4HAMA

Crystal structure of transcriptional antiterminator from listeria monocytogenes egd-e
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
SNAMFTINTKSQLPIYEQIVQKIKEQVVKGVLQEGEKILSIREFASRIGVNPNTVSKAYQELERQEVIITVKGKGTFIANQTDKLSSPKKLAETRTKLKETILDLVYLGVNIEEIHKLADEYSQDIIGGDVVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Transcriptional Antiterminator from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords Lmo2241 protein
total genus 43
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hamA01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hamA02
4KMUX 1ZG1A 1FWZA 1W7PD 5LHIA 1J75A 1BC8C 4ZYEA 3KFWX 5H6RA 1STZA 4B09A 3ML6A 1PDNC 4RB1A 3W6KB 2JRTA 1K7AA 2MA3A 3BJAA 2HYFA 3RJPA 4N0BA 2V1DA 2HGCA 1KA8A 3E3VA 1NH2B 2KRFA 2ZMEB 4EQQA 4EM2A 1LEAA 4OIRF 2KIUA 3RYPA 2L4MA 4M73A 4MGRA 1ZG5A 3GLXA 2C6YA 1TQPA 2EV5A 1LEBA 2QLZA 1ULYA 2BBYA 2M45A 1DUXC 4WXCA 3E97A 3K1PA 5ILVA 4WXDA 4XSZF 4M9ZA 3LQRA 1H9TA 4GXOA 2QM3A 4L9JA 5HS8A 5L3DA 1GXQA 4G9YA 3V7SA 1KQ8A 4OINF 3ROUA 4HYEA 5FGMA 2L54A 4CZZA 3HTUA 2HFHA 5HOOA 1EH6A 2QZ8A 3KZZA 4LB6B 2H09A 3BROA 2MD5A 4HX7A 2HKXA 4TV7A 1HXDA 2LDUA 2O6GE 1UB9A 3TDUC 3NQOA 2MLKA 3I53A 3D0SA 1FSHA 2CSOA 1LB2A 1TW3A 3GF2A 2LKPA 5E1WA 3DKWA 4EMSA 1Q1HA 1T98A 3U9GA 3RI4A 2ZO4A 4ETSA 2DTRA 3KP4A 3JSOA 1RIOH 2M30A 2F2EA 1TNSA 4I02A 3W7WA 1R22A 4P55A 1S7AA 3K1MA 3K0LA 3RKXA 1XSXA 1ZGAA 2ZCWA 5ICGA 4U0YA 3EETA 2KJBA 1OPCA 1WWXA 1UCRA 3HOTA 5K5QA 5A2QZ 4FHTA 2O3FA 4IVNA 2LF7A 2ZBKA 3L00A 2ESHA 3ISPA 2XUBA 3G73A 5LEJA 4MQVA 2VBZA 5HDGA 4LG0A 4I2OA 5FB2A 5HLGA 1FPQA 3CUQB 4ZYHA 5JI6A 5L3BA 1TTYA 1B6AA 2V9VA 1O57A 1SAXA 1IZ1A 4Z2YA 5TRDA 4NB5A 3QU3A 4I0AA 3J7AO 3ZN0A 1SMYF 1Z7UA 2DT5A 1H0MA 2K7LA 3DEUA 4ON0A 2NNNA 2XRNA 3J81Z 2NRAC 1SD6A 4IRIA 4O6JA 1GHCA 5D5VB 1YG2A 2FOKA 3BP8A 3HRTA 2E1CA 3ERED 2CFXA 4KT5C 4R79A 1O7FA 2STWA 1U5TB 4ENMA 2Z33A 4H0EA 5FD5A 3WGGA 5E1ZB 4CXFA 2YX7A 3WE3A 3LA2A 2CO5A 3GFIA 1O7LA 4I01A 4CICA 5J6XA 2EA4A 3OV8A 3TGNA 5E8GA 1IRFA 4L9TA 2Y75A 3QP6A 4M6YA 3LFKA 2XIGA 4BQAA 1QPMA 1ZH5A 3N97A 4Y17A 1FYLA 2O61A 4XLPF 2CW0F 1XD7A 1B59A 3FM3A 1FBSA 1KQ9A 1GXPA 4I98B 4L18B 2BYVE 4I0BA 3LAJA 3CTAA 2VE8A 1BI1A 5LLQA 1G3SA 2MH2A 4BHCA 1YTFB 4ESBA 4AIKA 3I71A 2KKOA 1ZYRF 3E6CC 2DK5A 3EYIA 3BY6A 4M9XA 3F6VA 1ZRFA 4UHTA 2L3DA 2O03A 1ZGJA 5HLIA 2G9WA 2RN7A 2PEXA 2D45A 5ED4A 4HQMA 3GUDA 1HKQA 1KYZA 3MWMA 5D4SA 1S29A 3TO7A 2ZKZA 2FRHA 3Q9SA 4PZJA 2IT0A 2QQ9A 3GVAA 2ISZA 4KN7X 1U5TC 5D8KB 3HSEA 2H94A 5L3CA 3IHUA 3RKYA 3K9TA 3ABTA 2MLGA 1IUYA 3HOSA 4GGGA 4P5OA 1O3QA 2XV4S 5ICFA 1IXRC 1R5GA 5KK1A 1IW7F 1IN7A 2GIVA 1IXSB 3GXOA 5CVUA 2EV6A 1FLIA 1CF7A 2DAOA 1XCVA 2GA2A 3IRQA 4HDUA 5BOXA 2A61A 3WU1B 4YFNF 4EGZA 1HW5A 1LQ1A 2TDXA 5DDGA 4MHGA 2MC3A 1DDNA 3JW4A 4P96A 4LFUA 3BDDA 4JK1X 4IHSA 1P4AA 3GO5A 2PG4A 2FMLA 2JZYA 1Z6RA 1MDMB 1XGMA 2ELHA 3HYIA 1MJBA 2AS5F 3IRRA 5HDNA 3WGIA 1F9NA 3ZMTA 3TDZC 4EGYA 3GFJA 1GVJA 3BJOA 4E70A 1S3JA 2GQQA 4AWXB 4OIOF 2QBYA 5IT9K 3R0JA 1S7OA 1FSEA 4HLYA 3W7XA 2P5KA 1JXSA 2HQRA 2VOOA 2HYGD 3R61A 3FHZA 2CGPA 3GFLA 1YW7A 2HTSA 4PCQA 1U2WA 1OYYA 3FM5A 4FX4A 2FF4A 3B73A 4S05A 2DFIA 4A0ZA 1RI7A 3C18A 2PQ8A 5HS7A 4OIPF 3JTHA 1IXCA 4KIGA 4WWCA 3GZ6A 1CF7B 1LNWA 2BE5F 1C0WA 1B9NA 2DBBA 1G4DA 1IF1A 3DF8A 2CWEA 4RGRA 4HQEA 3MCZA 2AXLA 3HRUA 3E6MA 4P9UA 3EDPA 1KU2A 1USSA 2O0YA 1HKSA 2IJLA 1EH7A 2Q8KA 1EH8A 2QENA 4K2EA 1U78A 2GWRA 3CO6C 2H6CA 2L02A 2DPDA 4LG0B 1XB4A 5LHHA 2P90A 3T8RA 1Z05A 3ZMVA 1TQMA 2DW4A 2D1VA 2QBYB 3DFGA 4A5MA 2L01A 3VOEA 5E18F 1T0FA 4RB3C 1BC7C 2A6HF 3EQLF 1FT9A 1ZRDA 2WV0A 3V7CA 5K5RA 2HTJA 2MH9A 4XSXF 4L0ZB 3HTSB 2QQBA 3AAFA 1XMAA 2HS5A 4CO8A 3W6JB 3JAMZ 4U88A 4HZFA 3P9IA 3SHFA 3VODA 2EFOA 3KP6A 2EFNA 1B4AA 3KP7A 2EA2A 3KLOA 2GA1A 5F1RA 2OZUA 3MZHA 1BIBA 1KU3A 2V1XA 2VONA 3I59A 2PMUA 5CVRA 3P7NA 1FZPB 5HLHA 4HAMA 1MKMA 2RDPA 1R23A 2FNAA 4IF4A 4UV8A 1YW8A 2J5OA 4Q5SF 4IJAA 4BHPA 5DEQA 2V6CA 1L3LA 3RPUA 4A0XA 1R58A 4HV5A 3W7SA 2COMA 3J80Z 2F5EA 2FMYA 4HDVA 3WG9A 3P9CA 2JTVA 4LJZF 2GAUA 5LGUA 4ASNA 1BI2A 3Q9VA 4RGSA 3WTUC 4AIJA 1IN6A 1R1VA 3QU6A 4U7BA 2M5WA 4S04A 3GEZA 1IN4A 5D4RA 1YFHA 3GYHX 4UXNA 2FU4A 1BOAA 4Y15A 3B02A 4BXUA 2JT1A 3K2ZA 1E2XA 4MNUA 3COAC 2MBFA 2XAHA 2VE9A 3MAJA 2D2WA 4M71A 5LRRA 3EUHA 1XN7A 4G6DA 4M74A 1TBXA 1YLFA 3WTSC 1XDSA 3L09A 2PJPA 4RGXA 2IA0A 1T6SA 1WKMA 3K1NA 4AVPA 2ESNA 4IXAA 1U3EM 4M72A 4WF2A 3RPQA 2PBIA 3HSFA 2STTA 2EJRA 3FXUA 3FMSA 1BI0A 1MJ9A 5IT9Z 3M8EA 1BM9A 4KN4X 3MQ0A 2XAFA 2G7UA 1FYMA 5E17F 4EV0A 1FBUA 4RGUA 3U1DA 1XGNA 4EJTA 1W7PB 2HOEA 5BMZA 3T8TA 1R5HA 2CQKA 3H3ZA 4LB5A 1F4KA 1P4WA 2EWNA 2E1NA 2EB7A 1MD0A 1SFEA 2ZXJA 3CUQA 1S8NA 3WE2A 3I64A 1IN5A 2P6SA 3SZPA 1R1UA 5F6FA 2UXXA 1FYKA 3M8FA 5CYVA 3F3XA 4IRGA 4M9SA 3WU0A 1YS7A 3TOBA 2V79A 4KIBA 1XCBA 3WTZA 2DPUA 1FOKA 2QWWA 2VN2A 3KP3A 3T0YA 4CHUA 1ON1A 1KU7A 2IA2A 1DP7P 4OIQF 1I1SA 1HSTA 2P7VB 5E8IA 4LLLA 5EEGA 1B9MA 4Q48A 1LDDA 1O3RA 2D1HA 4WK8F 4RB0A 3DPTA 3FMRA 4CDGA 1XGSA 3CUQC 3BPXA 5CJ9A 4CGZA 1D5VA 1ZAOA 4I7HA 2F5DA 4O5VA 4U0WA 3VEPA 3KP5A 3ZMDA 3IKTA 4Q47A 3I4PA 1YO5C 1KGSA 