1H2MA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/inhibitor
molecule keywords FACTOR INHIBITING HIF1
total genus 105
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2mA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2mA01
2YDEA 4QU2A 4NR1A 2ILMA 3P3NA 2XUMA 4AI8A 4JAAA 3P3PA 1H2LA 2YC0A 3KCYA 1H2MA 2CGOA 1MZFA 4Z2WA 3KCXA 1H2NA 1YCIA 2WA3A 4B7EA 4B7KA 4Z1VA 1MZEA 5JWPA 1IZ3A 3D8CA 2CGNA 2W0XA 4BIOA 2WA4A 2Y0IA 1H2KA 3OD4A
chains in the Genus database with same CATH superfamily
1NY71 3UCSC 1NA1C 2ZQMA 4ZXEA 2VNOA 4TTGA 1K5MA 4GD4A 3OEHG 3UETA 3B4SA 4OUSA 4X65B 1UXXX 5DQ0A 3V56A 3VBSA 1CGPA 3I59B 4OVEA 1W06A 1D2DA 1YZBA 2G9ZA 3RFRA 2E51A 4CZZA 1SQXH 4BE3A 2OIIA 2CV6A 3IC7A 2JDKA 4WVMA 4RWUA 3ZN1A 1XQNA 4IV1C 4CDUC 5CFCB 1VEWA 3OT7A 4RR3C 2LW8A 5FO8B 1SQ4A 2ZGPA 3SKJE 2YDEA 1COV3 1FX5A 1RUG1 4IV3A 4AHXA 2J1VA 4QDRA 4PBOA 4FMTA 5LGUA 2GTSA 1ZBA2 3OTFA 1JFFB 2DCKA 3JD0A 4CEWB 4BQXA 4EN9B 4IE6A 3AL6A 1UF2C 5K0UA 1GWKA 1ROPA 4KMQA 1AZDA 1Q6IA 3N7KA 3LFIA 2W08A 3B40A 1RUJ2 5A3WA 4OHXA 3DCQA 4TUYB 3IFXA 1F4MA 4QAWA 2QQNA 1S77D 1V70A 4JGYC 4H13B 1Q5OA 2FCTA 1HJGA 4DO0A 2ITDC 5ANNA 3T2MA 3J7HA 2PFWA 5DZEA 2LFRA 4PDLA 2Z3YA 3PVOA 1YIFA 1EAH2 3HOBA 4NXMB 3HNMA 1VBD1 2VG9A 2VULA 1B35A 2X09A 3PMSA 1GN2A 2DN9A 2QM7A 2Q5ZA 1DLLA 3OBTA 3RQ0A 2YXLA 5J2UA 1XNTA 3QTCA 4CP2A 3WG1A 3Q8FA 3PVEA 1VBA3 1N3PA 2SLIA 5FO9B 4XVHA 2VWJA 4LK6A 2UYAA 4IE0A 4N53A 4YW5A 2P4EA 4DR6B 1RUG2 3D3IA 1K4CC 3WNKA 4LCUC 2WUHA 3HN3A 4BB3A 2CTQA 1S5LZ 2HWF2 3NNLA 4B4PA 4E2QA 5FLXN 1RXGA 4PQQA 5KHHA 4CH5A 5EFUA 1G6UA 3AFGA 4A7ZA 4DUWA 2Q7GA 2HEPA 4WVWA 3AG7A 1BCCH 5JIAA 1AXKA 3A23A 1LEMA 1OJHA 4R9BA 3CHXA 2EULA 1NU1H 3ABMB 3SQOA 3UKTA 4F6RA 2WSVA 3G6EV 1IG3A 1PIV1 5GLWA 4KHPO 4DR4O 4XFBA 2BSKB 1ZL8A 2J1UA 3NO8A 1URFA 2NNUA 5C33A 1YC61 2ZDIA 1LHWA 3TEZA 3ZFGC 1Y66A 1RGSA 5FYUA 3D82A 3BY6A 2WZR3 5C4WB 3L72H 3QACA 4L0PA 4TN7A 5T54A 4YZ2A 2LGQA 3I3BA 3C7HA 1NKDA 3R4UA 1V54B 3G7DA 3ES4A 4YJ3A 2D6LX 1I6XA 2ZZJA 3WF0A 3UT5A 1AR61 4XURA 4N43B 4BXFA 1QJU3 4XJWA 1PVC3 4J11A 1TZOA 1SETA 4RUFA 2GALA 4DY3A 1AILA 1DGRN 4DQAA 1OCCB 4GX1A 4XDKA 2P34A 5IYZB 4AHWA 2ZGSA 1BS3A 1H4HA 2J1TA 2VQAA 3DTUB 3B5LB 1B35C 1CVNA 3N3HA 4QX2A 4IYHA 1W8HA 1Y9QA 4EFBA 1VF6C 2ZZQA 4JKKA 2WFF3 2L35A 4BQYA 4QKFA 4YY3B 3ABZA 1RUD2 4YZ5A 5IK5A 1UPSA 1RHI3 5C3OA 1XYNA 3EHKA 1V9PA 4AFBA 2BBAA 4CU8A 3OY8B 2XJRA 2J1AA 2QKCA 3E5XA 4LBKA 4QPIA 2WLLA 2Q7HA 4CPBA 4PJ0Z 4E4ZA 1UMZA 2GH2A 4QPGC 3VDCA 1LOEA 3O5SA 3T09A 1REEA 4Q4V2 2FZ1A 4NRQA 5F3CA 1YRZA 2P90A 3T30A 3NAPB 1S0CA 1ZZCA 1PNFA 1IS5A 3CX5F 2QVSB 4Q0QA 1ND2A 3N35A 4Q6GA 4B7EA 1PGL1 2B1GA 3GZAA 1S72V 2XHNA 5JR7B 3IIIA 4Z82A 4I4TA 4TQFA 4Y5TA 5HPOA 3H1HH 4Z2AA 1HNXO 4I01A 3MIGA 1XNDA 2F6BA 5J48A 2XBO1 2FCUA 2W6IG 4O2BA 5BPXA 4EROA 4QKNA 1VQNV 1DQ6A 1WNSA 1AX2A 1Y4MA 2EIMB 4P9YA 4DRVA 2AEYA 2JD4A 2RS51 2DWEC 3AEIA 2FMYA 2JIJA 1SCSA 5CADA 5LHGA 1SFNA 1QXRA 1NZ6A 5C93A 1FPN1 3WDXA 2EIEA 1LHOA 3KLSA 2BSKA 4OQ8A 4FFKA 1SLLA 2OQ7A 3UK9A 4EN6B 4BQ2A 1Z78A 4IXLA 5L9BA 1AJOA 1VAMA 5G05L 1JJ2U 5AC93 5FZOB 3AKRA 1AR81 3AK3A 3AVSA 1H1AA 5LWBA 4ZU7A 1K97A 4XPVA 2R061 2FHRA 1BVP1 5FNVB 4WM7A 3LA7A 2WNUA 1WPBA 2XMLA 2DBIA 4IEXA 4U3FH 5D8AC 3KCCA 1EBOA 2Y6GA 3R05A 4YW2A 4J9YB 3NJXA 3GM8A 2V1DA 3H1IH 2N05A 3T1YB 3NV4A 3HKDA 4FM2A 5GZCA 4AOCA 4LF8O 1E5HA 1WW7A 3GHMA 5DZGA 3VDDC 4P9WA 4GH4B 4AGGA 1V9U3 4AK3A 2VPVA 1U97A 1H2KA 4DS0A 2JKXA 1FNYA 3SLIA 4GKJO 4Q8LA 1RMU2 3MFAA 4HZFA 5FK7A 4YSFA 4AFAA 5FPBA 3BA8A 1L7LA 2VR4A 1PMIA 4E4SA 2C1FA 1VP7A 1K5JA 1OCRC 5FLJA 3TWIA 4S2GA 3P32A 5BV6A 3MO4A 4K9SA 2JS5A 4LNUB 4LXLA 1DF0A 2JDNA 2JDMA 3E89A 4HZ3A 4CEWC 1TMF2 1W8OA 1UX7A 3I2JA 1ONAA 1ZZ8A 1BQZA 2Q8DA 2BGOA 5FJHA 4I9WA 1AJQA 1VIBA 2ARCA 1JA8A 3JAKB 4TV9B 2FD8A 2WR9A 2VY0A 4COYA 3OR7C 4F6RB 2IJKA 1C8M3 4BMEA 4YM1A 5GLUA 4NAMA 4I55B 3W7TA 4I3PA 3THOA 2F4LA 3A0BZ 5FYBA 1FXHA 1CWPA 1MS0A 4AHZA 2UUAB 1T6GC 5IHRA 3JD72 3DC6A 4QGPA 3ZHVA 1Q90D 1TVGA 3HQUA 1HRV1 2ZGRA 5F39A 1VMJA 2DVBA 2R32A 3O14A 4LHKA 4O4LB 2EX3A 4LMFA 4OCTA 3CBNA 4AHYA 1M4WA 3OYWB 2WO1A 2XAJA 1ZZBA 3CCVV 3RZKA 1QJY2 1RVF1 1TEIA 5CG9A 4QM9A 4X9QA 1GWLA 5C70A 1YJ9V 2IM9A 3ZKUA 3H1JH 3LDKA 1VB4A 3ILRA 3T2OA 5DZFA 1VLNA 2L6LA 3J7MA 1PD3A 1W6OB 2O0OA 1JH5A 3ZXGA 4HKOA 1XYOA 1X36A 2C5DA 1A34A 2YB7A 5FMOL 3LAGA 3UV9A 5CA6A 4EWEA 5EZYA 1TVKB 3JASB 4Q26A 1UIKA 3CRRA 4Q4W2 4XIKA 4I09A 3VDDA 1HXS3 1J3QA 3GCXA 5J2UB 2UUCB 5T5LA 1KFUL 4L99A 5LY1A 4UV8A 4O4JA 2DU1A 4DV1O 4L8QA 3AP9A 1PX4A 4ISRA 1JVMA 1UD1A 1CX4A 4CEYB 4J80A 4CP0A 4YZ3A 3UT0A 3SH3A 1M57B 2LALA 4JKLA 3AYCA 3MI8A 1AL21 2OT5A 5EZWA 3JCZA 4XTMA 1FXKB 3K9SA 2M6YA 2Y26A 2XVLA 3BIWE 4RSUA 1MACA 4OUEA 3AKSA 3VZNA 2ZIOA 5FYCA 1N32O 2EZOA 1HNZO 1SMVA 3RNSA 2RQ6A 3RW0A 2HFEC 4XABA 4I4TB 1I94B 3I3QA 4UW5A 1A3KA 1JYNA 2V72A 5C9AC 1QNMA 3ZSLA 3JCIA 3OUIA 1VMHA 1RP3B 4N53C 4AFCA 4DR7O 5FZ6A 4JI0O 2WLQA 1QJX1 1I0HA 4J25A 1K8AW 2VZTA 5J9PC 4B3MB 1IPKA 5KC6A 5IYDO 3CMGA 4N9HA 3UKNA 4JTCB 3M3OA 1QJY3 3N9LA 1XJAA 4UCRA 4HPKB 1RXFA 5EBMC 1S0GA 