2HVJC

Crystal structure of kcsa-fab-tba complex in low k+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab heavy chain
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2hvjC00
1OCRC 1KKDA 3AG3C 4MVMA 4F4LA 2Q69A 3K08A 4LP8A 3E8FA 2KB1A 2NLJC 3SYPA 4XDKA 2ZD9A 1R3JC 3T4DA 2A9HA 5J9PC 5KUMA 2WLNA 3UM7A 3EFFK 3RVYA 4PDMA 2IH1C 3K0DA 2WLHA 4PA9A 3F5WC 2QTOA 5E1AC 2W0FC 2EIJC 3LDDA 3GB7C 2A0LA 2X6BA 3FB7C 3AG2C 3R65A 4GX2A 4PDRA 3T4ZA 3OUFA 5CBHA 3STZC 3KG2A 4GX0A 3SYQA 4H37A 2ITDC 3K06A 4MTOA 2BOBC 1LNQA 2DYRC 4P9PA 4GX1A 3ABLC 5B1BC 3JYCA 3K0GA 4OXSA 1J95A 4MVSA 3K04A 4P30A 4JTCB 2HFEC 3SPIA 3SYOA 5CBFA 2Y69C 4P2ZA 3STLC 3LDCA 3LNMB 4WFHA 4ZBMA 2HJFC 1OCOC 5BZBA 5KUKA 4QE7A 5EBLC 4J9YB 3FB6C 4LBEC 3T2MA 1OCZC 4MVZA 3OUSA 4MS2A 4WFEA 4WFFA 4PA4A 5EK0A 5IY5C 1XL4A 3LUTB 4PA7A 4R8CA 4BW5A 1R3IC 1R3LC 1V55C 2HVJC 2OCCC 2JK5C 2WLIB 3ASOC 4RAIA 3WG7C 2A79B 4PDLA 5CBGA 3E8BA 2K1EA 4CBCA 3F7YC 4QNHB 4PDVA 3T1CA 3OGCC 4MVRA 4HYOA 2AHYA 1QLEC 1V54C 4R7CA 3IFXA 3K03A 4JTAB 4P9OA 2AHZA 4RUFA 3SPHA 3FB5C 2EINC 4JTDB 3E86A 3ASNC 4PA3A 2HG5C 4MW8A 4X89A 3SJQC 2Q68A 5EBWC 1M57C 2IH3C 4G27B 4R6ZA 1ZWIC 2BOCC 2R9RB 3F7VC 1BL8A 2X6CA 4J9ZB 4RO2A 4UUJC 4R50A 1ORQC 4MVUA 4TWKA 2DWDC 3ABKC 1G4YB 2EIKC 4MVQA 3LDEA 4X8AA 5EC2C 1M56C 4MSWC 1OCCC 2WLJA 3BEHA 4MVOA 4MTGA 2QKSA 4EKWA 4XDLA 3SPJA 3SYCA 4HZ3A 5B1AC 4MTFA 2WLIA 4H33A 2X6AA 3UKMA 3X2QC 2WLLB 2ATKC 2HVKC 2YEVA 3IGAC 4I9WA 4KFMA 1K4DC 3AG1C 2EIMC 2ITCC 2WLLA 3E83A 2P7TC 4QE9A 2ZXWC 2WLMA 3PJSK 4LCUC 3OR7C 3RBZA 5EBMC 3E8GA 3FB8C 2DWEC 4GX5A 4MW3A 4RUEA 3VOUA 2Q67A 3SYAA 3ZRSA 4DXWA 3TETA 3ZJZA 1K4CC 3E8HA 2WLKA 4XDJA 5B3SC 1JVMA 2EILC 3RVZA 4G28B 3E89A 3AG4C 1P7BA 1XL6A 1S5HC 5EC1C 2H8PC 3SPGA 4WFGA 3HPLC 4X88A 2Q6AA 3ABMC 3RW0A 4PA6A 2DYSC 3OR6C 3SPCA 3TCUA 1R3KC
chains in the Genus database with same CATH superfamily
1YJNV 4JI5B 1XMQB 4U7NA 2KB1A 1IXBA 1FS0G 4X1IB 4X1IA 1P7GA 4N21A 2WLHA 1VQ8V 1VQ9V 3F5WC 5E1AC 5LGUA 2GV9A 3LDDA 3GB7C 1GH6A 3CWBH 3D36A 1M4UA 3T4ZA 3BCCH 4W4LA 3K9SA 2AGAA 4X1YB 1Q3EA 2AZ2A 4GX1A 1RM1B 4X1YA 3JD0A 5B1BC 1SA0B 3ZBHA 1FPOA 3G67A 3K04A 1KU9A 1SA0A 2Q0AA 1R1BA 3G4SV 4GKKB 5JJNB 4AQYO 2GTAA 5LOVB 2LFRA 4LF7O 4KL1A 2A79B 1K73W 2YIDA 3E8BA 4QNHB 1GKFA 1AP6A 1L8DA 4NXMB 1EBOA 3B09A 3ZRWB 1BHAA 3ZRWA 5LHHA 1M57C 1EN6A 3F7VC 3C90A 2Q5ZA 5LMNB 1SS3A 1G4YB 1KQSU 2OIEA 1Q6IA 1QLEB 4JPRA 3SDLA 4I55B 1PL0A 3SR2C 3K5MA 4I55A 3JASB 3IGAC 3JASA 1AILA 1URFA 3RBZA 4GX5A 3ZMVA 2ZDIC 1V9PA 1NR1A 2UUCB 2BE3A 1IZ3A 3TGUH 5LXTB 4DR1B 1SERA 4MT8A 3ZHVA 1Q6UA 2CTWA 4BR6A 4D7SA 3BHPA 5EIBD 4IIJB 3BABA 2YIBA 4IIJA 2GDSA 1MOFA 4IYHA 4GKJB 3K5LA 5C8YB 4JZGA 3OFNG 1NQTA 4NXNB 1GRJA 3DSQA 1HNZO 2IH1C 1BT8A 2N05A 4LFAO 1K97A 3KG2A 3K79A 3M8AA 3GWKC 3P3NA 1G8MA 1IXMA 2Q7HA 1J95A 1QCEA 3NR7A 3SYOA 3STLC 3AG2B 4JI7O 1SRYA 2F4VO 3MAQA 1OCZC 4WFFA 4PI2A 4PA7A 4R8CA 