1H2MA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator/inhibitor
molecule keywords FACTOR INHIBITING HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2mA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2mA01
3D8CA 4Z2WA 1H2KA 4QU2A 3KCXA 4B7KA 2Y0IA 2WA4A 4Z1VA 4JAAA 2ILMA 2CGOA 3P3PA 5JWPA 3KCYA 1H2NA 1H2MA 1YCIA 2W0XA 4AI8A 2WA3A 4BIOA 2XUMA 1IZ3A 1MZEA 4B7EA 3P3NA 2CGNA 1MZFA 2YDEA 1H2LA 4NR1A 2YC0A 3OD4A
chains in the Genus database with same CATH superfamily
1KFXL 1ZBA3 2HR3A 1I3HA 3Q4HB 3ZM8A 2IXIA 1QU7A 1QJX3 4XVHA 4KU8A 1GZWA 4BK4A 1AI7A 3KKYA 5FYBA 2B1GA 2RS13 4QPJA 5HPOA 1JYXA 2CGNA 2VH9A 5GONA 4EROA 1JBCA 1VAMA 1DGWX 1GO3F 3CE2A 4YZ5A 4MT8A 2OTLV 3ZFFB 1XNBA 1V6LA 3ZXFA 3VZMA 3QH6A 1WW4A 5BMVA 4FM1A 2PY5A 4GA9A 2ZNJA 2PI4A 2DYSC 4QX8A 1BCCH 4QXHA 4FXGB 4JI5B 1QU0A 3JSLA 4FLZA 3VKLA 4H44B 1RUH3 5LP6B 4CCCA 4XJUA 1WCDJ 1IURA 3PVNA 5BNQA 1ZZ7A 2YEVA 1Z2GA 3MPPG 3WLUA 4XDPA 5LA0A 4LF6O 2WLJA 1O8PA 1AX1A 2WO3A 1PNMA 1RXFA 1WW7A 2WZEA 2DWRA 2VUAA 1SKVA 5E16A 4X65B 2YC0A 5CKNA 3DF0A 1F7YA 2YBPA 3VDDB 3AJZA 1F5FA 1LNSA 3WNNA 2AACA 1XMOO 4MX3A 1GZTA 1OFSA 3USSA 3G71V 2VMFA 1Z7S1 1MQTB 4DZGA 4UXNA 2NMNA 1ND2A 3GB7C 2XJPA 1R1ZA 1WJZA 3TEZA 1J83A 4QHBA 1HN1A 5BNOA 5FZ4A 4X1KB 4WM8C 4Q0QA 3D3QA 1OVPA 4PCRA 1H1AA 5F2VO 4LLOA 2YIDA 3BI3A 2AXTZ 4JI3B 1GICA 3OD4A 4QHZA 1W8HA 1SQQH 4XDQA 3RYRA 2QKCA 1XNTA 5I91A 4YGDA 1UXXX 4UCVA 1VQ6V 2WNVA 1PK6A 4OI4A 1R1A1 1EY2A 1EUTA 4HPKA 1MS8A 1UKGA 2RS53 4MHRA 4XUOA 4P2ZA 4QB6A 3ZYFA 3ZSMA 3KT4A 3N7MA 3W5MA 1J1LA 1A8DA 1POV1 1QCEA 3I59B 5GLWA 3A23A 1K34A 1WA6X 3R65A 1GN4A 3ZYJB 1WLDA 4X1YB 4AVBA 4IIJB 3S5AA 2B9ZA 4Q4V3 3JALB 3TEWA 4A6SA 1BL8A 4RYDA 4AI8A 3VBOA 5LA9A 4WFEA 4XUPA 3O9OA 2P4EA 5ANNA 1PIV2 1Q8QA 1YVWA 4MXWB 1HRI1 2RDRA 1FKAO 4UVBA 1G9AA 2W92A 2VZQA 1YTFD 3K5LA 4Y1ZA 1T6GC 5E8AA 1HLCA 3USUA 1FXKC 1YITV 4F7ZA 3MD0A 2WBKA 1F35A 1UD1A 4NIGA 5EC2C 1COV2 4WVMB 1C8M2 2JGDA 2Y6HA 4J10A 3LEGA 4JRAA 5BYNA 4IGOA 4TQFA 3ES1A 2WQ8A 5CFDA 3ILNA 4O2BB 2Q73A 1VMFA 1O5LA 2B7YA 4FTEA 4XFCA 3NV3A 3U0ZA 3ELNA 4IEYA 4KI5M 2VL4A 2ZM6O 4CDXA 4FO9A 4Y5Z0 1KKDA 4HANA 1VP6A 4JGZC 1LUVA 4NYKA 2UUBB 4XBFA 4A44A 2Y0IA 1XUQA 4HETA 3TNQA 5AC93 3POBA 1VBA3 5ANQA 1VIWB 4J6GA 1RUC1 3LE0A 2VMIA 1YJ9V 4IEXA 4MVRA 4I0XA 4NPMA 3HPNA 1JJOA 3AG3C 3H1IH 2YPDA 1H30A 2DDUA 3AYAA 4R4ZA 1FOD3 1O59A 2VCMA 3MW4A 4OZXA 2RR11 1ZYBA 2HWC3 4MGSA 4LEJA 5EFUA 2CTVA 2D6LX 4DYLA 3C7HA 3VUOA 2QQVA 4XDLA 1BQPA 2D6NA 4IERA 1G6UA 3VQWA 1REDA 2P6HA 2QTWB 1JZ7A 1OD3A 2JIZG 1A32A 4IGGA 4BIOA 1LKNA 1CJDA 5K0UB 3HNBM 4A3ZA 2XT9A 2O1QA 4EFBA 1SC5B 1V0AA 3FB8C 3UKTA 1AXKA 1JFFA 5IJ9A 3LPFA 1CAWB 1K9MW 2JJ2G 4S2HA 2WFF2 2KQXA 1FV3A 1IGOA 1OKQA 1LNQA 3HT2A 3ZFFA 4LC1A 4ZPIA 4UB8Z 4XZUG 2ZE5A 5J96B 5HCAA 2ID4A 4BOWA 4Y22A 1H2MA 4LH6A 1X36A 2NLRA 4AVAA 2RMU1 3BTYA 4UBHA 4J1WA 3T2TA 3JCZA 2VO5A 3W7XA 3AMQA 1NUKA 5D8AC 3DSQA 2OVUA 3M3QA 4RHV2 2ARAA 4YVSA 2ZKNA 1AI4A 1DF4A 3AMHA 1I94B 2YU2A 3CCJV 4ZZ8A 1XB9A 4ASLA 4YM3A 1P8JA 4HVRA 3LSUA 4AVSA 1ND3B 5J36A 2VZ1A 2VVDA 4FTSA 2H0BA 5A9GA 4OMCA 1PNFA 4YM2A 5IWAO 3OTOO 2CDYA 3A21A 4HVOA 4A3XA 3VBRA 1WMDA 3VDDA 3WP4A 5L9BA 2HWB1 3F7YC 2Z42A 4NO4A 2HBTA 4XQWA 3WCRA 2F4VB 3CDZB 1W04A 4LO4B 2VZPA 3BU0A 4M01A 1XNKA 2ZAHA 3M99B 1W9FA 2VECA 3FL7A 4X1KA 3WG1A 1Z5WA 4FFIA 1PGSA 3AJYA 4LFAB 1ND2C 3PMSA 2JDIG 4CUGA 1FFXB 1MS0A 3WW2A 3WR0A 1AHSA 5BNOC 2WZR1 1VBD2 4X62O 4LWSB 3SJAC 4DR3O 4LR3A 5C7GA 1M1KW 4M4PA 2VUCA 3CO2A 5F9TA 2WT1A 3PJQA 1HJFA 4IEOA 3Q8AA 5LZ6A 2VBDA 5FPBA 4YZ2A 2CGOA 5EPAA 5FP3A 3ZKUA 3CRAA 1KU9A 4XJ9A 2C2AA 3I59A 3NRUA 1VBC1 2GC0A 5EBLC 2XAFA 4H0LB 4ZIBA 3S7IA 5K9YA 1FAYA 3JALA 1WLWA 3BGAA 4LF8O 1HP8A 3OGRA 4GIQA 4QIWF 5FYZA 1QDCA 3SPHA 3WDYA 3MFCA 2JK5C 2JKBA 1BMV2 1B09A 1GLHA 1QXRA 4IE5A 4LJHA 2AHZA 3F7VC 1ASJ1 2GU9A 4LO5B 3GGLA 4FTBA 1AB3A 1AP6A 2ZEYA 1GOGA 4Y1UA 1AR5A 4URTA 5LBQA 3WNXA 5LATA 5LYJB 2E9QA 3U1XA 2XJTA 1N34B 4LBJA 4LR4A 5H6RA 2CWSA 4AQYB 1X9PA 4UFMA 1WAZA 1S0BA 5LMNO 2ZHMA 5IVEA 3CC2V 3HT1A 3SPIA 3EMRA 2QDRA 4XOGA 1WPXA 1NR7A 1PVC1 2EJ7A 4KL1A 2E5LO 4CEYB 5F6KA 3VBUA 4L8QA 4HONA 3UT5B 4OYUA 3ITQA 3ZFEC 1BE3H 3I2JA 2CU5A 1VAVA 4O2BA 3OR6C 3BPSA 4BXSV 1DGLA 4CEWB 3P30A 5C93A 4W4ZA 4UFJA 1CD3G 1H4GA 1R082 5LXTB 4MTGA 3RSJA 1H9PA 4B3SO 4Z2WA 3B3QE 3FB6C 4ZI7B 4M00A 1XYNA 1PZ7A 1S76D 1EV12 2Y33A 2CUGA 2W08A 2UWBA 1W0KG 3RQ0A 2PYTA 1O3SA 3N2KB 3U75A 5A3TA 5EJ1B 5IVJA 4LKSA 2E6VA 1JA8A 3VBFB 1JTZX 2JDMA 3B40A 1APNA 3WB0A 2BYVE 2WABA 4TXWA 4AI9A 2HWD1 2WNEA 2GMEA 5B1AB 1XNCA 4LORA 4IYHA 3VDBA 2ZGNA 4YFWA 4KGGA 3HKDB 2QEXV 2UURA 4H7LA 2HWF3 1F4MA 2WLLB 2DCKA 1A34A 3BOPA 2VC9A 5KAFZ 1OC1A 2LQTA 3QF7A 2WAAA 1SZTA 2WAMA 4OPAA 1W3XA 1V9U2 4HK9A 5J2TA 1O4TA 1RUF3 1WGPA 2X6BA 1SACA 4JAAA 1X8EA 2UXDO 1YXBA 5H9PA 1PL0A 2AC1A 4NHXA 3O1TA 4I09A 3LNNA 4GMP3 4RA0A 5FO9B 1VLNA 2PLV2 1UNBA 5BY1A 1ZZBA 4H7MA 1AL23 2W1UA 2E7AA 3LB9A 3FWEA 2AZ2A 4XC9A 2HWE2 4CDUA 4EN7B 2NM1A 2YU1A 1S0FA 1IBMB 5LOVA 1WUVA 2WRAA 2F43G 2X0LA 4XFBA 4W6YA 1YHQV 3KT7A 4DR6B 3ZFFC 