1XSQA 4E8CA 4BR6A 5EC2C 3AKPA 1H8EG 4EV0A 4KUMA 5A33A 3OTOO 2Y6KA 3VB9A 3SITA 3VHPA 4COWA 3H3LA 3VQWA 4PDVA 5L36A 2WJSA 1HRV3 3VN4A 3BVCA 5GM0A 3TXQA 1KEXA 2XKOA 5HFLA 2Q73A 2HKXA 3S3WA 4KBZA 5A3LA 5BXZA 4XZPA 2WPDG 4DXSA 4IEYA 5FZ4A 1FKAO 1YFWA 2HYXA 2CE4A 4XETA 3IBMA 3ZIAG 4CBCA 3ASOB 4O65A 4XHBA 4PDWA 5IT9N 4D7SA 2ZTNA 5B66Z 4GALA 4YJ2B 4RQPA 1XBFA 1R3IC 4UYBA 1VQ5V 2YPDA 1QOOA 5HCBA 3ZN4A 1XNBA 3K4DA 1W04A 1FI2A 1E1RG 4GB32 1XMQO 2DFCA 1DGWX 4RS5A 4MVSA 3MIBA 3WW3A 5K4LA 2TBVA 1WA6X 2RMU3 1X59A 2K46A 3KV6A 1YJKA 3CXCU 3J9SA 3WHUA 1SQGA 2QSAA 1GZTA 4AILC 1EP0A 1MMMA 5CFDB 4FOWA 4DV5B 4GULA 1LGCA 2YBPA 3HKBB 1U0AA 3WP5A 3MLJA 2O8QA 1P7GA 2VBPA 4L2NA 4PF5A 3UGHA 1LR5A 4I3GA 1KBHA 1K12A 4PLMA 5LL6Y 1DIWA 2HWD1 3VBOA 4EQVA 3KV4A 3KCYA 1Q6UA 1D5AA 3NNJA 5FMBA 5CBLA 1KD1W 2Q67A 4O4IB 3O7OA 1JXNA 5EJ3A 1POV0 4Z07A 4YVSB 2NN4A 4LIVA 5A1LA 3UT5B 3E2EA 2JICA 3DYPA 4KP4A 1OMIA 1RUI2 3RJ2X 2ZEYA 4TXWA 2OTLV 3AP6A 5CKNA 3ZDVA 4UV9A 3QOPA 4MUVA 5LASA 4QB2A 5DXDA 1MSDA 3A22A 3M3EA 2PHRA 1G6NA 3WCRA 4W6YA 3ZFGB 5FLHA 2RV9A 1RSOB 1FFXA 2ID4A 1PO11 4C90A 3RYRA 4XFGA 4N90A 1VQ9V 2ZEXA 2JEXA 3E83A 4G27B 1G86A 2JDZA 1R3JC 3RGBA 1UKGA 4QHBA 1AHSA 4HMZA 1XNCA 3T1HB 2GAUA 3QBQA 2QQUA 4GWMA 1VE0A 1ULFA 4RR3A 3KHBA 4QDSA 4ZS3A 3AMHA 1JU4A 1FXKA 4YW4A 5JCTA 1C5IA 3ZHUA 3VHRA 5I0RA 4YM3A 2AC1A 2WO2A 2DCZA 5C8CC 1GNYA 2IXKA 1H30A 1GM9A 3PMEA 1JBCA 1V55B 1NQJA 3M8AA 5B3SB 2DFBA 3VD3A 3J80N 4JI5B 1VQKV 3O12A 4CCEA 3H8OA 5F2SA 1QJU1 2JJ2G 5EYPA 2EJRA 4X1KA 1MEC1 2VOTA 1N1TA 1UY3A 4YW6A 1W8TA 4P9OA 4PDWB 4D94A 1UZYA 4DR6O 3ZFEC 2QR4A 4IEOA 2VOVA 3RYFA 4JDMA 4C1XA 4PDMA 3DPRA 2J22A 4CS2A 1E5SA 1QU7A 1QNYA 4B3TB 3VBFA 5M0TA 3RYCB 5FP9A 3AFKA 2BDRA 3JZVA 1W6OA 3RDIA 3N9PA 3D6EA 5L3DA 3UYJA 3KVAA 4X1KB 3VL9A 1ZX3A 2VMEA 1H2LA 3DECA 1OV9A 1NT0A 5FZFA 2X5IA 2BTOA 2XQXA 2B46X 2CAUA 4TUYA 3VBRC 4D6RA 3LZZA 2B9UA 3WNXA 1FS0G 4DK1A 2NPIA 3AG2C 3MD0A 1ZAUA 5FPLA 1VBE2 5LZ6A 3PUSA 3A7QA 1OUXA 1K73W 1BQPA 3WW1A 5HCFA 1BK0A 4NIGA 4PIXA 3TN92 3ZYRA 5B1BB 3R6SA 3AJZA 4P08A 3ASNC 2A73B 2HR3A 1UN1A 4BA6A 1W6NA 4LEJA 5EJZB 1NCQA 4CXXA 2G9GA 4BM8A 3VKFC 4X65O 1IS4A 2EIBA 4LF4B 4TLFA 3FYEB 1BE3H 4OFGA 4GJZA 1H0BA 4S2DA 4WF9V 1DF4A 4MV2A 1US2A 3OGVA 1R082 1VAKA 2IXHA 1FPN2 3PURA 3O65A 2P06A 4LUKA 1NH2B 1PMJX 1BKZA 3ZFFB 1RUC1 2VQFO 3CDZB 1KRIA 2WINB 2EXIA 1AL22 3FX3A 5B1AC 2XJPA 3O1VA 1C28A 2JDIG 1SCRA 3S7EA 4I50A 3E8GA 1UJWB 2DURA 1PNMA 3KZ4C 4QQ2A 1Q86W 2YFUA 2VXRA 4FOVA 4HBNA 1GWMA 1OLRA 3AXEA 4JI7O 1S0BA 5BNOA 1JCHA 3AG2B 3GJBA 4QPKA 5L3GA 1XI1A 1D2SA 3O0WA 2W9XA 3U4SA 4FVVA 4B3SO 2GSMB 2N74A 3URFA 1JMUB 1RUE2 1O5UA 2GMPA 4UFIA 2GZWA 3TYJA 1YQ6A 3GXUA 4J7ZA 3S57A 1VF6A 4LFCO 5FUIA 2V09A 1P4RA 1CZTA 2W5FA 5KHJA 1AX0A 3ACGA 2DCJA 2RDQA 4NHYA 2NMNA 3MIFA 4URTA 4OI2A 1MS3A 2ZGUA 1T2XA 2XUEA 5LA6A 3VQYA 2ZMLA 1CIWA 2QQMA 2P5OA 2H3OA 3RZGA 1IQDC 1BMV1 1NYWA 3T4DA 1WLDA 4FLZA 5KC5A 2PAEA 4BJ0A 5CVRA 1RMU1 1VBE3 3W59A 1ZRRA 5FCCA 2QWNB 2AZ5A 3AK1A 1H2GA 5DDJ3 2D93A 2C2AA 5JJNB 4YVSA 3CCQV 3WDTA 5EXOA 4B08A 4R50A 2P4KA 5IFTA 1HV0A 2BOIA 4CXWA 5E89A 1QJFA 4UAPA 5DN6G 5FR3A 4DV0O 4YRDA 5IK8A 4DR1O 2QFEA 4KGQA 2YIBA 1RUG3 3IAYA 2WA3A 3HKDB 3EFFK 4N9IA 1S0FA 2QWPB 3UO2A 1ZTEA 1R083 5C3RA 4J7JA 3ZX7A 1NR1A 5FXVA 1L3JA 5LMUO 4JV4A 2G4IA 3VKMA 3ZMNA 5IYYA 4K0KO 5LRSA 5EC1C 3V0AB 1GN6A 4O2AA 4PBPA 3O1MA 2IJJA 3CJIC 1YTFB 1C4RA 1S2BA 2PHXA 3ATGA 2BFUS 2W2IA 2JEMA 3THPA 1W2OA 4IDZA 4QX8A 2QM8A 5LY2A 5FBJA 1LB2A 1W6PA 5FY8A 1US6A 4Y5SA 2VOXA 3H8UA 3DYMA 4NTYA 3W21A 3VZOA 4DV6O 2RMKB 1HW5A 4X6QB 4X89A 1OLME 1HB2A 3JALB 3D0JA 4NHLA 5FY0A 1EV12 3WNOA 1OOPC 4JZ2A 1YQCA 1JYVA 2NP0A 1X8EA 4NN0A 1MNGA 2Q69A 1AYM3 3QNEA 3VGIA 5FBZA 3AVRA 4CDXB 3TEWA 2GC3A 4A3XA 4YGDA 3CD6V 1OCRB 5EWSA 4RQPC 2W95A 1ZX5A 4XIOA 3RN4A 1UX6A 4IGQA 4BWOA 3JALA 2P2KA 1Y74B 3ZMSA 4COVA 2UXNA 1PZ8A 1XYPA 5IWAB 3AYEA 1RC6A 4B1LA 4GH4C 2H6BA 3VDDB 5JPMB 2O14A 1NA1B 3USSA 3NKGA 2JEUA 2R063 2CTVA 2N7GA 1OURA 3AZWA 4MO3M 5HV4A 2PI4A 2WS93 1VRBA 2W6JG 1SQVH 2E74B 3PTRB 4Q0UA 4A3ZA 1REFA 4ASUG 1GQGA 4A7KA 3N9OA 3APQA 2O8OA 3LEMA 5GLVA 1M90W 4BH9A 3NJZA 3ASOC 3QO5A 4QPIC 3LUTB 1AR5A 3ZFEA 3E5UA 4XQ4A 1SPPA 2PAKA 5A33B 4MXVA 4AVCA 2F43G 4YIOA 4XDPA 1AJKA 1QJU2 3AL5A 2HWB3 3SH4A 3TEYA 1M56B 5JVVA 3V0BB 4JI3O 2IU0A 1UOJA 4DFSA 4R4XA 3K4ZA 1CZSA 5A7WA 4NHKA 1MZFA 5IYBO 4UCOA 1W05A 2EIMC 5FP4A 1N1YA 1QY4A 4P02B 4GQ7A 4W8JA 5D21A 5FZCA 4QX3A 2E7QA 3VDAA 1N4CA 1D0GA 3CRCA 2ZHKA 3T4HB 4AFDA 2B9VA 1CJDA 2VECA 3Q4HA 1X50A 3HR9A 1FXZA 2W68A 2YMZA 3WUCA 2JG8C 4U7NA 2RCVA 3VD9A 4AVBA 5B1OA 1DZQA 1P49A 5JVDB 3NAPC 2R1BA 4PIZA 5KXDA 3WDYA 2D40A 1GOFA 1UWWA 4JI1O 2PQQA 3BU7A 1SLAA 2F23A 3FHQA 3I2GA 4CCDA 1KFXL 1UMHA 5BUVA 4JDNA 3U0ZA 5A9GA 5AVPA 5JVDA 2JIZG 3ZMOA 4MADA 4FXGB 4AQTA 4TLGA 3I59A 1ASJ3 2C24A 4GZ9A 5A70A 3B94A 2QCSB 3I3DA 4DK0A 5C4WC 1H4GA 5C9AB 4YM0A 5FZBA 2EAAA 5DABA 4J1XA 2VC9A 3KWVA 3SJQC 5LA0A 1W59A 4GWJA 4XCAA 1CAUA 1V6KA 1QJZA 3H9AA 3MDSA 3WFVA 1AP5A 1APNA 1DQ5A 4FAHA 4C8DA 3AP7A 2V5YA 3K3OA 5J2TA 