4HAMA

Crystal structure of transcriptional antiterminator from listeria monocytogenes egd-e
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
SNAMFTINTKSQLPIYEQIVQKIKEQVVKGVLQEGEKILSIREFASRIGVNPNTVSKAYQELERQEVIITVKGKGTFIANQTDKLSSPKKLAETRTKLKETILDLVYLGVNIEEIHKLADEYSQDIIGGDVVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2241 protein
publication title Crystal Structure of Transcriptional Antiterminator from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 43
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hamA01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hamA02
3QU3A 3F8BA 4UXNA 5E8GA 1MJAA 4P5OA 1HKSA 2ELHA 2DBBA 2YX7A 4CO8A 2FNAA 3VFZA 3CO6C 1HKTA 2L3DA 1OYIA 4OMYA 3U1DA 3LAJA 2GXBA 1BIBA 1GXPA 3I59B 1T38A 4Q47A 5CVIA 4ESBA 1B4AA 3SQNA 1J5YA 1AOYA 5LHHA 1Z6TA 1QO0D 1I6XA 4Z2YA 1S29A 4P9UA 5F6FA 1QBJA 1T6SA 2K4JA 1O3SA 2O0YA 1ON1A 1MKMA 2NRAC 1RNLA 5BQTA 4KMFA 3MFKA 3RI4A 1FC3A 1KU9A 3N97A 4A0XA 2QUFA 5LBQA 2X0LA 4XSZF 3RKXA 2ETHA 4P9FA 1SFEA 3TO7A 1R1UA 4MQ9F 1I1GA 2ZNZA 1ON2A 3DEUA 3R4KA 5GW7A 3CO7C 5HS9A 2WWYA 3J80K 4N9IA 2KIUA 3I5UA 1SAXA 4IRIA 2QBYB 3O2PE 3H3UA 3O6BB 4HQEA 3ZMUA 2DAOA 4EVIA 2P4WA 1UHMA 1WI9A 4AD9A 3BJOA 2E7XA 1JHHA 4HX7A 1U5TB 2BEOA 1KYWA 5JVTA 2OU2A 2HFHA 3W6KB 3FHZA 1ZLJA 2XVCA 1CF7B 2IRFG 4PCQA 1DUXC 5D5WB 5D5UB 5L3EA 2J5PA 2F5FA 1UHWA 1F4KA 5L3CA 3GXOA 2PEXA 1Z91A 1IAWA 1O3QA 3EUHA 3CUQC 5HOOA 3I54A 5D5XB 3WTTC 3DKWA 1SD6A 5H20A 1HW1A 5AIPA 1BM9A 1P4WA 1LNWA 1ZG5A 3TOAA 3FWEA 1P92A 1IXRC 3L7WA 2YU3A 5E17F 2O61A 3J81K 3QPTA 2RKHA 5L3FA 1MZBA 1G3YA 5LGNA 3HSRA 3BROA 1R7JA 4M6YA 2ZKZA 1HXDA 3VOEA 2P7VB 4A12A 5TJJA 1OKRA 3GO5A 1Q1HA 2E1CA 1ZAOA 4D0PA 2J5OA 4I0AA 1EV7A 2M8EA 1T98A 3F8FA 2HKXA 1EH6A 4I01A 4GYGA 4A6DA 3NRVA 1VTNC 5FD5A 3CTAA 2W25A 3DP7A 5FGMA 4BYYA 2FMLA 4L0ZB 3QOPA 2VC0A 1IN8A 4A2UA 2HEOA 1RUNA 1ZH5A 2QBYA 5K5OA 2ADUA 1YIOA 1BI2A 2M5WA 2WTEA 4M9XA 1NH2B 3EDPA 2VC1A 2CFXA 2P8TA 3LFKA 2DI3A 3E5UA 1G3SA 3GFJA 3ULQB 2KIFA 3EYIA 3V8LA 3H3ZA 1YS6A 2V1DA 1Z9CA 2XV4S 3I0TA 3RPUA 4K2EA 1RIOH 2XAHA 3G3ZA 2XUBA 2EFPA 2DFIA 4N9HA 4ON0A 2ZFWA 4R79A 1B9NA 1REPC 2IP2A 4LG0B 3S2WA 4A5NA 3HHHA 4E70A 1U8RA 1P2FA 4A6EA 3T8TA 2RDPA 2FMYA 2OZ6A 5CLSA 2KJBA 5A2QZ 1YS7A 1EH8A 4UV9A 1XGSA 3ZPLA 1JGSA 1YG2A 4KFCA 3W7TA 2E7WA 3PFIA 1J75A 3P9IA 5E18F 1MDMB 3V7CA 3JSOA 1IW7F 2XGXA 2PG4A 5LGUA 3LQQA 2D2WA 2YR2A 5IT9Z 1KQ9A 5E1XA 1UFMA 1YO5C 3IWFA 2A68F 3HSEA 3WU1B 3D3IA 3DXJF 5ILUA 1T0FA 4I7HA 4EJUA 4Y15A 1FX7A 1BC7C 1B6AA 3U2RA 4ZYDA 4FT8A 1YYVA 3KLOA 1SD7A 2VONA 1D5VA 1HW2A 1ZGJA 2G7HA 1YTFB 2IA0A 3E5QA 1ZRFA 3WGGA 2CWEA 1R36A 5KK1A 2P6TA 3GLXA 4LJZF 4M73A 2K4BA 3E35A 1IXSB 3ERED 1JXSA 3L9FA 2ISZA 2ACJA 4LB5A 4M9SA 2KJCA 4LLGF 2JPCA 3JW4A 4GO1A 4G6QA 1FYMA 2UWMA 4LLNA 2JRTA 1ZARA 4HX8A 2HDCA 5ILSA 2MH9A 4L18B 4EJWA 1Z6RA 5AONA 3FMSA 3WTVC 2YX4A 5D4SA 1K6OA 3ZMZA 4LG0A 1FY7A 1FT9A 3NEUA 2ZO4A 5HDGA 4B8XA 3ZMVA 5LLQA 3L09A 4F7ZA 4CICA 4HV5A 3K0LA 5LEJA 3HOSA 3BPVA 1DDNA 4UVBA 2FBKA 3Q5FA 3LWFA 3OOPA 3R61A 2R3SA 4GXOA 3K1MA 1MDMA 2UXNA 4FX4A 3K1NA 2LF7A 2OAZA 3HSFA 2EV6A 2CG4A 3JSPA 1BBYA 2F5DA 3E3VA 4M9ZA 4A5MA 3WTWC 1USSA 4XLNF 1F5TA 1ZN2A 1IN6A 1KU2A 4HOBA 1W4MA 3D0SA 3BY6A 1L0OC 3E6BA 1ONVA 3HRMA 3ISPA 4HDVA 1S3JA 3SZPA 3FMRA 3QPHA 4CYDA 1J9IA 2PMUA 1K78A 2FNPA 3GFIA 1Z05A 5CVJA 4IRHA 1FBSA 2JT1A 5ERIA 5D6FA 1HBXG 5BPIA 3CUOA 3HHGA 1DPUA 3HTUA 2F5EA 1LJ9A 1R1TA 1OR7A 3WGIA 2F5CA 4BAYA 1H9TA 4AIJA 3EYYA 5E1ZB 4RB0A 2IA2A 1S6LA 2EA2A 2K7LA 3RTRA 5A2QK 4RGRA 2L01A 1BC8C 4MNUA 1HSJA 3HRUA 4L9VA 3ECHA 2NAZA 1XCVA 1AWCA 1OYWA 1R00A 5ED4A 5ILVA 2W85A 1FSEA 1E2XA 1R22A 2CO5A 2V1XA 3R0AA 2HS5A 3T1BA 3DV8A 3WE3A 3I58A 2EFOA 1SFUA 4NQWA 4KICA 1YW7A 4IJAA 2VBYA 4YFNF 2H6BA 5DCMB 2DK5A 4HF0A 4EM2A 1XSDA 1EH7A 3TKYA 2QLZA 1XD7A 1HQCA 1RUOA 1Y0UA 2FOKA 2VBXA 3F72A 5D4RA 5LHIA 4G6DA 2K02A 4O5VA 2M1BA 4YG2F 3F6OA 1LDJA 3H92A 3KP2A 3JTHA 4L9TA 3F23A 2MLKA 2HZTA 5DUKA 2M30A 4AVPA 1O7FA 3K69A 1BI3A 5JR3A 2EFQA 1T39A 5CVUA 1X3UA 1O3RA 2WV0A 3L2CA 2KKOA 5DDGA 2XAGA 3DQVC 4L9NA 3EQLF 4WK8F 2GA1A 4Q5SF 2P6SA 2DT5A 5EEGA 4IXAA 3FXRA 1XN7A 4HLXA 1IRGA 2WAMA 1KU3A 4KUMA 1HKQA 5K5QA 1MD0A 2NYXA 4WXHA 2G7UA 2RNJA 2LF8A 2GQQA 1QNTA 2H27A 2EV5A 2GXGA 3KP7A 3U9GA 1J59A 3E6DA 1FBUA 3KE2A 1YW8A 2JTVA 1FZPB 3SXYA 1TTYA 3I59A 2P90A 4BHPA 4RAZA 2W24A 4CHUA 1LEAA 4G8XA 3GZ5A 3KZZA 4HV6A 2DO7A 3F3XA 4ETSA 3IRRA 2FXAA 3QP5A 3ZMDA 4GCVA 4M6XA 4WCGA 3F8MA 1TW3A 3ABUA 4YFXF 2QQ9A 1U6GA 1QQIA 4ZZDA 4ENNA 2JZYA 2ZNYA 1R58A 1W7PB 2ZJ2A 3OV8A 1F1ZA 5DCFA 2LKPA 4H0EA 3ZMSA 1BI1A 4S04A 2W57A 1G4DA 4KIBA 3T0YA 5EEHA 3K1PA 4XLPF 3LA7A 4HDUA 3M9AA 1V4RA 2GAUA 2Q8KA 1NHAA 4U0YA 4Q4ZF 2OZUA 4I98B 3FXQA 1CGPA 3E6MA 5AIQA 2VN2A 1IXCA 4L9JA 2RC4A 4I09A 5DCMA 3V7RA 1FOKA 2XASA 2YPRA 5CVRA 3IKVA 5H6RA 4QLCU 3QU6A 1RI7A 1S7OA 2HQRA 3B02A 3V7SA 4MEXF 1W5SA 2Z9OA 2UZKA 2PMHA 1ZGAA 3LAPA 4LK0F 1F9NA 2ZCWA 1XSVA 3GX4X 4EMSA 1FP1D 1W7PD 4L5JA 2EK5A 1MJ9A 5ICGA 4ZYGA 1J2XA 2EV0A 2RVCA 3C3WA 2EFNA 4MEYF 2QQAA 1U5TA 1U5TC 3W7SA 2UXXA 3KFWX 3FM5A 3J7AO 4KMUX 1B9MA 3WTUC 