1H2MA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/inhibitor
molecule keywords FACTOR INHIBITING HIF1
total genus 105
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2mA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2mA01
4B7EA 4Z1VA 3KCXA 4NR1A 4AI8A 3OD4A 1H2KA 3P3NA 3D8CA 2CGOA 2YC0A 1H2LA 2WA3A 1IZ3A 2XUMA 1H2MA 2ILMA 4Z2WA 5JWPA 2W0XA 1H2NA 2WA4A 4B7KA 2Y0IA 2YDEA 1MZFA 4JAAA 1YCIA 3KCYA 3P3PA 4QU2A 4BIOA 1MZEA 2CGNA
chains in the Genus database with same CATH superfamily
4Y20A 1BXHA 2ZX0A 2CAVA 2D2CB 1RXFA 1VBD3 4LORA 4DXTA 4QGMA 4NUBA 5ITZB 4COYA 1N3PA 2VVFA 3ZHRA 4ZBMA 3KWVA 1AJQA 3MI8A 1GUIA 3ZFGB 1ODNA 2ZAHA 3OOXA 2E31A 1HW5A 1XMOB 3Q8AA 4MVSA 4FOQA 1KC8W 5I8SA 4JI0B 3LDBA 1BMV2 4AQYB 3HNYM 3JUUA 4FLZA 2RS12 1W6NB 4YZ1A 1HB4A 5LA1A 3ZDSA 4XVHA 1BZKA 4YW7A 4B3RO 4D7YA 2NZ9A 2BDRA 2EF6A 5CADA 2QWOB 4PD4F 1SRYA 3TETA 3VKFC 3RI8A 5H6QA 2HWC2 4YRDA 3TBDA 1NA1B 1LESA 2OUJA 1PNLA 1J95A 1YQ5A 3VBSB 3TOJA 1Q56A 2AXTZ 2QWQB 2DBIA 2VR4A 1US6A 4WFHA 3ILNA 2QKDA 4MTFA 1LOGA 4DR3B 4BZ4A 1YIFA 5GLWA 1WBLA 5GW7A 1A3KA 3THPA 2RMKB 5FKCA 3VBUC 2H0BA 2ZR2A 3AG3C 1SLCA 2P37A 2BP6A 3GGLA 1PO12 3X29B 2NMNA 1ONAA 2Q1MA 3QF7A 4J41A 5EBLC 5DDJ3 5JQGA 1SBEA 3MBWA 2EULA 3CCMV 2YDEA 4YHHO 2HWB2 1FPN3 5A6XA 3PURA 2ZZQA 5IYYA 1FXHA 1VEWA 4IV1C 4B1MA 2VL4A 1D0HA 1D0GA 1QOSA 2GZWA 3FAVB 1GP5A 3ZMUA 1S0GA 3ZO0B 1EYBA 3OBAA 5FPUA 3O1VA 4AGVA 2OYQA 2W9XA 4DK1A 2HEYF 2VJXA 4AQ2A 1ND2C 3N2GB 1AL0G 4WCEV 4N43B 1Q6UA 2PMWB 1POV3 1QJU2 3POWA 5JZGB 1QJFA 2RE9A 5JZGC 4MGKE 4A3ZA 5J2TA 2YIBD 1UX7A 4LA3A 2JG9A 4K8XA 2D40A 3DYPA 3WF4A 2IM9A 1GM9A 2PHDA 1HP8A 2G4IA 4FLXA 1Y3TA 3UGHA 4WZCA 2BE3A 2G19A 3OPWA 2JDKA 5FK7A 4EKWA 3AK3A 3WB0A 2W68A 1TQ5A 2UUBO 3Q9OA 1SZXA 4CUCA 1Z0HA 2QGNA 4HFSA 2Q7HA 2ZGUA 1Q6IA 1H2GA 2K46A 2IJIA 3I2FA 4LKDA 1AI7A 2A7WA 1W2AX 3ZHTA 5A80A 4E2SA 1BCXA 1VBC3 3KS7A 3RYKA 5FLHA 1SZBA 2YU2A 3GF6A 2JDAA 4WF9V 3AEIA 2W08A 2DJVA 2FQPA 1UZVA 2VOXA 4CCKA 3EXAA 1XNAA 3VDDA 1ULEA 4NPLA 2GMMA 4DK0A 2DVDA 4NYKA 3WDYA 4ZOLA 3VD4A 3S5AA 5I0DA 5L9BA 2CDYA 1J5EO 1Q5OA 4CU6A 1AI5A 3NV2A 1ZRCA 3A23A 1A6CA 3ZSLA 2FMYA 1WW4A 4D6QA 2YI9A 1JZ8A 5HPOA 3TAYA 1NOVA 3OGIB 2A3WA 4ZZ5A 3NJVA 4NAOA 4IIJB 5LRRA 4I0AA 4RD7A 2JB8A 1LRHA 4Q4Y3 1N3OA 3MW2A 3DKQA 2XKOA 1K5MA 2OPWA 1Q8IA 3CMAV 3ASOB 3L75H 1OCCC 4BMEA 1MS8A 3OPTA 2F4VO 4PLOA 4Y4YA 4DS0A 5A1LA 3DTUB 3HN3A 3SNMA 1KJLA 2D7FA 2A9HA 1CZVA 4YLZA 4GWJA 3T1CA 5F1RA 3VKMA 1VQPV 4HN0A 1ZBA1 1JZ7A 2B45X 3I55V 1W2NA 1FPOA 1DGWX 1PNGA 2UU9O 4OLLA 4HL0A 4AEDB 2W95A 1HDJA 1OV9A 4FIPC 5LMNB 1ND2A 3H1JH 5A6YA 2ET1A 2X7RB 2ADEA 1Y74B 5LYJB 4XMIA 4DV7B 4GX0A 3DPRB 4JI3B 3D36A 3IAYA 4Z1VA 2ZGLA 4UBGA 4FFHA 1KFXL 5H5NA 3ORJA 4TYSA 1BT8A 4JGYB 5GM0A 5T54A 4N23A 1OLMA 2HH9A 1JH5A 4DUWA 3N35A 1IS6A 4XUNA 3SYAA 3ZHUA 4M3CF 2ZJCA 3SYQA 1IOAA 2W39A 2VOWA 5E1AC 1W8TA 2QZ2A 4FT8A 3ST7A 1JUHA 3CL1A 5C8CC 2QWRB 4LQRA 4I4TB 4ZONA 1XU1A 3FB6C 2IFWA 2CV6A 4H44B 1C5IA 2EAKA 4S2FA 5FZ1A 4ASUG 5CA6A 3BTYA 1HIXA 2UYAA 1D4M3 1WGPA 4I7ZB 2VU9A 2P5OA 2QVSB 4IHJA 2JG8A 3CBNA 1M56C 1ENQA 2XONA 1ENRA 1PGW2 4CEWB 4CEWC 1OPOA 4COWA 3O1OA 3ZR5A 4LFAB 5BV6A 5JVDB 1SLLA 2OCHA 1SQVH 3NW4A 3B00A 2G9GA 4XFBA 2V09A 1MEC2 4J7KA 1AR1B 3HPLC 1RJ8A 3ZXEA 4YZ3A 4XOGA 4X62O 4UW4A 3EQEA 1NVPB 4ZHQA 2OQ6A 4GB32 1ZWIC 3QTCA 2WO1A 3RYHB 4FQZA 4AHCA 5A7WA 5IFPA 4CDXC 4UWDA 4E2LA 4XBQA 1K5QA 4JQTA 3RYIB 3K08A 5F37A 4U36A 4LKSA 3FLTA 1QOOA 1C57A 5CA0A 3FUQA 2YG0A 4L97A 1B6QA 1RUF3 3MPBA 1XU2A 3N7KA 4ATEA 3HN1A 1KU9A 1ZA4A 3CC2V 4LOSA 3SYCA 4BAYA 3ACLA 2E6VA 1ZAUA 2D93A 1Y4WA 2CK3G 3O9OA 2RNBA 3ZX6A 2V1DA 4PA9A 4XUQA 2VZOA 5FYTA 5JJNB 1CPYA 3AKPA 3HD8B 4LITA 2C2AA 1QHDA 3CCRV 1FFXA 1ACCA 1FOD1 1NTMH 2VUDA 4UF0B 1ZYBA 4NHLA 1W8WA 1RUH3 3AP6A 3PIJA 4M0HA 5IWFA 2XQXA 5GKAC 2AR6A 2OW4A 3HKBB 3L72H 1IHMA 1DCSA 3RZZA 4NO4A 1OFNA 4COUA 1VB2A 5FQ0B 4TXWA 4RGKA 2OQ7A 1F4AA 4UW5A 5FMBA 1O5UA 1KDMA 1O4YA 3KSCA 3BABA 3CJHB 4Q4Y2 2ZPXA 3S57A 1PO11 4HETA 5GLZA 3OEAA 2NN8A 4HPKB 1KQRA 2LGWA 4LF4B 5FZ8A 4URTA 3ZKUA 3ME2A 5D8AC 1IXMA 1W0PA 2B42B 1XSRA 4AFDA 4OXSA 3SYPA 3U4XA 2DOSA 4JTOA 1WMDA 3JXSA 5FV3A 3T0DA 1ZZ6A 3OT7A 3PU3A 4I0XA 2V73A 2HWE3 4Y20B 4IGGA 2WYFA 5IVYA 3KZIZ 1QJY1 2J1TA 4FVVA 5FP3A 3USSA 5GLVA 5IWAB 2C4XA 1EZVH 3ZFGC 4UFLA 3CCSV 1NLRA 5KAIZ 2WINB 3P30A 4AK3A 5BZBA 3OGRA 5H2FZ 4IV1A 1AZDA 1WD4A 3ZMZA 2DUPA 4E4ZA 4ISRA 1OCRB 4CYDA 4GKKB 2Z3YA 4O4IA 4JDNA 2KQXA 4JGSA 3IDAA 4WM7C 2YMZA 1AVBA 3RW0A 1CAWA 5T52A 2W1UA 2GV9A 4B3TO 3AC0A 1GOFA 4HZ3A 4E4HA 2DYRC 3ZIAG 3SH3A 3BFRA 5C3OA 1C4RA 1X8EA 5FLIA 3FB7C 3GM8A 3USUA 3OF1A 5I0RA 4MVMA 3HKEB 3JARB 1OA3A 2GH8A 2IVIB 3J7AU 2EBOA 2XJUA 4JQRA 4IGQA 1G9BA 1SMVA 3N9LA 4LK6A 1H6XA 4QX8A 1SC5B 1EN5A 3VHOA 1IDSA 2GC1A 2RMU2 1FOD2 5LEJA 1MZFA 3W7TA 1SLTA 1XC6A 1K42A 3I2JA 1RB8G 1DQ0A 3ZXDA 4RL7A 1X82A 2QQWA 2P3KA 5EYPA 4AEKA 4PDVA 1V55B 3JCIA 1SQBH 2HG5C 2HFEC 4HOOA 1QWRA 1YUDA 3CEWA 1TVGA 2M6YA 3J7LA 1VBB1 4ZHNA 1AR93 4LO4B 5FOBB 1U0AA 4Y3OA 5JPNB 4K9SA 3N4MA 1GZTA 3BVCA 5JWPA 2DYSB 3CCQV 