3G71V 3NNMA 3CP1A 1UNBA 4YY3O 3A0HZ 3AYAA 4CH3A 5IYCO 3RYIA 5JMCA 2IUWA 4LQRA 4UOJA 3VL8A 2IVIB 1AP6A 1XBLA 1Y7BA 4XTPA 3ZHRA 3ZO0B 2J7MA 2RDRA 2ZX2A 4X64O 1Z5WA 1PKXA 1EY2A 2WAMA 2OW4A 2LM3A 3TAYA 1ND2B 2UWBA 4LF9O 4Z1MG 3U37A 1WMFA 1SDWA 4XFHA 5LMUB 1HQNA 4FFFA 4WZFA 3ZLIA 4P2ZA 4FAGA 3CIHA 1J59A 3WG2A 2VO5A 2WBKA 1F51A 2NLJC 2R6QA 2JG9B 3C7OA 3L2YA 4HVRA 3CRQA 1JR9A 1ZBE2 4Y22B 2Y6FA 2ZS6B 3ZRSA 2JB4A 4Y1YA 2MW2B 5CG8A 4FPKA 2Y60A 5JXGA 2IVJA 3WP4A 1R6NA 2DV9A 3K9AA 4D8MA 2B1IA 5J98B 2VTXA 2A6XA 2PHFA 1W2TA 1RUH1 4X1YA 4A7YA 3KF3A 4WBNA 1YJWV 1HDJA 1UW8A 2ZX3A 3JBG1 4JTDB 4CA9A 4FM1A 4WFEA 1QF3A 2D3PA 3SJBC 3AG3B 5K1XA 3FC0A 3U10A 1I3HA 1S0JA 1N1VA 5IVVA 1LENA 5LMNB 2O57A 1G7YA 1R091 4Q27A 5CISA 1Q82W 3WP3A 1W03A 2GMMA 1WB7A 5LATA 5B1NA 4LULA 1QNWA 3QH7A 3JD3A 4YG0A 5LBCA 4QQHA 1G9BA 3WG3A 3CCRV 4E8DA 2Q8EA 4RR3B 2ZAHA 3HKCA 3E8BA 4K8XA 4ASKA 1QH6A 5F3IA 1B06A 3DC5A 2ZACA 2ZBJA 4LHLA 2QA4V 2YFZA 4FTSA 2VTXJ 4DXTA 2ADQB 4LA3A 1DF5A 3B8MA 3LWCA 3E8HA 4WV8A 4JRAA 3ZYJB 4CU7A 2WQZC 1LOAA 1PO12 3WF1A 1N47A 3WSOA 3LSUA 3MEPA 3H3ZA 4DV5O 1KJRA 3LEIA 4JI4O 3PL0A 1AR62 4A45A 2WWJA 2QJ1A 4LKDA 1S5HC 3HKCB 3DXTA 1RFYA 2QQWA 5J96B 4WM7C 3V0AA 2BNOA 5ABJA 1RPOA 4L87A 2JGDA 1JODA 3FAVB 2AXTZ 3N2GA 5EPAA 1BBT3 2Z42A 4M0NA 1KXGA 2HH9A 2CYFA 2RS33 3D5OA 2CH7B 5KA6A 2QDNA 3KMHA 4HL0A 3QCWA 2VMHA 1AR73 2PQSA 1MEC2 1I5PA 5GZEA 2RE9A 4WFFA 3AK0A 4XDQA 4LNVA 3ZHQA 3ML0A 4AI0A 3N36A 1SQBH 2OZ6A 1EYBA 5FYSA 2JK5C 2B5HA 3KF5A 1ZZ7A 2E9QA 2HP8A 1A32A 4HANA 4M01A 5BY5A 3VBRA 3G67A 4BDVB 4OULA 2QEXV 2XONA 4CTEA 4IE4A 3RWKX 4D69A 1QQP2 4MSVA 2V73A 2A79B 4ITCA 1N8RW 5F2WA 1U5XA 4NPRA 3SYAA 4DNYA 2XAGA 1DCSA 5IYZA 1SBDA 4MVMA 1XNRO 2AREA 1D2QA 4X62B 5CBHA 3K08A 4H37A 4DXRA 3N2KA 4RS5B 4TSFG 2A06H 5FXWA 1QXPA 1FV3A 5FKCA 1AL23 1OC1A 4YNIA 1QJEA 1ZRIA 2YUAA 3OG2A 4IV3C 2JB8A 2EA7A 4EKWA 1YITV 1HNWO 1W0OA 4Y33A 1I5XA 5LGNA 3AZXA 5JMOA 2OUHA 1PO13 4EYUA 4W65A 4WVVA 1NKGA 1J5EO 4YPJA 5KAFZ 5BR8O 1GU3A 5B2GB 3EHBB 4RGGA 1LHNA 5C8YA 2QUOA 4JYBA 2R49A 3ITQA 1B6QA 3CEWA 2PXJA 3T4ZA 5FFOC 3A0RA 2XDVA 4LFAB 4OMDA 1VPHA 1W0NA 2Y6LA 4UW6A 3C3SA 3D4KA 1WD4A 1FAYA 2CDYA 3O1OA 2R0FA 3P3PA 1R1A3 4QNHB 2BNNA 3FZ3A 2VMCA 4YW3A 1QVGU 2GBOA 1NG0A 1QLEC 5C3PA 2B8MA 4LF7B 3KZIZ 3R4SA 2TUNA 5CB4A 1MEC3 2WLLB 1GR3A 4WCEV 4PELA 3ZFFA 2FDJA 1YIPA 1DFQA 4PHZA 5FMOS 2TNFA 5I8TA 1RSOA 1KJLA 1QHTA 2FL4A 4QWNA 5DDJ1 3WU2Z 2Y8KA 2GC2A 4CDQC 1AL0G 4AL9A 2C26A 2RDNA 2UURA 2LS6A 2I07B 2WRAA 2MNGA 2IFWA 2DCTA 3SCGA 3IT8A 1ULPA 4CYDA 2CSGA 3UNPA 1TUBB 1RUE1 2YGLA 1XNQO 2VJXA 4A44A 4HKWA 1GKFA 2VUDA 4XF4A 2HWC2 4MVRA 4BK5A 1AYM2 5L7OC 4XC9A 4CCKA 4AQSA 1XB9A 3CJHB 1VMGA 1F15A 4O7XA 2UY9A 4LTAA 5DAWA 4DV3B 1H8HG 1XE7A 2FDIA 4WBNB 2LGWA 1ACCA 5LCWL 1KDMA 1LOCA 4KNCA 3J81N 2G38A 2WSSG 4OXSA 2ZJCA 3MIHA 2HEYF 1LOFA 4AGRA 3UJOA 3UKMA 1F23A 3SNMA 4Q1PA 4BOWA 1AYN1 5F32A 1AXZA 3STLC 5J09A 1GNHA 1W39A 4JV5B 3GZEA 1I1EA 2VQTA 2Y0OA 2UXCO 4H55A 4B3NA 1ENSA 2HVKC 4RYDA 2VVEA 2OKXA 2C9AA 3H1YA 4KWUA 1EV13 4F4LA 2WZEA 5FZ0A 4UFJA 1K42A 1YVWA 4JGZA 2NN8A 2GDFA 4EB6B 3RG0A 1NCRA 1V0AA 1X9PA 5KAIZ 3ABKC 5FY4A 2VBDA 4UCTA 3ZYHA 2D6KA 3H7JA 2NMOA 1EZVH 5FKBA 1GZCA 4ZU5A 2WT0A 2QQPA 1SQFA 2YIBD 2X6AA 4CCJA 2Q1ZB 1RUI3 1O6UA 2VXJA 2D98A 2WDBA 2A6VA 5JSPA 4XUTA 3GZTB 1EN6A 2E53A 5FZ9A 4FTEA 5A3OA 4YG3A 1DLBA 2ARXA 3T1LA 1UOGA 1KUQA 1EN5A 2XKPA 4WVMB 1QQCA 1Y74A 1OSGA 4GH4A 4OHVA 4AI8A 3CC4V 1N36B 1IURA 2QQVA 4NO4A 1GMGA 2VZ1A 4Q0SA 3RVZA 4QGLA 4JI2O 5JOYA 3PJQA 2ITCC 1LHVA 5IVEA 5JSOA 1NXMA 1G1XB 1CAUB 4UXNA 4D6TH 2CL2A 2P6HA 1X33A 3M4FA 4PIYA 1PVC1 1VR3A 1BJQA 1W8FA 2YEVB 1WMDA 3CNAA 2R9IA 3OEBA 1XHZA 4QHZA 2ZHMA 5IFPA 3KQ4B 4D6SA 1OQEA 1MQTC 2A70A 2BNMA 2XUMA 4IEPA 1BLZA 1OD5A 3OUHA 5CIRA 3VDBA 2UWCA 1CP9A 2KQXA 5LYJA 4UFHA 2ZR3A 2YXHA 3OEAA 3KT1A 3VOUA 5ITZB 5A6YA 3ZXEA 3TJTA 3BCCH 3RYHB 4MT8A 3O9OA 3IJ4A 3INAA 4OPAA 4IQPA 5EIYB 3OGSA 4XAEA 5A7WB 4DUYO 2ZXQA 5J3UA 5GALA 5F6LB 3BPSA 2QQLA 4MLOA 1W0KG 5CBGA 4O61A 4HT1T 2WNVC 2D6OX 1YI9A 4JGYA 1AVMA 4XUPA 4X8AA 4LH7A 2VAUA 4UFLA 3T0DA 2DWRA 1ZWIC 3KB5A 3N7JA 2Q6AA 1ZBE3 3JATA 2QTOA 1GOGA 3KT7A 3VBOB 1NE6A 1SLCA 4LBJA 2ORXA 1P8JA 4A4AA 2H0BA 5LA6B 4WZCA 1ENQA 2OWOA 5BNPB 1NT2B 4MGQA 1W9YA 2XBO3 4Y3OA 3ZDSA 2XXZA 5B4XA 4FOYA 3QD6A 5DG2A 4KG8A 1CEZA 3MHSC 1YWKA 1FPN3 4L11A 3IMNA 5LXTB 3L73H 4LOSA 5C9AA 2HWF3 2J1SA 4MGZE 2ORZA 3WB0A 1HLCA 4NXNB 1RUI1 1FXKC 5LK7B 5JR2A 3ECQA 3MPPG 3T2QA 1O59A 2R72A 1YQ8A 1R092 4JRLA 1WN7A 3DXUA 4RFRB 5BR8B 2RR11 2P4VA 1ZRFA 3K51A 5E79Z 3DV8A 1EAH3 4DR7B 2PHUA 1O8PA 3S5AA 2GN7A 3TCUA 3HQRA 2A3QA 3IDAA 3FHAA 3LNMB 4Q4Y1 3DGEA 1CIYA 1ZNPA 2Y69C 3X2QC 5L73A 1BZWA 2RM21 1W6PB 1ASJ2 1BT8A 4B3RO 1NCRC 3OUJA 4TOIA 4FSJA 1RPRA 1EZJA 5LK5A 3TGUH 4ET7A 3HBKA 3E22A 1I9RA 1F5JA 2WZR1 4FPYA 1SLBA 4NPLA 4CDXA 4YFZA 3J7LA 5AFEA 3ZHTA 3DUIA 3CXHF 2QE3A 4AVTA 2M7WA 2HWB1 3WQ0A 4P5HA 3FN9A 2WLPA 2JG9A 4YYOA 4PV1B 3JD4A 4RAIA 1UYPA 4Y22A 5LMNO 5B3SC 2G1MA 3VZLA 1N1SA 3SEPA 3MW3A 4X88A 4GKKB 3ZKYA 1NQDA 1A8DA 3K3NA 1IG0A 