2HVJC

Crystal structure of kcsa-fab-tba complex in low k+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab heavy chain
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hvjC00
2AHZA 2HJFC 3AG2C 3PJSK 1R3KC 3E8HA 3GB7C 3SPJA 1M56C 4MTGA 3SYCA 5BZBA 4MW8A 1XL6A 3E83A 3SJQC 4MSWC 3SPIA 4DXWA 3OR7C 4MVZA 5CBGA 1K4CC 2A79B 3UKMA 1XL4A 3SPGA 3SYQA 2Q6AA 1K4DC 2NLJC 4HZ3A 4RAIA 3X2QC 3TCUA 2KB1A 4R8CA 2WLJA 2WLMA 2ZXWC 3E8FA 2ZD9A 3SPHA 5EBWC 2Y69C 3LDCA 4PDMA 3SPCA 4J9ZB 5CBHA 1BL8A 3FB7C 2EIJC 4KFMA 4PA7A 4ZBMA 4RO2A 3WG7C 3T2MA 2YEVA 3EFFK 4JTCB 5B3SC 4MVQA 2A0LA 4MVSA 4QNHB 2EIKC 5IY5C 3FB5C 3IFXA 2X6BA 1ZWIC 4XDJA 3RVYA 2DWDC 4CBCA 4X89A 2DWEC 3K06A 1R3IC 4GX5A 3OR6C 4WFHA 4MS2A 3F7VC 1P7BA 2QTOA 3ZJZA 4PDRA 4X8AA 3ZRSA 2WLHA 4H37A 4GX2A 4PA3A 1OCRC 3STLC 3STZC 4P9PA 4MTFA 2IH1C 3AG1C 1R3LC 2P7TC 4R6ZA 5EBLC 3K08A 1V54C 2BOBC 5KUMA 3R65A 4UUJC 2EILC 1OCZC 2K1EA 3RVZA 3F7YC 3E8GA 1OCOC 2WLKA 5EC2C 4P2ZA 2ITCC 1JVMA 4MVRA 3FB8C 4JTDB 4PDLA 2ATKC 3TETA 4I9WA 3LDDA 4P30A 2WLIA 3RBZA 3JYCA 1KKDA 2HVKC 3E86A 4BW5A 4MVOA 4XDKA 3ABMC 3K0DA 4GX1A 4P9OA 2AHYA 3VOUA 3FB6C 2A9HA 2WLNA 3F5WC 3ABKC 1V55C 3AG4C 4MTOA 4PDVA 1M57C 4PA6A 3UM7A 4LBEC 2DYRC 2HFEC 3ASNC 2R9RB 5J9PC 3LDEA 4WFGA 5E1AC 3ABLC 4MW3A 4R7CA 2QKSA 2WLLA 2HVJC 4XDLA 3T4DA 3K04A 4R50A 5EBMC 2HG5C 3OGCC 3T1CA 4GX0A 2Q68A 3BEHA 4EKWA 5B1AC 4QE7A 4G28B 2WLIB 2ITDC 1LNQA 3K0GA 3OUSA 2Q67A 3IGAC 2EINC 3LUTB 3SYAA 1OCCC 2H8PC 2EIMC 3E89A 4MVMA 2Q69A 4PA4A 3HPLC 4HYOA 3E8BA 4MVUA 1G4YB 4LP8A 4LCUC 2JK5C 4RUFA 4X88A 3SYPA 4WFFA 5EK0A 4QE9A 5B1BC 3ASOC 4F4LA 2X6AA 3SYOA 4J9YB 2BOCC 4H33A 3OUFA 1R3JC 4WFEA 3RW0A 2OCCC 2WLLB 4JTAB 4RUEA 4TWKA 2IH3C 3AG3C 4PA9A 1QLEC 2X6CA 1ORQC 4G27B 3LNMB 1S5HC 2DYSC 5CBFA 5KUKA 5EC1C 3K03A 4OXSA 1J95A 3KG2A 2W0FC 3T4ZA
chains in the Genus database with same CATH superfamily
1IZ3A 4Z1VA 3AG4B 3A0RA 2QR4A 2F66C 3FAVA 4LF6B 2ZXWC 3P3NA 4DO2A 2GBOA 3OE7G 4B7KA 4O4IA 5JH7A 4PA7A 2IJKA 2E5LB 1M93A 4JZ2A 1BZKA 1M5IA 1H2KA 4YY3O 3OR6C 4WFHA 4LF8O 1XREA 4MS2A 5JCOC 1KYOF 1Y4MA 4O4IB 4DUZB 4LFCO 2JVDA 3U10A 4JI3B 2Y0IA 4MVRA 3B8MA 2G38A 2UXCO 2H3OA 4K3AA 2DJVA 4HAMA 1IBMO 3QO7A 1BMFG 2ETNA 4KHPO 3CE2A 3UO2A 1ZSPA 2R9RB 3CCMV 1TA8A 4B3MB 4C7UA 3D36A 1N33O 2EIJB 3N2KA 2B5UA 2RN9A 1KD1W 1Y67A 4JI6O 1EN5A 3OD4A 5IJ9A 4JI0B 4I9QA 5JVDA 2M6YA 2QEXV 1QNMA 5JQGA 1XHXA 1QQCA 2KKWA 2ZXWB 4JZGA 3N2KB 4N21A 5IE9A 3WFVA 1QLEC 2EZPA 5LMNB 2ADQB 2HJFC 1RFYA 3GB7C 4L8JA 5JVDB 4MSWC 5L3EA 3A0BZ 3UKMA 5JQGB 3ABKB 1H2SB 2IM9A 1AJNA 2WLJA 2L35A 2QSAA 3CRAA 3W7UA 3ZHSA 2CAZC 2Q7HA 4UXNA 1AI4A 5EBWC 1BL8A 3LSQA 3H9VA 1H8EG 3WG7C 1KP3A 5KA5A 4U3FH 3AK3A 4IHJB 4NTWA 1IBLB 4X65B 5FNVA 4Z1MG 3ZRSA 1JFFA 4GKKB 4UVBA 4K8XA 2OCCB 4R6ZA 1FYJA 3ZX6A 1NTZH 1RPRA 3AG3B 2RDCA 2DYSB 1KP2A 4JI8O 1Y74A 1I94O 4CZZA 4JI4O 5IYDO 5IYBO 4D7TA 1JX9A 3JYCA 4FZ0A 3JAWB 1D5NA 4RQFA 1SESA 1JQ0A 1AJPA 1YTFB 1YI2V 1BHBA 1SQQH 4W4LA 4MW3A 2JGDA 3M8AA 3OMAB 1WN7A 4FLXA 4MT8A 3OM3B 4I5SA 1WAZA 4FJCC 4NYKA 4B3TB 4X66O 5K1PA 1OCCC 1CXZB 2EIMC 3OFNG 3U11A 2JS5A 1HNZO 2FL4A 1FXKA 4IT5A 4ZI7A 2UUAB 2ODMA 4DR6B 1DK1A 2X6AA 4H33A 1Q6UA 2JGDB 1QCEA 4TUYB 5KX5B 4NXNO 4DR3B 1PV0A 2YS8A 1S5HC 2R70A 1J95A 3AG2C 1QLNA 1XL6A 1EBOA 3OR7C 5IYZA 4FLZA 4YIOA 1YDXA 4YJ2A 4ZI7B 5EZYA 2UXXA 1QR9A 4UB8Z 4LF4B 1SZXA 4K0KO 1KUQA 3ZEDA 3ZRVA 4DV7B 4I0XA 2ZM6B 5IY5C 2CUGA 2EIKC 2N05A 1GAXA 2Y4TA 4AQYB 3IAYA 5IYZB 3FYIB 3T1YB 2V1DA 2P5OA 1FFXA 5J2TA 3ZJZA 3SR2C 4X64B 1CP9A 4GX2A 4PA3A 1YTFD 4P9PA 2Q0OC 2ZIOA 4FFBA 4UCTA 3CCEV 3BCCH 3A0HZ 3Q4HA 2BOBC 4DV0O 5BMVA 4I0XB 3E8GA 4B3SO 5A2QN 3RBZA 2JDIG 2XT9A 4FLUA 2F4VB 3ABMC 1FFXB 5J2TB 2CH7B 3ZS8C 2NN4A 4FFBB 1NT2B 3UM7A 2KQXA 3Q4HB 1HP8A 1MMMA 5BMVB 1Q8IA 4FVMA 4O2AA 4ICGA 3G6EV 3JALB 4EB6A 3K04A 1GO3F 1PL4A 3ICXA 2YI8A 4LFBO 4G28B 5BY1A 1FXVA 3HKCA 3JARB 4CH5A 5H9CA 1TAEA 2C2AA 3QO8A 4U3JA 1VQPV 3B4SA 3EXAA 1GN2A 5EK0A 3E35A 2Q73A 4Q6GA 3OGIB 4JV5O 1JJOA 4EB6B 4OX9O 2X6CA 1ORQC 2XAQA 3LNMB 1BE3H 3HKCB 4OXSA 4ZHQA 1B3QA 2YSUB 5JJJB 5D5PA 2AZ2A 5CBGA 2HJDA 3UT5A 5J2UA 2IU0A 3BA8A 1XMOO 2ZT9B 2PI4A 2ZE8A 3C90A 5IJ0A 4ZKIA 2YDEA 1Y76B 2W6IG 4EFEA 2P90A 4D7SA 2QTSA 4ZHQB 4RO2A 1YF2A 5E79Z 4TQFA 3JATB 4MVQA 3ZRWB 1HNXO 3CP1A 1YIJV 4X89A 3JSLA 3UT5B 1MABG 3RYCB 2GHYA 3BAAA 2YIBD 4JYBA 2QDOA 4MTFA 1WP8A 5KUMA 3K08A 3O65A 1P84F 2UXDO 3ZCCA 1XMQO 1AI5A 3B77A 2ITCC 3LDDA 4GYCB 4PJ0Z 5LMUB 1XNRB 1M4UA 3TXQA 1AB3A 4DR5B 4BW5A 1E1RG 4GX1A 1HR0B 1YSCA 1VQ9V 1YXBA 3X2QB 3B2EE 1GTOA 5J9PC 3KCXA 2Y69B 5H2FZ 4F6RA 5IWAB 1G8MA 3DC6A 4FK5C 3HKBB 1BCCH 3LUTB 5LL6Y 1PNKA 2ZE6A 3RWRD 3J81N 4I7ZB 3CS5A 1G4YB 1YHQV 3ETDA 2QWRB 2DMXA 2ZNJA 4WFFA 4E4EA 1NJIW 1K97A 4F6RB 2QJ1A 3ETQA 1AI6A 1RM1C 1NU1H 1VQ5V 4DV3O 2AHZA 1E79G 2PGGA 4YY3B 1OZ0A 4I50A 4LF8B 4WCEV 1IDSA 1W2BU 1DTOA 4UV9A 5CN0A 2GV9A 2EULA 5CA3A 1FKAO 4LFCB 3CHXA 1QHTA 4LFAO 4LWSA 3K5MA 5B3SC 2P4VA 3DXRA 2F43G 2UXCB 2DWDC 4I50B 3G71V 3K06A 1IBMB 5JWPA 4X9QA 1MG1A 3CRRA 2ILMA 4KHPB 3OAAG 5CMUA 2E74B 2Q8VA 1N33B 3MHSC 3DXRB 5LGTA 2ARHA 4JTDB 4JI6B 1L0LH 4DV4O 1WP7A 2VQFO 4OGQB 2RQ6A 5B1NA 3VQWA 4FLYA 3H1HH 3AG4C 4DR1O 3CSXA 2QA4V 3BVOA 1GN6A 2HFEC 4CH4A 1HW7A 2QKAA 4DR7O 2ZNIA 4JI2O 2QKCA 3DSQA 1LUVA 3QO5A 2Q68A 4BR6A 2H94A 2XOKG 1IVSA 3OMIB 3K0GA 3AK1A 2CGOA 2CTWA 4G2KA 3K5LA 3HPLC 4MVUA 3CC4V 3H1KH 4LCUC 3WB0A 1YZBA 3E22A 4BWAA 5ITZA 1NQTA 1YITV 4A5UB 1XILA 3SJCC 3ZIAG 1KKCA 3MHHC 1XNQO 2W0FC 5B3SB 1EFRG 4NVPA 5LBQA 4MW8A 1UPGA 1TVKA 2D2CB 5D5QA 1Q82W 3E22B 5ITZB 2NLJC 2FKXA 4R8CA 3N27A 1AI7A 3RYIA 3E8FA 1N34O 2PYJA 2QWPB 1A32A 4RQEA 2CTRA 2EIJC 4JI8B 3KKYA 1I94B 4K8ZA 4JI4B 2YEVA 5L3GA 1HNWO 1TVKB 