2HVJC

Crystal structure of kcsa-fab-tba complex in low k+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab heavy chain
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hvjC00
1R3LC 3IFXA 3SPGA 1R3IC 2EILC 4HZ3A 4J9YB 5E1AC 3FB6C 3LNMB 3SYQA 3ABKC 4WFEA 4P9PA 3ASOC 4XDJA 3E83A 1ORQC 5EBMC 4F4LA 4PA6A 3OGCC 3STLC 2DWDC 5CBHA 4WFHA 4PDVA 3K03A 2Q68A 3LDDA 4EKWA 3GB7C 1R3JC 4MVRA 5J9PC 3KG2A 2HG5C 3FB8C 4PDMA 1ZWIC 3K08A 4MVQA 2HVKC 2HJFC 3ABLC 4MTGA 4I9WA 3BEHA 1OCRC 4JTAB 2OCCC 2AHZA 2X6AA 4HYOA 3K0GA 4H37A 3SYCA 4MVMA 4PA3A 5KUMA 3R65A 4WFFA 3SYOA 3T4DA 1G4YB 4UUJC 5B3SC 4PA4A 5EC1C 2ITCC 2WLIB 2IH1C 3K06A 1K4CC 1V55C 5KUKA 3E8BA 2YEVA 2P7TC 4BW5A 2WLJA 5CBFA 3ZJZA 3E8HA 3AG3C 4X88A 4GX2A 4X8AA 1J95A 2WLKA 1LNQA 4GX1A 1V54C 2Q69A 3TCUA 4MVZA 3LUTB 3VOUA 3X2QC 2WLIA 4R50A 2H8PC 1S5HC 4PA7A 3LDCA 3RW0A 2NLJC 2QTOA 2W0FC 4QE7A 4QNHB 1K4DC 4XDKA 1M56C 2ITDC 4G28B 4RUFA 1XL6A 4MVSA 2KB1A 5EK0A 3OR7C 3PJSK 3F7YC 3ZRSA 2HFEC 2WLMA 4MW3A 2EINC 3AG2C 3F5WC 4JTDB 3SPHA 4P9OA 1QLEC 3SPJA 1XL4A 2A0LA 3SYPA 3ABMC 1BL8A 2ZD9A 1M57C 3K04A 4KFMA 4MW8A 4OXSA 3FB7C 4CBCA 2DYSC 3E8FA 3TETA 1KKDA 4R6ZA 3HPLC 3SPCA 2EIJC 2X6CA 4H33A 2Q67A 2IH3C 4DXWA 2HVJC 2R9RB 5BZBA 4LCUC 2AHYA 4RO2A 2Q6AA 4MTFA 3UM7A 3OUFA 3UKMA 1JVMA 1OCZC 4MVOA 5CBGA 4G27B 4RAIA 4LP8A 3E86A 3OUSA 1OCOC 4ZBMA 3T2MA 2ZXWC 5B1AC 2A79B 3F7VC 4GX5A 3WG7C 3AG4C 2DYRC 3RVYA 1OCCC 3RBZA 4PDLA 3SJQC 2DWEC 2EIMC 3STZC 5IY5C 3LDEA 1P7BA 3RVZA 3SPIA 2QKSA 3T1CA 4GX0A 3SYAA 4MSWC 3OR6C 4X89A 2BOCC 2EIKC 2WLLB 4MTOA 3FB5C 3IGAC 2K1EA 4P30A 4WFGA 4MVUA 5B1BC 2WLHA 3EFFK 4P2ZA 4TWKA 3ASNC 4JTCB 2X6BA 4LBEC 4R8CA 2ATKC 3AG1C 2WLNA 4PDRA 3JYCA 5EBLC 5EC2C 3T4ZA 2Y69C 1R3KC 2JK5C 4R7CA 4XDLA 2WLLA 4J9ZB 4MS2A 5EBWC 2BOBC 4RUEA 3E8GA 4PA9A 2A9HA 3E89A 3K0DA 4QE9A
chains in the Genus database with same CATH superfamily
1SQFA 3IFXA 3SPGA 1FFTB 3LNMB 1Q6UA 4U3JB 3W7WA 4O4HB 1WA8B 3CC4V 4TUYA 2F1MA 3JD4A 1UFIA 2IW5A 1K3EA 4X62O 1Q7YW 5LYJB 2QM7A 1WP8A 3FYIB 5BXZA 3UT5B 3BA9A 2OCCC 2UXBB 5K1XA 4WBNA 1R6TA 2ZINA 3N2KA 3H1KH 1N32O 1N8RW 1G8MA 1DGSA 2ITCC 2YEVA 2P7TC 3AG3C 4JI0O 4YJ2B 1M57B 1Y67A 4UFZA 5FNVB 4OPAA 4GKJB 4JASA 5C8YA 1U96A 1KC8W 1K7DA 3CXCU 1N0JA 3DXRB 4RUFA 1I94B 1GTOA 3B2EE 5IYCO 1S5LZ 3FAVB 4O4JB 3ASNB 4CS4A 3ABMC 1NTZH 3DSQA 3RYCA 3QO8A 2BCCH 3JALA 1AI4A 4L8JA 3HKDA 3ZRWB 2QGNA 2G38A 4DXWA 4I5SA 1J5EO 2ZNJA 3OMIB 1OCOC 3ICXA 1ZL8B 4LR3A 2ARHA 3RBZA 2UUAB 2XAQA 5IY5C 1ROPA 1S76D 3JAKA 4LFAO 2F93B 4B7KA 1M9NA 2XUMA 3RGBA 2K1EA 4TQFA 2B1GA 4J7ZA 4WFGA 1IBLO 4KUMA 2WLHA 4Z1VA 5JCOA 2X6BA 1KB9F 3AG1C 4PDRA 2RQ6A 4I4TA 4JPRA 1X59A 5LXTB 3MD0A 4QE9A 4CH4A 4DV6O 5EBMC 2R72A 3CEIA 3GWKC 2AGAA 4FLTA 4JI1O 1AI6A 2DYRB 3I56V 3JCZA 5TISZ 3U0ZA 2DQ3A 4O2AB 4NVPA 1DLBA 4LFAB 3M8AA 4QGPA 4A5UB 1LUVA 3WB2A 2WLIB 3IC9A 5KUKA 4YY3B 1AR5A 1LNQA 4GX1A 3JAMN 5B1OA 1GKFA 2XT9A 3ZHRA 1OV9A 3ZMVA 2ITDC 4OGQB 1E1RG 4N21A 5IJ0B 1K9MW 3S3WA 1IBLB 3JD1A 3OGIB 3K04A 3JATB 2DYSC 2KSDA 2JGDA 1KKDA 4X62B 1QR8A 4GKKB 3DC6A 3ETQA 1PL0A 4DR7O 2YIAA 1SESA 4G27B 5LOVA 3OUSA 5ITZB 4DR3B 2WAMA 4GX5A 3A0HZ 2PI5A 2DWEC 3LDEA 1V54B 1H38A 3T1CA 4TV9B 3W7SA 1M90W 3CRMA 1BQ0A 4PELA 1VQ8V 2QSAA 4KHPO 1NH2D 1BGYH 4F6EA 1KP2A 3JYCA 1XNRB 1BS3A 4J9ZB 2BOBC 4JF3A 2IM9A 4NKGB 1QQCA 3ABUA 2F66C 5CA1B 1ORQC 2KG7B 1FPOA 2ZR3A 2LJ2A 5H2FZ 1NR7A 2GTAA 4X65B 2B1IA 4BIUA 3ABLC 3JAWB 2GHYA 4TSFG 3T1YB 1BZKA 3RYFA 4NXMO 3CXHF 3R65A 1I0HA 2QJ1A 1CEZA 1B06A 5CN0A 2QWOB 1JA8A 4GX2A 4D7TA 3D36C 2NR5A 3ABLB 2IU3A 4R50A 1S5HC 3RW0A 3VQWA 2XOKG 3K5MA 1K4DC 4PJ0Z 1SRYA 1I94O 1PM9A 5B1BB 1AP6A 3SGIA 1I5XA 1XREA 4JAAA 2E5LO 4YY3O 5J2UB 5KAFZ 4J7JA 4O4LB 4K0KB 5A9GA 3VBBA 2LFRA 1WP7A 3ZHQA 4NR1A 3JSLA 1KECA 3G6BA 2E76B 4X1IB 1ENVA 5KHJA 3E86A 1V55B 2Y69B 4PI0A 3CYOA 1ZAUA 1S77D 5H5NA 1FXHA 3ZN0A 4LF8O 3CRRA 1WB7A 5IYDO 2RCVA 2BOCC 1EN4A 2EIJB 3IGAC 3CPWU 3B40A 3K9AA 4FVMA 3CCRV 1R6NA 4DV5B 3SJCC 5EC2C 5DECA 3RWRD 2UXDO 3DC5A 5IT9N 2LW1A 1ZTEA 3B09A 4J9YB 2CK3G 5IYZB 4XDJA 5JVDA 1K92A 2Z0AA 4EKWA 4JZ2A 4U3JA 1WA8A 4TUYB 2JS5A 3H1JH 4FM2A 2E3CA 4ZOLA 3NXSA 5LYJA 3K0GA 4J11A 5IE9A 1NKDA 1MSDA 4GYCB 5H6RA 3UO2A 5CBFA 3ABMB 3N2KB 3HB3B 3ZIAG 5LMUB 4DW0A 3ZEDA 3TXQA 1J95A 4X1KA 2P90A 3TCUA 4MVZA 3LUTB 2VQEB 5LHIA 4CH5A 1WPBA 4JYCA 1XI1A 3FD9A 1I08A 1WLEA 1XHXA 1GH6A 1VQOV 4GKJO 3ZBHA 4D7SA 3DXRA 4H44B 2BSKA 3THOA 3QTCA 4O4JA 1X4TA 3G6EV 1XOUA 1HWYA 4DR4O 4B3MO 3RYCB 1VQ9V 4LCUC 4OX9B 3UQ8A 3AK1A 4MTFA 2AZ2A 3OUFA 1XMOB 5CBGA 3ZRWA 1VQPV 1FFXB 2EINB 3ABTA 5B1AC 2HHHB 3AG3B 2P4VA 3T1HB 3CD6V 4X64O 1NH2B 2V1DA 2EIKC 3JAKB 4GT1A 4NTXA 2VQFB 3L75H 2E74B 5IWAB 3QNEA 4J80A 4EFBA 3BCCH 2PI4A 1DF5A 3R66A 3AK2A 5A2QN 1N34O 2ZT9B 3ZCCA 3D3IA 4I4TB 2OIEA 5LXTA 1EN6A 5EIBD 5KLVH 2Q4PA 2JRIA 1PNMA 1AROP 3I5DA 2HVKC 3CS5A 5IY5B 1VQ5V 3TGUH 2X6AA 1Q82W 5KUMA 4DR4B 1GM9A 1N4CA 4O2AA 1XMQB 1K4CC 1VF5B 5CB4A 5KA5A 4J7KA 2D2CB 1SETA 5C93A 4IIJA 3VOUA 1AI5A 2WLIA 1IBKO 2O57A 1VARA 4FFBA 3BAAA 3SDLA 5L3GA 1B6QA 3OR7C 3CCEV 2HJDA 1XMOO 1KKCA 3LNNA 4JZGA 1S5JA 2QKAA 3AG7A 3SPJA 4DUZO 2M7WA 2ODMA 4FLVA 4KFMA 1SZTA 4LFBB 3CCJV 1L1FA 3ABKB 5H9CA 2X0LA 4FLWA 2OYQA 1LUWA 1SQBH 1J5EB 5GONB 2JGDB 3LSUA 5JJJB 1EN5A 3RVYA 5GW7A 4DR1O 2JEUA 4JI4O 2UUAO 4GX0A 1AJQA 3SYAA 3ASOB 3ETDA 4ABMA 3FB5C 3GVMA 4P30A 4W4KA 5JH7A 1AB3A 2CGOA 4B3RO 4TV9A 3CCSV 4ZHQB 3K5LA 4IT5A 4XDLA 3IC7A 2IJJA 2A7WA 4PA9A 1AJPA 1R3LC 3OMAB 1S3JA 2R70A 3FFQA 3ASOC 3ETGA 4JGSA 1JJOA 1NVPD 1AR4A 4FMTA 3OGCC 3K03A 1O9HA 3FYEB 2Y0PA 3S3XA 1ZWIC 2Y48A 1JR9A 1F4MA 2P06A 4PA3A 1GM8A 2IJHA 4UVAA 4CS3A 4RQEA 4I7ZB 1N33B 1OCZB 1R1BA 1KUQA 3L9DA 3MHSC 1W0KG 4NTWA 4QPKA 1BCCH 