1H2MA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR INHIBITING HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/inhibitor
total genus 105
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2mA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2mA01
2ILMA 2CGOA 2WA4A 4NR1A 5JWPA 2YC0A 3D8CA 1IZ3A 3P3PA 4B7EA 4QU2A 1H2MA 2WA3A 4AI8A 4B7KA 3P3NA 2YDEA 1H2KA 3OD4A 2W0XA 1MZFA 3KCYA 4BIOA 4Z2WA 1H2NA 4Z1VA 1MZEA 2Y0IA 2CGNA 1H2LA 4JAAA 2XUMA 3KCXA 1YCIA
chains in the Genus database with same CATH superfamily
2Q1MA 3CJIB 5JXJA 1XJAA 1C1FA 1V54C 2IBZH 4LHSA 4JHTA 1IXMA 3IIAA 4B7KA 2XKOA 2JJ2G 3IFXA 2GNMA 1CQ9A 3V64A 4XMIA 2XHBA 4I0WB 1RGSA 2D6KA 5L7OA 3ACHA 5EV7A 3J7LA 2WLNA 1K3IA 1HNZO 2OUJA 2HYXA 3ZSLA 2VWJA 5KA6A 3T4VA 2DWDC 1VF6A 3ZHQA 2E5LO 4I02A 1JR9A 4DUYB 4FFBB 1FNYA 1HV0A 4JCKA 4CCLA 4AQ2A 3HEIA 1LRHA 1W3VA 1HRI3 4I55B 4DR3B 1XMQB 1V9U3 1W2NA 1XOYA 5FUIA 4PDMA 2J1UA 3N4MA 5IYZB 1PD3A 1I94O 3O1PA 1OQEA 3KQ4B 4J25A 3ZS8C 5DQ0A 1UD1A 4KU8A 4R8CA 1OC1A 5GZEA 4JZRA 4JI1O 5FMCA 5CFDA 2DYCA 2XVGA 4FLVA 4K0KB 3ZSJA 1OV9A 4FLUA 3RT3C 1IS3A 3ST7A 3ILRA 1UZ0A 2C0ZA 2D93A 5A9GA 5FY9A 1ZLZA 4XPVA 4CC6A 4QU1A 3VBUA 4B4QA 4XURA 4Q8LA 1PK6A 2JG8A 4COUA 2P5OA 2Q6AA 5JOZA 3VBSB 3VBRB 1QF3A 2WLIB 3ZMUA 2HBUA 3S5AA 1K5MC 3KCXA 3RVZA 4J7JA 1VQKV 4LFCO 3CEWA 1RL3A 4Y5Z0 2KB1A 3IDEA 3ENRA 5I91A 4CDWB 1NTKH 1W59A 3T4ZA 3LE0A 4XJ9A 3FB6C 2A3XA 2BGOA 2VAUA 2A70A 4J9YB 4HKOA 4U3JA 3ICXA 1D0HA 4AI1A 3J7AU 1QJU1 2JICA 1AYN3 2IJHA 5C9AC 5E89A 3LDBA 1SHWB 2W91A 4QQLA 2O14A 3N2KA 2D40A 5CKMA 4J11A 2PAEA 4K3UA 3AG1C 4XJWA 5LRRA 3EXUA 4X62O 2Q9LA 4Q0SA 2VZOA 3M3OA 1VQLV 4XBQA 4XUOA 4PA6A 4RFT0 5I8YA 5C70A 5IK5A 4IE4A 5FZGA 3DC5A 5IAVA 1V6OA 4EE2A 4GALA 5FYBA 3LAGA 2GMMA 1VQ4V 1LENA 2FCVA 2NLJC 3JD4A 5CFCC 4HOOA 2X10A 3PL0A 1QU0A 4FFFA 4CCCA 3ZN6A 5KLVH 5J96B 2CK3G 4I0AA 1HJFA 1ZRRA 1WCDJ 1VP6A 1W6MB 2UU9B 2HWF1 5IJ9B 4LFAO 1TME2 4OYUA 1GN2A 4DUZB 3OPTA 4DUXA 1PVXA 2JGDB 3JAKA 5T52A 3CMEV 4BHPA 2XOMA 3J7HA 2DBNA 4NTYA 2PHDA 1VR3A 2B45X 1Q8QA 5F3CA 5FO7B 3RZJA 4FP3A 2PGGA 4J6GA 2CAVA 4DV6B 3JB4C 3MIBA 3V65A 1O9GA 3O1SA 1YJNV 4QPGA 2RMKB 4LQRA 5CBGA 3O1OA 5FKCA 3CZJA 3U4SA 4FMTA 1QBZA 3FX7A 3DC6A 5LGTA 3SJQC 1ORQC 1AJQA 4OI4A 1LOAA 2E53A 2RM21 1Q5OA 1XU1A 3L2HA 1VALA 5GLZA 3LDEA 1VBC1 3VBHC 5EFUA 2CYFA 3DPRA 1DK1A 4Y20A 4XDOA 1AX0A 2W95A 4Z1MG 5FZ6A 4FLXA 3H7JA 5AG2A 1F15A 4DUYO 3ZSMA 2H94A 1H8TC 4IEQA 4YFWA 3UNPA 2WLPA 4MTOA 3HMYA 2ET7A 2PA7A 1MA1A 1MZFA 4DO2A 1RHI1 3TEYA 4AVCA 4DR2B 1XMQO 1QR9A 4LXLA 2XJRA 3KZIZ 3RGBA 4RS5A 2Y6FA 2ZBJA 3N36A 1URXA 1XL4A 4WM8C 3VKNA 3E86A 1W8HA 3VDDC 3S57A 5L19A 5JMCA 3IKWA 1JVMA 2RMU2 1WLWA 4K0KO 1RUH2 1P49A 4R6ZA 3K75B 4P9LA 3GJBA 3KF5A 2EXJA 1VQMV 3KLSA 1QJU3 3WF0A 4MW3A 1YJLA 1WW5A 5HCAA 4YJ2B 4TUYA 4CDXB 3IC9A 5FYUA 3WF3A 2WLKA 1A34A 4CDQA 2NQYA 3WDUA 2VO5A 3HIFA 3N7KA 4AYUA 1PMHX 4HG6B 3T08A 3E89A 2YGMA 2YICA 1I08A 2GNBA 1XUQA 4G27B 2Y64A 3B00A 1NXD1 1SCRA 4WZCA 4L2NA 1US6A 2CL2A 2WR9A 1YITV 2HWD2 2L9LA 2YUAA 2ETNA 2CHHA 1DBNA 1NR7A 4LNUB 3M4FA 2RJZA 2RS12 1VARA 3V0AB 1C1LA 3B7MA 2I45A 1LHWA 1NH2B 3HOBA 4CRQA 5JH7A 5HI0A 3KV5A 5IWAB 2V09A 4BQ5A 1F31A 3WB0A 2PN5A 4QXBA 5AVAA 1MG1A 2VZRA 1I5PA 4PD4F 1JUIA 3C90A 2VR4A 1AJKA 4P08A 4FAHA 4OZXA 4Y3OA 3GB7C 1FOD2 1OFNA 3WQ1A 5FZ0A 5CG9A 2XJSA 2GBOA 5BMVB 5FRAA 1CIYA 4AOCA 4J80A 1PV0A 2FMDA 1W9YA 2RE9A 4YNIA 3T0BA 2X09A 2Q7HA 4BZ4A 2GC2A 4DV7B 1XHXA 4X1YA 2UU9O 3KHBA 5CA1B 5J98B 3AZXA 1UPSA 2ZIMA 3BU7A 4DUZO 2RN9A 1DQ4A 3ZKUA 2KG7B 1H2MA 1XE7A 4UFZA 4ZU7A 1HV1A 2X5IC 2EBOA 4XQ4A 5KHGA 1VBC3 3WCRA 2FKXA 5EZYA 3SLIA 1VMGA 3BYWA 4BK5A 3RWKX 2R062 1S0IA 3DKWA 1YLLA 1IBLO 2A6ZA 2GNTA 4MOAA 4IV1A 1Y66A 3ASNC 2W0XA 3GVMA 3OFNG 5FY4A 1FMD1 5FR3A 1IS5A 4YYOA 4FVMA 1H2LA 3RG0A 4IGPA 4COWA 3MF9A 4GH4C 3FC0A 3MW3A 4EN7B 5KAFZ 2G19A 2ES3A 1SG3A 4WF9V 5FJHA 3THPA 1UMHA 1JZ3A 5KHHA 5FYSA 5C4WB 4JTCB 4EN9B 1WUVA 4MXVA 3UK9A 3OGIB 3AP9A 2V7QG 1YQ6A 2Z0AA 3NL1A 2D6NA 1ULCA 2VG9A 4FXGB 5C8YB 2Y0PA 1HB2A 4OHYA 3KM5A 3K51A 1QMJA 3RS6A 2AC1A 1W6QA 2XKPA 2OPKA 2UXDO 5FZOA 4DR2O 3NRUA 2WFF2 3EYPA 3U4XA 1Q8OA 2HHHB 1O9HA 5DEDA 2OTJV 4DMIA 4P02B 3ILFA 4NIHA 3N9OA 2EXKA 1K4CC 1SZTA 4IT5A 1UKRA 2UXNA 4I0XB 4YVSA 1QQP1 4YVWA 1QJEA 1QNWA 2OZJA 3MDPA 4ONUA 2WRAA 1QY4A 4QPIA 2WJSA 2MK3A 4MGZE 1AHSA 4BLIA 3EMRA 3GBGA 2VL4A 4MTXA 4TYSA 3RYCA 4KFMA 5CA3A 2GSMB 2A6WA 1ND3B 4AR2A 4QB2A 1R3IC 1LGCA 4GULA 1NI8A 3GF6A 4HSJA 4E27A 2E31A 5B1BB 4FOQA 4NIIA 1VBD1 3QF7A 2YC0A 1GMMA 3ZXAC 3DGTA 2BQPA 1VBB2 3AG2B 2RS31 4D6RA 5DN6G 2TEPA 4LEJA 1ASJ2 1OMIA 1YFXA 2KKWA 3L73H 1VRH1 5ACA2 1YIFA 4Y1XA 3FHQA 3B69A 1XEQA 5EK0A 1CONA 4OZOA 2VQUA 1JOPA 3LWCA 1W05A 2JKXA 5A6QA 2I74A 3K48A 5BPXA 3AX4A 3CCMV 4K8RB 2QQIA 4NHLA 4RWUA 1FFXB 5IWAO 3I2IA 1EY2A 1PGW2 5C93A 5L3BA 4J7KA 2F17A 1A78A 4OFGA 1O8SA 1COV1 3ZDSA 2BBVA 2B1GA 3H9VA 5H5NA 2LO1A 4O9EA 4LH7A 5EYPA 3GM8A 2ETEA 3VDAA 2QKDA 3P6BA 4ZU5A 1FS0G 3TWIA 3ZFGB 4X1KA 3PIJA 1F9KA 1FNZA 3WP5A 1MR5A 1FMD3 3M8LA 1Q6HA 2QSAA 5DUWA 4DV7O 4NHKA 