5LL6Y

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
GRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIGVLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 18S ribosomal RNA
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00312 Ribosomal_S15 Ribosomal protein S15
Y PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5ll6Y02
2VQEO 4JI4O 4DV1O 4DV0O 3R66A 1FJGO 4DV4O 2UUCO 4JI5O 4B3RO 2UU9O 4LF5O 3O65A 1IBLO 3J81N 1FKAO 4DV7O 4X62O 1XNRO 1J5EO 1N32O 1AB3A 2UXBO 4NXNO 1XMOO 5IWAO 4LF8O 4LFCO 4LF4O 1D2DA 5LMUO 1AILA 4DV6O 2AGAA 3JAMN 4DV3O 4LF9O 1N36O 4GKJO 4LFAO 1IBKO 1HNZO 1XEQA 4KHPO 4X64O 4OPHA 4JI6O 4DV5O 2DJVA 1XNQO 4B3TO 2HHHO 5BY1A 3J80N 4DR4O 4X65O 1FYJA 4A5UB 3T1HO 1HNWO 1I94O 1N33O 5IT9N 1HNXO 4DR1O 3F5TA 5H5NA 2VQFO 1R1BA 4DR6O 2DOSA 4B3MO 2FKXA 2F4VO 1HR0O 4LF6O 4JV5O 1XMQO 1R6TA 2N74A 4AQYO 2ZKOA 4JI1O 2LW7A 4LFBO 4YHHO 5LMNO 1N34O 5LL6Y 4DUYO 3RT3C 1G1XB 4JI2O 3OTOO 1IBMO 1X59A 3M8AA 1YZBA 3SDLA 1NS1A 5BR8O 1DK1A 2UXCO 1KUQA 3T1YO 2Z0AA 4LF7O 4JI3O 1A32A 2UUBO 3J7AU 4K0KO 4YY3O 4DR2O 4DR5O 4NXMO 2JRIA 5A2QN 4DUZO 5BXZA 4DV2O 4DR7O 2UUAO 4OX9O 2UXDO 4JYAO 4OPAA 5FLXN 2E5LO 4JI7O 2ZM6O 4GKKO 4JI8O 1F7YA 4DR3O 4JI0O 4B3SO 4X66O
chains in the Genus database with same CATH superfamily
2QM7A 4JAVA 4FK5C 2UUCO 2ZIOA 3O65A 1OCZC 3B8MA 4JI1B 2ITDC 4NR1A 1ZX3A 2AW9A 1N32O 3SJQC 4IIJB 4JYAB 1D2DA 3CEIA 3K0GA 3WG7C 3U11A 3D3QA 3ZN1A 3L72H 3LSUA 3OTOB 2VQFB 4DR3B 2GUZB 4FFBB 4X64O 2EJRA 1H2LA 2DJVA 2R70A 5L3FA 3CS5A 4J11A 4F4LA 3AK1A 1P49A 1N33O 4CBCA 3F5TA 5LP6A 5H5NA 1RSOB 1UJWB 4DV7B 2CE4A 4LWSA 3CPWU 5L3GA 1VQ5V 1D5AA 3K58A 1SQQH 5IY5B 2QWQB 1KECA 3DC5A 4JI1O 3IGAC 1YIJV 3RVYA 3CMEV 5LOVB 1NKDA 1VQOV 4KFMA 4JI2O 4MSWC 5J2UB 3CB2A 4KHPB 1FXKB 1Z5VA 3OMIB 1NR7A 5LYJB 3DXRA 3JATB 4UXNA 5JQGA 4BIOA 1UFIA 3QO8A 4HAMA 2L6LA 1CXZB 2AXTZ 2EIKB 4PI2A 2H94A 3CSXA 4U3JA 5EYPA 2OTJV 2UXXA 1YI2V 4YJ3B 4EB6B 1EN4A 4I7ZB 3NR7A 3QVNA 1GN2A 1S3JA 5DM6V 4NKGB 3SPGA 1VQ9V 3B40A 4DV1O 5JH7A 3SYPA 1ZL8A 1V55B 3RYIB 1MG1A 2YEVB 1YF2A 3OR6C 4FFKA 4H13B 3ZMUA 4UB6Z 4LC1A 4J10A 3RWRD 1NVPD 5LMUB 2HKOA 4P30A 3JARA 3OUFA 2Q68A 1K97A 4CH4A 4KXRA 3JAMN 1VMGA 3FB6C 2QSAA 2JJ2G 5K1XA 4YJ2A 4K0KB 1S77D 1I5YA 1JOYA 2PF4E 3TXSA 5KHKA 3B2EE 2Y4UA 2R9RB 2YSUB 5B1NA 4JZGA 4GCZA 2OIGA 4X1YA 3CJHA 2IM9A 1I94B 4J7ZA 3JYCA 2F4VO 4JTAB 4MVUA 5IY5C 4J7KA 2HJFC 5GTIZ 1VEWA 5LGNA 4JGSA 3K79A 5CA3A 5JVDB 4IGGA 2QA4V 5B1OA 3SGIA 3OTOO 1L8DA 1HW7A 2F4VB 1X59A 1MSWD 3N2GB 5BR8O 4I4TA 1KUQA 4I55A 3DGEA 3B77A 5DN6G 1ENVA 4LH7A 4FIPC 4PA3A 5EIBD 3JAWA 3CCRV 3U0ZA 3SPCA 3H01A 2WLHA 2Q67A 4QNHB 3H1KH 2QR4A 1H2MA 4JAUA 4DR7O 1X4TA 5D5QA 1CPYA 4JYAO 2P90A 3UO2A 4MVSA 3UT5B 4DO2A 3CXCU 1EM1A 1Y6XA 1K5SA 4JI0O 3WB0A 3ETQA 4BWAA 4QGPA 1WP7A 5GONB 4J42A 4TV8B 2ZDIA 4DV0O 1JPXA 1FPOA 3L9DA 3RBZA 5DEDA 3K5LA 1KB9F 1N33B 1ZWIC 1THZA 2HVKC 3WFVA 3MHHC 1XNRO 1F4NA 1OCCC 4D6TH 3DC6A 3ZMVA 4LFCO 5KX5A 2ZNJA 3P32A 4MVZA 1I08A 4KHPO 4FLVA 2JK5C 1TVKA 2WLLA 3ABLB 3FYEB 4J41A 1FS0G 1Y76A 4RAIA 2JEXA 1K73W 1VF6A 5KLVH 1Y74A 3ZX6A 1XMQO 4JI5B 5CBHA 1YVWA 3APQA 1SETA 2YC0A 1ZAUA 5B66Z 2YS8A 2ZQMA 1XDCA 2E75B 1ORQC 2CTQA 1GKFA 1N0JA 1FXVA 4QPJA 3A2FA 3ABKB 4GX2A 2Z0AA 5CBGA 1RPRA 5IJ9B 5IDJA 4LCUC 2A3QA 1QLNA 2VWKA 3LDCA 1JFFA 1WLEA 5A2QN 3MDSA 3U10A 1IBKB 1VQMV 5EBWC 2F23A 2ZE6A 1EFRG 1RM1B 3L75H 4X20A 2DQ0A 1RP3B 2PI4A 5IYBO 1PV0A 1R73A 4LF5B 4DV4O 5GONA 1FFXB 3ABKC 1IBLO 4XDJA 4O4HA 3J81N 5FNVA 1HWYA 4TUYB 4DR2B 1J5EB 4MVRA 1WA8B 3Q4HB 1OCCB 1YJNV 2M6YA 2Q7EA 4MTGA 1S0VA 1HDJA 1M9NA 2CUGA 4I5SA 3KG2A 4FLTA 2A79B 4R6ZA 1K4DC 4K8ZA 1NI8A 2ZXWC 3QF7A 4I50A 1DLBA 3T1HB 4LF9O 1H2GA 4LFAO 2ODMA 4PDRA 1NR1A 4ZOLB 1QQCA 1M56B 4I50B 3E8HA 4X88A 4OPHA 2XHBA 5LGTA 1K8AW 3OMAB 3O9OA 4UUJC 4OGQB 4TV9B 4X65O 2HVJC 4J7JA 1HP8A 3N2GA 2DW4A 3CC2V 5JJJB 1TUBA 1YDXA 5HFLA 4B3SB 1QVGU 3JCUZ 3JD1A 5KUMA 5FNVB 4DR7B 3GWKC 1OCRC 5EK0A 3K04A 2F1MA 4AQYO 3K5MA 4FVMA 4QE7A 4QPKA 2CTWA 2EIMC 3BHPA 4IYHA 4DUYO 2ZXWB 4FJCC 4DR5B 1BZKA 5KHGA 3TXQA 1YTFD 3BRCA 4X20B 2VQEB 4X62B 3FFQA 1TA8A 3E8FA 1O9GA 4MW8A 3BA8A 3CCUV 1NT2B 4XBFA 4WFFA 4DV3B 1EZJA 4DR5O 1L0NH 2HJDA 3MD0A 1GH6A 1XREA 2UXDB 4NTYA 2QWNB 1HNZB 2ZINA 4NXNB 2PZSA 2OCHA 1Q6HA 1QVFU 4DV6B 