4HAMA

Crystal structure of transcriptional antiterminator from listeria monocytogenes egd-e
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
SNAMFTINTKSQLPIYEQIVQKIKEQVVKGVLQEGEKILSIREFASRIGVNPNTVSKAYQELERQEVIITVKGKGTFIANQTDKLSSPKKLAETRTKLKETILDLVYLGVNIEEIHKLADEYSQDIIGGDVVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2241 protein
publication title Crystal Structure of Transcriptional Antiterminator from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 43
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hamA01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hamA02
1MDMB 1J2XA 2D1VA 5HS9A 4LG0A 3Q9SA 4XLNF 1FBQA 1SD6A 1J75A 2FSWA 2Z9OA 4R8HA 1I1SA 2VC0A 3GXOA 2ZXJA 1RZ4A 1DPRA 3F21A 4HDVA 4CXFA 3G3ZA 3ECHA 4I02A 1GXPA 2NNYA 2DK8A 2FU4A 3W7TA 2LKPA 1UCRA 1P2FA 1U5TB 5TJJA 4WXCA 4UVAA 5E1XA 4Y15A 2A3SA 3O2PE 2XRNA 4JQFA 1U6GA 1O57A 3RKYA 1O7LA 1HKTA 2VBWA 3GUDA 3U2RA 3HTSB 2JTVA 2EA2A 3VEPA 1EH6A 1BN5A 4EV0A 1TQPA 5CVIA 1MJ9A 5CLSA 2HGCA 5E8IA 1O3TA 5JR3A 1S6LA 4EJVA 4EVIA 2K27A 2VOOA 5DD8A 4P9UA 4OIRF 4CZZA 3RKWA 5LRSA 4UV9A 1JGSA 3RIRA 4EJWA 2IT0A 1F4KA 3R0AA 3E6MA 4O3MA 1WWXA 5JVTA 4YG2F 1B4AA 3KP4A 2G7UA 3D3IA 2LNBA 4G7HF 4ESFA 1QZYA 3VOEA 1MKMA 5EEHA 2IA0A 3ISPA 1XN7A 3PQKA 1J59A 4N9IA 2L54A 1KU3A 1QO0D 1FOKA 3C7JA 4MEYF 2Z3YA 3LWFA 2V9VA 1HBXG 3KP2A 2WWYA 2QENA 1PP7U 1J9IA 3R4KA 3E35A 5J8CA 3EETA 1OYWA 1ZG3A 4HV6A 1T38A 1FC3A 3BJAA 1PP8F 2DBBA 5HDNA 2MA3A 1XMKA 1IXCA 2LDUA 5L3FA 1XGNA 3I64A 4MGRA 1ON2A 2V1DA 1TQMA 2ZNZA 2BBYA 2QUFA 4UVCA 1LB2A 4TV7A 4Q48A 4NB5A 4XBFA 2CG4A 4N9HA 1WQ2A 5D6EA 2K86A 4S05A 3WTXC 1QBJA 5AIPA 2ZKZA 3H92A 1R00A 4P96A 3MQ0A 4HAMA 3ABTA 3HRTA 3Q5FA 1FYLA 1LEAA 3R0JA 5CVJA 3QP6A 2ZJ2A 2MH9A 5BPDA 3M8EA 1I1GA 4UNOA 4WK8F 3E3VA 2RKHA 1T6SA 3CUQA 3SFZA 3I71A 3CJNA 3WTWC 3R6SA 3GFLA 2XROA 4MHGA 3E97A 4A5MA 5CJ9A 4HQEA 2KJCA 4LFUA 2EV5A 1FLIA 4A0YA 3QAHA 2P5KA 3V7CA 3KZYA 3ECOA 2Z33A 1W4MA 3T8TA 1S7AA 2JPBA 1F9NA 1FY7A 1KQ0A 1FP2A 1H0MA 3WGIA 2K4JA 1B1BA 5LRRA 4I2OA 4WWCA 3CO6C 1TBXA 1RI7A 3HOSA 3BROA 5AIQA 3GYHX 4U7BA 1BIAA 2F5EA 1IUYA 4G7OF 1ZGJA 2VC1A 4BAYA 1D8JA 3RPUA 1GHCA 1XGOA 2D1HA 5DEQA 3FMSA 3QPTA 1Z6RA 3KP5A 3ELKA 3M1EA 4Q47A 2DT5A 1RUNA 2P6TA 3HYIA 4Q5SF 1HQCA 2NYXA 2A6EF 4RAZA 1DUXC 2P90A 4P55A 5LHHA 3FWEA 3SZTA 2K7LA 3GFMA 2CSOA 4PGGA 1Z05A 1R1TA 3WTUC 4JBAA 1REPC 1FPQA 3GF2A 2JT1A 1IRGA 2NAZA 1Z1DA 4HA8A 3J81K 1XSDA 2FMLA 4HV5A 2XIGA 2IP2A 3IL2A 4U0YA 2DO7A 3WU0A 3FMQA 5HS8A 2PBIA 3CUOA 4B8XA 5CA3A 1LNWA 1G4DA 3BDDA 3DP7A 2ZMEA 3NEUA 4BHBA 1YLFA 1HXDA 1IN5A 2VN2A 4RB0A 2KJBA 1KU9A 3GX4X 1D3YA 3TO6A 2OQGA 3RPQA 2CGPA 4HOBA 1OYYA 2FOKA 2EB7A 3BOQA 3CDHA 1FX7A 4ZYEA 2XGXA 2IJLA 3GLXA 3LSTA 1ZARA 4I7HA 1ZG1A 2M5WA 1ODDA 5CVRA 4IJAA 3GWZA 4EJUA 4HX4A 2HEOA 5K5RA 4U88A 1S7OA 4KN7X 5ED4A 1KU2A 2JSCA 4DNCA 1S29A 2QLZA 4M71A 2KRFA 3T0YA 4LB5A 2GXBA 2IA1A 1U8RA 2BGCA 1V3FA 2HWVA 2Y75A 2F2EA 5FLXK 3RYPA 4A6DA 1GVJA 3RKXA 5J6XA 1CGPA 5DYMA 3ZMUA 1BC8C 4L5JA 2IPQX 1XDUA 2CQKA 4I09A 4LLNA 3J81Z 3F8NA 2TDXA 6PAXA 1LVAA 3MAJA 3T1BA 1O3QA 4XLPF 5CYVA 5J8FA 1KU7A 1PDNC 1KQ8A 1UB9A 3M8FA 5LHGA 1U5TC 2PG4A 4IRIA 4ENKA 3C18A 3R61A 3EYYA 5DUIA 2HR3A 2FBHA 5FO5A 3B02A 4PCQA 2IVMA 1ZYRF 2HTSA 2W84A 3IKVA 3L09A 1WRJA 5LGNA 4RGUA 4IHSA 1G3WA 4HF2A 1P92A 3V8JA 5L3GA 2EJRA 2ADUA 2M1BA 4WXHA 3TOBA 4LB6B 2P7CB 2HKOA 3DPLC 5FFXA 1D5VA 2M45A 1Z7UA 3HHHA 2KKOA 4FHTA 1FBUA 3F3XA 2HYGD 3W7SA 1TW2A 4KA4A 1OYIA 1BI3A 4L9NA 3DEUA 5FLXZ 5A2QK 2VT2A 1WI9A 2AS5F 3U9GA 2E1CA 2FMYA 2PQ8A 5FGMA 4M72A 3SXYA 1XD7A 2GQQA 4A12A 2O6GE 2A68F 3ABUA 3NQOA 2FBKA 1ZLJA 5E20A 1DPUA 2FNAA 2RDPA 2HTJA 2HQRA 2Y48A 2RV8A 4Y13A 2P8TA 2KIMA 3JSPA 1KQ9A 1W7PB 3V7SA 2DTRA 2Z99A 5ILUA 1PUEE 1NHAA 3IWFA 1K6OA 2MH2A 3VFZA 4KT5C 3K9TA 1YTYA 3MZYA 2XVCA 1UHWA 2W85A 2VE9A 1TW3A 1HKSA 4UVBA 2HFHA 5L3CA 1FSEA 1T98A 2Q8KA 5H20A 2PMUA 1P4AA 4ZYGA 5HLHA 4HW0A 2FBIA 4PZJA 4G94A 4I0AA 1ONVA 3L7WA 4R1HA 5HLIA 1JE8A 1IZ1A 3KEOA 1JHFA 4U0VA 2BE5F 3HSRA 5E8GA 3RDIA 2RNJA 3P9KA 4N0BA 4RB2C 1L0OC 2NNNA 2GWRA 3F8MA 4LMYA 3W6JB 1F5TA 1J7KA 1FYMA 4HLYA 3T8RA 4ASNA 2KIFA 2K02A 3PQJA 1XGMA 2E7XA 5A2QZ 4HZFA 5TRDA 4WX9A 5D5WB 3WTVC 3KCCA 2OZ6A 3LQRA 1XDSA 4BYYA 4G6QA 2ISYA 3TO9A 4AD9A 3KLOA 2J5PA 2KIUA 2HZTA 2Y0MA 4LD5A 2RVCA 1QNTA 2H6BA 5ILVA 2MBFA 3GZ6A 4A2UA 4XSXF 1BI1A 1S8NA 4EJTA 4YFXF 3CO7C 3GFIA 1ZHFA 1O3SA 1R36A 2CFXA 1P4XA 3I54A 1U5TA 3T5XA 1L3LA 3DFGA 2YX7A 3JTGA 2YPRA 5E1WA 3KFWX 2FEZA 2O8XA 2C6YA 3I58A 5ICCA 2OD5A 1YFHA 1BI2A 2PFBA 3V7RA 1SMTA 1B9MA 2EWNA 2DPDA 4FX4A 2EV6A 1IN4A 4JK1X 1RUOA 5LHIA 1Z6TA 2RC4A 1XCBA 3WU1B 2ESNA 3P9CA 5L3DA 3DKWA 3EDPA 1W5TA 1YO5C 5LEJA 2V1UA 1LDKB 4KIBA 3B73A 1MJAA 2IRFG 3U1DA 3TQNA 1H9GA 3HSEA 2EFNA 3HTUA 3HRUA 3K1PA 2MLGA 5BQTA 1XMAA 2CYYA 3QOPA 1K78B 2V79A 3I59A 5LGTA 1ZH5A 2G9WA 4KIGA 1RM1C 2XHKA 1TQIA 4IXAA 4WCGA 4KIFA 2X0LA 3EUHA 4ZYDA 2DW4A 2P6SA 1NVPB 1G3TA 3HRMA 3V8LA 5L3EA 4Q4ZF 1G3SA 3JW4A 1CF7B 5CVUA 4BQAA 1SD7A 3C1DA 4CGZA 1VTNC 2QYOA 1YW7A 2XUBA 4BH9A 1QZZA 1W7PD 3W7XA 1KYZA 4BHCA 2VBZA 5JFRA 4LJZF 1R5GA 1FP1D 