5BPDA 1UFMA 4G8XA 4U0VA 3TOAA 3JSPA 2Q2EA 3H3UA 4LMYA 5HVQC 5JR3A 5TJJA 2OD5A 5D5UB 1SFXA 3F8BA 5LBQA 5BPIA 4R8HA 1G3TA 2WC2A 5E1XA 3EYYA 1B1BA 4I09A 2H6BA 2Z3YA 2P5LC 2JPBA 3FXRA 1DPUA 3ULQB 1HSJA 5DD8A 1NHAA 2JPCA 3CDHA 1SD4A 5L3EA 4HA8A 3IWZA 1HW2A 2OQRA 1LJ9A 1HBXG 3FWEA 2O8XA 3O2PE 4UUVA 5AIQA 2VXZA 3FXQA 2NNYA 4LGWA 1ZG3A 4EJOA 2L4AA 2Z99A 5FD6A 4MTEA 5LGNA 2M1BA 4CYDA 2IPQX 1TLHB 3DXJF 1IAWA 1FBQA 4YIIA 2DLLA 3E6BA 1Z91A 2F5CA 4P9FA 4IHTA 3ZMSA 3V8KA 3KETA 1U5TA 4ENJA 2XAJA 4UVCA 4QWQA 4BYYA 3F8MA 3M7GA 4MEXF 3W7UA 1EV7A 4AIHA 1K79A 4MEYF 5DV5A 3D5LA 2FXAA 1U8RA 2A69F 4G7HF 1RUOA 5D5WB 1G3WA 1I5ZA 1YS6A 2P4WA 5DUKA 3ZPLA 4HF0A 3L9FA 3R6SA 3HIFA 4ESJA 2LSOA 1ZARA 1V4RA 4YG2F 3BWGA 1J0RA 3IKVA 4KIFA 1F1ZA 1BIAA 2ZNZA 5ICCA 1TQIA 3IC7A 2R3SA 3I54A 5HDKA 1AOYA 2Z9OA 3G3ZA 3F6OA 4HOBA 3HSRA 1J5YA 4RS8A 4DNCA 1G6NA 2PMHA 2BEOA 4Y13A 3LA3A 3M9AA 5D8LB 3E5UA 1VTNC 1IN8A 4D0PA 2ACJA 2XKOA 4G7ZF 4A2UA 5BQTA 2NS0A 1J2XA 2K4JA 3DQVC 3DP7A 1JHHA 2PN6A 3F21A 3F8CA 3KEQA 2R7FA 2HR3A 2K4BA 3JTGA 2YR2A 4HX4A 1ZLJA 3Q5FA 1R7JA 1I27A 3PQJA 5JHUA 2BGCA 4U7DA 1I1GA 4KUMA 4WCGA 3I58A 3TO6A 3BPVA 4A12A 3N4MA 3WTTC 4B8XA 4G7OF 1QBJA 1R36A 2HQNA 1RNLA 3E5QA 1YQAA 5CLSA 1W5TA 3VB2A 4ZZLA 1P92A 2P8TA 1Y0UA 1KYWA 2P5VA 3I5UA 4KFCA 3SQNA 1LVAA 3KZYA 3WTVC 1RM1C 2EFQA 3ABUA 2E7XA 3V8JA 3GX4X 3NRVA 5K5OA 5D5XB 2OAZA 3LA7A 2VBXA 5AONA 2HEOA 3BZ6A 1O3SA 5H20A 4KICA 1RUNA 1D8JA 4KYWA 3QPHA 4LLGF 3F72A 2DQLA 3KE2A 1HQCA 3ZMZA 4PGGA 1FY7A 2YX4A 4O3MA 3FF5A 3S2WA 5J8FA 1ZREA 1YYVA 4LLNA 1T2KA 3DPLC 4GYIA 3V7RA 2YU3A 5EEHA 1KU9A 2QVOA 5ERIA 3RDIA 3HHHA 2RQPA 2OBPA 3ECOA 4JQFA 5JVTA 4A5NA 4HF1A 1OYIA 2IA1A 2RKHA 2DU9A 5E20A 1SD5A 2M8EA 2XGXA 3V4GA 3J80K 2VT3A 2QUFA 3O3KA 3W7TA 2CG4A 1T39A 4IRHA 1NVPB 3WODF 4MTDA 1SFUA 2XHKA 1P6RA 4L0YB 4A0YA 2E7WA 4DQ2A 2DK8A 3REOA 2XROA 2VC1A 1ON2A 4HBLA 5CVJA 2UZKA 4GO1A 2XAGA 4L5IA 2A5YB 1P4XA 4ESFA 1YIOA 3ELKA 1H9GA 1WQ2A 4M6XA 1MGTA 2V1UA 1ZN2A 4F7ZA 2VBWA 2KJCA 5FFZA 1KQ0A 4A6EA 6PAXA 5A2QK 3ZMUA 3RKWA 4WXHA 3U2RA 4EJVA 2FEZA 4LK0F 5L3GA 2Q0OA 3CLOA 1JHFA 3T1BA 3K69A 1QZYA 2X4HA 1J9IA 2QYOA 3GWZA 3QRFF 4BH9A 4RAZA 4WX9A 1F5TA 2W25A 2J5PA 1FP2A 2OU2A 3QPTA 2PI0A 3RIRA 1SD7A 2LF8A 2A07F 1XDUA 2ZMEA 2FBHA 3TQNA 3C7JA 4EM0B 4KA4A 1ZLKA 1PP8F 3TO9A 3NEUA 5DCMA 4BNCA 5ILUA 2OQGA 2M87A 3F8NA 1JGSA 4XBFA 1USTA 4NQWA 2RNJA 2GXGA 4EM1A 4UV9A 1TW2A 4N9HA 4XLNF 4YIFA 1L0OC 4YFXF 4EJUA 3H92A 1J59A 4FT8A 1JE8A 3CO7C 3MZYA 1FP1D 2VC0A 4XRFA 1BBYA 1LDKB 2CYYA 4R1HA 5CVIA 3SZTA 2ADUA 1ZRCA 3QP5A 1D8KA 2QQAA 2W85A 2XVCA 1YW9A 3J81K 3C3WA 4ZYGA 1QO0D 1UHWA 4KMFA 3SFZA 2A3SA 2XASA 2ZFWA 4OOIA 1OMIA 3HRMA 2P7CB 3KLNA 2A6EF 4YFKF 4BHBA 2IW5A 4ENKA 3PFIA 3CJNA 3LSTA 4UNOA 4RB2C 1AWCA 1QGPA 5GW7A 4IPAA 2A68F 4N9IA 5J8CA 1T38A 2VBYA 3HUGA 3WTXC 1PP7U 3L7WA 3LWFA 3KCCA 1Z1DA 4UVBA 1WRJA 3QAHA 2P6TA 3MEXA 3E6DA 3D3IA 1W5SA 4HV6A 2PFBA 5ICEA 1HKTA 1QNTA 2FNPA 1IRGA 4MQ9F 2BV6A 4BAYA 2FBKA 2EFPA 1OYWA 3WTYC 1MJAA 1W7PA 3R60A 2KIFA 2R7DA 2RVCA 2EFWA 2IVMA 3E35A 1V3FA 3WTWC 2DI3A 2VODA 1BI3A 3T5XA 4UVAA 3KEOA 5AIPA 3KP2A 4OMYA 3I0TA 4EVIA 3R0AA 4HLXA 1TNTA 3L2CA 2W57A 5CA3A 5D6FA 5DUIA 5IT3A 4OMZA 4GYGA 3LQQA 4A6DA 4PDKA 3GFMA 3QOPA 2FQ3A 2K86A 1XMKA 3FMQA 2ISYA 3ZP5A 3RYRA 1PUEE 1U6GA 1D3YA 3P9KA 5FLXK 3CUOA 3JAMK 1G3YA 1ZHFA 2K27A 2WTEA 5CVVA 4EJWA 2RV8A 4QLCU 2B0LA 5H6QA 4HX8A 2HWVA 3F23A 3R4KA 4ZYDA 1HW1A 5KVRA 1LDJA 5DCMB 5L3FA 3OOPA 1P2FA 3M1EA 4JBAA 3E5XA 3FZVA 2ZNYA 1Z9CA 2Y48A 4AD9A 1MDMA 2XAQA 3VFZA 1OR7A 2LNBA 4RAYA 1FX7A 4L9NA 5FLXZ 3F22A 3BOQA 2K02A 3RTRA 1RZ4A 1O3TA 1WI9A 4HW0A 5FFXA 1YTYA 1S6LA 3F8FA 1UHMA 4FX0A 1I6XA 2OA4A 2GXBA 3BJ6A 2ETHA 3IWFA 2H27A 5LHGA 2Z5UA 2HZTA 1R1TA 2IRFG 2ZJ2A 5LGTA 4Q4ZF 2NYXA 2WAMA 2Y0MA 4PGHA 2EK5A 2FSWA 2HDCA 2UWMA 4ENNA 4ZZDA 3ZN1A 4ZH4F 2KIMA 3C1DA 4G6QA 3GW2A 1K78A 1W4MA 3GZ5A 1XSVA 1DPRA 5FO5A 2OZ6A 4OU0A 2X0LA 2VT2A 4LK1F 4GCVA 2JSCA 1BN5A 3ECHA 3HHGA 1XSDA 3V8LA 3ZQ7A 5LEKA 4KNYA 2UXNA 3FX3A 1X3UA 3I59B 1CGPA 2FBIA 1QQIA 3TKYA 2YPRA 3IL2A 4G94A 1E17A 2DQRA 1R00A 5D6EA 2W84A 1MZBA 1SMTA 1FC3A 1WSUA 1A04A 2NAZA 2HKOA 2IP2A 1Z6TA 3LAPA 3PQKA 2GZWA 2G7HA 5DD4A 2FA5A 2WWYA 4HF2A 5DYMA 1J7KA 2XKPA 3O6BB 4LD5A 2RC4A 2EV0A 1FNNA 5LRSA 2PLYA 2W24A 4L9VA 2VOPA 3SXYA 3WGHA 5K1YA 2FE3A 3DV8A 4L5JA 1OKRA 2DO7A 3MFKA 5JFRA 4KDPA 1QZZA 1XGOA 5DCFA 5ILSA 1BJAA 1K6OA 2YSRA 5F64A 5HS9A 1ONVA 2F5FA 2RGVA 1ODDA 1K78B 5BS6A 4NHJA 1REPC 3HRSA
chains in the Genus database with same CATH superfamily