1X50A 3K08A 1OBNA 3E22B 3H1YA 3UETA 3VLBB 2QWQB 3B93A 1NAEA 3UT5B 3IJ4A 3PHMA 3AKPA 5B66Z 1PGL2 2YI9A 1DGWA 2E75B 5IK8A 2JS5A 4DR1B 4FSJA 2Q7GA 4GX2A 4YGEA 3DYOA 4GB31 2HWE1 2YIBA 1WBLA 3NJXA 4UF0A 2BJSA 4FM1A 2CH7A 4G2KA 4QKDA 1GANA 4L8QA 5C71A 2EIMC 2DCJA 5DMYA 4A3ZA 1YDXA 3PIGA 1DLLA 4YW3A 4FLYA 3ABLB 1JOBA 5FY7A 1RXGA 3IAYA 5KXBA 2RDNA 5F1RA 4AEDA 1SLIA 4W8JA 3UO3A 3BVOA 3MUZ1 4FM0A 4MADA 3FE5A 2HKOA 4Q26A 4E4DX 2W3JA 3CCRV 2ZE7A 4QMAA 2D97A 4Y22A 1WP7A 3NNGA 1FX5A 5LYJB 1R092 4GZRB 4NWVA 1XI1A 1JBCA 3AXEA 3OBRA 2R041 4XEZA 1OCZB 2XL9A 1CAVA 5HXVA 2D43A 2OWOA 1NLRA 5L3FA 1QLNA 1KITA 3P1IA 4E8DA 2JK5C 2X0LA 5L7OC 1JI6A 2CUGA 2HHHO 5BY1A 3BA8A 4PJYA 1ULDA 3AG4B 2WFPA 4PBPA 3RZHA 2FMLA 4IHJB 3S7IA 2I2SA 2GDSA 4BQ4A 1K4DC 4P5HA 5K1PA 4KL1A 1VBD3 5FK7A 4P2ZA 2RS33 3CMGA 1KDKA 4LBQD 2BCCH 2WSSG 4PF5A 3OTOO 3NKTA 1WB8A 4JI8B 5GW7A 1UY4A 5T55A 2ZDIC 1PX4A 1A8MA 2LUWA 1C28A 1BGYH 4S2GA 4COVA 1UOGA 1Q7YW 1WCUA 2PHXA 4CEWA 4Q4W2 1QJY2 4BQ3A 2ZCEA 3HKEA 2A73B 1R6TA 2XUEA 4MYEA 2B8MA 5GLUA 5CBLA 1VQPV 3CKHA 3VBUC 3WEZA 1SERA 4DFSA 4DR7B 5BZBA 1DLCA 2IVIB 3MF6A 1PO12 4AQTA 4I55A 2K2SA 3VKLA 4AVAA 2HJFC 3M3CA 4XIKA 5IYZA 2W68A 4NPMA 3SH3A 1K5SA 5LGNA 1GNZA 4W6YA 4JV4A 1LHVA 4F7ZA 4IE6A 5FO9B 1EZVH 3ZSKA 5IDJA 2IFWA 3POFA 3DF0A 3WHTA 1I3HA 1QHTA 1RPRA 1P8JA 4D94A 2CE4A 5LP6B 1LNSA 4NXNO 5F3IA 1NCRB 4C7UA 4FTBA 4DXSA 1KFUL 4FOYA 1DZTA 5C3SA 1U0AA 4GB33 2HWE3 3STZC 1UOFA 4LF8B 3ZIAG 3LIGA 3LZZA 3VBRA 2WLIA 4GMP0 1QXRA 4NXMB 1WLTA 5EC1C 1VQ5V 5C8WA 1IURA 1ENSA 5JQGB 2Q73A 2WUHA 4WFFA 2FQPA 3WDXA 3L71H 3APOA 3D0JA 5FZ8A 3PMEA 3ZVXA 1XE0A 3B09A 4DR1O 4MX3A 3CP1A 3MD0A 4MHUA 1AR72 1N3PA 4AVVA 5A7NA 2B5UA 3SPCA 4FI9A 5F32A 4O61A 1TVKB 1RSOB 4FPFA 1V00A 2OIGA 3O9OA 5J37A 2XAQA 2ZKNA 4AAXA 2PZSA 1HDKA 2R043 4ZONA 4XACA 5JVVA 1BMFG 5LHGA 1MPXA 4YG0A 3EO6A 3T4DA 3W7UA 1RIRA 4KBZA 2R1DA 4ZBMA 5I0UA 2YXHA 3T1YB 4Q4X3 3T2PA 3OGGA 1KUQA 5A3OA 1RJ8A 1QJFA 1IKQA 4CH5A 1TVGA 4KP4A 5B1NA 3W9AA 3BTXA 2H6CA 1W2AX 2XAHA 3GZAA 1AL21 2G38A 4DRXB 1W6MA 3OF1A 3OJBA 5IJ9A 1RP3B 3TK1A 2JGUA 4UCTA 1A3KA 4B08A 3SHRA 5JIAA 4FFGA 3VD4A 5GLTA 2DCTA 1PIV3 3J4UH 2ZGRA 4YWAA 1G9AA 1SLBA 1V55C 1UMZA 5B2GB 3S7EA 2GDFA 3F95A 1S2EA 5SV5A 1WLDA 3SXWA 2Z3YA 5LGUA 1JH5A 3ZKYA 3SPIA 5ANQA 1YJ9V 4QJFB 2RS51 4QB1A 3VBFC 3O1VA 4P9JA 4LR3A 3UM7A 4CCNA 4AILC 4O2BB 3AK3A 2ZM6B 4RS5C 4JI8O 2VJXA 2E9QA 5LY2A 4XDJA 4NE9A 4GCZA 4KWLA 3PJSK 5LBCA 1SZBA 1G4YB 2CWSA 2GMEA 1PVC1 4I0BA 2X6BA 1MS3A 3HAGA 1HB3A 3FUQA 4XQDA 3L72H 4HN1A 1HXS3 1Q8SA 1US2A 3ZLIA 2MW2B 3AJYA 4HN0A 2ZEWA 5DAPA 4DR7O 3GCXA 1UFIA 4WM7B 4YZ4A 2PHRA 5LY1A 2RR11 1SKVA 3JD72 4F6RB 3CNAA 3N9MA 4LO4B 5IVYA 4CDQC 4LO7A 3ZXJA 5JDBA 3PJYA 5A3WA 3FKSG 3IPVB 2GHYA 3BVCA 1PMIA 2YXSA 2BW8A 4Z2AA 1POV0 2Y38A 3MLJA 3I4IA 4PIZA 4TLGA 1ZZ8A 1QVFU 3BY6A 4QM8A 2WNVB 4TLFA 1UMIA 1AI6A 4OHXA 3IN9A 1HRI2 5A32B 1V9U2 2VE1A 1XNRB 3WDYA 3CLPA 4FPKA 5GM0A 3NAPA 4YJ2A 2Q1ZB 4MLOA 4JRLA 3HBKA 2W08A 3LEGA 2QE3A 4F4LA 2VZ1A 3OMAB 3MIEA 2ARCA 5FDBA 3E5QA 3JXSA 4NXMO 3RI9A 3FWEA 1V6JA 1DYPA 1RUI1 4MHRA 4CCDA 1V6LA 4YHHB 3DKQA 4UW4A 4WBNB 1JZ7A 2UUCO 4AWDA 1XNQB 5AVPA 2PHFA 3ZYJB 3K0DA 4N53B 4Q6GA 5FTTC 4AK3A 3OPWA 5JOXA 1SQPH 4WFGA 3A0HZ 3QOPA 1AL23 3NJYA 1ZZBA 3HNYM 4JI4B 4AVTA 3I3EA 2VOXA 4O4HB 4ZHQA 1KB9F 2E7QA 3FLTA 1DZQA 4BXSV 4BAYA 4UCSA 2P4EA 3IAQA 4DV1B 2XR4A 3T1YO 1W3XA 3R65A 4X20A 1JZ6A 2A71A 5BNPB 1FXKA 5JLVA 3S3XA 1OJHA 1AYN2 4A7YA 3ZHVA 3VV1A 1SLCA 3DXTA 1ZBA3 3MPBA 4LA3A 4Y5TA 1REFA 2OCCB 2RS53 4KGGA 4TQDA 2OX0A 4HMZA 2EJRA 1L7LA 2IXJA 3PMSA 1UO9A 3OBZA 4WFBV 3EBRA 4Q27A 5I0TA 2Y6GA 1QVGU 4DR5B 3M3IA 2W52A 1KEXA 2KG7A 5F2VO 4UB8Z 1PNGA 4AF9A 1GAXA 5FZBA 3ZFGC 3ACFA 4YM3A 3G4SV 5ISLA 2ZIOA 1JA8A 1BK1A 3SYPA 4BDVB 5JWPA 3D3QA 2MNGA 3RMXA 5IVCA 2HJDA 1LOBA 1JMUB 4ZZ8A 2HEVF 2BTVC 3MICA 2YIAA 1UU6A 1E5IA 5JZGA 1NCQB 3HR9A 2ZM6O 5C8CA 3JD2A 3AC0A 4MGTA 3ZYFA 3RVYA 1YNAA 1E57A 5FY8A 1AVBA 5C4WA 5KX5B 4R52A 3U78A 4LFBO 5IK7A 1IS4A 1UIKA 3VB9A 1XNDA 3MV11 4YVSC 1REEA 4YVWC 4MXWB 1IPJA 3P30A 1Q8VA 2Z42A 1C57A 2OS2A 4CC5A 4G4FA 3ABLC 3HT2A 5A33B 1QU7A 1OLMA 3WNOA 3CU7A 1ZA4A 3ABKB 3WB2A 1JUHA 3VHOA 1XOUA 1DQ1A 2XGXA 4KH9A 2XWJB 5KC5A 2PF4E 3PLQA 2C9KA 1NOVA 2IU3A 3VZOA 2P5BA 3V0BB 1V0AA 2ENRA 1RUI3 4LBMA 2ZEXA 4GKXA 4JYYA 3Q8FA 2Z4FA 3VUOA 2PELA 5FNVB 5GLVA 1JHJA 4IEUA 2WLLB 4D3WA 1CGPA 1XNRO 3AG4C 3ON7A 1HQWA 3LKJA 1LHOA 1G6UA 4J42A 1EUTA 3DL3A 1GU3A 3U1XA 1MS8A 2FDFA 3USUB 4AI9A 2W1SA 4MVZA 1ND3A 2FDHA 1CEZA 2EILB 3SCGA 2X6CA 3DGEA 5DN2A 5F6LB 1YQ5A 2XJUA 2ZHMA 4YHHO 2HYKA 1UPGA 2MHFA 2EINC 1IVSA 1QJU2 1SFNA 2BTOA 3UV9A 3MIGA 1OOPA 1VQNV 1W8WA 4UWDA 2PY5A 2Z79A 3NQHA 1QLEB 3CHXA 2BTQB 4CXWA 4ZKTB 1PNFA 1S0CA 1E1RG 4YM2A 1O4TA 2Q8DA 4I7ZB 4FM2A 1Z0HA 2EIEA 4R4ZA 4A2UA 1Z2GA 1GOGA 3BCWA 4LBQB 1LOGA 2JRIA 2QQPA 4M0NA 5FLJA 4AGGA 3THTA 1YEWA 3MZHA 4B1LA 1DDLA 1YJWV 1ODMA 2DJVA 3GBFA 3T1HB 3GHMA 1SA0B 4L99A 2HWB1 4I4TB 4Z07A 2B9ZA 3LOBA 5K0UB 1G9BA 4AFAA 4NROA 4ZIBA 1UKGA 3WCSA 4JGYB 1NCRC 1Y67A 5EBWC 2V4DA 4IGQA 3L70H 1NVPD 