2W0XA 3OD4A 4B3RB 1N36B 4IYIA 4R50A 3SJCC 3UQ8A 2BOCC 4X66O 3OR7C 3K0DA 2EX3A 2RDCA 1FXHA 4F6RB 3FX7A 4GT1A 5IJ0A 2PYLA 1BGYH 2GBOA 4MVOA 2K1EA 1S72V 1BQ0A 1AJQA 4PA7A 1PL4A 4LFCB 2YXYA 4U3JB 2QKSA 1JCHA 5L3DA 2Q0OC 3FB7C 2A06H 2NLJC 3BA9A 4DV3O 3JD2A 5C93A 1R3LC 4HYOA 3OGIB 4UCVA 4B3TB 3ZBHA 2WLMA 2PY5A 4N21A 4DV4B 1PP9H 4O4HB 1HNWO 3BFRA 4Q6GA 3GB7C 4X8AA 3N2KB 1XUQA 2DOSA 1HNXB 1CEZA 3VQWA 3I5DA 2KG7A 1Q6UA 2BSKA 3FB5C 2F43G 2YIDA 2JGDB 4G27B 1G8MA 4P9OA 5LP6B 4LFAB 4ZBMA 3M8AA 2GDSA 1YJWV 2M7WA 3C90A 1XI1A 2ZCEA 2P5OA 3LSSA 4CH5A 1SQGA 4QIWF 1WPBA 1RFYA 3J7AU 4K0KO 4YY3O 4DR2O 1SZXA 4DV2O 1DGSA 3A0RA 2WWWA 2YIBD 4X1KA 3K5OA 3WU2Z 1KYOF 4I4TB 2EINC 2Q7HA 5KHJA 4PELA 3VBBA 3AG1B 5F2VO 3F7VC 5H2FZ 2Y48A 5IE9A 4DR4B 5KHIA 1OCOC 3SJAC 4WFAV 2DYRC 5CMUA 1ZUQA 3ABUA 1M57C 1KMIZ 4LNUB 2OCCC 3CCVV 5H6QA 1JR9A 2X0LA 3T1YB 4DV6O 4LF7B 1DTOA 5IYZB 3MHSC 5KX5B 2DYSC 1IBMB 2CK3G 4MS2A 3K06A 1K9MW 2JVDA 1XMOB 4K8XA 4E4EA 2JEUA 2G38A 1AJPA 5CA1A 3ABLC 1NH2B 3ZMZA 3SPJA 2YEVA 2H3OA 2N05A 3CWBH 3CCQV 1QLEC 4E2LA 4B3MB 1R6TA 3OAAG 5AG2A 2IH1C 4LH6A 1G4YB 1T5EA 5ITZA 3KCXA 4RQEA 2CH7A 2IJIA 4NB5A 3SDLA 2A0LA 2B5UA 2Z3YA 4ZOLA 4LF7O 3ZMSA 3L71H 3G71V 3E86A 3LDEA 2UUBO 3ZHSA 5EC2C 1R3JC 2PI5A 3D36C 3DXRB 2Q73A 3QG5A 4I55B 1IXMA 3ABTA 1FXKA 1TGOA 2WPDG 1S5JA 5JJNB 1SRYA 2HEPA 4J9YB 3LSQA 4JI7O 1XQ8A 4CH6A 3CRCA 5C8YA 2Y0PA 1K92A 1FJGO 5CA0A 2CDYA 3ASOB 4W4KA 4UV8A 1KBHA 4I9WA 4X9QA 3ABMC 4LF5O 2ATKC 4R7CA 1RSOA 1QHTA 2PGGA 4O2BB 4JYCA 3CC7V 1MZFA 1JVMA 4DV2B 1J5EO 3IC9A 4LF8B 5L3CA 3E8GA 2YDEA 1AB3A 1SQBH 4FM0A 3LUTB 1SQPH 1AILA 1VF6C 2AGAA 2XASA 4FFBA 3QO5A 3S3WA 3GVMA 4GKJO 5BZBA 4NTXA 2A7WA 1WB8A 2BCCH 1IBKO 1Q86W 1AJNA 1QCEA 3STLC 4QE9A 4PDLA 2IJKA 2FL4A 2C2AA 4GUNA 2X6AA 4DR4O 1I94O 1E1QG 5CB4A 4FLXA 4BIUA 3C3TA 4JI8B 4MT8A 1SKVA 2Q9LA 1HR0O 1OCRB 3FYIB 3HKCA 1QNMA 2Q6AA 3AG1C 1P4RA 5KMGA 3VOUA 2BOBC 1N34O 2B9ZA 2ZR3A 4UCUA 5JCOA 4FLWA 1BCCH 1BHBA 1IBMO 1FAFA 2WSSG 2QEXV 4MVMA 2AZ2A 3HR0A 2CH7B 3AG7A 5ITZB 1XOUA 3X2QC 3LNMB 1LUVA 3NXSA 4DUYB 3SR2C 3BCCH 3JSNA 1E79G 1WB7A 4ZHQA 3IAYA 2UXDO 1CP9A 1U96A 4EFEA 4FLYA 1O9HA 3SYOA 3ZRWA 3E35A 1L1FA 1YXBA 4PDMA 4UFZA 5LOVA 3OW2U 1GM9A 3ZRWB 3CC4V 4JI8O 3AG3C 3JASA 4H0LB 4TSFG 4BW9A 2NNUA 3I56V 1Y66A 1GTOA 3BPZA 4JI5O 4G28B 4B3RO 1PNLA 3G4SV 2XAGA 2EJ7A 2Q7GA 4JYBA 2EULA 3ICXA 4WFEA 2AHZA 1V54B 3ZMTA 1R3IC 4GX5A 3W7XA 3RYFA 1XL4A 3RVZA 3SYQA 4U7OA 3R65A 2ETNA 2K9PA 5KMGB 3L73H 4FM1A 3F5WC 5EZYB 4PV1B 4CH3A 3G80A 4IIJA 1D5NA 3AG3B 1M90W 4FMTA 5LA6A 5K1PA 5GW7A 5CB4B 3J80N 2YICA 4IHJA 4GLXA 2YXHA 2QDOA 4X1KB 4X66B 1TAEA 2IJHA 1K5QA 4EFBA 1AI4A 2QJ1A 2Y0IA 2N74A 3HKBA 2WA4A 3B4SA 2B1GA 3ZHRA 4RO2A 4X1YB 5LBQA 5LMNO 4WF9V 3W7WA 3OFNG 5H9CA 1YZBA 1MNGA 3H9VA 4O2BA 4PDVA 2JGDA 2XT9A 4D7SA 1MOFA 1L0LH 3A0HZ 5KA6A 4NXMO 2BSKB 3CXHF 2UUAB 4DUZO 1J95A 2H8PC 2KG7B 3BEHA 2PTMA 1XNQB 1VQPV 3JD0A 1P84F 5B3SB 1XBLA 3HB3B 3T4ZA 1B06A 4B7KA 3QO7A 1GN4A 4FPPA 2EIJB 4ZHQB 3VQYA 1G6UA 5JH7B 3I55V 1PD3A 1BT8A 4O4JB 3OMNB 3RFRA 3E8BA 2RJZA 1WNSA 3W7SA 1BE3H 1URFA 3E2EA 1SESA 3AG2B 3E22B 2HG5C 2AHYA 3AK2A 3AG4B 2XAJA 1V55C 2OCCB 3QTCA 2XNDG 3H1IH 4KL1A 4QJFB 2YUAA 2OYQA 1IVSA 4MW3A 3UM7A 3X2QB 1Q5OA 1COWG 4JASA 1FXKC 4MVQA 1B6QA 4YXWG 2DMXA 4AQYB 3CRMA 2RN9A 3RN4A 1Z2GA 5CA1B 4DR6B 2FMLA 1LUWA 1OCZB 4X64B 1PL0A 1ROPA 4PJ0Z 3IJ4A 1H38A 1XL6A 4Z2WA 4DV1B 4LFBO 4FZ1A 4DR1B 3RT3C 2N04A 3JAKA 1N32B 1AP5A 2UXCO 1IX9A 2P4KA 1NQTA 3T1YO 5EIBC 1V9PA 2A9HA 2IBZH 4JI2B 1XNRB 4Z1VA 3OT7A 4PA9A 5LP6C 4IHJB 1SERA 3OEEG 1MMMA 1TUBB 3CMAV 4ASUG 2E5LO 5LA6B 2UUBB 3T2MA 3JD4A 1VF5B 3ZRXA 2GTAA 2ZR2A 2ZNIA 2DN9A 5LXTA 2WLNA 1Q6IA 3ZIAG 2QWRB 4JI7B 1XILA 5IYDO 3OUSA 3RYFB 4X89A 3HPLC 1OHHG 5EBLC 3HKEB 1W0JG 4HZ3A 1SC5B 1KU9A 3THOA 5LHGA 4LBEC 2W6IG 4O4LB 3RYCA 1VQ7V 4AHCA 1BS3A 3OE7G 2XAFA 1QBZA 4BIZA 1NJIW 2BTQB 4UCRA 1KD1W 4MTXA 5KUKA 4JPRA 3ZHUA 4JAAA 2YI9A 2JS5A 4RQFA 4DW0A 1Y67A 4HNAB 3ZHQA 1NZ6A 4I9QA 1IBLB 3CX5F 1HNXO 4O2AA 4JV5O 2OWOA 3B8NA 4FZ0A 1XHZA 1S5HC 3H1LH 4XDKA 1SQVH 5IJ9A 4GKKB 1R6KA 3EHBB 3K9SA 4PD4F 1EBOA 4WCEV 2KSDA 4MTFA 2P06A 2GHYA 3JD3A 4P2ZA 4YIPA 1SF9A 2EIKC 1EN6A 1NBMG 1VQ6V 3E89A 4NYKA 1BMFG 2Q8VA 4IL6Z 4X1IA 1QR8A 1KQSU 4JTCB 3VQXA 1LR1A 4G2KA 1R6NA 1TUEB 