4HA8A 3MQ0A 1CF7A 3C18A 3G73A 5H6QA 3E6CC 2JSCA 4QWQA 4JQFA 4ZYEA 3GFLA 4EJVA 1D8JA 3GWZA 1FPQA 4M72A 4DQ2A 2VBZA 3BOQA 2M45A 1U78A 2LSOA 3NQOA 2QWWA 2STTA 1XMKA 1FP2A 1G3WA 2G9WA 4RS8A 3GVAA 1TW2A 4PDKA 3FXUA 3ZN1A 2TDXA 3LA2A 4EV0A 5LEKA 1XDUA 1KYZA 4OMZA 4WXCA 4LK1F 1Z7UA 1G6NA 1ODDA 2V79A 2FE3A 3C7JA 1LEBA 3TO6A 3DF8A 4EGZA 2YSRA 2VXZA 2MBFA 1KQ0A 2PBIA 3M8EA 1KGSA 3WTSC 1J7KA 2VODA 1L3LA 1GXQA 2RQPA 1YQAA 3BP8A 2COMA 2BV6A 5CYVA 2L54A 4GGGA 1W7PA 3WGHA 3E97A 1YLFA 2DQRA 4AWXB 4BHCA 5HVQC 1BJAA 2PJPA 3EETA 2EFWA 1K79A 1TQPA 2QYOA 1FLIA 2ZBKA 3BJ6A 1YTYA 3RKYA 2B0LA 1H0MA 4WX9A 3V4GA 5FFZA 1FYLA 4RB1A 4A0ZA 3AAFA 3GZ6A 4UV8A 4FX0A 4GYIA 1PP8F 2ZMEB 3I53A 4HW0A 3P7NA 3WTXC 1FSHA 4HF1A 2R7DA 3R6SA 2P5KA 2ESNA 3QP6A 1S8NA 2DQLA 3HUGA 4BHBA 3CLOA 5FB2A 1QPMA 1QZZA 4I2OA 2XKOA 3SFZA 1WRJA 3J80Z 2FBIA 4KA4A 2XAJA 3QRFF 5HLHA 2VOPA 2XHKA 2LDUA 5IT3A 1I27A 1OPCA 1USTA 4NB5A 4AIKA 6PAXA 1DP7P 4RGUA 2BYVE 2RN7A 5CA3A 1FWZA 5ICFA 5DD8A 5E1WA 2E1NA 3MEXA 1P4AA 3WTYC 4OIRF 2DLLA 1JE8A 2WC2A 4HF2A 4U7BA 2Z3YA 4BXUA 2K27A 4KNYA 4UNOA 3DFGA 3F22A 1ZLKA 3M7GA 5KVRA 3COAC 2O8XA 4L5IA 2IT0A 1ZRCA 3RIRA 3V8JA 1U2WA 2FBHA 4U7DA 2QM3A 1V3FA 2IA1A 4NHJA 5FLXZ 5HDNA 1S7AA 2MA3A 1WQ2A 3KP5A 2OQRA 4U0WA 1SMTA 3RPQA 1TNTA 1BIAA 5ICCA 5HLGA 4RGSA 5BOXA 4BNCA 4UVAA 3F8NA 4PZJA 4ZH4F 2XROA 5D6EA 3IHUA 5J8CA 5K5RA 5HDKA 4WWCA 2VT2A 3TO9A 5DV5A 4YFKF 5L3GA 4G7OF 3F21A 4ENMA 3P9CA 3PQKA 4EJOA 2CSOA 1IN7A 1O57A 3D5LA 3VODA 2FEZA 4ENKA 2VE8A 4IRGA 1D8KA 4ESJA 2A69F 4ZZLA 5BS6A 5CJ9A 5F1RA 1R23A 1SD4A 2FA5A 2O3FA 3VEPA 4N0BA 2NNYA 3ROUA 4ASNA 4UVCA 2HOEA 5HLIA 1OYYA 5DEQA 4HZFA 4KDPA 2DPDA 3GFMA 5L3DA 5LRRA 2D1HA 1UCRA 1LB2A 3WE2A 2MH2A 2PLYA 1IN4A 1WWXA 3FF5A 4OOIA 2XRNA 2P5VA 3FM3A 1YFHA 4RAYA 4BH9A 1ZHFA 4S05A 4KN4X 3TGNA 3HRSA 2MC3A 4KYWA 3CUQB 1MJBA 1BOAA 1SMYF 4PGHA 2HR3A 2P7CB 3JAMZ 5L3BA 2VOOA 3GUDA 2CYYA 3HIFA 3TDZC 4U88A 4P96A 5LGTA 2HKOA 3I71A 1T2KA 3ABTA 3BPXA 3MZYA 1O7LA 5BMZA 1STZA 2XAFA 4MHGA 5IT9K 3KP3A 3IRQA 1LDKB 2FF4A 4A0YA 2L4MA 3GYHX 2Z99A 5LRSA 2BE5F 1KQ8A 5JFRA 4EQQA 4DNCA 4IHTA 1XDSA 3ECOA 1I5ZA 1R5GA 2QVOA 4OIPF 1IUYA 1Z1DA 2V6CA 4R1HA 3HRTA 1R1VA 1UB9A 4TV7A 2FRHA 3W7XA 1MGTA 4AIHA 4EM1A 1LQ1A 1SFXA 2OD5A 4CZZA 1XMAA 1TQMA 2A61A 1H9GA 2XIGA 3FZVA 1PUEE 2FSWA 1QZYA 3REOA 5ICEA 4LFUA 4OIOF 4O6JA 4M71A 3LA3A 4RGXA 2M87A 5DD4A 3F8CA 4ZYHA 2GIVA 1IN5A 2HGCA 4KT5C 1PDNC 5E8IA 3HYIA 4HLYA 3KETA 1TNSA 5F64A 5BPDA 2A6EF 3KEQA 2K86A 2W84A 1JHFA 2DW4A 2FU4A 3T8RA 3CDHA 3PQJA 2HTSA 4L0YB 2AXLA 3P9KA 1R5HA 2LNBA 3CUQA 3MZHA 4HX4A 5FLXK 3IKTA 4KN7X 3IWZA 2H94A 2D45A 3O3KA 3TQNA 1XGOA 2DK8A 4MGRA 3B73A 2NS0A 3RYPA 2VE9A 1K7AA 2HQNA 4HBLA 3LSTA 1E17A 2GA2A 2AS5F 3I64A 5D5VB 4WF2A 2A3SA 3SHFA 3ZMTA 2L4AA 1NVPB 2HTJA 1RZ4A 2ESHA 3JTGA 5D8KB 3ZN0A 4XRFA 4ESFA 3F6VA 4RB2C 4CGZA 1KA8A 2OA4A 4JBAA 5DYMA 2A5YB 2P5LC 1D3YA 5HS7A 4UUVA 1A04A 2IPQX 3KP6A 3TOBA 3RJPA 3K9TA 4P55A 2ZXJA 2Y48A 3CJNA 3RKWA 5FD6A 4R8HA 2GZWA 2C6YA 3K2ZA 1FYKA 4OU0A 4UHTA 3TDUC 2CW0F 2XAQA 5HS8A 2D1VA 2PFBA 3IC7A 3BWGA 2MD5A 1BN5A 2IJLA 4IHSA 3Q9VA 5DUIA 1U3EM 3GF2A 1TQIA 3RDIA 2EJRA 3SZTA 1P4XA 2QQBA 3JAMK 2PN6A 2QZ8A 4OIQF 1I1SA 4CDGA 4LD5A 4M74A 4EM0B 4G7HF 2PI0A 3KCCA 3HOTA 1ZYRF 3DPLC 1BI0A 2STWA 1GHCA 3KEOA 1WSUA 3E5XA 5FFXA 4OINF 2Y75A 4Y13A 2GWRA 2IW5A 1P6RA 1ZREA 1PP7U 2JPBA 2BGCA 2KRFA 2XKPA 4XSXF 4I0BA 3HTSB 2CQKA 2O03A 2KIMA 2A6HF 5LHGA 4IF4A 2H6CA 3W6JB 2HYGD 1XB4A 4IVNA 4MTDA 1LDDA 2X4HA 2EA4A 3Q9SA 4EJTA 2DPUA 2PQ8A 2Z5UA 1WKMA 2VT3A 3BDDA 2DU9A 3KP4A 3WTZA 4G94A 3M8FA 4I02A 1G3TA 1FBQA 2H09A 5FO5A 1HSTA 4Y17A 1QGPA 1KU7A 5E20A 5JI6A 3R60A 3C1DA 3GEZA 2QENA 3KLNA 1C0WA 3WODF 4PGGA 1YW9A 1K78B 3FX3A 4ENJA 5JHUA 3ZP5A 1XGNA 1XGMA 3QAHA 4LMYA 5K1YA 1TLHB 4LB6B 2HWVA 2ISYA 2V1UA 3BJAA 5J8FA 4WXDA 2RV8A 4MTEA 2A07F 4MQVA 2V9VA 2OQGA 1IRFA 3IL2A 4G7ZF 1XSXA 3RYRA 5J6XA 3FMQA 1RM1C 1DPRA 4XBFA 1OMIA 1W5TA 2F2EA 2Q0OA 2Q2EA 2VBWA 3I4PA 1TBXA 2EWNA 2BBYA 4HAMA 3MWMA 5D8LB 4G9YA 4LLLA 3VB2A 2MLGA 2L02A 4HYEA 4KIGA 2Z33A 2IVMA 5TRDA 3LQRA 3BZ6A 4Q48A 1J0RA 3T5XA 3ELKA 4IPAA 4FHTA 2HYFA 1ZG3A 1B1BA 1GVJA 2R7FA 4JK1X 1ZG1A 3L00A 1SD5A 2EB7A 2DTRA 3GW2A 2O6GE 1ZRDA 2OBPA 3J81Z 3W7UA 3ZQ7A 3W7WA 1LVAA 1XCBA 2CGPA 2Y0MA 1IF1A 1O3TA 3R0JA 4B09A 4KIFA 1ULYA 4U0VA 3N4MA 2FQ3A 4RB3C 2RGVA 1B59A 4HQMA 4YIFA 4EGYA 3DPTA 3MCZA 4BQAA 3M1EA 3MAJA 4YIIA 2NNNA 3ML6A 3KZYA 2ZMEA 5CVVA 1HW5A 3WG9A 3V8KA 4LGWA 4CXFA 1FNNA 3WU0A 1IZ1A 4O3MA
chains in the Genus database with same CATH superfamily
