5LL6Y

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
GRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIGVLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00312 Ribosomal_S15 Ribosomal protein S15
Y PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5ll6Y02
5BXZA 3J80N 4JI4O 4DV6O 4LF8O 2Z0AA 2DJVA 4JI0O 2JRIA 2UXBO 2UXCO 4A5UB 1R6TA 5BR8O 2UUCO 4OPHA 1XEQA 1J5EO 4DUZO 4OX9O 4X65O 5H5NA 4JI3O 2LW7A 3T1HO 1G1XB 2E5LO 4B3SO 4DR7O 1KUQA 2ZM6O 5LL6Y 1AILA 5LMUO 4LF5O 5LMNO 4JYAO 5IWAO 1XMOO 4DR4O 4DV1O 4B3RO 4LF6O 2HHHO 2UUBO 4LF4O 4DV5O 4YY3O 1N34O 3O65A 2AGAA 4AQYO 3J81N 3R66A 4DR1O 4GKJO 4KHPO 4X64O 3JAMN 4LF9O 3M8AA 4DR6O 4DR2O 4DV2O 1FKAO 4JV5O 1D2DA 4GKKO 4DR3O 2ZKOA 5BY1A 1IBKO 1F7YA 4JI5O 5IT9N 2DOSA 4JI1O 2UUAO 2VQEO 1HR0O 1YZBA 2UU9O 4JI8O 1HNWO 1X59A 1XNQO 5FLXN 4NXMO 4JI7O 2UXDO 4YHHO 4JI2O 1HNXO 4LFBO 1AB3A 4X66O 1A32A 1FYJA 4LFCO 3F5TA 1R1BA 4B3MO 1I94O 1IBMO 3J7AU 3OTOO 4DV3O 4DV4O 4NXNO 4DUYO 4DV7O 1IBLO 4K0KO 2VQFO 2N74A 1HNZO 1FJGO 3T1YO 1XMQO 4DR5O 3SDLA 1NS1A 1N36O 4OPAA 5A2QN 4JI6O 1XNRO 4LFAO 4X62O 4B3TO 2F4VO 1N32O 4LF7O 3RT3C 4DV0O 2FKXA 1DK1A 1N33O
chains in the Genus database with same CATH superfamily
2IU3A 3FAVA 4GX0A 3ASOB 5J9PC 3MHHC 1R6TA 4O2BB 1BT8A 2WLNA 1YTFD 3SYPA 4K8ZA 4FM2A 4OX9B 2R70A 2E76B 4PDMA 2E5LO 4MS2A 5B1OA 1NTMH 3HKDA 1O9GA 1AR5A 2P4KA 2QSAA 1NQTA 2XAGA 3CRRA 2ZM6B 3WU2Z 1VF6A 5IYCO 4LF6O 4YY3O 1U97A 2CAZC 4E4EA 2WLLA 1OCCB 2XUMA 3P32A 5DM6V 1SZTA 3OE7G 1F51A 4GUNA 3CJHA 1Q90D 4F6RA 1YI2V 2ZXWB 4RO2A 2DYRB 1NH2B 4UV9A 2MK3A 5JQGA 1GAXA 2ADPA 2CGNA 3C3SA 1YZBA 1HR0B 1F23A 4MTFA 3CCVV 3ZHQA 1RM1C 2UXNA 3LSUA 2EIJC 1Q7YW 2HP8A 3E2EA 1YJWV 1FXKB 4YHHO 2Y69B 2PZSA 2H8PC 5HFMA 4DV3B 2ITDC 1VQNV 2BOCC 1JMKC 3T1YO 3SPGA 2QE7G 4TQDA 5LA6B 2EILC 4PJ0Z 2LQTA 3M7MX 3ZJZA 1W2BU 1TA8A 1N4CA 2Y48A 3ABLB 1Q43A 4B7KA 1MG1A 3K3WA 2ZD9A 3K0GA 3TGUH 2Q8VA 4B3TB 1EFRG 1N32B 5KX5A 4LF6B 2A7WA 2P5OA 3J80N 3OR6C 4YY3B 2HG5C 3QNEA 5GONA 1DGSA 1WB8A 2NNUA 2OT5A 4LF8B 1EN4A 3OEHG 1XOUA 4KP4A 1KQSU 3B2EE 2O57A 5LGNA 2F43G 4DR7O 3CC2V 1PNMA 3K9SA 5C8YA 4RQEA 1K3EA 3E8FA 3CXCU 1M56C 1XHXA 1XMOO 1NVPD 3RN4A 3CRCA 4X8AA 2VWKA 3J81N 4LF4B 1QNMA 4IGGA 1MSWD 3JARA 1URFA 2R9IA 4X64B 4TV8A 3FB6C 2M6YA 2JGUA 1OJHA 4QPJA 3KCYA 4DR3O 2KQXA 3BEHA 1H2NA 1RFYA 4P9OA 2PI4A 1F7YA 2ZKOA 2P6JA 3RFRA 3G71V 4H33A 3N27A 4JI5B 5H6RA 4Z2WA 4LH6A 2LGQA 1MZFA 2AZ0A 4WFBV 1PD3A 1AJPA 4PA9A 2K9PA 1H8EG 4JI2B 4X66O 3BY6A 3MHSC 3OFNG 1QHTA 2D2CB 1AJQA 1UJWB 1K7DA 5LXTB 4CH4A 3TCUA 5LP6B 1M57C 3FYEB 1OV9A 3G67A 4MVZA 1JPXA 4QGPA 4YJ2B 1N36O 1KECA 4ABMA 1WB7A 1ENVA 4JI6O 5D5QA 1DF5A 1K9MW 3RYFB 1AR1B 3L75H 4X62B 4BW5A 2CTQA 1DK1A 1ZAUA 2XOKG 1N33B 1JQ0A 1AP6A 2HLDG 4J7ZA 5CN0A 2UXBB 2XAJA 4TOIA 5ITZA 2HFEC 1J5EO 4BIZA 2AXTZ 4NYKA 4MVRA 3SYQA 2PGGA 4AI8A 4IHJB 2QWOB 1R3JC 4I9QA 1KUQA 4J10A 1Q6UA 1SQFA 4UFZA 4JYAO 1SF9A 5IWAO 2DWDC 1JR9A 2GUZA 5FNVB 4LBEC 1S77D 4B3RB 4LR3A 5CMUA 1DTOA 1PNKA 2IH3C 1XL4A 4IT5A 1I5XA 3JASB 3JD1A 2KSDA 2GDSA 3K5LA 3I56V 5BMVB 4DRXA 2FTKA 4MT8A 5F2VO 2Q67A 2HVJC 3CX5F 1YITV 3L9DA 2UU9B 4GT1A 3JATA 1HNWB 2IH1C 2Q5ZA 4IIJA 2DQ3A 4L87A 2YI8A 3JCZA 1EBOA 4LFBO 1QVGU 1A32A 4BAYA 2X6BA 1W0KG 4NR1A 4WCEV 3P3PA 1IBMB 1S0VA 3OTOB 5GTIZ 3RW0A 4LWSB 4DUYB 1YVWA 3IJ4A 2R9RB 5L3BA 5TISZ 2VRZA 5IYZB 2JGDA 4K35A 1VQOV 5FPOA 5EC2C 4D7SA 1KYOF 1Y6XA 4EKWA 1UFIA 1L1FA 3Q4HB 4CC6A 1XNRO 2Q69A 2QA4V 3WB0A 5JJNB 2QTSA 4LFAB 1NZ6A 1SKVA 4JYAB 1AROP 2EINC 5LGUA 2YIBD 2Q6AA 3IAYA 3RBZA 3K5MA 3CCUV 3E8BA 2QEXV 4FZ1A 4X1YB 5L3EA 2R9AA 3AG4C 3E89A 4W4LA 5BZBA 1SQPH 3E8HA 2EULA 1SQXH 5JVDB 1KC8W 4AHCA 1VARA 3ZEDA 4WBNA 1Q6HA 4DUZO 1Y74A 4JF3A 4W4KA 3UT5B 3FB7C 1IURA 3DC6A 3IGAC 2CUGA 3T1HB 4PA3A 3QTCA 5J2UB 1QU7A 3BFRA 5EZYB 4CH6A 4DV1O 2HHHO 5E79Z 2PY5A 4DV5O 1AR4A 4DW1A 1IXMA 4KHPO 5EYPA 3L72H 3OD4A 4DR6O 3K03A 1K5SA 2JDIG 4RAIA 1NJIW 4O4IB 3E86A 1B06A 1XREA 4WFAV 2Y0PA 2DWEC 5IJ9A 4JI1B 2VQEB 1VQPV 5H2FZ 1V9PA 1OHHG 2AHYA 3CB2A 3IC9A 2Q0AA 1JJOA 1NTZH 5D5PA 4FLTA 4JI7B 4FIPC 2HJFC 1PL4A 1PV0A 4UVCA 1Y4MA 2W6IG 4DV4B 4K0KO 4X1IA 4DV7B 2QTOA 5JJJB 4GX5A 3ZS8C 3CC4V 4DR5B 1H38A 2P06A 4J42A 1COWG 2QWNB 4IL6Z 2W0FC 1G6UA 1Q5OA 1MMMA 3CE2A 3DXRB 4J9YB 1H2KA 4BW9A 