4KMUX 4LCUC 1ZG1A 1AR5A 1M90W 5B5EC 3DGEA 2ME0A 1ZR2A 3JCUC 1XMOB 3OR7C 4DBQA 1FWZA 2UUCO 1W7PD 1Z2GA 2JQ7A 2RNBA 5B1BC 1RSOB 4UB8C 5LHIA 5J2TA 1J75A 1BC8C 3JRFA 5J2UB 4ZYEA 5F0HA 5KX5A 3KFWX 3S1NJ 5H6RA 4Y7NJ 4PSXA 1STZA 1SQQH 4B09A 2VI6A 1SF9A 3ML6A 4CBCA 1PDNC 1W0KG 2VWJA 4RB1A 3W6KB 2JRTA 4A93J 1K7AA 1HNZB 2MA3A 4YJ3A 4BJTA 1OCOH 2ZJRF 3BJAA 2AZ2A 2Q5ZA 2HYFA 3RJPA 2W00A 4N0BA 3SYAA 1SC5B 2L0KA 1XEQA 2R7QA 1P7GA 5FJ8J 2V1DA 2HGCA 3H36A 1MSEC 4BWAA 1KA8A 2O5RA 2RREA 1NTCA 3E3VA 1VF7A 1HF0A 4D7TA 1NH2B 4RQEA 2KRFA 1I0HA 3FK6A 3CHXA 2ZMEB 4EQQA 4XM3A 1P7BA 3CJHB 2OCCC 1Q1VA 3WG7C 4BQOA 4EM2A 2Y0SA 4PA6A 1XQ8A 5C4JJ 5B5EZ 1GAXA 1LEAA 4K8ZA 2BTQA 2PUSA 4OIRF 2KIUA 2L9NA 3L1PA 3RYPA 2L4MA 2C2AA 2X6BA 3IGAC 3MDSA 1D1BA 3E0JB 4M73A 3OOUA 4MGRA 1ZG5A 3GLXA 4DYLA 1SAUA 4PK4A 1HWYA 1ZAUA 2WA0A 3CP1A 2C6YA 1TQPA 2PF4E 4P1WA 3HG9A 2EV5A 3A0BZ 1LEBA 3ABLC 2QLZA 3OSGA 1ULYA 2BBYA 1DQUA 2M45A 3G6EI 1R49A 1K4CC 3A0RA 5KAIZ 3D5SC 1DUXC 1PL4A 4WXCA 1BR2A 4TV8B 1WA8B 3E97A 3K1PA 2K1EA 1V5FA 2HP8A 2JIZG 5ILVA 5IY5C 4DV5O 4DV7B 3CC4V 2JGUA 4WXDA 2WAFA 4XSZF 4M9ZA 3LQRA 1H9TA 4GXOA 5KHIA 1EFRG 1IDYA 1CEZA 1S9HA 3J7ZI 4IO9F 1KP2A 1JQ0A 3GTKJ 2ZCEA 2QM3A 4H44B 4FLTA 4MTXA 3L70H 4L9JA 5HS8A 3RYHB 3TJTA 4E7KA 4J7ZA 5L3DA 1GXQA 4UUSA 1GN4A 1HW7A 5BR8O 4G9YA 3V7SA 1FJLA 2OCEA 1KQ8A 1LR1A 2ZFUA 1S77D 3OR1C 1XPXA 1WHUA 3HPGA 4OINF 3ROUA 4HYEA 3UNGC 5JCOC 5FGMA 2IGOA 2L54A 5EJCA 4CZZA 4IT5A 4J41A 3HTUA 2HFHA 3BG3A 1EH6A 5HOOA 2Y9ZA 2QZ8A 3S16J 3KZZA 3PUBA 4LB6B 3L75H 4LWSA 2B9ZA 3CJRB 5B1OA 3ZHUA 3D36A 2H09A 4JI7O 3BROA 3UO2A 2MD5A 4HX7A 2HKXA 1R3IC 1QHTA 1EN6A 4TV7A 5CB4A 1K7DA 4TV9B 1WCMJ 1HXDA 1QR8A 2LDUA 4WFHA 2O6GE 1UB9A 3TDUC 2N8GA 1YHQV 1W0JG 3C90A 5C8YB 2ZM6O 3HEFA 3SJBC 3CC2I 4X66O 2IGKA 1WLEA 3NQOA 2MLKA 3I53A 3D0SA 1FSHA 4FASD 1OLTA 3QG5A 4JPRA 2AO9A 2CSOA 1LB2A 1TW3A 3GF2A 4I7ZB 1WI3A 2LKPA 1AB3A 2VKDA 1MMNA 5E1WA 3DKWA 2QKLB 4EMSA 1AR4A 2LFRA 1GK9A 5IJ0A 3ASOC 1AI7A 1Q1HA 4O4HA 3FXJA 4B1RA 3IH4A 4DR6B 2JRIA 2RDCA 1T98A 4XONA 3MKYB 1Z3YA 2HLDG 3U9GA 4MVOA 5EYPA 3RI4A 3W6VA 2ZO4A 1THZA 4ETSA 2WLNA 1YSCA 2A3QA 4BACA 4D5CA 1H2SB 2DTRA 4XOPA 3KP4A 3JSOA 5FLXN 4HNTA 1RIOH 1NR1A 2M30A 2F2EA 1OCCC 4W4KA 3LSRA 1TNSA 2CH0A 4LBEC 3UT5B 4AILC 1HNZO 3X2QH 4I02A 2NXNB 4A3GJ 3ZEDA 5IOYA 3CF5F 3W7WA 1MG1A 1R22A 1HR0B 4P55A 1S7AA 4OPHA 3K1MA 4LITA 3K5MA 4L5EA 1XL4A 3QO5A 3O8GA 3K0LA 2OTLV 3RKXA 3K57A 1JKRC 2UXCO 3T2MA 4P30A 1XSXA 1NG6A 1LFBA 1ZGAA 1R3JC 2CRGA 2ZCWA 2Q7GA 5ICGA 1FIPA 2EZOA 4U0YA 4UCSA 2JWTA 2ATKC 1XHXA 3UM7A 3EETA 2EULA 3BTJA 2CUFA 1N0NA 2Y69H 2KJBA 1WZ2A 4TV9A 1OPCA 1HDPA 4F4LA 4U3FH 3G4SV 5LMUO 1BZKA 1WWXA 5C93A 4BU2A 3THOA 1UCRA 3HOTA 4LFCO 3BT9A 3DU5A 3KYDB 5K5QA 2NVQJ 3B6CA 4PFOA 5A2QZ 4FHTA 2O3FA 4IVNA 2GXAA 2HG5C 2Q2EB 3HXLA 4IHWA 1SQXH 3G67A 2ECCA 2W48A 2LF7A 1VQ5V 3VQWA 1AVMA 4G12A 1GKFA 2ZSIB 1PV0A 2ZBKA 3L00A 3D36C 2ESHA 1TP4A 1E1QG 4P9OA 3ZRWA 5IE9A 3SPCA 2UXDB 3CCRI 5IJ9B 1V54B 3ISPA 2XUBA 1MZFA 3K9AA 2N04A 3G73A 5LEJA 3S3MA 3LSKA 4MQVA 1TUBB 4OXSA 1N75A 2VBZA 4O4HB 2QKMB 4U7NA 5HDGA 4G6TB 1B6QA 1Y8QB 2X6XA 4N4NB 5K1PA 3HKCA 5EC2C 3LSSA 4GX2A 4CH7A 5DM7F 2P0WA 4F91B 2LJ2A 4LG0A 4I2OA 2W6JG 5FB2A 5HLGA 3DBLB 2A0LA 1FPQA 1ZL8A 3FFQA 3CUQB 1HNXB 3ETDA 1K8AW 3UKMA 3DTIA 4ZYHA 4JTAB 3BA9A 4LWSB 2OUMA 3JREA 1BMFG 5JI6A 1Y66A 5FNVA 5L3BA 1QLEB 3A8TA 2LBFA 1TTYA 5CA1B 1B6AA 2V9VA 1Q6HA 5LOVB 3LMMA 3LSGA 2X85A 1H2GA 2Q8VA 3H3VK 4MTOA 1O57A 1SAXA 1IZ1A 5M5WJ 4YJ2B 4Z2YA 1ZKGA 4JYYA 5TRDA 4B7EA 5EZYA 4IOCF 1VQLI 1BW6A 3QWLA 4NB5A 3O8HA 1LKXA 5KX5B 3QU3A 1SQBH 4B3AA 1MA1A 3AG4B 3AG2H 3PSFA 4GX1A 4I0AA 3J7AO 1M1EB 2CS3A 1YJNV 5IT9N 4C3IJ 3BTLA 3GTOJ 2E5LO 3OTFA 1LUWA 1E3HA 4DW6A 3AK1A 5EC1C 5IYBO 2KT0A 3DPUA 1ZR4A 1T95A 2EIJH 2WB1N 4YEJA 2GTSA 3FBNB 5JLXA 5J4VA 3OYHA 1ETKA 4HEA2 3ZN0A 1JFFA 1SMYF 1Z7UA 2AXTC 3G1OA 3SPHA 2DT5A 3ML0A 3QNEA 1H0MA 3CRCA 2QM7A 2K7LA 3DEUA 2YIBA 3B6AA 4ON0A 3T4ZA 1AP5A 1SQVH 2OC6A 4BW5A 2NNNA 1V55C 1Q90D 2XRNA 3J81Z 3SYCA 3OYDA 2GOXB 3TW6A 1AI5A 4DR5O 3IUOA 2NRAC 3K79A 2OTJV 2ARHA 2K9SA 1SD6A 3CD6V 5LFAA 4IRIA 2VQCA 4O6JA 1VQKV 1P84F 5CKTA 3ABKB 1ERDA 1GHCA 5D5VB 4MTFA 1YG2A 2FOKA 3BP8A 1HDJA 4GCZA 2BZTA 3HRTA 2E1CA 4O2BA 3CMEV 3ERED 1VQ9I 2BY1A 2CFXA 4LFAO 4XDJA 3JRGA 4WF9V 1JGGA 4KT5C 2PMZN 4R79A 5HNHA 1EJ9A 1RSOA 5J2TB 1O7FA 4H4KC 4UUTA 2STWA 4GYCB 1U5TB 2GSMB 3SZGA 4ENMA 2Z33A 4XR6A 1AU7A 3ZBHA 3I4MJ 5IOZA 2RNGA 1NJIW 4H0EA 4LG3A 4XNFA 3AG1B 2AHYA 5IWAO 1JT0A 5FD5A 1S5LZ 3B09A 4M3DA 3WGGA 5IWAB 4DV4B 2ELJA 1YHQI 1TWCJ 1K92A 5E1ZB 1XTAA 1KD1W 4CXFA 2YX7A 3K9SA 4B3SO 4CCKA 3WE3A 3CP8A 2ZQMA 4IEJA 1LVKA 4BR6A 2RMKB 3ICXA 3FXOA 3P3PA 2IS4A 3LA2A 1KP3A 3U11A 2CO5A 3T1HB 3GFIA 2M34A 5IYDJ 1O7LA 2LGWA 2RQQA 4I01A 2K9NA 4KHPO 4FETA 4CICA 1XNRB 2DJVA 5J6XA 1M56B 3WB2A 4JI4O 2QCOA 2JA5J 3S1RJ 2EA4A 3OV8A 2AQEA 2ZKOA 4A3KJ 1OCRH 1W0UA 1OZ0A 2L7MP 3BZCA 5E8GA 1IRFA 3TGNA 1NH3A 4L9TA 2R7ZJ 3AK2A 1AROP 2Y75A 3QP6A 4M6YA 3S93A 3S17J 3ZIAG 3LFKA 2XIGA 2DXIA 4BQAA 2NNUA 1QPMA 4RM2A 1ZH5A 4R6ZA 1N34O 1XX5A 3N97A 3I3LA 2CUEA 4Y17A 1TAEA 1FYLA 4MFDA 3H0DA 2DA2A 2O61A 1WNSA 2MC4A 2RJZA 4XLPF 4U7OA 5JJEB 3PNVA 2JVGA 5E1AC 3JAWB 2CW0F 2OTLI 3ASNC 1XD7A 1B59A 3FM3A 3NWTA 1SS3A 1FBSA 3S8PA 3SJMA 1KQ9A 1UMQA 2A05A 4I98B 1GXPA 3CX5F 4FLXA 4L18B 3DC6A 3MD0A 4F93B 2BYVE 4I0BA 1F36A 2ZMEC 3LAJA 3CTAA 1OCRC 5JH7B 2VE8A 1BI1A 1UELB 5LLQA 1G3SA 2AXTZ 4CSWA 2MH2A 2P06A 2WLLA 3FIWA 3DCFA 4BHCA 2CQXA 4ESBA 4RDUA 2JMWA 3I71A 4AIKA 1YTFB 2KKOA 1JR9A 2QKAA 1ZYRF 3E6CC 3RT3C 1MMDA 3K5LA 3Q0WA 4B3MB 2VKEA 2DK5A 5IP9J 3K59A 1MW7A 3EYIA 4RM3A 3BY6A 1WAZA 2MK3A 3I56I 4ABMA 1WJAA 1MSDA 2H8RA 4M9XA 