1U97A 2QDOA 3F7YC 5H6QA 2PYJA 3OTOO 3CCSV 1GM8A 4R7CA 1WA8B 1B3QA 5AG2A 4WFBV 2CGOA 2VQFB 1YJ9V 4FM2A 3A0HZ 1KP2A 1PNMA 1JQ0A 2L35A 3CD6V 2BOCC 3KKYA 2UU9B 1HWYA 4JYAB 4JI1O 1IVSA 2P6JA 1XHZA 5B1AC 2ATKC 2F95B 3FD9A 1GO3F 4DV0O 1FYJA 3CCUV 3OR7C 4MW3A 4OGQB 1PKXA 3ZHUA 3UT5B 3QO8A 3X2QB 3UT5A 1QVGU 1WPXA 3MDSA 3E2EA 4JYBA 4JYCA 3G71V 4YHHO 2GUZA 2PYLA 1XDCA 4MTXA 2PI5A 3K08A 4J42A 4DUZO 2IJHA 3JCUZ 2D3OW 5KUMA 2QR4A 2Q0OC 1Z5WA 3H1IH 5DECA 2V1DA 1ROPA 2OWOA 2WSSG 3CEIA 3I55V 3CRQA 5B1BB 3R65A 4GX2A 1SF9A 2P4VA 4JI3O 3T1YB 4GX0A 5HFMA 4OPHA 4JASA 2YS8A 4J11A 3CRMA 4W4KA 2QWOB 2GTSA 4J7ZA 5EK0A 4UCTA 4FK5C 1A32A 3RYHB 4UCUA 4H13B 2Q7EA 3RYHA 1TVKB 4UV9A 1TVKA 4FMTA 3JD2A 1SKVA 4DV1B 5LL6Y 1YVWA 2DE0X 2P22C 4LF4O 1ZWIC 3RVYA 2Z3YA 4BW9A 4MVUA 1PD3A 2UUAO 4JYYA 3WB2A 1M56C 1AROP 1VF6C 2F43G 2Y0IA 4O2AB 2L6LA 3OEEG 5K1PA 5H2FZ 4O2AA 3BY6A 4KFMA 4DV5B 1F23A 3AG7A 5EBMC 2QM7A 3VOUA 1XNQO 5EZYB 1S3JA 5CA3A 4B7EA 2IJJA 2AW9A 5EZYA 3RVZA 5D5QA 3AG4C 2ZE5A 3J80N 2EIMB 2HEPA 4DV7O 2FL4A 5LGTA 5GW7A 4DR7O 4Z1VA 2LQTA 3CRCA 2DMXA 2DYSC 1W0JG 3JD3A 3P30A 4LFBO 4JI8B 4UVBA 1JPXA 4XDKA 2ZD9A 5BMVB 2QKCA 3B4SA 1Y6XA 3JAWB 3JAWA 4PDMA 4NYKA 5LA6B 3QVNA 5JCOC 5LP6B 5LA6A 2ZNIA 5LP6A 2B1GA 1J5EB 3L75H 2FYUH 1Q43A 5BXZA 1Q8IA 4I0XB 4CH6A 5JJJB 4I0XA 3CC7V 4O4HB 1S76D 2A7WA 4Q20A 2Z0AA 5FPRA 1X59A 3CRAA 1EZVH 4FFBB 4O4HA 1DK1A 4K8ZA 1VQ6V 1B04A 4MVZA 4MS2A 1WAZA 4NVPA 3SJAC 1AI4A 2LJ2A 4PDLA 1Z5VA 1N33O 4TT3G 1NVPB 4Q6GA 2XNDG 3FB5C 4PA3A 5A2QN 2F1MA 4B3MO 4R6ZA 1COWG 1DF4A 4UUJC 1O9GA 2GBOA 1HNXO 2QKSA 1BQ0A 4X62B 2WA4A 5IE9A 1LUWA 1FXKC 4JGSA 5J2TB 4LCUC 1HR0B 5J2TA 2QGNA 3ZJZA 1SQVH 2PI4A 4X64O 3R66A 4DR3B 5BR8O 2JS5A 2H8PC 2CTQA 1HP8A 4DV4O 1THZA 1R6TA 3A0RA 4F4LA 2DQ3A 4X65B 3CE2A 3RT3C 3SYPA 2NLJC 1GM7A 4LH7A 4PI0A 5FLXN 5J9PC 2ZE6A 2Z5UA 2UXCB 3L74H 3ABTA 2Y4TA 5FPOA 1NKDA 1FJGB 2H94A 1P4RA 2ADQB 3ABUA 1NI8A 2QTSA 3ZHQA 2DYRC 5LMUB 4U3JB 2XAHA 2WA3A 1PPJH 3UCSC 1OJHA 1AI5A 2BCCH 1MG1A 5KHJA 4LC1A 5J2UA 4K35A 4J9YB 3T2MA 4DUYB 4K0KO 3BAAA 2GHYA 1IBMB 5KMGB 5IYZB 4PJ0Z 2OCCC 4EFEA 5IYZA 1AP5A 4ZKIA 3NXSA 4JAVA 1V54C 2AHZA 4X9QA 1NT2B 5IWAO 1VMGA 3THOA 4ZI7A 1JFFB 3DXRB 1JFFA 3J7AU 3DXRA 4PELA 3ABKC 4YXWG 1L0NH 2CGNA 4XDLA 3PN1A 3RYCB 4GUNA 3RYCA 4GYCB 3AK2A 1XMOO 3ZMTA 3CMAV 3FAVA 2JJ1G 5DN6G 1BE3H 2DYSB 4TQDA 4LH6A 1TAEA 1JX9A 1S5HC 1H2LA 3AG1B 3CPWU 4IGGA 2VQEO 4KUMA 4I4TB 1S5JA 4I4TA 4JI6O 4FFKA 4B3SO 1QLNA 3N2GA 4GLXA 2IU3A 4X1KB 2DOSA 4AQYB 2F23A 3ZCCA 2HKOA 1NR7A 3UM7A 1KKCA 4LFCO 2KQXA 1OCRB 3BRCA 5B5EZ 3CCJV 2A0LA 1AB3A 3A8TA 2R9AA 5KA6A 2BOBC 1ZSPA 1TUEB 3ABLC 2EZPA 1SQFA 4CS2A 2DN9A 2Y69C 4P2ZA 3UO2A 2ILMA 4DK0A 1K9MW 4EB6B 2CE4A 1YSCA 1MA1A 5EBLC 4EB6A 3W7TA 4PA4A 5IYDO 4FM1A 1GN3A 4I7ZB 2LW7A 2PTMA 1PP9H 2R72A 3P32A 1W0KG 4JTDB 1SQXH 5FNVB 1I94O 5FNVA 3ZN0A 2LP7A 1N4CA 5IJ0B 4KXRA 5IJ0A 3WB0A 4FZ0A 1N0NA 4X8AA 