4HAMA

Crystal structure of transcriptional antiterminator from listeria monocytogenes egd-e
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
SNAMFTINTKSQLPIYEQIVQKIKEQVVKGVLQEGEKILSIREFASRIGVNPNTVSKAYQELERQEVIITVKGKGTFIANQTDKLSSPKKLAETRTKLKETILDLVYLGVNIEEIHKLADEYSQDIIGGDVVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lmo2241 protein
publication title Crystal Structure of Transcriptional Antiterminator from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
total genus 43
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hamA01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4hamA02
1R00A 1BIBA 3J81Z 3F23A 3WTWC 1SFEA 2XAGA 4HLXA 2HYFA 1WI9A 3K1PA 4E70A 3VOEA 2STTA 4L0YB 1LJ9A 1WSUA 5FLXZ 1IRFA 1F4KA 3HOSA 2ZO4A 1HKTA 1S7AA 1JXSA 3HOTA 2ZCWA 1W5TA 1FSEA 3LSTA 2YX7A 4DQ2A 1IN7A 3DKWA 4U7DA 4CDGA 2YX4A 1MKMA 4HF1A 4FT8A 4YFXF 3I54A 1S7OA 3Q9VA 1HW2A 2RC4A 2ZNYA 3RJPA 2DPDA 3C7JA 1BN5A 3VFZA 5IT9Z 2IRFG 1FLIA 2EFOA 3HHHA 3RKXA 1FBUA 1YW7A 2FU4A 4QLCU 3F6VA 4LLLA 4N9HA 4U88A 5E1XA 1EV7A 3MWMA 2FNPA 3H3UA 3BDDA 1MZBA 2L3DA 4IXAA 1KU2A 1V4RA 3C3WA 3V4GA 5LRSA 1B4AA 4DNCA 2C6YA 2UWMA 3ZQ7A 3ZMZA 3WE3A 1EH6A 4G94A 1HKQA 1G3TA 4Y15A 5BS6A 2O03A 3IRRA 2O0YA 3J81K 4XSXF 2EFWA 3KCCA 3SHFA 4CZZA 4WCGA 2KIUA 4OMZA 2GA1A 4S05A 3W6JB 2W24A 5FLXK 2NNNA 2H09A 1LNWA 4BHCA 3KE2A 1IW7F 1O7FA 1YG2A 1ZG1A 2ESNA 1O57A 3F8BA 3NEUA 3FMRA 4L5IA 1XSDA 1VTNC 2VBYA 4GCVA 1ZGJA 2CFXA 5TRDA 2A07F 4A0ZA 4R8HA 4HX4A 1Z91A 4FHTA 4CYDA 4PCQA 2XAFA 1T2KA 3EQLF 2FBKA 3H92A 1XCVA 5IT9K 3KP6A 2TDXA 4WK8F 5DCMB 1E2XA 4HDVA 1IF1A 3LQRA 2FE3A 2R7DA 1BM9A 2V6CA 5HLIA 3R61A 4F7ZA 5FD6A 3K2ZA 4LG0A 1BI0A 3HSRA 2HTJA 1R36A 3R60A 1B59A 3JTGA 3GFLA 2O6GE 1KQ8A 1P6RA 3V7RA 1B9NA 2QM3A 3LWFA 4PGHA 2A61A 3KP7A 4L9TA 4A5MA 3RKYA 4EMSA 3WU0A 1YTYA 3CDHA 1K78B 1XCBA 3SQNA 2P5VA 2M1BA 3MZYA 2DTRA 2QQAA 1T98A 4M6YA 3IWZA 1O7LA 3I71A 4OOIA 4ENMA 5LHHA 1HXDA 4LLNA 2MC3A 2JPCA 1QNTA 1FYKA 2MH2A 2DW4A 3TKYA 3TO6A 3WGGA 1V3FA 3KLOA 2VONA 3HTUA 1RM1C 3U9GA 2YPRA 5K1YA 1YIOA 4I01A 2LF8A 4ESFA 1H9TA 3DP7A 3RTRA 2GA2A 4UVAA 2A3SA 1FOKA 1HW5A 2D1HA 3RDIA 3JW4A 1D3YA 3FXRA 3ABTA 2WAMA 3AAFA 3KP2A 1Y0UA 2JT1A 2RV8A 3RYRA 1J0RA 5J6XA 5LHGA 3ZN0A 2CO5A 4HOBA 5FO5A 2KJBA 2DI3A 2VC0A 1CGPA 1T0FA 1KQ9A 3CUQA 3E6DA 4KFCA 5AIPA 3BPXA 2EV0A 2VN2A 2BV6A 1IN4A 1SD4A 2KRFA 1LVAA 3HTSB 4MTEA 3U1DA 5IT3A 5LHIA 4I09A 1DPRA 3T8RA 2GIVA 2W25A 2BBYA 2Y48A 5ILSA 4GXOA 3W6KB 3RI4A 3I53A 2JPBA 2BYVE 2YSRA 2HQNA 2RN7A 3DQVC 4HX7A 2VE9A 2CYYA 3HSEA 3EYIA 2HWVA 2V9VA 2GWRA 3CO6C 5HLGA 2NRAC 2BGCA 4HBLA 1I5ZA 2GXBA 2ZFWA 1HSJA 2A5YB 1DDNA 2WTEA 5H6QA 4O6JA 4UVCA 4ON0A 3IKTA 2DFIA 1IAWA 2RGVA 4N9IA 4CGZA 5ICCA 2XRNA 3EYYA 1PP7U 1MGTA 1XDSA 4I02A 3FXQA 1IUYA 3CUOA 5ICEA 3V8JA 1B6AA 1G4DA 4ENKA 5BOXA 2FMLA 1DP7P 4LFUA 2P90A 3C18A 5KVRA 3P7NA 4G8XA 3DV8A 4KYWA 2P6TA 2J5OA 3N4MA 2VE8A 2HZTA 2VBWA 1TTYA 2O61A 3TOAA 4O3MA 5GW7A 4EM1A 4I98B 3GF2A 1XGNA 4KUMA 2UXNA 2HKXA 2QYOA 1USTA 1TQMA 1UFMA 3T1BA 2O3FA 1YS6A 4A2UA 2HQRA 4AIKA 4MNUA 3M9AA 4UV9A 1ZHFA 3GXOA 2GQQA 1KYWA 2E1CA 3QRFF 3RPQA 2EK5A 2NYXA 2XROA 1OKRA 1ON1A 2F2EA 1KGSA 1U3EM 1BIAA 2P6SA 4Y17A 1FPQA 3F8FA 2K7LA 3QPTA 5J8FA 3Q5FA 2P5KA 2W57A 3GWZA 2NAZA 3M8FA 2Y75A 2HDCA 4BH9A 4PGGA 3EUHA 4I0AA 1L3LA 1QPMA 1BJAA 2MD5A 2CSOA 1FC3A 2YU3A 3I64A 2RQPA 3BP8A 2Q8KA 5BQTA 1Z9CA 1U8RA 5CVIA 3WTTC 1IN8A 2PMHA 3BOQA 2CGPA 5E1ZB 3BROA 3FMQA 4FX0A 4BAYA 3T0YA 1LDKB 3HRMA 5DV5A 2IA0A 1GXQA 2DBBA 5CVVA 4MEXF 2H6CA 4KICA 4R79A 3WU1B 1R1VA 2FBHA 3TDZC 3ZN1A 3HYIA 4M74A 3TDUC 5DCFA 5DUKA 5FFZA 3TOBA 4HF2A 1O3SA 5KK1A 1TLHB 3RIRA 4NHJA 1EH7A 2QENA 3BJAA 3QU3A 4EJTA 3ELKA 2L02A 2XVCA 4Q5SF 4PZJA 3VEPA 3LAJA 1USSA 1XGMA 5FGMA 2K86A 5L3CA 2M87A 2V1XA 2M45A 2OQGA 3TQNA 4YIFA 4WXHA 3KZYA 1EH8A 3W7SA 4P55A 3ULQB 1WKMA 2P7CB 3LA3A 1YTFB 2YR2A 1J2XA 5CA3A 5A2QZ 2VOPA 5D6EA 1TQPA 3D0SA 5HLHA 2ZMEB 5CJ9A 4HF0A 3FF5A 2DPUA 4G6QA 3WTSC 1AWCA 4M9ZA 4I0BA 4EVIA 3WGIA 2FEZA 5DCMA 4AIJA 3L2CA 1FBSA 1LEAA 5L3FA 3ZMSA 3DEUA 4HW0A 4WX9A 4KIBA 4KN7X 4QWQA 5D5XB 1XGSA 2FXAA 4NB5A 1G6NA 3FXUA 1Z05A 3K1MA 1SMTA 2A6HF 2JRTA 4UNOA 3KZZA 1G3SA 1J5YA 4KA4A 4OIRF 4PDKA 4RGSA 1FBQA 2EV5A 2ZJ2A 2UXXA 2ZBKA 4RGXA 3MZHA 5LEKA 1W7PB 2E7XA 1I1SA 3ZMUA 4ZZLA 2QQ9A 1K78A 4P5OA 3LQQA 2MLGA 4BQAA 3QAHA 2IT0A 2CQKA 5TJJA 4M6XA 4FX4A 5JI6A 3MEXA 4MGRA 3E97A 1CF7B 2L54A 1TW3A 4K2EA 3HIFA 2X4HA 3FWEA 4KNYA 1TBXA 3BZ6A 2W84A 3TO9A 3O2PE 1U5TC 4MQVA 5BMZA 1OR7A 3ML6A 3I59B 3QP6A 4KT5C 4KMUX 1R5GA 1NHAA 3E5XA 4CO8A 1HSTA 4Z2YA 1ONVA 2OA4A 2QBYB 1R58A 1TNSA 2GXGA 4GYIA 3R4KA 6PAXA 3FX3A 1MD0A 2V1UA 4P9UA 2M5WA 2XASA 5A2QK 1C0WA 2DK5A 2EA4A 2ISYA 3EETA 2BEOA 4Q4ZF 3T5XA 4LJZF 3V8KA 3J80Z 2HS5A 4N0BA 3F21A 1IRGA 3Q9SA 4AIHA 1P4XA 5CVJA 4G9YA 1IN5A 2EA2A 3E5UA 1T6SA 3BY6A 4RS8A 1TNTA 2A68F 3DXJF 3RPUA 1K79A 4CICA 3PFIA 3IHUA 3SZPA 3GEZA 2G7HA 2LNBA 1WRJA 1K7AA 5HDNA 1BI2A 3ECOA 3IWFA 4KMFA 1P4AA 2FBIA 2XHKA 4YG2F 4RGUA 1F5TA 2Q0OA 1FWZA 5ERIA 3VB2A 4O5VA 3QOPA 3F6OA 2COMA 2QVOA 4CXFA 4M71A 4MQ9F 1LQ1A 2EFNA 3DFGA 4A12A 3M1EA 5JHUA 