1GYKA 1J58A 1JZ7A 1GSLA 4GXLA 3ETEA 5LA2A 4MW8A 4YM2A 2VZPA 1IKQA 5DAVA 2G9FA 2DTWA 4DV2O 4CU6A 2ZDIC 3K04A 2C4XA 3EBRA 3T08A 2RHPA 3LGRA 4QXBA 5DAPA 1XEQA 3CU7A 3OUSA 4ORFA 3K59A 1NXD1 1Y3TA 3OGJA 1ZA4A 1HP8A 3RYFB 3F2ZA 2B42B 1ND2C 5L9RA 1M93A 1GAXA 3WDVA 3UO3A 4HSLA 1GQHA 2PYTA 1GN4A 5KXCA 2XHBA 2WNUC 2PGGA 2EINC 1UYXA 1LCLA 2ZEZA 3HMYA 1XU2A 1H1IA 4F83A 1BHGA 1US3A 2JDUA 2Q9LA 4UXAA 4BLIA 1OPOA 3ACHA 1QBZA 4F8AA 1REDA 4PA4A 1WZXA 1V6NA 4XE9A 4HK8A 3ES1A 1MG1A 1S3JA 1NLSA 4Q4X1 5FYYA 3LE0A 4AXOA 2EF6A 3NV1A 3Q4HB 3IWZA 4LBOA 2ENRA 1VQLV 2VCMA 5C8CA 4MVOA 5DUWA 1MA1A 3HN1A 3KS7A 2WQ4A 1WBLA 1ODNA 1AROP 2ES3A 2XL9A 3VZKA 3P6BA 4XDOA 1WCKA 4XBLA 1MVQA 2YXSA 4LHNA 1JW6A 1F35A 4XBFA 4GB33 1AVBA 3ZPYA 1AUYA 4CP9B 4RHV1 3CCUV 4XMAA 3ASNB 3PUQA 4GCZA 4DV2B 2BRTA 2YG0A 1I7FA 1AX1A 3I3EA 4GX2A 2O1QA 1QDCA 4NHMA 2LJ2A 2SBAA 2ZCEA 2DVDA 3POGA 3FKSG 3SYPA 4CDQB 5ABJC 1W6MB 2YGMA 1OKOA 2W87A 1KS5A 1Q43A 1W2BU 4BZ4A 5LP6B 3LIHA 4TV8A 1WW6A 3F7VC 4XQDA 2I74A 1PNKA 3EO6A 2CGOA 3BI3A 4NUBA 4IIJB 3A2FA 5GZDA 1AXYA 3T1YO 5BXXA 4AEKA 2VE1A 3ORJA 1G9AA 4JI0B 3BVOA 3VBFB 1V9U2 3HKBA 1BMV2 1V6OA 2JECA 1FMD1 2X05A 3QVNA 3LIGA 5A2QN 4LFAO 1TAEA 3A8TA 3OYWA 4IT5A 1HRI3 3PUAA 4X1IA 1XC6A 3ZR6A 4P9IA 3CMAV 3FUOA 3LKJA 1WPXA 1XNRB 2XLAA 4JI8B 4M4PA 2R043 3LDBA 3BIEA 3P3NA 2LW1A 2EAKA 2LO1A 1JQ0A 3JAMN 5FAXA 4DO2A 3FYIB 2GC1A 3ZPOA 2VOKA 1Q8VA 4CUCA 5EIBC 1SA0A 5E1AC 3I2DA 5HCHA 2ETNA 4DW0A 1R3KC 5KLVH 3D8CA 3MF6A 3P30A 3TK1A 1FNZA 1HIXA 3PU3A 5KHKA 5LW9A 2ZKLA 4LF4O 2HLEA 4EE2A 1NI8A 2NZ9A 4YHHO 2LTNA 3QH6A 3ZRWB 3NJVA 1C5HA 1ZBA3 2EJ7A 2D7FA 2K9ZA 5GLTA 5FZGA 2P6CA 1NCRB 5K8SA 1SZBA 1Q56A 2A7AA 3OY8A 5FWJA 4MS2A 4M0HA 2MK3A 4X6RB 3H1MA 1OFSA 4MZUA 1QDOA 1HWYA 2XOMA 1GP4A 4I5SA 2ZGLA 1UYZA 4BIFA 4EFEA 2WLIB 3FB7C 2Y38A 1OF4A 4AEMA 3LNNA 4NIAA 3FB5C 4SBVA 4YGEA 3VHOA 3ZXFA 2JDAA 1FJGO 5FNVA 4WM7B 3ETQA 2ZKOA 4CC5A 3NWKA 3VBRB 2ZM6O 3LDEA 1Q7YW 1XRUA 3TB0A 3ACLA 3DSQA 2P3YA 2E31A 3M3CA 4DPNA 3IC9A 2YY1A 1OLMA 4JQTA 1O7FA 5FUNA 3S7IA 1H8TA 4H3WA 2VTFA 4OZXA 4FOQA 5F9TA 1NAEA 1O9GA 5FIXA 3OMNB 2XJUA 5TISZ 1OCOC 4M3CE 4BQ3A 3HKEA 2BCCH 2E76B 3I2KA 4AI9A 2GP5A 3OW2U 4QD2A 3ZRXA 1W2UA 3IDBB 3HBZA 1BZKA 1UZZA 4PA7A 2WLMA 2VQEO 3BODA 4J41A 2E7AA 4G3YC 5L3EA 2D5FA 2WZPP 4LKSA 3DPRB 4UCUA 4Q8KA 1A6CA 2JJ6A 1RUH2 1N36O 4K6BA 3ZYFA 2GNTA 3ZXLA 5FZIA 2RMU2 2IXIA 3E5QA 3LPFA 3SEEA 1W9SA 4YIPA 2PHDA 5AG2A 1H2MA 5C5UA 3MAQA 1GO3F 5E16A 4PA9A 2R041 2GNDA 4N7UA 1UQXA 4QDQA 3CLPA 4HG6B 3GB7C 3VD5A 5H9RA 2CDOA 5A6ZA 1V6MA 4BW5A 4UFKA 4MX3A 2VU9A 1SC5B 2Q1FA 4M3CA 4R6ZA 4N53B 2RS11 2CAZC 3HPLC 4ISQA 1QOTA 3WP6A 4CS4A 4AZZA 3D36C 1AR72 2Q30A 5C5TA 1P7BA 3R65A 4IHJA 1YXWA 4FZ1A 2DWDC 4CS3A 1GK9A 1AR82 4HN0A 3VBUA 5EYPB 2DF7A 5A3MA 4NTWA 5EZYB 4COZA 2VCBA 4B3SB 4KU7A 1HB4A 4PLNA 3WR0A 3N27A 4I0XA 5FQ0A 3CYOA 4G2KA 4QPYA 5DUUA 3BB6A 4UFMA 5FWEA 1QJX2 1CAXA 2X8KA 4QB6A 1SACA 4LT5A 5KR7A 5JLVA 5JI9A 5ACA2 4Y4YA 4CCCA 4FXKB 2QTWB 2RM22 5FYMA 5IT6A 3KG2A 5FYVA 1C3HA 3NMBA 2CNAA 2ZCWA 1XMQB 1HKDA 1J1TA 5H2FZ 4FFGA 2JDYA 5B4NA 1YSCA 3OFNG 4FLYA 2J1EA 4OQ9A 2MPFA 3UKVA 3B8NA 2RR12 3L71H 2PELA 2RMU1 5IVCA 4J1WA 4EN8B 3CO2A 3ZMUA 4LLOA 3WB2A 1HN0A 2A1XA 2GU9A 3A4UA 3N7LA 3OUFA 3C3VA 4IESA 2R073 1E79G 1PNLA 2FB5A 4OX9B 2HEWF 1F2NA 4ARXA 2WNVB 1IPJA 4KU8A 3E22B 1YEWA 3RYKA 3JXSA 1RUD3 3VKOA 3H8XA 3LB9A 3ZXAC 1WCSA 4XF1A 1SHWB 4AHCA 4LF7O 1VBA1 3L75H 4NOTA 2FDGA 4D6QA 1NZCA 4CH4A 3TBDA 1PV0A 5HXVA 3CF6E 2PF4E 3OBRA 1IVSA 5C4WA 2B7YA 1C1FA 3PVBB 1X9TA 3PJYA 3JARB 2DQ3A 4MXWA 1C57A 2X29A 4IW3A 1N0NA 2BWCA 2KG7B 3J7AU 3PTYA 1UOFA 3P1IA 5FY7A 4NR1A 2YXYA 1EAH1 2Z0AA 1IOAA 2WABA 2EIJB 3LDRA 2OA2A 5CA1B 1IZ3A 4U3JB 1ENXA 5FPOA 4GAZA 4P9XA 3AXDA 3LA3A 3RRDA 2VM9A 2XJSA 1XL6A 3A0NA 2Y6JA 2XASA 5D2AA 5IW0A 3B02A 4QX5A 2X5IB 1N34B 3S0MA 5IJ9A 3J4UH 2GN3A 5L3BA 3SDLA 3AJYA 1M56C 5FZ1A 1JX9A 4JI5O 4TQDA 2DVAA 3OF1A 1NQTA 4LA2A 4TYSA 3WNLA 1IKPA 3LA2A 4KBBA 1YIJV 5FPUA 5EBWC 4N8MA 5LHHA 3ZYIB 2LFSA 2ZABA 2KA3A 4XILA 1CXZB 4Y1UA 3ZMTA 3N2KB 5JSRA 2Y4TA 1QVFU 3B09A 2FKXA 4AEDB 2RG4A 1LNSA 1UU4A 2W47A 4I9QA 4OZOA 2DYSB 2QE7G 2ZT9B 2D6NA 2WWSA 2V4VA 1WWYA 1WCDJ 4IL7A 3ZR5A 5C8YB 4CDWB 2F17A 1JOBA 1BQ0A 2W46A 1AR93 1RUE3 2QQOA 1VBB1 4RHV2 2QDOA 1K34A 3C2UA 3WF3A 2TEPA 1AI4A 2GNMA 5BNQA 4NROA 4I0WB 1W3XA 3TETA 1CAVB 4ZOLB 2ZGMA 4P9JA 2JS3A 2E7TA 4DUYB 2JXAA 2WT1A 1PVXA 2Q4PA 2E3CA 2A0LA 2BWAA 4GZRB 3WCSA 3OMAB 4ZXKA 1OA3A 5LRRA 4H7LA 4UUJC 1ULDA 1JZ5A 3SPHA 1FMD2 3AG4B 3JSLA 1RUD1 3QLQA 4FBFA 4HONA 4UT5A 2VCCA 1XE0A 3SYOA 4CRQA 4TV8B 3W5NA 3WLUA 4NAOA 3KV9A 1DK1A 3AX4A 4HSJA 3K5NA 2XT9A 1EV11 5A32A 4K0KB 2YI9A 4LKFA 2OIEA 4AI1A 4F6EA 2RR13 2GH8A 4A6OA 4ZPIA 2AUYA 1W28A 1UZVA 1FT9A 2CWSA 4KG0A 3MHHC 4BQ5A 5IUQA 3E86A 1J3RA 1O8SA 1W8WA 1Y9MA 1R73A 3N2GB 4CZSA 2A71A 1WCUA 5KA5A 1MOFA 2JG8B 1FOD1 1Y76A 2CH7A 5H9PA 1K5SA 4QXHA 3BKZA 4IGGA 1RYYA 1W9FA 1FYJA 1GNZA 2Q4SA 2VMDA 3JQXA 1VQ4V 3H42B 1MABG 3GDBA 1LGNA 2ZXWB 3B9IA 1JZ2A 1CPYA 3STZC 4DR2O 5F7UA 1TUEB 1LULA 4LBEC 4LFCB 4B4QA 4FFBA 