4JI7O 1NG7A 3BAAA 3QU3A 3F8BA 1IRZA 5LP6C 2H1KA 1GUUA 4UXNA 1H2GA 2L9SA 2VUMJ 5F2VO 1K83J 2WV1A 4JP0A 5IJ9B 5E8GA 2QSAA 1JVMA 3PUBA 3H1KH 1MJAA 3QYBA 2RDCA 4P5OA 3KPHA 1HKSA 2ELHA 4L5EA 3SYPA 1VQ9V 4GT1A 4DW0A 5IWAB 2DBBA 2YX7A 1L0NH 4CO8A 1BCCH 1K4TA 2N8GA 2FNAA 3HKBB 4PDRA 4JAAA 5BY1A 3VFZA 3CO6C 5F27A 2AZ0A 1R4MB 1XMQO 3CDIA 1T08B 1HKTA 5KNLA 2UUBB 4LWSA 2L3DA 3CX5F 3D1NI 4IKFA 3DLAA 2VB6A 5J2TA 2VXDA 3ASOH 1E3PA 3GWKC 1VQOI 4LF6O 2VWJA 3CMYA 4AI8A 3J7AU 1OYIA 4OMYA 3ZCCA 3GTGJ 1P7IA 3U1DA 5B3SC 3LAJA 2GXBA 1BIBA 2OPTA 4MFDA 2GTSA 1GXPA 1BZKA 3I59B 1T38A 3GTKJ 4FMTA 3QPLA 3S3WA 4Q47A 4BXFA 3VWBA 1JPXA 2JIZG 5CVIA 4I4TA 4H0LB 4FLXA 4ESBA 4G12A 1B4AA 3SQNA 4IX7A 3ZBHA 2DMUA 1J5YA 3AFHA 1NK2P 5FPRA 1AOYA 4DRXB 5F08A 2D2CB 3TGUH 5LHHA 1Z6TA 4DBRA 1DU6A 3FXMA 4G6TB 1QO0D 3H5AA 1BQZA 1I6XA 1Y0NA 2RNGA 4Z2YA 4JYKA 3HOUJ 1NR7A 1Q6UA 1YDXA 3I9V2 5C4XJ 3SYAA 2WB1A 1S29A 1YZBA 2FD5A 1HP8A 2WAFA 4P9UA 4F3QA 2DWDC 4FFBA 5KHJA 2WA3A 2XOKG 2PYLA 1E1QG 1AB3A 5DTDA 4B4CA 3CCVI 1GN4A 5F6FA 3G2BA 2ZIMA 3RQ4A 1QBJA 5H2FZ 3CEIA 4MTFA 3JD0A 1T6SA 4XONA 3S3XA 1AR1B 1MZFA 3OTOO 4DR5B 1GO3F 4PV1B 2K4JA 1O3SA 2OTLI 2L2OA 2O0YA 1YIJV 1ON1A 1Y8RB 2IGOA 4DOZA 5K1XA 2ARHA 5KLVH 3E22B 1VQMV 1MKMA 2HOTA 3VYTB 2COBA 2NRAC 1RNLA 2LBFB 5BQTA 1DLBA 3S2DJ 3A0BZ 2TCTA 4B1RA 4KMFA 3E7LA 4XRSG 4II2A 4NYKA 5EEAA 2R9RB 4LF5B 1Y6IA 1GM8A 1G2HA 3UM7A 3MFKA 1NI8A 3RI4A 2X1DA 2Y4TA 3UKMA 5IJ0A 3HJEA 2IS6A 3FYIB 1FC3A 1KU9A 2DODA 3LSIA 3N97A 5B1OA 4F6RB 2BZTA 2CH7B 2JEXA 3OR6C 4A0XA 2QUFA 1B8IA 3CP1A 1NTMH 2ITCC 1I0HA 1YF2A 4FE4A 3JD4A 5LBQA 2CQQA 3JRDA 1RP3B 2ZD9A 3A8TA 3ABKB 2M8GX 3AG1B 2X0LA 3BABA 3WHBA 2IS1A 2PJRA 4PI0A 1X4TA 2XGEA 1SA0B 1LPQA 3FKJA 4XSZF 2P06A 3RKXA 2VS0A 5JQGA 2ETHA 3D8CA 2L9NA 2Q9LA 4GYCB 4P9FA 3JRCA 3CMEI 2F43G 4WFGA 5HFMA 4RQEA 3E8GA 2Y0SN 5J2UB 1SFEA 4RM3A 1YITI 3TO7A 3CCJI 5B5EC 1R1UA 4MQ9F 3L2QA 1I1GA 1X2MA 2ZNZA 1ON2A 2X6OA 3DEUA 3R4KA 1B72B 5GW7A 3STLC 1HW7A 3CO7C 2WAQA 3LL7A 5HS9A 2WWYA 2VL8A 3OMAB 3HGGA 1FJGO 3J80K 1Q1VA 1PPJH 4N9IA 2F66C 2LFRA 2X9DA 3IC9A 4LOCA 2KIUA 3I5UA 1SAXA 4IRIA 1GLNA 2YSUB 5LD2C 1FFXA 4LG3A 4JPRA 2QBYB 4O2AA 3TW6A 4HNTA 3H0DA 3O2PE 2RQQA 1FTTA 1UMQA 1HC8A 3ZS8C 4XLHA 3K08A 4GKJB 3H3UA 3O6BB 1D2DA 3BG9A 4HQEA 3ZMUA 2DAOA 2L9VA 4EVIA 2P4WA 3H9JA 1UHMA 5K1PA 3Q0VA 4BJ5C 1WI9A 4AD9A 1ENVA 3IH3A 1NU1H 2IJKA 1DF4A 2JGDA 2M4KA 4QTRA 3BJOA 2E7XA 5KAIC 1JHHA 3LSKA 4PJLA 2DDAA 1K9MW 2NS7A 4JTCB 4HX7A 4KP4A 2VJJA 5KA5A 1DGRM 2OCCC 3G6BA 5EZYA 1U5TB 2OV7A 2ZINA 1QVTA 3LSRA 1I94O 3TW7A 2BTOA 1QPIA 2BEOA 3APQA 1KYWA 4DV7O 1XL6A 1VQ5I 3BPZA 5JVTA 2VQCA 2OU2A 2HFHA 3H1CA 2A6TA 2X51A 3W6KB 1VQPV 3FHZA 2A7WA 4AYBN 2WBMA 1ZLJA 2R5ZA 2PMZN 3JSLA 3RZOJ 2LW7A 4XDJA 2XVCA 1CF7B 2IRFG 1T8IA 3CCYA 4PCQA 2R7VA 2XB0X 1DF5A 1DUXC 5D5PA 4X20B 5D5WB 1O4XA 1F23A 5D5UB 1MA1A 5CA1B 3T1YO 5L3EA 1RPOA 5BMVA 1A32A 1QCEA 4X64O 4YRVA 4DV1B 2J5PA 3K4NA 2F5FA 3EVKA 5IJ9A 1UHWA 4UCVA 4LFAO 1F4KA 5L3CA 3GXOA 3HPLC 4FASD 1S0VA 4A3MJ 2E2IJ 2N04A 2PEXA 1QVUA 3B8NA 4DR3O 1TT5B 4MTXA 2V1NA 2ID3A 3HB9A 4P2ZA 4AHCA 3ZHTA 4DUZO 1UPGA 1KBHA 4DXWA 1Z91A 1IAWA 2OWOA 4DW1A 3FAVB 1YJNV 1DTOA 1O3QA 3EUHA 5B1AH 3CUQC 3ONQA 3HKZA 3ASNC 3ZQCA 2YU9J 1K4CC 3ZOBA 3I54A 5HOOA 2CE4A 5D5XB 3WTTC 4LFCO 1MSWD 3DKWA 1SD6A 3SYTA 2L9RA 5H20A 1HW1A 3L70H 5EIBD 5AIPA 2R70A 2AO9A 3LSGA 4X66O 2KHMA 1BM9A 1P4WA 5H2FC 1LNWA 3BR2A 4HPQA 3PIOF 1VQLV 1ZG5A 1R3JC 3TOAA 4HNAA 3SPCA 3SYOA 1R5ID 2W6IG 3FWEA 1SRYA 2VJIA 2Q7GA 4LCUC 2I8DA 4JAVA 1P92A 2HEPA 1IXRC 3L7WA 3VYUB 3A0BC 3LSQA 2YU3A 1Y66A 2WLIB 2KISA 1BR2A 2P0WA 2JA8J 5E17F 2QTOA 2O61A 5FL7G 3J81K 3QPTA 1BT8A 1R6NA 2RKHA 5L3FA 2BTQB 2QM4A 1MZBA 1AILA 1VQ8V 2VLAA 3S17J 2LY1A 3Q4HB 2KT0A 1G3YA 4B3AA 3QODA 3HXLA 5LGNA 4PDLA 3HSRA 3BROA 5J1RA 1WLEA 4MVSA 2Q69A 1R7JA 4B47A 2IS2A 4FLYA 4QIWN 4M6YA 2H8RA 2DJIA 2NOGA 2XF7A 2ZKZA 1JR9A 1LE8A 1HXDA 2Y69B 2IU3A 3VOEA 2DJNA 1E1RG 4YY3O 4XNFA 4A3EJ 2P7VB 3CC7I 4A12A 5KX5A 2LR8A 3VSLA 2ZDIA 3JASB 5IDJA 3RPUD 5TJJA 1XS9A 3IAS2 2VKHA 1MSDA 1OKRA 3GO5A 3HOWJ 3CZ6A 3U1KA 1Q6HA 1Q1HA 4MTOA 2GV9A 4YHHB 1PNLA 2E1CA 1ZAOA 4UFZA 4D0PA 2GOMA 3CESA 5E3NA 2J5OA 4I0AA 3GMEA 3K79A 4PUSA 1EV7A 2M8EA 2XSDC 1EZJA 3UO3A 1T98A 3ZHVA 5JVDA 3F8FA 2L5QA 2CH7A 4WFBV 5LMUO 3BR1A 2HKXA 3E2EA 1N33O 1EH6A 4D5FA 3CCEV 4I6ZA 2M2EA 2M7AA 4LF8B 2EINB 4B44A 5EBMC 4I01A 3RYHA 1SA0A 3ETEA 3JALA 5KAFZ 4GYGA 5KHDA 4A6DA 3JRIA 3I55I 2B9SA 1US6A 4KL1A 1ETVA 3NRVA 4MIMA 1D1BA 2R7ZJ 1KB9F 2LK2A 3U21A 4XL9A 1ZKGA 1VTNC 3DC5A 5CKTA 5FD5A 3CTAA 1TUEB 5J2UA 4XM3A 2W25A 3DP7A 2JA6J 5B1BH 5FGMA 4DJAA 2NVXJ 2A79B 4BYYA 3T1HO 2FMLA 4LF4O 4L0ZB 3QOPA 2VC0A 2F4VB 2EJ7A 2MYSA 3H1JH 3BTCA 3DKXA 1B72A 1THZA 2TRTA 4LF9B 4KHPB 1O9HA 3PNYA 1IN8A 2WA0A 4A2UA 4E4HA 3ZQIA 2HEOA 3M7MX 4PA7A 3G71V 1RUNA 4RAGA 2DT7B 1ZH5A 1KZHA 1Q86W 5FKMA 2R7OA 2QBYA 5K5OA 4DYLA 2DMTA 1GH6A 4FLZA 3K2AA 5C3EJ 3MKYB 2Y0PA 2ADUA 4XDKA 2EQRA 3VBBA 1HR0B 5FNVA 4XLAA 3LFUA 2K40A 4Y52J 5EIBC 1YIOA 1NVPD 1RSOB 1X1DA 1BI2A 4LFBB 2KMUA 3D5RC 3RWRD 1IBLB 1VQ9I 2CMPA 4RMNA 3OGIB 3R66A 4RWUA 2M5WA 3OGCC 2WTEA 3GTJJ 3AG4C 1G1XB 2UXCO 4D7TA 4M9XA 4R50A 1NH2B 1F4MA 4OAZA 1IJWC 3EDPA 1IBMO 3CDLA 4AVZA 3JRHA 2ZJPF 2VC1A 3IUOA 2HP8A 2CFXA 5DS9A 1F51A 2FB5A 4HG2A 5M5YJ 3BG3A 4XKCA 2G38A 2P8TA 3E83A 2HDWA 2E1MB 2QKMB 3LFKA 2OF7A 3LSMA 2DI3A 3E0JB 3E5UA 2RAEA 4YEJA 2FQ4A 3OS0A 4DV3B 1G3SA 3GFJA 4UUJC 2W0FC 3ULQB 4ZC3A 2KIFA 3EYIA 2EBOA 5LMNB 5F0FA 4BE0A 4X20A 2I10A 3V8LA 1U96A 3H3ZA 3MMYB 3OMNB 5CA1A 3LSJA 4JI6O 1YS6A 4B3SO 2V1DA 1Z9CA 2P81A 2XV4S 4MVOA 1JUSA 2DMPA 3I0TA 5M3FJ 3RPUA 3C3TA 4K2EA 5JHFA 4O4JB 1RIOH 1L8DA 2XAHA 3G3ZA 