4HAMA

Crystal structure of transcriptional antiterminator from listeria monocytogenes egd-e
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
b'SNAMFTINTKSQLPIYEQIVQKIKEQVVKGVLQEGEKILSIREFASRIGVNPNTVSKAYQELERQEVIITVKGKGTFIANQTDKLSSPKKLAETRTKLKETILDLVYLGVNIEEIHKLADEYSQDIIGGDVVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2241 protein
publication title Crystal Structure of Transcriptional Antiterminator from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 43
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hamA01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hamA02
4N9IA 2LSOA 4MQ9F 3IKVA 2MLGA 1YS7A 4L0YB 4ESJA 3CUQC 3IC7A 2EV5A 4GO1A 4A6DA 3LWFA 4WF2A 3FM5A 2Z33A 3FZVA 3F8CA 4OU0A 2HS5A 2RC4A 3DV8A 2FNAA 2RGVA 4ASNA 3TO6A 2CQKA 2RNJA 5CA3A 2Z3YA 2O3FA 4IF4A 3N97A 5E17F 4G7ZF 1USTA 2XKPA 2JTVA 2EA2A 4ENMA 2A61A 1TLHB 4L9VA 2Q0OA 3ZP5A 1EV7A 4EJUA 3QU6A 3KETA 1UB9A 3EDPA 1QGPA 2HTJA 1KGSA 3K1NA 3CUQA 3V8LA 4O3MA 3DP7A 1HQCA 1ZH5A 2XV4S 1O3TA 1I1SA 2TDXA 1HXDA 4RAZA 4BH9A 1U3EM 5DYMA 2V9VA 3RYPA 2Y75A 1CF7A 4KIBA 2DQRA 1FZPB 2PFBA 4EV0A 2YX7A 3WG9A 4YIFA 5E8IA 1SFXA 2XROA 1R36A 3I53A 1FPQA 4GYIA 1YTYA 1AWCA 5CYVA 2Z9OA 1KYWA 2Q8KA 2IRFG 2UWMA 4UHTA 2BE5F 2LNBA 1SMYF 1QZZA 2F2EA 2OQRA 4L0ZB 2DK8A 3ZMUA 1Y0UA 1FYLA 1BIBA 1BI0A 2HKOA 2PN6A 4HV6A 1O3QA 3WTYC 4CO8A 1EH6A 3F8MA 4Z2YA 3KP3A 4RAYA 4OMZA 4M74A 5JFRA 1QPMA 3G3ZA 1IN4A 3ZMVA 4LG0B 2FEZA 3I4PA 2CFXA 3WU1B 2VBXA 3VFZA 3L9FA 2QVOA 2VODA 2JPCA 1DP7P 1F1ZA 4WXHA 3I0TA 1BJAA 2E1NA 4HBLA 3MZYA 1PDNC 2NRAC 4RGXA 1IRFA 4ESFA 1XDSA 1J7KA 5LGTA 2COMA 2H27A 2VOPA 3BDDA 1P2FA 5IT3A 5TJJA 2CG4A 2W24A 1BI3A 5ILVA 2ZFWA 4EJTA 2DFIA 3HSRA 3GYHX 2PI0A 3W6JB 3E6MA 4UVBA 2P5LC 5ERIA 4EJOA 1LNWA 1MJAA 3I64A 2P5VA 5IT9Z 3FWEA 3JSOA 1IF1A 1IW7F 3ABTA 5L3BA 1L3LA 1KU3A 3RKXA 1XMKA 5LGUA 3BOQA 4JQFA 1S29A 3MZHA 5E8GA 3C3WA 1GXPA 3WODF 1TW3A 2QBYA 5DDGA 2EFQA 4G7HF 1W5SA 1ZARA 1ZGJA 2K27A 2H6BA 3ROUA 2IVMA 3JAMK 1S6LA 5FLXZ 4HF2A 1XCBA 4LFUA 3E6DA 1MZBA 2M30A 2QLZA 3FXUA 4LD5A 4H0EA 2W25A 2P4WA 2EK5A 4KICA 3SFZA 2E7XA 2XIGA 4PGHA 1FSHA 2ADUA 1ZRCA 5KVRA 1L0OC 3E3VA 2ACJA 3RJPA 3KLNA 5CJ9A 3DF8A 4OIPF 3V8JA 1KYZA 5LGNA 2FNPA 2ZO4A 1R7JA 1JHFA 4JK1X 3GF2A 5FLXK 4Y15A 2HQRA 1XGSA 3TOAA 5D5WB 1W7PB 3DPTA 1C0WA 3K1PA 4RB0A 2G7UA 3HHHA 3BJAA 1W5TA 5HVQC 3WTVC 5BQTA 2PQ8A 1KQ8A 3QPTA 2AXLA 1ONVA 5LEJA 1FYMA 3ECHA 3LAPA 2OQGA 1FY7A 1EH8A 5D5XB 4MGRA 2EFOA 2AS5F 2VOOA 1S3JA 3F23A 5CLSA 2G9WA 1DPUA 5F1RA 2O6GE 3SQNA 1FNNA 3ZMDA 2ISYA 3R0AA 3CO6C 4ZZDA 4A2UA 4G6QA 4MEYF 4G7OF 5ICFA 5ICEA 3FF5A 3FM3A 2A68F 3I54A 3JSPA 1WRJA 4OINF 5HLIA 3KLOA 2L4AA 2EA4A 3WTZA 5D8KB 3NEUA 3DXJF 3W7UA 2HZTA 3KP4A 1ZRDA 1HKSA 1IXCA 1ZHFA 1FSEA 4OIRF 4HAMA 3ZN0A 2ZBKA 1VTNC 4XSZF 1F5TA 1IN5A 3TDUC 1D3YA 1MDMB 1XB4A 3LA3A 3H3UA 5JVTA 3G73A 2FXAA 3P9KA 3MFKA 3L2CA 4YIIA 3O6BB 2ZJ2A 5DCMA 1UFMA 4S04A 3IWZA 3BZ6A 4ENKA 1IXSB 3KP7A 2KIUA 5EEHA 2PLYA 5BS6A 2VN2A 3EQLF 1FLIA 1OR7A 2W84A 2J5OA 4LB6B 2K86A 2HDCA 2E1CA 1MJBA 1OYIA 3RPQA 2LF7A 5ICCA 2PG4A 3H3ZA 4RGRA 4HF0A 3E5UA 2P5KA 3E6BA 1BM9A 2XAGA 3HUGA 4EM2A 4U88A 5K5OA 4OIQF 2O8XA 4WCGA 1D8KA 3LFKA 2QWWA 1K78B 5DV5A 3BP8A 4CDGA 3N4MA 2R3SA 2K4BA 3MEXA 5K5QA 4U7DA 4QLCU 3RI4A 4HDVA 2V6CA 1R1UA 4HOBA 4RS8A 1G3YA 1I5ZA 4HX4A 4GYGA 4LMYA 2VBWA 2DO7A 5BOXA 4S05A 1U6GA 1U5TB 3E5XA 2OZUA 1UHMA 2FE3A 1FP2A 4KYWA 5E18F 3L7WA 5FD5A 3HTUA 1USSA 2RN7A 5A2QZ 3DEUA 3W7SA 2VBZA 2Z5UA 3VODA 2CGPA 3I59A 4IHTA 3M8EA 1BIAA 4RGSA 5CVIA 3HRSA 3HTSB 1TQMA 3REOA 1R1VA 3I58A 4KUMA 3QP6A 2V1XA 3VB2A 1SD6A 2GA2A 3GWZA 1S8NA 4IRIA 2KJCA 4EJWA 1K7AA 3R4KA 3E5QA 4P5OA 1QQIA 3PQKA 3CDHA 1ZG1A 4I98B 1SD7A 2ZNYA 4U0VA 5TRDA 5EEGA 4TV7A 5JR3A 5J8FA 2JPBA 1H9GA 1S7OA 2MLKA 3D3IA 3GEZA 1DPRA 3EETA 4WWCA 4OOIA 2XVCA 2D45A 5HLGA 1YW8A 3ULQB 2QUFA 3TGNA 1YIOA 4N0BA 1NHAA 2DLLA 3K1MA 1ON1A 2UZKA 4FX0A 4KNYA 3V7RA 1LEBA 1JXSA 4HV5A 4M9SA 1T6SA 4M9XA 3CO7C 4IXAA 3FMRA 3WTSC 2C6YA 4NHJA 3C1DA 1T39A 1HW1A 1U5TC 2HFHA 3ECOA 3GFIA 4M71A 3TOBA 3S2WA 5L3CA 5LBQA 4IPAA 4LK0F 1F4KA 2VONA 4HQMA 1G3WA 2JZYA 3GFJA 1YO5C 1JE8A 2FU4A 3ML6A 5D6EA 2RDPA 3WTUC 2IA2A 5GW7A 2UXNA 4IHSA 1XGMA 1YS6A 2XHKA 4UXNA 1KQ9A 4WXCA 2NAZA 1W4MA 2EFPA 4YFNF 4LLGF 1KU7A 2F5FA 1LDJA 2HQNA 2WTEA 2E7WA 3QOPA 4KA4A 2KRFA 2H09A 2VT3A 2GQQA 1U5TA 1XDUA 2ELHA 2OZ6A 5H6RA 1HSTA 1HKTA 1BN5A 4KDPA 4PGGA 1IN8A 1ZAOA 2V1UA 3PFIA 1P92A 4U0WA 1STZA 3KCCA 2IT0A 4Q48A 2MBFA 4EMSA 4ESBA 5D4SA 3TO9A 3WGHA 1I6XA 1FYKA 1FBSA 3FXRA 1G4DA 2P7CB 2VXZA 1Z6RA 3HYIA 5LRRA 4B8XA 4XLNF 3CTAA 1I1GA 3C7JA 2MC3A 2W85A 1XD7A 2R7FA 1BC8C 3QPHA 1MGTA 2GZWA 2XUBA 1MD0A 3V7CA 2QM3A 5CVRA 5CVJA 3R0JA 3GW2A 2GAUA 5HLHA 1FBQA 3TKYA 4LLNA 5E1ZB 4I7HA 3IKTA 1F9NA 2IJLA 3ISPA 5L3FA 1WWXA 4EQQA 3HSEA 1R1TA 2ESHA 3F8NA 1PP8F 3MAJA 4YFXF 2NNYA 4FT8A 1YTFB 5LHIA 3KP2A 4RB2C 2CWEA 2XAQA 5IT9K 4UNOA 4Q47A 5KK1A 4KIFA 1ZRFA 3H92A 5H6QA 2NNNA 3C18A 2Y48A 3BJOA 4BYYA 1Z9CA 4AWXB 2XGXA 5ED4A 4ZZLA 1IAWA 5ILUA 3MCZA 4BHCA 4HYEA 4FX4A 3P9IA 4M9ZA 3ZN1A 2M1BA 4I02A 4EGZA 2HEOA 1K6OA 1Z6TA 5CVUA 2DPUA 