4D0PA 4KN4X 3MFKA 1GVJA 1XD7A 2EB7A 3P9KA 3KFWX 2NNYA 5LGUA 4ZYEA 4OIOF 5E18F 2DQLA 1STZA 3F8NA 4RB3C 2ZKZA 2XKOA 1A04A 1U2WA 3R0AA 3ZMVA 3ECHA 4HA8A 3E6MA 1JE8A 3GW2A 5ED4A 3MCZA 4EGZA 1U5TB 1KU7A 3E6BA 3ZPLA 2GZWA 5F1RA 1MJBA 2RDPA 4ZYDA 5DD8A 2EJRA 1J9IA 3FM5A 1O3QA 3IKVA 1F9NA 1PP8F 4ENJA 3ZMTA 3WE2A 2R3SA 1XN7A 1RUNA 5EEHA 1SD5A 2VXZA 2WV0A 3ZMDA 2MH9A 2FNAA 4L9NA 3REOA 2PG4A 1RNLA 4BHBA 3D5LA 1HKSA 3WGHA 1J75A 5LGTA 1ZG3A 2F5EA 4IHSA 2V79A 4NQWA 3J80K 3HRUA 4ASNA 5HDKA 5D8LB 1FT9A 4MTDA 1HW1A 1I1GA 2KIFA 4EQQA 1ZGAA 2DK8A 1ZRFA 4OINF 3BJ6A 4LLGF 2FA5A 2XUBA 3BPVA 3PQJA 4OU0A 1FNNA 5HS8A 3WG9A 2FMYA 2QQBA 5DDGA 5D5UB 2A6EF 4BXUA 5E17F 5CVUA 3DPLC 3GUDA 4P9FA 5CLSA 1SMYF 1S3JA 3K0LA 1H0MA 1U6GA 4HX8A 4R1HA 1KYZA 2H94A 3RYPA 4UUVA 1OMIA 3V7SA 4ZYHA 1YLFA 3JSOA 3ROUA 2H27A 3GFMA 3PQKA 1S29A 4EM2A 4GGGA 2D1VA 2Z99A 2HR3A 4EM0B 3ERED 2OZ6A 1YO5C 2L4AA 2XAJA 2M8EA 2LF7A 3JAMZ 1UHMA 1ZH5A 4HDUA 3HRSA 4ESJA 1ZRDA 5D5WB 5F64A 5E20A 2E7WA 1NH2B 1LDDA 1SD7A 3L7WA 3FHZA 1MJ9A 5BPIA 1D5VA 3GZ5A 1QO0D 5LEJA 4HV6A 3CUQB 2XV4S 4KIFA 1ODDA 2W85A 4L9JA 1E17A 4L0ZB 1DPUA 2JSCA 4JK1X 2EV6A 4IRGA 4EV0A 3GZ6A 1IXSB 4EJWA 1L0OC 3HSFA 1OYWA 1W4MA 3DF8A 5L3EA 3MAJA 4IPAA 4IJAA 5CVRA 1J59A 1P2FA 1X3UA 4G7ZF 4JQFA 1BBYA 2FSWA 3LA2A 2PEXA 1ZN2A 5K5RA 1XSXA 2X0LA 2F5CA 4GYGA 2XAQA 2STWA 2A69F 4U0WA 1RI7A 1FSHA 3GFJA 3F22A 1IXRC 2OU2A 4A0YA 2M30A 5K5OA 2HOEA 4Q48A 4OIQF 1IXCA 1WWXA 2ZMEA 4Q47A 2FRHA 2OD5A 1TQIA 3SZTA 2K4JA 3B02A 2ETHA 2DQRA 5F6FA 5E8GA 1UB9A 4G7OF 3QPHA 2ZXJA 4LB5A 3WTXC 1XB4A 2V1DA 4WXDA 3U2RA 4MEYF 3KEQA 3ABUA 2PMUA 2PJPA 4H0EA 2R7FA 2CWEA 1ZLJA 1O3RA 5D6FA 2FF4A 1T39A 2EWNA 3JAMK 2VBXA 1MDMB 1R1TA 4YIIA 3E5QA 4BNCA 2WWYA 3NRVA 2ACJA 3GLXA 1IZ1A 4P96A 4WWCA 3WTZA 3GFIA 1R22A 3K9TA 3J7AO 3RKWA 1KA8A 2ZNZA 1W7PA 3HHGA 5JR3A 2BE5F 3IC7A 2Z33A 1FZPB 1FP2A 2PN6A 4HZFA 4YFKF 1LDJA 4LMYA 3EDPA 2L01A 4LK1F 5DYMA 3SFZA 4RB0A 4CHUA 4I2OA 4LGWA 1CF7A 4ESBA 1G3YA 2OQRA 3GO5A 1OYIA 2HGCA 2KKOA 4OMYA 3ISPA 3CJNA 3V8LA 2K27A 1Z1DA 4EJUA 3I59A 3W7WA 1FYMA 3C1DA 2OZUA 1XMAA 3WTUC 4B8XA 4A6DA 5HDGA 3WTVC 1LB2A 2EFQA 5D4SA 2PQ8A 2ADUA 5EEGA 3F72A 1YW8A 2QBYA 3KP3A 2UZKA 4U0VA 2Z3YA 3L09A 2IA2A 5JFRA 1T38A 3O6BB 1FYLA 2VC1A 2GAUA 1QZZA 1K6OA 2DT5A 5AONA 5BPDA 2FOKA 4U0YA 4ZZDA 1SFXA 4L18B 2O8XA 4L5JA 5LLQA 1UHWA 1NVPB 1YW9A 4U7BA 4XBFA 3P9IA 5JVTA 4RB2C 3S2WA 4IVNA 4XRFA 3P9CA 1XGOA 2XKPA 4JBAA 2JZYA 3QP5A 3CO7C 3COAC 3GYHX 1FY7A 3K1NA 5E1WA 5LBQA 4XSZF 1REPC 2DU9A 4KDPA 1P92A 4OIPF 4UVBA 2CW0F 2PBIA 1KQ0A 5H20A 4IRHA 1IN6A 1QBJA 3OV8A 1UCRA 1AOYA 2XAHA 2D2WA 3FM3A 2P7VB 1B9MA 2OAZA 1RZ4A 3IL2A 4XLPF 2MA3A 5L3DA 1U5TA 2ELHA 1Z7UA 3BWGA 2QWWA 2MLKA 1S8NA 1ON2A 2LKPA 2H6BA 3O3KA 4BYYA 1PDNC 2VOOA 3VODA 2IW5A 2XIGA 1KU9A 1Z6TA 1RUOA 2QUFA 4RAYA 1MJAA 3F8CA 2LDUA 5ICGA 1W5SA 4RAZA 3I0TA 1XMKA 5D4RA 2Q2EA 1R5HA 3TO7A 5HVQC 2KIMA 1QGPA 4RGRA 5CYVA 1LEBA 2PFBA 4HAMA 1OPCA 2E1NA 3R6SA 1DUXC 2QZ8A 4I7HA 4IF4A 2QLZA 1YYVA 3R0JA 4LB6B 3N97A 3T8TA 4HQMA 3GVAA 2CG4A 3JSPA 2IA1A 2P4WA 1SD6A 3FMSA 1HBXG 1GHCA 2D45A 1ZYRF 2P8TA 4XLNF 4BHPA 4ETSA 1QZYA 3KEOA 1FP1D 3KP5A 2DAOA 1ULYA 4M73A 4M72A 3K69A 2DO7A 5H6RA 1SFUA 1Z6RA 1OYYA 2L4MA 2NS0A 4ZYGA 2Z9OA 1YQAA 1YFHA 1P4WA 5ICFA 4EGYA 1R1UA 4UHTA 2HTSA 3LAPA 5AIQA 4IRIA 3CUQC 1XSVA 4LG0B 4WXCA 5K5QA 4A5NA 4GO1A 2ISZA 1KU3A 2PI0A 1PUEE 3M7GA 5ILUA 4M9XA 1BI3A 3W7TA 2OBPA 3LFKA 4AWXB 3E3VA 4AVPA 2B0LA 4WF2A 2EFPA 3G3ZA 1B1BA 5LRRA 2ESHA 4AD9A 5L3BA 2HEOA 2HYGD 5FD5A 2WC2A 3CLOA 3I4PA 3V7CA 3HRTA 2F5FA 2VBZA 4A6EA 5FB2A 4RB1A 4M9SA 4UV8A 1F1ZA 2RNJA 4LK0F 3DPTA 4LD5A 1D8KA 3IRQA 3BJOA 2IP2A 2JTVA 1GXPA 3JTHA 1D8JA 5LGNA 4G7HF 3M8EA 1WQ2A 4Y13A 1W7PD 2K4BA 5HS7A 3G73A 3E35A 4KIGA 4EJOA 4B09A 4HV5A 1TW2A 2J5PA 2RVCA 1R7JA 3W7UA 3I58A 3ZP5A 4HQEA 1J7KA 1YS7A 3NQOA 2G9WA 1JGSA 1Q1HA 3I5UA 2PLYA 3FZVA 2VODA 3CTAA 1QQIA 2FQ3A 4G6DA 1BC7C 3KETA 1MDMA 1ZG5A 2P5LC 2MBFA 4EJVA 2XGXA 2F5DA 3F8MA 3D3IA 1HQCA 3GX4X 2K02A 4MHGA 1I6XA 5DD4A 1XDUA 4TV7A 3HUGA 3WODF 3H3ZA 2HKOA 1O3TA 1RIOH 5FFXA 1SAXA 3KP4A 3SXYA 5J8CA 5HS9A 2IJLA 1BC8C 3TGNA 3OOPA 1I27A 3E6CC 5E8IA 2LSOA 1BOAA 3B73A 2Y0MA 2AS5F 3KLNA 1ZLKA 2VT2A 1JHFA 1R23A 4UXNA 2Z5UA 3LA7A 3L9FA 2IVMA 1JHHA 1ZRCA 4HYEA 1S6LA 4S04A 5ILVA 2VT3A 4L9VA 5L3GA 4ZH4F 2AXLA 1FX7A 1ZARA 5D5VB 5D8KB 2G7UA 3MQ0A 2KJCA 4A0XA 1H9GA 3QU6A 1BI1A 2DLLA 4YFNF 4ENNA 2RKHA 1U78A 4IHTA 2IPQX 5HOOA 1G3WA 1ZREA 4HLYA 1ZAOA 5DUIA 3L00A 3W7XA 3F3XA 3WTYC 2HFHA 5DEQA
chains in the Genus database with same CATH superfamily