3VQVA 2XUBA 2EFPA 2DFIA 5LOVB 3C90A 2DOAA 4N9HA 4ON0A 2JS5A 2A5WA 2ZFWA 4R79A 1S5HC 1AA7A 1B9NA 5JCOA 1XNQO 1REPC 2IP2A 4LG0B 3L1PA 3S2WA 4A5NA 3HHHA 4E70A 2EIMB 2CUZA 3X2QB 4GFBA 1BL0A 1AVMA 1U8RA 3VYSB 1P2FA 5E3LA 4UCSA 3GB7C 3JATB 3CMAV 4DUYO 3Q3SA 4A6EA 3OIQA 5CQEA 3U11A 3ZHUA 2ZM6O 2LOOA 3T8TA 2ZE8A 2RDPA 4AYBA 3CYOA 4YELA 2PMZA 4ZJZA 1YIJI 1VQMI 3CCVV 2ILMA 2JRIA 2LMDA 2ODMA 1A6IA 1OISA 3AG2B 1XMOB 2FMYA 2OZ6A 1UFIA 5CLSA 2KJBA 4BU2A 5A2QZ 4XKBA 1K4DC 1YS7A 3GWOA 4OXSA 1QR9A 1TZLA 1EH8A 4UV9A 1CQTA 5IP6A 3IV5A 3DTKA 1XC5A 1XGSA 4DR6O 3ZPLA 1KC8W 1JGSA 2CTRA 2W7NA 2XAUA 1YG2A 3U0ZA 1TUBB 5GADJ 4DR7B 4KFCA 1WHUA 3OYNA 3W7TA 2XRLA 2BW3B 3MD0A 1U0JA 4DR2O 2E7WA 1K92A 3PFIA 1QLEB 2DA5A 1R49A 1J75A 3P9IA 4Q6GA 4B7KA 1BSMA 3KYDB 5E18F 3K5LA 1MDMB 3S3NA 4WFEA 3S1RJ 1WPKA 1WNSA 4CZCA 3V7CA 4DR1B 3JSOA 3Q4HA 3PNVA 5EGOB 1IW7F 3BHPA 2VQEB 2XGXA 2GBYA 1IG7A 4TT3G 1OCOC 2PG4A 2HG5C 1D0XA 1VF6A 5LGUA 2VPLA 3LQQA 2Y30A 4UCOA 3J80N 1HWYA 4CH6A 2D2WA 2WA4A 2YR2A 1W0JG 2L6LA 1V55C 2LGQA 2LGWA 1JJ2U 3K10A 2X6YA 1JJ8C 5B1NA 2RN9A 5IT9Z 2HXIA 2V4DA 1KQ9A 3SYQA 4WFFA 5E1XA 1UFMA 5J3LA 5KAFC 2EILB 2DOFA 2YDEA 2E5LO 3MHHC 3K4KA 1H88C 1YO5C 3IWFA 2B7EA 2CUGA 2A68F 3HSEA 4JOMA 1OJHA 4I5SA 3WU1B 3D3IA 1WJEA 3DXJF 3BR0A 5ILUA 1OCCC 1T0FA 4NDLA 1VP7A 2ZE6A 4DV4O 1T0FC 4I7HA 2R4GA 2F48A 4EJUA 4Y15A 5HNFA 3Q0UA 4B43A 4JI1B 1FX7A 4FZ1A 5LYJB 1BC7C 4C30A 2B9ZA 2Q67A 3DXRA 2KP6A 4F6EA 1B6AA 3U2RA 1YI2V 1IC8A 1VQ6I 4ZYDA 1OCRB 3CCLV 4FT8A 3SR2C 4FE7A 2O5RA 1YYVA 2ZE5A 3KLOA 3DBLB 2DA1A 3LNQA 1V5GA 2G0EA 3LNNA 1IDZA 1SD7A 4J00A 2QKLB 2VONA 1D5VA 3OYDA 2KQRA 4LIUA 1CP9A 1FXKB 1VQPI 2R7QA 1HW2A 2ZXHA 2YUAA 1ZGJA 2ZNJA 4GKKO 2G7HA 4TUYA 2QWNB 1SZXA 5LP6A 1YTFB 2EX3A 2IA0A 3E5QA 4JTDB 1T95A 2CWEA 3WGGA 3ZR8X 3J7YJ 1ZRFA 3AEIA 1GV2A 3FB8C 1R36A 5KK1A 2P6TA 2JEUA 3GLXA 2ZR3A 5EG0B 2V9PA 4LJZF 4OX9O 3CLQA 1VF7A 4M73A 2K4BA 4C3HJ 1HCRA 4JI8O 2HJDA 3E35A 3QYFA 2VKVA 1IXSB 1VZ0A 3ERED 3UT5B 1M1EB 3DBRB 4XLEA 3OYIA 2HQAA 1JXSA 3L9FA 2ISZA 2ACJA 2QSHX 2IH3C 2P67A 5IE9A 1ETKA 2HJFC 3E86A 4D7SA 2OCEA 5FLXN 2ME0A 3OYGA 5FRMA 4WBNB 4C7UA 3AG3H 4C2MJ 4LB5A 2UU9O 4BDYA 3HOYJ 4M9SA 1X3ZB 4DV5B 3H36A 4R7CA 3TJTA 2PF4E 2KJCA 3BTLA 2DYRC 2L35A 3A01A 4LLGF 3ASOB 1OFCX 2JPCA 2AXTZ 2QM7A 3JW4A 4D6TH 2EIMH 1DP3A 1SQQH 1ACIA 2Q0OC 4GO1A 4G6QA 3H1IH 4BGDA 1K5QA 1FYMA 2UWMA 2Q0AA 1R1BA 4UB8Z 4LLNA 1RR8C 1KKCA 2JRTA 2E3CA 4D7NA 1MZEA 4B3TB 1SVOA 1ZARA 1FFTB 3QO5A 1HNZB 4BIOA 4HX8A 1VQLI 2HDCA 2FOWA 1Y56A 4UUSB 5ILSA 2MH9A 1YRNA 4L18B 1I5YA 4EJWA 4I55B 1FKAO 1WVRA 2DA7A 1Z6RA 2IEKA 5AONA 2GM4A 2DWEC 2QWRB 3K3WA 4O4JA 3FMSA 3WTVC 4XRMA 3GTOJ 3GZNB 2YX4A 5LOVA 2R7TA 2R5YA 2B63J 1Q82W 1JCHA 2OC6A 1N34O 1FMWA 5D4SA 4YIPA 1FXVA 1K6OA 3ZMZA 4RO2A 5ITZA 4LG0A 4JI3O 2JS3A 1VQ8I 2HHHO 1FY7A 2W0XA 1H2LA 3I4MJ 2QKAA 1QRYA 1FT9A 2EZHA 1TVKB 2EZPA 3P5JA 3NEUA 4YJ2B 2ZO4A 5HDGA 3E89A 3B6CA 4UY8I 4B8XA 2HQ5A 2XUMA 3P32A 3ZMVA 5LLQA 4CCKA 4X0GA 4J42A 2BXYA 5IY5H 3L09A 4F7ZA 3JSNA 1XNRB 4CICA 2P4KA 1JKOC 4HV5A 4NUBA 4KITB 2RCVA 2YICA 1DGSA 2JUGA 3G67A 2EULA 3C2HA 1NKDA 3K0LA 5LA6B 1ITYA 5LEJA 4P9OA 3SJAC 3HOSA 1HLVA 3BPVA 5IWAO 4NC8A 1DDNA 4UVBA 2P4VA 1BW5A 1KP3A 2F1MA 5IP7J 2FBKA 3KG2A 3WB1A 3K03A 1RC9A 2X6BA 1WAZA 1Z3XA 2IXSA 3Q5FA 4YJ3A 2LY9A 4NXNB 2UUBO 5HLTA 2MGQA 3S1NJ 4CCOA 4GZRB 3CP8A 3LWFA 3OOPA 1MSFC 3F9KA 3R61A 2R3SA 2BW3A 4PFOA 1APLC 2A3QA 4FTHA 4GXOA 1IX9A 2F95B 3CCEI 4DGWB 3THOA 4EKWA 4PJNA 3K1MA 4GX1A 1MDMA 2UXNA 1SQBH 2EIKH 5EYRA 3K1NA 2LF7A 4FX4A 1SQXH 1XEQA 2Z0AA 2OAZA 1QA6A 3DC6A 3OS1A 1AHDP 4R8CA 3B8MA 4LNUB 4E2LA 2VJ4A 3HSFA 1VI0A 4A3CJ 2EV6A 2Q5ZA 4O4IA 1SC5B 2WY8Q 2CG4A 5EYPB 3JSPA 3ZRWB 4MVUA 1BBYA 3NWTA 1LUWA 2VQGA 2F5DA 3E3VA 1BR1A 4HZ3A 4WFHA 4M9ZA 4A5MA 3WTWC 1USSA 4XLNF 3FB7C 5GONA 2XHBA 3TL4X 1ZN2A 1F5TA 1NR1A 3G80A 2RJZA 4XLCA 1ZX3A 1IN6A 1KU2A 4HOBA 4GUNA 1W4MA 3D0SA 4XQFA 4HNVA 3VPRA 3BY6A 1L0OC 4K8XA 1PJRA 3E6BA 1ONVA 3BG7A 3HRMA 2F23A 2DJVA 3AL0C 1F36A 2JSPA 3ISPA 4D5CA 5DM7F 4RBOA 1XTAA 2E2JJ 1SANA 3K58A 1K61A 4B08A 3JAMN 2K85A 5LYJA 5KAIZ 4QPQA 3HKCB 4LR3A 4IHYA 4DR5O 4RM2A 4HDVA 1S3JA 1BMFG 3SZPA 3FMRA 4ICGA 1JA8A 2HVSA 3QPHA 5CB4A 4M3EA 4X1KB 3S16J 4CYDA 3OL4A 1NJIW 1ZK8A 4XICA 1J9IA 2PMUA 1K78A 4GX5A 1D0YA 3D3QA 5M5XJ 4LF5O 2FNPA 2LKSA 3MKZA 4FFKA 3GFIA 1B3QA 1Z05A 1TC3C 1ZUQA 1S7EA 4LP8A 5B3SH 1YEWA 1P4RA 1M5IA 1MH3A 3P30A 5CVJA 4IRHA 3OR7C 1FBSA 1GVDA 1MIJA 2JT1A 2FJ1A 5ERIA 5D6FA 3MKWB 5BPIA 1HBXG 3CUOA 3F0CA 3HHGA 5E79Z 1DPUA 3M8AA 5KMGB 3HTUA 1MMAA 1LJ9A 2F5EA 1R1TA 2DYSC 4I50B 3K5MA 2AXTC 2KZVA 3MD2A 5EG0A 1JT6A 2HOAA 1OR7A 1XILA 1M93A 1TWGJ 3WGIA 1XG1A 2YEVA 2F5CA 1X1PA 4XR6A 4BAYA 1H9TA 3WU2C 4IHVA 3HGYA 4AIJA 4H13B 3RZDJ 4UB8C 1FSHA 4QE7A 3EYYA 4WCEV 3KIOA 3ABMC 4QJFB 2EZIA 3FFQA 4I9WA 4LF7B 2R7UA 5E1ZB 1ETOA 3FHNA 4O4LB 3I4NJ 1WPBA 1ZL8B 2CV2A 4TQFA 1IZ3A 4RB0A 2IA2A 3BQZA 1PNMA 1K34A 4IGGA 4WBNA 1R3IC 5IYZA 1S6LA 2EA2A 2K7LA 3RTRA 2GXAA 5A2QK 3CMAI 4RGRA 3LMMA 2L01A 1BC8C 3IH2A 1OLTA 4MNUA 2YI8A 5EK0A 3JARB 5B1AB 4PA4A 3WG7B 1YJ9V 2BOCC 1UJWB 1BGYH 1V54C 4U7OA 3HC7A 1M1KW 