3V8KA 3JTHA 2LSOA 3IRRA 3KZZA 1R1VA 1OKRA 4O6JA 1Z9CA 3CLOA 2YU3A 2F5DA 3WE2A 2EFWA 2FA5A 4D0PA 4L9TA 4HBLA 1IN6A 1SFXA 2NS0A 1SFEA 1HSTA 2EV0A 1I6XA 3K0LA 2VODA 1BI0A 3COAC 4I0BA 2QBYB 2DQRA 1IW7F 2HS5A 2J5OA 3FM3A 1ZAOA 4I98B 5FFZA 2WV0A 4UV8A 2ELHA 5GW7A 1UHMA 5EEGA 3WGHA 1AWCA 4IRHA 1ZRFA 4UHTA 2A61A 5DD4A 1LQ1A 3TOAA 1Q1HA 5HVQC 3FXRA 2D2WA 3QPHA 1WKMA 2ZCWA 1DDNA 3RTRA 1XGSA 1KYWA 1EH7A 1EV7A 2YSRA 4H0EA 2STTA 1P4WA 2K4BA 2W25A 3H3ZA 3LAJA 1R58A 3L9FA 5BS6A 2JZYA 5DCFA 4A6EA 2GAUA 5DV5A 3KP6A 5BPIA 4LK0F 4ENNA 2IA2A 2GIVA 3ML6A 3I4PA 2FF4A 2L3DA 3BP8A 1U2WA 3IC7A 1Z91A 1QGPA 1ZRDA 1O7FA 2R7DA 3FMRA 2PN6A 2HOEA 1G3YA 1TLHB 4HF1A 5DCMB 4A0XA 5D8LB 1ZREA 4OMYA 5ILSA 1KA8A 4L5IA 3ZQ7A 1YW9A 2CW0F 2HDCA 2QM3A 3DF8A 2XAJA 3TDUC 2AXLA 3QU6A 1F1ZA 2UXNA 2GXGA 1USTA 5E18F 4IF4A 2P5LC 4L0YB 4ETSA 4HYEA 4MQVA 1SD5A 4MTEA 3GW2A 4LG0B 1TNSA 1ZG5A 2L02A 2V1XA 4EGYA 2FNPA 3JSOA 1TNTA 3K69A 4G6DA 3S2WA 5D4SA 1HSJA 2R3SA 4AWXB 3DPTA 1U3EM 4OIQF 1LEBA 2UXXA 5F6FA 4F7ZA 2OA4A 4WXDA 2G7HA 2RGVA 2QQ9A 2DLLA 3FXUA 4R79A 5E17F 4YFNF 3ERED 2A6HF 3R60A 4MTDA 3I5UA 4A5NA 3L2CA 2A07F 2OQRA 4RB1A 2O03A 5HDKA 4B09A 4CDGA 3Q9VA 4P5OA 4M9SA 2PEXA 4LK1F 4IHTA 1B6AA 1K79A 5JI6A 4L9JA 3M9AA 2YR2A 2XKOA 5FB2A 1O3RA 2O3FA 3ZN0A 3HOTA 1ON1A 2R7FA 1OR7A 2ZNYA 1LJ9A 2DQLA 4PGHA 4GYGA 3ZP5A 3KP7A 1MZBA 1UFMA 1BM9A 4YIIA 2P7VB 1XCVA 4QWQA 2DK5A 3HUGA 4LGWA 1T2KA 3FM5A 1JHHA 3KE2A 1J0RA 3O3KA 2FQ3A 1ZGAA 1SMYF 2PLYA 4UXNA 3GZ5A 5ERIA 1KGSA 3KP3A 4HF0A 2P5VA 5HLGA 3W7WA 3FXQA 3CTAA 4XSZF 4AIKA 5D6FA 2GA1A 1FZPB 3MEXA 2FRHA 4OOIA 3TDZC 1RIOH 3WTZA 3WTYC 5IT9Z 3LA7A 2L4MA 4M9ZA 1E17A 4FT8A 5D5VB 4RS8A 4O5VA 4Z2YA 1XSXA 1USSA 3F8BA 4OIOF 3WTSC 5K1YA 1TTYA 3F22A 5CVVA 3WE3A 3E5UA 3MFKA 5HOOA 3ZMSA 2X4HA 4AIJA 1ZRCA 3ZMZA 1XSVA 4IRGA 1D8KA 1B9NA 2Z5UA 1ZN2A 2HYFA 3BY6A 3E5QA 3OOPA 1WSUA 3F6VA 4XRFA 1H9TA 4NHJA 3WG9A 5F1RA 1U78A 4KFCA 4L0ZB 5HS7A 3D0SA 1YTFB 4UUVA 1BBYA 3ZMTA 2L01A 2F5FA 3P7NA 4GYIA 1YG2A 3P9IA 5KK1A 3BJ6A 1QQIA 4U7DA 2QWWA 2GZWA 2VT3A 4KICA 4CYDA 1BOAA 2ZO4A 4L18B 3CUQB 1LDDA 4Y17A 2HKXA 3I59B 2CWEA 1MDMA 2DPUA 3J7AO 5D5XB 3DV8A 2ISZA 3I0TA 1ZLKA 1IN7A 3C3WA 3GVAA 2XASA 3GEZA 1A04A 5DUKA 2H27A 2H94A 4CO8A 3DXJF 3FF5A 4BXUA 2DFIA 3BWGA 3F6OA 4M74A 1SAXA 2DAOA 3PFIA 2DU9A 4RAYA 2M87A 1FNNA 3IHUA 4EM0B 3BPVA 3E6BA 2RQPA 1YIOA 3LQQA 2XAHA 5JHUA 4EGZA 5IT3A 5BMZA 2M8EA 1T39A 2E1NA 3GFJA 2QQAA 4KYWA 1B59A 1W7PA 4MEXF 3TKYA 2UWMA 2OBPA 3I53A 4NQWA 4U0WA 3SQNA 3MCZA 4G8XA 4K2EA 4KDPA 2JRTA 4HQMA 1S3JA 4L9VA 3KEQA 2M30A 3VB2A 2WTEA 4HLXA 1IF1A 4IVNA 3LFKA 1OMIA 2XAFA 3E5XA 3HSFA 2A69F 4WF2A 4MNUA 2COMA 4RB3C 2MC3A 4ZZLA 4M9XA 2B0LA 3LA3A 1IAWA 4GXOA 1QPMA 3SZPA 3ZPLA 1MJBA 2BV6A 4ZH4F 1HW1A 1OPCA 1T0FA 2CO5A 4E70A 4CICA 4HX7A 2LF8A 3SHFA 2ZFWA 4EQQA 3E6DA 2P4WA 3KLNA 1E2XA 2VBYA 3QP5A 4KMFA 3JAMK 4GO1A 4I01A 4LLGF 1ULYA 3IWZA 1AOYA 4AVPA 3D5LA 2XV4S 3QU3A 4RGSA 4RGXA 2WAMA 4M6XA 3FZVA 1JXSA 2ACJA 5K5QA 1DP7P 4ESJA 4S04A 2ZMEB 4ZYHA 5F64A 3BPXA 3TO7A 4ENMA 3O6BB 1IN8A 2OAZA 5ICGA 4KN4X 2PJPA 3REOA 4OIPF 4EJOA 4AIHA 2HQNA 3WTTC 1BC7C 3IRQA 3QRFF 2ETHA 1C0WA 2F5CA 3LA2A 3WODF 4M73A 3WGGA 3MWMA 1FYKA 2EFPA 3M7GA 4ESBA 2ESHA 4EMSA 1FT9A 3F23A 2W24A 3N97A 3G73A 5E1ZB 2PI0A 3MZHA 5H6RA 4EM2A 2EA4A 2EFQA 1HW5A 1I5ZA 3GO5A 4ON0A 1GXQA 4KNYA 2VONA 1IXRC 2NRAC 3F8CA 3AAFA 3HRSA 3JAMZ 5H6QA 2QZ8A 2BEOA 3BJOA 1HW2A 1NH2B 4OINF 1K78A 1IXSB 1R1UA 3LAPA 2MD5A 3RJPA 3ZMDA 1R5HA 2BYVE 4A0ZA 1SFUA 2STWA 5BOXA 4YIFA 4HX8A 3L00A 1YS7A 3F8FA 1CF7A 4FX0A 5FD6A 2DI3A 1BJAA 2IW5A 2EFOA 4PDKA 3K1MA 1W5SA 5D4RA 3ROUA 5DDGA 2H09A 2OZUA 1YS6A 2QVOA 4G7ZF 5ICEA 2H6CA 2PMHA 2MLKA 5LEKA 3W7UA 4HDUA 3J80K 3K2ZA 4IPAA 2UZKA 1V4RA 3K1NA 4DQ2A 2VBXA 2VOPA 1FWZA 4ENJA 4QLCU 1R23A 1XB4A 4BHPA 2WC2A 2XAQA 4M6YA 2VE8A 3F72A 2QBYA 2RN7A 5D8KB 3ZN1A 3IKTA 4GGGA 3VODA 2XKPA 3FX3A 2D45A 2FE3A 1YYVA 4YFKF 1K7AA 4MQ9F 2E7WA 5LBQA 4BNCA 5ICFA 2GA2A 2O0YA 5KVRA 3TGNA 3V4GA 2FXAA 5D5UB 1SD4A 2OU2A 4KMUX 4KUMA 4LLLA 4G9YA 2ZBKA 3DQVC 3KETA 3EQLF 5IT9K 3ZMVA 3E6CC 3RYRA 4OMZA 1MGTA 5AONA 2W57A 3W6KB 4ZZDA 3EYIA 2QQBA 1R7JA 1J5YA 4RGRA 5HDGA 1MD0A 3H3UA 3OV8A 3FHZA 3ULQB 3HHGA 1RNLA 4EM1A 2YX4A 5K5OA 2O61A 1HKQA 1R22A 2JPCA 3J80Z 2A5YB 4OU0A 1I27A 5FD5A 1LDJA 3BZ6A 1G6NA 1BIBA 1X3UA 3NRVA 1FSHA 5DCMA 3N4MA 4CHUA 2XAGA 4P9FA 1Y0UA 2L4AA 2LF7A 1P6RA 3HIFA 3RI4A 1YW8A 1EH8A 5L3BA 2VXZA 2Q2EA 5LLQA 1YQAA 2Q0OA 1IRFA 2V6CA 3CUQC 5LGUA 4GCVA 1FBSA 1STZA 2EK5A
chains in the Genus database with same CATH superfamily