3F6VA 1ZRFA 4O4JB 3ERMA 3A01A 5F0FA 2IJHA 2HXOA 2DTZA 4UHTA 4X1EA 2L3DA 2Z1DA 3Q0VA 3K4BA 3UKGA 4DR1B 2WAQN 3M8JA 3OE7G 1GH6A 2O03A 3I4NJ 2XUMA 3TBIA 2GLOA 1BOBA 1ZGJA 5HLIA 4M6VA 1BGYH 2M0MA 4W1UA 2BOCC 1PPJH 4FLWA 2G9WA 1RPOA 4IIJA 4MFEA 4JI8O 1H2NA 3BFRA 2RN7A 2PEXA 5M3MJ 4AIDA 2NN4A 4ZDOA 3AG7A 2D45A 2E19A 5ED4A 1LPQA 4NR1A 2QTOA 4HQMA 2ID6A 3E22A 4NVPA 3GUDA 1HKQA 2O8KA 3OGCC 3K5NA 3CLQA 1KYZA 3MWMA 5D4SA 4DV3O 1S29A 3TO7A 2HOSA 4DW1A 4AQYB 2ZKZA 2PJRA 1EKEA 2FRHA 4J42A 2CGOA 2ILMA 2EINH 3Q9SA 4PZJA 3CCJI 3PO2J 1YI2V 3FDYA 2IT0A 2Y0SN 1WH5A 2QQ9A 3GVAA 4A3JJ 2LR8A 2ISZA 1NR7A 3W2VA 2YIBD 4IQ4A 4KN7X 4XKBA 1U5TC 4E6KG 1MIJA 5D8KB 3HSEA 2H94A 1GM9A 5L3CA 3DLLF 2L6LA 1SA0A 4TQDA 2KZGA 2VPRA 3IHUA 1F23A 3RKYA 3B2EE 3K3WA 4M3GA 2PTMA 1A31A 2YSUB 3U1KA 4KT6A 4NDLA 3K9TA 1D5AA 1K5QA 2QWNB 1MSFC 2R92J 1N36O 3ABTA 2MLGA 1IUYA 3HOSA 2EIMB 2UXCB 3JSLA 3AFHA 4GGGA 3PSIA 3B8NA 1Y6IA 4P5OA 3M7MX 1KZHA 1X4OA 4BE1A 4M3BA 5DEDA 1O3QA 2XV4S 1FXHA 5ICFA 4I55A 1IXRC 3SDGA 4HRIA 2EIJC 4CH5A 2V1NA 1R5GA 5FRNA 3CESA 3H35A 3PJRA 1Z21A 3H0GJ 3S2HJ 5FKLA 3PNTA 3SR2C 5KK1A 1YJ9I 1IW7F 1IN7A 2KB1A 2GIVA 2RQ6A 1IXSB 4YY3B 4KITB 2KP6A 3J7AY 1M56C 1GT0C 3GXOA 1X1AA 5CVUA 1VQKI 1NTKH 3F5TA 4RAFA 3HPLC 4LF7O 3HKEA 2EV6A 2F4MB 1FLIA 1Q82W 1CF7A 1FS0G 4LH6A 1QVTA 3G1MA 1ORKA 2OCHA 2L9VA 2CMPA 4IQJA 1K3EA 2DAOA 1XCVA 1R4NB 2XTAA 2GA2A 3CMMA 3IRQA 1KYOF 4YJ2A 1A6IA 4HDUA 1JOYA 1B8IB 3OYKA 5BOXA 1S5HC 1VMGA 3TP0A 2DYSB 2EJ7A 1SRYA 4JYKA 2A61A 2DMTA 4YFNF 3WU1B 1IGNA 1NQTA 2E1OA 3CJTB 2JVHA 3JRHA 4EGZA 1XDCA 2O57A 1HW5A 3U10A 1LQ1A 4F6RA 2TDXA 1JJ2U 5DDGA 4MHGA 2CUGA 2MC3A 1Y4MA 2EILB 3CYOA 1DDNA 3OUSA 1R6RA 3JW4A 4PA9A 5K1XA 4DR2O 5LA6B 5B3SC 1ACIA 4X65O 3DLAA 4P96A 3CC4I 4LFUA 3BDDA 1H88C 2EH3A 4JK1X 1YIJI 4I6ZA 1P4AA 4IHSA 2E5NA 2UUBO 4JZ2A 2JN6A 2PG4A 3GO5A 3IFXA 4LC1A 2B9SA 2FMLA 3BQYA 2LD5A 1VQ4V 4LF6B 3IV5A 2X1DA 4LF6O 3A1YA 1ZUQA 2P6JA 5AG2A 2X1CA 1B06A 3W3CA 2JZYA 1Z6RA 3OS0A 1LFUP 2R7SA 5F08A 1MDMB 1O9GA 1GM7A 3RYFA 3QO8A 1XGMA 2BHZA 2ELHA 1D1CA 2PJRB 3HYIA 4FFKA 1V5GA 1MJBA 2AS5F 3IRRA 4WFBV 2O9LA 2IBDA 3GWOA 5HDNA 3WGIA 2KSDA 4E2LA 1F9NA 4CC6A 4YHHO 3H9GA 3ZMTA 3LNNA 2VUMJ 4X88A 1JA8A 1JMKC 3TDZC 2KPMA 4EGYA 2QWOB 3D5RC 3L73H 3GFJA 4QPKA 1GVJA 2LKSA 1X1PA 3BJOA 1S3JA 2GQQA 3ZR8X 4E70A 3HKBA 3FBIB 5FLVA 4I55B 4AWXB 4OIOF 4C3HJ 2QBYA 1VI0A 3R0JA 5IT9K 1NH2D 1BCCH 1S7OA 3ZCCA 4FLYA 1FSEA 2JUCA 5JJNB 4HLYA 2GDSA 3W7XA 1FXKC 3Q3SA 2YXYA 3ZCOA 5LP6C 2TCTA 4JAAA 2P5KA 2Z0AA 2P67A 4DR6O 1MABG 1JXSA 4X1IB 2HQRA 3DTKA 4DR4B 1AA7A 2VOOA 2HYGD 3GLLA 4F3QA 3MZ8A 3R61A 1UJWB 3FHZA 2CGPA 3K6GA 3GFLA 2XAUA 1H89C 1YW7A 2HTSA 4PCQA 1U2WA 1OYYA 1TC3C 2FTKA 3CDIA 3H1IH 3FM5A 1EN4A 4GT1A 4DUYO 4FX4A 4PUSA 1SZXA 4R50A 4W97A 1YITI 2FF4A 3B73A 1PNMA 4S05A 1E79G 2DFIA 4V2GA 4A0ZA 5E3NA 4RUFA 1RI7A 2YS9A 3BC8A 3C18A 2PX9A 1T08B 4O2BB 1Q6UA 3N2GB 5LMNB 4PA3A 1R71A 1W2BU 2FB5A 2LH9A 4FJCC 4PV1B 2PQ8A 2G38A 2JJ2G 5HS7A 1YXBA 5HFMA 4ANJA 3MN2A 3PFYA 3RYCA 4OIPF 3JTHA 3KCYA 1IXCA 4KIGA 4DYCA 1B8IA 4WWCA 2EIJB 2HXIA 3GZ6A 4JYCA 4Z1MG 2JGDA 3RW0A 5IYBJ 4PJ0C 4D9JA 3RKQA 1ZTEA 1CF7B 4UUSB 2QDOA 1MNMC 3OEHG 4IL6C 1OQYA 3RQ4A 1LNWA 2BE5F 2ICWG 1IJWC 1C0WA 1B9NA 2DBBA 1YEWA 2JVDA 3AG2B 4H33A 3FYEB 1G4DA 4F52A 4PFPA 2IH3C 4OAYA 1KKCA 2VWKA 1Q86W 4GLXA 3E22B 5IYZA 4IX7A 1IF1A 2XSJC 4UFZA 3CC7V 3DF8A 1MBEA 2R7OA 4OAZA 2R5YA 3C3SA 2DYRB 3H1CA 3CXHF 2CWEA 4RGRA 2KZVA 4HQEA 2IU0A 3ZQHA 2DYRH 1W1WE 3MCZA 2E35A 3P30A 5KHKA 4A3CJ 3QODA 2AXLA 2JA2A 3BABA 3HRUA 5CB4B 4DV5B 3E6MA 3A2FA 5EBMC 4P9UA 3EDPA 2WSSG 1KU2A 4JX5A 1USSA 1Z7LA 2O0YA 1JCHA 2MFZA 3J81N 1XNQB 4JI1O 3VYSB 3DXRB 3H9VA 2V4DA 1HKSA 1COWG 3K5OA 2IJLA 1BSMA 1H2MA 2P5OA 1EH7A 4KJZA 4B3MO 3AG3B 2Q8KA 3N27A 3ZHQA 3LNQA 1EH8A 2QENA 3NAUA 4K2EA 1U78A 2R93J 2GWRA 4B3XA 3D8CA 3CO6C 1TGOA 3SGIA 2Z2SB 4CS2A 4EB6A 2Q0OC 2H6CA 1GUUA 2L02A 5EYRA 2DPDA 4IKFA 4LG0B 2QR4A 3PN1A 3IAYA 4BE0A 1XB4A 5LHHA 4ZC3A 2NR5A 5CBFA 1FYJA 4TUYA 3FAVB 4ZBMA 5DN6G 2P90A 3K06A 3CCQV 3SYOA 3OYJA 3HZJA 4JYBA 4MVQA 3T8RA 3BVOA 2GBYA 4KL1A 1Z05A 3ZMVA 1TQMA 4I4TB 2DW4A 1Q8IA 4GX0A 1FTZA 2X6AA 2D1VA 5F04A 2QBYB 4R8CA 3CCSV 3DFGA 3BG6A 4RQFA 4A5MA 3JRDA 2L01A 2EINC 2F4VB 2K85A 3VOEA 5E18F 2KKWA 1NTZH 4U3JB 4UCVA 4FISA 3U21A 1T0FA 4RB3C 1BC7C 2CV2A 2A6HF 5GW7A 3EQLF 1FT9A 1ZRDA 1DGRM 2JEUA 4J80A 2WV0A 4HPQA 5GAGJ 3V7CA 4H13B 4HYOA 5K5RA 2DODA 3TL4X 3QF7A 2HTJA 2MH9A 5CA0B 3OR6C 3A0HC 2LY1A 5KUKA 4XSXF 4L0ZB 1FXKB 3FB7C 3HTSB 3ZHSA 4DV2B 3CCEV 2DA5A 5LL6Y 2VS0A 1OHHG 3W2WA 4AVZA 2QQBA 4H0LB 3AAFA 1D5NA 2WA3A 4UB6Z 3ZRSA 1GM8A 3RYCB 4GRIA 1GN3A 4IIJB 4QPOA 4RAGA 4HNUA 3FX7A 5J3LA 1XMAA 3DTUB 3ZHTA 5GAEJ 2HS5A 3CD6I 4R7CA 4DV4O 1BR4A 3H1KH 3DU6A 2ZR2A 4CO8A 1R4MB 2H8PC 2EZHA 5JJJB 5D5PA 4CA0A 3W6JB 3S1MJ 2VQFO 3CCRV 3M07A 5TGTA 3G6BA 3JAMZ 2K9PA 2EZIA 4U88A 2HQ5A 4HZFA 4X20A 3P9IA 3SHFA 3VODA 2IJJA 2EFOA 3KP6A 3LL7A 2R7RA 2LY2A 2EFNA 3GB7C 1J95A 3L71H 3BCBA 4D5FA 3AL0C 2DE0X 2G0EA 1B4AA 2XOKG 5B66Z 1Y8RB 5B1NA 3KP7A 2EA2A 3KLOA 3O9OA 2GA1A 2VJ5A 5F1RA 2OZUA 2IS1A 1G4YB 1JX9A 2QWRB 2KMUA 