 2BE5F 1B04A 4DV2O 4XRSA 4GDFA 3CDLA 4J9YB 4B3MB 2EIMC 2DMUA 2WA0A 2WB1N 4M9ZA 3GTKJ 4LFAO 4I55B 2K4BA 4LFCO 3N05A 1QZYA 3BR6A 2H1KA 2V1UA 3Q4HA 1S5JA 3HPLC 2PGGA 3W7XA 1NJIW 3T1BA 2WLNA 2JA5J 1XMOO 2PG4A 3WODF 1AR4A 1KYOF 3WU2C 4M6YA 5E79Z 4WX9A 4IQ4A 4D7TA 1TW2A 1Z6RA 2Y2ZA 4XN3A 4BJTA 4XONA 3CC4I 2VBYA 5HNFA 1FPOA 2HJDA 2PMUA 3FX3A 4PD4F 2HHHO 4UB6C 3L2CA 3AK1A 5H20A 2IW5A 4RAZA 5BNGA 3RI4A 5M5XJ 3M3YJ 3FXUA 1FXKA 1LUVA 1PKXA 4AHCA 5A2QN 5LBQA 3UQ8A 3ASNC 3IAS2 3OS0A 1Q43A 3WB0A 1LUJB 4YEJA 2N74A 3F7VC 2ZFUA 2ADUA 3VQVA 5KUMA 3BR0A 2DJNA 2G9WA 2ETNA 4CXFA 4AIDA 3B6CA 4FETA 1ZAUA 2MYSA 2KSDA 3JD0A 1W7PB 2V6CA 2M6YA 1FP1D 3F6VA 1HOMA 2QM3A 2VB6A 5K5OA 1ZL8A 2JGDB 2P67A 1LB2A 4QNHB 2IJHA 1E1RG 1E3HA 2P5OA 1QZZA 1T6SA 5ED4A 2K9LA 2TCTA 3FXJA 1KYWA 1OCCB 2ZE5A 3T1HB 5FKOA 2GIZA 2KISA 3WU1B 4LFCB 4LFAB 2HPIA 2JVDA 1HW5A 2UUZA 2Y69H 2Z16A 3REOA 3KPHA 4B1RA 3TK1A 2UXXA 4XKVA 3HOSA 2Z33A 2VBZA 4W4KA 1RC9A 1T95A 4RDUA 3D1NI 5K1PA 3B73A 1XNRO 1P7GA 4RQFA 4KYWA 3KLOA 1GV2A 2OZUA 3DXJF 4LCUC 2LH9A 5JH7A 1WI9A 5A9GA 4AQYO 1X3WB 3IC7A 5EK0A 4P1WA 2MG4A 3EUHA 2V1XA 2HVKC 5IY5C 2HDWA 1Z05A 4RLFA 5IT3A 4OIOF 2VQFB 6PAXA 4JI2O 1CXZB 4Z6YA 1AOYA 1JTXA 4E7SA 1KP3A 3K5LA 2HTSA 4DBQA 3RQ4A 1UFIA 5AG2A 4HG2A 4PFOA 1YJNI 2R7QA 4FM1A 2XAGA 1Q90D 5JJNB 1S5LZ 1Q1HA 4N4OB 2X9DA 4G9YA 4MQ9F 1POGA 2HDCA 1MABG 1VEWA 4B3TB 5LEJA 3FKSG 2QWNB 4Q6GA 4II2A 5CA0A 5IE9A 4FMTA 2E2IJ 1BI2A 4NUBA 2MGQA 2DYRB 1ZL8B 1IBMB 1Y8QB 2VKHA 2MD0A 4E7IA 3QO7A 5C8YB 2KLOA 1Z67A 2AXTC 3JAMZ 4BE1A 3L2WA 4A3JJ 1OQYA 5F0HA 4X20B 3K5MA 4DR2B 4CZZA 4DXWA 1VQPV 3GZ6A 1M93A 1DU0A 3A8TA 4ESJA 1JKPC 4WBNB 3K4LA 4QIWF 2O8XA 4FLTA 1NVPB 1ZQ3P 1QVTA 3DKWA 1EF4A 1GH6A 5HVQC 3EDPA 2W0XA 2V1NA 3QPSA 3LOCA 1GO3F 1GXPA 2BY1A 3EQLF 2F43G 2JEUA 1W36D 1Y1VJ 1HBXG 3O6BB 4J42A 3CB2A 4JI3O 3AL0C 4RGSA 4HOBA 5FKNA 1N75A 1B6AA 1FOWA 4ESFA 3E5UA 1RR7A 2R72A 4BH9A 2FNAA 4DK1A 4B3SB 2DT7B 4WWCA 4DV2B 3GWOA 2IGMA 5J2UA 4XKCA 2ZMEA 4DQ2A 3JAMN 1UPGA 