1IDSA 2EIMB 2Y4TA 4JV5B 3BFRA 1OCRB 1YIJV 2F4VB 1K5SA 2ZCEA 3KKYA 5LMNB 5EK0A 3F5WC 1PKXA 3OAAG 2RJZA 1MABG 3ZX6A 4BIZA 1OCCB 4L87A 2A0LA 3UO3A 4B3TB 1P49A 3DTUB 3JCUZ 4DR6B 4NB5A 4QIWF 1I5YA 2DOSA 2OTLV 2EIJC 1TUEB 4LWSB 3WU2Z 4O4LA 3D36A 4OPHA 3AG2B 3CJHB 3F7VC 3QO5A 1OCCC 5LA6B 3STZC 4X1IA 3U11A 1YITV 2JJ2G 4O4IB 4UCOA 3QG5A 3G4SV 5LGNA 3QVNA 2F43G 1M93A 1YJWV 1NI8A 4LBEC 5LL6Y 2ATKC 4IYIA 1XNRO 3K5NA 4K8XA 3E8GA 3UCSC 4I55B 3I55V 2IJKA 4AI8A 3KZIZ 4FM0A 4F4LA 1VQNV 1YJNV 4JI4B 5H6QA 4MVRA 1MSWD 1S0VA 1BE3H 2PY5A 5JVDB 2ADPA 5KHGA 2YIDA 1Y76B 4YIOA 1QLNA 2Y0IA 3W7XA 1M56B 4MVMA 3ZMSA 4ZOLB 3OTOO 2UUCO 1AR1B 5BY1A 3WG7B 3IJ4A 1TVKB 4LFCO 1H2SB 4DV4O 5JWPA 4QNHB 1Q43A 1KQSU 4DRXB 1M56C 4G28B 1RM1C 3B8NA 2KB1A 4X1KB 5GTHZ 4NTYA 4DR5O 2WLMA 2EINC 3J81N 1NQTA 5B1AB 1GN2A 3OM3B 1RPOA 3J80N 2OCCB 2Z5UA 3TETA 1N34B 2EJRA 2BSKB 1SA0B 2Q9LA 2Q67A 2ZQMA 4JI7O 3H9VA 1RM1B 3UM7A 4CS2A 1IXBA 1AILA 5LMNO 2UXNA 4FIPC 2VS0A 5KX5B 1CP9A 2Q73A 1MG1A 2FB5A 1AP5A 2YXLA 1UPGA 1FFXA 2QDOA 3CSXA 2UXBO 1IBMO 2DW4A 1FYJA 4B3RB 1WAZA 3ASNC 2K9PA 1R3KC 2XAGA 2ILMA 1N32B 1DF4A 1XEQA 3OD4A 3E83A 4HAMA 4RQFA 4DR7B 4LF5O 2DWDC 1EBOA 4JI2B 2X7RB 5J9PC 2YS8A 1JPXA 2QWQB 3MAQA 2YC0A 4MTGA 2EZPA 2DJVA 2E75B 3M7MX 2QWNB 1QHTA 3L74H 4X64B 4HYOA 2YDEA 2GBOA 1QVFU 2L6LA 2GTSA 2FYUH 2EIKB 4QPJA 2W0XA 3W7UA 3CCVV 4PA4A 4LF4B 5KMGA 1K34A 4FFKA 5CA3A 1QCEA 1S72V 1XBLA 2WLKA 4K35A 1WN7A 4B3SO 2PYLA 2YICA 3X2QC 2M6YA 5CB4B 3F5TA 3LDCA 2QTOA 4QE7A 4JYYA 4QJFB 5BR8O 4IIJB 3ZRVA 4P9OA 4I0XA 4FFBB 2JVDA 5LMUO 1IX9A 4DK0A 3CX5F 4B3TO 4OXSA 4IGGA 2KKWA 1KP3A 4B3MB 4CC5A 3HKBB 1KBHA 4KL1A 4YXWG 4RAIA 1H2LA 1NS1A 3EXAA 1JQ0A 3AG4C 4U7NA 1IBKB 3SJQC 1A32A 1YSCA 5GONA 1HNZB 4GUNA 4TQDA 2UUBO 3AEIA 2HR3A 4H13B 2ADQB 2FKXA 4MVUA 1GN6A 4GLXA 5DEDA 4TOIA 1PNKA 3GWOA 4ICGA 2GSMB 2A9HA 5JH7B 4YIPA 4ZHQA 4XBFA 3CE2A 2F4VO 3ABKC 2FTKA 4LC1A 3U10A 1IBMB 1HR0B 4HNAB 1BT8A 3K08A 3OEEG 2CUGA 2N74A 5LGUA 1OCRC 3ETEA 5KAIZ 2AHZA 3CCLV 4LF9O 1U97A 3SYOA 4DW1A 5B3SC 1NTKH 1L0NH 2CE4A 3E8BA 3E8HA 3ZS8C 1CPYA 4DO2A 4LFCB 4WFBV 1MMMA 1QU7A 4AQYB 4JI5B 3H01A 2WA4A 2PF4E 2MK3A 3ZHVA 5F2VO 1ZLZA 3RN4A 3AG2C 4DR2B 4JTDB 3SPHA 2ZM6B 1BL8A 2YIBD 2V4DA 4MW8A 1URFA 3E8FA 4R6ZA 1IVSA 2IH3C 5LP6A 2WWWA 4E4EA 4RO2A 1NR1A 3HKCB 1N36B 4MVOA 3K9SA 1L0LH 1PP9H 2A79B 2AZ0A 4LWSA 5IYBO 1VMGA 1VP7A 2VQEO 1P7BA 3CMEV 2HHHO 3JARA 3WB1A 3CJHA 4BWAA 4DV7O 1UJWB 5LA6A 1AJNA 3N2GA 2A06H 4LNUB 5B1BC 4BW9A 4O4IA 2WLNA 3QF7A 4DR2O 3OW2U 4LF7O 2V7QG 1R3IC 2EILC 1BMFG 1TA8A 2UXXA 5HFLA 2JJ1G 1EFRG 1T5EA 4I55A 3RYIB 3G80A 4J10A 3LDDA 2ZE5A 1K73W 3OT7A 1SQVH 2HG5C 1K97A 2YIBA 3FB8C 4MVQA 2HEPA 2DMXA 3E35A 4YJ3A 4GKKO 1H8HG 4AQYO 3APQA 3L73H 2AXTZ 4WFFA 5EZYA 1JJ2U 5EC1C 3K59A 1Y76A 3K06A 1YVWA 2QM4A 1GK9A 4X88A 3MHHC 3L71H 2FL4A 2LO1A 4JV5O 4KXRA 3B77A 1DK1A 4LF7B 4E2LA 3ZMZA 5IJ9A 3FX7A 4XDKA 2F95B 2Q5ZA 1TVKA 4JI3B 1KD1W 4UV9A 1E1QG 2HFEC 5AG2A 3RFRA 1GMGA 5JQGA 4UCRA 2QEXV 4DRXA 1XL4A 4DV3B 3VQYA 2L35A 5LHHA 4JI7B 5CA0B 1Y74B 3CCQV 2XHBA 4PI2A 1P7GA 3JD2A 1M4UA 3UKMA 2BTQA 1JVMA 2CTPA 2QE7G 2VRZA 2QR4A 3WG7C 1SA0A 3T1YO 2UU9B 1FAFA 2CAZC 3OTFA 3PN1A 4X1YA 2OT5A 1MOFA 5KX5A 1G6UA 4I50A 3Q4HA 2DN9A 4BR6A 1SZXA 4P2ZA 4TWKA 1NVPB 1YEWA 4JTCB 4R8CA 3ZMTA 1DTOA 4EFEA 1US6A 4WF9V 1KMIZ 3CRQA 1FS0G 3A8TA 3CRAA 2ZE8A 3M99B 5E1AC 2Q0AA 3FB6C 1AVMA 3RT3C 3H1IH 1EZVH 2KQXA 3H1HH 3K57A 1IXMA 1QBZA 4JI8O 2P5OA 4DV7B 3STLC 4U7OA 4PDVA 1RSOB 3GB7C 1FKAO 1XHZA 1TUBA 4IHJB 4I9WA 2UXDB 1WJZA 4EEQA 4DUYO 2P22C 3JSNA 1SQGA 5L3DA 3TJTA 2PYJA 3T4DA 1P4RA 1XDCA 3HKEB 3B4SA 4JI0B 4UVBA 4X8AA 2BTOA 5KMGB 4UB8Z 1W59A 1EZJA 1OZ0A 3FKSG 3ZRSA 3D3QA 1FD9A 1NT2B 3AG1B 1BSMA 5D5PA 1H2KA 2AW9A 4DV2O 2CH7B 4U3FH 4WCEV 1HNWB 1D5AA 1SQQH 3FB7C 4CBCA 1HNXO 4I0XB 5L3EA 1SERA 5CMUA 2EULA 2FMLA 1GRJA 2MW2B 2AHYA 1HP8A 3OFNG 1SQXH 1HR0O 2ZDIC 5IWAO 4O2BB 1YDXA 3CWBH 2F23A 2EBOA 2VQFO 4FZ0A 2DYRC 2QWPB 3HKBA 3WB0A 3AK3A 4PDLA 3TXSA 1QR9A 3X2QB 4B08A 4X20B 2WPDG 1Q86W 4YHHB 3EVKA 4X89A 4MTOA 1WB8A 2WLLB 5BMVA 2HP8A 4X9QA 5J2TA 1PNLA 2D3OW 4ZI7B 3T4ZA 1YF2A 4JI2O 3JD3A 1MZFA 4DV0B 1MA1A 1BHBA 4NXNO 4AILC 3K3WA 2PZSA 3P30A 2CTWA 4HZ3A 4LF6O 4WFEA 3P3PA 1F51A 3HR0A 4PA6A 1W2BU 2LW7A 1R3JC 4LH6A 4JAVA 1G1XB 3EHBB 2DYSB 2JGUA 4HNAA 1GO3F 2PGGA 1MNGA 2XTAA 4K8ZA 1NJIW 4N23A 1G4YB 4UUJC 4LF4O 4EB6B 2UU9O 4RWUA 2PTMA 4F6RA 5B5EZ 3CMAV 4DUZB 4DV5O 1V54C 4B3SB 3OMNB 3BVOA 4CC6A 4PV1B 1F7YA 4PA7A 4NXNB 4J41A 4GCZA 3JASB 1SQPH 1XL6A 2ZR2A 5BR8B 3D8CA 1XMQO 1R6KA 2IBZH 2QM8A 2WSSG 1JX9A 1Z5WA 2YXHA 2ZKOA 5FPRA 4FZ1A 4LF6B 2X6CA 5K1PA 1V9PA 1OCZC 1JOYA 4ASUG 4LP8A 2EJ7A 4FLUA 1RPRA 5LP6B 1Z2GA 2W6JG 5DM6V 2P4KA 2EIMC 1YTFD 3HKCA 1YJ9V 2QKSA 4DYLA 2ZE6A 3BA8A 5FLXN 1O9GA 2BE3A 1GN3A 1SF9A 1H2NA 3JARB 1NU1H 2Y4UA 4Q20A 4FLXA 5EBWC 4MS2A 2Q7GA 2RNBA 4RUEA 5LP6C 1HNXB 5KHIA 4LNUA 3N2GB 1XNQB 1IZ3A 3RYHB 3OE7G 4ZKIA 3ZHTA 4FM1A 3P32A 4JAUA 4P9PA 4TV8A 4JI3O 2B5UA 2P67A 3A0BZ 2ZE7A 5CBHA 1PL4A 4DV2B 4WFHA 4X66O 3J7AU 1H2GA 3CHXA 2R9AA 4FLYA 4DV1O 3RYIA 1JCHA 1WPXA 5B1NA 1GM7A 4UCSA 4BIOA 5DN6G 2B9ZA 1FXKC 2GUZA 1RP3B 1VQMV 4OX9O 4YJ3B 4X65O 4BW5A 4FPPA 4UCVA 5EZYB 5KHKA 1FXVA 3IAYA 1YXBA 2R9IA 3K79A 5LBQA 3ZRXA 2EILB 2NLJC 2W0FC 4B7EA 3N27A 1YHQV 4MW3A 5IJ9B 2LQTA 1FXKA 1TGOA 2ETNA 4PHZA 2QWRB 5JQGB 3HPLC 4DK1A 4FJCC 4H33A 3G71V 1N36O 5CA0A 2YI8A 4MT8A 1Y74A 4FK5C 2LP7A 2ZXWC 3E22A 2QA4V 2Q0OC 1W0JG 5EYPB 2BTQB 3SPIA 1K8AW 5L3CA 2VWKA 1TAEA 3H1LH 2UXCB 3O65A 1YCIA 4DV4B 4NYKA 1EM1A 3TK1A 1JFFB 1ZX3A 4Z1MG 4X1YB 2W6IG 4JYBA 4I50B 1BQZA 4O4HA 3Q4HB 4D6TH 4TT3G 1F23A 2CDYA 1K33A 3KCXA 1MZEA 2DQ0A 1HW7A 1VQLV 3NR7A 3UT5A 1VF6C 1SS3A 2ZIMA 1L8DA 