1R00A 3B6CA 1GM7A 4TOIA 1BIBA 1Y8RB 3J81Z 3OYCA 3OYAA 4DV6B 1W0TA 4CBCA 3F23A 3W6VA 3WTWC 4Z1MG 4AVZA 3TXQA 1SFEA 4K8XA 4ZOLA 2P81A 2XAGA 2ME6A 3CP8A 1B8IA 1P84F 2DWEC 4HLXA 5GONA 1OCRB 2HYFA 1WI9A 3K1PA 4DUYB 3T1HB 4E70A 4PA6A 2QJ1A 4JI6O 2F4VB 2IJKA 3A1YA 1RSOA 2P06A 3LMMA 1OISA 3VOEA 2STTA 2BY3A 4L0YB 5FRMA 4FJCC 1LJ9A 1AI4A 4O4IB 1WSUA 3G67A 2LBFA 1Q90D 1QVFU 5B3SH 1SQFA 1A35A 1OCRH 4ZDLA 3JRHA 4PD4F 5FLXZ 1IRFA 2X6WA 2KB1A 2N74A 4U3FH 5KAIC 4CCOA 4K35A 1F4KA 3HOSA 1XG1A 4H4KC 4LFCO 1WCMJ 4A93J 2OCEA 2ZO4A 1HKTA 4GLXA 3AG4B 1S7AA 1JXSA 4J42A 4JTDB 3HOTA 4ANJA 2UXCB 2KG7A 5IY5B 3TL4X 5EZYB 5DECA 2ZCWA 2E76B 3CC2V 2ZNIA 2Q69A 1W5TA 1FSEA 3B40A 3LSTA 2YX7A 4DQ2A 5LMUB 4CUGA 3AG4H 4IHWA 1IN7A 3OYFA 1FIPA 2W82A 3DKWA 2IJJA 3MZ8A 3CYOA 4DV7O 5IY5H 4LF4B 4YHHB 2N04A 4U7DA 4CDGA 4PI2A 3VQWA 3H9JA 2YX4A 3HL2A 1AKHB 1MKMA 3LSKA 4HF1A 4FT8A 5B1AB 4YFXF 2R0QC 4KISA 2YC0A 1NJIW 3FISA 3I54A 3K4LA 1X59A 2QTOA 1QVTA 1HF0A 1Q6HA 1WJCA 4J7JA 2KLOA 2ZDIC 4CH7A 5EIBC 1S7OA 1WLEA 3Q9VA 1HW2A 5J1YA 2RC4A 2ZNYA 4BDYA 1R9TJ 2CK3G 2IGOA 4JYAB 3RJPA 5B1AH 1AA7A 1M1EB 3M07A 2DPDA 5JQGA 2JJ7A 3DPUA 3J7YJ 1UMQA 1G6UA 4JI6B 2UUBO 1JX9A 3C7JA 1BN5A 3VFZA 1XMOO 2X1CA 5IT9Z 2IRFG 4X20A 2BHYA 2DA5A 5KHDA 1FLIA 4YEJA 2KKWA 4FFBB 2OPTA 2EFOA 3K03A 2XC7A 1R73A 3HHHA 3RKXA 1FBUA 3ASNB 1GO3F 1YW7A 4AHCA 4DW0A 2FU4A 1VQKI 4H33A 4EFEA 1XMXA 2ZXWB 3APQA 1AROP 2COBA 4QLCU 3F6VA 2N05A 4LLLA 3ABLC 1BSMA 3OY9A 1NTKH 2ZDIA 4JI0O 1Q82W 3P3NA 4N9HA 4DRXA 3ASNH 3D36A 2H3OA 4U88A 4BIOA 5IYZA 3BQZA 2HOSA 3FXJA 4BU2A 1VQ9V 2ZXWH 5E1XA 1QR9A 1EV7A 1FPOA 3VYUB 3GVMA 4A3GJ 4N23A 3MWMA 4RDUA 2H8WA 1FFXA 1XHZA 3V42A 2XSJC 5K7HA 1VQOI 1PNKA 4XLEA 2FNPA 3H3UA 4I55B 2WV1A 4DYCA 1AR5A 3GWKC 4PHZA 3BDDA 3RSNA 2I5UA 2XHBA 1MZBA 1ZK8A 2BXZA 3DC5A 2FQ4A 4UB6C 1GKFA 1XEQA 4HRIA 2NVQJ 5ITZB 2AQEA 4C30A 3VBBA 2L3DA 4IXAA 1KU2A 3S3XA 5KX5A 1V4RA 2JUGA 3C3WA 4U87A 2VIXA 1XMOB 4WFGA 5JLWA 4JX6A 5TGTA 3V4GA 5LRSA 1NZ6A 1WNSA 1R3IC 3DGEA 4UCSA 1B4AA 3CMEI 4DNCA 3PJRA 1QNMA 2C6YA 2UWMA 1GMGA 2X85A 5CQGA 1FXKB 3JAWB 3I3LA 3ZQ7A 2AQFA 2F95B 4GZRB 1MBJA 3SJCC 3ZMZA 2ZSIB 2VQHA 1TC3C 1CXZB 3EFFK 4LH7A 2DJVA 3LSSA 2VQLA 1RC9A 3WE3A 2QA4V 1EH6A 3CJQB 4MW3A 4YXWG 5HFMA 4G94A 4JI0B 3J7ZI 2CRGA 1HKQA 2R72A 3FX7A 1URFA 1G3TA 4Y15A 3ZHRA 3QWLA 5BS6A 2O03A 1ROPA 4UUJC 3IRRA 4GUNA 2O0YA 1IRXA 4MLOA 3L2UA 3J81K 5A2QN 4XSXF 2EFWA 1RESA 3IUOA 2CMPA 2AHQA 1XNQB 3KCCA 4RO2A 1IBMO 1N78A 1OJHA 5H2FC 3CHXA 2OYQA 1V5FA 3SHFA 4CZZA 4IT5A 3SR2C 1Q8IA 4WCGA 1VQNV 2KIUA 2LTPA 4OMZA 3APOA 2GA1A 4S05A 3E22B 3W6JB 2W24A 3BR2A 5FLXK 4G12A 2NNNA 3G4SI 4GKKO 2XF7A 2HQAA 2GDSA 4MS2A 4X0GA 2H09A 2E60A 1VQ6I 4X66O 4DR2O 2LO1A 1LNWA 4BHCA 1WZ2A 5CPRB 3CCSV 4OX9O 3KE2A 1Q43A 1IW7F 1I5YA 2MC4A 1O7FA 2ZB9A 4O2BA 1YG2A 1ZG1A 1US6A 2E74B 2ESNA 1S7EA 1DU6A 3ZRGA 3STZC 2GXAA 4MVMA 1ZTEA 5C4JJ 1GT0C 4GX1A 1NH2D 4G6TB 1O57A 3F8BA 3NEUA 3OMNB 5DN6G 3FMRA 4L5IA 1CEZA 1XSDA 1VTNC 2PJRB 2VBYA 3QPLA 4I50A 4MW8A 3Q0WA 4GCVA 1ZGJA 4UUTA 1YRNA 2K40A 5B1BC 2CFXA 5TRDA 2A07F 2XT9A 4A0ZA 3TXSA 3CD6V 1MNEA 3H9VA 3A0HC 3ASOB 4R8HA 4V19K 4HX4A 2R9RB 4LF8B 5JJNB 1Z91A 4A5UB 4FHTA 1BR1A 4CYDA 4E7JA 3CRMA 4PCQA 2KIQA 1TVKA 1MNGA 3RYFB 2WAEA 2XAFA 3TW7A 4HPQA 1T2KA 2NLJC 4CC5A 3K5MA 2F48A 3EQLF 2FBKA 3H92A 3ASOH 1XCVA 3A2FA 5IT9K 3HOWJ 3KP6A 2TDXA 3PL8A 3KIOA 3LUTB 4DR5O 2W48A 3HPHA 4IGGA 3TMOA 4AU7A 4WK8F 1IO2A 4PV1B 3BCBA 3LSQA 4GKKB 3MKWB 1K4TA 1FOXA 1VEWA 2WLHA 5KLVH 2DTZA 1VQ7V 2KT0A 5DCMB 3R65A 4X66B 1E2XA 5KAFZ 3ABLB 4HDVA 3BZKA 3DCFA 3CF5F 2O57A 2OTJV 4FLTA 3H9GA 4IOAF 3TK1A 1IF1A 2BCCH 3FBIB 1Y0NA 3LQRA 4LF5O 2X1EA 3CCUI 2R7ZJ 3CDLA 4IIJB 2FE3A 3H5NA 2R7DA 1BM9A 2V6CA 3ABLH 5HLIA 3R61A 2GOXB 4F7ZA 3DKXA 3DSQA 2VQFO 5FD6A 3SZGA 5M5YJ 5J2UB 3K2ZA 4ZBMA 2PY5A 2EZHA 4LG0A 3ZGKA 3SYPA 3FDYA 4R7CA 2EX3A 4DV2O 1BI0A 2FOWA 3HSRA 4KT6A 3CCMI 3QQAA 1JUPA 2LQTA 2CJJA 2HTJA 1WJ5A 2ZC2A 1R36A 3R60A 2GM4A 3GTGJ 1B59A 3JTGA 2HJFC 4X64O 4RAGA 4LFBO 1PD3A 1WFXA 2L2OA 1HNZO 4ABZA 3GTJJ 1G2HA 3GFLA 2O6GE 1KQ8A 3ZRWA 2Q0OC 5IPAA 4M3EA 2HZDA 1P6RA 3V7RA 4FASD 1B9NA 1P7IA 1HOMA 2QM3A 3LWFA 4PGHA 4XLHA 4JX4A 2A61A 1T56A 4RA2A 1SQQH 2CUFA 3KP7A 2LG4A 3MN2A 1ORQC 4L9TA 2IGNA 4DR5B 5F08A 4BEHB 3HKCB 4A5MA 1GUUA 1UHSA 3RKYA 4ZDPA 4EMSA 3CCRI 4B7KA 1RPRA 4FQGA 3FAVB 4ZTJA 3WU0A 1W36C 5KMGA 4BQOA 1YTYA 2K3FA 3CDHA 1QR8A 2PF4E 1IVSA 1K78B 3LSGA 3HKDA 1XCBA 2PMZA 2P5VA 3SQNA 2CQQA 1R3JC 1QVGU 3K70C 2UXBB 5JH7A 2M1BA 2E5ZA 3MZYA 1G8MA 2DTRA 3S93A 2QQAA 1T98A 2A5WA 4NDLA 5E3MA 1LPQA 2GLOA 4M6YA 2VQFB 3IWZA 1IBLO 5FKKA 3K5OA 1O7LA 3I71A 3K04A 4OOIA 2Q0AA 4ENMA 1I08A 1LUVA 5LHHA 3CJHA 1VF7A 1HXDA 2F1MA 3JATB 4DV2B 1FEXA 4LLNA 3CESA 4HEA2 1BW5A 2MC3A 3J80N 1BCCH 4PSXA 4X64B 1PPJH 3JR9A 2MW8A 1MMGA 2QE7G 1EFRG 4FPPA 4FZ0A 1ZR2A 2JPCA 1R71A 4LFBB 4A3FJ 1IV6A 1QLNA 2JEXA 1NTCA 1QNTA 1X4TA 2Y69C 3OGIB 1FYKA 2EIMC 3WB1A 4LNUB 2MH2A 4TT3G 4IL6C 1YJWI 2E5LO 1WJFA 2DA7A 2DW4A 1X1DA 1I39A 3G2BA 3TKYA 3TO6A 3WGGA 5C44J 4KP4A 1FD9A 4I9WA 3JD2A 1V3FA 1N8RW 1IJWC 4R6ZA 2XB0X 3VYTB 3SJMA 1F43A 4LF6O 3C2GA 2XRLA 2WLLA 3KLOA 3K0GA 1FTTA 3SDBA 2VONA 3HTUA 2MK3A 1RM1C 3U9GA 1LFUP 2YPRA 3HKEA 2O5RA 4XMYA 5K1YA 5DM6F 1YIOA 3HPLC 2QWOB 4I01A 2CTRA 3TETA 1KD1W 3RN4A 3SEZA 2LF8A 3S15J 3G6EV 1PUFB 4ESFA 1K5SA 1H9TA 2E35A 3DP7A 1MSFC 2CW8A 3RTRA 2GA2A 4XKVA 5EG0A 1DK1A 4UVAA 3RYCB 2A3SA 2IJIA 3OL4A 4GT1A 1IBLB 2QCOA 1FOKA 3D3QA 1Z7LA 2W6IG 3I56I 4ZHQA 3T1YB 3K10A 2EJ7A 1R6KA 5EF6A 4XDLA 1T0FC 1V54C 3FXOA 2LW1A 2HQ5A 1HW5A 1SF9A 5LOVB 4BE0A 1JKOC 2JDIG 3K57A 4DR1O 2D1HA 3RDIA 3JW4A 5CBGA 1O9GA 2VQCA 3CDIA 4WF9V 3K5LA 1D3YA 3FXRA 4DYQA 