1HSJA 2ZXWB 2P5OA 4JGSA 2XDVA 3M4OJ 3HRUA 2NR5A 4L9VA 2MG4A 4E6KG 1R73A 3ECHA 2NAZA 1XCVA 4D9JA 1AWCA 1XDCA 4DV6B 3SDGA 1JTXA 5FLVA 2DA6A 1OYWA 1R00A 5ED4A 2ID6A 5ILVA 2W85A 2JA7J 1FSEA 2QTSA 4I55A 3SJCC 4DBQA 1E2XA 1Z2GA 1R22A 4BW9A 1H2SB 4KISA 1UJ8A 2CO5A 2FKXA 2V1XA 2PI4A 4BR6A 3R0AA 5DEDA 2KRHA 2HS5A 4O2BA 4PD4F 3T1BA 2MK3A 3CD6V 1PKXA 1D0ZA 1TWFJ 4BBSJ 3DV8A 2LP7A 4U3JB 3WE3A 1H2MA 1XOUA 3I58A 4CC5A 2E5NA 2EFOA 3OM3B 1SFUA 3HBLA 3JCUZ 4NQWA 1UAAA 4E7ZA 2F4MB 2FUG2 4YJ2A 4KICA 1WJ5A 1YW7A 4IJAA 3CCMV 1KECA 2VBYA 4YFNF 2H6BA 5IYCO 1NK3P 1X3WB 5DCMB 5JH7A 4HNUA 2E1OA 2DK5A 4HF0A 4Y7NJ 3OYLA 4EM2A 1IGNA 3M99B 1XSDA 4TV9A 3CC2V 1EH7A 1P84F 4NBQA 3TKYA 3LSSA 5CA0A 2QLZA 1XD7A 1HQCA 3MKLA 5FKOA 1Y0UA 1RUOA 1XMQB 1HOMA 2FOKA 2VBXA 3F72A 5D4RA 2CUFA 3E8FA 5LA6A 1X1AA 5LHIA 4BXXJ 1FYJA 4G28B 4G6DA 3JAWB 2K02A 4O5VA 2NOJB 1LFPA 1ZGWA 1JOYA 2H3OA 2LYCA 2M1BA 4YG2F 4BWAA 3F6OA 1CXZB 1LDJA 1UHSA 3H92A 3KP2A 2ETNA 4I0XB 3JTHA 2GUZB 5C8YA 4CH3A 4L9TA 1YHQV 4ANJA 3F23A 5CBFA 4JYAB 1FOWA 3M8JA 2NXNB 2NVQJ 2YXLA 1RRJA 2MLKA 2HZTA 5DUKA 2XT9A 2E71A 3UCSC 4FM0A 1YI2I 5BNGA 2M30A 3L75H 1MMSA 4AVPA 1O7FA 3K9SA 3CCLI 1BQ0A 3K69A 2W1OA 2OCCH 4BE1A 1BI3A 1GDTA 2R7SA 1YVWA 1M56B 5JR3A 3K4MA 4E7SA 2DN9A 2EFQA 3PL8A 2P7TC 2KIQA 2V7FA 1T39A 4Z6YA 4IIJB 1JUMA 4K35A 5CVUA 1EM1A 3OW2U 1X3UA 5B1BB 1O3RA 1ZR2A 4D7MA 3N2KB 3CCUV 4AC0A 2WV0A 3P3PA 3L2CA 3ABLB 3JCZA 3PM1A 1W36D 4ZI7A 1R4NB 2KKOA 1MNDA 5DDGA 3IFXA 3HKEB 1PP9H 2XAGA 3DQVC 4L9NA 1MW7A 1SFKA 3EQLF 1EF4A 4WK8F 2GA1A 4Q5SF 2P6SA 2DT5A 2RREA 4FLWA 2MSYA 3H1LH 2JA5J 1GT0C 5EEGA 2M4GA 4IXAA 3FXRA 1PYVA 1X58A 4BEHA 3ZRXA 1XN7A 4K8ZA 2N74A 5GTIZ 5E79C 3S32A 3EUKL 2QKSA 2ICWG 3BA9A 1MSEC 1JMKC 4HLXA 1X59A 1IRGA 5E3MA 1QR8A 2WAMA 4JI0B 1UZCA 1KU3A 4KUMA 1M57B 1HKQA 2R9AA 1JFFB 5K5QA 1D5AA 3CRAA 3ASNH 4QGPA 3AG7A 1XPXA 2A05A 2JVDA 1MD0A 2NYXA 4WXHA 1EN6A 1M4UA 2G7UA 1T5EA 3HKBA 1S72V 2RNJA 2LF8A 2GQQA 4V19K 2HLDG 4DV0B 3K59A 1QNTA 2H27A 3ZQQA 2YIDA 2EV5A 2GXGA 3EUHC 3KP7A 3J7AY 1HDPA 3U9GA 1AKHB 5FRNA 3BCBA 3WG7H 3FKSG 4FZ0A 1K8AW 4E7HA 3SZGA 2CH0A 1J59A 3BG5A 1MMMA 1PUFB 2ZXWH 2GSMB 2HVKC 3E6DA 1FBUA 3KE2A 3OUSA 2HPMA 1YW8A 4LF8O 2Y31A 4IQ4A 2JTVA 2X85A 3ZRGA 4HSRA 5FKNA 1FZPB 1TTYA 3I59A 3SXYA 1U9NA 2AGAA 2XPVA 2P90A 3B40A 3CC4V 5KMGA 4IQJA 1E3OC 4PA3A 3EFFK 4BHPA 4RAZA 2W24A 2W00A 1VFCA 4CHUA 3WHCA 2YIBD 1LEAA 4XLFA 2W4SA 1SS3A 1D1CA 4G8XA 3GZ5A 4N23A 3L71H 3KZZA 3OYAA 4HV6A 4DRXA 1SESA 3RVZA 2DO7A 1N4CA 3FYEB 1FMVA 4NNJA 2F4VO 1KYOF 1VF9A 2DXIA 1GM9A 1WJDA 1JKRC 3F3XA 4ETSA 3IRRA 1I5XA 2FXAA 4LF9O 3QP5A 1OHHG 4J7ZA 4KHPO 3ZMDA 2PZSA 4GCVA 4M6XA 5TGTA 4GX2A 4WCGA 3S15J 2CU7A 3F8MA 1TW3A 1K5SA 4PA9A 3ABUA 3UNGC 1GK9A 4YFXF 2QQ9A 2ATKC 3ZRVA 1U6GA 1QQIA 3JD3A 4ZZDA 2HXOA 4ENNA 3OYCA 1ETXA 2K9MA 2KB1A 2JZYA 2ZNYA 2YXHA 1HR0O 1MH4A 1IO2A 1R58A 1W7PB 2DA3A 2QGUA 2ZJ2A 2WLMA 3O65A 3RYFB 4K0KB 1W0TA 3I5DA 3ZQLA 3U10A 3JCUC 1F1ZA 3OV8A 5DCFA 4FVMA 4NXMO 4W4LA 4LFBO 3DWLE 3LSPA 1URFA 2LKPA 3E22A 4MO7A 4H0EA 2ZDIC 1PVEA 2LC2A 3ZMSA 4B3XA 2LBFA 4CUGA 4ABMA 1BI1A 1QVFU 3FXKA 4S04A 1Q5OA 3MAQA 2CFOA 2W57A 4KIBA 1G4DA 3T0YA 2AW9A 4XDLA 5EEHA 4TSFG 5J9PC 1TA8A 5EBWC 2XC7A 4QNHB 5DN6G 4FLTA 3OR2C 4JAUA 3IAYA 2GTAA 3PIPF 3A2FA 3DKYA 3K1PA 4XLPF 2X6XA 3DBHB 3LA7A 3M9AA 4HDUA 1T33A 1V4RA 4E7JA 1W36C 2GAUA 2Q8KA 1NHAA 2ITDC 4U0YA 5H9CA 4Q4ZF 4F6RA 4X1YB 2V6EA 3T1YB 2OZUA 4I98B 3FXQA 2D3OW 4X64B 1CGPA 3NXSA 2DMXA 3B2EE 3E6MA 5AIQA 5FPOA 4DV3O 3GVMA 2VN2A 1IXCA 5LMNO 1JJ6C 1L1FA 3ABKC 4CYCB 4L9JA 3AG1C 2XF5A 4F92B 1H8EG 2RC4A 4I09A 2ZCEA 5DCMA 3V7RA 1H8AC 2XASA 1FOKA 3S14J 2YPRA 1FS0G 5CVRA 4U3FH 3IKVA 3K57A 3OL3A 2QEXV 5H6RA 3TP3A 4QLCU 3HOXJ 4IL6Z 1HDJA 2QGNA 3SPIA 3H0GJ 1RI7A 3QU6A 3K70D 1IDSA 5EBLC 1S7OA 2Y0IA 2HQRA 4X65B 1N8RW 3JAWA 2WWWA 2KG7B 3B02A 3V7SA 1NH3A 1BA5A 2GDSA 4EB6B 3HUGB 5K7ZA 3ABLH 5IYCJ 4MEXF 2H1LA 1W5SA 9ANTA 2ADPA 3K5NA 1WA8B 3TK1A 1K6YA 4JV5B 5LXTB 2Y2ZA 2Z9OA 2Y4UA 4HYOA 4ZDPA 2RNBA 2UZKA 2X48A 3CRCA 2PMHA 1ZGAA 3LAPA 1JX9A 5GTHZ 4LK0F 1F9NA 3CQZJ 3AG4H 4MSWC 3OWTA 2ZCWA 1XSVA 1X2NA 3GX4X 3A4CA 1MBHA 4CA0A 1PNKA 4EMSA 2WLKA 3D36A 4UCTA 3SGIA 3RYCB 1XMOO 1FP1D 1W7PD 4L5JA 1N32B 2EK5A 1G6UA 1MJ9A 3N2GB 5ICGA 3JRBA 4MW3A 5J40A 1J2XA 4ZYGA 2YIBA 2EV0A 3FISA 2RVCA 3C3WA 4H4KC 4M3FA 2EFNA 2CV0A 1YE9A 3JD1A 5GP9A 5GTIC 3FXLA 4CS2A 2Y0SA 4BQNA 4MEYF 1JJOA 2QQAA 1U5TA 1U5TC 3W7SA 2OIGA 4DR7O 4LITA 1DGWY 1QHTA 2UXXA 2CRGA 3KFWX 3LDEA 4PJ0Z 1P7BA 3FM5A 4EEFG 3J7AO 4KMUX 4B3MB 2IBZH 3HKEA 5BXZA 4FCYA 1B9MA 3SJMA 1OQYA 4X62B 3CPWU 3WTUC 4HA8A 3B77A 4I7ZB 3MQ0A 1CF7A 4YY3B 4DR1O 3F5TA 3C18A 3G73A 1Q81W 2E5ZA 2VQEO 4J7JA 2IH1C 3PFYA 3S3OA 4B3RB 1MNEA 5H6QA 1RKWA 3E6CC 2JSCA 1SQVH 4QWQA 5J1YA 1SERA 1ORKA 3G4SV 3DGEA 5C93A 4JQFA 3OSGA 1AR5A 4ZYEA 3GFLA 1RM1B 2OCHA 2EH3A 4EJVA 3GWZA 1D8JA 4CCNA 1Q6IA 1FPQA 4M72A 4XORA 4Q20A 4PSXA 4D1QA 2QDOA 4DQ2A 1H2KA 2VBZA 2Q4PA 2E36A 3BOQA 3AG3B 2Q2EB 1JFFA 2M45A 1IRXA 1U78A 3BFRA 5GAEJ 4CH4A 5CN0A 2LSOA 3NQOA 1Q3EA 2QWWA 2STTA 5JCOC 1RETA 3RN4A 2AQEA 1N33B 1XMKA 4L8JA 4WF9V 1FP2A 3G1OA 1YJ9I 