2D98A 1SESA 4NXMB 2E26A 5I8YA 2OCCB 4DUZO 2PI4A 5LK7B 2XBO2 1RUE3 4XEZA 4PJYA 5AC93 4NROA 3WDXA 3EFFK 2ZQMA 2WFF3 3O1RA 2Q1ZB 4XUPA 2ZDIC 1UY1A 5FWJA 2IXKA 1S0JA 4B3SO 1UWWA 3OPZA 4QX2A 3K57A 4B3NA 1BEV3 3R66A 4AHWA 2DWRA 2XTAA 3FYIB 4BW9A 3NWKA 3Q8EA 3LCPA 1OVPA 5DG1A 3LGRA 2FYUH 3ZBHA 4QHZA 1IKQA 4AYUA 2OWOA 3M3QA 1T2XA 4A44A 2HWD3 5DMYA 4YJ3B 3K51A 1QJU3 1TMF2 2O0OA 1KP3A 1BEV1 1XNKA 5JOYA 5LGUA 3UNPA 5C93A 5IVVA 3LD8A 2QTWB 5J37A 2PQQA 1V9U1 3IDBB 2AUYA 1AHSA 5AFEA 3E22B 5LMNO 3CPWU 4AQ6A 1UNBA 1WZXA 1HQLA 3U0ZA 3LWCA 1W9SA 4PF5A 5LXTB 2VZSA 3ZRWA 2ZHLA 4EFBA 2RJ2A 1WW7A 1XQNA 3A4UA 4A5UB 2QSAA 4LF8O 1VQOV 2GSMB 3UKVA 2HWB3 3LPFA 3EYPA 2Z5UA 1K33A 1LB2A 2ZGPA 4DUVA 4LBJA 1SLBA 4JVAA 3U07A 1STMA 4GZ9A 1FNZA 5IHRA 3CEIA 4N9IA 3PU8A 5F9TA 1HN1A 3GALA 4QKFA 4N53C 3GZEA 3WDUA 4EROA 3CJIB 2RMU1 2OUHA 4FZ1A 3BTZA 1EY2A 1JHJA 5C8CA 4YARA 2BRTA 1NY71 1VBE1 4KG0A 5FMDA 2D44A 3D0JA 3QO8A 3HEIA 1U5IA 4KWLA 3C90A 4Y5SA 2J1RA 3H3UA 3MFAA 1QJY2 2W92A 2X10A 1LHNA 1QF3A 4H37A 1JYIA 1VIWB 3SR2C 2E9QA 1RUC2 2WN2A 1FXZA 3HKCA 1QU7A 3JATA 3VBHB 3WT3A 4Y1YA 2XG3A 2V5DA 1DBNA 3HKDB 2Z79A 1MEC1 4CDWB 3WW4A 3OUFA 4FPJA 4CDWC 2IXLA 1P4RA 1GO3F 2RJLA 2WWSA 4GB31 4N7UA 1GWMA 2IXJA 2FTKA 4DRXA 4FTEA 1OKQA 1JYNA 4QPGA 4O9GA 2VOTA 3RJ2X 4ASLA 1QR9A 4OHZA 1R64A 4QPIB 3G71V 1R1A3 4C0BA 3WG7B 3S7IA 1R1A2 3E5UA 3ZPYA 2QM8A 1HNXB 1H9PA 3AP7A 3D3QA 4NE9A 5FZAA 1W0NA 2KKWA 3KLSA 2PHFA 5IVCA 5KX5B 5A3NA 2WS91 3ES1A 4XABA 2CNAA 1YO8A 1POV0 5IE9A 1SLIA 5KHKA 3CS5A 1MVQA 3I49A 3D6EA 2GTSA 1FYJA 2VXJA 1OCOB 1AYN3 1O91A 1UYPA 4W8JA 4X89A 1PVC3 4AAXA 2BPA2 4O4JA 4P9WA 1QVGU 4KWUA 4LKFA 3RZHA 1VBC1 3AJYA 3VZMA 3OR6C 4PIYA 4XURA 4Y1ZA 4V1PA 2XB6C 1ENSA 2HVKC 1X50A 1HNWB 1BZWA 5EJ1B 2GMEA 5FDBA 1LGCA 1W8UA 1EN6A 1YXBA 3I2IA 3W7XA 1WJZA 1S0FA 1KS5A 4OPAA 5LGNA 3SJAC 3BCCH 4P5YA 4Z2AA 1FKAO 4XDOA 4N7IA 2QNKA 3OGGA 5EJ3A 1VRBA 2ENRA 5JSPA 4MGZE 4UVAA 1AR82 2JDIG 4JZGA 2WWUA 4GWMA 3BU0A 4P9JA 5L3FA 3JSLA 3VD3A 4D94A 4GJZA 3AFGA 4B4PA 3NR7A 3V56A 3LPGA 1S2BA 2R70A 4FP3A 1TME1 2VW0A 5FZHA 1L0NH 5A1FA 2PHUA 3I3QA 5FZOB 1OC1A 3QCWA 4BQYA 3I5DA 4WVVA 5JVDA 1E5HA 1ZTEA 1L8DA 2EIBA 3NKGA 1UW8A 1K7DA 4LOTA 4XF3A 1QCEA 5EZYB 2PLV2 3ZYGA 3NJXA 4I09A 5BXXA 5FZ7A 5SV8A 5FUPA 1YI7A 2JDPA 3FUOA 3ETEA 3JD4A 5L7OA 2YC2A 4XFCA 3H3LA 1M1KW 5FZ4A 1WCDJ 4QB2A 3RGBA 1K45A 2WNUC 1ZRIA 2TNFA 1IURA 3DECA 4MLOA 3OE7G 2D6PA 2WZR2 2DCZA 1GYKA 1N0NA 1VQ5V 1ZBA2 3E2EA 4UV9A 5CFDC 3FN9A 3RS6A 2EIMB 3DXUA 5T50A 2QWNB 3T2QA 2ITDC 5A33A 4X62B 1VF7A 1ENVA 3AMPA 1CX1A 1GNZA 2A6WA 5DABA 2UXBB 2HLEA 5FYIA 4GCZA 5CB7A 4J80A 5KXDA 2WN3A 1U12A 1Q86W 4V2WA 5K4LA 5JXIA 4CP9B 3MLJA 3F2ZA 3E6DA 3IIAA 3O1UA 2UUAO 1VBC2 2UXBO 2XUEA 2QTSA 2J1UA 2ZMLA 1MZ6A 4G3YC 3NNLA 2IJKA 3OB8A 3IB3A 2DQ3A 5A6ZA 4YG6A 4J1WA 2ZTNA 4CDUA 3K5NA 5DAQA 2YXSA 1BBT2 1OOPC 1VAVA 1MEC3 3NJYA 4XETA 4DW1A 5CA1B 3T4ZA 5B1AB 2YUAA 2BFUS 1YC61 5DAPA 5HCHA 1UD1A 2RMU3 1NT0A 3ON7A 2MEV2 2IVJA 1SFPA 2R49A 3ZFFA 1F5FA 4XZPA 1UKGA 4AR2A 4RS5C 1LR5A 4FXKB 4DV4B 2X5IA 2F4PA 2VMIA 1UU4A 1H9WA 2HWB1 1VLNA 1CPMA 4P9OA 3NAPC 2ZBJA 4DUXA 5CISA 5JPMB 5IW0A 2RDNA 2XL7A 4A45A 3K9AA 5KMGA 4XC9A 4JGZA 1SF9A 1R082 2WAAA 3VBOB 3H1KH 4RYDA 2JE7A 2WFF2 5FZGA 3C7OA 3I4IA 5CYYA 1V9U3 3E89A 4OPHA 5LOVA 3KQRA 4E2GA 2JDNA 1O3SA 2B9VA 5IJRA 4WZFA 4JTCB 4DV6O 3SCHA 3R6SA 3GBGA 3MIHA 2YXHA 1GOHA 1VQ7V 4MOAA 2F4VB 2DF7A 1MS1A 5L3BA 5HXVA 1DF4A 5JIUA 4KHPO 2E32A 4N43A 1JODA 3HBKA 4B4RA 4OFGA 4AFMA 3FMGA 4DR5O 2VTFA 4X65O 1AXKA 4MVQA 1JX9A 1SZTA 5FZKA 1R3JC 1GNHA 1ZBE2 2VQEO 1C1LA 3AKSA 1V54B 3FLPA 1V54C 1KB9F 4QE9A 2VAUA 3PTRB 4CS2A 5FPOA 1S0VA 4M3CE 2KR2A 3KKYA 2KA3A 4AI8A 1FFTB 1QH7A 2XJVA 2QR4A 1QIQA 4H55A 4YJ2A 5CBLA 2J1VA 5EIBC 1JW6A 1QR8A 4NVPA 1AYM1 4Y1VA 1JOJA 4XCBA 2VOKA 1JPXA 2IXCA 4P9LA 4ASKA 3WNKA 2VVEA 2VUCA 3W5MA 2JEMA 3A0HZ 1DF0A 2ZACA 4PA4A 2QM7A 2TUNA 1X9PA 2VOVA 5FY1A 2H6CA 3VBFA 1UOBA 4WVZA 2RVAA 1TVKA 4UV8A 3U1XA 4LNUB 3KT1A 3PVOA 4RA0A 4IV3A 2NLRA 1RUE1 5T55A 1OXCA 2OVUA 4AW7A 2ZXWC 1PO23 3GZTB 1CZTA 5BNNC 4Q27A 5IDJA 1W90A 1W6QA 3JAWA 1WA8A 1J3QA 3UM7A 2VZVA 4O2BA 1GANA 3J8F1 5EK0A 3AG2B 2WRAA 3AG2C 4QPGC 3ZRWB 1D2SA 4GYCB 4TTGA 1IS3A 2EICA 4LHNA 4KH9A 5FZ3A 2ATFA 4C1WA 2VQAA 3HT2A 3WXPA 1BHBA 3M3CA 1O4ZA 1RUG2 3I3MA 1JS9A 3W58A 3ROUA 4XBFA 4IE0A 1WWYA 4HN1A 5FY7A 3RN4A 4FPFA 1W6OA 3W20A 3KVAA 3PJSK 4AFBA 1AJKA 3OMAB 4JRAA 5ACA2 4B08A 1VMGA 4XBLA 4XILA 4J42A 1O3TA 2YXYA 3Q8CA 4KHPB 3K0DA 3DN7A 1N4CA 1THZA 1DK1A 2WLHA 1ZZCA 2R042 1SFYA 5T3NA 2NN4A 2W2IA 1HRV2 2F43G 1NY72 1PZ7A 1JMKC 4X20A 4X1KA 3ZN1A 1EPWA 2XVKA 1RGSA 2VNVA 3C7GA 4DR2B 2W0XA 5JAXA 2WLLA 1KQSU 4XAAA 2GDSA 3MLKA 4XDJA 3GCWA 2C24A 1XJAA 5F3IA 4AHXA 3RYPA 3KG2A 1KECA 5AVAA 3M3OA 4CH5A 3BOWA 4CXXA 2ATKC 5EXOA 4FAGA 3RI9A 1PGW1 4Y33A 5IFTA 4Q4V1 1AX1A 3O5SA 1ENXA 2VCCA 2Y8KA 1G4YB 1VRH3 3MLLA 1GZCA 2W91A 1J3PA 1CN1A 3NJZA 3AZVA 5K9YA 4RQFA 2D6MA 3PUAA 3KZ4C 4UFKA 2R32A 2Q0AA 2PYTA 3H50A 2PAEA 3B5LB 2X0LA 4CBCA 2XDVA 4MYEA 1DQ6A 2Q8DA 1UOJA 1MNGA 4XFFA 1PK6B 2ZAAA 