1FXKB 3JALB 1F4MA 5LOVA 1FXKA 2XAJA 3JALA 4TUYB 4CH3A 1R73A 2KG7B 4TUYA 4WBNB 2HVKC 1WPBA 3H1JH 2XT9A 2KG7A 4WBNA 2R9IA 1AJNA 3CCRV 3PJSK 4B3TO 5EYPB 3CCMV 5L3DA 4DV2B 1YITV 3TETA 1SZXA 1W2BU 1HNZB 4JI2B 1RPRA 1N36B 1OZ0A 4LFAB 4D7TA 3VQVA 3CXCU 1Q86W 4LF6O 4E4EA 3HPLC 2Q6AA 1DLBA 3OT7A 1XOUA 3D3IA 4PA6A 2ZR3A 3CYOA 4OPAA 2Q69A 4TV8B 1XMQO 3ML0A 4CC6A 4TV8A 3T4DA 4ZIBA 4JI7B 5IYCO 4JI4O 2F4VB 1MABG 1LR1A 5KHHA 5JWPA 3B8MA 3ZX6A 1H38A 5LXTA 4UCVA 4I50B 1WP8A 2AZ0A 2JEXA 3JATB 3SJBC 4OX9B 3K0GA 1AJQA 3CRRA 4BIOA 1VARA 2HLDG 3JATA 3K57A 2UXDB 2HFEC 1W59A 3G6BA 5B66Z 2OCCB 4J41A 3LNMB 5C8YA 5DM6V 4JI1B 3DGEA 4QE7A 1UJWB 3H1HH 4DW0A 3LUTB 1YHQV 1XHXA 5CBGA 2HHHO 4GT1A 4DV0B 3DTUB 5LBQA 3QO7A 4P9OA 4UCSA 4NXMO 4KP4A 1ZX3A 3CS5A 4PHZA 4NTXA 3ASOB 5F2VO 2ARHA 3K3WA 1BL8A 1QVFU 3U10A 1BZKA 4TWKA 2W6IG 3JAKB 3JAMN 3JAKA 2QM4A 1BCCH 4EFBA 2YEVB 2XASA 2YEVA 4DV3O 1HNWO 4DUZB 2EBOA 2ITCC 4F6EA 2WLMA 1WA8A 2YXHA 3SJCC 1K4CC 2WLKA 5L3BA 5IYBO 4LF5O 3W7UA 1U96A 1XQ8A 2ZKOA 4FJCC 2UUCO 3SPGA 4DR1O 3CC2V 2ZE7A 3ABMC 1SZTA 2A06H 3O9OA 3CJHB 3FYIB 1NH2B 4UV8A 3CJHA 4WF9V 3HB3B 4GKJO 2ZT9B 3EFFK 4G2KA 1Z2GA 4PA9A 3W7SA 3L70H 2UUBO 4YY3O 2HJDA 1RP3B 1AI6A 4NR1A 3CCEV 2DQ0A 2ITDC 3HKEB 5IJ9B 3Q4HB 1Y66A 1Y74B 3Q4HA 4ZOLB 2BTOA 4LF4B 1Y74A 4ZOLA 1QQCA 3LDCA 1GK9A 3WFVA 2UUAB 1OCOC 1VF7A 1KP3A 2YSUB 4A5UB 2E5LB 4NKGB 2MK3A 5IY5C 2XAFA 2JK5C 3ETEA 4RAIA 1M93A 2OTJV 3L72H 1ZTEA 1XNQB 3ASNC 4BIUA 3RWRD 5EBWC 2VQFO 1VF5B 2UXBO 4ABMA 1ZAUA 4UB8Z 3ZS8C 1L1FA 1K5SA 3L9DA 2EIKC 3BPZA 4DR2B 1RFYA 4EKWA 1BQZA 4H44B 4HZ3A 3CCVV 4UFZA 4LFBB 2PZSA 1M57B 5KHIA 3IAYA 2OCHA 1VQ4V 1YXBA 3N27A 2DWEC 3WB1A 4B3RO 5L3EA 1Q6HA 3OGIB 3E8HA 2YUAA 2ZR2A 3ZEDA 3P3PA 3E89A 1JOYA 3QNEA 1S0VA 4WFGA 3ZMUA 1AVMA 4J7KA 4ASUG 1I0HA 4TSFG 2ZDIA 1KC8W 5KHKA 2FKXA 1BMFG 1SQBH 2RDCA 3W7XA 1TA8A 3A0BZ 5A9GA 3OEHG 3IJ4A 4CS3A 1NBMG 2YXYA 3GWOA 3C3TA 4DK1A 1AI7A 1VQ5V 2EIJC 3OW2U 2JJ2G 4JAUA 1Y76B 1N33B 3VQYA 1Y76A 1NZ6A 1N32O 1P49A 3FYEB 3JYCA 4Z2WA 4L87A 1NH2D 5BMVA 4DR4O 2Q8VA 1VQ7V 3H1KH 1HNXB 4WFEA 1BHBA 4BW5A 2IJKA 1IBKB 2XOKG 3T1CA 4O4LB 2QM8A 4HYOA 2QWRB 4O4LA 3IFXA 1H2KA 2O57A 5FL7G 1OCZB 2VWKA 2ZM6O 1N8RW 5BR8B 4FFBA 1Y4MA 1X4TA 4LF9O 2F66C 4DV4B 2WLLB 1KBHA 1DF5A 2N74A 2Q7GA 1TUBB 2WLLA 2ZXWC 1TUBA 2QKAA 4BWAA 2Q9LA 1MMMA 2JGUA 5B3SC 1B06A 1DGSA 2EJ7A 4O4IB 1VQMV 5B1AB 4O4IA 3OMAB 4KHPO 3KCYA 1OHHG 1VQLV 3WU2Z 4ICGA 3K59A 3OR6C 1RSOB 3D36C 1NTZH 1GMGA 1RSOA 1YCIA 3K9AA 5KAIZ 1JMKC 4FPPA 3HR0A 1WNSA 2ZNJA 2A9HA 4K0KB 4QPJA 4YJ3B 5L3CA 1K92A 1GN6A 2P67A 5CN0A 3AK3A 4DV6O 1YJWV 2V4DA 4YJ3A 5CB4B 1G6UA 5CB4A 5JVDB 2RMKB 3LSQA 1R6KA 5JVDA 3N2KB 5IWAB 3HKCB 3M99B 3N2KA 4OXSA 3HKCA 5L3FA 4FLVA 4PD4F 3SPIA 1P84F 2LO1A 4ZBMA 3DC5A 3ETDA 5BZBA 3RN4A 3FB6C 1M9NA 3FFQA 2JDIG 2WLIB 4X66O 2XTAA 3WG7C 2WPDG 1XMOB 4MVRA 1QLEC 1GTOA 5ITZB 2P06A 1NU1H 2KKWA 3SPHA 2W0XA 