3B09A 3KKYA 1KP2A 4LFBB 2DQ3A 3DTUB 4MTOA 4YIOA 2V4DA 5BMVB 1NTKH 1AR4A 2Q69A 4TT3G 2YIBA 5H6RA 3STZC 5L3BA 1SQFA 4X65B 5FL7G 1N34B 3K59A 1DF5A 5J2TB 3ZJZA 1FKAO 2JS3A 2Y69C 1F4MA 4WBNA 5GTHZ 2Y4TA 4UCSA 4B08A 1KKDA 4WFHA 4NXNO 5IWAO 3ZEDA 4JYYA 4JF3A 3ZCCA 1NH2D 4UVAA 2DWDC 1N36O 3APOA 5DECA 1XEQA 3QNEA 1F23A 1QR9A 3OM3B 4JI6O 4PA6A 4B3TO 5B1AC 3CYOA 5BY1A 1H2KA 3ETDA 1PNMA 4B7EA 1K33A 4TV9A 1IURA 1AI5A 2FKXA 4AILC 1YSCA 4ZKIA 5KA5A 3F7YC 4DRXB 2QTSA 2EZOA 3ML0A 3P3PA 3JAWB 4CS2A 1GAXA 3UKMA 2ZDIC 1G1XB 4DXWA 2RCVA 1BL8A 1KP3A 1RM1C 4KP4A 1DK1A 4UVBA 1WA8A 2ZD9A 3BY6A 3LNNA 3CRAA 3G6BA 2QM4A 5IJ0B 4F6RA 1FFXA 2YI8A 3BVOA 3HKDA 3TGUH 2W6JG 1A32A 5LMNB 4UCTA 4EKWA 1DF4A 3JALB 3TK1A 3RYHB 4DW1A 4CC6A 2ADQB 1JQ0A 2UUAO 2IU3A 1LNQA 2F95B 1U97A 2DWEC 2IH3C 3CJHB 2ZM6B 4NVPA 3SPIA 3D3IA 4GKKO 2R9IA 1JX9A 3K57A 1F7YA 4ICGA 4UVCA 2P4VA 2GV9A 5IYZA 2VWJA 4D7TA 2UU9B 1W0KG 2Q0AA 3CD6V 3ASNB 4LF9B 2FYUH 3FD9A 1OZ0A 1VF7A 4JV5B 2LO1A 3E83A 2QWPB 1VQKV 4K35A 5LHIA 5KHHA 3AG2C 1P7GA 2EIMB 1OV9A 3OEHG 4L8JA 2LW1A 3SPHA 2Q5ZA 1ZL8B 1IXBA 2P22C 4OX9B 1PM9A 3ZN0A 2HHHO 3ETEA 1I7FA 2X6BA 3T1HO 3CHXA 4YY3B 2WLLB 2VQFO 4DR6O 2OIEA 5B1BC 2IU0A 5B3SC 4FLZA 1WP8A 1BSMA 2MW2B 1YJ9V 2UUCB 1H8HG 3CCSV 5A9GA 1VARA 4RUEA 2EIJC 2WLKA 1IDSA 2RMKB 3CP1A 4JI3B 4ZI7B 2LGWA 1NVPB 1PKXA 2ITCC 3TCUA 1M1KW 4JI0B 2CGNA 2XAQA 4FLUA 4NTWA 3H1JH 1NS1A 3FAVB 2QWOB 4XDLA 2CAZC 1JJ2U 3SYAA 4ABMA 2UXCB 3KZIZ 4JI3O 4L87A 4TWKA 1M93A 2HR3A 3RYHA 1B04A 3N2KA 3AG4C 5B5EZ 5IYCO 2CGOA 3FAVA 3SYCA 3ASOC 2QM8A 1WN7A 4LP8A 3CCEV 2V7QG 3HKEA 4ZI7A 1VP7A 5FPOA 1GN3A 2QKCA 4DV0B 2GUZA 3DSQA 3VQVA 2GSMB 5EBMC 1YCIA 4GX1A 2EINB 1GK9A 3C3SA 4DRXA 1P7BA 2ADPA 2WLIB 1M56C 1E1RG 5IWAB 1VQ8V 2KKWA 4LF8O 4K3AA 4LF4O 5JVDA 5JCOC 1NU1H 1OCOB 2FTKA 5LMUO 2EILB 2YIAA 1K34A 3W7UA 4WFBV 4ZIBA 2QTOA 2V1DA 1N4CA 5FPRA 3BAAA 3A0BZ 1XNQO 3OGCC 5LGUA 4N23A 1TVKB 4BW5A 4UV9A 1K7DA 1Y4MA 4I0XB 1R1BA 3WB2A 5J2TA 4F6EA 1XMQB 4LF6O 1AI6A 4YJ2B 4O4IB 1Q3EA 1Q7YW 3ZRVA 5BMVA 1MABG 5TISZ 4YHHO 2WAMA 1JMKC 2LJ2A 2ZE5A 2UXNA 3A8TA 2BTOA 5CN0A 2LFRA 4KUMA 2WLJA 4BAYA 1JJOA 3ASNC 5CBFA 3ETGA 1AI7A 2UXBB 1AP6A 3IFXA 2XTAA 1YHQV 2LQTA 3JALA 2E3CA 3FB8C 4TV8A 3HKDB 3M99B 3TJTA 1K3EA 1US6A 2QKAA 2XAHA 4X1IB 3K08A 1B3QA 2O57A 2CTRA 2HLDG 1PPJH 2LFSA 3P3NA 2Z5UA 2WLIA 2DYRB 4EB6A 2BE3A 3EFFK 4W4LA 5EYPB 2KQXA 2VQEO 1ZSPA 4JI4O 1W2BU 1WPXA 5B1BB 4EEQA 1K4CC 3M7MX 1Z5WA 3Q4HA 4FM2A 5BR8B 4TUYA 4HNAA 4JI4B 3BABA 2UXBO 1XMOO 3G67A 3LDDA 2E76B 2EILC 4BR6A 2ILMA 4TOIA 2YXLA 1M5IA 2VS0A 1MZEA 4CZZA 4DYLA 4LWSB 4DV5O 3RYCB 4GX0A 4O4LA 1GMGA 4JI6B 1MA1A 1M57B 4WBNB 1VQLV 2WA3A 4IT5A 5LHHA 1FYJA 4UB8Z 2E5LB 3GWOA 4DR1O 1YITV 1JFFB 2PYJA 2AZ0A 4AI8A 4JZ2A 2DYSB 5KAFZ 1ZLZA 3HKBB 4PHZA 4J80A 1MSDA 5LXTB 3JARB 2LW7A 5JJEB 3OTFA 3CCLV 5LL6Y 1AROP 2F66C 2HP8A 3D36A 2ARHA 3RYIA 4Z1MG 1BHAA 5KAIZ 2Y69B 1Y74B 1SA0A 3CE2A 1I0HA 5BXZA 2MK3A 1YTFB 3MAQA 1KC8W 4YJ3A 1Y76B 2ZM6O 3JAKB 2IJJA 2HFEC 2ZE7A 1XHXA 3CCMV 5JQGB 2P7TC 1I5XA 4GYCB 2EZPA 2JJ1G 2ZIMA 3JCZA 2UU9O 3FKSG 3CRRA 1OJHA 3CCJV 3K03A 3AEIA 3JASB 5J2UA 4GKJB 1SS3A 1AVMA 2RQ6A 4LF6B 2OT5A 2ZT9B 4LF4B 1WAZA 1VQ4V 2JDIG 1M4UA 3EVKA 3IC7A 2LGQA 2BTQA 2X6CA 2CTPA 3L74H 2JGUA 1FFTB 1SQXH 4H37A 3UT5A 4CS3A 1GRJA 3E22A 5L3EA 4H33A 2OTLV 4UCOA 1GO3F 1HNWB 3RGBA 5E1AC 2R9AA 4R8CA 3AK3A 1PNKA 4U7NA 2W0FC 1EN5A 5E79Z 2NR5A 1S76D 1Q8IA 2HHHB 1SA0B 2B1IA 3HKCB 1EZVH 4OXSA 2ZKOA 2QGNA 5B1AB 4DK0A 2X7RB 5J9PC 2EBOA 1HR0B 4TQFA 3RW0A 3WG7B 1FD9A 3EXAA 1Q82W 4DV5B 3PJSK 3SJBC 2D2CB 3T1CA 1N0NA 4TQDA 2Q4PA 2KB1A 4GZRB 2JRIA 3KCYA 1QU7A 2P6JA 4WFGA 1W59A 1AR1B 3W7TA 2NN4A 1H2NA 1Q81W 4OPAA 3N27A 5FLXN 3JSLA 4P9PA 3ZHVA 1YEWA 1Q90D 2LP7A 4Q20A 4DR3O 5CA0B 1WJZA 1H2SB 3R66A 3ZRSA 4RUFA 2XUMA 3PN1A 1S5LZ 1VIBA 2VRZA 1UPGA 5C8YB 3D8CA 4DV7O 1ZTEA 4X62O 2QE7G 1F51A 2GTSA 2R72A 5D5PA 5HFMA 3WB1A 3T4DA 1JA8A 3K3WA 2D3OW 3ZS8C 1VQNV 2E74B 1AR5A 1N8RW 1QLEB 5EZYA 1HNZO 3ZHTA 1GN6A 4RWUA 4DUZB 4LR3A 1SZTA 1V54C 3K5NA 3UO3A 3G6EV 2JIZG 1FJGB 4U3FH 4A5UB 1NTMH 1GM7A 5IT9N 4C7UA 1KKCA 4O4JA 4B3MO 2PUSA 3JATA 5JWPA 2F93B 3S3XA 4O2AB 1IZ3A 5LYJA 4CS4A 1BQZA 1H8EG 1NTZH 4JTDB 4PA4A 1Q43A 5EC1C 2L35A 4J9ZB 4CC5A 3K9AA 4PI0A 4NXMB 3CRQA 2FB5A 2ZE8A 3P30A 2P67A 2XOKG 4H44B 4YHHB 4DK1A 2DE0X 4O4IA 3TETA 4OX9O 4HBNA 3UCSC 2IW5A 2RNBA 4LNUA 3ABMB 4I0XA 1RPOA 3L70H 1R3KC 4B3SO 1GM8A 3H1HH
