1H2MA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
335
structure length
332
Chain Sequence
b'EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR INHIBITING HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/inhibitor
total genus 105
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2mA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2mA01
2ILMA 3KCXA 3D8CA 4NR1A 1IZ3A 4BIOA 2WA3A 2Y0IA 2YC0A 4QU2A 3KCYA 5JWPA 1H2LA 2CGOA 2YDEA 2W0XA 3P3PA 3P3NA 4AI8A 3OD4A 1H2MA 2XUMA 4Z2WA 1MZEA 4B7KA 1YCIA 1H2NA 1MZFA 2WA4A 1H2KA 4Z1VA 4JAAA 4B7EA 2CGNA
chains in the Genus database with same CATH superfamily
1GICA 4NMIA 3BCWA 2WNOA 1T5EA 2RQ6A 2VAUA 2XQXA 1TE1B 3ZFEC 4MSWC 3HKCA 4FPGA 2D6KA 2JS3A 4Z2AA 1VPHA 5B2GB 5F5CA 2W39A 5EQUA 3UT5B 3HKDA 3HKEB 1QJU3 5FP7A 5I8SA 1J3RA 3FYEB 3QTCA 5KHHA 3BA9A 3M1HA 2XJPA 2ERFA 3EXUA 3BGAA 4IIJA 1NLSA 3LOIA 1YVWA 3VD9A 2WUHA 2I07B 3T1LA 3MUY1 1DIWA 4XYXA 3ZSMA 2JK5C 4UV9A 1TAEA 4XJ8A 4IHJA 1Q6IA 1DGWA 5ANQA 1IG3A 1SZTA 2ZHMA 2XVGA 2YBKA 4M4RA 2IJJA 3GBWA 3VN4A 5FP9A 4OFGA 1NT2B 3NJXA 4GALA 3RG0A 2P37A 1IGOA 5JI7A 4URTA 1AYM1 1DQ2A 4FLYA 4KU8A 2RS31 1XUQA 5IJ0A 2ZDIA 4PDVA 5JCOC 1YO8A 4DUYB 4JGSA 1ZA7A 1GNZA 5FO7B 3O1UA 3CP1A 4RN5A 2DYSB 4KU7A 3QO8A 1RYYA 3JD72 4J7ZA 4LF9B 1VF7A 3H7YA 4NOTA 3J81N 5ACA3 3VB9A 3K5LA 3V0BB 3W58A 1RL3A 2HEPA 4M0HA 3R65A 3I4IA 4ICGA 5CIRA 4PCRA 3R6SA 4BZ4A 4TLGA 1G7YA 1YI9A 1RUF1 2WYSA 2Q7HA 3JD4A 1EN4A 1QDCA 5HFMA 2UXCB 2BTQA 3BPSA 1IBKO 2PYTA 1IX9A 4WVWA 5JJEB 2A6WA 4TZDA 4O2AA 1R082 2UWAA 1AL21 3WP3A 2LFRA 4AFAA 3CEWA 3HR9A 3PU3A 2GP5A 3D82A 1NYWA 4MW3A 3R4SA 3NO8A 2OYZA 1Y76B 2BBVA 2BTVC 3JD73 4K0KO 2RDSA 1QU0A 4AF9A 4RGGA 3LDDA 4RS5B 2HWD2 3ALQA 3AP5A 1H8EG 2VQFB 2D3RA 3FFQA 3L70H 2PLV1 1PZ9A 2X7RB 4D6SA 3K5MA 5LA6A 3TGUH 4DNYA 3C3VA 1VBE2 2EILC 4J10A 3D36C 4DO2A 3OPZA 5FP3A 5LY2A 4JHZA 4PDWA 2W94A 4BPZA 5FYMA 1W2BU 3K9AA 1OV9A 1CAUA 4AK3A 1SDDB 3OTFA 4ABMA 1LESA 2YU2A 1U5YA 4JAAA 1VR3A 4IGQA 3AP9A 3TXQA 4LO4B 3S0MA 1R083 3T1HO 1QNWA 3BABA 2IM9A 4XC9A 2BCCH 4DV2O 2RS13 3N7MA 1UZ0A 3IDEA 4K8RB 4GKJB 4JI2O 3QOPA 1KUQA 1HNWB 1HNXB 5CEHA 1NQDA 1LOFC 5JXGA 4LBEC 3FKSG 2Y0OA 3VBFC 2O8QA 3OSDA 2HWD3 4GA9A 2A3QA 2O0OA 1O5LA 4R52A 3ZMVA 2KM2A 1JFFB 1BYHA 2G1MA 4FXKB 2XQRA 2JRIA 1XBFA 2DVGA 2LP7A 1M90W 4XAAA 2XXZA 5IYYA 4I0XB 4WF9V 1VBE3 2OW4A 2F6BA 1AHSA 5IVEA 5FPZA 4FJCC 2J1RA 3AL5A 2F4VO 4XF3A 4AGRA 2KG7B 2WLLB 4C1XA 4CDXB 2Q7GA 2E7QA 2YIAA 1FX5A 5JLVA 2X6AA 4X66B 4Y4RA 2GNBA 3A0KA 3UYJA 4UYBA 4QPWA 1MS8A 4HKWA 1ZWIC 2Y6HA 3ZRWB 1PGW2 3S7IA 1HN0A 3SJCC 3POWA 1PNLA 3CSXA 1JODA 1REDA 1TVGA 4PA4A 3MFCA 4AVCA 4LOSA 1SFNA 2XKOA 3POFA 1SA0B 2XOKG 3CJIC 1BBT1 3N35A 1UJWB 4BLJA 4IE4A 3MO4A 3OPTA 2IXLA 5B1BC 5FY1A 4Q4W1 3SJBC 5EPAA 2Q73A 2KD7A 5LEJA 5C3QA 2FDJA 4LHNA 2DVBA 2EVXA 1SZBA 3LWCA 1REEA 2IXHA 3POEA 2ETEA 2MW2B 2VUJA 1FNZA 1LKNA 4AHCA 4Q0PA 5FUPA 1BL8A 5FBJA 3BODA 1LGCA 2VZUA 1IBLO 1RIRA 1Y4WA 3I2IA 4I55A 1KITA 2Z5UA 1NR1A 2B46X 4BHPA 3I56V 3V56A 4QM9A 2F4LA 1WW4A 3GZAA 2GMEA 4LBNA 2DTWA 2XHKA 1UL9A 5KR7A 3LIHA 3ZFGB 4MVRA 1CWPA 4OZOA 1I3HA 1NZCA 2BTOA 1DGWX 5JI9A 1KP3A 4MX3A 1COV1 3PL0A 2QCSB 4QQHA 4NXNB 1A3KA 2OIIA 1BJQA 1RUH2 5D8AA 3FLRA 1F31A 4E4HA 3R05A 4LTAA 5FTTC 1PK6A 2NR5A 1LULA 4LHLA 4G4FA 5EJZB 4E4SA 1Z7S3 4GWNA 2QE3A 5LB6A 2LFSA 3RN4A 2GNMA 1ODNA 2JG8C 2N04A 2A73B 4ZHNA 1W8WA 2XAJA 4JC1A 3AP6A 5J2TB 2VZTA 4X6RB 5E6HA 2LUWA 2PGGA 1AP5A 1VIBA 5F3EA 3MF6A 1O3SA 2AHZA 4QPGA 1NT0A 2Z0AA 5C8YA 3FX3A 4V2VA 5A6YA 4NHYA 3D8CA 1W0KG 2Q68A 2UU9O 4R9CA 2BSKB 3A0HZ 1H2SB 5IE9A 4E27A 1RUH3 4BISA 1UFIA 3LE0A 4DEVA 4ZHQB 2RNBA 3WZ1A 5ABJC 2D6PA 4MUVA 2QTSA 2ZINA 1R3IC 3T1CA 2ZGNA 4CDUA 2QR4A 1VQKV 3N9NA 4IE5A 3BU7A 3RYCA 4QQLA 5IYDO 1XJAA 3SITA 1VBC2 3CRRA 5FYIA 2ZE6A 5JR7B 4DW0A 4M3CE 3B8MA 1LGNA 3SCFA 3VDDA 4Q6GA 4UAPA 3HVDA 3OEEG 1F4NA 3W7SA 1UX7A 3E8BA 4ES9A 3OR6C 3FHAA 1DZQA 5M0TA 2WNUB 3TEYA 1HQNA 1V55C 3RYHA 5B1OA 1S5JA 1D4VB 1D4M2 1WW5A 1DF5A 4ASUG 4KL1A 2Q5TA 1K73W 1NUKA 2AREA 5FPXA 3VKOA 1W8OA 4OULA 3BTAA 5AFEA 1H2GA 3VBOB 3UK9A 4HPKB 2W6IG 2WLKA 4X62O 4CU7A 5DZFA 4AE2A 3KV4A 3JXSA 1HB3A 4UCUA 1VMGA 1FMD3 3WW3A 2UY9A 4OUMA 1VBC3 2ZIOA 4LWSB 1IBKB 3S3XA 3CMEV 1XNDA 4CCDA 1VBB2 1UYXA 2DFCA 2XGXA 2OPWA 1HRV1 3VZNA 1US6A 2VQEO 1QEXA 3OBZA 3T3YA 2AC1A 4CP2A 5CBLA 4NIDA 5LRSA 5FL7G 4HKLA 3ZLIA 1CAVA 2CUGA 4K0KB 4EYUA 2RR11 5A33A 3ZVXA 2EULA 1D4M3 4NRPA 1FAYA 5FY7A 2WQZC 1ZBE3 3J7AU 5KAFZ 2EIKC 3B9IA 3G67A 5CVRA 3KVBA 1K9MW 3T1YO 3E2EA 2E7TA 4JRAA 4L2NA 4D8MA 1R64A 1SMVA 2ADEA 1XEQA 4RYDA 1O3RA 5LWBA 3KT7A 5JVVA 2X05A 4J9YB 5BZBA 3N7KA 4N9HA 1ZREA 3P6BA 4XBQA 5IYZA 4BQ4A 2HEWF 4CEYB 1K5JA 1HXS2 3T1HB 1VBB3 2D5FA 4PD4F 4BAYA 3RDIA 2V4VA 4DV2B 2VBPA 1HW7A 2I74A 5F5AA 3K5OA 4JI2B 2OIGA 2ZGUA 1ND3A 2A06H 4AEDC 2F1MA 5KLVH 5LK5A 5JDBA 5AVPA 1W2NA 2JG9B 4EZ4A 3WF2A 3SPCA 5EV7A 3BIEA 2ZE5A 3WG3A 4XXPA 4FQZA 5AVAA 3ZRXA 1W6NB 3STLC 2Y38A 1Q81W 2RJZA 1SFPA 4LBLA 3I3EA 4MTGA 2F17A 1H6XA 5JQGA 1QLEC 1ULOA 5A70A 2F4VB 1H2NA 1HNZO 5FUNA 4LMFA 4QPIA 1ZVFA 