1G3WA 2G9WA 5D5QA 2RQ6A 3FAVA 4RS8A 2DFEA 3GVAA 1TW2A 4PDKA 1D1AA 4C3IJ 1IBKB 3AK2A 1AKHA 4JI1O 3FXUA 3ZN1A 3S1QJ 2TDXA 4XRSA 4X1EA 3CJTB 1FOYA 2JWTA 2E35A 3LA2A 4MLOA 1XL4A 4J11A 3KX2A 4EV0A 1ZTEA 2NLJC 1R9TJ 4PDVA 3TBIA 5LEKA 3PJSK 4A69C 2QCOA 1XDUA 4NR1A 3BVOA 1EZVH 1KYZA 1N25A 2VKEA 5CQGA 4OMZA 4WXCA 3DU5A 1WPXA 4Y33A 1F4NA 3H5NA 3G1LA 2QE7G 3CS5A 3OT7A 4LK1F 5JVGF 3K70C 2DE0X 5IOZA 1ORQC 1Z7UA 1W59A 4Y4RA 1G6NA 2IM9A 1ODDA 2EZKA 2V79A 2FE3A 3C7JA 3OS2A 1LEBA 1NH2D 3CD6I 3TO6A 3DF8A 3PO2J 3UO2A 5DM6V 4EGZA 2LP0A 2LTPA 2YSRA 4PJJA 2VXZA 2UUAB 2L7MP 2MBFA 1KQ0A 2PBIA 3M8EA 1KGSA 3WTSC 4ZTFA 1OCTC 1J7KA 1MMGA 2KLOA 2VODA 1L3LA 3ETDA 2IGNA 1GXQA 2BTQA 2UXDB 1ENHA 2IS4A 1LVKA 3O8HA 1V55H 4E4EA 4KJZA 2RQPA 1YQAA 1D5YA 4PJMA 3CC2I 3BP8A 2COMA 2BV6A 5CYVA 3L2UA 5KUKA 2L54A 4P30A 5FKKA 1Z77A 4EATA 5IY5B 4GGGA 3ZIAG 1AJQA 1W7PA 4E7IA 1VF6C 2DA4A 1R6RA 2M0CA 3WGHA 4DW6A 2CTPA 2V7QG 3E97A 2Y69C 3UR3C 4OPHA 2CAZC 4RAIA 1IBMB 1YLFA 2E60A 3N05A 3JASA 2DQRA 4AWXB 4BHCA 4XN0A 4JYCA 1OCCH 3D5SC 5C44J 3UKGA 2M7WA 2K9LA 5HVQC 1G4YB 1BJAA 3S8PA 2Z2SB 4DV5O 2PJPA 3T4DA 3EETA 2EFWA 1YHQI 3VYRB 1K79A 2YIAA 1X1BA 4X1IB 4NXMB 1TQPA 2QYOA 4IL6C 4RLFA 1LFUP 4GLXA 4I9QA 1FLIA 2ZBKA 2OTJV 5EZHA 3SYCA 2BVLA 3BJ6A 2WAEA 1YTYA 2JUCA 1K3EA 2EIKB 2P22C 1W0KG 1AU7A 3FIWA 3RKYA 2B0LA 5GAHJ 1H0MA 3BZKA 3W2VA 1IXBA 4WX9A 2BHYA 1FPOA 2RMKB 1XX5A 3V4GA 2WLLB 1WJZA 4RAFA 3WB2A 2WLHA 5FFZA 1AROP 1FYLA 3JAKB 4B3TO 1R71A 2EINC 2F6CA 3NAUA 1Z21A 4RB1A 3OYJA 3H5RA 4A0ZA 1H89C 4EEQA 1HNZO 3AAFA 3GZ6A 4UV8A 4FX0A 1Y76B 2Q8VA 5GTHC 4GYIA 1PP8F 2WLNA 3ZHRA 4Z1MG 2DDBA 2UXBO 2LREA 3RCOA 2JDIG 2ZMEB 3I53A 4HW0A 3CCUI 3ZGKA 3DCFA 4OAYA 3P7NA 3DTEA 4OWRB 3WTXC 3OIOA 4F91B 2R7DA 2HVRA 1HF0A 4HF1A 3L9DA 3QO7A 3R6SA 5E1AC 3QPSA 1Q90D 1YSCA 2P5KA 2UUCB 1Y6XA 2IU0A 2ESNA 3QP6A 1S8NA 2DQLA 2CUEA 4V2FA 2IGKA 2R0QC 3GTQJ 4MS2A 4EB6A 3HUGA 2LFSA 4BHBA 4JYBA 3BR5A 3CLOA 3S2HJ 5FB2A 4ZKIA 4LH7A 1WA8A 2VKDA 4JI5B 1FTZA 2F93B 3FKIJ 5A9GA 1QPMA 1QZZA 4I2OA 3L2WA 2XKOA 3SFZA 1WRJA 4PJ0C 3J80Z 2FBIA 2JA2A 2JJ1G 1SVLA 3AK3A 1AI4A 1NZ6A 1XNRO 5EDNA 4KA4A 2QR4A 3RYCA 1RSOA 2XAJA 1VEWA 5IP9J 2DT6A 1GTOA 2XGDA 2DYRH 2WADA 1D5NA 3SDLA 1N36O 1QHGA 4NC6A 3K9AA 3HG9A 4J19A 3QRFF 3JRGA 1J5EB 1S72I 2FYUH 1YX3A 2H8WA 5HLHA 2VOPA 4AM3A 2XHKA 2LDUA 2VQHA 5IT3A 1I27A 4A93J 2Q1ZB 3L72H 5B3SB 4BIZA 1OPCA 3HKDB 5BR8B 2MW2B 1FOXA 1USTA 4DR4B 4M3GA 3AKZA 4NB5A 4AIKA 2CTWA 2YC0A 1XUQA 4KFMA 5JLXA 3HL2A 6PAXA 1DP7P 4RGUA 4BY1J 3L73H 2UV1A 1HNWB 2BYVE 2E1MC 3GCMA 3K4LA 4M3BA 2RN7A 5EZGA 3W3CA 1AI7A 4I4TB 3WU2Z 1FWZA 5CA3A 5IOYA 5ICFA 1XMXA 3C2BA 4M6VA 3DEWA 5DD8A 3CC4I 4CSWA 2MFZA 5E1WA 2E1NA 3MEXA 1P4AA 3A1YA 3WTYC 1AR4A 4OIRF 2DLLA 4X9QA 3J81N 1JE8A 2WC2A 2YUSA 2DMNA 4EFEA 4HF2A 1POGA 4U7BA 3VOUA 2Z3YA 3M3YJ 3C2GA 4FFBB 1RFYA 4BXUA 4B48A 2R7XA 2DFHA 2E76B 4A3KJ 2K27A 4KNYA 4UNOA 4ZBMA 3DFGA 3F22A 2XPWA 3LSHA 1ZLKA 1YTFD 2EIJH 2V26A 2EIMC 3M7GA 3K0DA 3QVNA 3X2QC 1FIPA 3IH4A 5FKLA 2O8XA 5KVRA 4L5IA 3COAC 3JATA 1B04A 1E79G 1QHHD 2X1CA 2IT0A 1ZRCA 3RIRA 3V8JA 1U2WA 2FBHA 3I3LA 5F1JA 2W82A 2O57A 1F7YA 4CCLA 4U7DA 2QM3A 3PJRA 2GHYA 1V3FA 4MFEA 3QTCA 5IJ0B 2IA1A 4NHJA 2NN4A 3AG2C 3PN1A 2JRMA 2ZNIA 5FLXZ 5HDNA 1S7AA 4E7LA 2R93J 2MA3A 1WQ2A 1CEZA 3KP5A 2OQRA 2KSDA 5HODA 4U0WA 1B8IB 3BRCA 1SMTA 3RPQA 1TNTA 1BIAA 5ICCA 5HLGA 3OYBA 4A3BJ 5BZBA 4RGSA 2BE3A 2WPDG 5BOXA 1BHAA 1TUBA 4BNCA 4UVAA 5KA6A 4U7NA 1SC7A 1VQKV 4OX9B 3F8NA 3CJQB 4PZJA 4BKXA 1UG0A 4ZH4F 2XROA 1JKPC 4GRIA 4FLVA 4M3DA 1QLEC 5D6EA 4ZTJA 3FBNB 3PSIA 3IHUA 3FB5C 1GRJA 2A0LA 4II3A 1LKXA 1YCIA 5J8CA 3B6AA 3BT9A 3TMOA 5K5RA 4N21A 5HDKA 2LLKA 2KRCA 5EGOA 4WWCA 3ML0A 1ROPA 2VT2A 3TO9A 2BY2A 2AHYA 5DV5A 3ZCOA 3JD2A 1Z0XA 2QEXI 1OCZH 2O9LA 3HDDA 4IOAF 1Y4MA 3CRQA 4YFKF 2L7KA 3QOEA 5L3GA 4G7OF 3CCSV 2LH9A 4LF7O 3F21A 4ENMA 3P9CA 2Q7EA 1MBGA 3PQKA 4EJOA 3NWSA 2LD5A 2HDDA 3KCYA 2CQ7A 2MC4A 4PSWA 1COWG 2EILC 2CSOA 5J47A 1IN7A 4CS3A 2GLOA 1RPWA 3H9QA 4X1IA 1O57A 3D5LA 2X6WA 2FEZA 3VODA 4ENKA 1OV9A 2PGGA 3EXAA 2B5UA 2VE8A 4IRGA 1D8KA 4ESJA 2Q73A 3OAAG 3QO8A 2A69F 4ZZLA 5BS6A 1O9GA 5CJ9A 3CCQV 3W2AA 3CJRB 5F1RA 3LNMB 1R23A 1SD4A 2FA5A 2O3FA 3VEPA 3N27A 5AG2A 5IYBO 4AQYB 4N0BA 2D5VA 2OCCB 2WLLA 2Y9YA 2JK5C 1VF5B 3K5OA 4IO9F 1XREA 4DV6O 2NNYA 3ROUA 2LO1A 2BSKB 4ASNA 4UVCA 1OCRC 3A0RA 2HOEA 5DECA 2CGOA 2Q7HA 1LNQA 3ZHQA 3OYMA 4ZHQB 1AJPA 4XN3A 5HLIA 1SKVA 1N75A 3TP0A 1H38A 1OYYA 2LKXA 5DEQA 4HZFA 1JTYA 4KDPA 1HA8A 1A35A 4DV2B 2DPDA 3GFMA 3BEHA 5L3DA 4J7KA 2DYSH 3OUFA 1TWHJ 1FXKA 2BOBC 4JZGA 4FM2A 1FXKC 5LRRA 2OIEA 2D1HA 1UCRA 1LB2A 4FJCC 1SQFA 5EF6A 5BMVB 1IVSA 3WE2A 3JRFA 3E8BA 4KXRA 2MH2A 3DPUA 3FBIB 2PLYA 1G8MA 1IN4A 4W1UA 1GN3A 1WWXA 3FF5A 3ABMH 4OOIA 2XRNA 3G4SI 4JZ2A 3TXQA 2GOXB 1MG1A 5F0HA 2P5VA 3FM3A 1YJWV 1YFHA 4RAYA 1OR7C 4IYHA 3L74H 1TWAJ 3UT5A 3HM5A 4BH9A 1VIBA 3CCRV 2IJJA 1ZHFA 3TGNA 4KN4X 4S05A 1PV0A 2PUSA 3HRSA 1VQ7V 3VQYA 2MC3A 4KYWA 3I56V 3CUQB 4RQFA 3ASNB 2VQFB 2E34A 3LUTB 1W2BU 3BLYA 1MJBA 1V54H 4JI4B 2KFDA 1BOAA 3ERMA 2E19A 1Y1VJ 2K9PA 3BQYA 1I39A 3MN2A 2L7ZA 3BR3A 3HKDA 