4RQPB 2R6QA 2JG9C 3O0VA 3LDKA 1GTOA 2YIAA 3I59B 1OHHG 2HWE1 4RO2A 1QLNA 4ZKIA 3VBSC 3PN1A 2Z4FA 2VTXJ 4FM1A 4DXRA 3STZC 3CRCA 2IFRA 1HR0B 2QCSB 4MG2A 5FPBA 1RMU3 1W03A 3SPHA 1TMF3 2FMDA 1NCRA 1EZJA 5JLVA 3ECQA 5LOVB 3JZVA 5L7OC 3D8CA 3A21A 3DYOA 5FOJB 3JD1A 3S0MA 4K21A 4O2AB 5CA1A 4J11A 1GU3A 3OD0A 2GC0A 3CZUA 2Y64A 3OTFA 2VQEB 1BVP1 4DRXB 3FD9A 1GQPA 4H3WA 4P9YA 4OQ8A 4JGYA 2FDJA 2RR13 3OGSA 1LOBA 1N47A 3K04A 3M70A 3T1HO 4ET7A 1GN6A 4F6RB 5J2UA 5KAFZ 4WV8A 2R043 3VL8A 2PELA 2RG4A 1JCHA 4CH6A 3ZHVA 3VLBB 5F2VO 2R0FA 1XE7A 1IGOA 1R3LC 2OIEA 3T1YB 4DOUA 3MHSC 2PLV3 4PI0A 2EIJB 5BXZA 1JZ2A 2QE7G 3B09A 5DECA 3BB6A 1CONA 2EJRA 3ASNB 3GBWA 3CCLV 5IT6A 3ZS8C 4GXLA 1QY4A 2ETNA 3AG1C 4TT3G 2LROA 3TEYA 4XFAA 2AREA 4WBBA 5BMVA 3CKHA 1NXMA 4W4KA 5JI9A 2J1AA 1RUI2 3WCSA 5HXMA 4RWUA 4PDWB 2DVFA 1QJX1 4I0BA 3M3EA 1W8NA 4OUMA 4YM0A 3GXUA 4E27A 2W3JA 1ORQC 4QT6A 2P7TC 1S0BA 1YDXA 5CFCA 3VN4A 4Q4W1 1CGPA 4LF6O 2EINB 1W6NA 1XDCA 4G2KA 3UO2A 3SITA 4AFAA 2WO7A 2JDUA 5IJ0A 2OT7A 1KUQA 1WW6A 1IPJA 1H4GA 1NR1A 3E8FA 4LUKA 1SA0B 1J5EB 3OBTA 1AR91 1MS9A 2BBAA 1OI6A 4MT8A 3W59A 4JPRA 4BDVB 2Q73A 2YPDA 1IQAA 2GMPA 4GWNA 3AFKA 4A41A 3GDBA 4Q0UA 3JD71 2D6NA 1MG1A 2I2SA 3S3WA 4XDQA 2P90A 5JR7B 3W7WA 3ML0A 4TLFA 3WNNA 4PBOA 3T08A 3I2OA 4FFGA 3D0SA 2UXDO 4GX1A 4P30A 1WUVA 2HKXA 5EZWA 1D4VB 1S0CA 1ZL8B 4OHYA 2YB7A 3DV8A 4QU1A 4MSWC 4HSLA 1O6UA 2C9KA 2ZZJA 1UQXA 2EJ7A 3CMGA 2ARAA 2IXIA 4ZU7A 3QG5A 3T4VA 1OA4A 2PY5A 3CF6E 2ZEXA 1B35C 3P3PA 2GU9A 5BNPC 2WAOA 4WFFA 2AENA 4LLOA 4XYXA 5J48A 2WS92 3RSJA 3CE2A 3M8AA 3RZLA 4D6TH 2VBDA 1YVWA 2KG7A 2A3YA 2NP0A 5K1PA 4CPBD 5FZCA 3VQXA 2PXJA 2PTMA 4AQSA 3WQBA 3AYDA 2CGOA 2LW1A 3B3QE 4IEUA 2ZOEB 4X1IB 3IFXA 3P5BA 3IT8A 2HJIA 2WNVB 1QU0A 2B7YA 2LFRA 1ROPA 1LOEA 5C5TA 3WDTA 5CVRA 5B2GB 1Q8QA 2KXLA 2R1DA 5FYYA 1RSOB 1NYWA 5JQGB 1WB7A 1JOBA 3ACHA 4HVQA 1H8EG 2IH1C 5BNOC 3K77A 1QJY3 1MS3A 1H38A 3SPJA 4AI3A 5M0TA 4LNUA 3O1PA 4OHVA 4IV3B 5J1XA 3CO2A 4CP2A 1ULCA 2OIIA 1W28A 3MPPG 1ULDA 3IAQA 2A3QA 4K40A 2DMXA 2RDCA 3K9SA 2ZKLA 5DAVA 1JYWA 5CMUA 2PYLA 3POJA 2M7WA 3TB0A 4XXPA 2P34A 4RR3B 4LBQA 5L3GA 1XNBA 1OCOC 5FUIA 4PIZA 4QGPA 4CC6A 5A32B 3VKLA 4NXNO 4DRVA 1JYTA 3F5WC 2YC0A 4KU8A 2Q6AA 2QDRA 2RHPA 2ADQB 3WF3A 3RQ0A 2E33A 1WPXA 1F51A 3HOBA 1GRJA 3ZRXA 1OCZB 3N9QA 4AI1A 4DR4O 4LFAO 1R3IC 1NVPD 2CWMA 3JU9A 4LF9B 4OUEA 1UIJA 2ITCC 3A0NA 4UXAA 1MS4A 2R041 1CAUB 1FMD2 2OTLV 1JOYA 2YGLA 2PFWA 3FWEA 1RUOA 3ZYFA 2XH6A 3AP9A 5I0TA 4BM8A 3POFA 2VMFA 5FO9B 1EP0A 1EPZA 3E5QA 3MEPA 4RFRB 4ZKTB 3B02A 4SLIA 4XIOA 2WQ8A 2C26A 3ZFGA 2BW8A 4CEYB 1RVF3 1VBB3 2SLIA 2WT2A 2FBEA 3NV3A 3TEZA 1MQTC 1MQTB 3BHPA 1TNFA 3RWNA 1YLLA 4GH4A 3F5TA 3T2TA 1PVC1 4DR7O 4AEJA 2UU9B 1BBT1 4LXLA 4FFIA 1NKDA 1AL23 3WB1A 2R7EB 3KF5A 3GJBA 3UESA 2XHNA 2EILC 2GC3A 3JCUZ 4WFBV 2B4KA 2FZ2A 2DE0X 5LY1A 1UO9A 4KMQA 3K48A 4BJ0A 3RYRA 3SEEA 4JI3O 3QBQA 3MIBA 1WCUA 1XE0A 5A3PA 4BQWA 5LA2A 4DV1B 2VXRA 3V65A 4AEMA 1LGBA 3IMNA 4MHRA 2AACA 3MIDA 5IK7A 2P2KA 5LRSA 2HWE2 3ZRVA 2VZPA 4ZS2A 3T3YA 3L9JT 2P06A 4QPWA 5ABJB 5C33A 4Q0VA 1D5NA 1G1XB 3LOBA 3BCWA 5LA6B 4BA6A 1IKPA 1OH4A 3WDWA 3SQOA 5CG8A 1H8TB 2FDIA 1H8TC 2G9ZA 2RJKA 3CU7A 4OMCA 1R093 1R1BA 1OQEA 2Q30A 1XXNA 3ZR6A 3JD72 3ZJZA 1PO22 3NRUA 1MPXA 2RS33 1LUWA 4P08A 5JJEB 1P8JA 1VQLV 1BSMA 4CEYA 1Y74A 4BLIA 5A70A 4DV1O 1BHAA 1YIJV 1IVSA 1OSGA 4M01A 1LEDA 4M4RA 4LTAA 5FAXA 4O9EA 4BU2A 4XF9A 1RUC1 4AGGA 3CWBH 4IUGA 4CE8A 1PVXA 1WLEA 3WUCA 4FQ4A 1Y9QA 3X2QB 2AGSA 4B3MB 1LHUA 4CXWA 2AHYA 2JG9B 4JCKA 2BVBA 2RQ6A 1OURA 2UXNA 1EAH1 2VUAA 3IN9A 3HQRA 4LK7A 5EJZB 5FYBA 3RYFA 4X1IA 2R9IA 2WNVA 4C1XA 3ABZA 2UUBB 2E51A 4NPRA 4R9BA 1G8WA 1W8ZA 2XAQA 2EIDA 5B1OA 3ZSEA 3IGAC 2MNGA 3ZXGA 1Z78A 4GH4C 4AVVA 4KL1A 3SDLA 3WNMA 1SETA 1ZX5A 4QKBA 3FX3A 2BWAA 5FZOA 2JDHA 1PIV1 1P84F 2B9UA 2F17A 3UGFA 2PHXA 1YQ6A 3WHTA 4YM1A 1UMHA 3T09A 3HPNA 2GP5A 1NAEA 3OUJA 2UUCB 1OQ1A 1UYZA 2HEWF 4IEPA 1VBA2 3O0WA 5LYJA 1URFA 5KR7A 4XJ9A 2R1BA 1VBB2 2Q68A 4CDQA 1PNKA 1O4TA 3AVRA 3EBRA 4DEQA 3ZOIA 3AB0A 3DYMA 1VBA3 2Q7EA 4IEOA 5DUUA 1W0KG 4NIIA 4MSVA 5LA6A 2E5LO 1Q8PA 4AXOA 2WQ4A 4MVUA 1J83A 2CGPA 3ACGA 5FL7G 3ASNC 3CB2A 1NTKH 3AJZA 2R061 1OZ0A 2VNOA 1ULPA 3NV4A 4F8AA 1A8DA 2RDSA 4GMP1 2KB1A 3MIEA 3FFQA 1ZRFA 3OD4A 4QX3A 1HXS2 2A1XA 1Q8OA 4N8MA 4M4PA 2ZXQA 4UFHA 2F66C 3N3HA 2DV9A 4E2QA 4QXBA 3UV9A 4NIHA 4O4JB 1I94B 5C71A 1MS5A 2ZEWA 2Y0OA 5JXJA 5LGTA 1VPHA 5E8AA 3CRQA 3SPCA 1HQWA 2PUSA 3HKDA 4JHTA 1YCIA 4I0WB 1AVMA 5IUQA 3G6JB 4CDWA 1F7YA 1ZZ9A 5GZEA 2A6YA 2NNUA 5APAA 3ZEDA 4TV8A 3SH4A 5HV0A 1GKFA 4BK4A 2MPFA 2VQUA 1EBOA 3OGCC 1PGL1 2WYSA 3H1YA 4K3AA 1VBE2 3SISA 1ND3C 1QVFU 1ND3B 5BNNB 4ITCA 1RUD2 1RMU1 2P3IA 3M3IA 4FOVA 4QM9A 4X64O 1HX6A 4JI2O 3RDIA 4EN0A 2XNDG 1VQNV 4BIZA 3DC6A 5E79Z 2A0LA 4QPGB 2GTAA 3RYCB 2QE3A 3ZFFC 3N36A 4WBNB 1TNRA 3WINE 1H2NA 4QX7A 4OZOA 3CCVV 1FAFA 1W6OB 3IMMA 2OT5A 1UF2C 1KD7A 2Y4UA 4EB6B 2BBVA 1RVF2 2EIEA 1HB1A 5FYZA 1O8SA 3ZXAC 1PZ9A 2X6BA 2DVBA 2VO5A 3C3TA 5FBZA 3HNMA 1AR61 1GBGA 1UY3A 2WDBA 2WO2A 1LAJA 1S76D 