5ITZA 2EIKB 4DO2A 4U3JA 3JCZA 5B1OA 2Q73A 2Q68A 2IH3C 3CCQV 3G80A 1GM9A 2X6CA 4J9ZB 2DWDC 3CXHF 2M6YA 1IBLB 1SQGA 5KMGA 1QHTA 4JI6B 4AILC 4X62O 2P5OA 1SESA 5H6RA 4DR5O 4U3FH 4LWSB 4LWSA 1KYOF 1M56B 3EVKA 3U11A 1SQPH 2E75B 4LFCB 1JVMA 1VF6A 1MSDA 1D5NA 1O9HA 1OV9A 2UXNA 3D8CA 4X88A 2XUMA 5GTIZ 1XNRO 4NTWA 1MSWD 3TCUA 1FXHA 4HBNA 3U0ZA 4JI0O 2BSKB 3AG4B 3S3XA 2BSKA 1R3JC 1HW7A 2ODMA 2QEXV 1BSMA 1XREA 3ZHTA 2EX3A 2IBZH 2RJZA 2UXCO 3IC7A 3RFRA 1VP7A 1KD1W 3AG2C 4PDRA 1E1QG 4FLUA 3LSUA 1H8HG 2RNBA 4O4JB 5L3GA 1I94B 4O4JA 2PGGA 5LMUO 3T1HO 1YIJV 3APQA 4MVSA 2LFSA 1QU7A 4X1KA 5JCOA 2EULA 1T5EA 4LF7B 1XL4A 4TOIA 1QR8A 3OMIB 1VQKV 2QJ1A 4YIPA 3QTCA 3OM3B 1EM1A 2K1EA 2D2CB 2EZOA 4PDVA 4IYIA 5B1NA 4B3TB 1GAXA 4H0LB 5KLVH 1I5YA 2OTLV 4JAAA 2JIZG 5C93A 3B2EE 3ICXA 4IHJB 2CK3G 4RQFA 1FFXB 2HR3A 2G38A 4IHJA 1FFXA 2B9ZA 2JGDB 1Q5OA 3JD4A 4NB5A 4LF6B 1PL4A 1AR1B 5EC2C 2JGDA 2ZXWB 3TXQA 1N34O 4LF8O 1S77D 4DR6O 2JRIA 3SYCA 2V7QG 3X2QC 5B3SB 1PNKA 3TK1A 3MD0A 5BY1A 1IURA 2CDYA 1SC5B 1XEQA 3CSXA 4JI4B 2ZCEA 3MHHC 2FTKA 5H9CA 3LNNA 1JJOA 3ZRXA 4IL6Z 1H2SB 5TISZ 3RW0A 2N04A 4JV5O 3AG3C 3ZRVA 4MVMA 2DW4A 5EYPA 2WLNA 3OD4A 5E79Z 3CC4V 2W0FC 1I7FA 3SGIA 2HHHB 1PM9A 3ETQA 3JD1A 5CBHA 1S72V 1PNLA 4YIOA 1LNQA 4EEQA 4B7KA 1M5IA 3CX5F 1F7YA 1Q7YW 4JI5O 1I5XA 1ZLZA 4AHCA 3AK1A 3WG7B 1FD9A 5LHGA 1M1KW 3ZN1A 1Q81W 4D6TH 2X7RB 4AI8A 1F51A 2ZIMA 2DYRB 2HVJC 3D3QA 3OTOB 4DV3B 1HNWB 3ZHSA 4GCZA 4JTAB 4RUFA 2R70A 4I50A 3JSLA 4MW8A 2OT5A 4B08A 4LF5B 2VRZA 3B40A 2R9RB 4E2LA 4RO2A 4WFAV 2AXTZ 3JARB 4GKKO 3JARA 4C7UA 4ZHQB 1V54B 2QWNB 2ZIOA 1XUQA 2OYQA 4ZHQA 3APOA 1KECA 1EFRG 3SPJA 4K3AA 1XBLA 4JZ2A 3C3SA 4FLYA 2EIMC 2P7TC 4QE9A 3H1LH 1I08A 3ABKB 4UCRA 2JEUA 2Y4UA 4RUEA 4UXNA 4DV2O 4JI2O 2EILC 2UUBB 4RWUA 4YY3B 2ADPA 1N36O 3L73H 5LMNO 1JR9A 1WN7A 4YHHB 2QWPB 2F93B 2OIGA 5LP6C 2EJRA 4LP8A 2Q4PA 3E8FA 1QNMA 1YDXA 2K9PA 2NNUA 1YI2V 2XAQA 4O2BB 2Y48A 2JS3A 1Q90D 4O2BA 3RYIB 3VQXA 1JJ2U 4JI3B 3RYIA 2YI9A 3SYQA 2IM9A 1KUQA 4CS4A 1M90W 4P9PA 2ZINA 3CP1A 1KMIZ 4OX9O 2UXBB 5H5NA 2UXDO 2ZQMA 1VIBA 4WFHA 1IX9A 1NTMH 1H2GA 4NXNO 4LBEC 1B6QA 3UQ8A 2MW2B 1E1RG 3ABLB 1R3IC 1R3LC 4RQEA 4UCOA 2P4KA 1DTOA 3S3WA 2VS0A 3OGCC 2Y69B 2AHYA 3CHXA 2QA4V 4PV1B 1EZJA 1K5QA 3HKEA 3K03A 5IJ9A 4B3RB 5KA5A 2YC0A 1YZBA 5JH7B 4BIZA 1VQOV 4R50A 5JH7A 2RQ6A 4Z1MG 1FKAO 1OCCC 2WLJA 4UVCA 1FFTB 2GUZB 2RN9A 2LGWA 1S5LZ 4I9WA 5KAFZ 1ENVA 4JF3A 2CAZC 1NTKH 5LGNA 4FLWA 2CTRA 2QWQB 1H2NA 4J7JA 2Q67A 3SYAA 3W7WA 3K5NA 3J81N 1Y67A 4JYAO 3AG3B 5LYJB 4DV7B 2UU9O 4TQFA 4DR7B 5LYJA 1N32B 5GONB 1GN2A 3QO5A 2XHBA 1Q82W 5GONA 3GVMA 4DYLA 2YIBD 4NTYA 4DR4B 2YICA 2CUGA 4I5SA 4TV9B 4TV9A 1E79G 2CTPA 2FB5A 2LGQA 3OUFA 1WB8A 5GTHZ 4H37A 1YTFB 5LHIA 3CMEV 3B8NA 4DRXB 2ZM6B 2YXLA 4P30A 4DRXA 4JTCB 2YIAA 3ZMSA 4X20B 3ETGA 4FIPC 2HJFC 3OAAG 5CA0B 4X20A 3IC9A 3DC6A 5CA0A 2QE7G 3OUSA 4LF9B 2E5LO 1IDSA 1V55C 