chains in the Genus database with same CATH topology
2VQEO 4JI4O 4DV1O 4DV0O 3R66A 1FJGO 4DV4O 2UUCO 4JI5O 4B3RO 2UU9O 4LF5O 3O65A 1IBLO 3J81N 1FKAO 4DV7O 4X62O 1XNRO 1J5EO 1N32O 1AB3A 2UXBO 4NXNO 1XMOO 5IWAO 4LF8O 4LFCO 4LF4O 1D2DA 5LMUO 1AILA 4DV6O 2AGAA 3JAMN 4DV3O 4LF9O 1N36O 4GKJO 4LFAO 1IBKO 1HNZO 1XEQA 4KHPO 4X64O 4OPHA 4JI6O 4DV5O 2DJVA 1XNQO 4B3TO 2HHHO 5BY1A 3J80N 4DR4O 4X65O 1FYJA 4A5UB 3T1HO 1HNWO 1I94O 1N33O 5IT9N 1HNXO 4DR1O 3F5TA 5H5NA 2VQFO 1R1BA 4DR6O 2DOSA 4B3MO 2FKXA 2F4VO 1HR0O 4LF6O 4JV5O 1XMQO 1R6TA 2N74A 4AQYO 2ZKOA 4JI1O 2LW7A 4LFBO 4YHHO 5LMNO 1N34O 5LL6Y 4DUYO 3RT3C 1G1XB 4JI2O 3OTOO 1IBMO 1X59A 3M8AA 1YZBA 3SDLA 1NS1A 5BR8O 1DK1A 2UXCO 1KUQA 3T1YO 2Z0AA 4LF7O 4JI3O 1A32A 2UUBO 3J7AU 4K0KO 4YY3O 4DR2O 4DR5O 4NXMO 2JRIA 5A2QN 4DUZO 5BXZA 4DV2O 4DR7O 2UUAO 4OX9O 2UXDO 4JYAO 4OPAA 5FLXN 2E5LO 4JI7O 2ZM6O 4GKKO 4JI8O 1F7YA 4DR3O 4JI0O 4B3SO 4X66O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE O;  4JI4 O;  4DV1 O;  4DV0 O;  3R66 A;  1FJG O;  4DV4 O;  2UUC O;  4JI5 O;  4B3R O;  2UU9 O;  4LF5 O;  3O65 A;  1IBL O;  3J81 N;  1FKA O;  4DV7 O;  4X62 O;  1XNR O;  1J5E O;  1N32 O;  1AB3 A;  2UXB O;  4NXN O;  1XMO O;  5IWA O;  4LF8 O;  4LFC O;  4LF4 O;  1D2D A;  5LMU O;  1AIL A;  4DV6 O;  2AGA A;  3JAM N;  4DV3 O;  4LF9 O;  1N36 O;  4GKJ O;  4LFA O;  1IBK O;  1HNZ O;  1XEQ A;  4KHP O;  4X64 O;  4OPH A;  4JI6 O;  4DV5 O;  2DJV A;  1XNQ O;  4B3T O;  2HHH O;  5BY1 A;  3J80 N;  4DR4 O;  4X65 O;  1FYJ A;  4A5U B;  3T1H O;  1HNW O;  1I94 O;  1N33 O;  5IT9 N;  1HNX O;  4DR1 O;  3F5T A;  5H5N A;  2VQF O;  1R1B A;  4DR6 O;  2DOS A;  4B3M O;  2FKX A;  2F4V O;  1HR0 O;  4LF6 O;  4JV5 O;  1XMQ O;  1R6T A;  2N74 A;  4AQY O;  2ZKO A;  4JI1 O;  2LW7 A;  4LFB O;  4YHH O;  5LMN O;  1N34 O;  5LL6 Y;  4DUY O;  3RT3 C;  1G1X B;  4JI2 O;  3OTO O;  1IBM O;  1X59 A;  3M8A A;  1YZB A;  3SDL A;  1NS1 A;  5BR8 O;  1DK1 A;  2UXC O;  1KUQ A;  3T1Y O;  2Z0A A;  4LF7 O;  4JI3 O;  1A32 A;  2UUB O;  3J7A U;  4K0K O;  4YY3 O;  4DR2 O;  4DR5 O;  4NXM O;  2JRI A;  5A2Q N;  4DUZ O;  5BXZ A;  4DV2 O;  4DR7 O;  2UUA O;  4OX9 O;  2UXD O;  4JYA O;  4OPA A;  5FLX N;  2E5L O;  4JI7 O;  2ZM6 O;  4GKK O;  4JI8 O;  1F7Y A;  4DR3 O;  4JI0 O;  4B3S O;  4X66 O; 
#chains in the Genus database with same CATH topology
 2QM7 A;  4JAV A;  4FK5 C;  2UUC O;  2ZIO A;  3O65 A;  1OCZ C;  3B8M A;  4JI1 B;  2ITD C;  4NR1 A;  1ZX3 A;  2AW9 A;  1N32 O;  3SJQ C;  4IIJ B;  4JYA B;  1D2D A;  3CEI A;  3K0G A;  3WG7 C;  3U11 A;  3D3Q A;  3ZN1 A;  3L72 H;  3LSU A;  3OTO B;  2VQF B;  4DR3 B;  2GUZ B;  4FFB B;  4X64 O;  2EJR A;  1H2L A;  2DJV A;  2R70 A;  5L3F A;  3CS5 A;  4J11 A;  4F4L A;  3AK1 A;  1P49 A;  1N33 O;  4CBC A;  3F5T A;  5LP6 A;  5H5N A;  1RSO B;  1UJW B;  4DV7 B;  2CE4 A;  4LWS A;  3CPW U;  5L3G A;  1VQ5 V;  1D5A A;  3K58 A;  1SQQ H;  5IY5 B;  2QWQ B;  1KEC A;  3DC5 A;  4JI1 O;  3IGA C;  1YIJ V;  3RVY A;  3CME V;  5LOV B;  1NKD A;  1VQO V;  4KFM A;  4JI2 O;  4MSW C;  5J2U B;  3CB2 A;  4KHP B;  1FXK B;  1Z5V A;  3OMI B;  1NR7 A;  5LYJ B;  3DXR A;  3JAT B;  4UXN A;  5JQG A;  4BIO A;  1UFI A;  3QO8 A;  4HAM A;  2L6L A;  1CXZ B;  2AXT Z;  2EIK B;  4PI2 A;  2H94 A;  3CSX A;  4U3J A;  5EYP A;  2OTJ V;  2UXX A;  1YI2 V;  4YJ3 B;  4EB6 B;  1EN4 A;  4I7Z B;  3NR7 A;  3QVN A;  1GN2 A;  1S3J A;  5DM6 V;  4NKG B;  3SPG A;  1VQ9 V;  3B40 A;  4DV1 O;  5JH7 A;  3SYP A;  1ZL8 A;  1V55 B;  3RYI B;  1MG1 A;  2YEV B;  1YF2 A;  3OR6 C;  4FFK A;  4H13 B;  3ZMU A;  4UB6 Z;  4LC1 A;  4J10 A;  3RWR D;  1NVP D;  5LMU B;  2HKO A;  4P30 A;  3JAR A;  3OUF A;  2Q68 A;  1K97 A;  4CH4 A;  4KXR A;  3JAM N;  1VMG A;  3FB6 C;  2QSA A;  2JJ2 G;  5K1X A;  4YJ2 A;  4K0K B;  1S77 D;  1I5Y A;  1JOY A;  2PF4 E;  3TXS A;  5KHK A;  3B2E E;  2Y4U A;  2R9R B;  2YSU B;  5B1N A;  4JZG A;  4GCZ A;  2OIG A;  4X1Y A;  3CJH A;  2IM9 A;  1I94 B;  4J7Z A;  3JYC A;  2F4V O;  4JTA B;  4MVU A;  5IY5 C;  4J7K A;  2HJF C;  5GTI Z;  1VEW A;  5LGN A;  4JGS A;  3K79 A;  5CA3 A;  5JVD B;  4IGG A;  2QA4 V;  5B1O A;  3SGI A;  3OTO O;  1L8D A;  1HW7 A;  