4AF9A 4Q20A 5EC2C 3SCGA 5HCBA 2E7QA 3DGEA 2XPJA 3HMYA 1UN1A 4XFHA 1UPSA 1VQ4V 4QB1A 2VVDA 1VAKA 3UJOA 1FT9A 5EFUA 4LH6A 3ZSJA 4FVMA 3LFIA 3KD4A 1M9NA 1H8HG 4U3FH 4I9WA 2QQNA 5EYYA 4FFBA 4IE7A 3NNJA 1S2KA 3MGUA 1R091 2ES3A 1QXPA 1D2DA 1IG3A 4G9SB 3LA7A 1LGNA 3LEGA 4OI2A 2WR9A 5IYBO 3E1F1 2PYJA 2FCUA 3K5LA 2PA7A 4W6YA 1R1ZA 5CIRA 1NCQB 2JGUA 4AVBA 2DYCA 3CQOA 3OMNB 1FAYA 2ZX3A 3OGJA 1EV13 5T5JA 4DR5B 1NKGA 1FX5A 2NQYA 3E8GA 3POSA 4J6GA 1COV1 2B1GA 4MGTA 1H1MA 4MTXA 5K8SA 3J8F3 4O4IB 1R081 1UPIA 5K7PA 3HKBA 4XJUA 4YW6A 1QJZA 4ZHQB 3N2KB 1RUH1 2F6BA 2QDOA 3RYHA 2BNNA 4AEDA 1ZX3A 4LE3A 1BS3A 2LW8A 5JXHA 4R8HA 5IYZB 4YG0A 1UMZA 4KU7A 4YW1A 3E8HA 5FZMA 1H2MA 1PO13 3T1LA 4UFMA 4CZSA 2RM22 2FB5A 2DTYA 2ERFA 1YJWV 4RQPA 5LEKA 2IJJA 4B3TB 2EZPA 3SMHA 3VB9A 5A9GA 5IY5B 2XAFA 2DDUA 1GN3A 4LR4A 4C90A 3KV9A 1QJX2 4O61A 1K34A 1RHI3 1FFXB 1FOD3 2WBKA 4IV1B 3B9CA 4Q4X2 4WM8B 2P6HA 1H2KA 2XJQA 4D6RA 2VNRA 2EIJC 2PN5A 4JI5B 2PHRA 3ZN0A 1DF5A 4UI9L 4CEYC 4BQ5A 5FBJA 2GP3A 4Z1MG 3NNMA 3AG1B 5FCCA 1RITA 4CZZA 4ZU4A 5LHIA 5F5CA 2J7MA 3LSQA 3G80A 2X6AA 2P4KA 2BTOA 5DN2A 5DM6V 5CZKA 3GCXA 3U4SA 1QQP1 5A3WA 1BQZA 2VZRA 4LH7A 4FFBB 4K20A 4LF5O 4M00A 3ZPOA 4QQLA 4BWOA 3U75A 4QMAA 3AP4A 1RUE2 5LK5A 4KBBA 1OLQA 3ZCCA 4A3XA 1NT2B 4BW5A 1MSWD 5A6QA 4ZIBA 4DXSA 2ZS6B 3LE0A 4LF4O 2QQMA 1CAUA 2DCYA 4RS5A 4XXAA 2DUQA 5DQ0A 3RYCA 1NE4A 2X5IC 3H1WA 1KKDA 5TSWA 1WP8A 2JENA 4JDOA 1JOPA 2VY0A 2HVJC 5CKQA 1OD5A 4TQFA 4LWSA 1WMXA 4BOWA 3OEBA 2WSVA 2B8MA 4LBQD 1DGRN 3O14A 3J7MA 4LR3A 2OZ6A 5LBFA 4ZI7A 3FKSG 1LTEA 3I54A 4NXNB 2FD8A 2ZEZA 4PDRA 4OI4A 3PVBB 3EB7A 1LOFC 1NUKA 2R9AA 2XAHA 5H6RA 4QKNA 1YFYA 1R6KA 1V6IA 2JE9A 5FQ0A 1RUC3 2VZUA 1BQPA 4UCVA 4MGSA 4CDQC 1YQCA 5JCOC 2RS52 3WNLA 5HV4A 4IYHA 2YROA 2YU1A 3AMNA 3FB8C 1ZSPA 3RFRA 2Y34A 4DINB 1V6LA 3N9NA 1OHFA 1Z5WA 4HBNA 3J7HA 4XACA 1BLZA 3IDEA 1OCCB 4K8RB 1E79G 3QACA 4GKYA 1LJ7A 4DQAA 1CXZB 3VHRA 4K8ZA 4H0LB 1V0AA 4XPVA 3T2PA 2AGAA 1NBMG 3EHKA 3OBZA 1QHTA 2ZGKA 3PMEA 3TNQA 4XDPA 1PGL2 4YWAA 5DUWA 1M90W 2W6IG 4HLTA 2VQTA 3VBUA 3MW3A 3HQUA 3ATGA 3I2HA 3JBG2 3NXSA 2A7AA 2P5BA 1IG0A 4FI9A 4UVBA 3NAPB 4XE9A 1RTVA 4BISA 4OI1A 5LWBA 4KI5M 2C1FA 1IQDC 3H7YA 4CCLA 3K3NA 4R52A 2P17A 5B4XA 2Y48A 1V6KA 5C4WA 1XREA 3FB5C 2DWDC 3E8BA 1POQA 1IZ3A 3ZSMA 1TVKB 5FKBA 3ABMC 3D5OA 2CSGA 4IV3C 2TEPA 5I0SA 4JAAA 1OFSA 4PIXA 2ZE5A 5A3MA 4H13B 4YVWA 4QPKA 4BWAA 2ZDIA 4JTAB 3CJIA 1AR71 3MV01 2R30A 3E5XA 4RFT0 5C8CB 2ETEA 4OHWA 2E7AA 4CCNA 3H1MA 3C7HA 2LP7A 5L3EA 3NO8A 1ZZ7A 2A6ZA 5J2UB 4F6RA 1Q6HA 3SXWA 2GDFA 4F4LA 2ZMKA 2NPIA 5HCAA 4JYYA 1NH2D 4D3WA 1UZYA 5K1XA 1M56B 3SPIA 3AG4B 4AOCA 2VWJA 2FDGA 4BLJA 2AZ0A 3LEMA 2YC4A 2CDPA 2JK5C 3DXRA 4AG4A 3OY8A 2YEVB 1NCQA 1J1TA 4LMFA 1G9FA 2VQFO 2XR4A 4FBFA 2B5UA 1LOFA 1DLBA 2WSUA 3BPSA 1YQ2A 2ZKOA 5FYCA 2IH3C 1YJKA 5CFCB 2HBUA 1FXVA 2JG8B 5K0UB 5A7SA 2AYHA 4JKMA 2GALA 4B29A 1HRI1 5H9SA 2QQOA 1MA1A 4FAHA 1OLRA 5FPLA 1I08A 1PV0A 5DN6G 1H0BA 2HWC1 4QM8A 4YG3A 1Y9GA 4QPIA 1N0JA 5L3CA 1YHFA 2DVAA 4AGRA 5D8AB 5IK5A 1R083 3CSXA 4Q1RA 3W7UA 4W6WA 3QLQA 4JYAO 5B1BB 5IYCO 1DZTA 2PAKA 1DDLA 4X1YA 2Y33A 5LB6A 5CA0B 4LF7O 3B2EE 1AR72 2EA7A 4TUYA 2ZHNA 4EQVA 1S0IA 3THDA 5JI7A 3A0RA 1GV9A 1UMIA 4CP9A 4YNIA 2K9PA 2ADDA 2HWD2 5FFOC 2UY8A 4Q26A 3RRDA 1XB9A 1RPOA 2W94A 4EB6A 2A79B 3AKRA 2D6LX 1WMEA 1TME2 5IATA 5CA3A 3ZX7A 3FAVA 3Q8BA 3DGTA 2UXCO 4CDUC 3KT7A 1G6NA 2DBNA 3BA8A 2E74B 1YITV 1RL3A 1NCRC 1NCRB 1RUH2 2VPVA 3OM3B 4B3SB 1CEZA 1SFNA 4G28B 4Q4V3 1F8VA 1XYNA 2ZMNA 1UJWB 5A3UA 5EPAA 1BK1A 2LJ2A 3UGGA 5C3PA 2VH9A 2Q7GA 5L9VA 4JX0A 2MK3A 4JKLA 2K1EA 3QD6A 3LNMB 2ZGRA 2GC2A 1KJRA 1XNTA 3CIHA 1RUJ3 1YFXA 3B8MA 4PDLA 3ETGA 1IBLB 2HHHO 5EC1C 4BCUA 1PM7A 4DEVA 4FCAA 3DXRB 5C9AB 1AJNA 2EZOA 3JASB 4F3JA 3KCYA 5GALA 2ARBA 2E75B 4FMTA 4P9IA 4FPEA 4X65B 2Y6FA 4PLNA 5BNQA 3RYFB 2O57A 4FLTA 1RSOA 4JV5B 1N1VA 1AR5A 2YPJA 3GJAA 5FZLA 2EXJA 3SKVA 3VOUA 4P14A 3SJBC 3K59A 1N1YA 4MV2A 1LHWA 1XQ8A 2ZR3A 4DV6B 2WA3A 1KD1W 2IBZH 4PV1B 1CAVB 3BY6A 4O4LB 4X66O 2MW2B 1YI9A 4IW3A 4QHOA 5FY0A 2Y69C 5G05L 3V0BB 3FHQA 1WA8B 1HRV3 1REFA 4H7MA 4NWWA 1CP9A 4OI0A 2IU3A 4O2BB 5A2QN 5EP9A 2X05A 2Y6KA 1GFF2 1KKCA 3RJRA 2IW5A 2XGXA 2LW7A 2YS8A 1TUEB 5BYNA 3AMMA 1NH2B 2XHBA 4B7EA 1XNCA 2YFUA 2JX9A 5T5PA 2HWD1 4XHBA 1SQGA 4L92A 2DU1A 4XJAA 4W65A 1WLWA 3AYCA 2ET7A 2UU8A 5E16A 2TBVA 1YFUA 2XAJA 3E97A 1UU6A 3B7MA 2R063 3NL1A 3WG3A 2WFPA 1QLEC 1JA8A 5EYPB 1YJLA 2WFF1 1V9U2 5C4WB 4LHKA 3P32A 1LECA 4CXYA 4LLFA 1ND2B 4Q8LA 4HSJA 1UPGA 3N2KA 5F39A 4BPZA 3JAWB 4XJWA 1B3QA 4LFBO 4YPJA 2UUAB 1VP7A 5K0UA 3JBG1 3U10A 3ABKC 5F2WA 2R071 3ICXA 2FDFA 1W05A 4YGDA 3JARA 4KXRA 2OTJV 4I2OA 1GNYA 5FXXA 4M3CA 1HLCA 5FPVA 2XXZA 3GHNA 1GMGA 4FK5C 4UCUA 3DL3A 4NPMA 5FXZA 1D4M2 1BL8A 1OF4A 4EWEA 4QE7A 4NWVA 1ZBE1 5HFMA 1VF6C 1L3JA 3INAA 2GNDA 1KXGA 1RUJ2 1C8M2 4IE6A 2YSUB 3K3WA 3U11A 1XMQB 3H8UA 3N7MA 3ASOC 4Y26A 3KQ4B 2ZA9A 5LCWL 2FKXA 4JTNA 3TYJA 3CRMA 4DMIA 4DV0B 4HANA 1XRUA 5FO8B 3KHCA 3Q8FA 1N8RW 4LF6B 3BRCA 1DGRA 1EAH3 3FE5A 1XNRB 1V6MA 2H6BA 2BU9A 