4AEDC 3UT5A 3U11A 1FPN1 4JDNA 1O4ZA 1NTMH 4DV3B 2L35A 4AHZA 2XJPA 4ATEA 2F6BA 5LEJA 4GKKB 4IEVA 5KXEA 2VTFA 1RUD1 1LR1A 1YC61 2TNFA 1QNMA 3NXSA 4HXCA 1I5YA 1M57B 1B09A 3RYRA 4Q4Y1 5FZMA 4J10A 4DNYA 5A3PA 1BHAA 3I2JA 1WW7A 4LITA 2J1EA 1MQTB 4YJ3B 5A7PA 3N27A 4XW3A 5FPOA 5BYNA 1OPMA 2QQWA 3ZFEB 5FYCA 2GU9A 3BOPA 3MHHC 1ZZ7A 4PQQA 3DYPA 2JIZG 3HJRA 5LYJA 3POGA 4XCBA 1QEXA 5EC2C 4XFHA 5IE9A 3WNXA 3CYOA 3IDAA 1KP2A 2EIJC 2BOJA 4CEYC 1REDA 1FJGB 3GCWA 2OXBA 2VC9A 1WNSA 4IE7A 4AFMA 1VF5B 5IVFA 1YI9A 1ULOA 4CEWC 2JECA 4P00B 2A9HA 1EYBA 2QQUA 4RQFA 4B3MO 1Q6UA 1SLAA 5FZAA 5A7QA 4IHJA 3GHNA 5HV0A 2OQ7A 4BW5A 4XFIA 3AZYA 1GZ9A 1JW6A 2R072 5JCOC 3TNQA 4QM9A 1LGNA 3DXUA 4XQWA 3E5UA 4URTA 3IMMA 2Y8KA 4BM8A 1JCHA 3LPFA 4JTAB 5FYVA 3OY8B 2Q4SA 4O4IA 4ET7A 4U36A 5ABJB 1S76D 1OUSA 4QKFA 5A6ZA 1AL0G 2BVVA 5EPAA 2W6JG 5HPOA 4ZXKA 3RYFB 4HBNA 2EVXA 2NR5A 1PGSA 4L11A 3OG2A 4IL7A 4S2FA 3CF6E 4BIZA 2YI8A 5LA6B 1AJPA 3VHPA 2FYUH 3OR7C 3C7FA 3VZJA 4LF5B 5FPVA 1KU9A 2LRPA 4UYBA 3FBMA 1UAIA 2BYVE 1UQXA 2XG3A 4QX0A 2FDIA 1CAXB 1F4HA 1YO8A 2X6AA 1IG0A 5JOYA 3N7JA 1TA8A 2HWB3 1D5AA 2P6CA 5BNNB 2PUSA 3ZBHA 1AR1B 5LOVA 4A41A 1LOCA 1P7GA 5FUNA 1YFYA 1CX4A 1HB1A 3O1UA 3USSA 1RMU1 4AHWA 4ZHNA 3TEZA 1BCCH 1FPN3 4GIQA 1XBFA 4NMIA 2XUMA 5LP6A 1AI4A 4IGGA 4JX0A 3I2HA 4KU7A 4BWOA 2VZQA 4C90A 4GYCB 4GZ9A 2R72A 1H2KA 3HWJA 4ASLA 3T1HO 5TSWA 3Q8CA 4YXWG 1M56C 1FV2A 1RUE3 4RO2A 3JYCA 4Q4Y3 1N32B 5FK8A 3LEIA 3LNNA 4GKYA 3FLRA 1F4AA 2F1MA 3ME2A 1ULEA 4N23A 4JGZC 3UKNA 5L3EA 4DV3O 3DV8A 1CZVA 2VW0A 1FMD2 5ITZB 2YSUB 4ASKA 2C4XA 1IGOA 5L9BA 1NY71 4Q0PA 1DGWX 4Z2WA 2KQXA 4XBLA 4B3NA 1GQPA 3BFRA 1M4UA 1CZTA 4XXAA 1ZNPA 4ZU4A 3ZPYA 3EVKA 1EFRG 2H8PC 4N53C 4PLMA 2WSUA 1ZSPA 1FV3A 1OCRB 3WG7C 4K21A 2OTLV 2P6HA 2MPFA 2ZXWC 3C7EA 1O3TA 4JAUA 5F3EA 2ZE8A 3FN9A 4EB6B 2WNUA 1V6KA 4LBEC 3GZUC 1PO21 3JARB 2ILMA 2XAGA 1AYM3 2JS3A 5A1FA 3H8UA 2JDNA 4A5UB 1JN2P 4OULA 4YLZA 2XQXA 3HQUA 4UAPA 1K97A 2QQJA 3POIA 5BNPC 1FJGO 5FZ7A 4GXLA 5I93A 3KQRA 1U5ZA 3OUIA 4ZOLB 2WL1A 2OCCC 2V5DA 4MZUA 3AEIA 1RUC2 2UYBA 1G86A 4YW4A 4CPBA 2E63A 4CDUA 4F6EA 3ZFFB 4BMEA 2QDRA 2WLQA 5CBHA 3UO2A 3HKBA 1GP4A 4GWMA 4UW5A 4BYYA 3WF1A 2QZ3A 1JZ2A 5DUXA 1XILA 4QQ2A 4YZ1A 4AVSA 4YW5A 2YXLA 3WF4A 1TNRA 1V54B 1IBMO 3CCLV 3THCA 3A4UA 1LECA 3D82A 2XWBB 2VZPA 4O9GA 1VBD2 3J8F3 1C8M1 4RQEA 2RS32 2XONA 4ORFA 3CX5F 1NCQC 4HAMA 4LF5O 4FAGA 1RUG3 1VQ9V 1PZ8A 3NNFA 1CJDA 5CADA 5D21A 3WQ7A 4GX5A 2PHUA 3BIWE 4XFGA 2FB5A 4WM7A 4TSVA 1SQBH 2VUDA 3C7OA 4BQ2A 2YB7A 4I5SA 4DOUA 4LKSA 2WINB 2ZINA 1UIJA 2Y6LA 2VZSA 3IPVA 5E8AA 3WW1A 1GLHA 1YI7A 1GRJA 3TN91 1S3JA 1F35A 1Y3TA 4MO3M 4RD7A 4K40A 4WBBA 3RSJA 2FL4A 5IATA 4Q29A 1F2NA 4LUMA 1NA1C 3M3QA 4XF4A 4H37A 1L1FA 2VQAA 3WDVA 2E7AA 5A32A 1F5JA 4FPPA 5FP7A 2GN3A 4DV4B 2BFUS 2K9ZA 4LBLA 1F5FA 1JYVA 4OUEA 4H44B 1QDCA 3CJHA 2QQMA 2ZGMA 3FB5C 2QVSB 1JFFB 5CEHA 1J84A 1N32O 4XABA 4EN0A 2A7AA 1K5MB 4W6WA 1BYHA 3AFGA 3AYDA 4HSLA 3N7LA 3SH4A 1PHMA 3FHAA 2VOTA 4TV9B 2YG0A 3A0RA 4U7OA 2UWBA 3RQ0A 2HWE2 3N7MA 4H14A 5K7PA 2HWC3 1YUDA 1QJX3 4N21A 5C9AB 4O4HA 1RITA 2ITDC 3THOA 3L9JT 4W6XA 3BEHA 1KMIZ 5FOJB 3MFAA 4YPJA 3AG1B 2HLDG 4DV5B 3D0SA 4QPYA 1HR0B 5EIYB 2HEWF 1WCKA 2DVAA 4XFCA 4CVUA 1SCSA 4IEPA 1G9FA 3WUDA 3T2QA 2IU0A 4A4AA 4PA9A 1VAVA 3ORJA 1OURA 5CFCB 4H0LB 1WD3A 5FBJA 2F93B 3ZEDA 4PDWC 1COWG 4AE2A 2H0VA 4GA9A 1R081 4OMDA 1S1AA 4JKMA 3JD3A 5C8CC 1DLBA 4FPLA 5F8PA 2XB6C 1VB4A 2VQTA 2GSYA 4Q4X2 2BGPA 2TBVA 4XTMA 2LP7A 1FI2A 5F3GA 2XMLA 1LAJA 1MSWD 1W0JG 2XL7A 2VZVA 4PA4A 1PNLA 2ORZA 3MLLA 3ZXKA 5BXXA 3WOGA 1MS9A 4SBVA 4DS0A 1ULFA 2IZWA 3SYOA 1K5JA 5KR7A 2MEV1 4IGOA 1GM8A 2FDJA 4AAPA 1PIV2 2V4AA 4WFHA 3R4DB 3T1MA 3LPGA 4JYCA 1PP9H 4B4RA 1K7DA 4H7LA 1ZAUA 3TN93 2VMDA 5KX5A 2YBPA 4WV8A 1P4RA 5C3RA 5D1IA 3CIHA 1OLRA 2WZ8A 4XBFA 4LO5B 3WG2A 3VBHB 1YYNA 4MXWA 5FYMA 5DECA 2X7RB 1SQGA 4LJHA 1OLQA 5A33A 2PLV1 5FJKA 1H8TB 1SFYA 1GOHA 1LESA 2AZ2A 3CMAV 1NVPB 4LO8A 2R0HA 3D36A 3FD9A 3ZR5A 2ZHLA 3DUIA 3B5LB 3W7WA 1G7YA 3ZFEC 3V0BA 3UKVA 3KF3A 1CAWA 1NS1A 1RXFA 4NJ4A 1HXS2 3JSNA 2ZX4A 2M6YA 5EWSA 3VDDB 1NE6A 4MGIE 1W6OB 2HR3A 2B5HA 1D4VB 3LIHA 5I0RA 3GZTB 3OPZA 5F2SA 3M7AA 3W20A 1JYXA 3C8XA 1E5RA 2WLLA 4IYIA 2D6OX 2GAUA 4H13B 2Q68A 4AEKA 3WV6A 4DV4O 1R1A1 3G71V 1CPMA 2B9UA 4RFRB 1G9DA 1RC6A 3ZJZA 1BMV1 5FYHA 2IFRA 1AR5A 4EJRA 1FYJA 2EZOA 1SRYA 4AHYA 5FKBA 1KS5A 2Y48A 1M4WA 2ATKC 4K8XA 3HKDB 3R4SA 2QWRB 3H8OA 1NKGA 2LW7A 4Y26A 5FZIA 4P9OA 5FREA 1GZTA 1XC6A 2WYFA 1V6IA 1YXWA 5LBBA 1OSGA 2BTQA 5CIRA 2UWAA 1GBGA 2G9FA 3OE7G 1R083 1AR62 2Y34A 3SH5A 3ML0A 4Y5SA 2EA7A 3WDTA 1S5LZ 4DV5O 2QZ2A 4BJ0A 4TXWA 4JAVA 5FZCA 4C1XA 2XBO1 3ZMZA 3AP5A 1CXZB 1M90W 2Q8OA 5AC92 5BNNC 2D2CB 5C7GA 2DYSC 1IPKA 3CL1A 3H1WA 2RJKA 3I3MA 1AL22 2OA2A 2PI4A 4Q20A 4NN0A 4EFBA 2FHRA 3W58A 3D8CA 2IXKA 5C3QA 5FP8A 3CXCU 1TQ5A 3BALA 4IIJB 4LOTA 2Y4UA 5LMUB 3FHIB 2ARBA 1WA8B 1C4RA 4F8AA 1BCXA 1DYOA 3CDZB 4JGYA 2WLMA 2P67A 4EEQA 5G05L 1CESA 1N47A 4AHXA 3PNAA 3CS5A 4QQOA 5CA6A 1VAKA 1W28A 2X5IB 4CXYA 1H2NA 4WVWA 5FPAA 