1H2MA

Factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
335
structure length
332
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor (Hif) Reveals Mechanism of Oxidative Modification of Hif-1Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription activator/inhibitor
molecule keywords FACTOR INHIBITING HIF1
total genus 105
structure length 332
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1h2mA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1h2mA01
4JAAA 2Y0IA 3KCXA 4B7EA 1IZ3A 2WA3A 1H2LA 2YDEA 2YC0A 4BIOA 2CGNA 5JWPA 2CGOA 2XUMA 2ILMA 3KCYA 2WA4A 3D8CA 4Z1VA 1H2KA 3OD4A 1H2MA 4B7KA 2W0XA 1MZEA 3P3PA 4NR1A 4AI8A 3P3NA 1H2NA 1YCIA 4QU2A 4Z2WA 1MZFA
chains in the Genus database with same CATH superfamily
3K5OA 1CAVA 3UKVA 5DDJ2 3VBRC 1VAVA 5FFOC 4KQ7A 1SA0A 3ABKC 1YEWA 1EN4A 1GNZA 3VQVA 2DQ3A 2W87A 4PELA 1NQTA 3MV11 2BOIA 3H1IH 1TQ5A 1EV13 4TXWA 1CZVA 5BMVB 2V4DA 1COV2 3FB8C 2ZIMA 5GLUA 2VMCA 5FWEA 4HXCA 1YZBA 3KGZA 4LKSA 1UKGA 3JD2A 2P37A 4UFZA 2XAFA 2IXHA 1AB3A 4K35A 5L7OB 4JI7O 3DCQA 5DG2A 4Y3OA 4I3GA 1OCOB 3MAQA 1FXKA 1RUI1 5C9AA 5LP6C 5FOBB 3GXUA 3LPFA 4EE2A 4IE5A 1DYPA 3LE0A 1AYM3 1H9PA 3WDUA 3OGJA 4BW9A 4BXFA 2IWGB 2RDSA 5BNOA 3FFZA 3I3DA 3N2KB 2PHRA 4X1KB 1SLCA 2F4VB 2HKOA 3KCYA 4U36A 3HKEB 3KMHA 2DQ0A 2CAVA 1LRHA 4DRXB 1K3EA 4XUNA 4QE9A 1O5UA 4LQRA 4U3JB 4XACA 2BOBC 3A23A 5D8AC 4NYKA 3AK3A 2OUHA 3H1HH 3JD3A 4ZY9A 4LHSA 2D6MA 2JIGA 4MHUA 5FPBA 3PDQA 3PURA 5JSPA 2F1MA 4YFZA 5CA1B 3G4SV 1WB8A 3L72H 4LR4A 3AYAA 2EXKA 3VZJA 4C0HA 1YLLA 1V6MA 5BXZA 1OFNA 1W8UA 2ORZA 1OPOA 2P06A 3UKMA 5BNPC 2DU1A 4RWUA 2R6QA 1AYM1 1GNHA 2L35A 2H3OA 1PNLA 4CYDA 1BMV2 5K8SA 4WBBA 2BTQA 3VKFC 3JQWA 4FFKA 4LF8B 3CCVV 5J37A 4SBVA 5IYDO 4GB32 2QM8A 2PQSA 3TEXA 5IYYA 3WU2Z 3ZYIB 3VBFB 3JQXA 3GZTB 1W8HA 2ZZJA 2RDRA 4CDXC 4DMIA 1O7FA 1Z78A 2ZHKA 4DYLA 2JGUA 1GN4A 2WLLB 5HV4A 4Y22A 2PYTA 1J3QA 2A3QA 4Y22B 3IAPA 4JPRA 4GH4A 1SDDB 1KJLA 2YIBA 1ZL8A 4EWDA 3CCLV 2PLV3 2CDYA 4LWSA 1NVPB 1OOPC 2BBVA 2BJSA 3AG7A 4FP2A 2QZ2A 4MXVA 1R081 1N32O 3LZZA 3ZXFA 4P02B 4IEYA 2RMU2 1DYOA 3AK2A 4FBFA 3SJQC 1W9YA 1IXMA 5C9AC 4XUOA 1GK9A 4Q8KA 1AI4A 1S0DA 4H0LB 5JQGA 5BPXA 5DUXA 1BE3H 4BK4A 3E35A 4K7JA 5IT6A 2FTKA 4X20A 1MS8A 1XMQO 3U4XA 4Z07A 2E7QA 1JYTA 1VQ8V 1ENSA 5D5QA 4PIXA 4XF0A 1DQ5A 4CUGA 1IPKA 5T5LA 1V9PA 1US3A 3VHPA 2GTSA 1ZZCA 2ZX1A 2ZA9A 5CKMA 3OBRA 3CWBH 4HKWA 5EZYA 1YJLA 1W8TA 3VKNA 2UUAB 4MS2A 2RJLA 4MH0E 3ETQA 2A6YA 5AVAA 1OLQA 3H1MA 5EIBC 1Y4WA 2VNVA 3EXUA 2VUDA 4N43C 1AXYA 1HRV3 4BIFA 2Z69A 1AI5A 3AJYA 4QGLA 4TV8B 4I55B 2QBXA 5JOWA 1NKDA 3AZYA 2YIAA 1GQGA 3GHNA 3BKZA 1CPNA 1NQDA 4IEZA 2RQ6A 3ZXGA 1QQCA 3WNPA 2XAQA 4LKFA 4D7SA 3M99B 1FV2A 5B3SB 3KHBA 3B00A 2ARHA 2WS91 3AYDA 2UWBA 1EM1A 3HOBA 4Z8BA 4BISA 2XBO2 2WLKA 1LOFC 5FLJA 1AR91 2BEOA 3PUHA 2F17A 4E4DX 2XJTA 4JYAO 5HCBA 1JVMA 4N53C 2DVDA 5A33A 2WT0A 2P34A 2QE3A 2XJQA 3BIEA 3CJHA 1VQMV 1W39A 3KF5A 1TUBB 1OPMA 2KKWA 3JAWA 5H9RA 5IAVA 2AW9A 3T2MA 1NLQA 4K1ZA 5FLHA 3RYKA 5FZ0A 1OCCC 2R7EB 4ZU5A 1FPN2 2R1BA 1IZ3A 1R1A2 3DXTA 5FCCA 2OTLV 4JI3B 4WVWA 4Y4YA 4NIAA 3JSLA 2Y4TA 4PDWB 3K3NA 1H8TC 2VOTA 3L2HA 3QG5A 3WB1A 1W6NA 3ZFGC 3SEEA 4AEDA 2VM9A 5I0DA 5CBHA 4QKBA 1YFYA 5IAXA 4JYBA 1RUD3 4AHCA 1AJNA 1B09A 1RIRA 4JCKA 4LBKA 5B1AB 4NXNB 1IKPA 3RZLA 4HOOA 1T5EA 1UZWA 3CL1A 2X05A 2GNDA 1CIWA 1AR71 4P9PA 3RQ0A 3D36A 3G71V 2QR4A 4UCSA 5H9SA 3PMSA 5J7MA 1PK6C 3HR9A 3LGRA 2YS8A 1AR81 5F8PA 2JJ2G 4WV8A 5IWAO 3BOPA 1MA1A 4JAAA 3A4UA 4W6XA 1JFFB 3THDA 3AB0A 1I5ZA 2FCTA 2UYBA 1WBLA 4B08A 1P7GA 3E97A 2IU0A 1ZRIA 3AMQA 1W6QA 3CS5A 3H1KH 5J36A 5DAWA 4LFCO 2Q8EA 2A0LA 1Q7YW 4IHJB 1NLRA 3H50A 2XL7A 4OX9O 2ZZQA 2IJJA 1C8NA 2HWE3 1N1SA 1NVPD 3WW3A 1CONA 2WLQA 3GCWA 1UU6A 4O4HA 2N05A 1G4YB 1YCIA 1EUUA 2E75B 4KWKA 1ENQA 2WNVC 1THZA 2Y6FA 5GZCA 4RAIA 1PMHX 4XFIA 3KM5A 4O4LA 5LA2A 3WSOA 2Z5WA 4N21A 1BEV2 5DDJ3 4CA9A 4J10A 1YI7A 5IK5A 3ITQA 1T6BX 2VCMA 5JCOC 4U3JA 1FD9A 4JQRA 2GDFA 2JDAA 5ACA3 1OUXA 4CEYC 3AG4C 1DZRA 1POV3 1Y67A 4NE9A 3BOWA 3ILNA 3RT3C 1ZBA1 3ZMTA 2HEVF 1RUD2 2YICA 1N36B 1S0JA 5KHKA 2AC1A 1BQZA 3I3EA 1F35A 4Q26A 1QQP2 5F9TA 4DFSA 4FCAA 2Z4FA 4E4SA 3HPLC 4V2VA 4LHLA 2BVVA 5FAXA 5KXEA 1L0NH 5FZ7A 2Q6AA 4A3ZA 4DV5B 1FXKB 4DR3O 2I07B 4E2QA 1NTKH 1BZWA 4ZU7A 2Y6JA 3O1RA 5JAXA 4FLTA 5KWRA 4GJYA 2RS32 2PAMA 2OCHA 1N47A 1OCRC 3CRRA 1MVQA 5FY0A 4Y1VA 1ZUQA 1MPXA 2GMEA 2ZCEA 5SV8A 1ENXA 2FZ2A 5L73A 1AR73 3L9DA 5E1AC 3G6BA 1LHOA 5C33A 1YVWA 3I2KA 4RGAA 5EFUA 2R0FA 1JMUB 2ZT9B 1LOBA 5BR8O 1VBA1 1VMHA 4DV3O 4DW0A 4Q4V2 3E22A 5IJ0B 1QHTA 2UUCB 1ZX5A 1RM1B 4ASMB 1ULPA 5DXDA 2WSSG 3JD1A 3NJYA 5F5CA 4DB5A 1Q90D 4LF6O 1J58A 3W7UA 3MW4A 5EV7A 1RUH2 4A7KA 2HJIA 4RFT0 1LHWA 3IGAC 1EN5A 2WYFA 3UNPA 3SYPA 4HLTA 4YZ1A 3K04A 3FJSA 1HP8A 2F23A 2WSVA 4Q1RA 2EILB 1XNBA 3QLQA 3WB0A 1IS5A 5JI7A 1JPXA 5A6YA 3OTOB 3ZS8C 4DY5A 2ZHMA 1FXKC 4Q0VA 5K0UA 4BB3A 1Q6IA 5FZBA 3UKNA 4L92A 5FMCA 2VC9A 4N7UA 4PA6A 1AX1A 3Q8BA 1H6YA 2XJRA 1NZCA 3GJBA 2KXLA 4GULA 4DR5B 3NJZA 4WM7A 1CZTA 1YDXA 4TQDA 2ZGRA 1JOYA 1V55B 4J25A 4AQ2A 1M93A 