2EVXA 5DAWA 3AKQA 5JDBA 4TLGA 4ZI7B 4I50A 3L74H 4L8QA 2I74A 3CRAA 2YBPA 2EIKB 4XCAA 2ADPA 5H9PA 2FCVA 2BGPA 2VCAA 3B69A 3CJIC 4P9PA 1DQ5A 2DFBA 2EALA 4U3JA 2RM21 3K2OA 2ARCA 2BVVA 4GWIA 5IJ9B 2XLGA 3PTYA 1DYKA 4Q4Y1 5GTHZ 1HB2A 2BV4A 2V5YA 4YVSC 2Q8VA 1TZOA 2Y6JA 3VBSA 5EV7A 4JI4O 2VMHA 3IAPA 1N36B 2Q0OC 2DCTA 4DR3O 4DFSA 1DLLA 2PHTA 4DV4O 4EWAA 4EV0A 3J26N 1Q82W 2E53A 2OA2A 1SEFA 3B01A 3AZXA 1NXD1 5FJKA 3HR0A 1W8OA 2I07B 2BGCA 1ASJ2 3T0BA 3VBUB 3OUIA 3VQYA 2A75A 1M06G 3AG3B 3DPRC 1BYHA 1YI2V 1YWKA 1W04A 2P3YA 1J58A 3G67A 3K5MA 3V0AB 1I7FA 3POYA 2GNTA 4UW3A 2ILMA 3GWKC 1P7GA 3ZMVA 5KWRA 5EBMC 4GMP0 1O5LA 1QQP2 1CAWB 5FZ9A 2Y26A 3TN91 3UT5B 5KXBA 4MZUA 3WG7C 3CYOA 4OULA 2OPKA 4SBVA 3AG7A 2HBTA 4JTDB 3DF0A 4K6BA 4GKXA 4CVUA 4UCSA 4DUZB 4Q1PA 3LDCA 3PLQA 4FO9A 1GQHA 5FYSA 4DO0A 4NIAA 1JZ5A 4IESA 2VBBA 4FJCC 1JU4A 2BNOA 4CCCA 4OX9B 4Y22A 5LATA 4B3MO 3NNGA 5DZFA 1W9FA 2KSDA 1PK6A 3OGVA 1XL6A 4CCOA 1OCZC 1Y6XA 3GWOA 5FZEA 2ZGTA 2RS13 1VF5B 3KCXA 1J59A 5JSOA 2JJ1G 1ULFA 1SHWB 3EXUA 3SKJE 4E8DA 4FFFA 2QZ3A 5FY4A 5FPZA 1YEWA 2DU0A 2OS2A 5CFCC 2CAUA 3UETA 3ZN4A 2XASA 4LHLA 4HKLA 1FPN1 4F6EA 5J98B 1VQ6V 3E83A 1PZ8A 3A22A 2NYYA 2JDYA 1W99A 3WR0A 4O2AA 3A7QA 4WVMA 4W50A 2W5FA 4PHZA 5DUXA 1IX9A 5LZ6A 3HT1A 5F3CA 1Y43B 2NM1A 3J80N 2BWCA 2ARXA 4D8MA 4DUYB 1IXBA 2A71A 1IBKO 1RJ7A 2JJ2G 4BQ2A 3STLC 4K0KO 4UFZA 2UURA 1RFYA 4YJ3A 4KGQA 1XMOO 5IVEA 3LIGA 2MHFA 4D69A 2E3CA 1REDA 2ODMA 2ZKNA 5JJJB 3ILFA 4TSFG 5A1AA 1U5ZA 4HT1T 4UFIA 5C3SA 1J1LA 2V4AA 2B1IA 4MUVA 4DUYO 4QQ2A 1PL0A 5C6CA 3VV1A 5SV5A 4BK5A 4FLWA 3H1HH 1HNWO 1L0LH 3K5OA 1EUUA 1RUD3 1B35A 3ZXLA 1GP6A 4CC5A 3CDZB 3SYOA 3UT5A 4YW2A 4JRLA 2WSSG 4C91A 1DTOA 5FWEA 2YGMA 3A0BZ 1NX9A 1S55A 2PHWA 3AL6A 2WIIB 5B1NA 4AEDC 1WCSA 3IJ4A 2VQ0A 4R9CA 1EAH2 4EE2A 4TWKA 1I94O 3VDBA 3LKJA 4I3GA 4XQWA 2V4DA 1AYM2 1REEA 1UAIA 1K5MC 1XILA 4DO2A 5KA6A 4XFGA 4CA9A 4BIFA 4MGQA 3MF6A 2ZT9B 1Z5VA 5CAZA 1WAZA 3M4FA 1QQCA 1W8FA 2IWGB 3VHPA 2XVLA 4LBNA 3X2QC 4JI8O 3ZXFA 2X8KA 2CY6A 5F6LB 1AJPA 3ZSKA 1Y66A 4K3UA 4CU9A 3UQ8A 3VBOC 1Y67A 4WM7B 3ABLC 3T2OA 5KHGA 3KCCA 3FHIB 2ID4A 2AZ2A 2VW1A 4FPYA 3WD5A 1VRH2 4IL6Z 3ZFEA 2VECA 4IHJB 1N34O 1I1EA 1W0JG 3D3AA 2G9FA 4YHHB 4LP8A 5F3EA 3GYDA 2GUZB 4OHXA 2VZ3A 2D3PA 3MYXA 4XJ8A 3T30A 4CCEA 5EIBD 1AYN2 2WNEA 3T4DA 1N33B 4Q8KA 3TN92 3ABMB 4H2AA 1URXA 4QXHA 1S0EA 1FD9A 1HJGA 1YF2A 4QNHB 2O1QA 5L3DA 1QDCA 1KS4A 3IZOA 1QJX3 1WKYA 4IGOA 1SQQH 1PGSA 4NRQA 5LBCA 2UYBA 3ZXJA 2ZM6B 3GNEA 5IJ9A 3MHHC 3I7DA 5E89A 5KX5A 2XUMA 1Y76A 2PI5A 3BU7A 1G86A 3KV6A 3WQ0A 3DUIA 1GZWB 1X9TA 4EJRA 3V64A 2ZGSA 4MGIE 2YI8A 3DXTA 4HNAB 1AROP 4OCTA 1MZ5A 4NN0A 3VZJA 3VUOA 3JATB 3VBHA 1SQPH 3JBG3 4B1LA 4JI1O 3WW2A 4ABMA 3PIGA 1GICA 5FP8A 3B77A 5C70A 2VZQA 3HVDA 3W7SA 1CAVA 4JASA 1O3QA 4EWDA 1S72V 4GMP3 1NS1A 4JV4A 3N7LA 3VKOA 2ZGNA 4FPHA 3R4SA 4LIUA 3JYCA 1EM1A 1QH6A 4DV3O 3TNPB 2PHLA 1DQ1A 5KXEA 1BE3H 5GONA 5F7UA 3D3IA 4IXLA 3GZUC 1SBDA 3ZN6B 1NZIA 3VHNA 2XAGA 3UYJA 4QQPA 4JYBA 2WNUA 4Q0QA 1N1TA 1RUG1 4ARXA 3GBFA 5D1IA 4TSVA 2RR12 5F8PA 3T0AA 1I9RA 1QKQA 3CZJA 1AYN1 3ZYJB 5JOXA 2LRPA 1OA2A 4X8AA 1KYOF 1OPMA 2WT1A 4EFEA 4AWDA 1NE6A 1JYXA 4BIUA 3OCPA 3KV4A 4KQ7A 1Q8SA 2QKSA 3IWZA 3ZN5A 4YFWA 4BE3A 3OTOO 2BSKA 4DW0A 3HWJA 1RMU2 3ZFEC 3CCUV 2NLJC 3C8XA 3BPZA 1RUF2 5GLUA 3B9IA 5F6KA 3SPGA 5JR2A 2QUOA 4ORFA 2O8OA 4LF5B 4O7XA 2WZPP 4YW5A 3THCA 4LBQB 3C2UA 3H3ZA 4TV9A 2XLAA 3OYWA 1FATA 1YYNA 2JB4A 3LEKA 5FK8A 5CG9A 3CJXA 4CDUB 3HJRA 3AK2A 5FYHA 4MW3A 5D8AA 2GNMA 4P02B 4AL9A 5GTIZ 3OMIB 5GZCA 3LSDA 5E1RA 3ENRA 3ITQA 4PLMA 3ZLIA 5KC5A 3MZHA 4MVOA 1KBHA 1C28A 2QDNA 4L2NA 4W4ZA 5FUNA 1JTZX 4NRPA 1GQGA 5CNAA 3D82A 4AI0A 4TUYB 5KHHA 3SHRA 1PK6C 3WEZA 3J4UH 2I45A 1WBFA 3UK9A 2ZE6A 4FSJA 4Z2WA 1U97A 5FZ0A 4AI2A 2CH7A 1XHZA 3IM0A 2H94A 4QGLA 3ZHSA 1W59A 3VBHC 3T1HB 4KG8A 2RJZA 3ZMTA 1XNQO 2JIZG 1XYOA 4HKWA 1YXWA 2JD9A 1LHVA 5FYMA 4RHV3 4JGZC 4JGZB 1SQXH 4XDKA 2C9AA 1VBE3 4GIQA 4JKKA 3UO3A 1NCQC 4OQ9A 2LALA 2XT9A 2CDOA 5G04L 3VDCA 1MABG 5L73A 3BA9A 1O7FA 3THOA 4NHYA 4H14A 4X6RB 1RP3B 2VULA 1ZL8A 3LFMA 1E5SA 4LFCO 2D43A 1AR83 4GKJB 2HWF1 4HK9A 2OXBA 3AP5A 4AFCA 5J9PC 1H6YA 1AP5A 4UT5A 3HKEA 2ZNIA 3ZIXA 1JZ3A 1NZCA 4IDZA 1YJ9V 4CUGA 1OUSA 1S77D 2WZ8A 1W2BU 3K4AA 2G38A 2FZ1A 3R4UA 1NA1C 3IC7A 3BTXA 1K8AW 3DEMA 2WLJA 4R50A 1BVVA 2QKAA 2D3RA 1HNXO 5CB4A 2HJDA 5FZDA 2JGDA 1YRZA 1IBMO 2EXKA 3OUHA 4A7KA 4Z92B 2ZGQA 4QGNA 5J7MA 2IC1A 4META 4MTOA 4UW6A 2Y60A 4R9AA 3DKWA 2CU5A 4X1KB 4X20B 1SDDB 1Q90D 4XIKA 5BPXA 4UF0A 5IY5C 3KV5A 1QJU1 2N04A 4R7CA 1RUF1 3I97A 1XUQA 4YW3A 5KBFA 2K9ZA 4UB8Z 4CRQA 3QH7A 1S4CA 3M7MX 2GH2A 5LY2A 4DV5B 2XBO1 1NQDA 4PDWC 4MADA 1DGSA 2JWPA 4NHKA 1BQ0A 3QO5A 4KBZA 3VD7A 2W1WA 1MR5A 4GX5A 4MHUA 3CC4V 2WWWA 5ERLA 5IAXA 3HAGA 2F4LA 3JQWA 4XUOA 4Q4X1 5F5QA 4X8NA 5FREA 4A6SA 5AC91 3TXSA 2SBAA 1QEXA 1WA4A 3ZYIB 1JBCA 4L8JA 1HQNA 1BGYH 4GD4A 1KDKA 3WF2A 1PX4A 4BH9A 3APBA 4CS3A 1R73A 5GONB 3RZGA 1M4WA 4BXSV 3AKTA 5FXVA 2W1SA 1V6OA 5FJHA 5LASA 1GZ9A 5A7NA 2O8QA 4M3CB 2HKOA 3DCQA 1Y76B 