3KG2A 4WBNB 5FL7G 4PDMA 4LF9B 3BY6A 2ZNIA 4JTAB 4UV8A 4K0KO 4JI6B 1RSOA 2YEVB 4H37A 1TUBB 4IHJA 4YJ2A 2ZM6O 5FNVA 2VWJA 3W7TA 1FJGO 2RDCA 5LGTA 4JYAO 3CC2V 2JDIG 3K5OA 2IH1C 1CXZB 1OCOB 1M5IA 5C8YB 1N0NA 4J42A 2JIZG 4AHCA 2RN9A 2N05A 1YZBA 3L72H 3L70H 3LSQA 3FAVA 2H8PC 3HKEA 3DGEA 1VF6A 1Y6XA 1HDJA 2HLDG 4DUYB 2LGQA 3PJSK 3F7YC 1PPJH 3JALB 3HKDB 2DE0X 1VF7A 1XNQO 3SYPA 3BPZA 1M57C 5JCOC 4CH3A 2OWOA 2H94A 3KCYA 1ZL8A 3SPCA 1KU9A 1RFYA 1B04A 1Q90D 4WFAV 5BZBA 2CH7A 4I9QA 1OJHA 4H0LB 3CRCA 4DV6B 1Q8IA 4DV3O 1KYOF 4GZRB 4HBNA 3K58A 1NTMH 5KA6A 1H8EG 1XILA 4FLZA 1D2DA 4BAYA 4LFBO 4O2BA 1D5NA 1JMKC 2Q8VA 3OR6C 5HFMA 1AI7A 5JJNB 4UVCA 4UXNA 4X20A 3SJBC 2JK5C 4R7CA 2WLLA 4UCUA 5BMVB 1VQ4V 2QKCA 5J2TB 3E89A 3K0DA 1Y66A 1VQKV 3CCUV 4DR1B 2ZDIA 3P3NA 4ZI7A 5KHHA 4NXMB 2UXCO 3C3SA 5E79Z 4KHPB 4KP4A 4JI8B 1H2MA 1B3QA 2H3OA 4Z2WA 5FPOA 1XQ8A 2GDSA 2XAFA 3AG4B 1M1KW 2NNUA 2N04A 4DV0O 3LSSA 1COWG 3SYCA 2Z3YA 1P84F 4LF5B 1BHAA 2A3QA 2WLJA 3ZJZA 4IYHA 2NN4A 4EB6A 3ZHUA 5IJ0A 1Q5OA 2HKOA 4F6RB 3A2FA 4C7UA 3JATA 4IL6Z 1FJGB 1Q81W 2E5LB 1ZUQA 2LGWA 3JASA 5JJEB 1VQ6V 2C2AA 4UCTA 4JI6O 1HNWO 1HNZO 2ZIOA 5LOVB 5ITZA 1I7FA 4G2KA 2Q7EA 5L3FA 4LF8B 2HVJC 1SKVA 5B3SB 1NZ6A 4Q6GA 1PV0A 5EIBC 3RVZA 2YUAA 4MSWC 3C90A 1VEWA 3O9OA 1Q3EA 2UUCB 4ZIBA 3SJAC 3ML0A 5EBLC 2OIGA 1R73A 2PUSA 4ZBMA 1SC5B 2WA3A 5CA1A 1LR1A 2KG7A 1NBMG 4CH6A 3SYQA 3OEHG 3ZMUA 1QNMA 3JAWA 3WFVA 3VQXA 1YTFB 3RYHA 4MTXA 3RYFB 2Q68A 3A0RA 5B66Z 3SR2C 4TV8B 1K5QA 1THZA 2HJFC 4X66B 3BEHA 4UB6Z 5IDJA 5L3BA 2UUBB 3QO7A 2XASA 4JI5O 2CTRA 3CCMV 5LHGA 3E2EA 4LH7A 4DR5B 1QLEB 1VIBA 2RMKB 1V55C 2GV9A 3BABA 2OTJV 2GUZB 1IURA 2XNDG 3C3TA 2Q69A 2JS3A 2LFSA 1Z5VA 2YSUB 3VQVA 2P6JA 2YXYA 1GAXA 1OHHG 4MVSA 1WNSA 5J2UA 4YHHO 3OTOB 1Y4MA 3B8MA 2ZXWB 1QLEC 2IJIA 4PD4F 2QTSA 3CP1A 2Q7HA 1YI2V 2ZD9A 5D5QA 4DR6O 1E79G 3BHPA 1Q6HA 2YI9A 3ZN1A 1ZSPA 5GTIZ 1Q6IA 4W4LA 4CZZA 1QVGU 1FXKB 2R9RB 4K3AA 2Q6AA 3JD0A 3BRCA 3MDSA 3T2MA 4DR3O 2EZOA 2CTQA 3T1HO 1XUQA 1VQ7V 2IU0A 2OCHA 2JEXA 1GN4A 3APOA 3E22B 3G67A 1PD3A 3ZHSA 5EYPA 3CC7V 2EX3A 4JYAB 1N33O 3EFFK 1F4NA 3CB2A 2XAHA 5IYZA 4JI1B 2XAJA 2Y69C 1JFFA 2CGNA 4DV1B
chains in the Genus database with same CATH topology
3IFXA 3SPGA 4XBFA 3OE7G 1FFTB 4ZKIA 3LNMB 3P32A 3ABKC 4JAUA 3ZCCA 4P9PA 3D3IA 2FTKA 3W7WA 4LC1A 3CC4V 2B5UA 3JD4A 2P67A 2IW5A 1K3EA 5CBHA 1Q7YW 1PNMA 4WFHA 1H2GA 2QM7A 1AROP 3FYIB 3K08A 2HVKC 3OEEG 5LGUA 5IY5B 1OCRC 1VQ5V 2OCCC 3ETEA 2AHZA 2X6AA 3CCLV 1JCHA 1Q82W 1WPXA 5B1NA 1GM7A 5DN6G 5KUMA 1FXKC 1GM9A 3SYOA 1VQMV 5B3SC 1N8RW 1G8MA 2ITCC 1K4CC 5KA5A 3E8BA 2YEVA 2P7TC 4BW5A 3E8HA 3AG3C 4FPPA 1M57B 1SETA 5C93A 1CPYA 1FXVA 4DO2A 3VOUA 1AI5A 2R9IA 2WLIA 4WFBV 3K79A 5LBQA 4JASA 3ZRXA 2EILB 1KC8W 2NLJC 2W0FC 1K7DA 3CXCU 3H01A 4RUFA 5L3GA 1B6QA 2MK3A 1GTOA 3OR7C 5IYCO 3CCEV 1YHQV 4MW3A 3AG2C 4JTDB 3SPHA 3ASNB 3SPJA 3ABMC 1BL8A 1FXKA 2M7WA 3QO8A 4KFMA 4MW8A 1AI4A 1SZTA 3CCJV 3E8FA 3ZRWB 1L1FA 4R6ZA 3HPLC 3ABKB 4FJCC 2X0LA 5H9CA 4H33A 2IH3C 4DXWA 4I5SA 2WWWA 3G71V 4RO2A 1NR1A 4MVOA 4MT8A 3OMIB 4FK5C 2LP7A 1OCOC 2ZXWC 2A79B 2QA4V 3RVYA 5GW7A 3RBZA 1W0JG 2JEUA 5IYBO 2XAQA 5IY5C 1P7BA 1ROPA 1S76D 3SPIA 3CMEV 1K8AW 4GX0A 5L3CA 1AJQA 3SYAA 3ASOB 1M9NA 3ETDA 1UJWB 1AJNA 3FB5C 2K1EA 4P30A 2B1GA 3TK1A 4WFGA 4KUMA 5B1BC 2WLHA 3CCSV 4Z1MG 2X6BA 3AG1C 4PDRA 2WLNA 2W6IG 4JYBA 3IC7A 2IJJA 4XDLA 3OW2U 4JPRA 4PA9A 1AJPA 4TT3G 1F23A 3MD0A 4QE9A 2V7QG 1R3LC 3OMAB 1R3IC 2EILC 1BMFG 1K33A 1S3JA 2UXXA 5HFLA 3ASOC 3ETGA 4JGSA 2JJ1G 2DQ0A 1VQLV 1EFRG 5EBMC 1NVPD 4FMTA 3OGCC 3K03A 3LDDA 1K73W 3FYEB 3KG2A 2HG5C 5FL7G 1AI6A 1K97A 2DYRB 3FB8C 4PDMA 3I56V 1ZWIC 3JCZA 4MVQA 2Y48A 2DQ3A 3BY6A 3E35A 4JTAB 4UV8A 1F4MA 1H8HG 2YEVB 4H37A 4PA3A 1DLBA 1GM8A 2IJHA 4UVAA 4RQEA 4WFFA 3W7TA 5LGTA 1JJ2U 3CC2V 1OCZB 2JDIG 5EC1C 2WLIB 2IH1C 3K06A 3MHSC 1OCOB 5KUKA 1W0KG 2JIZG 4QPKA 1GK9A 4X88A 3MHHC 2EIMB 1LNQA 3LSQA 4GX1A 3B77A 5B1OA 1GKFA 2H8PC 1OCRB 1YIJV 3DGEA 4E2LA 3ZMZA 1K5SA 4XDKA 3ZMVA 2ITDC 2HLDG 1KD1W 4UV9A 1E1RG 4N21A 5EK0A 3PJSK 3F7YC 1E1QG 2HFEC 1K9MW 3F5WC 3JD1A 1PKXA 1GMGA 3OAAG 1MABG 4BIZA 1OCCB 4L87A 2QEXV 1XL4A 2A0LA 3SYPA 5LHHA 1M57C 3K04A 3DTUB 4QIWF 1I5YA 2DYSC 3CCQV 1KKDA 2H94A 2OTLV 3SPCA 2EIJC 1TUEB 4WFAV 1QR8A 5BZBA 3JD2A 3UKMA 3D36A 1JVMA 1PL0A 2QE7G 1SESA 4G27B 3AG2B 3OUSA 3WG7C 3F7VC 2WAMA 4GX5A 3QO5A 1OCCC 2PI5A 5KA6A 1H8EG 2DWEC 3STZC 3LDEA 1V54B 4BAYA 1H38A 3T1CA 1M90W 3W7SA 1YITV 2JJ2G 2OT5A 3OR6C 4PELA 1MOFA 5HFMA 1VQ8V 1AI7A 3G4SV 5LGNA 2F43G 4UVCA 1NH2D 4UXNA 1KP2A 1YJWV 4P2ZA 4TWKA 1NVPB 4JTCB 4LBEC 4R8CA 2ATKC 1DTOA 3ZMTA 3JYCA 4WF9V 2JK5C 4R7CA 1FS0G 2WLLA 4J9ZB 2BOBC 3E8GA 1VQ4V 4JF3A 3E89A 3K0DA 1Y66A 1VQKV 3CCUV 2ZDIA 3M99B 5E1AC 3FB6C 3ABUA 3I55V 2IJKA 1IXMA 1QBZA 1ORQC 4KP4A 4F4LA 2ZR3A 1VQNV 3STLC 4U7OA 1NR7A 1YJNV 4PDVA 5H6QA 3GB7C 4MVRA 1MSWD 2XAFA 3AG4B 2B1IA 4BIUA 1M1KW 1S0VA 3ABLC 4I9WA 2GHYA 4TSFG 2NNUA 1QLNA 3LSSA 3W7XA 1M56B 5L3DA 1COWG 3SYCA 4MVMA 2Z3YA 3R65A 3T4DA 3ZMSA 1P4RA 1AR1B 1BHAA 1CEZA 5CN0A 3WG7B 2WLJA 3ZJZA 4GX2A 4UVBA 4X8AA 3ABLB 2IU3A 4R50A 1S5HC 3RW0A 2HKOA 2XOKG 4QNHB 1K4DC 1KQSU 1M56C 4G28B 1EZJA 1OZ0A 3B8NA 1SRYA 2KB1A 1RM1C 3FKSG 3ZRSA 2WLMA 5B1BB 2EINC 1NQTA 5B1AB 3AG1B 1Q81W 1I5XA 3OM3B 1VQ6V 1RPOA 2C2AA 4WCEV 3FB7C 4CBCA 2OCCB 5L3EA 3VBBA 2LFRA 2Z5UA 1SERA 3TETA 5CMUA 4G2KA 5L3FA 2EJRA 2Q67A 2HVJC 2ZQMA 1RM1B 1KECA 2AHYA 3OFNG 3UM7A 5B3SB 1ENVA 2ZDIC 3E86A 2UXNA 1V55B 2Y69B 2EBOA 4FIPC 2DYRC 3CYOA 4PDLA 1CP9A 1MG1A 3RVZA 1S77D 1QR9A 1FXHA 3X2QB 3ZN0A 2WPDG 1Q86W 5IYDO 4MSWC 4X89A 2BOCC 2WLLB 4MTOA 2EIJB 3IGAC 3CPWU 2DW4A 1PNLA 3K9AA 3CCRV 3ASNC 1R6NA 2D3OW 3ML0A 5EBLC 1R73A 5EC2C 3T4ZA 