4CBCA 3G4SV 3ICXA 5KAIZ 4LF7O 1SRYA 2DW4A 1XILA 1M1KW 3ZN1A 3AG1B 1XL6A 4UVAA 2JRIA 2CTPA 3HR0A 1NU1H 2UXCB 3SPJA 2OTJV 2KB1A 1SESA 1K4CC 3E35A 4UCSA 5C93A 2CH7A 4LF5O 1OCOB 5LMNB 4F4LA 2EIMC 4DK1A 1ZL8A 2W6JG 2QWQB 5E1AC 4UCTA 4AQYO 4TT3G 3R66A 3DC5A 1R3KC 1M5IA 4KFMA 1VF6C 4NKGB 2XTAA 3UCSC 4Q6GA 4QE9A 3ZMZA 2F95B 1GN4A 2WAMA 2QJ1A 5IT9N 3THOA 1GTOA 2QKCA 3JALA 4JZGA 3T2MA 3CWBH 3IFXA 1U96A 2Q73A 3RYIA 4G2KA 1R73A 3ZHVA 1NKDA 4I55A 3ABKC 4NXMB 3SPCA 5IYDO 1QBZA 2IBZH 1HNXB 1XQ8A 3F5TA 1Y76A 3QF7A 1I94B 3RYHB 5LOVB 1IBLO 4BIOA 2Q7GA 1RPRA 1KD1W 1OCRC 3N2GB 2CTWA 4EFEA 2JVDA 4HBNA 4PV1B 2ZQMA 3D36A 1SA0B 1THZA 4QE7A 5B1NA 2FB5A 4I4TB 3OMNB 1SQVH 1GH6A 1R3LC 3WG7C 4U3JB 4YXWG 1IX9A 2Y4UA 3ETEA 3KCXA 2AW9A 2IM9A 3W7XA 3X2QC 3E83A 2Q4PA 3CCQV 5JH7B 4B7EA 4LNUB 2UUCO 1AI7A 2XAQA 1XEQA 3CRMA 1QR9A 3CD6V 3BA9A 3BCCH 1RPOA 5CBGA 4B3SO 5FL7G 1WA8A 4X20A 5FPRA 4Z1MG 4CS2A 3FAVB 2UUBO 2JJ2G 3NXSA 1P7GA 2ZCEA 2ZIMA 3D3QA 3AK2A 4O4JA 4GKJB 3JAMN 3B8MA 3K04A 5IYBO 4WF9V 4RUFA 2C2AA 3HKDB 1CEZA 1HW7A 4DV2B 1RP3B 2JS3A 3BABA 1JOYA 1FFTB 2UUAB 3APQA 4WFFA 3EXAA 4FFKA 4KXRA 5EIBD 4D6TH 4UB6Z 3SJAC 4Q20A 4FVMA 2IU0A 4F6RB 4X1KB 1XNQB 2V4DA 4FLVA 3CCEV 2WLMA 4O2BA 1BMFG 5JQGB 1HP8A 2EIKC 1O9HA 4NXNO 2LW1A 2OCCC 3SJBC 1B6QA 1H8HG 1W59A 1Z2GA 2N74A 2VQFB 1HNZO 3LNNA 2YEVA 5L3GA 1OCZB 1VIBA 3LUTB 2RQ6A 1I0HA 4MW8A 3EFFK 1YF2A 1PP9H 1UPGA 4H44B 1HWYA 2ZDIC 1GM9A 4NB5A 4I7ZB 2OIEA 1AJNA 1V54C 2F4VB 2NLJC 3SJQC 3CCMV 5IY5B 4JI0O 4YIPA 1QLEB 1YIJV 5BR8O 1Q3EA 3CCRV 4O2AB 2PF4E 1AILA 3JSLA 2E5LB 3QO5A 5KX5B 2L6LA 4IYHA 5B66Z 2QKAA 5GONB 3FB5C 1MZEA 1Q86W 5KA6A 4EB6A 3UKMA 2WLKA 2Y4TA 1K8AW 2LFRA 3SGIA 1W0JG 5CB4A 3ZRVA 5C8YB 4JV5O 4UCOA 4PDVA 2KG7B 4J9ZB 1AI5A 1WNSA 2A3QA 5J2TA 1PKXA 4J7JA 2JS5A 1FXHA 3OGCC 2E3CA 4FFBA 3JARB 3H1KH 4FM0A 1EM1A 2IJHA 2UXXA 4TV8B 3UQ8A 3APOA 3CEIA 3D8CA 1AB3A 1PL0A 4YHHB 1ZWIC 4H0LB 1GM7A 1N0JA 1BCCH 3BPZA 4PA7A 2OYQA 4KUMA 3ZRWB 3W7SA 4ZKIA 4ZIBA 5LHGA 3LDEA 2KKWA 1S72V 4O4LA 1XMQO 3T1YB 1NR1A 1NI8A 3G6EV 1XHZA 1YSCA 2RN9A 4J11A 1AVMA 3QVNA 3K9AA 1RM1B 2EIJB 1GK9A 3ZMSA 3K0DA 1K33A 4HNAA 3H1IH 3ABUA 2XHBA 1LUVA 5CBFA 2F66C 1FPOA 5EK0A 4LH7A 2RMKB 2ZDIA 4GYCB 3A0BZ 2G38A 5LYJB 3STZC 1DF4A 2EILB 3OGIB 1G1XB 3CXHF 2QR4A 5LL6Y 3W7WA 4QIWF 4DR7B 1WP8A 4J80A 3OW2U 3TJTA 4LC1A 5LXTA 5B1BC 5LP6A 1XMOB 1N34O 2ZE8A 3MAQA 5ITZB 1M93A 2WWWA 3L71H 4LF9O 3QO8A 3VQYA 2HR3A 3AK3A 3JYCA 4YJ2A 4U7NA 2A79B 4DR3B 3G80A 5KUMA 5KA5A 1NH2D 2XNDG 4MVOA 5B3SC 1M56B 1JJ2U 3L74H 1NTKH 3AG2C 4PA4A 4UXNA 1N8RW 4JTCB 4X66B 3STLC 5DEDA 1FFXA 2Q7EA 4FLZA 3ZHUA 4JAVA 2W0XA 1LR1A 3SYAA 2JIZG 1PM9A 1TUBB 1K5QA 4J41A 2OCHA 2JK5C 4UCVA 4E2LA 1N36B 3JASA 3P30A 1K92A 4FPPA 3K57A 4JI6B 3ABMC 5BMVA 4DO2A 4ICGA 3F7YC 1BZKA 4K3AA 1TAEA 3RYCA 2JGDB 3N2KB 2B9ZA 4I0XB 4JI4O 2GBOA 2Z0AA 2GV9A 1M57B 3FKSG 1CXZB 1JFFA 2QM8A 1GM8A 3K79A 3JD0A 1J5EB 3W7UA 1N0NA 3JAKA 5EC1C 1BGYH 3E22A 4NTWA 1M90W 5IWAB 3CPWU 4DR4O 4LWSA 3K08A 2A06H 2OIGA 1EN6A 4DR1O 3ZBHA 1G4YB 1MNGA 2F93B 2IJJA 4P2ZA 4GKKO 3RWRD 2GTSA 1IBKO 1YJ9V 4ZI7B 1WN7A 3AG3C 4FLWA 2R72A 3K5OA 5EYPB 2H3OA 4X1YA 4I50B 2YXHA 5FLXN 2UXDO 4XDLA 3H1JH 5JVDA 5KAFZ 2A9HA 1IZ3A 4LFBB 4CC5A 5KHIA 4LFCO 1K73W 2D3OW 3UT5A 1AP5A 3H9VA 2ATKC 3FX7A 5KMGA 5J2UA 1PPJH 5EZYA 1FJGO 2WLIA 2P90A 2LO1A 1Y66A 2RJZA 1X4TA 4PA6A 1ROPA 1E1QG 2AZ2A 1TGOA 2QGNA 4X1IB 5KLVH 1KU9A 1XNRB 2NR5A 1GMGA 3D36C 5B1AC 1YDXA 3RT3C 4DV0O 2FKXA 4X9QA 4DV6O 1V55C 1NBMG 1TVKB 4JTDB 2XASA 4I9WA 3ZCCA 2ITCC 4X65O 1VQ6V 1R6KA 4JI3O 1WAZA 2LW7A 4DUZB 2QWPB 5LMUO 2ZNJA 3AG7A 3K59A 1VQLV 4JPRA 4X89A 3CHXA 4DV1B 3JSNA 1M9NA 3TXSA 3UM7A 2HHHB 4DV5B 3ZHSA 2QDOA 4ASUG 2EINB 4KHPB 4DR2O 4R7CA 2CH7B 5CA3A 3AG4B 4DR6B 1FXVA 3ASNC 2DYSC 1BQZA 4TUYB 3DXRA 4RQFA 4MTOA 4O4HB 4CZZA 5K1PA 2E74B 3U11A 3ZMVA 4JI8O 1P49A 1ORQC 3BRCA 4U3FH 2BTQB 5CA1B 4P9PA 4YJ3A 4OGQB 1BQ0A 1RSOA 4GX1A 4PHZA 5CA0B 1KBHA 2ZINA 3ASOC 3HKBA 3B8NA 3UO3A 4K0KB 1WP7A 1SERA 1OZ0A 3RYIB 4N21A 4DW0A 4I55B 4ZOLA 3HKCB 3VQXA 5H9CA 4H13B 1H2GA 5IJ0A 3CC7V 2OTLV 4H37A 4MW3A 1OCCC 4TV9A 3ETGA 4LF7B 3T4DA 2ZXWC 2YDEA 5K1XA 4G27B 2DYRC 3AK1A 3TETA 3JCUZ 1VF5B 3ML0A 3LDDA 4QPKA 4OX9O 1AI4A 3G6BA 2LJ2A 2IJKA 3JAWA 2ZM6O 3FD9A 3HKEA 2BSKA 4LF5B 1VQ7V 