2ISZA 3AAFA 4ZYGA 3U2RA 3FX3A 3WE3A 1T38A 1RI7A 4HDUA 4CYDA 1NVPB 2EWNA 3T0YA 3F22A 2YSRA 2O61A 2QZ8A 3TO7A 5J8CA 1E17A 1O57A 1ZG3A 2RV8A 2ZXJA 5HOOA 4KMFA 1ZYRF 2HWVA 3RTRA 2JSCA 4D0PA 5FD6A 3BY6A 5FFZA 3FXQA 1QZYA 3DKWA 1BI1A 2ETHA 1IN7A 1MJ9A 4KT5C 5DD8A 3IL2A 1HKQA 2F5CA 3EYIA 5FB2A 4LG0A 3IHUA 1TQPA 5FFXA 4UV9A 4XBFA 4EVIA 2XAHA 1LB2A 4CHUA 3KZYA 4KIGA 1P4AA 1XGOA 1LJ9A 2FMLA 3LQRA 3LSTA 1Z1DA 3FMSA 1P4XA 1R23A 4L9TA 2PMUA 1J2XA 1TNTA 2WAMA 4I09A 2YX4A 3M9AA 2A6EF 4ZYEA 2DK5A 3W7TA 2M87A 2ZKZA 1XN7A 4LJZF 2LKPA 4I01A 1ON2A 1P4WA 1Q1HA 1O7FA 1V4RA 1XMAA 3T5XA 3IRRA 3CUOA 3F3XA 2QENA 5BPIA 3WTTC 2DPDA 4I0AA 1OYWA 3GZ6A 4DNCA 1LEAA 2FF4A 2RQPA 3HHGA 1SD5A 3KEOA 1WI9A 1TW2A 3VOEA 4N9HA 4HLXA 2HOEA 4HLYA 4ON0A 1B9MA 3U1DA 4A6EA 3HSFA 1P6RA 2DTRA 3CUQB 2DI3A 1ZLKA 3E35A 1ULYA 5D8LB 1JGSA 2P7VB 2CO5A 1RUOA 2RVCA 1TQIA 2CYYA 3R60A 2DU9A 2STWA 2JRTA 6PAXA 4EGYA 3D0SA 4F7ZA 1UCRA 2BV6A 1G6NA 2RKHA 3KE2A 4LK1F 1RZ4A 1B6AA 1I27A 5F64A 3HRTA 5BMZA 3K2ZA 4IJAA 4ZYHA 1IZ1A 1T98A 3J80Z 2IA0A 1YW9A 4XLPF 1WQ2A 4XRFA 1IUYA 4P96A 4MTDA 1TBXA 1W7PA 1J9IA 3NQOA 3M8FA 2V79A 1EH7A 3B73A 2HYGD 3I5UA 2FQ3A 2XKOA 5AONA 1AOYA 4L5IA 3L00A 3KFWX 3GVAA 3HIFA 2F5DA 2HGCA 4AIKA 5F6FA 2FBKA 3HRUA 3LAJA 1G3SA 3J80K 4HQEA 5HDGA 3QRFF 4EM0B 4G6DA 1LDDA 4DQ2A 4MHGA 3OOPA 3W6KB 3E6CC 4KFCA 2VC0A 3EUHA 3LQQA 4KN4X 2M8EA 4CZZA 2YU3A 2DQLA 3F8FA 2FBHA 3K9TA 3ERED 2XRNA 1KU9A 3Q5FA 4PDKA 1KQ0A 4WX9A 3BROA 4EM1A 2IW5A 3WE2A 4OMYA 5A2QK 1O7LA 4GCVA 2D2WA 4ENJA 3W7WA 2STTA 1R22A 1Z91A 4M73A 4A12A 2FMYA 2L02A 1XGNA 2FSWA 3KZZA 1S7AA 4K2EA 1U2WA 2O0YA 4MQVA 4Q4ZF 1MDMA 5LRSA 2QQAA 3CJNA 1HSJA 1OPCA 4R1HA 1UHWA 3J81Z 4AIHA 1E2XA 1XSDA 1RM1C 4CICA 4G94A 4M6YA 2MA3A 4FHTA 5JI6A 2QQBA 4L18B 3DFGA 1FOKA 2ZMEB 4AD9A 3ZMSA 1J0RA 4GGGA 3V4GA 2QBYB 4NB5A 2D1VA 3W7XA 1ZN2A 2HTSA 2BGCA 1A04A 3SZTA 4MNUA 2IPQX 5AIPA 2K7LA 3V7SA 1GXQA 3T8RA 4PZJA 4BQAA 4OIOF 3J81K 4P9FA 4G9YA 2EJRA 1K78A 2XAFA 3M7GA 1BC7C 2ZCWA 1PUEE 1T0FA 4G8XA 2P6TA 5D4RA 2BBYA 1FWZA 3GXOA 1R5GA 3ABUA 2M5WA 3QAHA 5HS8A 1X3UA 2UXXA 3RKYA 4L9NA 3BWGA 1D5VA 5K5RA 5E1WA 2CW0F 2MH9A 3IRQA 1JHHA 5D5VB 1REPC 4UVCA 2F5EA 2K02A 4IRHA 2M45A 3F8BA 3ZPLA 4O5VA 1OMIA 1DDNA 3FHZA 3PQJA 1XCVA 5HS7A 3V8KA 1BI2A 2A69F 3RDIA 1SMTA 2FBIA 4HF1A 3DQVC 4MTEA 4L9JA 3D5LA 4A0YA 2A07F 1QO0D 2V1DA 2R7DA 1RNLA 5DUIA 1BOAA 1OKRA 4QWQA 1H0MA 4UVAA 2NYXA 1W7PD 1YYVA 3TQNA 1B59A 1K79A 3ELKA 5L3EA 1IRGA 3M1EA 5FO5A 5D5UB 4HA8A 3J7AO 5DEQA 3VEPA 3JAMZ 2W57A 5ILSA 1D8JA 4RB1A 1LVAA 4UV8A 1O3RA 4LGWA 3BPVA 1PP7U 3Q9SA 1T2KA 4I0BA 3JTHA 2VBYA 4CXFA 1SAXA 3HOSA 4YG2F 3LA7A 4BXUA 2O03A 1KU2A 1YG2A 2ZMEA 1DUXC 5J6XA 2PBIA 4Y17A 1IXRC 3KEQA 2EFNA 3BPXA 2X0LA 2OA4A 1SFUA 4YFKF 2KIFA 5DCMB 4A0XA 4XSXF 4LLLA 2A3SA 3L09A 3HRMA 2EFWA 2H6CA 2DAOA 2X4HA 1B9NA 4EJVA 2GWRA 5DD4A 2A5YB 2FRHA 2K4JA 1HW2A 4E70A 2KIMA 5HDKA 3R6SA 2DBBA 3K69A 3F6OA 3KP5A 3E97A 4ENNA 4BAYA 2HKXA 5ICGA 2OBPA 2VE9A 2H94A 2KJBA 3Q9VA 2L01A 1FX7A 3SHFA 1J5YA 4R8HA 2MH2A 1FC3A 2PJPA 3K0LA 3RIRA 3RYRA 1ZLJA 2YPRA 1XSVA 2PMHA 2VE8A 5HDNA 4R79A 4P55A 4BHPA 1V3FA 2P8TA 3B02A 4A5NA 4HX8A 4LB5A 2GXGA 3GZ5A 3P9CA 4MEXF 3ZMTA 4PCQA 2DT5A 2VT2A 1SFEA 3ZQ7A 2Z99A 2GIVA 2P90A 1GVJA 2EB7A 1FP1D 4Q5SF 2DW4A 2ESNA 1MKMA 1CGPA 2WWYA 3T1BA 1R00A 3F72A 2FOKA 4IRGA 3LA2A 4RB3C 3O3KA 2A6HF 4WXDA 1U8RA 2HYFA 2Q2EA 3I59B 1KA8A 4L5JA 3GLXA 4ETSA 4UUVA 5E20A 3FMQA 4JBAA 4NQWA 1LDKB 2XASA 1QBJA 1XSXA 4IVNA 3GX4X 4BHBA 5AIQA 2PEXA 5HS9A 2LF8A 2P6SA 2EV6A 5CVVA 2J5PA 1HW5A 4A5MA 5H20A 4I2OA 3SXYA 1ODDA 2D1HA 2L54A 3P7NA 5LEKA 3WTWC 1GHCA 5K1YA 5D6FA 2IA1A 3WU0A 2WC2A 4U0YA 2IP2A 1HBXG 3GO5A 2Y0MA 2GA1A 3GFMA 1B1BA 2MD5A 4RGUA 2OU2A 5LHHA 4HZFA 3F21A 1B4AA 4CGZA 3T8TA 3I71A 1SD4A 1RIOH 5FGMA 1FT9A 4BNCA 3DPLC 3OV8A 2BEOA 5LHGA 1RUNA 2OAZA 3IWFA 4P9UA 3U9GA 4M6XA 3EYYA 3JW4A 2JT1A 1R5HA 1J75A 4Y13A 2L3DA 1CF7B 3MQ0A 1U78A 1Z7UA 1ZREA 4B09A 1QNTA 3MWMA 1WSUA 3BJ6A 1BBYA 2BYVE 2CSOA 2WV0A 5LLQA 3JTGA 1TNSA 2NS0A 1YQAA 2LDUA 3GFLA 1H9TA 2FA5A 1Z05A 2QQ9A 3RKWA 3RPUA 2KKOA 3WGGA 3QP5A 3WTXC 2OD5A 5BPDA 1ZGAA 5L3DA 4HW0A 4GXOA 5DCFA 4WK8F 5DUKA 4KN7X 2G7HA 1J59A 4U7BA 1WKMA 1YLFA 1IN6A 4O6JA 3R61A 4ZH4F 2L4MA 3NRVA 4HX7A 3KP6A 3ZMZA 1G3TA 4KMUX 4A0ZA 3SZPA 1NH2B 2QYOA 3F6VA 5JHUA 3WGIA 1YFHA 4AIJA 2YR2A 2VC1A 3COAC 3GUDA 4AVPA 3HOTA 2B0LA 1ZG5A 2HR3A 3TDZC 1OYYA 2ZNZA 3O2PE 1R58A 2EV0A 3CLOA 1LQ1A 5E1XA 1TTYA 5L3GA 2GXBA 4M72A 1FBUA 1YW7A 3QU3A 2XAJA 4ZYDA 1O3SA
chains in the Genus database with same CATH superfamily