5M5WJ 4BACA 2HYJA 1SMYF 2ZKOA 3LOCA 2K1EA 1HNXB 1MBEA 4PGHA 4MT8A 3ASOC 1L0LH 4CBCA 2HR3A 2P7CB 3JAMZ 3L2RA 5L3BA 4C9YA 3NR7A 3QYEA 2VOOA 3GUDA 3BTIA 4C3JJ 1B06A 1VQNV 2CYYA 4BUPA 4GKJO 4A3IJ 2VIXA 4IT5A 3HIFA 3TDZC 4HNAB 3L2VA 3FK7A 4U88A 4P96A 3K0GA 4C2TA 1FXHA 4QPJA 1WZ2A 5LGTA 2HKOA 2QSFX 2DOSA 3W6VA 2NNUA 2ZE7A 4DV2O 3I71A 4UUSA 3ABTA 1T2KA 4NVPA 1Q7YW 1UELB 4WFAV 2ZC2A 5GPAA 5JJNB 3BPXA 1Y8QB 3MZYA 4U87A 4DYCA 4IZZA 1N0JA 4FM1A 2ZR2A 1O7LA 2JVGA 4TV8B 2XF6A 1ETYA 1Z5WA 5BMZA 1STZA 3CMMA 1AP5A 2XAFA 1ZQ3P 1P7GA 1Q8IA 4MW8A 4FETA 3ZXSA 1EJ9A 4NKGB 3VQWA 4MHGA 1GMGA 5J1UA 5IT9K 1LE8B 2HZDA 4GCZA 3KP3A 3IRQA 4JI7B 1LDKB 5KX5B 2FF4A 4A0YA 2L4MA 3BZCA 3GYHX 1ZSPA 4H37A 1TVKA 1NTZH 3SJBC 1PL0A 5E3OA 2F5VA 3H1HH 2Z99A 2ZB9A 4F4LA 1FIAA 5LRSA 1Y67A 1N0NA 5K7HA 4ZDLA 2BE5F 2FTKA 3E8HA 4DV1O 5B66C 4A3JJ 5JFRA 1KQ8A 4JI0O 5DM6F 1JQ0A 2IJIA 2NVUB 4EQQA 1ZLZA 1TWCJ 4DNCA 3OTFA 2X7RB 3OEEG 3TETA 3KYLA 1BE3H 4ZIBA 3KCXA 4RUEA 5JVDB 2Y9ZA 2X6CA 1WJCA 2V9KA 2Z1DA 4IHTA 1XDSA 2Q68A 5IYDO 4LF6B 3CF5F 2OTJI 3ECOA 1I5ZA 3CF2A 4FQGA 1R5GA 2QVOA 1QNMA 4DV0O 1S76D 4OIPF 4X6AJ 3ZHSA 4PFPA 2R72A 3RYHB 2R7WA 2JN6A 2YXYA 3JALB 2XB5A 4A3FJ 2MD0A 1IUYA 1Z1DA 4CC6A 2V6CA 1N34B 4R1HA 4ASUG 2CW7A 1NQTA 1I3AA 1QU7A 3HRTA 1I3QJ 1R1VA 1UB9A 2CW8A 3GBGA 4TV7A 4QPKA 5FROA 2FRHA 3HPGA 3K7AJ 2JQ7A 3VQXA 3W7XA 1MGTA 3GTLJ 2XNDG 4LNUA 1WJFA 1KP2A 1VARA 1BHBA 4J9ZB 2JMWA 3Q0WA 4AIHA 4DZPA 2QWOB 3M1CA 1W0UA 5EYPA 3ZRWA 1JT0A 4KT6A 2M6YA 4EM1A 4ZYAA 1LQ1A 2ELJA 3OIPA 4P1WA 3HOZJ 3IJ4A 3QF7A 3QG5A 1SFXA 2KL4A 4G27B 1NTCA 1SETA 4OPAA 2OD5A 4CZZA 2DMQA 1G59A 1XMAA 1IV6A 1TQMA 4HRIA 2A61A 2H8PC 2R9IA 2M3AA 4B7EA 1H9GA 2XIGA 3FZVA 1PUEE 3AK1A 3CHXA 5FNVB 3OTOB 4Y3OA 4MVMA 2ZT9B 2FSWA 1QZYA 2PX9A 3REOA 5ICEA 4LFUA 2E75B 2R7RA 4Z1VA 4S0HB 3HZJA 2MW8A 4FIPC 4OIOF 4O6JA 1A31A 1RESA 3HPHA 1WH5A 4M71A 3AG4B 1X19A 3LA3A 4RGXA 2BHZA 4BDZA 3A0HZ 2M87A 4ITVA 5DD4A 3B4SA 3HKCA 4K0KO 3F8CA 1I50J 4ZYHA 2Q6AA 4QIWF 2GIVA 4PA6A 5TISZ 2BSKA 1IN5A 2HGCA 3F7YC 4KT5C 4BY7J 1PDNC 4X1KA 1IV8A 3CSXA 4DZJA 3H3VK 3JRAA 4ZHQA 5E8IA 2QJ1A 4DK1A 3HYIA 1GN2A 4DYQA 2HOSA 5IYBJ 4HLYA 2KPMA 4TWKA 3KETA 4YHHO 1IUFA 2CK3G 2V4JC 1TNSA 3OMYA 1GM7A 4IEJA 4F93B 5F64A 2QA4V 5BPDA 2A6EF 2ZJQF 1BW6A 1X4OA 3DSQA 1FJLA 3KEQA 4I99C 4BQOA 5CPRB 2K86A 2XSJC 2YS8A 4RLQA 3FK6A 3JREA 2W84A 2ZIOA 1JHFA 3KZIZ 1Z7LA 2DW4A 2Z16A 4J41A 2FU4A 4I50A 2WLJA 3T8RA 4CH7A 2JJ7A 3CDHA 3ESWB 2W48A 3SPGA 3PQJA 3J7ZI 1BOBA 4J10A 2HTSA 2IBDA 2XGCA 2LQTA 4J9YB 4L0YB 3DLLF 3O9OA 2AXLA 1QBZA 1FJGB 3QWLA 3P9KA 4QPOA 1R5HA 2LNBA 1WI3A 3CWBH 3RVYA 3CUQA 4O4LA 3PNTA 3PUFA 4HX4A 3MZHA 1ZL8A 1NG6A 4X65O 2B1GA 1OCPA 1QVGU 5FLXK 4NTXA 2ZSHB 3EPZA 3OYHA 3IKTA 4AU7A 4KN7X 1R6KA 4XK4A 4JV5O 3K04A 4FLUA 2JVHA 3IWZA 4CCJA 2H94A 1FEXA 3JARA 3RSNA 5KHIA 5B1AC 1I6HJ 3WG7C 3A02A 4ZOLB 2NS8A 2D45A 5IPAA 2IAIA 3O3KA 3TQNA 1PM9A 2FX0A 2ZXWC 5CMUA 1V5FA 1XGOA 1MOFA 2ADQB 2EBIA 1SQGA 2DK8A 4MGRA 2K9SA 3B73A 1BL8A 3CXHF 2NS0A 3RYPA 4K3AA 4DYRA 4OGQB 5J4VA 1N32O 3IP4B 1VQ6V 3HR0A 1I94B 2VE9A 2XPUA 1K7AA 4DV7B 2HQNA 1J95A 4QSHA 3O8GA 4IHXA 1WP7A 1RR7A 3OY9A 3P3NA 2OJED 3FX7A 4HBLA 3LSTA 4W97A 1ETWA 1E17A 2WSSG 2GA2A 4BJTA 1R6TA 3QNEA 1VQKI 1YXBA 1QZEA 4UCUA 4EFBA 4TV8A 5H5NA 3RBZA 1DU0A 2AS5F 3K06A 3I64A 5D5VB 3BC8A 1OCOB 1H8HG 2HVJC 4WF2A 2A3SA 3SHFA 3ZMTA 3ABKH 3AG1H 4IHJB 2L4AA 1Y74B 4B3MO 2K3FA 1MBKA 1NVPB 1NTKH 2HTJA 4F52A 2NVTJ 4X62O 3CXCU 1V55B 3S93A 4U3JA 5KUMA 2LY2A 4MVZA 1XHZA 3S1MJ 4YIOA 2M0MA 1RZ4A 2ESHA 3JTGA 5D8KB 3OYKA 4L87A 3ZN0A 4B3RO 2HVQA 3SJQC 4LFAB 3HOVJ 1WFXA 5EJCA 4XRFA 4ESFA 4DR3B 3CCSI 3F6VA 5FJ8J 4RB2C 1E3HA 4CGZA 1TAEA 1WN7A 1KA8A 2OA4A 4JBAA 4DUZB 1NT2B 1OCCB 3CP2A 5DYMA 1S5JA 1JKQC 1IURA 2A5YB 1S5LZ 2BVMA 5F04A 1KD1W 2VWKA 3CCRI 4RDUA 2P5LC 4LFCB 1Z5VA 3DXRB 1D3YA 1EN5A 5HS7A 4I0XA 3A2KA 4UUVA 3CJHB 4JASA 2LFBA 2GUZA 1A04A 2CDYA 3CCQI 4W4KA 2IPQX 3KP6A 3TOBA 1FD9A 3OR1C 1UG2A 2HNHA 4UUTA 1IBKO 3RJPA 2VRZA 1XQ8A 4X66B 3E1SA 3K9TA 4P55A 4HBNA 2ZXJA 2QWQB 1AI6A 3ETQA 4MTGA 3TCUA 1DK1A 2BOLA 2HPIA 5IYDJ 1GV5A 2Y48A 3CJNA 3TXSA 3A03A 3RKWA 5FD6A 3D36C 2OYQA 3ZQHA 1SZTA 4R8HA 1WCMJ 1T56A 4JI2O 4PDMA 2GZWA 2C6YA 3K2ZA 2X6AA 1FYKA 1M56C 4TUYB 4OU0A 4UHTA 3SFIA 5FLMJ 5LP6B 2PI5A 3A0HC 3TDUC 4IIJA 2CW0F 2XAQA 3ZQGA 2D1VA 5HS8A 1V9PA 2VI6A 2PFBA 3APOA 1U9OA 3IC7A 1TL8A 4BIUA 3R65A 2O7OA 2ELKA 5B1BC 2CQNA 3BWGA 4XKWA 5TISC 2IJHA 1VQ4V 2MD5A 3N2KA 1BN5A 1QLNA 3GTPJ 2IJLA 4IHSA 3Q9VA 3G6EV 3DEEA 5DUIA 3FD9A 2JK3A 1ZELA 1U3EM 3ABLC 2UUAO 1BS3A 4XIDA 3GF2A 2UXDO 1TQIA 2QWPB 1EKEA 4BJ6C 1WB7A 1YJWI 4ABZA 1TP4A 3RDIA 3JR9A 1PL4A 2EJRA 3SZTA 4R6ZA 5A2QN 3OYEA 2EZLA 3H9VA 1WB8A 1OJLA 2BY1A 2CGNA 1P4XA 2QQBA 4X8AA 1VQ7I 2DCEA 2ECCA 2PN6A 3JAMK 3KZIC 3I56I 2DYRB 3RW0A 2VASA 2R92J 2QZ8A 3DTIA 3A01B 4OIQF 4CDGA 4HSTA 4A3GJ 1I1SA 2VQLA 4YXWG 1ZTRA 2GIZA 4LD5A 1M57C 2VPRA 4LC1A 1IXMA 3OE7G 4BQQA 4LIVA 4M74A 4EM0B 1GAXA 1MMNA 1N77A 1RPRA 4UCRA 1K97A 5LMUB 4G7HF 2PI0A 2WLIA 1QU3A 1ETQA 3KCCA 4NC7A 1XBLA 2N05A 1VQOV 3HOTA 1ZYRF 3DPLC 4XMYA 1LFBA 4IOCF 1BI0A 1K4SA 2STWA 1VQNI 