3ABTA 2WAMA 3AAFA 3KP2A 3MD2A 1Y0UA 2EULA 4NC8A 1BA5A 2JT1A 2RV8A 4MFDA 3RYRA 2E2HJ 3JRBA 2DYSC 1J0RA 3WG7C 2E5LB 3H1LH 9ANTA 1GLNA 5J6XA 2M7BA 2NVYJ 5LHGA 3ZN0A 2CH7B 1F36A 1L1FA 2AXTC 2CO5A 1D5AA 1WB8A 4HOBA 3HOXJ 3S3MA 4LF6B 5FO5A 4PA7A 2KJBA 3ZQIA 1K33A 2DI3A 1V9PA 2E1MB 1JFFA 1PP9H 3SDGA 2ATKC 3N2KA 4U3JB 4JV5O 2VC0A 1CGPA 4QIWN 1T0FA 4PJ0C 3W2AA 3PNTA 1KQ9A 3CUQA 3FK6A 3E6DA 2QQ8A 3RWRD 1SZXA 3T4DA 5EBLC 3K9SA 4KFCA 5AIPA 2CV0A 3CJTB 3BPXA 1MH4A 2EV0A 2VN2A 1H2LA 1OCCB 3C90A 1R5ID 1S5LC 2BV6A 3OR2C 1IN4A 1SD4A 2KRFA 1MMMA 1P7GA 1VF5B 4QPJA 4YIPA 1YI2V 4NTWA 4MVUA 3H1JH 1QCEA 1JJ2U 1LVAA 2DE0X 3BTCA 1LE8A 3HTSB 4MTEA 3U1DA 1M4UA 3P3PA 4HZ3A 5IT3A 3RGBA 1MMNA 3J7AU 1TUBA 1OCCH 2X6XA 5LHIA 2JA8J 1WAZA 2LMDA 2QKAA 4I09A 4QJFB 4DR1B 4HNVA 1HR0O 1DPRA 4BJTA 3T8RA 3BC8A 2GIVA 3A2KA 3N2GA 4QTRA 3DLLF 1MW7A 2W25A 2BBYA 4ZKIA 1KECA 4MVRA 4C3IJ 2WSSG 2RAEA 4QPQA 1OV9A 1K73W 4QSHA 3JRAA 2Y48A 5ILSA 1JVMA 4GXOA 3W6KB 3DKYA 3AK2A 5LP6C 3RI4A 3I53A 3NR7A 2R9AA 2XPVA 2JPBA 2BYVE 2ADQB 4PI0A 5DM6V 1Q81W 2UU9B 3SPJA 5H9CA 3CMMA 2YSRA 1I3QJ 2DA4A 2HQNA 4BY7J 2RN7A 3DQVC 4F55A 1D0ZA 1VNDA 4HX7A 4C2MJ 1WGXA 2Y0SA 1H89C 2IJHA 2VE9A 1ETQA 4JYBA 5K1XA 2LREA 5CBHA 4JV5B 1NR7A 2CYYA 3HSEA 3EYIA 3UO2A 4ZI7A 5JJJB 2EIJC 4OPAA 1K4CC 2HWVA 3S17J 4ABMA 2ZM6B 2BOBC 3IH4A 2WLJA 5EGOA 2V9VA 4I0XB 1MSEC 2GWRA 3CMYA 5CA0A 3F0CA 3K7AJ 1A32A 1H2SB 3CO6C 1IDSA 3ABMB 5HLGA 4UCOA 2F23A 2OTLV 2NRAC 2BGCA 3B2EE 1GN4A 4Y3OA 3OR6C 5EYPA 1NVPD 4HBLA 1M56C 1I5ZA 4S0HB 2GXBA 2Y69B 4XKBA 2ZFWA 3ABMH 3ZQHA 1E1RG 4JF3A 4IHJB 3HPGA 3UKGA 2OCCC 1YIJV 1HSJA 2A5YB 3SFIA 1DDNA 2L6LA 3BAAA 4DBRA 2WTEA 2F93B 5IJ0A 5H6QA 1HR0B 4O6JA 1K97A 4UVCA 4ON0A 3IKTA 4I6ZA 2PI5A 1AB3A 5LMNO 1N33O 5LXTA 1MIJA 2DFIA 4C3JJ 1IAWA 1MSDA 2RGVA 5KNLA 4N9IA 4CGZA 5ICCA 1YF2A 4XK4A 5FNVA 3U10A 2XRNA 3OS2A 1D0XA 4E7IA 2R7VA 3CS5A 3ZEDA 3EYYA 1YHQI 2Y0IA 1BMFG 1RM1B 3JD3A 1PP7U 1MGTA 3L75H 4NVPA 1XDSA 2VJJA 1HCRA 2XNDG 2DJIA 2K9QA 5EC1C 2L0KA 3UCSC 4K0KO 4XRSA 4I02A 1AP6A 3FXQA 5B3SC 1N32O 3QYFA 3BQYA 1IUYA 3CUOA 1NH3A 1BT8A 5ICEA 3V8JA 2Y4UA 5CMUA 1B6AA 5GAGJ 3TEDA 2DMPA 5HLTA 1G4DA 3SJAC 1H8HG 4ENKA 1FXHA 3JSNA 4DR3B 2OF7A 5BOXA 2ZE7A 2FMLA 2B5UA 3RT3C 3PM1A 3B09A 4X1EA 1DP7P 3LSRA 4LFUA 4HNUA 2P90A 5F27A 3B6AA 3C18A 1V54B 1XBLA 2E34A 5KVRA 3P7NA 3ETEA 2PX9A 4G8XA 1BR2A 1LKXA 3BR5A 2Y4TA 5CA1B 3DV8A 4KYWA 2P6TA 3OS0A 2J5OA 5KA6A 2HYJA 3AEIA 4D5FA 3AG4C 2LFSA 2VL8A 3E83A 2P5OA 2Q8VA 2DA6A 5D5QA 3N4MA 2VE8A 2HZTA 2VBWA 4NQWB 1GM9A 4LR3A 1V54H 2IXSA 1TTYA 3M1CA 3TOAA 3BTJA 4O3MA 2M4GA 2O61A 2DYSB 3FB7C 5GW7A 1KMIZ 1VQMI 3PNYA 4EM1A 4I98B 3C2HA 3GTPJ 2JA2A 3GF2A 3CJRB 1XGNA 4KUMA 4B1RA 2UXNA 2HKXA 2KRCA 5M3MJ 4IHYA 1AJPA 1JMKC 3H0GJ 3E8GA 2D3OW 5LMNB 4GKJO 2QYOA 1N33B 4UB8Z 4O4LB 2DYSH 1USTA 3G1LA 1TQMA 4M3GA 1HC8A 4O4IA 1UFMA 2CV1A 3T1BA 3EUKL 2O3FA 1YS6A 2ITDC 3FYIB 3JREA 4A2UA 1TWGJ 2XAUA 2HQRA 4AIKA 2R7UA 2JK5C 4MNUA 1GN6A 3G71I 2XUMA 1GV2A 3M9AA 1TWAJ 4K0KB 1PNMA 4YJ3B 1N32B 1NTMH 3GCMA 1R49A 4UV9A 2D5VA 2NVTJ 1ZHFA 3GXOA 3RZOJ 2GQQA 1ITYA 1KYWA 2E1CA 2CQ7A 4F93B 4J01A 2DFHA 3QRFF 3QO7A 4MFEA 4XRMA 4QE9A 3RPQA 3OYIA 4UCTA 2EK5A 1JCHA 2NYXA 3HKZA 2JN6A 4FLZA 2IBDA 2XROA 2DA1A 3NAUA 2E2JJ 1AKHA 1OKRA 1ON1A 3L2RA 4B3AA 2F2EA 1KGSA 2BOLA 4ZTFA 4RAIA 4D9JA 1I50J 1U3EM 2LFBA 3KKYA 4I76A 5LP6B 1IV8A 1G1XB 1BIAA 1LUWA 2P6SA 4Y17A 1FPQA 3F8FA 3CB2A 3CC7V 2K7LA 2LY1A 3QPTA 5J8FA 2LGQA 2ZMEC 3Q5FA 2P5KA 5FJ8J 2W57A 3GWZA 3E7LA 3QODA 2G38A 2Q73A 4MTFA 2Q7EA 2GHYA 4DO2A 3G1OA 2NAZA 3HB9A 3M8FA 4WFHA 4FFBA 4DUYO 2IS1A 2F4VO 2ZR3A 2Y75A 4O4JA 1IDYA 2HDCA 3SYQA 4MVSA 3K9AA 2RQQA 5K7ZA 1IUFA 1X1AA 2JK3A 4BH9A 4NUBA 1ETYA 4PGGA 4BXXJ 4Y52J 1Q5OA 1Y76B 5C3EJ 3EUHA 4I0AA 2F6CA 4BACA 1QPMA 1T33A 2DJNA 4D7NA 1L3LA 1BJAA 1TZLA 1F23A 3JAKB 3LDEA 4JAAA 4DR7O 3OGCC 4JZGA 4CS4A 2MD5A 2CSOA 1FC3A 2YU3A 2IS2A 3AFHA 4A3KJ 5LYJB 1SVOA 3I64A 3VYSB 3PIPF 2CV2A 2RQPA 3BP8A 3MMYB 2Q8KA 5BQTA 1H38A 1M56B 1Z9CA 4JI1O 2GSMB 2EH3A 1U8RA 1BHAA 1B6QA 3AG1B 2QKCA 4DV4O 3MHSC 2VPLA 5LMUO 1NK2P 5CVIA 3PO2J 3WTTC 1IN8A 4I55A 1X1CA 2PMHA 3S32A 3BZCA 2YXHA 4RAFA 4YHHO 4YJ2B 4CYCB 3BOQA 3K0DA 3AG1H 2CGPA 2E75B 5E1ZB 3BROA 3FMQA 1BQZA 4FX0A 4BAYA 3CCJV 4J9ZB 5ITZA 3T0YA 1VQ8I 1LDKB 3OIPA 2VJIA 3HRMA 3HC7A 4XOPA 2IA0A 5DV5A 4E7ZA 1K9MW 3CXCU 1X1BA 4GYCB 2UUZA 5B3SB 2Y0SN 1WJBA 1HNWB 1ZKGA 4JYAO 4E4HA 1GXQA 2DBBA 5CVVA 4M6VA 2H6CA 4MEXF 3TP0A 3HOVJ 4TV8B 1FXKA 3LSPA 1T5EA 3JAWA 2VRZA 4KICA 4R79A 3WU1B 3H35A 1NQTA 2QF7A 1R1VA 2FBHA 5J9PC 1DU0A 1QPIA 3FK7A 3FXMA 3ZQFA 3FB8C 4JTCB 3TDZC 5IYDJ 4JI5O 2UUAB 2HLDG 3LSJA 3ZN1A 1XS9A 3HYIA 4OWRB 4M74A 3TDUC 1P49A 4IEJA 5DCFA 5DUKA 5FFZA 3TOBA 1ETVA 4D1QA 3CCEI 1Z0XA 2EINB 2EBOA 4HF2A 1O3SA 2L5QA 2BW3A 3SYTA 5KK1A 1TLHB 1VQLV 4JI1B 3RQ4A 4B3MB 3RIRA 4NHJA 1EH7A 3MAQA 2X6CA 3CX5F 2QENA 1ACIA 3LSHA 4DV4B 2DDAA 3S3WA 3BJAA 4ZC3A 2DFFA 3QU3A 4EJTA 2EINH 2BVMA 1XQ8A 2FTKA 3ELKA 2L02A 1ZWIC 3A8TA 4A3EJ 2XVCA 4Q5SF 1KB9F 4BXFA 4PZJA 1XREA 3VEPA 4NKGB 2ZKOA 3LAJA 1NKDA 1SA0B 5IJ9B 1USSA 2Y30A 5KCMA 3LDCA 4B3TO 1XGMA 3LSUA 3E22A 