3ZOIA 2P90A 4PHZA 2UUAO 3L74H 3P3PA 5IY5B 4IETA 5LASA 1D4M1 5DDJ2 1JODA 1DLBA 1DHKB 2AZ5A 3IB3A 4MVUA 2R0HA 2VULA 2KA3A 4BQ4A 2V4DA 3AMMA 4YVSC 3SYAA 1ND3A 1JYTA 4I30A 3ILRA 2N7GA 3X2QB 5A7SA 3MPBA 3QH7A 4CA9A 5FUPA 5DG2A 2X29A 3WF0A 2PGGA 4I0BA 3TK1A 1M9NA 1I5XA 1ZSPA 4BMBA 1STMA 1X50A 2ZGPA 2WLQA 3LSQA 5C5UA 2XG3A 2OX0A 3U37A 4PA6A 3VDDC 2L35A 4Y20B 2YDEA 1R3LC 2K0GA 2JD9A 2PQSA 2VJXA 1MQTC 3AVRA 4D6TH 4AF9A 2IH3C 3O14A 4TN7A 4HKLA 1DGRA 1ZRIA 4RFRB 1QH7A 2R063 3K5OA 4MXVA 1NJIW 4LWSA 2P3YA 4RL7A 4U3FH 2Q8CA 1DQ5A 4QGNA 1P84F 3CJIB 5FZ3A 3DTUB 1MVQA 2RJKA 2E53A 1RUOA 1DU3D 2EZOA 2YI9A 2HLEA 2Y6KA 5EWSA 1NA1A 3K3NA 1VBB1 1RJ7A 3WHUA 2B46X 2Q5TA 2D97A 2ZZQA 1GTOA 2UU9B 3POFA 1OLME 4XBLA 4B3TB 1N1TA 3UJOA 5JVDA 3K2OA 5EZWA 2ITCC 3P6BA 1M4UA 3RWKX 3RWNA 3ZN0A 4CXWA 1OHHG 1EUUA 1NZ6A 3AKSA 4RFT0 3OUHA 1RUD1 4DRXA 1D4VB 2ARXA 1OFNA 4DK0A 3FN9A 4X6QB 2E26A 4YLZA 3D36C 2ITDC 3ZN1A 4KHPO 1SBEA 1SS3A 1Y43B 2ZE6A 4QQPA 4TV9A 1ZBA1 4UVCA 4NB5A 2QKSA 1BCXA 1QJX1 4ZONA 5KC6A 3WQBA 3VD9A 1DZRA 2QQUA 1HNWB 2X8KA 4CPBD 4WZFA 1AXYA 2RS11 5JH7A 4A4AA 4QXCA 5CIRA 1V9PA 5EC1C 4HZFA 5IVFA 4YZ3A 4HOOA 3SXWA 1AYM1 1JUHA 1YI2V 4JF3A 3ZIAG 1HW5A 1SPPB 2OT7A 1IG0A 2VOXA 3J8F3 4M4RA 3KHBA 1K73W 1W8UA 1DLCA 2XUMA 4V2WA 3GXUA 3UT5A 1EN6A 4AZZA 2BVVA 3TJTA 2GN3A 4S2FA 4K7JA 1FPOA 3E1F1 4META 3WQ1A 3QO8A 3NMBA 3LSSA 4UAPA 2PFWA 3GVMA 4ZI7A 4JDOA 4FPEA 3AK2A 3FUQA 1IOAA 1RUH1 4UCRA 3MV01 3T1MA 2CL2A 3DYPA 3CCEV 1F15A 2UXXA 3N2KA 5KX5B 4IEVA 5DN2A 3VBFA 3KHCA 2IJHA 5KHIA 2IWGB 4E8CA 3WP5A 2W47A 3RYCB 3HKCB 3DGTA 3R05A 2G38A 3M3IA 2DMXA 4B08A 1K33A 4XILA 4DO0A 3HKDA 4ISRA 4O7XA 3ACGA 1F31A 2WLLA 3ZYGA 4CU7A 1ZZCA 2FKXA 3ETGA 5C3QA 2BRTA 1ULOA 4FPOB 1WA8B 3AKRA 3B2EE 3EO6A 4K9SA 2BOIA 3OEHG 3T0BA 5FZ7A 4NTWA 4O2AB 3ABZA 1RC6A 3T1CA 4XBNA 1EZVH 1M06G 4ATEA 3LNMB 4PV1B 1W2TA 1EM1A 4YHHO 1URXA 5K0UC 3ZSJA 4PDWA 2AHYA 4D6QA 2WLKA 5AFBA 4YGCA 3J7LA 5H9RA 1OZ0A 5CAZA 1QR9A 4TV8B 3OSDA 3M7MX 4CCKA 1HNZO 2WYFA 3ZYIB 2WNUA 5LHGA 4KXRA 2QJ1A 2VTXJ 3K9AA 5F2SA 2WZPP 4YJ3A 4XAEA 1K92A 4WFBV 3K48A 4DMIA 2D6OX 1Q8PA 2VNOA 3ZDSA 1LAJA 1JMUB 2MEV2 1CGPA 4GMP0 3N7LA 4BISA 2EIEA 4EN0A 5FPAA 2W95A 2AH2A 3AG4B 2G9FA 3ZFGB 2K2SA 3BA9A 2VQFB 5J48A 1CPNA 4Q27A 5CNAA 3B69A 2W39A 4OPHA 1ND3C 3MZHA 3CKHA 3OBZA 3BB6A 4YW3A 3DV8A 1EP0A 3WQ0A 3ZHTA 3JD3A 1S0CA 5ERLA 3PJYA 3PJSK 2DFBA 2YXLA 5KAIZ 2AGSA 1CAUA 1N3PA 4XJ8A 2W5FA 4K20A 1LODA 1UOBA 2BOJA 4BW5A 4RQFA 3NKTA 1IS6A 3P3NA 4DR5B 5A80A 1YZBA 5FMCA 4JTNA 3FB5C 3CC4V 1VRBA 2OZ6A 3U10A 2I07B 5JWPA 4QB1A 3A8TA 4NTYA 4LBOA 1NE4A 2FTKA 3UJQA 1Y9MA 5ABJA 3CCRV 4MUVA 5JSRA 4FLTA 3L72H 2FCUA 1X7NA 2OIGA 5AC91 1E5HA 4Y24A 1D2QA 5C8WA 2J1AA 3S3XA 3UKVA 1HKDA 1S1AA 2ENRA 3SEEA 3K3WA 3WCSA 1J3RA 4CBCA 3THOA 4QHOA 4I2OA 3N4MA 2V5DA 1FOD1 2JDHA 3S3WA 1XXNA 3IAYA 3N2GB 2WA3A 1Q7YW 1N36O 2A0LA 2HWC1 1Y74B 1DQ0A 2DVDA 3ZX6A 5G04L 3BYWA 1NTZH 1Z7S2 1Q82W 2ZE8A 2Y69B 4UFHA 4YXWG 2A3QA 3JARB 1W8NA 4F3JA 1Y6XA 5CZKA 2DTWA 3MF6A 5H6QA 4XETA 1ST8A 5A1FA 3I3BA 3AYEA 2ADDA 1RUG3 3SITA 1AJPA 4AOCA 1TA8A 2Z79A 3ZN6B 3OGCC 3KWVA 1RUJ3 2YPJA 1R1A2 2E7QA 4BWOA 4ZXKA 2YI8A 1G8MA 5ACA3 2WWSA 3BPZA 5FPLA 4BQ3A 4L87A 1I08A 4I4TB 3JASB 5E1RA 4R4XA 3DC6A 2PYJA 1X9TA 5LY2A 2Y4TA 1QOOA 2P5OA 5F3IA 2HFEC 3SYPA 4FP3A 3ZRSA 3EFFK 4ICGA 4CEWC 3QTCA 4QXKA 3B09A 3U4XA 1GMMA 3GWKC 3J81N 2ORXA 2W91A 3H9VA 3EHKA 4CDWA 1Y9QA 4QPIB 1MS5A 3TETA 3ZIWA 3LSDA 2ZIMA 3TEXA 1F2NA 1SESA 2FQPA 5B4NA 3HKCA 1B35B 1MVEA 5FPZA 1S3JA 1HRI2 1MS3A 3VBFC 3M3CA 2ZGQA 3AK3A 3RN4A 1KB9F 4DV0B 1HNXB 2DCTA 5FYHA 1ULEA 5B1AC 1GM8A 2EX3A 1FMD3 4X8NA 4ATFA 3BCWA 1CR7A 4J7KA 4N21A 2HKOA 4N43A 4MLOA 2R043 1O5UA 5I8YA 4QPGA 3KQRA 1LHUA 5T5OA 3OT7A 1O3RA 3OTOB 1ZZ8A 4LHKA 3VB9A 1PGW1 4NIAA 2WLMA 5IJ0A 2Y60A 3CCLV 4K1ZA 5LA1A 1OUSA 3ZHVA 3B77A 1MACA 4Q4W1 4Q5OA 5LBEA 2YUAA 3FJSA 4QX7A 3O12A 1CAXA 3E83A 2VY0A 2F6BA 4YY3O 4XMAA 5LHIA 2G1MA 1F4AA 5LY1A 4UF0A 1O91A 1RUC2 3FHAA 1OA4A 4DR3B 4DV3O 5I0RA 4Q4Y3 2LRPA 4EZ4A 5L73A 1R092 3SDLA 4B3MB 1NXMA 4LK6A 1L0NH 3RYKA 1W8WA 1GV9A 2P5BA 4JI0B 3ZYRA 1OCCB 4QU1A 5IY5C 2BBAA 3ENRA 3ZFGA 3RYFB 3RNSA 5BPXA 1XOUA 3BODA 1FXHA 1JZ3A 5LCWL 1QOSA 4IYIA 4QE9A 4DINB 3BRCA 1MABG 4X6RB 4J9ZB 2VQUA 2Q4PA 1CONA 4L2NA 4UFKA 2UXBO 1YJKA 2O0OA 1PKXA 5I0DA 2ZGTA 4QDRA 4LF8B 5IYYA 3FYEB 2C9KA 1QKQA 4OHWA 4LBMA 5A7WA 3K46A 1UY0A 3PUQA 3M3OA 2VMHA 2VZUA 2VM9A 3ZXDA 4OHZA 2OZJA 4WBNB 1Y7BA 5GW7A 3AK0A 4WM7B 2VZVA 3J7AU 2XNDG 3O0WA 1K3EA 3CHXA 3NL1A 5C4WB 2YXSA 2PHTA 5FLIA 3JCUZ 3I54A 2HP8A 4RQEA 1US2A 4XF0A 1LHOA 4U3JB 1XBLA 1Q8OA 2DCYA 5EBWC 2OCCC 1MEC3 1KS5A 5IYCO 1J84A 3C2UA 4GX1A 3PTYA 3QO7A 4F6RA 4OQ8A 1XNQO 4EN9B 4KG0A 4NIIA 1CQ9A 1TG7A 2FZ1A 2SLIA 4OULA 3CJIC 5A2QN 3ZRWB 1BBT3 2E76B 2P17A 1DK1A 2J1VA 1P7GA 3HB3B 4YSFA 1RVF2 5M0TA 1DYKA 5FPVA 5KMGA 1SA0A 1EN4A 3C8XA 4LKFA 2AREA 5BXXA 3LDDA 5BNPA 4B3SB 1I5YA 1G9FA 3D6EA 4YM1A 2HWB2 3E22B 1R6KA 1UU5A 2VUDA 2WT0A 4LO8A 4AFMA 4B3RO 1MZ6A 5FY9A 3AZZA 1GM7A 3FAVA 2QKDA 1AYN3 1ULPA 5HFMA 3RG0A 5IT6A 4CZSA 4MGIE 