1CAWA 4A2UA 3DGEA 2A73B 5BNOB 4PJYA 4XUTA 5LXTA 5F3GA 4LMFA 1UN1A 3NR7A 2ITDC 1QR9A 1HW5A 2JX9A 4XPVA 3PVNA 1RXGA 5CVRA 3OR7C 5GLTA 3L74H 3NNMA 3IAYA 2AYHA 2ZMLA 4GWJA 3CRMA 4LF4B 3F95A 4JI0O 4I50B 4X9QA 1PHMA 4L11A 1ALYA 3GALA 5LA9A 2W1SA 4JI6O 3POEA 3CJXA 3SYOA 4YXWG 1D0GA 4ZZ5A 2WFF3 4JGYC 5FQ0A 3B8MA 1NA1A 2XVKA 3LQCA 2FB5A 4JKMA 1KXGA 2ZE7A 4HVQA 2Y48A 4NHLA 1QF3A 5IVJA 1MQTA 4O4IA 4XHXA 2YBSA 3K46A 3OCPA 1OVSA 2RV9A 4NMIA 4CCKA 1W0NA 3BTZA 4OI0A 4SLIA 4NIDA 2HR3A 1ULOA 3URFA 4J11A 4ITCA 3RNSA 2ARAA 1G1XB 5KR7A 4D7YA 1LJ7A 2I2SA 1QJZA 3ACGA 3J7AU 4DRRA 3NO8A 3T0BA 4KHPB 2NNUA 5L9BA 5CIRA 3QBQA 1AR82 5B5EZ 1AI7A 1GWKA 4XDKA 1H2KA 2YIBD 1UZVA 1PGL2 1RUH1 3OGIB 3A21A 4GWNA 4AVSA 2JKBA 1Z5WA 4Q0UA 3VDDC 1WD3A 4IYIA 1AHSA 4DR7O 5LA6B 2F6BA 5H9CA 1SESA 2RDQA 1E1QG 4DV3B 2XHKA 3GCXA 5H6QA 2Q7HA 2WWWA 4YGBA 3PN1A 4DS0A 4PI2A 4H7MA 5DUWA 5D8AB 4LUMA 1Y9MA 2R071 4MGZE 1HLCA 4NROA 3K3WA 5C4WC 3QACA 3E5QA 2J1EA 2DV9A 3H3UA 4RQPA 3MW3A 4A42A 4FOVA 4JAVA 4MVRA 1V6IA 2RS31 4CCOA 3AG2C 1GP5A 3CCSV 2E32A 3S57A 3VBSB 1HV1A 1U97A 4D6QA 4LULA 2V5YA 5J48A 1XXNA 4K8ZA 1H1MA 4XBFA 2CK3G 3B40A 2W47A 4R6ZA 1KITA 2QQIA 2D3OW 1X36A 5IYBO 5C8CA 1NU1H 2OIEA 2CTPA 4GIQA 5BNQA 1RUOA 1QCEA 1RFYA 4Y1YA 1YI9A 1R1ZA 3D3QA 4UXNA 4OCTA 3SH3A 2WA3A 5EZWA 5A3UA 1AR5A 1YJNV 1BHBA 4GX1A 1QJY3 2FKXA 4XOGA 1AR92 3VBRA 5FY1A 1G8MA 5FPOA 4CDUB 1R3KC 3TCUA 1OA4A 2ITCC 1YXWA 1XPWA 4DV4O 1XNQO 2IXJA 4EWEA 3C7EA 1MS5A 1UY1A 1RC6A 3E86A 2CDPA 3JARA 3JALA 2FZ1A 2PN5A 5CB4A 3D3AA 3P32A 2OT7A 2LP7A 1UPSA 2B9UA 2EZOA 4UYBA 1RUF3 5EK0A 1V9U3 3CCRV 4CXYA 1VEWA 1HWYA 2OXBA 3OBTA 3SXWA 1TUEB 3I2GA 2OIGA 3JBG1 4LO5B 3USUB 4WFBV 1N1YA 2Q4PA 1O3TA 1UPGA 3OY8A 1I5YA 3MIBA 4N53A 1QQP3 4BQ1A 1MZFA 3JCIA 4V1PA 2WT2A 1NI8A 4EB6A 4WBNA 1KFUL 4HPKB 4M3CE 5HCHA 1C57A 2DF7A 3KV6A 4AOCA 4AI9A 2X5IA 5CA0A 3UL2A 4QU1A 3I8TA 4JTAB 2VZVA 2WBKA 1HNZB 3B02A 4QPIC 4G3YC 4LFCB 2QJ1A 3A0RA 3NJXA 2ETEA 2Y6LA 4BLIA 2XLAA 3O14A 4ZS3A 4AXOA 3DYPA 2WA4A 4W4KA 4QDQA 2ENRA 1RUJ2 1S76D 4NUBA 5F32A 2R9IA 4TV9B 1XMOB 3DSQA 1FXVA 4AW7A 2A3YA 4Y26A 4BE3A 4DO2A 3N9QA 4LBEC 2E53A 5CB7A 4CUAA 2QVSB 4CDQB 1RP3B 1S0BA 5ABJC 5FY5A 2XBO3 3APBA 4NN0A 2UXDB 1EAH2 4CCLA 5GONA 1D4VB 1F4AA 3JD4A 3ACFA 1ORQC 3HKCB 3POBA 4J6GA 4BA6A 4NXNO 1WB7A 1SQ4A 3D36C 3S3WA 3KT4A 4QPWA 3MDPA 2BZDA 2EXHA 4F7ZA 2JK5C 1QEXA 3LSEA 5A6ZA 1MS0A 4TUYB 1ULFA 1M57C 3WF4A 4FOYA 5JUVA 3AP9A 3CCUV 5FP7A 1KFXL 1KYOF 3K06A 3GDBA 3P6BA 4KGGA 4IE6A 3CKHA 2AZ0A 4RD7A 1O3SA 2UY9A 4O4LB 4LFAO 4QB2A 5CADA 4WM8A 5H5NA 1DGRA 2E31A 1NH2B 4O61A 4O4JB 3H7JA 5KMGA 4MTXA 4AI1A 1W6PA 4Q4Y3 3O12A 1NZIA 1YC61 1BKZA 4LLOA 4L99A 3IC9A 5K1XA 2CNAA 1NE6A 5AC93 1GM9A 2VU9A 1FJGO 1KRIA 1GKBA 1TUBA 5IWFA 1GH6A 3PUIA 5T3NA 4CU7A 2VZRA 2P1BA 1XRUA 3UT5B 2JICA 2WNVB 1AJQA 4UVBA 3NVCA 3AEIA 1OHHG 2LTNA 5FUPA 2WWUA 3SYQA 1XU2A 4PDRA 2ARBA 5CFDC 4XTMA 4FQ4A 1VAMA 4Q0SA 4UVCA 5FZEA 1X7NA 4TWKA 4IQPA 4IXLA 3CXHF 4JGZA 1YFWA 4RGGA 2C9KA 2XT9A 1EY2A 4RUFA 1J3PA 5LMNB 2DCZA 3OF1A 2TUNA 3AP7A 2W1WA 3LA2A 4FPOB 3T09A 4ASKA 1RUI2 3ZRSA 4DXZA 4Z2AA 1L0LH 5JZGB 4XXPA 3AMMA 2YROA 3KV5A 3GHMA 1SC5B 1KDKA 4MV2A 3Q9OA 4RSUA 1SFNA 4OZOA 4MSWC 3K4ZA 5M0TA 5DAPA 3WNNA 3AM2A 1PNMA 3N27A 1CVNA 2XOMA 4FZ1A 3HMYA 3TYJA 2Y60A 1VPHA 1XOYA 3AG2B 1KC8W 3K5LA 4AF9A 1REFA 1QJX3 3VUOA 2C24A 4U7OA 3OEAA 5DDJ1 2ZEZA 1G9BA 3FMGA 2ZNIA 5J2TB 1DP0A 4C7UA 2CUGA 3NJVA 1UZZA 1OZ0A 4OPAA 1K34A 2Y6GA 1JZ4A 4LKEA 1O4ZA 2XVGA 3GBFA 2UUCO 1WW4A 2EIKB 4Q4W1 3RYFB 1ZZ7A 1QNWA 2GV9A 1WLDA 4KG8A 3E8BA 3QO8A 1H2GA 3I54A 1CAWB 2G1MA 5GW7A 4NIGA 4AQSA 3W7XA 2Y6HA 4W6YA 2IVJA 2L9LA 1D5NA 3ZJZA 5JOXA 5T5PA 1ST8A 4A4AA 1NOVA 3DYOA 1AJPA 1UOGA 3WVJA 5HFMA 1R64A 1VQNV 5DUVA 1HN0A 2ZABA 2X09A 3T0DA 1XUQA 5L9VA 2IH1C 2KM2A 1O4YA 3BIWE 4TWTA 4HNAB 1SHWB 3VN4A 3TEZA 4OHYA 3SDLA 4BQ5A 4R9DA 3ZFFA 3ABZA 4IEUA 5H9PA 3SH4A 1GNYA 2HWF1 1CJDA 2LROA 3MIHA 1HB2A 1RYYA 5LA1A 3NNJA 1ACCA 3O65A 4OI4A 5FYCA 4FOWA 5HCAA 2FDJA 1WBFA 2RM22 3GGLA 3MFCA 3LAGA 3H42B 5F1RA 2QDOA 3G7DA 5HI0A 2LJ2A 2BQPA 4UF0A 3ZX6A 1O3RA 4GMP3 1AXKA 4LNUA 3A22A 4HNAA 1O6UA 2YDEA 2E6VA 2YC0A 2BBAA 3CLPA 2X6CA 3VLBB 5CA1A 1K8AW 2B5HA 4BLJA 2ZKOA 1ONAA 1PGW1 2Z42A 1C1FA 3BABA 4AGRA 2CGPA 3SHRA 4WF9V 1LGNA 1VP6A 1SQPH 3O1PA 2C5DA 4G28B 2D5HA 1Q5OA 1YTFB 1KBHA 2Q8CA 1PNFA 5EXOA 3WHTA 2QTWB 4XDPA 4CEWC 3U10A 4E2GA 2GNMA 1K3IA 3FYEB 1AYN1 4FSJA 5C3QA 2GSMB 1H8TB 5GZDA 1GUIA 4ES8A 3N35A 4QQHA 4QWNA 4ZKTB 1DDLA 4PA7A 4YJ3B 3FB6C 1UYPA 3K2OA 1KD1W 5DN2A 2UU8A 2FCVA 1NXD1 4UB8Z 4QPIB 3O1MA 5FPVA 3KZIZ 2WQZC 2XKOA 2A5ZA 2N04A 1ND3B 4XZPA 5JXGA 2P3IA 4OUSA 3E1F1 1WWYA 1D4M3 4XFHA 2DVBA 1F9KA 4UW3A 1GM7A 3I2HA 2M7WA 1TG7A 1UJWB 1H2SB 4AVCA 1GP6A 1SQFA 1BBT2 1DTOA 3AC0A 3NWKA 1WA4A 3SC7X 3K75B 2WS93 2HVKC 4XMAA 2UXXA 3UETA 4HETA 2DYCA 1E57A 1FYUA 3QCWA 1D2SA 2KG7A 2BTQB 3SNMA 2EAAA 5FY4A 2WN2A 3BRCA 1W90A 4OHXA 3BA9A 2WN3A 4FPLA 1GANA 4RS5B 2ZINA 1XNRO 1HRV1 3K59A 4CDQC 2H0VA 3MBWA 4LE3A 3BCWA 5DG1A 2WSUA 3HN3A 1PL0A 1UX7A 4D94A 1FMD3 3VBFC 1SKVA 2Q9LA 4HONA 2VQFO 2NPIA 1F4HA 1XILA 