5FGMA 2DMUA 5JWPA 3VDXA 2K86A 2M7WA 2PZSA 2ELKA 2AO9A 2M87A 5L3CA 2N8GA 2HDWA 2V1XA 2VQEO 2LJ2A 2M45A 1VQPV 3DLAA 2OQGA 1F4MA 2JJ1G 3ASOC 5JVGF 2H1KA 3ZHSA 3TQNA 2LR8A 2CAZC 1BS3A 2EILB 3TCUA 3S1NJ 5LA6B 4GX5A 2HVJC 4YIFA 4WXHA 4F4LA 3KZYA 3ZS8C 1EH8A 4DV5O 3W7SA 4P55A 3JALB 3ULQB 2PUSA 2X6YA 4JI5B 1SANA 1WKMA 2Y9ZA 2JVDA 4NR1A 2P7CB 4UCUA 2ZSHB 2EILH 4DUZO 3LA3A 4J80A 2YIBA 4QNHB 1YTFB 2PJRA 3J81N 2YR2A 1FIAA 3SGIA 1J2XA 3H1HH 5KAFC 5FPOA 5CA3A 4FE4A 1VFCA 2GUZB 2RN9A 1WH7A 2JUCA 2E5NA 5A2QZ 2VOPA 2QWPB 5D6EA 1TQPA 3D0SA 1YVWA 5HLHA 2ZMEB 3KEYA 4E6KG 5C8YB 3CCJI 1X1PA 1VZ0A 4HF0A 5CJ9A 3TP3A 4UUSB 1FMVA 3FF5A 3OIQA 3S1MJ 3E8HA 5M5WJ 2DPUA 4G6QA 1QU3A 4TUYA 3WTSC 4LOCA 1AWCA 1XI1A 2LRDA 3NWTA 1NU1H 4M9ZA 1R6RA 3EHBB 4B3TB 2EBIA 4HNAB 2Y31A 4I0BA 3MVPA 4I99C 4DIQA 4EVIA 3WGIA 4A3JJ 2FEZA 4CCNA 3OR7C 1W59A 4C3HJ 3OIOA 2VQEB 4B7EA 5DCMA 2ZE6A 4AIJA 1FS0G 3L2CA 3VSLA 2O9LA 1VF6C 1FBSA 2PYJA 1LEAA 1UJWB 3VPRA 5L3FA 4F3QA 1ZUQA 3ZMSA 3DEUA 4HW0A 4WX9A 1TA8A 4KIBA 3K08A 4DV5B 4J10A 3FKIJ 4IIJA 1WJDA 3HKZN 4KN7X 3K70D 3I55V 4QWQA 3RVZA 5D5XB 3AG2C 1XGSA 3PSIA 3W2VA 4DUZB 5J2UA 2FXAA 3G80A 2P22C 2QSGX 4NB5A 1G6NA 3CC2I 5JVDB 1M5IA 4Z1VA 2XPUA 1JOYA 3FXUA 2RNGA 4JASA 2B7EA 1Z05A 1MMDA 1HA8A 3HZJA 4LC1A 5F0CA 4TQFA 3PUFA 1KUQA 3K1MA 1SMTA 2A6HF 2JRTA 4BQQA 4UNOA 3KZZA 3Q3SA 1MH3A 3MKZA 2DMTA 3E8FA 1FXVA 3JCUZ 2A0LA 3K06A 5B1NA 1G3SA 1J5YA 2MGQA 4OIRF 4KA4A 2DYRB 1QQCA 4PDKA 5IT9N 4RGSA 2LLKA 1FBQA 4IO9F 4B3SB 4LF8O 2EV5A 2JA7J 1W5CC 2LBFB 2ZJ2A 2UXXA 2ZBKA 4RGXA 3MZHA 1Y4MA 4CA0A 4BEHA 2Z0AA 3L73H 5LEKA 1W7PB 2DYRH 4FMTA 1I94O 3S3NA 2E7XA 3FAVA 1Y67A 1I1SA 1BJZA 2MD0A 3OWTA 3ZMUA 4ZZLA 1KBHA 2V4JC 2QQ9A 1LNQA 3DBLB 2X6AA 1D2DA 1OR7C 1SC7A 1K78A 4K8ZA 4P5OA 3A02A 3LQQA 4ITVA 3HOUJ 2MLGA 3M3YJ 1Z67A 4PSWA 3WHCA 2ZIOA 2DDBA 1IBKB 4BQAA 1O4XA 2NVXJ 2VLAA 3DTIA 3QAHA 1K34A 2IT0A 1R3KC 2CQKA 5TJJA 4M6XA 5M5XJ 4FX4A 5JI6A 2V7QG 4DJAA 4TV9B 3MEXA 1K5QA 1TP4A 1YSCA 4MGRA 1YITV 4X1IB 3E97A 2VJ4A 1MBKA 2V26A 2X9DA 2YS8A 1CF7B 5IYDO 5GTHZ 2L54A 1TW3A 1UJ8A 4K2EA 1TT5B 3HIFA 3RVYA 3H5AA 1Z21A 2X4HA 3FWEA 4KNYA 5FLMJ 1TBXA 1FJLA 3JATA 1D1AA 2IS4A 3BZ6A 2W84A 3TO9A 3FIWA 2QWNB 2CUZA 4MIMA 2KZVA 1VQ9I 3O2PE 1U5TC 4MQVA 4EATA 5DS9A 5BMZA 2HXIA 5E3NA 1OR7A 2K9PA 3SPIA 1FFTB 3T1CA 3ML6A 3SJBC 1JJ8C 3I59B 5K1PA 4PFOA 3A01A 3QP6A 4HYOA 4KT5C 4KMUX 4YIOA 2R7OA 4LNUA 3K6GA 3JD4A 4D7MA 4LF9O 4J41A 1R5GA 3W3CA 2MABA 3SPGA 1GV5A 1NHAA 4RUFA 4XICA 2DOFA 3E5XA 4CO8A 1NTZH 4WFBV 4KHPO 1HSTA 4Z2YA 2LH9A 2TRTA 1T08B 1XC5A 4AC0A 1E1QG 4E4EA 1I94B 3JRIA 3Q4HB 1BHBA 1X4PA 1ONVA 1OCPA 2V1NA 1JJOA 3F7YC 5CQEA 2OA4A 3BCAA 3O9OA 2QBYB 3K2AA 3VQVA 1R58A 1TNSA 2GXGA 2XB5A 4GYIA 3R4KA 6PAXA 3FX3A 3GTOJ 2YICA 1PUFA 1MD0A 4D6TH 2WY8Q 2GBYA 1RPWA 4XN0A 1Q6UA 2V1UA 1J5EO 3P30A 2Q6AA 2YI8A 3ZBHA 1Z3XA 4P9UA 2HU9A 2JVGA 2M5WA 3K4KA 2KQXA 2M8GX 3RYCA 3CCQV 2XASA 4XR6A 3RYIB 2UXBO 2QA4I 1P7JA 2QSHX 1Z5VA 1D1BA 2X1DA 5A2QK 4H13B 4Z2WA 1S77D 2E1MC 2NNUA 3C3TA 1C0WA 2DK5A 2EA4A 3FXLA 2ISYA 3EETA 4MVQA 3EUAA 3HM5A 2BEOA 1AR1B 5LOVA 5B66Z 2R5YB 3F7VC 3OYNA 5J4VA 4Q4ZF 3GTQJ 3ETGA 3H3VK 1F51A 3HEFA 4WBNB 1RETA 3T5XA 1OCOC 1QU7A 2R93J 1ZL8A 4LJZF 3V8KA 3J80Z 2HS5A 4N0BA 3WU2Z 3F21A 1F4NA 3QPSA 1OCCC 2LKXA 2K9SA 4OGQB 2B1GA 4LF9B 3HBLA 4F92B 3L1PA 4W1UA 1L0LH 1IRGA 3Q9SA 2CH7A 4MT8A 2A79B 1VQNI 2Y0PA 3OM3B 5JCOC 4KHPB 2WAQA 2M2EA 4AIHA 1HW7A 1P4XA 5CVJA 4G9YA 1IN5A 3HB3B 2EA2A 3E5UA 4BE2A 3FXKA 1T6SA 2DT6A 3BY6A 1TNTA 2A68F 3DXJF 4RS8A 3RPUA 1K79A 2JEUA 4CICA 4U3JA 3PFIA 4FLVA 2L9VA 1KKCA 4LBEC 3AG2B 3S14J 3KYCB 2X6OA 3OSGA 1XX5A 4FFKA 1EZVH 3CCSI 3IHUA 3SZPA 1R6NA 2IH3C 3GEZA 2G7HA 4CH3A 2LNBA 1WRJA 1YITI 1K7AA 5HDNA 1XL4A 1H2KA 2OV7A 1BI2A 2YEVA 4DK1A 4G2KA 1J5EB 1Q3EA 1Y66A 1JI8A 2E1OA 1I5XA 3AG2H 3ECOA 3IWFA 4KMFA 1YEWA 1R3LC 5J2TA 3CCVV 1E3HA 4XKWA 3JARB 4OXSA 2K9MA 1VF9A 2RJZA 5BXZA 1NBMG 3TW6A 3KYLA 1P4AA 2FBIA 2XHKA 3H5RA 4FE7A 4PJLA 4YG2F 4RGUA 1F5TA 1BQ0A 1MMAA 2EZIA 1M93A 1IC8A 4WFEA 2Q0OA 3PJSK 1FWZA 5ERIA 3BT9A 3VB2A 5JJEB 2XGCA 3AG7A 4O5VA 1XNRO 1N25A 1TT0A 3SPCA 5GPCA 3QOPA 1SS3A 2UV1A 3F6OA 3T1YO 1Q7YW 3DXRB 2DWDC 2COMA 3CD6I 2QVOA 2BTQB 4PJMA 4CXFA 1TWFJ 3ABMC 4M71A 4MQ9F 5M3FJ 1LQ1A 3LSMA 2EFNA 1ERDA 3DFGA 4A12A 1EA3A 5IY5C 3M1EA 5JHUA 2NOGA 4D0PA 2P4KA 3HKBB 2IGKA 2IU0A 2VWJA 3OR1C 4KN4X 2VKDA 5J3LA 3MFKA 3C2BA 1E79G 1GVJA 1XD7A 3ZJZA 3BA8A 2EB7A 1KZHA 2DMXA 1S0VA 3OTFA 2QTSA 2W4SA 3P9KA 2K1EA 3EXAA 1H8EG 3PIOF 1XUQA 2A9HA 3HR0A 3KFWX 2NNYA 4J9YB 4TSFG 5LGUA 4ZYEA 1VQ7I 4OIOF 1K7DA 5E18F 5IE9A 2DQLA 1STZA 2Y2ZA 3F8NA 4RB3C 2ZKZA 4ZDOA 1DLBA 1ETXA 2OCHA 2XKOA 1A04A 1NG7A 1U2WA 3R0AA 3ZMVA 2OTJI 4I0XA 1MOFA 2FD5A 3ECHA 3E6MA 4HA8A 3CCQI 1JE8A 4XLCA 1APLC 3GW2A 5ED4A 4LITA 2KHMA 4XRSG 3OYBA 2WWWA 3JCZA 2P0WA 4I50B 4PELA 3MCZA 4EGZA 2K9LA 1U5TB 1HDDC 1IXMA 1RKTA 4BWAA 1KU7A 4NNJA 1MNMC 3FFQA 3E6BA 3ML0A 4WFFA 1P4RA 5HFLA 3ZPLA 2GZWA 3JRFA 5F1RA 3VOUA 1G4YB 2UUCB 2OWOA 3O8HA 2JMWA 4IHJA 1R1BA 2YSUB 1MJBA 3AKZA 3OTOO 1YX3A 2RDPA 4ZYDA 1AP5A 1YZBA 4XONA 3RBZA 3K58A 1XNRB 1FKAO 4XM3A 2NR5A 5BMVA 5DD8A 