4L87A 2WLPA 1I5ZA 2QQIA 2XKPA 3LDDA 2VTXA 2Y6LA 4HG6B 4IGPA 4XFIA 2Y6HA 5F32A 2Z69A 1F4MA 2P6CA 5GLTA 3KT4A 2RDQA 4CCDA 1GN4A 1Z7S1 3MAQA 4JYCA 1K9MW 1WD3A 1CR7A 3MD0A 3JALB 3RBZA 4ZS3A 3GVMA 3ETQA 2LM3A 2WABA 1JMUB 5J3UA 2XJSA 1ASJ1 4RUFA 4LO8A 3CHXA 1HDKA 3E6CC 3U78A 4YY3O 5A3LA 4RR3A 1F15A 3I2DA 2ZX1A 1DQ2A 1SDWA 5ANQA 4QXCA 3WP3A 2HYXA 1PD3A 3PNAA 2EX3A 1I3HA 5JCTA 1NTZH 5CN0A 3S6PA 3H42B 4KWKA 4D7SA 2WT0A 1JYVA 1XOYA 3SGIA 2N74A 3WX5A 3N9MA 1NA1A 1OOPA 1G6UA 5HI0A 5CBFA 4DZGA 4MXVA 4QXKA 1MACA 4I3PA 2XJRA 3WQ1A 3ZKYA 5FPXA 4W4LA 2QQVA 4HVOA 5DXDA 3ELNA 1JFFB 2D3OW 5J2TB 4GLXA 4I02A 2VCMA 1H2SB 2A5ZA 1GZWA 4Q2FA 1WLTA 2J22A 3VBRC 3BIWE 1G9DA 2ZIOA 3VBRB 2WNVC 4X66B 1UXXX 1TEIA 2ZE7A 4A4AA 2RM23 2E76B 3CCJV 5C7GA 5BY1A 2A06H 4GT1A 3O65A 4DV5O 3UKMA 1TE1B 3I3EA 2BJSA 2EIGA 1I6XA 4NXMO 3M2MA 1N3QA 1B35B 2PAMA 5AG2A 4LFBB 2CTWA 1W6QB 4DV7O 1H30A 2CWSA 3AXEA 2E63A 3KGLA 2IJHA 3WP4A 1YTFB 1T6GC 4NMIA 3TEXA 4N9HA 1ZLZA 2J1EA 4YVWB 1AF9A 1TGOA 3V0AA 5IJ0B 2LS6A 3MO4A 2ZX2A 2QKCA 1JR9A 3FJSA 5LW9A 2Q69A 4X9QA 5H9QA 3HBZA 2ZINA 4JGYC 1WLCA 2FL4A 1PMHX 3BKZA 2WZR3 4EZHA 4QPIC 3BEHA 3OUSA 2P4EA 4Q6GA 4O4HA 4E9KA 3O7OA 3DC5A 4PCRA 1BMFG 4CDXB 5FPRA 2WAMA 1VF6A 2CYFA 3KGZA 1EN4A 1FPN2 3NSTA 3PVNA 1K3EA 4U2AA 4OVEA 2WLKA 2AZ5A 2Q4PA 4Z82A 4QX5A 5D5PA 3WHUA 2W46A 1ST8A 3QVNA 4B3RB 1O59A 2GN7A 1SERA 1HKDA 4XUTA 5DEDA 2VMDA 3RZJA 4J9ZB 1PMJX 1K92A 4G27B 4LBOA 1QDOA 1XNQB 1POV1 2OIGA 1FJGO 1JHNA 2HLDG 1NG0A 1OUXA 4EN6B 1D2QA 4IEVA 3WF1A 4RAIA 3BGAA 3WV6A 5D21A 1JUIA 1IS5A 1FXKA 3FYEB 5TISZ 4JF3A 1JZ6A 1UU5A 4EYUA 2Q8EA 2E7TA 5DZEA 1DYPA 2AHZA 5FRAA 4COVA 1JJOA 2O14A 1YHQV 4CU7A 1ZZBA 2JXAA 2HWF2 1BCCH 5DG2A 5C3QA 1CJPA 2HWF3 3AZYA 4HNAA 3SH5A 3G7DA 5JSRA 3WG1A 1XOUA 3AZZA 5B1BC 4A2UA 3BI3A 3E35A 4KFMA 1AR62 4JDMA 2WS93 4GA9A 4GAZA 3ACIA 3POIA 4R6ZA 1W2UA 2OYZA 4AE2A 2D5HA 5LBQA 3K46A 5J96B 1KEXA 4RHV1 4LBMA 5B3SB 2Q5TA 2VC9A 1XBLA 3PJYA 3K3OA 1SCSA 5C5UA 1COV3 4IERA 4DB5A 4V2VA 2W6JG 4NJ4A 5F2SA 3DPRA 2D97A 1DGWA 5JCOA 3I3BA 2JS3A 3P6BA 3LUTB 1SS3A 4J10A 1YJNV 1VBD2 4K8FA 4S2GA 3JAMN 1B09A 1GP4A 4PQQA 4K1YA 1SA0A 5CFDA 2Q8OA 2Y0IA 5FY5A 1OOPB 1YIPA 4PI2A 2EXHA 3OG2A 2DYRB 1JZ4A 1T6BX 4WFGA 5E88A 5CKNA 5LBEA 4FPCA 3R65A 1WCQA 1WW5A 2R9RB 4K0KB 2KD7A 1S0DA 3JSNA 5EQUA 1ZBA3 4JI2B 2Z42A 3H1IH 4K1ZA 3LOIA 1N32B 4JI1B 2ORXA 3JD0A 1K5MB 4KP4A 4IEXA 3WW1A 3QH6A 1VB4A 4H33A 3M1HA 3WSOA 4AAPA 4S2HA 1VQMV 2DUOA 2JE8A 4UCRA 4YW4A 1UY4A 1BEV2 2XOKG 3CRRA 3L9DA 1XBFA 2QJ1A 1S5HC 4AHYA 3JAKB 2F23A 1V55C 1FV3A 4J7ZA 1FMD3 1UYXA 3N2GA 1S2EA 3GB7C 2YYOA 4AQTA 3NV1A 2KG7B 4U3JB 1OBNA 3PUIA 4RQPC 4GALA 5BR8B 4ICGA 1E1RG 5LMUB 4FLYA 4Z07A 3BVOA 2OX0A 1S5LZ 3CXHF 1N33O 1HV0A 4S2DA 1FS0G 1AR92 3OBRA 1ZM1A 4FFKA 2VMCA 1DIWA 4IL7A 2LTNA 4FLVA 3CX5F 1UY0A 3G4SV 1N34B 3OJBA 2YUEA 2UWCA 5KMGB 1ASJ3 1C8M3 4URAA 1ZZ8A 1R6TA 1KP2A 2YXLA 2Q1FA 3A2FA 1E5RA 5A33B 1A34A 3S30A 1COWG 3ZYHA 2Z2SB 1PO21 1U5YA 2JICA 4E4SA 4L11A 4AVCA 1VJ2A 2FMLA 5A3TA 4UAPA 3WNPA 2ZABA 4WVWA 1CJDA 3I3DA 4JI6B 1OLME 4DR1O 1CD3G 4YGCA 3FHAA 1F4NA 1I0HA 2YIBA 1LENA 2MEV3 5A7OA 2JDZA 2DYSC 2QBXA 3ILRA 5FZ6A 2BOBC 1C8NA 1QLEB 2BTVC 3BOPA 3LNNA 4CS4A 1VQ9V 4DV2B 4R8CA 4YM2A 2LQTA 3O1SA 3TWIA 4PA3A 3ZDVA 1U96A 2D6KA 5F3GA 4DRRA 3CCEV 4HXCA 3NMBA 4XDLA 1W06A 2R062 1NZ6A 5IAVA 2F95B 2UXCB 2UWAA 5FY9A 1X7NA 4OGQB 1NQTA 5KUKA 2HEPA 4ZY9A 3POGA 2VZ1A 3ABTA 2N05A 1XYPA 4CDXA 1MZEA 3NQHA 5AC92 3WF0A 3TGUH 5FY8A 1WN7A 3ZFFB 2VG9A 4HZFA 4Y1UA 3VGIA 3WOGA 2XHKA 3MW4A 2VRZA 4DY3A 1VMHA 4L9BA 1GAXA 4HYOA 1HXS3 3LQCA 4E4DX 1COV2 1PP9H 2FCTA 1RM1B 4MS2A 2VZTA 4L0PA 5JIAA 3T1MA 4N90A 5EHDA 4C7UA 1H8TA 3VBOA 1KFUL 4ZZ8A 4LBEC 3WY6A 1APNA 4A7YA 2EINC 5E6HA 3LEIA 1GM7A 4IEZA 1PM9A 4MGYE 1FMD1 4YIOA 3L71H 3J8F2 1OT5A 1AJOA 3O0XA 2GN3A 4R9DA 3R0RA 4X88A 3MUZ1 1AP6A 4XJZA 2XWBB 2LFSA 1UX6A 3KHBA 3W9AA 2JIJA 1VAMA 5BNPB 5KC6A 1UXZA 2QQPA 3K75B 2BFUL 1UIKA 3I2KA 1W8HA 2JECA 1EFRG 4OYUA 1V6NA 1JN2P 2EIKC 1GR3A 1Q3EA 2CTPA 4D7TA 3MHZA 1LOCA 4QB6A 3B4SA 2P22C 5IVJA 2VM9A 2ARHA 3ZMNA 3T4HB 2WPDG 4WM8A 4B7KA 2UY9A 2ZX4A 2BOCC 2QJVA 1W3VA 2G1MA 5DAXA 4F7ZA 3R4DB 4IE4A 5FZBA 4C8DA 5JH7B 1S1AA 1DLCA 4R4XA 3K79A 3AK0A 3ZM8A 5B5EZ 3FC0A 1WP7A 4E8CA 2AW9A 2WO3A 3HR9A 1SBFA 1VARA 3F7YC 3H1LH 3OW2U 4ZXEA 3WB2A 1ULGA 2K0GA 5FMCA 4Y5Z0 4CUBA 3BYWA 2UUCO 1XSQA 4JI8B 3FBYA 5H9CA 4ES9A 5GZFA 5F5IA 3E22A 3ALQA 4LUMA 1PL4A 4YVWC 1FXKB 1H8VA 2IXHA 5FP7A 3ETPA 5A7WB 3ZMSA 1IBMB 2HYKA 5KLVH 2WLIB 4MW8A 2J1SA 4L99A 1CQ9A 3BTAA 1AB3A 3WFVA 3W21A 4HMZA 1LUVA 1VR3A 3KB5A 1UCXA 4IIJA 1HR0O 2HEVF 2RS51 1YSCA 4PBPA 1JJ2U 4NIGA 2FHRA 3WDVA 1RUI1 3I59A 3WNOA 1DYOA 1VALA 1DQ4A 1D7PM 3ZXKA 3MUY1 3AMQA 2DCJA 4QD2A 2VS0A 5FZFA 4H7LA 3OY8B 2YEVA 2QQLA 3RG0A 4XF1A 4B4QA 1OMIA 1L1FA 2RV9A 2XLFA 5J09A 1X33A 4LNVA 4CSWA 3H0OA 2DQ0A 3B40A 3K0GA 4FOWA 3TCUA 2XL9A 2ZIMA 4XAEA 4QDSA 3M99B 1D5AA 5JXGA 3RWRD 2DFCA 2XJTA 5I91A 4ZPIA 4CP0A 4XQ4A 3WG2A 1TAEA 4CP1A 3BUCA 2NR5A 2GHYA 4GKKO 3RT3C 4CEWA 4Q4V2 5FIXA 4XF0A 1CX4A 2EILB 4TQDA 3AZWA 