2PHFA 2ZM6B 2A71A 4KH9A 1CAUA 1WCKA 1TME1 2FD8A 4O7XA 4PQQA 4H33A 4DXRA 2GNBA 3O0XA 5DAVA 3CO2A 3FYIB 2PF4E 1H2NA 2LW8A 1FXZA 2PELA 4XUPA 5EHDA 5ITZB 4LO4B 4PA3A 2IZWA 5FYBA 5DECA 3ETEA 1W6MA 1WP8A 1N1VA 3AKPA 2AZ2A 5FTTC 3ZPOA 4E4ZA 4CUCA 4DXWA 4OYUA 2VRZA 1E5HA 1ODMA 4GQ7A 2XDVA 2ZD9A 5A3LA 1VBB3 1VQ7V 2JDZA 1I3HA 2EIKC 4CEYB 3W59A 4PV1B 4AHZA 3N2GB 2GDSA 1XNRB 1ZZ8A 4J7JA 4HVRA 4I4TA 2KA3A 3W5NA 2P2KA 2WFF1 3K0DA 3CP1A 2NN8A 3SKJE 1GMGA 4EYUA 5K0UC 4TOIA 2EVXA 3ILFA 2VQEB 1HRI3 4A6SA 2ZE5A 2CTWA 1REEA 5L7OA 2VZQA 2WC2A 1ZZ9A 3NQHA 3J80N 4MTGA 5C5TA 2GUZB 3ZFGA 4J80A 1WAZA 1GTOA 3BI3A 3H3LA 2C9AA 4MYEA 1O8PA 3MHSC 2LW1A 1BXHA 1S0VA 2JG8C 4FPFA 2E74B 2JD9A 1X59A 1N0JA 4Y4RA 3D6EA 2UXBO 1GN3A 3SPHA 4ZHNA 4AFBA 3S30A 3M1HA 1C5HA 5LRSA 1XL4A 2VJXA 1DLCA 1N3QA 2D6KA 4CU8A 1N1TA 1ZZ6A 2PA7A 3QNEA 3AG3B 1W59A 1H30A 1AJKA 3PVBB 3RYHA 1BYHA 4MW8A 2Q5ZA 5AC92 4COUA 1AILA 3AYEA 2AGAA 3HT2A 4QX8A 3MIDA 2DCJA 1ZNPA 1D2DA 2XAHA 1V9U1 1KP2A 3NAPB 3C8XA 4D69A 5FP4A 5I93A 1VBD2 1NQJA 1U5XA 3CYOA 2YIDA 2Y33A 2QKSA 3IPVA 3N7MA 5HBAA 1MACA 4JF3A 1GSLA 4DXTA 4KNCA 5CA3A 1JW6A 5FPZA 1RXFA 2ZE6A 3AXDA 2E76B 3P3PA 3QOPA 2EINB 1LU2A 2VW2A 2EIMC 4FAGA 1UD1A 1X50A 4Q0QA 3CF6E 4GB33 1EZJA 4FPHA 4DUXA 3ZVXA 1QVFU 5JJEB 5FO8B 2CGNA 4BWAA 3W7SA 4MGKE 1YFXA 2XONA 4PD4F 4BIUA 4YM3A 1YYNA 3MDSA 3WP6A 1RUC1 3B09A 4K21A 5FIXA 2AUYA 4L2NA 2Z0AA 5FMDA 1XSQA 4PLNA 4FVVA 4TSVA 3CU7A 3RI9A 2NP0A 2ZGSA 4HBNA 4DR7B 5FY7A 1LHUA 4WVZA 3JD72 1ULDA 3G6EV 4X8PA 3RWRD 4JAUA 3M8AA 2O8QA 3OGGA 3POSA 4YVWB 3CPWU 4FM0A 4XQWA 1TVKA 1RUC2 1SBEA 1W9TA 5EQUA 1OHFA 4AEDC 3WG3A 3SKVA 1KUQA 2QQNA 2ORXA 2QQUA 1RMU3 4DR1B 2Q1ZB 3MICA 4D6RA 2FBEA 3MHZA 2QM4A 3N9OA 4OUMA 3RSJA 5KUMA 1QXPA 4W8JA 4E27A 2QQOA 1NX9A 1OOPA 5CFDA 4GT1A 3S5QA 3OM3B 5JVDB 4XF9A 1PK6A 2WZPP 3W7TA 4PF1A 4BCUA 1GWLA 1ZRRA 4UI9L 1YQ8A 1S77D 1S4CA 5FKBA 3W9AA 3RYHB 1VBD1 4LBLA 2DCKA 3DGTA 4KMQA 3ZIAG 1NTZH 2YFUA 5BMVA 2QDNA 3ZRWB 3ZSMA 3JB4C 5SV5A 2ZGQA 2P4VA 3AL6A 4QKNA 2Y34A 3FC0A 1OQ1A 4I5SA 1Y9GA 4BQ3A 1Z2GA 2W95A 1K5MA 2XXZA 3TK1A 1XBLA 4DV1O 1POV0 4BHPA 2XPJA 4A44A 4ONUA 1Y43B 4NTYA 5J2TA 1DQ6A 4COZA 2CE4A 1E5SA 2PHDA 4YJ2A 3J8F1 2GP3A 4UFHA 2UUBB 4A7ZA 5H2FZ 5CKNA 2UU9O 3FLPA 4QQOA 4MVZA 3STLC 3CBNA 4GD4A 1W99A 4QMAA 4FTEA 3CCQV 4IEPA 4AR2A 4DK0A 3KT1A 3C3VA 3ZRXA 3PL0A 4NAOA 1T2XA 1PZ8A 5CMUA 2Y69B 1NTMH 2RMKB 4Y1XA 1HXS2 2VZ1A 1K5MB 3T2OA 2ZAAA 2WINB 2LFRA 3SPIA 2VGDA 1D4M1 3J8F2 4KWUA 4NO4A 3BU0A 4C0BA 1BLZA 1W9SA 4B3NA 5FPUA 4E9KA 2ZDIC 4CDUA 4LH7A 3I2OA 1OKQA 1J3RA 2ZCWA 2D44A 1YHFA 4LOSA 4IDZA 3MIEA 2FQPA 2UXNA 4F6RA 4N9IA 2ZX4A 3ACIA 2GZWA 3HKCA 1G9AA 4OUEA 1BHGA 4R9BA 2VQEO 2P17A 5C5UA 2VNRA 4IEQA 5B1BB 5LGUA 4GKKO 1DLBA 1QDCA 1SBDA 3V64A 3ZRVA 1I7FA 2VUAA 3M7MX 1OOPB 4R9CA 2XHNA 1H1IA 5C7GA 3TXQA 3WW4A 4LNUB 5B1BC 2ZEWA 1I5XA 1XYOA 3VBSC 1J5EB 1VQPV 3WNLA 1F8VA 2F93B 2XJVA 1RUE3 4DR2O 3DV8A 2D43A 4DW1A 1NH2D 1MSWD 4JI7B 3T1YO 1SZBA 4DOUA 4NHYA 5E89A 2V1DA 2VG9A 2QWQB 4PLMA 3BTAA 1CAVB 3ASIA 5L3FA 2F66C 4META 3RPQA 3VHNA 1JZ7A 3RI8A 4FFFA 3GBGA 3ZKUA 5FPLA 1RINA 1WMEA 3WCSA 2MEV1 1HR0O 3VBOB 3ES4A 2QQPA 5A3NA 4QXKA 3HBKA 3KZ4C 1PIV1 2MHFA 5LYJA 3IJ4A 4GA9A 5FZHA 2XNDG 4DEVA 4O4JA 2OPKA 3OE7G 4EV0A 4MXWB 4LIVA 5F6LB 4YPJA 4I3PA 2C26A 3NSTA 1XU1A 2FHRA 2ADEA 1LGCA 4GKJO 3ZN1A 5LATA 3GF6A 3KB5A 4RA0A 3I3MA 4DRXA 1QXJA 4XJAA 1JYNA 5KAFZ 3FB7C 1V9U2 1C3HA 3OMAB 2D6NA 4MO3M 1PO11 3WX5A 2FDIA 3VZOA 3CJIA 3N3HA 4Q27A 2BDRA 3R0RA 3SEPA 4NTXA 5C4WA 2IBZH 1QJU3 2BNNA 1MQTB 3MFAA 4PQ9A 3RYCA 4MT8A 1AL22 2JG8A 3CSXA 5IYZB 4QE7A 3SPCA 4JYCA 1VBB1 4LCUC 3BCCH 1JXNA 1KS5A 2W92A 5FZGA 4GX0A 3ZXAC 1ZRCA 3LIHA 2OZJA 1NA1C 4BMBA 3ABUA 1BT8A 2ZBJA 3ABMB 1EZVH 4OI1A 1CAUB 3AG1B 1RUE2 3K03A 2ZS6B 2PMWB 3SJAC 2J1VA 2VMDA 1VMGA 3AZWA 1HJFA 4D3WA 4FOQA 4WCEV 3AK0A 4NHXA 2PHUA 4HZFA 2NLJC 5A32B 4RS5A 2DWRA 2K9ZA 3M3IA 5IYZA 1Z0HA 2JXAA 1LKNA 2WLMA 1UCXA 3RYCB 3K79A 2KG7B 5LHIA 3ZN4A 2JDHA 2RM21 1QWRA 3E8FA 5BNOC 1UU5A 2W1QA 4NJ4A 4DV7O 2EIGA 5E8AA 4FLVA 5FZFA 4CZSA 1RMU1 4XTPA 5FYVA 4UCUA 3U07A 2Y69C 2Q7GA 3M7AA 2HWF2 4RFRB 1AI6A 1OLME 4XJ8A 3QH6A 2GUZA 2A70A 4BPZA 3P3NA 1YRZA 2WAOA 2G38A 1VIWB 1DF5A 1RGSA 3I2DA 1GOGA 4AHXA 1B06A 3U11A 4X62B 3U4SA 1JU4A 4TSFG 4KWJA 2WNEA 2QNKA 2E5LB 1N34O 5LMUO 3N9LA 2B39A 1AR1B 3R6SA 3GYDA 3UT5A 4Y33A 2IJIA 4MXWA 1RUG3 1V00A 3JARB 4MZUA 3LF7A 3TEWA 3CC7V 1UOFA 1XL6A 2JE8A 2YPDA 1W8ZA 1NCQB 3ZHSA 3OBZA 2SLIA 3N2KA 4CH3A 4FFBB 4ZOLA 2JDIG 2VPVA 4NPMA 4DR5O 2HEYF 2XHBA 1WN7A 5EJZB 1UOJA 1FV3A 1MNGA 1YJWV 4FPKA 4JDOA 4YM0A 2EINC 5FZKA 3BEHA 1LENA 3R4SA 2X10A 4UWDA 1G8WA 4KXRA 1RUF2 5L9RA 1PMIA 5E88A 1CWPA 3CC2V 2A3XA 3ZFEA 3JU9A 3OPTA 3RBZA 1H9WA 2G9ZA 5KHHA 1S72V 1J1TA 3BVOA 3B5LB 3C90A 2WO1A 4UW4A 2ZMKA 3IMMA 1HDKA 1H8EG 1DGWA 3N36A 3V0BA 5JXJA 2HG5C 4YZ3A 3RW0A 4IGGA 2IC1A 4Z1MG 3FLRA 5A3WA 1US2A 4LF4O 2BWCA 3HNBM 4JI5O 4LKDA 1BJQA 1WZXA 1JFFA 1V6OA 4K3UA 4QKDA 5LBQA 1A3KA 1TME2 2IXIA 1L1FA 5HXVA 4LC1A 2QGNA 2VW0A 3TN92 3LOIA 2JB8A 2GN3A 2XOKG 1Q6HA 1SLBA 2WKKA 5LMNO 1YQ6A 3VQWA 3OEBA 4JX0A 