3WD5A 3GGLA 3CRMA 3IPVB 3KKYA 1CQ9A 1UFIA 1YYNA 4PA3A 4YARA 2XAQA 1UZ0A 1JN2P 2ET7A 3DXRB 4C1WA 2QGNA 1CJPA 4CP9A 4QJFB 5EHDA 1W90A 1AF9A 2HJFC 1PVC2 4FLXA 5ISLA 3OJBA 2CUGA 1RM1C 3V64A 4JI8O 4Y24A 2ARBA 4LP8A 4CP1A 1HQLA 1UPGA 3ZHSA 3O1SA 4YVWA 2JG9C 3RT3C 4LF9B 1JZ6A 2BGPA 4B3RB 4XJ8A 1TME2 4JYYA 4O4HA 3V0BA 2DE0X 1QU0A 5DN2A 5T5JA 5CKMA 1TVKA 2UXBB 1LESA 1BSMA 1OBNA 2VQ0A 1YO8A 2P37A 5T52A 1XOUA 3WV6A 3ALQA 1HRI2 2YIDA 2OX0A 1XNKA 3SJAC 4C91A 5I0TA 1TGOA 1Z7S2 3MLLA 5C8WA 4X20A 5J1XA 4RO2A 3DGTA 2CTPA 1ULEA 4TSVA 3WNNA 4I0XB 3LDCA 1DP0A 2VZRA 4QPWA 4FPFA 2WLHA 1F31A 3DPRC 4JHZA 2J42A 1CAWB 4DXWA 1CD3G 2K1EA 4DR3B 1ZSPA 3W7XA 2DCYA 2CGPA 4ONUA 5H9QA 4FLUA 1GICA 3BOPA 5F3EA 1L0NH 1F5FA 4CCOA 2X10A 5KWRA 4FI9A 4PI2A 2D43A 2RNBA 1ZBE1 2N04A 1ZREA 4AQYB 1JYXA 3WQ7A 2Z69A 4MVQA 1MZ6A 5JWPA 3SCHA 2PHLA 1ASJ1 4DV1B 3LDDA 2VRZA 3ILNA 3FBYA 4FPOB 4AI2A 3LFMA 1W6MA 4UVCA 1SF9A 5DAXA 2NYYA 1QOSA 3H3UA 1XNAA 4NB5A 4AQ2A 1PK6B 3BHPA 4GA9A 1DGWA 3DYOA 1K5QA 4ARYA 1K5MB 2QKAA 1OQDA 3AG3C 2F95B 5GONB 1WLEA 5LEJA 4BIZA 3BPZA 1JYIA 4O9GA 3WVJA 1ALYA 2FQPA 4JTAB 3R4DB 1KU9A 3LEGA 5CB7A 1LGBA 3FB6C 2ZOEB 5FTTC 5F3GA 5FZAA 2EALA 1UL9A 1PZ9A 1SERA 1M9NA 2HLDG 1DZTA 1NVPB 1YFYA 3HEIA 4BW9A 3G80A 1PIV3 1K7DA 1PK6A 4QPGB 2WNEA 1K33A 3BABA 3UJQA 1VQ6V 4EZ4A 3AG1C 1O91A 4JZGA 5JJEB 2W1SA 4B3TO 1VRH1 5HBAA 3M1HA 3OMIB 2WS92 3AMQA 3AKTA 3ZFEB 2PN5A 1TA8A 1MS1A 4LPLA 4FFHA 2ZKNA 3CSXA 4HFSA 3WX5A 3J8F2 3JB4C 4QU1A 3ETPA 3GCWA 3T1HO 4QPGA 4XQWA 1UZWA 4GX5A 3MPBA 3GWKC 2V4DA 4RQEA 3VUOA 2EIJC 4CE8A 4GJYA 2D44A 4MXWB 1UPIA 3I2IA 1IBKO 4LF5O 5F5CA 1GANA 2FYUH 3AK2A 5JOZA 4OPHA 3QG5A 3D0SA 3BU0A 3BTAA 3VBFC 5IJ0B 1SQPH 1RMU3 3D3AA 5DPNA 3HNYM 4EN0A 2ZPXA 4GKJB 3WF4A 2QZ3A 3X29B 4I55A 4WVZA 3WT3A 1H9PA 4CDWC 2BEOA 3WQ1A 3RVHA 1BXHA 4MVZA 1TMF3 3MFCA 4KHPB 4LF8B 4XUNA 3VBUC 4L92A 4ICGA 4QX7A 3WNPA 5FOBB 2RJLA 5BMVA 2QNKA 3RVYA 2JWPA 2RJ2A 3T2PA 1N33B 4AEDC 4DYLA 5A7QA 5I8SA 4TZDA 3CQOA 5I0DA 2HVJC 5HV0A 3H8RA 2FDHA 3WDUA 3PDQA 2QJVA 3JB8A 2KB1A 3AB0A 1VBB2 2D3RA 3HKEB 4X66B 4NTXA 2VMGA 2NM1A 1AYN2 2AEZA 2CWMA 5AC92 2D6MA 3RI8A 2IBZH 1OOPB 1LUWA 3A21A 5LEKA 4PI0A 5SV5A 2OVUA 3GALA 1VQMV 3C8XA 2FTKA 1UU5A 2YS8A 1IXBA 2VVFA 4QX0A 4FVMA 3UGFA 1J1LA 5ACA3 1WA4A 2H0VA 4Y26A 1H1MA 1PPJH 4XDLA 2Y33A 1VB2A 4FPGA 3THCA 3C7FA 2XNDG 4IEVA 2CDPA 3K5LA 3IDEA 2HJDA 1SA0B 1HNXB 2Z2SB 5CAZA 4P9LA 2BUKA 5FP3A 3UL2A 1OOPA 1PGW2 3R0RA 4C0HA 1OXCA 3ZXDA 4YHHB 2ZAAA 2WNUB 4KWKA 1Z0HA 2AZ2A 1H6YA 2UXDO 4TWTA 1S2KA 4MOAA 2BBVA 2B4KA 4YVSC 4K40A 2W1QA 1NCQC 2Q8VA 3ICXA 3KGZA 4DUXA 3MGUA 4DINB 3FUQA 3N9NA 3SXWA 3SJCC 4GKKO 3IB3A 1FXVA 2VMIA 2XB6C 4QPIB 4QX1A 1SRYA 5JJJB 1WCQA 3BALA 1YF2A 3ZXJA 5EJ1B 1BCXA 1PGW1 2W52A 4YJ3B 4K7JA 5D1IA 4YW1A 4B3MO 1UCXA 1PO22 1ENVA 1MS4A 1MR5A 4Q2FA 4CDUB 3PUHA 3ZSJA 1S55A 4BYYA 4P30A 3OAAG 4HNAB 4O4JB 3OTOB 4X1YB 1PM4A 1GMMA 2R16A 2ZGKA 1KB9F 3MUZ1 1UY2A 4QQLA 3U1XA 3WG7C 1PHMA 3K48A 1UY1A 4FPLA 4BQ4A 1YUDA 3IDCB 5JZGB 1SESA 4KXRA 1VIWB 5L7OB 3VBHC 4X8NA 4XJZA 3AMMA 3D3QA 4LR3A 1OHHG 5C3QA 3VQVA 2VUCA 1PO21 1MVEA 4QGMA 1R1BA 3FJSA 1S0IA 5IVYA 1HRI1 3H50A 4XDJA 5CA1A 3HNBM 4ZKTB 4FFIA 1ODMA 4LBMA 1Y4WA 1BEV3 4OHWA 3ZMVA 3CCMV 1MS9A 4BK4A 5SV8A 2RDSA 2XPJA 1G8MA 4DRXA 3MHZA 3DKWA 4JCKA 2B9ZA 4WFHA 2AZ0A 5FZ3A 1XHXA 2YV8A 1NBMG 4LO5B 2XR4A 4G4FA 2WQ8A 3POJA 5A7SA 4IIJA 2OQ6A 4Q29A 5H6QA 5LOVA 2ZA9A 3K79A 4Y1ZA 1YCIA 2ATKC 3H1KH 3E6BA 4N23A 5EP9A 4LBNA 1G8WA 5LBBA 4AR2A 3AZVA 5GKAC 1Y6XA 4DR2B 4U3JA 1WAZA 4I50B 3SPCA 5DEDA 3APOA 4DR4B 1T5EA 4N21A 1L7QA 5IDJA 3RZLA 1QEXA 3CZUA 4SLIA 3QO7A 3O0XA 2XHKA 3X2QB 4A6SA 4Q4X2 5F6KA 1NOVA 4AE2A 3ZX6A 1MS5A 4GKYA 1CN1A 3T2TA 3CMEV 5GTIZ 2OUJA 2UXDB 1AI7A 4K21A 1LOBA 2Y0PA 1H9WA 3SYQA 4YVWB 2W92A 3SR2C 2UY8A 3RZHA 1W3VA 4LNUA 3RYCA 1C8NA 2Y6HA 1K3EA 1ND3C 1F4AA 2EICA 5JOXA 1LOFC 2FMLA 4XZUG 4DMIA 3MBWA 1HXS1 4CSWA 4CEYA 3HVDA 3GZUC 3NW4A 4Q4W1 3MLKA 1POQA 4JI4B 1T6BX 3EQEA 2P67A 1X8MA 3T4VA 2F4VO 2B45X 1O5LA 1AR4A 3KSCA 1OFNA 3FE5A 4IEQA 1FD9A 3HWJA 3DN7A 5DMYA 4DV4O 2Z4FA 4QE7A 1XOYA 3BFRA 1OD3A 1O4ZA 3H9VA 3JYCA 1CX1A 3POEA 4LK7A 2Y69B 3K5MA 1VRH2 4XJ9A 2HJIA 4IEUA 2ZE6A 4QIWF 1DU3D 4HVOA 4L9BA 1HB3A 1FFXB 1RUC2 4DUZB 3WZ1A 2JX9A 1KMIZ 2WO3A 4RA0A 3AYDA 5JQGA 4ZI7A 3WEZA 2OPWA 4EEQA 4FT8A 1A8MA 2UU9O 4DY5A 4XFCA 2AYHA 2WL1A 4XUOA 4LO6B 2YROA 1ZZ9A 3NQHA 1RUF1 5EBLC 5FYHA 4JPRA 2GMEA 5FY5A 4UF0B 2YICA 4S2FA 1YTFD 1DYOA 5FZOA 1BMFG 5KHIA 1RITA 4H14A 4YZ1A 1Z5VA 3G6JB 5A6QA 2ZXWC 1QJX3 2KR2A 2W39A 2WYSA 4OHYA 5FJKA 5IY5C 1FYUA 2GSYA 4CUGA 1HQWA 2FMDA 3ASIA 5L9VA 2P6JA 1BBT2 1BL8A 1QR9A 5JI7A 1RTVA 1KQRA 1RUNA 2A7WA 2RS32 4IETA 4JAVA 4E27A 2RN9A 4P9PA 1GTOA 4Q0PA 1JJOA 1ULOA 4M3CF 2VW2A 4UCVA 3K03A 5CFDA 1HB1A 3DXRA 4D7YA 3M3QA 4F7ZA 3M70A 4LIUA 1TME3 3ST7A 3CEIA 1XQ8A 3DF0A 2PLV1 5DM6V 5IATA 5JXJA 2GHYA 4OI0A 1DQ1A 1Y9GA 1K4DC 3OBAA 3ZS8C 1COV1 3POSA 3JUUA 5LBFA 1HNWB 2W94A 3EVKA 4TWKA 3S6PA 2DVGA 4ZZ5A 1SZXA 2ZX1A 4BCUA 3RZJA 4XCBA 1YHQV 5AVAA 1UKRA 2XWBB 3ACIA 3BTYA 1AB3A 4LO7A 3WF2A 