2P6JA 4BXFA 3JB8A 2JKXA 4O65A 2QWPB 2LUWA 2DTWA 5EWSA 1F35A 1W6MA 5FR3A 4GQ7A 5IYZA 1RHI1 3VDAA 1U5XA 3ASIA 4QQHA 4U7OA 3WU2Z 2WNUB 3ZMOA 1OF3A 2R0HA 5CKMA 5AVPA 4WM8C 4UYBA 4JI7O 5FLJA 3H01A 3MDSA 2DN9A 3MIFA 1L7QA 1W6PB 5ABJC 1AR81 3IC9A 4BIOA 2VNGA 2HJFC 3BODA 2Y0PA 3T2MA 5LBBA 1K97A 2ZEYA 1ZA7A 2V4VA 2BUKA 4GUNA 1ODMA 3BN6A 4YGBA 4DR6O 1F31A 1C5HA 1VQ8V 4EN7B 4RGAA 1CESA 1TMF1 5BY5A 3LDRA 1CIYA 1RIRA 5FO7B 4RUEA 2GBOA 1VMJA 3WP6A 2WLIA 1IS4A 1RC6A 2WUHA 5I8TA 1ZNPA 1LKNA 1UOFA 1LU2A 4OX9O 4U7NA 3TRSB 1EV11 2AC1A 1GM8A 3BALA 4MX3A 3L73H 4UFJA 1JVMA 2C6SA 4JAVA 1X4TA 1V70A 1P49A 3R05A 2ZGMA 4OMDA 4YVSA 3RWKX 4XTMA 4CU8A 1Q8VA 1X59A 2WWJA 1VQKV 4DPNA 3FX7A 3TK1A 2EIMC 4BB3A 1OJHA 4QKDA 4AVSA 4LEJA 4GB33 3RMXA 4JYAB 2A6XA 2XWJB 5KXCA 2BCCH 4Y24A 2WLNA 1FJGB 4FPGA 5A7QA 2H3OA 2Q5ZA 4XHXA 1GMMA 2QEXV 1MOFA 4DR4B 1PKXA 3JCZA 1M57C 3UKTA 2ZHMA 3VL9A 2QA4V 1AX0A 3OYWB 1OKOA 4IQPA 1OVSA 3ZHQA 4ZOLB 3UL2A 2AEYA 3ABLB 4ATFA 1N1SA 4NHXA 1WLDA 4HK8A 5BNPA 4W6XA 1AXYA 2RS32 4PDWA 4X6QB 4UCTA 5KHIA 4FM0A 1E5IA 1CAXB 1RHI2 4FPKA 4BQ4A 1K4DC 5B1AC 1SACA 2K2SA 1RUNA 2Q67A 4XMAA 3FZ3A 3U14A 3S7EA 5CB4B 4ASMB 4NHMA 4XW3A 1V9PA 4MH0E 4PA7A 4RS5B 4BYYA 1E1QG 1QXJA 4Y22B 1JXNA 2LGQA 3CLPA 3T1YO 1G8MA 1FNYA 4Y4RA 1K73W 1GH6A 3ACFA 2WQZC 1XPWA 2CGNA 1YNAA 1CWPA 4XZUG 1NU1H 2YFZA 2ZNJA 3OEEG 2JJ6A 1HWYA 1T5EA 2Q9LA 1GWLA 4NTYA 5BNOB 4ZXKA 1ALYA 2QQKA 1W9TA 5DPNA 2P3JA 4GX2A 1A32A 4LPLA 2X09A 3H8XA 3AM2A 4R4ZA 1AILA 5BMVB 1HNZO 1GN2A 1O9GA 2JS5A 3I8TA 3IIIA 4LCUC 4DYLA 4Y1XA 3CNAA 4RR3C 3LAGA 1WCKA 2W1QA 1IBLO 4KWJA 1KITA 3CC7V 5JOWA 3RVHA 1TUBA 4QIWF 3VBBA 3HB3B 5KHJA 2W52A 4Q4X3 3H9AA 5CEHA 4GKJO 2Z5WA 4JZRA 3L2HA 4LFCB 3JQXA 3EHBB 1E57A 4TV8B 5L19A 4PF1A 5T5OA 4A6OA 1GKBA 1PPJH 1C8M1 4TN7A 3AL5A 2VE1A 4A7ZA 1UL9A 5IVBA 4Q0SA 2FDKA 2XBO3 4I4TA 5IWAO 1DP0A 2B46X 4LIVA 5FZIA 2CHHA 1XI1A 1SLAA 4GULA 5FYUA 1W2OA 5DDJ1 5FTTC 3MDPA 4A42A 5HCFA 2CL2A 4WBNA 1HN0A 4IEYA 2WLLB 4XQDA 4QAWA 1GLHA 1RUI3 1RM1C 4DY5A 2IZWA 3VZNA 2B39A 1RINA 5CBHA 1UFIA 1MQTA 5I93A 4LWSB 3SEPA 4JZ2A 2YBSA 3JALA 2WL1A 4YZ2A 1OH3A 4M0NA 3MFCA 5ACA1 4DV3B 4LBLA 4RN5A 3AK1A 4K7JA 1IPSA 3ZFEB 3U37A 5LA9A 4LF7B 4MO3M 5EZYA 1K12A 4IE5A 3N27A 3SCFA 4YZ5A 1AL22 2BNMA 1FYUA 4B8EA 3CJHA 5LXTA 1LODA 4IEQA 2WKKA 4QDRA 4QX0A 2R16A 3WZ1A 1SG3A 3NKTA 1EV12 1HRI2 3K58A 1OQDA 4G4FA 4OZXA 1PMIA 2PZSA 3ZYBA 4XTPA 5DUVA 1Q7YW 4NR1A 3LB9A 4GZRB 1US2A 2JDMA 1XNRO 3JD3A 4I01A 4IYIA 5B4NA 1W0OA 3GHMA 4GJYA 4COZA 4FTSA 1OCRC 4UVCA 2JRIA 4CH4A 2WZEA 4DR6B 4DV0O 4OUSA 2RDRA 3I2GA 1RUJ1 4AHZA 1I5XA 3CXCU 4NAMA 1K3IA 3PMSA 4QPYA 2CUGA 3TXQA 4I5SA 3APOA 3RPQA 2ZE8A 1MMMA 1QNMA 4JV5O 4J25A 3ZVXA 1WA6X 2GNBA 1O8PA 4TWTA 3VDDB 5FLXN 4JI7B 3VDDC 1SPPB 2WC2A 5ANNA 4JI6O 2GUZA 5C3RA 4BR6A 4J9YB 2JIGA 4I50B 2LO1A 2HHHB 4IETA 2BERA 1ZREA 4LA2A 1QXRA 5LP6C 3PDQA 3CP1A 5LP6B 3QOPA 3VZOA 4BHPA 5L7OB 2CTRA 1AR4A 5C8YA 1LCLA 2QTOA 3PL0A 4Q0PA 1BMV1 2C0ZA 1AR63 3IKWA 3VZKA 2CTQA 3KMHA 1JYCA 1XL4A 1O9HA 4MXWA 1H1IA 4FPOB 4YJ2B 3EO6A 2F93B 2VWKA 3RYIA 4LO5B 4HAMA 1DGLA 5JH7A 5H9RA 4UUJC 4P00B 1PVC2 3MICA 5J36A 4PT6A 4XF4A 3VD5A 4NOTA 3NAPA 5AFBA 5C9AA 2V72A 4PELA 4MVZA 3NVCA 2QM4A 1LULA 1RPRA 2WNOA 5CBGA 1WNSA 4NRMA 2XJPA 1UOGA 1BBT3 3K03A 2DW4A 1NLSA 5EBWC 1C1FA 4ARYA 3OFNG 2KM2A 4CCJA 4MTGA 2RS11 1CZSA 1CAXA 1WMFA 4AQYO 1RUG3 1K5JA 1PX3A 4YZ4A 1A78A 3D36C 3OAAG 5IT9N 2CAZC 5LHGA 4LC1A 3BIEA 3UKNA 1CIWA 3FL7A 1ZVFA 3IBMA 1Q43A 1W3XA 4YFZA 1TUBB 1AYM3 2W87A 4DR2O 2ZCWA 3IDCB 3JD2A 3POEA 1QOTA 3TJTA 2C5DA 2EAAA 2Z0AA 3I56V 1L7LA 5KA5A 4INDA 1HB3A 3J7NA 2D3SA 5FP9A 2B5HA 2X5IB 3K4DA 3RVYA 2VCBA 1P7BA 1FV2A 3CD6V 4I55B 1W9WA 4X8PA 4D6SA 3LF7A 2HP8A 1AI6A 4EZ4A 2X29A 2OKXA 1TG7A 3AYAA 3GZAA 1A8MA 1LEMA 1HV1A 1AR73 2VQFB 3ABKB 1D4M1 4NB5A 2VGDA 2XVGA 3S5QA 2FDHA 3G6BA 4JC1A 3VBFC 3VBFB 1PIV2 4QHBA 1CPNA 5HFLA 1UZ0A 1Z7S2 3SJQC 3O1TA 4CPBA 5JVVA 3HNBM 3E86A 5C8YB 4DR7B 1ND3A 2D6OX 1AX2A 2XQRA 3N7JA 1YQ8A 3PJQA 5EIYB 4FP2A 4F83A 4Z8BA 1LNSA 4HVRA 2JKBA 3ZYPA 4MVTA 2YIDA 3PUQA 3VQVA 4TOIA 4YVSB 3KM5A 5B66Z 4P9GA 3IPVB 4XBNA 3S3XA 3OEHG 2JGDB 3H7JA 4AI9A 1VMFA 1UY2A 3VZLA 4LF9O 1SCRA 3AX4A 1KGYA 3AVSA 4CUAA 3K06A 1ZUQA 3POBA 4QX1A 3G6EV 2VMEA 1H4HA 4LULA 1M57B 2OZJA 2J42A 1L7RA 2DWEC 5IK4A 3RZMA 4CTEA 4FM2A 4FOYA 1BK0A 2H8PC 4N21A 4BQ1A 4AVAA 5GZGA 4LHSA 4RQEA 1F2NA 2YBKA 4Q29A 2R072 4DIQA 4HONA 4HPKA 3WG4A 1UZZA 2Q8CA 2P4VA 3WCRA 1V6JA 1MVEA 5LL6Y 4TZDA 1R092 1C3HA 4UXNA 3USUB 4KNCA 2YY1A 1SQ4A 3JD73 1QGLA 4FPLA 1ZBE3 2RS31 4N53A 1S5JA 4J7JA 1X36A 2B9ZA 4Q5OA 2D5FA 3A8TA 1FXKC 1F5JA 1J84A 4QU2A 1RUD1 1G9AA 3EJKA 2P67A 5ACA3 1JI6A 1XHXA 1M93A 3ES4A 4DR1B 2BOJA 1W39A 4ZU5A 5DDJ2 5D5QA 3RMYA 4MXWB 1QQP3 2H0VA 5GJ6A 2VW2A 2DVGA 1DU3D 3NNFA 3LIHA 3H8OA 4LKEA 3D4KA 2RCVA 5GZDA 1AXZA 3PUHA 3C3VA 4AVTA 2ZD9A 4QPJA 1UKRA 2BGOA 4NKGB 3JASA 1MS0A 2X6CA 4Q4W3 3QO7A 4WM7A 3MF9A 4DNYA 3M8LA 3SJCC 2W47A 3B94A 5FNVB 1ZRRA 4PQ9A 1AI4A 1VE0A 2RN9A 2PQSA 1AL21 1O3RA 1SPPA 4QDQA 3ZN6A 2WLQA 5BR8O 1TME3 3LZZA 2F1MA 1F9KA 