2WQ4A 4XBNA 2C6SA 4OXSA 3JD73 1NCRB 1N3OA 4QPGC 4R9AA 3AXEA 1VBE1 2DVAA 5IY5B 3GZAA 4RS5C 4JI8O 2CAZC 1UIKA 2ATFA 4GWMA 1WA8B 2XUEA 3L70H 2NYYA 3BFRA 5FZLA 1JBCA 2P6JA 3Q8CA 3WR0A 5GTHZ 2X6AA 3PU8A 4RR3A 2KR2A 4O65A 4FLXA 2BGPA 4AVTA 3H9VA 3R65A 4KP4A 1DFQA 1ND3A 2PHLA 4YHHO 5LOVA 4IGQA 2X5IC 1Z7S3 3ZYRA 1LNQA 4DR2B 1S2EA 2W6IG 1HN1A 1B04A 4A5UB 1VALA 2ZPXA 5T55A 5I0UA 2A7WA 3N7LA 3RRDA 4OQ8A 4NWVA 4Y5TA 5KAIZ 3ZDVA 2Q8VA 4HG6B 1FPOA 5CKQA 2HEPA 2JG9A 1AVMA 4FPJA 2Z79A 1WMDA 1W0OA 3Q8EA 1ASJ3 5KHJA 1A78A 2RS51 2NQYA 3U75A 3JYCA 5FPRA 3ETGA 4A7YA 3PHMA 4LF8O 5BYNA 2ERFA 2YXSA 1Y9QA 4Q6GA 3O1SA 2RR12 4MOAA 2A6ZA 4AGVA 4JZ2A 4ET7A 4CC6A 4TZDA 1XE7A 3CCEV 4LLFA 2D5FA 3OY8B 5B3SC 1OCZC 3ZRWA 5LP6B 2ZR3A 5LEJA 1A6CA 1IBKB 4LBQB 1R1A3 1ZX3A 5GM0A 3ZYFA 3AFKA 1VRH2 1DQ1A 5CBLA 3DL3A 2CTQA 4NHMA 1UY0A 5ANQA 3WUDA 3UGFA 3JXSA 2H6BA 1PVC2 5JVDA 2XR4A 2XTAA 4Q4X1 5CB4B 4CDXB 5C71A 5JZGA 2J1RA 2WJSA 3O9OA 2Q67A 3CE2A 4LPLA 4FXKB 3UO3A 1WW5A 2W52A 3ZN6A 4J1WA 4Y1ZA 1L7RA 1WGPA 2AZ5A 1BQ0A 1RSOA 1HQWA 4OMCA 3ASOC 1PX3A 4CCMA 4NKGB 5LCWL 1JYWA 2RS53 4XDJA 2F4VO 1GOHA 1UXZA 3JZVA 2KQXA 1HIXA 3OBAA 1JHJA 4DPNA 4LNVA 3LEMA 4W6WA 1FS0G 3VZLA 1NAEA 2HWD2 2ZTNA 2YSUB 4Q4W2 2H6CA 4N7IA 3STZC 4J7ZA 2B7YA 1Z7S1 5KXCA 2IJHA 3X2QB 2UURA 2O14A 2RHPA 5IVFA 1V6KA 1MEC1 5IDJA 1SG3A 1W03A 4AI3A 1TMF1 4RQPB 1DQ2A 2DYRC 2YBPA 5BZBA 4W50A 4FLZA 1ODNA 4LH6A 3LDKA 1Q8SA 4Q4W3 5IATA 3F5WC 2VMIA 2DBNA 3R4UA 1W3VA 2GP5A 5FYZA 4HZ3A 1YTFD 5FY9A 4O9GA 3BN6A 1QJU2 1Z5VA 1W6PB 2MEV3 2IXKA 1VBC2 1XYNA 3TB0A 1AR62 3BYWA 3JBG3 3J4UH 4URAA 1UKRA 3ZYHA 4PLOA 1VRH3 4OHWA 1BQPA 3IPVB 2DCTA 4XBQA 1KDMA 4ASUG 2IVIB 4WZCA 2IW5A 1KGYA 1QDOA 3H8XA 3HQXA 3R05A 3ACLA 4JC1A 4PDMA 4KWLA 4XURA 2P4KA 3JBG2 4MHRA 1K5QA 3KHCA 3HJRA 1VMJA 1VRH1 3UK9A 3F7VC 4XDQA 1HV0A 1PNKA 3ETPA 3JAKB 3PNAA 2JRIA 4QGNA 3ECQA 4I0BA 2ZGPA 1JOPA 5C8YA 3WNOA 3OR6C 4ASLA 3LEKA 4ZIBA 4A45A 4CS2A 3MLJA 2EIJC 2IU3A 2W91A 4EROA 2CAUA 1STMA 4YZ5A 4LFBB 5JZGC 4N23A 3ZOIA 1WLCA 3HKDA 4K1YA 4XAAA 3RWKX 2AACA 3K4DA 3VZKA 3VBHA 1UFIA 1IBMO 2Q5TA 3TNPB 3LKJA 4YW1A 4QX7A 4XVHA 1R3IC 1K4DC 4DY3A 2XWBB 4Q0PA 1EP0A 4HN0A 4PA4A 4FTSA 5DN6G 4PDVA 3LSSA 2R063 2B4KA 4X20B 4HANA 1MS9A 2ARXA 4UFMA 5ANNA 5LBCA 4D8MA 1K5JA 3OEEG 2D40A 4FPPA 1ZTEA 4ZXKA 3ABLB 1BCCH 1XDCA 1O59A 2VY0A 1SEFA 5D8AA 5A1FA 4CEWB 3HKBA 3MZHA 2HFEC 4I02A 5IWAB 1B35B 1WD4A 2RS13 2VZSA 3L9JT 2PLV2 2Z3YA 4WM8B 1K45A 1PZ9A 3WXPA 2DDUA 4K9SA 2R041 3FX7A 5A7WA 3DN7A 3WDVA 4JRAA 4YVSC 1WLTA 2O0OA 3MIGA 4CBCA 5EWSA 4FPCA 4YWAA 4MTOA 2Q0AA 4FFHA 2TNFA 2E7AA 1GR3A 1QJX1 1PV0A 5F7UA 1SETA 1Q3EA 3SQOA 1TME3 3E8HA 2ES3A 3F7YC 2D97A 3VOUA 3SYCA 5JJJB 4JYAB 3THCA 1ZAUA 2VQUA 2E5LO 1RUF1 1AP6A 4RN5A 1QH7A 1REDA 4FJCC 2JE7A 1BK0A 1Q6UA 1ZREA 5F5IA 1WCDJ 1OMIA 3EBRA 2HP8A 1JJ2U 2HLEA 4H2AA 1FOD1 4R8CA 5K1PA 4AEDB 3E6DA 1QLEC 4COYA 1IXBA 3O1TA 1BK1A 2LM3A 3OG2A 3RZGA 3D0JA 1R091 4CS4A 1VB4A 2P4EA 3K5MA 4AI2A 4I0AA 2OVUA 2PFWA 2Y0OA 2GALA 5KHIA 3ZHVA 2JB4A 1W2AX 4QX5A 5KLVH 1LOEA 4QXCA 3G67A 1ULCA 5FZMA 1GQPA 3ABTA 1VBD3 4H14A 4JV4A 5IVBA 1RMU2 2QWNB 3PJSK 1RUJ1 4JI8B 2R1DA 5EIYB 2RS33 1HX6A 4CDWB 4NVPA 1NUKA 3BUCA 2ZACA 1SFYA 2P3JA 3LD8A 5B1OA 2Q4SA 1AL0G 2R32A 4WZFA 2ZQMA 2YYOA 3WNKA 5FR3A 2KB1A 1SZTA 1HB4A 1I0HA 4NAMA 3K48A 5FZAA 3RGBA 5H9QA 1N34B 5C3OA 1C4RA 3WDWA 4DIQA 4FVMA 4RYDA 4QX0A 4JASA 4NXMB 4XAEA 4UF0B 4JGYA 2DFCA 2DUPA 1WLWA 4FPEA 3RYRA 3TEYA 2A6WA 5FP8A 3HR0A 2Y4UA 4B3MO 1PX4A 1VBB2 3BPSA 4XETA 2VXJA 1AL21 5I8TA 1P4RA 3I49A 1F51A 4GLXA 1UF2C 4CCCA 5FQ0B 1OSGA 1YSCA 2WLNA 2YMZA 2WLIA 2RCVA 4S2GA 2A79B 1XMQB 1NCQC 4CP2A 2V4VA 3M3EA 3OGRA 3VBSA 1UY3A 5BNPB 5EYYA 2OWOA 1BVVA 3ROUA 4DV2B 5FK8A 4XQDA 2VMFA 3V65A 4YY3O 4KHPO 2IH3C 1EV11 4ZPIA 4F3JA 1QNMA 4GWIA 1M1KW 1IBLB 4F6RB 3P5BA 3FHAA 1Q8VA 2ZEYA 4A41A 2WLHA 5L3DA 5F3EA 1A34A 2UUAO 4M00A 2E26A 4EWAA 1VBC3 4EKWA 1RVF1 1IGOA 2JG9B 1XI1A 4DUZO 4FFBA 4ZOLB 3FUQA 4XJUA 4D0QA 4KU7A 3IC7A 3DUIA 4UCVA 3SITA 2G19A 2BE3A 4XUQA 3B9CA 1G6UA 1JOBA 4JDMA 1KECA 4BM8A 3T4VA 2E33A 2R072 5LOVB 2QZ3A 4BJ0A 4KG0A 2VCCA 3SJCC 3T30A 2ZGLA 4P30A 1WCSA 2VWJA 5C3RA 2QE7G 3BGAA 3OGVA 2WAMA 1VAKA 4S2DA 5IJRA 1OJHA 3IKWA 3ZN5A 5FMBA 2WLLA 3SLIA 4PT6A 2AEYA 5T52A 4TN7A 1SDWA 3KT7A 4X1IB 4X65B 2LGQA 1T6GC 1NCRA 4KBBA 4EN0A 5CA6A 2BFUS 3FHIB 3KKYA 3H3ZA 4OGQB 1W06A 2DTYA 2EILC 4O4IB 1ZVFA 3JAWB 2DOSA 4LR3A 1ZRDA 3FBYA 1HQLA 2HWC2 4QNHB 2O8OA 3C3TA 2Q1MA 4JZGA 3RFRA 2VQTA 3K0GA 4QM8A 2NLRA 2WZ8A 5EIBD 4DUZB 5FYUA 4NIIA 3EO6A 1YFUA 4IV1B 5B1AC 1D4M2 2R061 1AR4A 3N9MA 4NIHA 3N9PA 1ULEA 1XNDA 1P49A 4DUVA 3E8GA 5DAXA 3NNFA 4JDNA 1W3XA 3IMNA 3SCGA 4CP1A 4MVUA 5KA6A 3RVHA 4LA2A 4OVEA 4YVSB 5A7QA 1MSDA 4IV1C 1AX2A 3IFXA 2B42B 5FV3A 2HWD3 2B45X 4AVBA 1Y66A 1OUSA 2JE9A 4KL1A 4Y20A 2VOKA 3IM0A 3EYPA 3ZHRA 4CH4A 1URFA 4YARA 5F2VO 3NV1A 4CP0A 3LFIA 5C4WB 2G9FA 2R30A 3WOGA 3DKQA 2LRPA 5TSWA 3CJIB 2E3CA 1DYKA 2ZGOA 4OULA 4BQWA 3MD0A 3POYA 1DU3D 1W6MB 4JTOA 3T1LA 5C6CA 1OH4A 2DWDC 4MGYE 3RMXA 4B3SO 2JDKA 4B29A 1W6OB 2EICA 2R073 1VBA2 3FWEA 2VQAA 5A7PA 4CPBA 