4I9QA 4CBCA 2M7WA 3T1YO 2UXXA 1AR5A 3I5DA 1AJPA 1R6NA 2EINC 1WB7A 3E86A 4B3MB 1VQNV 5IDJA 3OE7G 4G27B 4KHPB 1SQQH 1RPOA 4FM0A 1KB9F 1NS1A 4MVQA 3HKBB 1AR4A 2ETNA 5JQGB 4MTGA 4DR2O 3HKBA 5KHGA 2NR5A 3OMNB 5JQGA 4MTFA 3UKMA 3H9VA 1K4DC 3AG1C 2EILB 3EXAA 3E35A 5EIBC 3E8GA 3FB8C 5K1XA 4IT5A 2ZE8A 4DXWA 1EN4A 4DV1O 4X64B 4XDJA 1JA8A 2B5UA 2IW5A 4DV6B 3B77A 1QR9A 2E3CA 1XL6A 1UFIA 3UO3A 4GZRB 1PV0A 5D5PA 1JCHA 3KZIZ 3SPCA 4K8XA 1OCRC 1KKDA 1MNGA 2W6JG 2BTQB 4LNUB 4DV5O 2BTQA 4LNUA 1N0JA 3O65A 5DEDA 3BVOA 4F6RB 3ABMB 3K0DA 3EHBB 4F6RA 2QTOA 1EN5A 4X66B 1VQPV 3OTFA 3FB7C 3KCXA 3M7MX 4FLXA 3STZC 3TJTA 2IU0A 1XILA 3K06A 4CZZA 1NJIW 4HAMA 1K7DA 4U7OA 4HNAB 4JI8O 1VEWA 4HNAA 2WAMA 2P90A 3F5TA 3ZMZA 1RM1C 5KUKA 1MZFA 3ZHRA 3QF7A 4CC5A 2NN4A 2CH7B 2XAGA 1D5AA 1US6A 2YDEA 3I56V 2CH7A 4DR5B 1IBKO 1J5EO 1OCOB 2IJIA 2QSAA 3JSNA 1YTFD 3MHSC 5IY5B 2HG5C 1OCCB 4UVAA 1K3EA 1SETA 3CB2A 1F4NA 4FVMA 4MVOA 3BEHA 1XNRB 4QPKA 2C2AA 1QBZA 3ASNB 2WLIA 3CCLV 2X6AA 4JI0B 1BGYH 3E83A 1WP7A 3E22B 1GN4A 1LUVA 1TGOA 4FZ1A 3ZIAG 2E76B 3E22A 2DJVA 2HP8A 2PUSA 1FAFA 3AEIA 4FLZA 1FXVA 2B1IA 1YEWA 4CH5A 2A3QA 5EC1C 2VQEB 1K33A 4BAYA 1CXZB 4YJ2B 2FMLA 2RCVA 4B3SB 1R3KC 3TXSA 3T1HB 4YJ2A 1WLEA 1YF2A 2JVDA 5J2UB 1HR0O 4FLTA 4CH4A 2LW1A 3K58A 4LR3A 3RGBA 3BFRA 3QG5A 3VBBA 4QIWF 1UPGA 2X6BA 2KSDA 4DR3O 1BS3A 1CEZA 1H2MA 3BA8A 4MTOA 5KX5B 4ZI7B 1K34A 1ZL8B 5KX5A 1ZL8A 5CA1B 4X65O 2EIJB 2GSMB 5CBFA 1V55B 4DW1A 5CA1A 2PF4E 1K8AW 1N34B 4LF8B 4DR6B 2WWWA 1MZEA 1D2DA 3ASOC 1CPYA 2EINB 1H8EG 4UB6Z 3FKSG 1L0LH 1FJGO 3FX7A 3H01A 1WJZA 5IT9N 4L8JA 3HKDB 1HDJA 3FAVB 3HKDA 2YI8A 1NVPD 3L71H 1G1XB 3VQWA 3SJQC 4X89A 4QJFB 3BA9A 2Y0PA 2VWJA 4N23A 1ORQC 4XBFA 3LDEA 3RYFB 4DUYO 4MSWC 4JV5B 1IBLO 3RYFA 1IBMO 5CMUA 5JJEB 2PY5A 4H33A 3N2GB 1ZUQA 2E74B 3LSSA 2X0LA 4J10A 3ZRSA 4QGPA 4J80A 4G28B 1P7BA 3K5OA 1CP9A 5HFLA 1XI1A 3A2FA 3G6EV 2H3OA 4WCEV
chains in the Genus database with same CATH topology
1YJNV 3A0RA 4TSFG 2ZDIA 1KC8W 4F4LA 2DQ3A 2EJRA 4LP8A 1BMFG 3E8FA 4U7NA 2KB1A 2NLJC 3SYPA 1GM7A 3W7XA 2NNUA 1FS0G 5J9PC 3OEHG 1YI2V 2XAQA 2Z5UA 1NBMG 2Y48A 4N21A 2WLHA 1VQ8V 3ABTA 3GWOA 1VQ9V 3F5WC 1AI7A 5E1AC 1NKDA 5LGUA 1VQ5V 2EIJC 3LDDA 3GB7C 1JJ2U 3OW2U 3D36A 2H94A 3T4ZA 2JJ2G 4JAUA 1P4RA 3SYQA 3ABUA 2DYRC 1M90W 4P9PA 3FYEB 4GX1A 1RM1B 3CP1A 3JD0A 5B1BC 2XAHA 3JYCA 4L87A 3K04A 1NH2D 2ZQMA 1AI5A 4WFHA 3G4SV 1MG1A 4LC1A 1H2GA 1VQ7V 4J9YB 4LBEC 3T2MA 1B6QA 4WFEA 1BHBA 2GHYA 2LFRA 1E1RG 4BW5A 3ABLB 1R3IC 2OCCC 1R3LC 4RQEA 2IJKA 2A79B 1K73W 1DTOA 4ZKIA 2XOKG 3E8BA 3NXSA 4JAVA 4QNHB 1GKFA 3T1CA 3OGCC 2QM8A 2Y69B 4HYOA 2AHYA 2QA4V 1V54C 1EZJA 1K5QA 3IFXA 3K03A 1EBOA 2AHZA 3ZRWB 5KA5A 5FL7G 1BHAA 1OCZB 3ZRWA 5LHHA 1M57C 1N8RW 3F7VC 4BIZA 1VQOV 4R50A 4PELA 3ABKC 4YXWG 1G4YB 4Z1MG 1KQSU 1QLEB 1Y4MA 4JPRA 1OCCC 2WLJA 4UVCA 1FFTB 4XDLA 1PL0A 2WLLB 3IGAC 1DF5A 4I9WA 1ENVA 2WLLA 