2PHWA 5LGNA 1NG0A 4CRQA 3JARA 1WB7A 1CAVB 5B1OA 4BCUA 4FFBB 1UMIA 4ORFA 4GLXA 3SCHA 5JMCA 2AENA 4XFHA 1KUQA 5FZ8A 2GZWA 4PA9A 4GMP1 2AZ0A 2VTXA 2WZR2 2LM3A 4CYDA 1X4TA 1H2GA 4A5UB 3ETPA 1GYKA 5FY1A 5JSPA 2GC2A 4ZU5A 1XHZA 1AL21 5DUWA 1YYNA 2YROA 4MTFA 1YQ6A 4JQRA 1IKPA 2JB8A 4GX2A 3T4ZA 3HPLC 3WNPA 4LKEA 1IS5A 4JI4O 5DEDA 3FKSG 4COUA 1VBC2 5JVVA 2YXYA 1Q8IA 3DXRB 4CCLA 3WQ7A 2Y4UA 2XLGA 3EHBB 3SC7X 2JEXA 3INAA 2Y6JA 5C9AA 1NCRA 2QE3A 2DCJA 5FYMA 2XJQA 3KCCA 2JXAA 1COV1 3WDXA 4UFLA 2YB7A 5A6QA 3W59A 1SBFA 2FDJA 2LUWA 1A78A 3T0DA 4NXMB 4BK5A 2WLPA 1PO23 4JYYA 1ASJ2 3POSA 1B35A 1AUYA 4ZHNA 4K8XA 3GJAA 4CDWC 4IV1A 2UUAB 5JZGB 1VR3A 1JYCA 1W2BU 1SHWB 2ORZA 1YO8A 3PUAA 2RM22 1QJY3 3RZKA 1BK1A 1HV1A 2ARBA 3VGIA 1UOJA 1AX0A 4NKGB 4LH7A 1VBE3 3RPQA 4FOVA 4B29A 2JDYA 5IYBO 1PVC2 4XE9A 3SLIA 3UKMA 1KKCA 4DFSA 3H01A 1OXCA 3N3HA 3DYMA 2BEOA 3ZYHA 1UKRA 4JGSA 1Q86W 3GALA 4IUGA 1PIV3 2E3CA 1V55B 3I97A 4GKYA 4BR6A 4QPGC 2GMMA 2PYLA 4NXNB 3R0RA 3Q8EA 2EIBA 1SERA 5FO7B 3A7QA 4DR7O 1F9KA 2GMPA 1SFPA 2W52A 3MLKA 1VALA 2VAUA 4QE7A 4MZUA 1P4RA 5ISLA 4HBNA 1S0EA 3CCMV 4UCTA 1GR3A 1JN2P 3D82A 3E2EA 4MV2A 4GCZA 4MGYE 5JOXA 3AKPA 2Q9LA 2EIKC 1GQHA 5FNVB 1OCRB 1W6QA 3HKEA 3ZSLA 4CXXA 4E4DX 4LBNA 2OT5A 5GZEA 3PUIA 3KB5A 1CPYA 2HWD2 3FX7A 4M3CB 2FDKA 3OM3B 1SFYA 4XEZA 5F2WA 4DXWA 4QQOA 4LHSA 3IBMA 4QXBA 4NVPA 2K1EA 3VHRA 3MBWA 4D6RA 3HEIA 5DG1A 1F4HA 1S2BA 3NAPA 2R30A 3ZFGC 3ZMZA 3A0RA 3H7JA 4TUYB 1WBFA 4FVMA 5KUKA 3BTAA 4N7UA 1U97A 5DAPA 4P5YA 2R9AA 3BTXA 5FWEA 3CMAV 4WZCA 4RHV1 2JIGA 2CGPA 2W1WA 2WO2A 5IK5A 4YVWA 3VBSA 1TZOA 2AGAA 5K1XA 4YARA 3DEMA 3J8F1 2RCVA 5DN6G 4DW1A 2YSUB 5JJNB 5GLTA 4X88A 3OTFA 2XHKA 5C4WA 5KHHA 1LTEA 5FP8A 3DGEA 3MEPA 4FAHA 4GKKB 2BTOA 4COYA 1Q81W 3K79A 3CJHB 3OY8A 2F93B 4K3UA 5F7UA 3IKWA 4E4SA 1U96A 4LXLA 3JSNA 4O9GA 2PTMA 1URFA 3D5OA 1N1SA 4YW1A 1GU3A 2BNMA 4IEQA 3ZRWA 1JZ2A 5FYVA 3RYHA 5LA6B 2WFF3 3V56A 3HIFA 1JHNA 4LITA 4XTPA 2RDNA 3JD2A 1NLSA 1D2SA 1E79G 2DV9A 2X5IA 4B3NA 1DQ1A 5GLUA 2JG8B 1AX2A 2H6BA 2XWBB 3BN6A 2Y6FA 4CP9A 3TNPB 3AXDA 3A0KA 2DOSA 5FBJA 4LIVA 4CDQB 5LRSA 4LMFA 1QHDA 5FQ0B 1YQ2A 1VQ9V 1ZBE3 1VRH1 1RUE2 2XOKG 3JD73 2UXCO 4E4EA 1XMQO 2IUWA 3LIHA 5TSWA 4OUMA 2YG0A 5H9QA 1YF2A 3BEHA 3DECA 1SQBH 1J1TA 5SV5A 4YW2A 2Y69C 1ZRFA 5LK7B 5DUXA 4X66O 4GKJO 3O1RA 4RGKA 2QQNA 3SPJA 2VPVA 2R9RB 3NXSA 4BPZA 3K03A 1GWMA 3Q8BA 4NAOA 4O4IB 3JCIA 2AW9A 5C3PA 3O1SA 3CF6E 4WFGA 3LOIA 3I7DA 2K9PA 1NAEA 3H3UA 4H13B 4NHLA 2WSUA 4DXSA 2JG9A 4ET7A 1VBB2 1LOAA 3VHNA 2WT2A 2VQEB 3OOXA 3OEEG 1MSWD 1LEDA 1UAIA 2D3OW 2TUNA 3ZR6A 3RYPA 3DXRA 3BVOA 4YHHB 3Q8FA 3QNEA 4XXPA 2ZXWB 1LB2A 4JYAB 1RUI3 2WR9A 3KVBA 3E6DA 4X1IA 4LFCO 4D0QA 2DTYA 1N33O 2ZX1A 1LUWA 2JENA 2PF4E 1Q3EA 4TT3G 1RUD2 1JJ2U 5C9AC 1NCRC 4IT5A 4BIUA 4P9OA 4SLIA 1XREA 3H1YA 3OR7C 4QPIC 4DXTA 1GN6A 2G9ZA 5JZGA 1RSOB 2WA4A 1ZBA2 1R6NA 4IV3A 2ZOEB 2ZGLA 1JS9A 3JU9A 3EYPA 4MTOA 3T4VA 4GZ9A 3C3SA 3STZC 1I0HA 1QJX2 1B35C 4CVUA 4DRVA 3RZMA 4XF3A 2YV8A 4IV1C 3PU8A 2RS12 1R6TA 4N23A 4YZ4A 3IGAC 2ZKLA 4R9DA 3MLLA 3E8HA 4I9QA 5I0UA 1AYM2 3RVZA 2W3JA 3LA3A 4RGGA 4EB6B 2NP0A 1PMJX 2XAGA 5BR8O 4CSWA 5A3WA 2YC2A 3K04A 5B1BC 3H3ZA 3JAKA 4J42A 1WLTA 1KS4A 1XL4A 5GJ6A 4UBGA 4TYSA 2V73A 3O65A 3C7GA 3G80A 2Q8VA 1RUH2 2XKPA 4XF1A 3UCSC 2VVEA 3WP3A 1PM4A 1YCIA 2LFSA 2ZNIA 1OLMA 4IE7A 1V9U1 4OVEA 4X20A 5FNVA 1QQP3 4LHNA 2LO1A 4GT1A 1QJU3 3JATA 1W2UA 1UYPA 5IYDO 4XBQA 1J58A 2YFZA 4IQPA 3LEMA 2EIMC 2PLV1 4MGQA 5F5QA 1W8ZA 3E6CC 1WCUA 1XQNA 4MW3A 1OI6A 5IATA 1N32O 2JS5A 4QKDA 1RPOA 2WLIB 3B8NA 1QIQA 4QKNA 1GN3A 3A0NA 4W4KA 1OCCC 4JTAB 2JJ6A 4IHJA 1WW6A 3QVNA 3VD4A 4OHYA 2VUJA 2Q4SA 3ALQA 4FMTA 4W4LA 3GZUC 3I5DA 2VMEA 5IT9N 4BQ2A 4TUYA 4NR1A 3AZYA 3M3EA 1IS4A 1K5MB 4YWAA 3CEIA 1XC6A 1N36B 3NAPC 5F3EA 3IZOA 3T1HO 4LBKA 3JAMN 1RUG1 1SBDA 1UFIA 2C24A 3UGGA 5EIBC 1O4ZA 1ONAA 1RUJ1 4JGYA 3GZEA 4UV8A 2CTQA 2RS52 3ETDA 5ACA1 1KJRA 5IJRA 1U0AA 1M57B 2ZDIC 4GWIA 2TNFA 3TXQA 2VBPA 2PAKA 1I6XA 4JTCB 2BGCA 4WM7C 4P14A 1UY4A 3CJHA 1W6PB 4QJFB 2KSDA 4FFGA 4DR1B 4A7KA 3ML0A 1YIFA 5C4WC 2OKXA 4NRMA 3NSTA 4Q4V2 3CRMA 1VB4A 4PIZA 4CUAA 4YZ1A 3W7WA 1ZL8B 4CU6A 3SPGA 2GC1A 3ZMTA 2ZX0A 4P5HA 4M3CF 2BSKA 4UW4A 1H8TB 3B8MA 3HBZA 3SYOA 4JI2B 1TME3 1YRZA 3AKQA 4GKXA 5A6ZA 4HAMA 4E2LA 2BV4A 4G27B 1JVMA 1HB4A 1MS1A 3AYDA 3TAYA 1RPRA 4CDQA 1N3OA 5FXXA 5KA6A 2X5IC 4MADA 4AQSA 1NI8A 2Y6LA 2GH2A 5BV6A 2VOTA 1IPJA 2ZGRA 4AFAA 1KBHA 1FMD1 4LNVA 4DV7B 2ZX2A 2QQJA 3OB8A 4BQXA 4N8MA 1DGRN 2Q6AA 2R041 4DR4B 1UO9A 3ZHQA 4J41A 2O57A 5EXOA 3IIAA 1WLCA 5J1XA 2G19A 3A4UA 2ZHKA 1H1IA 1KRIA 3U07A 1X82A 2Q67A 5IFPA 4LQRA 4N90A 4JI6B 4L99A 2C5DA 3GF6A 1HQLA 4LF4O 5LMUB 1XU2A 3PURA 3KZIZ 4P9IA 1G9BA 1JHJA 3ACHA 4ZS2A 3EBRA 1OOPB 4KBBA 3K0GA 2CWMA 4WM8A 4MH0E 4DUXA 3RFRA 2B5HA 2W94A 3IC7A 3DN7A 1FJGO 1PVXA 5AC92 1VBA2 2GNDA 2BOCC 2QWOB 2DWDC 1QNYA 3VHPA 4QKFA 5J2UB 3DPRA 1H2LA 2PQQA 3OUSA 2BWCA 1NX9A 2JG9C 5DZEA 1REEA 3AZWA 4Q4Y1 4AHXA 4KMQA 2QTOA 2QBXA 2A6VA 4YG3A 4WF9V 5FBZA 4LFBB 1FOD2 3JAWB 5C70A 2HWC2 3W9AA 1WBLA 