4OHWA 1ZBA2 3AKQA 2ZZJA 4IEWA 2HEPA 5T5PA 1K33A 4N90A 1NR1A 2CV6A 2N7GA 2OYQA 1W0PA 3ASNB 2PLV3 1JS9A 3SGIA 2YS8A 3AJZA 5AFEA 3NJVA 1UXZA 2QQNA 3E2EA 2VXRA 1J5EB 1WCQA 1T5EA 4GH4B 3D3IA 4EZ4A 3ZYHA 1ZZCA 1QQCA 1AJOA 3STLC 2D3RA 3F7YC 5GLWA 4FLWA 3KSCA 1MQTA 1FXVA 4YJ3A 1GP5A 3ZMSA 3VGIA 2W2IA 4P9WA 3SJBC 1PX3A 1Q6IA 4F83A 4LO6B 2Q4PA 1EBOA 1YQ2A 1FD9A 4P5YA 4DV2B 4E4SA 2PXJA 2AH2A 4JZ2A 1L7RA 5F37A 2UUAB 2ADPA 2DCKA 1JZ8A 1R1A3 1XDCA 3HKCA 1Y76B 1ZRDA 1GR3A 1S4CA 3H1LH 1B35C 1NQDA 3PURA 2Q8VA 2JDMA 4Z92B 3BGAA 5GZCA 4D7TA 1OQDA 2ZE5A 5T54A 3TB0A 2BRTA 2EZPA 4LFAB 3C3SA 2EIKC 5A3MA 1UYZA 3NJZA 1VRBA 5CA0B 3UT0A 4F3JA 4ES8A 4KMQA 1T6GC 1ULPA 1GWKA 4PV1B 3ZHTA 4UUJC 5FYZA 3SMHA 3W7TA 1I6XA 3K9SA 5LXTB 1DIWA 3I97A 3INAA 4H3WA 2OZ6A 2IH3C 3VDCA 2AW9A 3VQYA 3CCVV 3OTFA 1UZYA 1RUJ1 5ABJA 2IW5A 3F5WC 3AZWA 4IQPA 4BR6A 3KGZA 5FYIA 4RGGA 3ZFFC 1OUXA 3TGUH 5KHIA 3THDA 4ISRA 5LA6A 3LA3A 4QDQA 4LIVA 2VPVA 2XBO3 1URFA 4YZ5A 2RMU1 4DXTA 1CX1A 5LBQA 5D8AA 3AL5A 3Q4HB 2KM2A 1RUH1 1YZBA 5KAIZ 1EV13 4LBKA 1CAXA 4LPLA 4Y1UA 2VMGA 2A6XA 3UGFA 2VULA 2WNEA 2WZR3 4FPJA 3LCPA 1GQHA 4KWUA 2BPA2 1PM4A 4QPJA 1IQDC 1GYKA 1D2DA 1H6XA 4DY3A 1NJIW 5FUPA 5JUVA 3VBBA 3ZHSA 4BB3A 4CP9B 5L9VA 1ZZ9A 4LF9O 4CUBA 2EX3A 1GUIA 2VUJA 4JTNA 5FCCA 3ZN0A 5T3NA 2IM9A 1UNBA 2HWD1 5DM6V 1N1TA 1SESA 4IEOA 5A2QN 2PHLA 4PBOA 1WAZA 3JQWA 4MW8A 1AXZA 5GTIZ 3JAWB 2G9GA 1N1YA 4N9HA 4UW6A 1SEFA 5L9RA 2RS11 3CC2V 4HNAA 5J2UA 3EFFK 5LMUO 1YF2A 3IIIA 3VZLA 4N8MA 5EP9A 1E1QG 1W0KG 4XMAA 4ZI7B 5HXMA 2WNUC 2K0GA 5F7UA 1YFUA 1W6NB 4TZDA 5FOBB 5A1AA 4Q2FA 4YZ3A 2P37A 3VL8A 5ITZA 1O59A 1FAYA 3W7SA 4HFSA 1S0VA 4JTDB 3JASB 4ABMA 2BVBA 2DYRC 2VXJA 4R9DA 2X53S 4W65A 2DCZA 2NN8A 4DRRA 2IXLA 1F23A 1Q90D 4D7YA 3RZMA 2PI5A 4XTPA 1J5EO 5C6CA 2CDOA 2LJ2A 2EIMB 3TYJA 4NRQA 2EICA 2CDPA 1R3KC 3AYEA 3CCQV 4EB6A 4IV3C 4CDUC 3ACGA 1OHFA 4A3XA 5DG1A 3BHPA 1O7FA 1D7PM 2YXYA 1I5XA 3SKJE 1RUF3 2ARHA 5FY0A 3JCUZ 4IL6Z 2JDYA 4QKNA 4DEQA 3SITA 4QPKA 4B8EA 4PELA 2R061 4H55A 5EJ1B 1OFSA 4X65O 1QWRA 1W0NA 1XNCA 1YWKA 3BU0A 4DV2O 4ARXA 1T2XA 4X1IB 2BNMA 2KD7A 4BPZA 4BH9A 4O65A 2UUAO 5DUVA 2QGNA 3OD0A 1LCLA 4AEJA 1RUJ3 4E9KA 4K20A 2VBBA 1HIXA 5L3CA 1XYOA 4YY3B 4FP2A 1MSDA 1QCEA 3LSQA 4KI5M 5L7OB 3EJKA 1EPZA 2V5YA 4H7MA 1UX6A 3SR2C 2ZABA 2IXHA 1M9NA 2RMU3 3OEEG 1ONAA 4QGLA 1VMHA 2PYTA 4DV0B 1ZWIC 4CCJA 1AP6A 2W47A 4X89A 2ZT9B 3ATGA 4UBGA 3Q8EA 1TGOA 2ZCWA 3NW4A 1X4TA 1XQ8A 3CO2A 1IBLB 3AMHA 4EQVA 3KV4A 1W6PB 1YQ8A 5CFDB 2DVDA 1J1LA 5H6RA 4QQHA 5FXWA 2Z69A 4NAOA 2QQOA 3KVAA 4E4ZA 3VBUB 1SACA 5EZWA 3EQEA 4OHZA 1XNBA 5FAXA 1H2GA 2B1IA 4X9QA 2VOWA 1P7BA 3OR6C 3MHSC 3BKZA 4E2QA 3FB7C 3VZKA 2D6LX 1SQVH 3BB6A 1KJRA 4QDRA 2ODMA 5KMGA 2N04A 5IVBA 3BODA 4BXFA 4BMBA 3K77A 2IJIA 1MABG 3W5MA 1VMFA 1Y74A 4UFJA 4XFAA 2QKSA 2UXDB 1CPYA 1YSCA 1DF5A 2Q0AA 4XHBA 5J9PC 4LF6B 4U3JB 1VBB1 3T2MA 3PVEA 4JQTA 2Y6JA 1ASJ1 5FZKA 2VMHA 3AXDA 3O0XA 3MYXA 1N36B 3N2KB 3K4ZA 1ZRFA 4ZPIA 1Z78A 2JDUA 1JFFA 2YFZA 2WT2A 4EN8B 2LGQA 3WB1A 2HLEA 1Z7S2 2YY1A 1AJNA 4MSVA 2GC0A 2G9ZA 1PGW1 1AXYA 1JOYA 4R4XA 3O1MA 1FPN2 3LSEA 1XL6A 1A8DA 2YFUA 1SZXA 4TV9A 3E1F1 4FLZA 2ZR2A 3M1HA 3OW2U 4MGSA 2DMXA 2G1MA 2H6BA 2JDIG 4K8FA 5C9AA 4QX2A 1RUE2 5FLHA 3KG2A 3M8AA 5FP4A 1X8EA 5CBFA 4Q4Y2 1I5ZA 1SC5B 4UXAA 2ZEYA 4A42A 4JVAA 5B4XA 3JBG1 2D98A 1LOFC 4G3YC 4AZZA 2PAMA 2VNOA 3RVHA 5FP9A 4PLNA 1K5QA 2WLHA 3SDLA 4YM1A 2WKKA 4HONA 3R66A 4HYOA 5I8TA 4J1XA 4Y1ZA 1UY3A 3O7OA 2ZMLA 2JWPA 1NBMG 4OLLA 1NQTA 3D4KA 2HWF3 5CFCA 1PGL1 4E8CA 1VQ8V 2YBSA 1JTZX 4YG3A 2GC3A 1IXBA 1DTOA 1R3JC 1SDDB 2JX9A 4QX3A 1X7NA 4DK0A 3WFVA 2C26A 1H1MA 3CPWU 4RR3A 4AG4A 5IFTA 4YY3O 2WN2A 3ZR6A 2RJ2A 1N8RW 3LA2A 1V55B 2EAKA 1KBHA 3A0BZ 1AYM2 3C7GA 1W8FA 4A45A 3DPRB 1ZA7A 1WA4A 2AACA 4Y20B 2B7YA 3JD1A 2WS91 5GALA 3GXUA 4XF9A 2P22C 5FLIA 1ST8A 5H9SA 1V6NA 2RJLA 4DV0O 4XZUG 3QVNA 3T2TA 2RM23 3ZRWA 3B02A 3VBFB 1JJ2U 2JIJA 1HX6A 1R091 4JHZA 4X88A 2LALA 1S0GA 1UCXA 1PKXA 5JXHA 4RS5B 3RZGA 2EIGA 1MEC1 5JXGA 2XVLA 1LUWA 4XDPA 2ZX1A 2YMZA 2B39A 1NZ6A 5FWEA 1UL9A 4I3PA 3N35A 1VBE2 4ISQA 1AZDA 1ZYBA 3TEWA 1VBA1 3VKMA 3WHUA 1RHI3 1I1EA 1ND2C 4X64B 3AYCA 3VD7A 3GJAA 4CSWA 1H8TA 4FTEA 1AR91 4YW7A 2RDCA 3AMMA 5DDJ1 5D5QA 1ASJ3 1Q3EA 3Q8AA 4KBBA 4EN6B 3MFCA 3GYDA 4TUYB 4XIOA 2R32A 4CDQB 3JAMN 4PI2A 3LSDA 2WT0A 3WNPA 3J8F2 4WM8A 3ABUA 1W6OA 3TXSA 2VECA 1XPWA 3JATA 3UJQA 1XREA 1RUG2 4Q4W1 1YRZA 1QJY1 5DABA 5F5AA 4WVMA 1KD1W 4N43A 2AR6A 5HV4A 1U96A 3LOIA 2EIBA 1LNQA 3JD0A 2CTWA 5C5TA 1H1AA 2R6QA 3FFZA 4Q4V2 4LF6O 3JALA 1F51A 3MV01 4QU2A 4AI8A 3RYIB 2BOBC 4FFHA 2BV4A 4TT3G 1PO11 5T50A 5JH7B 5J48A 2VMCA 3K79A 1N36O 2Y69B 1BBT2 3E8HA 4BLJA 3JBG3 3VBOA 3VQVA 2DW4A 3T30A 1S0EA 3IWZA 2KSDA 4EKWA 3AK0A 2G4IA 5FBZA 2XJQA 1LGBA 4COZA 3A23A 2YPJA 3TBDA 4FFIA 1GN3A 1D4M2 3MW4A 2XOKG 3IBMA 3HKDA 3VQWA 4I9QA 2DTWA 5EJ3A 3OTOB 1A6CA 1TAEA 1R3LC 4LWSA 2J1AA 2EALA 4O4LA 2BSKA 1CIWA 1NY72 4JI6B 2LROA 1GZWA 3W21A 3TEXA 1UW8A 1NZCA 1W2BU 4DYLA 1W9SA 2LQTA 5FY5A 2LM3A 1WJZA 3H1JH 2IH1C 1WKYA 5FPLA 1I0HA 3W7XA 2A6YA 