5LGTA 1H2LA 1FXKC 5GW7A 2Y69C 3ZHTA 1PNLA 3KG2A 2ARHA 4Z1VA 4AQYB 1ZTEA 1VQMV 3ZRSA 1SQGA 1S5JA 1LNQA 1SC5B 4GX2A 1BHAA 1SA0A 4MSWC 3DSQA 1D2DA 4X20B 2PTMA 3LNMB 4I4TA 1ZX3A 1QVFU 3BA8A 3OMAB 2VS0A 2X6CA 1HR0O 3ZIAG 3JD4A 2CTRA 4O4JB 5EBWC 4L8JA 3ABLC 4HAMA 1EN5A 2EIMB 1ZUQA 4ZHQA 4LNUA 1FYJA 3CCLV 3OT7A 2X0LA 4DV3O 3ETDA 2P67A 5IDJA 1YCIA 1IBLB 1KKDA 1F4NA 2WLLB 1VMGA 5GTHZ 2V7QG 2RCVA 4OXSA 4TQFA 3A8TA 3CJHB 2N04A 4R8CA 2CGOA 1P7BA 1VQ8V 3ABKB 3CCJV 4B3TO 3WB2A 1JX9A 1N32O 4TSFG 2YEVB 3ZRXA 1VQ4V 5DN6G 1DLBA 2Q9LA 3LSSA 1GN6A 4LF8O 2DJVA 2K1EA 3BAAA 3O9OA 3OTFA 3QO7A 1GO3F 1SS3A 4X1KA 3P3NA 2UUCB 1OCRB 5L3FA 1Q8IA 4GZRB 2BTOA 4B3SB 1Z5VA 2B1IA 2DQ0A 3WG7B 1WPBA 4LF4O 4P30A 2AGAA 2UUBB 2EJ7A 5CBHA 2CDYA 2L35A 4X64O 3X2QB 5LBQA 1Q6IA 5LP6C 4XDJA 1FXKA 5HFLA 4FLYA 4JI5O 2DN9A 1EZVH 4DK0A 3MDSA 1VQ9V 3SJCC 4EB6B 5KHJA 3FYIB 1LUWA 3CCSV 1GRJA 2EZOA 3IC7A 3U0ZA 5CB4B 3VQWA 4JI2O 5LA6A 2IJIA 5KHGA 3B77A 4HZ3A 3ZHRA 4B3MO 4I5SA 1E1RG 3RVYA 5J2TB 2YC0A 4AILC 4O2AA 1Y67A 4NXNB 4KL1A 4BIUA 4FFBB 3TK1A 1HNZB 4MVSA 1I5YA 1YHQV 2YS8A 1S3JA 1KMIZ 3OR7C 2E75B 4K8XA 2JJ1G 2YIAA 4CS4A 4LCUC 5H6QA 5A2QN 2B1GA 4CS3A 4FZ0A 3CSXA 2KG7A 4X62O 2AHZA 2YIBA 4O4LB 2EIKB 2WLJA 2YXLA 3ZMTA 4MVMA 2Z3YA 1N33O 3SYOA 2HJDA 2X7RB 2OCCB 1R6NA 3H1LH 1T5EA 3K06A 2UXBO 4A5UB 4JI0B 4JGSA 3C3TA 4OPHA 3JD3A 5BR8B 4HNAB 1FD9A 5L3CA 1VP7A 2N05A 5L3DA 3E8GA 1XBLA 1YXBA 3H1HH 1MA1A 3ZRWA 4B3RO 2PYLA 3EVKA 4UVBA 2MW2B 1BHBA 4ZBMA 1V54B 2EZPA 3OUFA 3M8AA 3C90A 2QWRB 1G8MA 4UB8Z 4B3MB 2JEUA 2FYUH 3S3XA 3RGBA 4JV5B 3T1CA 4PD4F 3EHBB 1JVMA 4PI2A 4DYLA 2UU9O 1HNWO 1GN2A 2YIDA 4MTGA 5IE9A 3R65A 1K34A 1VQ5V 1CPYA 4FLXA 1L0NH 3K5NA 5AG2A 1R1BA 4UCUA 2QKSA 2ZT9B 3D3IA 1IBMO 3J7AU 1QCEA 3OTOO 2P22C 5LYJA 1J95A 4DUYO 3KZIZ 3GB7C 2GUZB 4XBFA 1VQKV 4EFBA 3RYFA 2ZE5A 3M99B 1AI6A 4GLXA 2CE4A 1L8DA 2ZE6A 1XMQB 3SDLA 2YI9A 1MSDA 2ZR3A 3FB8C 4QJFB 3CRAA 4OPAA 4DRXB 1FFXB 1WLEA 4LFAO 4IHJA 2PYJA 1US6A 2GSMB 4XDKA 2WLHA 4PELA 3JATB 2PUSA 1MABG 1BL8A 4IIJB 3S3WA 3OMIB 5FNVA 1F4MA 2LP7A 3HB3B 1QLNA 4JAAA 2A0LA 3A2FA 3LSQA 2JEXA 3OEEG 4PDLA 5H5NA 5JJEB 3T1HO 2LGWA 3AEIA 3RYCB 1P84F 4FJCC 3BVOA 1H2MA 1P4RA 3NR7A 2ILMA 1D5NA 3O65A 1TUBA 1JFFB 1S5HC 2BOBC 2EJRA 1N34B 3OAAG 2ZNIA 4FMTA 3PJSK 3JAKB 4CH3A 4J7KA 4LF9B 5EIBC 3QG5A 3E22B 2LFSA 1CP9A 1B04A 3W7TA 4JI1O 2VQEO 1XDCA 2F1MA 4EEQA 3CYOA 4TWKA 2PI5A 3N2KA 4QNHB 3LDCA 2ETNA 4WBNB 3SPIA 4I0XA 5IYZA 4JI7O 4PI0A 1R3IC 5B1BB 1Y74B 1S76D 4MVUA 5JCOC 2H94A 3AG1C 4DV4O 5EBLC 3Q4HA 3I5DA 4FK5C 4DV7O 4NTYA 3CRQA 3ETQA 2HVKC 2BCCH 3OUSA 4WFGA 2Q68A 3CMAV 2GHYA 3L73H 2WA4A 4JYCA 1KP3A 3DTUB 4DR5O 4YIOA 4LP8A 1WPXA 3OM3B 3CMEV 1ZSPA 1BS3A 1NS1A 4UV8A 5B3SB 1OCOC 4UUJC 2DMXA 2ADQB 2NN4A 4JZ2A 2QM4A 5IJ9B 1IVSA 5KMGB 3ZX6A 3AG2B 2Z5UA 4ZI7A 2WLIB 3CS5A 4BR6A 2ODMA 3B09A 4JAUA 4JI4B 2UXCO 4JYBA 4I50A 4U7OA 2P4VA 3ABTA 1NR7A 2YXYA 3JD2A 2OWOA 1I7FA 2CK3G 5LMNO 4O4IA 4DXWA 3RVZA 4DR4B 2P7TC 3ABMB 2VWJA 4WFEA 2XAFA 4IYIA 1YTFB 2YSUB 4DR1B 3KKYA 1IDSA 4R6ZA 3F7VC 1WJZA 3SR2C 4GKKB 5BY1A 2DOSA 3A0RA 2QM7A 1IBKB 1MOFA 4UCRA 2WPDG 4PDRA 3VQVA 4BWAA 1SZXA 4RUEA 2F23A 1BE3H 2HEPA 4NXMO 4JYYA 3UO2A 2UXDB 1HNXO 1VF7A 1KP2A 2X6AA 1TVKA 1B3QA 5A9GA 1I94O 4C7UA 4LFCB 1JCHA 1ZL8B 2Q7HA 4MVQA 4JASA 3GVMA 4GCZA 3WFVA 1GN3A 5JCOA 1Z5WA 4D7TA 3WB1A 3I55V 1FJGB 4YJ3B 3DGEA 1QQCA 1YEWA 4N23A 2XAHA 3AG3B 3ZN0A 3GWKC 4R50A 1RSOB 1E79G 5B5EZ 1NT2B 3HKBB 1XUQA 3CP1A 3JALB 4FM1A 4HYOA 3H01A 4TUYA 5KHHA 5KHKA 1FS0G 4O4HA 4ZOLB 1I08A 3B40A 3FFQA 3PN1A 1BSMA 4DV0B 1GKFA 2Q0OC 2ZE7A 5BXZA 2YUAA 2WSSG 4X88A 3K58A 4DV6B 2EBOA 5IJ0B 3MD0A 3L70H 2FMLA 2GTAA 5DECA 2BTQA 5CA1A 1Y76B 3VBBA 4NVPA 2RNBA 1JA8A 4X65B 5JWPA 4JI3B 2V1DA 5CA0A 1L0LH 4TV9B 3A0HZ 5LMUB 2M7WA 3B4SA 1K97A 1TUEB 4GKJO 1D5AA 5B1AB 3HKCA 4DV2O 1SETA 4G28B 3SYCA 3JAWB 1SQQH 1FKAO 4DR2B 1V55B 1ZLZA 3HKEB 2BSKB 3BHPA 4WFHA 2UUAO 3VOUA 1OCZC 1VEWA 1NVPB 1Q81W 3RYHA 4NTXA 2XT9A 1QR8A 5LOVA 1Q82W 1FAFA 4JI8B 1X59A 3T4ZA 4CH5A 5LHIA 1XNQO 3N2GA 1EZJA 1KKCA 2FL4A 2YICA 3U10A 3F5WC 1HDJA 5LHHA 3SPHA 5KUKA 4FLUA 1WA8B 2EX3A 2WA3A 2ZIOA 4RWUA 3HPLC 5IY5C 4U3JA 2VQFO 1H2SB 1SQBH 3ASNB 1QLEC 2HKOA 2DYSB 1XI1A 4JTAB 2RDCA 2B5UA 4ZHQB 3GWOA 4F6EA 2IW5A 5JH7A 4B08A 2BE3A 1S5LZ 4MTXA 3TXQA 2Y0IA 2ZR2A 1YJNV 5EBMC 3ZMUA 1IXBA 1K4DC 2F4VO 1KB9F 1M4UA 2DE0X