3MZHA 4BEHB 2WLMA 1H38A 4O4IB 2XT9A 1BIBA 1KU3A 2V1XA 2VONA 5C4XJ 1P49A 2R7WA 3SPJA 1ZGWA 4NXMO 3I59A 3KYLA 1I7FA 2PMUA 5CVRA 2LP0A 2BVMA 4XMYA 3GTLJ 3P7NA 1FZPB 5LOVA 5DTDA 1PP9H 5HLHA 4HAMA 1EZJA 1MKMA 2RDPA 2X9DA 1ROPA 1I94O 2L9RA 2XPUA 3LFUA 2Q69A 3L2QA 5B1AC 1R23A 2IEKA 2FNAA 4IF4A 2B1IA 4UV8A 1YW8A 2J5OA 4BE2A 4Q5SF 2CUZA 4IJAA 4RAIA 3ZS8C 3HL2A 1YJ9V 4NUBA 3VDXA 4BHPA 3IP4B 5DEQA 2V6CA 2P4VA 2DA6A 5HLTA 2F5VA 4C7UA 1MBGA 5A9GA 4F6EA 1L3LA 2CTQA 3RYIA 3UR3C 3RPUA 3ETQA 3VWBA 4A0XA 1QRYA 4LF4B 1O9HA 1R58A 3APOA 1BQ0A 4HV5A 3W7SA 2COMA 1MMAA 2M7AA 4BJ6C 9ANTA 4XORA 3J80Z 1ZL8B 4FMTA 1IBLO 2QEXV 1CPYA 4YIRX 4BW9A 4CS3A 1OCZC 1WA8A 4XDKA 2ZIMA 4KFMA 4G28B 3CCLV 2WLLB 5H2FC 4LP8A 2F5EA 3L72H 5IP7J 2FKXA 2FMYA 3QQAA 1BA5A 1OISA 2M2EA 4JTDB 4HDVA 3SYQA 3WG9A 3P3NA 2OF7A 2JTVA 3P9CA 4LJZF 2GAUA 1AJNA 2QSFX 5LGUA 3D3QA 3E8BA 3OMAB 2CTPA 4ASNA 1BI2A 1I3AA 1A36A 4MW8A 3JAMN 2FX0A 2H1LA 4Z6YA 1PNKA 4FLVA 4D1QA 4XN0A 3Q9VA 4FQGA 4RGSA 3WTUC 2UXBO 4AIJA 1IN6A 2B5UA 1M1KW 1R1VA 3AG4H 3MHSC 3QU6A 1VF5B 3C2BA 4IHYA 3E1SA 4U7BA 2M5WA 1JUMA 4OX9O 1N25A 5GAHJ 5IPAA 3M99B 4S04A 2L35A 2ZXWC 2A5WA 2EINB 4BGDA 3GEZA 1IN4A 5D4RA 3L2VA 2M4KA 1YFHA 4IHXA 5BXZA 3MKLA 3GYHX 2WADA 1QZEA 4UXNA 2P7TC 3B40A 2QM4A 2FU4A 4FK5C 1BOAA 1QHGA 2KQXA 3JATA 3JD1A 1FIAA 3OL4A 5CQEA 4Y15A 1BL8A 3B02A 2W0FC 4BXUA 1I5YA 2JT1A 1ITYA 2QGNA 2QTSA 3K2ZA 1YX3A 4OWRB 2CGNA 3G2BA 2QE7G 1E2XA 4MNUA 2QSHX 3RSNA 2WAEA 2JK5C 3COAC 2KISA 2E2JJ 1TWFJ 3QYEA 1BHAA 2MBFA 2XAHA 5KHHA 3CCMI 1JTXA 3C2HA 4II2A 2VE9A 3MAJA 2D2WA 4M71A 5LRRA 1P4RA 3T1CA 1ZELA 3EUHA 3OYLA 1XN7A 4G6DA 5GADJ 2HOTA 4M74A 1IXMA 1QLEC 1V54H 1TBXA 2E2HJ 4QTRA 4TT3G 1YLFA 1FMWA 3A02A 1I39A 3WTSC 3S1QJ 1AJQA 2HDWA 2Q7EA 2F1MA 4X62B 1XDSA 2OWOA 1N33B 1L1FA 3L09A 2NVYJ 2PJPA 3JRIA 4RGXA 3VPRA 2IA0A 4K8XA 4LIUA 1T6SA 1WKMA 3K1NA 4XRSA 1HA8A 5CPRB 4AVPA 2DFFA 1QU3A 1TVKB 4NTYA 2ESNA 4IXAA 4DZJA 1W59A 3ZQQA 3CRAA 1U3EM 4M72A 4WF2A 5GP9A 3OYGA 3JCZA 3FHNA 3S32A 4FCYA 4YELA 2PBIA 3RPQA 1FFTB 1X3ZB 3HSFA 2STTA 1A32A 1H2LA 2EJRA 3FXUA 5H2FZ 3FMSA 3CE2A 4I9WA 1S0VA 5BNGA 2QA4I 2IGMA 2KL4A 4AYBA 4E7HA 1BT8A 2EIKC 2KG7A 2B7EA 1BI0A 1MJ9A 1OCZH 1S72I 5IT9Z 2VIXA 3M8EA 2DMUA 1BM9A 3AG3H 4KN4X 4XLEA 5K7ZA 3MQ0A 1FD9A 1XREA 2XAFA 3IH3A 4PJJA 4BBRJ 4XIDA 4XK4A 4N21A 1WPXA 4O2AA 2G7UA 3U0ZA 1FYMA 1R3KC 3UQ8A 1E1RG 5E17F 3O65A 3MMYB 5E3OA 3IJ4A 2R7TA 5GTIC 2R7VA 1PD3A 1VARA 2XGCA 3KIOA 4B43A 3FD9A 4DGWB 4A3DJ 4EV0A 4F6RB 1FBUA 1FJGB 4RGUA 3U1DA 1UAAA 4N4OB 1XGNA 1VZ0A 4EJTA 2R7UA 2A7WA 1RC9A 2L2OA 1W7PB 2HOEA 3TP3A 2P22C 2NVUB 4Y52J 4XOTA 2AQFA 4RA2A 5E79C 5BMZA 4C9YA 3LSJA 3T8TA 4E7ZA 4CYCB 2E34A 3CJHA 3OW2U 4BY1J 4DV0B 2LW1A 5DS9A 1IBMO 3AG1C 1R5HA 4FIPC 2CQKA 1WJEA 1T5EA 3H3ZA 2Y69C 4LB5A 1Y0NA 4K0KO 3BG9A 1F4KA 1P4WA 1XHZA 2PY5A 2EWNA 2E1NA 2EB7A 1QPIA 4X8AA 1MD0A 3ESWB 3L2RA 2QWQB 2GOMA 1S7EA 5ITZB 4P9PA 4C2TA 2CK3G 4K35A 1SFEA 4OX9B 4DR7O 1CXZB 4L87A 5GPCA 1VFCA 4NKGB 3CUQA 2ZXJA 1S5JA 1S8NA 3SJCC 3HDDA 4ZIBA 3WE2A 4CC5A 4D7MA 3I64A 2JRMA 1WB7A 2V7FA 2GIZA 2F43G 1WH7A 4NYKA 1IN5A 1X2NA 2A6TA 4I9QA 2P6SA 4KP4A 5KHJA 3X2QC 2IXSA 1KONA 4JAUA 5TISZ 3WB1A 3B4SA 3SZPA 1G1XB 1R1UA 4A3FJ 5F6FA 2UXXA 5LMUB 5F27A 1FYKA 1DF5A 1EA3A 3M8FA 3K7AJ 5CYVA 3F3XA 3BHPA 2F4IA 4IRGA 4ZDLA 3K4KA 3LUTB 1L0NH 4PA4A 4M9SA 5J40A 1WJBA 3KX2A 1M9NA 3MHHC 3AKZA 4JV5B 3KZIC 1IRXA 3A0HZ 1P9QC 3GMEA 1Z77A 5J1YA 3WU0A 2LK2A 3QYFA 1PVEA 1UHSA 2XRLA 2VQEO 1ENHA 1YS7A 1U97A 3TOBA 2V79A 4KIBA 4HNAA 3R66A 3KZIZ 4Z1VA 1XCBA 1N32B 1HR0O 1DU6A 2HOAA 4NC7A 2ZR3A 2BTQB 3E89A 1X1CA 3WTZA 4J00A 2YUAA 4JGSA 3OGIB 4LOCA 5CA1A 1F7YA 2DPUA 3LSPA 2VJJA 1FOKA 1AI4A 1D0YA 2KG7B 5DECA 2F4VO 1TT5B 2Q67A 3ZQIA 2WPDG 4YXWG 2ETNA 2WV1A 1BJZA 4BKXA 2DCEA 5C8YA 4JI3O 2QWWA 2WBMA 2VN2A 4TOIA 5JVDB 4LF5O 3KP3A 3T0YA 4HSTA 4CHUA 1ON1A 1SC7A 1FKAO 4MVMA 4NTWA 1ZSPA 3G80A 2UUAB 1YE9A 1KU7A 2Z16A 3FXLA 2MG4A 2Y30A 1RR7A 1N0JA 2IA2A 4DOZA 3L2WA 1DP7P 4DW0A 5KNLA 4OIQF 1I1SA 1M57C 5CN0A 1HSTA 3P32A 3GTPJ 2P7VB 1E0EA 1AR1B 2D2CB 5E8IA 2N74A 3JD0A 3RN4A 4LLLA 4XLFA 5EEGA 1B9MA 3RYIB 5F2VO 4Q48A 5F0CA 1IC8A 1LDDA 1YRNA 2EX3A 1O3RA 4DV1O 4LH7A 2ZD9A 2D1HA 2LFBA 1GRJA 2DQ3A 4PI0A 1UFIA 3OAAG 1URFA 1JJOA 5J2UA 1JUSA 4WK8F 4RB0A 3L9DA 3B77A 3DPTA 5LXTA 3FMRA 3TETA 1VQPV 4CDGA 1XGSA 1QCEA 3FB8C 1VQ7V 4XKWA 3CUQC 2DYSH 3OIQA 5J1UA 3BPXA 1IV8A 5CJ9A 4CGZA 2RCVA 1YIJV 4ICGA 1D5VA 3ETEA 1ZAOA 1QBZA 4PDLA 4I7HA 2DA1A 4FFBA 2F5DA 4GFBA 3VQYA 4O5VA 2KRCA 4U0WA 3ZQLA 1RR8C 3BR1A 3CQZJ 3VEPA 2IGNA 2F95B 3ABKH 3KP5A 2Y4TA 2LY9A 3JD3A 1VQ5I 2F6CA 2LKXA 3MKWB 3E8FA 3ZMDA 1IBKO 4E4HA 1ETXA 1IDZA 3IKTA 2JS5A 2ZE6A 4Q47A 3STZC 1K9MW 2YC0A 3I4PA 1YO5C 1OV9A 2LG4A 2ZNIA 1KGSA 1R6TA 4Y3OA 1NZ6A 5BPDA 2P81A 2HPMA 3HR0A 1UFMA 1RPRA 1FXVA 3SYPA 2CQQA 4G8XA 1QU7A 4U0VA 3TOAA 1IUFA 3MAQA 3EUHC 3JSPA 2BY0A 4LF7B 2Q2EA 3H3UA 2XC7A 1JVMA 2QWPB 2OIEA 2EIMH 4LMYA 5HVQC 1SQFA 2NLJC 5JR3A 3JASA 4JI3B 5TJJA 4X89A 2DDBA 2OD5A 1UJ8A 4J10A 1XG1A 5D5UB 5A2QN 1SFXA 3F8BA 5LBQA 4B3TB 5JVDA 1L0LH 2LOOA 4UCRA 1SANA 5BPIA 4FZ0A 2KLOA 4R8HA 1G3TA 2WC2A 