1R3KC 3JD3A 4ZBMA 1BHBA 2XAGA 3K3WA 1NBMG 3P30A 4J9YB 2CK3G 4HZ3A 3OEHG 3SYQA 3ZMUA 1DF4A 4WFEA 4XDJA 1F51A 3E83A 3WFVA 4HAMA 4RQFA 1YTFB 4PA6A 2DWDC 1W2BU 4MTXA 1K92A 1EBOA 2Q68A 3A0RA 4EKWA 2X7RB 1R3JC 5J9PC 1JPXA 1K5QA 4MTGA 4JAVA 1THZA 2HJFC 2EZPA 3BEHA 3EHBB 3NXSA 2DYSB 5IDJA 5L3BA 4HYOA 3K0GA 1GO3F 3QO7A 1QVFU 2XASA 1NKDA 3CCMV 2EIKB 4N23A 4QPJA 1NJIW 5LHGA 1G4YB 4UUJC 3W7UA 3CCVV 3E2EA 4PA4A 1QLEB 5H6RA 1K34A 1V55C 5CBFA 5CA3A 2OTJV 1QCEA 3ABMB 1S72V 3HB3B 3ZIAG 1J95A 2WLKA 2XNDG 3CMAV 1V54C 2P90A 2Q69A 4MVZA 3LUTB 3OMNB 3TCUA 3X2QC 2LFSA 5LHIA 4PA7A 2YSUB 3LDCA 2P6JA 2QTOA 4JYCA 4QE7A 4GCZA 1OHHG 4QJFB 1XL6A 4MVSA 2ZR2A 1WLEA 3ZRVA 1VQOV 1Y4MA 3B8MA 2ZXWB 1R6KA 1QLEC 4P9OA 2IJIA 2QM8A 2WSSG 1JX9A 3CP1A 1YI2V 2ZD9A 1E79G 4OXSA 3G6EV 3ZN1A 1HWYA 1KP3A 2X6CA 4CZZA 1QVGU 1FXKB 2R9RB 4LCUC 1VQ9V 2Q6AA 3JD0A 4MTFA 3OUFA 4YXWG 1OCZC 1JOYA 5CBGA 4RAIA 3ZRWA 4LP8A 4ASUG 2EINB 3T2MA 1VQPV 3ABTA 5B1AC 1RPRA 1JQ0A 3AG3B 2EZOA 3AG4C 4U7NA 2W6JG 5DM6V 3SJQC 2EIMC 1YTFD 1YSCA 1YJ9V 2QKSA 1VQ7V 2IU0A 3CD6V 2JEXA 3AEIA 2HR3A 1PD3A 1NH2B 2V1DA 2EIKC 3CC7V 4MVUA 3EFFK 1F4NA 2XAHA 4GT1A 2XAJA 2Y69C 4Q20A 1PNKA 3GWOA 5EBWC 2GSMB 4MS2A 4RUEA 3QNEA 2A9HA 2PI4A 1DF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3L C;  3IFX A;  3SPG A;  1R3I C;  2EIL C;  4HZ3 A;  4J9Y B;  5E1A C;  3FB6 C;  3LNM B;  3SYQ A;  3ABK C;  4WFE A;  4P9P A;  3ASO C;  4XDJ A;  3E83 A;  1ORQ C;  5EBM C;  4F4L A;  4PA6 A;  3OGC C;  3STL C;  2DWD C;  5CBH A;  4WFH A;  4PDV A;  3K03 A;  2Q68 A;  3LDD A;  4EKW A;  3GB7 C;  1R3J C;  4MVR A;  5J9P C;  3KG2 A;  2HG5 C;  3FB8 C;  4PDM A;  1ZWI C;  3K08 A;  4MVQ A;  2HVK C;  2HJF C;  3ABL C;  4MTG A;  4I9W A;  3BEH A;  1OCR C;  4JTA B;  2OCC C;  2AHZ A;  2X6A A;  4HYO A;  3K0G A;  4H37 A;  3SYC A;  4MVM A;  4PA3 A;  5KUM A;  3R65 A;  4WFF A;  3SYO A;  3T4D A;  1G4Y B;  4UUJ C;  5B3S C;  4PA4 A;  5EC1 C;  2ITC C;  2WLI B;  2IH1 C;  3K06 A;  1K4C C;  1V55 C;  5KUK A;  3E8B A;  2YEV A;  2P7T C;  4BW5 A;  2WLJ A;  5CBF A;  3ZJZ A;  3E8H A;  3AG3 C;  4X88 A;  4GX2 A;  4X8A A;  1J95 A;  2WLK A;  1LNQ A;  4GX1 A;  1V54 C;  2Q69 A;  3TCU A;  4MVZ A;  3LUT B;  3VOU A;  3X2Q C;  2WLI A;  4R50 A;  2H8P C;  1S5H C;  4PA7 A;  3LDC A;  3RW0 A;  2NLJ C;  2QTO A;  2W0F C;  4QE7 A;  4QNH B;  1K4D C;  4XDK A;  1M56 C;  2ITD C;  4G28 B;  4RUF A;  1XL6 A;  4MVS A;  2KB1 A;  5EK0 A;  3OR7 C;  3PJS K;  3F7Y C;  3ZRS A;  2HFE C;  2WLM A;  4MW3 A;  2EIN C;  3AG2 C;  3F5W C;  4JTD B;  3SPH A;  4P9O A;  1QLE C;  3SPJ A;  1XL4 A;  2A0L A;  3SYP A;  3ABM C;  1BL8 A;  2ZD9 A;  1M57 C;  3K04 A;  4KFM A;  4MW8 A;  4OXS A;  3FB7 C;  4CBC A;  2DYS C;  3E8F A;  3TET A;  1KKD A;  4R6Z A;  3HPL C;  3SPC A;  2EIJ C;  2X6C A;  4H33 A;  2Q67 A;  2IH3 C;  4DXW A;  2HVJ C;  2R9R B;  5BZB A;  4LCU C;  2AHY A;  4RO2 A;  2Q6A A;  4MTF A;  3UM7 A;  3OUF A;  3UKM A;  1JVM A;  1OCZ C;  4MVO A;  5CBG A;  4G27 B;  4RAI A;  4LP8 A;  3E86 A;  3OUS A;  1OCO C;  4ZBM A;  3T2M A;  2ZXW C;  5B1A C;  2A79 B;  3F7V C;  4GX5 A;  3WG7 C;  3AG4 C;  2DYR C;  3RVY A;  1OCC C;  3RBZ A;  4PDL A;  3SJQ C;  2DWE C;  2EIM C;  3STZ C;  5IY5 C;  3LDE A;  1P7B A;  3RVZ A;  3SPI A;  2QKS A;  3T1C A;  4GX0 A;  3SYA A;  4MSW C;  3OR6 C;  4X89 A;  2BOC C;  2EIK C;  2WLL B;  4MTO A;  3FB5 C;  3IGA C;  2K1E A;  4P30 A;  4WFG A;  4MVU A;  5B1B C;  2WLH A;  3EFF K;  4P2Z A;  4TWK A;  3ASN C;  4JTC B;  2X6B A;  4LBE C;  4R8C A;  2ATK C;  3AG1 C;  2WLN A;  4PDR A;  3JYC A;  5EBL C;  5EC2 C;  3T4Z A;  2Y69 C;  1R3K C;  2JK5 C;  4R7C A;  4XDL A;  2WLL A;  4J9Z B;  4MS2 A;  5EBW C;  2BOB C;  4RUE A;  3E8G A;  4PA9 A;  2A9H A;  3E89 A;  3K0D A;  4QE9 A; 
#chains in the Genus database with same CATH topology
 1SQF A;  3IFX A;  3SPG A;  1FFT B;  3LNM B;  1Q6U A;  4U3J B;  3W7W A;  4O4H B;  1WA8 B;  3CC4 V;  4TUY A;  2F1M A;  3JD4 A;  1UFI A;  2IW5 A;  1K3E A;  4X62 O;  1Q7Y W;  5LYJ B;  2QM7 A;  1WP8 A;  3FYI B;  5BXZ A;  3UT5 B;  3BA9 A;  2OCC C;  2UXB B;  5K1X A;  4WBN A;  1R6T A;  2ZIN A;  3N2K A;  3H1K H;  1N32 O;  1N8R W;  1G8M A;  1DGS A;  2ITC C;  2YEV A;  2P7T C;  3AG3 C;  4JI0 O;  4YJ2 B;  1M57 B;  1Y67 A;  4UFZ A;  5FNV B;  4OPA A;  4GKJ B;  4JAS A;  5C8Y A;  1U96 A;  1KC8 W;  1K7D A;  3CXC U;  1N0J A;  3DXR B;  4RUF A;  1I94 B;  1GTO A;  3B2E E;  5IYC O;  1S5L Z;  3FAV B;  4O4J B;  3ASN B;  4CS4 A;  3ABM C;  1NTZ H;  3DSQ A;  3RYC A;  3QO8 A;  2BCC H;  3JAL A;  1AI4 A;  4L8J A;  3HKD A;  3ZRW B;  2QGN A;  2G38 A;  4DXW A;  4I5S A;  1J5E O;  2ZNJ A;  3OMI B;  1OCO C;  3ICX A;  1ZL8 B;  4LR3 A;  2ARH A;  3RBZ A;  2UUA B;  2XAQ A;  5IY5 C;  1ROP A;  1S76 D;  3JAK A;  4LFA O;  2F93 B;  4B7K A;  1M9N A;  2XUM A;  3RGB A;  2K1E A;  4TQF A;  2B1G A;  4J7Z A;  4WFG A;  1IBL O;  4KUM A;  2WLH A;  4Z1V A;  5JCO A;  2X6B A;  1KB9 F;  3AG1 C;  4PDR A;  2RQ6 A;  4I4T A;  4JPR A;  1X59 A;  5LXT B;  3MD0 A;  4QE9 A;  4CH4 A;  4DV6 O;  5EBM C;  2R72 A;  3CEI A;  3GWK C;  2AGA A;  4FLT A;  4JI1 O;  1AI6 A;  2DYR B;  3I56 V;  3JCZ A;  5TIS Z;  3U0Z A;  2DQ3 A;  4O2A B;  4NVP A;  1DLB A;  4LFA B;  3M8A A;  4QGP A;  4A5U B;  1LUV A;  3WB2 A;  2WLI B;  3IC9 A;  5KUK A;  4YY3 B;  1AR5 A;  1LNQ A;  4GX1 A;  3JAM N;  5B1O A;  1GKF A;  2XT9 A;  3ZHR A;  1OV9 A;  3ZMV A;  2ITD C;  4OGQ B;  1E1R G;  4N21 A;  5IJ0 B;  1K9M W;  3S3W A;  1IBL B;  3JD1 A;  3OGI B;  3K04 A;  3JAT B;  2DYS C;  2KSD A;  2JGD A;  1KKD A;  4X62 B;  1QR8 A;  4GKK B;  3DC6 A;  3ETQ A;  1PL0 A;  4DR7 O;  2YIA A;  1SES A;  4G27 B;  5LOV A;  3OUS A;  5ITZ B;  4DR3 B;  2WAM A;  4GX5 A;  3A0H Z;  2PI5 A;  2DWE