1EAH1 1QJFA 4YPJA 3X29B 2RDSA 2EIJB 4I01A 4OX9B 4GWJA 3MF9A 1YIPA 2KKWA 2B4KA 5HCBA 1RSOA 5LBCA 5JR7B 3ZHRA 1OCZB 1BQZA 5IK8A 4FSJA 1N3QA 3HQXA 4FT8A 2WWWA 5JZGC 1RTVA 2YC4A 1CPMA 4O4HA 1W0PA 3KV6A 1CX1A 3LDEA 5D5PA 1OLQA 3Q8CA 1YQ5A 4EB6A 1IVSA 2QM8A 3TBDA 3HOBA 3CPWU 3W20A 4WBBA 3EB7A 5FP7A 3GBGA 5K4LA 1FXKA 2UXBB 2XL9A 1KYOF 3VKMA 3RZZA 3TCUA 3DC5A 1MEC1 2P2KA 4X64B 3N7JA 3OF1A 4D94A 2B9UA 1G6NA 1IBLB 1UIJA 3KMHA 4TZDA 4DR2O 4KWKA 1H0BA 1TUBB 1V55C 1N1YA 4LF7B 4E27A 2A70A 4K1YA 4I0AA 1ULCA 1BT8A 1BBT1 4LBLA 3WT3A 4LNUB 4NTXA 3WNLA 1FNYA 2DBNA 5EYXA 4AEDB 4COZA 1XILA 4RQPA 1HB3A 4BMEA 2R70A 4I50A 2A9HA 2OIEA 3VKFC 1QLEB 1BSMA 1OCRC 5CBFA 3D4KA 3LFMA 1Q43A 1QF3A 5CEHA 2DBIA 3P5BA 1AYN1 5H9SA 1XHXA 1LECA 4MS2A 3LGRA 3SR2C 4DUZB 2NQYA 4N7IA 4AVTA 1O9HA 2V1DA 4HNAA 1HJGA 2J22A 4DV4B 2CTPA 3IMNA 4Y4RA 5DUUA 3KGLA 4LCUC 2HEPA 4Q0VA 4UWDA 4HZ3A 1PGW2 3IT8A 4AI3A 1SLBA 2ETEA 3OUIA 3CEWA 5C8CB 2W1SA 3VLBB 4GXLA 4CZZA 2I45A 4B3RB 2LROA 1GP6A 4P9WA 3PDQA 3G4SV 3NNFA 2RN9A 1B6QA 5KXCA 5K1PA 1RB8G 4ZHQB 3PL0A 2EALA 3RMXA 1JYVA 5C6CA 3TN93 1QJEA 1I5ZA 3SCFA 3NJZA 2X09A 1AR93 5LEJA 1D5NA 2EJRA 1AZDA 1W6PA 3HJRA 2FDFA 4LIUA 5L7OA 4CPBA 3GHMA 4E4ZA 4QPYA 3I2GA 5F5IA 5FAXA 5T5PA 3SQOA 2W6IG 3ZN5A 1JZ6A 2P3KA 5CA3A 4Q0SA 3T0AA 1AR83 2UXNA 3AC0A 4YM0A 2FMDA 4CE8A 4DW0A 1PO21 4ASMB 4GH4B 3JZVA 2ZGSA 2BTQB 2DYRB 3UQ8A 1CVNA 1REFA 4W6WA 1E1RG 5D8AA 5IWFA 3ABLB 2NPIA 2D44A 1QJY1 1G4YB 2JG8C 1NT2B 1OUXA 2CHHA 2KXLA 1RUNA 1DF5A 1VBE1 2ERFA 2VXRA 2N05A 5FTTC 4CDQC 1B3QA 2IFWA 3NV1A 3OMIB 4OCTA 3PVEA 3K5NA 5T50A 1FT9A 3SKVA 2EILB 2EXHA 2VQAA 2VW2A 1JXNA 1UPSA 4JI1B 2JEUA 2VW0A 3C7EA 5ITZB 2WO7A 3N35A 1KQSU 4AGVA 4MG2A 2DE0X 2A73B 1XE7A 2KB1A 1OURA 2X7RB 2P6CA 1NBMG 4NMIA 2Q1MA 3GDBA 3S57A 2QWRB 2A3XA 1TNFA 2LW7A 2Q8EA 3V0BB 4Z07A 5KUMA 4MOAA 1S5LZ 1YFXA 4UW5A 1BK0A 4QKBA 5FZOA 2XONA 2CSGA 4FAGA 4K8FA 5C8YB 2A6XA 1UY2A 4Z8BA 1FXVA 5J09A 4KBZA 4AAPA 5JUVA 5J7MA 5E88A 3E89A 1IPSA 2LW1A 2ZA9A 2VG9A 1J5EB 1XL6A 3DPRC 4Y1XA 4F83A 5EYPA 1TVKA 3APQA 1R64A 4LHLA 1E5IA 4WVZA 4XDOA 2HWF2 3JD1A 5FZ6A 2UUCB 5FZGA 4FVVA 5LRRA 3CCSV 3M70A 4QDQA 1PP9H 3K4ZA 4G4FA 4XJWA 1VQKV 3CXHF 1TVGA 3QO5A 4J7JA 1WP7A 1IBKO 2ZR2A 1E5SA 1RUF2 5HV4A 3RW0A 4QMAA 2W1QA 2GBOA 4LOTA 4B4PA 3J26N 1JOYA 2A6WA 4LF9B 5EIBD 2XHBA 1D2DA 1AILA 4LBQD 3B94A 3JB4C 4JZRA 2LGQA 1AL22 2QSAA 3W5NA 1T2XA 2GHYA 3ZVXA 5FY0A 3FMGA 1PNLA 4HN0A 1LOGA 5IYZB 2A3WA 3ZO0B 4INDA 1NZIA 3TOJA 4NE9A 4XCBA 1UPGA 1CESA 3KG2A 4N9IA 1TUBA 2P37A 4GWNA 5FJHA 2WO1A 5FYSA 4MVOA 1BYHA 1ODMA 3UL2A 3WW4A 4FPKA 3AG1B 2C0ZA 2GTSA 3ZFEA 1W0NA 4FJCC 2ZPXA 4A7YA 1QOTA 2RS33 2EXKA 3B9IA 4AEDA 4KNCA 1LR1A 4QQHA 2Q0AA 3T4HB 4AEJA 4AE2A 5T55A 4KU7A 4L0PA 3MFAA 4AFBA 4PDMA 2FCVA 1POV3 4PELA 3V0AB 1ZRRA 4RQPC 1ZBE1 5FREA 5CFCB 3T1YB 1OSGA 4BIFA 1O7FA 3JD71 3AMNA 2JWPA 5DAQA 4LP8A 4N9HA 4XJZA 1OLRA 2PA7A 4L92A 3KVAA 3ON7A 4MO3M 4NIDA 1PZ9A 3AP6A 4J1XA 5IAXA 3DL3A 1BVP1 3MIGA 3O1PA 2XL7A 4RN5A 2XAHA 1AR73 3NNLA 2R062 2ZS6B 1XI1A 4XABA 3LAGA 5DZGA 1DP0A 3VZJA 1MPXA 4XHXA 2VMGA 5A32B 1R091 4LK7A 1BHAA 2QWNB 2ATFA 3WHTA 4C0HA 2ET7A 5DM6V 2ZEWA 3CP1A 4ZOLA 1W90A 4CP0A 1C4RA 2J7MA 3J4UH 1ZA4A 3PNAA 2QQMA 1S4CA 3UKNA 4B1LA 3CRCA 4ZHQA 1YQCA 3CWBH 3HKBB 1KDKA 5HBAA 2J1RA 3RDIA 1CP9A 3W21A 3AFGA 4D7SA 3I56V 2FDHA 1UYYA 1O8SA 4QM9A 2UUBO 3Q4HA 4BQ5A 2F23A 1JOJA 1M57C 5FZ0A 1XBFA 1L3JA 4Q4X3 4QX5A 3WD5A 1FD9A 5FP4A 4XPVA 3SPCA 3G6BA 1YNAA 5FY7A 3H0OA 5L7OC 3F5TA 4JV4A 3H7YA 2RJ2A 3POIA 3OGSA 5F32A 4H55A 4X9QA 2Z5WA 3I2OA 3U4SA 4ZKTB 4EKWA 4X8PA 4W50A 2BTQA 5A1LA 4O9EA 3GWOA 3R66A 3A0HZ 4RUEA 1HQNA 1UL9A 2HHHB 3PMEA 4GD4A 1H8TC 2R073 3WG2A 2WINB 1W06A 2XASA 2BQPA 3L2HA 1RUC3 2YFUA 2GDSA 4YG0A 1Q56A 4LFCB 3IM0A 1ENQA 4FFFA 1N33B 1SQPH 1HR0O 3VDAA 1AVBA 1NR1A 2ZZJA 3DCQA 5LP6A 1DG6A 1UPIA 2R1DA 5AVPA 2EBOA 2JDPA 3VBHB 5J3UA 2XDVA 3J8F2 4JX0A 4IL6Z 2RR13 4ONUA 1RVF1 4EWAA 2O8OA 4NWVA 3B02A 3NV4A 2D3RA 3VZOA 2C6SA 1NE6A 1S72V 3CSXA 5HXMA 2F17A 4A45A 3KV5A 2ZBJA 4OLLA 3IPVB 3KQ4B 5B3SB 2ZKOA 2O14A 2ZGUA 4FFKA 2R16A 3PVBB 1MQTA 4JVAA 5APAA 3V0BA 3CRQA 3TRSB 3ATGA 2FL4A 2A6ZA 1Y76B 1QQP1 1O3QA 3IIIA 1W2OA 3LWCA 4DV5B 1I7FA 3ZN4A 5FY8A 2OXBA 4MHUA 3N27A 5EBMC 5IVVA 1EZJA 1D5AA 2OS2A 2XLAA 2M7WA 2RMU3 2XXZA 2VCCA 2A79B 4WFAV 1VRH2 2ZHLA 2YHJA 1V70A 4DK1A 3LZZA 2QM7A 2VMCA 1TAEA 5F3CA 1ULDA 2RJZA 4FPCA 3KS7A 4KWLA 1EFRG 2DFCA 5CKMA 3E35A 3WEZA 2EIJC 2DN9A 1TNRA 5JXIA 4X1YA 1I1EA 4IIJA 1OCZC 4JKMA 2XWJB 4LFAO 2V72A 1Y4WA 3D36A 3JUUA 1HIXA 2XGXA 1U5ZA 3N9QA 4ARYA 4ASUG 4AR2A 4E4HA 3WINE 1GP4A 4J80A 3QD6A 1BS3A 5IYZA 2E33A 4O65A 4MXWA 1RJ8A 3FLPA 3ZXGA 1QR8A 1JW6A 4YGBA 1JI6A 4B8EA 3WVJA 1W59A 4Z2AA 2RM21 3JBG3 3L70H 4ZU4A 4R9CA 4D6SA 5CISA 5D21A 3VV1A 1H2KA 3I49A 2Y64A 3MHZA 4Q6GA 3SJCC 1M93A 5FZHA 4IXLA 3ZXEA 4WVMA 3FB7C 4N53B 1ZREA 3NQHA 1VE0A 1TME1 4QGPA 3LEIA 3NKGA 5DXDA 3OYWB 4XIOA 2D6PA 5KXEA 2EZPA 1CZSA 2W68A 4JRLA 4AEDC 1W8TA 4DV1O 1NVPD 3AK1A 3THDA 3MW2A 1PX4A 3VD3A 1W03A 4P00B 1W6MB 5JOYA 4AEKA 4EQVA 1GNYA 1QLEC 