4LBQD 4L97A 1JYCA 4DV3O 4OMCA 5A7PA 5BNPA 3HR0A 1LR1A 3APBA 1BVVA 5CA0B 2A9HA 2Z79A 2GNBA 5CKQA 1SLTA 3SGIA 4W4ZA 3POFA 2PHWA 4QKBA 3KD4A 3K3WA 1UO9A 3BUCA 1VBC3 1IS6A 3F5WC 5HXMA 4HN1A 2R30A 2HWE2 1A78A 1WGPA 4JF3A 1UXZA 2GUZA 1ZUQA 2BVBA 2V4AA 2IFRA 1Z2GA 4QB1A 2B39A 3VZJA 3ILFA 4I0AA 4LLFA 4M00A 5BYNA 2ZEWA 4O4IA 4JI1B 2LRPA 1W9WA 4B1MA 4FCAA 1XE8A 5K9YA 2HHHB 1NS1A 2HWD3 2R071 3OGIB 2A3XA 4UB8Z 1Q81W 3MICA 1I08A 2E6VA 2F93B 1IX9A 5A6XA 4J10A 5ABJB 3C7EA 3L9DA 5BZBA 4B7KA 4JQRA 2YUEA 4MVTA 3RBZA 3ME2A 3E6DA 2EBOA 2RS53 1IBLO 4DXZA 1S2EA 1YQ2A 2XJVA 1XMOB 3W7UA 4NVPA 3HIFA 5JZGC 1CAVA 5HCAA 1V6LA 5C7GA 4XFFA 2ATFA 1ZRDA 1OUSA 1SBEA 5CEHA 1X82A 3E97A 5FL7G 3AP4A 1FOD3 1D7PM 2YHJA 1JUHA 5A80A 5KX5B 2ZGQA 3ABLC 1DQ2A 1WLCA 3LSEA 5K0UC 1H8VA 3O1PA 4DV7B 4RQPB 1HNZB 5IE9A 3HAGA 1VRH3 3ZEDA 4O2BB 2A6ZA 2BVVA 3N4MA 3TXSA 1H8TC 1S1AA 4AEJA 2YBKA 5CBFA 4XOGA 1NR7A 4QQPA 4PA6A 1RUJ3 1FFTB 3K2OA 4KL1A 3B00A 3I2FA 5LP6C 3HD8B 3OGRA 5CYYA 1QIQA 3F95A 3GF6A 1G4YB 1NE4A 3TNQA 1FV2A 1EUUA 5CFDC 2HBUA 1Q8IA 4XAAA 4HXCA 4LO4B 3CB2A 3K58A 2XH6A 2HHHO 3M2MA 1DGLA 1K5MC 1JHJA 3E1F1 2JENA 5J2TB 3EXUA 5FOJB 3OCPA 5DDJ2 3RYPA 2Q7EA 1PNGA 2E26A 4K20A 3MW4A 4OHZA 5FK8A 4ATFA 5FZ8A 1GZWB 1YHFA 2JE8A 1VF5B 2XQRA 5JCOA 3ROUA 5IK7A 4ABMA 3POBA 4GWIA 4XBQA 3J8F1 3ABKB 5IVBA 3JCUZ 3PIJA 4H44B 2AHZA 5GTHZ 2QZ2A 1B04A 3AG4C 4V2WA 5JUVA 4XYXA 2XLFA 4HOOA 1GV9A 5KMGB 4C7UA 1OQ1A 4MTFA 4D0QA 1GP6A 3BN6A 1KKCA 2KSDA 4FPEA 2UUBB 2BTVC 5LB6A 1FJGB 1K9MW 4RUEA 4ZHQB 4DV6B 3MYXA 2W0XA 1QKQA 3D36A 1CAXB 4FPCA 5D5PA 3OOXA 4NPMA 1IGOA 5EYYA 4AF9A 3GNEA 4GMP3 2EINB 3EXAA 4P9GA 4HK9A 1FOD2 2EILC 1IPSA 1VBD3 4E2SA 4EB6A 3ZOIA 1VALA 3R66A 4CC6A 2WAAA 4Y1XA 4X66O 3NV3A 1D4M2 3GHNA 4W4LA 5FQ0B 4QHOA 1OA4A 4GT1A 2QBXA 3VKNA 1RB8G 1E57A 4RHV3 1X4TA 2EXKA 4WFAV 1VBC2 2WYFA 1XNQB 3QO8A 1JZ8A 3BTZA 1VARA 4E4EA 3CJHA 4FPJA 2OCCC 4QQOA 2I45A 1Q6HA 3EYPA 3SH5A 4JI6O 1VJ2A 3LCPA 1GZWA 2A6YA 4BMBA 5LHIA 2VW1A 1GM8A 3CCEV 4MGYE 1GZ9A 1YDXA 3E8FA 4XXAA 5A1FA 1L8DA 5FZDA 2VW0A 5F2VO 3ZFFC 1RUJ1 2VNVA 3L74H 3AKQA 3CL1A 1RUOA 5JCOC 1XUQA 4HAMA 3G4SV 3PVNA 2D97A 1WA8B 3NRUA 2ZIMA 3JAWB 1RINA 1GM7A 3THDA 3IPVA 1DG6A 1VP6A 1W6NB 4LWSA 1U5ZA 5FPVA 5IVFA 4DRXB 2HG5C 2QDRA 1WJZA 3OGGA 4BHPA 3SHRA 5GONA 3HPNA 5GJ6A 1CESA 2BV4A 3HB3B 3FL7A 4CEWA 5J37A 2R0HA 5B1BC 5JZGA 5A7NA 1POV3 1AR63 4M3CB 4DV4B 5F37A 1E1QG 1DBNA 5LBQA 2Z5UA 3FLTA 4V1PA 3HQXA 2ZX4A 4WM8A 3MUY1 1O9HA 3S30A 1HX6A 2E32A 4W6XA 1SPPB 4DUVA 3MIDA 3HT1A 1LOGA 4CU9A 1QQP1 1L1FA 1JZ3A 3JBG3 3IKWA 3TNPB 3U11A 4QKDA 3FFZA 1K92A 5EYXA 1KP3A 5T5OA 5FP7A 1WBFA 5KHGA 1BEV2 2WIIB 3SPGA 2RS12 3PIGA 2ZHNA 4Q0VA 4OI4A 3L9JT 3MDPA 4NIIA 3JD1A 2CY6A 3RJRA 4MHUA 3VV1A 3ENRA 4OX9O 4H0LB 3ZFGA 1WMEA 4Z8BA 4UVAA 5FUPA 1EN4A 4FJCC 4CVUA 4DR5B 1GRJA 4MYEA 2A3YA 5FXXA 3MIEA 2Y0IA 2D6PA 4UI9L 3PHMA 4GMP1 4QGNA 1QH7A 2X53S 2UUCO 3E35A 3I55V 4UW4A 1MZ5A 1IBMO 3ZN0A 5H9SA 5K7PA 1EPZA 3OD4A 1CZVA 1Z7S3 1Q8OA 4LBQA 4R8HA 4I02A 5LA9A 4Q4X3 1QHDA 1X7NA 4QE9A 4LHSA 4DR3O 2R042 2DUQA 4IHJB 4BU2A 1ZRCA 1VQPV 4LO8A 2OZJA 1F7YA 3B01A 3PU8A 3I2HA 1J84A 4U36A 5ANQA 3J26N 2GC0A 4BISA 1BBT1 4F3JA 2AGAA 2OT7A 4CCMA 2OIGA 4E2LA 4PT6A 4HVQA 3ABUA 1XILA 3VZMA 2IZWA 1WUVA 1SFYA 2VBBA 1F4NA 4AVSA 2F4PA 3OB8A 2BU9A 2BFUL 1DTOA 3JATB 4DW1A 4Q4W3 1KITA 3ZVXA 1D4VB 3JD73 4R9AA 3WNMA 2BOJA 1FPOA 2BE3A 3OBZA 2XLGA 2K9PA 2X5IC 2MEV2 4HYOA 2UXBO 1WLWA 3KQRA 2WS91 2WLJA 3PN1A 2RJKA 4DZGA 2DU0A 1EUTA 3N9MA 4UVBA 3USUA 5JH7A 2BTQB 1U5YA 2BP6A 4ASMB 4P5YA 1D4M3 1H2SB 2WZR2 1DDLA 2JDHA 3CCSV 1OCCC 1Q8QA 2JDPA 3THTA 4ZBMA 4RGAA 1F9KA 2IWGB 4V2VA 2ZGTA 5BNOB 4E4HA 2AW9A 3ZN6A 4O2AB 1TNFA 4NWVA 1AJPA 1ULGA 5EV7A 3CC2V 2BTQA 4X1IB 1GLHA 3VD4A 3I97A 1OT5A 1GUIA 3U14A 1RUF3 4A41A 3CJXA 1DQ4A 2CU5A 1THZA 4IV1A 2PLV2 4CDWA 5JOWA 2FZ2A 1UYYA 4PD4F 4JI2B 4BAYA 2VWKA 4BIOA 4H7MA 4JZRA 1YJLA 4XJUA 4YW7A 2B5UA 3S5QA 3OE7G 3OD0A 1W0JG 2KKWA 4R8CA 3LD8A 4QMAA 4JI6B 2X0LA 2VUAA 1LTEA 1C1LA 2D2CB 5JXIA 2UU9B 1MS8A 2HWD2 4WBBA 1TMF1 3ABMC 4LC1A 2DYRC 1HW7A 4I0BA 4R7CA 5KUKA 1RHI2 3ZIWA 4LH6A 5FZLA 4K1YA 3FBMA 2DYSC 3K57A 2NLRA 4FQZA 1LEDA 5JDBA 3K0GA 2VQEB 1B35B 1OVPA 1VAVA 4YZ4A 5DG1A 1V55C 3B77A 3KM5A 5FMCA 5HI0A 3Q8BA 1VF7A 5HFMA 4AW7A 4XF0A 2W91A 2JE7A 1JOPA 3OM3B 3FB8C 4OYUA 4BXSV 1YLLA 3FAVA 5BNOC 2UYBA 3TN91 1TME1 3ZJZA 3GYDA 4NJ4A 2F4VB 2AACA 3NJYA 5E8AA 4NRMA 5L7OA 4K3AA 3BYWA 1Z7S1 4GWNA 2ZINA 1GKBA 5FPAA 2EXHA 2XWJB 2VNRA 3A0KA 3AMPA 4OLLA 5CB4B 2ZM6B 3FX7A 4RFT0 3IMMA 2UXCB 2LP7A 2IXJA 3FLRA 2WAOA 1BHAA 2MEV3 5F5IA 1XXNA 4ZHQA 2VZUA 4U2AA 5K1PA 4E9KA 2BOBC 5GZGA 2DUOA 4NKGB 1IBLB 4LUMA 1JYTA 3ON7A 2VH9A 3BCWA 5FYZA 2LQTA 4LF6B 2XTAA 4YLZA 1RL3A 1LU1A 4GB31 3AC0A 4UBGA 1G9DA 1JU3A 5FYIA 4IE5A 5CU1A 4COUA 4RS5C 2FDFA 1IQAA 5FDBA 1QWRA 4D7TA 1R1ZA 3U75A 5H9CA 2VUJA 5LOVB 3ZYGA 3T0BA 4INDA 1SEFA 1F4HA 4LE3A 4B4RA 3PJSK 4JGZC 1V54C 2ZGOA 3PNAA 4AGVA 2DYCA 5IK4A 3BOWA 5KXEA 4LKEA 2W1WA 1S76D 3I5DA 2YI8A 5FRAA 1YXBA 1IBKB 4LF5B 3M3IA 4ZS2A 1NA1A 3WW4A 1DLCA 3FD9A 3AG1B 