2CTWA 4N9IA 5EG0A 2LSOA 4JF3A 2XHBA 3SPGA 2QE7G 4MQ9F 2PGGA 3CZ6A 2A5WA 2NVQJ 1P9QC 3BPZA 3UO3A 3IKVA 2MLGA 3OR2C 1YS7A 2CQXA 5CBGA 2QKCA 3AL0C 4L0YB 4ESJA 4DV3O 1SVLA 3CUQC 4NXNB 3IC7A 4JI0B 5FLMJ 1MW7A 3BR6A 3OYHA 5E3OA 4BW9A 4WBNB 2EV5A 1MH4A 4GO1A 4D5FA 1L1FA 4A6DA 1OCOC 3LWFA 3T1YO 4WF2A 4E7HA 4ABZA 4HNTA 3S32A 1SKVA 3FM5A 2NS8A 2Z33A 4ZBMA 5B1BB 4ZHQB 2DYRB 4FFKA 2KZGA 1Y4MA 3S16J 3FZVA 3K0DA 2YI9A 3KIOA 1GN6A 2UXDO 3F8CA 1VQ4I 4OU0A 3LDDA 4HYOA 2V9PA 4JTCB 2HS5A 4A3DJ 4UY8I 1P4RA 3ZIAG 2PZSA 3A01B 2L9RA 2RC4A 3DV8A 3K57A 4QIWF 5B3SB 2FNAA 3HKZA 5IE9A 2QWQB 2HFEC 2RGVA 4MIMA 1B72B 4ASNA 3TO6A 2CQKA 2RNJA 3CJQB 3BTCA 3ZXSA 4XRMA 2IGOA 2GHYA 2P06A 5CA3A 3AKZA 4IQ4A 2Z3YA 4U87A 4U7OA 2O3FA 4BWAA 3CS5A 5DECA 3ABLH 2EIJB 3RYFB 2OYQA 4M3GA 2R9RB 2W0FC 3PN1A 4IF4A 1TZLA 4MFEA 2KMUA 4DYLA 2X6YA 3N97A 1R71A 2JDIG 3DCFA 3EUKL 5E17F 4G7ZF 2R7TA 2UUZA 1USTA 4MTOA 1FXVA 5FNVB 2XKPA 1DU0A 2JTVA 2MGQA 1PPJH 2DA4A 1E3HA 2HU9A 3K5MA 2EA2A 3BTLA 4ENMA 4CH7A 2A61A 2EZOA 1TLHB 3HB3B 4L9VA 1VQOI 2VJ4A 2Q0OA 1JMKC 3L1PA 5LOVB 3AEIA 3N2GA 4LF8B 1MABG 3OYEA 4QJFB 3ZP5A 1EV7A 2LKSA 4QIWN 4GUNA 4MVZA 4EJUA 3QF7A 3QU6A 5FKNA 3UNGC 3TCUA 1ZK8A 3KETA 1UB9A 3VYTB 2VPLA 3CF5F 4DW0A 3EDPA 3P5JA 1QGPA 2HTJA 5F27A 4F93B 2X6AA 4IHYA 1KGSA 3BR0A 5GTHC 3K1NA 4JOMA 3CUQA 1R3LC 3D3QA 5C8YB 2O5RA 1DGSA 3G4SI 1DTOA 3FX7A 3V8LA 4O3MA 3DP7A 2R7RA 1M57B 2E5LO 3CJTB 3CC7I 3Q4HB 1HQCA 1VP7A 1ZH5A 1Q82W 1K92A 2COBA 2VKDA 2XV4S 2AHYA 1O3TA 1I1SA 2A3QA 3CMEI 1R49A 2TDXA 5ITZA 1HXDA 2XPWA 4RAZA 4BH9A 3B8NA 1U3EM 2ME6A 2WPDG 4RQEA 5DYMA 3HKZN 5IYCO 2V9VA 3CF2A 2PF4E 2JA7J 3MD2A 3RYPA 1LNQA 3IGAC 4O4JB 3BG3A 5F0CA 2Y75A 4AUXA 3FIWA 1Q6HA 2JEXA 1MNEA 1CF7A 3OFNG 1I3AA 4JYYA 3CMAV 4LCUC 1ETKA 2DCEA 4OWRB 2LO1A 2PX9A 4KIBA 1WJCA 3FXJA 2DQRA 2E71A 2ZNJA 1FZPB 2ZKOA 1HWYA 1KBHA 3B6CA 2PFBA 2AZ2A 4EV0A 3L70H 2YX7A 2RJZA 1QZEA 3WG9A 4YIFA 3M99B 1IZ3A 5CN0A 3H5AA 5E8IA 2L9VA 2ZIMA 3SJAC 1SFXA 3J7AU 1P7JA 2UV1A 1V9PA 2X6CA 2IU0A 2DOAA 1WJZA 4RMNA 4PA9A 2XROA 4XDLA 1ETOA 1V5GA 3OTOO 1R36A 3I53A 1FPQA 2HDWA 1JKOC 4GYIA 1W36D 1P7IA 4BJ5C 4CSWA 3G1OA 1OV9A 1AKHB 1D5NA 1PVEA 2CU7A 1MIJA 2E74B 1YTYA 1AWCA 2L7MP 3BTJA 3MN2A 5CYVA 2Z9OA 3ABKC 1BHAA 1I94B 1KYWA 1UFIA 5DM7F 2Q8KA 1QPIA 1GV2A 2IRFG 2UWMA 4UHTA 2BE5F 3F5TA 3GVMA 3JALB 3LUTB 2LNBA 1SMYF 1N34O 2NLJC 2D2CB 4P9OA 1QBZA 2LBFA 2UUBO 3MKLA 4A3FJ 3HKEB 3IJ4A 1QZZA 2F2EA 2OQRA 1H8HG 1WN7A 2P67A 3JR9A 3H9QA 2VQEO 3UCSC 4L5EA 1SERA 4A3EJ 4L0ZB 1ERDA 4AIDA 2DK8A 1YJNV 3H35A 3ZMUA 2MSYA 3ZHQA 1Y0UA 1FYLA 1OCRC 3OW2U 1BIBA 2Y4UA 4O4IA 1Q43A 3CSXA 3HJEA 1TL8A 2O7OA 2DYRC 3APOA 5B1BC 3H3VK 1BI0A 5CA0A 2HKOA 2PN6A 4JI1O 3CMMA 1UAAA 4HV6A 2A06H 3ZEDA 2LC2A 1LE8B 4TUYB 1O3QA 2YXYA 2XGEA 3WTYC 1K97A 1YTFD 4CO8A 3A2FA 2I10A 2RNGA 1HNWB 3SYCA 3GMEA 4A3KJ 3T4DA 1RSOB 1EH6A 2ZJQF 3J7AY 2JVHA 1WPXA 3F8MA 5FROA 3JRFA 1KKCA 4Z2YA 3KP3A 1RKWA 2F95B 3UQ8A 2Z16A 2EIJC 4AILC 2HHHO 2YIAA 3NWTA 4RAYA 4OMZA 4JYAB 5EGOB 4M74A 5JFRA 3E86A 1QPMA 3G3ZA 2CQNA 2DDBA 3LSUA 3OR7C 1IN4A 3U21A 4MFDA 4DJAA 1TWHJ 3ZMVA 4FM2A 1IVSA 1S76D 1ZTEA 1S5LZ 1K9MW 4LG0B 2V9KA 2BSKB 2YEVA 2FEZA 3I4PA 5C44J 2CFXA 3WU1B 2D3OW 3IUOA 2VBXA 2JMWA 3VFZA 3L9FA 2QVOA 3CC4I 2VODA 5EYPB 1VQ5V 2JPCA 4ZDOA 4RA2A 1DP7P 2EIKC 3Q0WA 1F1ZA 4WXHA 3HOVJ 3PUFA 4MW3A 3I0TA 4DR6B 1YIJV 5H2FC 5F1JA 3CHXA 3K5OA 1BJAA 2E1NA 4HBLA 2JQ7A 3MZYA 1PDNC 2Q7GA 3TETA 3F7YC 2OIGA 5HFLA 4GRIA 2VQHA 2NRAC 1K5QA 4X8AA 4RGXA 1IRFA 2XC7A 4V19K 4X65O 1IBKO 5J1YA 1WP7A 3H5RA 4ESFA 1XDSA 1J7KA 5LGTA 2HVKC 3WB2A 2COMA 4LF5O 4LF6B 1BS3A 2H27A 1ZSPA 2VOPA 3BDDA 3OUFA 4H0LB 4W4LA 5BR8B 4B4CA 1P2FA 1R4MB 3B6AA 4A3CJ 1V55C 2HP8A 5IT3A 3FK7A 1DLBA 4F6RA 4LFBB 1NVPD 5JQGB 5TJJA 1Z3XA 2DN0A 4PA3A 2NR5A 3CCUI 4HG2A 1VQPV 4PJJA 3RFRA 3A01A 2YIDA 1BR1A 2CG4A 2W24A 2EIMB 1E1QG 5KMGA 1BI3A 2KDOA 1G6UA 5ILVA 2ZFWA 4EJTA 2UU9O 4FFBB 1YRNA 2DFEA 2DFIA 1ROPA 3ASOC 3HSRA 3GYHX 2PI0A 3ZRXA 4HEA2 3OSGA 1NJIW 3CQZJ 3W6JB 4J42A 3E6MA 2QM8A 3ABKH 3EVKA 4X66B 4UVBA 4XQFA 1WHUA 4QPOA 2P5LC 1UELB 3OYFA 4JZ2A 5ERIA 4EJOA 2R7QA 2F6CA 2ZNIA 1O4XA 3T1HO 3N05A 4LFCO 1LNWA 1X2MA 4XLEA 1MJAA 3JD3A 3I64A 4LF6O 4AHCA 4DV0O 2P5VA 4CZCA 1WB8A 2XOKG 1EJ9A 5IT9Z 4GX0A 3JRGA 4GZRB 4NYKA 3FWEA 4YELA 3JSOA 1N8RW 1IF1A 1IG7A 1OJLA 5JCOC 5JLXA 1RFYA 2V4JC 4BY7J 3LMMA 1VQMI 4YIPA 1OCZB 4DR5B 1IW7F 3T2MA 1WJEA 4JI4B 4CCMA 2K3PA 2Y30A 5IJ9A 5KX5B 3ABTA 4R7CA 1N0NA 5L3BA 1L3LA 1MMNA 1KU3A 4K8ZA 2B7EA 3RKXA 4BS9A 1Y8QB 1XMKA 2NVXJ 1TUBB 4UCUA 5LGUA 3BT9A 5AG2A 5EBLC 2L6LA 3BOQA 2BW3B 4XLHA 4JQFA 4CC5A 2AXTZ 4DV2B 3H36A 1S29A 5JVGF 2F48A 1ETYA 2DMNA 3MZHA 3FD9A 1V54H 5GTIZ 2FJ1A 4PSWA 3ZQQA 3E83A 5E8GA 3C3WA 4E2LA 3CCSI 1GXPA 1G2HA 3WODF 1TW3A 2QBYA 4MTFA 2P5OA 4LIUA 3HZJA 3OIPA 2KQXA 1WGXA 3TXQA 5DDGA 2EFQA 4G7HF 2JVDA 2YICA 1W5SA 1MSFC 4GX2A 1HDDC 1ZARA 1ZGJA 1MH3A 2K27A 3RYIA 4DV1B 2H6BA 2VPRA 3ROUA 2IVMA 4AU7A 4CYCB 3JAMK 2C2AA 3H1KH 5BZBA 1S6LA 5KHKA 1HA8A 3DBLB 4IHJA 4QE9A 3K7AJ 5FLXZ 3BCBA 3PL8A 1P49A 1IO2A 4JX6A 1ZR2A 4PDMA 4HF2A 1XCBA 2KHMA 4LFUA 2BVLA 4A93J 2MW2B 4R50A 3E6DA 1MZBA 4DV3B 2B1GA 2M30A 3G6BA 1QLEB 4NXNO 4PJ0Z 2QLZA 3FXUA 1GH6A 3SPJA 4LD5A 3K59A 2K85A 1JJOA 5DM6F 2W25A 4H0EA 2P4WA 3BLYA 3WG7H 4BJTA 3DU6A 3BHPA 4BBSJ 1QU7A 3A4CA 2EK5A 3BG9A 3C2GA 4KICA 3T1YB 1NZ6A 3SFZA 2E7XA 1K4TA 2XIGA 2CUFA 2E1MC 4PGHA 3GWOA 3OR1C 2NNUA 1FSHA 1V55H 2DE0X 1AKHA 3HOYJ 1EFRG 5JCOA 4J19A 1D1BA 2ADUA 2DMXA 4IGGA 1UPGA 1Z5WA 1ZRCA 5KVRA 2UUCB 1L0OC 2CFOA 1APLC 3E3VA 4NDLA 1THZA 3B4SA 2XGDA 4RDUA 3MHSC 2ACJA 2ADQB 5FLVA 3RJPA 3KLNA 3OL3A 5CJ9A 3OYLA 3I56I 4FZ1A 3DF8A 3HUGB 1AJQA 1X4TA 5F04A 4AQYB 1I0HA 