1SQVH 2EJRA 1J9IA 3FM5A 1O3QA 3IKVA 3I4MJ 4MVOA 4DXWA 1F9NA 1PP8F 4ENJA 3NARA 1V5GA 3ZMTA 3WE2A 2G0EA 3KPHA 3FHNA 2W7NA 2W0XA 2R3SA 1XN7A 3SJQC 1OQYA 1RUNA 3P32A 5EEHA 3IJ4A 4CH6A 4EFBA 2KMUA 1SD5A 3BEHA 5IYBJ 2VXZA 2FKXA 1K92A 3L2WA 4L8JA 2WV0A 4P1WA 2UU9O 1V5EA 3BG3A 3ZMDA 2MH9A 1ZTRA 2FNAA 4L9NA 3REOA 2PG4A 1RNLA 4UB8C 2JA5J 1S5JA 3ZCOA 3LNMB 1MMSA 4BHBA 2IEKA 2Q2EB 3D5LA 1HKSA 4JOMA 2XDVA 2ZM6O 4KL1A 3NXSA 3WGHA 3O65A 1J75A 2CH0A 2YXLA 5LGTA 3S1QJ 1AJQA 1OCOB 4MO7A 1ZG3A 2VKHA 1X3WB 2F5EA 4Z6YA 3DBHB 4M3BA 3G1MA 3H1CA 1XPXA 2HPIA 1OCTC 2V79A 4NQWA 3U1KA 5J1RA 2ILMA 3OEHG 3OOUA 1D5NA 1HDJA 3J80K 2FL4A 3F5TA 5BNGA 3OTOB 2HVRA 3HRUA 3ZRWB 4ASNA 4ZJZA 5HDKA 1E0EA 3N27A 3QVNA 4IYIA 1OCOH 5D8LB 3QOEA 4BJ5C 3RKQA 1FT9A 2W00A 1WP7A 4MTDA 1HW1A 1I1GA 1LR1A 4O4LA 3WB0A 4TQDA 2KIFA 2KFDA 2V4DA 4EQQA 1JUMA 1KP2A 3EVKA 1K61A 1ZGAA 1QBZA 4K3AA 1E3PA 2DK8A 5FKNA 1ZRFA 2CTPA 1PJRA 2K5CA 4OINF 2WLKA 4DYLA 4XKCA 2KZGA 4JAUA 1DGWY 4DR4O 4JYKA 4YJ3A 2KQRA 4D7SA 3BJ6A 1RPOA 4HG2A 3JRGA 4U7OA 3Q0VA 1FTZA 2LP0A 4LLGF 4FCYA 3ZR8X 2FA5A 4NC6A 1ZR4A 1N36B 2V9KA 2JA6J 1KYOF 3A0RA 2XUBA 3BPVA 3WB2A 4BBRJ 3BABA 3PQJA 4MTOA 1S9HA 4OU0A 2WLIB 1FNNA 1UPGA 5HS8A 2KPMA 3WG9A 2FMYA 3G6EI 2R9IA 2OJED 2QQBA 5DDGA 4R50A 4NXMO 5D5UB 2IM9A 3J7AO 2A6EF 1KKDA 4DR3O 4BXUA 5E17F 4I4TB 5CVUA 4DZPA 3DPLC 3GUDA 4P9FA 2EZOA 3EPZA 5CLSA 1SMYF 1S3JA 4B4CA 3R66A 1YJNV 1ZLZA 1TWCJ 2DT7B 3K0LA 4PFPA 1H0MA 1U6GA 4HX8A 2GTAA 1Y74B 2FX0A 5LP6A 2GTSA 1QZEA 4R1HA 1KP3A 1KYZA 3KX2A 4GFBA 2H94A 1WB7A 4EEFG 1EKEA 1RR8C 1P7BA 3DWLE 1MBHA 3RYPA 1Z5WA 2WAQN 4UUVA 1VP7A 2L7FP 1TL8A 3AG1C 1OMIA 3N05A 3V7SA 4KITB 4ZYHA 4JI3O 5B5EZ 5KHKA 1YLFA 3JSOA 2WLLB 3OFNG 3ROUA 2H27A 1N77A 3ONQA 2RQ6A 4F6RB 4ZYAA 3GFMA 1NK3P 5FRNA 3PQKA 2R7RA 5IWAO 1S29A 2EQRA 4E7HA 4EM2A 3OEEG 4NBQA 3JAKA 4DR4B 2OT5A 1VQ4V 4G27B 2M7AA 4GGGA 3RYHB 4PA3A 2D1VA 2ECBA 4FLXA 3AG3C 1BZKA 3K4BA 2Z99A 1NI8A 4X1YA 2HR3A 4GCZA 4EM0B 3ERED 4JYCA 5LYJA 2MYSA 1PM9A 1S72V 5EG0B 3CF2A 2DA2A 2R92J 1SQXH 2ZQMA 4RM2A 1AHDP 2OZ6A 1YO5C 2L4AA 2W1OA 2XAJA 3F9KA 1OZ0A 2CS3A 3JASB 1YJ9V 2M8EA 3CEIA 1GAXA 5IOYA 2L9RA 2ITCC 4RLQA 5EBMC 4JGSA 2LF7A 2LVSA 3JAMZ 5E1AC 1YI2I 4DZJA 4F52A 4YJ2A 4CYCA 2X51A 5DTDA 1UHMA 2WADA 1PNLA 2HOAA 4V2FA 1L8DA 5TISZ 1ZH5A 2XSDC 1EM1A 2IBZH 2CE4A 1R6TA 2EINC 3L9DA 4HDUA 3HRSA 1WJAA 1XOUA 3JD1A 4ESJA 3X2QC 4CH5A 4BY1J 1ZRDA 5D5WB 5F64A 2YIBD 1FOWA 5E20A 5EDNA 1D0YA 3CCLV 2E7WA 2JGUA 2D2CB 4JI3B 3M4OJ 2HJDA 4W4LA 1NH2B 1X2NA 2LY2A 1LDDA 1SD7A 2Z16A 5EIBD 2Q5ZA 4EB6B 2VPRA 3L7WA 2PI4A 2V9PA 1MJ9A 3FHZA 5BPIA 1D5VA 3CP2A 4C9YA 3GZ5A 4TV8A 1QO0D 2MFZA 3DU6A 5LEJA 1D1CA 5IWAB 4HV6A 4BW5A 3CUQB 5KHHA 1CPYA 3DTKA 5GP9A 2JRIA 2LGWA 4FK5C 1BW6A 2XV4S 4O4HB 5KA5A 4KIFA 1ODDA 2E19A 2W85A 5IYBO 4L9JA 4FM2A 4DK0A 2L9SA 4JI8O 1SQGA 3K4NA 2A06H 2JIZG 1Y1WJ 1MSWD 1E17A 1RP3B 5EZHA 2Q67A 4L0ZB 4A3BJ 5EZYA 4QIWF 3U0ZA 4YRVA 2ID3A 1DPUA 2EILC 2JSCA 2VI6A 4JK1X 2EV6A 4D7TA 5BY1A 2M34A 4AUXA 3KCYA 2XGEA 1YJNI 2BOCC 1AU7A 3L71H 4IRGA 4EV0A 3OUFA 3QNEA 1KQSU 3GZ6A 2OTLI 1IXSB 2KDOA 4EJWA 1L0OC 3AL0C 4F6EA 3HSFA 1DQUA 1OYWA 1W4MA 3A03A 3OYLA 3DF8A 5L3EA 2X48A 5IJ9A 1W1WE 3MAJA 4IPAA 1YIJI 1EN4A 1E3OC 2AZ2A 4IJAA 3CXHF 4AQYO 3M8JA 5CBFA 5CVRA 1J59A 2OUMA 1P2FA 2JSPA 2F4OB 4BUPA 2QR4A 1X3UA 2JS5A 1FOYA 3BR6A 3MKLA 3BLYA 4QE7A 4XDKA 4J7ZA 2QEXV 2DQ3A 2M0MA 4G7ZF 4JQFA 1BBYA 1ETKA 4IQ4A 3E89A 2FSWA 2X6BA 3UT5B 5FPRA 3GTMJ 2HPMA 5CB4B 5LA6A 3LA2A 1BOBA 3K4JA 1HNWO 2PEXA 1ZN2A 2L7ZA 5K5RA 3JALA 1XSXA 2X0LA 1S72I 2M0CA 3U21A 2F5CA 4GYGA 2MG4A 2XAQA 4ICGA 4RBOA 2A69F 4U0WA 2STWA 3UO3A 4A3CJ 2YU9J 4O2AB 1RI7A 1D5YA 3IAS2 4DV1B 4JI8B 2Z2SB 3Q0UA 1FSHA 3GFJA 2XTAA 3F22A 4NTYA 1UFIA 1IXRC 1YOVB 2OU2A 4A0YA 2M30A 5K5OA 2UUAO 2HOEA 2L7MP 3S3OA 4LF7O 1COWG 4MTGA 4Q48A 1AI7A 3OYKA 2NN4A 2YDEA 1Y8QB 1JKQC 3FD9A 3E0JB 1IXCA 1WWXA 2R5ZB 4OIQF 3UNGC 2CUGA 2ZMEA 3GB7C 5C8YA 4B3MO 4UUSA 4Q47A 1B72B 4IYHA 1K3EA 4X9QA 2FRHA 1EF4A 1YE9A 2OD5A 1TQIA 3HG9A 5IYCJ 1EN6A 3SZTA 1GDTA 1ENVA 4HNAA 1I3AA 4PK4A 4B3RO 4OAZA 3CCLI 4ASUG 2K4JA 4CSWA 1YXBA 4AQYB 2FUG2 2ETHA 3B02A 2DQRA 3BR0A 1IG7A 4JTAB 2CGNA 3CLQA 5F6FA 5E8GA 2R70A 1UB9A 4G7OF 3QPHA 2E3CA 1WVRA 2ZXJA 3JCUC 2QWQB 3AG3B 2BY1A 2P67A 1QLEC 2Q7GA 4LB5A 3WTXC 1XB4A 1Y56A 3KG2A 2V1DA 4WXDA 3ZQGA 2DYRC 3U2RA 4MEYF 3KEQA 2LD5A 3ABUA 1XL6A 2PMUA 1JT0A 2PJPA 3BG9A 3CE2A 3ZRVA 4DW1A 4CZCA 3AG3H 4H0EA 1ZGWA 4IKFA 2GV9A 4YELA 1SRYA 2WPDG 4CS3A 2H8PC 2R7FA 3L72H 2CWEA 1ZLJA 3GBGA 5JVDA 1O3RA 1LFBA 2B9SA 4JAVA 1X4OA 2DFEA 2CUEA 2FF4A 2DOAA 5D6FA 2EWNA 3JAMK 1T39A 2VBXA 3J7AY 3CRCA 4UFZA 1MDMB 4LF7B 1R1TA 4YIIA 1AILA 1VQOV 3E5QA 4BNCA 2CQXA 3VWBA 1JTXA 2WWYA 3NRVA 3QF7A 1YX5A 4LIVA 2ACJA 1H2MA 1WJZA 3ABKC 3X2QB 2Q4PA 2LK2A 2BXYA 3GLXA 1BGYH 1IZ1A 1N4CA 1HNXB 4P96A 4IZZA 1K4SA 4WWCA 5GTHC 1UG2A 2ZJRF 1ZQ3P 3WTZA 2QKMB 1FMWA 3HUGB 3GFIA 1VIBA 2DCEA 3QG5A 1R22A 4B3RB 5EZGA 4BIZA 3X2QH 3K9TA 3B8NA 2MSYA 3RKWA 2QEXI 1KA8A 2ZNZA 1W7PA 4AYBN 2JQ7A 3BG5A 3CC7I 1SAUA 3HHGA 1SKVA 1TAEA 3WG7B 3OYJA 1WA8B 5JR3A 4IHXA 1QHTA 2BE5F 3IC7A 1DGRM 3CMEV 