5E1XA 3EYYA 5E3LA 1MNGA 1B1BA 4I09A 4KISA 4MVSA 4CH4A 2H6BA 2K5CA 2EZPA 2QKCA 4ZI7B 3N2KA 1J5EB 1WGXA 2Z3YA 2JPBA 5KCMA 3VYTB 2P5LC 3PUFA 1VQMI 1R6KA 1U8BA 1Y74A 5EIBC 1KQSU 1AP6A 5BZBA 2BXZA 1AKHB 3FXRA 3ONQA 1YJNI 1DPUA 4MO7A 4TQFA 2PYJA 3ULQB 1N36B 5LXTB 4HNAB 1HSJA 3FXKA 1NHAA 2JPCA 3OIOA 5DD8A 1H2KA 2QKSA 3CDHA 3CPWU 2ZC2A 4XLAA 4JV5O 1SD4A 5L3EA 1VF6C 3DC5A 3H5AA 2FOWA 4JP0A 1XNQO 1GLNA 3K08A 4LF8B 4HA8A 4B3RO 4WFAV 3JAWA 4B48A 3IWZA 5EGOA 3ZRVA 4F55A 1HW2A 3GTJJ 4UCUA 1KB9F 4PI2A 4AQYO 3KKYA 2OQRA 5EK0A 4EFBA 3WFVA 4D6TH 4ZYAA 1LJ9A 5JQGB 1HBXG 1FFXA 4WCEV 3FWEA 2O8XA 3O2PE 3A01B 1ZQ3P 4HG2A 4UUVA 5AIQA 2VXZA 3BR0A 1QQCA 1EM1A 3FXQA 1RETA 2NNYA 3OM3B 1K4DC 3CC7I 1K5SA 3AG1H 3K70C 5BR8B 1MSWD 3QO7A 4LR3A 4JI8B 2LVSA 1ZG3A 4LGWA 1LE8B 4YIPA 4FFBB 1EN5A 1OR7C 3FXMA 4BBSJ 4QE7A 4DR4O 4EJOA 1GDTA 1ZWIC 4FLUA 3CRRA 1YCIA 4LNUA 4AHCA 2L4AA 3VQVA 2Z99A 3EUAA 3HOVJ 4IHJB 1BR1A 3CCYA 4MTEA 3VSKA 5FD6A 5LGNA 3SYTA 4JZGA 1HNWB 2M1BA 3BPZA 4E7JA 4CYDA 2IPQX 1TLHB 2M8GX 3DXJF 2ZXHA 1IAWA 1D5YA 1FBQA 3JD4A 4YIIA 3M1CA 1VQOV 2DLLA 2IH1C 3WB0A 1G59A 3E6BA 1Z91A 5B3SH 1B3QA 4X6AJ 4DRXA 3BTIA 4NXNB 1U0JA 2F5CA 3CMAI 1FOYA 4P9FA 2YXLA 4DR2B 1SERA 2R4GA 1BHBA 2X51A 4IHTA 2EBIA 2BXYA 1VQ8I 3NR7A 3HKDA 5FKKA 3ZMSA 1AILA 3V8KA 4I0XB 3J7YJ 2EPFA 3KETA 3LSUA 5TISC 2K9LA 1MBJA 4DUYB 2E36A 1U5TA 5EF6A 2XAJA 4ENJA 1RRJA 2R9IA 3HKEB 4UVCA 2VQEB 1MH3A 1BQZA 4QWQA 4JI2B 3HOUJ 2UU9B 3EUKL 4BYYA 3F8MA 3M7GA 1OCRB 3K0DA 2DMNA 5FL7G 4MEXF 1GMGA 3W7UA 5LD2C 2XF6A 1Y1WJ 1YVWA 3CCVV 3DTEA 1EV7A 2BVLA 2L9SA 3CDLA 2VB6A 1L8DA 4PHZA 4AIHA 3HOXJ 2LLKA 1K79A 2VJIA 4MEYF 5DV5A 1PM9A 1BL0A 2JA8J 2K40A 1Y56A 3D5LA 3SPGA 3F0CA 3K4CA 2FXAA 4V19K 1U8RA 4IL6Z 2A69F 5IJ0B 2ADQB 1RKTA 4G7HF 2HVKC 4J9YB 3PJSK 4PJ0Z 2MW8A 2LMDA 1RUOA 1SETA 4KHPB 3E7LA 5D5WB 1B04A 1VEWA 2LO1A 4ZOLA 1G3WA 4B08A 2LRDA 1I5ZA 4EEFG 2B63J 4J7JA 2E60A 1YS6A 3T1HO 2P4WA 3OUFA 2EILH 1HDDC 3GTGJ 5DUKA 3ZPLA 5EG0A 3H1HH 3CCEI 4HF0A 2M7WA 3L9FA 3R6SA 3HIFA 2R5ZA 2V4JC 4ESJA 2Q6AA 2LSOA 4DR1O 1V9PA 3IAM2 1YOVB 2JJ1G 1ZARA 5GTIZ 1V4RA 4YG2F 1HOMA 3S3WA 4X64B 3E2EA 3BWGA 3RCOA 1J0RA 4DV0O 2JJ7A 2XSDC 1DGWY 3IKVA 1KKDA 1WJZA 2WLKA 2UUBB 1XUQA 1XS9A 4KIFA 2COBA 2FYUH 1PL0A 3I56V 1F1ZA 1F4MA 1V5EA 1WP8A 2RAEA 1BIAA 4YRVA 4QIWN 5FNVB 2L7ZA 3OYNA 1NK2P 2ZNZA 2HVQA 5CQGA 3ETGA 5ICCA 1GVDA 3JATB 1RM1B 1TQIA 3M3YJ 2Y2ZA 3IC7A 1VQ6V 2NS8A 2R3SA 4DRXB 3D1NI 3K58A 3HKCB 2DN0A 3I54A 2DA4A 3HJEA 5HDKA 4FTHA 1AOYA 2Z9OA 3G3ZA 3OIPA 3F6OA 3HGYA 4HOBA 1VF9A 3DEWA 3V42A 3HSRA 1J5YA 4ZJZA 2DQ0A 5EDNA 4RS8A 2X1EA 4DNCA 2WY8Q 4J9ZB 4LF5B 5KAIC 1K97A 2Q7HA 3KCXA 2Y0IA 3ZRWB 1WFXA 1G6NA 2PMHA 1W36C 2BEOA 1AHDP 4I4TA 1YDXA 1PKXA 3PM1A 4Y13A 4UCTA 3LA3A 1PUFA 3M9AA 5D8LB 3HM5A 3OT7A 1RFYA 3E5UA 3P5JA 3X2QB 1H8HG 5IYDO 2ZNJA 1VTNC 5B1BB 4AI8A 1IN8A 4D0PA 2ACJA 1DP3A 3DXRA 5BMVB 3BG7A 2XKOA 3I9V2 5DM6V 4PSWA 5JHFA 5EZHA 2R0QC 1Y1VJ 5K7FA 2I5UA 4G7ZF 2VQHA 2NVXJ 2XNDG 2KHMA 5FPRA 5B1AH 4A2UA 5BQTA 2GM4A 4X62O 3F9KA 1D1AA 2MD0A 1WJ5A 2NS0A 1J2XA 3S3OA 2WA4A 2VL8A 4BXXJ 3LDCA 1S76D 4EFEA 2E1MC 2K4JA 3DQVC 1P7JA 4MTGA 3DP7A 1JHHA 2PN6A 2YI9A 1MNEA 4IOAF 4BIZA 2BW3B 3F21A 3LSMA 4QIWF 3FB6C 1QHHD 3F8CA 3F5WC 3KEQA 1Q6IA 2R7FA 2AGAA 5JCOA 2CFOA 2HR3A 2K4BA 2YR2A 3BR3A 3HBLA 4HX4A 3JTGA 2JA7J 5HFLA 1WJDA 4QPJA 1ZLJA 1JTYA 5EGOB 3Q5FA 1E3OC 1R7JA 2A79B 1I27A 4ASUG 3I55V 4CCLA 2R7XA 1Z5WA 3PQJA 3J80N 5JHUA 1B72A 3DSQA 2BGCA 4U7DA 1I1GA 3HB3B 4KUMA 1JPXA 4WCGA 3CRQA 3RYHA 5EZGA 2E75B 2BY2A 5CBHA 3I58A 1XMXA 3ZRXA 3TO6A 2W4SA 3BPVA 1M57B 2YI8A 2ADPA 4A12A 2XPWA 3PIOF 2FL4A 1TL8A 3IC9A 3ABLB 3ZQCA 4B3SB 5HNFA 3RWRD 3VYUB 2Y4UA 1T56A 3N4MA 3CRMA 2WLJA 1U96A 5E79Z 4ZTFA 5J4YA 1JKOC 1WPBA 4DR5B 3WTTC 4DJAA 4B8XA 2ECBA 5FLMJ 4G7OF 4C2UA 1QBJA 1VIBA 4F92B 1R36A 2HQNA 1RNLA 1QR9A 3E5QA 2EZKA 2VASA 5EYPB 4A69C 4GKKO 1Q5OA 3K10A 1OJHA 3K70D 1X2MA 1YQAA 4ITVA 2HVSA 5CLSA 4QGPA 1W5TA 1YX5A 1QVFU 1UG0A 4FE4A 2HHHO 1FTTA 4PELA 2DA3A 3H9JA 3VB2A 1N77A 4ZZLA 1SVLA 4CCMA 2R72A 3UCSC 2DA7A 1SA0B 1SQPH 4NNJA 3W2AA 1P92A 5FRMA 2WY7Q 2VLAA 4LF4O 1KECA 1QLNA 2DFHA 4C2MJ 1VP7A 3N2KB 2P8TA 3TGUH 1VQMV 3OD4A 4E7SA 1Y0UA 2ZB9A 1JKQC 2E74B 1KYWA 3RFRA 2DOSA 2P5VA 2W1OA 3S2DJ 3I5UA 4PDMA 1NK3P 2CH7B 4KFCA 3SQNA 2R9RB 3Q4HB 2VJ4A 3FKIJ 1LVAA 5B66C 3E83A 3KZYA 2QEXI 3WTVC 3E8GA 1RM1C 2CUJA 2EFQA 3JRCA 4ZHQA 5LA6A 2Q9LA 3ABUA 2E7XA 4BUPA 3CCLI 4EKWA 3V8JA 2VKVA 3VYRB 3OWTA 2W82A 3NRVA 3GX4X 1EZVH 1HP8A 3QOEA 1US6A 5JWPA 5K5OA 4RMNA 2GV9A 4RUEA 2PMZA 4PJNA 5D5XB 1AJPA 4DV6B 2OAZA 4PD4F 4TV8A 1IBLB 2HJDA 3LA7A 3OYEA 1E3PA 2VBXA 5AONA 2ZDIA 4AUXA 1GV2A 5FPOA 2E5LB 2JUGA 3AG2C 2HEOA 1SVOA 2DOEA 3BZ6A 1IZ3A 4Q6GA 2ZSHB 4I76A 3ASOB 1O3SA 3QYBA 5H20A 2HHHB 1I08A 4KICA 4DO2A 1Y6XA 1YITV 5IYCO 2ZXWB 1RUNA 1PNLA 4GKKB 2JS3A 2QSAA 2DYRC 1D8JA 4KYWA 2OT5A 3JCUZ 4MS2A 1YJWV 3QPHA 2M6YA 4LLGF 2CE4A 3F72A 2DQLA 4PJLA 3KE2A 3HC7A 4BJ5C 2IJKA 2V7QG 2X7RB 4MIMA 1HQCA 3ZMZA 1R1BA 1ENVA 2E3CA 5JVGF 5CA0A 1DU0A 3QPSA 4PGGA 2CU7A 1TWGJ 1FY7A 2YICA 2YX4A 4O3MA 2HZDA 3FF5A 3F7YC 3K04A 3S2WA 3SFIA 5J8FA 5J9PC 