2VE1A 3RZHA 5JXHA 1N34O 2E31A 1RHI3 4AQYO 1S0VA 2WC2A 1VQLV 4NIHA 3LUTB 2ATKC 5F3GA 1XU1A 3M4FA 1FPN3 3JQWA 1OHFA 5F1RA 5A32A 4DV2O 3E86A 4JHZA 4QX3A 4LE4A 3WF2A 2BP6A 3ABUA 1GQGA 4OI0A 2VWJA 1S0JA 1SQGA 1UOGA 1GZWB 3HKBA 4C7UA 3WUDA 4LTAA 2WS93 4E2SA 1KP3A 4JAVA 1RINA 1I9RA 5K0UA 2BU9A 1NTKH 4GWMA 3I55V 1EPZA 2E75B 1VJ2A 1UOFA 5BMVB 1F51A 1CAWA 4IGPA 4AGGA 1AL0G 1QXJA 4M0HA 1R3KC 3PHMA 1DCSA 3WF3A 3FFZA 3ES4A 4U2AA 4BWAA 1FJGB 5I0TA 2BGOA 2MW2B 1THZA 5F5AA 5HFLA 2WUHA 3HQRA 3WDWA 3OFNG 3DKWA 4FLYA 2CNAA 4QD2A 3U11A 1C8NA 4DEQA 1HDKA 2XHNA 5T52A 2CH7B 3BABA 5C3SA 1AROP 1GKBA 3CX5F 1S0DA 2H6CA 1US3A 4GH4C 4OXSA 1ENSA 2XVKA 1LHNA 1NCQB 2YEVB 3RZLA 1M56B 3K08A 3JQXA 4BM8A 2JKXA 1PD3A 3OMAB 1RUG2 4Q29A 4NUBA 4B7EA 2Q0OC 2OW4A 1RUJ2 3WF4A 2QDOA 3O5SA 4C90A 3WU2Z 1XE0A 2XJUA 2P4KA 1VQNV 3S7EA 5ACA2 4RS5B 2VGDA 2P3IA 3WOGA 5LP6C 5FZ9A 2VOWA 1ND2B 1YSCA 1IXMA 4JI8B 1NKDA 1GZ9A 4W8JA 2EILC 1PO13 1ULFA 5BNOB 4Y1YA 3RVYA 1IBMO 2WFPA 1RUE1 1XYPA 4DR6O 1OH3A 2CDPA 4O61A 1WMFA 4F4LA 4GAZA 2D3SA 5FZLA 3M2MA 3GM8A 3LCPA 1NTMH 2HG5C 5FMDA 2WNVB 3OGIB 1PK6B 3BIEA 4UB6Z 3MAQA 1SFNA 1IG3A 4HPKB 4OFGA 5B66Z 4YGEA 3STLC 1ZA7A 1FFXA 3NVCA 4QDSA 4DR2B 4HKWA 4QNHB 1F5JA 1JUIA 1G9DA 4UI9L 1PPJH 1NOVA 2JDKA 1S5JA 4TLGA 3AMPA 1FMD2 3KF5A 4DXZA 4D69A 4LF5B 3OG2A 1D4M3 5A7NA 2R042 2IFRA 2QNKA 5CG9A 5E79Z 2JRIA 3VBOB 3JXSA 4RSUA 2JS3A 5GLVA 2QDNA 3ZMNA 4CH3A 5CG8A 2DUOA 5EZYB 2QM4A 1W9WA 4C0BA 4BLIA 2D98A 3E8BA 4M3CE 3ASOB 1FNZA 4OMDA 4XUNA 3K3OA 2DUPA 3B9CA 3USUB 2ZR3A 3I2KA 3TN91 2XVLA 3APBA 4K35A 3K59A 1AR91 5TISZ 3WDUA 1E1QG 3BCCH 3VKNA 5LYJA 2QFEA 2JGDB 4Q8KA 4Q4Y2 2UU9O 4IL7A 2DF7A 1WW5A 5A70A 1PM7A 2VZOA 2NLJC 4B3TO 2VZ3A 5D2AA 5CFDB 1W3VA 2HKXA 3I8TA 4FPFA 1AR81 1JYWA 1WN7A 4N53A 4Q8LA 2HYXA 2WLNA 1YFWA 4IW3A 1EAH2 2DCZA 5H9CA 4EV0A 2YZ4A 4CDXB 3MICA 1L1FA 2Y26A 4CEYA 4JI7O 3AG1C 3FHIB 3OYWA 4FZ1A 4CCDA 4JQTA 5A3PA 1LJ7A 4CEWA 4FM0A 4D8MA 1WKYA 4FP2A 5LXTA 2VVFA 2R7EB 5I0SA 4PDRA 3K0DA 5FMBA 4G3YC 3WG7B 1W6MA 1LOEA 4GUNA 3WFVA 1QGLA 4AVVA 1AP5A 4JKLA 2G4IA 2YBKA 4KWJA 2X6AA 2ARHA 1MMMA 2Q68A 4JDMA 4NHYA 5EQUA 5CFCC 4P9PA 3W58A 1K5QA 2QQKA 2XBO3 4ARXA 3MV11 1K8AW 5A33B 4DV6O 2R6QA 5BXZA 1FAFA 1QNMA 5A7OA 4NRPA 1SMVA 4U7NA 1HN0A 3ST7A 1MEC2 2OWOA 1KDMA 5F6LB 2JE8A 1YUDA 3WNKA 2WAOA 1K5JA 2P6JA 1WPBA 2Q1FA 3AYCA 1T5EA 1TMF3 1SETA 1JFFB 5IJ9B 5KA5A 1BBT2 3T2OA 5LHHA 5J98B 4LF6B 4XF9A 1FI2A 1AYM3 1LHVA 2M6YA 4MVQA 2MK3A 1GZCA 4FI9A 3URFA 1IXBA 3HN3A 3AP7A 4BJ0A 5FO8B 3J7MA 3PIJA 3EJKA 1LENA 4G9SB 1XMOB 1WWYA 2V7QG 4Y22B 4Q0UA 1RMU3 1A3KA 3V64A 4GYCB 5A3OA 1JYNA 2V09A 1GKFA 4E2GA 1AYN2 4A42A 1XNRO 4TWKA 3IN9A 2Y6GA 2GP3A 2RS51 2ODMA 4YVSB 1WCKA 1QY4A 3BTZA 3APOA 2J1SA 3BUCA 4BZ4A 3UT0A 2CH7A 1Q90D 4JYBA 1EBOA 2BFUL 5JPMB 2YYOA 1NCQA 3T4DA 2PAMA 1ZX3A 3NNGA 3N9MA 2F1MA 4UOJA 3VQXA 4Q4V1 1BHBA 4RAIA 5FXWA 4FQZA 3SMHA 3VBRB 3B93A 1VQ8V 2AEYA 5FPUA 5DUVA 3UETA 4MYEA 1UJWB 4F6EA 5DQ0A 2J1EA 1WA4A 4RS5A 1IBKB 1C1FA 4DNYA 2R0FA 1F8VA 1ENXA 3B4SA 3VBHC 2A06H 2XAJA 1IQDC 3ACFA 4BLJA 2WLHA 3RGBA 1TE1B 2BFUS 4M0NA 1MG1A 3JYCA 4JCKA 1DQ4A 4GULA 3IC9A 4NOTA 1SF9A 1M4WA 1W8OA 2ZTNA 4MTXA 4Y20A 3QACA 5CN0A 1YC61 1LOBA 5B3SC 5EK0A 5GTHZ 2RS31 5FY4A 2VOVA 1HRV3 1PO22 3H42B 1UYZA 4B4QA 4UXAA 1BHGA 4JAUA 1HB1A 1RM1B 2P67A 3WG3A 1QLNA 3D8CA 3KV4A 3HN1A 1CWPA 2VQFO 1QJY2 2BVBA 3AP5A 2UWCA 3CJIA 1UW8A 1NLQA 1VBE2 3VOUA 5CVRA 1GOHA 2QQWA 3KGZA 2FMLA 3R6SA 1C5HA 1ZZ6A 1VBA1 1LGCA 5IVYA 3MIEA 1LOCA 3UM7A 1AR71 4PI0A 3CQOA 1HWYA 1H2SB 3ABKB 1MA1A 4UVAA 2PELA 5DAXA 4HKOA 5EZYA 4PA4A 2NN4A 3OPTA 1H8VA 3CD6V 4B7KA 2GC3A 1FS0G 1BZWA 2ZM6B 1QNWA 4DR5O 1W2AX 3I3QA 1AR63 1H6YA 2YIBD 1C28A 4RGAA 4Q1PA 3ZLIA 3RZJA 3OE7G 3UV9A 2UYAA 1POQA 2ZACA 4YIPA 1UX7A 2VR4A 1W8FA 1XE8A 1L0LH 3WNOA 1NY72 1DFQA 3K4AA 3ZMVA 2ZD9A 4AFCA 4Q4X1 3VBUB 3VBBA 4JV5O 2XTAA 1TUEB 1EYBA 3F2ZA 1K3IA 1K97A 4X89A 5FJKA 2DVFA 1BLZA 2HEVF 2B5UA 3OEAA 1DLLA 4FPLA 1G8WA 1PNGA 1LOFA 1SPPA 3ICXA 1C3HA 4L8JA 1JH5A 2PMWB 2A5ZA 3NNJA 4N53C 5B5EZ 3N7KA 2L6LA 1DDLA 4HFSA 1LEMA 1SQ4A 2ZINA 4I9WA 1F23A 1VQPV 2R071 4QQ2A 1Y4MA 4CEYC 4J9YB 3ETQA 1U5IA 3IFXA 1XSQA 4CH5A 1W99A 3MW3A 2JICA 1K45A 3ZPYA 4A2UA 3G67A 5FIXA 2NMOA 4ZKIA 3AL6A 4Z82A 4ZZ5A 5KX5A 3EXAA 3G7DA 5A33A 1VF5B 4CTEA 3HNMA 1LR5A 3UK9A 3J9SA 3RYCA 1Q8VA 1Y67A 5JXJA 1IDSA 2ZX4A 3POJA 1AJQA 2YUEA 1JZ8A 4BW9A 1VEWA 5J2TB 4AAXA 1CZVA 1HR0B 2X05A 2RJLA 1ZAUA 1CJPA 1LGNA 3PLQA 3RWRD 2F4LA 4QU2A 3KV9A 3I3MA 1WA8A 1ZLZA 3OBAA 4P9XA 1UZZA 1I5PA 1K5SA 1V6IA 4Y4YA 2WN3A 5IWAB 1NKGA 4O2AA 1ENVA 3ABMB 5CB7A 1QQCA 5A3MA 4CDUB 4Q2FA 5LOVB 3FBMA 1ALYA 1OF4A 2D3PA 2WL1A 4OUEA 3HR9A 3ZYPA 4XFGA 1BEV3 1ZBE2 3CZJA 2WDBA 3ACIA 5DAWA 4XW3A 3A22A 3JD72 4TV8A 4D3WA 4DV0O 1GSLA 1HNXO 2BZDA 2RQ6A 4AQ6A 4FXKB 1BGYH 5KWRA 2QZ2A 5FRAA 1NT0A 4S2GA 4DXRA 4GB33 5F37A 3UYJA 4X62B 2UU8A 5FZAA 1OH4A 1FYUA 5GZFA 4I3GA 2J1TA 2WIIB 3V65A 2UY9A 1UYXA 3SYCA 1OA2A 4FIPC 3LQCA 5DAVA 1E5RA 1MSDA 1OD5A 1PNKA 1NCQC 1R3JC 3FUOA 4CXYA 1M56C 5L19A 2DQ0A 1Z5VA 1UWWA 5FZIA 5CU1A 2VNRA 