2F4V B;  1X59 A;  1MSW D;  3N2G B;  5BR8 O;  4I4T A;  1KUQ A;  4I55 A;  3DGE A;  3B77 A;  5DN6 G;  1ENV A;  4LH7 A;  4FIP C;  4PA3 A;  5EIB D;  3JAW A;  3CCR V;  3U0Z A;  3SPC A;  3H01 A;  2WLH A;  2Q67 A;  4QNH B;  3H1K H;  2QR4 A;  1H2M A;  4JAU A;  4DR7 O;  1X4T A;  5D5Q A;  1CPY A;  4JYA O;  2P90 A;  3UO2 A;  4MVS A;  3UT5 B;  4DO2 A;  3CXC U;  1EM1 A;  1Y6X A;  1K5S A;  4JI0 O;  3WB0 A;  3ETQ A;  4BWA A;  4QGP A;  1WP7 A;  5GON B;  4J42 A;  4TV8 B;  2ZDI A;  4DV0 O;  1JPX A;  1FPO A;  3L9D A;  3RBZ A;  5DED A;  3K5L A;  1KB9 F;  1N33 B;  1ZWI C;  1THZ A;  2HVK C;  3WFV A;  3MHH C;  1XNR O;  1F4N A;  1OCC C;  4D6T H;  3DC6 A;  3ZMV A;  4LFC O;  5KX5 A;  2ZNJ A;  3P32 A;  4MVZ A;  1I08 A;  4KHP O;  4FLV A;  2JK5 C;  1TVK A;  2WLL A;  3ABL B;  3FYE B;  4J41 A;  1FS0 G;  1Y76 A;  4RAI A;  2JEX A;  1K73 W;  1VF6 A;  5KLV H;  1Y74 A;  3ZX6 A;  1XMQ O;  4JI5 B;  5CBH A;  1YVW A;  3APQ A;  1SET A;  2YC0 A;  1ZAU A;  5B66 Z;  2YS8 A;  2ZQM A;  1XDC A;  2E75 B;  1ORQ C;  2CTQ A;  1GKF A;  1N0J A;  1FXV A;  4QPJ A;  3A2F A;  3ABK B;  4GX2 A;  2Z0A A;  5CBG A;  1RPR A;  5IJ9 B;  5IDJ A;  4LCU C;  2A3Q A;  1QLN A;  2VWK A;  3LDC A;  1JFF A;  1WLE A;  5A2Q N;  3MDS A;  3U10 A;  1IBK B;  1VQM V;  5EBW C;  2F23 A;  2ZE6 A;  1EFR G;  1RM1 B;  3L75 H;  4X20 A;  2DQ0 A;  1RP3 B;  2PI4 A;  5IYB O;  1PV0 A;  1R73 A;  4LF5 B;  4DV4 O;  5GON A;  1FFX B;  3ABK C;  1IBL O;  4XDJ A;  4O4H A;  3J81 N;  5FNV A;  1HWY A;  4TUY B;  4DR2 B;  1J5E B;  4MVR A;  1WA8 B;  3Q4H B;  1OCC B;  1YJN V;  2M6Y A;  2Q7E A;  4MTG A;  1S0V A;  1HDJ A;  1M9N A;  2CUG A;  4I5S A;  3KG2 A;  4FLT A;  2A79 B;  4R6Z A;  1K4D C;  4K8Z A;  1NI8 A;  2ZXW C;  3QF7 A;  4I50 A;  1DLB A;  3T1H B;  4LF9 O;  1H2G A;  4LFA O;  2ODM A;  4PDR A;  1NR1 A;  4ZOL B;  1QQC A;  1M56 B;  4I50 B;  3E8H A;  4X88 A;  4OPH A;  2XHB A;  5LGT A;  1K8A W;  3OMA B;  3O9O A;  4UUJ C;  4OGQ B;  4TV9 B;  4X65 O;  2HVJ C;  4J7J A;  1HP8 A;  3N2G A;  2DW4 A;  3CC2 V;  5JJJ B;  1TUB A;  1YDX A;  5HFL A;  4B3S B;  1QVG U;  3JCU Z;  3JD1 A;  5KUM A;  5FNV B;  4DR7 B;  3GWK C;  1OCR C;  5EK0 A;  3K04 A;  2F1M A;  4AQY O;  3K5M A;  4FVM A;  4QE7 A;  4QPK A;  2CTW A;  2EIM C;  3BHP A;  4IYH A;  4DUY O;  2ZXW B;  4FJC C;  4DR5 B;  1BZK A;  5KHG A;  3TXQ A;  1YTF D;  3BRC A;  4X20 B;  2VQE B;  4X62 B;  3FFQ A;  1TA8 A;  3E8F A;  1O9G A;  4MW8 A;  3BA8 A;  3CCU V;  1NT2 B;  4XBF A;  4WFF A;  4DV3 B;  1EZJ A;  4DR5 O;  1L0N H;  2HJD A;  3MD0 A;  1GH6 A;  1XRE A;  2UXD B;  4NTY A;  2QWN B;  1HNZ B;  2ZIN A;  4NXN B;  2PZS A;  2OCH A;  1Q6H A;  1QVF U;  4DV6 B;  2W0X A;  3OD4 A;  4B3R B;  1N36 B;  4IYI A;  4R50 A;  3SJC C;  3UQ8 A;  2BOC C;  4X66 O;  3OR7 C;  3K0D A;  2EX3 A;  2RDC A;  1FXH A;  4F6R B;  3FX7 A;  4GT1 A;  5IJ0 A;  2PYL A;  1BGY H;  2GBO A;  4MVO A;  2K1E A;  1S72 V;  1BQ0 A;  1AJQ A;  4PA7 A;  1PL4 A;  4LFC B;  2YXY A;  4U3J B;  2QKS A;  1JCH A;  5L3D A;  2Q0O C;  3FB7 C;  2A06 H;  2NLJ C;  3BA9 A;  4DV3 O;  3JD2 A;  5C93 A;  1R3L C;  4HYO A;  3OGI B;  4UCV A;  4B3T B;  3ZBH A;  2WLM A;  2PY5 A;  4N21 A;  4DV4 B;  1PP9 H;  4O4H B;  1HNW O;  3BFR A;  4Q6G A;  3GB7 C;  4X8A A;  3N2K B;  1XUQ A;  2DOS A;  1HNX B;  1CEZ A;  3VQW A;  3I5D A;  2KG7 A;  1Q6U A;  2BSK A;  3FB5 C;  2F43 G;  2YID A;  2JGD B;  4G27 B;  1G8M A;  4P9O A;  5LP6 B;  4LFA B;  4ZBM A;  3M8A A;  2GDS A;  1YJW V;  2M7W A;  3C90 A;  1XI1 A;  2ZCE A;  2P5O A;  3LSS A;  4CH5 A;  1SQG A;  4QIW F;  1WPB A;  1RFY A;  3J7A U;  4K0K O;  4YY3 O;  4DR2 O;  1SZX A;  4DV2 O;  1DGS A;  3A0R A;  2WWW A;  2YIB D;  4X1K A;  3K5O A;  3WU2 Z;  1KYO F;  4I4T B;  2EIN C;  2Q7H A;  5KHJ A;  4PEL A;  3VBB A;  3AG1 B;  5F2V O;  3F7V C;  5H2F Z;  2Y48 A;  5IE9 A;  4DR4 B;  5KHI A;  1OCO C;  3SJA C;  4WFA V;  2DYR C;  5CMU A;  1ZUQ A;  3ABU A;  1M57 C;  1KMI Z;  4LNU B;  2OCC C;  3CCV V;  5H6Q A;  1JR9 A;  2X0L A;  3T1Y B;  4DV6 O;  4LF7 B;  1DTO A;  5IYZ B;  3MHS C;  5KX5 B;  2DYS C;  1IBM B;  2CK3 G;  4MS2 A;  3K06 A;  1K9M W;  2JVD A;  1XMO B;  4K8X A;  4E4E A;  2JEU A;  2G38 A;  1AJP A;  5CA1 A;  3ABL C;  1NH2 B;  3ZMZ A;  3SPJ A;  2YEV A;  2H3O A;  2N05 A;  3CWB H;  3CCQ V;  1QLE C;  4E2L A;  4B3M