2BSKB 1Y6XA 1N75A 1U0JA 4BL0B 4FM1A 2DA3A 2Z33A 2P4VA 3W2WA 5F0FA 1FZPB 1FP2A 2PN6A 3QO5A 4HZFA 4YFKF 1LDJA 1GRJA 1V55C 4TV9A 3BTIA 4LMYA 4C2TA 4XN3A 3EDPA 2L01A 1A36A 4LK1F 5DYMA 3SFZA 3OS1A 4X1IA 4RB0A 4CHUA 4I2OA 3CRQA 4LGWA 2GOMA 1CF7A 4ESBA 1N34O 1G3YA 2OQRA 2NS7A 3GO5A 1OYIA 2HGCA 3AL0B 2L35A 2WB1N 1MZFA 2KKOA 1UELB 5DEDA 4OMYA 4CCJA 1JKPC 2BTOA 5F0HA 1DF4A 2E36A 3D5RC 3ISPA 2CTWA 3CJNA 4JX5A 3RPUD 1BE3H 4X88A 4BR6A 3V8LA 1EBOA 3DBRB 2QKSA 3JRCA 5GTIZ 2K27A 1Z1DA 5E79Z 4PJJA 4W97A 4EJUA 3I59A 2BHZA 3D36C 2ID6A 2QWRB 3KZIZ 3W7WA 3KYDB 4PJNA 3C1DA 2KRHA 1FYMA 1I0HA 4J11A 2OZUA 4RQEA 1XMAA 3WTUC 4W4KA 4B8XA 1ENHA 4A6DA 5HDGA 3WTVC 2QM7A 1LB2A 4X1KB 1W2BU 2EFQA 4FLYA 5D4SA 2PQ8A 1ZAUA 2KP6A 3G4SV 2ECCA 1ZELA 3Q4HA 4O4JB 2ADUA 5B66C 5EEGA 3F72A 3O8GA 3B8MA 2EZPA 4B3SO 1WPBA 3H36A 1VQ6V 1P9QC 2ELJA 4HNTA 5FLXN 4LFCB 1YW8A 4CCLA 2QBYA 4TWKA 4DV1O 4XQFA 3KP3A 3KCXA 3WU2C 3BR1A 2UZKA 2OIGA 4U0VA 1ZX3A 3IAYA 1VI0A 2Z3YA 3L09A 2DOSA 1SFKA 4CH4A 2IA2A 5JFRA 1T38A 1W0JG 4CC6A 4XNFA 3O6BB 1SESA 1NR1A 5FL7G 2DQ0A 3HOZJ 3U11A 1FYLA 2VC1A 1W36D 2HXOA 1IBKO 3RYIA 4DV7B 1N34B 4RWUA 1WPXA 3ZHTA 3GLLA 4H0LB 1JTYA 2GAUA 1Q1VA 1ETWA 1QZZA 1K6OA 4M3DA 2JGDB 4LWSB 4X89A 2DT5A 4E7SA 2B63J 4XDJA 4JP0A 5AONA 4II3A 2R5YA 2DN0A 1VQLI 5E3LA 2AGAA 4JI2O 5BPDA 4WBNA 1SZTA 1IZ3A 2RCVA 1FJGO 2FOKA 5K7FA 1H2GA 4UCRA 3HGGA 3HXLA 4FETA 2EIKB 3GWOA 5EEAA 2F4IA 2UUBB 4ZOLB 1VF6A 3ZHUA 4X62O 5FROA 1PKXA 1QLEB 3RYFA 1B8IB 1J09A 3IH2A 4U0YA 2F66C 4ZZDA 5GONB 2ZD9A 5IYCO 1SFXA 2O7OA 3A4CA 4L18B 1G59A 3OT7A 4FM0A 1RSOB 3OW2U 2O8XA 2HNHA 2EIKH 3CCYA 4A69C 1GTOA 1HWYA 2A7WA 1B3QA 3SYOA 3LFUA 2VS0A 1VQPI 4L5JA 4P30A 4LCUC 3BVOA 1TGOA 2HFEC 3HKCA 5LLQA 1UHWA 2HI3A 2YS9A 1NVPB 1YW9A 4U7BA 2IGMA 4GRIA 3CCUV 4XBFA 1IGNA 3OL3A 2DXIA 4X6AJ 3A0BZ 3BPZA 4JZ2A 4Q6GA 5AG2A 3P9IA 5JVTA 4RB2C 3S2WA 3T4ZA 4IVNA 2X7RB 4XRFA 4BE1A 2KG7B 2BW3B 3P9CA 2RDCA 3JARA 4D5CA 2W6JG 1XGOA 1A5JA 3OD4A 2XKPA 4FLUA 1Q86W 3H0DA 4JBAA 4J19A 2JZYA 3ABKB 2AZ0A 2LFRA 4J00A 3CCMV 3SPHA 5KUMA 3QP5A 4PA4A 2VKVA 3CO7C 3COAC 3GYHX 1FY7A 3K1NA 5E1WA 5LBQA 3CRAA 4XSZF 1REPC 4A3LJ 4JI2B 2DU9A 1CP9A 3DXRA 4QPKA 4KDPA 5BR8O 1FJGB 3ABKH 1P92A 4OIPF 1Z2GA 2BTQA 4WCEV 4UVBA 1XTAA 2CW0F 2MW2B 5BZBA 2PBIA 4B47A 5KAIZ 3P5JA 1T95A 1KQ0A 3OE7G 3HKBA 3E1SA 5H20A 2AHYA 3FKSG 1I6HJ 4IRHA 1IN6A 2VKEA 4X62B 3RZDJ 4X8AA 2HP8A 1QBJA 2DMNA 4P9OA 3OV8A 1UCRA 4C2UA 5JQGB 3CCRV 1AOYA 2XAHA 1NT2B 2D2WA 4E7KA 2LP7A 1V55B 1F7YA 3FM3A 1AJNA 1XMQO 4X20B 2I8DA 3BFRA 2P7VB 3MKYB 1B9MA 4Y4RA 2OAZA 3OYDA 1RZ4A 5GPAA 3CQZJ 1XDCA 3IL2A 4B08A 4XLPF 1MNDA 1V55H 2MA3A 3JRDA 2DN9A 3JSLA 3LDDA 5LD2C 5L3DA 2AW9A 2OC6A 4EKWA 1U5TA 5FLVA 2RNBA 1U9OA 3I55I 1WH5A 2ELHA 3HJEA 1S76D 1DGSA 4DRXB 1UG0A 1Z7UA 3BWGA 4RLFA 1O9HA 4A3IJ 1IBMB 5IYZB 3QYEA 2WAFA 3ZQCA 3IFXA 2QWWA 1Z77A 5GAEJ 5FKLA 3L2QA 1FFXB 2L7KA 3T2MA 4E2LA 2MLKA 1JQ0A 4H37A 4TUYB 1Z3YA 5BR8B 4BBSJ 1S8NA 2H1LA 2R7SA 1ON2A 3H9QA 4HSTA 5DM7F 4XL9A 4CS2A 3I5DA 3CC4V 3GMEA 1YJWV 2LKPA 2QDOA 1G8XA 1U9NA 2H6BA 3O3KA 4BYYA 1GH6A 1WPKA 2CTQA 2Q7HA 1T8IA 2ETNA 2RMKB 3ZX6A 1PDNC 2VOOA 2VWKA 5JLXA 3THOA 3VODA 2IW5A 1HDPA 4DR2B 4OX9B 2XIGA 1KU9A 2YUSA 5F2VO 1Z6TA 1RUOA 2FYUH 1B06A 5KX5B 2R7XA 4WFAV 2QUFA 1LFPA 4RAYA 1DF5A 1XHXA 1MJAA 1U96A 1W0KG 1XMQB 5CKTA 1NS1A 1GK9A 3F8CA 2YUAA 2LDUA 1AI6A 5H5NA 5ICGA 1CQTA 2Q68A 1W5SA 4RAZA 1SFOJ 1H2NA 4ZIBA 3I0TA 1XMKA 3OMIB 3FB6C 2QSFX 5D4RA 2Q2EA 5J4YA 3LL7A 3OSFA 2HVKC 1PYVA 2A6TA 2O8KA 1EZJA 2VASA 4YY3O 3LSIA 2PGGA 3HDDA 4AM3A 1R5HA 3TO7A 2CDYA 3PN1A 4DR6O 3PSFA 4DOZA 1KC8W 4DBQA 5HVQC 2KIMA 3I56V 1QGPA 2QGNA 4UB6Z 4RGRA 2K3PA 4E7LA 3ERMA 2IU3A 2JS3A 5CYVA 1LEBA 4MTXA 2DMQA 2PFBA 4HAMA 1OPCA 2E1NA 3HGYA 3R6SA 3TBIA 1DUXC 4I5SA 2QZ8A 4I7HA 2V6EA 4IF4A 2WA4A 1K6YA 3OYEA 1DTOA 5JCOA 2QLZA 1X2MA 3SDLA 1YYVA 2UUCO 3R0JA 2V7FA 1OCZC 1A6QA 3SYCA 3BRCA 2LY9A 3CMAV 1AI5A 4LH6A 5A9GA 4N4OB 4BDZA 2UXDO 4LB6B 4HSRA 2A05A 3N97A 3T8TA 4HQMA 1IDZA 3STLC 1PV0A 2OIEA 2KL4A 2EZKA 2VJ5A 3GVAA 2CG4A 3S8PA 3JSPA 2IA1A 5EBWC 3OYMA 5E3OA 4H44B 1M90W 2P4WA 1SD6A 2VUMJ 1SQBH 2ZR2A 5LFAA 5KHGA 4LF5B 3BCCH 3FMSA 1HBXG 2ZNJA 1SERA 3K79A 2HVQA 2KDZA 4RMNA 2FB5A 2ZE5A 3CSXA 4FZ1A 1GHCA 1H88C 5EYRA 2CQNA 3OYHA 2WLIA 2WY7Q 3FBNB 5B5EC 3G6BA 4O2BB 2D45A 4II2A 1TUEB 1ZYRF 2P8TA 2Y9YA 4GDFA 4PDMA 4PDVA 4XLNF 4I7ZB 4YY3B 4B3XA 4BHPA 3M7MX 3K4CA 5H2FZ 4ETSA 2ME0A 4DR6B 2F43G 4I4TA 1GVDA 3IGAC 1H8AC 2FJ1A 3ESWB 3BHPA 1QZYA 2VXDA 3KEOA 1XILA 1FP1D 3KP5A 1OHHG 3OMAB 1JGGA 2JRMA 1HNZB 1K83J 2DAOA 1Y74A 1YRNB 3A01B 1ULYA 4M73A 4M72A 2QSAA 5GAHJ 2R7WA 3CC4I 4NXNO 3K69A 1S5HC 2DO7A 1FAFA 4AILC 2IH1C 1SVMA 2CFOA 2EZLA 1QA6A 1EJ9A 5H6RA 1WN7A 1A31A 1JR9A 4JYYA 1SFUA 5D5PA 1TVKB 3UKMA 2UXDB 3VQYA 2Z1DA 2M3AA 4IX7A 1Z6RA 4KXRA 1OYYA 2E71A 2XGDA 1U8BA 1MZEA 4F6RA 3F5WC 2L4MA 1Y39A 5TISC 2NS0A 1WI3A 3RYHA 4ZYGA 2Z9OA 5CN0A 3S16J 1YQAA 1YFHA 5BMVB 1IXBA 1P4WA 2PTMA 5ICFA 2YIAA 2BZTA 4V2GA 4EGYA 5B1BB 4BS9A 2ODMA 2YXYA 1R1UA 5J47A 4UHTA 3ZRSA 4LP8A 3K5NA 1M9NA 4FVMA 2HTSA 3A0HZ 3LAPA 1ORKA 5IDJA 1YJ9I 3LOCA 3JASA 3S1RJ 4RM3A 5B1BH 