4JAAA 3GJAA 2VCAA 2JGUA 4FFBB 1PX3A 1ORQC 4X8PA 5T5PA 1J5EB 1W8NA 1XU1A 3WINE 1N34O 5GZFA 1K3IA 2GDSA 3I7DA 3M7MX 5BY1A 1RUH3 4RD7A 5CFCA 2F66C 4YG6A 3N9QA 1WB8A 4IERA 2PI5A 2OYZA 1WP8A 4K8FA 3CE2A 1U96A 1S0VA 4O4HB 1I94O 4KH9A 1G9CA 2C9KA 2K2SA 1W6QB 3B93A 4PCRA 1SLIA 3LOBA 2XG3A 4LE4A 3NSTA 4X62O 5CMUA 5BNNA 4IYIA 5EK0A 3H7YA 1P84F 2P3JA 2Q0AA 1KD7A 3ZSKA 1PO23 1OA2A 3DL3A 1COWG 3ZXKA 2AENA 4NXNO 4JVAA 1DHKB 1U5IA 3CCJV 1J95A 2DUPA 4OGQB 3WDWA 2Y4UA 1R3LC 2XAHA 1XREA 5F8PA 5EQUA 2V7QG 1NZIA 1ZA7A 3TEXA 1N0JA 1GFF2 4NIDA 5JH7B 2RVAA 3RS6A 2YC4A 1CONA 2UU8A 3U07A 4CUBA 1OKQA 3V65A 4O9EA 2PLV3 4K8RB 5IWFA 2W3JA 2QWRB 2ZD9A 3Q8CA 4HLTA 2QWQB 3H01A 4FLTA 3RI9A 3JU9A 2EIGA 3POWA 4B8EA 1QLNA 4UF0A 1BYHA 2WWUA 5IWAO 5KXBA 4LF6O 1S4CA 1NX9A 1WKYA 4UW3A 1B09A 2WA4A 3K06A 3I2OA 2R9AA 5I0SA 3UQ8A 3C3TA 3B3QE 1W9TA 4CUAA 4K1ZA 2VZSA 4ASLA 5C71A 2ZNJA 4EJRA 2Y64A 3NVCA 4LITA 4IEWA 1R081 4JYCA 3U4XA 3ZRVA 1KKDA 4IV1B 1OH3A 1D5NA 2OCCB 4MVUA 1E5RA 4JHTA 4P00B 2KM2A 4I30A 4FQ4A 1UIJA 3BA9A 3LSQA 4JGYB 4QXKA 4Q4V3 1LU2A 1ULCA 1OF3A 2X6BA 4HETA 3CC7V 4IEZA 4FO9A 1HR0B 3L70H 1OLQA 1Y43B 2UUAO 2ZE5A 3KHCA 3OPWA 5LYJB 2PYJA 3JAWA 4JV5O 4QT6A 4PDRA 1DYPA 4FTBA 3BEHA 5C3SA 5J36A 1IHMA 2HKOA 3CRAA 4LR4A 2JJ1G 2C0ZA 4BIUA 4M4RA 5L3FA 1ZVFA 2BOCC 2KG7A 5D8AB 1RUC3 5LA1A 2A3WA 1NY72 2Q68A 3NV2A 1N33O 3O1RA 4E2GA 1JOJA 2LROA 4Z1VA 5DECA 1PMHX 3RSJA 3RZZA 1ZM1A 1L7RA 1URXA 2WC2A 2HWE1 2BPA2 1LECA 4GUNA 2K0GA 2GUZB 5KX5A 4QPJA 2QQIA 4AWDA 4AG4A 2R072 5A3PA 2YU1A 4AEDA 3ETGA 1OCOB 3OPZA 4GX0A 3AZZA 4FLVA 1W8ZA 2C6SA 5FREA 3P5BA 4CPBD 3JBG2 2WN3A 4AVVA 4E4DX 4Y4RA 4GIQA 3KGLA 4FK5C 3RYHA 2RM23 2R7EB 4JYAO 5FV3A 2JIGA 1LKNA 2RS13 1UY4A 4EN7B 2VGDA 1ND3B 3AM2A 4FPHA 3HJRA 2WLKA 3VBBA 3JARA 3K75B 4XMIA 2X6CA 3I4IA 2E5LB 3LSDA 4Y5Z0 1M4UA 3PUIA 5C8CB 1JYWA 2DJVA 3FFQA 1VBE1 4AAPA 1UAIA 4X20B 3VD7A 2WLNA 2X7RB 1KDKA 3CPWU 1VMFA 2PMWB 4CDXC 2ZMKA 1CAWA 1RHI1 2PTMA 2YBSA 3T1MA 2R062 4EWDA 4XXPA 4PJYA 4X64B 4NIHA 1YFUA 3MZHA 4JX0A 2L9LA 3M99B 3T1CA 1RJ8A 1TE1B 4YWAA 1SKVA 4LOTA 3CCLV 3ELNA 3ABLB 3SISA 1OHFA 4FM0A 5K0UB 3SPJA 5KMGA 2XJQA 4YGBA 4QXCA 2JKBA 1ZYBA 5FZ7A 4XJAA 1PZ7A 3WG4A 1VBB3 3QF7A 4DEQA 3JSNA 4UWDA 4XBNA 2BW8A 3RWRD 1AYN3 3VBSB 1IBMB 1PGL2 5L19A 1W99A 2WT2A 2PHTA 4BPZA 1FATA 5BNNB 4KWLA 5FXZA 2JG8A 2EXJA 1SZTA 5T50A 2AR6A 2DTYA 3POYA 2XBO2 1R64A 2XVGA 3FHIB 4MTOA 2VZQA 1W0PA 4G9SB 1M5IA 2GP3A 2WLIA 1RJ7A 3T3YA 3B7MA 2A6WA 2IW5A 4BLJA 3OPTA 4MTGA 2Q0OC 5D5QA 3ACFA 2XVKA 3AZYA 1OI6A 3F5TA 1QR8A 5FPXA 3M8LA 3GWOA 4O4LA 2HWE3 4MSWC 3ZYBA 1O3RA 2YC0A 5I0UA 2WNOA 3GBFA 3WHTA 1AR83 5FMDA 1NTMH 3E6CC 5LXTA 4FLWA 5CN0A 5B5EZ 3JD71 4W4KA 3JQWA 2XJTA 1Q8SA 2CAVA 2JVDA 2UWAA 4KGGA 4CXYA 2OYQA 2E5LO 5FO7B 2VZ3A 3FWEA 2E75B 1I5YA 1NJIW 2D3SA 1M06G 4ZHNA 3EMRA 1OPMA 2DW4A 2HYKA 2VOWA 4ATEA 4ZI7B 1DYKA 1DZRA 2RS52 4ZZ8A 1JFFA 5FZKA 3NR7A 1ZZ6A 1V9U1 1SG3A 2ZE7A 4Z2WA 1I5ZA 3JD2A 2RJZA 5A7OA 4BQWA 1YFXA 2ZGNA 4FZ0A 3VQXA 3K0DA 3ZSMA 3ZYPA 3I3MA 4FPPA 2H8PC 1GP5A 5FY1A 4ZKIA 3WY6A 5H6RA 1H6XA 2BQPA 1YI7A 2OCHA 3RZMA 5FYTA 3FLPA 2PUSA 3SMHA 1Q3EA 5H5NA 2PZSA 3GVMA 3SC7X 1FMD3 5A1AA 2DBNA 2HEVF 4WM8C 2DQ0A 1VQOV 2OPKA 3WUDA 4AFMA 1QGLA 4DEVA 3EJKA 1YQ5A 2FBEA 1UU6A 3CZJA 2WFF1 5D8AA 2GTAA 2ILMA 2OXBA 1NVPD 1J3PA 1WLTA 4Y1VA 2HWC3 3KVBA 3IGAC 1H8TB 1IS3A 2BZDA 1AR91 5A3NA 3UESA 3USUB 2MHFA 4DUZO 3J8F3 3LSSA 5A32B 1NTKH 4JTOA 2OS2A 3OR6C 2VS0A 1LRHA 5CA3A 3MW2A 3VBOC 2WZ8A 4ZU4A 2RDCA 3S3XA 5CFCC 3RMXA 1EFRG 4YJ2A 1KYOF 3ZSEA 3NL1A 3N7MA 3NNGA 4LJHA 2IJIA 2VZOA 4W50A 1M57C 1JI6A 3CJIB 4DOUA 3W20A 2QKSA 3TN93 1TNRA 1JMKC 3OEEG 1UOBA 3BTXA 1OCZB 4OUMA 4NXMO 1VBA2 1S5JA 4P14A 4LBQB 4Y20B 1OCZC 2XAFA 2JE9A 2FCVA 5J7MA 5FY9A 4YFWA 2ODMA 4AAXA 4R9CA 2JGDB 2EILB 4WFGA 4CCNA 4DR1B 1ZBA1 4TT3G 1JZ4A 1QCEA 1U12A 4URAA 2BYVE 5E88A 1MQTB 2HWB2 2XOKG 4MGSA 5DAQA 1AYM1 3KT4A 4DRRA 3AMNA 4PDWC 3VBSC 2P3KA 3ZRWA 4DIQA 3GBGA 5B1AB 2AH2A 1SDDB 4R9DA 4BQ1A 4H33A 5AFBA 4J6GA 2YC2A 1OH4A 2Y34A 1MSWD 1NLRA 2H6CA 1HXS2 2P5BA 2IXCA 1O3QA 1HN1A 1Y67A 2I2SA 5L3CA 1ZL8B 1V00A 3W7SA 4NMIA 1D4M1 4WM8B 1V6IA 3EB7A 1BGYH 2YEVA 1J83A 2VD7A 2IH1C 5JXHA 3I49A 4J42A 4UB6Z 4LWSB 4IGOA 3IAQA 1O4YA 5FPRA 1WP7A 1IXMA 2WWWA 3U78A 2ARAA 1QMJA 1SBFA 2IXLA 2CTWA 4XW3A 3RMYA 2VZVA 2IJHA 2EVXA 4MGKE 1O4TA 4MH0E 2ZMNA 4NRPA 5T55A 2CK3G 1HDKA 2W1UA 4KQ7A 4NYKA 2YPJA 3TOJA 4NWWA 1HRV2 1LHUA 3IAPA 4RQFA 3WOGA 4HPKA 4ZY9A 5JQGB 3LEKA 2ETEA 1CPMA 2IH3C 1POV1 3UM7A 5CA0A 4GMP0 1XMOO 2HWC1 4JI7B 4D3WA 2D5HA 3Q9OA 4JC1A 2NR5A 2WFF2 1RVF2 1G9FA 1QJY1 4LFBB 1NLQA 1SQQH 3SKVA 4LBLA 5JIUA 1PL4A 1R6KA 1QQP3 1VQ8V 4JKMA 1LUVA 5IVJA 4XHXA 1CR7A 4JAUA 3MV01 4JGSA 2PY5A 3FMGA 5BNPC 1R1A1 2H94A 1PL0A 4J9ZB 2WNVA 4MW3A 2VQFB 4N43A 4S2HA 1C8M1 3DKQA 2P17A 1H2NA 2R1DA 1RM1B 1LODA 3WG7B 4META 4N7IA 4RGKA 3LPGA 1FAFA 4Z92B 1GBGA 1JUIA 1JTZX 1NUKA 3H0OA 4OI1A 2FDKA 1PGSA 5FLIA 3J7NA 4JGZB 4XF3A 2BGCA 5G04L 3W7WA 2ADDA 2MEV1 4GLXA 3TRSB 3SPIA 4Q5OA 3L2HA 4UBHA 3O1UA 4KFMA 2QM4A 4CCLA 2P7TC 2YYOA 1W6QA 2UXXA 