4JF3A 2ZXWC 5LGNA 3RBZA 3ZMTA 3CMAV 4GX5A 3ZMVA 2Q67A 2ZDIC 3SYAA 3W7WA 2JJ1G 5B3SC 5DN6G 1VQMV 1NR1A 2DYSB 5B1AB 3OMAB 1JX9A 3AG3B 1OHHG 1S5HC 3AG1B 1SERA 4MT8A 3CPWU 1VQLV 4KUMA 3OR6C 1GMGA 3QO5A 1Q82W 3K9AA 1QLNA 4FPPA 1MOFA 2IU3A 2A9HA 3OFNG 1NQTA 3ZCCA 2HKOA 1NR7A 4I5SA 4QPJA 3UM7A 2IH1C 1E79G 5L3CA 1K92A 2P67A 5CN0A 1YJWV 1OCRB 3CCJV 2A0LA 1K97A 3OUFA 5KA6A 3KG2A 3K79A 4H37A 3LSQA 1YTFB 1R6KA 5LHIA 2BOBC 1G8MA 1TUEB 3CMEV 3M99B 1IXMA 3ABLC 2EZPA 3B8NA 4OXSA 1J95A 1QCEA 5L3FA 4P30A 4JTCB 3SPIA 3SYOA 3ZMSA 2Y69C 4P2ZA 3ETGA 4FIPC 3AG2B 3STLC 4ZBMA 2HJFC 3OAAG 3ETDA 5BZBA 1K9MW 1YSCA 1SRYA 5EBLC 3FB6C 2QE7G 1OCZC 3OUSA 1M9NA 4WFFA 3W7TA 4PA4A 5IYDO 4PA7A 2JDIG 4R8CA 1V55C 2WLIB 3WG7C 2WPDG 4CBCA 2M7WA 3F7YC 5H6QA 4MVRA 1QLEC 3CCSV 1GM8A 1GTOA 4R7CA 2UXXA 3P32A 3SPHA 1AJPA 1W0KG 4JTDB 1R6NA 2EINC 2EIKB 4WFBV 3E86A 4DO2A 3JCZA 1VQNV 5IDJA 5B1OA 1YJ9V 2Q68A 1KP2A 2IH3C 3ZN0A 2LP7A 3OE7G 1PNMA 1JQ0A 4G27B 3CCQV 3CD6V 2BOCC 1RPOA 1GM9A 2X6CA 4J9ZB 1HWYA 2DWDC 4MVQA 4X8AA 1FXKB 1F4MA 4MTGA 1FXKA 2XAJA 3OMNB 2P6JA 1R73A 5B1AC 4MTFA 3UKMA 2ATKC 2HVKC 1SESA 1K4DC 3AG1C 2EILB 5H6RA 1GO3F 2R9IA 3E35A 1AJNA 3CCRV 3CCUV 3PJSK 3OR7C 3E8GA 3FB8C 5L3DA 4MW3A 3CCMV 1YITV 4DXWA 1M56B 3TETA 1PKXA 1W2BU 4XDJA 1RPRA 2B5UA 2IW5A 1JVMA 1OZ0A 3B77A 1QR9A 3QO8A 3X2QB 1XL6A 1QVGU 3CXCU 1WPXA 1Q86W 3E2EA 2UXNA 3HPLC 4JYBA 4X88A 2Q6AA 1DLBA 1JCHA 3D3IA 4PA6A 4JYCA 3G71V 3SPCA 1MSWD 3TCUA 1FXHA 2ZR3A 1OCRC 1KKDA 3CYOA 2PI5A 4MTXA 2Q69A 2W6JG 3K08A 3AG4B 3ML0A 1R3JC 3T4DA 5IYCO 2IJHA 2D3OW 2QEXV 5KUMA 3ABMB 1MABG 3K0DA 3EHBB 2V1DA 1ROPA 2QTOA 3IC7A 2WSSG 3I55V 1VQPV 3B8MA 5B1BB 1KD1W 3FB7C 3AG2C 3R65A 4GX2A 4PDRA 1E1QG 3STZC 1H38A 4GX0A 2IU0A 1H8HG 3K06A 4CZZA 5HFMA 1NJIW 4HAMA 5L3GA 1K7DA 4U7OA 2JEXA 4JASA 3K0GA 1AJQA 1YIJV 2HLDG 4MVSA 2HFEC 2OCCB 2LFSA 3LNMB 2WAMA 2P90A 5DM6V 3ZMZA 1RM1C 3DGEA 4QE7A 5KUKA 1UJWB 5EK0A 1XL4A 3LUTB 1QR8A 3OMIB 4FK5C 1VQKV 1YHQV 2XAGA 3OM3B 5CBGA 4UV9A 2K1EA 3I56V 2EZOA 4GT1A 4PDVA 3DTUB 5B1NA 5LBQA 3QO7A 1OCOB 2IJIA 4P9OA 1I5YA 1YTFD 4FMTA 2OTLV 3JD2A 3MHSC 4KP4A 2JIZG 5C93A 5IY5B 2HG5C 1OCCB 4UVAA 2CK3G 4RQFA 1K3EA 1SETA 2HR3A 3ASOB 1ZWIC 3RVYA 3K3WA 1BL8A 1QVFU 2Z3YA 4MVUA 4TWKA 1PD3A 1F4NA 2W6IG 3JD4A 1AR1B 5EC2C 1M56C 2ZXWB 1AROP 4MVOA 3BEHA 4QPKA 2C2AA 1S77D 2F43G 1QBZA 2YEVB 3OEEG 3SYCA 3ASNB 2V7QG 2WLIA 2X6AA 2XASA 3X2QC 2YEVA 3BY6A 1PNKA 5B3SB 3CCLV 4KFMA 3MD0A 3TK1A 2EBOA 2ITCC 3E83A 2WLMA 1F23A 2QM7A 5EBMC 3VOUA 3ZIAG 3MHHC 1K4CC 1S3JA 2WLKA 5CA3A 5L3BA 2IJJA 5IYBO 2FTKA 5H9CA 3AEIA 3RVZA 3AG4C 1FXVA 3W7UA 2B1IA 4FJCC 2EIMB 5EC1C 3ZRXA 3SPGA 3CC2V 5LGTA 5GW7A 3ABMC 1K33A 1SZTA 3RW0A 4BAYA 2DYSC 1W0JG 1R3KC 3JD3A 3P30A 1WLEA 3AG3C 3ZRVA 4MVMA 2DW4A 3FYIB 1NH2B 4UVBA 4UV8A 4WF9V 3HB3B 1JPXA 4XDKA 2ZD9A 2WLNA 3EFFK 4G2KA 4PDMA 4PA9A 3W7SA 3CC4V 2W0FC 3VBBA 4QIWF 2X6BA 3JD1A 5CBHA 1AI6A 1CEZA 