3Q0WA 1GN2A 1R3IC 1MDMB 1J2XA 2RQ6A 2EZIA 2D1VA 2L9SA 4A3DJ 2E1MC 5HS9A 3CRMA 2JGUA 5B5EZ 1WJBA 4DR2B 4LG0A 1QHTA 1N33B 2ZXHA 1Y8RB 1T5EA 3HKCA 1I5YA 2ADQB 4LF5B 2E2HJ 1MBJA 2R5YA 3Q9SA 4XLNF 2WA3A 4F4LA 1NH2D 3ZQIA 2YUSA 1N75A 1FBQA 1SD6A 1J75A 4XRSG 3JD4A 3HKZN 3QVNA 5EZYA 3QF7A 3H9JA 2BOBC 2QQ8A 3GVMA 4PELA 1TC3C 2E76B 2CFOA 4A3FJ 2FSWA 3ABMB 4ICGA 5B66C 1K5QA 5DS9A 2HLDG 1SFKA 2Z9OA 4R8HA 1PM9A 1I1SA 1V54H 1IURA 1SETA 2VC0A 1MMMA 5JVDA 3GXOA 4CCNA 2ZXJA 3A0BZ 1RZ4A 1HNXO 5IPAA 1DPRA 2RQQA 5JLWA 4U87A 1THZA 2M4KA 3F21A 2VQGA 4HDVA 3MVPA 4J19A 2HOSA 1KQSU 1D0XA 4CXFA 3G3ZA 4LF8B 3ECHA 1RKTA 4I02A 4DUYB 4ZYAA 1X2MA 3K4LA 1TUBB 1GXPA 2NNYA 4AUXA 2DK8A 4BBSJ 1S7EA 2FU4A 4MTFA 3RVYA 3W7TA 3OYFA 3CEIA 1V5GA 2V4DA 3K0GA 2LY9A 2LKPA 4QPOA 1UCRA 1P2FA 2WLLB 1PVEA 5FPOA 1U5TB 4B4CA 3B8MA 5TJJA 4WXCA 2QWNB 1HCRA 1NS1A 1GUUA 4UVAA 1Y76B 2E2JJ 5E1XA 4M3EA 4K8ZA 1V9PA 4XM3A 4Y15A 2A3SA 3O2PE 2XRNA 4A93J 3JCZA 3KKYA 4X66B 4JQFA 1U6GA 3S1NJ 1O57A 3RKYA 1O7LA 2KIQA 1S72I 1HKTA 3BVOA 3R65A 4A3LJ 3SYCA 2H8RA 4II2A 2VBWA 3CMAV 3GUDA 4AM3A 3LSJA 2QE7G 3U2RA 1BE3H 2AXTC 3HTSB 2XTAA 4JTAB 2JTVA 2EA2A 2JVDA 1MW7A 1V54B 3OYHA 1IRZA 1NTCA 3FB6C 3VEPA 1U96A 3G6EV 2D5VA 1MH4A 1GT0C 4ZKIA 1EH6A 1BN5A 2IEKA 2IS2A 4EV0A 2QKAA 3J80N 1TQPA 4X65B 4EFBA 5CVIA 1X1AA 3IUOA 3JRCA 1MJ9A 5CLSA 2HGCA 2K3PA 5F04A 4ZJZA 2VKVA 5E8IA 1H2SB 4X64O 1O3TA 2XB5A 5JR3A 4IL6Z 4HYOA 1S6LA 4EJVA 1UHSA 2E60A 4EVIA 1IX9A 4GKJB 2K27A 1WH7A 1OCZC 4CS4A 1GRJA 3OYAA 2UXCO 4RM3A 3HL2A 2VOOA 1JA8A 4YIOA 3THOA 4YHHO 1K6YA 4XLHA 5DD8A 1DF4A 2YUAA 1HW7A 2OT5A 1GN6A 1Z5WA 2AHQA 4CCMA 4P9UA 4OIRF 1QHHD 3K4JA 3PIOF 2EIKC 1AKHB 4P9PA 2VJIA 4TQDA 2HHHO 2LBFA 3RKWA 4CZZA 4I55A 3WB0A 2QM8A 5LRSA 4UV9A 5KAFZ 1JGSA 4DV2O 1QU7A 1FOYA 3RIRA 4EJWA 2IT0A 3C90A 1F4KA 1HDPA 2IAIA 3R0AA 2E1MB 3H9VA 4B3MO 4LFAB 2M7BA 3E6MA 5F1JA 1YIJI 1WWXA 3BR3A 5JVTA 5F0CA 4O3MA 4YG2F 1YF2A 5KHKA 2AZ0A 2OJED 2GUZA 1B4AA 3BZCA 1U0JA 3E0JB 3KP4A 4HNVA 1VQ4V 2G7UA 1KZHA 2JGDA 2W7NA 1ZR2A 3K58A 5EGOB 2IS6A 3D3IA 4B08A 2LNBA 4G7HF 2E5LO 1VQMV 1FMVA 4ESFA 2BHYA 1QZYA 3VOEA 3N2GB 3LSSA 1MKMA 5EEHA 3E8GA 4X88A 2CQQA 4FQGA 2IA0A 3JRDA 2YIDA 4IHVA 2ZE7A 2CTPA 3ISPA 2Y0SA 1XN7A 3LSGA 3PQKA 1J59A 3JATA 3HOYJ 1NKDA 4N9IA 2JS3A 2R9AA 2L54A 1KU3A 1QO0D 1FOKA 3C7JA 4ANJA 4MEYF 2Z3YA 1GDTA 3LWFA 4XQFA 3JD2A 2V9VA 3HB9A 1VQ5V 3JALB 2ZIMA 1F43A 2KKWA 4P2ZA 3B09A 1K3EA 2WLKA 3B77A 4NXMO 2GLOA 3I55V 1HBXG 4JYKA 3TMOA 3KP2A 2JS5A 3FDYA 5FKOA 1MMSA 4JASA 2WWYA 3K5LA 2IBDA 1R71A 3CMMA 3L2QA 5D5PA 1WFXA 2HPIA 4QPKA 5JJNB 4BW5A 2IS1A 1G6UA 4DRXB 4JI6B 3LSMA 1M1EB 3DKXA 3BEHA 1OCZH 4LNUA 4NC7A 3PO2J 4TOIA 4EB6B 3S3XA 2VQEB 2QENA 1RSOA 1PP7U 1J9IA 3OR6C 5IWAB 3R4KA 3E35A 5J8CA 3EETA 4BE1A 1SVLA 3S14J 1MZEA 3JD0A 1OYWA 1ZG3A 4HV6A 1T38A 1FC3A 5JLXA 3BJAA 2JUCA 4N23A 1PP8F 5LP6C 3JD3A 3LNQA 4RQFA 2DBBA 2HDDA 5JQGB 3CCLV 2EIKH 1KBHA 4PI2A 5HDNA 2OF7A 3JRBA 4AI8A 2GBYA 4CS3A 1N8RW 1ETWA 2MA3A 2X51A 2CTWA 3HM5A 5EG0A 1XMKA 1NU1H 1IXCA 2LDUA 4DZJA 1XTAA 3BQYA 1LUVA 1N32B 2DDAA 4QIWN 1XGNA 3I64A 4M3GA 5L3FA 1XPXA 1E79G 1YI2V 4R50A 1IBKO 1ETQA 4MGRA 3CWBH 3A4CA 1ON2A 4UUSB 4F3QA 2V1DA 3I4NJ 4DV6O 1TQMA 2ZNZA 3VYSB 3K79A 1GMGA 3FB5C 2BBYA 2V7FA 3T1HO 5EC1C 2BSKB 2UXDO 5KHGA 4XOPA 2A3QA 3LDDA 3OYCA 2QUFA 2QTOA 4UVCA 1NTZH 3LFUA 1X3ZB 3KX2A 1LB2A 3A8TA 1MBFA 2DCEA 4TV7A 2DXIA 3CCMV 4Q48A 3SPJA 3CCEV 2V1NA 4NB5A 2YC0A 3TXQA 4DW0A 2YDEA 3QWLA 4XICA 4JYCA 3L2UA 1EFRG 1GN3A 5A9GA 5J2TA 4XBFA 2CG4A 4N9HA 3TL4X 4CSWA 4DGWB 3JRFA 4JI1B 2HFEC 1WQ2A 2CRGA 2K86A 5D6EA 4S05A 2HYJA 3WTXC 1QLEC 3DTUB 3GLLA 4BEHB 5AIPA 5EZGA 1YJNI 1QBJA 3GTOJ 4I9WA 2ZKZA 3H92A 4LH6A 1R00A 4P96A 4A3GJ 3RW0A 3MQ0A 4HAMA 4B3RO 4ZTFA 1YITV 3ABTA 2LREA 3JSLA 3HRTA 3Q5FA 1WB8A 2ZE8A 4XLFA 2HVSA 1FYLA 3AL0C 5GAGJ 4F6EA 2EH3A 1LEAA 3R0JA 2ZB9A 5CVJA 5C3EJ 3QP6A 2ZJ2A 3OYEA 1VQNV 4X1YA 2EIMB 3CJTB 4N4OB 2MH9A 3BA8A 3IFXA 3W2VA 2CW8A 2V4JC 5BPDA 3UKGA 3M8EA 3QO8A 5CBHA 1I1GA 3CESA 3UM7A 3JASA 4ZIBA 1QLNA 3J7AU 1I7FA 1NK2P 4UNOA 3X2QC 4WK8F 4DV0O 3E3VA 2LO1A 2RKHA 3ETEA 1ZX3A 4DR7O 1T6SA 4M3FA 3CUQA 2W6IG 1ZWIC 2EJ7A 3SFZA 3EXAA 3I71A 3CJNA 4I50A 2JSPA 3W6VA 2CUZA 2P22C 4Z1VA 1Q1VA 1ZAUA 5KHIA 2JWTA 1E3OC 3WTWC 3K4BA 1FMWA 2VI6A 2WY8Q 1RR8C 1HDDC 1JMKC 4L5EA 3R6SA 1PUFB 3GFLA 2XROA 1HLVA 3T1CA 4MHGA 3IAM2 4DOZA 1VQ9V 3E97A 3OEEG 1A5JA 1NG7A 4FZ0A 2N8GA 4A5MA 5CJ9A 4XMYA 4HQEA 3I5DA 2KJCA 5JJEB 2JVGA 4QSHA 2L2OA 4LFUA 2CK3G 4H13B 1PNLA 2FJ1A 2EV5A 1BR4A 2EX3A 4QE9A 4E7IA 1DP3A 5B1NA 3BG6A 3DBHB 4FK5C 1AI6A 4WFGA 2FQ4A 1FLIA 4A0YA 3K6GA 3HOVJ 3QAHA 4NKGB 2CJJA 1VQ8I 2OTJV 4MW3A 2P5KA 4AYBA 3NAUA 3V7CA 3KZYA 1VQ6V 3ECOA 3OTFA 1DK1A 1OFCX 2Z33A 3CHXA 1W4MA 1UG2A 2HJDA 3T8TA 1S7AA 4FLVA 2JPBA 3ESWB 3ZQLA 4FPPA 1FPOA 1MIJA 1F9NA 4J7JA 3FYIB 3LSRA 1FY7A 1KQ0A 2MD0A 2ZXWC 5LMUO 1FP2A 1SESA 2A7WA 2JDIG 4TSFG 1H0MA 5K1XA 1T56A 1XMOO 4C30A 1JTYA 3WGIA 4EFEA 2K4JA 2OCHA 3FXKA 3SR2C 2EZKA 5JH7A 1I94B 1VQLI 1B1BA 2Q8VA 3L2VA 5LRRA 2L9RA 3K70D 2CH0A 4I2OA 4WWCA 3CO6C 5H2FZ 3RYCB 1TBXA 1RI7A 3HOSA 3BROA 3X2QH 1VEWA 5AIQA 2H3OA 3GYHX 2ZE6A 3GZNB 4U7BA 2MK3A 1BIAA 2F5EA 1OCCC 1ZLZA 1IUYA 4J10A 3CQZJ 3OIPA 2K9PA 4G7OF 1ZGJA 1MMGA 4YY3B 3MHSC 1YJ9I 2X6XA 2VC1A 1ZTRA 4BAYA 1GV5A 1D8JA 3VPRA 2IJJA 2JVHA 1IG7A 4NTXA 2MW2B 3TK1A 4DV4O 5J1YA 3CZ6A 3QO5A 1TT0A 5KMGB 2B7EA 1IBLO 3OS1A 1OJHA 2ECBA 3RPUA 1O9GA 2Q6AA 1GHCA 1XGOA 2D1HA 2DTZA 4OAZA 5DEQA 1H89C 4P30A 2Q1ZB 3FMSA 3QPTA 1R3JC 2Q69A 1OR7C 3QG5A 5CPRB 1Z6RA 3I4MJ 5C4XJ 2Y69C 4OPHA 3EUAA 3KP5A 1NTKH 1WNSA 4LWSB 3IH3A 3AL0B 3E83A 2IM9A 3ELKA 3CCVV 3M1EA 2WPDG 1Q5OA 2PTMA 5EJCA 1OCOC 3SYTA 4RLFA 2DFHA 