chains in the Genus database with same CATH topology
5BXZA 3J80N 4JI4O 4DV6O 4LF8O 2Z0AA 2DJVA 4JI0O 2JRIA 2UXBO 2UXCO 4A5UB 1R6TA 5BR8O 2UUCO 4OPHA 1XEQA 1J5EO 4DUZO 4OX9O 4X65O 5H5NA 4JI3O 2LW7A 3T1HO 1G1XB 2E5LO 4B3SO 4DR7O 1KUQA 2ZM6O 5LL6Y 1AILA 5LMUO 4LF5O 5LMNO 4JYAO 5IWAO 1XMOO 4DR4O 4DV1O 4B3RO 4LF6O 2HHHO 2UUBO 4LF4O 4DV5O 4YY3O 1N34O 3O65A 2AGAA 4AQYO 3J81N 3R66A 4DR1O 4GKJO 4KHPO 4X64O 3JAMN 4LF9O 3M8AA 4DR6O 4DR2O 4DV2O 1FKAO 4JV5O 1D2DA 4GKKO 4DR3O 2ZKOA 5BY1A 1IBKO 1F7YA 4JI5O 5IT9N 2DOSA 4JI1O 2UUAO 2VQEO 1HR0O 1YZBA 2UU9O 4JI8O 1HNWO 1X59A 1XNQO 5FLXN 4NXMO 4JI7O 2UXDO 4YHHO 4JI2O 1HNXO 4LFBO 1AB3A 4X66O 1A32A 1FYJA 4LFCO 3F5TA 1R1BA 4B3MO 1I94O 1IBMO 3J7AU 3OTOO 4DV3O 4DV4O 4NXNO 4DUYO 4DV7O 1IBLO 4K0KO 2VQFO 2N74A 1HNZO 1FJGO 3T1YO 1XMQO 4DR5O 3SDLA 1NS1A 1N36O 4OPAA 5A2QN 4JI6O 1XNRO 4LFAO 4X62O 4B3TO 2F4VO 1N32O 4LF7O 3RT3C 4DV0O 2FKXA 1DK1A 1N33O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXZ A;  3J80 N;  4JI4 O;  4DV6 O;  4LF8 O;  2Z0A A;  2DJV A;  4JI0 O;  2JRI A;  2UXB O;  2UXC O;  4A5U B;  1R6T A;  5BR8 O;  2UUC O;  4OPH A;  1XEQ A;  1J5E O;  4DUZ O;  4OX9 O;  4X65 O;  5H5N A;  4JI3 O;  2LW7 A;  3T1H O;  1G1X B;  2E5L O;  4B3S O;  4DR7 O;  1KUQ A;  2ZM6 O;  5LL6 Y;  1AIL A;  5LMU O;  4LF5 O;  5LMN O;  4JYA O;  5IWA O;  1XMO O;  4DR4 O;  4DV1 O;  4B3R O;  4LF6 O;  2HHH O;  2UUB O;  4LF4 O;  4DV5 O;  4YY3 O;  1N34 O;  3O65 A;  2AGA A;  4AQY O;  3J81 N;  3R66 A;  4DR1 O;  4GKJ O;  4KHP O;  4X64 O;  3JAM N;  4LF9 O;  3M8A A;  4DR6 O;  4DR2 O;  4DV2 O;  1FKA O;  4JV5 O;  1D2D A;  4GKK O;  4DR3 O;  2ZKO A;  5BY1 A;  1IBK O;  1F7Y A;  4JI5 O;  5IT9 N;  2DOS A;  4JI1 O;  2UUA O;  2VQE O;  1HR0 O;  1YZB A;  2UU9 O;  4JI8 O;  1HNW O;  1X59 A;  1XNQ O;  5FLX N;  4NXM O;  4JI7 O;  2UXD O;  4YHH O;  4JI2 O;  1HNX O;  4LFB O;  1AB3 A;  4X66 O;  1A32 A;  1FYJ A;  4LFC O;  3F5T A;  1R1B A;  4B3M O;  1I94 O;  1IBM O;  3J7A U;  3OTO O;  4DV3 O;  4DV4 O;  4NXN O;  4DUY O;  4DV7 O;  1IBL O;  4K0K O;  2VQF O;  2N74 A;  1HNZ O;  1FJG O;  3T1Y O;  1XMQ O;  4DR5 O;  3SDL A;  1NS1 A;  1N36 O;  4OPA A;  5A2Q N;  4JI6 O;  1XNR O;  4LFA O;  4X62 O;  4B3T O;  2F4V O;  1N32 O;  4LF7 O;  3RT3 C;  4DV0 O;  2FKX A;  1DK1 A;  1N33 O; 
#chains in the Genus database with same CATH topology
 2IU3 A;  3FAV A;  4GX0 A;  3ASO B;  5J9P C;  3MHH C;  1R6T A;  4O2B B;  1BT8 A;  2WLN A;  1YTF D;  3SYP A;  4K8Z A;  4FM2 A;  4OX9 B;  2R70 A;  2E76 B;  4PDM A;  2E5L O;  4MS2 A;  5B1O A;  1NTM H;  3HKD A;  1O9G A;  1AR5 A;  2P4K A;  2QSA A;  1NQT A;  2XAG A;  3CRR A;  2ZM6 B;  3WU2 Z;  1VF6 A;  5IYC O;  4LF6 O;  4YY3 O;  1U97 A;  2CAZ C;  4E4E A;  2WLL A;  1OCC B;  2XUM A;  3P32 A;  5DM6 V;  1SZT A;  3OE7 G;  1F51 A;  4GUN A;  3CJH A;  1Q90 D;  4F6R A;  1YI2 V;  2ZXW B;  4RO2 A;  2DYR B;  1NH2 B;  4UV9 A;  2MK3 A;  5JQG A;  1GAX A;  2ADP A;  2CGN A;  3C3S A;  1YZB A;  1HR0 B;  1F23 A;  4MTF A;  3CCV V;  3ZHQ A;  1RM1 C;  2UXN A;  3LSU A;  2EIJ C;  1Q7Y W;  2HP8 A;  3E2E A;  1YJW V;  1FXK B;  4YHH O;  2Y69 B;  2PZS A;  2H8P C;  5HFM A;  4DV3 B;  2ITD C;  1VQN V;  2BOC C;  1JMK C;  3T1Y O;  3SPG A;  2QE7 G;  4TQD A;  5LA6 B;  2EIL C;  4PJ0 Z;  2LQT A;  3M7M X;  3ZJZ A;  1W2B U;  1TA8 A;  1N4C A;  2Y48 A;  3ABL B;  1Q43 A;  4B7K A;  1MG1 A;  3K3W A;  2ZD9 A;  3K0G A;  3TGU H;  2Q8V A;  4B3T B;  1EFR G;  1N32 B;  5KX5 A;  4LF6 B;  2A7W A;  2P5O A;  3J80 N;  3OR6 C;  4YY3 B;  2HG5 C;  3QNE A;  5GON A;  1DGS A;  1WB8 A;  2NNU A;  2OT5 A;  4LF8 B;  1EN4 A;  3OEH G;  1XOU A;  4KP4 A;  1KQS U;  3B2E E;  2O57 A;  5LGN A;  2F43 G;  4DR7 O;  3CC2 V;  1PNM A;  3K9S A;  5C8Y A;  4RQE A;  1K3E A;  3E8F A;  3CXC U;  1M56 C;  1XHX A;  1XMO O;  1NVP D;  3RN4 A;  3CRC A;  4X8A A;  2VWK A;  3J81 N;  4LF4 B;  1QNM A;  4IGG A;  1MSW D;  3JAR A;  1URF A;  2R9I A;  4X64 B;  4TV8 A;  3FB6 C;  2M6Y A;  2JGU A;  1OJH A;  4QPJ A;  3KCY A;  4DR3 O;  2KQX A;  3BEH A;  1H2N A;  1RFY A;  4P9O A;  2PI4 A;  1F7Y A;  2ZKO A;  2P6J A;  3RFR A;  3G71 V;  4H33 A;  3N27 A;  4JI5 B;  5H6R A;  4Z2W A;  4LH6 A;  2LGQ A;  1MZF A;  2AZ0 A;  4WFB V;  