3FDYA 3B09A 1S9HA 2CUJA 3FXOA 1GHCA 3KEOA 1WSUA 1MNGA 3E5XA 4E7KA 3ETGA 3T2MA 1YRNB 5FFXA 4OINF 2PYJA 1GKFA 2KDOA 3RFRA 2Y75A 1PUFA 4Y13A 2GWRA 3MHSC 2LW1A 2IW5A 2KQXA 5CBHA 2R5YB 3WB0A 3SEQA 1PD3A 3H01A 5IT9N 1P6RA 5GAGJ 4JX4A 1ZREA 2JJ2G 3T1HB 5ITZB 4LF4B 4CCMA 4JX6A 1PP7U 4G2KA 3QQAA 4JI6B 4B3SB 1LR1A 2XTAA 3STZC 2JPBA 2BGCA 1XI1A 2F4IA 2KRFA 2XKPA 4RA2A 3RQIA 2NVYJ 1V5EA 2UUCO 3OFNG 4XSXF 1NS1A 1P7JA 2WY7Q 1A36A 5K7FA 2KKWA 2ZFUA 4C2UA 1ZWIC 1OCOH 4I0BA 1Y39A 2EIJB 5JJEB 3HTSB 4JI5O 4LH6A 1IDYA 1Z3YA 3GTMJ 3BR6A 3BCCH 2CQKA 2Y69H 2O03A 3BCAA 2A06H 2OTLV 2KIMA 5M3MJ 4ZOLA 2A6HF 3ZRSA 5LHGA 4DIQA 1RKTA 3DTUB 2UXCB 4IF4A 2BY3A 3RYFA 2H6CA 3W6JB 2HYGD 4JX5A 4XOTA 3OYFA 4JYYA 1KONA 1XB4A 3OOUA 4PK4A 4PI2A 2K5CA 4YJ3B 4IVNA 4X88A 3K4JA 4MTDA 2QKCA 3T1CA 1LDDA 3GLLA 1J5EO 2X4HA 4YIRX 1FAFA 5EC2C 3FB6C 1YX5A 2EA4A 1LUVA 3RYIB 3Q9SA 4EJTA 1XHXA 5BR8O 2DPUA 2PQ8A 1JGGA 4DR4O 1P49A 4BBRJ 3PO3J 3ZX6A 3S3MA 4IHJA 1S5LC 1BJZA 1MABG 2EINH 4LBEC 2K9QA 4O4IB 1AP6A 2Z5UA 1Y74A 3MDSA 4X1YA 1E0EA 5EC1C 1HNWO 2L7FP 5CBGA 2C2AA 3KEYA 4IYIA 1YOVB 2E2HJ 1ERDA 1WKMA 3OMIB 4DK0A 2M34A 1OZ0A 3K6GA 4MVRA 3UQ8A 3F5WC 2VT3A 1WJBA 2DOEA 1EBOA 3BDDA 1LUJB 2QF7A 4O4HB 4FK5C 5GONB 2DU9A 1OCZB 4CYCA 1SF9A 3CMEV 3KP4A 2X1EA 3WTZA 4G94A 1A5JA 2YI9A 2EPFA 3M8FA 1YITV 1XNQB 4BE2A 3H35A 3CCJV 3JYCA 4X89A 4I02A 2DN0A 1G3TA 1FBQA 4H44B 2DA2A 2H09A 1HSTA 3DU6A 4Y17A 5FO5A 1P9QC 4J01A 3AL0B 5GPCA 4UB6Z 1QGPA 1KU7A 1AJNA 3SPHA 1JUPA 2KZGA 3RGBA 1QQCA 5E20A 4AUXA 1VMGA 4DUYB 5JI6A 2ZM6B 4XKVA 3KYCB 2UUZA 3R60A 2CTQA 1EFRG 3TEDA 2KG7A 4TOIA 1B6QA 4HEA2 2KDZA 3BA8A 2DFFA 3C1DA 4N4OB 3GEZA 2EZOA 5JJJB 2QENA 3CJHA 1W5CC 1X1CA 3KLNA 1C0WA 1KMIZ 5LXTA 2QQ8A 3WODF 4PGGA 2PTMA 5CB4B 1AI5A 1R3LC 1YW9A 4GX0A 2DTZA 1K78B 3ZEDA 1MNMC 3FX3A 4ENJA 4NTYA 1MBJA 2CS3A 4FPPA 5KHGA 4DR6B 1K73W 5JHUA 1X4PA 3ZP5A 2ZQMA 4TQDA 4LWSB 1XGNA 2WB1N 3N2GA 4J80A 5J2TB 1XGMA 3G1MA 3QAHA 4LMYA 5K1YA 1NBMG 4N4NB 1TLHB 2L0KA 4DR2B 3FXJA 2AHQA 4LB6B 2HWVA 3SEZA 1VQ5V 2ISYA 3H9GA 2V1UA 2ZXIA 5KHKA 3BJAA 4FISA 2DYSB 3T4ZA 5J8FA 4WXDA 4NXNO 2QA4I 2RV8A 1I7FA 4MTEA 5KCMA 4AILC 2A07F 1W1WE 1MBFA 2YEVB 1TT0A 1KKDA 3OSFA 3K4BA 2P6JA 4MQVA 2V9VA 3ABMB 1S77D 2OQGA 2PY5A 3K4CA 4JTAB 1IRFA 4IHWA 3IL2A 4G7ZF 1CPYA 2M7BA 5J4YA 1XSXA 5IYZB 2E5LB 2MABA 3RYRA 5J6XA 3FMQA 4ZDOA 1GN6A 2VJ5A 1RM1C 1DPRA 4XBFA 3LSUA 1V54B 1OMIA 3CB2A 3X2QH 1W5TA 2F2EA 2IGMA 1MMDA 2Q0OA 2Q2EA 2M9HA 4DV4B 3AG3C 1Z67A 2VBWA 1HDDC 3ZQFA 2BY0A 3ZJZA 3I4PA 4Z2WA 1M90W 2BXZA 3KKYA 2I5UA 2YS9A 1TBXA 1M9NA 2E74B 2EWNA 2BBYA 4HAMA 1BR4A 1SVMA 3MWMA 2HU9A 2OT5A 1Y1WJ 4BW5A 5D8LB 3AG2H 4BL0B 4G9YA 4LLLA 4I76A 3IAM2 3VB2A 3PSFA 2MLGA 4AQYO 2UXBB 4GDFA 3HEFA 4QE9A 2L02A 1TGOA 4HYEA 4KIGA 2Z33A 2IVMA 1KUQA 5TRDA 2W6JG 3LQRA 5LFAA 1SQPH 2HFEC 2WAQN 4RUFA 5JWPA 1DQUA 4JI2B 2F4OB 1F43A 4GKKB 2LJ2A 3BZ6A 4Q48A 4O2BB 2CQXA 1WH7A 4A3LJ 1ZR4A 4JF3A 1J0RA 2QM8A 3T5XA 1I08A 3LDDA 3WFVA 3ELKA 4IPAA 4FHTA 4NQWB 1YJNI 1EN4A 4NTWA 1VNDA 2HYFA 4DO2A 3C3SA 1ZG3A 5JLWA 4A3DJ 4JYAO 1WP8A 2PJRB 1B1BA 3MVPA 1GVJA 2LRDA 1SFOJ 2BCCH 1EA3A 1U97A 5JH7B 5HNHA 2ZJRF 5JQGB 2R7FA 2GBOA 3VSKA 4JK1X 1ZG1A 1H2NA 4JI8B 4TV9B 3V42A 2K9NA 1SD5A 3L00A 4BS9A 2AHZA 2EIJC 5B66Z 5CA0B 2AQFA 2EB7A 2DTRA 3GW2A 2CV1A 2O6GE 3BG6A 4XOPA 1Q43A 2QSGX 2A9HA 1N36B 1ZRDA 3ICXA 3CC7V 2OBPA 3J81Z 3W7UA 1KQSU 4V2GA 3LDCA 1WGXA 3ZQ7A 3W7WA 2HI3A 5KHHA 1G8XA 1LVAA 2CJJA 2EILH 1XCBA 2CGPA 4AIDA 2JGUA 2Y0MA 4CS4A 5C8YB 5IY5C 2UU9B 1IF1A 1SEUA 1O3TA 3OEHG 1U8BA 3R0JA 4B09A 4KIFA 2VQFO 1ULYA 2AZ2A 3BTJA 1FFXB 4U0VA 4JI4O 4O2AB 2ME6A 3CRMA 3CCMI 3N4MA 2FQ3A 3RYIA 4RB3C 1K33A 1A6QA 1IBLO 4UB6C 2RGVA 2DQ3A 1B59A 3RT3C 1HNXO 2ECBA 3IGAC 5B5EZ 4HQMA 4PHZA 1J09A 2LVSA 2JGDB 5LL6Y 4A5UB 2B1IA 1OCRH 4YIFA 3VDXA 3OD4A 2O8KA 4MVQA 4PELA 2EIKC 4EGYA 3CE2A 1N78A 3HB3B 4H33A 3DPTA 3MCZA 4F55A 4BQAA 3M1EA 2DQ0A 3I55V 5EZYB 2K3PA 3EUAA 3JAKA 4O4HA 3MAJA 4YIIA 1OCZC 2LG4A 4CH5A 2NNNA 1SAUA 3NARA 3M07A 1Y76A 3G71I 4ZI7B 3F7VC 4JI3B 3ML6A 3RKQA 3KZYA 2ZMEA 2OUMA 3HKZN 1VQ4I 5CVVA 2ZMEC 2R5ZB 1R3KC 2HHHB 1WJAA 1HW5A 5C4JJ 3G6EI 3WG9A 3SPJA 2FL4A 5F0CA 4LGWA 3V8KA 1ZAUA 3CRRA 5HFLA 3SDBA 1FNNA 2ZSIB 4CXFA 1JI8A 1K7DA 3EHBB 4BEHB 3MZ8A 3WU0A 1IZ1A 4O3MA 4P9PA 3W2WA
chains in the Genus database with same CATH topology
3QU3A 3F8BA 4UXNA 1H2GA 5E8GA 1JVMA 1MJAA 4P5OA 1HKSA 2ELHA 3SYPA 1VQ9V 4GT1A 2DBBA 2YX7A 4CO8A 4PDRA 2FNAA 3VFZA 3CO6C 1HKTA 2L3DA 1OYIA 4OMYA 3ZCCA 3U1DA 5B3SC 3LAJA 2GXBA 1BIBA 1GXPA 3I59B 1T38A 4FMTA 4Q47A 1JPXA 2JIZG 5CVIA 4ESBA 1B4AA 3SQNA 1J5YA 1AOYA 5LHHA 1Z6TA 1QO0D 1I6XA 4Z2YA 1NR7A 3SYAA 1S29A 2DWDC 4P9UA 2XOKG 1E1QG 5F6FA 1QBJA 4MTFA 3JD0A 1T6SA 1AR1B 1GO3F 2K4JA 1O3SA 2O0YA 1YIJV 1ON1A 1VQMV 1MKMA 2NRAC 1DLBA 1RNLA 5BQTA 4KMFA 2R9RB 1GM8A 3UM7A 3MFKA 3RI4A 3UKMA 3FYIB 1FC3A 1KU9A 3N97A 5B1OA 2JEXA 3OR6C 4A0XA 2QUFA 3CP1A 2ITCC 3JD4A 5LBQA 2ZD9A 3ABKB 3AG1B 2X0LA 4XSZF 3RKXA 2ETHA 4P9FA 2F43G 4WFGA 5HFMA 4RQEA 3E8GA 1SFEA 3TO7A 1R1UA 4MQ9F 1I1GA 2ZNZA 1ON2A 3DEUA 3R4KA 5GW7A 3STLC 3CO7C 5HS9A 2WWYA 3OMAB 3J80K 4N9IA 2LFRA