4Q47A 2YI9A 3ZEDA 2UUAO 2DT5A 1RUNA 4D7NA 2GTAA 2P6TA 1FAFA 3HYIA 4Q5SF 2OIGA 1IJWC 2YU9J 1VQMI 1VF5B 1TZLA 2ZXWH 1EZJA 1X4PA 3X2QB 2ZKOA 1V55C 2HVQA 3ZQFA 2LY2A 4Q6GA 1ETVA 1VQKI 1HQCA 1N0JA 4IO9F 2NYXA 4NXNB 1WJZA 2A6EF 3OYGA 2HZDA 4BXXJ 4CC6A 4RAZA 1DUXC 1BS3A 3AG7A 3FKJA 4XLCA 3ERMA 2P90A 2H1LA 4P55A 1KC8W 5LHHA 2BTQA 1IZ3A 3FWEA 3RBZA 4LF4O 2L9VA 2A79B 3SZTA 1I6HJ 5CA1A 2K7LA 3GFMA 2Y0PA 4TUYB 2A9HA 4DUZO 2CSOA 2L0KA 4E7ZA 4F91B 4PGGA 2R7RA 1YRNB 1Z05A 1R1TA 2K85A 1OCCH 3WTUC 3C3SA 4FFBB 4JBAA 5KLVH 2L7FP 5LYJB 1REPC 4RUEA 1FJGB 1LVKA 1B3QA 3O65A 1FPQA 2LOOA 1M56B 2FL4A 3GF2A 4LIUA 2JT1A 3PO3J 2QDOA 4JI3O 3OR1C 4XKWA 1IRGA 3B6AA 3TP0A 4YRVA 3OR7C 2NAZA 1Z1DA 2I5UA 3FIWA 4HA8A 3S32A 3J81K 1XSDA 4W1UA 2KFDA 3FK7A 2FMLA 4GFBA 4HV5A 4JX5A 3MMYB 4IHJB 1I50J 2XIGA 2Y69H 3N27A 3H1IH 4MVMA 4OX9B 4DV5B 2JMWA 2EILC 2IP2A 2K9SA 1P7JA 3IL2A 5FL7G 4JI8B 3JAWB 4U0YA 2ZXWB 4ZC3A 2DO7A 3WU0A 3FMQA 3K04A 5HS8A 1WAZA 2RREA 1MNDA 4J80A 3CUOA 2PBIA 3NWSA 4B8XA 1OCOH 3CD6I 5CA3A 1LNWA 1G4DA 4MVSA 1R6TA 5IJ0A 5F27A 3BDDA 3SEZA 5IE9A 3K9SA 3OYJA 3DP7A 5KAIC 2ZMEA 1Q6IA 3NEUA 4BHBA 1ACIA 1YLFA 1HXDA 3JCUZ 5BMVB 1IN5A 2RCVA 2VN2A 4RB0A 5J2UA 1A31A 1V55H 2KJBA 5LP6A 1QVFU 1KU9A 4CH7A 4JV5B 3ZRSA 3GX4X 1XMQO 2JRMA 3DBRB 3ZR8X 3HJEA 2O9LA 2VQFO 2D3OW 1D3YA 5K7FA 1R3LC 3TO6A 2WAQA 2OQGA 1F7YA 4A3CJ 2PUSA 1IV6A 2YEVA 3NR7A 3RPQA 2CGPA 4HOBA 1HR0B 3M07A 2R9IA 2JEXA 1OYYA 2FOKA 3Q4HB 4CA0A 2EB7A 3BOQA 3VQXA 3OIOA 3CDHA 4I76A 1X1DA 1MZFA 2DWDC 1FX7A 2DMQA 2KZGA 4ZYEA 5KA6A 2XGXA 3LSKA 2IJLA 2L7MP 3GLXA 4C3HJ 4YELA 3LSTA 2PJRB 1XNRO 1SA0B 2ZDIC 1YITI 2R5ZB 2IH1C 1ZARA 1JGGA 1KP3A 3E1SA 4I7HA 2XSDC 4E7JA 1ZG1A 4D6TH 5LOVA 2M5WA 1ODDA 5CVRA 2BZTA 1R73A 4IJAA 3GWZA 2CU7A 4EJUA 3M8AA 4HX4A 3A0BC 2ATKC 3OMIB 2M3AA 1AU7A 2HEOA 2PF4E 3L74H 4JX4A 5K5RA 1IBMO 2F4VO 4U88A 1S7OA 2KDZA 2EILH 3HUGB 4KN7X 5ED4A 4X1KA 2ITCC 2B63J 1KU2A 1AI4A 2JSCA 1U97A 5KHHA 4XOTA 3N2KA 1V55B 1GM7A 2TRTA 4E2LA 2QEXV 4DNCA 3TJTA 2DWEC 1K5SA 1S29A 2WSSG 2QLZA 4M71A 4MVOA 2KRFA 3ZHQA 3BR6A 2F48A 3T0YA 2QSHX 1WJDA 2A0LA 2UUCB 4LB5A 3HKEB 3VQYA 3ABLC 3WG7B 4RMNA 4C9YA 2Q67A 1JUPA 4G28B 2GXBA 3E8HA 2IA1A 2NVXJ 3M8JA 2DOFA 1U8RA 1IXMA 2BGCA 2QKLB 2N04A 1V3FA 1JX9A 2ZINA 1WZ2A 2HWVA 2Y75A 3K06A 2JQ7A 2F2EA 3CC2V 5FLXK 1R6RA 4PJNA 3RYPA 4A6DA 1B8IA 3A2FA 4UCSA 4S0HB 3VDXA 2X6YA 3QYEA 1GVJA 3OSFA 3RKXA 3K59A 5BNGA 5J6XA 4XDKA 5FKKA 1FXKC 3CCQV 2CGNA 1CGPA 3C2GA 2B1IA 1FXVA 4KHPB 1YCIA 1LKXA 5DYMA 1FS0G 3ZMUA 5EZYB 2R4GA 4BDYA 1BC8C 1VQ7V 3DU5A 2F5VA 1S77D 4L5JA 3OTOB 4LF6B 2IPQX 1IRXA 4ZDPA 2Q5ZA 5B1OA 4PSWA 2OTJI 5DM6V 1XDUA 2AO9A 2CQKA 2H8PC 4RAIA 3CP1A 5JVDB 4I09A 2VKDA 4D7SA 3S1MJ 4LLNA 2OCEA 3MDSA 3J81Z 2JRIA 2EILB 2MG4A 1DTOA 2M2EA 1JKRC 3B8NA 4YJ3A 2QA4V 5FKLA 4P9OA 4DR1O 3K4MA 1HWYA 1MG1A 3F8NA 3RYIB 2TDXA 1HF0A 6PAXA 4D5CA 1TWAJ 2L7ZA 1JJOA 1WGXA 2PY5A 1LVAA 2KG7A 3OIQA 3I56I 3JAKB 4JTDB 3HB3B 2AZ2A 1YHQV 5IP7J 2WLMA 4MVQA 4DR4O 2XPWA 3MAJA 4KT6A 4CYCA 3T1BA 1O3QA 3GTQJ 3BZKA 4XLPF 1DU6A 3EFFK 3OUFA 3ZRVA 4B3SO 4UUJC 5CYVA 2OC6A 5J8FA 1KU7A 1PDNC 2O8KA 1KQ8A 1UB9A 5KAFC 3M99B 3M8FA 1J95A 2VJJA 2NVUB 3K70C 3CCSI 2B1GA 5LHGA 1U5TC 4DV1O 1GAXA 5IP9J 4B47A 4PA6A 1VF7A 3ABLH 2PG4A 4IRIA 4ENKA 3C18A 4XKVA 1N36O 3CE2A 4JI7O 1HNWO 2ELJA 3HKBB 2JA5J 2ZR3A 1X4TA 5IOYA 4Z1MG 3R61A 4O4IB 2A06H 2M9HA 4QGPA 3EYYA 4MIMA 5DUIA 5IYDJ 1HNXB 2HR3A 3HGGA 3D5SC 4RA2A 2FBHA 2LJ2A 5FO5A 2UUBO 3B02A 4TV8A 4PCQA 2IVMA 4BY1J 1ZYRF 2HTSA 1OV9A 1Y67A 1BGYH 2W84A 3IKVA 3L09A 4X20B 1S0VA 2DN9A 4GKKO 1WRJA 2B9SA 5CB4A 5GONB 5ITZB 5LGNA 1RR7A 2IBZH 3ETQA 4JYAO 1KKDA 2A05A 5J3LA 4FASD 4RUFA 1S76D 2DT6A 4HRIA 4RGUA 2E35A 4IHSA 2X9DA 1ITYA 1Q90D 2D2CB 1G3WA 4HF2A 1RFYA 4ZOLA 2OYQA 1P92A 4DR3O 3V8JA 2DYSC 5CA0B 5L3GA 1M5IA 2JJ7A 2PMZA 2DA2A 2EJRA 2ADUA 1FYJA 1T0FC 2CTRA 2M1BA 4IYIA 3CJHB 3BT9A 4WXHA 3DPUA 3TOBA 1SF9A 4FLXA 3QPLA 4I9QA 2LBFB 4LB6B 4I55B 2P7CB 2CMPA 2HKOA 3DPLC 1ZKGA 5FFXA 1D5VA 1M4UA 2M45A 1Z7UA 2JK5C 3W2AA 4O4LB 3S3WA 3HHHA 2KKOA 4FHTA 5IJ9A 3KZIC 2XC7A 1FBUA 3F3XA 2HYGD 4R7CA 3W7SA 1TW2A 4KA4A 2JGDB 1OYIA 1BI3A 1H8EG 1HNZB 3WU2Z 1FXKB 4UCUA 3L9DA 4L9NA 4X64B 3DEUA 5FLXZ 1Y6IA 5A2QK 2XNDG 2VT2A 3EUHC 2ME6A 5KHJA 1NT2B 4MW8A 3T4DA 3U0ZA 2E19A 2WAFA 1EM1A 2UXCB 1WI9A 1HA8A 2AS5F 3U9GA 2EZPA 1TVKB 2EPFA 2E1CA 1JCHA 4FM2A 2PI4A 2FMYA 2PQ8A 4XN0A 5IDJA 5FGMA 1SAUA 3RFRA 1K73W 4BUPA 3RYHA 4GUNA 1MNMC 1XBLA 1K4CC 3CF2A 4M72A 2HQ5A 3SXYA 1XD7A 2GQQA 4A12A 1BR1A 2O6GE 4TV9B 2A68F 2M7AA 1AI5A 4BIZA 2HHHB 2F95B 3ABUA 3NQOA 2FBKA 3MZ8A 3S2DJ 4DK1A 4DV2B 3HOWJ 2XOKG 4YJ2A 2BXZA 1ZLJA 2NXNB 5E20A 4OXSA 1DPUA 2XGEA 3FKIJ 2FNAA 2Q4PA 1DGWY 3BLYA 4B3MB 2RDPA 2HPMA 2JA6J 2Y2ZA 3VSLA 2HTJA 2HQRA 2DYSH 2Y48A 2W82A 2RV8A 4Y13A 2P8TA 3OEHG 1BL0A 3J81N 2I10A 3OWTA 2HOTA 2KIMA 2E5LB 3JSPA 2ZM6O 1KQ9A 1W7PB 3OYKA 3V7SA 1OCPA 3JSNA 3JRGA 2DTRA 2XF7A 2Z99A 3P32A 4NQWB 2EZOA 1BMFG 2HXOA 5ILUA 1QBZA 5LXTA 1Z3XA 2R7SA 1PUEE 1F4NA 2QJ1A 3ASNB 1NHAA 4IOAF 1XNQO 2KT0A 3IWFA 4JYYA 1K6OA 2MH2A 3VFZA 2DMXA 2LW1A 4KT5C 1P4RA 2MGQA 3K9TA 3S8PA 1ERDA 2OPTA 4J11A 