C;  3LDE A;  1V54 B;  1H38 A;  3T1C A;  4TV9 B;  3W7S A;  1M90 W;  3CRM A;  1BQ0 A;  4PEL A;  1VQ8 V;  2QSA A;  4KHP O;  1NH2 D;  1BGY H;  4F6E A;  1KP2 A;  3JYC A;  1XNR B;  1BS3 A;  4J9Z B;  2BOB C;  4JF3 A;  2IM9 A;  4NKG B;  1QQC A;  3ABU A;  2F66 C;  5CA1 B;  1ORQ C;  2KG7 B;  1FPO A;  2ZR3 A;  2LJ2 A;  5H2F Z;  1NR7 A;  2GTA A;  4X65 B;  2B1I A;  4BIU A;  3ABL C;  3JAW B;  2GHY A;  4TSF G;  3T1Y B;  1BZK A;  3RYF A;  4NXM O;  3CXH F;  3R65 A;  1I0H A;  2QJ1 A;  1CEZ A;  1B06 A;  5CN0 A;  2QWO B;  1JA8 A;  4GX2 A;  4D7T A;  3D36 C;  2NR5 A;  3ABL B;  2IU3 A;  4R50 A;  1S5H C;  3RW0 A;  3VQW A;  2XOK G;  3K5M A;  1K4D C;  4PJ0 Z;  1SRY A;  1I94 O;  1PM9 A;  5B1B B;  1AP6 A;  3SGI A;  1I5X A;  1XRE A;  4JAA A;  2E5L O;  4YY3 O;  5J2U B;  5KAF Z;  4J7J A;  4O4L B;  4K0K B;  5A9G A;  3VBB A;  2LFR A;  1WP7 A;  3ZHQ A;  4NR1 A;  3JSL A;  1KEC A;  3G6B A;  2E76 B;  4X1I B;  1ENV A;  5KHJ A;  3E86 A;  1V55 B;  2Y69 B;  4PI0 A;  3CYO A;  1ZAU A;  1S77 D;  5H5N A;  1FXH A;  3ZN0 A;  4LF8 O;  3CRR A;  1WB7 A;  5IYD O;  2RCV A;  2BOC C;  1EN4 A;  2EIJ B;  3IGA C;  3CPW U;  3B40 A;  3K9A A;  4FVM A;  3CCR V;  1R6N A;  4DV5 B;  3SJC C;  5EC2 C;  5DEC A;  3RWR D;  2UXD O;  3DC5 A;  5IT9 N;  2LW1 A;  1ZTE A;  3B09 A;  4J9Y B;  2CK3 G;  5IYZ B;  4XDJ A;  5JVD A;  1K92 A;  2Z0A A;  4EKW A;  4JZ2 A;  4U3J A;  1WA8 A;  4TUY B;  2JS5 A;  3H1J H;  4FM2 A;  2E3C A;  4ZOL A;  3NXS A;  5LYJ A;  3K0G A;  4J11 A;  5IE9 A;  1NKD A;  1MSD A;  4GYC B;  5H6R A;  3UO2 A;  5CBF A;  3ABM B;  3N2K B;  3HB3 B;  3ZIA G;  5LMU B;  4DW0 A;  3ZED A;  3TXQ A;  1J95 A;  4X1K A;  2P90 A;  3TCU A;  4MVZ A;  3LUT B;  2VQE B;  5LHI A;  4CH5 A;  1WPB A;  4JYC A;  1XI1 A;  3FD9 A;  1I08 A;  1WLE A;  1XHX A;  1GH6 A;  1VQO V;  4GKJ O;  3ZBH A;  4D7S A;  3DXR A;  4H44 B;  2BSK A;  3THO A;  3QTC A;  4O4J A;  1X4T A;  3G6E V;  1XOU A;  1HWY A;  4DR4 O;  4B3M O;  3RYC B;  1VQ9 V;  4LCU C;  4OX9 B;  3UQ8 A;  3AK1 A;  4MTF A;  2AZ2 A;  3OUF A;  1XMO B;  5CBG A;  3ZRW A;  1VQP V;  1FFX B;  2EIN B;  3ABT A;  5B1A C;  2HHH B;  3AG3 B;  2P4V A;  3T1H B;  3CD6 V;  4X64 O;  1NH2 B;  2V1D A;  2EIK C;  3JAK B;  4GT1 A;  4NTX A;  2VQF B;  3L75 H;  2E74 B;  5IWA B;  3QNE A;  4J80 A;  4EFB A;  3BCC H;  2PI4 A;  1DF5 A;  3R66 A;  3AK2 A;  5A2Q N;  1N34 O;  2ZT9 B;  3ZCC A;  3D3I A;  4I4T B;  2OIE A;  5LXT A;  1EN6 A;  5EIB D;  5KLV H;  2Q4P A;  2JRI A;  1PNM A;  1ARO P;  3I5D A;  2HVK C;  3CS5 A;  5IY5 B;  1VQ5 V;  3TGU H;  2X6A A;  1Q82 W;  5KUM A;  4DR4 B;  1GM9 A;  1N4C A;  4O2A A;  1XMQ B;  1K4C C;  1VF5 B;  5CB4 A;  5KA5 A;  4J7K A;  2D2C B;  1SET A;  5C93 A;  4IIJ A;  3VOU A;  1AI5 A;  2WLI A;  1IBK O;  2O57 A;  1VAR A;  4FFB A;  3BAA A;  3SDL A;  5L3G A;  1B6Q A;  3OR7 C;  3CCE V;  2HJD A;  1XMO O;  1KKC A;  3LNN A;  4JZG A;  1S5J A;  2QKA A;  3AG7 A;  3SPJ A;  4DUZ O;  2M7W A;  2ODM A;  4FLV A;  4KFM A;  1SZT A;  4LFB B;  3CCJ V;  1L1F A;  3ABK B;  5H9C A;  2X0L A;  4FLW A;  2OYQ A;  1LUW A;  1SQB H;  1J5E B;  5GON B;  2JGD B;  3LSU A;  5JJJ B;  1EN5 A;  3RVY A;  5GW7 A;  4DR1 O;  2JEU A;  4JI4 O;  2UUA O;  4GX0 A;  1AJQ A;  3SYA A;  3ASO B;  3ETD A;  4ABM A;  3FB5 C;  3GVM A;  4P30 A;  4W4K A;  5JH7 A;  1AB3 A;  2CGO A;  4B3R O;  4TV9 A;  3CCS V;  4ZHQ B;  3K5L A;  4IT5 A;  4XDL A;  3IC7 A;  2IJJ A;  2A7W A;  4PA9 A;  1AJP A;  1R3L C;  3OMA B;  1S3J A;  2R70 A;  3FFQ A;  3ASO C;  3ETG A;  4JGS A;  1JJO A;  1NVP D;  1AR4 A;  4FMT A;  3OGC C;  3K03 A;  1O9H A;  3FYE B;  2Y0P A;  3S3X A;  1ZWI C;  2Y48 A;  1JR9 A;  1F4M A;  2P06 A;  4PA3 A;  1GM8 A;  2IJH A;  4UVA A;  4CS3 A;  4RQE A;  4I7Z B;  1N33 B;  1OCZ B;  1R1B A;  1KUQ A;  3L9D A;  3MHS C;  1W0K G;  4NTW A;  4QPK A;  1BCC H;  1IDS A;  2EIM B;  2Y4T A;  4JV5 B;  3BFR A;  1OCR B;  1YIJ V;  2F4V B;  1K5S A;  2ZCE A;  3KKY A;  5LMN B;  5EK0 A;  3F5W C;  1PKX A;  3OAA G;  2RJZ A;  1MAB G;  3ZX6 A;  4BIZ A;  1OCC B;  4L87 A;  2A0L A;  3UO3 A;  4B3T B;  1P49 A;  3DTU B;  3JCU Z;  4DR6 B;  4NB5 A;  4QIW F;  1I5Y A;  2DOS A;  2OTL V;  2EIJ C;  1TUE B;  4LWS B;  3WU2 Z;  4O4L A;  3D36 A;  4OPH A;  3AG2 B;  3CJH B;  3F7V C;  3QO5 A;  1OCC C;  5LA6 B;  3STZ C;  4X1I A;  3U11 A;  1YIT V;  2JJ2 G;  4O4I B;  4UCO A;  3QG5 A;  3G4S V;  5LGN A;  3QVN A;  2F43 G;  1M93 A;  1YJW V;  1NI8 A;  4LBE C;  5LL6 Y;  2ATK C;  4IYI A;  1XNR O;  3K5N A;  4K8X A;  3E8G A;  3UCS C;  4I55 B;  3I55 V;  2IJK A;  4AI8 A;  3KZI Z;  4FM0 A;  4F4L A;  1VQN V;  1YJN V;  4JI4 B;  5H6Q A;  4MVR A;  1MSW D;  1S0V A;  1BE3 H;  2PY5 A;  5JVD B;  2ADP A;  5KHG A;  2YID A;  1Y76 B;  4YIO A;  1QLN A;  2Y0I A;  3W7X A;  1M56 B;  4MVM A;  3ZMS A;  4ZOL B;  3OTO O;  2UUC O;  1AR1 B;  5BY1 A;  3WG7 B;  3IJ4 A;  1TVK B;  4LFC O;  1H2S B;  4DV4 O;  5JWP A;  4QNH B;  1Q43 A;  1KQS U;  4DRX B;  1M56 C;  4G28 B;  1RM1 C;  3B8N A;  2KB1 A;  4X1K B;  5GTH Z;  4NTY A;  4DR5 O;  2WLM A;  2EIN C;  3J81 N;  1NQT A;  5B1A B;  1GN2 A;  3OM3 B;  1RPO A;  3J80 N;  2OCC B;  2Z5U A;  3TET A;  1N34 B;  2EJR A;  2BSK B;  1SA0 B;  2Q9L A;  2Q67 A;  2ZQM A;  4JI7 O;  3H9V A;  1RM1 B;  3UM7 A;  4CS2 A;  1IXB A;  1AIL A;  5LMN O;  2UXN A;  4FIP C;  2VS0 A;  5KX5 B;  1CP9 A;  2Q73 A;  1MG1 A;  2FB5 A;  1AP5 A;  2YXL A;  1UPG A;  1FFX A;  2QDO A;  3CSX A;  2UXB O;  1IBM O;  2DW4 A;  1FYJ A;  4B3R B;  1WAZ A;  3ASN C;  2K9P A;  1R3K C;  2XAG A;  2ILM A;  1N32 B;  1DF4 A;  1XEQ A;  3OD4 A;  3E83 A;  4HAM A;  4RQF A;  4DR7 B;  4LF5 O;  2DWD C;  1EBO A;  4JI2 B;  2X7R B;  5J9P C;  2YS8 A;  1JPX A;  2QWQ B;  3MAQ A;  2YC0 A;  4MTG A;  2EZP A;  2DJV A;  