3OGCC 2VBDA 1PP9H 1KFUL 1Y74B 4CCEA 4YJ3B 3OYWB 4XVHA 2JDZA 3ZN5A 1HXS3 4ZONA 5H5NA 2OTJV 5C4WC 1B35B 2EIJB 4P9JA 1BT8A 2VU9A 2W92A 4IEXA 4AAPA 1IOAA 4OZXA 4IERA 4MSVA 4Z8BA 3WQBA 2GBOA 1BSMA 1WA8B 3N27A 3WG7C 1GZCA 4D7YA 3GJBA 4Y1ZA 5JSPA 2WN3A 1H4HA 1WUVA 4IV1C 3DSQA 1XYPA 5A32A 4P30A 1CPNA 4DR1O 1TMF3 4A45A 4HVRA 3WP6A 5HCBA 1K5MA 4I7ZB 3K9SA 3OGSA 1CZSA 1RUI2 4AI0A 1IBLB 1IDSA 1VE0A 4XFCA 1WA4A 4HMZA 4MGZE 4YVWC 2QZ2A 4UFLA 2IFWA 4JTCB 4OHWA 4AI2A 2E51A 5JOWA 2RDCA 3K79A 3BTYA 2D6NA 4O9EA 4LO7A 1KQSU 1L7QA 1L7RA 2X09A 2EXJA 1QJEA 2DQ3A 4FPFA 1RMU2 1CPYA 1SQ4A 1RB8G 3PN1A 3ZN6B 1S0VA 3FB8C 4YIOA 2Q30A 3KG2A 3CJHA 2CWMA 3ES4A 4C91A 3KT1A 1BCCH 1F5FA 1J1TA 4HANA 4XW3A 5D21A 3ZFEA 2A6VA 4NWVA 1OBNA 2VE1A 1BEV3 3DPRB 2BRTA 4ASLA 5LGTA 3HOBA 5A7OA 1G1XB 5GZDA 4C0BA 4GMP3 5K9YA 1A6CA 2R062 4XABA 1H8TC 4PIZA 1SQVH 1AVBA 3AKTA 3ZKYA 5LBEA 2ARHA 1SC5B 4UCVA 3U07A 4I0AA 3RMXA 4BIUA 2UU9B 2WKKA 2XAGA 3H0OA 3RPQA 3W7XA 2HWC1 1W0PA 3FLTA 4YM3A 3OUSA 3SR2C 3ASOB 1TME2 1VAMA 3T1MA 1MS9A 3DC5A 4COYA 5FP4A 2DCJA 3UT0A 5BNQA 3L2HA 1QCEA 3BEHA 4IEVA 3DKQA 3NJYA 3T0BA 2H8PC 1DLLA 2HBTA 4RUEA 3T30A 3RJ2X 2YSUB 1WZXA 2QGNA 3ILRA 4JAVA 5JCOA 4KXRA 2CTQA 1LOAA 3KF5A 2R063 4O61A 3W9AA 5CFDC 1NU1H 1MA1A 2NLJC 1VQ7V 3OR7C 4LJHA 4Q4X2 1ULPA 2FDHA 3K3NA 4IEPA 5FLXN 1WP7A 3SYOA 4LE4A 1NY71 4R9AA 4J80A 2VD7A 2YYOA 1LR1A 4LORA 1FS0G 3FB7C 1Y76A 3KCCA 2HJFC 3B5LB 4YZ2A 4GX0A 2DURA 2EIDA 4C1WA 3L9JT 3LDEA 4TSFG 4X62B 1BMV2 1ZM1A 3B01A 1SG3A 2DUOA 3W21A 5JJJB 3KSCA 1RPOA 3ZYBA 3N2KB 3K5NA 2A70A 2P6CA 4PDLA 3DKWA 1CIWA 2YV8A 3QH6A 2PI5A 3NNJA 5SV8A 3M3EA 3NNGA 4KGGA 5E89A 3MIBA 4M3CB 4FO9A 1D2DA 5HCHA 2QQJA 2JDYA 3N36A 2VZRA 2P3YA 2VQEB 4Q4Y2 1G9CA 1ZAUA 1K34A 3T4DA 1Z78A 4BLIA 2GHYA 2HBUA 4Y5Z0 2WO7A 3K2OA 3BB6A 3D4KA 4QPKA 1S2KA 1X59A 1XOYA 1IHMA 4EFEA 1QIQA 4LA3A 3D36A 3OGGA 2RS51 4S2DA 3RZLA 1NA1B 1PMHX 1M57C 5FPAA 1ZYBA 5CA6A 4QU2A 4UW3A 1PD3A 1JFFA 4Y5SA 2P6JA 2YDEA 5F32A 5FCCA 2JDPA 1SFYA 3DXUA 2GV9A 3J8F1 4Q0UA 3ZR6A 5A3NA 4FFIA 1OA4A 1NQJA 2KG7A 2WLLA 4J25A 3BPZA 4X1YB 2P4EA 5JVDB 1NR7A 1NKGA 1KECA 1FXKC 1H2MA 3AG1B 3BN6A 3ZRWA 1LOFA 2BJSA 4B4PA 3VBFA 5KA6A 3AKRA 2Z2SB 2WWUA 4LR4A 3O1VA 4YW2A 2PHLA 3FJSA 4DS0A 3IGAC 1AZDA 2HKXA 1SA0A 1GQHA 3FX7A 2XG3A 5L3BA 1WCUA 3HJRA 5HPOA 2JICA 1HNZB 2J1TA 4JI6O 2CHHA 3TAYA 1J95A 3MDPA 3ELNA 1R1A2 3WNXA 2QDRA 1F4MA 1AR61 4CH5A 4CSWA 5FY9A 1GM7A 4QQPA 4AQ2A 5CA0B 3WP5A 1URFA 2QSAA 1NTMH 4AQYO 1ZRFA 4LXLA 3MPPG 2G19A 1CX4A 1US3A 2NYYA 2JIJA 5FYZA 1JPXA 1XNCA 1ND2C 1XMQB 1OF4A 3B40A 2K0GA 2VS0A 4QQ2A 3L74H 3Q8FA 2Q8EA 1NE4A 1N8RW 3GYDA 5IYBO 4OVEA 5B3SB 4DR1B 5ITZB 2A79B 3HWJA 2A1XA 2VMHA 1XOUA 5KMGA 1SQFA 3SH3A 1R1A3 2W0XA 4DK1A 4RL7A 3JQWA 4UCTA 3ZMNA 2PZSA 4A7KA 1OLRA 4GWJA 1OT5A 2QQOA 1ND2B 5L3FA 5B4NA 3FD9A 1FI2A 5EJ1B 2Q1FA 3LSUA 3I49A 3KGZA 1IXMA 5DAQA 3ZYPA 5J2TA 5CISA 4KP4A 4Q1RA 3GM8A 4Y33A 4OQ9A 1H2KA 2UU8A 2MPFA 3APBA 4G9SB 5H6QA 3N9QA 5FY5A 3NL1A 4NKGB 5H6RA 5FMOS 2JVDA 1F9KA 3ZXDA 4YVSC 3I2JA 4LNUB 1QHDA 2VTXA 1AI5A 2JE8A 3GZTB 2JG8A 4DRVA 1KS4A 3M7AA 4ZHQA 2WBKA 3KCYA 4HVOA 2EXKA 2LQTA 4D7TA 1FXVA 5ISLA 4H7LA 4PQ9A 2W95A 4GT1A 3R66A 1K5QA 4CZSA 4QXCA 4EN9B 4LFAO 3H1KH 1EZJA 4I3GA 4F83A 1I6XA 4AZZA 4NAMA 1CVNA 4O4HB 4LEJA 4LO5B 3RGBA 4JI8B 4YXWG 1YWKA 1WPXA 5L7OC 2CAUA 3U75A 2ZGSA 1H8HG 3QF7A 4AYUA 5ABJA 4JV4A 1MVEA 2XPJA 1W04A 1IQDC 3CCJV 4FM1A 4IT5A 4QXHA 5J98B 2ZHNA 1AX1A 3VBOA 5KBFA 4HPKA 2DUQA 5LATA 3LIGA 2E5LO 4NTWA 4LF7O 4W65A 2RDQA 4NAOA 3VGIA 1SQPH 3C2UA 2YY1A 3J9SA 4PHZA 4M01A 1W8TA 4N7UA 4YZ1A 5C71A 3A4UA 3USSA 3NNLA 5C8CC 1LENA 4JASA 3RVYA 2IXKA 3ZHQA 4AFDA 1VBD2 1VB2A 1CAXB 4L0PA 1OCOB 5F3GA 2QBXA 2AHYA 4QPYA 1O91A 3U4SA 3BTZA 1MZ5A 1ULCA 1Q6HA 4J7KA 4PDRA 3TRSB 4FOVA 1VRH1 4C0HA 2VNOA 2QM7A 4ISRA 3ZYGA 1WGPA 3HMYA 1Y7BA 2FMYA 3UGHA 3ZRVA 1A78A 3H1HH 1DGRN 3B09A 4IE7A 1AR4A 2IC1A 2J1UA 3B93A 4B08A 4DV6O 3ZIWA 1AXKA 5I0UA 4UFKA 5FZAA 3X29B 5A7SA 2AENA 1A8MA 2VOTA 2G4IA 3OD0A 4OLLA 1P84F 3OGVA 4WFHA 2BNMA 1CP9A 4XBLA 2ZKLA 1BBT3 5A9GA 2PFWA 1Z0HA 1VBD3 4QXBA 4Y26A 5EP9A 1ORQC 1ST8A 5C9AB 4FMTA 3L9DA 1P4RA 2FDGA 4COZA 1NTKH 5BXZA 1OCRB 3D6EA 4P5HA 3AG7A 4TWTA 1M9NA 1S0FA 2YB7A 2P3KA 2JG9A 2VCMA 3ABKB 3AMMA 3M4FA 2Y4UA 2BFUS 1W6NA 3H1IH 2B9UA 3MHZA 2RM21 2D93A 1XE0A 2FZ2A 5LMNO 4BIFA 3TYJA 2PQSA 2A6ZA 2J1SA 1C28A 3LSQA 1RUG2 4DINB 2VCCA 3IWZA 5C93A 4GX1A 1ZX5A 2H0BA 1MQTB 2WT1A 3OCPA 4LBQB 1Y74A 2WWSA 5FXXA 1Q6UA 2IVIB 2DW4A 1DYPA 2RCVA 3U11A 1JYIA 3OYWA 4LCUC 1SRYA 1C8M1 5JIUA 5IDJA 4O4LA 4C8DA 2AGSA 2N74A 1JX9A 5DUVA 3SYAA 3AK1A 2ZABA 1B35A 3CD6V 1EAH1 3MFAA 5C3RA 1D2QA 1TUBB 1G8MA 2LROA 1NH2D 1BQPA 1RUJ2 5GONB 3UKMA 3OMNB 3VBUC 4Z82A 1Q8OA 2P2KA 4XETA 1OUXA 3R0RA 4JI6B 3ZYRA 1X9TA 1V6LA 2QQUA 1Y66A 2ZCEA 1S0EA 3E6CC 2ZEXA 4JDOA 2ZOEB 3VDAA 2DVFA 2WZR1 3DYMA 5LL6Y 4LBOA 2H0VA 1M06G 4O65A 3M3IA 2EBOA 3CO2A 1WLWA 1RXGA 3LA3A 1QR9A 4XIOA 1EV12 4AQYB 3SJAC 4IGPA 3HT2A 3J4UH 2ZKOA 2LM3A 4RGAA 3G6EV 2L9LA 2HLDG 4WBNB 1WCDJ 4DUZO 4I50A 2JD9A 1ZBA1 2ET1A 3QLQA 2EF6A 3MGUA 2CYFA 