2QWRB 1YCIA 4OIPF 3V8JA 4PV1B 4TWKA 3T4ZA 1E3PA 1KYZA 1RC9A 1JX9A 1N78A 2IH1C 3MKZA 3CYOA 4YJ2B 3S3OA 2A7WA 2JGDB 2ITDC 2GTAA 5LGNA 2DA1A 2ZO4A 2KRHA 1R7JA 2FNPA 1WI3A 1JHFA 4KFMA 4JK1X 3GF2A 1P7BA 3MAQA 5FLXK 1GKFA 1SESA 4Y15A 1WFXA 5B1AC 1T08B 2EULA 2HQRA 2VQCA 2V7FA 1JOYA 1XGSA 1JGGA 4KXRA 1MMMA 1X58A 3LSQA 4TUYA 3OIQA 3TOAA 3KG2A 5M3FJ 5D5WB 1W7PB 3DPTA 1X19A 4B47A 1B6QA 1FFXB 1C0WA 1K61A 2OF7A 3ESWB 2WY7Q 2E5NA 3K1PA 4RB0A 4FPPA 4CH5A 4LF8O 1LPQA 1YF2A 4TT3G 2G7UA 2B5UA 4B3SB 1ORKA 4RUEA 3E1SA 3HHHA 3BJAA 1W5TA 2DA7A 2KPMA 3BRCA 2V7QG 4DR3B 1M56C 3OSFA 5EGOA 2DOFA 5IJ0A 2Z0AA 2GV9A 4MLOA 5HVQC 3WTVC 5BQTA 2PQ8A 2Y2ZA 3AG7A 1IUFA 3JARA 5BNGA 3QPTA 4IL6C 1KQ8A 2DYSC 2AXLA 3TP0A 1ONVA 5LEJA 1FYMA 1PUFB 1AP6A 1BT8A 3HG9A 2BSKA 3ECHA 1MBGA 3LAPA 1S5HC 4YY3B 3D5RC 2OQGA 2WADA 1FY7A 5EYPA 1EH8A 2MG4A 4MGRA 5D5XB 3RQIA 1FTZA 2ZQMA 2EFOA 3PM1A 2YSUB 1OCZC 5KAIZ 1XC5A 3OYKA 2IH3C 4XLAA 2ELJA 2A79B 2AS5F 2VOOA 1S3JA 2OTJI 2R7ZJ 2ZE7A 3F23A 1YE9A 3LDCA 4HNAB 5M5YJ 3ZRWA 5FKKA 2FD5A 1A31A 3GLLA 2HVRA 5GPAA 5CLSA 2HPMA 3AG2C 2LREA 4X1YA 2G9WA 1IDZA 3OR6C 1DPUA 4JI0O 5F1RA 2O6GE 4IZZA 3S2DJ 1B06A 3SQNA 3DTEA 1FNNA 3ZMDA 4OAZA 2XF7A 1SQVH 2IAIA 4F91B 2ISYA 3R0AA 2QCOA 3CO6C 1HF0A 1DF4A 4ZZDA 1K34A 4E7ZA 1YHQI 5KA5A 2EPFA 4A2UA 4ZIBA 3B2EE 4BE1A 2ZC2A 4G6QA 3E2EA 4MEYF 4DZJA 4FLVA 4G7OF 3E22B 2A9HA 5ICFA 2X48A 5ICEA 3FF5A 3FM3A 2DT7B 3CB2A 3K9SA 1K4DC 2A68F 1YJ9V 3ABLB 3I54A 2LP7A 3JSPA 1WRJA 4OINF 4P1WA 1W0UA 2WLLA 5HLIA 2BOCC 3QVNA 5K7HA 2CDYA 4U3JA 4DIQA 3VSKA 3KLOA 1I94O 3MMYB 3O65A 1N34B 2L4AA 3MKWB 3P3PA 1OISA 4K0KB 3BG5A 1MNDA 1K4SA 3DU5A 4RBOA 1QLEC 2EA4A 3K4NA 3WTZA 5D8KB 1H88C 2UXBB 2QKMB 3NEUA 1IDYA 2LG4A 5CA1B 5J2TA 3K5NA 4DUYB 4EEQA 2LJ2A 3DXJF 2H1LA 3W7UA 4KL1A 2HZTA 2X1DA 3KP4A 1ETQA 1ZRDA 3VPRA 5FKMA 1GN3A 3CJHB 3UR3C 3ZOBA 3QG5A 2JJ7A 2PMZA 3B8MA 1HKSA 2ID3A 1IXCA 1ZHFA 1FSEA 5EZYA 4JI1B 1KB9F 2P4KA 2IU3A 4OIRF 5B1AH 4HAMA 3LSHA 3ZN0A 1BOBA 4CS2A 1R3IC 2ZBKA 2BHZA 1VTNC 1JI8A 2CGNA 4I0XB 4GKJO 1HNWO 3K4LA 2Y9YA 1GTOA 2KB1A 2VQFB 4XSZF 1F5TA 4NKGB 1D0YA 1IN5A 2A0LA 4MTGA 4N23A 3K06A 4X1KB 3CC2I 3SPCA 4D7SA 3TDUC 1D3YA 2R7OA 3BR2A 1NBMG 1XL6A 3X2QB 1XQ8A 2CJJA 1MDMB 3PSFA 4DR2B 1VARA 1PL0A 3P32A 1XB4A 2BW3A 3H9GA 3LA3A 2HVQA 3H3UA 5JVTA 1FIPA 3PIOF 3TW6A 3G73A 2E2HJ 2JA8J 5LFAA 2P22C 1HP8A 4NTWA 1Q6UA 2FXAA 3MZ8A 2MW8A 4JYBA 3P9KA 1SQBH 3MFKA 2HQ5A 2YXHA 2UXCB 3VQXA 2E34A 1JKQC 2CS3A 3L2CA 1OQYA 4XICA 2ZJRF 1AI5A 2DYSH 4YIIA 3O6BB 1QHGA 2ZJ2A 4CYCA 5DCMA 3JD4A 3IH2A 2JGUA 1Y67A 4DR6O 1UFMA 4S04A 4CCJA 5FKOA 1MA1A 3IWZA 3BZ6A 4ENKA 1AP5A 3IFXA 1IXSB 3KP7A 2KIUA 3BQZA 2FOWA 4X65B 5EEHA 1T95A 1G1XB 3CCLV 4LF5B 1MBJA 4I5SA 2PLYA 4HNVA 3AFHA 3ABMH 1GRJA 5BS6A 5DN6G 2VN2A 3AG2H 3EQLF 1R6NA 3OS0A 2PMZN 4MVRA 5E79Z 1SVMA 1UJWB 4XKBA 3CCMV 2JS3A 1FLIA 1OR7A 1K8AW 2PYLA 2W84A 2J5OA 3G6EV 2XSDC 4LB6B 1WJDA 2K86A 2HDCA 2E1CA 1MJBA 4DR4O 3K03A 2WAEA 4XOTA 1OYIA 3JRIA 3L2QA 3RPQA 2X6BA 4HSTA 2LF7A 2VJIA 3R66A 2AQFA 5ICCA 2E2JJ 2PG4A 3BCAA 2JA2A 3H3ZA 3HPHA 2Q4PA 2F5VA 4HF0A 4RGRA 2OIEA 3E5UA 3U1KA 4X1IB 2P5KA 4XLCA 1L8DA 3C3SA 3E6BA 1BM9A 4BXXJ 2XAGA 3TP3A 4A3LJ 1MZFA 2LGQA 3HUGA 4EM2A 2R5YB 1Q6IA 4U88A 3VQWA 5K5OA 3K3WA 2BCCH 4O2BB 1LKXA 2VKEA 4OIQF 1M9NA 4GYCB 4RUFA 2O8XA 1G59A 4WCGA 1D8KA 1QVFU 3LFKA 2QWWA 1K78B 4F52A 4G28B 4X66O 5DV5A 3WHCA 3BP8A 4CDGA 3N4MA 2R3SA 2K4BA 3MEXA 4BU2A 2JJ1G 3NARA 2CH0A 1US6A 5K5QA 2W82A 2AHQA 4U7DA 2EZHA 2E75B 3OYDA 4ZKIA 2XPUA 4DV5O 1VQNI 4QLCU 1ZELA 1PNLA 2KL4A 3RI4A 4DR1B 4HDVA 5BXZA 2R9AA 2V6CA 1F43A 1XUQA 5LD2C 2F4OB 1R1UA 3CP8A 5A9GA 1JFFA 2GUZA 3UT5A 4HOBA 2R7WA 1VEWA 1RM1B 3IAS2 5LMUO 4KITB 4RS8A 3SPIA 3PO2J 1IX9A 1Y76A 3L2RA 4DK1A 1B8IA 3U0ZA 5CB4B 4JI4O 1G3YA 5JH7B 3RVZA 4C3HJ 1I5ZA 2DMQA 4HX4A 4GYGA 1WAZA 1X1DA 4LMYA 1D5AA 4LNUB 5LA6B 1IXMA 4UB6Z 2VBWA 1XL4A 5IWAO 3CCRV 2BY2A 2DO7A 5BOXA 1DU6A 1Q1VA 1YOVB 3WU2C 4S05A 1E1RG 1R3KC 1P84F 3JAWB 1U6GA 1SS3A 2AGAA 4L87A 1U5TB 3E5XA 2G38A 2K9LA 3PUBA 2Y69C 2OZUA 4UUSA 1UHMA 2HNHA 1JT0A 2ICWG 2FE3A 1VQKI 2HJFC 2P7TC 5CBHA 1FP2A 2OCCH 3K70C 2DN9A 1HNZO 4KYWA 5E18F 3L7WA 5FD5A 3MD0A 2X51A 3HTUA 3CD6V 2ZE6A 2MK3A 1USSA 3K04A 2RN7A 2XRLA 4LP8A 4DV1O 1ZQ3P 3OYNA 3JCZA 5A2QZ 1HOMA 3DEUA 1ENHA 2JK3A 1ZGWA 3W7SA 4Y4RA 3CMEV 4TV8A 1OCCH 2VBZA 2Z5UA 3VODA 3X2QC 5LXTA 3F9KA 2CGPA 2GM4A 3JCUZ 3I59A 3LNNA 5J47A 3K58A 4IHTA 1VQ8I 3M8EA 5KUMA 1BIAA 2RREA 1Y8RB 1FEXA 4QPKA 4RGSA 3DC5A 1XX5A 4A3MJ 3GTQJ 1NKDA 1X59A 5CVIA 1VQ9V 3HRSA 2HEPA 1H2LA 3HTSB 1TQMA 3REOA 1R1VA 3HDDA 2CTPA 1HDPA 2LOOA 1POGA 3I58A 4KUMA 4LH6A 3QP6A 5KHHA 1FTTA 2X6XA 2BE3A 4H37A 2V1XA 3VB2A 2ADPA 4CBCA 1Q86W 2EINH 1SD6A 2GA2A 3BG7A 3GWZA 1YJWI 1S8NA 4IRIA 2KJCA 4NBQA 3JAMN 2UUCO 2WSSG 2CMPA 5EIBC 3WB1A 1IURA 4EJWA 2ZXWH 4B3AA 1K7AA 2VWKA 1BW5A 3JSLA 3H0GJ 3TBIA 3R4KA 1Y0NA 2VI6A 2PJRB 4WFAV 3SYTA 2K5CA 2YU9J 2ME0A 3E5QA 4P5OA 1QQIA 4ANJA 1F36A 2PUSA 4AQYO 1NQTA 3PQKA 3CDHA 4E6KG 1ZG1A 3TL4X 2F93B 4I98B 3ZHRA 4KHPO 1SD7A 2ZNYA 4U0VA 2LFRA 2W6JG 3W6VA 3Q4HA 5TRDA 3ZRVA 5EEGA 3AG1C 2OUMA 3AG4H 4J11A 4HRIA 3L2WA 