1ZREA 1YYVA 4LLNA 4XL9A 1T2KA 1VQNI 3Q0UA 2D5VA 3RBZA 4V2FA 2GTAA 3DPLC 3EHBB 3FK7A 2ME6A 1MNDA 2UV1A 4GYIA 2LTPA 1Z5VA 4MVZA 3VBBA 3MVPA 3V7RA 3TW7A 2YU3A 5EEHA 3WU2C 1KU9A 2QVOA 1VQ8V 2X6WA 2UXDO 2TRTA 2X6YA 4RWUA 5ERIA 3RDIA 1Y67A 1M93A 2A06H 2F23A 3HHHA 4G2KA 4GUNA 4X1YA 4ZHQB 3HOZJ 2RQPA 1BW5A 2LW7A 3GCMA 4O4IA 2OBPA 1SZTA 2VQFB 3EVKA 4FM1A 2QQ8A 4DBRA 5C3EJ 3ECOA 4JQFA 4RLQA 5JVTA 2MW2B 3EPZA 3BCCH 5LYJB 4JOMA 2DFEA 4A5NA 4HF1A 2PZSA 1OYIA 3CMYA 1NS1A 2IA1A 2RKHA 1CP9A 4BIUA 2DU9A 5E20A 1VQLV 2EQRA 1KC8W 1K33A 1SD5A 1QNMA 3EXAA 3CCUV 2M8EA 2XGXA 2VKHA 4D7NA 3V4GA 3OMIB 2HNHA 3J80K 3HOWJ 1K83J 2K9QA 1PYVA 2XGDA 2F4OB 5F1JA 2VT3A 4E7IA 2L7FP 1M5IA 2ZIOA 2UU9O 1S72V 2XHBA 3CZ6A 2QUFA 3O3KA 3MKZA 3W7TA 2CG4A 1MBFA 3I5DA 1T39A 1KBHA 3R65A 1AKHA 4IRHA 1NVPB 3WODF 4MTDA 1K4SA 1SFUA 2XHKA 1A35A 1P6RA 1OCCH 4L0YB 4A0YA 2E7WA 1JJ6C 4MVUA 1D2DA 4DQ2A 2WAQA 1M4UA 2DK8A 3JRAA 5M5YJ 3REOA 2K3FA 1OFCX 3NWSA 2XROA 3L2UA 1ZX3A 3PL8A 4QPQA 2VC1A 1ON2A 4UY8I 3LOCA 4HBLA 4XN3A 5CVJA 4GO1A 2XAGA 2UZKA 4L5IA 2A5YB 3K4LA 2M7BA 1P4XA 4CCJA 3CCSI 4ESFA 1Y76A 2Q73A 3JARB 3T4DA 2FJ1A 1YIOA 4NC8A 4U87A 3ELKA 3ASOH 4CYCA 2R9AA 1H9GA 1WQ2A 4M6XA 1MGTA 2V1UA 1XILA 1PUFB 3H01A 1ZN2A 1MZEA 4F7ZA 2VBWA 4JI2O 1NT2B 2KJCA 2IAIA 5FFZA 3RZDJ 2ITDC 2Y69B 1MMMA 2AW9A 3ABMB 3AL0B 1A5JA 4II3A 4YHHB 4JYAO 2ID3A 3KPHA 1KQ0A 1MOFA 4WFGA 4A6EA 1IRZA 1SFKA 6PAXA 3SJAC 2HYJA 1RESA 2MSYA 2YU9J 5A2QK 3ZRGA 1VQPI 4MT8A 2ZM6B 2UUCB 3ZMUA 3RKWA 4WXHA 3U2RA 4EJVA 2F93B 2LGQA 2FEZA 3JAKA 4FM2A 1IDSA 3LDDA 4LK0F 1HC8A 5L3GA 3GTMJ 2Q0OA 3CLOA 1R73A 1JI8A 1FFXB 1JHFA 3T1BA 3K69A 3K4NA 2W7NA 1FOXA 3UO3A 1TVKA 3DEEA 1X58A 3HKZN 2HVRA 4JASA 1TZLA 1SKVA 5FKMA 3HKDB 1VNDA 2FQ4A 2IJIA 1QZYA 2X4HA 1J9IA 3LSIA 3CS5A 4UCOA 3OMNB 3JYCA 5EBLC 4ZKIA 3AEIA 2QYOA 3GWKC 2YEVA 3CXCU 3GWZA 3QRFF 5JH7A 4S0HB 1NI8A 4BH9A 3VSLA 2QJ1A 3FYIB 1I5XA 1R3LC 4DV2O 1HLVA 4JYAB 3FB5C 4RAZA 3S14J 3JSNA 2VQLA 4C30A 1GO3F 3RGBA 1ZK8A 1JJ8C 1B72B 4CS4A 3AK3A 4WX9A 1F5TA 2B1GA 2W25A 1X19A 3ZQGA 2J5PA 4A3BJ 4O2AB 2LBFB 1H8AC 2AZ0A 4N23A 1FP2A 2DDAA 2OU2A 3QPTA 3CCMV 3T1YO 2BSKB 2X6CA 2H1KA 3HB9A 2PI0A 2UUAO 3JR9A 1YF2A 3RIRA 1N4CA 2DT6A 2OV7A 2MGQA 2GBOA 1SD7A 2LF8A 2A07F 4DR3O 1XDUA 4BDZA 2ZMEA 5LYJA 3H5NA 2HEPA 2FBHA 3OS2A 2DOFA 3OTOO 4RBOA 4YIOA 2Q68A 3TQNA 3C7JA 3BCAA 1ETYA 4AU7A 4DYRA 4EM0B 1XBLA 1SVMA 4KA4A 1FEXA 2I8DA 2M9HA 2Y0PA 5KMGA 1ZLKA 4CCOA 4IYHA 4TWKA 3LDEA 4CZCA 2K9MA 4ZDPA 1UZCA 1PP8F 5IDJA 1N32O 4I0XA 3TO9A 3FISA 4J01A 3NEUA 3JALB 5DCMA 1U9NA 4BNCA 5ILUA 2M4GA 2OQGA 4QJFB 1P7IA 1K61A 3BRCA 1I6HJ 3G71V 3M4OJ 2CW8A 1DGSA 4X66B 2M87A 4LF9O 1Z0XA 2OPTA 1YJWI 3H1JH 3N2GA 3F8NA 3CP2A 2YUSA 3A2KA 1JGSA 4XBFA 3LSHA 4CUGA 4X0GA 3CMEI 2NS7A 1OCPA 2QA4V 2V6EA 1YRNB 1USTA 1S5LC 4NQWA 1Q3EA 2RNJA 2GXGA 4WFFA 3QVNA 2GUZB 2PYLA 4DR3B 2WLIA 1H8EG 4EM1A 4UV9A 4XRSG 4BXFA 2ZDIC 2R5YB 4JI7B 1X3WB 1TW2A 4N9HA 3S3NA 1WN7A 4WBNB 4XLNF 2DWEC 4YIFA 2CTRA 1L0OC 3ASNB 4YFXF 4EJUA 2E2IJ 3H92A 4M3EA 3CWBH 1J59A 4O4JA 4FT8A 1JE8A 4DV1B 4IZZA 3CO7C 3WHCA 3MZYA 1FP1D 2VC0A 4XRFA 2KQRA 1BBYA 1GN2A 1LDKB 2CYYA 2JEXA 1TT0A 4R1HA 5CVIA 3SZTA 4B44A 2ADUA 4BY7J 1ZRCA 4XRMA 3QP5A 4NTXA 2JGDB 3RVYA 4DR7B 4I5SA 1D8KA 2QQAA 2W85A 3C3TA 1ETQA 2CW7A 3HKZA 2XVCA 1YW9A 3J81K 1IBKB 4IGGA 4NBQA 4XKVA 1N78A 4IHJA 4J19A 3C3WA 1NG7A 4CCNA 1LUJB 4ZYGA 1QO0D 1WB8A 2IU3A 1NU1H 3K4JA 2HJFC 1UHWA 4KMFA 5KHDA 3SFZA 2A3SA 2CV0A 1TWAJ 1IBMB 5IYZB 2XASA 3SJQC 3GZNB 1R5ID 1OCTC 2D3OW 2CJJA 3QPLA 1DF4A 1YTFD 2ZFWA 1UG2A 3CCUI 1EF4A 4JI0B 3CMAV 4OOIA 3CC2V 3Q4HA 4FPPA 2XF5A 1OMIA 3HRMA 2P7CB 3S15J 1PJRA 3VQXA 4X65B 3KLNA 2E5ZA 5JLWA 4B47A 2EIKB 2A6EF 1JUPA 3OYBA 3CB2A 2KFDA 1SFOJ 4JTCB 4JX4A 4BHBA 4YFKF 2IW5A 4ENKA 3ASNH 4LF9B 3PFIA 2HU9A 3CJNA 2LC2A 3LSTA 2HQAA 3WHBA 2VXDA 1NBMG 2ODMA 4UNOA 4DK1A 1RP3B 4J7KA 1TUEB 4RB2C 2BOBC 1AWCA 1QGPA 4X9QA 2EZLA 1IVSA 3L74H 4CH6A 4I50A 4OGQB 4IPAA 5J1RA 3BR6A 2A68F 5K7HA 4N9IA 1ETWA 5J8CA 2Y9YA 5BMVA 2X6OA 5FKNA 1T38A 3CSXA 2VBYA 4RLFA 2RN9A 3OYFA 3HUGA 3WTXC 1PP7U 3L7WA 1WP7A 4B3TO 3LWFA 1HCRA 4WBNA 3DWLE 3KCCA 2BSKA 1MBHA 1Z1DA 4UVBA 1WRJA 3QAHA 1WPKA 2P6TA 2YIAA 4JI6B 3MEXA 3E6DA 1F4NA 2ZE5A 1F43A 3D3IA 3OYAA 1G8MA 1W5SA 1QVUA 4HV6A 2X48A 4BQQA 2DJIA 2E71A 4Y33A 1W0TA 1SQGA 4MSWC 2PFBA 5ICEA 1HKTA 1QNTA 2FNPA 4BQNA 1IRGA 3GVMA 5KMGB 5KA5A 2EIMC 5KUMA 4MQ9F 1IO2A 1XC5A 2BV6A 4BAYA 4B7KA 3OFNG 2FBKA 5JQGA 4Q20A 3K4MA 5HODA 1X1BA 4P2ZA 4IYIA 5EG0B 5M5XJ 2IS2A 2EFPA 4RO2A 5IJ9A 1OYWA 3WTYC 3OYIA 1N33O 3H5RA 3OR2C 5E3MA 1MJAA 1W7PA 3OY9A 1V55B 4ZOLB 2WLIB 4DUZO 3R60A 4PJMA 4MLOA 2KIFA 2R7DA 2RVCA 2XDVA 3A0BC 2IVMA 4XLCA 5J47A 2EFWA 1X59A 2OIGA 2Q0AA 1T0FC 2PI4A 1WJCA 1X4PA 2V9PA 3OSFA 1XL6A 1D0XA 1V3FA 2H8WA 3WTWC 3E35A 3S3XA 2DI3A 2VODA 1APLC 1G6UA 1BI3A 3T5XA 2BW3A 4UVAA 4PA7A 1Q43A 3ABKC 3KEOA 3G4SI 3TMOA 5AIPA 3BG5A 3ZQFA 3KP2A 3H1LH 3OMYA 3CJQB 2EBOA 2NOGA 3I0TA 4OMYA 4MW3A 4ABZA 5GONB 5ITZA 4XDLA 2F66C 1J09A 4GDFA 2DYSC 2MYSA 4EVIA 2K3PA 3R0AA 1ZTRA 2DT7B 2ZE7A 4LFAB 5CMUA 4HLXA 2V26A 1TNTA 1W5CC 3H9QA 3L2CA 2W57A 3RQIA 3BTCA 