1S72V 2B1GA 3CCEV 2DQ0A 2ITDC 4MTOA 1PNLA 1LNQA 1K34A 1Y66A 1Q7YW 1I5XA 2EIJB 3CC7V 2GSMB 5CBFA 1V55B 1S76D 4Q20A 3LDCA 1GK9A 3WFVA 3WG7B 5LHGA 1M1KW 1OCOC 3ZN1A 1KP3A 2YSUB 1VQ6V 1Q81W 1K8AW 2MK3A 4MVZA 2X7RB 4MS2A 1F51A 5IY5C 2DYRB 2WWWA 2XAFA 3ASOC 1CPYA 2HVJC 1AI4A 2EINB 1H8EG 2JK5C 3ETEA 4RAIA 3FKSG 4PDLA 3H01A 4GCZA 4TT3G 2OTJV 1NVPB 4JTAB 4RUFA 2XNDG 3FB5C 1NVPD 3ASNC 4BIUA 4PA3A 4MW8A 2OT5A 4X89A 3SJQC 5EBWC 4QJFB 4R6ZA 2R9RB 4E2LA 1COWG 1DF4A 4N23A 4RO2A 4UUJC 1ORQC 4WFAV 1L1FA 1K5SA 4XBFA 2EIKC 3LDEA 1V54B 4MSWC 2QKSA 4EKWA 1KECA 1EFRG 3SPJA 5CMUA 4HZ3A 3CCVV 4H33A 1M57B 2EIMC 2P7TC 1FXKC 4JGSA 4QE9A 1VQ4V 4LCUC 3ABKB 2X0LA 3LSSA 2JEUA 2DWEC 4RUEA 3ZRSA 5L3EA 4UXNA 3ZJZA 3E8HA 2PI4A 2EILC 2ZR2A 4G28B 3E89A 1P7BA 1JOYA 3QNEA 1S0VA 1CP9A 2H8PC 5HFLA 4WFGA 3ZMUA 3G6EV 4ASUG 1THZA 4WCEV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCR C;  1KKD A;  3AG3 C;  4MVM A;  4F4L A;  2Q69 A;  3K08 A;  4LP8 A;  3E8F A;  2KB1 A;  2NLJ C;  3SYP A;  4XDK A;  2ZD9 A;  1R3J C;  3T4D A;  2A9H A;  5J9P C;  5KUM A;  2WLN A;  3UM7 A;  3EFF K;  3RVY A;  4PDM A;  2IH1 C;  3K0D A;  2WLH A;  4PA9 A;  3F5W C;  2QTO A;  5E1A C;  2W0F C;  2EIJ C;  3LDD A;  3GB7 C;  2A0L A;  2X6B A;  3FB7 C;  3AG2 C;  3R65 A;  4GX2 A;  4PDR A;  3T4Z A;  3OUF A;  5CBH A;  3STZ C;  3KG2 A;  4GX0 A;  3SYQ A;  4H37 A;  2ITD C;  3K06 A;  4MTO A;  2BOB C;  1LNQ A;  2DYR C;  4P9P A;  4GX1 A;  3ABL C;  5B1B C;  3JYC A;  3K0G A;  4OXS A;  1J95 A;  4MVS A;  3K04 A;  4P30 A;  4JTC B;  2HFE C;  3SPI A;  3SYO A;  5CBF A;  2Y69 C;  4P2Z A;  3STL C;  3LDC A;  3LNM B;  4WFH A;  4ZBM A;  2HJF C;  1OCO C;  5BZB A;  5KUK A;  4QE7 A;  5EBL C;  4J9Y B;  3FB6 C;  4LBE C;  3T2M A;  1OCZ C;  4MVZ A;  3OUS A;  4MS2 A;  4WFE A;  4WFF A;  4PA4 A;  5EK0 A;  5IY5 C;  1XL4 A;  3LUT B;  4PA7 A;  4R8C A;  4BW5 A;  1R3I C;  1R3L C;  1V55 C;  2HVJ C;  2OCC C;  2JK5 C;  2WLI B;  3ASO C;  4RAI A;  3WG7 C;  2A79 B;  4PDL A;  5CBG A;  3E8B A;  2K1E A;  4CBC A;  3F7Y C;  4QNH B;  4PDV A;  3T1C A;  3OGC C;  4MVR A;  4HYO A;  2AHY A;  1QLE C;  1V54 C;  4R7C A;  3IFX A;  3K03 A;  4JTA B;  4P9O A;  2AHZ A;  4RUF A;  3SPH A;  3FB5 C;  2EIN C;  4JTD B;  3E86 A;  3ASN C;  4PA3 A;  2HG5 C;  4MW8 A;  4X89 A;  3SJQ C;  2Q68 A;  5EBW C;  1M57 C;  2IH3 C;  4G27 B;  4R6Z A;  1ZWI C;  2BOC C;  2R9R B;  3F7V C;  1BL8 A;  2X6C A;  4J9Z B;  4RO2 A;  4UUJ C;  4R50 A;  1ORQ C;  4MVU A;  4TWK A;  2DWD C;  3ABK C;  1G4Y B;  2EIK C;  4MVQ A;  3LDE A;  4X8A A;  5EC2 C;  1M56 C;  4MSW C;  1OCC C;  2WLJ A;  3BEH A;  4MVO A;  4MTG A;  2QKS A;  4EKW A;  4XDL A;  3SPJ A;  3SYC A;  4HZ3 A;  5B1A C;  4MTF A;  2WLI A;  4H33 A;  2X6A A;  3UKM A;  3X2Q C;  2WLL B;  2ATK C;  2HVK C;  2YEV A;  3IGA C;  4I9W A;  4KFM A;  1K4D C;  3AG1 C;  2EIM C;  2ITC C;  2WLL A;  3E83 A;  2P7T C;  4QE9 A;  2ZXW C;  2WLM