1I5YA 2BE3A 2DWEC 4GX5A 2JEXA 3TXSA 3RYIB 2WLHA 5LP6A 1YJ9V 4LR3A 1AP5A 2PI5A 1I0HA 3I5DA 2GTSA 3D36C 3B8NA 2YEVB 1WLEA 4P2ZA 2HHHO 5TISZ 1M56B 1BT8A 4X66B 2RJZA 1HNZB 3VOUA 2A9HA 1F7YA 5LP6B 3ABKC 5GTHZ 3FAVB 1VF6A 1NR1A 2ZR2A 2P6JA 4NXNB 4WFGA 2O57A 5JH7B 5CB4A 2VRZA 1QU7A 3BFRA 3NR7A 4LNUA 2EINC 4J7KA 5KAIZ 2H8PC 3F5TA 4OPAA 4TV9A 2P06A 3D8CA 1PPJH 4PV1B 4ZOLA 2F93B 4YXWG 1E1QG 1Z2GA 4FM0A 5KHJA 3TJTA 2K9PA 3RW0A 2OCCC 1HDJA 4K0KB 4B08A 3AG3C 5CB4B 1VQ7V 3K5OA 1OCOB 2DN9A 2DYSC 4FMTA 4LNUB 4PHZA 4JI5O 2DOSA 4ZIBA 1XL4A 1AROP 4ZOLB 1R6NA 4H0LB 1WPBA 1V9PA 2JJ2G 3ABLB 5CA0A 1URFA 4DV0B 3C3SA 4J9ZB 1VEWA 1BS3A 4ZBMA 2UU9O 4CC6A 4B3SB 3CJHA 3K9SA 3HKEA 2HR3A 5IJ9B 4DV6O 2V4DA 1DF5A 2DE0X 5KHGA 2VWKA 1GKFA 3ASOB 3STZC 1IXMA 5A9GA 2MW2B 5CA0B 3L72H 4FM1A 2ZR3A 5EYPA 3ZMSA 1P7GA 3CJHB 3B09A 3HKEB 4LFBB 2Q5ZA 5K1XA 4I9WA 3U0ZA 1JJ2U 4FIPC 4DRXA 4QIWF 1FFTB 2EINB 1FXKC 3K0DA 3M99B 2DQ0A 2WLNA 3LNNA 1Q3EA 1EN4A 3BHPA 1OV9A 4JYCA 4OX9B 2F1MA 2QWOB 3P30A 1THZA 3T1CA 1SF9A 3G6BA 4DRXB 5C8YA 4EKWA 4QE7A 2ITDC 4JAVA 2ZDIA 1LUWA 4MVMA 1ENVA 4HYOA 3E8BA 1NZ6A 3K79A 5FNVB 4LP8A 4X1IA 4BIOA 1K5QA 1JFFB 3K3WA 4XBFA 1XMOB 2BOCC 2WA4A 3OTOO 2IH3C 2PF4E 1Y74B 5C8YB 4OPHA 4UV8A 3T1HO 3CMEV 3KG2A 3LDEA 1AR4A 2Q9LA 2YIAA 1FAFA 1HNXB 3UO3A 4TV8A 4X1IB 3KCYA 5DECA 3AEIA 1K4DC 4RAIA 1H8HG 1M57B 2LP7A 1GK9A 4UCRA 1B6QA 3K57A 2UXDB 1K3EA 1N36O 1XMQB 2Q7EA 2E5LO 4GLXA 3P32A 1NVPB 4JTCB 3K5NA 1ZWIC 4DV5O 4TV8B 3RYFA 1N32B 4LF9O 1Q86W 2YC0A 1FXKB 4O4LA 4X8AA 3CRQA 4KL1A 2IJJA 1K73W 1PD3A 1OCZC 1Y66A 2WLKA 1IURA 5EC2C 3FB8C 3RYFB 2ZIMA 3QNEA 1R73A 4XDKA 4YJ2B 1XUQA 4O4LB 5EZYB 3K58A 2YUAA 3G67A 1PL0A 2KG7A 4J11A 3QG5A 3CB2A 1N0JA 4DV3B 1QVGU 2QGNA 3OUSA 5FPOA 3BY6A 2Q69A 3THOA 1O9HA 2F95B 2OCHA 3EVKA 4QE9A 4J9YB 3LSUA 4O4JA 1V54B 2KG7B 1SQGA 1KC8W 1GRJA 2PYLA 1L1FA 5L3DA 4LFAB 4U7NA 5EC1C 1S3JA 1NH2B 3CEIA 3BRCA 5LHIA 4JAAA 1DGSA 4BAYA 1KMIZ 2LW7A 3I56V 4FM2A 1AILA 4JI1O 3OT7A 4HZ3A 4YHHO 2N04A 3X2QC 1CEZA 2Q0AA 4ABMA 5CA1A 1Q90D 4DR4O 5KAFZ 4O2AB 2Y69C 1Q43A 3LDCA 1OCZB 3CRCA 5IYCO 4QNHB 4MVSA 4DV4B 1MSWD 2X6BA 1VQOV 4U3JB 2EJRA 1KB9F 5CA1B 4DR1B 1NTKH 4DR7B 5EBLC 1GM8A 3B40A 4JI2B 3R65A 1MNGA 4AILC 4UCOA 3CCVV 4J42A 1KQSU 1F23A 1BQ0A 3MD0A 1VQMV 2L6LA 3MDSA 3DC5A 3CCUV 4DV2O 2WLIA 1ZX3A 3JAKA 2UXBO 2HVKC 2R72A 4J10A 3ETEA 5J2UB 3M7MX 3A8TA 1Q6IA 1SQXH 1JMKC 2X7RB 5L3BA 2DYRC 3ASNC 1AJQA 3ZMUA 4QPKA 5IJ0B 3D3QA 2R9AA 4JF3A 5DEDA 5GW7A 2LQTA 4DYLA 2WLIB 2JS3A 3JAKB 2OIEA 3UCSC 1VQ6V 3ABUA 3RYHA 5KHIA 2HP8A 1ZTEA 1S76D 3HKDA 4X88A 1OCRB 4F4LA 1XQ8A 3BPZA 4B7EA 1N34B 1Q81W 4UB6Z 5BR8O 4JTAB 2EILB 1BHAA 3H01A 3L73H 2BSKA 1Q5OA 2IJIA 4W4KA 3WU2Z 1PNLA 5JJEB 3ZN1A 1R1BA 3T4ZA 3PJSK 5C93A 2XASA 1HNWB 4MTGA 2N74A 1VARA 3HKDB 1JA8A 2YXLA 1QBZA 4IYHA 2QM7A 3EHBB 2Q6AA 2OTJV 4GKJO 2XAJA 4O2BA 2CTPA 2P67A 1SQVH 5LGNA 1Z5WA 2OT5A 3AG7A 4DR2O 2FTKA 4DV7O 2FMLA 4GCZA 3H1IH 2VWJA 4DK1A 3T2MA 5DN6G 2HHHB 2MK3A 5L3FA 3CYOA 3SJAC 3G80A 4O2BB 2A7WA 5B1BB 3STLC 5FPRA 2DYRB 2IH1C 3AG1C 3ASNB 4X1KA 3GVMA 3CCRV 2XAGA 3OEEG 1TUBA 2PZSA 1PM9A 3TETA 4P30A 4PELA 2LW1A 2XAHA 2IBZH 2AHYA 3FB6C 1N0NA 4AHCA 4B3RO 1SQBH 4UVAA 4LBEC 1AVMA 5LOVA 2HKOA 4LF7O 1K34A 1TUBB 4LWSB 3T4DA 1W59A 2VQEO 1B06A 1ZLZA 5B1AC 3CXCU 1EN6A 3SYAA 3VQYA 1IX9A 3QTCA 4FLTA 2RCVA 3GWOA 4JYAO 4I4TA 4WFEA 1P49A 4GZRB 1EZVH 1P4RA 3H1JH 2UU9B 1M56C 1US6A 4LH7A 4DV6B 4FLVA 4PD4F 3E83A 3SPIA 2ZE7A 1F51A 4X62O 2A79B 1M90W 5L3CA 2QE7G 2XHBA 5LP6C 2AW9A 4I4TB 3JD3A 3ZHTA 2BCCH 1U97A 3CXHF 3AG1B 1D2DA 1IBKO 3ZN0A 5KHHA 1Y6XA 3EFFK 3S3XA 2NNUA 4PI0A 3S3WA 4CBCA 1M9NA 5H6QA 4YIPA 1YEWA 1VF6C 1Q7YW 2GTAA 4UUJC 3PN1A 2BTQA 1W0KG 1OHHG 3F7YC 3KZIZ 1OCOC 1JVMA 2IW5A 3SJBC 5B1AB 3CC2V 1FPOA 4LH6A 4P9OA 1GH6A 1Z5VA 2B9ZA 3L71H 1M1KW 4K35A 4PDVA 2XAFA 5KLVH 1VQNV 2CTQA 1BQZA 2BTQB 3ABLC 3OTOB 3JSNA 1FJGO 3TK1A 3FX7A 3T1HB 3RGBA 4MTXA 3O9OA 4EFBA 3N2GA 3JAMN 1H2MA 4WBNA 2X0LA 3OW2U 3DTUB 4NXMO 4UCUA 4X20A 3ASOC 1MA1A 1R3JC 1YCIA 1N36B 4DUYO 1VF7A 4XDJA 3E8HA 3N2GB 3SYCA 4QJFB 4DV5B 4WBNB 4LF9B 3JASA 3W7SA 2ADPA 2FB5A 3AK2A 2HEPA 3JCUZ 4X20B 4IIJA 4J80A 3CCLV 2NR5A 2ZD9A 2ZQMA 1XOUA 2GUZA 5H5NA 3WB1A 1EZJA 1NS1A 5LHGA 4QPJA 2QWQB 2EBOA 3CX5F 5EIBC 3W7TA 1VQ8V 3JASB 4NKGB 1J5EO 5HFMA 1H38A 4TV9B 3OEHG 4IIJB 5AG2A 4LF5O 2GUZB 1GN3A 4J41A 1JOYA 3ZMTA 1VMGA 3GWKC 4IL6Z 2K1EA 2B1GA 1G1XB 2LJ2A 4PDLA 2ZDIC 3FYEB 1F4MA 2Q4PA 5KA6A 4F6EA 3SDLA 3ABTA 1M57C 5JCOA 4X1YA 1NI8A 2A06H 5E1AC 2WAMA 4H44B 2JRIA 1JR9A 3ZHUA 4XDLA 4R50A 4O4HA 2FYUH 3RN4A 3ZHVA 3JD1A 4IHJA 4TQDA 3APQA 1FD9A 4JI1B 1SQPH 4CS3A 4YHHB 2UUCO 3TGUH 1NKDA 4X1YB 2WPDG 4DR4B 4JGSA 1WB7A 3JD0A 1DLBA 2KSDA 4JV5B 4NTYA 5EYPB 4O4HB 3RT3C 4FLWA 3K03A 4HNAA 4J7JA 1VQKV 1K8AW 2PTMA 3A2FA 3FFQA 2AXTZ 4IGGA 3D3IA 2UUBO 4DXWA 4MVZA 3JAWA 1K4CC 2AGAA 4CH6A 4DV1O 4TSFG 4JI7O 3VBBA 3SYQA 4TT3G 3W7XA 4JYYA 4BIZA 5B1OA 3BABA 1WPXA 2LGQA 4HNAB 4GUNA 1W0JG 2E75B 2QWNB 2WA3A 1GM9A 3FB5C 5HFLA 4DV2B 3IC9A 2UXBB 1UJWB 4J7ZA 5B5EZ 2R9IA 5BXZA 1S77D 3ZMVA 1I08A 1I7FA 1N8RW 1MOFA 4QGPA 2ZINA 4LF6O 3QVNA 2WSSG 1R3LC 2EJ7A 4TUYA 1V54C 1RPOA 1MZFA 5KX5A 2GSMB 3W7WA 1QLEB 1AR1B 2HLDG 2Z0AA 4PI2A 5LGUA 4EEQA 4L87A 2WWWA 2XTAA 2CK3G 1XBLA 4MTOA 1IXBA 1O9GA 5BR8B 3ZRXA 4DUZO 1UFIA 4R7CA 4Z2WA 2ZKOA 2DQ3A 2Y4UA 4JI3O 3WG7B 4GX0A 5EIBD 1LNQA 2Q67A 3IGAC 3IJ4A 2E76B 3CWBH 5IDJA 1H2NA 4RUFA 3SYPA 5GTIZ 4GKJB 2RMKB 1B04A 2V7QG 4D6TH 2B1IA 1ZAUA 4DR2B 4TWKA 4B3MO 3CC7V 1KBHA 4G27B 3WB2A 1KU9A 3SPJA 1COWG 5BZBA 4JI0O 2YI9A 3SJQC 2PUSA 1SKVA 1MSDA 1MZEA 2CH7A 5LXTA 3RFRA 1WNSA 2E3CA 4JASA 2YIBA 3H1LH 2JEUA 3ZHRA 2ZE5A 1ZL8A 2DW4A 2M7WA 3OTFA 4PDMA 3ZHQA 3J80N 1NBMG 4YJ3A 