1X4TA 1LFPA 5B3SB 4PDVA 5D6FA 5DUIA 5CA3A 2H3OA 4K0KB 1V55H 2MABA 4GKJO 1ETVA 4A5UB 5IT3A 4OMZA 3G71I 3VOUA 4BIOA 2LREA 4GYGA 4YY3O 2OCCB 3WG7B 3SDBA 3LQQA 4A6DA 1GTOA 3K0GA 3GFMA 4PDKA 3KG2A 3QOPA 2FQ3A 2K86A 1XMKA 3FMQA 3HOYJ 3CCVI 4L8JA 1WVRA 2ISYA 1MMSA 1NVPD 5KAFC 2QSGX 2BHYA 3ZP5A 4UB8Z 2CQ7A 2HI3A 3RYRA 1FJGO 1LNQA 4Z2WA 1I50J 4BEHA 1PUEE 2DMXA 4BL0B 1U6GA 1Y76B 1D3YA 2DWDC 2WWWA 3JARA 1XNRO 4X1KA 2L7KA 2HDDA 3P9KA 2KDZA 3C2GA 2AHZA 4KXRA 5IP6A 1FAFA 4JI5B 5FLXK 3CUOA 3KYCB 3JAMK 1I3QJ 2QGUA 2IS6A 1G3YA 1FPOA 4ZI7A 4DV6O 1ZHFA 2K27A 1TA8A 2WTEA 3ZOBA 3MD2A 5CVVA 4QSHA 4EJWA 2GUZA 2RV8A 2YIDA 2CH7A 1F51A 4QLCU 2DJNA 2W6IG 2B0LA 3PIPF 2KDOA 5H6QA 3K03A 5LP6B 5C44J 1N34B 1T33A 2HWVA 4HX8A 3F23A 2PGGA 1Q81W 1I94B 3SEZA 4DV3B 1LUVA 5H5NA 3FKJA 1HNXO 3R4KA 3I55I 4ZYDA 1FOWA 3CF2A 2VRZA 1XMQO 1IXBA 1HW1A 2QM8A 5KVRA 1Q7YW 1LDJA 5DCMB 2DMPA 3IH2A 4M3FA 5L3FA 1EBOA 5KLVH 4JX6A 2HFEC 3DBRB 2A9HA 3OOPA 2BOLA 1P2FA 4GX5A 3M1EA 4JBAA 2PI5A 3E5XA 4B4CA 3FZVA 4GZRB 3TEDA 2ZNYA 3SEQA 3ZX6A 1MBKA 2YDEA 4O4LB 4TSFG 1Z9CA 1SESA 2ZINA 3TCUA 1VQ9V 4JAVA 2UXBB 1VQ6I 4XQFA 4DXWA 1XMQB 4X1YB 1AI6A 2Y48A 4AD9A 2FUG2 2XAQA 1MDMA 3ABMC 3VFZA 1T8IA 1OR7A 2LNBA 4RAYA 1BE3H 1FX7A 4L9NA 3JRBA 4X20B 2HPIA 5FLXZ 1A6QA 3F22A 4LFCB 4XLHA 1VQ7I 3ABMH 3GBGA 4NQWB 5KA6A 3BA8A 4FM0A 3BOQA 2K02A 3RTRA 1RZ4A 4C3JJ 1ETOA 4X64O 1RPWA 1Z3XA 1O4XA 1O3TA 5DM6F 4HNVA 4FE7A 3A4CA 3RVZA 1WI9A 4HW0A 5FFXA 2BTOA 1YTYA 1S6LA 1Z67A 1OCOB 4HSRA 4E7LA 4A3LJ 4TUYB 4JF3A 3F8FA 1UHMA 2DN9A 4FX0A 3HKBB 2XPVA 4NC6A 4QE9A 1I6XA 2KIQA 2OA4A 3CEIA 2DMQA 1JFFB 2GXBA 4EB6B 3BJ6A 5FKOA 2CAZC 2CTWA 1BS3A 2CQNA 3OYMA 2ETHA 5IYCJ 3HUGB 3M8AA 4H37A 4OPAA 2XB0X 3ZHVA 1FXKA 4DK0A 3IWFA 5LP6A 1KMIZ 1OCCB 4X1KB 1GV5A 2H27A 3LSQA 4I50B 4MVRA 1POGA 5LHGA 5D5QA 4BS9A 2Z5UA 4XICA 1XOUA 2HZTA 1R1TA 4A3IJ 3ZXSA 2E1MB 5EEAA 4A3MJ 2IRFG 2VPLA 2ZJ2A 3AG3C 2Y31A 5LGTA 4Q4ZF 2OJED 2EIKH 4LIVA 4DYQA 2NYXA 5M3FJ 1SEUA 4NXMB 4GKJB 3G1LA 1K6YA 4EATA 1Y39A 3K2AA 1W36D 2WAMA 4JI4B 2Y0MA 2OTJI 4PGHA 2BCCH 2ZJPF 4IHVA 2LYCA 3A03A 3SDLA 3QTCA 5EZYB 3FKSG 3BLYA 1IX9A 2JSPA 2N05A 2EK5A 1K4TA 1UPGA 2FSWA 3PNYA 3E86A 3E8HA 5KAFZ 1TWHJ 1IG7A 4J11A 2ZT9B 2HDCA 2UWMA 4UUJC 3J7AU 4ENNA 2Q4PA 5CBGA 3DKYA 1QA6A 4ZZDA 2P4KA 3ZN1A 4ZH4F 4A3EJ 2WB1A 4FZ1A 1XI1A 2KIMA 3C1DA 2NVTJ 4G6QA 3ZHRA 3GW2A 1K78A 1W4MA 4JI1B 3GZ5A 1G8XA 2V9KA 1XSVA 5GPAA 1K34A 4YJ3B 3ZGKA 2FD5A 1DPRA 5FO5A 4QNHB 2OZ6A 1V54C 4O4LA 2O7OA 4EEQA 3G6EV 1K73W 5GTHC 4OU0A 2L5QA 2WLHA 2ZJQF 2X0LA 2VT2A 3TXSA 3ZJZA 1VQNV 4LFBO 2KRHA 3JASB 4LK1F 1RKWA 2GHYA 4GCVA 4HZ3A 3WU2Z 2JK3A 4DUZB 2ZE8A 3F7VC 2LP7A 2JSCA 4PDRA 1BN5A 2I10A 4K3AA 1X1DA 3ECHA 2XB5A 3HHGA 2EILC 1XSDA 3TXQA 1MMGA 2F48A 2XGEA 3V8LA 2HVJC 3OS1A 3BAAA 3ZQ7A 2OYQA 4FLZA 5LEKA 1JT6A 1U9OA 4Y4RA 5IY5H 3B8MA 2R70A 1QVGU 2AHQA 2JDIG 2UXNA 3FX3A 4KNYA 1X3UA 3I59B 1Y74B 2ITCC 1CGPA 2FBIA 3N05A 1QQIA 4AYBN 5KHGA 3TKYA 2YPRA 3ABLH 2W0XA 3BEHA 4W4LA 2ZXWH 1KUQA 1WJFA 3DBHB 3IL2A 4XKCA 1R6NA 4G94A 1YI2I 2E76B 3TK1A 1R9TJ 3CCQI 1E17A 3GTQJ 3FAVA 2DQRA 1R00A 5D6EA 2W84A 1MZBA 1SMTA 2YEVB 1DK1A 1FC3A 3AG4C 1WSUA 3STLC 1A04A 4AC0A 4AM3A 2NAZA 1FMVA 4LF8O 1DTOA 4B3RB 2BE3A 1VQOI 3CCJV 5LMNO 2HKOA 2Q1ZB 2LFSA 5H9CA 4FVMA 5EIBD 1ORQC 2IP2A 1VF6A 2YXHA 1Z6TA 4HBNA 1IURA 2ZXIA 3IAS2 3LAPA 1MH4A 1CQTA 2OCCH 3WG7H 4JI5O 3PQKA 2GZWA 1ZLZA 3KEYA 2G7HA 5DD4A 3HPHA 2FA5A 3OL3A 2QF7A 2WWYA 3RPUD 4HF2A 5IY5B 5DYMA 4UB6C 1J7KA 4D7SA 1J5EO 2XKPA 3O6BB 2BY3A 3JALA 3BR2A 3OYCA 4BDYA 4NXNO 1OCOC 1GN6A 1IV6A 1NTMH 5BY1A 4LD5A 2DOAA 2RC4A 2YS8A 4JI6O 5B1AB 2EV0A 1D0ZA 1FNNA 2JA6J 4X1IA 3OTOB 5LRSA 2W24A 4L9VA 2PLYA 3RZOJ 2CDYA 2VOPA 1DLBA 2IM9A 3SXYA 3WGHA 3T1YB 3JD2A 5K1YA 3DV8A 2FE3A 5EBWC 1TUBA 3UT5A 5B1BH 2NOJB 2M3AA 3DKXA 3HGGA 4L5JA 4U3JA 1OKRA 1OJLA 2DO7A 3MFKA 2LQTA 5JFRA 3BZKA 4KDPA 1G2HA 4E4EA 1QZZA 1XGOA 5GONA 2VQGA 4I99C 5DCFA 1NKDA 3NXSA 5ILSA 1YZBA 1OCZB 4LFBB 1BJAA 1K6OA 3JAKB 2M0CA 2CV1A 3PO3J 2YSRA 3LNMB 5F64A 1LE8A 1XMOO 5GTHZ 3EFFK 3BQZA 5FROA 4DZPA 1VQ4I 3OEEG 1JKPC 2UUZA 3BR5A 5HS9A 3SPIA 3NARA 1N8RW 1ONVA 2IBZH 4WFEA 2F5FA 2XF7A 4JI0O 4LNUB 2R5ZB 4CH3A 4DV7O 2RGVA 3RYFB 3APQA 1ODDA 1K78B 4G27B 5BS6A 1HNWO 2ELKA 4ZTJA 4NHJA 1REPC 4DIQA 3HRSA
chains in the Genus database with same CATH topology
4KMUX 4LCUC 1ZG1A 1M90W 3DGEA 3OR7C 1FWZA 1W7PD 5B1BC 5LHIA 1J75A 1BC8C 4ZYEA 3KFWX 5H6RA 1STZA 4B09A 3ML6A 4CBCA 1PDNC 1W0KG 4RB1A 3W6KB 2JRTA 1K7AA 2MA3A 3BJAA 2HYFA 3RJPA 4N0BA 3SYAA 2V1DA 2HGCA 1KA8A 3E3VA 1NH2B 4RQEA 2KRFA 2ZMEB 4EQQA 1P7BA 2OCCC 3WG7C 4EM2A 4PA6A 1LEAA 4OIRF 2KIUA 3IGAC 3RYPA 2L4MA 2C2AA 2X6BA 4M73A 4MGRA 1ZG5A 3GLXA 1HWYA 3CP1A 2C6YA 1TQPA 2EV5A 3ABLC 1LEBA 2QLZA 1ULYA 2BBYA 2M45A 1K4CC 3A0RA 1DUXC 4WXCA 3E97A 3K1PA 2K1EA 2JIZG 3CC4V 5ILVA 5IY5C 4WXDA 4XSZF 4M9ZA 3LQRA 1H9TA 4GXOA 1EFRG 1CEZA 1KP2A 1JQ0A 2QM3A 4MTXA 4L9JA 5HS8A 5L3DA 1GXQA 4G9YA 3V7SA 1KQ8A 1S77D 4OINF 3ROUA 4HYEA 5FGMA 2L54A 4CZZA 3HTUA 2HFHA 5HOOA 1EH6A 2QZ8A 3KZZA 4LB6B 5B1OA 3D36A 2H09A 3BROA 2MD5A 4HX7A 2HKXA 1R3IC 4TV7A 1K7DA 1HXDA 1QR8A