1PD3 A;  1AJP A;  4PA9 A;  2K9P A;  1H8E G;  4JI2 B;  4X66 O;  3BY6 A;  3MHS C;  3OFN G;  1QHT A;  2D2C B;  1AJQ A;  1UJW B;  1K7D A;  5LXT B;  4CH4 A;  3TCU A;  5LP6 B;  1M57 C;  3FYE B;  1OV9 A;  3G67 A;  4MVZ A;  1JPX A;  4QGP A;  4YJ2 B;  1N36 O;  1KEC A;  4ABM A;  1WB7 A;  1ENV A;  4JI6 O;  5D5Q A;  1DF5 A;  1K9M W;  3RYF B;  1AR1 B;  3L75 H;  4X62 B;  4BW5 A;  2CTQ A;  1DK1 A;  1ZAU A;  2XOK G;  1N33 B;  1JQ0 A;  1AP6 A;  2HLD G;  4J7Z A;  5CN0 A;  2UXB B;  2XAJ A;  4TOI A;  5ITZ A;  2HFE C;  1J5E O;  4BIZ A;  2AXT Z;  4NYK A;  4MVR A;  3SYQ A;  2PGG A;  4AI8 A;  4IHJ B;  2QWO B;  1R3J C;  4I9Q A;  1KUQ A;  4J10 A;  1Q6U A;  1SQF A;  4UFZ A;  4JYA O;  1SF9 A;  5IWA O;  2DWD C;  1JR9 A;  2GUZ A;  5FNV B;  4LBE C;  1S77 D;  4B3R B;  4LR3 A;  5CMU A;  1DTO A;  1PNK A;  2IH3 C;  1XL4 A;  4IT5 A;  1I5X A;  3JAS B;  3JD1 A;  2KSD A;  2GDS A;  3K5L A;  3I56 V;  5BMV B;  4DRX A;  2FTK A;  4MT8 A;  5F2V O;  2Q67 A;  2HVJ C;  3CX5 F;  1YIT V;  3L9D A;  2UU9 B;  4GT1 A;  3JAT A;  1HNW B;  2IH1 C;  2Q5Z A;  4IIJ A;  2DQ3 A;  4L87 A;  2YI8 A;  3JCZ A;  1EBO A;  4LFB O;  1QVG U;  1A32 A;  4BAY A;  2X6B A;  1W0K G;  4NR1 A;  4WCE V;  3P3P A;  1IBM B;  1S0V A;  3OTO B;  5GTI Z;  3RW0 A;  4LWS B;  4DUY B;  1YVW A;  3IJ4 A;  2R9R B;  5L3B A;  5TIS Z;  2VRZ A;  5IYZ B;  2JGD A;  4K35 A;  1VQO V;  5FPO A;  5EC2 C;  4D7S A;  1KYO F;  1Y6X A;  4EKW A;  1UFI A;  1L1F A;  3Q4H B;  4CC6 A;  1XNR O;  2Q69 A;  2QA4 V;  3WB0 A;  5JJN B;  2QTS A;  4LFA B;  1NZ6 A;  1SKV A;  4JYA B;  1ARO P;  2EIN C;  5LGU A;  2YIB D;  2Q6A A;  3IAY A;  3RBZ A;  3K5M A;  3CCU V;  3E8B A;  2QEX V;  4FZ1 A;  4X1Y B;  5L3E A;  2R9A A;  3AG4 C;  3E89 A;  4W4L A;  5BZB A;  1SQP H;  3E8H A;  2EUL A;  1SQX H;  5JVD B;  1KC8 W;  4AHC A;  1VAR A;  3ZED A;  4WBN A;  1Q6H A;  4DUZ O;  1Y74 A;  4JF3 A;  4W4K A;  3UT5 B;  3FB7 C;  1IUR A;  3DC6 A;  3IGA C;  2CUG A;  3T1H B;  4PA3 A;  3QTC A;  5J2U B;  1QU7 A;  3BFR A;  5EZY B;  4CH6 A;  4DV1 O;  2HHH O;  5E79 Z;  2PY5 A;  4DV5 O;  1AR4 A;  4DW1 A;  1IXM A;  4KHP O;  5EYP A;  3L72 H;  3OD4 A;  4DR6 O;  3K03 A;  1K5S A;  2JDI G;  4RAI A;  1NJI W;  4O4I B;  3E86 A;  1B06 A;  1XRE A;  4WFA V;  2Y0P A;  2DWE C;  5IJ9 A;  4JI1 B;  2VQE B;  1VQP V;  5H2F Z;  1V9P A;  1OHH G;  2AHY A;  3CB2 A;  3IC9 A;  2Q0A A;  1JJO A;  1NTZ H;  5D5P A;  4FLT A;  4JI7 B;  4FIP C;  2HJF C;  1PL4 A;  1PV0 A;  4UVC A;  1Y4M A;  2W6I G;  4DV4 B;  4K0K O;  4X1I A;  4DV7 B;  2QTO A;  5JJJ B;  4GX5 A;  3ZS8 C;  3CC4 V;  4DR5 B;  1H38 A;  2P06 A;  4J42 A;  1COW G;  2QWN B;  4IL6 Z;  2W0F C;  1G6U A;  1Q5O A;  1MMM A;  3CE2 A;  3DXR B;  4J9Y B;  1H2K A;  4BW9 A;  4CBC A;  3G4S V;  3ICX A;  5KAI Z;  4LF7 O;  1SRY A;  2DW4 A;  1XIL A;  1M1K W;  3ZN1 A;  3AG1 B;  1XL6 A;  4UVA A;  2JRI A;  2CTP A;  3HR0 A;  1NU1 H;  2UXC B;  3SPJ A;  2OTJ V;  2KB1 A;  1SES A;  1K4C C;  3E35 A;  4UCS A;  5C93 A;  2CH7 A;  4LF5 O;  1OCO B;  5LMN B;  4F4L A;  2EIM C;  4DK1 A;  1ZL8 A;  2W6J G;  2QWQ B;  5E1A C;  4UCT A;  4AQY O;  4TT3 G;  3R66 A;  3DC5 A;  1R3K C;  1M5I A;  4KFM A;  1VF6 C;  4NKG B;  2XTA A;  3UCS C;  4Q6G A;  4QE9 A;  3ZMZ A;  2F95 B;  1GN4 A;  2WAM A;  2QJ1 A;  5IT9 N;  3THO A;  1GTO A;  2QKC A;  3JAL A;  4JZG A;  3T2M A;  3CWB H;  3IFX A;  1U96 A;  2Q73 A;  3RYI A;  4G2K A;  1R73 A;  3ZHV A;  1NKD A;  4I55 A;  3ABK C;  4NXM B;  3SPC A;  5IYD O;  1QBZ A;  2IBZ H;  1HNX B;  1XQ8 A;  3F5T A;  1Y76 A;  3QF7 A;  1I94 B;  3RYH B;  5LOV B;  1IBL O;  4BIO A;  2Q7G A;  1RPR A;  1KD1 W;  1OCR C;  3N2G B;  2CTW A;  4EFE A;  2JVD A;  4HBN A;  4PV1 B;  2ZQM A;  3D36 A;  1SA0 B;  1THZ A;  4QE7 A;  5B1N A;  2FB5 A;  4I4T B;  3OMN B;  1SQV H;  1GH6 A;  1R3L C;  3WG7 C;  4U3J B;  4YXW G;  1IX9 A;  2Y4U A;  3ETE A;  3KCX A;  2AW9 A;  2IM9 A;  3W7X A;  3X2Q C;  3E83 A;  2Q4P A;  3CCQ V;  5JH7 B;  4B7E A;  4LNU B;  2UUC O;  1AI7 A;  2XAQ A;  1XEQ A;  3CRM A;  1QR9 A;  3CD6 V;  3BA9 A;  3BCC H;  1RPO A;  5CBG A;  4B3S O;  5FL7 G;  1WA8 A;  4X20 A;  5FPR A;  4Z1M G;  4CS2 A;  3FAV B;  2UUB O;  2JJ2 G;  3NXS A;  1P7G A;  2ZCE A;  2ZIM A;  3D3Q A;  3AK2 A;  4O4J A;  4GKJ B;  3JAM N;  3B8M A;  3K04 A;  5IYB O;  4WF9 V;  4RUF