2A9HA 1O9GA 4H37A 3NNGA 4DV7B 3RZZA 1K97A 1JYVA 3AG4B 2ZXWB 2QQJA 1RB8G 4UCOA 1E79G 1G6NA 4MGSA 1NE4A 1QHDA 2J1UA 4YJ2B 4GX2A 1BSMA 3JASA 1L7LA 1RUH3 3DECA 1SBFA 4BQ2A 5A1LA 3GZUC 2G9GA 3NKGA 4J1XA 4O4HB 3B01A 3IDCB 1OCOC 3HKDB 2P3KA 4FM2A 3MV01 3T2PA 4OMDA 3JB8A 4AWDA 3M3OA 1QLEB 1CJPA 2GMPA 4GZRB 3POIA 3JATA 1EV12 5A7OA 4YW5A 3KSCA 3GWKC 2AREA 2P5BA 1LOGA 4O2AB 3PU3A 4IV3A 3RZKA 3FZ3A 4FMTA 2PHXA 3ZFEC 1V70A 5IW0A 3ZIXA 4JGZB 3KG2A 1ZL8B 3J7MA 3ZMOA 2DUQA 2VQFB 4WFEA 5BY5A 2HWE1 1UIJA 4D6SA 2KD7A 1O91A 3WF1A 3WV6A 1AYN3 3FE5A 3VKOA 4R50A 5KUKA 4DR4O 2X8KA 4WFHA 4DR6O 2VZUA 2XH6A 4LFAB 2QTSA 3TAYA 4X64B 3J26N 1F23A 3J8F3 2UXCO 2GNTA 5HV0A 3VDDA 1VQLV 3NRUA 2D6PA 2BOJA 4AEJA 2AXTZ 4JV5O 3PIJA 1TVKB 5IVCA 1X82A 4ZXEA 3FUOA 4QPYA 4DUWA 4BDVB 3AKSA 5EYXA 2FDFA 1GKFA 2H0BA 4R4ZA 4I2OA 4C91A 4M3CB 3OAAG 4KFMA 4BIZA 4HPKA 2WQ8A 4BW5A 4FLWA 4E2LA 4FFGA 4G9SB 1IS4A 2JIJA 4EB6B 1VLNA 3T0AA 2QFEA 2NMNA 5KMGB 3OUFA 4RR3C 2JDUA 5A7NA 5IHRA 2QM7A 4XMIA 2B1IA 3BB6A 2PI5A 1RHI1 1JX9A 2VBPA 1QKQA 4A6OA 2QUOA 4DXSA 1XE8A 2H94A 2OYZA 1H8VA 4LJHA 4YG3A 3ZN0A 3NV3A 1I94B 1W6OA 3M3QA 1D7PM 1ZBE2 2J1TA 3U1XA 5C93A 5CN0A 2XAJA 3IIAA 1W0JG 4H3WA 1DZQA 1CX1A 2XL9A 1CIYA 3HKEA 4I9QA 1NS1A 4B3RB 2VMHA 3TXSA 4MW3A 2PI4A 4M4PA 2LQTA 2QWOB 1IS6A 4LUKA 4JI1O 1IQAA 4JKKA 3W58A 1KQRA 3VV1A 3OGCC 1F7YA 5LL6Y 1NT2B 5FBJA 4HT1T 2YGLA 5DAQA 4J9ZB 1JYXA 1QBZA 4JI3O 1FXHA 4YVSA 4DEQA 3ATGA 1N36O 3C7GA 2YPJA 1KEXA 5JMCA 3WZ1A 4MGTA 1JYIA 1FOD2 2ZHLA 1VR3A 3LDCA 2YZ4A 3LNMB 2VECA 4XIOA 4QAWA 1M57B 3LDEA 3WD5A 3I3QA 1LB2A 3TRSB 3LFMA 1HB3A 5LA0A 2QQKA 1HNWB 2XB6C 2F4PA 3WCRA 1TEIA 4B1MA 2VBDA 3WG7C 5LZ6A 1Y74A 2WYSA 4LIUA 2WFF2 1SA0B 5K4LA 1R6TA 3M3CA 4GH4C 3IIIA 2K0GA 4Q8LA 2YG0A 1SQGA 4RQEA 1W0PA 4B3MB 3J9SA 5FUIA 5LA6A 1VARA 3OMIB 4KU8A 5IJ9B 4YW7A 4UW6A 1JH5A 5B4NA 3CJIC 1UY4A 5J98B 4D7TA 1SACA 5L7OC 3QF7A 3H8UA 1A8DA 1POV1 3VBUB 1RJ7A 1SQXH 2LFSA 4I4TB 1JU3A 1CX4A 1GQHA 2D3RA 1NLSA 4JI4B 2FMYA 3SCHA 4YJ3A 2B46X 1R3LC 4G2KA 3NXSA 1GO3F 2Y8KA 2JJ1G 4GZ9A 1QNYA 1UAIA 1FPN1 2VS0A 2W39A 3UESA 1FAFA 2BNOA 2XG3A 3OT7A 3QH7A 1PO21 3M70A 4FTBA 4P08A 3EVKA 3A0NA 2GH2A 3D3IA 1OCRB 1F5FA 4K6BA 3CRAA 1N33O 4OLLA 1IG0A 3PIGA 1JZ5A 5GLVA 4NTWA 2G4IA 1OH3A 4PA9A 3O7OA 2XUMA 3INAA 1GU3A 1U96A 2RN9A 3KV9A 4P9YA 1AUYA 1GZTA 1M06G 4HAMA 2QEXV 3B7MA 3FD9A 2JS5A 1KD7A 4XE9A 3HT1A 4YYOA 3CRQA 4YM1A 2WZR3 4M4RA 4NXMO 1DGLA 1FOD3 2JVDA 3NNLA 5EPAA 2KSDA 3CZUA 2QSAA 3UCSC 2UWCA 1VF7A 5AFBA 4OQ9A 3KCCA 2IJKA 4QHBA 4QQ2A 4FP3A 4Q20A 1Q8IA 4I55A 2EF6A 4EJRA 5ABJB 4JI4O 2X0LA 2WS92 3ETDA 1LHNA 4E2SA 1GRJA 5EC1C 4XCBA 1COV1 1PVC3 2ZGTA 1QJFA 4Q4V3 4X65O 5I0TA 1Y7BA 4AEMA 5FZOB 4JTDB 1UWWA 3NMBA 1IHMA 4Q4X3 2UUBO 3OSDA 2A75A 2ZKNA 1QLNA 3RVZA 3VBUC 4YG0A 1AL23 3ZFGB 3I56V 1FT9A 1V0AA 1KU9A 3UKTA 4P2ZA 5B1NA 4NWWA 1BL8A 3H9AA 2EBOA 3O1OA 4DR4B 2CWSA 2QWRB 1RITA 3QTCA 2RDCA 2D98A 2RS11 4YGCA 1ENVA 5G04L 4PIYA 4COWA 1BGYH 4LF7B 1WA8A 1DGSA 4UVAA 4FPYA 1QU7A 5F5AA 4P9LA 1GAXA 5DM6V 1L3JA 2ET7A 5FP3A 3H01A 5IK8A 1K73W 3NW4A 1FI2A 1RSOB 4XABA 2W0XA 4BQ4A 1QMJA 3OGSA 2I74A 1MEC2 4I09A 5IJ0A 3DEMA 2WWSA 1SPPB 1V6NA 5GTIZ 1BMV1 4O9EA 2DE0X 2AH2A 4XEZA 5C9AB 1AYM2 3KS7A 4GH4B 3NAPC 2OPWA 5LEKA 4IIJB 4QXBA 1CP9A 1UU4A 1DGWX 3SCFA 2BUKA 3DYMA 4XW3A 1UNBA 3R66A 1HJGA 1OBNA 1JCHA 1AR93 1RJ8A 3ST7A 3A0BZ 2GN7A 4IIJA 4X8NA 2AGSA 2AHYA 2RMU3 4JRLA 4O2AA 3NL1A 4YIPA 3ZR5A 1KP3A 4ORFA 2ZIOA 2VVDA 5A2QN 4L87A 4BWOA 5FO7B 3T1YB 3UYJA 4PCRA 1VQ5V 2PHWA 2PYJA 3ZSJA 3RMYA 5J3UA 2D2CB 4JYYA 1W2BU 1AZDA 4UUJC 2XAGA 2B9VA 1Y76A 2RS12 2Y64A 5C70A 4WVMB 4JTNA 3S7IA 1N33B 3SJBC 4Z2WA 2OT5A 5IFTA 2CGOA 2JDNA 1BEV3 1VQ9V 3VHRA 3A2FA 2WLJA 4JTCB 4FO9A 4HMZA 4CXXA 4NHKA 3VDCA 1YITV 3K5NA 5I0RA 1QOTA 2JG9C 2RJKA 2RR11 4RR3B 4PHZA 1F15A 1OC1A 1VBA3 4BR6A 2EXIA 3RYIB 4K3AA 2ZGKA 1SF9A 4AGGA 4X1KA 1YO8A 2WO2A 3PJYA 5E6HA 1X33A 1OD3A 4AFDA 2R72A 5BY1A 3VKMA 3E83A 4LTAA 3WW2A 5LBEA 5EYPB 1OF3A 2VTXJ 4M3CF 1QY4A 4B3TB 4PDLA 5C8CC 1I5PA 3THOA 3ZXJA 2HWB2 4AI0A 3RZHA 2W3JA 3TOJA 3WQ0A 3BVCA 3U14A 2LALA 4ATFA 1POQA 4UT5A 4B8EA 3W20A 3BA8A 2VE1A 3WQ7A 1VBE2 5J2UA 4XDLA 5LK5A 2CTVA 5CG8A 2JDPA 3ZEDA 1XNCA 4LF9B 1DZTA 1LECA 2JS3A 3ZFEB 4LOTA 1OF4A 1J84A 4LHKA 3SPGA 1FNYA 5DQ0A 5EYPA 3CNAA 2DWEC 1QVGU 5H6RA 2O57A 4Q1PA 3LOBA 4X89A 2OIIA 1C8M3 3CDZB 1XNTA 2JIZG 5CU1A 1XNAA 4JI5B 2XLFA 4XDOA 5CAZA 2UYAA 4MGQA 3T1HB 1PO23 5KC6A 4P9JA 1NCQA 2N7GA 4XJZA 2QWPB 1RHI3 4LBNA 1WMXA 4QDRA 1EYBA 2EXJA 2XLGA 5F39A 3B3QE 3B4SA 1LNSA 3Q8FA 3ABKB 4ZS2A 1Q86W 4CP9B 1BMFG 1U5YA 1A8MA 2OX0A 1COWG 1Y3TA 1WNSA 4Q4Y2 4XJ9A 3THPA 3IB3A 3VGIA 3AZVA 2DURA 1XMOO 1XEQA 1XE0A 4BQYA 1DQ4A 4QPIA 4UFJA 2VOXA 3POWA 5FNVA 4C8DA 1B35A 1AJOA 5JSRA 2FDGA 3HKBB 4U2AA 4FQZA 1ASJ1 1OQEA 1H8TA 3HIFA 3C3SA 4WVMA 1UPIA 1W8WA 4LA3A 1V54C 3PVEA 2ZKLA 3EB7A 1PO13 1WLEA 3CCMV 3AG1C 4WBNB 4X6QB 3GZEA 2JEUA 2ZOEB 1NA1B 1WA6X 1EBOA 4QIWF 2YV8A 5A3OA 2FL4A 5JJNB 4IYHA 4UFKA 3VD4A 5DMYA 3H1JH 4LXLA 1BBT3 5LBBA 3USUA 1UZ0A 4L0PA 3CXCU 3ZMSA 3FFQA 5HPOA 5CFCB 3UQ8A 1JTZX 1GN6A 2HYXA 5JLVA 4QHOA 