2E75 B;  3M7M X;  2QWN B;  1QHT A;  3L74 H;  4X64 B;  4HYO A;  2YDE A;  2GBO A;  1QVF U;  2L6L A;  2GTS A;  2FYU H;  2EIK B;  4QPJ A;  2W0X A;  3W7U A;  3CCV V;  4PA4 A;  4LF4 B;  5KMG A;  1K34 A;  4FFK A;  5CA3 A;  1QCE A;  1S72 V;  1XBL A;  2WLK A;  4K35 A;  1WN7 A;  4B3S O;  2PYL A;  2YIC A;  3X2Q C;  2M6Y A;  5CB4 B;  3F5T A;  3LDC A;  2QTO A;  4QE7 A;  4JYY A;  4QJF B;  5BR8 O;  4IIJ B;  3ZRV A;  4P9O A;  4I0X A;  4FFB B;  2JVD A;  5LMU O;  1IX9 A;  4DK0 A;  3CX5 F;  4B3T O;  4OXS A;  4IGG A;  2KKW A;  1KP3 A;  4B3M B;  4CC5 A;  3HKB B;  1KBH A;  4KL1 A;  4YXW G;  4RAI A;  1H2L A;  1NS1 A;  3EXA A;  1JQ0 A;  3AG4 C;  4U7N A;  1IBK B;  3SJQ C;  1A32 A;  1YSC A;  5GON A;  1HNZ B;  4GUN A;  4TQD A;  2UUB O;  3AEI A;  2HR3 A;  4H13 B;  2ADQ B;  2FKX A;  4MVU A;  1GN6 A;  4GLX A;  5DED A;  4TOI A;  1PNK A;  3GWO A;  4ICG A;  2GSM B;  2A9H A;  5JH7 B;  4YIP A;  4ZHQ A;  4XBF A;  3CE2 A;  2F4V O;  3ABK C;  2FTK A;  4LC1 A;  3U10 A;  1IBM B;  1HR0 B;  4HNA B;  1BT8 A;  3K08 A;  3OEE G;  2CUG A;  2N74 A;  5LGU A;  1OCR C;  3ETE A;  5KAI Z;  2AHZ A;  3CCL V;  4LF9 O;  1U97 A;  3SYO A;  4DW1 A;  5B3S C;  1NTK H;  1L0N H;  2CE4 A;  3E8B A;  3E8H A;  3ZS8 C;  1CPY A;  4DO2 A;  4LFC B;  4WFB V;  1MMM A;  1QU7 A;  4AQY B;  4JI5 B;  3H01 A;  2WA4 A;  2PF4 E;  2MK3 A;  3ZHV A;  5F2V O;  1ZLZ A;  3RN4 A;  3AG2 C;  4DR2 B;  4JTD B;  3SPH A;  2ZM6 B;  1BL8 A;  2YIB D;  2V4D A;  4MW8 A;  1URF A;  3E8F A;  4R6Z A;  1IVS A;  2IH3 C;  5LP6 A;  2WWW A;  4E4E A;  4RO2 A;  1NR1 A;  3HKC B;  1N36 B;  4MVO A;  3K9S A;  1L0L H;  1PP9 H;  2A79 B;  2AZ0 A;  4LWS A;  5IYB O;  1VMG A;  1VP7 A;  2VQE O;  1P7B A;  3CME V;  2HHH O;  3JAR A;  3WB1 A;  3CJH A;  4BWA A;  4DV7 O;  1UJW B;  5LA6 A;  1AJN A;  3N2G A;  2A06 H;  4LNU B;  5B1B C;  4BW9 A;  4O4I A;  2WLN A;  3QF7 A;  4DR2 O;  3OW2 U;  4LF7 O;  2V7Q G;  1R3I C;  2EIL C;  1BMF G;  1TA8 A;  2UXX A;  5HFL A;  2JJ1 G;  1EFR G;  1T5E A;  4I55 A;  3RYI B;  3G80 A;  4J10 A;  3LDD A;  2ZE5 A;  1K73 W;  3OT7 A;  1SQV H;  2HG5 C;  1K97 A;  2YIB A;  3FB8 C;  4MVQ A;  2HEP A;  2DMX A;  3E35 A;  4YJ3 A;  4GKK O;  1H8H G;  4AQY O;  3APQ A;  3L73 H;  2AXT Z;  4WFF A;  5EZY A;  1JJ2 U;  5EC1 C;  3K59 A;  1Y76 A;  3K06 A;  1YVW A;  2QM4 A;  1GK9 A;  4X88 A;  3MHH C;  3L71 H;  2FL4 A;  2LO1 A;  4JV5 O;  4KXR A;  3B77 A;  1DK1 A;  4LF7 B;  4E2L A;  3ZMZ A;  5IJ9 A;  3FX7 A;  4XDK A;  2F95 B;  2Q5Z A;  1TVK A;  4JI3 B;  1KD1 W;  4UV9 A;  1E1Q G;  2HFE C;  5AG2 A;  3RFR A;  1GMG A;  5JQG A;  4UCR A;  2QEX V;  4DRX A;  1XL4 A;  4DV3 B;  3VQY A;  2L35 A;  5LHH A;  4JI7 B;  5CA0 B;  1Y74 B;  3CCQ V;  2XHB A;  4PI2 A;  1P7G A;  3JD2 A;  1M4U A;  3UKM A;  2BTQ A;  1JVM A;  2CTP A;  2QE7 G;  2VRZ A;  2QR4 A;  3WG7 C;  1SA0 A;  3T1Y O;  2UU9 B;  1FAF A;  2CAZ C;  3OTF A;  3PN1 A;  4X1Y A;  2OT5 A;  1MOF A;  5KX5 A;  1G6U A;  4I50 A;  3Q4H A;  2DN9 A;  4BR6 A;  1SZX A;  4P2Z A;  4TWK A;  1NVP B;  1YEW A;  4JTC B;  4R8C A;  3ZMT A;  1DTO A;  4EFE A;  1US6 A;  4WF9 V;  1KMI Z;  3CRQ A;  1FS0 G;  3A8T A;  3CRA A;  2ZE8 A;  3M99 B;  5E1A C;  2Q0A A;  3FB6 C;  1AVM A;  3RT3 C;  3H1I H;  1EZV H;  2KQX A;  3H1H H;  3K57 A;  1IXM A;  1QBZ A;  4JI8 O;  2P5O A;  4DV7 B;  3STL C;  4U7O A;  4PDV A;  1RSO B;  3GB7 C;  1FKA O;  1XHZ A;  1TUB A;  4IHJ B;  4I9W A;  2UXD B;  1WJZ A;  4EEQ A;  4DUY O;  2P22 C;  3JSN A;  1SQG A;  5L3D A;  3TJT A;  2PYJ A;  3T4D A;  1P4R A;  1XDC A;  3HKE B;  3B4S A;  4JI0 B;  4UVB A;  4X8A A;  2BTO A;  5KMG B;  4UB8 Z;  1W59 A;  1EZJ A;  1OZ0 A;  3FKS G;  3ZRS A;  3D3Q A;  1FD9 A;  1NT2 B;  3AG1 B;  1BSM A;  5D5P A;  1H2K A;  2AW9 A;  4DV2 O;  2CH7 B;  4U3F H;  4WCE V;  1HNW B;  1D5A A;  1SQQ H;  3FB7 C;  4CBC A;  1HNX O;  4I0X B;  5L3E A;  1SER A;  5CMU A;  2EUL A;  2FML A;  1GRJ A;  2MW2 B;  2AHY A;  1HP8 A;  3OFN G;  1SQX H;  1HR0 O;  2ZDI C;  5IWA O;  4O2B B;  1YDX A;  3CWB H;  2F23 A;  2EBO A;  2VQF O;  4FZ0 A;  2DYR C;  2QWP B;  3HKB A;  3WB0 A;  3AK3 A;  4PDL A;  3TXS A;  1QR9 A;  3X2Q B;  4B08 A;  4X20 B;  2WPD G;  1Q86 W;  4YHH B;  3EVK A;  4X89 A;  4MTO A;  1WB8 A;  2WLL B;  5BMV A;  2HP8 A;  4X9Q A;  5J2T A;  1PNL A;  2D3O W;  4ZI7 B;  3T4Z A;  1YF2 A;  4JI2 O;  3JD3 A;  1MZF A;  4DV0 B;  1MA1 A;  1BHB A;  4NXN O;  4AIL C;  3K3W A;  2PZS A;  3P30 A;  2CTW A;  4HZ3 A;  4LF6 O;  4WFE A;  3P3P A;  1F51 A;  3HR0 A;  4PA6 A;  1W2B U;  2LW7 A;  1R3J C;  4LH6 A;  4JAV A;  1G1X B;  3EHB B;  2DYS B;  2JGU A;  4HNA A;  1GO3 F;  2PGG A;  1MNG A;  2XTA A;  4K8Z A;  1NJI W;  4N23 A;  1G4Y B;  4UUJ C;  4LF4 O;  4EB6 B;  2UU9 O;  4RWU A;  2PTM A;  4F6R A;  5B5E Z;  3CMA V;  4DUZ B;  4DV5 O;  1V54 C;  4B3S B;  3OMN B;  3BVO A;  4CC6 A;  4PV1 B;  1F7Y A;  4PA7 A;  4NXN B;  4J41 A;  4GCZ A;  3JAS B;  1SQP H;  1XL6 A;  2ZR2 A;  5BR8 B;  3D8C A;  1XMQ O;  1R6K A;  2IBZ H;  2QM8 A;  2WSS G;  1JX9 A;  1Z5W A;  2YXH A;  2ZKO A;  5FPR A;  4FZ1 A;  4LF6 B;  2X6C A;  5K1P A;  1V9P A;  1OCZ C;  1JOY A;  4ASU G;  4LP8 A;  2EJ7 A;  4FLU A;  1RPR A;  5LP6 B;  1Z2G A;  2W6J G;  5DM6 V;  2P4K A;  2EIM C;  1YTF D;  3HKC A;  1YJ9 V;  2QKS A;  4DYL A;  2ZE6 A;  3BA8 A;  5FLX N;  1O9G A;  2BE3 A;  1GN3 A;  1SF9 A;  1H2N A;  3JAR B;  1NU1 H;  2Y4U A;  4Q20 A;  4FLX A;  5EBW C;  4MS2 A;  2Q7G A;  2RNB A;  4RUE A;  5LP6 C;  1HNX B;  5KHI A;  4LNU A;  3N2G B;  1XNQ B;  1IZ3 A;  3RYH B;  3OE7 G;  4ZKI A;  3ZHT A;  4FM1 A;  3P32 A;  4JAU A;  4P9P A;  4TV8 A;  4JI3 O;  2B5U A;  2P67 A;  3A0B Z;  2ZE7 A;  5CBH A;  1PL4 A;  4DV2 B;  4WFH A;  4X66 O;  3J7A U;  1H2G A;  3CHX A;  2R9A A;  4FLY A;  4DV1 O;  