3JALA 3JD2A 5LMNO 1VP7A 3MAQA 4KXRA 4UCVA 2A0LA 1NVPD 2YXHA 2LO1A 3FD9A 3JARA 1OCCB 2EIMB 1XEQA 1HWYA 2LFSA 5LXTB 5KHKA 3F7VC 1P7BA 2QTOA 4B3RB 5LYJA 4H37A 1ZL8B 1OCRC 1NR7A 1R6TA 2JIZG 2RNBA 4O4JB 1L0NH 4H13B 1AR5A 5FLXN 2EILC 4LF7B 3CCQV 4YJ3B 1NTMH 3J7AU 2VQEB 2XUMA 3OMNB 2XNDG 4JAUA 3AG2B 4E2LA 2UXNA 2VQFB 1SQFA 3IC7A 1KKDA 4CS2A 1PNMA 4LC1A 1IBLO 4X65O 4UCSA 2EX3A 4HBNA 5LYJB 1V55C 3L9DA 1FXHA 4GKKO 3FKSG 3CMAV 4JYAB 3HB3B 3R66A 2AZ0A 2QKSA 2Y0PA 2HVJC 1VF5B 1N4CA 1AP6A 1Y76A 1ZUQA 2IJHA 3K59A 3ETGA 5IY5B 2Z3YA 2EIKB 3JATA 3ZRWA 4U7OA 3E89A 4PA4A 3CD6V 4X62B 2OIGA 2JK5C 3RYCA 2PY5A 1WA8A 2CDYA 5B1BC 2OTLV 3OUFA 1VIBA 1S0VA 4RUEA 1IBKB 4KP4A 3L70H 1K5SA 1XI1A 1XNQB 1NH2D 3JCZA 4B3TO 1DF4A 4FZ1A 3ABMB 4FFKA 3VQVA 3SGIA 1WA8B 1XHZA 2UUAO 4DR6O 2WLMA 4GT1A 3VQXA 3SPHA 1OJHA 4DR3O 1TUEB 5CBHA 1L8DA 3LSSA 3APOA 5B66Z 3JD4A 2QM4A 3DGEA 3HKBA 4IYIA 4N23A 1S5JA 5DM6V 1N32O 3RYHB 2QM8A 3RVYA 1CPYA 3ZBHA 1YJNV 3QF7A 3C3TA 1QR8A 2OWOA 1V55B 3L75H 2YICA 4UVCA 5IT9N 1G6UA 4LF4O 4WF9V 1LR1A 2BSKB 1VQLV 4CH3A 1FJGB 1SZTA 2ZCEA 2ZM6O 5GONA 3I55V 2ATKC 3E2EA 1KECA 4AQYO 1K9MW 1SS3A 2IU3A 3T1YO 1I5XA 1GM7A 1S72V 3F5WC 4NXMB 2YIDA 4X64O 4BIUA 1SA0A 2Y48A 4WFBV 1F4NA 1XDCA 1D5AA 1PP9H 4DUYB 1JCHA 3G4SV 5EBMC 1K33A 4RWUA 1Q6HA 2HG5C 3OGCC 5GONB 1U96A 5KMGA 1YVWA 3BEHA 5LHHA 1H2GA 4AI8A 1ROPA 1X4TA 3K9AA 2F4VO 1SRYA 2W0XA 1SA0B 3SYOA 4X1KB 2P22C 3P3PA 2BTOA 2Q7GA 5KMGB 4PA9A 1GN4A 2LFRA 5CBFA 5KUKA 1R3KC 2JJ1G 4JI5B 1J5EB 4JPRA 4UFZA 3ZMZA 2OYQA 3SPGA 3TCUA 4LF5B 2KB1A 3BA9A 1SC5B 5LOVB 1BSMA 1S5LZ 1VQ4V 4Q20A 2EZOA 1QVFU 3SPCA 3FB7C 4KFMA 4NR1A 2GDSA 3IFXA 1PKXA 4CS4A 1RSOA 1SETA 5LA6A 1R3IC 1SERA 3UQ8A 2P4KA 4CC5A 1JPXA 4I55A 4PDRA 4DW0A 2VS0A 2JGUA 5H6RA 1FS0G 2CGNA 4NB5A 2P7TC 1K7DA 3RVZA 1RM1B 2A3QA 2LGWA 1RSOB 5FL7G 5LA6B 1K92A 1EM1A 1WJZA 2F23A 3E86A 2W6JG 4MVOA 4NTXA 4KUMA 3CCSV 1RP3B 4I55B 5JJNB 5F2VO 2UUCB 4DK0A 4WFAV 4PA6A 2WLLA 2CE4A 4ASUG 3HR0A 3ML0A 4FPPA 1BGYH 2YXYA 3CCJV 5LMUO 1H2LA 3CRMA 1XNRO 2UUBB 4DR5O 1X59A 4DV1B 1HR0O 4JI7B 3L74H 2Z5UA 1WB8A 4BW9A 4DW1A 3CPWU 2D3OW 1T5EA 4TOIA 2WLLB 1YJWV 3NXSA 5IWAO 1GMGA 1R6KA 1TGOA
chains in the Genus database with same CATH topology
2AHZA 1E79G 1VQKV 1K8AW 4BAYA 3D3IA 3I56V 4DXWA 4MVZA 1K4CC 1OZ0A 4TSFG 3VBBA 4WCEV 3SYQA 1W2BU 4HZ3A 3AG4B 1DTOA 4UV9A 5CN0A 3A0RA 3X2QC 1CEZA 5CA3A 2ZXWC 4TT3G 4DO2A 3W7XA 3OE7G 4BIZA 5B1OA 2Y69C 3LDCA 1OCZB 1WPXA 4PA7A 2IJKA 5IYCO 1W0JG 5B3SC 4QNHB 4MVSA 2F43G 1GM9A 3FB5C 1MSWD 5HFLA 2X6BA 1UJWB 2DWDC 1VQOV 2EJRA 3G71V 3K06A 2R9IA 3OR6C 4WFHA 1S77D 4MS2A 3ZMVA 1N8RW 1MOFA 1MG1A 3OAAG 2WSSG 1Y4MA 1R3LC 5CMUA 5EBLC 1GM8A 1V54C 1RPOA 3R65A 2GSMB 3W7WA 3CCVV 1QLEB 1KQSU 1AR1B 1F23A 3MHSC 2HLDG 5LGTA 4MVRA 3MD0A 4JTDB 5LGUA 1VQMV 4L87A 2WWWA 3B8MA 3CCUV 2WLIA 2HVKC 5B1NA 3ETEA 2CK3G 4HAMA 3QO7A 3AG4C 4MTOA 1BMFG 2X7RB 5L3BA 2QA4V 2DYRC 2HFEC 3ASNC 1AJQA 2R9RB 4QPKA 3ZMUA 3CCMV 3ZRXA 3D36A 4R7CA 2EIJB 2B5UA 2DQ3A 4JF3A 5GW7A 3WG7B 4GX0A 3QO5A 2Q68A 1KD1W 2H94A 2XOKG 2WLIB 3OMIB 1LNQA 3K0GA 2Q67A 3IGAC 1VQ6V 3ABUA 4G2KA 3HPLC 1S76D 4MVUA 3CC4V 2QEXV 4LCUC 5IDJA 4RUFA 4X88A 3SYPA 1NQTA 1OCRB 4F4LA 1YITV 2ZXWB 1Q81W 2V7QG 2B1IA 4JTAB 2EILB 4N21A 4TWKA 3H01A 3WFVA 1BHAA 3CC7V 1QLEC 2IJIA 4G27B 2EZPA 3ZIAG 3MHHC 1PNLA 2W0FC 3ZN1A 3T4ZA 5B3SB 2HJFC 1EFRG 3PJSK 5C93A 3GB7C 2XASA 3SPJA 1COWG 4MTGA 5BZBA 5LBQA 4MW8A 3SJQC 4MSWC 5L3EA 1Q82W 3UKMA 1QBZA 2QM7A 3ABKB 3EHBB 2Q6AA 2NLJC 2OTJV 4JASA 2XAJA 2JEUA 4R8CA 1AJNA 2P67A 2WLJA 1AI7A 5LGNA 2OT5A 3E8FA 3W7UA 2DW4A 4UXNA 1AI4A 2M7WA 5EBWC 2FTKA 4PDMA 4RQEA 1BL8A 1NBMG 3LSQA 4GCZA 2EIJC 1H8EG 3JD2A 3WG7C 3T2MA 2YEVA 5L3GA 5DN6G 2A0LA 2MK3A 5L3FA 1NVPD 1KP3A 5KA5A 3CYOA 1OCCB 2EIMB 1HWYA 1I5YA 2LFSA 2DWEC 4GX5A 2JEXA 3F7VC 1P7BA 2QTOA 4Z1MG 3ZRSA 2WLHA 4H37A 5B1BB 1YJ9V 1OCRC 4UVBA 3STLC 2PI5A 1NR7A 2JIZG 2DYRB 3AG1C 3ASNB 2IH1C 2OCCB 4R6ZA 3CCRV 2XAGA 1RPRA 2EILC 3B8NA 3OEEG 3AG3B 3CCQV 2YEVB 2DYSB 1KP2A 1WLEA 4P2ZA 4CZZA 3OMNB 2XNDG 5IYDO 4JAUA 3AG2B 3TETA 5IYBO 4E2LA 2UXNA 1M56B 4P30A 4PELA 3IC7A 2XAHA 1JX9A 3JYCA 1KKDA 1PNMA 4RQFA 4LC1A 2AHYA 3VOUA 3FB6C 2A9HA 1SESA 3ABKC 1V55C 1JQ0A 1AJPA 4UVAA 1NR1A 1YTFB 1FXHA 2ZR2A 3FKSG 4LBEC 1YI2V 3CMAV 2P6JA 3HB3B 1BHBA 2HKOA 4WFGA 4MW3A 3OMAB 2QKSA 1K34A 2HVJC 3T4DA 4MT8A 3OM3B 2IJHA 4I5SA 3ETGA 5IY5B 2Z3YA 5B1AC 2EIKB 3CXCU 3ZRWA 4FJCC 4U7OA 2EINC 3SYAA 1OCCC 2H8PC 2EIMC 3OFNG 3E89A 4PA4A 3CD6V 1FXKA 2JK5C 4YXWG 1E1QG 5B1BC 2X6AA 2OTLV 3GWOA 4H33A 3OUFA 1QCEA 4WFEA 3RW0A 2OCCC 1S0VA 4RUEA 4KP4A 1VQ7V 3AG3C 1OCOB 1K5SA 1S5HC 2DYSC 1P4RA 4FMTA 1J95A 1NH2D 3AG2C 3JCZA 1M56C 1QLNA 1DF4A 1XL6A 3E83A 3SPIA 3ABMB 1EBOA 3OR7C 1F51A 2A79B 1M90W 1XL4A 5L3CA 1AROP 2QE7G 1R6NA 2UXXA 1QR9A 2WLMA 3JD3A 4GT1A 2JJ2G 3SPHA 3AG1B 3ABLB 3ZN0A 1TUEB 5CBHA 4J9ZB 3LSSA 3ZRVA 4ZBMA 3EFFK 3JD4A 3DGEA 5IY5C 2EIKC 4N23A 2NNUA 2HR3A 5DM6V 2QM8A 3RVYA 1CPYA 3FYIB 1DF5A 4CBCA 1M9NA 5H6QA 2V1DA 1YJNV 1QR8A 3ZJZA 1V55B 1GKFA 1CP9A 3ASOB 4GX2A 4PA3A 3STZC 1YTFD 1IXMA 4P9PA 4UVCA 3CCEV 1Q7YW 4WF9V 2BOBC 4UUJC 1VQLV 1W0KG 2ZR3A 3ZMSA 1OHHG 3F7YC 3E8GA 1OCOC 1SZTA 1JVMA 2IW5A 3I55V 2ATKC 5B1AB 4I9WA 1JJ2U 3E2EA 4FIPC 4QIWF 1KECA 1FFTB 1K9MW 2EINB 3RBZA 3CC2V 2JDIG 1FXKC 3ABMC 3K0DA 2IU3A 4P9OA 3M99B 1I5XA 2DQ0A 1GM7A 2WLNA 1S72V 3F5WC 1M1KW 4PDVA 2XAFA 1VQNV 3UM7A 4JYCA 4BIUA 2Y48A 4WFBV 1F4NA 3ABLC 1JCHA 3P30A 3G6EV 3G4SV 3K04A 1GO3F 1THZA 1K33A 5EBMC 2HG5C 3OGCC 3T1CA 3TK1A 3BEHA 4EKWA 4QE7A 5LHHA 1H2GA 4G28B 1FXVA 2ITDC 5H9CA 2C2AA 4JAVA 4MTXA 2ZDIA 1ROPA 3QO8A 4MVMA 1ENVA 3K9AA 4HYOA 3E8BA 3K79A 1VQPV 4LP8A 2X0LA 3OW2U 3DTUB 1SRYA 1K5QA 5EK0A 3K3WA 3E35A 4XBFA 