1G7YA 4J7ZA 2OUJA 4XUTA 1W0OA 4UCUA 2IXLA 3AL5A 5LK5A 1HXS3 3RI8A 2IU0A 4O4JB 1GWLA 2DVBA 4KH9A 4YYOA 5BZBA 4FOYA 1UX6A 4L11A 4RS5C 3JBG1 3VZNA 1H4HA 1RUI2 2PHUA 3X2QC 1J3PA 4LBQB 2DURA 4ITCA 3MHSC 4UCOA 4DUYO 3OGJA 2RV9A 1O3TA 2CV6A 3I3EA 1VP7A 1OVSA 2XOMA 1SQVH 1JOPA 4Q4W3 4B3MO 2IVIB 1K42A 4JI0O 4PF1A 1NA1B 4LUMA 5LEKA 1XSRA 5GM0A 2YIAA 2WNVC 3E5XA 4PDLA 1PK6C 4TSVA 1SLIA 3K58A 3RBZA 5LMNB 1W6OB 2JDNA 5L3BA 5JVDB 2Y0PA 2GP5A 3TYJA 1ZVFA 1RIRA 5JCOA 1RHI1 2E5LB 4J11A 2PXJA 3HWJA 1UY1A 3POEA 2BTVC 1S55A 2VD7A 3O1VA 4DRXB 1HX6A 1FPN1 2KM2A 5GLZA 4EE2A 4E2QA 4XJAA 4CCJA 1FX5A 4B4RA 4DV1B 4TLFA 3VBOC 3FX3A 4AHYA 5T3NA 4TV9B 2GUZB 5IVBA 1KITA 3N2GA 1Y74A 3L9JT 1JX9A 3PN1A 2HWF1 4HK8A 2ZMKA 4K6BA 2XAQA 3S6PA 1RFYA 1O9GA 5JH7B 2W87A 1PZ8A 4Y1VA 3ASOC 2ZHNA 2WS91 4XDKA 1XNAA 4PLOA 2Z4FA 1MS4A 4FPHA 1QQP2 1OKOA 1RUF1 3KM5A 5GZGA 1QVFU 4DV2B 4JYCA 3FE5A 3M8AA 1QJU2 3S5QA 1UQXA 4JKKA 1UIKA 2FBEA 1YHFA 3D0JA 1HV0A 3E8GA 2HEYF 1VQ7V 3QBQA 4UW6A 3OGGA 1BXHA 4KUMA 5FL7G 3FLRA 1H1MA 5GTIZ 2TBVA 3CS5A 4Q1RA 3ZN6A 1YWKA 2ZEXA 2YMZA 4EYUA 3DUIA 5CFDC 1HW7A 3JD0A 2ZMNA 2QZ3A 5D1IA 4I4TA 2B42B 3JASA 3D0SA 2CAZC 1LOFC 2ZMLA 4CDXC 3LDKA 5C71A 2UXDB 1AI5A 3LD8A 1DQ2A 2WQ4A 2G9GA 2BGPA 1XPWA 1JPXA 4CS4A 4HSLA 5HV0A 1J59A 4KG8A 4YW7A 2D5HA 2EIGA 1NLRA 2EAKA 4QPIA 3ZXKA 3WG7C 4P9YA 1QEXA 4IEUA 2XQXA 1DF0A 2BCCH 3MLJA 2CTRA 2DVGA 4NRQA 3DYOA 5EJ3A 1PGL1 2E74B 1PO11 1QMJA 2WYSA 3BVCA 4PIXA 4NAMA 2R1BA 4LULA 3I2HA 3T2QA 3IDCB 4NN0A 3T2MA 2P1BA 3HNYM 5CBLA 2J1UA 5DMYA 4Y3OA 1V6KA 2XPJA 2JJ1G 1Y9GA 3RJRA 2HJDA 2VWKA 2P7TC 2D7FA 2Q8DA 3S30A 4PDWB 2A7AA 3WX5A 1R3IC 3KSCA 3VL9A 2Z2SB 5KHGA 2BUKA 4MVSA 4P30A 1TME2 4Z92B 3O0XA 4MGZE 3MYXA 2R061 5DZFA 3UO2A 2QVSB 1KQRA 1AR4A 4BAYA 3E8FA 4FLVA 2WNUB 4NXMO 5FFOC 5FOBB 3CRRA 3W7TA 3OUFA 3SJBC 1L7RA 2GN7A 3QG5A 1XRUA 4YJ3B 3UESA 1KD7A 1QH6A 4WCEV 4AWDA 1GOFA 3THTA 5AG2A 1KECA 1QXPA 2VNGA 3R4SA 2IW5A 3EVKA 2WSVA 4NPLA 2VXJA 3BFRA 5FCCA 4ABMA 4BA6A 3FZ3A 4FPJA 1RXGA 1COV3 3ZHSA 2P06A 1C8M3 1VMHA 5FZFA 1YIJV 2W0XA 1VIBA 5A6XA 2F66C 4O4LB 4PLNA 4W65A 2MHFA 1UXZA 3H9AA 5LW9A 1BZKA 2OQ7A 4DQAA 3RYFA 3OUJA 3WNMA 4NXNO 1W6NB 2JVDA 3VBRC 2FD8A 4QM8A 4O4JA 5FYYA 1CAUB 1N0NA 2PAEA 3N9OA 3AG4C 3OAAG 2PZSA 1JU4A 4DY5A 1JR9A 4PT6A 3I2FA 3WY6A 1XJAA 1JCHA 2OCCB 4LBQA 3CB2A 2JDAA 4EJRA 3AVSA 5FY5A 1A6CA 4BXFA 2CY6A 3ZRVA 4DUVA 2ZAAA 4K8RB 2ZDIA 3ZHUA 2GNBA 4UUJC 1C1LA 2PHRA 3KZ4C 4WBNA 4WM7A 4KHPB 5EIYB 1N47A 1CX4A 4XQ4A 5ABJB 1AI6A 3VD7A 4ES9A 1MZFA 1N1VA 2QWQB 4U3JA 1NQTA 4AQTA 4JZGA 2BDRA 4DO2A 1RM1C 1W6OA 1UY3A 4Q0PA 4LOSA 2K9ZA 1PM9A 1SDDB 3WXPA 1G9CA 5I93A 1SLTA 1M5IA 4D7YA 5CA6A 4JI7B 2XBO1 2IJKA 1YFYA 2F95B 5EV7A 3WB2A 5JXGA 1VQOV 3NV2A 4MGTA 1W9TA 2Q69A 2ZIOA 5JCOC 5L3EA 2DWEC 2GDFA 3MO4A 1S0IA 4HSJA 3ME2A 4FLUA 3EXUA 1NVPB 2GUZA 5H2FZ 2LTNA 4C1WA 2HEWF 1ROPA 1DZQA 3E22A 4KFMA 3ASIA 3ABKC 2E7TA 4GKKO 4YW5A 5JOZA 1YJWV 4Q20A 4UCSA 1NQJA 2Q7EA 1TMF1 2P4VA 3VZKA 2EF6A 2RDQA 1VQMV 4RHV3 4DV6B 1OT5A 1CAVA 4FFBA 3MIDA 1W2NA 2EINB 1A8MA 2WJSA 3ZIXA 4DOUA 1XEQA 2IJIA 3L71H 2ADEA 1OMIA 4Z1MG 5HXVA 1UF2C 1L7QA 1MNGA 2VQ0A 2DW4A 5JJJB 3WUCA 1RMU1 1FXZA 4XDJA 3VBUC 2GH8A 3SNMA 1NU1H 2RDCA 1DYOA 5JLVA 4MGKE 2MPFA 1VARA 3K9SA 5D5QA 3CBNA 3SHRA 2IH1C 2X6CA 2EXIA 2BOBC 1YI7A 5KXBA 4CDWB 2EIDA 5B1NA 5IVCA 4PLMA 5FZ1A 4JPRA 2Z5UA 4WV8A 2ARCA 1MZEA 2N74A 3ZJZA 2LALA 2VQTA 1XNRB 3PUSA 4FPGA 1VBD3 1OA3A 3ZBHA 3PUHA 1G1XB 5EJZB 2JECA 3H8OA 2O8QA 1HNZB 5BNNB 5GALA 2NNUA 4QB2A 1VRH3 4UYBA 2OYZA 3TN92 2ZABA 4ZU7A 1QDOA 1WMEA 1H8HG 1AR92 1BMFG 3LPGA 4N43B 3D3IA 3K06A 3OJBA 4QPGB 4Y33A 2C1FA 1WCQA 3E97A 4AW7A 2DYCA 2VQEO 5LBFA 3N9PA 2FDIA 3LEKA 4EWDA 5IJ0B 3POGA 4BQYA 3NJVA 4BHPA 4AL9A 1XNDA 4ZBMA 2D43A 3AKTA 4I55B 3RI9A 2GSYA 1AR82 1PHMA 4XUQA 4JYAO 4TQDA 5L9VA 3NWKA 5C3RA 1TQ5A 1HRV1 3LKJA 2F4PA 3SH3A 2EIKB 5LWBA 1GQPA 1SDWA 4AFDA 4H33A 2YGLA 4GJZA 2LJ2A 2Z0AA 1CAXB 4LO7A 1US6A 3QOPA 1DIWA 2XR4A 4UF0B 4U36A 3ABMC 5CKQA 4BB3A 3GCWA 4LA2A 1DBNA 1R73A 4BE3A 2P22C 4JC1A 4CDUC 3AG2B 4CS3A 4PI2A 2ZJCA 4QT6A 5IHRA 2VMDA 4B1MA 3KT1A 5JIAA 1GWKA 5B4XA 4H3WA 1NH2D 2KG7B 1K12A 1Q5OA 2OPWA 3I4IA 1GNHA 3SH4A 3CL1A 3RZGA 1MOFA 3CXCU 4O4LA 4P9JA 4YG6A 3M1HA 2SBAA 4M3CA 4K8ZA 2BJSA 1AR61 2Q1ZB 3C3VA 1XOYA 2JEMA 3GBWA 3EQEA 2FB5A 1R083 1OF3A 1W6NA 4P02B 3FBYA 2RNBA 4FOQA 2PHDA 3FC0A 2BBVA 2D5FA 5A7WB 1B04A 2X10A 1CZTA 1EV13 1UU4A 2HH9A 3I2DA 4H2AA 3ZKYA 4YFZA 3OMNB 1BQ0A 2XMLA 1Q8SA 3E6BA 3H1KH 3L73H 3ZPOA 3H8XA 2ZEZA 4TTGA 4ZXEA 2QQIA 3B7MA 4GX0A 4YW4A 1KEXA 4JZ2A 1EN5A 1V6JA 1OCOB 4F6RB 2WKKA 1YFUA 1N4CA 3VQVA 2ES3A 2BW8A 2V4AA 3I2IA 3AZXA 4JV5B 1V9U3 2YGMA 2HLDG 1NA1C 5KMGB 1SA0B 1E57A 2YS8A 3H1HH 4COWA 2WWUA 2RHPA 5FZEA 2H8PC 2IXCA 4RWUA 3LF7A 1PMIA 5BNPB 5T54A 1SLCA 1IHMA 4K0KO 3J7NA 5FZCA 1IX9A 4C1XA 5LA6A 2PI5A 5EHDA 2OIIA 1DGSA 4HL0A 5J37A 3AFKA 2PLV3 5L3CA 3FAVB 5FK7A 4IDZA 2JG8A 4NROA 4R9BA 2HWE3 1VF7A 2Q7GA 2RG4A 3BIWE 3BKZA 5FQ0A 3BALA 4NPRA 4PJYA 4IE6A 3VQYA 2EVXA 1S77D 4EEQA 2D40A 4DR1O 4KGQA 1NYWA 2R72A 5DDJ3 3CYOA 