B;  1R6T A;  3OAA G;  5AG2 A;  2IH1 C;  4LH6 A;  1G4Y B;  1T5E A;  5ITZ A;  3KCX A;  4RQE A;  2CH7 A;  2IJI A;  4NB5 A;  3SDL A;  2A0L A;  2B5U A;  2Z3Y A;  4ZOL A;  4LF7 O;  3ZMS A;  3L71 H;  3G71 V;  3E86 A;  3LDE A;  2UUB O;  3ZHS A;  5EC2 C;  1R3J C;  2PI5 A;  3D36 C;  3DXR B;  2Q73 A;  3QG5 A;  4I55 B;  1IXM A;  3ABT A;  1FXK A;  1TGO A;  2WPD G;  1S5J A;  5JJN B;  1SRY A;  2HEP A;  4J9Y B;  3LSQ A;  4JI7 O;  1XQ8 A;  4CH6 A;  3CRC A;  5C8Y A;  2Y0P A;  1K92 A;  1FJG O;  5CA0 A;  2CDY A;  3ASO B;  4W4K A;  4UV8 A;  1KBH A;  4I9W A;  4X9Q A;  3ABM C;  4LF5 O;  2ATK C;  4R7C A;  1RSO A;  1QHT A;  2PGG A;  4O2B B;  4JYC A;  3CC7 V;  1MZF A;  1JVM A;  4DV2 B;  1J5E O;  3IC9 A;  4LF8 B;  5L3C A;  3E8G A;  2YDE A;  1AB3 A;  1SQB H;  4FM0 A;  3LUT B;  1SQP H;  1AIL A;  1VF6 C;  2AGA A;  2XAS A;  4FFB A;  3QO5 A;  3S3W A;  3GVM A;  4GKJ O;  5BZB A;  4NTX A;  2A7W A;  1WB8 A;  2BCC H;  1IBK O;  1Q86 W;  1AJN A;  1QCE A;  3STL C;  4QE9 A;  4PDL A;  2IJK A;  2FL4 A;  2C2A A;  4GUN A;  2X6A A;  4DR4 O;  1I94 O;  1E1Q G;  5CB4 A;  4FLX A;  4BIU A;  3C3T A;  4JI8 B;  4MT8 A;  1SKV A;  2Q9L A;  1HR0 O;  1OCR B;  3FYI B;  3HKC A;  1QNM A;  2Q6A A;  3AG1 C;  1P4R A;  5KMG A;  3VOU A;  2BOB C;  1N34 O;  2B9Z A;  2ZR3 A;  4UCU A;  5JCO A;  4FLW A;  1BCC H;  1BHB A;  1IBM O;  1FAF A;  2WSS G;  2QEX V;  4MVM A;  2AZ2 A;  3HR0 A;  2CH7 B;  3AG7 A;  5ITZ B;  1XOU A;  3X2Q C;  3LNM B;  1LUV A;  3NXS A;  4DUY B;  3SR2 C;  3BCC H;  3JSN A;  1E79 G;  1WB7 A;  4ZHQ A;  3IAY A;  2UXD O;  1CP9 A;  1U96 A;  4EFE A;  4FLY A;  1O9H A;  3SYO A;  3ZRW A;  3E35 A;  1L1F A;  1YXB A;  4PDM A;  4UFZ A;  5LOV A;  3OW2 U;  1GM9 A;  3ZRW B;  3CC4 V;  4JI8 O;  3AG3 C;  3JAS A;  4H0L B;  4TSF G;  4BW9 A;  2NNU A;  3I56 V;  1Y66 A;  1GTO A;  3BPZ A;  4JI5 O;  4G28 B;  4B3R O;  1PNL A;  3G4S V;  2XAG A;  2EJ7 A;  2Q7G A;  4JYB A;  2EUL A;  3ICX A;  4WFE A;  2AHZ A;  1V54 B;  3ZMT A;  1R3I C;  4GX5 A;  3W7X A;  3RYF A;  1XL4 A;  3RVZ A;  3SYQ A;  4U7O A;  3R65 A;  2ETN A;  2K9P A;  5KMG B;  3L73 H;  4FM1 A;  3F5W C;  5EZY B;  4PV1 B;  4CH3 A;  3G80 A;  4IIJ A;  1D5N A;  3AG3 B;  1M90 W;  4FMT A;  5LA6 A;  5K1P A;  5GW7 A;  5CB4 B;  3J80 N;  2YIC A;  4IHJ A;  4GLX A;  2YXH A;  2QDO A;  4X1K B;  4X66 B;  1TAE A;  2IJH A;  1K5Q A;  4EFB A;  1AI4 A;  2QJ1 A;  2Y0I A;  2N74 A;  3HKB A;  2WA4 A;  3B4S A;  2B1G A;  3ZHR A;  4RO2 A;  4X1Y B;  5LBQ A;  5LMN O;  4WF9 V;  3W7W A;  3OFN G;  5H9C A;  1YZB A;  1MNG A;  3H9V A;  4O2B A;  4PDV A;  2JGD A;  2XT9 A;  4D7S A;  1MOF A;  1L0L H;  3A0H Z;  5KA6 A;  4NXM O;  2BSK B;  3CXH F;  2UUA B;  4DUZ O;  1J95 A;  2H8P C;  2KG7 B;  3BEH A;  2PTM A;  1XNQ B;  1VQP V;  3JD0 A;  1P84 F;  5B3S B;  1XBL A;  3HB3 B;  3T4Z A;  1B06 A;  4B7K A;  3QO7 A;  1GN4 A;  4FPP A;  2EIJ B;  4ZHQ B;  3VQY A;  1G6U A;  5JH7 B;  3I55 V;  1PD3 A;  1BT8 A;  4O4J B;  3OMN B;  3RFR A;  3E8B A;  2RJZ A;  1WNS A;  3W7S A;  1BE3 H;  1URF A;  3E2E A;  1SES A;  3AG2 B;  3E22 B;  2HG5 C;  2AHY A;  3AK2 A;  3AG4 B;  2XAJ A;  1V55 C;  2OCC B;  3QTC A;  2XND G;  3H1I H;  4KL1 A;  4QJF B;  2YUA A;  2OYQ A;  1IVS A;  4MW3 A;  3UM7 A;  3X2Q B;  1Q5O A;  1COW G;  4JAS A;  1FXK C;  4MVQ A;  1B6Q A;  4YXW G;  2DMX A;  4AQY B;  3CRM A;  2RN9 A;  3RN4 A;  1Z2G A;  5CA1 B;  4DR6 B;  2FML A;  1LUW A;  1OCZ B;  4X64 B;  1PL0 A;  1ROP A;  4PJ0 Z;  3IJ4 A;  1H38 A;  1XL6 A;  4Z2W A;  4DV1 B;  4LFB O;  4FZ1 A;  4DR1 B;  3RT3 C;  2N04 A;  3JAK A;  1N32 B;  1AP5 A;  2UXC O;  1IX9 A;  2P4K A;  1NQT A;  3T1Y O;  5EIB C;  1V9P A;  2A9H A;  2IBZ H;  4JI2 B;  1XNR B;  4Z1V A;  3OT7 A;  4PA9 A;  5LP6 C;  4IHJ B;  1SER A;  3OEE G;  1MMM A;  1TUB B;  3CMA V;  4ASU G;  2E5L O;  5LA6 B;  2UUB B;  3T2M A;  3JD4 A;  1VF5 B;  3ZRX A;  2GTA A;  2ZR2 A;  2ZNI A;  2DN9 A;  5LXT A;  2WLN A;  1Q6I A;  3ZIA G;  2QWR B;  4JI7 B;  1XIL A;  5IYD O;  3OUS A;  3RYF B;  4X89 A;  3HPL C;  1OHH G;  5EBL C;  3HKE B;  1W0J G;  4HZ3 A;  1SC5 B;  1KU9 A;  3THO A;  5LHG A;  4LBE C;  2W6I G;  4O4L B;  3RYC A;  1VQ7 V;  4AHC A;  1BS3 A;  3OE7 G;  2XAF A;  1QBZ A;  4BIZ A;  1NJI W;  2BTQ B;  4UCR A;  1KD1 W;  4MTX A;  5KUK A;  4JPR A;  3ZHU A;  4JAA A;  2YI9 A;  2JS5 