5JJNB 3CJHA 1VNDA 3DLAA 3KCYA 1EBOA 5KAIC 2VKHA 4TV7A 5JR3A 1GMGA 2BTQB 2R92J 3H0DA 3PJRA 3ICXA 4XKVA 5EK0A 3RT3C 3ONQA 5J8FA 2JPBA 1KC8W 1WPKA 1H9GA 1S7OA 2N8GA 2MLKA 3D3IA 3MHHC 3GEZA 1DPRA 4JI8B 4DR7B 1V5FA 2QJ1A 1WZ2A 1EN5A 3EETA 4WWCA 4OOIA 1V54B 4DRXA 3A0BC 2XVCA 1L0NH 2KZVA 2D45A 5HLGA 3HC7A 1YW8A 3S3MA 4B3SO 3ULQB 2QUFA 3TGNA 1YIOA 2QSHX 4NXMB 4O4HB 2WV1A 1VQ7I 4N0BA 1NHAA 2MD0A 2R7XA 3H5NA 4TV9B 3CCEV 2DLLA 4XLFA 4DR3O 4B3MB 3K1MA 1A6QA 1ON1A 4B3RB 5JWPA 2VLAA 3LSPA 1PM9A 4FLXA 2UZKA 4FX0A 4KNYA 5FLXN 3S2HJ 2DWDC 3V7RA 1LEBA 1Y74B 2F66C 3EXAA 1JXSA 4A3IJ 4HV5A 4M9SA 5J2UB 4DV0B 1MBKA 1T6SA 4YY3O 2X1EA 1XG1A 1U8BA 3DXRB 2Y69H 1B04A 4M9XA 1WA8B 1SEUA 1JUSA 4PJMA 4E7KA 1CPYA 3H01A 2QR4A 4DV4B 3CO7C 3AG3H 2EILB 1S72I 3BEHA 3GBGA 4IXAA 1XOUA 3FB6C 3FMRA 5IDJA 2ZR3A 3WG7B 4FLUA 5CPRB 2NVYJ 3WTSC 1MNMC 1P7GA 3HKBB 2DA6A 4P2ZA 2C6YA 4LWSA 4NHJA 4ICGA 2GOMA 2OTLI 3JATB 3C1DA 1T39A 1HW1A 5E3LA 4FLZA 5B66C 3PSIA 1U5TC 1BL8A 2HFHA 3E89A 2WLHA 3ECOA 3GFIA 5IY5C 4M71A 3TOBA 1GUUA 4DO2A 5IOZA 3S2WA 1EZVH 5L3CA 5LBQA 1AJPA 1NTMH 2IJJA 1FYJA 3GTKJ 4IPAA 2V6EA 1OCOH 4A69C 3K4MA 4LK0F 1F4KA 2ID6A 1PNKA 5K1XA 2VONA 4TOIA 4HQMA 1U9OA 1G3WA 3SYOA 4OGQB 1JTYA 2R5YA 2RNBA 2JZYA 4XDKA 3GFJA 3RSNA 4NC8A 1YO5C 1NTZH 3GZNB 5H9CA 3KZIC 2LD5A 3OY9A 1JE8A 3CCUV 2FU4A 1SQQH 1D2DA 3D36C 4K0KO 2IS6A 2ZD9A 3ML6A 5D6EA 2NS7A 1MNGA 2R7VA 4KP4A 1EZJA 1XMOB 1W5CC 2RDPA 4FK5C 3WTUC 1GN4A 4DUYO 4MTXA 4ZDLA 2IA2A 3F5WC 4GLXA 2PY5A 5GW7A 1X2NA 2HOAA 5CQGA 1TUEB 4UCTA 4II2A 1QVUA 2UXNA 4IHSA 1A35A 3QQAA 3B09A 4EB6B 1XGMA 5B5EC 1YS6A 2VUMJ 1AILA 2XHKA 4UXNA 5J40A 1KQ9A 2O8KA 1JQ0A 3QTCA 1W0JG 3GB7C 3AK1A 4WXCA 2NAZA 3OYGA 2KISA 1W4MA 2EFPA 2XF5A 4YFNF 3JAKB 3JD0A 3K08A 1IBLB 4JI2O 4GKJB 4LLGF 1UHSA 2F5FA 2OCEA 1LDJA 1KU7A 2HQNA 1TC3C 1IRZA 2WTEA 2JWTA 2E7WA 3QOPA 4IQJA 3L9DA 5B3SC 2Q6AA 2VQFO 4FCYA 4KA4A 1H2SB 3DTIA 3FAVA 2WLJA 3G71V 2JA6J 2AO9A 4DV7B 5LP6B 2KRFA 5JVDB 2H09A 1Y6IA 1NTCA 2VT3A 2ZE8A 1GT0C 2WAFA 3HKCB 3D1NI 4DR2O 4O2AA 4CCLA 1H2NA 4XKCA 2GQQA 3OWTA 3JAWA 1PKXA 2ZINA 1U5TA 4IOCF 4LFAB 1XDUA 1MMGA 2IS2A 2QWNB 2DA5A 2ELHA 3TK1A 3APQA 3FBNB 4DV6B 4J7ZA 2OZ6A 5KCMA 5H6RA 2UXCO 2H1KA 1HSTA 3JD2A 2JIZG 1GO3F 4BJ6C 5F08A 1E79G 1HKTA 1ZUQA 4DYRA 1G8MA 3WFVA 1TVKB 1BN5A 4F92B 4NUBA 2LQTA 3H1JH 1QHTA 4KDPA 2KG7A 4C2TA 4PGGA 2WLIA 2Q9LA 1JVMA 5TISZ 3SPHA 4I99C 1IN8A 2YC0A 4LH7A 1M1EB 5CMUA 1ETWA 4M6VA 1ZAOA 1FXHA 3J7YJ 3N27A 3SJQC 2V1UA 4U7NA 3I3LA 1BJZA 2B9ZA 3S15J 1TWAJ 5F2VO 2Q0AA 1XTAA 3PFIA 4GX1A 4OPAA 1P92A 2DJVA 4U0WA 3STLC 1STZA 1Z7LA 4WBNA 3KCCA 2OCHA 2IT0A 5BMVB 1NTKH 1M57C 2E1OA 3CMAI 2IJKA 3I5DA 5J1UA 4Q48A 1VI0A 2ECCA 1QNMA 2MBFA 1RR7A 4DR4B 2RCVA 1WP8A 4ZI7B 4ZHQA 1U0JA 3RPUD 4BXFA 5IY5H 1K33A 4EMSA 3KYCB 2JS5A 4NTYA 5GP9A 4W97A 1YSCA 3LFUA 4QSHA 4BL0B 2QDOA 4R6ZA 4Z1VA 4ZYAA 2EILC 5KHIA 4ESBA 5D4SA 1JT6A 3TO9A 4J00A 3WGHA 1I6XA 5GPCA 1SC7A 1RPOA 5BY1A 1FYKA 2Q2EB 5HNFA 1N0JA 2W1OA 1B72A 1FBSA 1HDJA 1N33O 4DK0A 3FXRA 2XB5A 1G4DA 1EN6A 3K2AA 2EZIA 4DGWB 2P7CB 4NQWB 5KNLA 2CE4A 3RYFA 4M3BA 4CCNA 2VXZA 1XREA 3M8JA 1Z6RA 2ATKC 1FJGB 2BVMA 3HYIA 2ARHA 1D1AA 5LRRA 2JUCA 3ERMA 2LR8A 4XLNF 4B8XA 2ILMA 3CTAA 4DV5B 2UUAB 1DGWY 1EF4A 1H2MA 1I1GA 3C7JA 5FNVA 2AZ0A 2MC3A 3PFYA 4BBRJ 1K73W 4DR1O 1T8IA 2W85A 1XD7A 4IT5A 3ZQFA 2R7FA 2CH7B 4UB8Z 1KZHA 2V4DA 5EC1C 2IGNA 4CS4A 2R93J 1OCRH 1BC8C 3QPHA 1FXKB 3BA8A 1MGTA 4RQFA 2GZWA 2XUBA 4JX5A 5B1BH 2DYRH 1MD0A 3V7CA 3JCUC 3S3NA 1JJ8C 5LOVA 3GWKC 2QM3A 3CCVV 3U10A 5CVRA 1CQTA 1H2GA 5CVJA 1KYOF 1ZL8B 3R0JA 3CCQV 3LSJA 3DC6A 3LL7A 4C7UA 3E8HA 2LTPA 3GW2A 1TWCJ 2GAUA 5IWAB 5HLHA 1A36A 1FBQA 5C8YA 3A1YA 4Y3OA 4IIJB 3OYIA 3TKYA 3VYRB 5GAHJ 4LLNA 2EIJH 4Q20A 4JYAO 5E1ZB 2E5LB 5IYDJ 1HW7A 4I7HA 3IKTA 1F9NA 1E0EA 2IJLA 3ISPA 2HOTA 3S17J 3QO5A 5L3FA 1WWXA 1SFOJ 2TCTA 1HNZB 1SAUA 3M4OJ 1RPRA 1NK2P 4EQQA 4F55A 1K6YA 1R1TA 3HSEA 2ESHA 1HCRA 3F8NA 4A3GJ 4I4TB 4PDRA 1PP8F 2IJIA 1AB3A 3MAJA 1WCMJ 4ABMA 2QSFX 4O4JA 2VWJA 3ABMB 4YFXF 2NNYA 4FT8A 1WH5A 1SA0B 2JA5J 1YTFB 1L0LH 5FPOA 5LHIA 5LYJB 2EIKH 3KP2A 4RB2C 3S1RJ 5DS9A 2CWEA 3RBZA 2HDDA 2XUMA 2XAQA 4WFBV 5IT9K 5K7ZA 1VQ5I 4UNOA 3LSKA 4Q47A 2DQ0A 5KK1A 4KIFA 1ZRFA 2L35A 3C90A 1N36B 2WB1A 1ETXA 3ZQLA 3H92A 3OYBA 1YIJI 1PD3A 3HPLC 3ZX6A 5LL6Y 5H6QA 2NNNA 4XL9A 3C18A 5EJCA 4X20B 2Y48A 3BJOA 4BYYA 4DXWA 4PFPA 4K8XA 2L7FP 4FE4A 3ASNB 2OTJV 1VF9A 1WVRA 1Z9CA 4AWXB 1SZTA 3CP1A 4X64B 2CRGA 3TXSA 3FKJA 1MZEA 5FPRA 2I5UA 3WHBA 2XGXA 5ED4A 2X7RB 4D6TH 3QYFA 4ZZLA 5ILUA 1IAWA 5C93A 2ZE5A 4BQOA 4YRVA 3MCZA 2WLMA 4BHCA 2YS8A 4HYEA 4FX4A 3P9IA 4M9ZA 2VRZA 4J9ZB 3ZN1A 1Q81W 2M1BA 4I02A 4EGZA 1YITV 1N4CA 1JKPC 2HEOA 4I9WA 1K6OA 4BQNA 1Z6TA 1CEZA 5CVUA 1D5YA 1VQPI 3JALA 1X3WB 4IYIA 4I55B 2DPUA 2N74A 3FXOA 3ASOH 2H8PC 2ISZA 4KHPB 2F4IA 3HKEA 3AAFA 4ZYGA 4DYCA 2XDVA 3U2RA 3ZCOA 3FX3A 3KEYA 3WE3A 2H3OA 1S9HA 4QTRA 3K70D 3HKDB 2UUBB 1IGNA 4MSWC 1T38A 1BQ0A 1RI7A 4BE2A 4XDJA 2CTQA 2X6WA 3HOXJ 4HDUA 3SGIA 4CYDA 4N4OB 2H8WA 2RMKB 3A8TA 1CXZB 4FASD 4JASA 2EJ7A 2EWNA 3SDLA 2HQAA 2NXNB 3T0YA 3F22A 1LE8A 2YSRA 3KKYA 3IP4B 2O61A 