2HVJC

Crystal structure of kcsa-fab-tba complex in low k+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab heavy chain
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hvjC00
3TCUA 1KKDA 1JVMA 2DWEC 4MVQA 5J9PC 5B1AC 4QE7A 4R6ZA 3OR7C 4WFEA 1OCRC 2WLKA 3FB6C 4BW5A 2DYSC 3AG2C 1OCCC 3KG2A 4LBEC 3SPHA 3SYQA 3E8BA 4X8AA 4MW3A 2Q68A 3RW0A 1V55C 4PDMA 3HPLC 4HYOA 2A0LA 2AHYA 3E83A 5EC1C 4MTGA 5KUMA 2BOCC 4UUJC 3T4ZA 3PJSK 1ZWIC 3STLC 2AHZA 4OXSA 1R3IC 3F7YC 4MS2A 2QTOA 2IH1C 4RO2A 5KUKA 5EBMC 1QLEC 4F4LA 3F5WC 4LP8A 2IH3C 4XDJA 4PA9A 3RVYA 4GX2A 1R3LC 2W0FC 3SJQC 3SYPA 5B1BC 2WLNA 2WLJA 4PA6A 4PDRA 4TWKA 4LCUC 5EBLC 1R3KC 3LUTB 3E8GA 2H8PC 2A79B 4MSWC 4WFFA 3ASOC 2Q67A 3K06A 3SPCA 4RUFA 2HJFC 1K4CC 3ABKC 3ASNC 3GB7C 5BZBA 3VOUA 4PA7A 5IY5C 1XL4A 4P30A 3OUFA 3UM7A 3EFFK 2HG5C 1R3JC 3IGAC 2WLLB 4X88A 4WFHA 3OGCC 4JTCB 2X6AA 4J9ZB 3RVZA 2A9HA 2DYRC 3K04A 2ATKC 2BOBC 2OCCC 5B3SC 4G28B 2X6BA 4G27B 4HZ3A 2JK5C 3T1CA 2DWDC 4MTFA 4PDLA 3F7VC 4PDVA 3R65A 4MVMA 4H33A 2NLJC 3SYCA 1M57C 2WLLA 2EILC 3IFXA 4J9YB 2KB1A 2ITDC 3K03A 5EC2C 3WG7C 3X2QC 2X6CA 4X89A 2YEVA 4XDKA 3E86A 3K08A 3LDEA 2Q6AA 5EBWC 1XL6A 4JTDB 1ORQC 3UKMA 1LNQA 1M56C 1OCZC 3OR6C 1G4YB 2ZD9A 1S5HC 4QE9A 2Q69A 2ZXWC 4P2ZA 3BEHA 4RAIA 4EKWA 3JYCA 4DXWA 3ABMC 4H37A 3LNMB 4MVZA 3E8FA 2EIMC 2Y69C 2ITCC 3K0GA 1BL8A 2WLIB 3LDDA 1P7BA 1V54C 2EIJC 4R8CA 2WLHA 3TETA 5EK0A 2HVJC 3ZJZA 4MVOA 4R7CA 3SYOA 3SPIA 4XDLA 3E8HA 4KFMA 4MVRA 2HVKC 4MVUA 3ZRSA 3OUSA 2EIKC 3T4DA 5CBFA 2EINC 3SPGA 4ZBMA 1K4DC 4MTOA 2HFEC 4GX5A 2K1EA 4I9WA 2P7TC 4GX1A 2QKSA 4R50A 3FB7C 5CBHA 2WLIA 3STZC 3LDCA 4MW8A 4CBCA 4JTAB 4WFGA 3ABLC 3AG3C 3SYAA 3RBZA 2WLMA 5E1AC 3FB8C 4RUEA 3SPJA 3FB5C 4PA3A 3E89A 3AG1C 3T2MA 4P9PA 3K0DA 4P9OA 5CBGA 1J95A 1OCOC 2R9RB 4GX0A 4MVSA 4QNHB 3AG4C 4PA4A
chains in the Genus database with same CATH superfamily
3CRRA 5J9PC 2JJ2G 1BCCH 2L6LA 3JALA 4JI2B 2Q9LA 1BGYH 3H1IH 4DR5O 1XHXA 5IYBO 1Y66A 4DV7O 2QWNB 5KUKA 3JAKB 1I5XA 1TUBA 1H2KA 2XNDG 3CC7V 3EVKA 3L73H 1M57B 3TXQA 4RUFA 4Z2WA 4B3TO 1AP5A 2YEVB 1K8AW 4FLTA 4DR4B 4U3JA 4LF4O 3WB1A 1KP2A 3K04A 4FIPC 4X1KA 3RYFB 5KMGA 1P7GA 4FJCC 2VQFO 4G27B 4DR3O 4MVMA 2YXLA 1JX9A 2AW9A 3X2QC 1QR8A 4PI2A 3K08A 4JI8B 2Q6AA 4LF8B 1S5HC 3H1JH 1Z5WA 3UO3A 1M4UA 1N8RW 4JI7O 2QM4A 1AI7A 3ZRWB 2YIBA 1EN5A 1M9NA 4DV2O 1XQ8A 4DUYO 2DYRB 1MZFA 5CBFA 1P4RA 2EINC 4ZBMA 3JSNA 3HR0A 4DR6O 1OZ0A 2ZINA 3AG3C 1WLEA 5KHGA 5ITZA 2F4VB 2A3QA 3EHBB 2XHBA 2JEUA 1H2NA 5CBGA 2HHHO 5FPRA 2YIBD 3SJCC 4DW0A 2P4KA 3CRAA 1JVMA 3CCEV 3G4SV 3AG4B 4MVQA 5IDJA 2JEXA 3DGEA 4LBEC 4BW9A 1GN3A 3ABTA 4PDMA 5BMVB 1I7FA 3CMAV 1GM7A 2IJHA 4O4LB 1OV9A 1IXMA 3J80N 3N2GA 2QDOA 3STLC 1YDXA 2N04A 1WPXA 5CA1A 1OCZB 3GVMA 3RVYA 1B06A 4O4JB 3EXAA 4IIJA 2ZKOA 3H1LH 1IBLO 3AG3B 5EZYB 4LF5O 3C90A 3NXSA 1Z5VA 3B77A 2F95B 1NTKH 2IM9A 2XASA 2UXBB 4IHJB 1B3QA 2DYRC 1HDJA 1N0NA 2N74A 3T1YB 4JI1O 1YEWA 2NLJC 3ZMTA 1K73W 1NR7A 1OHHG 4NXMO 1MSDA 2XAQA 2CGNA 1N36B 1LNQA 3QO7A 3JD2A 3ASOB 3CE2A 4BIOA 3HKCB 4EB6A 1XNQB 2NR5A 4UVCA 2KG7A 3ZCCA 2WLHA 5EK0A 3P30A 5IJ0B 2FB5A 4J42A 3BY6A 3RYCB 4U7NA 3CCRV 3CD6V 3I55V 3DXRA 4GCZA 1TGOA 1ZSPA 2PGGA 3JAWB 1PNKA 3L9DA 3K79A 1AVMA 3ABLB 3DXRB 1E79G 5FNVB 4PA4A 2QWOB 2P22C 1GN2A 3JALB 2CK3G 4R6ZA 1EFRG 4JYBA 1F23A 4X62B 3GWKC 3UQ8A 5IYCO 3OT7A 1I94B 1H2GA 2PY5A 2A0LA 1Y6XA 3Q4HB 3U10A 1SQGA 4PELA 3OEEG 2BSKB 4FPPA 4JV5B 4UCOA 4DK1A 4LF9B 1IZ3A 1NH2B 1R3KC 1GN6A 2GDSA 1WA8A 3ASNC 3CCMV 5IY5C 1NJIW 1OJHA 1BHAA 2BTOA 4LFBO 5DN6G 2CDYA 1EN4A 3A8TA 2UU9O 2GBOA 2ARHA 4AILC 2YXYA 2P67A 1SZXA 4X20A 4FLVA 3LSUA 3OMAB 3BPZA 3HKDA 2ITDC 1H2LA 3THOA 2M6YA 3TXSA 1XL6A 2FL4A 3UKMA 1Q90D 5LMNB 2ZXWC 4DR6B 1IBMB 3ABKB 2UXXA 1VQ5V 3ZBHA 3JATA 1FXHA 3JCZA 4DRXA 3RYHA 1SC5B 2K9PA 2ZT9B 3IC9A 3ABUA 4FLUA 3N2KA 2ZQMA 2JDIG 1JCHA 4JYCA 4GX1A 3JSLA 4CS2A 2VQFB 4PI0A 4ZIBA 3E2EA 1R6TA 5L3FA 1YCIA 1PL0A 3T1HO 3BA9A 1GO3F 2BTQA 2P6JA 2CH7A 1N4CA 4KL1A 2OIGA 2LFSA 1WB7A 2EBOA 1RSOB 4DW1A 3JD4A 1QR9A 3ZN0A 4YY3O 1I5YA 2Z5UA 5JVDA 3VQWA 4CC5A 3G71V 2EJ7A 5L3DA 3FAVB 3D36C 2ZCEA 1VF5B 2AHZA 1O9HA 1VQOV 3AK3A 3JAWA 4GX2A 3BCCH 2IW5A 1SZTA 1GH6A 4KUMA 5KX5B 1QLEB 2GTAA 2YXHA 3CMEV 3QF7A 4AHCA 2ZE8A 2EJRA 1K4CC 4X66O 4CZZA 1DGSA 4WFBV 3LSSA 3B8MA 4LF8O 5J2TB 4DR4O 3JD3A 3BFRA 3JD1A 4OGQB 1FXKC 4DV0O 4PDLA 4PJ0Z 5KAFZ 2NNUA 3APQA 1BS3A 2YS8A 5FL7G 2YEVA 2DQ0A 4TT3G 3WU2Z 3Q4HA 1SKVA 1Y76A 4UVAA 4Z1MG 1VQPV 4H13B 4UCVA 1D5NA 1IURA 2F93B 5CN0A 1WPBA 1WAZA 4UFZA 1A32A 4GZRB 1V54C 4R8CA 2B5UA 5FNVA 4FMTA 1SQPH 3SPGA 2YICA 2QTSA 4YY3B 4NVPA 3STZC 1I94O 5A2QN 4U7OA 4NKGB 2VS0A 4NXMB 5B66Z 4GX0A 3VQVA 2EZOA 5KHKA 3CRQA 2KSDA 4X20B 2WWWA 1VQ8V 1M1KW 1K5QA 3HKBB 1AP6A 3FB6C 2WLKA 4ZHQB 1LUWA 1THZA 3JARB 4JI0B 2Q68A 3FFQA 3HPLC 4HYOA 1KYOF 4G2KA 4UV9A 1YJ9V 1JA8A 4YJ2B 4LF5B 3JARA 2XUMA 3ZMSA 3HB3B 5ITZB 1QLEC 4CC6A 2W0FC 2NN4A 3T1YO 1YJNV 4K35A 1KUQA 3SR2C 4MT8A 2JGDB 1VQLV 3ZHRA 4DO2A 5KHJA 3OGIB 4FFBB 4UB6Z 4DK0A 2YIDA 2HG5C 1R3JC 3DSQA 1YTFD 2XT9A 2FMLA 2LO1A 3BVOA 3RVZA 3CP1A 3J7AU 4NR1A 4G28B 2AZ2A 4O4HA 2HJDA 4WBNA 4IYIA 3SYCA 4BWAA 2W6JG 4ASUG 1N0JA 3QVNA 1M56C 1OCZC 3W7SA 1G4YB 4CS4A 5LA6A 2O57A 2JRIA 3ZRXA 4DXWA 3WFVA 2Y69C 5GW7A 4X1IA 1AILA 1G6UA 4GUNA 1AR5A 4JI3B 2LGQA 2WLIB 4OX9O 5CMUA 2PYLA 3DTUB 4FK5C 4TV8B 3OW2U 4XDLA 4PHZA 1VQKV 3K5NA 4UB8Z 1SQBH 1F7YA 4JTAB 3M99B 1AI5A 3U11A 4TOIA 3RBZA 3SPJA 4K0KO 5DEDA 2DQ3A 4X65B 3DC5A 4JI1B 1JOYA 1WNSA 4MVSA 3ICXA 3TCUA 2UXDO 1KKDA 4N21A 3AK1A 1VQ9V 3W7UA 2EINB 4FM1A 5C8YA 4KHPB 3WB0A 2VWJA 4FZ1A 4JI6B 3ETEA 3ETQA 3MD0A 5KA6A 4NTYA 1Y4MA 1HP8A 1RP3B 4IT5A 4RO2A 4BIZA 4ZKIA 4GKKO 3NR7A 2UUAB 2W6IG 2FKXA 