3IDEA 4P08A 4CP1A 3AP4A 1LGBA 2RS32 2ZT9B 3H1WA 5FXVA 1Q6IA 1X8MA 4XFAA 3HQUA 2B39A 5FZKA 1COWG 4IGQA 4HT1T 1NQDA 1U12A 2HJIA 4E8DA 4JI2O 4HMZA 4I02A 4O4IA 1BEV1 3ZXLA 2JB4A 5KLVH 5FYIA 3GJBA 1UN1A 4BYYA 5KBFA 5EYYA 3IWZA 4HLTA 1Q6UA 5C9AB 1NCRB 3CLPA 3O7OA 4XACA 4DV7O 4GB31 1P7BA 3CCVV 3OD0A 3POYA 4DR4O 5FK8A 1AR72 4LBEC 4P9GA 3FLTA 2Q7HA 5E89A 5IUQA 1IPKA 3O0VA 4IV1B 4I0WB 1D0GA 2HBUA 4PA7A 3OCPA 3K77A 2XB6C 4JI6O 1B06A 4V2VA 1V6MA 5BNNA 5LMUO 2EXJA 4L9BA 4YY3B 1ORQC 2ET1A 1HXS1 2K46A 1PL4A 2VNVA 4EWEA 3WF1A 5B1BB 4R50A 5EP9A 4IEWA 1ZRCA 4DV3B 3T08A 4JASA 1Z0HA 1JZ5A 4W6XA 4Q4X2 4YIOA 3U14A 3IAQA 2UYBA 1RL3A 3OPWA 4DRRA 2MNGA 3C7OA 4I55A 4F8AA 5FR3A 4LFBO 5FYCA 4BQWA 2HJFC 4CS2A 4AXOA 2DU1A 5FYUA 3GZAA 4XMIA 4PDWC 2PUSA 1SLAA 3E5UA 3SKJE 5FWJA 5FP9A 4OX9O 2R072 1SZXA 2EULA 4NHMA 1W6QB 2ZQMA 1WLEA 3HKEB 4HYOA 4DUYB 2WNUC 2Q30A 2WWJA 4ZS3A 3AZVA 2EIMB 4LT5A 2YXHA 2XJRA 1S0GA 4KQ7A 1XYOA 3GZTB 4R52A 4CCMA 4S2DA 2E51A 3TEYA 4BDVB 2KG7A 2RR12 4SBVA 1EAH3 2TEPA 4Z1VA 2IJJA 1GMGA 2ZGOA 1H2NA 5LL6Y 1VB2A 1SRYA 4EN6B 5CB4B 5FLJA 3NAPB 3H50A 4XQDA 1V00A 2FCTA 4TWTA 4R8CA 4PIYA 1GNZA 1XNQB 2H0VA 4V1PA 4X8AA 1SQXH 1FFTB 3I3DA 2WPDG 3TB0A 4X64O 1DGWA 2EA7A 3OGVA 4JTOA 2WLIA 4DUWA 1IBLO 1QVGU 3MDPA 1OQDA 5LGTA 4FPYA 3TWIA 2RMKB 2OPKA 4AI0A 5B2GB 4YVWB 3VBSB 4UFIA 3ZCCA 4JDNA 4LF7O 4JHTA 4E9KA 2Q5ZA 5JDBA 2NN8A 4CUCA 1M90W 5K7PA 1S5HC 1CIWA 2XKOA 5A7PA 5IK7A 1K5MA 1JZ4A 3IMMA 2LFRA 1WP8A 1YTFB 3O1OA 1WZXA 1ENRA 2RMU2 3T30A 3OY8B 1C5IA 3HR0A 2QKAA 4YNIA 2IU3A 4OGQB 4RR3B 1YJLA 3GNEA 5T5JA 1ZNPA 5A3LA 1CXZB 1W9YA 1QBZA 4DEVA 4QGLA 1OPOA 3CMGA 2ZXQA 1RP3B 2Y48A 4DUZO 3FFQA 3RYHB 5JSOA 5ABJC 4BQ1A 2X5IB 4DV4O 1DZTA 1BVVA 4AK3A 3NO8A 3OBTA 4CP9B 3BOWA 4OHVA 5HI0A 2JE7A 1ZL8A 2BWAA 2ZE7A 4MW8A 3MGUA 3LDCA 2NZ9A 4OZOA 2IXHA 1H8TA 1HDJA 3AM2A 1V6NA 1HQWA 4JI4B 2QQLA 1NZCA 1IZ3A 3OBRA 2LW8A 1AXZA 1GAXA 4K21A 5LA2A 1OV9A 3JBG2 2FHRA 4AI2A 4AILC 2VOKA 1S2KA 3WP6A 1F4NA 2WZ8A 2NR5A 2P3JA 4AHCA 4FCAA 2QE7G 2DQ3A 2MEV3 1SEFA 2VZSA 5T5LA 2IXJA 3H1LH 1PV0A 3NW4A 4YRDA 4R8HA 3AG7A 1R1BA 1ZWIC 5CA0B 1XQ8A 2JG9B 5KXDA 4MVMA 1GN2A 1PIV1 4A6OA 1Z78A 1UZYA 2CE4A 1GFF2 4IEZA 2QQPA 2EINC 1EPWA 1RGSA 4FLXA 1OOPA 3M7AA 3ZDVA 2CYFA 3VKOA 2GNMA 2HVJC 3LDBA 3ZXJA 2LGWA 1RHI2 4X1IB 3B01A 5FKBA 4QX0A 4JI5O 5F39A 3AP9A 2QQOA 1NY71 4XTMA 1C8M1 1GM9A 5J2UA 4XXAA 1FYJA 4FFHA 1FPN2 1K4CC 3ABTA 3WW1A 5JJEB 5FZDA 5JPNB 3ZRXA 4ES8A 1KFUL 1W9SA 5A3NA 4WFHA 4DR7B 1W28A 4IV3B 3VN4A 3JAWA 3ZS8C 3VD5A 1V54B 3ETEA 1AJKA 4CC5A 1ZRDA 2OTJV 4JI1O 1T6BX 2ZXWC 2VCAA 4X65O 2Y34A 3RVHA 1S2EA 2YBSA 1ZM1A 3DXTA 4AHWA 3SH5A 3FD9A 3NNMA 2XUEA 2WS92 2PHLA 3T3YA 5BNNC 4AG4A 3ASNB 2QTSA 5JI9A 2IC1A 1ZTEA 2V5YA 3MUZ1 4PQ9A 1U5YA 3LSEA 2JE9A 4N43C 3JAKB 1VPHA 3ZXAC 1ZZ9A 1OQEA 1LHWA 3K5MA 1O4YA 2RE9A 5FDBA 4NHKA 2IXKA 3AEIA 4K3AA 3FHQA 1J5EO 4JI3O 2ILMA 5FZMA 3S0MA 3QCWA 2GTAA 4FBFA 4GX5A 2P34A 5LGUA 3IJ4A 1P49A 1Z7S3 3AXEA 3RT3C 3A0BZ 2UUCO 4L97A 3F5WC 4X20B 2FYUH 3MDSA 4I3PA 2VZTA 1AJNA 3JATB 4XF4A 2Z69A 5KHKA 1LU2A 2W0FC 1MZ5A 3ZYBA 4DB5A 5HCFA 4LNUA 4LF9O 5C3OA 2WFF1 4LA3A 3AG2C 2A6YA 4HG6B 1CIYA 2QGNA 1D0HA 1R1A3 5FOJB 5KC5A 3H1MA 2PHXA 2I2SA 3K75B 1GUIA 1X33A 5CB4A 1PGL2 1GK9A 1PO12 4IHJB 4AVCA 2ZX3A 5IFTA 4I7ZB 3OPZA 4BU2A 1LU1A 2GV9A 3RYIB 1JOBA 3ZX7A 3MIBA 2EICA 2W46A 5F5CA 1C57A 1AVMA 4PA3A 5A1AA 1UU6A 2D6MA 1VF6A 3MI8A 2DVAA 1U5XA 4J25A 3VZLA 4EN8B 4R7CA 2VCBA 4LKDA 4JGYB 4KP4A 3CZUA 5CBGA 5JCTA 5H5NA 2CTWA 4CCOA 5C8CA 1WMXA 3CCQV 3WDVA 3BAAA 3PU3A 2YIBA 5FV3A 3LOBA 4IEPA 1HRI3 4AHZA 4LUKA 2CK3G 4Q26A 2UXCB 2CAVA 3U78A 1K5MC 1OJHA 5L3FA 1XMQB 3ROUA 4RR3A 5K8SA 3LIGA 1D4M2 1CEZA 3N9LA 5G05L 1K4DC 4U7OA 3T1YO 3MIFA 4EZHA 1LULA 1BJQA 4TOIA 4GALA 1OCOC 4X66B 4GKJB 3PTRB 5AFEA 2BSKB 5KR7A 2V4VA 2VTFA 2DYSB 1RUI1 1NXD1 5JQGB 4NWWA 1RITA 3R4DB 1V6OA 4CH4A 3HD8B 1SQFA 3HVDA 4LE3A 1VBD1 4TSFG 2B45X 3A2FA 3NR7A 2JD4A 3H1JH 5FXZA 1Y3TA 2JIJA 3CCUV 2W9XA 4GH4A 5BNPC 2PHFA 4PQQA 5GZDA 1DYPA 3UO3A 2A3YA 2FDGA 5A3UA 1YJNV 3O1UA 3KF3A 2OCHA 3R4UA 2QJVA 4D7TA 1CN1A 3IAPA 3PIGA 4RO2A 4QX1A 3THPA 3CIHA 1R093 2H3OA 1L8DA 3BU7A 5L3GA 3WG4A 1BMV1 4WM8B 5CA0A 1ZX5A 3N36A 4MSWC 2RVAA 4DIQA 2WSSG 5ITZA 3N9NA 3GHNA 4QWNA 2ZCWA 5A7QA 3DPRB 3NJXA 3VL8A 2E32A 1YDXA 2HHHO 3DXUA 1XDCA 4C8DA 1UZVA 3SGIA 4OUSA 1QHTA 5C5TA 1K7DA 2ADQB 1YEWA 5BR8B 5BUVA 1OOPC 2B1IA 4CCNA 2XBO2 5C33A 4A7ZA 1ACCA 1WB8A 5C8YA 4CC6A 1I94O 2BPA2 3SEPA 3GBFA 4KWUA 2XJVA 1QJU1 4XURA 2XVGA 2AEZA 1AR1B 1VMJA 1FV2A 3ILFA 2GSMB 1WCSA 1UMHA 2A75A 1FATA 1DTOA 1R081 1OQ1A 5FUIA 1SLLA 4OI2A 1TMF2 3WZ1A 2VW1A 2ZGMA 1SCSA 4FPPA 4O4HB 1GP5A 1EV11 2H94A 3KCYA 2XLFA 4HN1A 2F4VO 4PBOA 2R32A 5FLXN 4PD4F 3ZMOA 4AYUA 1X59A 1KC8W 3D3AA 1L7LA 1RVF3 1PX3A 3E5QA 3KCXA 1AF9A 1FXKB 1RMU2 2D2CB 4DV5O 2Y8KA 2DJVA 2GAUA 5SV8A 1N32B 4QQLA 2A1XA 3H8RA 4I5SA 2HWB3 2QA4V 3C90A 3H3LA 5FLHA 2ZGKA 4XZPA 4HVQA 4UFZA 3UNPA 2Y0OA 4QX2A 1H9WA 2JDUA 1ULGA 3B00A 4CU8A 2Y38A 1N0JA 3G6JB 4RUFA 3T09A 2UY8A 3JB8A 4GJYA 3UGFA 3T1HB 1KJLA 2D93A 3ZMSA 3ZR5A 