1YTYA 3MZYA 2XVCA 1UHWA 3UR3C 4UCVA 3QODA 1WI3A 2W85A 2VE9A 1CQTA 2QWOB 1LFPA 1HKSA 1TW3A 2Y4UA 4UVBA 4O4JB 3LOCA 3T1YO 2CTQA 2HFHA 2HU9A 5L3CA 3FX7A 1FSEA 1T98A 1EF4A 5CKTA 1FTZA 1ZL8B 2Q8KA 5H20A 3F5WC 3HPHA 4NUBA 4WCEV 2H8WA 3D1NI 2PMUA 1P4AA 2KDOA 2WB1A 4A3BJ 1EJ9A 3FHNA 3U1KA 4ZYGA 3AEIA 2CAZC 2Y0IA 5HLHA 4HW0A 3Q0UA 4TQFA 2FBIA 1HDJA 4FLWA 2MYSA 4PZJA 4G94A 2DYSB 5J2TB 2KQXA 4I0AA 1ONVA 3L7WA 3OAAG 4Z2WA 4DBRA 4BJ6C 1ETYA 4E7HA 3W3CA 1AROP 3FK6A 2XGCA 4ZDOA 5IY5B 4NDLA 4R1HA 2ZC2A 3E22A 2AQEA 2JN6A 2R7QA 5HLIA 1JE8A 1MA1A 2QEXI 3UT5A 1IZ1A 3KEOA 1JHFA 4U0VA 2BE5F 1Z3YA 3H1KH 4JAUA 4KP4A 4PDMA 4ZHQA 3HSRA 2QKMB 1IBKB 2JJ2G 5E8GA 4ZI7B 4NR1A 3RDIA 2RJZA 3ZRWB 4DR2O 2RNJA 1AP6A 3P9KA 2C2AA 5E79C 4N0BA 2YIBD 1MBEA 4RB2C 5C8YA 5TISZ 1L0OC 2NNNA 4M3DA 2XAUA 2AGAA 5GTHZ 4DV6B 3KYLA 3T1HB 2GWRA 3F8MA 3ABKC 4LMYA 1K4TA 3J7AY 3CC2I 2QF7A 3W6JB 1W36D 1F5TA 1H2LA 1J7KA 1SQBH 4PDVA 2HXIA 4J7ZA 1FYMA 4BKXA 2EIMC 4HLYA 2W0FC 3T8RA 3V42A 4ASNA 1W5CC 2K02A 2KIFA 1VQ7I 2VXDA 3PQJA 1XGMA 2E7XA 2O7OA 1Z67A 4CCKA 5H2FC 5A2QZ 1Y1WJ 1FFXB 4Y33A 5HNHA 2GM4A 1NTMH 4X62O 3L2RA 4HZFA 3VQVA 5TRDA 2IJKA 3K08A 1WA8A 2DA1A 4WX9A 5J9PC 5D5WB 3D8CA 2DDBA 4DYQA 3WTVC 3KCCA 2X1EA 2VS0A 3DLLF 4B3RB 1D0YA 3OMNB 5KX5A 2OZ6A 3LQRA 5FLXN 1R9TJ 2LH9A 1XDSA 4LF8O 4BYYA 1PNKA 4Y52J 4G6QA 4DUYO 3OUSA 2ISYA 2ID6A 3TO9A 4AD9A 4BL0B 3KLOA 3CCUI 4DW6A 2J5PA 4ABZA 1RP3B 4LCUC 1Q7YW 2AQFA 3SJMA 2KIUA 2HZTA 2MC4A 2Y0MA 2X7RB 4LD5A 3GTMJ 3G80A 5FPRA 1YHQI 2V6EA 1Q3EA 2ZR2A 2RVCA 1QNTA 1XEQA 4LF9O 2L5QA 2H6BA 5ILVA 3PL8A 1W0TA 2MBFA 4KL1A 3GZ6A 4CCLA 4HG2A 2PYLA 3LMMA 5LA6A 1BOBA 3A03A 4Z6YA 4A2UA 4XSXF 3GTGJ 3WB2A 1BI1A 1ORQC 4DV0B 4NTYA 1HOMA 2LK2A 4PFOA 2CH7B 3CRCA 4DR7B 4KITB 1ETXA 1S8NA 3ASOC 1WJAA 1J5EB 3KZIZ 3G4SI 3BG7A 4HNAB 1VF6C 1H88C 2O5RA 1APLC 2ARHA 3RZOJ 1Z0XA 2WA4A 2VPRA 2WY7Q 2OWOA 4EJTA 2Q7HA 4N4NB 3CMYA 4YFXF 3ABKH 4IHYA 2UU9O 4HNUA 3CO7C 1Z7LA 1MOFA 4IGGA 3GFIA 3PN1A 1ZHFA 1FIAA 2XHBA 2EIMH 3HGYA 5IYCO 1X59A 3CDIA 1SC7A 1O3SA 1TUBA 3PFYA 2P06A 5FJ8J 1LUWA 4XRSA 3QPSA 1R36A 1PD3A 4PDRA 2CFXA 4U3JB 1Q6HA 5IYZA 4UCRA 4BIUA 4KISA 1P4XA 1GTOA 3ONQA 3PJRA 2JA7J 2WLLA 3I54A 2R7OA 4I5SA 3RWRD 3KPHA 1U5TA 4QE7A 1XHXA 1FTTA 3SPCA 4JI0O 3ZBHA 1Y76A 1COWG 3T5XA 1L3LA 3DFGA 3BR5A 2YX7A 2MFZA 2NVYJ 2YPRA 5E1WA 3JTGA 1D5NA 1PV0A 2QGNA 3KFWX 3KG2A 5GAHJ 1P7IA 4LFCB 3A01B 5FRMA 2FEZA 4BQQA 1LUJB 3DC6A 2Q7EA 3AK2A 2O8XA 2F4IA 2Y0SN 2VKEA 1RPRA 3S17J 2C6YA 2NN4A 5B1BB 3I58A 5ICCA 2OD5A 1YFHA 1P7BA 1BI2A 2PFBA 1PPJH 1R1BA 4MVRA 1SERA 1I3AA 3V7RA 1SMTA 2LY1A 3CJQB 3WHCA 3CC4V 4BE0A 4PJJA 1XMOB 1B9MA 5H5NA 2EWNA 2DPDA 4FX4A 2EV6A 1IN4A 3CX5F 4JK1X 4LFAO 3K9AA 1G8XA 3UO2A 1RUOA 1XI1A 5LHIA 1QVTA 1Z6TA 1SS3A 2RC4A 5BZBA 1XCBA 3CC7I 3WU1B 1CP9A 2ESNA 3P9CA 5L3DA 1Q43A 4JAVA 4U7OA 3DKWA 1EN4A 3EDPA 3ABKB 1KP2A 3JD1A 1W5TA 4GLXA 1YO5C 4AIDA 4JI2B 3AG3B 5LEJA 2V1UA 2KB1A 3ASOH 2VPLA 1VQPV 1LDKB 3BCAA 2BVMA 3K4KA 1JJ8C 3H1LH 3JARB 3CXCU 4L8JA 4KIBA 3B73A 3P3PA 3CPWU 3HOZJ 1MJAA 2GV9A 2IRFG 1LE8B 1FOWA 3RQIA 3U1DA 3TQNA 3CF5F 2JUGA 3BPZA 2JA8J 1AP5A 2QSAA 1H9GA 3HSEA 3WB1A 2EFNA 3HTUA 2X6AA 1IBLB 3HRUA 3JCUC 3K1PA 2MLGA 5IYBJ 1PYVA 5BQTA 2ZNIA 1XMAA 2W4SA 1AKHA 2CYYA 3QOPA 1WJFA 1K78B 4I6ZA 2V79A 1Y8QB 3H35A 4IQJA 4X8AA 5B3SC 1N78A 3A0RA 4A3MJ 3I59A 1VP7A 5LGTA 1ZH5A 2G9WA 4KIGA 5CA1B 2E34A 1K7DA 3CRAA 4H33A 1RM1C 2XHKA 4RDUA 4E6KG 5CBGA 3QOEA 4GX1A 3BQZA 1TQIA 2DOEA 2E5ZA 2DJVA 5IYDO 1UELB 4IXAA 4WCGA 5A2QN 4KIFA 2X0LA 1K83J 3EUHA 4I4TB 4ZYDA 2DW4A 1ORKA 2P6SA 4B48A 5EGOA 3IV5A 3OSGA 3DXRB 4TWKA 3FXMA 3VSKA 1Y66A 2X6OA 2Z2SB 1M56C 3D36C 2Q9LA 3N2GA 2LW7A 5EK0A 2YSUB 1NVPB 4GDFA 2FUG2 3OM3B 2LKXA 2ICWG 4C2MJ 1JFFB 1G3TA 3HRMA 1QR9A 2DQ0A 4OPAA 3V8LA 3ZX6A 2QKCA 4O2BB 4XKBA 2GBOA 5L3EA 4Q4ZF 1G3SA 3JW4A 1D1AA 1CF7B 1JR9A 2HVJC 3ASOB 2BXYA 5CVUA 5FNVB 3RYFB 4BQAA 1VQOV 3JALA 1SD7A 3TXSA 3C1DA 3APQA 1Y74B 5DM6F 3OW2U 4CGZA 5DEDA 3CP8A 1VTNC 3OY9A 4LF4B 2QYOA 1YW7A 1BSMA 3OD4A 4CBCA 5IJ0B 2XUBA 4CUGA 3OYNA 4BH9A 2QGUA 1TL8A 1IV8A 4XDLA 4DUZB 1K33A 1VQ4I 3CMAI 2V26A 1QZZA 1W7PD 9ANTA 1K97A 1SRYA 4PA9A 4DRXA 1KYZA 3W7XA 4BHCA 1YX5A 2VBZA 1W1WE 1NK3P 2NR5A 5JFRA 3MD0A 4LJZF 1DLBA 1FEXA 1OZ0A 1R5GA 4EB6A 1FP1D 3V8KA 3JTHA 2LSOA 3IRRA 3K5OA 2KPMA 3KZZA 4J42A 1IO2A 2K40A 2X1DA 3DEWA 1R1VA 3G6EI 4MTOA 4JI3B 4NVPA 4RQEA 1OKRA 3VYRB 1H8AC 1H2KA 3CDLA 2I8DA 3EPZA 1Q6UA 4LF7O 4O6JA 3UO3A 5JQGA 1R5ID 3QQAA 1Z9CA 3CLOA 5DM7F 2YU3A 5C44J 2F5DA 3STLC 2VQLA 1GN4A 3WE2A 5B3SH 2EFWA 2IXSA 1VNDA 2WAEA 2WLIB 4PI0A 2FA5A 1KMIZ 3H1HH 4D0PA 4L9TA 4HBLA 1IN6A 1SFXA 4WFEA 2NS0A 3FISA 4DR5O 4LIVA 1SFEA 5BY1A 5JJJB 3BTCA 1HSTA 1QVUA 4UUSA 1NR7A 5CBFA 2EV0A 2P81A 1I6XA 3K0LA 3AFHA 2VODA 1TP4A 1MABG 1D5AA 1BI0A 3COAC 1ZR4A 1WCMJ 3IJ4A 3S1RJ 1DU0A 4MFDA 4I0BA 4EKWA 2UXBO 3U10A 2QBYB 3ZQCA 5JCOC 5FKNA 1Y6XA 4XK4A 4F55A 5JWPA 4B3TB 1MMDA 2VQHA 4IHWA 2DQRA 1IW7F 1XQ8A 3GTLJ 2ELKA 1XMQB 2HS5A 1K92A 2J5OA 2ZFUA 2CE4A 2Y4TA 3FM3A 1ZAOA 4WBNB 2VQFB 4I98B 3ICXA 5FFZA 3KCYA 2WV0A 1YE9A 4UV8A 2ELHA 2Q0OC 3D5RC 3N2KB 2KMUA 3SYOA 5GW7A 3CRRA 