3ASOC 3SYOA 2BOCC 1R3JC 2IH3C 4PA9A 2X6CA 1ORQC 2XAQA 3LNMB 2LFRA 5CBFA 4UV8A 5KUKA 4OXSA 3CMEV 3KG2A 3LDEA 4XDJA 1R3KC 3E8HA 2JJ1G 2YSUB 3SYCA 4QJFB 4JPRA 5CBGA 3W7SA 3ZMZA 3SPGA 3AEIA 2IU0A 1K4DC 4RAIA 3TCUA 1H8HG 1M57B 2KB1A 3CCLV 2LP7A 1GK9A 2PI4A 1B6QA 2ZD9A 2ZQMA 1VQ4V 4Q20A 4ZKIA 1K3EA 1EZJA 2EZOA 1QVFU 3SPCA 3FB7C 4KFMA 2W6IG 5LHGA 2P90A 4QPJA 3P32A 4RO2A 1NVPB 2EBOA 4JTCB 4MVQA 3ZRWB 3IFXA 1PKXA 3W7TA 1ZWIC 3CP1A 1VQ8V 1SETA 1YIJV 5HFMA 4X89A 1H38A 1Q86W 3OEHG 1R3IC 1FXKB 1MABG 2GHYA 1SERA 1JPXA 4PDRA 4X8AA 4JYBA 2IJJA 1K73W 5H6RA 1FS0G 4MTFA 2P7TC 5KUMA 1JOYA 1K7DA 3K08A 3ZMTA 1PD3A 1OCZC 3ZCCA 2K1EA 2B1GA 1Y66A 3RVZA 2WLKA 1RM1B 1AI5A 3B77A 5EC2C 2ITCC 3FB8C 4PDLA 2ZDIC 3LDDA 5FL7G 3FYEB 3QNEA 1R73A 1F4MA 1K92A 3E86A 4BW5A 4MVOA 4XDKA 2W6JG 1E1RG 4GX1A 4KUMA 3CCSV 1YSCA 5KA6A 1VQ9V 4WFAV 3X2QB 3ABTA 1M57C 4PA6A 1GTOA 5J9PC 5E1AC 2WAMA 2Y69B 1PL0A 2WLLA 4XDLA 4ASUG 1G8MA 4R50A 4FK5C 3ML0A 4FPPA 1QVGU 3JD1A 3OUSA 3LUTB 3CCJV 3BY6A 2Q69A 1PNKA 1G4YB 1YHQV 3ETDA 2Z5UA 4WFFA 1NKDA 4QE9A 3CPWU 2D3OW 2WPDG 4J9YB 1NJIW 4JGSA 1K97A 1V54B 3JD0A 2WLLB 1DLBA 1KC8W 1YJWV 1AI6A 3NXSA 1L1FA 5L3DA 4U7NA 1RM1C 1GMGA 5EC1C 3K03A 1VQ5V 1S3JA 1NH2B 1R6KA 5LHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHZ A;  2HJF C;  3AG2 C;  3PJS K;  1R3K C;  3E8H A;  3GB7 C;  3SPJ A;  1M56 C;  4MTG A;  3SYC A;  5BZB A;  4MW8 A;  1XL6 A;  3E83 A;  3SJQ C;  4MSW C;  3SPI A;  4DXW A;  3OR7 C;  4MVZ A;  5CBG A;  1K4C C;  2A79 B;  3UKM A;  1XL4 A;  3SPG A;  3SYQ A;  2Q6A A;  1K4D C;  2NLJ C;  4HZ3 A;  4RAI A;  3X2Q C;  3TCU A;  2KB1 A;  4R8C A;  2WLJ A;  2WLM A;  2ZXW C;  3E8F A;  2ZD9 A;  3SPH A;  5EBW C;  2Y69 C;  3LDC A;  4PDM A;  3SPC A;  4J9Z B;  5CBH A;  1BL8 A;  3FB7 C;  2EIJ C;  4KFM A;  4PA7 A;  4ZBM A;  4RO2 A;  3WG7 C;  3T2M A;  2YEV A;  3EFF K;  4JTC B;  5B3S C;  4MVQ A;  2A0L A;  4MVS A;  4QNH B;  2EIK C;  5IY5 C;  3FB5 C;  3IFX A;  2X6B A;  1ZWI C;  4XDJ A;  3RVY A;  2DWD C;  4CBC A;  4X89 A;  2DWE C;  3K06 A;  1R3I C;  4GX5 A;  3OR6 C;  4WFH A;  4MS2 A;  3F7V C;  1P7B A;  2QTO A;  3ZJZ A;  4PDR A;  4X8A A;  3ZRS A;  2WLH A;  4H37 A;  4GX2 A;  4PA3 A;  1OCR C;  3STL C;  3STZ C;  4P9P A;  4MTF A;  2IH1 C;  3AG1 C;  1R3L C;  2P7T C;  4R6Z A;  5EBL C;  3K08 A;  1V54 C;  2BOB C;  5KUM A;  3R65 A;  4UUJ C;  2EIL C;  1OCZ C;  2K1E A;  3RVZ A;  3F7Y C;  3E8G A;  1OCO C;  2WLK A;  5EC2 C;  4P2Z A;  2ITC C;  1JVM A;  4MVR A;  3FB8 C;  4JTD B;  4PDL A;  2ATK C;  3TET A;  4I9W A;  3LDD A;  4P30 A;  2WLI A;  3RBZ A;  3JYC A;  1KKD A;  2HVK C;  3E86 A;  4BW5 A;  4MVO A;  4XDK A;  3ABM C;  3K0D A;  4GX1 A;  4P9O A;  2AHY A;  3VOU A;  3FB6 C;  2A9H A;  2WLN A;  3F5W C;  3ABK C;  1V55 C;  3AG4 C;  4MTO A;  4PDV A;  1M57 C;  4PA6 A;  3UM7 A;  4LBE C;  2DYR C;  2HFE C;  3ASN C;  2R9R B;  5J9P C;  3LDE A;  4WFG A;  5E1A C;  3ABL C;  4MW3 A;  4R7C A;  2QKS A;  2WLL A;  2HVJ C;  4XDL A;  3T4D A;  3K04 A;  4R50 A;  5EBM C;  2HG5 C;  3OGC C;  3T1C A;  4GX0 A;  2Q68 A;  3BEH A;  4EKW A;  5B1A C;  4QE7 A;  4G28 B;  2WLI B;  2ITD C;  1LNQ A;  3K0G A;  3OUS A;  2Q67 A;  3IGA C;  2EIN C;  3LUT B;  3SYA A;  1OCC C;  2H8P C;  2EIM C;  3E89 A;  4MVM A;  2Q69 A;  4PA4 A;  3HPL C;  4HYO A;  3E8B A;  4MVU A;  1G4Y B;  4LP8 A;  4LCU C;  2JK5 C;  4RUF A;  4X88 A;  3SYP A;  4WFF A;  5EK0 A;  4QE9 A;  5B1B C;  3ASO C;  4F4L A;  2X6A A;  3SYO A;  4J9Y B;  2BOC C;  4H33 A;  3OUF A;  1R3J C;  4WFE A;  3RW0 A;  2OCC C;  2WLL B;  4JTA B;  4RUE A;  4TWK A;  2IH3 C;  3AG3 C;  4PA9 A;  1QLE C;  2X6C A;  1ORQ C;  4G27 B;  3LNM B;  1S5H C;  2DYS C;  5CBF A;  5KUK A;  5EC1 C;  3K03 A;  4OXS A;  1J95 A;  3KG2 A;  2W0F C;  3T4Z A; 
#chains in the Genus database with same CATH topology
 1IZ3 A;  4Z1V A;  3AG4 B;  3A0R A;  2QR4 A;  2F66 C;  3FAV A;  4LF6 B;  2ZXW C;  3P3N A;  4DO2 A;  2GBO A;  3OE7 G;  4B7K A;  4O4I A;  5JH7 A;  4PA7 A;  2IJK A;  2E5L B;  1M93 A;  4JZ2 A;  1BZK A;  1M5I A;  1H2K A;  4YY3 O;  3OR6 C;  4WFH A;  4LF8 O;  1XRE A;  4MS2 A;  5JCO C;  1KYO F;  1Y4M A;  4O4I B;  4DUZ B;  4LFC O;  2JVD A;  3U10 A;  4JI3 B;  2Y0I A;  4MVR A;  3B8M A;  2G38 A;  2UXC O;  2H3O A;  4K3A A;  2DJV A;  4HAM A;  1IBM O;  3QO7 A;  1BMF G;  2ETN A;  4KHP O;  3CE2 A;  3UO2 A;  1ZSP A;  2R9R B;  3CCM V;  1TA8 A;  4B3M B;  4C7U A;  3D36 A;  1N33 O;  2EIJ B;  3N2K A;  2B5U A;  2RN9 A;  1KD1 W;  1Y67 A;  4JI6 O;  1EN5 A;  3OD4 A;  5IJ9 A;  4JI0 B;  4I9Q A;  5JVD A;  2M6Y A;  2QEX V;  1QNM A;  5JQG A;  1XHX A;  1QQC A;  2KKW A;  2ZXW B;  4JZG A;  3N2K B;  4N21 A;  5IE9 A;  3WFV A;  1QLE C;  2EZP A;  5LMN B;  2ADQ B;  2HJF C;  1RFY A;  3GB7 C;  4L8J A;  5JVD B;  4MSW C;  5L3E A;  3A0B Z;  3UKM A;  5JQG B;  3ABK B;  1H2S B;  2IM9 A;  1AJN A;  2WLJ A;  2L35 A;  2QSA A;  3CRA A;  3W7U A;  3ZHS A;  2CAZ C;  2Q7H A;  4UXN A;  1AI4 A;  5EBW C;  1BL8 A;  3LSQ A;  3H9V A;  1H8E G;  3WG7 C;  1KP3 A;  5KA5 A;  4U3F H;  3AK3 A;  4IHJ B;  4NTW A;  1IBL B;  4X65 B;  5FNV A;  4Z1M G;  3ZRS A;  1JFF A;  4GKK B;  4UVB A;  4K8X A;  2OCC B;  4R6Z A;  1FYJ A;  3ZX6 A;  1NTZ H;  1RPR A;  3AG3 B;  2RDC A;  2DYS B;  1KP2 A;  4JI8 O;  1Y74 A;  1I94 O;  4CZZ A;  4JI4 O;  5IYD O;  5IYB O;  4D7T A;  1JX9 A;  3JYC A;  4FZ0 A;  3JAW B;  1D5N A;  4RQF A;  1SES A;  1JQ0 A;  1AJP A;  1YTF B;  1YI2 V;  1BHB A;  1SQQ H;  4W4L A;  4MW3 A;  2JGD A;  3M8A A;  3OMA B;  1WN7 A;  4FLX A;  4MT8 A;  3OM3 B;  4I5S A;  1WAZ A;  4FJC C;  4NYK A;  4B3T B;  4X66 O;  5K1P A;  1OCC C;  1CXZ B;  2EIM C;  3OFN G;  3U11 A;  2JS5 A;  1HNZ O;  2FL4 A;  1FXK A;  4IT5 A;  4ZI7 A;  2UUA B;  2ODM A;  4DR6 