3RYI A;  1JCH A;  1WPX A;  5B1N A;  1GM7 A;  4UCS A;  4BIO A;  5DN6 G;  2B9Z A;  1FXK C;  2GUZ A;  1RP3 B;  1VQM V;  4OX9 O;  4YJ3 B;  4X65 O;  4BW5 A;  4FPP A;  4UCV A;  5EZY B;  5KHK A;  1FXV A;  3IAY A;  1YXB A;  2R9I A;  3K79 A;  5LBQ A;  3ZRX A;  2EIL B;  2NLJ C;  2W0F C;  4B7E A;  3N27 A;  1YHQ V;  4MW3 A;  5IJ9 B;  2LQT A;  1FXK A;  1TGO A;  2ETN A;  4PHZ A;  2QWR B;  5JQG B;  3HPL C;  4DK1 A;  4FJC C;  4H33 A;  3G71 V;  1N36 O;  5CA0 A;  2YI8 A;  4MT8 A;  1Y74 A;  4FK5 C;  2LP7 A;  2ZXW C;  3E22 A;  2QA4 V;  2Q0O C;  1W0J G;  5EYP B;  2BTQ B;  3SPI A;  1K8A W;  5L3C A;  2VWK A;  1TAE A;  3H1L H;  2UXC B;  3O65 A;  1YCI A;  4DV4 B;  4NYK A;  1EM1 A;  3TK1 A;  1JFF B;  1ZX3 A;  4Z1M G;  4X1Y B;  2W6I G;  4JYB A;  4I50 B;  1BQZ A;  4O4H A;  3Q4H B;  4D6T H;  4TT3 G;  1F23 A;  2CDY A;  1K33 A;  3KCX A;  1MZE A;  2DQ0 A;  1HW7 A;  1VQL V;  3NR7 A;  3UT5 A;  1VF6 C;  1SS3 A;  2ZIM A;  1L8D A;  3KG2 A;  4WBN B;  5FL7 G;  4PDM A;  4LF9 B;  3BY6 A;  2ZNI A;  4JTA B;  4UV8 A;  4K0K O;  4JI6 B;  1RSO A;  2YEV B;  4H37 A;  1TUB B;  4IHJ A;  4YJ2 A;  2ZM6 O;  5FNV A;  2VWJ A;  3W7T A;  1FJG O;  2RDC A;  5LGT A;  4JYA O;  3CC2 V;  2JDI G;  3K5O A;  2IH1 C;  1CXZ B;  1OCO B;  1M5I A;  5C8Y B;  1N0N A;  4J42 A;  2JIZ G;  4AHC A;  2RN9 A;  2N05 A;  1YZB A;  3L72 H;  3L70 H;  3LSQ A;  3FAV A;  2H8P C;  3HKE A;  3DGE A;  1VF6 A;  1Y6X A;  1HDJ A;  2HLD G;  4DUY B;  2LGQ A;  3PJS K;  3F7Y C;  1PPJ H;  3JAL B;  3HKD B;  2DE0 X;  1VF7 A;  1XNQ O;  3SYP A;  3BPZ A;  1M57 C;  5JCO C;  4CH3 A;  2OWO A;  2H94 A;  3KCY A;  1ZL8 A;  3SPC A;  1KU9 A;  1RFY A;  1B04 A;  1Q90 D;  4WFA V;  5BZB A;  2CH7 A;  4I9Q A;  1OJH A;  4H0L B;  3CRC A;  4DV6 B;  1Q8I A;  4DV3 O;  1KYO F;  4GZR B;  4HBN A;  3K58 A;  1NTM H;  5KA6 A;  1H8E G;  1XIL A;  4FLZ A;  1D2D A;  4BAY A;  4LFB O;  4O2B A;  1D5N A;  1JMK C;  2Q8V A;  3OR6 C;  5HFM A;  1AI7 A;  5JJN B;  4UVC A;  4UXN A;  4X20 A;  3SJB C;  2JK5 C;  4R7C A;  2WLL A;  4UCU A;  5BMV B;  1VQ4 V;  2QKC A;  5J2T B;  3E89 A;  3K0D A;  1Y66 A;  1VQK V;  3CCU V;  4DR1 B;  2ZDI A;  3P3N A;  4ZI7 A;  5KHH A;  4NXM B;  2UXC O;  3C3S A;  5E79 Z;  4KHP B;  4KP4 A;  4JI8 B;  1H2M A;  1B3Q A;  2H3O A;  4Z2W A;  5FPO A;  1XQ8 A;  2GDS A;  2XAF A;  3AG4 B;  1M1K W;  2NNU A;  2N04 A;  4DV0 O;  3LSS A;  1COW G;  3SYC A;  2Z3Y A;  1P84 F;  4LF5 B;  1BHA A;  2A3Q A;  2WLJ A;  3ZJZ A;  4IYH A;  2NN4 A;  4EB6 A;  3ZHU A;  5IJ0 A;  1Q5O A;  2HKO A;  4F6R B;  3A2F A;  4C7U A;  3JAT A;  4IL6 Z;  1FJG B;  1Q81 W;  2E5L B;  1ZUQ A;  2LGW A;  3JAS A;  5JJE B;  1VQ6 V;  2C2A A;  4UCT A;  4JI6 O;  1HNW O;  1HNZ O;  2ZIO A;  5LOV B;  5ITZ A;  1I7F A;  4G2K A;  2Q7E A;  5L3F A;  4LF8 B;  2HVJ C;  1SKV A;  5B3S B;  1NZ6 A;  4Q6G A;  1PV0 A;  5EIB C;  3RVZ A;  2YUA A;  4MSW C;  3C90 A;  1VEW A;  3O9O A;  1Q3E A;  2UUC B;  4ZIB A;  3SJA C;  3ML0 A;  5EBL C;  2OIG A;  1R73 A;  2PUS A;  4ZBM A;  1SC5 B;  2WA3 A;  5CA1 A;  1LR1 A;  2KG7 A;  1NBM G;  4CH6 A;  3SYQ A;  3OEH G;  3ZMU A;  1QNM A;  3JAW A;  3WFV A;  3VQX A;  1YTF B;  3RYH A;  4MTX A;  3RYF B;  2Q68 A;  3A0R A;  5B66 Z;  3SR2 C;  4TV8 B;  1K5Q A;  1THZ A;  2HJF C;  4X66 B;  3BEH A;  4UB6 Z;  5IDJ A;  5L3B A;  2UUB B;  3QO7 A;  2XAS A;  4JI5 O;  2CTR A;  3CCM V;  5LHG A;  3E2E A;  4LH7 A;  4DR5 B;  1QLE B;  1VIB A;  2RMK B;  1V55 C;  2GV9 A;  3BAB A;  2OTJ V;  2GUZ B;  1IUR A;  2XND G;  3C3T A;  2Q69 A;  2JS3 A;  2LFS A;  1Z5V A;  2YSU B;  3VQV A;  2P6J A;  2YXY A;  1GAX A;  1OHH G;  4MVS A;  1WNS A;  5J2U A;  4YHH O;  3OTO B;  1Y4M A;  3B8M A;  2ZXW B;  1QLE C;  2IJI A;  4PD4 F;  2QTS A;  3CP1 A;  2Q7H A;  1YI2 V;  2ZD9 A;  5D5Q A;  4DR6 O;  1E79 G;  3BHP A;  1Q6H A;  2YI9 A;  3ZN1 A;  1ZSP A;  5GTI Z;  1Q6I A;  4W4L A;  4CZZ A;  1QVG U;  1FXK B;  2R9R B;  4K3A A;  2Q6A A;  3JD0 A;  3BRC A;  3MDS A;  3T2M A;  4DR3 O;  2EZO A;  2CTQ A;  3T1H O;  1XUQ A;  1VQ7 V;  2IU0 A;  2OCH A;  2JEX A;  1GN4 A;  3APO A;  3E22 B;  3G67 A;  1PD3 A;  3ZHS A;  5EYP A;  3CC7 V;  2EX3 A;  4JYA B;  1N33 O;  3EFF K;  1F4N A;  3CB2 A;  2XAH A;  5IYZ A;  4JI1 B;  2XAJ A;  2Y69 C;  1JFF A;  2CGN A;  4DV1 B; 
#chains in the Genus database with same CATH homology
 3IFX A;  3SPG A;  4XBF A;  3OE7 G;  1FFT B;  4ZKI A;  3LNM B;  3P32 A;  3ABK C;  4JAU A;  3ZCC A;  4P9P A;  3D3I A;  2FTK A;  3W7W A;  4LC1 A;  3CC4 V;  2B5U A;  3JD4 A;  2P67 A;  2IW5 A;  1K3E A;  5CBH A;  1Q7Y W;  1PNM A;  4WFH A;  1H2G A;  2QM7 A;  1ARO P;  3FYI B;  3K08 A;  2HVK C;  3OEE G;  5LGU A;  5IY5 B;  1OCR C;  1VQ5 V;  2OCC C;  3ETE A;  2AHZ A;  2X6A A;  3CCL V;  1JCH A;  1Q82 W;  1WPX A;  5B1N A;  1GM7 A;  5DN6 G;  5KUM A;  1FXK C;  1GM9 A;  3SYO A;  1VQM V;  5B3S C;  1N8R W;  1G8M A;  2ITC C;  1K4C C;  5KA5 A;  3E8B A;  2YEV A;  2P7T C;  4BW5 A;  3E8H A;  3AG3 C;  4FPP A;  1M57 B;  1SET A;  5C93 A;  1CPY A;  1FXV A;  4DO2 A;  3VOU A;  1AI5 A;  2R9I A;  2WLI A;  4WFB V;  3K79 A;  5LBQ A;  4JAS A;  3ZRX A;  2EIL B;  1KC8 W;  2NLJ C;  2W0F C;  1K7D A;  3CXC U;  3H01 A;  4RUF A;  5L3G A;  1B6Q A;  2MK3 A;  1GTO A;  3OR7 C;  5IYC O;  3CCE V;  1YHQ V;  4MW3 A;  3AG2 C;  4JTD B;  3SPH A;  3ASN B;  3SPJ A;  3ABM C;  1BL8 A;  1FXK A;  2M7W A;  3QO8 A;  4KFM A;  4MW8 A;  1AI4 A;  1SZT A;  3CCJ V;  3E8F A;  3ZRW B;  1L1F A;  4R6Z A;  3HPL C;  3ABK B;  4FJC C;  2X0L A;  5H9C A;  4H33 A;  2IH3 C;  4DXW A;  4I5S A;  2WWW A;  3G71 V;  4RO2 A;  1NR1 A;  4MVO A;  4MT8 A;  3OMI B;  4FK5 C;  2LP7 A;  1OCO C;  2ZXW C;  2A79 B;  2QA4 V;  3RVY A;  5GW7 A;  3RBZ A;  1W0J G;  2JEU A;  5IYB O;  2XAQ A;  5IY5 C;  1P7B