5IJRA 1OOPC 2VMEA 4P9OA 3VBBA 3FLPA 2JDMA 3ZN6A 2PY5A 1UZZA 3H3UA 3UKTA 3RSJA 5F2SA 1O4YA 1U5IA 1JOPA 3ABMC 3WUCA 3IJ4A 4AVAA 1W8NA 2DCKA 3TN92 4CH4A 2D6MA 1FNYA 2OPKA 1NBMG 1XE8A 3PMSA 4LBMA 3DPRA 2HWF1 4OI0A 1K42A 1EV13 4HG6B 4JYCA 1ZRDA 1SZXA 3ZXFA 5AC91 5I8YA 5DDJ2 1FOD1 3ABTA 3OBRA 3PVNA 3DYOA 1J58A 1V6JA 5FPUA 4KQ7A 3ETEA 3FL7A 3LDKA 3ZYHA 1SCSA 3LSEA 1QVFU 4HYOA 1C5HA 3ABLC 1YIJV 1LB2A 4H14A 3HQXA 3EFFK 3AK3A 3GBFA 1O8SA 1A34A 1S2BA 4OUSA 1AR82 1RUNA 4QB2A 4XFIA 4UBGA 3P1IA 2HEYF 4NR1A 4LC1A 1AROP 5DN2A 4LF6O 3ICXA 4PI0A 1AL0G 4ZS3A 4ZU7A 4Y20B 3WB2A 1YJ9V 1W8UA 4K1YA 1V6MA 2VC9A 1HV0A 1COWG 3NAPC 5FZDA 4UW5A 4YZ5A 1SESA 2WNVC 5LHIA 2A3YA 2RR13 3N2GB 1YF2A 4LFAB 3MIGA 2EIGA 1PGL1 3MLKA 4HBNA 1YFWA 5DUWA 1E5IA 3G4SV 4SLIA 2WZEA 2JD4A 3DECA 4LHKA 2L6LA 2VTXJ 3LFMA 2PMWB 4IGGA 2W91A 3ZHVA 4TYSA 1ENQA 1NCRB 5FYUA 3AZVA 2Y6KA 3HKBB 2UYBA 1WD3A 1SF9A 1RUC1 5A1LA 4KBZA 3LA2A 4KH9A 4W6WA 5K0UB 4CUBA 2AZ5A 3JQXA 3O9OA 3WU2Z 2X5IC 3BALA 1IQAA 3K46A 5A3UA 3B77A 4IW3A 1WBFA 4YG3A 3B9CA 3ZN1A 2VULA 4NIHA 2WYFA 3AZZA 3VBRB 4YHHO 2BOCC 2E5LB 3EBRA 4NHMA 3N2KA 3CCLV 3IFXA 5FYSA 2D3OW 4L8QA 4RQPC 1UW8A 4M3CA 4OYUA 1UY4A 3OBAA 1AJNA 2ZMKA 1RSOB 3OTOO 3CF6E 1TVKA 3ZN4A 2Z69A 3JATB 2VMDA 1X50A 1RJ7A 2JEUA 3HKCB 3OUFA 4C7UA 2F43G 1ASJ1 5D5QA 4XPVA 4XEZA 1PX3A 1AYN1 1S55A 1W3VA 2PTMA 1JHJA 1KRIA 1XMOO 3WHUA 2XVLA 4FPCA 1PIV1 2P6HA 1DQ0A 4R8HA 4DV6B 2DJVA 4OX9O 3ML0A 4TN7A 5C5UA 4P9LA 4DPNA 1XE7A 3TOJA 3SHRA 3WF1A 3THOA 4WV8A 1ENRA 2VUAA 3F2ZA 1KJLA 5CG8A 3KQ4B 1AF9A 2ZE8A 1ZSPA 4QT6A 5BNPC 2CL2A 3QCWA 3K77A 4X1YA 4JPRA 2GAUA 3ES1A 4LUKA 5FZBA 3O12A 4FPOB 3HT1A 1OLME 4UFIA 4P5YA 5LA2A 5JH7A 3WLUA 4ZU4A 2R071 4OI4A 4FFFA 2YC4A 3R4DB 3GHMA 1SBDA 3I54A 5JOXA 1BK0A 1XNKA 4Y3OA 2XR4A 5IJ0B 4YNIA 5LMNB 5T5PA 2YPJA 4XCAA 3ZSEA 1V0AA 4X1KA 4H37A 2QQKA 5BNPB 2IU3A 4LPLA 4LH6A 1CXZB 1NX9A 3I2DA 4P9XA 2BWCA 1FXKA 5GW7A 3M3CA 1OA2A 3VHOA 4Y24A 4EV0A 1PMIA 4FVVA 1AJPA 3DV8A 2KB1A 3ACLA 1GO3F 1E1RG 4O4JB 1UKRA 1YYNA 1CGPA 5GLUA 4EJRA 2R6QA 4AFBA 5KHGA 3PVBB 1NVPB 1N1SA 2D2CB 3CNAA 5KAIZ 4WVMA 1BVVA 4AEMA 2P1BA 3JZVA 1VQMV 3PMEA 2BTQB 5FUIA 1V9U2 2B5UA 2ZGKA 4CC6A 4O2AB 4LE3A 4DV0O 5GTHZ 1MSDA 2WLMA 2C4XA 4KI5M 2BYVE 1DDLA 3ZPYA 1DFQA 5ITZA 1MACA 1VBA2 3EQEA 2YIBA 1Z2GA 4YARA 5A7NA 2JE7A 4D0QA 2JX9A 2HWC3 4I02A 1VMHA 2W52A 1X36A 1W2OA 4GJYA 1ND2A 4JKMA 2FCUA 4AQSA 3DXRA 1HRI1 3NW4A 4PDWB 2OCCB 1SQQH 4DUZB 4FLXA 4CDQC 2KSDA 1CAUB 3UCSC 3M3QA 1GYKA 1XC6A 1MS1A 3CCVV 5FYVA 3QACA 1JH5A 2NN4A 5CYYA 5LA9A 5CB7A 5K1PA 2YG0A 4LF8O 4QX5A 2UUBB 1YIPA 1W6PA 5FZ7A 4NTYA 4M00A 2P4VA 1LNSA 4CPBA 4LNUA 3WD5A 5F3CA 1IBMO 2XJTA 4Y5TA 4AHXA 1GV9A 4D6RA 5IHRA 3NKGA 2ZGMA 4TV8A 3WV6A 3MBWA 5JXJA 4BQ5A 3GZUC 5DUUA 4LR3A 4NRQA 2PHTA 1U0AA 4A7YA 1N1TA 2BQPA 4COUA 4QWNA 1MR5A 3H50A 2ZBJA 1WNSA 2JXAA 1R1BA 3D0JA 2EJ7A 3CL1A 4JQRA 5FO9B 3AC0A 1UNBA 4GB31 1GKBA 2ZGTA 3C8XA 5FKCA 2ES3A 3K08A 4YY3O 2UWBA 4LF6B 3EHKA 2YXHA 4FM0A 5BR8O 2O57A 2QKSA 4XILA 4ZOLA 1UPSA 1AI7A 5FWEA 4IE0A 4H13B 1PM9A 3H1MA 3K03A 1EFRG 3ASNB 1SPPB 2I45A 4QX1A 4F6RA 1XI1A 1UOGA 1Y6XA 2UXNA 3I8TA 1RVF2 4LK6A 2ZTNA 4MOAA 1WJZA 3PIGA 2PN5A 2D6LX 2QM4A 2GTAA 4BQ1A 3ZXLA 1GOGA 4UW4A 5DN6G 1XQ8A 4W4ZA 2WT0A 4GWMA 1YQ2A 1EYBA 1CAXA 4ASMB 4ZIBA 3THCA 2DQ0A 1LECA 4MHUA 3RZHA 3J8F3 1MS0A 2XBO2 1LEMA 4Q8KA 1JOJA 4OI1A 2E74B 2A5ZA 3J7LA 1OJHA 3PUSA 1E57A 2RMU1 3MW3A 1JYXA 4YHHB 1V6IA 3WDYA 3OEBA 3D3IA 5F3IA 3O1SA 3GVMA 3LPGA 5C8CA 2ZZJA 1U97A 5TISZ 1RVF3 1RM1B 2WAMA 3TJTA 4PIYA 5LBCA 1X7NA 1HV1A 2MEV2 5F2VO 1S2EA 4HK9A 5D8AB 4FLTA 1W9SA 3H3LA 3ZFFC 4XIKA 5GM0A 4JGYB 3A0BZ 2VQTA 4MYEA 3OTOB 1XREA 1MEC1 3IDBB 4M0NA 4NWWA 4OHXA 2Q8VA 1FFTB 2QJVA 3D3AA 3MUZ1 2SBAA 4URAA 3B00A 4AVTA 4HVQA 4FPJA 3AG3B 1VF6C 4IE6A 2XBO3 4JTNA 1AR63 1XMOB 1I5YA 3X2QC 1MZEA 2GMMA 2GC2A 4U3FH 1OI6A 1ULEA 1VQLV 4OX9B 3RS6A 4QPGB 5LBBA 1YFUA 5T50A 2WSVA 2VZQA 3WDXA 4RR3C 4GQ7A 2QWRB 2ZGLA 5LY1A 1CAWB 3QH7A 3UESA 3I2KA 3VBHB 4YRDA 4DV5O 1GLHA 4K35A 4X8AA 5FLHA 3CHXA 4DUYO 5GZEA 5A3LA 2MEV3 1N36O 1YQCA 4BOWA 5CA1A 5FZ1A 5IVFA 3U4XA 1X8MA 4LBQA 5B1AC 2GTSA 1VQPV 5FLIA 5GLVA 3OAAG 4CDUB 3IB3A 3SNMA 2WAAA 3VKLA 1W6MB 2R1BA 4LITA 1K4CC 1KC8W 2UUAB 3LDCA 1W8HA 4YGDA 2NNUA 2DUPA 1OPOA 4LKEA 5LOVB 5FBZA 4ONUA 2G38A 4UXNA 4XDPA 1N47A 1U12A 4Q5OA 4AI9A 4I9QA 1TUBA 5JIAA 3IPVA 4YM0A 4FLUA 5GONA 3AVRA 5FYBA 3AKPA 1GOHA 2CTRA 2L35A 5BNOC 5FDBA 1GTOA 4BW9A 1APNA 2Q4PA 4LFBB 3I2FA 4Y1YA 3OT7A 3FUQA 5FMOL 2WS92 5JAXA 5LRRA 2CH7B 2Y8KA 2EIMC 2XAFA 1RUE2 1N0NA 1PVXA 2R32A 4P08A 3HIFA 1PO12 4N43B 4LFCO 4PA6A 3VBUA 1CQ9A 1LAJA 1S0DA 4PF5A 3B69A 3BHPA 2ARXA 2QZ3A 5FP8A 5IFTA 1DU3D 4D6TH 4DV0B 4WBNA 4Y4YA 4WM7C 4E4ZA 2MK3A 4TWKA 3IDCB 2PHXA 4EN0A 1OVSA 3AXEA 3JAWB 4DV7O 3A0RA 4IEZA 4QAWA 3C90A 5EC2C 5F5QA 3RVZA 3AZWA 3O7OA 2YXSA 2ETNA 3BFRA 4AGVA 2DWDC 3W20A 2ZGQA 4EWAA 2BOIA 3VLBB 2J22A 1UMHA 4QX0A 5F1RA 4GKJO 2LGWA 1V54C 1XU1A 2QQLA 3E5QA 1HNXO 4LT5A 1RUE3 1GWLA 2VBBA 1W0NA 2DVDA 3DEMA 3BI3A 4DR2O 3ZRSA 1NG0A 2CK3G 4UCRA 4B4RA 3ZHUA 1AILA 4YW5A 4DUVA 4CVUA 