B;  1DK1 A;  2X6A A;  4H33 A;  1Q6U A;  2JGD B;  1QCE A;  4TUY B;  5KX5 B;  4NXN O;  4DR3 B;  1PV0 A;  2YS8 A;  1S5H C;  2R70 A;  1J95 A;  3AG2 C;  1QLN A;  1XL6 A;  1EBO A;  3OR7 C;  5IYZ A;  4FLZ A;  4YIO A;  1YDX A;  4YJ2 A;  4ZI7 B;  5EZY A;  2UXX A;  1QR9 A;  4UB8 Z;  4LF4 B;  1SZX A;  4K0K O;  1KUQ A;  3ZED A;  3ZRV A;  4DV7 B;  4I0X A;  2ZM6 B;  5IY5 C;  2CUG A;  2EIK C;  2N05 A;  1GAX A;  2Y4T A;  4AQY B;  3IAY A;  5IYZ B;  3FYI B;  3T1Y B;  2V1D A;  2P5O A;  1FFX A;  5J2T A;  3ZJZ A;  3SR2 C;  4X64 B;  1CP9 A;  4GX2 A;  4PA3 A;  1YTF D;  4P9P A;  2Q0O C;  2ZIO A;  4FFB A;  4UCT A;  3CCE V;  3BCC H;  3A0H Z;  3Q4H A;  2BOB C;  4DV0 O;  5BMV A;  4I0X B;  3E8G A;  4B3S O;  5A2Q N;  3RBZ A;  2JDI G;  2XT9 A;  4FLU A;  2F4V B;  3ABM C;  1FFX B;  5J2T B;  2CH7 B;  3ZS8 C;  2NN4 A;  4FFB B;  1NT2 B;  3UM7 A;  2KQX A;  3Q4H B;  1HP8 A;  1MMM A;  5BMV B;  1Q8I A;  4FVM A;  4O2A A;  4ICG A;  3G6E V;  3JAL B;  4EB6 A;  3K04 A;  1GO3 F;  1PL4 A;  3ICX A;  2YI8 A;  4LFB O;  4G28 B;  5BY1 A;  1FXV A;  3HKC A;  3JAR B;  4CH5 A;  5H9C A;  1TAE A;  2C2A A;  3QO8 A;  4U3J A;  1VQP V;  3B4S A;  3EXA A;  1GN2 A;  5EK0 A;  3E35 A;  2Q73 A;  4Q6G A;  3OGI B;  4JV5 O;  1JJO A;  4EB6 B;  4OX9 O;  2X6C A;  1ORQ C;  2XAQ A;  3LNM B;  1BE3 H;  3HKC B;  4OXS A;  4ZHQ A;  1B3Q A;  2YSU B;  5JJJ B;  5D5P A;  2AZ2 A;  5CBG A;  2HJD A;  3UT5 A;  5J2U A;  2IU0 A;  3BA8 A;  1XMO O;  2ZT9 B;  2PI4 A;  2ZE8 A;  3C90 A;  5IJ0 A;  4ZKI A;  2YDE A;  1Y76 B;  2W6I G;  4EFE A;  2P90 A;  4D7S A;  2QTS A;  4ZHQ B;  4RO2 A;  1YF2 A;  5E79 Z;  4TQF A;  3JAT B;  4MVQ A;  3ZRW B;  1HNX O;  3CP1 A;  1YIJ V;  4X89 A;  3JSL A;  3UT5 B;  1MAB G;  3RYC B;  2GHY A;  3BAA A;  2YIB D;  4JYB A;  2QDO A;  4MTF A;  1WP8 A;  5KUM A;  3K08 A;  3O65 A;  1P84 F;  2UXD O;  3ZCC A;  1XMQ O;  1AI5 A;  3B77 A;  2ITC C;  3LDD A;  4GYC B;  4PJ0 Z;  5LMU B;  1XNR B;  1M4U A;  3TXQ A;  1AB3 A;  4DR5 B;  4BW5 A;  1E1R G;  4GX1 A;  1HR0 B;  1YSC A;  1VQ9 V;  1YXB A;  3X2Q B;  3B2E E;  1GTO A;  5J9P C;  3KCX A;  2Y69 B;  5H2F Z;  4F6R A;  5IWA B;  1G8M A;  3DC6 A;  4FK5 C;  3HKB B;  1BCC H;  3LUT B;  5LL6 Y;  1PNK A;  2ZE6 A;  3RWR D;  3J81 N;  4I7Z B;  3CS5 A;  1G4Y B;  1YHQ V;  3ETD A;  2QWR B;  2DMX A;  2ZNJ A;  4WFF A;  4E4E A;  1NJI W;  1K97 A;  4F6R B;  2QJ1 A;  3ETQ A;  1AI6 A;  1RM1 C;  1NU1 H;  1VQ5 V;  4DV3 O;  2AHZ A;  1E79 G;  2PGG A;  4YY3 B;  1OZ0 A;  4I50 A;  4LF8 B;  4WCE V;  1IDS A;  1W2B U;  1DTO A;  4UV9 A;  5CN0 A;  2GV9 A;  2EUL A;  5CA3 A;  1FKA O;  4LFC B;  3CHX A;  1QHT A;  4LFA O;  4LWS A;  3K5M A;  5B3S C;  2P4V A;  3DXR A;  2F43 G;  2UXC B;  2DWD C;  4I50 B;  3G71 V;  3K06 A;  1IBM B;  5JWP A;  4X9Q A;  1MG1 A;  3CRR A;  2ILM A;  4KHP B;  3OAA G;  5CMU A;  2E74 B;  2Q8V A;  1N33 B;  3MHS C;  3DXR B;  5LGT A;  2ARH A;  4JTD B;  4JI6 B;  1L0L H;  4DV4 O;  1WP7 A;  2VQF O;  4OGQ B;  2RQ6 A;  5B1N A;  3VQW A;  4FLY A;  3H1H H;  3AG4 C;  4DR1 O;  3CSX A;  2QA4 V;  3BVO A;  1GN6 A;  2HFE C;  4CH4 A;  1HW7 A;  2QKA A;  4DR7 O;  2ZNI A;  4JI2 O;  2QKC A;  3DSQ A;  1LUV A;  3QO5 A;  2Q68 A;  4BR6 A;  2H94 A;  2XOK G;  1IVS A;  3OMI B;  3K0G A;  3AK1 A;  2CGO A;  2CTW A;  4G2K A;  3K5L A;  3HPL C;  4MVU A;  3CC4 V;  3H1K H;  4LCU C;  3WB0 A;  1YZB A;  3E22 A;  4BWA A;  5ITZ A;  1NQT A;  1YIT V;  4A5U B;  1XIL A;  3SJC C;  3ZIA G;  1KKC A;  3MHH C;  1XNQ O;  2W0F C;  5B3S B;  1EFR G;  4NVP A;  5LBQ A;  4MW8 A;  1UPG A;  1TVK A;  2D2C B;  5D5Q A;  1Q82 W;  3E22 B;  5ITZ B;  2NLJ C;  2FKX A;  4R8C A;  3N27 A;  1AI7 A;  3RYI A;  3E8F A;  1N34 O;  2PYJ A;  2QWP B;  1A32 A;  4RQE A;  2CTR A;  2EIJ C;  4JI8 B;  3KKY A;  1I94 B;  4K8Z A;  4JI4 B;  2YEV A;  5L3G A;  1HNW O;  1TVK B;  1I5Y A;  2BE3 A;  2DWE C;  4GX5 A;  2JEX A;  3TXS A;  3RYI B;  2WLH A;  5LP6 A;  1YJ9 V;  4LR3 A;  1AP5 A;  2PI5 A;  1I0H A;  3I5D A;  2GTS A;  3D36 C;  3B8N A;  2YEV B;  1WLE A;  4P2Z A;  2HHH O;  5TIS Z;  1M56 B;  1BT8 A;  4X66 B;  2RJZ A;  1HNZ B;  3VOU A;  2A9H A;  1F7Y A;  5LP6 B;  3ABK C;  5GTH Z;  3FAV B;  1VF6 A;  1NR1 A;  2ZR2 A;  2P6J A;  4NXN B;  4WFG A;  2O57 A;  5JH7 B;  5CB4 A;  2VRZ A;  1QU7 A;  3BFR A;  3NR7 A;  4LNU A;  2EIN C;  4J7K A;  5KAI Z;  2H8P C;  3F5T A;  4OPA A;  4TV9 A;  2P06 A;  3D8C A;  1PPJ H;  4PV1 B;  4ZOL A;  2F93 B;  4YXW G;  1E1Q G;  1Z2G A;  4FM0 A;  5KHJ A;  3TJT A;  2K9P A;  3RW0 A;  2OCC C;  1HDJ A;  4K0K B;  4B08 A;  3AG3 C;  5CB4 B;  1VQ7 V;  3K5O A;  1OCO B;  2DN9 A;  2DYS C;  4FMT A;  4LNU B;  4PHZ A;  4JI5 O;  2DOS A;  4ZIB A;  1XL4 A;  1ARO P;  4ZOL B;  1R6N A;  4H0L B;  1WPB A;  1V9P A;  2JJ2 G;  3ABL B;  5CA0 A;  1URF A;  4DV0 B;  3C3S A;  4J9Z B;  1VEW A;  1BS3 A;  4ZBM A;  2UU9 O;  4CC6 A;  4B3S B;  3CJH A;  3K9S A;  3HKE A;  2HR3 A;  5IJ9 B;  4DV6 O;  2V4D A;  1DF5 A;  2DE0 X;  5KHG A;  2VWK A;  1GKF A;  3ASO B;  3STZ C;  1IXM A;  5A9G A;  2MW2 B;  5CA0 B;  3L72 H;  4FM1 A;  2ZR3 A;  5EYP A;  3ZMS A;  1P7G A;  3CJH B;  3B09 A;  3HKE B;  4LFB B;  2Q5Z A;  5K1X A;  4I9W A;  3U0Z A;  1JJ2 U;  4FIP C;  4DRX A;  4QIW F;  1FFT B;  2EIN B;  1FXK C;  3K0D A;  3M99 B;  2DQ0 A;  2WLN A;  3LNN A;  1Q3E A;  1EN4 A;  3BHP A;  1OV9 A;  4JYC A;  4OX9 B;  2F1M A;  2QWO B;  3P30 A;  1THZ A;  3T1C A;  1SF9 A;  3G6B A;  4DRX B;  5C8Y A;  4EKW A;  4QE7 A;  2ITD C;  4JAV A;  2ZDI A;  1LUW A;  4MVM A;  1ENV A;  4HYO A;  3E8B A;  1NZ6 A;  3K79 A;  5FNV B;  4LP8 A;  4X1I A;  4BIO A;  1K5Q A;  1JFF B;  3K3W A;  4XBF A;  1XMO B;  2BOC C;  2WA4 A;  3OTO O;  2IH3 C;  2PF4 E;  1Y74 B;  5C8Y B;  4OPH A;  4UV8 A;  3T1H O;  3CME V;  