4AYBN 1UHMA 3KYCB 5EEGA 3WGHA 4BEHA 2LP0A 1W36C 1YEWA 1AWCA 3AG2B 4IRHA 1ZRFA 1EKEA 4UHTA 3BR0A 1JKPC 4XORA 2DA6A 2A61A 5DD4A 1LQ1A 2KL4A 3TOAA 4V2FA 1N77A 4DV3O 1Q1HA 5HVQC 1MNEA 2W00A 3FXRA 4UCTA 5B3SB 1FJLA 3WG7C 1XNRB 2D2WA 1DF5A 4E7KA 3QPHA 1RM1B 2XSJC 1WKMA 2ZCWA 1VQ5I 3RVZA 1DDNA 3H1CA 5K7HA 1B8IB 3RTRA 1TWHJ 3ZJZA 3OYIA 1GV2A 1FIPA 1XGSA 4GZRB 4W4LA 3I55I 1KYWA 1EH7A 1EV7A 1Z5VA 2YSRA 1BCCH 5HFLA 4H0EA 3E2EA 5BR8O 4BE2A 1QZEA 4HSTA 4FETA 2HVRA 2STTA 1P4WA 4JI4O 2VL8A 3G2BA 2EZHA 2K4BA 2W25A 1IBMB 1Y1VJ 1XOUA 2F4VB 4BU2A 1B72A 1UMQA 3H3ZA 3FAVB 3CXHF 3OYBA 2WA0A 5HODA 5EYPB 4PFPA 1BJZA 1B6QA 1OJLA 2EIJC 3LAJA 2P67A 1R58A 3AG1C 3L9FA 4XNFA 3EVKA 1BW6A 4QTRA 5EYRA 5BS6A 1AB3A 2F43G 1M93A 2HOAA 4QPQA 2JZYA 2R7ZJ 2XF6A 2W1OA 4X6AJ 3CCLI 1I94O 1UZCA 5DCFA 4A6EA 2DYRC 2GAUA 1PUFA 5DV5A 2X85A 3GTKJ 2EBIA 1AJQA 1TT5B 3H5NA 3SPIA 1ZK8A 3KP6A 3FXLA 4Y4RA 5BPIA 5J1RA 2KG7B 4C3IJ 4LK0F 4EEFG 4ENNA 2FB5A 3CB2A 2IA2A 1ZQ3P 3F7VC 2GIVA 3ML6A 3RZDJ 1AR1B 4MLOA 4I0XB 4O4HB 3HR0A 3QNEA 4LH7A 1YI2I 1R3KC 3I4PA 2PGGA 3VYUB 2FF4A 3OGIB 5E3MA 2LLKA 3RT3C 1RETA 2L3DA 2VJ4A 4IX7A 3PUBA 4J9YB 5GADJ 1RC9A 3QYFA 1Q8IA 3H0DA 4YY3O 2QWRB 2IGOA 2BHZA 3BP8A 1YOVB 1U2WA 3IC7A 1BL8A 1OCRC 5GAEJ 1Z91A 2VWJA 3NXSA 1QGPA 4G2KA 4AC0A 2LFSA 3WG7H 5GTIC 3CCMI 2CUJA 1I39A 2Z1DA 1ZRDA 1O7FA 3CCEI 3FYEB 2R7DA 4GX2A 4IIJB 1S5LZ 1L1FA 3WU2C 3P3NA 3FMRA 3GBGA 2PN6A 4AU7A 3OYLA 1QQCA 2G38A 2VRZA 3K0DA 2HOEA 3DLAA 4RAFA 1E1QG 4PA7A 5B1AB 1G3YA 4DR6O 1TLHB 1NI8A 5LMNB 5E1AC 4HF1A 3RYCA 1VF9A 5DCMB 4PV1B 4A0XA 5D8LB 5IOZA 1ZREA 2LTPA 2GXAA 4OMYA 1WPKA 5ILSA 4E4HA 1KA8A 4L5IA 4B3AA 1ENHA 4Q20A 2R92J 3HG9A 3QTCA 3ZQ7A 4QIWF 1YW9A 2CW0F 3PIPF 3SYQA 1OCTC 4B3SB 2HDCA 2QM3A 3DF8A 2XAJA 5F0FA 3E8BA 3RPUD 1PJRA 2F66C 1KKCA 3OE7G 3TDUC 4V2GA 2AXLA 3ZQHA 3QU6A 4LFBO 1MBHA 3SJQC 3HBLA 1F1ZA 2E2IJ 2R7UA 2UXNA 2GXGA 1VQNI 3CRQA 1VQPI 2Q2EB 2DYRH 4OAYA 1GKFA 3OS0A 3DTIA 2JA2A 5KMGA 1USTA 2VWKA 5E18F 2F1MA 4IF4A 1N25A 1AVMA 2Z16A 4A3KJ 2P5LC 2R7VA 4L0YB 4ETSA 4N21A 1U9OA 4HYEA 1CXZB 3BFRA 4O2AB 3K10A 2VB6A 1EN5A 4MQVA 2CDYA 3L73H 5M5YJ 4K0KB 2ETNA 4LWSA 5IJ9B 1SD5A 3HEFA 2KP6A 4DV7O 4B1RA 4C3JJ 2UUZA 4MTEA 5HLTA 3GW2A 3VWBA 1NH3A 1P49A 5CMUA 4GKKB 3TW7A 1D2DA 2ZJPF 4ZBMA 2DFFA 2NOJB 3I3LA 1TNSA 1SVMA 3HOXJ 5EF6A 1ZG5A 4LG0B 1S5HC 3HKCB 4JYAB 2L02A 1OCRH 1JKQC 2V1XA 1VQ9I 2ILMA 4FLTA 3PNVA 1QNMA 1SEUA 2R5YB 4HSRA 3P5JA 4DR3B 4EGYA 3ZHSA 3H5RA 2IH3C 3IC9A 5F2VO 2R7XA 4R6ZA 2P7TC 2EIJB 3AG1B 1JI8A 4OX9O 2FNPA 1TNTA 3K69A 4G6DA 3S2WA 3JSOA 2ZJRF 1D0ZA 2WAQN 1FD9A 1W2BU 2VQCA 5D4SA 4JI5O 2NLJC 1HSJA 2LD5A 4XRMA 4CH4A 2R3SA 5LL6Y 4JI8O 2PZSA 1X1BA 3MKZA 4PSXA 1VQ6I 2MW8A 2ZXIA 3DC5A 3HPLC 4AWXB 4AQYO 2VKHA 2DYRB 1VQOI 2VASA 1YIJV 2EINC 2LC2A 3DPTA 1FXHA 3MHHC 2DA4A 1U3EM 4MT8A 4E4EA 4TUYA 3JAMN 3OFNG 2ADPA 1YRNA 4OIQF 5FROA 1ETOA 1NVPD 4FFBA 1Y39A 1LEBA 3ZCOA 2UXXA 3W2WA 2E3CA 1N34O 1H2NA 1UPGA 5F6FA 4YIPA 4XIDA 2G0EA 4F7ZA 3RCOA 2OA4A 4WXDA 4F6RA 1AI7A 2QWQB 3IP4B 3IH2A 2G7HA 2RGVA 1T08B 4H4KC 3TP3A 5FRNA 3HKDA 3PNYA 2MSYA 2QQ9A 2DLLA 2GOMA 3M1CA 2CQ7A 4I99C 2DQ3A 1WP8A 2KISA 3FXUA 4OWRB 4R79A 5E17F 2QKSA 4YFNF 4IHJA 5TISC 2IJHA 4LG3A 1IVSA 1E3HA 1OCRB 3ERED 5GTHC 2A6HF 1EN6A 3R60A 1QCEA 3M3YJ 1HR0O 3ASNC 1M1KW 5K1PA 4MTDA 3I5UA 3DGEA 3JAWA 1QHGA 3DBLB 4A5NA 3L2CA 1BQZA 4AILC 1XL4A 3G6BA 2A07F 1T8IA 1S5JA 1ZELA 2X48A 3M4OJ 1JUMA 3O8HA 4L87A 2OQRA 3D3QA 3UQ8A 4RB1A 3ZS8C 2O03A 5BMVA 3WHBA 5TGTA 5HDKA 1M90W 5EDNA 4B09A 4CDGA 3Q9VA 4P5OA 3LNNA 4FM1A 4GYCB 1LFBA 3HKZA 2NOGA 4M9SA 2PEXA 3S3MA 4LK1F 3T2MA 4FFKA 4IHTA 1B6AA 2BTOA 4LC1A 1K79A 3CCVI 2ZM6B 5JI6A 4L9JA 3M9AA 3GWKC 2YR2A 1QVGU 1R6KA 2XKOA 5FB2A 1SKVA 2OUMA 1N0NA 3MAQA 1O3RA 2W6JG 3OT7A 4XLEA 2O3FA 5CQEA 3SYPA 1XNQB 4K8XA 2N74A 4Y7NJ 3ZN0A 4H0LB 2DT7B 1ZGWA 3KYDB 3HOTA 3Q4HA 2UUCO 1ON1A 5IY5C 3K57A 3DU6A 2R7FA 4GRIA 3SDGA 1R6NA 4UY8I 1OR7A 5C93A 2ZNYA 2PJRA 3FBNB 1LJ9A 3T1YB 2DQLA 1SA0A 2YIAA 3KCXA 3BTJA 1DGRM 4PGHA 1Y56A 4GYGA 4UUTA 1QRYA 3L1PA 2R5ZA 3KP7A 3ZP5A 1MZBA 4FTHA 2VUMJ 5C8YB 4WF9V 4A5UB 4HEA2 1GVDA 4K3AA 1UFMA 1BM9A 3GTJJ 2WLJA 4YIIA 2GUZB 1F51A 2ZT9B 2P7VB 5GTIZ 2DJIA 1IDYA 1MMAA 1XCVA 1K9MW 4QWQA 2DK5A 3ASNH 3FBIB 1MBGA 3HUGA 3FFQA 1WJ5A 1A36A 3U11A 1YJNV 3DCFA 1K34A 3CCJV 1SZTA 2DOAA 4LGWA 1T2KA 1PL4A 2RN9A 3S93A 4X9QA 3A0HZ 3K2AA 4IKFA 3FM5A 2LRDA 2B5UA 3JATB 2XT9A 3HPGA 4FE4A 1JHHA 3DKYA 4IZZA 3KE2A 4MTGA 3HKEA 4YHHB 1J0RA 4B3XA 3O3KA 3APOA 4QNHB 1V5FA 2FQ3A 1M9NA 5KX5B 2QWPB 1ZGAA 4WFFA 2DA3A 1SMYF 2K9LA 3BR1A 2PLYA 3B40A 4HZ3A 4UXNA 2EINB 3LUTB 3GZ5A 5ERIA 1KGSA 4A3EJ 2ODMA 4KFMA 1PL0A 2V7QG 3KP3A 4HF0A 2P5VA 4DXWA 5HLGA 1YX3A 4D9JA 3W7WA 2XF5A 3FXQA 1L8DA 4RO2A 3G1OA 3CTAA 2CW7A 4XSZF 4AIKA 2XB0X 2GA1A 5D6FA 1GK9A 4LNUB 4B43A 4IT5A 4I7ZB 4X1IA 5LA6B 3LDEA 3ETGA 1XL6A 5EZHA 1RSOB 1FZPB 3MEXA 1TUEB 2ZCEA 2KHMA 2FRHA 5F0HA 4J41A 4OOIA 5IY5H 3TDZC 1RIOH 4V19K 2KSDA 2M4GA 2FTKA 3WTZA 3WTYC 5IT9Z 1ROPA 3LA7A 2IGMA 1NG6A 4D1QA 4W4KA 2L4MA 4M9ZA 4BS9A 4X62B 3LSQA 1E17A 2QSFX 4FT8A 3SFIA 5D5VB 2VIXA 4O5VA 4RS8A 2PMZN 4Z2YA 4FLYA 1XSXA 