1PNKA 1KZHA 1UHSA 5JVGF 4A0ZA 3WE2A 4U87A 1COWG 2A9HA 1JA8A 1KECA 3JRFA 4S05A 2R7XA 4D5FA 5FKLA 1T0FA 5K7ZA 2ZFWA 4B7EA 2XAQA 3C7JA 4IVNA 3MWMA 4UVBA 1M56C 4ZOLB 1H8HG 5EIBC 4BKXA 2IJLA 2BYVE 1LJ9A 2EV6A 3FKIJ 1R00A 4ZC3A 1K4TA 4CH7A 2M0CA 2YIBA 1Z21A 4UCUA 4WXDA 1XL4A 3CCRI 1KC8W 1YJWI 3V8LA 1ZR4A 2IT0A 1GXQA 3ZQCA 3DC5A 2RNGA 3M7MX 2HFHA 1D0XA 1XCVA 3BTIA 3JD2A 1VQ9V 3C3WA 5FFZA 3HUGB 2M34A 3UO3A 3W6KB 2F1MA 3ZHVA 3I4NJ 4DR5O 2CW0F 3GFLA 2WY7Q 1TLHB 3UT5B 3CX5F 2OUMA 3AG1C 1EH8A 5JCOC 3K57A 3S14J 5IPAA 5CPRB 1SVMA 3ZR8X 2W25A 1WB8A 3QYBA 3H1LH 2XTAA 2O0YA 2RN9A 1QVGU 3MAJA 3HKCB 4PELA 5IYZB 2ZKOA 3ABUA 5E1XA 1QU3A 1EA3A 5BMVB 4ETSA 1XEQA 1Q5OA 2VWJA 2H27A 1D1CA 4HF0A 1TQMA 3ZX6A 2VBWA 4EGYA 1WKMA 3KEYA 3OYFA 1ZRCA 1WPBA 2EIJC 2L35A 1ZG3A 5EIBD 5LLQA 2VLAA 3RT3C 5E8GA 2Y0SA 1FJGO 5D5UB 5EYPA 3QO5A 2NNYA 3VQYA 1JJ6C 3R0JA 4AUXA 2FQ3A 4XRFA 1IN8A 4V2FA 3JW4A 4E6KG 1YITI 1BW5A 1Y4MA 3C90A 3CCRV 1DK1A 4XLHA 1XPXA 4IKFA 4DNCA 1U97A 3OYJA 4CS2A 3CP8A 2WY8Q 1A32A 2I5UA 4X9QA 2VQGA 4UV9A 2G7HA 3GWZA 1L0LH 1IURA 3EHBB 2N8GA 3HUGA 2K02A 3PQKA 3BG7A 4RB0A 4U7NA 3C3SA 2WAFA 1J5EB 3K1MA 4ZYDA 1VQ8V 3UT5A 2Q0AA 4OGQB 2N05A 4A12A 1LUWA 3IGAC 1DGWY 1ZAOA 2K40A 2MA3A 5JHUA 4ENMA 3ELKA 1B72A 2RNBA 5IYZA 5LD2C 5E1AC 2FSWA 3HYIA 5E8IA 2YX4A 4XICA 1VF7A 2A6HF 2LKPA 4A2UA 2LRDA 2X6WA 2W0FC 4FVMA 2ZJ2A 4P9FA 3CP2A 5D5XB 2OT5A 3SGIA 2ZR2A 1LDKB 4L9JA 5JJEB 2EBOA 1OISA 3NEUA 1ETWA 1MJAA 5BPIA 2OCHA 1YRNB 3JAKB 2HGCA 5FNVA 2MLGA 1E3PA 4U88A 3RDIA 3CJNA 1ZREA 1WGXA 1IN4A 4KIFA 4LLGF 4YFXF 1F43A 4KICA 4PJMA 2R9AA 3SPJA 3F8CA 5M3FJ 1U2WA 4HYOA 1TGOA 2XOKG 1N36O 4NXMB 4RM3A 4BBSJ 1FX7A 3HTSB 3CCVV 1N32O 2EINB 2GA2A 3O8HA 1T0FC 3ABKB 1U5TC 2AZ0A 3CCLV 5LYJA 3CUQC 3KCXA 5C4XJ 1PVEA 3P30A 1VQ7V 2JJ7A 2NN4A 5LXTB 2DA3A 1E3OC 1YJNV 2XAJA 1F51A 2GTAA 4YHHO 5CQEA 4EJUA 3GYHX 1FOKA 2BXYA 1I08A 2QTOA 1GDTA 2DYSC 1ON2A 3IL2A 2YIBD 5DUIA 1EN4A 2MFZA 1K4CC 3HRUA 1BHBA 2RKHA 2X6XA 2MH2A 1CP9A 3ASOB 1JHHA 5ITZB 