3CSXA 1V9PA 2QM7A 1GAXA 1GK9A 5LGNA 4B08A 2HEPA 5JJJB 2HJFC 3E22A 2WA3A 2CTPA 4E2LA 1K92A 1S0VA 4I7ZB 2JVDA 2OYQA 5IYZB 4X1IB 3IC7A 3CCQV 4LH7A 4HZ3A 5KX5A 4HNAB 3JATB 2BE3A 1IXBA 4GKJO 5GONB 1M57C 2EILC 4B3RO 5LYJB 1XMQB 2X6CA 3LDEA 3UCSC 4GYCB 2ZD9A 4H37A 1PNLA 4X66B 4LF9O 5GTIZ 3L71H 4ZI7A 1Z2GA 2EIJC 5L3BA 4JGSA 1Q86W 2HVJC 2WSSG 3ZIAG 2EIKC 2M7WA 4L8JA 2KG7B 4GT1A 3CEIA 1V55B 2P06A 1JFFB 3LSQA 3FB5C 1VEWA 4LFCO 3ZN1A 1HNZB 1J95A 5LHHA 1OCRC 1HNXO 1ZUQA 1Q82W 3SPHA 1X4TA 2UUBO 4NXNO 2E5LO 3M7MX 4DR1O 5H2FZ 4J10A 1FPOA 2HLDG 4IHJA 1TA8A 4TSFG 4DV2B 4LF6O 2N05A 3LNNA 1N34B 2UUCO 5LGTA 2LJ2A 2RQ6A 2V4DA 5LGUA 3G6EV 4TWKA 2PUSA 4IL6Z 3S3WA 3ASOC 2EILB 2Q67A 1DLBA 3ABKC 2A06H 2VQEO 1NH2D 4DYLA 1HNZO 3VOUA 4DV6B 3OUFA 4X88A 3D3QA 4JYYA 1BZKA 3N2GB 3OGCC 4DR2B 1AR4A 3CCVV 5K1XA 2QKCA 2QA4V 1NKDA 2JK5C 4F6RB 3L75H 2WA4A 2EULA 1K5SA 4B3SO 5LMUO 5LP6B 1XILA 1TVKB 2JS3A 5IYZA 1JJOA 3L74H 1EZJA 4X89A 3QO5A 4JTDB 3JAKA 3ZHTA 5L3EA 4WF9V 1VF6A 4D7SA 3G67A 1NS1A 4MVZA 3IJ4A 1NVPB 4WBNB 1QVGU 1VP7A 5E79Z 3RGBA 2AGAA 3ZHUA 4DR5B 1KU9A 4MVOA 1P84F 3SPIA 3OUSA 1ZL8A 2K1EA 2P7TC 1VF7A 5J2UA 1QBZA 2ZIMA 3ETGA 4DR3B 1MMMA 3OMNB 4J80A 3FD9A 2WLMA 4P9PA 4N23A 1NBMG 2UXBO 2YDEA 1D2DA 2PI5A 2DW4A 3IAYA 3CJHB 2D2CB 5IE9A 2ODMA 1NVPD 4QE7A 1BMFG 3K5LA 4AQYO 3OR7C 1COWG 4UCTA 1QQCA 4HAMA 4JI3O 3B40A 1WJZA 3K9SA 5KUMA 2BOCC 2CAZC 1T5EA 2OCCB 2F23A 5EYPB 3BHPA 2Q7HA 1FYJA 1I0HA 2XAJA 3BAAA 4UCRA 2IH1C 4B7EA 3CC4V 1R73A 4Z1VA 1J5EO 1HW7A 1H2SB 4PA9A 2HKOA 3UO2A 2EIKB 1FAFA 1Q6IA 2CTRA 3SJBC 3RWRD 4WFFA 5LA6B 4NB5A 3T1HB 2LQTA 5JH7A 3CRCA 4JI0O 1KBHA 4JTCB 2X6AA 4EFBA 3A0BZ 5JH7B 1BHBA 5IJ9A 2Q5ZA 1KECA 2LW7A 1Y76B 4O2AA 5B1OA 4TV9A 3OE7G 4DV6O 2IBZH 1XDCA 4JYAO 2JGDA 3K58A 1K33A 4P2ZA 3K59A 4EKWA 1RFYA 2OWOA 5EYPA 4BAYA 1WP8A 4YJ3B 1AB3A 2P90A 5IJ0A 4QJFB 1IBLB 4X1KB 3RYFA 5KMGB 2UXCB 1NTZH 4ZOLB 1M5IA 2MK3A 4MVRA 3T4DA 3OAAG 5KHHA 4GX5A 4I9WA 2PF4E 2WLIA 2UUBB 5B1BB 1ENVA 4RUEA 1R6KA 2ZE7A 1W0KG 3AG4C 4FFBA 2Q0OC 5EZYA 3AG2C 1L1FA 1YZBA 3CRMA 3P32A 3A0HZ 2JIZG 1PKXA 1F4NA 3AG2B 2UXCO 4OX9B 1SESA 2IH3C 2KQXA 3SJQC 4J11A 5BR8B 1YIJV 4DV5B 4PDRA 1WB8A 2D3OW 5EBLC 4JI5B 3CHXA 3F5TA 3E8GA 5CA1B 3ZX6A 3JASA 3P3PA 4TV8A 2YUAA 5DECA 1XMQO 1HNXB 5BMVA 3JASB 4WFHA 1Q7YW 1RM1C 2ATKC 1HNWO 1NU1H 4NTXA 5GTHZ 1E1QG 1BQ0A 1IDSA 1Q3EA 2WLLA 4LF7B 4X9QA 4PD4F 2CE4A 5EBWC 4CH3A 1QCEA 2F1MA 3OR6C 5JCOA 5A9GA 4Q20A 1S5JA 3LNMB 3MDSA 4DUZO 3E8FA 4J7KA 3ZRWA 2B1IA 1VQ6V 2E76B 2Q73A 3B8NA 3WB2A 5JVDB 1ZL8B 1MZEA 1RPOA 3TETA 4DV4B 2JJ1G 1HR0B 4KFMA 2UXDB 5H9CA 1IBKO 3CCLV 1XMOB 4K8XA 1QU7A 1KKCA 4IYHA 4MTOA 5KLVH 2BCCH 2QEXV 2B1GA 1K34A 2OTJV 1HNWB 3JCUZ 4I5SA 1AI6A 3OMIB 4I50A 2ZE6A 1MABG 3SDLA 2PYJA 4DV5O 1WN7A 4X8AA 1W0JG 4RQFA 2LP7A 4DRXB 1US6A 5EC1C 2RMKB 3RYIB 4WCEV 1MNGA 3MHSC 3R66A 1ZWIC 3F7YC 2LFRA 5J2TA 3K9AA 2Q0AA 3FAVA 3B2EE 4Q6GA 2H8PC 4X64O 4NXNB 3ML0A 5BZBA 1Q6UA 2RNBA 1U97A 4TV9B 5CB4A 3B09A 4FM0A 3RN4A 1VQNV 2BOBC 2X6BA 2AXTZ 5BXZA 4MTFA 1GN4A 3HKCA 4EB6B 3R65A 2G38A 1ZLZA 4LFAO 3IFXA 4J9YB 1RSOA 3A0RA 4RWUA 5LXTA 1V54B 1EN6A 2GSMB 3JAMN 2FYUH 1H2MA 5LHGA 1JQ0A 4X1YA 2ADQB 4U3JB 1VIBA 3KCYA 3FYIB 1BT8A 4J7ZA 1VQ4V 4U3FH 3ZRSA 4YJ3A 1RPRA 2AZ0A 3SJAC 4UXNA 4QGPA 1PP9H 4MW8A 4DV0B 2WPDG 3AG1B 1KC8W 2HP8A 1PM9A 3BABA 3DC6A 3CXHF 2LGWA 3K0DA 3CWBH 4QNHB 1NZ6A 4O2BA 4O4IA 2P5OA 1AI4A 4AQYB 2DOSA 5FLXN 1IX9A 2E74B 4JF3A 2OIEA 4YIPA 4DV3O 1PPJH 1V55C 3D3IA 1GRJA 1M56B 5IYDO 2Q7GA 1MSWD 3ZHVA 2ZDIC 4WFAV 2YIAA 1LUVA 2DE0X 4LWSA 4F4LA 3HKEA 4DR7B 5HFMA 4F6RA 1SS3A 3A2FA 2EIMB 3LUTB 1SA0B 4DUYB 4MSWC 2EX3A 2ILMA 1HWYA 1UFIA 1AJNA 2QM8A 4ZOLA 1SQVH 4JYAB 4P30A 2JS5A 3FX7A 2RN9A 4YXWG 2A9HA 1BSMA 4LR3A 4ZHQA 4UV8A 2IJIA 2DWDC 1VMGA 3UT5B 2PTMA 1B6QA 4PDVA 2R70A 2QKAA 3QG5A 3G6BA 4O4JA 4XDKA 2QE7G 2P4VA 2Q69A 1M90W 4ABMA 4JI5O 3CYOA 3JYCA 4JI7B 5IJ9B 1H38A 3H1KH 2XAHA 1X59A 1VQ7V 4BR6A 5LOVA 1FFXB 4LC1A 1YITV 3H01A 4I4TB 2BTQB 4MVUA 3CB2A 3CX5F 4I50B 4YHHO 1TAEA 4R50A 2QKSA 3LDCA 4OPAA 2CTQA 4GLXA 1GTOA 3OTFA 1S77D 1KMIZ 2X7RB 4X65O 2YI9A 3OFNG 1OCCB 2QR4A 3T2MA 2QWQB 2ZR3A 1OCOC 2Z3YA 4NTWA 4J41A 4JI4B 1M93A 4BW5A 2DYSC 3KG2A 3E8BA 4MTGA 3PJSK 2DMXA 4OXSA 1R3IC 1AJQA 1EM1A 5JJEB 1XMOO 4QPJA 5K1PA 1R3LC 5JWPA 5B1BC 2WLNA 2WLJA 4LCUC 1GM9A 3RYCA 3K06A 2ZDIA 4K3AA 4NYKA 1FXKA 1CP9A 2E3CA 1KQSU 2WLLB 3KKYA 1QLNA 4DV1O 4J9ZB 4YJ2A 4X62O 5B3SC 2WAMA 1YTFB 1FD9A 1XBLA 2CH7B 3F7VC 2VRZA 1G1XB 4H33A 1QVFU 2F4VO 2DYSB 2KB1A 2Y69B 1S76D 1L8DA 3K5MA 2A7WA 2XOKG 1PV0A 1MG1A 1FJGO 2UUCB 4QE9A 2PZSA 2ZNIA 5EIBD 2MW2B 1U96A 4UCUA 2IJKA 3CCUV 5JQGA 1TUBB 1AROP 1BL8A 3SGIA 1P7BA 1Q43A 1MOFA 4ZI7B 4O2BB 4O4IB 3SYOA 3APOA 2KKWA 1YF2A 3PN1A 2HFEC 2RJZA 2ADPA 3FB7C 4DV3B 4DR1B 3ABLC 4B3SB 4LH6A 2B9ZA 2Q8VA 1SQFA 3AG1C 3L72H 4P9OA 2ZXWB 1QNMA 2R9RB 3CCSV 4UCSA 3H1HH 4H0LB 4B3RB 2F43G 3I5DA 2DWEC 3ZHQA 1URFA 2ZM6O 5B1AC 3KCXA 2CTWA 4BIUA 1CEZA 3ABMB 4YHHB 3K5OA 4JAAA 4MW3A 1N33B 1S3JA 1DTOA 1EZVH 1Q81W 3CXCU 3S3XA 3WG7B 5LXTB 1OCRB 1K9MW 2HR3A 3VQXA 1H8HG 2IU0A 1SA0A 5D5PA 4LP8A 4XDJA 4CH6A 4JZGA 4JV5O 4O4HB 1NQTA 1VF6C 5D5QA 3O9OA 4PA6A 4CH4A 5LMNO 3BRCA 1MA1A 1KB9F 5BY1A 1L0LH 3B4SA 3VBBA 3N27A 4D6TH 4LFCB 1XL4A 2CGOA 1XI1A 3J81N 3IGAC 1R6NA 3GWOA 4KXRA 5C8YB 2R72A 4TQFA 1B04A 5JJNB 1EBOA 5EC2C 3WG7C 3K03A 3K57A 1E1RG 3MAQA 5LP6C 1W2BU 1YVWA 2XAGA 3ZS8C 4X64B 3ABMC 2IU3A 3TK1A 5KHIA 1JMKC 2VQEB 2RDCA 3K0GA 3HKBA 1F51A 3ZJZA 2IJJA 4JI8O 1Y74B 5CA3A 2QGNA 2YSUB 4X1YB 4QIWF 3CJHA 1N34O 1FS0G 1KD1W 1UPGA 1VARA 4JASA 4D7TA 4W4LA 1IBMO 4DR2O 2LW1A 1SQQH 2Y4TA 1RM1B 3E89A 2E5LB 1Q6HA 2GUZA 5B1AB 5J2UB 4W4KA 2UXNA 1YXBA 4O2AB 4I0XA 4WFEA 4RQEA 1WP7A 4AI8A 