3O1TA 1MOFA 3A22A 5IWFA 5J2TA 1OQ1A 3DCQA 1KD7A 2DBIA 2E76B 2IC1A 4XJUA 2Q7EA 3FJSA 1YXBA 4KQ7A 1RPOA 3GBWA 4LHKA 2VCMA 2WLJA 3KT4A 4YIOA 5JJEB 4AFBA 3QO7A 4WFAV 3F5TA 5EZYB 2RDRA 5LBEA 4XAEA 2HWC2 2WS93 4RQPA 2FDKA 1QJX2 3ZX7A 1UOBA 3HNMA 3H1IH 1DGLA 2ZS6B 4IIJA 3K59A 4O7XA 1WA8A 5IFPA 1QH7A 1R093 2P1BA 4P9IA 3H8XA 4X6QB 2QEXV 4CH4A 1MEC3 4NXNB 2A0LA 1KS4A 3FFQA 5JOWA 1DF4A 1OVSA 4PA3A 3QACA 2E32A 3K5LA 1PZ9A 3CC4V 2JD9A 2PQSA 2RVAA 1C5IA 4FK5C 2W1QA 1VBA3 2XLFA 2QTOA 3FUOA 4N7UA 3ZHRA 3HVDA 2ZKLA 3LEMA 3BABA 4JGSA 1ZL8A 1AR93 5A7WB 2ZQMA 3H1HH 5DDJ3 1KRIA 1W6QB 3NWKA 3HB3B 4L92A 3VDBA 5FZOB 2V4VA 2Q69A 4GH4A 2GP3A 1NZIA 2D5FA 3CSXA 5FIXA 2DU0A 3P3NA 2L6LA 5A6XA 1CP9A 4BK4A 5ERLA 4NTXA 4C8DA 4R9CA 3D5OA 2F95B 1POQA 3ZMNA 4UOJA 1TMF1 4MVQA 3M3EA 4AI2A 5EIBC 1C8NA 1CAUB 2WN3A 2VBPA 4CS3A 4FPYA 4UFKA 1LU2A 4YVSB 4YVWB 2QDNA 4X64O 4IXLA 3AMPA 1IQAA 4OI2A 5FPRA 1FFTB 3QNEA 1CPNA 1HRV2 4LF7B 5KC6A 3EHKA 4CCKA 4JI2B 3OBAA 3H01A 3TN92 1W9FA 2KA3A 2PHTA 2TUNA 3LFMA 2JG9A 5BNOA 1NTZH 1TUBB 1QQP3 5GJ6A 2DURA 3K3WA 4P14A 4GLXA 2NZ9A 4LKFA 1KDMA 5D8AC 2AUYA 5CA0A 3RWRD 1CJPA 1ZVFA 3SC7X 5LXTA 1N0NA 3NO8A 1AF9A 3K04A 2Z5UA 3MDSA 1D2SA 2ZHKA 3JD71 2UUBB 4XUPA 3IT8A 1AR82 4JYAB 2LTNA 4LORA 4JI7B 2LGWA 2BNOA 3NMBA 1VF6C 4N7IA 3QTCA 5F5CA 4QE7A 1W90A 1OD5A 1OCCC 1O5LA 2F43G 2ITCC 1VRH3 4DR4B 2ZR3A 4E4EA 2R9AA 5IYDO 3CJIA 3ETPA 2BNNA 2EINB 4R9BA 3SJAC 1HJGA 4HKWA 4JI6O 4X1KB 5FP3A 5CFDC 3ZRXA 3E6DA 4B3SB 5IY5B 3Q9OA 2CGOA 4Q1PA 5IYYA 1COV3 2VNGA 1JU3A 5LK7B 2XQRA 3B9CA 5A1LA 5JVDB 3ZHUA 2ZACA 4UBHA 4FFBA 1OKOA 2VMIA 3OGSA 1YHFA 1PK6C 2JG8C 3AG3C 2VH9A 2D3OW 1QDOA 5EHDA 3N9NA 1KFXL 4LK7A 4FO9A 4YGCA 1UPIA 3R6SA 4XHXA 5J09A 5A70A 2ID4A 4D0QA 3CWBH 4Y4YA 4IUGA 1R082 4AHCA 1XQNA 3ZRSA 5BNQA 1W2TA 4YW6A 5AFBA 3N9PA 3J9SA 5G04L 2A7WA 5H9CA 1C5HA 1AVMA 1BVP1 2H0BA 4NIGA 5F2WA 4UB6Z 4K1YA 2XVKA 3L2YA 3CQOA 4IESA 4CCEA 5JSRA 1UX7A 1HQNA 4CE8A 4V2VA 3RFRA 1BEV1 1GKBA 4GX0A 1W6NA 4AEDB 3SYQA 4OUSA 1TMF3 1H0BA 1JYCA 2WSVA 4KNCA 3VBSA 4XF1A 4AQYB 4O2AB 2A6VA 1AYN1 2D3PA 2IJJA 1LOEA 4P9GA 1EPWA 4Y22B 2RHPA 1WLEA 2Q8CA 2RQ6A 4OVEA 3K9AA 1DGRN 3HQRA 2UWCA 4E2LA 1GTOA 3K5OA 3M70A 2WIIB 2UUCB 4CDWA 4OQ8A 1CAVB 1PM7A 4JI5B 4NRPA 1ACCA 1J3PA 1H6YA 4D7SA 2VW2A 4JI3O 3HT1A 3NNMA 5M0TA 4W4LA 2X8KA 1GKFA 5D2AA 2Y0OA 3MPPG 2PLV2 3B2EE 4BE3A 4JZGA 1R6KA 4JDMA 3T3YA 4LF7O 4JI2O 3JD73 4EYUA 3MBWA 2EIJB 4CEYB 3T1CA 3ZCCA 2ZMKA 3CXHF 1IKPA 5FZHA 3EXAA 3X2QC 4CEWB 3H8RA 3SEEA 3HKEB 4FPOB 4QPGC 1S0BA 1WBFA 5FMOL 2AZ5A 2P17A 3H50A 3PUSA 3IGAC 4PT6A 4FLTA 3FYIB 3WY6A 2JXAA 2LW1A 1CD3G 4HZ3A 3KB5A 3UKMA 2JGDA 1V70A 4WZFA 1R1A2 4UV9A 1O3QA 3ZRVA 2NN4A 1KP3A 2OIIA 2VCBA 2QWOB 1BMV2 3AP7A 3DPRC 2GC1A 4COYA 5KWRA 2ZDIA 2UUBO 2JDPA 4JYAO 5LA1A 1CR7A 4JI7O 4P9PA 3O14A 1W6PA 1JZ5A 3WSOA 1DP0A 5F6KA 2WA4A 1DQ6A 5E1RA 1Q82W 4B3RO 5LA9A 2IJKA 4DW1A 4DR4O 1HNXB 2Q30A 1S5JA 5B3SB 1KXGA 5B1OA 4CS4A 2QJVA 3N3HA 4DQAA 1R73A 1O6UA 2VTXJ 1U5XA 1OLME 4JKKA 4L8JA 4QPWA 2GALA 1N1SA 3NV3A 3BPSA 1WW4A 3SISA 4JF3A 5FO8B 4I2OA 3ZYBA 3CD6V 4B3SO 4LFBB 2NPIA 3WD5A 3LGRA 2K1EA 1F8VA 4DINB 2QWPB 1N33B 3ZXFA 4NIAA 4TN7A 3WG1A 1JZ4A 2XBO2 2ZA9A 4K9SA 2WQ8A 1BEV3 3WT3A 2JDKA 4NAMA 4NOTA 3VD9A 1L8DA 5CB4B 1EV12 4QGNA 2JE8A 5FZ9A 3ABMC 5I0DA 2OIEA 5LA0A 5LZ6A 1ZRCA 5FPXA 4M4RA 2EIDA 2WZR2 5DAWA 1GH6A 2Y33A 4UT5A 5A3NA 2VQEB 1ENRA 1RB8G 4CYDA 4M0HA 1M56B 1NX9A 4IEZA 4BQWA 2BEOA 4K8ZA 3CRMA 3SQOA 4LHNA 2WO3A 1D0GA 3RWNA 4WFEA 3TCUA 4TTGA 1V6MA 4FZ1A 3SKVA 4CDXA 5IVVA 3N2GB 4QT6A 3ZXLA 1F7YA 4C1WA 2ZJCA 2Y69C 4JGZB 2QBXA 3K03A 4AQYO 3ROUA 3ZXEA 4PA7A 1SF9A 5DPNA 4YRDA 5EJZB 2WDBA 1Z5WA 2YEVB 4V2WA 1A32A 2JEUA 4PI0A 2C24A 3AB0A 1O3SA 4RR3C 5JI7A 3I59B 5JR2A 4JI5O 3ASOC 4M3CE 2W6IG 4LNUA 1DG6A 2QM8A 1XMOB 3L9DA 4BIUA 2F4VB 1WPBA 3WG7B 4RYDA 3H3LA 3ABTA 5FQ0B 1HDJA 2ZXWB 5DZEA 3V0AA 3WUCA 5FZDA 2O57A 1H9PA 4MTFA 4Z1VA 2BP6A 1BK0A 4IE5A 2OPWA 2ARAA 2ZEZA 5B1AC 2EAAA 1OI6A 5SV8A 4M00A 2ZGOA 3WX5A 2E7TA 5A80A 2PYJA 4INDA 1QXJA 5EBLC 2P4VA 2SBAA 3QO8A 3LSSA 2XH6A 5FYTA 4KWJA 4KWKA 4HANA 1L7QA 3A8TA 1X9PA 5FWJA 2R7EB 4QHZA 4CXXA 4FQZA 1TG7A 5BMVA 3B77A 4DEVA 2R70A 3BTAA 3N9QA 5FV3A 3E8BA 4IV1C 3UGHA 1XBLA 2JKBA 2B4KA 1RUF2 2YYOA 3K5MA 5CVRA 5A3LA 3UYJA 2BERA 1GK9A 5CA1A 2ZGNA 3T0AA 1B04A 5FYYA 2NLRA 3WQBA 3WNMA 1RUJ2 2PQQA 3VBFA 2WAAA 1HW7A 4DR3O 2C2AA 4PLOA 1PVC3 1Q8IA 3E83A 5L36A 1JXNA 1QR8A 3ACIA 5FL7G 1T6BX 1FT9A 3OMIB 1OCOC 1SLLA 1YFWA 4LLFA 2VOKA 1NXMA 1E5SA 3TNPB 4N43C 1ZRIA 4L0PA 2RR13 2QCSB 5IYBO 1HNXO 3I2GA 3LSUA 4QB6A 2R071 4K7JA 4L97A 3ZX6A 4LULA 3OGJA 3NAPB 3ZN5A 1BJQA 5GKAC 2ZX0A 2FBEA 2WPDG 2R30A 4FPGA 2AHZA 4JAAA 1UOJA 3VBOC 4BCUA 4QIWF 3I49A 1THZA 1ODNA 3LEKA 3ZMOA 1WWYA 1N33O 4TSFG 5C8YA 3FYEB 4MVUA 1W8OA 4D6QA 5TISZ 5DZFA 4IDZA 1AUYA 1VIBA 3I2DA 1MS1A 3HBZA 1W8ZA 2WO2A 3TXQA 3ASIA 3KV9A 4QPIC 3CCSV 4FXKB 5H9RA 3RYKA 1VIWB 4NHYA 1R1BA 1KYOF 1BZKA 1NA1B 3ITQA 3MGUA 4TWTA 3RYIA 1MZ6A 1EM1A 4CPBD 4B3MB 3GZEA 2P34A 3UJOA 2VQEO 3RN4A 4ZHQB 2C5DA 2J22A 1UYYA 2UXCB 4I0XA 4WVZA 3OD4A 