2QZ8A 3TO7A 3F0CA 5J8CA 1O57A 1E17A 2EIMC 2Z1DA 1ZG3A 2RV8A 3OMYA 2ZXJA 1URFA 3CEIA 3K79A 4PSXA 4JI8O 5HOOA 1FOWA 1ZYRF 4KMFA 1RSOA 2HWVA 2WB1N 4DR7O 1FAFA 1X3ZB 3RTRA 1JCHA 2JSCA 4D0PA 1S7EA 2F1MA 5FD6A 2WA0A 3BY6A 2L9NA 5FFZA 2OCCB 3FXQA 1QZYA 3DKWA 1BI1A 4NXMO 2ETHA 1IN7A 1MJ9A 4KT5C 5DD8A 3IL2A 2GDSA 1HKQA 2F5CA 1GK9A 4B3MO 3LSRA 1R5ID 3EYIA 4JI5B 4B3RO 4DYQA 2QA4V 2IM9A 3CCYA 4B7EA 1N32B 1F4MA 1ETVA 5FB2A 4LG0A 5EIBD 2FTKA 3N2KB 3IHUA 3SJCC 1W36C 1TQPA 5FFXA 1IC8A 1R3JC 1TVKA 2M6YA 3L74H 1QVTA 4UV9A 3SEQA 5DTDA 1SZXA 3CX5F 1M90W 3A0HZ 3ZRSA 2QM7A 4DV4O 4LBEC 2L9SA 1RPWA 2LY1A 5EBMC 3I55V 4XBFA 4EVIA 3IAYA 4WFGA 2E36A 2XAHA 4HSRA 2H8RA 4J7KA 1I5XA 5FJ8J 4YEJA 1FD9A 5LMNB 3G1MA 4Q6GA 1LB2A 4CHUA 3EFFK 4WFHA 2IBDA 3KPHA 5M5XJ 3KZYA 4KIGA 1R9TJ 1WLEA 4GX5A 2RN9A 1P4AA 1ZX3A 1XGOA 1LJ9A 2LKXA 2QSAA 1AU7A 4A3BJ 2FMLA 2NOJB 2X6OA 2IGKA 2X1CA 1SVOA 2QGNA 5J4YA 2Q5ZA 2ZXWB 3LQRA 4OX9B 5JQGA 2KQRA 3ETGA 3LSTA 1Z1DA 3FMSA 4PUSA 4MW8A 2LW7A 1R23A 1P4XA 1NR7A 2HYJA 3RYCB 3MVPA 4L9TA 1K5SA 1Q8IA 4IEJA 2YIBA 1FKAO 5EG0B 3ZHSA 1FJLA 4II3A 1QQCA 4HNUA 1M4UA 2PMUA 1Y1VJ 1J2XA 4FFBA 3IC9A 1TNTA 2WAMA 1JUMA 1FMWA 4I09A 4XK4A 1S77D 2YX4A 3STZC 3M9AA 3SZGA 5H5NA 2A6EF 4ZYEA 2DMTA 1VZ0A 2DK5A 4LG3A 2WWWA 3W7TA 4WF9V 1KONA 2M87A 2CV2A 2E5ZA 4YJ3B 5GTHZ 1S5LC 2ZKZA 4DW6A 1XILA 1XN7A 2IGMA 1UJ8A 2WAQA 1DF5A 4LJZF 2NN4A 2LKPA 4I01A 1ON2A 1P4WA 1Q1HA 3ASNC 3BFRA 4KISA 1O7FA 1H8EG 5IYBJ 2FB5A 2K40A 1V4RA 4CA0A 1XMAA 1NH2D 4P30A 2HXIA 2LVSA 4YIRX 1BMFG 3T5XA 3H1LH 3ZS8C 2QEXV 3HM5A 2IJHA 3CMYA 3IRRA 3CUOA 1W0KG 4YHHB 2OT5A 1ITYA 3F3XA 1NS1A 4IKFA 2QENA 5BPIA 3WTTC 4WFEA 3I4NJ 4JI2B 2HVSA 3DTUB 3ZRGA 1VQNV 2IS1A 1ZL8A 3OE7G 2DPDA 4I0AA 5KAFZ 1IBLO 1OYWA 1AVMA 5KX5A 1JR9A 3GZ6A 2QF7A 1X1CA 1R6TA 4NC6A 4DNCA 1TUBA 4G2KA 1LEAA 1MOFA 4DV7O 5E1AC 1VQLI 2FF4A 1BCCH 4QE7A 2ZSIB 4CC6A 2CTRA 2QKLB 2DQ3A 4JI6O 2CK3G 2RQPA 3HHGA 4JYKA 1SD5A 4LFAO 2ZFUA 1ORQC 3KEOA 3OYAA 4JYCA 3I9V2 4JAAA 1WI9A 1TW2A 4DV6O 2P81A 4J10A 3FISA 1GAXA 3VOEA 4N9HA 4HLXA 4E7JA 1MMDA 2R70A 3N2GB 2HOEA 4HLYA 1VIBA 4ON0A 4PA7A 1B9MA 3U1DA 2BY1A 3FXMA 3C3TA 2DOEA 4A6EA 2Q7HA 1FMVA 3HSFA 4BIOA 2JN6A 1P6RA 2DTRA 1A32A 3JREA 2K9PA 1Z0XA 3CUQB 1H2KA 1OCZH 2DI3A 4BDYA 1QCEA 1ZLKA 1WJFA 5HNHA 3E35A 2WAQN 5IYDO 1ULYA 5D8LB 3IV5A 2PI5A 2Y0IA 1JGSA 2P7VB 2CO5A 1RUOA 5D5QA 3J7ZI 4C2UA 3WB0A 4X20A 5FL7G 4PA4A 1RRJA 1OCOB 2RVCA 3TJTA 1SQFA 4C2MJ 3NXSA 4Z6YA 3HXLA 3Q3SA 3RCOA 2E35A 5IPAA 3RW0A 5GONB 5ITZB 1U9NA 2QKSA 1TQIA 2CYYA 4MVUA 2KFDA 2QGUA 3R60A 3K4CA 2DU9A 2VQLA 3PO3J 1Z67A 2STWA 5EDNA 4FLTA 1TWFJ 2JRTA 6PAXA 4IHWA 3S1MJ 2ZSHB 3JRBA 4EGYA 2VJ5A 3FK6A 4HBNA 4AI8A 2VASA 4FISA 2QWOB 2MABA 2L7KA 3D0SA 5K1PA 4F7ZA 4DW1A 1HNXB 1NT2B 1SC5B 2AXTC 1UCRA 2BV6A 5LMUB 1N33B 1G6NA 2RKHA 2XF6A 2CW8A 5GTIC 3KE2A 4IHVA 4LK1F 2VKVA 1YJ9I 1LUJB 1RZ4A 1XI1A 1B6AA 1VQ4V 1YJWV 2GXAA 4JV5O 1I27A 5F64A 2BHYA 3BR3A 3HRTA 1XS9A 5BMZA 4YJ2A 4LOCA 4LC1A 3K2ZA 2JGDA 2XSJC 4PA6A 1Y66A 1FJGO 3TEDA 3VSLA 4IJAA 4ZYHA 1IZ1A 1WPBA 2CAZC 2UUAO 4IOAF 1T98A 4BDZA 3J80Z 2IA0A 3M7MX 1YW9A 4XLPF 1BSMA 1WQ2A 3A03A 4XRFA 1IUYA 5FRMA 1I08A 1Y39A 1H89C 2GLOA 3EUHC 3OAAG 4P96A 4MTDA 1TBXA 3CE2A 4LR3A 1W7PA 1J9IA 3ABLC 2M34A 2OV7A 3NQOA 1FFXA 3M8FA 4PD4F 3ETEA 3LOCA 2V79A 1EH7A 5H2FZ 3ZQIA 2LBFB 4PJ0C 1IBMO 2CW7A 3SYPA 4BY1J 3K5LA 1NK3P 2KRCA 2XTAA 4GCZA 2K3FA 3Q0VA 1QR8A 1VQOV 3D5SC 1N25A 2XNDG 3M8AA 3B73A 2HYGD 5IP7J 4JPRA 2G0EA 3I5UA 2FQ3A 4D7NA 4EATA 4O4IB 3CXCU 3K4BA 2M0CA 2QTOA 2XKOA 3RVYA 4LF4B 2Y0SA 5AONA 1AOYA 3ETDA 4L5IA 3L00A 2ZR2A 2ETNA 3FKSG 3KFWX 1Z5VA 3QNEA 5CA0B 2K9MA 1PUFA 1IDSA 4OAYA 2M7WA 2DJNA 1K4CC 5IYZB 3GVAA 3GTJJ 3FB7C 3ZJZA 1JUPA 4JAVA 3G67A 3ETQA 1LFPA 3ZGKA 2BZTA 3HIFA 3S14J 1VQ7V 2F5DA 2HGCA 3G4SV 5K7FA 1R73A 1IXBA 3BTIA 3O8GA 4AIKA 2RQ6A 4J9YB 5F6FA 3GTGJ 4IYHA 3CC7V 2FBKA 3HRUA 4I76A 1GDTA 3LAJA 3ZBHA 1KQSU 1G3SA 3J80K 4HNAA 4IHXA 1H38A 4HQEA 1JKRC 2GBYA 4OPHA 2UXBO 1N36O 5HDGA 3QRFF 4EM0B 2OPTA 1SETA 1GM9A 4G6DA 4CH3A 4PJNA 1PP9H 5M5WJ 1ZLZA 1LDDA 3QYEA 2VJJA 4PI2A 4CH6A 3K6GA 4DQ2A 4MHGA 1AR1B 3A02A 2LY2A 3OOPA 2YEVB 3W6KB 3E6CC 2BOBC 4H13B 4X64O 3CCLI 1VQ6I 4KFCA 5CQEA 3OYJA 4NC7A 2HG5C 5JHFA 1SRYA 4PI0A 2VC0A 1AI6A 2K9NA 3EUHA 3I4MJ 3E22A 2L5QA 3LQQA 3QPSA 2FQ4A 3ABKB 4KN4X 4ZOLB 2M8EA 4CZZA 3HB9A 4PDLA 3G6EI 3LSMA 3HGGA 2YU3A 2DFHA 2DQLA 2FBHA 3F8FA 3K9TA 3DSQA 2R4GA 1EN4A 1XMXA 4RLQA 2OJED 3ERED 2FL4A 3LSGA 5IT9N 2XRNA 4E7SA 1KU9A 3DBHB 4PDKA 1KQ0A 3Q5FA 4WX9A 2Y0SN 5EC2C 3K4KA 3M1CA 4YJ3A 3BROA 1OCRB 3ZHVA 4EM1A 1Q3EA 4F6RB 5CA1A 2IW5A 3WE2A 3E8GA 1R1BA 5TGTA 2PI4A 4OMYA 5A2QK 4JGSA 2R72A 2CQ7A 1YZBA 1EA3A 1O7LA 3A0HC 3BCCH 1S5JA 1X1PA 4GCVA 2D2WA 4ENJA 1N77A 2Q73A 2E19A 4ZJZA 3W7WA 4BUPA 2E76B 4PHZA 2LH9A 4B1RA 3DPUA 2STTA 1BE3H 3GCMA 5B1NA 4UCRA 1R22A 5KMGB 4BGDA 1YI2I 4ZC3A 1NG6A 1Z91A 4M73A 1Y56A 1RR8C 1YRNB 4A12A 2YUAA 4B7KA 2FMYA 4QPJA 2K9SA 4I0XA 2L02A 1XGNA 2FSWA 3CLQA 3KZZA 2W0XA 1S7AA 2M4KA 4X1KA 1LUVA 3E7LA 3OS1A 4K2EA 3CCJI 1U2WA 1GV5A 4F4LA 1NVPB 1QVGU 5IYBO 2O0YA 4MQVA 1PV0A 3L73H 3W3CA 4Q4ZF 5LRSA 1MDMA 