5CA0B 2UU9B 1NT2B 4HBNA 1CPYA 3BA8A 4UUJC 4B3TB 2EZPA 3ETDA 3RFRA 1ZAUA 5B5EZ 3FKSG 4DV4O 2PI4A 4DV7B 4FLZA 4TQDA 1J5EB 1PL4A 2DN9A 1QHTA 4JI2O 1Y74A 3GB7C 2XAFA 3HKEB 4LFAB 1ZX3A 5IWAB 1XNRO 5F2VO 3UM7A 4FM2A 1S72V 1CXZB 3W7XA 1FFXA 5LOVB 3RYHB 2DJVA 3T1CA 1W59A 5H6QA 1YHQV 4K0KB 1AR1B 1XUQA 2GHYA 3AEIA 4EEQA 3QTCA 5B3SB 3CPWU 1SF9A 4EFEA 3CS5A 1N32B 3QNEA 4I55B 2VWKA 1SETA 1R1BA 3W7TA 4RAIA 3ZMZA 5C93A 2OT5A 2Y0PA 4FLYA 1IVSA 4IGGA 2JGUA 2EIMC 2OTLV 3UT5A 4DR7O 4O4LA 2ITCC 3W7WA 1LR1A 4FLWA 4JAUA 5AG2A 1N32O 4R7CA 1N36O 2W0XA 1K4DC 1TUEB 2GTSA 1TVKA 3I56V 2QWRB 2Z0AA 1NR1A 4WFGA 2Q7EA 3FB8C 5LMUB 2Y0IA 2Y4UA 4H44B 4TUYB 4I4TA 5B1NA 1F4MA 4LNUB 4JI4O 1K97A 1OCOB 4LF4B 3X2QB 5HFLA 4FVMA 1OCCC 1Q8IA 1O9GA 3K3WA 3RW0A 1GM8A 1GMGA 2AHYA 4YIOA 3E83A 1SRYA 4I9QA 1YSCA 3U0ZA 3FYEB 4F6EA 1JJ2U 2L35A 4K8ZA 2GV9A 4OPHA 1GKFA 3F5WC 1XNQO 4JI6O 2C2AA 5JCOC 4B7KA 4IIJB 4J7JA 4B3MO 2ZE5A 4A5UB 3ZHSA 2E75B 2ZM6B 3EFFK 1WA8B 3OM3B 5LL6Y 4KHPO 3RT3C 1JFFA 2XTAA 3D8CA 1BQZA 1Q5OA 2YC0A 2V1DA 4JAVA 2OCHA 2HHHB 1XOUA 3TJTA 5L3CA 5IWAO 1XNRB 3BEHA 3ZMVA 2FTKA 2V7QG 3ASNB 1JR9A 3OTOB 2ZIOA 1XREA 2R9IA 1Y67A 3LDDA 4LWSB 2Y48A 4QPKA 1HR0O 1FXKB 4I55A 3E8HA 2HVKC 3M8AA 3P3NA 1P49A 3MHHC 3AK2A 5LYJA 5CB4B 4MTXA 4DV1B 2R9AA 4L87A 5FPOA 1L0NH 2GUZB 5CA0A 5IT9N 3SYAA 1S5LZ 5EIBC 4PA3A 1N33O 3HKDB 3C3TA 4XBFA 2Q4PA 1K7DA 1PNMA 4KP4A 4LF7O 5DM6V 3SYQA 1I08A 1SQXH 1ZTEA 3ZEDA 4B3MB 4HNAA 3OTOO 4CH5A 2RCVA 1FKAO 3G80A 3T4ZA 3C3SA 1IBKB 5L3GA 4MS2A 2QTOA 3ZRVA 2BSKA 2H3OA 5EBMC 1ROPA 5LP6A 4GKKB 4FFKA 2UUAO 3E22B 3JD0A 3SYPA 1BE3H 5H6RA 4DUZB 4E4EA 2A79B 3N2KB 3QO8A 3SPCA 1FFTB 4LF6B 4UVBA 1SERA 1KP3A 4PA7A 2F66C 1NTMH 3O65A 4LFBB 1FJGB 1PD3A 2OCCC 2CUGA 1XEQA 3OEHG 5JQGB 2ZR2A 1DK1A 3VQYA 3AG7A 4I0XB 3D36A 2QJ1A 5H5NA 1DF5A 1G8MA 3OD4A 3E86A 4PV1B 2YI8A 1ORQC 5GONA 2EIJB 3E35A 2ETNA 4FLXA 4JPRA 5LHIA 1JPXA 3L70H 4CS3A 5BR8O 3CC2V 2QWPB 1NI8A 4ICGA 1K3EA 1YI2V 1AJPA 1H8EG 1D5AA 3KZIZ 2X0LA 4LNUA 4TUYA 1DF4A 4C7UA 4FZ0A 2ZNJA 5KA5A 5TISZ 3ZMUA 1XHZA 3RYIA 2H94A 3H9VA 5CBHA 2QSAA 5IY5B 1VQMV 1UJWB 1YJWV 3CCJV 4CBCA 5LBQA 5KAIZ 4JZ2A 3TGUH 1FXVA 4GKJB 5E1AC
chains in the Genus database with same CATH topology
2WWWA 1VQ8V 2F43G 2DWEC 1M1KW 1K5QA 5J9PC 5B1AC 2JJ2G 3FB6C 2WLKA 4BIUA 1CEZA 3ABMB 3AG2C 1THZA 1L1FA 4MW3A 2Q68A 3HPLC 4HYOA 3P32A 4G2KA 4UV9A 1S3JA 1YJ9V 2JIZG 1DTOA 1PKXA 1Q81W 3CXCU 5IYBO 3WG7B 1OCRB 3ZMSA 1Y66A 1F4NA 3AG2B 1K9MW 2HR3A 1H8HG 3HB3B 2IU0A 5KUKA 1SESA 1QLEC 1I5XA 4LP8A 2IH3C 4XDJA 2W0FC 3SJQC 2XNDG 1YIJV 1NQTA 4PA6A 4PDRA 1YJNV 3CC7V 5EBLC 2D3OW 3E8GA 1M57B 4RUFA 4MT8A 1VQLV 3VBBA 4DO2A 2YEVB 1XL4A 1K8AW 2HG5C 1R3JC 3IGAC 1YTFD 1R6NA 3GWOA 4WFHA 1Q7YW 1RM1C 3RVZA 1KP2A 3CP1A 3K04A 4FIPC 2ATKC 4FJCC 4G28B 4G27B 1E1QG 1EBOA 4MVMA 3SYCA 1JX9A 2W6JG 2WLLA 5EC2C 3WG7C 1QR8A 3K03A 3X2QC 1E1RG 4ASUG 3K08A 1W2BU 2Q6AA 5EBWC 1M56C 1OCZC 1QCEA 1G4YB 2XAGA 3OR6C 1S5HC 3W7SA 4Q20A 3ZRXA 4DXWA 3ABMC 2IU3A 3LNMB 1N8RW 3E8FA 3ZRWA 3WFVA 2B1IA 2Y69C 3TK1A 1AI7A 1VQ6V 5GW7A 3ZRWB 3K0GA 3B8NA 1F51A 2WLIB 1M9NA 5CMUA 1RPOA 3DTUB 4FK5C 3TETA 2JJ1G 3OW2U 2DYRB 3ZJZA 4XDLA 2IJJA 4KFMA 5H9CA 5CA3A 3CCLV 1VQKV 5CBFA 1P4RA 2EINC 2YSUB 4ZBMA 4QIWF 4MTOA 1FS0G 2QEXV 1KD1W 2B1GA 1K34A 1OZ0A 4JASA 2OTJV 4JTAB 3M99B 4I5SA 1AI5A 3AG3C 3RBZA 3SPJA 1WLEA 1AI6A 2DQ3A 3E89A 3EHBB 1RM1B 1JOYA 3OMIB 2JEUA 5CBGA 5B1AB 2UXNA 4MVSA 3TCUA 1KKDA 1JVMA 3CCEV 4N21A 3G4SV 3AG4B 4MVQA 1VQ9V 3W7UA 5IDJA 2EINB 4WFEA 2JEXA 4RQEA 1MABG 3DGEA 4LBEC 4X8AA 3ABTA 1W0JG 4RQFA 2LP7A 4PDMA 3ETEA 3CMAV 1GM7A 2IJHA 3MD0A 1CPYA 5EC1C 5KA6A 1IXMA 4UUJC 4WCEV 3MHSC 2EZPA 3ETDA 1ZWIC 3STLC 1Y4MA 3F7YC 1WPXA 2LFRA 3FKSG 4RO2A 4BIZA 4ZKIA 2PI4A 3K9AA 2W6IG 1OCZB 3RVYA 2QM7A 1GK9A 2H8PC 3ML0A 5LGNA 3AG3B 2HJFC 5BZBA 3GB7C 2XAFA 4E2LA 1K92A 3NXSA 1S0VA 3B77A 3UM7A 2XASA 1S72V 3IC7A 3W7XA 2DYRC 3CCQV 1VQNV 2BOBC 2X6BA 4HZ3A 5H6QA 3T1CA 1YHQV 1AR1B 4MTFA 2GHYA 3AEIA 3R65A 2NLJC 5B3SB 3CPWU 1M57C 3ZMTA 2EILC 1K73W 3IFXA 4J9YB 3A0RA 1NR7A 1OHHG 2X6CA 3QNEA 2XAQA 3LDEA 1SETA 1LNQA 1V54B 2ZD9A 3QO7A 2GSMB 3JD2A 3W7TA 4RAIA 3ZMZA 5C93A 2OT5A 3ASOB 5LHGA 4H37A 1JQ0A 2EIMC 2OTLV 1PNLA 2ITCC 3W7WA 4UVCA 3FYIB 4JAUA 2EIJC 5L3BA 4JGSA 3ZCCA 2WLHA 5EK0A 1Q86W 2HVJC 4R7CA 3P30A 1VQ4V 2WSSG 3ZIAG 3ZRSA 2EIKC 2M7WA 3BY6A 1K4DC 1RPRA 4U7NA 1TUEB 4GT1A 4UXNA 3I56V 3CCRV 3CD6V 3I55V 4MW8A 1V55B 4GCZA 1NR1A 4WFGA 2WPDG 3AG1B 5E1AC 3FB8C 3LSQA 1KC8W 3FB5C 1PNKA 3ZN1A 3K79A 3ABLB 3K0DA 1J95A 1E79G 4QNHB 5B1NA 1F4MA 1AI4A 4PA4A 5LHHA 1K97A 2CK3G 1OCOB 4R6ZA 1EFRG 4JYBA 5HFLA 1F23A 1OCRC 3X2QB 1Q82W 1OCCC 3SPHA 4JF3A 3K3WA 5IYCO 3RW0A 1H2GA 1V55C 1GM8A 1GMGA 2A0LA 2AHYA 3D3IA 3E83A 1M56B 1SRYA 1YSCA 2HLDG 5IYDO 4TSFG 4PELA 3FYEB 1JJ2U 1MSWD 3OEEG 2ZDIC 4WFAV 1GKFA 4FPPA 4F4LA 3F5WC 5LGTA 5HFMA 2C2AA 5LGUA 3G6EV 4TWKA 1NH2B 2EIMB 1R3KC 3LUTB 4MSWC 3ASOC 2EILB 2Q67A 1DLBA 1HWYA 3ABKC 3ASNC 1NH2D 1AJNA 2QM8A 3VOUA 3CCMV 5IY5C 1NJIW 4P30A 1BHAA 3OUFA 3EFFK 4X88A 5DN6G 3OM3B 3OGCC 4YXWG 2A9HA 3CCVV 4UV8A 2QA4V 1NKDA 2IJIA 2JK5C 2DWDC 2P67A 1K5SA 4PDVA 1B6QA 3OMAB 2V1DA 2ITDC 4JAVA 4X89A 1EZJA 4XDKA 3QO5A 5L3CA 1XL6A 4JTDB 2QE7G 3UKMA 5L3EA 2Q69A 2ZXWC 4WF9V 3BEHA 1M90W 3CYOA 3ZMVA 2FTKA 2V7QG 3ABKB 3ASNB 3JYCA 1H38A 4MVZA 2UXXA 1VQ5V 1NVPB 1FXHA 3JCZA 2XAHA 1QVGU 2R9IA 1VQ7V 3LDDA 2Y48A 4QPKA 4LC1A 1FXKB 1YITV 3H01A 4MVOA 3SPIA 3ABUA 3E8HA 2HVKC 4MVUA 3OUSA 3MHHC 2ZQMA 2JDIG 2K1EA 1JCHA 2P7TC 4GX1A 2QKSA 4JYCA 4MTXA 4R50A 4L87A 3LDCA 1QBZA 1GTOA 3ETGA 3OMNB 1S77D 3SYAA 2X7RB 2WLMA 3OFNG 3E2EA 4PA3A 5L3FA 1OCCB 1PL0A 3T2MA 4P9PA 4N23A 2ZR3A 1NBMG 1GO3F 1OCOC 4XBFA 2Z3YA 1K7DA 2P6JA 2PI5A 