2XQRA 4RQPB 2L9LA 1JQ0A 4WVVA 3C3TA 4I50B 4DS0A 2ADPA 4JGZB 3CC7V 2WZR3 4XAAA 1W05A 4GQ7A 5CMUA 5FMOL 4DPNA 1QJZA 1BKZA 3W7SA 2LS6A 1YI9A 4P9LA 2CDOA 2R9IA 2OQ6A 2BE3A 4HNAB 2HWE1 1GH6A 2NYYA 5DABA 4LPLA 5FUNA 2X53S 2I74A 3AG3B 2Z3YA 1UMZA 2D6KA 5CADA 1JYIA 4YJ2B 3V0AA 2VS0A 5CA1B 1G86A 5CFCA 1VBC3 4EFEA 3RYIA 4ISQA 3OEBA 4IESA 4K0KB 4QAWA 4OI1A 1JMKC 1SZBA 1LRHA 4FZ0A 4FQ4A 5DDJ1 1WD3A 2VRZA 3ORJA 4ASKA 4C91A 1JU3A 3T1LA 4GZRB 1HRV2 5J9PC 3HBKA 5FMOS 3ACLA 3WB1A 3MHHC 3AX4A 4YVWC 5FKCA 1KD1W 3VBSC 1ASJ3 1PMHX 1VF6C 5JOWA 4XYXA 2OYQA 1GRJA 1IQAA 3RS6A 3M8LA 4DY3A 4CH6A 1POV0 3P1IA 4MSVA 5L7OB 1W39A 4HXCA 2RM23 4CCEA 5C8CC 3ECQA 1AJOA 2R49A 3ZEDA 2BNNA 4JTDB 1NS1A 5CYYA 2B8MA 2FMYA 5E6HA 2JX9A 3RJ2X 5GONB 4RR3C 3SYQA 4UT5A 2AYHA 1PVC3 1H8EG 5FPXA 1QWRA 4LF4B 4XFFA 4FLWA 1OBNA 5JQGA 1MS9A 4YW6A 5L9RA 3IDAA 2LP7A 2KR2A 3F95A 5D8AB 3PVOA 1AR62 3J7HA 1Q6HA 1YXWA 2GALA 1D7PM 3GYDA 1DQ6A 2AR6A 2IVJA 3G6EV 2WNOA 3CNAA 5FPOA 1LCLA 1KP2A 1LESA 5L36A 1YLLA 1KGYA 5IW0A 1YQ8A 4PF5A 5I8SA 2UWAA 2DYRC 4PBPA 3CJXA 5DECA 3MIHA 3RMYA 1KXGA 5KHJA 4AGRA 3P32A 3ABLC 5BY5A 2HWD3 3WDTA 5F8PA 2J42A 3TGUH 2HYKA 4OQ9A 3SISA 1ODNA 3VBHA 3BA8A 5LB6A 1IS3A 3AB0A 4AQ2A 4CU9A 4URAA 3C7FA 4Y5SA 4H14A 2B9VA 5IK4A 4XIKA 4FM2A 3IPVA 5GZCA 1TGOA 1HB2A 5FZOB 2WN2A 4LO6B 4WFFA 3VHOA 2EAAA 4PDVA 2IZWA 1RYYA 4RD7A 4OHXA 4MVZA 3WV6A 4Y26A 5EYPB 3GCXA 1TVKB 2JGUA 2ETNA 2C26A 2DUQA 1Y76A 3LDRA 2QUOA 1ZUQA 1KMIZ 4ZY9A 4QGMA 5CBHA 5A6YA 2E63A 5JI7A 3CU7A 4WVWA 5IE9A 1Y66A 2A71A 1OPMA 1WD4A 4LLFA 4XCAA 2JDZA 3VDCA 3KLSA 4JI8O 4BH9A 3ZMUA 3Q9OA 2OA2A 5AVAA 5LBBA 2IBZH 2CAUA 2ZCEA 4XHBA 2A7WA 1NH2B 4IV3C 2WQZC 2PN5A 1V54C 5FZBA 5JR2A 5FPRA 2YY1A 3THCA 3BY6A 3FYIB 3K57A 3L9DA 5FYTA 3SCGA 3LA7A 5JIUA 3QLQA 3NJYA 4FK5C 3J80N 4IE4A 2DU0A 1WNSA 2AUYA 3ASNC 5I8TA 3ZSKA 3MUY1 1BEV2 5HCHA 3O1MA 4BIZA 2VZRA 4R6ZA 3WSOA 4CUBA 4G28B 2VU9A 1RUE3 3UGHA 3B5LB 2C9AA 5DPNA 2IM9A 3LA2A 3SJQC 5JAXA 1SCRA 2W6JG 3ZFEB 1GANA 4GB32 2KD7A 3HMYA 4LF5O 4Y5TA 2W2IA 5L3DA 1J3QA 3L2YA 2C4XA 4QPKA 3JD4A 2YICA 4XFIA 3KD4A 3W7UA 4AI1A 3ZSEA 1VQ4V 1VQ5V 4JGZA 3OW2U 4COVA 1SG3A 2QR4A 1J95A 1W0JG 1H38A 1IKQA 3L75H 1GBGA 4PJ0Z 4UV9A 1H6XA 1HXS2 4A41A 1UCXA 1VAKA 1VBB3 2BNOA 4CP2A 5GKAC 2N04A 3K4DA 4YJ2A 3RRDA 5CA1A 4UW3A 1O6UA 1UZWA 5JMOA 4FOWA 4MVTA 1UZ0A 2XH6A 3LFIA 4IE0A 3WW3A 4I0XB 3IDBB 2HVKC 3POWA 2VBBA 5E1AC 1N8RW 1VMGA 1TEIA 2QWPB 4AEMA 2MEV1 1HNWO 3K51A 2Q8OA 5IDJA 5IAVA 2BERA 4Q4W2 3CMEV 4ZOLB 3DKQA 4G2KA 3H8UA 2QCSB 3BHPA 1RUD3 3TXSA 2OUHA 2FZ2A 4QPWA 3HAGA 3T2PA 4H37A 4R9AA 4NJ4A 2XJSA 4K40A 1MR5A 2GNTA 4JGYC
chains in the Genus database with same CATH topology
1KS5A 1AR92 2YHJA 1KFXL 1V70A 1ZBA3 3LZZA 1I3HA 4N43B 3C2UA 2IXIA 3PTYA 1ULDA 4EN9B 1QJX3 4KU8A 4FPCA 3OJBA 4KG0A 4QPGB 2C1FA 3KS7A 4KWLA 2DFCA 1CQ9A 2FZ1A 2SLIA 3E97A 1GZWA 4AW7A 4OULA 2DYCA 3CJIC 1BBT3 4EWDA 2P17A 2RS13 4BHPA 2CGNA 1TNRA 1XNDA 2VH9A 2D43A 4YSFA 1RVF2 3AKTA 4EROA 1JBCA 1DYKA 1VAMA 3RI9A 1DGWX 1AR82 2GSYA 1PHMA 1I1EA 2XWJB 4YZ5A 3NWKA 1TQ5A 3ZFFB 1HRV1 2AREA 3LKJA 1XNBA 5BXXA 3JUUA 1V6LA 3ZXFA 5BNPA 2F4PA 3VZMA 3QH6A 1HIXA 1WW4A 2XGXA 1G9FA 3D6EA 1U5ZA 3SH3A 4YM1A 2HWB2 1SDWA 4GA9A 4AFDA 1UU5A 2YGLA 2WT0A 1CAXB 4LO7A 3WINE 4LO8A 4AFMA 1MZ6A 3QD6A 3AZZA 2QKDA 1AYN3 3QOPA 4MXWA 1DIWA 1RJ8A 3RG0A 3FLPA 4U36A 5IT6A 4CZSA 4FXGB 4MGIE 3ZXGA 1JW6A 4LA2A 4YGBA 1DBNA 4B8EA 2PHWA 1QU0A 3WVJA 4BE3A 1NG0A 4CRQA 4JC1A 1CAVB 3VKLA 4CDUC 4BCUA 2RM21 1RUH3 3JBG3 4ORFA 2ZJCA 4QT6A 4ZU4A 3SCHA 4R9CA 3KT1A 4XJUA 5JIAA 1WCDJ 1H2KA 3VV1A 3PVNA 5BNQA 5JMCA 1ZZ7A 4H3WA 2AENA 4XFHA 3MPPG 3WLUA 2GZWA 1Q5OA 4IXLA 3I4IA 3ZXEA 4WVMA 4GMP1 1AX1A 2WZR2 4N53B 1ZREA 2LM3A 4CYDA 1GNHA 1WW7A 3SH4A 2DWRA 2VUAA 5E16A 3CL1A 1GYKA 2YC0A 5JSPA 1TME1 3DF0A 2GC2A 4ZU5A 4P9JA 3VDDB 1AL21 4YG6A 3AJZA 1F5FA 3M1HA 2SBAA 5DUWA 5DXDA 3NKGA 4M3CA 1YYNA 3OYWB 2YROA 1AR61 2Q1ZB 3C3VA 4XIOA 1GVGA 4MX3A 2D6PA 2JEMA 1OFSA 5KXEA 4JQRA 3GBWA 3USSA 3EQEA 1IKPA 2W68A 1R083 1Z7S1 4JRLA 1MQTB 4AEDC 4DZGA 2NMNA 1ND2A 1W6NA 2XJPA 5J92A 1R1ZA 3FBYA 1IS5A 3MW2A 4FOQA 2PHDA 4COUA 1VBC2 4QHBA 5JVVA 3FC0A 1W6MB 2BBVA 5JOYA 4AEKA 5BNOA 2D5FA 4WM8C 1EV13 1UU4A 4Q0QA 3I2DA 4PCRA 3WQ7A 2XLGA 1RHI3 3INAA 4YFZA 2WC2A 1H1AA 5C9AA 1NCRA 4LLOA 2QE3A 2DCJA 1Q8SA 2XJQA 3KCCA 2JXAA 1GICA 1COV1 3OD4A 3WDXA 1XU1A 3E6BA 3W59A 1SBFA 3M4FA 2LUWA 1FPN3 4XDQA 1A78A 3RYRA 3JQWA 5I91A 4YGDA 1OHFA 2WLPA 2WNVA 5F1RA 1PO23 3B7MA 1PK6A 4YW4A 5A32A 1ASJ2 4OI4A 1R1A1 1B35A 1EY2A 3POSA 4HPKA 1AUYA 4LE4A 4CDWC 1MS8A 1UKGA 2RS53 4IV1A 5JZGB 1VR3A 1V6JA 1GQGA 1JYCA 4OI0A 2WKKA 1YFUA 3ZSMA 3KT4A 1S0JA 3N7MA 1YO8A 2RM22 1QJY3 1J1LA 1BK1A 1A8DA 1HV1A 4M2GA 1POV1 2ARBA 1GZWB 2ES3A 1OTJA 3I59B 2BW8A 5GLWA 3VGIA 1AX0A 3WUDA 1JR7A 3AZXA 4LTAA 3ZYJB 1VBE3 2WS93 1WLDA 3RPQA 1V9U3 2YGMA 4E2SA 4FOVA 1RINA 1I9RA 4B29A 1NA1C 4AVBA 4M23A 5K0UA 1E57A 1PVC2 4Q4V3 4XE9A 3SLIA 4COWA 4GWMA 2RHPA 2IXCA 4DFSA 1EPZA 1PMIA 5BNPB 3N3HA 1VJ2A 2BEOA 5T54A 4AI8A 1SLCA 3VBOA 1UKRA 1IHMA 1CAWA 3GALA 4AGGA 4C1XA