2QQAA 2W48A 3SEZA 3CJNA 1HSJA 3NAUA 1AROP 3GTMJ 3DEWA 3L2VA 3HOUJ 4X9QA 1OPCA 4JI3B 1AHDP 4D1QA 4R1HA 2KLOA 1UHWA 1TAEA 1BA5A 4JI5O 4RLFA 1BR2A 4YXWG 3OEHG 4E7LA 3JRDA 2QM4A 1T0FC 3J81Z 4AIHA 3FB8C 3CCRI 2EIKB 3QO8A 1N32O 2CUZA 1E2XA 3QYBA 2YI8A 4PELA 3RGBA 4CS3A 3KCXA 1UG0A 1XSDA 2WA4A 5IJ9B 1RM1C 4CICA 4XN3A 4G94A 2JJ2G 2YUSA 2MA3A 2LK2A 4M6YA 2JUGA 4FHTA 5E3NA 4J80A 1NR1A 5JI6A 2QQBA 4L18B 3DFGA 3SDBA 2ZXHA 2MC4A 1FOKA 3CD6I 2ZMEB 4AD9A 3CC4V 3ZMSA 3FYIB 5LMNO 3TW7A 4RAIA 1J0RA 1QLNA 1V55B 3GTLJ 3X2QH 3HOZJ 4GGGA 1WJAA 2ZDIC 3V4GA 2V26A 2QBYB 2L2OA 3H1CA 1LFBA 4NB5A 2E3CA 3SJMA 2VQGA 2Q68A 1UG2A 2D1VA 5GONA 1XHZA 4DBRA 3DBRB 2YIBD 3W7XA 1ZN2A 4OX9O 1SF9A 3JRHA 4ZTJA 1SFKA 1TP4A 2HTSA 4RAGA 1KECA 3RYIB 1NH3A 2BGCA 5KAFC 2N05A 1BHBA 2DMPA 1A04A 2QQ8A 2XT9A 3SZTA 3H9JA 2GSMB 3NR7A 4F6EA 4X1IA 4U3FH 4MNUA 2IPQX 1VQ9I 3CDLA 3ASOB 4IHJB 5AIPA 4MS2A 2K7LA 3V7SA 3ZQGA 1WJ5A 1GXQA 3T8RA 2LY9A 3G2BA 4PZJA 4BQAA 5M3MJ 4MVSA 4O2BA 4OIOF 5KHJA 3J81K 1B3QA 4P9FA 4G9YA 2EJRA 3B77A 2ZCEA 3BC8A 5J4VA 1K78A 2XAFA 1G4YB 3DLLF 1TA8A 3E8BA 3M7GA 3PIPF 4H44B 4Z1MG 2MFZA 3DKXA 2ZJPF 4FJCC 4JAUA 3M07A 1OFCX 4NNJA 1BC7C 3CXHF 1M1KW 1MMAA 3KYLA 2ZCWA 1PUEE 1VF7A 4TSFG 4EKWA 1MBEA 2WBMA 1W1WE 2BOLA 2K1EA 3OTFA 4JTDB 4J41A 5GAEJ 4UCOA 3HEFA 1T0FA 3AG1H 3JRCA 1ZTRA 4IL6Z 4D9JA 2ZXIA 4BE0A 4G8XA 4LITA 3H1HH 2ELKA 4YHHO 2P6TA 5D4RA 4BIZA 2BBYA 1FWZA 3GXOA 1R5GA 3ABUA 3OD4A 1KD1W 2M5WA 3QAHA 1IJWC 1T33A 5HS8A 5CB4A 1X3UA 4N21A 1A6IA 2UXXA 3RKYA 3L75H 5JH7A 2CUJA 4L9NA 3BWGA 5E79C 3LNQA 1D5VA 3P30A 4A5UB 5CKTA 4LF7B 5K5RA 4M3FA 1ENVA 2QKAA 2WLKA 4I50B 5D5PA 3RN4A 4LNUA 1M5IA 5LA6A 5E1WA 2DJIA 2CW0F 2MH9A 1VQMV 1I7FA 3IRQA 2ZDIA 3DGEA 4JI6B 2E2IJ 2FKXA 3JASB 5C4XJ 1JHHA 2L7ZA 1HC8A 3DEEA 4YIOA 4RWUA 2F43G 5D5VB 1EKEA 4FTHA 1TGOA 1REPC 4WCEV 1OZ0A 5IYZA 4UVCA 2IBZH 1QRYA 3CCEI 1F23A 3SR2C 3CP2A 2DFFA 2F5EA 2K02A 4IRHA 3SDGA 4XRSG 5C4JJ 3JSNA 4B3TO 2AQEA 2M45A 2M9HA 2VS0A 1SANA 4XN0A 3F8BA 3ZPLA 2Y0PA 3FB5C 5E3MA 3CCSV 3VQVA 3BG6A 1V5EA 1V54C 4FM1A 1Q5OA 1XMQB 1MMSA 2LYCA 4O5VA 5IJ0B 1OMIA 1JJ2U 1Y1WJ 2R7UA 1DDNA 1VMGA 3FHZA 3D36A 3JARB 1PYVA 3PQJA 2F4VB 1D0XA 2K9QA 4DUZB 1X1AA 1XCVA 3L2UA 4E7IA 4Y33A 3SYQA 5HS7A 4GT1A 1WJBA 3GTPJ 2E1MB 2EZKA 3BR1A 1Y6XA 1I6HJ 1LUWA 1HR0B 2W7NA 3BVOA 3V8KA 1RKTA 2XB0X 1M93A 4B08A 2ODMA 1BI2A 2W4SA 2BXZA 3FXLA 2A69F 3RDIA 4FIPC 3OOUA 4ZOLA 1SMTA 2FBIA 2LGWA 4X89A 4Y52J 4HF1A 2JRMA 2DA2A 2LMDA 3DQVC 4PFOA 4MTEA 3ZRWB 4L9JA 2LFBA 1K83J 3D5LA 4C3IJ 2ZM6O 4UB6C 2VIXA 4X1YB 2B9SA 4GFBA 1MG1A 4A0YA 1HNXO 2PJRA 3WG7C 2HPIA 1RP3B 3RWRD 3CESA 1JJ6C 1QO0D 2A07F 2V1DA 2R7DA 1RNLA 3KYDB 2ZMEC 5DUIA 4DZPA 2FYUH 4JV5B 3ZHTA 4UCSA 4H33A 4JTAB 3CJRB 1CP9A 4X0GA 1BOAA 1OKRA 3H1IH 4QWQA 3ML0A 3A2KA 5B1AB 1H0MA 3DWLE 1W59A 3I56V 4UVAA 3RZDJ 4OXSA 2NYXA 4I9QA 1W7PD 1AI7A 3PNVA 1BL0A 2BTQA 2EBOA 4BW5A 3CPWU 1ZWIC 1QU3A 1YYVA 3TQNA 2DWEC 1GLNA 4C9YA 4FMTA 1YDXA 1MSDA 2CGOA 3FYEB 1X4PA 4EFEA 2A05A 2WY8Q 2WLLB 4FE7A 1T56A 1YJNI 3B40A 1O9HA 4U3JB 3RKQA 1KUQA 1B59A 5HFMA 1K79A 3ELKA 4F3QA 2Y9ZA 3W2VA 1DGRM 1O9GA 5L3EA 3UO2A 1IBMB 1TT0A 4AYBA 4LF9B 2NVUB 1IRGA 1KP3A 2BTOA 1XNRB 1M56B 3QODA 3M1EA 2Y31A 5FO5A 4HA8A 5D5UB 5C3EJ 3J7AO 2HOSA 5DEQA 5J2TB 3VEPA 1XNQB 3JAMZ 5B3SH 4S0HB 3HL2A 2W57A 4O4HA 4C30A 4G12A 5ILSA 1Z3YA 4ZYDA 1D8JA 2DYSB 4TV9A 4X62O 1Q7YW 1ZR4A 3RYHB 4RB1A 4Z2WA 3FXKA 1LVAA 3G71I 4R8CA 5EZYB 4LF4O 1Y74A 4UV8A 2LRDA 1GN2A 1O3RA 4GKKB 4DBQA 4BIUA 2YS9A 4LGWA 5J2UA 3BPVA 5FRNA 4IX7A 1VF6C 2WLNA 3DXRA 2GBOA 4ITVA 1KKDA 1PP7U 1WA8A 3Q9SA 1T2KA 4I0BA 3K0GA 1YXBA 3JTHA 2CUGA 2VBYA 5EYRA 3S3WA 4CXFA 1SAXA 3AG2B 3HOSA 3QWLA 4YG2F 4X6AJ 4BR6A 3LA7A 5KHDA 3O8HA 4BXUA 2AW9A 3HKBA 2O03A 5KA6A 4XORA 1KU2A 1OHHG 1YG2A 4D5CA 1OCTC 1T5EA 4UUJC 2ZMEA 4MO7A 5F0HA 5J6XA 2PBIA 1DUXC 5LP6C 3JATA 4Y17A 2OWOA 3MKYB 1MSWD 1IXRC 2YDEA 1YX5A 2XPVA 3KEQA 2EFNA 3BPXA 4WFFA 5J1RA 1EM1A 3S1NJ 2VL8A 1ZKGA 3S1QJ 1J5EB 2X0LA 2OA4A 1SFUA 4B44A 4YFKF 3L72H 4D7MA 4JP0A 2KIFA 5JLWA 1ACIA 2KIQA 1Z77A 4XMYA 2CQQA 5DCMB 4A0XA 4AC0A 4JI7O 4KJZA 4ZDPA 1BQZA 4XSXF 2Z2SB 4FETA 3OMAB 4CCKA 4AYBN 4LLLA 5KLVH 5CBFA 5KUKA 5J9PC 2A3SA 3L09A 4XONA 5IP6A 1FPOA 5JJJB 2DTZA 3HRMA 1YHQV 2M0MA 2EFWA 3J80N 2H6CA 2DAOA 2EILH 2X4HA 1ZAUA 1J95A 1B9NA 4EJVA 1SQPH 3CWBH 3OYMA 2GWRA 3HPGA 5DD4A 2R7SA 2A5YB 2FRHA 1JTXA 3BQYA 1AJNA 3V42A 2K4JA 1HW2A 2ZT9B 4E70A 4B3XA 1S0VA 3BABA 2KIMA 2GTSA 2DDAA 5HDKA 3R6SA 2DBBA 3WU2Z 3K69A 2UXDB 2X9DA 3H9VA 3F6OA 3UKMA 3KP5A 3FHNA 3E97A 1QR9A 3ZQCA 4EB6A 1D0ZA 4BAYA 2HKXA 4ENNA 4HPQA 5ICGA 1VF6A 2OBPA 2VE9A 1U96A 1X4OA 4UUTA 2ZIOA 1LFUP 1QA6A 3VOUA 2M2EA 3BZKA 2HLDG 4X1EA 4UCVA 2ZB9A 3JAKA 2BXYA 4V2GA 2R5ZB 1XNQO 4XOPA 4BEHB 2LW1A 2H94A 2KJBA 3Q9VA 1F4NA 5EZGA 2L01A 1FOXA 4QPQA 1FX7A 3SHFA 1J5YA 2Q1ZB 2M3AA 3HBLA 4R8HA 4B48A 1XHXA 2MH2A 3CRAA 1PNMA 4I50A 3ZCCA 5LP6A 3OT7A 1FC3A 2PJPA 5JVDA 3HKCA 1DK1A 3JYCA 1MBFA 4IO9F 3U11A 3CCVI 3F7VC 4MT8A 3K0LA 3JASA 3RIRA 2HI3A 3CCQI 3RYRA 1FFTB 1ZLJA 5A2QN 2E60A 4LIVA 2YPRA 4JI3O 2O9LA 3CC2V 1XSVA 1JFFB 2EBIA 2PMHA 2GUZB 2Q67A 3UT5B 1KP2A 