1PNMA 2DW4A 4KP4A 2LFSA 2EBOA 1NVPD 4QE7A 1BMFG 3JD4A 1QR9A 3ZN0A 3OR7C 5DM6V 4BW5A 2DYSC 1COWG 3KG2A 3SYQA 1I5YA 4HAMA 3E8BA 2Z5UA 3G71V 4MTGA 5KUMA 2BOCC 2OCCB 5L3DA 3T4ZA 3PJSK 5L3GA 2AHZA 4OXSA 1R3IC 1AJQA 2XAJA 2QTOA 4MS2A 2IH1C 3ZRVA 1VQOV 3CC4V 1R73A 5EBMC 4QPJA 1ROPA 4PA9A 4GX2A 2HKOA 1R3LC 3JD0A 3SYPA 2IW5A 1SZTA 4KUMA 5B1BC 2WLNA 1QLEB 2WLJA 5H6RA 4LCUC 1GM9A 2EIKB 3CMEV 2A79B 4WFFA 3K06A 2EJRA 3QO8A 2ZDIA 3SPCA 1FFTB 1K4CC 4UVBA 1SERA 1KP3A 1FXKA 4CZZA 1CP9A 4PA7A 4WFBV 3LSSA 3B8MA 1KQSU 3JD3A 2WLLB 1QLNA 3JD1A 4JTCB 2X6AA 4J9ZB 1FXKC 1PD3A 2OCCC 1BHBA 5B3SC 2WAMA 1YTFB 3OEHG 4PDLA 3F7VC 2ZR2A 4H33A 1QVFU 2DYSB 2NNUA 1KECA 2KB1A 2Y69B 1S76D 3D36A 5B1OA 5FL7G 1DF5A 1G8MA 2YEVA 3E86A 3OE7G 2XOKG 1MG1A 1ORQC 2DQ0A 4TT3G 2EIJB 3E35A 4QE9A 1K33A 4P2ZA 4JPRA 4EKWA 4UVAA 5LHIA 4Z1MG 1VQPV 1JPXA 3CC2V 4BAYA 2IJKA 3CCUV 5CN0A 2P90A 1YI2V 1K3EA 1AROP 1BL8A 1AJPA 1H8EG 4QJFB 1P7BA 1V54C 4R8CA 2B5UA 1MOFA 2X0LA 3SYOA 1DF4A 2MK3A 4MVRA 4FMTA 3T4DA 5KA5A 3SPGA 3ZMUA 2H94A 2HFEC 3OAAG 4GX5A 5CBHA 4I9WA 3FB7C 2WLIA 5IY5B 3STZC 5B1BB 1VQMV 1UJWB 1YJWV 3CCJV 4U7OA 4CBCA 3ABLC 1ENVA 5LBQA 4RUEA 3AG1C 1R6KA 4P9OA 2ZXWB 1FXVA 3CCSV 2R9RB 1W0KG 4GX0A 2EZOA 3AG4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCU A;  1KKD A;  1JVM A;  2DWE C;  4MVQ A;  5J9P C;  5B1A C;  4QE7 A;  4R6Z A;  3OR7 C;  4WFE A;  1OCR C;  2WLK A;  3FB6 C;  4BW5 A;  2DYS C;  3AG2 C;  1OCC C;  3KG2 A;  4LBE C;  3SPH A;  3SYQ A;  3E8B A;  4X8A A;  4MW3 A;  2Q68 A;  3RW0 A;  1V55 C;  4PDM A;  3HPL C;  4HYO A;  2A0L A;  2AHY A;  3E83 A;  5EC1 C;  4MTG A;  5KUM A;  2BOC C;  4UUJ C;  3T4Z A;  3PJS K;  1ZWI C;  3STL C;  2AHZ A;  4OXS A;  1R3I C;  3F7Y C;  4MS2 A;  2QTO A;  2IH1 C;  4RO2 A;  5KUK A;  5EBM C;  1QLE C;  4F4L A;  3F5W C;  4LP8 A;  2IH3 C;  4XDJ A;  4PA9 A;  3RVY A;  4GX2 A;  1R3L C;  2W0F C;  3SJQ C;  3SYP A;  5B1B C;  2WLN A;  2WLJ A;  4PA6 A;  4PDR A;  4TWK A;  4LCU C;  5EBL C;  1R3K C;  3LUT B;  3E8G A;  2H8P C;  2A79 B;  4MSW C;  4WFF A;  3ASO C;  2Q67 A;  3K06 A;  3SPC A;  4RUF A;  2HJF C;  1K4C C;  3ABK C;  3ASN C;  3GB7 C;  5BZB A;  3VOU A;  4PA7 A;  5IY5 C;  1XL4 A;  4P30 A;  3OUF A;  3UM7 A;  3EFF K;  2HG5 C;  1R3J C;  3IGA C;  2WLL B;  4X88 A;  4WFH A;  3OGC C;  4JTC B;  2X6A A;  4J9Z B;  3RVZ A;  2A9H A;  2DYR C;  3K04 A;  2ATK C;  2BOB C;  2OCC C;  5B3S C;  4G28 B;  2X6B A;  4G27 B;  4HZ3 A;  2JK5 C;  3T1C A;  2DWD C;  4MTF A;  4PDL A;  3F7V C;  4PDV A;  3R65 A;  4MVM A;  4H33 A;  2NLJ C;  3SYC A;  1M57 C;  2WLL A;  2EIL C;  3IFX A;  4J9Y B;  2KB1 A;  2ITD C;  3K03 A;  5EC2 C;  3WG7 C;  3X2Q C;  2X6C A;  4X89 A;  2YEV A;  4XDK A;  3E86 A;  3K08 A;  3LDE A;  2Q6A A;  5EBW C;  1XL6 A;  4JTD B;  1ORQ C;  3UKM A;  1LNQ A;  1M56 C;  1OCZ C;  3OR6 C;  1G4Y B;  2ZD9 A;  1S5H C;  4QE9 A;  2Q69 A;  2ZXW C;  4P2Z A;  3BEH A;  4RAI A;  4EKW A;  3JYC A;  4DXW A;  3ABM C;  4H37 A;  3LNM B;  4MVZ A;  3E8F A;  2EIM C;  2Y69 C;  2ITC C;  3K0G A;  1BL8 A;  2WLI B;  3LDD A;  1P7B A;  1V54 C;  2EIJ C;  4R8C A;  2WLH A;  3TET A;  5EK0 A;  2HVJ C;  3ZJZ A;  4MVO A;  4R7C A;  3SYO A;  3SPI A;  4XDL A;  3E8H A;  4KFM A;  4MVR A;  2HVK C;  4MVU A;  3ZRS A;  3OUS A;  2EIK C;  3T4D A;  5CBF A;  2EIN C;  3SPG A;  4ZBM A;  1K4D C;  4MTO A;  2HFE C;  4GX5 A;  2K1E A;  4I9W A;  2P7T C;  4GX1 A;  2QKS A;  4R50 A;  3FB7 C;  5CBH A;  2WLI A;  3STZ C;  3LDC A;  4MW8 A;  4CBC A;  4JTA B;  4WFG A;  3ABL C;  3AG3 C;  3SYA A;  3RBZ A;  2WLM A;  5E1A C;  3FB8 C;  4RUE A;  3SPJ A;  3FB5 C;  4PA3 A;  3E89 A;  3AG1 C;  3T2M A;  4P9P A;  3K0D A;  4P9O A;  5CBG A;  1J95 A;  1OCO C;  2R9R B;  4GX0 A;  4MVS A;  4QNH B;  3AG4 C;  4PA4 A; 
#chains in the Genus database with same CATH topology
 3CRR A;  5J9P C;  2JJ2 G;  1BCC H;  2L6L A;  3JAL A;  4JI2 B;  2Q9L A;  1BGY H;  3H1I H;  4DR5 O;  1XHX A;  5IYB O;  1Y66 A;  4DV7 O;  2QWN B;  5KUK A;  3JAK B;  1I5X A;  1TUB A;  1H2K A;  2XND G;  3CC7 V;  3EVK A;  3L73 H;  1M57 B;  3TXQ A;  4RUF A;  4Z2W A;  4B3T O;  1AP5 A;  2YEV B;  1K8A W;  4FLT A;  4DR4 B;  4U3J A;  4LF4 O;  3WB1 A;  1KP2 A;  3K04 A;  4FIP C;  4X1K A;  3RYF B;  5KMG A;  1P7G A;  4FJC C;  2VQF O;  4G27 B;  4DR3 O;  4MVM A;  2YXL A;  1JX9 A;  2AW9 A;  3X2Q C;  1QR8 A;  4PI2 A;  3K08 A;  4JI8 B;  2Q6A A;  4LF8 B;  1S5H C;  3H1J H;  1Z5W A;  3UO3 A;  1M4U A;  1N8R W;  4JI7 O;  2QM4 A;  1AI7 A;  3ZRW B;  2YIB A;  1EN5 A;  1M9N A;  4DV2 O;  1XQ8 A;  4DUY O;  2DYR B;  1MZF A;  5CBF A;  1P4R A;  2EIN C;  4ZBM A;  3JSN A;  3HR0 A;  4DR6 O;  1OZ0 A;  2ZIN A;  3AG3 C;  1WLE A;  5KHG A;  5ITZ A;  2F4V B;  2A3Q A;  3EHB B;  2XHB A;  2JEU A;  1H2N A;  5CBG A;  2HHH O;  5FPR A;  2YIB D;  3SJC C;  4DW0 A;  2P4K A;  3CRA A;  1JVM A;  3CCE V;  3G4S V;  3AG4 B;  4MVQ A;  5IDJ A;  2JEX A;  3DGE A;  4LBE C;  4BW9 A;  1GN3 A;  3ABT A;  4PDM A;  5BMV B;  1I7F A;  3CMA V;  1GM7 A;  2IJH A;  4O4L B;  1OV9 A;  1IXM A;  3J80 N;  3N2G A;  2QDO A;  3STL C;  1YDX A;  2N04 A;  1WPX A;  5CA1 A;  1OCZ B;  3GVM A;  3RVY A;  1B06 A;  4O4J B;  3EXA A;  4IIJ A;  2ZKO A;  3H1L H;  1IBL O;  3AG3 B;  5EZY B;  4LF5 O;  3C90 A;  3NXS A;  1Z5V A;  3B77 A;  2F95 B;  1NTK H;  2IM9 A;  2XAS A;  2UXB B;  4IHJ B;  1B3Q A;  2DYR C;  1HDJ A;  1N0N A;  2N74 A;  3T1Y B;  4JI1 O;  1YEW A;  2NLJ C;  3ZMT A;  1K73 W;  1NR7 A;  1OHH G;  4NXM O;  1MSD A;  2XAQ A;  2CGN A;  1N36 B;  1LNQ A;  3QO7 A;  3JD2 A;  3ASO B;  3CE2 A;  4BIO A;  3HKC B;  4EB6 A;  1XNQ B;  2NR5 A;  4UVC A;  2KG7 A;  3ZCC A;  2WLH A;  5EK0 A;  3P30 A;  5IJ0 B;  2FB5 A;  4J42 A;  3BY6 A;  3RYC B;  4U7N A;  3CCR V;  3CD6 