3P1IA 1XREA 1URXA 2ZE8A 3ZX7A 3X29B 4L97A 4LP8A 2HBUA 1FFTB 1EAH3 5JR2A 4YW4A 3ZSLA 5CEHA 4N43A 2MNGA 2XQRA 3I59A 1GOFA 1ND2A 3SPJA 1PM4A 2W6JG 5FJHA 3OPWA 2OS2A 1I9RA 4LBMA 4N43B 3WLUA 1W8FA 3MW2A 4LHNA 2K2SA 3O1VA 4BXSV 1YI2V 1RUE1 4N9HA 1RHI2 2X53S 3BTYA 3EHBB 1US6A 2NR5A 5LWBA 5DPNA 5A7WB 5FPAA 3H1LH 3WDXA 2BP6A 3GBWA 3J7NA 4QM9A 3ZSEA 3OD4A 2PTMA 2UXDO 3W5MA 2WNVA 4PDWA 2R0HA 4GMP0 3L73H 3S6PA 3CB2A 2YI9A 1UYXA 3EJKA 3HEIA 3MF6A 1RL3A 3KLSA 1SLAA 2CU5A 1LGBA 1D0HA 1PO12 4P9IA 3ABLC 2H8PC 2GAUA 4GAZA 3OMNB 4P9XA 3TETA 3C7OA 2PQQA 4CH5A 3HNMA 3BODA 1F4NA 2R70A 5A32A 4N53B 3E6BA 4E4HA 1PZ7A 1VMFA 4IHJA 4M0HA 4IL6Z 4CSWA 3FB5C 1EUTA 1DLLA 1UYYA 5FXVA 3WNXA 2GTAA 1O4TA 5FUNA 2LUWA 3K9SA 2ZX2A 2VVFA 5F2WA 2DU0A 4CU6A 2WNOA 4R8HA 3BU7A 1JA8A 2YEVB 3A7QA 1PO22 2E63A 2EZPA 1IDSA 2LS6A 3JALB 2BSKA 1OXCA 3AP5A 1WW7A 4MVTA 3GNEA 4XYXA 5I8SA 3VD3A 1NBMG 5LGNA 4OHZA 3RG0A 1YIFA 3PTRB 3MO4A 4Q5OA 1DHKB 4FFIA 4PBPA 4QB6A 1DQ0A 1CPYA 1YQ5A 2ZGMA 3L2YA 4IV3C 4EEQA 1MS3A 4IW3A 3FLTA 2HWE2 1LEMA 1E5IA 4Q29A 2YEVA 2XQXA 1OCZB 1DK1A 2GHYA 3E5XA 2ZX0A 2OW4A 3CCJV 5C3PA 2TEPA 3MUZ1 4JI0B 4ATEA 3AP4A 1S5JA 4LFBO 4QGPA 1FYJA 4LT5A 4ISQA 4YVWC 5IJ9A 4UCRA 3SISA 4ZBMA 3VZNA 2WPDG 2F95B 1SQVH 3GWOA 3DPRB 2NMOA 1UQXA 4Y1UA 5CBFA 4L9BA 4UCTA 3RJRA 1GFF2 4DZGA 2PAKA 4XHBA 1LU1A 5L3EA 1IKQA 4JKLA 3Q4HA 4H55A 5CA0B 4DV6O 1LTEA 3X2QC 3A0HZ 2XVLA 4AILC 1HW7A 3CJHB 4DR6B 3T1HO 1O3QA 3MLLA 4AVAA 1VF6C 1P8JA 3ZXKA 3OUSA 3IN9A 4F83A 3HN1A 4FZ0A 1UYZA 1LUWA 3LA3A 1JS9A 1RUJ3 2YB7A 2ZM6O 4UV9A 5GZFA 3KQ4B 1WMFA 3T2TA 3W7WA 2R062 4XC9A 4BIOA 4WFGA 1DBNA 3OUHA 3NKTA 4BOWA 1HNXB 1JZ2A 4RUEA 2D93A 2RG4A 4X66B 4GCZA 4YZ4A 1WPBA 1AX0A 1RUI3 5LHGA 2E51A 2HYKA 2DVGA 2XWJB 1ZSPA 4DRVA 4B3RO 2I45A 4I0XB 1YIPA 3D8CA 3ASOB 1WCQA 3WF2A 1EN6A 3B2EE 3KV4A 4GKXA 4BAYA 1JYCA 2P6HA 2BYVE 4CPBD 4NPRA 3UO2A 3E22B 3RDIA 1NYWA 1GICA 1ZBE1 4HYOA 1DGRN 4FM1A 5FBZA 5A3TA 4QHZA 3S0MA 3ZPYA 4F4LA 2X6BA 2CV6A 1W2UA 2Q73A 3MUY1 5FZ9A 5GKAC 1SZXA 2HEWF 1X8MA 1LODA 5ACA1 1E1RG 4ZKIA 4TV9A 1S2KA 2RJZA 4J41A 4CTEA 2LW7A 1OV9A 1SCSA 3VBHC 2Y6KA 2VUCA 3JAMN 1QOSA 3AP6A 4K0KB 2WWJA 3DXRA 5JSOA 4JI2O 1JZ6A 2QKCA 1CAXA 3ZCCA 1LOAA 2ADDA 1I08A 1KJRA 2JDYA 3MPBA 1PMJX 3AFGA 1M4UA 4AFMA 3OPZA 2WZR2 1S0FA 2X5IB 4DV0B 4IGOA 1JN2P 4KUMA 4LO7A 3WFVA 2HKXA 2J1SA 1XNQB 3BALA 1Y74B 1MS1A 1B35C 3EFFK 5LGTA 1JHNA 4CDUC 4LORA 1OCCB 3M8LA 2GSYA 3OTOO 4UFIA 4GALA 1C8M2 4INDA 4HN1A 4BQXA 4M01A 4CCEA 1CGPA 3P30A 1OLMA 4K8XA 3H1WA 4QGMA 4EFEA 4DUYB 4UAPA 4QT6A 1Q8QA 4CP9A 1MABG 3PVOA 2XASA 1JJOA 1QOOA 1NG0A 4IESA 2YY1A 5JXIA 1WCUA 1KS4A 3POJA 2OQ7A 3WEZA 2QQLA 4ARXA 1RVF2 1ZZBA 3FN9A 4MX3A 2DFBA 4RHV2 4IV3B 2HH9A 2Q8DA 4TLFA 5FY8A 1Q8PA 4B4PA 4TV8A 2XJUA 1AR83 1P84F 1H1AA 3ELNA 4JI1B 1NT0A 1XJAA 4GKJB 2C1FA 4G4FA 2JKXA 3IT8A 4JZRA 1FPN3 4GXLA 2VCBA 3WQ1A 4CDXA 4H7LA 3CX5F 3ON7A 4YZ2A 4G27B 2BRTA 1QQP1 4CH6A 3R4DB 1UZYA 2YI8A 1LAJA 4NRPA 5F3CA 3JASB 2GC0A 1HDJA 5I0SA 1RUD1 5FKCA 1ZBA2 4XF3A 1KB9F 1K4CC 3ASNC 2VOWA 4NOTA 4J9YB 1ENRA 1FMD1 3ZDSA 3K57A 4UFLA 1K5MC 2ZR2A 1XB9A 1X9PA 1GV9A 3I97A 1RPRA 3VL9A 4R52A 1BEV1 4ZONA 5LK7B 1SPPA 4LEJA 1MS4A 4Q2FA 3M2MA 1XHZA 2VD7A 4AAPA 5BR8B 4I01A 1K9MW 2OTJV 5ISLA 4ZI7A 4AHWA 3UJOA 5JR7B 3IBMA 4IEVA 3VB9A 4LO6B 4YGEA 2Q7EA 3SMHA 1UW8A 3VDDB 2ID4A 5FYIA 4P14A 2QKAA 3UJQA 3ES1A 4Y24A 1PD3A 1C5IA 1RM1C 2DYRB 3VQYA 1LCLA 4Y20B 2YBKA 5BNNA 2ETNA 4RQFA 1WUVA 4P9WA 1L8DA 1WP7A 2EJ7A 3I2FA 1RTVA 2W1UA 4QX1A 1QJY2 4BYYA 3RVYA 1WJZA 2VZTA 1BS3A 3CMGA 5K9YA 4OPHA 2AEZA 1PNGA 5BNPA 2ADPA 3SGIA 3CC4V 2PAEA 2WT1A 1Q82W 5IYCO 2VR4A 5GLZA 2HWC1 1JZ3A 1AP5A 3VL8A 2IM9A 1K42A 1HXS3 3UM7A 3QD6A 3AKTA 5A80A 1D5AA 5FREA 5JPNB 2P90A 3MHHC 5FZDA 4IE7A 1IS3A 3VD7A 2CDOA 5IE9A 3TWIA 2FCUA 1JQ0A 5FJKA 3ENRA 1N3PA 4MG2A 2CTRA 5KX5B 4X62O 4DV1B 2JEXA 3O0VA 2B9ZA 1R092 3C7FA 5FLIA 1NR1A 2EJRA 1PM9A 4AI8A 4TTGA 3CZJA 5J2UB 1ZBA3 2VH9A 3GB7C 2ZNJA 2DTWA 3I2JA 1M5IA 1F5JA 2OCCB 2VXRA 1O9HA 3DXUA 2A06H 1CQ9A 4X66O 4CRQA 1MZ6A 2WUHA 2J1AA 1XNKA 3HD8B 1VF5B 2HHHB 3OW2U 4RGKA 4FK5C 4YM2A 4L8JA 5A7SA 2A6VA 5JPMB 1YXBA 5FPXA 4J7KA 1BVP1 2Q8OA 2ODMA 1M9NA 4IE0A 3ZMZA 2ZEXA 5A3MA 5AVPA 1R1A1 4BH9A 5TISZ 5L19A 5GZGA 1MEC3 3TN93 2HWF3 5IVVA 3VDBA 3AKQA 3HB3B 4IERA 2VUJA 2GH8A 1I6XA 5IK7A 2P67A 3T2QA 5FZCA 4JHTA 4MLOA 2R042 5D2AA 5APAA 3KVAA 2CWMA 1DG6A 5JI9A 2GBOA 2Z5UA 1HRI1 1RUG2 4W4ZA 5IUQA 4FLUA 4UW5A 2PLV1 3BAAA 4W4LA 4FLYA 4QJFB 2BERA 3RWNA 2C4XA 4B1LA 2R49A 2HWB3 3DF0A 2E9QA 4JI2B 1FKAO 1S0CA 5LHHA 2DYSC 2WNUA 4XCAA 1AYN2 3VHOA 1FJGB 1QJEA 3BTXA 3PTYA 4K20A 2LO1A 1SFPA 3TGUH 1W8OA 4EZ4A 1AXZA 3LB9A 4LF7O 4QDSA 4UB6Z 5JMOA 1AVBA 2ADQB 1Q56A 2CH7B 2EIDA 4IETA 5LB6A 1G9CA 1HR0B 2ZHNA 1H38A 4LE4A 2QJVA 5CNAA 1HNXO 1PGW2 2RVAA 5JVVA 4GYCB 3JD0A 1H6XA 4QPGA 4QQLA 3ZXEA 1KQSU 5LASA 4DK1A 3AVRA 5BXXA 3WW1A 5GONB 4CCNA 1ROPA 5DZEA 1PK6B 3KGLA 1VIBA 3V56A 4XZUG 4TT3G 1VBC1 4CDQA 1XC6A 2W68A 3E5UA 3ZXDA 4LK7A 3ZM8A 1GMMA 1IX9A 1V54B 1QJU1 4YHHB 2JD4A 1LR5A 2DJVA 4YLZA 5A6QA 5EC2C 3DKWA 5AG2A 4J42A 4PF5A 4MSVA 1W04A 1MVEA 