3WGGA 4IIJA 1NK3P 1BR4A 3FXLA 4I50A 1Z1DA 4DYRA 5GAHJ 2BW3B 4EEQA 3TCUA 3LSHA 4AU7A 2EV0A 3JAKA 4FM0A 2OA4A 2Y0MA 5EZYB 3ZOBA 1Q1VA 3IAM2 2K3PA 3LSTA 3AG2H 5F0FA 4NBQA 2IEKA 2H8RA 5FRMA 1M56B 3N4MA 4MEXF 1JI8A 2E1MC 4RB1A 2A06H 3ERMA 5B66Z 3HPHA 1I39A 2HKOA 2VXZA 1PUFB 1SQFA 2LYCA 3QAHA 1W2BU 2KP6A 3OE7G 3JALB 3S2HJ 1U0JA 1K33A 2Q5ZA 2CUFA 1K61A 4QE9A 5LYJB 2KL4A 3WHCA 1R3LC 2UUCO 5CB4A 2M8GX 3F5WC 3WTWC 5CMUA 2ID3A 3BTLA 2IJIA 3CSXA 3H1CA 3QYFA 4K3AA 1SQBH 1VQ4V 4B3RO 2ZNJA 4PI0A 1PDNC 4NXNB 3S1NJ 3I59B 4PZJA 3CE2A 4FFBB 2XB5A 2CSOA 3E8FA 4J80A 3OYEA 1JFFB 2MW2B 5L3CA 1OJLA 2IVMA 3IWFA 2K85A 4CYCB 3GX4X 2GA1A 3ZEDA 3HKZA 1JJOA 1ZELA 2R5ZA 4BE0A 1I1GA 2EIKC 2PYJA 4J9ZB 4HQMA 1BC7C 2NLJC 2CW8A 5ILSA 3G6EI 3L09A 1H2GA 3PSFA 4I50B 3QVNA 2DA1A 1Y6IA 1YTYA 4JI6B 2OCEA 4HAMA 2PI0A 3AK2A 3SDBA 4QIWN 3CWBH 1P9QC 1JXSA 1BE3H 3ZPLA 5HLIA 1RESA 2OIEA 1XNRB 4UCOA 3W7TA 2LG4A 2UXCO 1AR1B 4PJJA 2G38A 2V4JC 2DDAA 1KONA 4M3GA 2QSHX 1IBKO 4IEJA 5LP6C 4BJ6C 3RYIB 1R6KA 1BCCH 4F6RB 4G6QA 3S15J 4PDKA 3JATB 3CD6V 5IY5B 3LMMA 1ZTEA 2ZINA 5FKMA 1V3FA 1IG7A 4U7BA 1V54H 2GUZB 1ZG5A 2HP8A 4GZRB 2WAQN 5CA1A 2M45A 2FA5A 4U0WA 2IU3A 2LMDA 2W24A 5HLHA 3TOAA 2Q6AA 2D5VA 4KUMA 4CS4A 2QEXI 2ESNA 3CC4V 4F93B 4XOPA 1R4NB 4RAFA 5LP6B 4P9OA 4OX9B 3H1JH 1L3LA 2P6JA 1HWYA 4GKKO 2RC4A 3M8FA 2WLJA 3B8MA 2LFRA 2P4KA 3K3WA 2NOGA 1GHCA 3QNEA 1HNWO 3JSNA 2R7TA 2CE4A 1RKWA 4LF9O 2X85A 5J1UA 1NR7A 4CSWA 4IOCF 1P6RA 1RPWA 2DI3A 2ZJRF 1SQVH 4E2LA 3WTZA 1R5HA 4XL9A 2PJPA 2M1BA 2P7VB 3T1CA 1QHHD 4RGRA 2P5LC 1W5CC 1XGOA 3FBNB 3AL0B 2XAUA 3SZGA 1GK9A 2K4JA 3Q4HB 4TWKA 4TV8B 3TJTA 2K86A 3QOPA 2YEVB 3ZCCA 3BROA 4MVQA 3RYIA 1YW7A 2DN9A 3ZQ7A 1I5YA 2CQQA 2ECCA 2M9HA 4LC1A 4UB8Z 1R7JA 4AYBN 4LLNA 2JJ2G 1IW7F 4B44A 2AHYA 2FOKA 2DYSH 1Z9CA 3I55V 5IP6A 2IA0A 5J47A 1GM7A 4C3HJ 1H9GA 4P9UA 1GMGA 1KQ8A 1VQKV 3CC2V 3GXOA 4CCLA 3FISA 2VQCA 3R65A 4JTDB 2L4MA 4Z1MG 1G1XB 1FJGB 3CJHB 4LNUA 3EUAA 1UB9A 4UCSA 5J2TA 1G4DA 1Z7UA 1SFXA 4KMUX 