V;  3I55 V;  3DXR A;  4GCZ A;  1TGO A;  1ZSP A;  2PGG A;  3JAW B;  1PNK A;  3L9D A;  3K79 A;  1AVM A;  3ABL B;  3DXR B;  1E79 G;  5FNV B;  4PA4 A;  2QWO B;  2P22 C;  1GN2 A;  3JAL B;  2CK3 G;  4R6Z A;  1EFR G;  4JYB A;  1F23 A;  4X62 B;  3GWK C;  3UQ8 A;  5IYC O;  3OT7 A;  1I94 B;  1H2G A;  2PY5 A;  2A0L A;  1Y6X A;  3Q4H B;  3U10 A;  1SQG A;  4PEL A;  3OEE G;  2BSK B;  4FPP A;  4JV5 B;  4UCO A;  4DK1 A;  4LF9 B;  1IZ3 A;  1NH2 B;  1R3K C;  1GN6 A;  2GDS A;  1WA8 A;  3ASN C;  3CCM V;  5IY5 C;  1NJI W;  1OJH A;  1BHA A;  2BTO A;  4LFB O;  5DN6 G;  2CDY A;  1EN4 A;  3A8T A;  2UU9 O;  2GBO A;  2ARH A;  4AIL C;  2YXY A;  2P67 A;  1SZX A;  4X20 A;  4FLV A;  3LSU A;  3OMA B;  3BPZ A;  3HKD A;  2ITD C;  1H2L A;  3THO A;  2M6Y A;  3TXS A;  1XL6 A;  2FL4 A;  3UKM A;  1Q90 D;  5LMN B;  2ZXW C;  4DR6 B;  1IBM B;  3ABK B;  2UXX A;  1VQ5 V;  3ZBH A;  3JAT A;  1FXH A;  3JCZ A;  4DRX A;  3RYH A;  1SC5 B;  2K9P A;  2ZT9 B;  3IC9 A;  3ABU A;  4FLU A;  3N2K A;  2ZQM A;  2JDI G;  1JCH A;  4JYC A;  4GX1 A;  3JSL A;  4CS2 A;  2VQF B;  4PI0 A;  4ZIB A;  3E2E A;  1R6T A;  5L3F A;  1YCI A;  1PL0 A;  3T1H O;  3BA9 A;  1GO3 F;  2BTQ A;  2P6J A;  2CH7 A;  1N4C A;  4KL1 A;  2OIG A;  2LFS A;  1WB7 A;  2EBO A;  1RSO B;  4DW1 A;  3JD4 A;  1QR9 A;  3ZN0 A;  4YY3 O;  1I5Y A;  2Z5U A;  5JVD A;  3VQW A;  4CC5 A;  3G71 V;  2EJ7 A;  5L3D A;  3FAV B;  3D36 C;  2ZCE A;  1VF5 B;  2AHZ A;  1O9H A;  1VQO V;  3AK3 A;  3JAW A;  4GX2 A;  3BCC H;  2IW5 A;  1SZT A;  1GH6 A;  4KUM A;  5KX5 B;  1QLE B;  2GTA A;  2YXH A;  3CME V;  3QF7 A;  4AHC A;  2ZE8 A;  2EJR A;  1K4C C;  4X66 O;  4CZZ A;  1DGS A;  4WFB V;  3LSS A;  3B8M A;  4LF8 O;  5J2T B;  4DR4 O;  3JD3 A;  3BFR A;  3JD1 A;  4OGQ B;  1FXK C;  4DV0 O;  4PDL A;  4PJ0 Z;  5KAF Z;  2NNU A;  3APQ A;  1BS3 A;  2YS8 A;  5FL7 G;  2YEV A;  2DQ0 A;  4TT3 G;  3WU2 Z;  3Q4H A;  1SKV A;  1Y76 A;  4UVA A;  4Z1M G;  1VQP V;  4H13 B;  4UCV A;  1D5N A;  1IUR A;  2F93 B;  5CN0 A;  1WPB A;  1WAZ A;  4UFZ A;  1A32 A;  4GZR B;  1V54 C;  4R8C A;  2B5U A;  5FNV A;  4FMT A;  1SQP H;  3SPG A;  2YIC A;  2QTS A;  4YY3 B;  4NVP A;  3STZ C;  1I94 O;  5A2Q N;  4U7O A;  4NKG B;  2VS0 A;  4NXM B;  5B66 Z;  4GX0 A;  3VQV A;  2EZO A;  5KHK A;  3CRQ A;  2KSD A;  4X20 B;  2WWW A;  1VQ8 V;  1M1K W;  1K5Q A;  3HKB B;  1AP6 A;  3FB6 C;  2WLK A;  4ZHQ B;  1LUW A;  1THZ A;  3JAR B;  4JI0 B;  2Q68 A;  3FFQ A;  3HPL C;  4HYO A;  1KYO F;  4G2K A;  4UV9 A;  1YJ9 V;  1JA8 A;  4YJ2 B;  4LF5 B;  3JAR A;  2XUM A;  3ZMS A;  3HB3 B;  5ITZ B;  1QLE C;  4CC6 A;  2W0F C;  2NN4 A;  3T1Y O;  1YJN V;  4K35 A;  1KUQ A;  3SR2 C;  4MT8 A;  2JGD B;  1VQL V;  3ZHR A;  4DO2 A;  5KHJ A;  3OGI B;  4FFB B;  4UB6 Z;  4DK0 A;  2YID A;  2HG5 C;  1R3J C;  3DSQ A;  1YTF D;  2XT9 A;  2FML A;  2LO1 A;  3BVO A;  3RVZ A;  3CP1 A;  3J7A U;  4NR1 A;  4G28 B;  2AZ2 A;  4O4H A;  2HJD A;  4WBN A;  4IYI A;  3SYC A;  4BWA A;  2W6J G;  4ASU G;  1N0J A;  3QVN A;  1M56 C;  1OCZ C;  3W7S A;  1G4Y B;  4CS4 A;  5LA6 A;  2O57 A;  2JRI A;  3ZRX A;  4DXW A;  3WFV A;  2Y69 C;  5GW7 A;  4X1I A;  1AIL A;  1G6U A;  4GUN A;  1AR5 A;  4JI3 B;  2LGQ A;  2WLI B;  4OX9 O;  5CMU A;  2PYL A;  3DTU B;  4FK5 C;  4TV8 B;  3OW2 U;  4XDL A;  4PHZ A;  1VQK V;  3K5N A;  4UB8 Z;  1SQB H;  1F7Y A;  4JTA B;  3M99 B;  1AI5 A;  3U11 A;  4TOI A;  3RBZ A;  3SPJ A;  4K0K O;  5DED A;  2DQ3 A;  4X65 B;  3DC5 A;  4JI1 B;  1JOY A;  1WNS A;  4MVS A;  3ICX A;  3TCU A;  2UXD O;  1KKD A;  4N21 A;  3AK1 A;  1VQ9 V;  3W7U A;  2EIN B;  4FM1 A;  5C8Y A;  4KHP B;  3WB0 A;  2VWJ A;  4FZ1 A;  4JI6 B;  3ETE A;  3ETQ A;  3MD0 A;  5KA6 A;  4NTY A;  1Y4M A;  1HP8 A;  1RP3 B;  4IT5 A;  4RO2 A;  4BIZ A;  4ZKI A;  4GKK O;  3NR7 A;  2UUA B;  2W6I G;  2FKX A;  3CSX A;  1V9P A;  2QM7 A;  1GAX A;  1GK9 A;  5LGN A;  4B08 A;  2HEP A;  5JJJ B;  2HJF C;  3E22 A;  2WA3 A;  2CTP A;  4E2L A;  1K92 A;  1S0V A;  4I7Z B;  2JVD A;  2OYQ A;  5IYZ B;  4X1I B;  3IC7 A;  3CCQ V;  4LH7 A;  4HZ3 A;  5KX5 A;  4HNA B;  3JAT B;  2BE3 A;  1IXB A;  4GKJ O;  5GON B;  1M57 C;  2EIL C;  4B3R O;  5LYJ B;  1XMQ B;  2X6C A;  3LDE A;  3UCS C;  4GYC B;  2ZD9 A;  4H37 A;  1PNL A;  4X66 B;  4LF9 O;  5GTI Z;  3L71 H;  4ZI7 A;  1Z2G A;  2EIJ C;  5L3B A;  4JGS A;  1Q86 W;  2HVJ C;  2WSS G;  3ZIA G;  2EIK C;  2M7W A;  4L8J A;  2KG7 B;  4GT1 A;  3CEI A;  1V55 B;  2P06 A;  1JFF B;  3LSQ A;  3FB5 C;  1VEW A;  4LFC O;  3ZN1 A;  1HNZ B;  1J95 A;  5LHH A;  1OCR C;  1HNX O;  1ZUQ A;  1Q82 W;  3SPH A;  1X4T A;  2UUB O;  4NXN O;  2E5L O;  3M7M X;  4DR1 O;  5H2F Z;  4J10 A;  1FPO A;  2HLD G;  4IHJ A;  1TA8 A;  4TSF G;  4DV2 B;  4LF6 O;  2N05 A;  3LNN A;  1N34 B;  2UUC O;  5LGT A;  2LJ2 A;  2RQ6 A;  2V4D A;  5LGU A;  3G6E V;  4TWK A;  2PUS A;  4IL6 Z;  3S3W A;  3ASO C;  2EIL B;  2Q67 A;  1DLB A;  3ABK C;  2A06 H;  2VQE O;  1NH2 D;  4DYL A;  1HNZ O;  3VOU A;  4DV6 B;  3OUF A;  4X88 A;  3D3Q A;  4JYY A;  1BZK A;  3N2G B;  3OGC C;  4DR2 B;  1AR4 A;  3CCV V;  5K1X A;  2QKC A;  2QA4 V;  1NKD A;  2JK5 C;  4F6R B;  3L75 H;  2WA4 A;  2EUL A;  1K5S A;  4B3S O;  5LMU O;  5LP6 B;  1XIL A;  1TVK B;  2JS3 A;  5IYZ A;  1JJO A;  3L74 H;  1EZJ A;  4X89 A;  3QO5 A;  4JTD B;  3JAK A;  3ZHT A;  5L3E A;  4WF9 V;  1VF6 A;  4D7S A;  3G67 A;  1NS1 A;  4MVZ A;  3IJ4 A;  1NVP B;  4WBN B;  1QVG U;  1VP7 A;  5E79 Z;  3RGB A;  2AGA A;  3ZHU A;  4DR5 B;  1KU9 A;  4MVO A;  1P84 F;  3SPI A;  3OUS A;  1ZL8 A;  2K1E A;  2P7T C;  1VF7 A;  5J2U A;  1QBZ A;  2ZIM A;  3ETG A;  4DR3 B;  1MMM A;  3OMN B;  4J80 A;  3FD9 A;  2WLM A;  4P9P A;  4N23 A;  1NBM G;  2UXB O;  2YDE A;  1D2D A;  2PI5 A;  