A;  1ROP A;  1S76 D;  3SPI A;  3CME V;  1K8A W;  4GX0 A;  5L3C A;  1AJQ A;  3SYA A;  3ASO B;  1M9N A;  3ETD A;  1UJW B;  1AJN A;  3FB5 C;  2K1E A;  4P30 A;  2B1G A;  3TK1 A;  4WFG A;  4KUM A;  5B1B C;  2WLH A;  3CCS V;  4Z1M G;  2X6B A;  3AG1 C;  4PDR A;  2WLN A;  2W6I G;  4JYB A;  3IC7 A;  2IJJ A;  4XDL A;  3OW2 U;  4JPR A;  4PA9 A;  1AJP A;  4TT3 G;  1F23 A;  3MD0 A;  4QE9 A;  2V7Q G;  1R3L C;  3OMA B;  1R3I C;  2EIL C;  1BMF G;  1K33 A;  1S3J A;  2UXX A;  5HFL A;  3ASO C;  3ETG A;  4JGS A;  2JJ1 G;  2DQ0 A;  1VQL V;  1EFR G;  5EBM C;  1NVP D;  4FMT A;  3OGC C;  3K03 A;  3LDD A;  1K73 W;  3FYE B;  3KG2 A;  2HG5 C;  5FL7 G;  1AI6 A;  1K97 A;  2DYR B;  3FB8 C;  4PDM A;  3I56 V;  1ZWI C;  3JCZ A;  4MVQ A;  2Y48 A;  2DQ3 A;  3BY6 A;  3E35 A;  4JTA B;  4UV8 A;  1F4M A;  1H8H G;  2YEV B;  4H37 A;  4PA3 A;  1DLB A;  1GM8 A;  2IJH A;  4UVA A;  4RQE A;  4WFF A;  3W7T A;  5LGT A;  1JJ2 U;  3CC2 V;  1OCZ B;  2JDI G;  5EC1 C;  2WLI B;  2IH1 C;  3K06 A;  3MHS C;  1OCO B;  5KUK A;  1W0K G;  2JIZ G;  4QPK A;  1GK9 A;  4X88 A;  3MHH C;  2EIM B;  1LNQ A;  3LSQ A;  4GX1 A;  3B77 A;  5B1O A;  1GKF A;  2H8P C;  1OCR B;  1YIJ V;  3DGE A;  4E2L A;  3ZMZ A;  1K5S A;  4XDK A;  3ZMV A;  2ITD C;  2HLD G;  1KD1 W;  4UV9 A;  1E1R G;  4N21 A;  5EK0 A;  3PJS K;  3F7Y C;  1E1Q G;  2HFE C;  1K9M W;  3F5W C;  3JD1 A;  1PKX A;  1GMG A;  3OAA G;  1MAB G;  4BIZ A;  1OCC B;  4L87 A;  2QEX V;  1XL4 A;  2A0L A;  3SYP A;  5LHH A;  1M57 C;  3K04 A;  3DTU B;  4QIW F;  1I5Y A;  2DYS C;  3CCQ V;  1KKD A;  2H94 A;  2OTL V;  3SPC A;  2EIJ C;  1TUE B;  4WFA V;  1QR8 A;  5BZB A;  3JD2 A;  3UKM A;  3D36 A;  1JVM A;  1PL0 A;  2QE7 G;  1SES A;  4G27 B;  3AG2 B;  3OUS A;  3WG7 C;  3F7V C;  2WAM A;  4GX5 A;  3QO5 A;  1OCC C;  2PI5 A;  5KA6 A;  1H8E G;  2DWE C;  3STZ C;  3LDE A;  1V54 B;  4BAY A;  1H38 A;  3T1C A;  1M90 W;  3W7S A;  1YIT V;  2JJ2 G;  2OT5 A;  3OR6 C;  4PEL A;  1MOF A;  5HFM A;  1VQ8 V;  1AI7 A;  3G4S V;  5LGN A;  2F43 G;  4UVC A;  1NH2 D;  4UXN A;  1KP2 A;  1YJW V;  4P2Z A;  4TWK A;  1NVP B;  4JTC B;  4LBE C;  4R8C A;  2ATK C;  1DTO A;  3ZMT A;  3JYC A;  4WF9 V;  2JK5 C;  4R7C A;  1FS0 G;  2WLL A;  4J9Z B;  2BOB C;  3E8G A;  1VQ4 V;  4JF3 A;  3E89 A;  3K0D A;  1Y66 A;  1VQK V;  3CCU V;  2ZDI A;  3M99 B;  5E1A C;  3FB6 C;  3ABU A;  3I55 V;  2IJK A;  1IXM A;  1QBZ A;  1ORQ C;  4KP4 A;  4F4L A;  2ZR3 A;  1VQN V;  3STL C;  4U7O A;  1NR7 A;  1YJN V;  4PDV A;  5H6Q A;  3GB7 C;  4MVR A;  1MSW D;  2XAF A;  3AG4 B;  2B1I A;  4BIU A;  1M1K W;  1S0V A;  3ABL C;  4I9W A;  2GHY A;  4TSF G;  2NNU A;  1QLN A;  3LSS A;  3W7X A;  1M56 B;  5L3D A;  1COW G;  3SYC A;  4MVM A;  2Z3Y A;  3R65 A;  3T4D A;  3ZMS A;  1P4R A;  1AR1 B;  1BHA A;  1CEZ A;  5CN0 A;  3WG7 B;  2WLJ A;  3ZJZ A;  4GX2 A;  4UVB A;  4X8A A;  3ABL B;  2IU3 A;  4R50 A;  1S5H C;  3RW0 A;  2HKO A;  2XOK G;  4QNH B;  1K4D C;  1KQS U;  1M56 C;  4G28 B;  1EZJ A;  1OZ0 A;  3B8N A;  1SRY A;  2KB1 A;  1RM1 C;  3FKS G;  3ZRS A;  2WLM A;  5B1B B;  2EIN C;  1NQT A;  5B1A B;  3AG1 B;  1Q81 W;  1I5X A;  3OM3 B;  1VQ6 V;  1RPO A;  2C2A A;  4WCE V;  3FB7 C;  4CBC A;  2OCC B;  5L3E A;  3VBB A;  2LFR A;  2Z5U A;  1SER A;  3TET A;  5CMU A;  4G2K A;  5L3F A;  2EJR A;  2Q67 A;  2HVJ C;  2ZQM A;  1RM1 B;  1KEC A;  2AHY A;  3OFN G;  3UM7 A;  5B3S B;  1ENV A;  2ZDI C;  3E86 A;  2UXN A;  1V55 B;  2Y69 B;  2EBO A;  4FIP C;  2DYR C;  3CYO A;  4PDL A;  1CP9 A;  1MG1 A;  3RVZ A;  1S77 D;  1QR9 A;  1FXH A;  3X2Q B;  3ZN0 A;  2WPD G;  1Q86 W;  5IYD O;  4MSW C;  4X89 A;  2BOC C;  2WLL B;  4MTO A;  2EIJ B;  3IGA C;  3CPW U;  2DW4 A;  1PNL A;  3K9A A;  3CCR V;  3ASN C;  1R6N A;  2D3O W;  3ML0 A;  5EBL C;  1R73 A;  5EC2 C;  3T4Z A;  1R3K C;  3JD3 A;  4ZBM A;  1BHB A;  2XAG A;  3K3W A;  1NBM G;  3P30 A;  4J9Y B;  2CK3 G;  4HZ3 A;  3OEH G;  3SYQ A;  3ZMU A;  1DF4 A;  4WFE A;  4XDJ A;  1F51 A;  3E83 A;  3WFV A;  4HAM A;  4RQF A;  1YTF B;  4PA6 A;  2DWD C;  1W2B U;  4MTX A;  1K92 A;  1EBO A;  2Q68 A;  3A0R A;  4EKW A;  2X7R B;  1R3J C;  5J9P C;  1JPX A;  1K5Q A;  4MTG A;  4JAV A;  1THZ A;  2HJF C;  2EZP A;  3BEH A;  3EHB B;  3NXS A;  2DYS B;  5IDJ A;  5L3B A;  4HYO A;  3K0G A;  1GO3 F;  3QO7 A;  1QVF U;  2XAS A;  1NKD A;  3CCM V;  2EIK B;  4N23 A;  4QPJ A;  1NJI W;  5LHG A;  1G4Y B;  4UUJ C;  3W7U A;  3CCV V;  3E2E A;  4PA4 A;  1QLE B;  5H6R A;  1K34 A;  1V55 C;  5CBF A;  5CA3 A;  2OTJ V;  1QCE A;  3ABM B;  1S72 V;  3HB3 B;  3ZIA G;  1J95 A;  2WLK A;  2XND G;  3CMA V;  1V54 C;  2P90 A;  2Q69 A;  4MVZ A;  3LUT B;  3OMN B;  3TCU A;  3X2Q C;  2LFS A;  5LHI A;  4PA7 A;  2YSU B;  3LDC A;  2P6J A;  2QTO A;  4JYC A;  4QE7 A;  4GCZ A;  1OHH G;  4QJF B;  1XL6 A;  4MVS A;  2ZR2 A;  1WLE A;  3ZRV A;  1VQO V;  1Y4M A;  3B8M A;  2ZXW B;  1R6K A;  1QLE C;  4P9O A;  2IJI A;  2QM8 A;  2WSS G;  1JX9 A;  3CP1 A;  1YI2 V;  2ZD9 A;  1E79 G;  4OXS A;  3G6E V;  3ZN1 A;  1HWY A;  1KP3 A;  2X6C A;  4CZZ A;  1QVG U;  1FXK B;  2R9R B;  4LCU C;  1VQ9 V;  2Q6A A;  3JD0 A;  4MTF A;  3OUF A;  4YXW G;  1OCZ C;  1JOY A;  5CBG A;  4RAI A;  3ZRW A;  4LP8 A;  4ASU G;  2EIN B;  3T2M A;  1VQP V;  3ABT A;  5B1A C;  1RPR A;  1JQ0 A;  3AG3 B;  2EZO A;  3AG4 C;  4U7N A;  2W6J G;  5DM6 V;  3SJQ C;  2EIM C;  1YTF D;  1YSC A;  1YJ9 V;  2QKS A;  1VQ7 V;  2IU0 A;  3CD6 V;  2JEX A;  3AEI A;  2HR3 A;  1PD3 A;  1NH2 B;  2V1D A;  2EIK C;  3CC7 V;  4MVU A;  3EFF K;  1F4N A;  2XAH A;  4GT1 A;  2XAJ A;  2Y69 C;  4Q20 A;  1PNK A;  3GWO A;  5EBW C;  2GSM B;  4MS2 A;  4RUE A;  3QNE A;  2A9H A;  2PI4 A;  1DF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...