A;  2C2A A;  3HKD B;  1CEZ A;  1HW7 A;  4DV2 B;  1RP3 B;  2JS3 A;  3BAB A;  1JOY A;  1FFT B;  2UUA B;  3APQ A;  4WFF A;  3EXA A;  4FFK A;  4KXR A;  5EIB D;  4D6T H;  4UB6 Z;  3SJA C;  4Q20 A;  4FVM A;  2IU0 A;  4F6R B;  4X1K B;  1XNQ B;  2V4D A;  4FLV A;  3CCE V;  2WLM A;  4O2B A;  1BMF G;  5JQG B;  1HP8 A;  2EIK C;  1O9H A;  4NXN O;  2LW1 A;  2OCC C;  3SJB C;  1B6Q A;  1H8H G;  1W59 A;  1Z2G A;  2N74 A;  2VQF B;  1HNZ O;  3LNN A;  2YEV A;  5L3G A;  1OCZ B;  1VIB A;  3LUT B;  2RQ6 A;  1I0H A;  4MW8 A;  3EFF K;  1YF2 A;  1PP9 H;  1UPG A;  4H44 B;  1HWY A;  2ZDI C;  1GM9 A;  4NB5 A;  4I7Z B;  2OIE A;  1AJN A;  1V54 C;  2F4V B;  2NLJ C;  3SJQ C;  3CCM V;  5IY5 B;  4JI0 O;  4YIP A;  1QLE B;  1YIJ V;  5BR8 O;  1Q3E A;  3CCR V;  4O2A B;  2PF4 E;  1AIL A;  3JSL A;  2E5L B;  3QO5 A;  5KX5 B;  2L6L A;  4IYH A;  5B66 Z;  2QKA A;  5GON B;  3FB5 C;  1MZE A;  1Q86 W;  5KA6 A;  4EB6 A;  3UKM A;  2WLK A;  2Y4T A;  1K8A W;  2LFR A;  3SGI A;  1W0J G;  5CB4 A;  3ZRV A;  5C8Y B;  4JV5 O;  4UCO A;  4PDV A;  2KG7 B;  4J9Z B;  1AI5 A;  1WNS A;  2A3Q A;  5J2T A;  1PKX A;  4J7J A;  2JS5 A;  1FXH A;  3OGC C;  2E3C A;  4FFB A;  3JAR B;  3H1K H;  4FM0 A;  1EM1 A;  2IJH A;  2UXX A;  4TV8 B;  3UQ8 A;  3APO A;  3CEI A;  3D8C A;  1AB3 A;  1PL0 A;  4YHH B;  1ZWI C;  4H0L B;  1GM7 A;  1N0J A;  1BCC H;  3BPZ A;  4PA7 A;  2OYQ A;  4KUM A;  3ZRW B;  3W7S A;  4ZKI A;  4ZIB A;  5LHG A;  3LDE A;  2KKW A;  1S72 V;  4O4L A;  1XMQ O;  3T1Y B;  1NR1 A;  1NI8 A;  3G6E V;  1XHZ A;  1YSC A;  2RN9 A;  4J11 A;  1AVM A;  3QVN A;  3K9A A;  1RM1 B;  2EIJ B;  1GK9 A;  3ZMS A;  3K0D A;  1K33 A;  4HNA A;  3H1I H;  3ABU A;  2XHB A;  1LUV A;  5CBF A;  2F66 C;  1FPO A;  5EK0 A;  4LH7 A;  2RMK B;  2ZDI A;  4GYC B;  3A0B Z;  2G38 A;  5LYJ B;  3STZ C;  1DF4 A;  2EIL B;  3OGI B;  1G1X B;  3CXH F;  2QR4 A;  5LL6 Y;  3W7W A;  4QIW F;  4DR7 B;  1WP8 A;  4J80 A;  3OW2 U;  3TJT A;  4LC1 A;  5LXT A;  5B1B C;  5LP6 A;  1XMO B;  1N34 O;  2ZE8 A;  3MAQ A;  5ITZ B;  1M93 A;  2WWW A;  3L71 H;  4LF9 O;  3QO8 A;  3VQY A;  2HR3 A;  3AK3 A;  3JYC A;  4YJ2 A;  4U7N A;  2A79 B;  4DR3 B;  3G80 A;  5KUM A;  5KA5 A;  1NH2 D;  2XND G;  4MVO A;  5B3S C;  1M56 B;  1JJ2 U;  3L74 H;  1NTK H;  3AG2 C;  4PA4 A;  4UXN A;  1N8R W;  4JTC B;  4X66 B;  3STL C;  5DED A;  1FFX A;  2Q7E A;  4FLZ A;  3ZHU A;  4JAV A;  2W0X A;  1LR1 A;  3SYA A;  2JIZ G;  1PM9 A;  1TUB B;  1K5Q A;  4J41 A;  2OCH A;  2JK5 C;  4UCV A;  4E2L A;  1N36 B;  3JAS A;  3P30 A;  1K92 A;  4FPP A;  3K57 A;  4JI6 B;  3ABM C;  5BMV A;  4DO2 A;  4ICG A;  3F7Y C;  1BZK A;  4K3A A;  1TAE A;  3RYC A;  2JGD B;  3N2K B;  2B9Z A;  4I0X B;  4JI4 O;  2GBO A;  2Z0A A;  2GV9 A;  1M57 B;  3FKS G;  1CXZ B;  1JFF A;  2QM8 A;  1GM8 A;  3K79 A;  3JD0 A;  1J5E B;  3W7U A;  1N0N A;  3JAK A;  5EC1 C;  1BGY H;  3E22 A;  4NTW A;  1M90 W;  5IWA B;  3CPW U;  4DR4 O;  4LWS A;  3K08 A;  2A06 H;  2OIG A;  1EN6 A;  4DR1 O;  3ZBH A;  1G4Y B;  1MNG A;  2F93 B;  2IJJ A;  4P2Z A;  4GKK O;  3RWR D;  2GTS A;  1IBK O;  1YJ9 V;  4ZI7 B;  1WN7 A;  3AG3 C;  4FLW A;  2R72 A;  3K5O A;  5EYP B;  2H3O A;  4X1Y A;  4I50 B;  2YXH A;  5FLX N;  2UXD O;  4XDL A;  3H1J H;  5JVD A;  5KAF Z;  2A9H A;  1IZ3 A;  4LFB B;  4CC5 A;  5KHI A;  4LFC O;  1K73 W;  2D3O W;  3UT5 A;  1AP5 A;  3H9V A;  2ATK C;  3FX7 A;  5KMG A;  5J2U A;  1PPJ H;  5EZY A;  1FJG O;  2WLI A;  2P90 A;  2LO1 A;  1Y66 A;  2RJZ A;  1X4T A;  4PA6 A;  1ROP A;  1E1Q G;  2AZ2 A;  1TGO A;  2QGN A;  4X1I B;  5KLV H;  1KU9 A;  1XNR B;  2NR5 A;  1GMG A;  3D36 C;  5B1A C;  1YDX A;  3RT3 C;  4DV0 O;  2FKX A;  4X9Q A;  4DV6 O;  1V55 C;  1NBM G;  1TVK B;  4JTD B;  2XAS A;  4I9W A;  3ZCC A;  2ITC C;  4X65 O;  1VQ6 V;  1R6K A;  4JI3 O;  1WAZ A;  2LW7 A;  4DUZ B;  2QWP B;  5LMU O;  2ZNJ A;  3AG7 A;  3K59 A;  1VQL V;  4JPR A;  4X89 A;  3CHX A;  4DV1 B;  3JSN A;  1M9N A;  3TXS A;  3UM7 A;  2HHH B;  4DV5 B;  3ZHS A;  2QDO A;  4ASU G;  2EIN B;  4KHP B;  4DR2 O;  4R7C A;  2CH7 B;  5CA3 A;  3AG4 B;  4DR6 B;  1FXV A;  3ASN C;  2DYS C;  1BQZ A;  4TUY B;  3DXR A;  4RQF A;  4MTO A;  4O4H B;  4CZZ A;  5K1P A;  2E74 B;  3U11 A;  3ZMV A;  4JI8 O;  1P49 A;  1ORQ C;  3BRC A;  4U3F H;  2BTQ B;  5CA1 B;  4P9P