3KG2 A;  3LDE A;  1AR4 A;  2Q9L A;  2YIA A;  1FAF A;  1HNX B;  3UO3 A;  4TV8 A;  4X1I B;  3KCY A;  5DEC A;  3AEI A;  1K4D C;  4RAI A;  1H8H G;  1M57 B;  2LP7 A;  1GK9 A;  4UCR A;  1B6Q A;  3K57 A;  2UXD B;  1K3E A;  1N36 O;  1XMQ B;  2Q7E A;  2E5L O;  4GLX A;  3P32 A;  1NVP B;  4JTC B;  3K5N A;  1ZWI C;  4DV5 O;  4TV8 B;  3RYF A;  1N32 B;  4LF9 O;  1Q86 W;  2YC0 A;  1FXK B;  4O4L A;  4X8A A;  3CRQ A;  4KL1 A;  2IJJ A;  1K73 W;  1PD3 A;  1OCZ C;  1Y66 A;  2WLK A;  1IUR A;  5EC2 C;  3FB8 C;  3RYF B;  2ZIM A;  3QNE A;  1R73 A;  4XDK A;  4YJ2 B;  1XUQ A;  4O4L B;  5EZY B;  3K58 A;  2YUA A;  3G67 A;  1PL0 A;  2KG7 A;  4J11 A;  3QG5 A;  3CB2 A;  1N0J A;  4DV3 B;  1QVG U;  2QGN A;  3OUS A;  5FPO A;  3BY6 A;  2Q69 A;  3THO A;  1O9H A;  2F95 B;  2OCH A;  3EVK A;  4QE9 A;  4J9Y B;  3LSU A;  4O4J A;  1V54 B;  2KG7 B;  1SQG A;  1KC8 W;  1GRJ A;  2PYL A;  1L1F A;  5L3D A;  4LFA B;  4U7N A;  5EC1 C;  1S3J A;  1NH2 B;  3CEI A;  3BRC A;  5LHI A;  4JAA A;  1DGS A;  4BAY A;  1KMI Z;  2LW7 A;  3I56 V;  4FM2 A;  1AIL A;  4JI1 O;  3OT7 A;  4HZ3 A;  4YHH O;  2N04 A;  3X2Q C;  1CEZ A;  2Q0A A;  4ABM A;  5CA1 A;  1Q90 D;  4DR4 O;  5KAF Z;  4O2A B;  2Y69 C;  1Q43 A;  3LDC A;  1OCZ B;  3CRC A;  5IYC O;  4QNH B;  4MVS A;  4DV4 B;  1MSW D;  2X6B A;  1VQO V;  4U3J B;  2EJR A;  1KB9 F;  5CA1 B;  4DR1 B;  1NTK H;  4DR7 B;  5EBL C;  1GM8 A;  3B40 A;  4JI2 B;  3R65 A;  1MNG A;  4AIL C;  4UCO A;  3CCV V;  4J42 A;  1KQS U;  1F23 A;  1BQ0 A;  3MD0 A;  1VQM V;  2L6L A;  3MDS A;  3DC5 A;  3CCU V;  4DV2 O;  2WLI A;  1ZX3 A;  3JAK A;  2UXB O;  2HVK C;  2R72 A;  4J10 A;  3ETE A;  5J2U B;  3M7M X;  3A8T A;  1Q6I A;  1SQX H;  1JMK C;  2X7R B;  5L3B A;  2DYR C;  3ASN C;  1AJQ A;  3ZMU A;  4QPK A;  5IJ0 B;  3D3Q A;  2R9A A;  4JF3 A;  5DED A;  5GW7 A;  2LQT A;  4DYL A;  2WLI B;  2JS3 A;  3JAK B;  2OIE A;  3UCS C;  1VQ6 V;  3ABU A;  3RYH A;  5KHI A;  2HP8 A;  1ZTE A;  1S76 D;  3HKD A;  4X88 A;  1OCR B;  4F4L A;  1XQ8 A;  3BPZ A;  4B7E A;  1N34 B;  1Q81 W;  4UB6 Z;  5BR8 O;  4JTA B;  2EIL B;  1BHA A;  3H01 A;  3L73 H;  2BSK A;  1Q5O A;  2IJI A;  4W4K A;  3WU2 Z;  1PNL A;  5JJE B;  3ZN1 A;  1R1B A;  3T4Z A;  3PJS K;  5C93 A;  2XAS A;  1HNW B;  4MTG A;  2N74 A;  1VAR A;  3HKD B;  1JA8 A;  2YXL A;  1QBZ A;  4IYH A;  2QM7 A;  3EHB B;  2Q6A A;  2OTJ V;  4GKJ O;  2XAJ A;  4O2B A;  2CTP A;  2P67 A;  1SQV H;  5LGN A;  1Z5W A;  2OT5 A;  3AG7 A;  4DR2 O;  2FTK A;  4DV7 O;  2FML A;  4GCZ A;  3H1I H;  2VWJ A;  4DK1 A;  3T2M A;  5DN6 G;  2HHH B;  2MK3 A;  5L3F A;  3CYO A;  3SJA C;  3G80 A;  4O2B B;  2A7W A;  5B1B B;  3STL C;  5FPR A;  2DYR B;  2IH1 C;  3AG1 C;  3ASN B;  4X1K A;  3GVM A;  3CCR V;  2XAG A;  3OEE G;  1TUB A;  2PZS A;  1PM9 A;  3TET A;  4P30 A;  4PEL A;  2LW1 A;  2XAH A;  2IBZ H;  2AHY A;  3FB6 C;  1N0N A;  4AHC A;  4B3R O;  1SQB H;  4UVA A;  4LBE C;  1AVM A;  5LOV A;  2HKO A;  4LF7 O;  1K34 A;  1TUB B;  4LWS B;  3T4D A;  1W59 A;  2VQE O;  1B06 A;  1ZLZ A;  5B1A C;  3CXC U;  1EN6 A;  3SYA A;  3VQY A;  1IX9 A;  3QTC A;  4FLT A;  2RCV A;  3GWO A;  4JYA O;  4I4T A;  4WFE A;  1P49 A;  4GZR B;  1EZV H;  1P4R A;  3H1J H;  2UU9 B;  1M56 C;  1US6 A;  4LH7 A;  4DV6 B;  4FLV A;  4PD4 F;  3E83 A;  3SPI A;  2ZE7 A;  1F51 A;  4X62 O;  2A79 B;  1M90 W;  5L3C A;  2QE7 G;  2XHB A;  5LP6 C;  2AW9 A;  4I4T B;  3JD3 A;  3ZHT A;  2BCC H;  1U97 A;  3CXH F;  3AG1 B;  1D2D A;  1IBK O;  3ZN0 A;  5KHH A;  1Y6X A;  3EFF K;  3S3X A;  2NNU A;  4PI0 A;  3S3W A;  4CBC A;  1M9N A;  5H6Q A;  4YIP A;  1YEW A;  1VF6 C;  1Q7Y W;  2GTA A;  4UUJ C;  3PN1 A;  2BTQ A;  1W0K G;  1OHH G;  3F7Y C;  3KZI Z;  1OCO C;  1JVM A;  2IW5 A;  3SJB C;  5B1A B;  3CC2 V;  1FPO A;  4LH6 A;  4P9O A;  1GH6 A;  1Z5V A;  2B9Z A;  3L71 H;  1M1K W;  4K35 A;  4PDV A;  2XAF A;  5KLV H;  1VQN V;  2CTQ A;  1BQZ A;  2BTQ B;  3ABL C;  3OTO B;  3JSN A;  1FJG O;  3TK1 A;  3FX7 A;  3T1H B;  3RGB A;  4MTX A;  3O9O A;  4EFB A;  3N2G A;  3JAM N;  1H2M A;  4WBN A;  2X0L A;  3OW2 U;  3DTU B;  4NXM O;  4UCU A;  4X20 A;  3ASO C;  1MA1 A;  1R3J C;  1YCI A;  1N36 B;  4DUY O;  1VF7 A;  4XDJ A;  3E8H A;  3N2G B;  3SYC A;  4QJF B;  4DV5 B;  4WBN B;  4LF9 B;  3JAS A;  3W7S A;  2ADP A;  2FB5 A;  3AK2 A;  2HEP A;  3JCU Z;  4X20 B;  4IIJ A;  4J80 A;  3CCL V;  2NR5 A;  2ZD9 A;  2ZQM A;  1XOU A;  2GUZ A;  5H5N A;  3WB1 A;  1EZJ A;  1NS1 A;  5LHG A;  4QPJ A;  2QWQ B;  2EBO A;  3CX5 F;  5EIB C;  3W7T A;  1VQ8 V;  3JAS B;  4NKG B;  1J5E O;  5HFM A;  1H38 A;  4TV9 B;  3OEH G;  4IIJ B;  5AG2 A;  4LF5 O;  2GUZ B;  1GN3 A;  4J41 A;  1JOY A;  3ZMT A;  1VMG A;  3GWK C;  4IL6 Z;  2K1E A;  2B1G A;  1G1X B;  2LJ2 A;  4PDL A;  2ZDI C;  3FYE B;  1F4M A;  2Q4P A;  5KA6 A;  4F6E A;  3SDL A;  3ABT A;  1M57 C;  5JCO A;  4X1Y A;  1NI8 A;  2A06 H;  5E1A C;  2WAM A;  4H44 B;  2JRI A;  1JR9 A;  3ZHU A;  4XDL A;  4R50 A;  4O4H A;  2FYU H;  3RN4 A;  3ZHV A;  3JD1 A;  4IHJ A;  4TQD A;  3APQ A;  1FD9 A;  4JI1 B;  1SQP H;  4CS3 A;  4YHH B;  2UUC O;  3TGU H;  1NKD A;  4X1Y B;  2WPD G;  4DR4 B;  4JGS A;  1WB7 A;  3JD0 A;  1DLB A;  2KSD A;  4JV5 B;  4NTY A;  5EYP B;  4O4H B;  3RT3 C;  4FLW A;  3K03 A;  4HNA A;  4J7J A;  1VQK V;  1K8A W;  2PTM A;  3A2F A;  3FFQ A;  2AXT Z;  4IGG A;  3D3I A;  2UUB O;  4DXW A;  4MVZ A;  3JAW A;  1K4C C;  2AGA A;  4CH6 A;  4DV1 O;  4TSF G;  4JI7 O;  3VBB A;  3SYQ A;  4TT3 G;  3W7X A;  4JYY A;  4BIZ A;  5B1O A;  3BAB A;  1WPX A;  2LGQ A;  4HNA B;  4GUN A;  1W0J G;  2E75 B;  2QWN B;  2WA3 A;  1GM9 A;  3FB5 C;  5HFL A;  4DV2 B;  3IC9 A;  2UXB B;  1UJW B;  4J7Z A;  5B5E Z;  2R9I A;  5BXZ A;  1S77 D;  3ZMV A;  1I08 A;  