1VLNA 3PNAA 5FK7A 1G9DA 3LNMB 3ETDA 5EWSA 5FO8B 2B39A 5FOBB 2W9XA 1OOPA 4LF5O 2CAVA 3B4SA 2ZE7A 4GAZA 4L87A 4Q27A 2JKBA 5IYZB 2R041 5JZGC 4OI2A 2UY8A 5JXIA 4ET7A 4G28B 2QJ1A 2BW8A 4LF8B 1K7DA 2VZOA 1JYCA 3AG4C 1PGSA 4PI2A 4YM1A 1QY4A 1JMUB 2EINC 2Q8DA 4BH9A 4CP0A 1QNYA 2VY0A 1DF0A 5JOZA 1XHXA 4LKSA 4GH4B 1IBMB 2BGPA 4K6BA 2WWWA 4RD7A 2HWB2 3TEXA 3SGIA 1PO21 2WFF2 4HONA 1L1FA 1O59A 1VRH3 4MW8A 1DCSA 3E8GA 4XDOA 1QNMA 3N2GA 3GNEA 1SQXH 3POJA 3WOGA 4NN0A 2AEYA 5JOYA 4AILC 2DYRB 2CSGA 1IZ3A 2YMZA 4KG8A 2XHNA 4ZXEA 5FZ3A 4KFMA 5IK7A 4NTXA 1F7YA 1OLQA 4FPPA 3SJQC 2ZEZA 3FHIB 3IM0A 5E8AA 3MW4A 5K1XA 3AMHA 4QKFA 3S6PA 5FZKA 4YY3B 2Z4FA 2QKCA 4FVMA 5H9PA 5LA1A 5BR8B 3ZYJB 1NCRA 2BVBA 1QJU1 2Q0OC 1S0JA 1F5JA 3HKBA 2QTOA 3PURA 3ZHTA 1K8AW 3NAPA 5T5OA 4EZHA 2QQPA 4WFGA 1OVPA 2WNVA 2PHFA 4QD2A 5K0UA 3VBSC 4BW5A 2DYCA 5IK8A 4FLZA 3H8RA 5LP6B 1Q43A 5LGUA 5JCTA 2VW1A 3GWOA 1W2AX 1SLIA 1HP8A 3B2EE 1JYTA 2WFF3 3LUTB 5CA3A 2ITCC 2W68A 3RVHA 4BDVB 4YW3A 1WMDA 3CYOA 2DCYA 1I9RA 2IFRA 5JMCA 4BMEA 2BFUL 2Z3YA 2ZAAA 5HI0A 1JHNA 5IY5B 1K5MB 1M56B 1NOVA 1V00A 2LJ2A 2QQVA 3E8FA 1RSOA 1H1AA 4ZI7B 2QKAA 3JATA 2V1DA 1Q8IA 1BHAA 1YXWA 4AEKA 1S76D 2Y6JA 4QKBA 3FC0A 4E2SA 1UU5A 4UV8A 1LOBA 5IVVA 2HVJC 3ROUA 4PBOA 5DUXA 4BK5A 4JGZC 1C8M3 4HZ3A 1RJ8A 4WFAV 3JUUA 4JZGA 1EAH3 4NE9A 4RQPA 3WG4A 2ZCWA 3CJHB 1UD1A 1N0JA 2P3JA 4YM2A 4XF4A 1ZRCA 1MS5A 5AG2A 1KBHA 4W4KA 1GP6A 5F2WA 3C3TA 2Y69C 1EUUA 4PDMA 5E1RA 5J96B 4AAXA 4WCEV 1J83A 3ZS8C 3ZFEB 5L9VA 5ACA2 2WA3A 4P02B 2VMGA 3JCZA 2R1DA 1KDKA 1OF3A 1M4WA 3RQ0A 3EYPA 2WZR3 2AH2A 3O0VA 3ILFA 3DXTA 3NQHA 1JS9A 5JPMB 5CBFA 2D98A 3IZOA 4CBCA 5BNNC 1QKQA 5LMUO 3P5BA 3J26N 2XHBA 1FV3A 1QOOA 4YJ2B 3PU8A 2J7MA 2E9QA 3JD71 3I2GA 4DV5B 2VZVA 1D2SA 1H1IA 1VMFA 3WX5A 1WBLA 5BNPA 1N3PA 3JARA 1N36B 3AM2A 2OVUA 2Y33A 1DP0A 2IXIA 4GJZA 2X6BA 4YPJA 3V64A 4BE3A 2W46A 1QGLA 5T5LA 1WD4A 3FFZA 2P90A 4QB1A 1F51A 1S5HC 1OPMA 2AXTZ 4BR6A 1JZ4A 3VZOA 1UPGA 2B9VA 1NS1A 1H30A 2XB6C 1JUHA 4HSLA 3VD7A 4MVTA 4O4JA 3CCMV 1AR72 1DGRA 2FMLA 1DZTA 4O9GA 3WUDA 2UUCO 5IFPA 4OHVA 4B4QA 1R081 2K2SA 4XFHA 2H94A 1W6QA 4HETA 4YGCA 3ZMTA 1DBNA 1P7BA 4DW1A 4ZKIA 1SLLA 1FOD3 1AXYA 3FBMA 4QX7A 3H1LH 4LIUA 4QNHB 2RS12 2P34A 2V5YA 2HWD1 1NTZH 4U36A 1TUEB 4GIQA 1K92A 4DOUA 2DWRA 3HNYM 3ZXAC 2ZGPA 4EFBA 1VBE1 3T2PA 1S1AA 2UXDO 1VAKA 4LFCB 3JASB 3JCUZ 3ZN0A 2ZKNA 3ZSJA 4PJ0Z 1UO9A 1C8NA 2P7TC 2YIDA 1K4DC 1AR73 3L75H 2YGLA 1AI4A 3C7EA 3VZJA 4NHLA 3AYDA 1AI6A 4NUBA 1KKDA 1MZFA 2LGQA 4XCBA 5HCAA 3I3QA 4DV7B 1OHHG 4DV4O 2Y48A 2DF7A 1I7FA 3JSLA 4DR5O 1S0BA 3CWBH 2Z79A 4HT1T 5CU1A 3KMHA 2GALA 3KS7A 5FXZA 1UYPA 3WNPA 2EILB 2XJUA 4COWA 3THPA 4UB8Z 3PVEA 3CKHA 1YTFB 2VVDA 2E26A 4DR2B 4HK8A 1C57A 1ZA4A 1ENVA 1KD7A 3P30A 1MABG 3DCQA 4V1PA 4COVA 1YXBA 4E4EA 3ETGA 3CCSV 1HWYA 2GUZB 4LF5B 2VNRA 3WG2A 3IMMA 1DQ6A 2GZWA 4Q4V2 2WIIB 2W3JA 3T2TA 4AGGA 1XYNA 2E31A 4L11A 1B09A 4FTBA 4D94A 3ON7A 3QD6A 5DXDA 1PGW1 4OGQB 2XWJB 5JSRA 4P9GA 4ZPIA 1LHOA 4D6QA 3AG2C 3NWKA 1VP7A 4NPMA 3STZC 4EROA 3VBFB 2XAQA 1HQLA 3B3QE 4Y22A 3WW1A 2XL7A 4QGPA 3WP4A 4FFGA 4IDZA 4X9QA 2JENA 1NAEA 2AZ0A 1SCRA 3T0DA 3RZGA 1SPPA 2LS6A 2IJIA 1ASJ3 3NXSA 4CZZA 1VMJA 2XAHA 1ZLZA 3ZM8A 1IPSA 3WNNA 1FPN2 1YC61 1UMIA 2QFEA 3OEAA 2WC2A 1OA3A 2FYUH 3AG2B 3ABZA 4KG0A 4Y1UA 4CXXA 2NN8A 4Q4V3 1JUIA 2ILMA 2XDVA 1FYUA 4PJYA 4CXYA 1OCCC 1Z7S2 2VL4A 4A3XA 3K59A 1KU9A 3RWKX 4QJFB 5DABA 1R092 3RYRA 5E79Z 2G9ZA 4B7KA 4XFAA 5FRAA 1XNRO 1BQZA 1UKGA 1TEIA 3CJIB 4Q8LA 3S57A 3HQUA 3BY6A 3J7MA 5B1BB 1IG0A 1GM9A 3ZBHA 2FMDA 4UFJA 2JJ1G 1DLCA 4KWLA 3WSOA 4LBKA 1Q90D 1OC1A 1RUH1 3S3WA 4HL0A 1GZTA 2JGDA 3AKQA 1U5XA 2RG4A 3ZXEA 1HJGA 1OCZC 3KVAA 1FPN3 3D0SA 1IPKA 5KMGB 4JZRA 3OY8B 4LBJA 5FR3A 5EZYB 3INAA 1SLCA 3LF7A 5APAA 4JGYA 1KJRA 4ASKA 1AR92 4ATEA 2ZQMA 2TUNA 2ZNIA 4K1ZA 2E7AA 2YZ4A 3GDBA 2NLRA 2E6VA 2ZHLA 4AHZA 4Q29A 1R093 3WQ1A 3H42B 1YSCA 1IS6A 1Z5VA 3EJKA 2IU0A 3AB0A 3NV1A 4XUTA 1ZTEA 1IS5A 1QU7A 4WM8C 2YBPA 2ZR3A 4DMIA 1H2LA 2O14A 4TT3G 3ZFFA 1F2NA 1CAWA 3KZ4C 3K0GA 2WDBA 3VBHA 1JZ5A 1JZ3A 2EAAA 1LRHA 5H2FZ 2JG8B 4H7MA 3FN9A 1QJX2 2ZX1A 3GCWA 5JR2A 2EZPA 4FZ1A 4B3SO 3POGA 3OG2A 1VF6A 2VOVA 2GSYA 1UZVA 4O4IB 2RN9A 4N53C 1AR93 1M4UA 4X89A 3CCRV 1VBC1 1RGSA 3W59A 2X6CA 3RZMA 4NB5A 5DG2A 2E33A 1G4YB 4JI5O 1W6MA 2E32A 1FMD2 3AK2A 5FY0A 4YW4A 1GZ9A 1JJOA 2CTVA 4TQFA 4KWJA 3IIIA 5F6LB 4RR3A 5LMUB 4ZU5A 4EN7B 1AR5A 3I2HA 3IMNA 5LOVA 5J37A 1EUTA 1SBFA 2BZDA 1NZ6A 2D97A 2WINB 2PUSA 4I4TB 1D4M1 4K9SA 2GH2A 1U96A 2PAKA 4CRQA 4FZ0A 2OUJA 4NRMA 5ABJB 3BYWA 1QH6A 3I55V 3VQXA 5IVBA 3JBG2 1CESA 5I0DA 4Z1VA 3AP7A 1ZBE2 1UIJA 2CTWA 1QJX3 2R7EB 1YNAA 1OFSA 4C90A 2CH7A 2C9AA 2BNOA 4DXZA 3K04A 1W28A 3MAQA 4QXKA 4NJ4A 2Z42A 2UUCB 4N43A 1MVQA 5A6XA 5D1IA 1OLMA 1VBB1 4L8JA 1DQ4A 2A3XA 1JQ0A 1H9PA 1XXNA 1SQGA 1V55B 2OIEA 2DVAA 3F7YC 3U0ZA 1I5ZA 4PV1B 5LGNA 4H55A 3SYPA 1RHI2 3E5UA 4N7IA 3AP4A 3MIEA 4DV3B 3E89A 4MTOA 4AQ6A 4DIQA 2YXLA 4O2BB 2VCAA 1QF3A 1GKFA 4A42A 3UETA 3O14A 5F39A 4MVZA 2FZ1A 3JAWA 4YW6A 3CC4V 1K5SA 3RRDA 1UN1A 3JBG3 4O7XA 2AACA 