1H4HA 2JENA 2CSGA 5D21A 2WAAA 1UL9A 4CDWA 5JOYA 5DUUA 4P9OA 3HQRA 3HQUA 2M6YA 3K4AA 4FT8A 2ATKC 4LF9O 3WQBA 3Q4HB 1YWKA 4CC5A 2FMDA 4ES9A 2JJ6A 1A32A 4AG4A 2PYLA 1PP9H 2RMU1 3UGGA 2K46A 1MR5A 1GBGA 3FHQA 3DPRA 2Y26A 1R082 3WF0A 4DQAA 3RZMA 4K0KO 3AKRA 3RJ2X 4OHVA 5CG9A 4M0NA 5FO9B 4DO0A 2J7MA 3FBMA 4CVUA 5CZKA 3OEHG 2WLIB 1TNFA 1G9DA 3MEPA 1S0EA 4HSJA 4FI9A 3V0AA 4WFAV 1LR1A 1W9WA 4U3FH 5GLWA 4X88A 2OCCC 4XFAA 1QJX2 1TMF2 4Q4X2 2MPFA 2YXLA 5A33B 2VULA 3VBRB 2MW2B 2DBIA 4PIZA 1S2BA 1S0IA 2V09A 4JGYB 3L71H 1SQQH 2IUWA 3T4ZA 3IDEA 2Y38A 2L6LA 5ITZA 3EMRA 2ZXQA 5IVYA 2WDBA 1JUHA 5J96B 2PY5A 1SS3A 1MZEA 1SERA 3HBZA 2RNBA 4XFBA 5EBWC 2OUJA 1PGSA 5DZGA 2Q69A 3KQRA 1UMIA 2UY8A 5D5PA 3ZHQA 4IV1A 4AQ6A 4FXGB 4WVVA 4FPGA 5LW9A 1M56C 5FYMA 2PUSA 1JODA 5HFLA 4LO8A 4X64O 3MYXA 3RZJA 2O1QA 4GX5A 1GZ9A 4QQPA 2VAUA 4DV4B 1OVPA 2FYUH 1IBLO 4AK3A 1BHAA 5FZ4A 2GU9A 5JOZA 3V0AB 1PVC1 5L36A 2YFZA 4DR1O 5FZ3A 1RPOA 2A3WA 2VQ0A 3ZMNA 5EBMC 2WRAA 1LULA 2WNUB 2BCCH 5J09A 1PVXA 5C3SA 3WDYA 1CAXB 1R083 4S2FA 3LPGA 3E2EA 4OFGA 2UXBB 3K9AA 2X7RB 1F2NA 3O1UA 4AQYB 4DINB 5BUVA 3EQEA 1YQ2A 5FYTA 4MTFA 1IPJA 5T50A 4X6RB 1S0GA 2DN9A 3OJBA 3B77A 5FXXA 5JQGB 2RS52 4MADA 5J9PC 2ZAHA 5F37A 4IT5A 3PJQA 2XKPA 2CY6A 3TN91 2BTVC 3BPZA 2PZSA 3RN4A 2E7TA 1TNRA 2DCYA 3PUSA 2EAKA 4QKFA 4AQTA 4B7EA 1GLHA 1GWMA 1SCRA 5JCOA 3ZKYA 3WUCA 3I4IA 1N4CA 2BTOA 2YC4A 2W9XA 1W8NA 4NB5A 3I59B 2YXYA 2WO7A 1G9FA 1VQ4V 1ZA4A 1Q81W 1YQCA 2WLPA 4IEXA 4V2WA 3JAKA 4UV8A 5DZFA 4YW6A 1V6JA 4MVSA 2WO3A 1F31A 2RR13 5B66Z 2UXCB 2Q68A 4DR3B 1DIWA 4XQ4A 3AK1A 1M56B 1G86A 4ICGA 1AR61 5CFCC 2QKDA 2A7AA 1NZ6A 4I50A 4D6TH 4H44B 4QPGB 2QQMA 3VBFA 3AG3C 3ZHUA 1K5SA 1OI6A 3J7HA 1U5IA 2P7TC 3J7LA 5T5JA 1MQTC 2BVBA 3K08A 1HNWO 5FZ8A 1I1EA 2BNMA 3MLKA 3OB8A 4LF6B 5FDBA 1HB1A 4EFBA 1N32B 2FMLA 1S5HC 1EAH1 4L8QA 3SYAA 3LUTB 4AYUA 4CCJA 3LDRA 3S3XA 1Z7S2 5T5OA 2B5UA 2P22C 2PHTA 4PBOA 2YGMA 2V72A 1NY72 3T08A 4RO2A 3CMAV 3K58A 2HWD1 1SQBH 5L3CA 1VBE3 5KBFA 1FFXB 1PPJH 1EFRG 5FMOL 4O2BB 2ZMNA 1TMF3 2JECA 3ACHA 5K0UB 2MK3A 2IXLA 4EN6B 3S7EA 3M4FA 4K40A 1YIJV 4I0WB 3POGA 2W46A 4DV6B 1TAEA 4JVAA 4I30A 3G6JB 5L3GA 2EIMB 3FAVB 1VE0A 3ALQA 3BHPA 3APQA 5CBGA 3WP4A 1ND2B 3GM8A 2X29A 5FYYA 1M90W 4B4RA 2BSKB 3ZXLA 3HNYM 4AQYO 2B1GA 1VJ2A 1NXMA 3O0WA 1B6QA 3KVBA 3WG7B 3PLQA 4XFCA 1OA2A 3V0BB 1H2LA 5GZEA 4YY3B 4P9GA 3CMEV 3BY6A 3KF3A 3ZMVA 4AZZA 1OT5A 5LP6A 2HBTA 2C2AA 1D2QA 3TNQA 4PI0A 4GJZA 4JI6B 3OTFA 5FZIA 1RUG1 1LOFA 4NRMA 1HRI2 4HL0A 5FL7G 2VZ3A 1COV3 4HVOA 3I2IA 2D6OX 1F4MA 2Q1FA 4WFFA 3T1CA 3SR2C 1K7DA 2YHJA 4KBZA 1GYKA 1WKYA 3WINE 2VW1A 1TGOA 2RJ2A 4LITA 5IK4A 4GKKB 3ILRA 5JH7B 2VTFA 1H0BA 4R4XA 5LY1A 1IVSA 3DC5A 3ML0A 2CYFA 1C1LA 2HJFC 2VZPA 4E4EA 1GZWA 5L3BA 1TZOA 1LHVA 2BFUL 1IPSA 2J22A 4MVQA 5FXZA 1V55C 5E1RA 4QPJA 3D82A 1O5LA 3USSA 2EULA 4IE4A 5C8WA 1WW6A 5AFEA 2VMEA 4Z92B 4IUGA 2DUOA 1IOAA 5FK7A 1JI6A 2YU1A 3DPRC 1VRBA 1SLIA 2WFPA 5E79Z 1QXRA 2VNOA 3A8TA 1UX6A 1OKOA 1Y76B 1SMVA 3CIHA 3H1YA 1JUIA 3PMEA 4GKYA 3ZN6B 4P5YA 1PGL1 4XJWA 1TA8A 3DXRB 3APOA 2IFWA 1BCXA 4CE8A 1Y4MA 4JQTA 2VZOA 1CZSA 3HVDA 1YJ9V 1B3QA 4HKLA 3G80A 5JXHA 1LEDA 1PIV2 4F8AA 4B3TO 2P6CA 3CRCA 2D6LX 2ILMA 3K77A 1UY2A 4LBQA 3IZOA 3VBHB 2DW4A 1AR63 4DV2O 1MMMA 5LY2A 3WDTA 1O8SA 2AENA 4EN7B 2JGDB 1R3JC 3ZFFC 1U12A 1X4TA 1QJY1 1X9TA 3IWZA 4LBJA 3U37A 1HXS1 5FRAA 5LXTB 4B3SB 4NR1A 1W28A 3W21A 3AYCA 3VBBA 1J83A 4IL7A 3WT3A 1W2NA 1R6NA 4LF5B 4WM7B 3OD0A 5FNVB 1Q8OA 3B69A 4AFAA 4R7CA 1UMHA 1YJKA 3A0KA 3OYWA 1ND2C 1IBKO 4YG6A 3CEWA 1MOFA 1K12A 3VBUA 2EIEA 3AL5A 1CR7A 1PL4A 3ZSKA 3LSDA 3N9NA 4AE2A 4CU9A 1HKDA 1DCSA 1H2MA 1FMD2 1J5EO 5GJ6A 3QVNA 4RHV3 2YU2A 3LDBA 3MPPG 4AEKA 4YFWA 4E8CA 5LYJB 4CZZA 3IAQA 3AZXA 1RUNA 4CEWA 1GZCA 1OFSA 3B93A 4ZI7B 3T4HB 5J1XA 3ORJA 1XBFA 1VF6A 3RYFA 2B8MA 4ZHQB 5BNNC 2CHHA 4QPKA 4YIOA 2Q30A 1HNZO 4K8RB 4DV0O 1PM7A 4QB1A 1IG3A 1W9FA 1U0AA 3C2UA 5JIUA 2A1XA 2ET1A 1CPMA 3AMPA 1APNA 1J95A 3NV2A 4DV5O 1FAYA 1JR9A 1M4WA 2GC2A 1W0KG 2JEMA 3LDDA 2WL1A 4QX2A 1YUDA 1N0NA 1ZM1A 4MVMA 1L7QA 5IFPA 4UBGA 2D7FA 1C28A 2HVJC 2AR6A 1SLTA 4AL9A 1QH6A 2VNGA 3TBDA 1S1AA 1K33A 2R043 5CFDB 3UGHA 4Y5Z0 5CYYA 5A70A 4Q4V1 5FYSA 1C8M1 3MI8A 2DYSB 1VQ6V 2OYQA 5C8YB 4ARYA 4EQVA 3ZFFB 2XJSA 4TLGA 3FAVA 1RVF3 3WG2A 4MGIE 2R9RB 5KC5A 5I91A 4XF1A 4I0XA 2IFRA 2LGWA 3ZBHA 1W2TA 5JWPA 3LSQA 2VTXA 4YVWA 4YW2A 1AF9A 4HK9A 1ZBE3 4YNIA 5C8CB 2VCAA 2WZR1 3E89A 4CXWA 4OZXA 4RHV1 1UOBA 2ZXWC 1DF0A 2RM23 3T4DA 2TBVA 1GM8A 4C1WA 1X8EA 2VBBA 4X1YB 2RE9A 1KKDA 4EZHA 1FFXA 5IT9N 3B9IA 3RS6A 1KMIZ 2MEV2 3I7DA 5JH7A 3JCZA 3QO7A 2ZJCA 3ZO0B 2BV4A 3VQXA 4I7ZB 3DTUB 2QA4V 3T1MA 5FZOA 3IDAA 2OA2A 4RQPC 1FX5A 4WM7C 1VQKV 2W5FA 1ND3C 4K8FA 4ISRA 1PIV3 1PKXA 5ERLA 4WM8C 1JMKC 5EP9A 5KA5A 3JD71 5FXWA 3WB2A 1QIQA 3LWCA 3CQOA 4TQFA 4TYSA 2JWPA 1GN2A 3FL7A 1Y6XA 4ABMA 4FAHA 2OKXA 1DF4A 4DUYO 2YUEA 2XMLA 3ZYPA 3OUJA 3B8NA 4OX9B 4QXHA 1NCRC 4URTA 3LIGA 4UOJA 3KCXA 2W94A 4LBQD 3PUQA 1MZ5A 1XQ8A 1Q43A 3H8OA 2DMXA 1NKGA 1UO9A 5D1IA 4RL7A 3N7KA 4TUYA 5ACA2 3N4MA 4KGQA 2JG8B 3AX4A 3RYPA 