1I7F A;  1N8R W;  1MOF A;  4QGP A;  2ZIN A;  4LF6 O;  3QVN A;  2WSS G;  1R3L C;  2EJ7 A;  4TUY A;  1V54 C;  1RPO A;  1MZF A;  5KX5 A;  2GSM B;  3W7W A;  1QLE B;  1AR1 B;  2HLD G;  2Z0A A;  4PI2 A;  5LGU A;  4EEQ A;  4L87 A;  2WWW A;  2XTA A;  2CK3 G;  1XBL A;  4MTO A;  1IXB A;  1O9G A;  5BR8 B;  3ZRX A;  4DUZ O;  1UFI A;  4R7C A;  4Z2W A;  2ZKO A;  2DQ3 A;  2Y4U A;  4JI3 O;  3WG7 B;  4GX0 A;  5EIB D;  1LNQ A;  2Q67 A;  3IGA C;  3IJ4 A;  2E76 B;  3CWB H;  5IDJ A;  1H2N A;  4RUF A;  3SYP A;  5GTI Z;  4GKJ B;  2RMK B;  1B04 A;  2V7Q G;  4D6T H;  2B1I A;  1ZAU A;  4DR2 B;  4TWK A;  4B3M O;  3CC7 V;  1KBH A;  4G27 B;  3WB2 A;  1KU9 A;  3SPJ A;  1COW G;  5BZB A;  4JI0 O;  2YI9 A;  3SJQ C;  2PUS A;  1SKV A;  1MSD A;  1MZE A;  2CH7 A;  5LXT A;  3RFR A;  1WNS A;  2E3C A;  4JAS A;  2YIB A;  3H1L H;  2JEU A;  3ZHR A;  2ZE5 A;  1ZL8 A;  2DW4 A;  2M7W A;  3OTF A;  4PDM A;  3ZHQ A;  3J80 N;  1NBM G;  4YJ3 A;  3JAL A;  3JD2 A;  5LMN O;  1VP7 A;  3MAQ A;  4KXR A;  4UCV A;  2A0L A;  1NVP D;  2YXH A;  2LO1 A;  3FD9 A;  3JAR A;  1OCC B;  2EIM B;  1XEQ A;  1HWY A;  2LFS A;  5LXT B;  5KHK A;  3F7V C;  1P7B A;  2QTO A;  4B3R B;  5LYJ A;  4H37 A;  1ZL8 B;  1OCR C;  1NR7 A;  1R6T A;  2JIZ G;  2RNB A;  4O4J B;  1L0N H;  4H13 B;  1AR5 A;  5FLX N;  2EIL C;  4LF7 B;  3CCQ V;  4YJ3 B;  1NTM H;  3J7A U;  2VQE B;  2XUM A;  3OMN B;  2XND G;  4JAU A;  3AG2 B;  4E2L A;  2UXN A;  2VQF B;  1SQF A;  3IC7 A;  1KKD A;  4CS2 A;  1PNM A;  4LC1 A;  1IBL O;  4X65 O;  4UCS A;  2EX3 A;  4HBN A;  5LYJ B;  1V55 C;  3L9D A;  1FXH A;  4GKK O;  3FKS G;  3CMA V;  4JYA B;  3HB3 B;  3R66 A;  2AZ0 A;  2QKS A;  2Y0P A;  2HVJ C;  1VF5 B;  1N4C A;  1AP6 A;  1Y76 A;  1ZUQ A;  2IJH A;  3K59 A;  3ETG A;  5IY5 B;  2Z3Y A;  2EIK B;  3JAT A;  3ZRW A;  4U7O A;  3E89 A;  4PA4 A;  3CD6 V;  4X62 B;  2OIG A;  2JK5 C;  3RYC A;  2PY5 A;  1WA8 A;  2CDY A;  5B1B C;  2OTL V;  3OUF A;  1VIB A;  1S0V A;  4RUE A;  1IBK B;  4KP4 A;  3L70 H;  1K5S A;  1XI1 A;  1XNQ B;  1NH2 D;  3JCZ A;  4B3T O;  1DF4 A;  4FZ1 A;  3ABM B;  4FFK A;  3VQV A;  3SGI A;  1WA8 B;  1XHZ A;  2UUA O;  4DR6 O;  2WLM A;  4GT1 A;  3VQX A;  3SPH A;  1OJH A;  4DR3 O;  1TUE B;  5CBH A;  1L8D A;  3LSS A;  3APO A;  5B66 Z;  3JD4 A;  2QM4 A;  3DGE A;  3HKB A;  4IYI A;  4N23 A;  1S5J A;  5DM6 V;  1N32 O;  3RYH B;  2QM8 A;  3RVY A;  1CPY A;  3ZBH A;  1YJN V;  3QF7 A;  3C3T A;  1QR8 A;  2OWO A;  1V55 B;  3L75 H;  2YIC A;  4UVC A;  5IT9 N;  1G6U A;  4LF4 O;  4WF9 V;  1LR1 A;  2BSK B;  1VQL V;  4CH3 A;  1FJG B;  1SZT A;  2ZCE A;  2ZM6 O;  5GON A;  3I55 V;  2ATK C;  3E2E A;  1KEC A;  4AQY O;  1K9M W;  1SS3 A;  2IU3 A;  3T1Y O;  1I5X A;  1GM7 A;  1S72 V;  3F5W C;  4NXM B;  2YID A;  4X64 O;  4BIU A;  1SA0 A;  2Y48 A;  4WFB V;  1F4N A;  1XDC A;  1D5A A;  1PP9 H;  4DUY B;  1JCH A;  3G4S V;  5EBM C;  1K33 A;  4RWU A;  1Q6H A;  2HG5 C;  3OGC C;  5GON B;  1U96 A;  5KMG A;  1YVW A;  3BEH A;  5LHH A;  1H2G A;  4AI8 A;  1ROP A;  1X4T A;  3K9A A;  2F4V O;  1SRY A;  2W0X A;  1SA0 B;  3SYO A;  4X1K B;  2P22 C;  3P3P A;  2BTO A;  2Q7G A;  5KMG B;  4PA9 A;  1GN4 A;  2LFR A;  5CBF A;  5KUK A;  1R3K C;  2JJ1 G;  4JI5 B;  1J5E B;  4JPR A;  4UFZ A;  3ZMZ A;  2OYQ A;  3SPG A;  3TCU A;  4LF5 B;  2KB1 A;  3BA9 A;  1SC5 B;  5LOV B;  1BSM A;  1S5L Z;  1VQ4 V;  4Q20 A;  2EZO A;  1QVF U;  3SPC A;  3FB7 C;  4KFM A;  4NR1 A;  2GDS A;  3IFX A;  1PKX A;  4CS4 A;  1RSO A;  1SET A;  5LA6 A;  1R3I C;  1SER A;  3UQ8 A;  2P4K A;  4CC5 A;  1JPX A;  4I55 A;  4PDR A;  4DW0 A;  2VS0 A;  2JGU A;  5H6R A;  1FS0 G;  2CGN A;  4NB5 A;  2P7T C;  1K7D A;  3RVZ A;  1RM1 B;  2A3Q A;  2LGW A;  1RSO B;  5FL7 G;  5LA6 B;  1K92 A;  1EM1 A;  1WJZ A;  2F23 A;  3E86 A;  2W6J G;  4MVO A;  4NTX A;  4KUM A;  3CCS V;  1RP3 B;  4I55 B;  5JJN B;  5F2V O;  2UUC B;  4DK0 A;  4WFA V;  4PA6 A;  2WLL A;  2CE4 A;  4ASU G;  3HR0 A;  3ML0 A;  4FPP A;  1BGY H;  2YXY A;  3CCJ V;  5LMU O;  1H2L A;  3CRM A;  1XNR O;  2UUB B;  4DR5 O;  1X59 A;  4DV1 B;  1HR0 O;  4JI7 B;  3L74 H;  2Z5U A;  1WB8 A;  4BW9 A;  4DW1 A;  3CPW U;  2D3O W;  1T5E A;  4TOI A;  2WLL B;  1YJW V;  3NXS A;  5IWA O;  1GMG A;  1R6K A;  1TGO A; 
#chains in the Genus database with same CATH homology
 2AHZ A;  1E79 G;  1VQK V;  1K8A W;  4BAY A;  3D3I A;  3I56 V;  4DXW A;  4MVZ A;  1K4C C;  1OZ0 A;  4TSF G;  3VBB A;  4WCE V;  3SYQ A;  1W2B U;  4HZ3 A;  3AG4 B;  1DTO A;  4UV9 A;  5CN0 A;  3A0R A;  3X2Q C;  1CEZ A;  5CA3 A;  2ZXW C;  4TT3 G;  4DO2 A;  3W7X A;  3OE7 G;  4BIZ A;  5B1O A;  2Y69 C;  3LDC A;  1OCZ B;  1WPX A;  4PA7 A;  2IJK A;  5IYC O;  1W0J G;  5B3S C;  4QNH B;  4MVS A;  2F43 G;  1GM9 A;  3FB5 C;  1MSW D;  5HFL A;  2X6B A;  1UJW B;  2DWD C;  1VQO V;  2EJR A;  3G71 V;  3K06 A;  2R9I A;  3OR6 C;  4WFH A;  1S77 D;  4MS2 A;  3ZMV A;  1N8R W;  1MOF A;  1MG1 A;  3OAA G;  2WSS G;  1Y4M A;  1R3L C;  5CMU A;  5EBL C;  1GM8 A;  1V54 C;  1RPO A;  3R65 A;  2GSM B;  3W7W A;  3CCV V;  1QLE B;  1KQS U;  1AR1 B;  1F23 A;  3MHS C;  2HLD G;  5LGT A;  4MVR A;  3MD0 A;  4JTD B;  5LGU A;  1VQM V;  4L87 A;  2WWW A;  3B8M A;  3CCU V;  2WLI A;  2HVK C;  5B1N A;  3ETE A;  2CK3 G;  4HAM A;  3QO7 A;  3AG4 C;  4MTO A;  1BMF G;  2X7R B;  5L3B A;  2QA4 V;  2DYR C;  2HFE C;  3ASN C;  1AJQ A;  2R9R B;  4QPK A;  3ZMU A;  3CCM V;  3ZRX A;  3D36 A;  4R7C A;  2EIJ B;  2B5U A;  2DQ3 A;  4JF3 A;  5GW7 A;  3WG7 B;  4GX0 A;  3QO5 A;  2Q68 A;  1KD1 W;  2H94 A;  2XOK G;  2WLI B;  3OMI B;  1LNQ A;  3K0G A;  2Q67 A;  3IGA C;  1VQ6 V;  3ABU A;  4G2K A;  3HPL C;  1S76 D;  4MVU A;  3CC4 V;  2QEX V;  4LCU C;  5IDJ A;  4RUF A;  4X88 A;  3SYP