4G12A 4X1EA 5EG0B 2BY1A 2HNHA 3RYIA 1USSA 4UB6Z 1HP8A 3F8BA 2Y9YA 4OIOF 1WN7A 3WTSC 3JAKA 4DYLA 5K1YA 3SDBA 2Y30A 4XKCA 4PJ0Z 1TTYA 3SZGA 3F22A 3PNTA 2F93B 5IYZB 4UB8C 1W0KG 2FX0A 2GIZA 1VQ8V 1WVRA 1E1RG 3ZIAG 1GH6A 5CVVA 1JT0A 2BW3A 4P1WA 4LF9B 1PP9H 3WE3A 3IH4A 3E5UA 4ITVA 3CP2A 3MFKA 1SQPH 1M57C 4JP0A 2LG4A 5HOOA 1BA5A 5EBMC 3KEYA 3A1YA 3ZMSA 2X4HA 1X1PA 4AIJA 1X58A 3H0GJ 4A69C 1ZRCA 3AG4C 3K03A 2OTLV 3ZMZA 1XSVA 2DMNA 2JIZG 4IRGA 1D8KA 1VFCA 1B9NA 2LP7A 3HKBA 4CC5A 4DYRA 2Z5UA 2HQAA 1ZN2A 2HYFA 4XONA 5GPCA 1U8BA 3CYOA 4O4IA 2QCOA 1X3WB 3BY6A 3E5QA 3OOPA 1WSUA 5B1BC 3F6VA 1K4SA 3OR2C 4B7EA 3VOUA 3G71V 1VQLV 1MMNA 4XRFA 1H9TA 4NHJA 3WG9A 5F1RA 3TEDA 1U78A 1RPOA 3AK1A 4GX5A 4KFCA 2UU9B 1B06A 4L0ZB 1JPXA 3ETDA 5HS7A 5H9CA 2ZDIA 2BOLA 4J01A 1X19A 4X20A 3D0SA 1JQ0A 2FOWA 1D1CA 4D5FA 1XHZA 2L35A 4KJZA 1YTFB 5ITZA 5GONA 1HNZO 1N33O 4UUVA 4MVZA 1BBYA 3ZMTA 3DSQA 1BHBA 3S1QJ 4YXWG 2L01A 4LF5O 3T4ZA 2CQNA 1JUSA 1OQYA 2F5FA 2MABA 4BGDA 3WFVA 4X1YB 3CJRB 3ZRXA 1K4DC 1YJ9V 3P7NA 4NXMB 2YXLA 2UXDB 4GYIA 3ZRGA 1VZ0A 3TW6A 4JI0B 1YG2A 4PD4F 3P9IA 5KNLA 5KK1A 3AG3C 3BJ6A 1JVMA 5CA0A 3JASB 2Y9ZA 2F4OB 1QQIA 3CCQI 4U7DA 5J47A 2DN0A 2QWWA 2YICA 2GZWA 2VT3A 2QTSA 4KICA 1YSCA 4CYDA 1BOAA 1UG0A 2ZO4A 4DIQA 4L18B 3CJHA 3CUQB 5KCMA 1LDDA 2GHYA 3VBBA 1TA8A 2KLOA 4Y17A 4I50B 5M3FJ 4D7TA 4IOCF 4JGSA 1DQUA 2HKXA 3I59B 4BDZA 1I3QJ 2CWEA 4O4LA 3JRIA 2B9ZA 1MDMA 2DPUA 1Y0NA 5D5XB 3J7AO 3DV8A 2V9KA 2P4VA 3NWTA 2ISZA 2A6TA 5LFAA 2K1EA 1ZTEA 3I0TA 2QA4I 1ZLKA 5D5QA 1IN7A 3C3WA 2CV2A 3GVAA 2XASA 3AG4H 3GEZA 1TWFJ 3ZOBA 1FXKA 4J00A 1A04A 5DUKA 4PA3A 4BY7J 3NARA 2H27A 2R70A 4UCOA 2WB1N 2WADA 2H94A 4CO8A 1QA6A 3G67A 4H37A 3B4SA 3DXJF 3BAAA 1K61A 1VQKV 1RPWA 3FF5A 2DFIA 5B1BH 3ZGKA 2KRHA 3BWGA 1BR2A 4BXUA 1EA3A 5FLVA 1TVKA 2Q7GA 2P0WA 3R66A 2NVQJ 4AHCA 3F6OA 1XDCA 4M74A 4B3TO 3TBIA 1SAXA 2DAOA 1XMXA 4YIRX 3H3VK 4X66O 3PFIA 2DU9A 4BJTA 1R4NB 1EZVH 3SJAC 1B04A 3EHBB 4TV9A 4ASUG 1X2NA 4RAYA 3RQ4A 2M87A 1O9HA 1VMGA 1FNNA 2M0MA 2BY0A 2BY3A 3IHUA 5FKMA 2LMDA 3BPVA 4EM0B 2CUFA 5F08A 3E6BA 4JYBA 3JREA 5EBWC 4FVMA 3F7YC 4QPJA 2NNUA 5BXZA 3I9V2 3S16J 3K4NA 5JH7B 2RQPA 1D5YA 1YIOA 3C2BA 3LQQA 2XAHA 5JHUA 3ZHTA 1E0EA 2V9PA 3H9QA 3OYDA 4EGZA 2R9RB 5IT3A 3ML0A 5BMZA 1WP7A 2M8EA 3AG3H 1T39A 5AG2A 5IT9N 4X65O 3L2WA 2ZMEC 2E1NA 2HI3A 2WV1A 3G1LA 3GFJA 2RDCA 3L75H 1CEZA 2QQAA 4KYWA 1P7GA 1B59A 1G2HA 1W7PA 4MEXF 3A02A 3TKYA 2UWMA 2M7WA 4PDLA 2OBPA 5KHDA 3I53A 2LGQA 1M57B 4NQWA 2BVLA 4U0WA 3SQNA 1YJWV 1JTXA 4GKJO 2W48A 2XPUA 5FLMJ 3MCZA 4G8XA 5J4VA 3S3OA 3AG4B 3CCRV 3LNMB 4K2EA 2GOXB 4KDPA 2JRTA 4HQMA 1A35A 1S3JA 1POGA 3KEQA 2M30A 4L9VA 5KUMA 3CD6V 1KD1W 1NQTA 3VB2A 2WTEA 4HLXA 2ZSIB 1IF1A 3FKSG 3GCMA 4IVNA 1GM9A 2P5OA 4O4JA 3ZCCA 3LFKA 1KYOF 5LMUB 1OMIA 2XAFA 3LDCA 3VQWA 4ZDLA 1ZL8A 2UUAB 3E8FA 3E5XA 1I0HA 4GCZA 3HSFA 2A69F 5B66Z 4RBOA 2X6CA 1KUQA 4IQ4A 4WF2A 4FLZA 4MNUA 2COMA 2DFEA 5EEAA 5EC2C 4CH3A 4RB3C 2MC3A 1URFA 3F5TA 4ZZLA 2R0QC 2M6YA 4M9XA 1FKAO 2XUMA 3H01A 2B0LA 3DTEA 2K5CA 2LFBA 3LA3A 4GXOA 1IAWA 1AR4A 1KB9F 1W59A 4WFHA 1QPMA 3SZPA 3ZPLA 2RNGA 1OCZB 3CSXA 4LF7B 1MJBA 3SJBC 4W97A 2BV6A 1Q81W 1BHAA 3ZXSA 4PHZA 1Q86W 1H2MA 4ZH4F 2F4MB 1HW1A 1RRJA 1X4OA 4BXFA 1OPCA 3CCJI 1AJNA 1T0FA 2CO5A 1H38A 1RKWA 2Q73A 4NBQA 4E70A 1FOXA 4DV4B 1LNQA 3JYCA 4F52A 2EIKB 4UB8Z 4BBRJ 4CICA 4JF3A 1NZ6A 2AHZA 2LR8A 2ME0A 2XRLA 3AG2C 5KUKA 3SDLA 4DYCA 4F93B 4ZI7A 2XPVA 4DR5B 4HX7A 2LF8A 3BABA 3ZRWA 3SHFA 2ZFWA 2DMTA 4IEJA 2BTQB 2DMPA 4EQQA 4IYHA 3E6DA 4WFAV 2EBOA 3SPGA 2P4WA 2R93J 3KLNA 1E2XA 2P6JA 2UXBB 2ZJQF 5DN6G 3BG5A 2Z0AA 4JI6O 2VBYA 3QP5A 2X6BA 4KMFA 2E5NA 3JAMK 1S5LC 2NS8A 2PX9A 4GO1A 2VQEO 4I01A 3J7ZI 4LLGF 4BACA 1PKXA 1ULYA 5M5XJ 1B72B 1AHDP 2AXTZ 1XG1A 3EUKL 1MSEC 2DA7A 5IWAO 3IWZA 1AOYA 2L7KA 4AVPA 1HC8A 2VLAA 3S15J 3ZHVA 1FFXA 3D5LA 2XV4S 3QU3A 1J5EO 4HBNA 4RGSA 4RGXA 2WAMA 3S2HJ 3ZQQA 3FD9A 4M6VA 4E7SA 4G27B 1JOYA 3GTPJ 3FB7C 4M6XA 1QR8A 1PNMA 1SQGA 3SPHA 1N32O 4DV3B 3FZVA 1JXSA 2ACJA 1J09A 1G8MA 3L72H 4G6TB 4X0GA 2WWWA 4A3JJ 4M3BA 5K5QA 5E3OA 1G4YB 1DP7P 4BW9A 4ESJA 3SYAA 1G1XB 3L70H 2K9QA 3JRAA 4FIPC 3CLQA 4FE7A 4S04A 1IDSA 3K4CA 2ZMEB 1XREA 4ZYHA 5BR8B 4XN3A 4JI4B 3HZJA 5F64A 3BPXA 5CN0A 4CZCA 4GT1A 5J2UB 3TO7A 5LP6B 5GP9A 2GTSA 4QJFB 4ENMA 4LFCO 4JAAA 3O6BB 2CH7A 3MKYB 3AG2H 4J7KA 1IN8A 1S9HA 2HVKC 4JI1O 3CS5A 3BCBA 2OTLI 3LSUA 2OAZA 3MN2A 4HNAA 5ICGA 3Q0VA 4KN4X 4XL9A 2PJPA 3L71H 4XR6A 5M3MJ 2X6WA 3REOA 3C3TA 2YEVB 1SQFA 4OIPF 1SC5B 5EBLC 3I56V 1SQVH 4MS2A 2LYCA 4EJOA 3RGBA 3G1MA 3G71I 3QYBA 1ENVA 4AIHA 2HQNA 3WTTC 1BC7C 3IRQA 2E74B 5B1AC 2K9MA 3QRFF 3IAYA 1T95A 4LITA 3DEEA 2ETHA 4U3JA 4BJ5C 2KRCA 2IJIA 4JI2O 4PJLA 5LOVB 3CCSV 2X1CA 2E36A 1C0WA 2R7TA 3U21A 1VARA 2BSKA 2EULA 3B6CA 2F5CA 3RSNA 3LA2A 4J9ZB 4XLAA 3WODF 4M73A 4RM2A 3TGUH 4DW1A 3WGGA 3MWMA 4CS2A 4RLQA 3M7MX 1FYKA 3A01A 1I08A 1WB7A 5EIBD 2EFPA 1QLEB 4X1KB 1RESA 3M7GA 4ESBA 2ESHA 4BIOA 1AR5A 4RWUA 4EMSA 1MBKA 2F23A 4EEQA 5GPAA 1FT9A 3F23A 4JZ2A 2PI5A 2HEPA 5J1UA 1X1CA 4ABMA 1YTFD 2M0CA 2W24A 1ETKA 2XDVA 3LSPA 4B7KA 3N97A 4DR6B 3G73A 