4N43C 4O4LA 3N9OA 3WW3A 2P1BA 2BTQA 1DZRA 1YTFD 1RVF1 4PDMA 4JI0O 1NJIW 3Q4HA 2JEUA 4YSFA 3RVZA 1YFWA 4P5HA 3OTOB 5LHHA 1DFQA 1CVNA 1KMIZ 4LJHA 3SLIA 5KUMA 1GWKA 4J1XA 3CMEV 4RGGA 3BAAA 2ZCEA 4I0XB 1LU1A 2GAUA 5BUVA 5ITZA 3ZRSA 1QBZA 4D0QA 3UT0A 4I55A 1NQJA 5F5AA 1N32O 2ZGOA 2QFEA 1X8MA 2BEOA 2L35A 2WZR1 3K4ZA 1US3A 4RSUA 2JD4A 4YYOA 1PNMA 2L9LA 2W0FC 4I30A 1Q81W 3FLRA 4C0HA 3LA3A 4UB6Z 4YY3B 4EEQA 1ULOA 4NTXA 4JAUA 4FLUA 3WQ7A 5LP6A 1IBKB 3JAKA 3MIGA 3UJQA 1W9YA 4LT5A 4CCMA 1RYYA 2EXIA 4YGEA 3FBMA 4IEWA 3ETDA 3C7FA 5I0UA 3KVBA 5B3SC 1V00A 5A3OA 5CFDB 5BNNA 2XOMA 1F4HA 3TN93 2BZDA 4X64B 2CE4A 1G7YA 4NTWA 4YM3A 3N9PA 4WVMB 1YZBA 5A7PA 3LSSA 1BHGA 2QQJA 3WVJA 5JZGA 4JHZA 4CH3A 3Q4HB 4MVRA 2UWBA 2VD7A 2CH7B 2WJSA 1R1A1 1UZWA 3PUSA 1NI8A 1GOGA 3H8RA 3C3SA 1MSDA 2IU0A 1DZQA 5C9AC 4LO7A 1R3KC 3F95A 1Z2GA 2JEXA 3URFA 2DCKA 2Y38A 4P9XA 5IK8A 1HJFA 2JVDA 2BYVE 3O12A 3MV11 3HKCB 1B06A 5EYXA 4HKOA 1XMQO 3TEWA 4LF8B 5FNVA 1VRH1 2BSKB 3LSEA 1VP6A 2VBPA 3VKNA 3OSDA 4KGGA 1AUYA 1NLQA 5JOZA 1KRIA 5L36A 1HNZB 1VIBA 4BQ3A 1BKZA 2Q4SA 5FPAA 3C7EA 2E5LB 4BMBA 4GH4B 2QQUA 2L6LA 3A0KA 2A73B 3H9VA 4TV9B 2GSYA 3JB4C 3ABUA 4CDQB 1VBD1 4EN8B 3M7AA 4ES8A 1QNYA 5FMOS 1SKVA 1K4CC 2PF4E 3LDEA 3UCSC 2R72A 2CTVA 4O4HB 3P1IA 4IT5A 1IPKA 2NMOA 1JU3A 2A6VA 4Y5TA 1DG6A 4I9QA 4K35A 1HXS1 2HWC3 5C8WA 1XE8A 3LA2A 3O1MA 1JQ0A 4YXWG 1QJEA 1Z7S3 1LHOA 1BJQA 2IUWA 5LMUO 2ZHKA 4JI5O 2YZ4A 1HRI3 3IPVA 1PHMA 2AEZA 5IYDO 1W6PA 2AH2A 5ABJA 1F23A 1I5PA 3WUDA 3J9SA 2R073 4YIPA 5HBAA 3WLUA 5IVFA 5L9RA 2OCCC 5C4WC 4ONUA 5BNOA 4QQOA 1EUTA 3OR7C 4UCOA 3VQWA 1RXGA 3RNSA 2ZM6O 2Y69B 4JI4B 1LOAA 2BOIA 3DSQA 1H1AA 1DHKB 1NR7A 1S3JA 1K5SA 4ISQA 2YHJA 3FFZA 4LO6B 1N36O 3AXDA 3V0BA 1Y4MA 3EMRA 5D2AA 1TA8A 2V7QG 2N7GA 1PM4A 2MEV1 4PJ0Z 1W6MB 4BQXA 4FTBA 3QNEA 2ORZA 4WFAV 5K0UC 4AZZA 2XMLA 1GSLA 1VBA1 2YICA 4UOJA 3RZKA 1JFFA 1OD3A 2UXXA 3WP5A 5FYVA 4FPPA 1XNDA 2BTQB 3E6BA 3W5NA 3EVKA 5FMOL 5JMCA 4KUMA 4LE4A 3WNXA 1R6NA 1W2TA 3L2YA 1B04A 1M5IA 3B93A 4DXZA 3SC7X 2A3XA 2VUJA 1ZRDA 4QWNA 4QJFB 1QMJA 3LSUA 4PA6A 2PLV1 2PGGA 1HW7A 1SQFA 3AG4C 3ZYRA 1XEQA 5FXWA 1HRV1 2Y6GA 4RHV2 2DURA 1PIV3 4LBKA 3HIFA 4UBHA 1GK9A 2ZXWB 3F7VC 2HR3A 3APQA 1PNFA 1UYYA 3PVEA 2YV8A 1LR1A 2BQPA 3ZIWA 3AYEA 5T5LA 2Y4TA 3L70H 1M4UA 5FP4A 2VMGA 5LA0A 2A70A 2RR11 2JG8C 3P3NA 5ISLA 1H2LA 4E4EA 2RS53 4DV2O 1WB8A 3PHMA 5A32A 5CU1A 2UXDB 3KF3A 3THTA 2X53S 1Y7BA 1FI2A 4N53B 5JMOA 4DXWA 1J3RA 1I5YA 3AMHA 1Y9MA 5DZGA 1WPBA 4EN9B 5JUVA 3HQXA 3B8NA 4WFEA 1QNWA 3J81N 2WLMA 4Q4W2 1LNQA 4FXGB 2WA4A 4FZ0A 4P2ZA 4X1YB 4NIDA 4AILC 1G9CA 3VD9A 3VBRA
chains in the Genus database with same CATH topology
4Y20A 4B7EA 1PK6B 1BXHA 1XNCA 2ZAAA 2ZX0A 4RQPB 2R6QA 2CAVA 2JG9C 2JX9A 3ZFFB 5T5PA 1VBD3 2VG9A 4HZFA 4Y1UA 3VGIA 2HWD1 3WOGA 3O0VA 4XHBA 2XHKA 3EATX 3MW4A 4QGMA 4DY3A 4L92A 4COYA 2DU1A 3I59B 1N3PA 2VVFA 2HWE1 4L9BA 4XJAA 4W65A 1WLWA 3VBSC 3AYCA 2ET7A 2UU8A 5E16A 2TBVA 3MI8A 1YFUA 3E97A 1HXS3 3ZFGB 4E4DX 1COV2 2ZAHA 1DRTA 1UU6A 3B7MA 2IFRA 2R063 5JIAA 1HW5A 3T1MA 3NL1A 4N90A 3WG3A 2WFPA 2QCSB 1H8TA 3VBOA 1KFUL 1RMU3 4FOQA 5I8SA 1YJLA 2WFF1 3WY6A 1V9U2 5C4WB 1APNA 4LHKA 4A7YA 1LECA 1BMV2 4LLFA 1TMF3 2FMDA 1NCRA 1ND2B 4IEZA 4MGYE 4Q8LA 1FMD1 3J8F2 5JLVA 3ECQA 3JUUA 4HSJA 3JZVA 5L7OC 4BPZA 3D8CA 2RS12 4XJWA 1AJOA 1W6NB 5FOJB 4YZ1A 3S0MA 4K21A 3O0XA 2GN3A 4R9DA 3R0RA 3OD0A 2GC0A 3OTFA 1BVP1 5K0UA 3ZDSA 3JBG1 4XJZA 4H3WA 2XWBB 3U10A 4P9YA 2R071 1UX6A 3W9AA 5BNPB 1VAMA 4D7YA 2NZ9A 5KC6A 4JGYA 2EF6A 2QQPA 4YGDA 2BFUL 2RR13 5CADA 1UIKA 1LOBA 1N47A 2JECA 3VKFC 1V6NA 3M70A 3RI8A 4I2OA 1JN2P 4M3CA 2HWC2 1HLCA 4YRDA 1GR3A 3GHNA 1Q3EA 3TBDA 3DL3A 4D7TA 1D4M2 1NA1B 1LESA 2OUJA 4WV8A 1LOCA 2R043 3VL8A 2PELA 4EWEA 3VBSB 3TOJA 4NWVA 1Q56A 1ZBE1 3VLBB 1L3JA 3INAA 2GNDA 2R0FA 1KXGA 3ILNA 2QKDA 1RUJ2 1XE7A 1C8M2 4OJ8A 1IGOA 1LOGA 1OS7A 4DOUA 4BZ4A 2PLV3 1YIFA 3ZMNA 5GLWA 1WBLA 4WM8A 4B7KA 3BB6A 1CONA 1A3KA 2UY9A 3THPA 2ZX4A 3GBWA 3U11A 3H8UA 3N7MA 2QJVA 5IT6A 3VBUC 4Y26A 4F7ZA 3R4DB 2H0BA 4GXLA 1QY4A 1S1AA 2ZA9A 4JTNA 4R4XA 3AK0A 3TYJA 1SLCA 2P37A 4XFAA 4DMIA 2AREA 1PO12 4WBBA 3X29B 4HANA 2NMNA 1ONAA 2Q1MA 1XRUA 5FO8B 3FC0A 5DDJ3 1SBEA 1DGRA 2YDEA 1EAH3 3HR9A 1NXMA 1SBFA 2HWB2 3FE5A 1V6MA 2H6BA 5JI9A 2EVXA 1RUI2 1FPN3 2ZZQA 3WCSA 4IV1C 1ULGA 2K0GA 2DVFA 4PDWB 3AKQA 1QJX1 4I0BA 5JDBA 3M3EA 4Y5Z0 1D0HA 4OUMA 4YM0A 4E27A 1D0GA 1QOSA 2GZWA 4L8QA 2I74A 4QT6A 3FBYA 4ES9A 1S0GA 1S0BA 4M2EA 5GZFA 3ZO0B 1EYBA 3ALQA 4LUMA 5CFCA 3VN4A 4AGVA 4YVWC 4Q4W1 1H8VA 2IXHA 4M23A 1CGPA 5H9PA 2HEYF 4AQ2A 1W6NA 3B69A 1ND2C 2HYKA 1AL0G 4L99A 3CJIC 1CQ9A 3BTAA 3SITA 4N43B 4AFAA 1DQ5A 4HMZA 1POV3 2DFBA 1QJU2 3POWA 2EALA 5JZGB 2RE9A 5JZGC 4MGKE 1VR3A 2RM21 1WW6A 3KB5A 1UCXA 2BVVA 4LA3A 2HEVF 1IPJA 2JG9A 2RS51 1H4GA 4PBPA 2D40A 3VBRA 2XLGA 4LUKA 3PTYA 2FHRA 1DYKA 4Q4Y1 2PHDA 3WDVA 3OBTA 1RUI1 1AR91 2G4IA 1MS9A 3I59A 2V5YA 4YVSC 1VALA 1DQ4A 1OI6A 3ZXKA 3W59A 1Y3TA 3AMQA 4WZCA 3VBSA 5EV7A 2VMHA 2DCJA 4QD2A 2DCTA 4H7LA 1IQAA 2GMPA 3OY8B 3RG0A 4XF1A 4DFSA 4B4Q<