4B43A 1JT6A 5AIQA 4IRIA 3CCVI 1Q6IA 3CUQC 3D8CA 4DV3O 3VQXA 3DEWA 2JVHA 1XSVA 4LG0B 5EK0A 2M4KA 5J1UA 1ZL8B 4WXCA 5CA1A 5K5QA 1PL0A 1L0NH 3IP4B 2LKSA 4DYRA 5HNFA 3CMAI 3CP1A 4A5NA 3I9V2 4GO1A 4NXNB 1N0NA 2ISZA 4DV0O 2XF5A 2HG5C 2ZINA 1KU3A 3DC6A 2QM8A 2C2AA 4MSWC 3RFRA 1YTFD 4DW6A 2PI0A 3RQIA 5HODA 1PUEE 3M7GA 2P7TC 2K9NA 1SC5B 1JKRC 1YHQV 4EB6A 1MA1A 1MG1A 5ILUA 3DEEA 2LC2A 1M1KW 4M9XA 1X3ZB 1BI3A 3W7TA 2LOOA 3IAM2 3ZQLA 3L70H 4PA9A 1AVMA 4PDLA 4O4HA 2HDDA 1THZA 4BW9A 2YEVB 2OBPA 3LFKA 5KMGB 5EC2C 2WBMA 2WA0A 3E3VA 4AWXB 2P6JA 4I9QA 3BG6A 3CPWU 4QPOA 4AVPA 2ADPA 2B0LA 2QM4A 3TJTA 5IP6A 2L9NA 1A6IA 4WF2A 2AHZA 3CRRA 2EFPA 3HKDB 3TGUH 5J2TB 4JI4O 3DU5A 1M57C 5JH7B 3G3ZA 1I7FA 4QGPA 1B1BA 5LRRA 2CUJA 3D5SC 3UR3C 4N21A 3QTCA 2ESHA 3VYRB 2Q9LA 3AK1A 4C7UA 4AD9A 3FKJA 1SQPH 5L3BA 2HEOA 4DV3B 2HYGD 1OCZB 4B48A 3B77A 5FD5A 3PFYA 2WC2A 3MHHC 3CLOA 2ZJPF 3I4NJ 2R7TA 3CJHB 1FYJA 3I4PA 1VQMV 4FIPC 4LIUA 5B1OA 4XORA 2Q1ZB 4P9PA 5C93A 4P2ZA 2QKLB 3RCOA 2XF6A 3V7CA 1OCZH 3FB5C 4DV0B 3HRTA 1VMGA 3GTKJ 4G28B 2F5FA 4F91B 2VBZA 3E2EA 2QGUA 4L87A 4A6EA 3GZNB 1Y1VJ 1KONA 5KHIA 1U97A 5FB2A 4UY8I 4RB1A 1GN2A 4M9SA 4UV8A 5LL6Y 1F1ZA 2HOTA 2RNJA 4LK0F 3JYCA 3UT5A 5CB4A 3BG7A 3DPTA 4LD5A 3M8AA 3G71V 1D8KA 2NXNB 2NVUB 3IRQA 3BJOA 2IP2A 1IX9A 4JI7O 5F04A 2JTVA 2JWTA 4LFAO 1GXPA 4DR7B 1Y76A 3JTHA 4AYBA 1JJ6C 1D8JA 1QRYA 1VQ5V 5LGNA 4G7HF 3HKEB 3OYGA 1MBGA 4O2AA 4NYKA 4U7NA 4JI4B 4IHVA 1OLTA 2BY2A 3M8EA 1JPXA 1MBEA 1WQ2A 4Y13A 4KFMA 1W7PD 2K4BA 4N4NB 5C4XJ 3LNNA 5HS7A 2BVLA 4BQNA 5GADJ 3G73A 3M99B 4PDRA 3UQ8A 5IP7J 4RQFA 3E35A 1PL4A 3RW0A 4KIGA 4EJOA 2EIMB 2XOKG 1RRJA 3DTEA 2W0FC 2WLNA 3WHBA 1JA8A 3UM7A 2PYLA 2R5ZA 4IL6Z 2H8RA 4B09A 4HV5A 1B72A 5IP9J 4OPHA 4ZHQB 1XNQO 3SYAA 1TW2A 2WLMA 3E8BA 3ZQQA 2ZJQF 4FTHA 2BE3A 2Y69H 4M3FA 1WHUA 2J5PA 1R4NB 5JHFA 2EIMH 2RVCA 1J95A 4NXMB 2F5VA 1R7JA 2ZXHA 2WB1A 1JUSA 3W7UA 3I58A 1PVEA 5KUKA 3NWSA 5FKMA 3ZP5A 4HQEA 2PMZN 1J7KA 1YS7A 1K4DC 1YCIA 2LW7A 3NQOA 1RFYA 2G9WA 1JGSA 1Q1HA 1OCRC 2KSDA 3JD0A 3ZOBA 3PUBA 3VSKA 3IC9A 1N0JA 3D1NI 4GX0A 4Y33A 4JI7B 4Q20A 1SVLA 2IAIA 2R4GA 1JFFB 4LFAB 3I5UA 3N2KB 2F4MB 4CCMA 4FLWA 3ZXSA 4X65O 2PLYA 1HLVA 4CCKA 4J7KA 2EPFA 3FZVA 3CTAA 2VODA 1AR4A 1QQIA 2YIDA 2FQ3A 4G6DA 1LUJB 1BC7C 3KETA 4PUSA 1MDMA 1ZG5A 1ETOA 2BY0A 2P5LC 2JJ2G 3B4SA 2MBFA 2CU7A 4HBNA 1BR4A 1MBFA 3OMYA 4AIDA 3BA9A 4EJVA 2XGXA 2DOEA 2F5DA 3F8MA 3HOYJ 4NTXA 2RREA 3D3IA 2HHHO 1HQCA 5J40A 3GX4X 1MABG 2K02A 4MHGA 2R7QA 1I6XA 5DD4A 1LE8B 1TWHJ 2AXTZ 3AK3A 2CW7A 2ICWG 1XDUA 5KHJA 4TV7A 4BKXA 3HUGA 3WG7H 1TUBB 2HVSA 1RR7A 1VQ8V 1WP8A 3ZHVA 3WODF 3OUSA 3CWBH 3BR3A 3H3ZA 1SEUA 3N2GB 2HKOA 4MVZA 5B1AC 1O3TA 1RIOH 5FFXA 1LVKA 1SAXA 3KP4A 4PJ0Z 3SXYA 5J8CA 1SA0A 1WA8A 5HS9A 4AI8A 5GTIC 1QHHD 5E79C 2IJLA 2BSKA 3CZ6A 1NG6A 4LG3A 3KZIC 4NC7A 4XLAA 3IV5A 1B04A 1BC8C 3TGNA 2GIZA 2ZT9B 3PNVA 2UXCO 3ZRXA 3OOPA 3K3WA 1I27A 5FKOA 3MDSA 3MD0A 1S5LZ 1M57B 3E6CC 1BL0A 1VQ5I 5E8IA 1QVUA 4L5EA 5EJCA 3PO3J 3OAAG 2XPWA 1VQ4I 2LSOA 1BOAA 4BIUA 1UAAA 4ZI7B 4RUEA 3B73A 1X58A 1OJLA 1Y6IA 4X65B 3CCEV 3JAMN 2Y0MA 1GN3A 2ZFUA 5F1JA 3S2HJ 3ASNC 5EGOB 3EUHC 2AS5F 3KLNA 2WA3A 1ZLKA 2VT2A 1JHFA 2ZXWC 3H1IH 1R4MB 4BJ6C 5CA0B 1SETA 3K59A 1R23A 2Z5UA 4UXNA 3LA7A 2HEPA 3L9FA 2I10A 2IVMA 4YIRX 1JHHA 4B44A 1DP3A 1N36O 3H01A 3L2VA 1ZRCA 1WJEA 3ETDA 4JPRA 4HYEA 4FISA 2GUZA 2ARHA 4EEQA 4DV6O 2HHHB 4IQJA 1S6LA 2ZXIA 4S04A 5ILVA 2B9ZA 3QO8A 5EYPB 4X1KA 1RKWA 2VT3A 4A3DJ 2NOJB 3K4MA 3L74H 4GKJB 4L9VA 3GTLJ 4XIDA 2E2IJ 5IJ0B 5L3GA 3DTUB 2NS8A 3QYBA 1UZCA 3BTLA 3H1KH 4ZH4F 1HNXO 3T1HO 2AXLA 2YI9A 2EIJB 1GM8A 1FX7A 1ZARA 3SEQA 5LXTB 2A3QA 5D5VB 2M6YA 5FNVB 3ZCCA 5D8KB 3ETQA 2G7UA 1BL8A 3MQ0A 2DODA 2KISA 2KJCA 4A3MJ 4A0XA 1H9GA 2ZIMA 1IRZA 3QU6A 1BI1A 2VQGA 4XOTA 2K85A 1HP8A 2EIJH 4OAYA 4IOCF 4X1YB 1VARA 2DLLA 1OFCX 4YFNF 4Y7NJ 4ENNA 1YDXA 2RKHA 1ZSPA 2EIKC 1U78A 3FYEB 4DGWB 3E86A 2ZE8A 3ZIAG 1EN5A 2M9HA 4BGDA 4IHTA 2IPQX 2VB6A 1X19A 5HOOA 1G3WA 4GX2A 1ZREA 2CGOA 3C3SA 4HLYA 1POGA 2OCCB 1VQKV 1IURA 1ZAOA 3IH3A 1K8AW 3S2DJ 3WFVA 5DUIA 1FXKC 2B1IA 1QHGA 5HNHA 5IOZA 2JGDA 3L00A 1W0UA 4LWSA 3W7XA 4IHSA 4LF4O 3F3XA 3WTYC 2GBOA 3ICXA 4UCVA 2IS6A 2HFHA 2TCTA 3LNQA 2OCCH 4XLFA 5DEQA 4R8CA 2ZCEA 3ZHQA 2LYCA 3A0BC 4KJZA
chains in the Genus database with same CATH topology
1R00A 1GM7A 1BIBA 3J81Z 4CBCA 3F23A 3WTWC 4Z1MG 1SFEA 2XAGA 2DWEC 4HLXA 1OCRB 2HYFA 1WI9A 3K1PA 4E70A 4PA6A 2IJKA 3VOEA 2STTA 4L0YB 4FJCC 1LJ9A 1AI4A 1WSUA 1QVFU 5FLXZ 1IRFA 2KB1A 1F4KA 3HOSA 2ZO4A 1HKTA 3AG4B 1S7AA 1JXSA 4JTDB 3HOTA 5IY5B 2ZCWA 3CC2V 2Q69A 1W5TA 1FSEA 3LSTA 2YX7A 4DQ2A 1IN7A 3DKWA 2IJJA 3CYOA 4U7DA 4CDGA 2YX4A 1MKMA 4HF1A 4FT8A 5B1AB 4YFXF 1NJIW 3I54A 2QTOA 2ZDIC 1S7OA 1WLEA 3Q9VA 1HW2A 2RC4A 2ZNYA 2CK3G 3RJPA 2DPDA 1JX9A 3C7JA 1BN5A 3VFZA 5IT9Z 2IRFG 1FLIA 2EFOA 3K03A 1R73A 3HHHA 3RKXA 1FBUA 3ASNB 1GO3F 1YW7A 2FU4A 4H33A 2ZXWB 1AROP 4QLCU 3F6VA 4LLLA 3ABLC 2ZDIA 1Q82W 4N9HA 3D36A 4U88A 1VQ9V 5E1XA 1QR9A 1EV7A 4N23A 3MWMA 1PNKA 2FNPA 3H3UA 3BDDA 1MZBA 1GKFA 3VBBA 2L3DA 4IXAA 1KU2A 1V4RA 3C3WA 4WFGA 3V4GA 5LRSA 1R3IC