1L0NH 4CH5A 5E1ZB 2PI0A 4TT3G 2DOSA 3BCCH 2YS9A 2E1OA 1SZXA 3HC7A 3GB7C 3MZHA 3PSIA 3E7LA 5H6RA 2ZQMA 4EM2A 3FXJA 2F6CA 3O8GA 3VYTB 2EA4A 3TETA 3CMEV 1MH3A 2EFQA 1HW5A 1I5ZA 1UJ8A 2IU3A 3GO5A 3Q3SA 5JHFA 1BW5A 4ON0A 1GXQA 2Q68A 4LBEC 4CCJA 2CV1A 3OYMA 1IXBA 2OIEA 1OISA 3E89A 5J4YA 4KNYA 3B2EE 3F0CA 2BCCH 3JARA 2VONA 2ZE5A 1IXRC 2NRAC 3MD2A 4LFBB 3F8CA 3AAFA 1JKOC 5HNFA 3HRSA 3JAMZ 1R49A 5K7ZA 5H6QA 1LE8A 2QZ8A 4LR3A 2WBMA 2BEOA 2HDWA 5HFMA 3BJOA 2DODA 1HW2A 3OMAB 1NH2B 3HDDA 4OINF 1K78A 5B1AH 5E79Z 1GLNA 1IXSB 1R1UA 2LGWA 3GWOA 3DTKA 4UFZA 3OL3A 3BA9A 3LAPA 1NJIW 2E71A 3RN4A 1A6IA 1YZBA 4YJ3B 4MFEA 1Z2GA 2ID3A 2NVTJ 1XX5A 1US6A 2ZD9A 1SQQH 3H1JH 2MD5A 4DV7B 2K3FA 1Q82W 3RJPA 3ZMDA 1ZUQA 4I4TA 2K9NA 2Q0AA 1R5HA 2RAEA 2ITDC 3BR2A 3DXRA 2WLHA 4F6RB 2BYVE 4A0ZA 1SFUA 2LFRA 4CYCB 4LOCA 2STWA 5BOXA 2YXYA 3HKDB 4PK4A 5JVGF 3OMYA 1YXBA 1D1BA 4YIFA 1W0JG 4HX8A 3OS2A 4LP8A 3L00A 1JFFA 1F23A 1YDXA 3JR9A 1KONA 2IGKA 2YS8A 4FJCC 1YS7A 4O2BA 3F8FA 1CF7A 4FX0A 2N05A 5FNVA 1R4MB 4EATA 2KQRA 5FD6A 1YJWI 4JTCB 2DI3A 3CCRI 1CPYA 3RYFA 1BJAA 3PSFA 4CH6A 4BR6A 4JI5B 2IW5A 1VF6A 2EFOA 3FXOA 2UV1A 3K1MA 4PDKA 1LPQA 1N4CA 1Y74A 2WLNA 4Y3OA 4IHXA 2QR4A 3E86A 4AQYB 1W5SA 2E75B 3DWLE 5D4RA 3J7YJ 2H1KA 3ROUA 5DDGA 1IC8A 2H09A 2OZUA 1YS6A 4DR1B 5CQGA 2QVOA 1SVOA 4TV8B 4PJMA 5ICEA 4G7ZF 3FB8C 2H6CA 2PMHA 1ZSPA 2L9NA 3A0HC 3CC4I 2YXHA 3ZHUA 3RKQA 1TAEA 1N34B 1MSWD 1QPIA 1SFOJ 2MLKA 2W0XA 4DR4B 1OHHG 5LEKA 4FZ1A 5CB4B 3W7UA 1V5EA 2LVSA 1OCCB 4HDUA 2IGNA 3J80K 3IGAC 1P84F 2EIJH 4CCOA 3AG1H 4NC8A 1QU3A 2P4KA 3K2ZA 2CUEA 4PUSA 4DJAA 1F4MA 4IPAA 4ZOLB 2AHYA 5B5EC 2UZKA 2DA5A 1T33A 1V4RA 3K1NA 1S72V 4DQ2A 1XS9A 4DV1B 2VBXA 2WLIA 4D7MA 2VOPA 1FWZA 2RMKB 1N36B 1TWCJ 4JI7B 4DZPA 4NXNO 2OCCC 4K35A 1HNWB 4ENJA 4QLCU 1R23A 3JRHA 1LFUP 1WHUA 1XB4A 4BHPA 5C4JJ 4C2TA 1WLEA 2QM4A 2Y69B 3O9OA 4R8CA 3TCUA 2WC2A 1H8HG 2XAQA 1SQXH 1A6QA 4M6YA 4WFBV 2L6LA 1SANA 1EBOA 2ZSHB 2VE8A 2UUBB 4PA4A 4X89A 3F72A 2QBYA 1FJGO 1OCOB 3MKWB 3BTLA 2RNBA 3STZC 2RN7A 5DECA 1F36A 4FM0A 5D8KB 2EZLA 2VJ5A 2LKSA 3LSHA 3ZN1A 3IKTA 4FCYA 1IDZA 2JJ1G 1WH5A 4GGGA 3P30A 3UCSC 3VODA 3BC8A 4NNJA 2CS3A 4HPQA 2XKPA 4WBNA 3FX3A 2D45A 1AJPA 4UB6C 4A3IJ 2FE3A 1YYVA 5DTDA 4YFKF 2EQRA 3ZQGA 3HXLA 1K7AA 4MQ9F 3F9KA 2DJNA 2E7WA 1VIBA 1BQ0A 5LBQA 3H36A 2PYJA 4PJ0C 4BNCA 3CCYA 4C2UA 5IYCJ 4NYKA 1G59A 1H2GA 2FKXA 4DV5O 5ICFA 3RYHB 2GA2A 2KZVA 2O0YA 2AW9A 4KXRA 4MSWC 4NC6A 5KVRA 2A5WA 3TGNA 4E7LA 1I5XA 1OLTA 1YVWA 3BG3A 2M8GX 4U3FH 3K3WA 3BG9A 2ZNJA 3V4GA 3BHPA 4F92B 4H44B 3SJCC 2FXAA 2COBA 5D5UB 3HOUJ 2FYUH 4YJ2B 2TCTA 2ZIOA 4FISA 4AVZA 2QM7A 1SD4A 3OGCC 2OU2A 1E3PA 3BRCA 4KMUX 5LYJA 3LL7A 4KUMA 1LR1A 2HP8A 4LLLA 4X1IB 3KIOA 4G9YA 5LD2C 3D36A 4C7UA 1JJ6C 4MTXA 1TWGJ 2ZBKA 3DQVC 4JV5O 3KETA 3FAVA 1K8AW 5EYPA 3EQLF 4B44A 5IT9K 2IU0A 2OCCH 2OV7A 3BTIA 3ZMVA 2CUGA 3ABMC 1U9NA 3E6CC 3RYRA 5LXTB 4OMZA 4RAGA 1Z77A 1MGTA 2Y31A 5AONA 3PJSK 2W57A 4YEJA 2JEUA 4JZGA 4IL6C 3LSIA 4DBQA 2R7WA 1Z21A 3QO7A 1DGSA 3W6KB 1AA7A 4ZZDA 3EYIA 1KECA 2XGDA 3CCUV 2QQBA 3K5MA 1R7JA 5LMNO 1J5YA 3C2HA 4RGRA 1NBMG 2LQTA 2QSGX 4U7NA 2FD5A 1WJCA 5HDGA 2HG5C 4I0XA 4O4HA 1Y4MA 1MD0A 3A2KA 2CV0A 4NTWA 1MSDA 5IYBO 3H3UA 3OV8A 2BE3A 3MKLA 3FHZA 3ULQB 2BW3B 2GDSA 2BY2A 3HHGA 1WPBA 1JJ2U 4ZTJA 1RNLA 2DE0X 1FFTB 2YI8A 1IGNA 3IAS2 3AKZA 1O4XA 5J40A 4II3A 4EM1A 5KA5A 2CQXA 3H5AA 4MO7A 2YX4A 5K5OA 2O57A 2NS7A 2O61A 2HJFC 3S3NA 3G4SV 2GSMB 1HKQA 4JX6A 3PM1A 1R22A 2JPCA 1W0UA 1GM8A 3J80Z 1UAAA 1UJWB 2A5YB 3H9GA 4OU0A 1I27A 3K7AJ 3BZ6A 1LDJA 5FD5A 1G6NA 4IIJA 1XC5A 1WPXA 1BIBA 2EINH 4FLUA 3AK3A 3SEQA 1L0LH 1WJEA 3N05A 2OCCB 3E22B 3UT5B 1VI0A 4K0KO 5E3LA 1X3UA 1NR1A 3NRVA 1BZKA 1FSHA 1V54C 4DK0A 4ZHQB 3UKMA 1P9QC 2IS4A 5DCMA 4XDJA 5EIBC 3N4MA 4CHUA 2XAGA 3GMEA 3OOUA 5M5WJ 3ZHRA 1JT6A 2DMUA 4P9FA 3SGIA 3OL4A 4FMTA 2JK3A 2R72A 1Y0UA 2L4AA 3PUFA 4BQOA 5JCOA 5E3NA 2LF7A 1XUQA 3ABMH 3CMEI 1P6RA 3HIFA 3RI4A 4KHPO 1IUFA 5IP6A 1YW8A 1EH8A 5L3BA 2VXZA 2YIBA 4BQNA 2BOCC 2Q2EA 5LLQA 1YQAA 1MNGA 1UFIA 1XILA 3OTOO 4DO2A 2Q0OA 1AILA 2M34A 4LF6O 4OGQB 1TGOA 4MVUA 3K5NA 5KAIZ 3UNGC 4JOMA 1MSFC 1IRFA 1A32A 4GX0A 2V6CA 3ABLB 4HNTA 1BT8A 1GO3F 3CUQC 4O2AA 4JPRA 1WA8B 4BWAA 2CGOA 5LGUA 4GCVA 1FBSA 3CC7V 1STZA 2EK5A 2ECCA
chains in the Genus database with same CATH topology
1R3IC 1MDMB 1J2XA 2D1VA 5HS9A 4LG0A 1I5YA 3Q9SA 4XLNF 4F4LA 1NH2D 1FBQA 1SD6A 1J75A 3JD4A 2BOBC 4PELA 2FSWA 3ABMB 1K5QA 2HLDG 2Z9OA 4R8HA 1I1SA 1SETA 2VC0A 3GXOA 2ZXJA 1RZ4A 1DPRA 1THZA 3F21A 4HDVA 1KQSU 4CXFA 3G3ZA 3ECHA 4I02A 1GXPA 2NNYA 2DK8A 4MTFA 2FU4A 3RVYA 3W7TA 3K0GA 2LKPA 1UCRA 1P2FA 2WLLB 1U5TB 3B8MA 5TJJA 4WXCA 4UVAA 5E1XA 3JCZA 4Y15A 2A3SA 3O2PE 2XRNA 4JQFA 1U6GA 1O57A 3RKYA 1O7LA 1HKTA 3R65A 3SYCA 2VBWA 3CMAV 3GUDA 2QE7G 3U2RA 3HTSB 4JTAB 2JTVA 2EA2A 1V54B 3FB6C 3VEPA 3G6EV 4ZKIA 1EH6A 1BN5A 4EV0A 1TQPA 5CVIA 1MJ9A 5CLSA 2HGCA 5E8IA 1O3TA 5JR3A 4HYOA 1S6LA 4EJVA 4EVIA 2K27A 1OCZC 2VOOA 5DD8A 1DF4A 2OT5A 4P9UA 4OIRF 2EIKC 4P9PA 4CZZA 3RKWA 2QM8A 5LRSA 4UV9A 1JGSA 3RIRA 4EJWA 2IT0A 1F4KA 3R0AA 3E6MA 4O3MA 1WWXA 5JVTA 4YG2F