4IERA 2R9IA 2A06H 3WP6A 2W1UA 3ETDA 1FAFA 2W87A 4CH3A 3WG4A 3CBNA 3WQ0A 3ZSEA 2NMNA 5GZDA 4QXCA 2DQ0A 2LFRA 4X20B 5K8SA 4AL9A 3ZMVA 2WZEA 4KXRA 1FXKB 4RQPC 1DQ2A 2QNKA 4KGQA 3I55V 1HB4A 1RVF1 2XASA 3JB8A 4QX1A 3NV2A 2ZGLA 4YFZA 3P32A 1XRUA 2XHKA 2DE0X 1WMFA 4HVOA 2IVJA 1BXHA 2FDGA 2ET1A 2BU9A 3ZOIA 1Q56A 3IC7A 4IE0A 1IG3A 4N9IA 1H9WA 1Q8PA 1XMOO 2C6SA 2F4VO 3K4DA 5JSOA 5FPBA 4X8PA 3RYHB 4HVRA 4NO4A 1AILA 3D3AA 3HD8B 2AGAA 5IY5C 1VMJA 4H33A 2JEMA 1SMVA 2QE7G 2YGLA 4DV6O 1FFXA 3SCHA 3CC7V 3AZZA 3PUQA 2RG4A 4RSUA 1LU1A 2OUHA 4I30A 4PDWB 5JZGB 2DWEC 2HP8A 1JODA 4U2AA 4TOIA 3ACLA 5C8CB 2AENA 1HQLA 1VQ7V 3QD6A 2P3KA 3NKGA 3R0RA 3Q8BA 3ZFGA 2HWF2 3OB8A 5IVEA 2VU9A 3MHZA 5CG8A 3HN3A 3H9AA 3WINE 2QKAA 4RL7A 1RM1C 4GKJB 1K12A 4YZ2A 2R073 2DWRA 5K9YA 3E22A 5A7WA 1NT0A 2FD8A 4FIPC 5GTHZ 3G7DA 1UU4A 2NYYA 3H42B 4XC9A 1OXCA 3KHCA 3BRCA 4C0BA 3OGVA 2GN7A 3A2FA 2ZD9A 2OW4A 4I09A 4J7ZA 2JG9C 5BNOC 1AROP 1PPJH 1FYUA 1N0JA 1UWWA 1SQFA 4ES9A 2CAZC 5CU1A 4LTAA 1CAUA 4LH6A 1D5NA 3G80A 4LBJA 3JCIA 4ATFA 3K3OA 1ZREA 1RUC1 2VMEA 1WGPA 3URFA 1VP7A 1ROPA 2ADDA 4XZPA 3WZ1A 2E33A 2RM22 3B94A 1PNMA 1SDWA 1G6NA 3KCCA 1VBC2 4W4ZA 3S5QA 3M7MX 5CNAA 2R0FA 1J59A 4B4PA 1JPXA 2CTQA 2WAMA 1BE3H 4OCTA 4JKLA 3EB7A 5FMOS 1TUBA 5LBFA 3O5SA 1GSLA 4QHBA 4OXSA 4BA6A 4I01A 1RHI2 3CJIC 1H8EG 2QM4A 4IEYA 3ZPOA 3PUIA 4QE9A 4KHPB 1I9RA 1OOPB 1RVF3 5T5LA 4M4PA 1L3JA 4E2SA 4YGBA 4Y1YA 2ZGUA 1J95A 4K3AA 3RNSA 1MMMA 1ENVA 1O3RA 3WLUA 3JCZA 2OVUA 4PDVA 3B01A 3HPLC 2UXCO 2JB4A 3M99B 1XNTA 2X05A 3K57A 4MVMA 1IDSA 4CUGA 4M3CB 5CKQA 4CS2A 5C3OA 1GNYA 1WCSA 1HN1A 4JYBA 1XXNA 2R16A 1IBMB 4BWAA 4YARA 3LB9A 3HN1A 4AI3A 1KECA 1Y7BA 4HETA 1SFPA 1F4NA 3FL7A 3JBG2 3I2FA 1RUOA 1BT8A 3APQA 5B3SC 5JVDA 2VWKA 2OYZA 3ZYPA 1J58A 4LK6A 1BKZA 2W94A 4GT1A 4ITCA 2H3OA 5IJ0B 4K1ZA 3U14A 1PNKA 3VBSC 3ZM8A 4AW7A 1J3QA 3DECA 3VBRC 2ZGTA 1SQQH 4LKEA 5T5JA 2DYSB 1QHDA 4AVBA 2CGNA 1X82A 5LCWL 2PYLA 3JSLA 1VEWA 1BZWA 1US3A 1XYPA 2JIGA 3U75A 1XNKA 3U37A 4CDWC 4CA9A 3CJXA 3WU2Z 3BN6A 3SYAA 4L9BA 4PDLA 5BY5A 4XILA 1MS5A 1NCRA 4D8MA 1ALYA 4ZS2A 3OM3B 1Z5VA 1W2OA 2J1RA 4PDRA 1RUD3 4W4KA 2WS92 5HCFA 2YDEA 3G67A 4ZKIA 5HCHA 1RUC3 5DXDA 4O2AA 4NKGB 4META 1X9TA 4GKJO 1PZ7A 5LEKA 3E8GA 1X8MA 5JJNB 2LS6A 5A3UA 3SJCC 3PJQA 2D3SA 5JQGA 1LJ7A 1VPHA 1MEC2 3VKFC 1N1VA 3OEHG 5JCTA 5GONB 2BBAA 1YQCA 2JENA 1OA3A 2W5FA 2GV9A 2XAJA 4KG0A 2UY8A 3E97A 4Q4X1 4QHOA 1AX2A 2ZNJA 1TVKA 1RSOA 1VBA2 3PVOA 1S0JA 3O1RA 2WYSA 1AR92 5F5QA 1GM7A 1VLNA 5JIUA 3VOUA 5DDJ2 5LB6A 4AI0A 4OI1A 3C7HA 3RZLA 2ZOEB 4YSFA 2RDQA 5JXIA 1HKDA 5FY1A 4O4IB 4CEYA 1PIV1 5CB7A 4DZGA 3WG3A 5EXOA 3KT7A 1LB2A 2V72A 3LQCA 2ATFA 2WQZC 3QLQA 4CZSA 2QQKA 1B35B 3K06A 2UURA 5KUMA 3NNJA 4DRXA 3IM0A 3POYA 3OAAG 1NLSA 1X36A 4UFHA 5J36A 3J7MA 3GWOA 5JCOA 1UU5A 2EIKB 4YG6A 1WMXA 5FZ1A 4KHPO 1GFF2 5IT9N 5E88A 1XNAA 1WP8A 2NNUA 1B6QA 4CU8A 2F66C 1QXPA 5E6HA 3R05A 4QQPA 3MW2A 1SPPB 4OQ9A 3B8NA 5A6YA 5LOVB 4HPKB 1QQP2 4XUNA 1L0LH 4UFLA 4R9AA 5DAXA 3CRAA 2IXCA 2WBKA 1HXS1 1PMJX 5JPMB 4MVTA 2P4KA 1ULGA 5B5EZ 3B9IA 2PFWA 2DV9A 4O2BA 3ZXDA 1OH4A 1KKDA 1VAMA 1W0OA 3IAPA 3E5XA 3BCCH 3TOJA 3SPHA 1X59A 2OT7A 4RHV1 2GUZB 4J1WA 1WZXA 4JQRA 3HNBM 2QDOA 1RMU3 3RJ2X 4A7ZA 1AP5A 1W8NA 1U5IA 1VRH2 3NV1A 2WAOA 4X66B 1YTFD 1HW5A 2IWGB 3K0GA 5FXZA 3BI3A 4EZHA 1I7FA 3WNNA 2ARXA 3NAPC 5CB4A 4CDXC 4J41A 2VZTA 4F6RA 3H3UA 4PHZA 4CU6A 1DHKB 2QUOA 1W8TA 3AVSA 3BUCA 4IYHA 2ZGKA 1JX9A 2R9RB 4SLIA 4PCRA 1COV2 2A75A 4LHLA 3CRRA 3T0DA 4QX7A 1Q81W 2FCUA 4HLTA 3UQ8A 1BQPA 3OOXA 2WZPP 5EIBD 2VNRA 1Q86W 4FPEA 2Y26A 1AR61 2GMPA 5H6QA 2WNVA 2FMYA 4Y1VA 4JC1A 5T5OA 4A44A 2WNUB 3MEPA 2QA4V 3N2GA 5J7MA 4ZZ5A 1ZBE1 4JGZA 5H9QA 5AC91 1DGRA 2ZAHA 1K8AW 1LEDA 1HN0A 2YEVA 2N74A 1L0NH 1SBFA 2DYRB 2EXIA 4WBNA 1DCSA 4Y24A 1FXKC 2DOSA 3I59A 1BSMA 1HWYA 4CP1A 4N53A 3VL9A 1PO23 2ZNIA 4GB32 1GICA 4IETA 1IX9A 1TMF2 5FQ0A 4BOWA 1STMA 2DFCA 3RZZA 4XJZA 1FATA 4IV3B 2OCHA 4NHXA 5JR7B 4OGQB 4CDUB 4NVPA 4I50B 1S0DA 3CRQA 2P7TC 2QJ1A 1ZBA1 4HK9A 4AXOA 3CZUA 4I3GA 1OH3A 3LDRA 2BE3A 4ARYA 1MACA 1JOJA 2VW1A 3HKBB 2Z2SB 4DRVA 1NE4A 3OCPA 3BTZA 5BNPA 2W9XA 3BA9A 2D7FA 3NSTA 3WNKA 4UI9L 3I2OA 5APAA 2DN9A 5JZGC 2R042 3AKSA 3LDDA 4QNHB 2VQFB 1RINA 1OPOA 1IBKB 1OF3A 5FFOC 4PQ9A 5C4WC 5GZGA 1PL0A 3OBTA 1FXHA 1B3QA 2BOIA 5K4LA 4XUQA 4RHV3 1XE8A 1C8M3 2XLAA 4XF3A 4PIXA 1XYNA 3GGLA 3POSA 3AZVA 1MVEA 5E1AC 3I7DA 1M1KW 3O65A 1BLZA 2JE9A 1KQRA 3ES1A 1NCQA 2ADQB 4XFFA 5DG2A 2NM1A 4QXKA 3WDWA 2W39A 1QOOA 3QO5A 3PDQA 3JQXA 1EAH1 4LF8O 1Y9QA 5EYXA 4KUMA 4HKLA 3CJHB 1Y9GA 3POJA 2FZ2A 4WCEV 1AR63 1W06A 4BQYA 2LFSA 3DYMA 1VF7A 3QBQA 4X66O 2XAFA 3DXRB 3DN7A 4D69A 4UV8A 5DUUA 3UCSC 3FAVB 2Y6KA 1ZBE3 4GWNA 1NA1A 3IB3A 2J1VA 2VUCA 1W99A 2GNDA 5AC93 3TAYA 2UYAA 4DB5A 2QR4A 1ND3C 4XBNA 1YHQV 1IOAA 4C91A 3I5DA 3WP3A 2SLIA 2JD4A 5B1BC 1E5HA 4UFIA 3IDCB 3AK1A 3LA7A 3AG2C 1EUUA 1BEV2 4GUNA 5FNVA 5J3UA 2PHWA 2QM7A 1WW6A 2WWSA 2HBTA 1OOPC 1H4HA 3WP4A 3KGLA 4KG8A 2JDZA 3CB2A 2PMWB 3E6CC 4JPRA 2DU1A 2VS0A 4G28B 2P6JA 2WT1A 3USUA 2B42B 1GWMA 