1VF6C 2DA6A 4UUJC 3ZBHA 3ZGKA 2UZKA 2MSYA 2YU3A 1YIJI 4DO2A 1R5ID 1RIOH 2KB1A 3P9KA 3GTPJ 2VXDA 1H88C 3ETEA 4HRIA 1XSDA 1Y56A 4D0PA 2JGDA 5B5EZ 1Q6HA 4BHPA 1JKRC 5KUKA 4OAZA 4XLNF 2W6JG 1VQNV 4C7UA 4O4HB 2UUAB 3CXHF 2BY3A 3FK7A 4TV8A 4DV1B 2EIMB 2F93B 1G6UA 2LP0A 4DOZA 1PV0A 2A7WA 1MZEA 4MIMA 4TUYB 2XRLA 1JGSA 2LOOA 2Z1DA 3R4KA 3WGIA 3JRHA 3D3IA 2E71A 2E19A 3QTCA 4L0ZB 2IA1A 3ZRVA 5HODA 5EG0B 3FMSA 4UVAA 1K8AW 3JSLA 4ZYEA 4MW8A 3ETDA 1ETVA 4BU2A 2PI4A 1W0JG 2DQRA 3BJ6A 2CUGA 1AA7A 1M90W 2VASA 4GUNA 2FE3A 1NH3A 2JK5C 2NOJB 3ZCOA 4G7ZF 1LVAA 4HV6A 3FM5A 1IGNA 3CJHA 2H09A 4LNUB 3LDEA 5FD5A 3UM7A 5BR8B 4XM3A 4F3QA 4DR7O 4BL0B 4MVZA 4EKWA 5M5WJ 4TOIA 4DV1O 2R4GA 4GFBA 2QF7A 1ZGJA 2Q2EB 3SZPA 4R50A 5CA0B 1RZ4A 5JQGA 2E5LO 3AEIA 1XMOB 1MSEC 4J7JA 1IVSA 3RBZA 1HNXB 2X51A 3K58A 2ID6A 3ZMZA 2V4DA 4X1EA 5C8YA 2VOOA 1H38A 4FX4A 2M3AA 2W00A 2TRTA 3SFZA 4A3CJ 2LGWA 2FBKA 2V1DA 2VJIA 1QPMA 4BNCA 3OMYA 1XL6A 1KB9F 1Z5WA 1NVPD 4Y33A 4RGUA 3ZMUA 2RREA 1SEUA 1LNWA 4B48A 2RDCA 3GTMJ 1OCCH 3K4CA 5TJJA 3GLXA 3SR2C 3OYHA 2QCOA 5JR3A 4EB6B 3W7WA 4KJZA 1JCHA 3LSRA 4R6ZA 4A0YA 4L5JA 4F6EA 1TL8A 2HYJA 4I0XA 1QVUA 3P5JA
chains in the Genus database with same CATH topology
2GSMB 1K73W 4LGWA 1H9TA 3WG9A 5KK1A 1F4MA 1J9IA 1I5ZA 3ZMTA 2Q2EA 4I09A 1HKTA 1FYMA 1F23A 2DBBA 1XMAA 4L9NA 5FL7G 2EK5A 5TRDA 2LFSA 1BM9A 1BBYA 4HDUA 2HZTA 1QQIA 2B1GA 4KP4A 1STZA 4N23A 2JTVA 1LEAA 3WG7B 2JDIG 3EFFK 2R7FA 3HHHA 1IZ1A 1NHAA 2VN2A 3ASOC 2YSUB 1O7LA 3I4PA 2RV8A 4K2EA 4RAYA 5AIQA 3FB5C 3RKXA 1TNSA 4IRHA 3LDCA 1FXKB 3P9CA 2Q69A 3SYAA 1QLEB 4HZFA 3T0YA 1U6GA 1X3UA 2HYFA 1YQAA 3CUQB 4HBLA 4BHBA 2WLIB 1I27A 4RUEA 1XGNA 1R3KC 2KIFA 1O3QA 2P5VA 5BPDA 2QQ9A 3K69A 3AAFA 3KLNA 4F7ZA 2JZYA 3E2EA 2A3SA 3CTAA 3GEZA 1UHWA 3I0TA 2EA2A 1TNTA 4M9XA 1V55B 2PEXA 1G4YB 1K7DA 4WFAV 4HW0A 1R23A 3K0GA 2QQAA 1U5TA 2A6EF 4HX8A 3JSPA 1PD3A 4L5IA 2WLIA 3K0DA 3LWFA 4XDLA 3F8NA 4WFEA 1KU9A 3W6JB 1BI0A 1AI6A 1YG2A 5AONA 1OZ0A 4XDKA 2B5UA 1P4XA 2IJKA