A;  4YJ3 A;  4OGQ B;  1BQ0 A;  1RSO A;  4GX1 A;  4PHZ A;  5CA0 B;  1KBH A;  2ZIN A;  3ASO C;  3HKB A;  3B8N A;  3UO3 A;  4K0K B;  1WP7 A;  1SER A;  1OZ0 A;  3RYI B;  4N21 A;  4DW0 A;  4I55 B;  4ZOL A;  3HKC B;  3VQX A;  5H9C A;  4H13 B;  1H2G A;  5IJ0 A;  3CC7 V;  2OTL V;  4H37 A;  4MW3 A;  1OCC C;  4TV9 A;  3ETG A;  4LF7 B;  3T4D A;  2ZXW C;  2YDE A;  5K1X A;  4G27 B;  2DYR C;  3AK1 A;  3TET A;  3JCU Z;  1VF5 B;  3ML0 A;  3LDD A;  4QPK A;  4OX9 O;  1AI4 A;  3G6B A;  2LJ2 A;  2IJK A;  3JAW A;  2ZM6 O;  3FD9 A;  3HKE A;  2BSK A;  4LF5 B;  1VQ7 V;  5LGT A;  1H2L A;  1FXK C;  5GW7 A;  2Y69 C;  3ZHT A;  1PNL A;  3KG2 A;  2ARH A;  4Z1V A;  4AQY B;  1ZTE A;  1VQM V;  3ZRS A;  1SQG A;  1S5J A;  1LNQ A;  1SC5 B;  4GX2 A;  1BHA A;  1SA0 A;  4MSW C;  3DSQ A;  1D2D A;  4X20 B;  2PTM A;  3LNM B;  4I4T A;  1ZX3 A;  1QVF U;  3BA8 A;  3OMA B;  2VS0 A;  2X6C A;  1HR0 O;  3ZIA G;  3JD4 A;  2CTR A;  4O4J B;  5EBW C;  4L8J A;  3ABL C;  4HAM A;  1EN5 A;  2EIM B;  1ZUQ A;  4ZHQ A;  4LNU A;  1FYJ A;  3CCL V;  3OT7 A;  2X0L A;  4DV3 O;  3ETD A;  2P67 A;  5IDJ A;  1YCI A;  1IBL B;  1KKD A;  1F4N A;  2WLL B;  1VMG A;  5GTH Z;  2V7Q G;  2RCV A;  4OXS A;  4TQF A;  3A8T A;  3CJH B;  2N04 A;  4R8C A;  2CGO A;  1P7B A;  1VQ8 V;  3ABK B;  3CCJ V;  4B3T O;  3WB2 A;  1JX9 A;  1N32 O;  4TSF G;  2YEV B;  3ZRX A;  1VQ4 V;  5DN6 G;  1DLB A;  2Q9L A;  3LSS A;  1GN6 A;  4LF8 O;  2DJV A;  2K1E A;  3BAA A;  3O9O A;  3OTF A;  3QO7 A;  1GO3 F;  1SS3 A;  4X1K A;  3P3N A;  2UUC B;  1OCR B;  5L3F A;  1Q8I A;  4GZR B;  2BTO A;  4B3S B;  1Z5V A;  2B1I A;  2DQ0 A;  3WG7 B;  1WPB A;  4LF4 O;  4P30 A;  2AGA A;  2UUB B;  2EJ7 A;  5CBH A;  2CDY A;  2L35 A;  4X64 O;  3X2Q B;  5LBQ A;  1Q6I A;  5LP6 C;  4XDJ A;  1FXK A;  5HFL A;  4FLY A;  4JI5 O;  2DN9 A;  1EZV H;  4DK0 A;  3MDS A;  1VQ9 V;  3SJC C;  4EB6 B;  5KHJ A;  3FYI B;  1LUW A;  3CCS V;  1GRJ A;  2EZO A;  3IC7 A;  3U0Z A;  5CB4 B;  3VQW A;  4JI2 O;  5LA6 A;  2IJI A;  5KHG A;  3B77 A;  4HZ3 A;  3ZHR A;  4B3M O;  4I5S A;  1E1R G;  3RVY A;  5J2T B;  2YC0 A;  4AIL C;  4O2A A;  1Y67 A;  4NXN B;  4KL1 A;  4BIU A;  4FFB B;  3TK1 A;  1HNZ B;  4MVS A;  1I5Y A;  1YHQ V;  2YS8 A;  1S3J A;  1KMI Z;  3OR7 C;  2E75 B;  4K8X A;  2JJ1 G;  2YIA A;  4CS4 A;  4LCU C;  5H6Q A;  5A2Q N;  2B1G A;  4CS3 A;  4FZ0 A;  3CSX A;  2KG7 A;  4X62 O;  2AHZ A;  2YIB A;  4O4L B;  2EIK B;  2WLJ A;  2YXL A;  3ZMT A;  4MVM A;  2Z3Y A;  1N33 O;  3SYO A;  2HJD A;  2X7R B;  2OCC B;  1R6N A;  3H1L H;  1T5E A;  3K06 A;  2UXB O;  4A5U B;  4JI0 B;  4JGS A;  3C3T A;  4OPH A;  3JD3 A;  5BR8 B;  4HNA B;  1FD9 A;  5L3C A;  1VP7 A;  2N05 A;  5L3D A;  3E8G A;  1XBL A;  1YXB A;  3H1H H;  1MA1 A;  3ZRW A;  4B3R O;  2PYL A;  3EVK A;  4UVB A;  2MW2 B;  1BHB A;  4ZBM A;  1V54 B;  2EZP A;  3OUF A;  3M8A A;  3C90 A;  2QWR B;  1G8M A;  4UB8 Z;  4B3M B;  2JEU A;  2FYU H;  3S3X A;  3RGB A;  4JV5 B;  3T1C A;  4PD4 F;  3EHB B;  1JVM A;  4PI2 A;  4DYL A;  2UU9 O;  1HNW O;  1GN2 A;  2YID A;  4MTG A;  5IE9 A;  3R65 A;  1K34 A;  1VQ5 V;  1CPY A;  4FLX A;  1L0N H;  3K5N A;  5AG2 A;  1R1B A;  4UCU A;  2QKS A;  2ZT9 B;  3D3I A;  1IBM O;  3J7A U;  1QCE A;  3OTO O;  2P22 C;  5LYJ A;  1J95 A;  4DUY O;  3KZI Z;  3GB7 C;  2GUZ B;  4XBF A;  1VQK V;  4EFB A;  3RYF A;  2ZE5 A;  3M99 B;  1AI6 A;  4GLX A;  2CE4 A;  1L8D A;  2ZE6 A;  1XMQ B;  3SDL A;  2YI9 A;  1MSD A;  2ZR3 A;  3FB8 C;  4QJF B;  3CRA A;  4OPA A;  4DRX B;  1FFX B;  1WLE A;  4LFA O;  4IHJ A;  2PYJ A;  1US6 A;  2GSM B;  4XDK A;  2WLH A;  4PEL A;  3JAT B;  2PUS A;  1MAB G;  1BL8 A;  4IIJ B;  3S3W A;  3OMI B;  5FNV A;  1F4M A;  2LP7 A;  3HB3 B;  1QLN A;  4JAA A;  2A0L A;  3A2F A;  3LSQ A;  2JEX A;  3OEE G;  4PDL A;  5H5N A;  5JJE B;  3T1H O;  2LGW A;  3AEI A;  3RYC B;  1P84 F;  4FJC C;  3BVO A;  1H2M A;  1P4R A;  3NR7 A;  2ILM A;  1D5N A;  3O65 A;  1TUB A;  1JFF B;  1S5H C;  2BOB C;  2EJR A;  1N34 B;  3OAA G;  2ZNI A;  4FMT A;  3PJS K;  3JAK B;  4CH3 A;  4J7K A;  4LF9 B;  5EIB C;  3QG5 A;  3E22 B;  2LFS A;  1CP9 A;  1B04 A;  3W7T A;  4JI1 O;  2VQE O;  1XDC A;  2F1M A;  4EEQ A;  3CYO A;  4TWK A;  2PI5 A;  3N2K A;  4QNH B;  3LDC A;  2ETN A;  4WBN B;  3SPI A;  4I0X A;  5IYZ A;  