2KT0A 2VE8A 5J3LA 5HDNA 2HZDA 3CRCA 1OCCB 1VQLV 4R79A 1SQXH 3AK3A 4P55A 1Y76B 1FXKC 2W6IG 1B8IB 4RM2A 2EZLA 1I5YA 4O4LB 3UM7A 4BHPA 4RAFA 3W2WA 1V3FA 2P8TA 3B02A 3RQ4A 4A5NA 2HVJC 4HX8A 4E4HA 2DT6A 2DMUA 3OUSA 4LB5A 2GXGA 3GZ5A 3P9CA 3ZQHA 3PJSK 2OC6A 3AK2A 4MEXF 2Q7EA 4K35A 3SYAA 3ZMTA 4PCQA 2DT5A 2VT2A 3CRMA 1SFEA 3ZQ7A 2EQRA 2Z99A 3HOWJ 2GIVA 3DKYA 2P6JA 2P90A 2JSPA 3EUAA 3OGIB 5HODA 1BZKA 4GDFA 1GVJA 2EB7A 4BKXA 5EEAA 1HLVA 2Q69A 5BMVA 4UUSB 4ZTFA 1FP1D 1WNSA 1UMQA 1YX3A 2EINB 4Q5SF 3Q0UA 1WH7A 2ECBA 2DW4A 1MKMA 2ESNA 5IOYA 2QSGX 3P3NA 3TMOA 4JZGA 1CGPA 4ZI7A 1X1BA 2WWYA 3T1BA 5GAGJ 1H8AC 1OJHA 1R00A 3F72A 2DOSA 4MVOA 2FOKA 4IRGA 3LA2A 1R6KA 4RB3C 4W4KA 3O3KA 2A6HF 1UZCA 2V1NA 4WXDA 1U8RA 3BR5A 1D1CA 2D5VA 2HYFA 3C2HA 4V2FA 1VFCA 1AR4A 1BGYH 3ABMC 4TV8B 5LXTB 1Q90D 4M3EA 2Q2EA 3LNMB 3I59B 1KA8A 1W0TA 3AG4B 4L5JA 2L0KA 2QWPB 2KDZA 3GLXA 3G1LA 4ETSA 4XKWA 4UUVA 5E20A 1F7YA 3A0BZ 1I3QJ 3FMQA 4TQDA 4JBAA 2AHZA 5IP9J 1J09A 1E3OC 4NQWA 1LDKB 9ANTA 1LR1A 4QNHB 2KKWA 3OS2A 2DODA 3HR0A 3ZHUA 3OTOB 1YITI 2DA3A 4FVMA 4J7JA 3MDSA 2XASA 3FKIJ 2F4MB 4EEFG 2P4VA 3S8PA 2RQQA 1RETA 3NWSA 1QBJA 1XSXA 2NVTJ 4IVNA 2JEUA 2F23A 5TISC 2GOXB 4BHBA 3GX4X 2LLKA 2CH7A 5AIQA 2PEXA 3BA9A 5HS9A 4NR1A 1FXKA 2LF8A 1I39A 2P6SA 3QOEA 3VDXA 4L8JA 2EV6A 5DM6V 4RM3A 5B1OA 5CVVA 2P0WA 2KSDA 5DEDA 1BR4A 4E4EA 5F0FA 2N04A 2J5PA 1HW5A 3J81N 4A5MA 5H20A 4I2OA 2EIMH 3VYSB 1OLTA 3TGUH 1XMOO 2VQEB 4LF7O 2B1IA 3SXYA 4CH4A 1AA7A 1ODDA 4AVZA 5HLTA 3JRAA 4Y7NJ 2Q8VA 1OR7C 2D1HA 2L54A 4N4NB 4PK4A 3A0RA 4TQFA 3SJBC 3VQYA 4IIJA 2PTMA 3P7NA 3LSSA 1OCPA 3R65A 3RYHA 1FOYA 5LEKA 2Y69B 1XDCA 3WTWC 1GHCA 3G80A 5K1YA 3D8CA 3AG3B 5B66Z 3OYCA 5D6FA 2IA1A 1Z21A 1GM8A 3WU0A 3E8FA 1W2BU 3EPZA 1G8XA 2WC2A 2IP2A 4U0YA 3CRQA 1F51A 1HBXG 3GO5A 1XEQA 2M8GX 2MYSA 2Y0MA 4DOZA 4NVPA 4G6TB 2GA1A 3GFMA 4B3TB 1B1BA 4KT6A 2MD5A 4I4TA 4QGPA 4DRXB 4RGUA 4I6ZA 2OU2A 3OL4A 4FZ0A 2QA4I 5LHHA 1DP3A 1AR5A 4HZFA 3F21A 1B4AA 1IV8A 1PJRA 4W1UA 2XGCA 3VWBA 4CGZA 3T8TA 5IYCJ 3I71A 1XPXA 1SA0A 4FM0A 2HHHB 5LYJA 1RESA 3AL0B 2W00A 1YVWA 1VQKV 3CRRA 1SD4A 1RIOH 1XMQO 5FGMA 1JA8A 2X85A 3KZIZ 1FT9A 4BNCA 3DPLC 3GTOJ 3OV8A 2OCCC 2BEOA 5LHGA 1BW6A 1I50J 5GADJ 4EFBA 3I55I 1RUNA 3FDYA 2F4VO 4UB8C 4DUZO 2OAZA 3IWFA 4J01A 1K7DA 1NU1H 4P9UA 2JK5C 3U9GA 2WA3A 4M6XA 3OEEG 1HR0O 3EYYA 3JW4A 2JT1A 1QHHD 1NG7A 3QPLA 1PL4A 4NTXA 4FLYA 1R5HA 1GVDA 1J75A 3CDIA 1OCCC 2M7AA 2A6TA 3K10A 1VQ8V 3K4JA 4XNFA 2DXIA 2YXLA 5B5EZ 2LP0A 3RZOJ 4Y13A 2M4GA 2L3DA 1CF7B 2EX3A 2ZM6B 4FLWA 1JPXA 1IBKB 4B43A 1FS0G 3QO7A 3MQ0A 3BAAA 4LWSB 3VBBA 4M3DA 4XM3A 1U78A 3T1CA 1GM7A 1VQ6V 1Z7UA 1ZREA 4B09A 2PYJA 1QNTA 3FBIB 3HGYA 2CUEA 3MWMA 1WSUA 3BJ6A 2ITCC 1BBYA 2BYVE 1N75A 2CSOA 3PNTA 3LDEA 1IRXA 1U97A 3AG1B 4I55A 3S3XA 5BR8O 2WV0A 5LLQA 5EF6A 4A3JJ 3JTGA 4LFBO 2EINC 3KX2A 1TNSA 2NS0A 2CV1A 1YQAA 1COWG 3HKDA 1KMIZ 5KHGA 2IEKA 4H4KC 3E0JB 2R0QC 2LDUA 2M7BA 3GFLA 2RDCA 2ZXWC 1H9TA 3M3YJ 2FA5A 2IS4A 1Z05A 2O57A 2RAEA 4BACA 1R6RA 2QQ9A 2XAUA 3ASNH 3RKWA 3RPUA 2KKOA 2UU9B 1Z2GA 3WGGA 1YEWA 4MVQA 1R4NB 1WB7A 3QP5A 3IAM2 3WTXC 2R5ZA 2OD5A 5BPDA 4BEHA 1ZGAA 1AI4A 1K3EA 4P9PA 2HXOA 3K9AA 5L3DA 4HW0A 3AG4C 2VXDA 2QEXI 4GXOA 5DCFA 4WK8F 1VF5B 3JD1A 3BZCA 3EHBB 1FIAA 4LF9O 5DUKA 2EZPA 4KN7X 2Y4TA 1XNRO 2G7HA 3T1HB 4C3JJ 4CCOA 4LFCB 1YI2V 4XRSA 1J59A 3OM3B 1TT5B 1XBLA 4U7BA 1WKMA 2KP6A 1YLFA 1IN6A 1MSEC 2HJDA 4O6JA 3R61A 4PJLA 5EBWC 4D7TA 1MBHA 4ZH4F 5EZHA 4X62B 2QTSA 4CUGA 2L4MA 3NRVA 2LFSA 1LVKA 4HX7A 2JVGA 4MVMA 3CCJV 3LSIA 4HZ3A 2I8DA 3OGCC 4XR6A 3KP6A 1NI8A 3C2BA 3ZMZA 4I7ZB 2JRIA 1G3TA 4KMUX 4A0ZA 3PNYA 3SZPA 1A5JA 2BY3A 5JJEB 1NH2B 2NOGA 4XIDA 3N2KA 2QYOA 4ASUG 4GKKO 3DTKA 2IXSA 4DR5O 3F6VA 2EH3A 2VB6A 5JHUA 3WGIA 4O4LA 1YFHA 4RO2A 4AIJA 2YR2A 4UFZA 3OMNB 4JX4A 2VC1A 3IH3A 3FAVB 1TWGJ 1DQUA 3IH4A 3O9OA 3COAC 3W2AA 3SFIA 3GUDA 3OIOA 2GIZA 4X88A 4AVPA 2BY0A 1SQGA 3L71H 4O2AB 2B63J 3HOTA 2B0LA 1ZG5A 4G27B 4DV2O 2HR3A 4BQQA 3OMIB 3TDZC 1OYYA 5IY5B 2ZNZA 2CV0A 3O2PE 3VYUB 1S72V 1R58A 2EV0A 3CLOA 1IV6A 3S93A 1LQ1A 3THOA 5E1XA 3FFQA 2R9IA 3UKGA 3ZR8X 3AG3C 1TTYA 5FKLA 1J5EO 4PDVA 4K3AA 2FUG2 4AM3A 5L3GA 2GXBA 4M72A 2TRTA 2Q0OC 1FBUA 2OTLV 2KG7B 4JI7B 1YW7A 2WLIB 3QU3A 2XAJA 4FQGA 3CCMI 3RYCA 1O3SA 2FX0A
chains in the Genus database with same CATH topology
4N9IA 2LSOA 4JF3A 3SPGA 2QE7G 4MQ9F 3IKVA 2MLGA 1YS7A 5CBGA 4L0YB 4ESJA 3CUQC 3IC7A 2EV5A 4GO1A 1L1FA 4A6DA 1OCOC 3LWFA 4WF2A 4ZBMA 3FM5A 2Z33A 5B1BB 2DYRB 1Y4MA 3FZVA 3K0DA 3F8CA 4OU0A 3LDDA 4HYOA 4JTCB 2HS5A 3ZIAG 1P4RA 2RC4A 3DV8A 4QIWF 5B3SB 2FNAA 2HFEC 2RGVA 4ASNA 3TO6A 2CQKA 2RNJA 2GHYA 5CA3A 2Z3YA 4U7OA 2O3FA 2EIJB 2W0FC 2R9RB 4IF4A 3N97A 2JDIG 5E17F 4G7ZF 1USTA 4MTOA 1FXVA 2XKPA 2JTVA 2EA2A 4ENMA 2A61A 2EZOA 1TLHB 3HB3B 4L9VA 2Q0OA 3AEIA 1MABG 4QJFB 3ZP5A 1EV7A 4MVZA 4EJUA 3QU6A 3TCUA 3KETA 1UB9A 3EDPA 2X6AA 1QGPA 2HTJA 1KGSA 3K1NA 3CUQA 1R3LC 1DTOA 3V8LA 4O3MA 3DP7A 1M57B 1HQCA 1ZH5A 1Q82W 1K92A 2AHYA 2XV4S 1O3TA 1I1SA 2TDXA 1HXDA 4RAZA 4BH9A 3B8NA 1U3EM 2WPDG 4RQEA 5DYMA 5IYCO 2V9VA 3IGAC 1LNQA 3RYPA 2Y75A 2JEXA 1CF7A 3OFNG