1V9PA 1NT2B 4FZ0A 1ZZ6A 2WNOA 4WVVA 3B4SA 5KHKA 4XETA 4AGVA 1S0FA 1ZX5A 1OKQA 3D6EA 5CN0A 4B1MA 4JV5B 1NUKA 1OZ0A 3MUY1 1DFQA 1VE0A 2QKCA 4BIOA 2Q8EA 2Q0OC 2BDRA 5I8SA 4FTSA 3PVNA 4BISA 3AP6A 3CEIA 3RYHA 3G6BA 4BQXA 4R7CA 1PL4A 3RI8A 2P3JA 1M06G 3UGGA 2YIDA 4I9WA 1YJKA 2YROA 5F5IA 5FXVA 4CUCA 1TE1B 3W5NA 4DUWA 4MUVA 4PDWA 4DW0A 4DXZA 4LBQA 4LF9B 2QQVA 1M93A 1UZVA 4QXHA 1QJZA 3OSDA 1NKDA 4GWIA 2N05A 1K73W 3NV4A 5H9PA 3B40A 4LF4B 4QGPA 1OA2A 4NPLA 3BAAA 5HCBA 4LOSA 2ZGPA 2CY6A 2P90A 1SA0A 4I4TA 3FMGA 2MEV3 1DYKA 1DZRA 1KJLA 2VZUA 3KD4A 4HT1T 5K0UA 3VD5A 3L75H 3RW0A 2J1SA 3FB8C 5IHRA 2VQFO 4NPRA 4XXPA 1IBKO 2QQLA 1EAH3 1WB7A 5E16A 3OEAA 3FLPA 1U12A 3AL6A 3PN1A 2ZKOA 3WF2A 4Q5OA 3K58A 4LCUC 1UY1A 4FBFA 1CAWB 5FPUA 2RS52 2DTYA 1NYWA 3V56A 2FTKA 4RGKA 5D5PA 1S72V 2AEZA 1O4YA 1U97A 3WNLA 2CTVA 1GO3F 3H7YA 1SBEA 3PUHA 5CISA 1OCZC 1QNYA 2AREA 2E3CA 3MAQA 2O8QA 1MZ5A 1SQXH 1TME1 3OYWB 1LULA 1ND2B 2WO7A 3CRCA 1PVC2 4EFEA 3IZOA 4LE3A 3RYPA 1NU1H 2A1XA 4BW9A 3RBZA 4FPHA 2A3QA 3AKTA 4RA0A 3ZN4A 4DUVA 3H1MA 2E6VA 3I2KA 4EWEA 1R1ZA 2J7MA 2BFUL 2LW8A 2W46A 3SCFA 5EBMC 3AVRA 3ZFEA 3R4UA 3FZ3A 1J1TA 2Z5WA 3KZ4C 1UF2C 1JHNA 3RRDA 1XU2A 4OPAA 2UY9A 1W03A 4X65B 2RR12 4RUFA 4QDSA 3B8MA 1UYXA 3I3QA 1DQ0A 4FT8A 2YU2A 4H2AA 1XNQO 4LE4A 5I0SA 4MTGA 2F4LA 2HVKC 4EWAA 3A7QA 1MNGA 1HP8A 4JASA 1O5UA 4GMP1 4M01A 4XF0A 4YM0A 2P06A 1FPOA 3UESA 3AK2A 2C9AA 5A3TA 2AYHA 4M3CF 4NR1A 3VZNA 2XJTA 4HVQA 4JI4O 4GJZA 4ASUG 4XOGA 1RFYA 4XUTA 4CU7A 1Y4MA 4YW1A 5DAVA 1ZTEA 3I3BA 4NHMA 1OT5A 4M3CA 4DV1O 1OHHG 1LUVA 1UN1A 4NTWA 2X29A 2EULA 4NRMA 5LA2A 4ZS3A 5IT6A 3OY8A 1WLCA 4NB5A 1WA6X 3BIEA 3LD8A 3KWVA 3RYFA 4OHVA 1RUI2 1IZ3A 3IDBB 3POEA 4XE9A 2ZPXA 3KKYA 2HH9A 4NWWA 1ZUQA 3POBA 3W59A 2XNDG 2HFEC 3P5BA 4JV5O 4Q1RA 2QTWB 4DR5O 4GQ7A 5LP6C 3I54A 1K42A 1WMDA 1Z7S1 4FQ4A 5IJ0A 2WA3A 5CZKA 2JVDA 1GNHA 4UFMA 4URAA 4XFBA 2Y4TA 2DQ3A 3SNMA 1GZCA 2A79B 5BR8B 4LBOA 5BNNA 4RN5A 1H4GA 1DGSA 1H8VA 4HK8A 4Y4RA 4CU9A 3L74H 2ZMNA 1JJOA 3ZIXA 4UXNA 2CNAA 1P84F 1RUE1 2AHYA 1W9WA 1CZSA 1YIJV 1GOFA 1JQ0A 1SETA 2EJ7A 4LKDA 3OUJA 3H0OA 3VKOA 2YC4A 3RDIA 2BUKA 4LF4O 4HZFA 4XDLA 4LLOA 1NQJA 3DTUB 5LL6Y 3UL2A 3ECQA 2A3YA 5L3DA 3LF7A 4AQSA 2YPDA 1AI7A 2GTSA 1TME3 2YBKA 1UYPA 3KMHA 3HR0A 4FFKA 1F4MA 3ABZA 1YTFB 3HKCB 4AGRA 2ZE6A 1BVVA 4ICGA 2VVEA 5GONA 4C0HA 2HKXA 4A6OA 1W8UA 1FOD1 4MVRA 5JPNB 3QG5A 4DK1A 4UVBA 3RZKA 2QTSA 2VQ0A 3PVBB 3LDKA 1AYM1 2ZX2A 4X8NA 2OKXA 2Y60A 4GMP3 2YUEA 2CTPA 4TV8B 2K9PA 3BPZA 1POV1 3S6PA 3AFKA 1ENQA 3JARA 3H3ZA 1B35A 4QAWA 1K3EA 2EF6A 1BHBA 3KS7A 2EXHA 2Q1FA 2JB8A 3GNEA 4LBNA 4O4JB 5BXZA 3CCUV 3O0VA 5KHJA 3AKRA 2VCAA 4XDKA 1YCIA 4PF1A 1VBE1 5A7OA 5D8AB 2Y6HA 4FOWA 1U5YA 2O1QA 3BTYA 3UKTA 2BZDA 1S5HC 4ZOLA 4BQ1A 1SQ4A 1QOTA 2WWUA 2RV9A 1SPPA 1QOSA 5EQUA 3ES4A 2WO1A 4HPKA 5IK4A 2DDUA 3ZYRA 5J1XA 2DUOA 3ZFFA 2Q67A 2DVBA 3ZO0B 4Q0VA 4MV2A 2AEYA 1RUH3 3J8F1 3QH7A 4WM7C 1Z7S3 4Z82A 5FZEA 1OCCB 1K34A 5DZGA 3TJTA 3SYCA 4CTEA 1RUG1 5L73A 4LUKA 1RVF2 3M2MA 4B29A 1CVNA 5KXCA 2XPJA 4Q4V1 5LASA 4A7KA 3WXPA 2YIBD 3JUUA 1LODA 3RMYA 2WFF1 4MGYE 2ADEA 4HNAB 5J2UB 2GUZA 1LEMA 1FXZA 2GZWA 4OX9B 1KQSU 2VY0A 2WNVC 4MH0E 1BBT1 2B46X 3OGRA 2B9VA 2GH8A 4QGMA 2HWD3 1IHMA 2CTRA 4CUAA 4UVCA 4CCOA 1PK6B 4S2HA 2OT5A 4UVAA 2JG8B 3AG3B 1D4M1 5JAXA 2RS13 1H38A 5BR8O 3K2OA 5F9TA 1BQ0A 1Y9MA 4FOVA 3JZVA 4GKKO 2VOVA 2JDHA 4DY5A 2BWCA 4QWNA 2R1BA 3QH6A 1H1IA 5E79Z 5LK5A 2XT9A 2F4PA 4AFDA 1EN4A 4FCAA 1S2BA 5C5UA 2HEYF 1CWPA 2ZX3A 1SLTA 1FOD3 1KGYA 4DR6B 1JYIA 1K45A 2WABA 4UCVA 3KCYA 3E35A 3IMNA 2WC2A 4GX1A 2HWB2 5IUQA 4NIDA 3NR7A 1UY0A 3K4AA 3BOWA 4JRAA 1DU3D 2VBDA 5ACA1 3WW4A 3F2ZA 4Q0QA 2DCYA 4FPCA 3FX3A 1N3OA 2HWC1 4UCRA 4YGDA 1QJX1 3PTRB 4CZZA 4A6SA 1K5MA 1AX1A 2DFBA 1POV3 2ZZQA 5FZ4A 1Y43B 3PU8A 1S2KA 3OMNB 4TWKA 3RPQA 1GQGA 1QGLA 3T09A 1UJWB 1LR5A 1RUD2 3A0KA 1GN4A 4QX5A 2FZ1A 3LFIA 3ZN6B 2E26A 2R063 4IV3A 5IVJA 1O8PA 4I50A 1R64A 1Q43A 3X29B 4B7EA 4UCUA 4LT5A 4CH6A 4S2DA 4JDOA 1DQ5A 1OF4A 1QIQA 1VBE3 1ENXA 4QX8A 1D2QA 2CDYA 4MVSA 2DVFA 1FKAO 1AR4A 3HPNA 3JAKB 2Y0IA 4PIYA 2IXIA 1CN1A 2HVJC 4NUBA 2XJVA 4ZY9A 1KKCA 3POWA 5LHHA 4XJ8A 3CCEV 5A7SA 1RYYA 4Y33A 1YI2V 2W1WA 3X2QB 2V73A 1HLCA 1R6NA 2D6MA 4CCMA 4QPGB 1MS0A 3J80N 2DVGA 1BQZA 2D5HA 3OUSA 2D6PA 2OQ6A 3I8TA 3OUFA 5HFMA 2VD7A 1SS3A 4CP2A 1NLQA 5HFLA 2YU1A 1C3HA 3AMQA 4Q4V3 5IJRA 5ANNA 5CKNA 5EYYA 4L87A 1OD3A 2WFF3 4W50A 5FMBA 1HRV1 2VM9A 4R8HA 1VB2A 5JMOA 4ASMB 5LATA 3MIDA 1BBT3 3U10A 5KMGB 1B06A 2JDAA 4Q8KA 3ABKC 4OPHA 1Y74B 3MIFA 4AQ6A 1D4M3 3QCWA 3D36C 2VUAA 1DF0A 3ZYIB 1OVPA 1WN7A 1GWLA 4J9ZB 4GWJA 3PUAA 2E51A 1N34B 3MIHA 3MO4A 1UZZA 1QKQA 5FMDA 3GDBA 3VBHA 1EZJA 3T1LA 4OX9O 2FCTA 5F39A 5JI9A 3AM2A 5FPZA 1AR81 1XSRA 4XVHA 3DXRA 1K92A 3VHNA 1VBB3 3FAVA 4LIUA 1JYNA 1HNWB 4LR4A 4XYXA 5ACA3 3ETGA 1TNFA 1X33A 3ABMB 3K3NA 2WQ4A 2EILC 1SBDA 4XCAA 4QKBA 2E74B 1BHGA 4ZXEA 1RMU2 3VDDA 3A21A 5B4NA 3HQXA 3P3PA 3NNLA 1W39A 4LA2A 2VZ3A 2R49A 4U3FH 2AGSA 1J83A 3ETEA 2W92A 1LTEA 2DUPA 2CU5A 3G6JB 4DR6O 2DUQA 1MS4A 4JI0B 2QFEA 1QLEC 