4JI7 O;  4PI0 A;  1R3I C;  5B1B B;  1Y74 B;  1S76 D;  4MVU A;  5JCO C;  2H94 A;  3AG1 C;  4DV4 O;  5EBL C;  3Q4H A;  3I5D A;  4FK5 C;  4DV7 O;  4NTY A;  3CRQ A;  3ETQ A;  2HVK C;  2BCC H;  3OUS A;  4WFG A;  2Q68 A;  3CMA V;  2GHY A;  3L73 H;  2WA4 A;  4JYC A;  1KP3 A;  3DTU B;  4DR5 O;  4YIO A;  4LP8 A;  1WPX A;  3OM3 B;  3CME V;  1ZSP A;  1BS3 A;  1NS1 A;  4UV8 A;  5B3S B;  1OCO C;  4UUJ C;  2DMX A;  2ADQ B;  2NN4 A;  4JZ2 A;  2QM4 A;  5IJ9 B;  1IVS A;  5KMG B;  3ZX6 A;  3AG2 B;  2Z5U A;  4ZI7 A;  2WLI B;  3CS5 A;  4BR6 A;  2ODM A;  3B09 A;  4JAU A;  4JI4 B;  2UXC O;  4JYB A;  4I50 A;  4U7O A;  2P4V A;  3ABT A;  1NR7 A;  2YXY A;  3JD2 A;  2OWO A;  1I7F A;  2CK3 G;  5LMN O;  4O4I A;  4DXW A;  3RVZ A;  4DR4 B;  2P7T C;  3ABM B;  2VWJ A;  4WFE A;  2XAF A;  4IYI A;  1YTF B;  2YSU B;  4DR1 B;  3KKY A;  1IDS A;  4R6Z A;  3F7V C;  1WJZ A;  3SR2 C;  4GKK B;  5BY1 A;  2DOS A;  3A0R A;  2QM7 A;  1IBK B;  1MOF A;  4UCR A;  2WPD G;  4PDR A;  3VQV A;  4BWA A;  1SZX A;  4RUE A;  2F23 A;  1BE3 H;  2HEP A;  4NXM O;  4JYY A;  3UO2 A;  2UXD B;  1HNX O;  1VF7 A;  1KP2 A;  2X6A A;  1TVK A;  1B3Q A;  5A9G A;  1I94 O;  4C7U A;  4LFC B;  1JCH A;  1ZL8 B;  2Q7H A;  4MVQ A;  4JAS A;  3GVM A;  4GCZ A;  3WFV A;  1GN3 A;  5JCO A;  1Z5W A;  4D7T A;  3WB1 A;  3I55 V;  1FJG B;  4YJ3 B;  3DGE A;  1QQC A;  1YEW A;  4N23 A;  2XAH A;  3AG3 B;  3ZN0 A;  3GWK C;  4R50 A;  1RSO B;  1E79 G;  5B5E Z;  1NT2 B;  3HKB B;  1XUQ A;  3CP1 A;  3JAL B;  4FM1 A;  4HYO A;  3H01 A;  4TUY A;  5KHH A;  5KHK A;  1FS0 G;  4O4H A;  4ZOL B;  1I08 A;  3B40 A;  3FFQ A;  3PN1 A;  1BSM A;  4DV0 B;  1GKF A;  2Q0O C;  2ZE7 A;  5BXZ A;  2YUA A;  2WSS G;  4X88 A;  3K58 A;  4DV6 B;  2EBO A;  5IJ0 B;  3MD0 A;  3L70 H;  2FML A;  2GTA A;  5DEC A;  2BTQ A;  5CA1 A;  1Y76 B;  3VBB A;  4NVP A;  2RNB A;  1JA8 A;  4X65 B;  5JWP A;  4JI3 B;  2V1D A;  5CA0 A;  1L0L H;  4TV9 B;  3A0H Z;  5LMU B;  2M7W A;  3B4S A;  1K97 A;  1TUE B;  4GKJ O;  1D5A A;  5B1A B;  3HKC A;  4DV2 O;  1SET A;  4G28 B;  3SYC A;  3JAW B;  1SQQ H;  1FKA O;  4DR2 B;  1V55 B;  1ZLZ A;  3HKE B;  2BSK B;  3BHP A;  4WFH A;  2UUA O;  3VOU A;  1OCZ C;  1VEW A;  1NVP B;  1Q81 W;  3RYH A;  4NTX A;  2XT9 A;  1QR8 A;  5LOV A;  1Q82 W;  1FAF A;  4JI8 B;  1X59 A;  3T4Z A;  4CH5 A;  5LHI A;  1XNQ O;  3N2G A;  1EZJ A;  1KKC A;  2FL4 A;  2YIC A;  3U10 A;  3F5W C;  1HDJ A;  5LHH A;  3SPH A;  5KUK A;  4FLU A;  1WA8 B;  2EX3 A;  2WA3 A;  2ZIO A;  4RWU A;  3HPL C;  5IY5 C;  4U3J A;  2VQF O;  1H2S B;  1SQB H;  3ASN B;  1QLE C;  2HKO A;  2DYS B;  1XI1 A;  4JTA B;  2RDC A;  2B5U A;  4ZHQ B;  3GWO A;  4F6E A;  2IW5 A;  5JH7 A;  4B08 A;  2BE3 A;  1S5L Z;  4MTX A;  3TXQ A;  2Y0I A;  2ZR2 A;  1YJN V;  5EBM C;  3ZMU A;  1IXB A;  1K4D C;  2F4V O;  1KB9 F;  1M4U A;  2DE0 X; 
#chains in the Genus database with same CATH homology
 5BXZ A;  3J80 N;  4JI4 O;  4DV6 O;  4LF8 O;  2Z0A A;  2DJV A;  4JI0 O;  2JRI A;  2UXB O;  2UXC O;  4A5U B;  1R6T A;  5BR8 O;  2UUC O;  4OPH A;  1XEQ A;  1J5E O;  4DUZ O;  4OX9 O;  4X65 O;  5H5N A;  4JI3 O;  2LW7 A;  3T1H O;  1G1X B;  2E5L O;  4B3S O;  4DR7 O;  1KUQ A;  2ZM6 O;  5LL6 Y;  1AIL A;  5LMU O;  4LF5 O;  5LMN O;  4JYA O;  5IWA O;  1XMO O;  4DR4 O;  4DV1 O;  4B3R O;  4LF6 O;  2HHH O;  2UUB O;  4LF4 O;  4DV5 O;  4YY3 O;  1N34 O;  3O65 A;  2AGA A;  4AQY O;  3J81 N;  3R66 A;  4DR1 O;  4GKJ O;  4KHP O;  4X64 O;  3JAM N;  4LF9 O;  3M8A A;  4DR6 O;  4DR2 O;  4DV2 O;  1FKA O;  4JV5 O;  1D2D A;  4GKK O;  4DR3 O;  2ZKO A;  5BY1 A;  1IBK O;  1F7Y A;  4JI5 O;  5IT9 N;  2DOS A;  4JI1 O;  2UUA O;  2VQE O;  1HR0 O;  1YZB A;  2UU9 O;  4JI8 O;  1HNW O;  1X59 A;  1XNQ O;  5FLX N;  4NXM O;  4JI7 O;  2UXD O;  4YHH O;  4JI2 O;  1HNX O;  4LFB O;  1AB3 A;  4X66 O;  1A32 A;  1FYJ A;  4LFC O;  3F5T A;  1R1B A;  4B3M O;  1I94 O;  1IBM O;  3J7A U;  3OTO O;  4DV3 O;  4DV4 O;  4NXN O;  4DUY O;  4DV7 O;  1IBL O;  4K0K O;  2VQF O;  2N74 A;  1HNZ O;  1FJG O;  3T1Y O;  1XMQ O;  4DR5 O;  3SDL A;  1NS1 A;  1N36 O;  4OPA A;  5A2Q N;  4JI6 O;  1XNR O;  4LFA O;  4X62 O;  4B3T O;  2F4V O;  1N32 O;  4LF7 O;  3RT3 C;  4DV0 O;  2FKX A;  1DK1 A;  1N33 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...