2PYJA 1E5SA 5J48A 4QB6A 2ZGRA 1GK9A 3VL8A 4FCAA 5IWAO 3POIA 2UXDB 1KXGA 3AMPA 3JCIA 4CYDA 2DBNA 2RMKB 2HFEC 3O1OA 2LRPA 1VQ9V 4WM7A 4PF1A 5FYTA 1XL4A 2QWPB 4QPJA 4DYLA 1HXS1 1BE3H 2LO1A 5IK5A 3BUCA 3AVSA 1SETA 2X53S 5L19A 5J36A 1EM1A 4DV4B 4IEWA 3WG1A 1WLCA 2VZSA 4DR5B 1RHI3 2O1QA 2EIKB 4B1LA 3APOA 1CONA 4GZRB 5LBQA 1UOBA 2EA7A 3URFA 4CUAA 5EBMC 4DR6O 1RPRA 1J5EO 1THZA 4IYHA 1RUD2 1OQDA 2ZS6B 3O65A 2RDNA 2ZD9A 2WR9A 3KLSA 4GH4A 2PI4A 5FQ0B 3B7MA 2W1SA 5KUKA 3IAPA 3B8NA 1LNQA 4CEWC 4KBBA 4XTPA 2CWSA 3CU7A 2B42B 3ZOIA 2VUDA 4X8NA 2WABA 4RHV2 3JALB 3CX5F 5J09A 3VDDC 5JZGA 4TOIA 4TLFA 1TMF2 5CNAA 4L99A 2HWE2 3UNPA 2R0HA 2IBZH 5CKQA 2ZJCA 3NV2A 4OMCA 4AEDB 1J1LA 1L7LA 5BY5A 4FLWA 1PZ7A 1FAFA 4O4LB 1MS3A 2XT9A 3B94A 2LW1A 1GH6A 3CMGA 3QVNA 1JU4A 2CNAA 1PL4A 1MEC3 1RUD3 5D2AA 3RYKA 1QLEB 1VQOV 2JECA 1LOCA 4YG6A 3GXUA 3G80A 5LP6A 4IETA 4D3WA 5T52A 1WLEA 1XMQO 3BOWA 4X1IA 4A44A 1WCSA 1HKDA 1NCQC 2KKWA 1JBCA 1S77D 4RHV3 4BMBA 4IUGA 3QNEA 2WJSA 3WY6A 2UXXA 4YGEA 1RUI1 4YG0A 4I0BA 5C4WB 2TBVA 2HWE3 3OEHG 2V7QG 1BEV2 1QXJA 2ZXWC 1QQP2 4ZI7A 3WG7B 1XNRB 3ZHRA 2KXLA 5JSOA 4QX2A 2J42A 1OSGA 1RMU1 1N33O 5JMOA 1I08A 3HB3B 3PLQA 1NCQB 1SHWB 4AXOA 4I50B 4AFMA 4IV1B 2AZ2A 1CJDA 4GLXA 3VKMA 4TV9A 2JIGA 1DK1A 2J1EA 4XBFA 3CCQV 4JI3O 2JDIG 3AL6A 3MHHC 4YVWB 2WWJA 5HCFA 4XBNA 4R9BA 4F7ZA 3V0AB 3JB4C 2ZMNA 3ETPA 4HOOA 1UF2C 2QTWB 2H6BA 1YHQV 1HB1A 1RUOA 2R061 5A6QA 1ND3C 4U7NA 1QQP3 5FZOB 2ORZA 3OE7G 1H38A 3LB9A 3OGRA 3EHBB 3LKJA 4XXAA 2A6YA 1JZ2A 1NXMA 2TNFA 4FFBA 5CB4B 2XLAA 3WQ7A 4I2OA 3RWNA 1M93A 1GOFA 4HAMA 1I5XA 4YJ2A 3GCXA 4QU1A 3N9LA 4IQPA 3IT8A 2QNKA 4JI8O 3OB8A 1TME1 2PHWA 4QPIC 4LUMA 4HXCA 4CP9A 3K0DA 1PVC2 4YW1A 2YI8A 4B3SB 3UQ8A 2ZEYA 3ZXJA 1POQA 2ZPXA 3WHTA 2IJHA 1PX4A 4LHSA 4JI5B 1HN1A 1W99A 1H8TB 2DOSA 4UVAA 2R16A 3T4HB 3JU9A 1E5RA 4FXGB 1YUDA 4EE2A 1F8VA 4MADA 3VUOA 4NIGA 1T6BX 4Q4X1 3VHRA 5C8WA 2YPDA 1WLTA 3J7NA 1W9YA 2VZ1A 1PNGA 3GZEA 1H6YA 1QJY2 5IVCA 5CFCC 1IS3A 5AFBA 4MTXA 3TETA 3BKZA 4GKYA 4OUEA 2B7YA 3PJSK 1WP8A 4JF3A 1BMV1 1PVC3 3GF6A 5IWFA 3OFNG 4IV3C 1JU3A 4CUGA 3Q8CA 4JKKA 4AI3A 1UZWA 2QQMA 1PM4A 2WLPA 2OT5A 2XKPA 4JX0A 1JZ8A 2P3IA 1P49A 3JASA 4K8XA 1OMIA 5CFDB 3LA7A 3MZHA 5CFCB 4Q4Y1 4XDKA 4J9ZB 3VQWA 5F8PA 1OKQA 4XDJA 4QMAA 2E3CA 1IPJA 2GC0A 5CN0A 4YFWA 1A32A 1TVKB 2WO1A 3VKFC 4JYBA 1QJY3 1ZZ7A 1LUWA 2HH9A 1GN4A 3ME2A 3LSSA 3UGGA 1O7FA 3G71V 4PQQA 4XFFA 3VKNA 3IIAA 1Q3EA 5IWAB 2M6YA 3OD4A 1O4TA 3LFIA 1JZ7A 1GR3A 4ZXKA 4LP8A 3C7HA 1W3XA 3PHMA 1I1EA 1HLCA 3UO3A 1Y9QA 5GTIZ 2GUZA 2OQ6A 5K7PA 2WL1A 2QQWA 5EYPA 2F23A 3AFKA 4CS2A 2W1WA 2O8OA 3JB8A 3RW0A 2ZIMA 4EQVA 3EO6A 4MTFA 1DZRA 1VIWB 4QE9A 3APQA 4AR2A 3HAGA 3TCUA 4HN1A 2DYSC 2V5DA 1R1ZA 4PLMA 3RI9A 4DR6B 1J5EB 3BOPA 1V70A 5JH7B 1NLRA 3M99B 1M57B 4HFSA 3F5WC 2A75A 4FFKA 2P5BA 1CEZA 1XB9A 2B1IA 1KGYA 5FREA 3S7EA 3SPHA 2DU0A 3BRCA 4GKXA 1JI6A 2BVVA 2QWNB 5FOJB 5IUQA 3K51A 4X1KB 3K58A 1R1A1 2JEXA 2BGCA 4MGQA 2WT2A 3MW2A 1SBEA 3WW2A 3LEMA 1B06A 1AYM2 1Y9GA 1FXKB 1XDCA 4HLTA 5HV4A 2RS32 4X20B 3KB5A 3RZKA 5GZGA 2F95B 4E2GA 4XUQA 1EP0A 4AVBA 1NJIW 3K57A 4XQ4A 2OCHA 3CRQA 2YS8A 2KA3A 4OHZA 1NE6A 4WVMB 5FNVA 4GXLA 3MDSA 4KWKA 3CJIA 4RS5C 1DTOA 5LA0A 4RFRB 2W1QA 1Q8VA 3WDVA 2FDKA 4LO6B 2IH3C 1RUF2 4A7ZA 3N7LA 3OGIB 3SYCA 4JDNA 5KXCA 3TEZA 2E53A 1GN6A 2VOXA 1AYM3 3D5OA 3OY8A 3IN9A 3I7DA 4WBBA 2CU5A 1KS5A 5EZYA 2RS33 3UL2A 2WAOA 1AL22 3M8AA 3SH4A 4AI8A 1LU1A 3KF3A 4K3AA 4OXSA 1YI7A 4I3PA 3DXRB 3CS5A 3WNKA 4AHWA 1N33B 1JA8A 2ARAA 2VWJA 3JYCA 1BGYH 3PUHA 3Q9OA 1QXRA 5F9TA 1N34B 4PT6A 5FZFA 2PLV2 2XJSA 4UF0A 2DE0X 2ITDC 1Y67A 4ORFA 5F7UA 1UU4A 4JI3B 1W9TA 4NIIA 3TBDA 1RUF3 1N4CA 2DCTA 1PM7A 5C33A 5C3OA 1RTVA 2RJKA 5GJ6A 3H9AA 1W6PB 2OQ7A 3V65A 4CDXC 1L3JA 2DTYA 2YFZA 1I0HA 4ZS2A 3JD3A 1Q8PA 1AL23 4K40A 5CADA 2ZT9B 2Y34A 4TV8B 4O4IA 4FSJA 4I09A 3CCUV 1EBOA 2Y6LA 1FFXB 1MG1A 1P7GA 1TGOA 3K48A 4WM8A 2C1FA 3H7JA 4R7CA 1RP3B 4DV1O 3ACGA 1BQ0A 5A3OA 4EEQA 4N9IA 5FAXA 1WLDA 1BVP1 4NVPA 3SC7X 4R4XA 5KHKA 5IYCO 3FMGA 3CE2A 4YVSB 2PLV3 2GMPA 4XOGA 3N9OA 4I4TA 1YJKA 4W6XA 1YEWA 2R49A 3NSTA 1FXHA 1S72V 4IEOA 3WNOA 2ZZQA 4N53A 4ZOLB 4XHBA 5EXOA 2F66C 4J11A 1WMXA 5CMUA 2FHRA 1WWYA 1CZVA 3KT4A 4YLZA 2QEXV 4F6RB 2BBAA 2OKXA 1TNFA 1KQRA 1XPWA 2QWQB 1YFXA 1DLBA 1J3PA 1GN2A 1S0CA 1POV1 4DUXA 5L7OB 1VBD1 3TWIA 1O6UA 3U78A 3HNMA 1R3JC 1W9FA 1GM8A 4XFBA 3ZDSA 2VQUA 4XQWA 2KQXA 5K4LA 4DR3O 3QO5A 1BBT2 1R3KC 4S2GA 3KKYA 3ZFGC 1IVSA 4XDQA 5BPXA 3LCPA 4Q4W2 4CCNA 4O2BA 1HJFA 4R8CA 3FE5A 1KB9F 3UM7A 5LCWL 1QOTA 5KXDA 3QBQA 4YW7A 5CKMA 3AXDA 2PELA 2ZM6O 5IAVA 2OUHA 3W5MA 1BZWA 2ORXA 2VUCA 2Y6GA 2I2SA 3FYIB 3D3QA 3E22B 5DEDA 5C8CB 2A7AA 4UFMA 2B5HA 3N9PA 4UCSA 3K4AA 4XACA 1BZKA 1X8EA 2NPIA 3USUA 1ALYA 2CDOA 3OJBA 4ARXA 3MIHA 4HKOA 2ZA9A 4P14A 1MNGA 1COV2 2GNTA 2TEPA 1REFA 4Q4W3 4J42A 2OZ6A 2DMXA 4P9IA 4CCCA 3E5XA 1SKVA 5CKNA 4DXWA 3OOXA 3OW2U 4MLOA 3TEWA 1JYWA 4JV5O 2IUWA 4MG2A 1BHGA 1ZZ8A 5JWPA 3CZUA 5FQ0A 1BKZA 1XRUA 3L2YA 1UXXX 1RUG1 3E97A 2F93B 1QVGU 1MSWD 4MHRA 3JALA 1F35A 1JMKC 2CAZC 2WFPA 2ZR2A 