A;  1NQT A;  1OCR B;  4F4L A;  1YIT V;  2ZXW B;  1Q81 W;  2V7Q G;  2B1I A;  4JTA B;  2EIL B;  4N21 A;  4TWK A;  3H01 A;  3WFV A;  1BHA A;  3CC7 V;  1QLE C;  2IJI A;  4G27 B;  2EZP A;  3ZIA G;  3MHH C;  1PNL A;  2W0F C;  3ZN1 A;  3T4Z A;  5B3S B;  2HJF C;  1EFR G;  3PJS K;  5C93 A;  3GB7 C;  2XAS A;  3SPJ A;  1COW G;  4MTG A;  5BZB A;  5LBQ A;  4MW8 A;  3SJQ C;  4MSW C;  5L3E A;  1Q82 W;  3UKM A;  1QBZ A;  2QM7 A;  3ABK B;  3EHB B;  2Q6A A;  2NLJ C;  2OTJ V;  4JAS A;  2XAJ A;  2JEU A;  4R8C A;  1AJN A;  2P67 A;  2WLJ A;  1AI7 A;  5LGN A;  2OT5 A;  3E8F A;  3W7U A;  2DW4 A;  4UXN A;  1AI4 A;  2M7W A;  5EBW C;  2FTK A;  4PDM A;  4RQE A;  1BL8 A;  1NBM G;  3LSQ A;  4GCZ A;  2EIJ C;  1H8E G;  3JD2 A;  3WG7 C;  3T2M A;  2YEV A;  5L3G A;  5DN6 G;  2A0L A;  2MK3 A;  5L3F A;  1NVP D;  1KP3 A;  5KA5 A;  3CYO A;  1OCC B;  2EIM B;  1HWY A;  1I5Y A;  2LFS A;  2DWE C;  4GX5 A;  2JEX A;  3F7V C;  1P7B A;  2QTO A;  4Z1M G;  3ZRS A;  2WLH A;  4H37 A;  5B1B B;  1YJ9 V;  1OCR C;  4UVB A;  3STL C;  2PI5 A;  1NR7 A;  2JIZ G;  2DYR B;  3AG1 C;  3ASN B;  2IH1 C;  2OCC B;  4R6Z A;  3CCR V;  2XAG A;  1RPR A;  2EIL C;  3B8N A;  3OEE G;  3AG3 B;  3CCQ V;  2YEV B;  2DYS B;  1KP2 A;  1WLE A;  4P2Z A;  4CZZ A;  3OMN B;  2XND G;  5IYD O;  4JAU A;  3AG2 B;  3TET A;  5IYB O;  4E2L A;  2UXN A;  1M56 B;  4P30 A;  4PEL A;  3IC7 A;  2XAH A;  1JX9 A;  3JYC A;  1KKD A;  1PNM A;  4RQF A;  4LC1 A;  2AHY A;  3VOU A;  3FB6 C;  2A9H A;  1SES A;  3ABK C;  1V55 C;  1JQ0 A;  1AJP A;  4UVA A;  1NR1 A;  1YTF B;  1FXH A;  2ZR2 A;  3FKS G;  4LBE C;  1YI2 V;  3CMA V;  2P6J A;  3HB3 B;  1BHB A;  2HKO A;  4WFG A;  4MW3 A;  3OMA B;  2QKS A;  1K34 A;  2HVJ C;  3T4D A;  4MT8 A;  3OM3 B;  2IJH A;  4I5S A;  3ETG A;  5IY5 B;  2Z3Y A;  5B1A C;  2EIK B;  3CXC U;  3ZRW A;  4FJC C;  4U7O A;  2EIN C;  3SYA A;  1OCC C;  2H8P C;  2EIM C;  3OFN G;  3E89 A;  4PA4 A;  3CD6 V;  1FXK A;  2JK5 C;  4YXW G;  1E1Q G;  5B1B C;  2X6A A;  2OTL V;  3GWO A;  4H33 A;  3OUF A;  1QCE A;  4WFE A;  3RW0 A;  2OCC C;  1S0V A;  4RUE A;  4KP4 A;  1VQ7 V;  3AG3 C;  1OCO B;  1K5S A;  1S5H C;  2DYS C;  1P4R A;  4FMT A;  1J95 A;  1NH2 D;  3AG2 C;  3JCZ A;  1M56 C;  1QLN A;  1DF4 A;  1XL6 A;  3E83 A;  3SPI A;  3ABM B;  1EBO A;  3OR7 C;  1F51 A;  2A79 B;  1M90 W;  1XL4 A;  5L3C A;  1ARO P;  2QE7 G;  1R6N A;  2UXX A;  1QR9 A;  2WLM A;  3JD3 A;  4GT1 A;  2JJ2 G;  3SPH A;  3AG1 B;  3ABL B;  3ZN0 A;  1TUE B;  5CBH A;  4J9Z B;  3LSS A;  3ZRV A;  4ZBM A;  3EFF K;  3JD4 A;  3DGE A;  5IY5 C;  2EIK C;  4N23 A;  2NNU A;  2HR3 A;  5DM6 V;  2QM8 A;  3RVY A;  1CPY A;  3FYI B;  1DF5 A;  4CBC A;  1M9N A;  5H6Q A;  2V1D A;  1YJN V;  1QR8 A;  3ZJZ A;  1V55 B;  1GKF A;  1CP9 A;  3ASO B;  4GX2 A;  4PA3 A;  3STZ C;  1YTF D;  1IXM A;  4P9P A;  4UVC A;  3CCE V;  1Q7Y W;  4WF9 V;  2BOB C;  4UUJ C;  1VQL V;  1W0K G;  2ZR3 A;  3ZMS A;  1OHH G;  3F7Y C;  3E8G A;  1OCO C;  1SZT A;  1JVM A;  2IW5 A;  3I55 V;  2ATK C;  5B1A B;  4I9W A;  1JJ2 U;  3E2E A;  4FIP C;  4QIW F;  1KEC A;  1FFT B;  1K9M W;  2EIN B;  3RBZ A;  3CC2 V;  2JDI G;  1FXK C;  3ABM C;  3K0D A;  2IU3 A;  4P9O A;  3M99 B;  1I5X A;  2DQ0 A;  1GM7 A;  2WLN A;  1S72 V;  3F5W C;  1M1K W;  4PDV A;  2XAF A;  1VQN V;  3UM7 A;  4JYC A;  4BIU A;  2Y48 A;  4WFB V;  1F4N A;  3ABL C;  1JCH A;  3P30 A;  3G6E V;  3G4S V;  3K04 A;  1GO3 F;  1THZ A;  1K33 A;  5EBM C;  2HG5 C;  3OGC C;  3T1C A;  3TK1 A;  3BEH A;  4EKW A;  4QE7 A;  5LHH A;  1H2G A;  4G28 B;  1FXV A;  2ITD C;  5H9C A;  2C2A A;  4JAV A;  4MTX A;  2ZDI A;  1ROP A;  3QO8 A;  4MVM A;  1ENV A;  3K9A A;  4HYO A;  3E8B A;  3K79 A;  1VQP V;  4LP8 A;  2X0L A;  3OW2 U;  3DTU B;  1SRY A;  1K5Q A;  5EK0 A;  3K3W A;  3E35 A;  4XBF A;  3ASO C;  3SYO A;  2BOC C;  1R3J C;  2IH3 C;  4PA9 A;  2X6C A;  1ORQ C;  2XAQ A;  3LNM B;  2LFR A;  5CBF A;  4UV8 A;  5KUK A;  4OXS A;  3CME V;  3KG2 A;  3LDE A;  4XDJ A;  1R3K C;  3E8H A;  2JJ1 G;  2YSU B;  3SYC A;  4QJF B;  4JPR A;  5CBG A;  3W7S A;  3ZMZ A;  3SPG A;  3AEI A;  2IU0 A;  1K4D C;  4RAI A;  3TCU A;  1H8H G;  1M57 B;  2KB1 A;  3CCL V;  2LP7 A;  1GK9 A;  2PI4 A;  1B6Q A;  2ZD9 A;  2ZQM A;  1VQ4 V;  4Q20 A;  4ZKI A;  1K3E A;  1EZJ A;  2EZO A;  1QVF U;  3SPC A;  3FB7 C;  4KFM A;  2W6I G;  5LHG A;  2P90 A;  4QPJ A;  3P32 A;  4RO2 A;  1NVP B;  2EBO A;  4JTC B;  4MVQ A;  3ZRW B;  3IFX A;  1PKX A;  3W7T A;  1ZWI C;  3CP1 A;  1VQ8 V;  1SET A;  1YIJ V;  5HFM A;  4X89 A;  1H38 A;  1Q86 W;  3OEH G;  1R3I C;  1FXK B;  1MAB G;  2GHY A;  1SER A;  1JPX A;  4PDR A;  4X8A A;  4JYB A;  2IJJ A;  1K73 W;  5H6R A;  1FS0 G;  4MTF A;  2P7T C;  5KUM A;  1JOY A;  1K7D A;  3K08 A;  3ZMT A;  1PD3 A;  1OCZ C;  3ZCC A;  2K1E A;  2B1G A;  1Y66 A;  3RVZ A;  2WLK A;  1RM1 B;  1AI5 A;  3B77 A;  5EC2 C;  2ITC C;  3FB8 C;  4PDL A;  2ZDI C;  3LDD A;  5FL7 G;  3FYE B;  3QNE A;  1R73 A;  1F4M A;  1K92 A;  3E86 A;  4BW5 A;  4MVO A;  4XDK A;  2W6J G;  1E1R G;  4GX1 A;  4KUM A;  3CCS V;  1YSC A;  5KA6 A;  1VQ9 V;  4WFA V;  3X2Q B;  3ABT A;  1M57 C;  4PA6 A;  1GTO A;  5J9P C;  5E1A C;  2WAM A;  2Y69 B;  1PL0 A;  2WLL A;  4XDL A;  4ASU G;  1G8M A;  4R50 A;  4FK5 C;  3ML0 A;  4FPP A;  1QVG U;  3JD1 A;  3OUS A;  3LUT B;  3CCJ V;  3BY6 A;  2Q69 A;  1PNK A;  1G4Y B;  1YHQ V;  3ETD A;  2Z5U A;  4WFF A;  1NKD A;  4QE9 A;  3CPW U;  2D3O W;  2WPD G;  4J9Y B;  1NJI W;  4JGS A;  1K97 A;  1V54 B;  3JD0 A;  2WLL B;  1DLB A;  1KC8 W;  1YJW V;  1AI6 A;  3NXS A;  1L1F A;  5L3D A;  4U7N A;  1RM1 C;  1GMG A;  5EC1 C;  3K03 A;  1VQ5 V;  1S3J A;  1NH2 B;  1R6K A;  5LHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...