3T0AA 3JASA 2Q5TA 3B2EE 5JPNB 1NCQB 2RS31 3W58A 4FIPC 1KGYA 1AR92 4YGCA 1TUBA 4DR5O 1KECA 1W2AX 5I8YA 3H1WA 2EIDA 1B3QA 1BK1A 3MF9A 2VL4A 5KBFA 5CZKA 4NE9A 1WA8A 4JASA 5A3TA 5LBEA 2BJSA 3CS5A 2QQKA 4LFBO 2Z5WA 2IC1A 4RL7A 5ERLA 5AC91 3W5MA 4IUGA 2R70A 1WW4A 2OTJV 2WFPA 4XFIA 1BHBA 2JRIA 4XF9A 1UMIA 3VHNA 4EWAA 2DOSA 4PLOA 3K77A 2IU3A 3ETDA 1YNAA 3IZOA 5TSWA 4YVWC 1W8UA 3ZMZA 2Q8CA 3GBWA 4Q4Y2 2HBTA 4UFZA 2CHHA 1QXJA 5F5QA 5FZMA 2P3IA 2PAMA 4FP3A 4HKLA 3SCFA 1MPXA 3KCXA 4DV0B 3Q8AA 1KP2A 1RIRA 1WD3A 3DEMA 4K3UA 5LGTA 3NKTA 4IV3B 1L0LH 2ADEA 3WQBA 4CDUA 2VMFA 1GQPA 2GV9A 1JHNA 4JDOA 1PM7A 4TV9A 2VQUA 4JYAB 1DGRA 3MV11 4RN5A 4R4ZA 3KV5A 2Y48A 4N43C 1IDSA 2R9RB 3K46A 2YU2A 1KQSU 2P22C 2ERFA 4CDQA 4ZIBA 1LAJA 2EIKC 5E6HA 4XACA 5E1RA 3OGCC 3B9CA 3SYCA 3VLBB 4ZOLA 1JPXA 1OVSA 1TQ5A 2JD9A 2XL7A 1STMA 5JAXA 2W0FC 1N3QA 5A3UA 4A2UA 1R6TA 3H1LH 1PP9H 3W9AA 1AJNA 1O3TA 1DQ0A 1MQTA 3POIA 2Q8OA 3VBUB 1UY0A 2A75A 1AI6A 4ES9A 1H38A 4Q1RA 4DB5A 5C6CA 3I54A 3K4AA 1K45A 1N3OA 4YXWG 2AGSA 4BWAA 2KD7A 2ZNIA 1W2NA 1XDCA 1R093 1R1A2 1SFPA 4FP2A 4IGPA 5IJRA 4EZHA 3HT2A 3CJIA 4KI5M 2VNGA 4B29A 3LOIA 3UGGA 1RUF2 5DUXA 5APAA 1ND3A 1HV1A 2WSUA 4PQ9A 4WFBV 2KXLA 3VBHB 2QWOB 2DDUA 5BNNC 3ZCCA 5GLZA 1LNQA 5KUMA 3CKHA 3PLQA 1PIV2 1WMXA 1HR0O 5IJ0A 2V5DA 5F5AA 5I93A 1VQ7V 4IE7A 1LJ7A 4KWJA 5IAXA 3G6BA 2CGNA 2UUBO 1Y76B 1D0HA 4PF1A 5IAVA 2PA7A 3NNFA 2D3OW 5ACA1 4AVAA 4QU2A 1SS3A 2XGXA 1RVF3 2YSUB 2ARHA 4J7KA 4R52A 2EIKB 1TG7A 1EM1A 3C7GA 3NAPA 4Q20A 1JOYA 4LORA 1HJFA 4GYCB 4I7ZB 1EPWA 2WN2A 2BERA 2YZ4A 3WW2A 1GN3A 4A42A 3CWBH 1VBC1 4CH6A 2E33A 4ES8A 2CTRA 2LW7A 2QKDA 2AHYA 4JTNA 2P1BA 4GKXA 2VVDA 5CNAA 1MZEA 3JAKA 2DVFA 4ZONA 3BRCA 4Q4V1 1QLEB 3BAAA 5FPZA 1AR71 4XEZA 5FZHA 4A5UB 2ADPA 3K5OA 3ZN6B 4XFAA 3LQCA 1XL4A 4U7OA 3IN9A 5LP6A 1COV2 4IL6Z 4MTXA 1O3SA 3WXPA 3BGAA 4MG2A 4I2OA 1S0EA 2Q1MA 4G28B 2PYLA 1PK6C 4AQYO 1VBD2 2DMXA 4Y20A 4K35A 3ABTA 1ZLZA 1M1KW 4MHRA 4CEYC 2NQYA 3ZN5A 3C90A 4AI3A 2ET1A 5ITZA 2ZHLA 3RPQA 1KC8W 5FP8A 1Q8PA 1XPWA 2WKKA 3VKLA 5EIBD 1E5IA 1GOHA 4HNAA 2ZR2A 2J1RA 4AQ6A 3O1TA 3O0VA 1YJNV 1F8VA 3I8TA 1AI5A 1NH2D 3F7YC 2HWF1 1AR1B 5T3NA 1CPNA 1V6JA 1C8M2 5BMVB 1WW5A 3VBHA 2F1MA 2WO7A 2QQJA 4W6WA 5FZEA 4MGIE 1ST8A 1YI2V 3ZBHA 1DGSA 2QTSA 5IJ9B 1JS9A 1GH6A 3LF7A 4AYUA 2ZE8A 4XUQA 3M7AA 3I56V 1N32B 3IM0A 2LUWA 2A5ZA 3IIAA 1OZ0A 3B69A 3WB1A 2DYRB 1PM9A 4C0BA 1XSRA 3ZM8A 4Q4Y3 2EZPA 4NHXA 4L8JA 5F1RA 3RWNA 4DV7O 4UCSA 3Q8EA 4H2AA 3OSDA 4QM8A 1NTZH 3RYIB 5GW7A 2ZX0A 1BEV1 1S0DA 4JI3B 5DUVA 3AP5A 4K8ZA 2YIAA 5I91A 3ZIXA 1KS4A 3NXSA 1ENRA 2G19A 4MGTA 5IY5B 2E63A
chains in the Genus database with same CATH topology
1NY71 2DVAA 3OF1A 1NA1C 4LA2A 4TYSA 2VNOA 3B01A 1IKPA 3LA2A 1K5MA 4U36A 1CAUA 3J26N 4KBBA 1V6KA 1QJZA 2GC0A 3H9AA 1BBT1 4F3JA 1APNA 1DQ5A 4FAHA 4OUSA 3ZYIB 4M2CA 4HVQA 3AP7A 2ZABA 2V5YA 2KA3A 3VZMA 3V56A 2IZWA 1WUVA 1SFYA 4XILA 3VBSA 1CGPA 4AVSA 2F4PA 3AYAA 3I59B 4OVEA 4Y1UA 2BFUL 5JMCA 2E51A 3VL8A 4Q4W3 1KITA 3ZVXA 1D4VB 3JD73 4R9AA 4BE3A 2OIIA 2CV6A 5JSRA 1Y7BA 4WVMA 4XTPA 1XQNA 4IV1C 3ZO0B 4CDUC 2XLGA 5CFCB 2X5IC 2ZX2A 2MEV2 3KQRA 1WLWA 2WS91 4RR3C 4AEDB 5FO8B 1EY2A 2OW4A 2RJKA 1SQ4A 2DU0A 2LM3A 2ZGPA 3TAYA 2YDEA 1COV3 1FX5A 4DZGA 1ND2B 1RUG1 2UWBA 1UU4A 4IV3A 3USUA 4AHXA 1U5YA 4PBOA 4ASMB 1WMFA 1ZBA2 3OTFA 2DCKA 1SDWA 4CEWB 1D4M3 2WZR2 4XFHA 1HQNA 4EN9B 1DDLA 4WZFA 2D6NA 2WWSA 1UF2C 1Q8QA 5K0UA 3THTA 4FAGA 1J59A 3WG2A 1WCDJ 4IL7A 1AZDA 4CDWB 3N7KA 2W08A 2R6QA 4RGAA 2JG9B 1F9KA 1AR93 1RUJ2 1RUE3 3L2YA 4HVRA 4OHXA 1VBB1 2IWGB 4RHV2 2ZGTA 3C2UA 5BNOB 1ZBE2 4Y22B 1V70A 4JGYC 2ZS6B 2TEPA 3ZN6A 2GNMA 1TNFA 4NWVA 5BNQA 4Y1YA 1Q5OA 1ULGA 4I0WB 1CAVB 5CG8A 2ZGMA 5EV7A 4FPKA 2PFWA 4P9JA 5DZEA 3WP4A 3PVOA 1GLHA 2E7TA 1YIFA 2JXAA 2WT1A 1EAH2 1PVXA 2DV9A 1RUF3 2BWAA 1VBD1 3CJXA 1DQ4A 2VG9A 2VULA 5J98B 2A6XA 3WCSA 2PHFA 1B35A 1RUH1 4ZXKA 1OA3A 4A7YA 3PMSA 5LRRA 1DLLA 3OBTA 4IV1A 4H7LA 3RQ0A 2PLV2 4CDWA 1ULDA 5JOWA 1FMD2 2FZ2A 1UW8A 2ZX3A 3JBG1 1RUD1 3QLQA 4FBFA 4BG1A 4BIOA 4H7MA 1YJLA 4XJUA 4CP2A 3OD0A 3WG1A 3PVEA 1QF3A 2D3PA 4QMAA 1VBA3 1N3PA 2SLIA 3FC0A 5FO9B 2VUAA 1LTEA 3U10A 1I3HA 2UYAA 4CRQA 1C1LA 1S0JA 3WLUA 4N53A 4YW5A 1MS8A 1N1VA 2HWD2 4WBBA 1TMF1 1LENA 1RUG2 1G7YA 3AX4A 4HSJA 4I0BA 1R091 1RHI2 3ZIWA 4Q27A 4K1YA 1EV11 5A32A 3FBMA 3WP3A 3V15A 2NLRA 4FQZA 2GMMA 1LEDA 5JDBA 4LULA 2HWF2 1QNWA 3QH7A 4YG0A 1B35B 4QQHA 4B4PA 1G9BA 4E2QA 3WG3A 4FFAA 1VAVA 4YZ4A 4AI1A 5DG1A 3KM5A 5KHHA 5HI0A 4RR3B 2ZAHA 2RR13 2GH8A 5EFUA 1QH6A 2AUYA 4AW7A 1FT9A 2CWSA 2ZACA 3AFGA 2ZBJA 4KG0A 4XF0A 4A7ZA 2JE7A 4LHLA 4WVWA 4FTSA 5IUQA 1J3RA 5JIAA 1AXKA 1LEMA 4LA3A 4R9BA 4CZSA 1YLLA 3LWCA 5BNOC 2A71A 4WV8A 4JRAA 3ZYJB 2WQZC 1LOAA 2UYBA 1PO12 3TN91 1TME1 1N47A 2JG8B 1FOD1 3MEPA 3UKTA 3H3ZA 3GYDA 5E8AA 2WSVA 5H9PA 1KJRA 5L7OA 1AR62 1Z7S1 1PIV1 4GWNA 5GLWA 1GNZA 1GKBA 2EXHA 2Q4SA 2XWJB 3JQXA 2VNRA 3A0KA 3AMPA 4OLLA 4XFBA 1LGNA 3B9IA 4RFT0 3NO8A 1LULA 5J96B 2IXJA 3FLRA 5C33A 4WM7C 3V0AA 2MEV3 1XXNA 1LHWA 2BNOA 3ZFGC 1RGSA 4U2AA 4B4QA 4E9KA 3D82<