4CS4A 4YZ3A 2Q7EA 4FPLA 5CA1B 1T2XA 1POV0 1YRZA 2QVSB 4FBFA 2IXCA 4I0WB 5EC1C 1IKPA 3OPWA 2J1VA 2ENRA 2XMLA 2WNUC 3J7HA 4AEDA 1COV3 3JAKA 4NO4A 2CTPA 5HXVA 5T3NA 3NMBA 4BIOA 2B9ZA 1RUJ1 1BCXA 5E88A 3AEIA 3KHBA 3KM5A 4CEWA 4AHYA 2JB8A 5A7WA 4SBVA 5HV0A 2LW7A 3A23A 2XLFA 1N3QA 3AJZA 4BQWA 2XJVA 3VBOC 3IPVB 2P06A 4W50A 4RA0A 3H8OA 4N90A 3HR0A 2A3WA 2X29A 3LSDA 1IS4A 5GKAC 3VD3A 1B04A 4H0LB 2QUOA 1EV11 1GP4A 1T6GC 2GN3A 1UYZA 2BPA2 3O1PA 4JQTA 4N23A 3A2FA 5C4WA 2P22C 3ZIXA 3ECQA 5FMDA 4ATFA 3S5QA 4DR4O 2VGDA 3OF1A 4LLOA 1Y43B 4TXWA 5IJ9B 4AVSA 1Q56A 4YFZA 2ATFA 2WNEA 3VBUB 5HFLA 4R4ZA 4XJZA 4UFHA 3CRAA 5L3CA 4B1MA 1LOEA 3GALA 1NCQA 1SDWA 1YCIA 4Q1PA 1WB7A 1Q5OA 4IV1A 4Y1VA 4UBHA 4B7EA 1JOBA 3FB6C 5FZGA 3TN91 2XH6A 4AG4A 5BV6A 3OM3B 4BB3A 4TQDA 4MGKE 4F4LA 3ZJZA 5CBHA 3MYXA 2YEVB 1O9GA 2P4KA 2ODMA 3CC7V 1F15A 4ITCA 4I01A 5B66Z 2UUBO 4YVWA 1HRV2 5A80A 4CEYC 5SV5A 2MNGA 1STMA 5FYYA 5DDJ1 5EHDA 2Q1MA 3V0AA 3JAMN 2RR12 2IZWA 1CZTA 3WCRA 4RGKA 3SPJA 2Y4TA 5FZOA 2JG9C 1EZVH 1OOPB 4K8ZA 1TG7A 1V6NA 4BXSV 4L9BA 3Q4HA 3HEIA 5CB4A 1JYVA 3O1TA 1AR81 1KFXL 1Q8QA 3M3OA 5FY8A 4IL6Z 3ABMB 5I0TA 1NZIA 1CIYA 4GKKO 2GSMB 2JDNA 4MO3M 4QGNA 1SLAA 3LAGA 4FI9A 3K3OA 3DN7A 4B3RO 4BYYA 1HRV3 2DWEC 3HPLC 1UY2A 4AQTA 4NPRA 4H3WA 1R6NA 4DQAA 3NVCA 1B35C 2EIJC 2Q5ZA 1CPMA 4HNAB 1H9WA 4DV1B 1LODA 3RZJA 2R9AA 1H8TA 3ABLB 4Q0SA 1Y3TA 3CPWU 4AEJA 2D3PA 3TNQA 4H2AA 1VRBA 5KC5A 4K3UA 1S0GA 4G27B 3HBKA 4FOYA 4MXWB 3FAVA 3DGEA 5FZ9A 3AX4A 3KD4A 2JJ6A 4J1XA 2ARBA 1UZYA 2YIBD 4EWDA 2WPDG 5IT6A 2V4AA 2JS5A 1QXPA 3PUIA 4QKDA 2FDIA 1KDMA 3NAPB 4LF4O 1SEFA 3DGTA 2WNVB 4DUWA 1PNFA 1BLZA 2QKDA 3RJRA 2IJKA 4A3ZA 5FPVA 3AK0A 1E5HA 3M70A 4F3JA 3P3PA 4CP1A 1G8WA 4TUYA 4JRLA 3WF0A 3N7JA 3MIFA 3HN3A 3JD1A 4BA6A 4CCKA 1W06A 4MV2A 5CFDA 4NHXA 4XAEA 4JI1O 5CFCA 2R30A 2WRAA 5LXTB 4DR3B 4EKWA 1D5AA 1KKCA 2HR3A 2FBEA 5FPOA 3Q8BA 1GQGA 3H9VA 2X5IB 4IV3A 3MHSC 3LEKA 3FHQA 4CPBD 2GU9A 3I59A 4DRXB 2ZM6B 4PLNA 1ENSA 3TXSA 4LK7A 1JYNA 3DPRC 2Q6AA 3DL3A 5L9RA 1GMGA 5C5TA 3UT5A 3HKEA 4E8DA 3MV11 4RQPB 3EMRA 4ZZ8A 2XVKA 4FPEA 5B1NA 5FZHA 3C7GA 5EIYB 2FL4A 5HXMA 3BIWE 1ZZ9A 2VXJA 4DXRA 5C7GA 2PF4E 2ZNJA 4X6QB 5CAZA 3OUIA 2VM9A 3WF3A 2YXYA 3G6JB 5TSWA 4FP2A 1C3HA 2CE4A 1RUI3 4WZFA 3RYFB 3E6BA 3ASOC 4BXFA 4JV5B 1FV2A 2UUAO 1UCXA 4DEQA 1FD9A 3BA8A 1GWMA 5IVYA 2OYQA 1G86A 4JTAB 3RYPA 2XL9A 4XDLA 5LYJB 4F6EA 3ASIA 4A2UA 4KMQA 4MGYE 5G05L 1RMU3 2C9KA 2KR2A 1QHTA 3JARB 4LH7A 4AI1A 2VOKA 3IC9A 5GLWA 1VAVA 4LFBO 4W6YA 4X20A 3VQYA 2VW0A 3T09A 5KWRA 2HWC2 2C6SA 2K9ZA 5I0RA 3V0BA 1GBGA 5E16A 4XZUG 1GN3A 1OUSA 4BIZA 1UY1A 1V9U1 3ATGA 3CXCU 3IDAA 1W6QB 4MGSA 2Y26A 3M7MX 4RQFA 1YLLA 3K4DA 3PDQA 2AYHA 4QHZA 1OHFA 1VBA1 4Q2FA 3C7OA 2EXIA 3T08A 5FXWA 1DGSA 4QHBA 3ZSKA 4G3YC 5F6KA 2H3OA 2BOJA 3WB0A 2LTNA 2RE9A 4YSFA 3H8XA 4MGIE 2YI9A 2VECA 1B3QA 2PAEA 1UXZA 4DR4B 4B8EA 1TME3 2AR6A 4GX5A 3M8LA 1NY72 4RS5A 2Y0PA 5EK0A 1NH2B 2RJLA 1RC6A 2PAMA 5FZIA 1VJ2A 2UURA 1WCKA 1ZZCA 1OURA 1IXBA 3G7DA 1CD3G 2AEZA 4XMIA 2HP8A 1NA1C 3WDTA 5FIXA 1QJFA 4FIPC 5BY1A 5KA5A 3H1JH 1XSQA 3LPFA 2YFUA 5DECA 4Q4X3 1G9FA 4DB5A 2WN2A 5L9BA 3OBTA 2QM8A 4LBQD 4UI9L 3LZZA 4X64O 1X82A 3L71H 4XZPA 5IT9N 3A22A 3W5NA 3T0AA 2ZMLA 3T1YB 4BM8A 3BAAA 2A7WA 3AG1C 3Q8AA 4CDQB 1N1YA 2CGNA 3K75B 4CC5A 1AX2A 4JI0O 3P32A 1FFXA 1SS3A 3AKSA 2MHFA 1NXD1 2R9IA 3ZMOA 1Q7YW 2NMOA 2RS52 5FZ4A 4CCOA 4I0XA 3CCEV 4DY5A 2WLQA 1DHKB 1ZZ6A 1UYYA 4OCTA 4Q0VA 1HDJA 4YVSA 1BHBA 4CDXA 1FKAO 1D5NA 4GKKB 2RDRA 3TB0A 3NV3A 3VD5A 4Q4Y3 2HJDA 3J8F2 4UOJA 5FMCA 5C70A 2D40A 2NQYA 1NI8A 4XJWA 4B3RB 4Y22B 2GC3A 1W6OB 1RVF1 3NKTA 3ZPOA 5HBAA 5IVJA 3U1XA 1CN1A 2A9HA 2VQ0A 1H4GA 1N32O 5I0SA 5JXHA 4JYAO 5L7OA 2BERA 3ZX7A 2RS53 1UIKA 5H9CA 1O4ZA 5A7QA 3RYIB 4G2KA 4PELA 2XBO1 1BMFG 2P17A 1K33A 5C3PA 2PYLA 3ZSLA 1MMMA 4XJ9A 5B3SC 4K21A 1N1VA 3SH5A 1US2A 4LF4B 4N8MA 1W0OA 5DG1A 3ITQA 2DBIA 2ARCA 3PIJA 3KV6A 1AR62 4GD4A 4HZFA 5A3PA 3BVOA 5GZCA 4YWAA 1D0HA 1D0GA 2VVEA 5J2UB 5FJHA 1HIXA 1OH4A 1HDKA 3UJOA 4KNCA 1VARA 2VZPA 3ZCCA 3WNLA 2MEV1 4DZGA 5EIBD 2JGDB 4R50A 2VTFA 2WLIB 3E22A 5FPLA 5CG9A 4JI1B 3ZFGA 4FAHA 2J1AA 3ZKUA 3ABUA 4DO0A 4P00B 3ZO0B 3NNFA 1AJOA 4JI4O 1IKQA 2EIBA 3LQCA 3AYEA 1V6KA 5IAXA 2EIEA 1L0NH 3SPGA 4YZ4A 2RHPA 4UWDA 2FB5A 2VW2A 4KWUA 3CDZB 1SLTA 1VQ6V 3ST7A 4PA3A 3THTA 4XJAA 5KX5B 1GNYA 1AJKA 3CQOA 1XYOA 2ZEWA 3SMHA 3UV9A 2HEVF 4JVAA 4E2LA 1XNBA 2EZOA 3ZFFB 2ZACA 3WEZA 4XF9A 4K20A 5FFOC 3JD0A 2Y0IA 1EN5A 4CH3A 3A7QA 4A6SA 5KXBA 2QE7G 3AZYA 1DQ5A 2BSKA 2VJXA 3CXHF 1R73A 3O0WA 2YC0A 3ZMSA 1QWRA 4S2HA 1ZRIA 3X2QB 2OZJA 5D5PA 2QDOA 2IXJA 4UUJC 3CRCA 1KEXA 4NXMO 3SEEA 4CDWC 4CTEA 2GP3A 4RR3B 1GANA 3IC7A 1TZOA 2VOWA 4DXSA 5DMYA 4BWAA 3ZIAG 2ADQB 3OMIB 1ZX3A 1DYOA 5FZLA 1GAXA 3S30A 5ERLA 4E4DX 2NP0A 5FJKA 1UPIA 5ANNA 2JGUA 2FKXA 5B1AB 3W7WA 2WS91 3ZXKA 2WNUA 1RUE1 1O5UA 2CGOA 5I8TA 4QGMA 1JOYA 1WB8A 2K46A 4CDWB 3HPNA 1PO11 1OCOC 2YBSA 1LUVA 4MVSA 2BGOA 3WB1A 1ULGA 4Q20A 1QDOA 1UQXA 2WQ8A 1B6QA 3AYCA 5IJ9A 4GZ9A 5K8SA 2GN7A 3GBGA 4UXAA 2VVFA 1P8JA 4RAIA 4UFZA 1OQ1A 