2DW4 A;  3IAY A;  3CJH B;  2D2C B;  5IE9 A;  2ODM A;  1NVP D;  4QE7 A;  1BMF G;  3K5L A;  4AQY O;  3OR7 C;  1COW G;  4UCT A;  1QQC A;  4HAM A;  4JI3 O;  3B40 A;  1WJZ A;  3K9S A;  5KUM A;  2BOC C;  2CAZ C;  1T5E A;  2OCC B;  2F23 A;  5EYP B;  3BHP A;  2Q7H A;  1FYJ A;  1I0H A;  2XAJ A;  3BAA A;  4UCR A;  2IH1 C;  4B7E A;  3CC4 V;  1R73 A;  4Z1V A;  1J5E O;  1HW7 A;  1H2S B;  4PA9 A;  2HKO A;  3UO2 A;  2EIK B;  1FAF A;  1Q6I A;  2CTR A;  3SJB C;  3RWR D;  4WFF A;  5LA6 B;  4NB5 A;  3T1H B;  2LQT A;  5JH7 A;  3CRC A;  4JI0 O;  1KBH A;  4JTC B;  2X6A A;  4EFB A;  3A0B Z;  5JH7 B;  1BHB A;  5IJ9 A;  2Q5Z A;  1KEC A;  2LW7 A;  1Y76 B;  4O2A A;  5B1O A;  4TV9 A;  3OE7 G;  4DV6 O;  2IBZ H;  1XDC A;  4JYA O;  2JGD A;  3K58 A;  1K33 A;  4P2Z A;  3K59 A;  4EKW A;  1RFY A;  2OWO A;  5EYP A;  4BAY A;  1WP8 A;  4YJ3 B;  1AB3 A;  2P90 A;  5IJ0 A;  4QJF B;  1IBL B;  4X1K B;  3RYF A;  5KMG B;  2UXC B;  1NTZ H;  4ZOL B;  1M5I A;  2MK3 A;  4MVR A;  3T4D A;  3OAA G;  5KHH A;  4GX5 A;  4I9W A;  2PF4 E;  2WLI A;  2UUB B;  5B1B B;  1ENV A;  4RUE A;  1R6K A;  2ZE7 A;  1W0K G;  3AG4 C;  4FFB A;  2Q0O C;  5EZY A;  3AG2 C;  1L1F A;  1YZB A;  3CRM A;  3P32 A;  3A0H Z;  2JIZ G;  1PKX A;  1F4N A;  3AG2 B;  2UXC O;  4OX9 B;  1SES A;  2IH3 C;  2KQX A;  3SJQ C;  4J11 A;  5BR8 B;  1YIJ V;  4DV5 B;  4PDR A;  1WB8 A;  2D3O W;  5EBL C;  4JI5 B;  3CHX A;  3F5T A;  3E8G A;  5CA1 B;  3ZX6 A;  3JAS A;  3P3P A;  4TV8 A;  2YUA A;  5DEC A;  1XMQ O;  1HNX B;  5BMV A;  3JAS B;  4WFH A;  1Q7Y W;  1RM1 C;  2ATK C;  1HNW O;  1NU1 H;  4NTX A;  5GTH Z;  1E1Q G;  1BQ0 A;  1IDS A;  1Q3E A;  2WLL A;  4LF7 B;  4X9Q A;  4PD4 F;  2CE4 A;  5EBW C;  4CH3 A;  1QCE A;  2F1M A;  3OR6 C;  5JCO A;  5A9G A;  4Q20 A;  1S5J A;  3LNM B;  3MDS A;  4DUZ O;  3E8F A;  4J7K A;  3ZRW A;  2B1I A;  1VQ6 V;  2E76 B;  2Q73 A;  3B8N A;  3WB2 A;  5JVD B;  1ZL8 B;  1MZE A;  1RPO A;  3TET A;  4DV4 B;  2JJ1 G;  1HR0 B;  4KFM A;  2UXD B;  5H9C A;  1IBK O;  3CCL V;  1XMO B;  4K8X A;  1QU7 A;  1KKC A;  4IYH A;  4MTO A;  5KLV H;  2BCC H;  2QEX V;  2B1G A;  1K34 A;  2OTJ V;  1HNW B;  3JCU Z;  4I5S A;  1AI6 A;  3OMI B;  4I50 A;  2ZE6 A;  1MAB G;  3SDL A;  2PYJ A;  4DV5 O;  1WN7 A;  4X8A A;  1W0J G;  4RQF A;  2LP7 A;  4DRX B;  1US6 A;  5EC1 C;  2RMK B;  3RYI B;  4WCE V;  1MNG A;  3MHS C;  3R66 A;  1ZWI C;  3F7Y C;  2LFR A;  5J2T A;  3K9A A;  2Q0A A;  3FAV A;  3B2E E;  4Q6G A;  2H8P C;  4X64 O;  4NXN B;  3ML0 A;  5BZB A;  1Q6U A;  2RNB A;  1U97 A;  4TV9 B;  5CB4 A;  3B09 A;  4FM0 A;  3RN4 A;  1VQN V;  2BOB C;  2X6B A;  2AXT Z;  5BXZ A;  4MTF A;  1GN4 A;  3HKC A;  4EB6 B;  3R65 A;  2G38 A;  1ZLZ A;  4LFA O;  3IFX A;  4J9Y B;  1RSO A;  3A0R A;  4RWU A;  5LXT A;  1V54 B;  1EN6 A;  2GSM B;  3JAM N;  2FYU H;  1H2M A;  5LHG A;  1JQ0 A;  4X1Y A;  2ADQ B;  4U3J B;  1VIB A;  3KCY A;  3FYI B;  1BT8 A;  4J7Z A;  1VQ4 V;  4U3F H;  3ZRS A;  4YJ3 A;  1RPR A;  2AZ0 A;  3SJA C;  4UXN A;  4QGP A;  1PP9 H;  4MW8 A;  4DV0 B;  2WPD G;  3AG1 B;  1KC8 W;  2HP8 A;  1PM9 A;  3BAB A;  3DC6 A;  3CXH F;  2LGW A;  3K0D A;  3CWB H;  4QNH B;  1NZ6 A;  4O2B A;  4O4I A;  2P5O A;  1AI4 A;  4AQY B;  2DOS A;  5FLX N;  1IX9 A;  2E74 B;  4JF3 A;  2OIE A;  4YIP A;  4DV3 O;  1PPJ H;  1V55 C;  3D3I A;  1GRJ A;  1M56 B;  5IYD O;  2Q7G A;  1MSW D;  3ZHV A;  2ZDI C;  4WFA V;  2YIA A;  1LUV A;  2DE0 X;  4LWS A;  4F4L A;  3HKE A;  4DR7 B;  5HFM A;  4F6R A;  1SS3 A;  3A2F A;  2EIM B;  3LUT B;  1SA0 B;  4DUY B;  4MSW C;  2EX3 A;  2ILM A;  1HWY A;  1UFI A;  1AJN A;  2QM8 A;  4ZOL A;  1SQV H;  4JYA B;  4P30 A;  2JS5 A;  3FX7 A;  2RN9 A;  4YXW G;  2A9H A;  1BSM A;  4LR3 A;  4ZHQ A;  4UV8 A;  2IJI A;  2DWD C;  1VMG A;  3UT5 B;  2PTM A;  1B6Q A;  4PDV A;  2R70 A;  2QKA A;  3QG5 A;  3G6B A;  4O4J A;  4XDK A;  2QE7 G;  2P4V A;  2Q69 A;  1M90 W;  4ABM A;  4JI5 O;  3CYO A;  3JYC A;  4JI7 B;  5IJ9 B;  1H38 A;  3H1K H;  2XAH A;  1X59 A;  1VQ7 V;  4BR6 A;  5LOV A;  1FFX B;  4LC1 A;  1YIT V;  3H01 A;  4I4T B;  2BTQ B;  4MVU A;  3CB2 A;  3CX5 F;  4I50 B;  4YHH O;  1TAE A;  4R50 A;  2QKS A;  3LDC A;  4OPA A;  2CTQ A;  4GLX A;  1GTO A;  3OTF A;  1S77 D;  1KMI Z;  2X7R B;  4X65 O;  2YI9 A;  3OFN G;  1OCC B;  2QR4 A;  3T2M A;  2QWQ B;  2ZR3 A;  1OCO C;  2Z3Y A;  4NTW A;  4J41 A;  4JI4 B;  1M93 A;  4BW5 A;  2DYS C;  3KG2 A;  3E8B A;  4MTG A;  3PJS K;  2DMX A;  4OXS A;  1R3I C;  1AJQ A;  1EM1 A;  5JJE B;  1XMO O;  4QPJ A;  5K1P A;  1R3L C;  5JWP A;  5B1B C;  2WLN A;  2WLJ A;  4LCU C;  1GM9 A;  3RYC A;  3K06 A;  2ZDI A;  4K3A A;  4NYK A;  1FXK A;  1CP9 A;  2E3C A;  1KQS U;  2WLL B;  3KKY A;  1QLN A;  4DV1 O;  4J9Z B;  4YJ2 A;  4X62 O;  5B3S C;  2WAM A;  1YTF B;  1FD9 A;  1XBL A;  2CH7 B;  3F7V C;  2VRZ A;  1G1X B;  4H33 A;  1QVF U;  2F4V O;  2DYS B;  2KB1 A;  2Y69 B;  1S76 D;  1L8D A;  3K5M A;  2A7W A;  2XOK G;  1PV0 A;  1MG1 A;  1FJG O;  2UUC B;  4QE9 A;  2PZS A;  2ZNI A;  5EIB D;  2MW2 B;  1U96 A;  4UCU A;  2IJK A;  3CCU V;  5JQG A;  1TUB B;  1ARO P;  1BL8 A;  3SGI A;  1P7B A;  1Q43 A;  1MOF A;  4ZI7 B;  4O2B B;  4O4I B;  3SYO A;  3APO A;  2KKW A;  1YF2 A;  3PN1 A;  2HFE C;  2RJZ A;  2ADP A;  3FB7 C;  4DV3 B;  4DR1 B;  3ABL C;  4B3S B;  4LH6 A;  2B9Z A;  2Q8V A;  1SQF A;  3AG1 C;  3L72 H;  4P9O A;  2ZXW B;  1QNM A;  2R9R B;  3CCS V;  4UCS A;  3H1H H;  4H0L B;  4B3R B;  2F43 G;  3I5D A;  2DWE C;  3ZHQ A;  1URF A;  2ZM6 O;  5B1A C;  3KCX A;  2CTW A;  4BIU A;  1CEZ A;  3ABM B;  4YHH B;  3K5O A;  4JAA A;  4MW3 A;  1N33 B;  1S3J A;  1DTO A;  1EZV H;  1Q81 W;  3CXC U;  3S3X A;  3WG7 B;  5LXT B;  1OCR B;  1K9M W;  2HR3 A;  3VQX A;  1H8H G;  