2RDSA 1TZOA 4G9SB 1BL8A 1IS6A 4HL0A 4IW3A 2C1FA 3VHRA 2WWWA 1JMKC 1JYTA 2XTAA 2VNVA 1M5IA 4P30A 2VCCA 5BUVA 3U07A 4QD2A 2UXXA 2HG5C 3DEMA 3J26N 1GN6A 3I3DA 3MI8A 5L3GA 2JE7A 1LOFA 4JTOA 4AEMA 4RR3B 1MVQA 5LMNB 1O91A 3ASOB 2VMFA 3S3WA 4V1PA 2ZGQA 3J81N 4BIFA 3ZIWA 1EP0A 2P3YA 5K0UC 4X1YB 1KC8W 3K46A 3JU9A 2VRZA 4JGYC 5B1AB 3SEPA 2ERFA 2J42A 3NVCA 1G8MA 3N9LA 3CE2A 4U7NA 2ZHNA 3ZRWB 1J3RA 1HRV3 1PO22 3LUTB 3A0NA 5CMUA 1S55A 2WWJA 5H2FZ 2XDVA 1TEIA 1UXXX 1W9TA 5FZ3A 5DAQA 2O8OA 5BV6A 2QWNB 2VVDA 1Y6XA 3ETQA 4LMFA 4XJAA 2J1TA 3C3VA 4IV1B 5CYYA 1M57C 1GP6A 4YW2A 1H8HG 3O0WA 1AR71 3VD3A 2Q5TA 4B3TB 4RUEA 1H30A 3LNMB 2CWMA 1WMEA 3GWKC 2JJ6A 5JJJB 5LRSA 1G1XB 3FBYA 2ZAAA 3ZYGA 2CSGA 2YHJA 2UXBB 1MQTC 1AI5A 4NYKA 4DXRA 2YZ4A 2X5IA 4MGQA 1ZX3A 3SPGA 3WW2A 3ZXGA 2AZ0A 2P3IA 1AR83 2D44A 1ZM1A 4WM8B 4EV0A 1OCOB 3CCJV 5KXDA 1W2UA 3JATB 4E2GA 4R50A 5LWBA 1N3QA 4K6BA 4WVMB 4N43B 1VJ2A 5K1XA 3ZMTA 1GV9A 4PJ0Z 3G6EV 1YIPA 2O0OA 3OYWA 3E6BA 4DPNA 1ND2A 2VVFA 3PU3A 3JALB 2NP0A 1OA4A 4RHV2 1C8M2 1N34O 1NH2D 3AYAA 2F23A 4JI3B 4P9YA 4MG2A 4Q4W3 3ELNA 4X8AA 3T4HB 4BU2A 4DIQA 1QJY3 3VBOB 2M7WA 1GM9A 1H2SB 4LC1A 4EWDA 3GALA 4XAAA 3O12A 1G8WA 5LW9A 2PTMA 2XLGA 3S30A 3ZN1A 1HNWO 5ABJC 2GTAA 4LWSB 1Y76A 4QPIB 1PO13 4O4LB 2BSKB 3I56V 3KT1A 2W0FC 4D6TH 1GZWB 5C3PA 2DF7A 3RYCB 3WVJA 1S77D 1HNZB 4Z8BA 3LDCA 4RAIA 5FLXN 4AFCA 3AP4A 3RJRA 5IAXA 5J2TB 3S0MA 2E5LB 3B3QE 4P9XA 3T2OA 1HR0O 2HJIA 1AB3A 5IW0A 5FZFA 4JI0O 1WPXA 4OI0A 1ZBE2 3C2UA 3OT7A 2VGDA 3VN4A 4LP8A 5IYCO 5CAZA 1YVWA 1QH6A 1EV11 3J7NA 1VQ6V 1I94B 1JU4A 4RQPB 2JEXA 3C3TA 4D6SA 4MGKE 3DSQA 5FZLA 1XSQA 5C33A 2XHNA 4X6RB 3OEBA 2WZR1 3ALQA 3WW3A 4JI1B 4MS2A 4CP0A 1LHUA 2I07B 3WR0A 4UCOA 4B3RB 3TRSB 3AG7A 1PM9A 2P2KA 2A3WA 3SPJA 2KXLA 3Q4HA 1BS3A 3VQXA 1EN5A 5EYPB 4GJYA 5LMNO 1LKNA 5HBAA 3PTYA 2K46A 1HRI1 4E4HA 4XDQA 1V9U1 2AXTZ 1AR73 5KUKA 2KR2A 1XB9A 4OUMA 4GD4A 1IPSA 4CBCA 2VTXA 3VZMA 1E79G 1ZL8B 4CP9A 2RCVA 4FVVA 4LFCB 1RUNA 1UY2A 2ZTNA 2JJ1G 2BGCA 4YIPA 4FJCC 2PAKA 3F7VC 3U0ZA 1UZWA 4EROA 5KBFA 2IUWA 2GH2A 5FXXA 3JAWA 1APNA 2UU8A 2YV8A 4UW3A 4UF0B 2CH7B 4OMCA 4B3TO 5LHIA 4X62B 1RM1B 2A5ZA 1OCRC 3MLKA 2GP5A 5GZFA 4ZI7A 3TETA 2CGPA 3KV6A 1TUEB 2ZGSA 2UXBO 1Y4WA 1AXKA 2CAUA 4GAZA 1XHZA 1WD4A 3APBA 2V1DA 2JG9B 5BNOB 2MEV2 3H1KH 3K5NA 3ILNA 3JASA 1LHNA 1VQOV 3ZDVA 4TQFA 2BWAA 1N4CA 4MSWC 1RUF1 2NMOA 3OGCC 2BOCC 1EAH2 2RNBA 1GMGA 4K35A 4RGAA 4TV8A 5JSPA 3AMNA 1G9CA 1RTVA 3OUHA 4MVOA 4DO0A 1EN6A 2ORXA 5KA5A 3KVBA 4LNVA 1K9MW 4Q0UA 3E8FA 2ZXQA 1RJ7A 1JYWA 4IEXA 4O4JA 2Q5ZA 1MZEA 2XXZA 4DXWA 4X1IA 3EHBB 1W04A 2YC2A 4MT8A 1NG0A
chains in the Genus database with same CATH topology
2Q1MA 3GHMA 3CJIB 5H9QA 5AC91 4L99A 1H8TA 4FTEA 1AR91 2HWB1 1C1FA 1DGRA 3AMMA 5DDJ1 4Z07A 1ASJ3 3IIAA 1Q3EA 4B7KA 4KBBA 3LOBA 2XKOA 4EN6B 2GNMA 5K0UB 3MFCA 3GYDA 1G9BA 2ZAHA 4AFAA 1LEDA 1CQ9A 4NE0A 4XIOA 3R1JA 1UKGA 3V64A 4XMIA 1SBFA 4I0WB 3WCSA 2R32A 2EXIA 1RGSA 4JGYB 2D6KA 4CDQB 5L7OA 1NCRC 5EV7A 1OIJB 3LSDA 4Y24A 2WT0A 2OUJA 3J8F2 4WM8A 4AEDC 3I59A 3ZSLA 4CP1A 4N53A 1W6OA 3VL9A 2VECA 1PO23 3U11A 4GB32 1GICA 3UJQA 1FPN1 4IETA 1O4ZA 1RUG2 1TMF2 4JDNA 4Q4W1 1YRZA 1QJY1 4I02A 5FQ0A 4AHZA 4BOWA 4WVMA 1FNYA 4N43A 1HV0A 4JCKA 2AR6A 2XJPA 2DFCA 4AQ2A 3LOIA 3RZZA 4XJZA 1FATA 1DRTA 4IV3B 1H1AA 4ATEA 5JR7B 2F6BA 2R6QA 5LEJA 1LRHA 3FFZA 4Q4V2 4CDUB 4NVPA 4IEVA 5KXEA 1RUD1 1S0DA 1HRI3 1ZBA1 2TNFA 1V9U3 4HK9A 4AXOA 4QU2A 2WBQA 4AI8A 1B09A 3RYRA 3N4MA 4I3GA 1MACA 1JOJA 1OQEA 2VW1A 2Z2SB 4Q4Y1 4DRVA 1PO11 5T50A 1NE4A 5J48A 1UD1A 3OCPA 4KU8A 4DNYA 1BBT2 4BLJA 5GZEA 3JBG3 3VBOA 5CFDA 2DYCA 2XVGA 5BNPA 1WW7A 1S0EA 3IWZA 5J92A 2D7FA 3AK0A 3ZSJA 1IS3A 2G4IA 5FBZA 3ST7A 2XJQA 3ILRA 1LGBA 1MQTB 2C0ZA 2D93A 4COZA 3NSTA 2YPJA 3TBDA 1D4M2 3MW4A 4XPVA 3IBMA 4XW3A 5BYNA 1OPMA 3VBUA 2DTWA 5EJ3A 3ZFEB 4B4QA 1A6CA 2GU9A 3BOPA 1ZZ7A 5JZGC 4Q8LA 2EALA 2R042 1PK6A 1CIWA 2JG8A 1NY72 4COUA 3AKSA 1GZWA 4XFHA 1UW8A 1RINA 1OPOA 5JOZA 1NZCA 3WNXA 3VBSB 2LM3A 5FFOC 3VBRB 4CEYC 1REDA 2A6YA 4PQ9A 1QF3A 5C4WC 5GZGA 3OBTA 4AFMA 1K5MC 3KCXA 1YI9A 4CEWC 2JECA 4RHV3 1EYBA 1XE8A 1OQ1A 1C8M3 3CEWA 2XLAA 1RL3A 1SLAA 1KD7A 4XF3A 2IC1A 3IDEA 4XJUA 3GHNA 4PIXA 4Y5Z0 3ENRA 1XYNA 3FJSA 5I91A 4CDWB 3POSA 4KQ7A 3AZVA 3GBWA 1MVEA 4LHKA 2A3XA 3I7DA 4XJ9A 3KT4A 4AFBA 4XFIA 2A70A 3AZYA 1GZ9A 4HKOA 1JW6A 2JE9A 2R072 1D0HA 4AI1A 3TNQA 1KQRA 1QJU1 4QM9A 1LGNA 2JICA 1AYN3 3ES1A 5C9AC 5E89A 1NCQA 2HWC2 2WS93 4RQPA 4XFFA 5DG2A 1QJX2 2NM1A 4XQWA 3E5UA 4QXKA 3WDWA 4QQLA 4URTA 3ZX7A 2W39A 2D40A 2PAEA 1QOOA 4BM8A 1DGLA 4K3UA 4XJWA 3OY8B 5LRRA 2Q4SA 2ZS6B 3EXUA 4Q0SA 3JQXA 1EAH1 3M3OA 4U36A 5ABJB 4XBQA 1QH7A 1R093 1AL0G 1Y9QA 2BVVA 5EYXA 4RFT0 4ZXKA 4HBNA 4P9IA 2EVXA 5I8YA 4HKLA 4X6QB 1PGSA 4L11A 2FZ2A 5IK5A 1MEC3 4IL7A 4S2FA 3CF6E 1V6OA 1AR63 1KS4A 3FFQA 4GALA 3LAGA 2GMMA 5JOWA 1LENA 5CFCC 3QACA 3VHPA 3VZJA 1PZ9A 3QBQA 1QU0A 3DN7A 3ZN6A 4D69A 3FBMA 5J96B 1C5IA 4I0AA 1UAIA 2BYVE 1VBA3 2XLFA 2XG3A 3FUOA 5DUUA 1ZRRA 1CAXB 1WCDJ 4N7UA 1YO8A 1VP6A 1W6MB 1ZBE3 4GWNA 1NA1A 2HWF1