1AVMA 2Q8CA 3PVOA 5FZCA 1PNMA 4CU6A 2YGMA 5BNOB 1S0IA 3ILNA 1YZBA 2XTAA 4LWSA 1O3QA 2WZ8A 3VD4A 4XUOA 3L72H 5FWJA 2D7FA 2EIMB 3POSA 3ACFA 4KUMA 3IAYA 2YU1A 2YEVA 4XTMA 3DUIA 2D3SA 1FATA 4BK4A 1HB4A 3CBNA 1YQ5A 1JJ2U 1ACCA 1OXCA 3LEIA 2YROA 5FZEA 5C9AC 1RITA 1WMFA 1VRH2 4CA9A 4IXLA 4X88A 5H9RA 2ET7A 2BOBC 3GB7C 2WSSG 1JXNA 1OCRC 1LHWA 1GZWB 1QH7A 4WM7B 4JAUA 2V72A 4U2AA 1XL6A 4IGOA 4RFT0 3H8UA 3ABKC 1Y9MA 2WQ4A 5IK4A 5LASA 1YHFA 4EB6B 1OD5A 1K3EA 2FCVA 2NM1A 3C7FA 2VR4A 3GWKC 3H01A 1OD3A 4WVVA 5T5JA 1LR5A 1MZ6A 4PA9A 3LDRA 4GCZA 4FK5C 1POV3 1EPZA 3GGLA 4CEYA 1V54B 4I30A 5L73A 4XMAA 2Q1ZB 4X64B 4GX2A 2UWCA 3OUHA 2HWB1 1MQTC 3RMYA 2WFF1 1I5PA 1WN7A 3HQRA 4QX3A 2XONA 4UVBA 4ZKTB 2PA7A 2VRZA 3MD0A 4JI0B 1LHVA 4N21A 2P5OA 3K4ZA 1JN2P 1LOGA 4CU9A 2R72A 3ACIA 1NVPD 4HNAA 1U5ZA 3VHPA 5JZGB 2Q8OA 4NPLA 1R3LC 4QIWF 2ZX2A 2BE3A 4LOTA 3AG4B 4J6GA 3K3WA 2RM22 2JDUA 3WF4A 2W1UA 2EINB 4MXWA 4M3CF 4JKLA 2C5DA 2VMFA 1HX6A 1ONAA 4W4LA 3H1YA 3HD8B 4YJ3A 3BU0A 1K45A 4ES8A 3CLPA 3BTXA 4MVQA 1URXA 4ZBMA 5H9SA 1C8M2 1S3JA 4FAGA 2D5HA 4IEQA 4XE9A 2RV9A 3ZEDA 1YIFA 1V9PA 4WZCA 4X1IB 3POBA 1EAH2 1WA8A 1N32B 2IVJA 4JDMA 4UCOA 1MS4A 5DAPA 4JYAB 1I94O 2Y6FA 4DR7O 3WW4A 4A5UB 4DXTA 2G9GA 5LXTA 2VCBA 3IKWA 1RUG3 2DCZA 2RM23 1YJLA 1HQWA 4YGBA 4RQEA 4P2ZA 3FUOA 1XU2A 3VBSB 4Z92B 2WZR2 1UAIA 2X5IA 1RFYA 4KHPO 3T2MA 4DFSA 2E75B 1R6TA 3ETQA 1LHNA 2VMIA 5LZ6A 4DRXA 1VQ5V 4H33A 5DAVA 4YIPA 3CZJA 2ZAHA 1HB2A 4GUNA 4XF1A 5FPRA 4CE8A 2K1EA 1RUJ3 4TV9B 4RWUA 1GFF2 2W08A 4OPHA 4FM2A 5A6ZA 5EIBC 3MICA 3KQRA 5ACA1 3N4MA 2HKOA 1HR0O 5BXXA 3C3SA 2JWPA 4JI4B 1ZBA2 1PNKA 1PZ8A 5CBGA 2W47A 5JPNB 5F5IA 3CRMA 1Y4MA 5A1AA 3UKVA 3AMNA 1DGLA 3DF0A 5FZMA 3JD2A 1E79G 1M5IA 4OPAA 2K9PA 4PA7A 1K3IA 4NIAA 2AW9A 3GJAA 2N05A 4QQOA 4JGZB 1S5LZ 4X65O 4H44B 1W90A 3LDBA 2JEMA 2C0ZA 4XF0A 4U3JB 5DZGA 3RYFA 4FFBB 2QQNA 4CCMA 5JJNB 3KCXA 2HWF2 3J80N 4A6OA 2W2IA 3WDWA 1DF4A 4FT8A 5AC92 3A21A 3PUAA 2Y69B 5LYJA 4YYOA 5CZKA 3OMAB 1Z5WA 1FOD2 1ULFA 5E1AC 3ACHA 5J3UA 1ZL8B 4CP9B 3UKNA 5A3TA 3I3MA 2EX3A 1MPXA 4OMDA 1EPWA 1ZBA3 5DQ0A 5IW0A 5EYYA 1VEWA 1AR71 5JUVA 2VNGA 1NCRC 3TN93 3CMAV 4BWOA 5G04L 4NXMB 5KHJA 5BNNB 4B29A 4X8PA 4QDRA 1XNQO 5K0UC 2JDHA 5LHHA 1LEDA 2FTKA 1KP2A 1AXZA 3I2OA 2Q9LA 5DDJ3 4QGLA 3FWEA 1DG6A 2WLJA 1LGBA 2HWF3 3W7TA 3VBRC 2RS11 3NRUA 5AC93 5GLTA 3VZKA 4WFEA 2GC1A 2Y64A 1PGL2 2PQQA 2HVKC 2VQAA 4DV3O 5FMBA 1HW5A 4CH6A 1Q82W 1O9HA 2B4KA 2GNDA 1X9PA 5A1FA 2EXHA 1AR83 2BNNA 4GWIA 4J41A 3FBYA 4M4PA 1DQ1A 3U14A 2YUAA 1RUC2 3CJXA 4IL7A 2FQPA 3FZ3A 5BMVB 2F4PA 4FFHA 4E8CA 4K7JA 2JDAA 2UXBO 2IWGB 2GH8A 4LF7B 1S4CA 1WW7A 2AGAA 1C1LA 1JCHA 1LHUA 5A7PA 2OS2A 2HLEA 5EBLC 2ADDA 3NR7A 1GMMA 1ODMA 5FKBA 2W87A 3WDUA 1SACA 5KXEA 4QDSA 4I9WA 3LOBA 1PPJH 1J59A 1O8PA 3U37A 5A3MA 2WLHA 4XUPA 3EXAA 1ZRRA 2RVAA 1F4AA 5LEKA 1AX0A 4FOQA 4PLOA 2EAKA 4DK0A 4L92A 4FQ4A 1ZUQA 4HSJA 4RUFA 1K97A 3HN1A 3HKDB 1H1MA 1Q8SA 4V2WA 3SQOA 1OKOA 5FZ0A 3T2QA 2HHHO 1ASJ2 1UMZA 4Q4V1 4QX8A 4CDQA 1RUC3 1FJGO 1AYN2 1NA1A 4AVVA 1FYJA 2YHJA 3NNMA 3HBZA 4B3TO 2CY6A 1PIV2 1UY0A 3I97A 1AB3A 1LTEA 1YJNV 5EYPB 3IBMA 4MVOA 1WAZA 4IIJB 1W2TA 2QA4V 2M7WA 2ZDIC 4MVMA 2V73A 5L3DA 4GYCB 3SLIA 2IH1C 4IHJB 4UVCA 5JVDA 3O1MA 3VL9A 4I5SA 4HN0A 3KZIZ 5GALA 3VDBA 2NMNA 1YDXA 2Y60A 1OQEA 1C1FA 1XNTA 1O3TA 1W6OA 1E1QG 1FPN1 1LU2A 1C5IA 3IAQA 2VH9A 1YQ8A 4EN8B 3O5SA 1GWKA 1GNHA 1XQNA 3PJQA 4ISQA 4QE7A 3CC2V 1W03A 2R072 3PJYA 5B4XA 1AYN3 1WA6X 4UT5A 2IW5A 1GSLA 1JW6A 1GUIA 5FV3A 1Z7S1 4IESA 1PIV3 3NJZA 3EVKA 5C6CA 1R091 3RYIA 4B3MO 1L0LH 1G9AA 2JJ2G 2HYXA 2PHUA 3ORJA 2DFBA 5J9PC 4K8FA 5CA0A 4BQ2A 5FYHA 3MEPA 1GU3A 5IATA 5LBFA 2OXBA 3VV1A 5FNVB 3LEGA 2BWAA 2E76B 1A8DA 3CIHA 3DC6A 2BUKA 2CDPA 5J2UA 2EALA 3U10A 4INDA 4Z07A 1I94B 2CGPA 3R4UA 1X4TA 2VZ3A 4FPKA 2JIZG 4DR7B 4PDWC 2XJQA 3WINE 1PKXA 3KHCA 5L36A 2WLIA 1OFNA 1OCCB 2OCCC 2XNDG 1JZ6A 2R073 2JDKA 1AR91 2XJRA 3WQ0A 1TA8A 2LALA 3N9MA 3SXWA 3LNNA 1UY3A 1C4RA 3WCSA 1YITV 4JTDB 2JB4A 4MGTA 1PMJX 4KHPB 5I93A 1CJPA 1ZNPA 5LA6B 3PUQA 1KYOF 4Z1MG 2XASA 4TSVA 4LO8A 2WO3A 5DAXA 3F7VC 5F37A 5KX5A 4J1WA 1OCZB 4UF0B 2Q67A 4QDQA 2D6OX 1VP6A 3E6DA 3HNBM 1HRI2 4NROA 2WZPP 3ZR5A 4AW7A 4JTOA 1G9BA 1QJX1 2XOMA 1V9U3 4Q0QA 1HR0B 4A41A 1Q86W 4RSUA 3SEPA 3I3BA 4R9DA 1GRJA 1VALA 5FPBA 1VBA3 3MV01 4DY3A 3MLLA 1FMD1 3NV4A 4X65B 5DPNA 3RBZA 1W2UA 2BDRA 2X0LA 1DYKA 2V4DA 2OX0A 1PHMA 4WM8B 4BCUA 3CEIA 1W05A 3ZYFA 3S5AA 1FXZA 3KGLA 3ASNC 1PL0A 3QG5A 3TNPB 2X8KA 2OTLV 3WFVA 4E2QA 1AP6A 3JBG1 4O4HA 3L73H 5GLZA 1UU6A 1HRI3 1AUYA 1ZBE1 2FCTA 4Z2WA 3E1F1 2HJIA 4N53B 2BP6A 4QKNA 1KD1W 5H9QA 3ZHSA 4EN6B 1PV0A 2UYAA 3AJYA 4FLVA 3W7UA 4LULA 4GB32 3WT3A 4IEUA 5J1XA 1X33A 1FT9A 4CDWA 3F95A 1SERA 2BU9A 4LLFA 1W0JG 4FPHA 2B1GA 3SCHA 3ZMZA 2A6XA 1XNQB 2VG9A 1NLQA 1AJQA 2DN9A 1KMIZ 3UJQA 1QLNA 1QQCA 1L8DA 1RHI1 1UOFA 4J7JA 3SCGA 3O0XA 5BNOA 2XUMA 1UX6A 2JE9A 1YJWV 2E63A 3RNSA 2OWOA 1RM1C 2C2AA 3BCCH 2PXJA 3FB5C 4LKFA 4XJUA 5D8AC 3I5DA 1R6KA 4I55B 1PK6C 1XHZA 4JI7O 4JGYC 2DV9A 1G6UA 1WMEA 3UGFA 1W8ZA 1XSRA 3NJVA 4GB33 1YFYA 