5IVEA 1KKCA 3C7HA 4Z1VA 1R1BA 2BWAA 3I3BA 1FNZA 4HKOA 4YGDA 3AJZA 2Z2SB 3ICXA 1JOJA 2D3PA 3D4KA 2A6XA 3VDAA 4JV5B 3MGUA 3ZYBA 3WP5A 5HXMA 5FWJA 2QCSB 2JGDA 2EIJB 1OD5A 2VO5A 4PDWC 2WR9A 3THTA 1FATA 4A3XA 3HAGA 4BU2A 4EN8B 1RUC3 4CS3A 5EJ3A 1W05A 2OQ6A 2UWAA 1OLRA 2Y0PA 4HFSA 2DVFA 1YF2A 3WG4A 5CFCA 1R093 1EPZA 2BGCA 1VB2A 5JDBA 2R16A 1H8HG 5DABA 4MVOA 4QX3A 3IDBB 2EALA 3WNMA 5CISA 1AR72 2HLDG 3JUUA 4B4QA 4ZHQA 3D0SA 4MUVA 4FIPC 3WHUA 4CDWC 5F6KA 4BZ4A 3DC6A 3LSUA 1CEZA 1GP4A 3AZZA 1U5ZA 3H7YA 1QU0A 1WPXA 2W2IA 4GUNA 3N7JA 3Q8AA 2VVEA 5I8YA 5ABJA 1ZWIC 5KXDA 4H13B 3K51A 4AFCA 2K9PA 2YC2A 2V4AA 4JGSA 3F5TA 3ZYJB 2IXCA 3MIFA 4ZU4A 1IBMB 2SBAA 2ZGUA 3E6CC 5IY5C 2P3YA 2V73A 4YSFA 1TVGA 3VD5A 5T54A 4LBOA 1OURA 4XBLA 4C90A 3ASNB 4LK6A 1XOUA 1W6QB 4DNYA 1SRYA 3NAPA 3LNNA 2P5OA 3WY6A 1G7YA 3OUIA 4QU2A 3J81N 1S5LZ 1R6KA 2Y0IA 1LUVA 4CUBA 2EIBA 1JZ8A 5FOJB 1VQOV 2EA7A 3AMNA 4XILA 1W2OA 3UV9A 1K92A 3JSNA 2BW8A 3ABMC 4NRQA 1LOCA 1UXXX 4NPLA 4C1XA 3VKLA 3ME2A 4IEOA 2YXHA 5K7PA 3MF9A 4F6EA 4OI2A 3CHXA 2YUAA 2XBO1 5F2SA 5JIAA 1J59A 5EZYB 4KI5M 5A3PA 2ZGNA 3GVMA 3LEGA 3ZIWA 3CD6V 2XGXA 5LRRA 4XFGA 5FLXN 2J42A 5EBLC 1MG1A 1W6NB 1CN1A 2QQVA 2HHHO 4XXAA 4N8MA 3U0ZA 4JHZA 1NJIW 3I5DA 3LCPA 2Q0OC 2NM1A 1H4GA 2HWC3 2ZX3A 1HRV2 1AROP 2W0FC 3WG1A 5B4XA 4E8DA 2WIIB 1UMZA 5LBFA 2BPA2 3HPNA 1HQNA 5HCFA 1TE1B 2VWKA 4M3CA 3N2GA 5BV6A 3JCUZ 2VL4A 2WABA 4XIKA 3ZR6A 5FYHA 4LF5O 2GC1A 4Z82A 1S55A 2F4LA 2VMGA 1BBT1 4HK8A 5A9GA 2NZ9A 2PGGA 3H0OA 3H8RA 3TJTA 3RYIA 5KHGA 4P5HA 5FZ1A 3POFA 2UU9B 1SLLA 4X1YA 3ZMUA 4XFFA 3VBOC 5AC91 3WP3A 3EHKA 2CL2A 4Y5SA 5G05L 4O2BA 1GZWB 1XQNA 2VOVA 1ZA7A 5LMUB 4QD2A 3OYWB 3U78A 1P7BA 3ZLIA 1ZLZA 2WNUC 2R9AA 3CEIA 3FKSG 1N8RW 3D5OA 1VP7A 1IQDC 4BK5A 2RDNA 3I55V 2ARCA 2BGOA 2GMMA 5E16A 3GJAA 4B7KA 4UBHA 2ZDIA 2WZEA 1OQDA 5KX5A 3JATB 3LEIA 4JGZC 3ZYGA 5DEDA 5EJ1B 1XSRA 1BZKA 1CESA 4IGPA 3AMHA 3OOXA 4IEWA 3LA7A 4COVA 2AHZA 2V5DA 2GC3A 1XHXA 3F2ZA 5FZ6A 3VZMA 4I9WA 4YRDA 3FX3A 4X1IA 3SH5A 3S5AA 1ASJ2 5GALA 3UT0A 1V6LA 1NR7A 2FDKA 1ZYBA 5A6XA 1I94O 3EXAA 4W65A 1CXZB 4GB31 2JDMA 3WF3A 4AAXA 3HWJA 3VD9A 1ULGA 2HJDA 1QGLA 3B94A 1R73A 1E5RA 5BNNB 3PUAA 4Q4Y1 4CEYA 4P00B 1J1LA 1NY71 4EN9B 1EPWA 4YW3A 3OFNG 3O5SA 5JCTA 3NV4A 1IURA 1YNAA 2BU9A 2QTOA 2NN4A 3ZHTA 1YHQV 2V7QG 2FDHA 4UXAA 3QO5A 3KWVA 2QDRA 5F3IA 5F5QA 4ZZ8A 5A1AA 4GMP1 3AVSA 5KXBA 4LWSB 2N74A 1OA3A 2PXJA 4HSLA 4PJ0Z 2QQWA 1QR8A 4AHYA 5FMOS 2D3SA 1XYPA 4XF4A 2BOCC 4BMEA 2W08A 4S2HA 5B2GB 1S3JA 4U7NA 1ZRFA 1CD3G 4AVVA 2K1EA 3T3YA 2F43G 5FP9A 3VBOA 3K3OA 4N90A 4X8AA 4CCDA 3KD4A 1LESA 2CH7A 3L75H 2HWB1 2XJPA 2EX3A 2C0ZA 2OZ6A
chains in the Genus database with same CATH topology
1CAVA 3UKVA 2EAAA 5DDJ2 3FBYA 1HQLA 3ENRA 3VBRC 2HWC2 1VAVA 4OHXA 1N3PA 4KQ7A 5FFOC 2O8OA 2Q1MA 1GNZA 1OS7A 4FPLA 1GANA 4RS5B 4QM8A 2NLRA 3O0VA 1HRV1 4CDQC 1R092 2H0VA 3EO6A 5FLIA 1YFUA 4LE3A 1TQ5A 1EV13 3BCWA 4AI8A 4IV1B 5DG1A 1COV2 2WSUA 4D94A 1FMD3 1D4M2 3VBFC 2R061 1ZBA3 2VH9A 5GLUA 1ULEA 2DTWA 2NPIA 3KGZA 2PHFA 1XNDA 2A71A 4KH9A 1UKGA 2P37A 1CAUA 1WCKA 1TME1 2IXHA 1F5JA 4JDNA 3V17A 2VXRA 3IMNA 3SCGA 2GNBA 1CQ9A 4CP1A 5L7OB 3O0XA 3CO2A 1GQWA 4CRQA 1MZ6A 5DG2A 1H2NA 4LA2A 4OVEA 4YVSB 4I3GA 4IV1C 1XNKA 3HD8B 1AX2A 1FXZA 1RUI1 5C9AA 2PELA 2B42B 5FOBB 2HWD3 4LO4B 2B45X 4YM2A 4AVBA 2IZWA 2JE9A 4KL1A 2A6VA 5JPMB 4Y20A 1DYPA 5FPXA 2VOKA 1W6MA 1BVP1 2Q8OA 3IM0A 1NX4A 1AYM3 1H9PA 3WDUA 3OGJA 1N1VA 3AKPA 4YARA 2IWGB 5BNOA 5FTTC 4E4ZA 5A3MA 3FFZA 3NV1A 4CP0A 5AVPA 1R1A1 5C4WB 2G9FA 2R30A 3WOGA 4BH9A 5L19A 5GZGA 5TSWA 1MEC3 3TN93 2HWF3 1OIHA 3AKQA 2PHRA 1SLCA 3CJIB 4IERA 1DYKA 2VUJA 2GH8A 3KCYA 1I6XA 2ZGOA 4U36A 4OULA 3KMHA 4GQ7A 5A3LA 5IK7A 3POYA 1DU3D 1VBB3 2JDZA 2CAVA 1W6MB 1I3HA 4JTOA 3T1LA 4CEYB 5C6CA 3W59A 4AHZA 1LRHA 1ZZ8A 4HVRA 4MGYE 2KA3A 4MLOA 3RMXA 2P2KA 2R042 1O5UA 2WFF1 4B29A 2CWMA 1DG6A 5JI9A 2NN8A 1W6OB 2R073 5K0UC 1VBA2 5D8AC 1HRI1 2OUHA 3FWEA 2EVXA 3ILFA 1HRI3 1RUG2 2VQAA 5IUQA 1REEA 2PLV1 4UW5A 5L7OA 2D6MA 2WC2A 1ZZ9A 5JSPA 3RWNA 3ZFGA 3RZZA 4YFZA 1RB8G 2R49A 1G6NA 2C9AA 2HWB3 4MYEA 1NE4A 1QHDA 3DF0A 4LR4A 2E9QA 3AYAA 2EXKA 4M23A 1BXHA 1RUH3 1S0CA 3VZJA 4C0HA 1SBFA 1YLLA 1OTJA 1V6MA 2WNUA 1OFNA 2JG8C 3GZUC 2G9GA 1AYN2 1OPOA 4FPFA 3VHOA 3NKGA 4J1XA 3B01A 3IDCB 3PTYA 4K20A 5BNPC 2P3KA 3D6EA 2DU1A 3JB8A 4AWDA 1AXZA 2R6QA 3M3OA 4AFBA 3S30A 3LB9A 1AYM1 1GNHA 2GMPA 1CJPA 4CYDA 3M1HA 1AVBA 1C5HA 5K8SA 5LRSA 1BMV2 1Q56A 4WBBA 1EV12 1N3QA 2D6KA 4IETA 1DS1A 4YW5A 3VKFC 3JQWA 1N1TA 3KSCA 1G9CA 5J37A 2AREA 1LOGA 4SBVA 1ZZ6A 4IV3A 2PA7A 4GB32 3FZ3A 2ZHNA 4LE4A 2PHXA 2QJVA 5CNAA 1PGW2 3ZYIB 3VBFB 5JVVA 3ZFEC 3JQXA 3GZTB 4QPGA 1H30A 1AJKA 2ZZJA 3PVBB 4CDXC 4DMIA 1O7FA 1V70A 4QQLA 1Z78A 2ZHKA 3ZIXA 3ZXEA 4C5WA 4JGZB 1BYHA 5BXXA 3WW1A 5AC92 3ZMOA 4COUA 2DUQA 3AYEA 3HT2A 3MIDA 2DCJA 5DZEA 1ZNPA 4Y22A 2PYTA 1PK6B 5BY5A 3KGLA 1J3QA 2HWE1 1UIJA 1V9U1 4Y22B 3V56A 3NAPB 1O91A 4GH4A 3WV6A 1AYN3 1VBC1 3FE5A 3VKOA 4D69A 4CDQA 5I93A 1VBD2 2W68A 1KJLA 2X8KA 3E5UA 3ZXDA 4EWDA 1NQJA 1U5XA 1QJU1 2PLV3 2XH6A 3IPVA 3N7MA 5HBAA 1MAC<