2IU0 A;  1SA0 A;  5D5P A;  4LP8 A;  4XDJ A;  4CH6 A;  4JZG A;  4JV5 O;  4O4H B;  1NQT A;  1VF6 C;  5D5Q A;  3O9O A;  4PA6 A;  4CH4 A;  5LMN O;  3BRC A;  1MA1 A;  1KB9 F;  5BY1 A;  1L0L H;  3B4S A;  3VBB A;  3N27 A;  4D6T H;  4LFC B;  1XL4 A;  2CGO A;  1XI1 A;  3J81 N;  3IGA C;  1R6N A;  3GWO A;  4KXR A;  5C8Y B;  2R72 A;  4TQF A;  1B04 A;  5JJN B;  1EBO A;  5EC2 C;  3WG7 C;  3K03 A;  3K57 A;  1E1R G;  3MAQ A;  5LP6 C;  1W2B U;  1YVW A;  2XAG A;  3ZS8 C;  4X64 B;  3ABM C;  2IU3 A;  3TK1 A;  5KHI A;  1JMK C;  2VQE B;  2RDC A;  3K0G A;  3HKB A;  1F51 A;  3ZJZ A;  2IJJ A;  4JI8 O;  1Y74 B;  5CA3 A;  2QGN A;  2YSU B;  4X1Y B;  4QIW F;  3CJH A;  1N34 O;  1FS0 G;  1KD1 W;  1UPG A;  1VAR A;  4JAS A;  4D7T A;  4W4L A;  1IBM O;  4DR2 O;  2LW1 A;  1SQQ H;  2Y4T A;  1RM1 B;  3E89 A;  2E5L B;  1Q6H A;  2GUZ A;  5B1A B;  5J2U B;  4W4K A;  2UXN A;  1YXB A;  4O2A B;  4I0X A;  4WFE A;  4RQE A;  1WP7 A;  4AI8 A;  5CA0 B;  2UU9 B;  1NT2 B;  4HBN A;  1CPY A;  3BA8 A;  4UUJ C;  4B3T B;  2EZP A;  3ETD A;  3RFR A;  1ZAU A;  5B5E Z;  3FKS G;  4DV4 O;  2PI4 A;  4DV7 B;  4FLZ A;  4TQD A;  1J5E B;  1PL4 A;  2DN9 A;  1QHT A;  4JI2 O;  1Y74 A;  3GB7 C;  2XAF A;  3HKE B;  4LFA B;  1ZX3 A;  5IWA B;  1XNR O;  5F2V O;  3UM7 A;  4FM2 A;  1S72 V;  1CXZ B;  3W7X A;  1FFX A;  5LOV B;  3RYH B;  2DJV A;  3T1C A;  1W59 A;  5H6Q A;  1YHQ V;  4K0K B;  1AR1 B;  1XUQ A;  2GHY A;  3AEI A;  4EEQ A;  3QTC A;  5B3S B;  3CPW U;  1SF9 A;  4EFE A;  3CS5 A;  1N32 B;  3QNE A;  4I55 B;  2VWK A;  1SET A;  1R1B A;  3W7T A;  4RAI A;  3ZMZ A;  5C93 A;  2OT5 A;  2Y0P A;  4FLY A;  1IVS A;  4IGG A;  2JGU A;  2EIM C;  2OTL V;  3UT5 A;  4DR7 O;  4O4L A;  2ITC C;  3W7W A;  1LR1 A;  4FLW A;  4JAU A;  5AG2 A;  1N32 O;  4R7C A;  1N36 O;  2W0X A;  1K4D C;  1TUE B;  2GTS A;  1TVK A;  3I56 V;  2QWR B;  2Z0A A;  1NR1 A;  4WFG A;  2Q7E A;  3FB8 C;  5LMU B;  2Y0I A;  2Y4U A;  4H44 B;  4TUY B;  4I4T A;  5B1N A;  1F4M A;  4LNU B;  4JI4 O;  1K97 A;  1OCO B;  4LF4 B;  3X2Q B;  5HFL A;  4FVM A;  1OCC C;  1Q8I A;  1O9G A;  3K3W A;  3RW0 A;  1GM8 A;  1GMG A;  2AHY A;  4YIO A;  3E83 A;  1SRY A;  4I9Q A;  1YSC A;  3U0Z A;  3FYE B;  4F6E A;  1JJ2 U;  2L35 A;  4K8Z A;  2GV9 A;  4OPH A;  1GKF A;  3F5W C;  1XNQ O;  4JI6 O;  2C2A A;  5JCO C;  4B7K A;  4IIJ B;  4J7J A;  4B3M O;  2ZE5 A;  4A5U B;  3ZHS A;  2E75 B;  2ZM6 B;  3EFF K;  1WA8 B;  3OM3 B;  5LL6 Y;  4KHP O;  3RT3 C;  1JFF A;  2XTA A;  3D8C A;  1BQZ A;  1Q5O A;  2YC0 A;  2V1D A;  4JAV A;  2OCH A;  2HHH B;  1XOU A;  3TJT A;  5L3C A;  5IWA O;  1XNR B;  3BEH A;  3ZMV A;  2FTK A;  2V7Q G;  3ASN B;  1JR9 A;  3OTO B;  2ZIO A;  1XRE A;  2R9I A;  1Y67 A;  3LDD A;  4LWS B;  2Y48 A;  4QPK A;  1HR0 O;  1FXK B;  4I55 A;  3E8H A;  2HVK C;  3M8A A;  3P3N A;  1P49 A;  3MHH C;  3AK2 A;  5LYJ A;  5CB4 B;  4MTX A;  4DV1 B;  2R9A A;  4L87 A;  5FPO A;  1L0N H;  2GUZ B;  5CA0 A;  5IT9 N;  3SYA A;  1S5L Z;  5EIB C;  4PA3 A;  1N33 O;  3HKD B;  3C3T A;  4XBF A;  2Q4P A;  1K7D A;  1PNM A;  4KP4 A;  4LF7 O;  5DM6 V;  3SYQ A;  1I08 A;  1SQX H;  1ZTE A;  3ZED A;  4B3M B;  4HNA A;  3OTO O;  4CH5 A;  2RCV A;  1FKA O;  3G80 A;  3T4Z A;  3C3S A;  1IBK B;  5L3G A;  4MS2 A;  2QTO A;  3ZRV A;  2BSK A;  2H3O A;  5EBM C;  1ROP A;  5LP6 A;  4GKK B;  4FFK A;  2UUA O;  3E22 B;  3JD0 A;  3SYP A;  1BE3 H;  5H6R A;  4DUZ B;  4E4E A;  2A79 B;  3N2K B;  3QO8 A;  3SPC A;  1FFT B;  4LF6 B;  4UVB A;  1SER A;  1KP3 A;  4PA7 A;  2F66 C;  1NTM H;  3O65 A;  4LFB B;  1FJG B;  1PD3 A;  2OCC C;  2CUG A;  1XEQ A;  3OEH G;  5JQG B;  2ZR2 A;  1DK1 A;  3VQY A;  3AG7 A;  4I0X B;  3D36 A;  2QJ1 A;  5H5N A;  1DF5 A;  1G8M A;  3OD4 A;  3E86 A;  4PV1 B;  2YI8 A;  1ORQ C;  5GON A;  2EIJ B;  3E35 A;  2ETN A;  4FLX A;  4JPR A;  5LHI A;  1JPX A;  3L70 H;  4CS3 A;  5BR8 O;  3CC2 V;  2QWP B;  1NI8 A;  4ICG A;  1K3E A;  1YI2 V;  1AJP A;  1H8E G;  1D5A A;  3KZI Z;  2X0L A;  4LNU A;  4TUY A;  1DF4 A;  4C7U A;  4FZ0 A;  2ZNJ A;  5KA5 A;  5TIS Z;  3ZMU A;  1XHZ A;  3RYI A;  2H94 A;  3H9V A;  5CBH A;  2QSA A;  5IY5 B;  1VQM V;  1UJW B;  1YJW V;  3CCJ V;  4CBC A;  5LBQ A;  5KAI Z;  4JZ2 A;  3TGU H;  1FXV A;  4GKJ B;  5E1A C; 
#chains in the Genus database with same CATH homology
 2WWW A;  1VQ8 V;  2F43 G;  2DWE C;  1M1K W;  1K5Q A;  5J9P C;  5B1A C;  2JJ2 G;  3FB6 C;  2WLK A;  4BIU A;  1CEZ A;  3ABM B;  3AG2 C;  1THZ A;  1L1F A;  4MW3 A;  2Q68 A;  3HPL C;  4HYO A;  3P32 A;  4G2K A;  4UV9 A;  1S3J A;  1YJ9 V;  2JIZ G;  1DTO A;  1PKX A;  1Q81 W;  3CXC U;  5IYB O;  3WG7 B;  1OCR B;  3ZMS A;  1Y66 A;  1F4N A;  3AG2 B;  1K9M W;  2HR3 A;  1H8H G;  3HB3 B;  2IU0 A;  5KUK A;  1SES A;  1QLE C;  1I5X A;  4LP8 A;  2IH3 C;  4XDJ A;  2W0F C;  3SJQ C;  2XND G;  1YIJ V;  1NQT A;  4PA6 A;  4PDR A;  1YJN V;  3CC7 V;  5EBL C;  2D3O W;  3E8G A;  1M57 B;  4RUF A;  4MT8 A;  1VQL V;  3VBB A;  4DO2 A;  2YEV B;  1XL4 A;  1K8A W;  2HG5 C;  1R3J C;  3IGA C;  1YTF D;  1R6N A;  3GWO A;  4WFH A;  1Q7Y W;  1RM1 C;  3RVZ A;  1KP2 A;  3CP1 A;  3K04 A;  4FIP C;  2ATK C;  4FJC C;  4G28 B;  4G27 B;  1E1Q G;  1EBO A;  4MVM A;  3SYC A;  1JX9 A;  2W6J G;  2WLL A;  5EC2 C;  3WG7 C;  1QR8 A;  3K03 A;  3X2Q C;  1E1R G;  4ASU G;  3K08 A;  1W2B U;  2Q6A A;  5EBW C;  1M56 C;  1OCZ C;  1QCE A;  1G4Y B;  2XAG A;  3OR6 C;  1S5H C;  3W7S A;  4Q20 A;  3ZRX A;  4DXW A;  3ABM C;  2IU3 A;  3LNM B;  1N8R W;  3E8F A;  3ZRW A;  3WFV A;  2B1I A;  2Y69 C;  3TK1 A;  1AI7 A;  1VQ6 V;  5GW7 A;  3ZRW B;  3K0G A;  3B8N A;  1F51 A;  2WLI B;  1M9N A;  5CMU A;  1RPO A;  3DTU B;  4FK5 C;  3TET A;  2JJ1 G;  3OW2 U;  2DYR B;  3ZJZ A;  4XDL A;  2IJJ A;  