3H1WA 5A3WA 3AFGA 1XILA 5A2QN 1SQBH 4KGQA 1BXHA 2EJRA 4L97A 5EBWC 2UXBB 3AG3C 4XFGA 5EYXA 4D7SA 1GZWA 2YC2A 1W8FA 1VF5B 3WVJA 2RMU2 5L3GA 2ZGOA 1EY2A 4LIVA 3T4ZA 2D43A 3USUB 4BU2A 4MH0E 1VQ8V 1ROPA 4WVZA 5L3EA 5DM6V 3DTUB 3ZYIB 4EB6A 3PTYA 4QPGC 4F8AA 5KC6A 2DU1A 1PK6B 1OH3A 1W59A 2W5FA 1N3OA 4JHTA 1FPOA 3VBHC 1RUD1 5KUMA 2ZHKA 2NZ9A 1IURA 2WA4A 2DDUA 2G9FA 4ZZ5A 2C24A 2B45X 2OA2A 5C9AA 1MEC2 4FOWA 4P9WA 2XWBB 2XLGA 4CDUC 2Q4SA 4RHV1 2HHHB 1YI2V 4JYYA 4NYKA 4D69A 1FJGB 4MVUA 3SYQA 2VPVA 3QO7A 2ZX3A 1TMF1 1RXFA 5C8YB 2HWE1 4B3TB 3MPBA 4QM8A 3P3NA 5BYNA 4LKDA 5FYCA 2H6CA 2RMU3 3TK1A 2X10A 2YUEA 3A8TA 4U7OA 3RT3C 5EJ3A 1MQTA 2VO5A 3G6BA 3JAKB 4LF9O 3SPIA 2ADPA 3LGRA 1TNRA 1W9WA 3MIDA 2QWOB 4CEWB 1CR7A 3RWRD 3RYCB 5A7WB 4CCLA 2FDFA 1VQNV 4LQRA 4XHXA 4FTSA 3ZXGA 5FY4A 4UB6Z 3VDDB 1RINA 3VZLA 1JVMA 3PTRB 2D44A 1YQ6A 4S2FA 2EICA 1UOJA 4N43C 3DYPA 4IEYA 1NKDA 3B02A 5DAWA 3RI8A 2UXCO 1QMJA 1W39A 4Y1XA 2QDNA 2SLIA 2JKXA 1BEV1 3RYHB 1ULDA 3VDCA 5FZ6A 4META 3UO2A 4UW6A 4B3MB 1QR8A 3Q8EA 1QQP1 4XUNA 2ZX4A 4FPYA 4GMP1 1J3QA 3VOUA 4E9KA 3VBSA 2C26A 5T54A 4OHYA 1GP5A 4LNVA 1TQ5A 3ZDVA 3POYA 2VNVA 3A0NA 1WPBA 2VQFO 4ZY9A 2A71A 2AUYA 1YTFD 3K06A 5FZ8A 4BQYA 5FLJA 1BK1A 1V6OA 5C3SA 3JSNA 2VWKA 1N34O 3BVCA 2Q69A 2YICA 4B3NA 4TTGA 2W6JG 3VHNA 4AOCA 4JZ2A 2HG5C 5GZFA 2VMCA 4FP3A 3N3HA 4R6ZA 1EN6A 4GULA 2ZXWB 4WFBV 2Z5WA 1CAVB 3RZZA 1LJ7A 5A33B 4OQ8A 5B5EZ 4XURA 1WKYA 4BJ0A 2WLNA 3SKJE 3OGJA 4XQDA 1AR1B 2N7GA 4CUCA 3SISA 2OT7A 2WS93 1F4HA 3MF9A 1ZZBA 1HNWO 5EZWA 2BEOA 4A4AA 1LCLA 4JGZA 3THDA 2PHRA 5LHGA 3E83A 1GQPA 4GH4C 2ZXQA 1BS3A 4U3JA 1PO13 2WSUA 3Q4HB 5LK7B 1SLBA 1WCQA 3SDLA 3KV5A 3KV9A 4WFFA 1PVC1 5FXVA 5J7MA 1JR9A 4CCJA 5DZEA 4AFCA 4AL9A 4X66O 2DYRC 4NHKA 1ZL8A 3OUJA 2CDYA 3WNMA 3T2OA 2R042 3AZXA 2WO2A 1ND3B 1UWWA 1VQ4V 5LW9A 3T4VA 1ENXA 2W0FC 2ATKC 1K12A 2B8MA 4Y20A 4BQXA 3I3DA 3WXPA 3LD8A 5BUVA 5BNNA 4BQ3A 4GMP0 2P67A 5JQGB 4JCKA 2Q0AA 3E35A 1G6NA 1QJY1 5LP6C 4P9PA 1PO22 3CB2A 4QPIB 3VQVA 3SKVA 1MOFA 3FAVB 2GDFA 4ARYA 1WW6A 2A0LA 1OZ0A 4EWEA 3ENRA 2BV4A 4PIXA 3AYAA 1QJZA 4IYIA 2QQIA 1NQTA 4CS3A 1QBZA 5KHIA 4DRRA 3VZMA 3GHNA 5FK8A 2CV6A 1XBLA 3MI8A 4MXVA 4CU8A 1J84A 4MZUA 2R043 1D7PM 5IY5C 1K5MC 1JTZX 1M56C 2ID4A 4AWDA 2LW8A 4Q26A 1QJU2 4TUYB 1H0BA 2PHDA 2GDSA 2HWB3 3EB7A 2XUEA 3KWVA 3AMQA 5BMVA 2V09A 1QOSA 3VBRA 4MT8A 3E86A 4W8JA 1H8VA 2R0FA 1F23A 2HYKA 3M2MA 5A32B 5I91A 2R70A 4LA2A 3F5TA 1PO23 2RJ2A 2ZX0A 5T55A 4NXNO 2R9RB 3ZMUA 1CX1A 3RFRA 2VXRA 1M1KW 2FD8A 5EFUA 3O1RA 3E8HA 4CXWA 4IV3B 1VB4A 4MS2A 3ZX6A 4QHOA 4RO2A 1XNAA 4P9YA 4FTEA 4JI7B 4PBPA 3I59B 3H3ZA 3WR0A 3MLJA
chains in the Genus database with same CATH topology
1GICA 4JDOA 3BCWA 2D97A 1AX2A 2ZOEB 2DVFA 2WINB 2WZR1 4LBOA 2H0VA 1M06G 1D4M1 1TE1B 3ZFEC 4K9SA 2GH2A 3M3IA 4FPGA 3AKSA 2MHFA 1NXD1 1WLWA 3CO2A 2D6KA 2PAKA 4CRQA 5B2GB 2OUJA 3ZMOA 3LA3A 2NMOA 4XIOA 2RS52 1EV12 2W39A 5ABJB 1QH6A 3JBG2 1CESA 4M2GA 1QJU3 4DY5A 2WLQA 1DHKB 1ZZ6A 4Z1VA 5I8SA 3AP7A 1J3RA 1ZBE2 4Q0VA 1UIJA 3HT2A 4YVSA 4M2EA 3J4UH 2LM3A 4CDXA 1QJX3 4RGAA 1YNAA 5KHHA 3TB0A 3NV3A 1OFSA 4C90A 4Q4Y3 3M1HA 3J8F2 2C9AA 2XJPA 1OIIA 2ERFA 2BNOA 3EXUA 4DXZA 1WCDJ 4QXKA 2D40A 1ZBA1 1NLSA 2NQYA 2Z42A 4XJWA 2ET1A 3LOIA 3QLQA 2EF6A 3MGUA 4Y22B 2CYFA 2GC3A 1OOPC 1W6OB 2I07B 4N43A 3T1LA 1MVQA 1RVF1 1DIWA 3NKTA 3FLPA 5D1IA 1VBB1 4XYXA 3ZSMA 5HBAA 2A3XA 1DQ4A 1H9PA 3ZN6A 4XJ8A 1XXNA 1DGWA 1UZZA 3H3UA 3UKTA 3RSJA 2DVAA 2ZHMA 2XVGA 3U0ZA 1CN1A 1I5ZA 1O4YA 1U5IA 2VQ0A 4H55A 1RHI2 1H4GA 3E5UA 3WUCA 4N7IA 4AVAA 3AP4A 3GBWA 2DCKA 3MIEA 3VN4A 3TN92 4OFGA 5I0SA 4AQ6A 2D6MA 1FNYA 1QF3A 4GALA 3O14A 2OPKA 3RG0A 1XE8A 2P37A 5L7OA 1IGOA 2FZ1A 3PMSA 4LBMA 3DPRA 2HWF1 3ZX7A 4OI0A 2RS53 1EV13 5JI7A 1UIKA 1O4ZA 1AYM1 4URTA 1DQ2A 3RRDA 1UN1A 3JBG3 1ZRDA 5AC91 3ZXFA 2XBO1 4KU8A 2RS31 5J48A 2P17A 5I8YA 5DDJ2 1FOD1 2ZGRA 3OBRA 3PVNA 3ZSLA 1YO8A 3VL8A 1J58A 4FCAA 4XJ9A 4K21A 1GVGA 1N1VA 5FO7B 1GNZA 3SH5A 1V6JA 1W0OA 5DG1A 1KXGA 4KQ7A 4KU7A 3AMPA 3JCIA 4CYDA 3JD72 1SCSA 3LSEA 4HZFA 1AR62 1C5HA 5GZCA 1LB2A 4CVYA 1D0HA 4H14A 3HQXA 4WM7A 3H7YA 3GBFA 4NOTA 1D0GA 2VVEA 1S2BA 4OUSA 5ACA3 1AR82 1HIXA 3V0BB 1RUNA 3W58A 1HDKA 1HXS1 4UBGA 4XFIA 3UJOA 4KNCA 2HEYF 4NR1A 1RL3A 5IK5A 2MEV1 4M0HA 2X53S 4DZGA 3I4IA 1AL0G 5J36A 5L19A 5CIRA 4PCRA 4IEWA 3WG1A 3R6SA 1WLCA 4ZU7A 4BZ4A 5CG9A 1RHI3 1G7YA 4Y20B 3ZFGA 4FAHA 4BG1A 1YI9A 2O1QA 1RUF1 4K1YA 1V6MA 1HV0A 3ZO0B 3NAPC 1CONA 4YZ5A 2EA7A 4UW5A 1QDCA 1AJOA 3URFA 1IKQA 2WNVC 3AYEA 2A3YA 1V6KA 2RR13 2PYTA 1RUD2 1OQDA 4YZ4A 2RHPA 2ZS6B 4WVWA 2A6WA 3MIGA 4TZDA 2EIGA 1R082 3KLSA 4GH4A 4M23A 1AL21 2UWAA 2VW2A 3WP3A 2R6SA 2OG5A 1PGL1 5FQ0B 3B7MA 3CEWA 3MLKA 4HBNA 4AFAA 3HR9A 1YFWA 1SLTA 3ST7A 4NE0A 5DUWA 4CEWC 4KBBA 3D82A 4XTPA 2CWSA 1NYWA 3CU7A 4SLIA 3R4SA 1DRTA 2B42B 3NO8A 2OYZA 2BBVA 3THTA 2BTVC 2JD4A 3JD73 4LHKA 4X8NA 4XJAA 4RHV2 1QU0A 4AF9A 5J09A 4TYSA 3VDDC 1ENQA 1AJKA 4RGGA 5JZGA 4RS5B 1XYOA 1NCRB 2HWD2 3ALQA 3AP5A 3SMHA 3AZVA 2HEVF 4TLFA 3UV9A 1TMF2 2UYBA 4JVAA 1WD3A 2D3RA 4L99A 5CNAA 2HWE2 3FFQA 1XNBA <