A;  4RQF A;  4DW0 A;  1Y67 A;  4HNA B;  3ZHQ A;  1NZ6 A;  4I9Q A;  1IBL B;  3CX5 F;  1HNX O;  4O2A A;  4JV5 O;  2OWO A;  3B8N A;  4FZ0 A;  1XHZ A;  1S5H C;  3H1L H;  4XDK A;  1SQV H;  5IJ9 A;  4GKK B;  1R6K A;  3EHB B;  3K9S A;  4PD4 F;  1EBO A;  4WCE V;  2KSD A;  4MTF A;  2P06 A;  2GHY A;  3JD3 A;  4P2Z A;  4YIP A;  1SF9 A;  2EIK C;  1EN6 A;  1NBM G;  1VQ6 V;  3E89 A;  4NYK A;  1BMF G;  2Q8V A;  4IL6 Z;  4X1I A;  1QR8 A;  1KQS U;  4JTC B;  3VQX A;  1LR1 A;  4G2K A;  1R6N A;  1TUE B;  3B09 A;  3KKY A;  1KP2 A;  4LFB B;  2DQ3 A;  3DTU B;  4MTO A;  4YIO A;  2V4D A;  5BMV B;  1NTK H;  1AR4 A;  2Q69 A;  4TT3 G;  2YIB A;  5H6R A;  3STZ C;  5L3B A;  1SQF A;  4X65 B;  5FL7 G;  1N34 B;  3K59 A;  1DF5 A;  5J2T B;  3ZJZ A;  1FKA O;  2JS3 A;  2Y69 C;  1F4M A;  4WBN A;  5GTH Z;  2Y4T A;  4UCS A;  4B08 A;  1KKD A;  4WFH A;  4NXN O;  5IWA O;  3ZED A;  4JYY A;  4JF3 A;  3ZCC A;  1NH2 D;  4UVA A;  2DWD C;  1N36 O;  3APO A;  5DEC A;  1XEQ A;  3QNE A;  1F23 A;  1QR9 A;  3OM3 B;  4JI6 O;  4PA6 A;  4B3T O;  5B1A C;  3CYO A;  5BY1 A;  1H2K A;  3ETD A;  1PNM A;  4B7E A;  1K33 A;  4TV9 A;  1IUR A;  1AI5 A;  2FKX A;  4AIL C;  1YSC A;  4ZKI A;  5KA5 A;  3F7Y C;  4DRX B;  2QTS A;  2EZO A;  3ML0 A;  3P3P A;  3JAW B;  4CS2 A;  1GAX A;  3UKM A;  2ZDI C;  1G1X B;  4DXW A;  2RCV A;  1BL8 A;  1KP3 A;  1RM1 C;  4KP4 A;  1DK1 A;  4UVB A;  1WA8 A;  2ZD9 A;  3BY6 A;  3LNN A;  3CRA A;  3G6B A;  2QM4 A;  5IJ0 B;  4F6R A;  1FFX A;  2YI8 A;  3BVO A;  3HKD A;  3TGU H;  2W6J G;  1A32 A;  5LMN B;  4UCT A;  4EKW A;  1DF4 A;  3JAL B;  3TK1 A;  3RYH B;  4DW1 A;  4CC6 A;  2ADQ B;  1JQ0 A;  2UUA O;  2IU3 A;  1LNQ A;  2F95 B;  1U97 A;  2DWE C;  2IH3 C;  3CJH B;  2ZM6 B;  4NVP A;  3SPI A;  3D3I A;  4GKK O;  2R9I A;  1JX9 A;  3K57 A;  1F7Y A;  4ICG A;  4UVC A;  2P4V A;  2GV9 A;  5IYZ A;  2VWJ A;  4D7T A;  2UU9 B;  1W0K G;  2Q0A A;  3CD6 V;  3ASN B;  4LF9 B;  2FYU H;  3FD9 A;  1OZ0 A;  1VF7 A;  4JV5 B;  2LO1 A;  3E83 A;  2QWP B;  1VQK V;  4K35 A;  5LHI A;  5KHH A;  3AG2 C;  1P7G A;  2EIM B;  1OV9 A;  3OEH G;  4L8J A;  2LW1 A;  3SPH A;  2Q5Z A;  1ZL8 B;  1IXB A;  2P22 C;  4OX9 B;  1PM9 A;  3ZN0 A;  2HHH O;  3ETE A;  1I7F A;  2X6B A;  3T1H O;  3CHX A;  4YY3 B;  2WLL B;  2VQF O;  4DR6 O;  2OIE A;  5B1B C;  2IU0 A;  5B3S C;  4FLZ A;  1WP8 A;  1BSM A;  2MW2 B;  1YJ9 V;  2UUC B;  1H8H G;  3CCS V;  5A9G A;  1VAR A;  4RUE A;  2EIJ C;  2WLK A;  1IDS A;  2RMK B;  3CP1 A;  4JI3 B;  4ZI7 B;  2LGW A;  1NVP B;  1PKX A;  2ITC C;  3TCU A;  1M1K W;  4JI0 B;  2CGN A;  2XAQ A;  4FLU A;  4NTW A;  3H1J H;  1NS1 A;  3FAV B;  2QWO B;  4XDL A;  2CAZ C;  1JJ2 U;  3SYA A;  4ABM A;  2UXC B;  3KZI Z;  4JI3 O;  4L87 A;  4TWK A;  1M93 A;  2HR3 A;  3RYH A;  1B04 A;  3N2K A;  3AG4 C;  5B5E Z;  5IYC O;  2CGO A;  3FAV A;  3SYC A;  3ASO C;  2QM8 A;  1WN7 A;  4LP8 A;  3CCE V;  2V7Q G;  3HKE A;  4ZI7 A;  1VP7 A;  5FPO A;  1GN3 A;  2QKC A;  4DV0 B;  2GUZ A;  3DSQ A;  3VQV A;  2GSM B;  5EBM C;  1YCI A;  4GX1 A;  2EIN B;  1GK9 A;  3C3S A;  4DRX A;  1P7B A;  2ADP A;  2WLI B;  1M56 C;  1E1R G;  5IWA B;  1VQ8 V;  2KKW A;  4LF8 O;  4K3A A;  4LF4 O;  5JVD A;  5JCO C;  1NU1 H;  1OCO B;  2FTK A;  5LMU O;  2EIL B;  2YIA A;  1K34 A;  3W7U A;  4WFB V;  4ZIB A;  2QTO A;  2V1D A;  1N4C A;  5FPR A;  3BAA A;  3A0B Z;  1XNQ O;  3OGC C;  5LGU A;  4N23 A;  1TVK B;  4BW5 A;  4UV9 A;  1K7D A;  1Y4M A;  4I0X B;  1R1B A;  3WB2 A;  5J2T A;  4F6E A;  1XMQ B;  4LF6 O;  1AI6 A;  4YJ2 B;  4O4I B;  1Q3E A;  1Q7Y W;  3ZRV A;  5BMV A;  1MAB G;  5TIS Z;  4YHH O;  2WAM A;  1JMK C;  2LJ2 A;  2ZE5 A;  2UXN A;  3A8T A;  2BTO A;  5CN0 A;  2LFR A;  4KUM A;  2WLJ A;  4BAY A;  1JJO A;  3ASN C;  5CBF A;  3ETG A;  1AI7 A;  2UXB B;  1AP6 A;  3IFX A;  2XTA A;  1YHQ V;  2LQT A;  3JAL A;  2E3C A;  3FB8 C;  4TV8 A;  3HKD B;  3M99 B;  3TJT A;  1K3E A;  1US6 A;  2QKA A;  2XAH A;  4X1I B;  3K08 A;  1B3Q A;  2O57 A;  2CTR A;  2HLD G;  1PPJ H;  2LFS A;  3P3N A;  2Z5U A;  2WLI A;  2DYR B;  4EB6 A;  2BE3 A;  3EFF K;  4W4L A;  5EYP B;  2KQX A;  2VQE O;  1ZSP A;  4JI4 O;  1W2B U;  1WPX A;  5B1B B;  4EEQ A;  1K4C C;  3M7M X;  1Z5W A;  3Q4H A;  4FM2 A;  5BR8 B;  4TUY A;  4HNA A;  4JI4 B;  3BAB A;  2UXB O;  1XMO O;  