4KFM A;  5H9C A;  5CA3 A;  3CCL V;  1VQK V;  5CBF A;  1P4R A;  2EIN C;  2YSU B;  4ZBM A;  4QIW F;  4MTO A;  1FS0 G;  2QEX V;  1KD1 W;  2B1G A;  1K34 A;  1OZ0 A;  4JAS A;  2OTJ V;  4JTA B;  3M99 B;  4I5S A;  1AI5 A;  3AG3 C;  3RBZ A;  3SPJ A;  1WLE A;  1AI6 A;  2DQ3 A;  3E89 A;  3EHB B;  1RM1 B;  1JOY A;  3OMI B;  2JEU A;  5CBG A;  5B1A B;  2UXN A;  4MVS A;  3TCU A;  1KKD A;  1JVM A;  3CCE V;  4N21 A;  3G4S V;  3AG4 B;  4MVQ A;  1VQ9 V;  3W7U A;  5IDJ A;  2EIN B;  4WFE A;  2JEX A;  4RQE A;  1MAB G;  3DGE A;  4LBE C;  4X8A A;  3ABT A;  1W0J G;  4RQF A;  2LP7 A;  4PDM A;  3ETE A;  3CMA V;  1GM7 A;  2IJH A;  3MD0 A;  1CPY A;  5EC1 C;  5KA6 A;  1IXM A;  4UUJ C;  4WCE V;  3MHS C;  2EZP A;  3ETD A;  1ZWI C;  3STL C;  1Y4M A;  3F7Y C;  1WPX A;  2LFR A;  3FKS G;  4RO2 A;  4BIZ A;  4ZKI A;  2PI4 A;  3K9A A;  2W6I G;  1OCZ B;  3RVY A;  2QM7 A;  1GK9 A;  2H8P C;  3ML0 A;  5LGN A;  3AG3 B;  2HJF C;  5BZB A;  3GB7 C;  2XAF A;  4E2L A;  1K92 A;  3NXS A;  1S0V A;  3B77 A;  3UM7 A;  2XAS A;  1S72 V;  3IC7 A;  3W7X A;  2DYR C;  3CCQ V;  1VQN V;  2BOB C;  2X6B A;  4HZ3 A;  5H6Q A;  3T1C A;  1YHQ V;  1AR1 B;  4MTF A;  2GHY A;  3AEI A;  3R65 A;  2NLJ C;  5B3S B;  3CPW U;  1M57 C;  3ZMT A;  2EIL C;  1K73 W;  3IFX A;  4J9Y B;  3A0R A;  1NR7 A;  1OHH G;  2X6C A;  3QNE A;  2XAQ A;  3LDE A;  1SET A;  1LNQ A;  1V54 B;  2ZD9 A;  3QO7 A;  2GSM B;  3JD2 A;  3W7T A;  4RAI A;  3ZMZ A;  5C93 A;  2OT5 A;  3ASO B;  5LHG A;  4H37 A;  1JQ0 A;  2EIM C;  2OTL V;  1PNL A;  2ITC C;  3W7W A;  4UVC A;  3FYI B;  4JAU A;  2EIJ C;  5L3B A;  4JGS A;  3ZCC A;  2WLH A;  5EK0 A;  1Q86 W;  2HVJ C;  4R7C A;  3P30 A;  1VQ4 V;  2WSS G;  3ZIA G;  3ZRS A;  2EIK C;  2M7W A;  3BY6 A;  1K4D C;  1RPR A;  4U7N A;  1TUE B;  4GT1 A;  4UXN A;  3I56 V;  3CCR V;  3CD6 V;  3I55 V;  4MW8 A;  1V55 B;  4GCZ A;  1NR1 A;  4WFG A;  2WPD G;  3AG1 B;  5E1A C;  3FB8 C;  3LSQ A;  1KC8 W;  3FB5 C;  1PNK A;  3ZN1 A;  3K79 A;  3ABL B;  3K0D A;  1J95 A;  1E79 G;  4QNH B;  5B1N A;  1F4M A;  1AI4 A;  4PA4 A;  5LHH A;  1K97 A;  2CK3 G;  1OCO B;  4R6Z A;  1EFR G;  4JYB A;  5HFL A;  1F23 A;  1OCR C;  3X2Q B;  1Q82 W;  1OCC C;  3SPH A;  4JF3 A;  3K3W A;  5IYC O;  3RW0 A;  1H2G A;  1V55 C;  1GM8 A;  1GMG A;  2A0L A;  2AHY A;  3D3I A;  3E83 A;  1M56 B;  1SRY A;  1YSC A;  2HLD G;  5IYD O;  4TSF G;  4PEL A;  3FYE B;  1JJ2 U;  1MSW D;  3OEE G;  2ZDI C;  4WFA V;  1GKF A;  4FPP A;  4F4L A;  3F5W C;  5LGT A;  5HFM A;  2C2A A;  5LGU A;  3G6E V;  4TWK A;  1NH2 B;  2EIM B;  1R3K C;  3LUT B;  4MSW C;  3ASO C;  2EIL B;  2Q67 A;  1DLB A;  1HWY A;  3ABK C;  3ASN C;  1NH2 D;  1AJN A;  2QM8 A;  3VOU A;  3CCM V;  5IY5 C;  1NJI W;  4P30 A;  1BHA A;  3OUF A;  3EFF K;  4X88 A;  5DN6 G;  3OM3 B;  3OGC C;  4YXW G;  2A9H A;  3CCV V;  4UV8 A;  2QA4 V;  1NKD A;  2IJI A;  2JK5 C;  2DWD C;  2P67 A;  1K5S A;  4PDV A;  1B6Q A;  3OMA B;  2V1D A;  2ITD C;  4JAV A;  4X89 A;  1EZJ A;  4XDK A;  3QO5 A;  5L3C A;  1XL6 A;  4JTD B;  2QE7 G;  3UKM A;  5L3E A;  2Q69 A;  2ZXW C;  4WF9 V;  3BEH A;  1M90 W;  3CYO A;  3ZMV A;  2FTK A;  2V7Q G;  3ABK B;  3ASN B;  3JYC A;  1H38 A;  4MVZ A;  2UXX A;  1VQ5 V;  1NVP B;  1FXH A;  3JCZ A;  2XAH A;  1QVG U;  2R9I A;  1VQ7 V;  3LDD A;  2Y48 A;  4QPK A;  4LC1 A;  1FXK B;  1YIT V;  3H01 A;  4MVO A;  3SPI A;  3ABU A;  3E8H A;  2HVK C;  4MVU A;  3OUS A;  3MHH C;  2ZQM A;  2JDI G;  2K1E A;  1JCH A;  2P7T C;  4GX1 A;  2QKS A;  4JYC A;  4MTX A;  4R50 A;  4L87 A;  3LDC A;  1QBZ A;  1GTO A;  3ETG A;  3OMN B;  1S77 D;  3SYA A;  2X7R B;  2WLM A;  3OFN G;  3E2E A;  4PA3 A;  5L3F A;  1OCC B;  1PL0 A;  3T2M A;  4P9P A;  4N23 A;  2ZR3 A;  1NBM G;  1GO3 F;  1OCO C;  4XBF A;  2Z3Y A;  1K7D A;  2P6J A;  2PI5 A;  1PNM A;  2DW4 A;  4KP4 A;  2LFS A;  2EBO A;  1NVP D;  4QE7 A;  1BMF G;  3JD4 A;  1QR9 A;  3ZN0 A;  3OR7 C;  5DM6 V;  4BW5 A;  2DYS C;  1COW G;  3KG2 A;  3SYQ A;  1I5Y A;  4HAM A;  3E8B A;  2Z5U A;  3G71 V;  4MTG A;  5KUM A;  2BOC C;  2OCC B;  5L3D A;  3T4Z A;  3PJS K;  5L3G A;  2AHZ A;  4OXS A;  1R3I C;  1AJQ A;  2XAJ A;  2QTO A;  4MS2 A;  2IH1 C;  3ZRV A;  1VQO V;  3CC4 V;  1R73 A;  5EBM C;  4QPJ A;  1ROP A;  4PA9 A;  4GX2 A;  2HKO A;  1R3L C;  3JD0 A;  3SYP A;  2IW5 A;  1SZT A;  4KUM A;  5B1B C;  2WLN A;  1QLE B;  2WLJ A;  5H6R A;  4LCU C;  1GM9 A;  2EIK B;  3CME V;  2A79 B;  4WFF A;  3K06 A;  2EJR A;  3QO8 A;  2ZDI A;  3SPC A;  1FFT B;  1K4C C;  4UVB A;  1SER A;  1KP3 A;  1FXK A;  4CZZ A;  1CP9 A;  4PA7 A;  4WFB V;  3LSS A;  3B8M A;  1KQS U;  3JD3 A;  2WLL B;  1QLN A;  3JD1 A;  4JTC B;  2X6A A;  4J9Z B;  1FXK C;  1PD3 A;  2OCC C;  1BHB A;  5B3S C;  2WAM A;  1YTF B;  3OEH G;  4PDL A;  3F7V C;  2ZR2 A;  4H33 A;  1QVF U;  2DYS B;  2NNU A;  1KEC A;  2KB1 A;  2Y69 B;  1S76 D;  3D36 A;  5B1O A;  5FL7 G;  1DF5 A;  1G8M A;  2YEV A;  3E86 A;  3OE7 G;  2XOK G;  1MG1 A;  1ORQ C;  2DQ0 A;  4TT3 G;  2EIJ B;  3E35 A;  4QE9 A;  1K33 A;  4P2Z A;  4JPR A;  4EKW A;  4UVA A;  5LHI A;  4Z1M G;  1VQP V;  1JPX A;  3CC2 V;  4BAY A;  2IJK A;  3CCU V;  5CN0 A;  2P90 A;  1YI2 V;  1K3E A;  1ARO P;  1BL8 A;  1AJP A;  1H8E G;  4QJF B;  1P7B A;  1V54 C;  4R8C A;  2B5U A;  1MOF A;  2X0L A;  3SYO A;  1DF4 A;  2MK3 A;  4MVR A;  4FMT A;  3T4D A;  5KA5 A;  3SPG A;  3ZMU A;  2H94 A;  2HFE C;  3OAA G;  4GX5 A;  5CBH A;  4I9W A;  3FB7 C;  2WLI A;  5IY5 B;  3STZ C;  5B1B B;  1VQM V;  1UJW B;  1YJW V;  3CCJ V;  4U7O A;  4CBC A;  3ABL C;  1ENV A;  5LBQ A;  4RUE A;  3AG1 C;  1R6K A;  4P9O A;  2ZXW B;  1FXV A;  3CCS V;  2R9R B;  1W0K G;  4GX0 A;  2EZO A;  3AG4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...