3G67 A;  3LDD A;  2E76 B;  2EIL C;  4BR6 A;  2ILM A;  4TOI A;  2YXL A;  1M5I A;  2VS0 A;  1MZE A;  4CZZ A;  4DYL A;  4LWS B;  4DV5 O;  3RYC B;  4GX0 A;  4O4L A;  1GMG A;  4JI6 B;  1MA1 A;  1M57 B;  4WBN B;  1VQL V;  2WA3 A;  4IT5 A;  5LHH A;  1FYJ A;  4UB8 Z;  2E5L B;  3GWO A;  4DR1 O;  1YIT V;  1JFF B;  2PYJ A;  2AZ0 A;  4AI8 A;  4JZ2 A;  2DYS B;  5KAF Z;  1ZLZ A;  3HKB B;  4PHZ A;  4J80 A;  1MSD A;  5LXT B;  3JAR B;  2LW7 A;  5JJE B;  3OTF A;  3CCL V;  5LL6 Y;  1ARO P;  2F66 C;  2HP8 A;  3D36 A;  2ARH A;  3RYI A;  4Z1M G;  1BHA A;  5KAI Z;  2Y69 B;  1Y74 B;  1SA0 A;  3CE2 A;  1I0H A;  5BXZ A;  2MK3 A;  1YTF B;  3MAQ A;  1KC8 W;  4YJ3 A;  1Y76 B;  2ZM6 O;  3JAK B;  2IJJ A;  2HFE C;  2ZE7 A;  1XHX A;  3CCM V;  5JQG B;  2P7T C;  1I5X A;  4GYC B;  2EZP A;  2JJ1 G;  2ZIM A;  3JCZ A;  2UU9 O;  3FKS G;  3CRR A;  1OJH A;  3CCJ V;  3K03 A;  3AEI A;  3JAS B;  5J2U A;  4GKJ B;  1SS3 A;  1AVM A;  2RQ6 A;  4LF6 B;  2OT5 A;  2ZT9 B;  4LF4 B;  1WAZ A;  1VQ4 V;  2JDI G;  1M4U A;  3EVK A;  3IC7 A;  2LGQ A;  2BTQ A;  2X6C A;  2CTP A;  3L74 H;  2JGU A;  1FFT B;  1SQX H;  4H37 A;  3UT5 A;  4CS3 A;  1GRJ A;  3E22 A;  5L3E A;  4H33 A;  2OTL V;  4UCO A;  1GO3 F;  1HNW B;  3RGB A;  5E1A C;  2R9A A;  4R8C A;  3AK3 A;  1PNK A;  4U7N A;  2W0F C;  1EN5 A;  5E79 Z;  2NR5 A;  1S76 D;  1Q8I A;  2HHH B;  1SA0 B;  2B1I A;  3HKC B;  1EZV H;  4OXS A;  2ZKO A;  2QGN A;  5B1A B;  4DK0 A;  2X7R B;  5J9P C;  2EBO A;  1HR0 B;  4TQF A;  3RW0 A;  3WG7 B;  1FD9 A;  3EXA A;  1Q82 W;  4DV5 B;  3PJS K;  3SJB C;  2D2C B;  3T1C A;  1N0N A;  4TQD A;  2Q4P A;  2KB1 A;  4GZR B;  2JRI A;  3KCY A;  1QU7 A;  2P6J A;  4WFG A;  1W59 A;  1AR1 B;  3W7T A;  2NN4 A;  1H2N A;  1Q81 W;  4OPA A;  3N27 A;  5FLX N;  3JSL A;  4P9P A;  3ZHV A;  1YEW A;  1Q90 D;  2LP7 A;  4Q20 A;  4DR3 O;  5CA0 B;  1WJZ A;  1H2S B;  3R66 A;  3ZRS A;  4RUF A;  2XUM A;  3PN1 A;  1S5L Z;  1VIB A;  2VRZ A;  1UPG A;  5C8Y B;  3D8C A;  4DV7 O;  1ZTE A;  4X62 O;  2QE7 G;  1F51 A;  2GTS A;  2R72 A;  5D5P A;  5HFM A;  3WB1 A;  3T4D A;  1JA8 A;  3K3W A;  2D3O W;  3ZS8 C;  1VQN V;  2E74 B;  1AR5 A;  1N8R W;  1QLE B;  5EZY A;  1HNZ O;  3ZHT A;  1GN6 A;  4RWU A;  4DUZ B;  4LR3 A;  1SZT A;  1V54 C;  3K5N A;  3UO3 A;  3G6E V;  2JIZ G;  1FJG B;  4U3F H;  4A5U B;  1NTM H;  1GM7 A;  5IT9 N;  4C7U A;  1KKC A;  4O4J A;  4B3M O;  2PUS A;  3JAT A;  5JWP A;  2F93 B;  3S3X A;  4O2A B;  1IZ3 A;  5LYJ A;  4CS4 A;  1BQZ A;  1H8E G;  1NTZ H;  4JTD B;  4PA4 A;  1Q43 A;  5EC1 C;  2L35 A;  4J9Z B;  4CC5 A;  3K9A A;  4PI0 A;  4NXM B;  3CRQ A;  2FB5 A;  2ZE8 A;  3P30 A;  2P67 A;  2XOK G;  4H44 B;  4YHH B;  4DK1 A;  2DE0 X;  4O4I A;  3TET A;  4OX9 O;  4HBN A;  3UCS C;  2IW5 A;  2RNB A;  4LNU A;  3ABM B;  4I0X A;  1RPO A;  3L70 H;  1R3K C;  4B3S O;  1GM8 A;  3H1H H; 
#chains in the Genus database with same CATH homology
 2VQE O;  4JI4 O;  4DV1 O;  4DV0 O;  3R66 A;  1FJG O;  4DV4 O;  2UUC O;  4JI5 O;  4B3R O;  2UU9 O;  4LF5 O;  3O65 A;  1IBL O;  3J81 N;  1FKA O;  4DV7 O;  4X62 O;  1XNR O;  1J5E O;  1N32 O;  1AB3 A;  2UXB O;  4NXN O;  1XMO O;  5IWA O;  4LF8 O;  4LFC O;  4LF4 O;  1D2D A;  5LMU O;  1AIL A;  4DV6 O;  2AGA A;  3JAM N;  4DV3 O;  4LF9 O;  1N36 O;  4GKJ O;  4LFA O;  1IBK O;  1HNZ O;  1XEQ A;  4KHP O;  4X64 O;  4OPH A;  4JI6 O;  4DV5 O;  2DJV A;  1XNQ O;  4B3T O;  2HHH O;  5BY1 A;  3J80 N;  4DR4 O;  4X65 O;  1FYJ A;  4A5U B;  3T1H O;  1HNW O;  1I94 O;  1N33 O;  5IT9 N;  1HNX O;  4DR1 O;  3F5T A;  5H5N A;  2VQF O;  1R1B A;  4DR6 O;  2DOS A;  4B3M O;  2FKX A;  2F4V O;  1HR0 O;  4LF6 O;  4JV5 O;  1XMQ O;  1R6T A;  2N74 A;  4AQY O;  2ZKO A;  4JI1 O;  2LW7 A;  4LFB O;  4YHH O;  5LMN O;  1N34 O;  5LL6 Y;  4DUY O;  3RT3 C;  1G1X B;  4JI2 O;  3OTO O;  1IBM O;  1X59 A;  3M8A A;  1YZB A;  3SDL A;  1NS1 A;  5BR8 O;  1DK1 A;  2UXC O;  1KUQ A;  3T1Y O;  2Z0A A;  4LF7 O;  4JI3 O;  1A32 A;  2UUB O;  3J7A U;  4K0K O;  4YY3 O;  4DR2 O;  4DR5 O;  4NXM O;  2JRI A;  5A2Q N;  4DUZ O;  5BXZ A;  4DV2 O;  4DR7 O;  2UUA O;  4OX9 O;  2UXD O;  4JYA O;  4OPA A;  5FLX N;  2E5L O;  4JI7 O;  2ZM6 O;  4GKK O;  4JI8 O;  1F7Y A;  4DR3 O;  4JI0 O;  4B3S O;  4X66 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...