A;  3PJS K;  4LCU C;  3OR7 C;  3RBZ A;  5EBM C;  3E8G A;  3FB8 C;  2DWE C;  4GX5 A;  4MW3 A;  4RUE A;  3VOU A;  2Q67 A;  3SYA A;  3ZRS A;  4DXW A;  3TET A;  3ZJZ A;  1K4C C;  3E8H A;  2WLK A;  4XDJ A;  5B3S C;  1JVM A;  2EIL C;  3RVZ A;  4G28 B;  3E89 A;  3AG4 C;  1P7B A;  1XL6 A;  1S5H C;  5EC1 C;  2H8P C;  3SPG A;  4WFG A;  3HPL C;  4X88 A;  2Q6A A;  3ABM C;  3RW0 A;  4PA6 A;  2DYS C;  3OR6 C;  3SPC A;  3TCU A;  1R3K C; 
#chains in the Genus database with same CATH topology
 1YJN V;  4JI5 B;  1XMQ B;  4U7N A;  2KB1 A;  1IXB A;  1FS0 G;  4X1I B;  4X1I A;  1P7G A;  4N21 A;  2WLH A;  1VQ8 V;  1VQ9 V;  3F5W C;  5E1A C;  5LGU A;  2GV9 A;  3LDD A;  3GB7 C;  1GH6 A;  3CWB H;  3D36 A;  1M4U A;  3T4Z A;  3BCC H;  4W4L A;  3K9S A;  2AGA A;  4X1Y B;  1Q3E A;  2AZ2 A;  4GX1 A;  1RM1 B;  4X1Y A;  3JD0 A;  5B1B C;  1SA0 B;  3ZBH A;  1FPO A;  3G67 A;  3K04 A;  1KU9 A;  1SA0 A;  2Q0A A;  1R1B A;  3G4S V;  4GKK B;  5JJN B;  4AQY O;  2GTA A;  5LOV B;  2LFR A;  4LF7 O;  4KL1 A;  2A79 B;  1K73 W;  2YID A;  3E8B A;  4QNH B;  1GKF A;  1AP6 A;  1L8D A;  4NXM B;  1EBO A;  3B09 A;  3ZRW B;  1BHA A;  3ZRW A;  5LHH A;  1M57 C;  1EN6 A;  3F7V C;  3C90 A;  2Q5Z A;  5LMN B;  1SS3 A;  1G4Y B;  1KQS U;  2OIE A;  1Q6I A;  1QLE B;  4JPR A;  3SDL A;  4I55 B;  1PL0 A;  3SR2 C;  3K5M A;  4I55 A;  3JAS B;  3IGA C;  3JAS A;  1AIL A;  1URF A;  3RBZ A;  4GX5 A;  3ZMV A;  2ZDI C;  1V9P A;  1NR1 A;  2UUC B;  2BE3 A;  1IZ3 A;  3TGU H;  5LXT B;  4DR1 B;  1SER A;  4MT8 A;  3ZHV A;  1Q6U A;  2CTW A;  4BR6 A;  4D7S A;  3BHP A;  5EIB D;  4IIJ B;  3BAB A;  2YIB A;  4IIJ A;  2GDS A;  1MOF A;  4IYH A;  4GKJ B;  3K5L A;  5C8Y B;  4JZG A;  3OFN G;  1NQT A;  4NXN B;  1GRJ A;  3DSQ A;  1HNZ O;  2IH1 C;  1BT8 A;  2N05 A;  4LFA O;  1K97 A;  3KG2 A;  3K79 A;  3M8A A;  3GWK C;  3P3N A;  1G8M A;  1IXM A;  2Q7H A;  1J95 A;  1QCE A;  3NR7 A;  3SYO A;  3STL C;  3AG2 B;  4JI7 O;  1SRY A;  2F4V O;  3MAQ A;  1OCZ C;  4WFF A;  4PI2 A;  4PA7 A;  4R8C A;  1U97 A;  2QDO A;  3F7Y C;  5H6Q A;  2PYJ A;  3OTO O;  3CCS V;  1GM8 A;  4R7C A;  1WA8 B;  1B3Q A;  5AG2 A;  4WFB V;  2CGO A;  2VQF B;  1YJ9 V;  4FM2 A;  3A0H Z;  1KP2 A;  1PNM A;  1JQ0 A;  2L35 A;  3CD6 V;  2BOC C;  3KKY A;  2UU9 B;  1HWY A;  4JYA B;  4JI1 O;  1IVS A;  2P6J A;  1XHZ A;  5B1A C;  2ATK C;  2F95 B;  3FD9 A;  1GO3 F;  4DV0 O;  1FYJ A;  3CCU V;  3OR7 C;  4MW3 A;  4OGQ B;  1PKX A;  3ZHU A;  3UT5 B;  3QO8 A;  3X2Q B;  3UT5 A;  1QVG U;  1WPX A;  3MDS A;  3E2E A;  4JYB A;  4JYC A;  3G71 V;  4YHH O;  2GUZ A;  2PYL A;  1XDC A;  4MTX A;  2PI5 A;  3K08 A;  4J42 A;  4DUZ O;  2IJH A;  3JCU Z;  2D3O W;  5KUM A;  2QR4 A;  2Q0O C;  1Z5W A;  3H1I H;  5DEC A;  2V1D A;  1ROP A;  2OWO A;  2WSS G;  3CEI A;  3I55 V;  3CRQ A;  5B1B B;  3R65 A;  4GX2 A;  1SF9 A;  2P4V A;  4JI3 O;  3T1Y B;  4GX0 A;  5HFM A;  4OPH A;  4JAS A;  2YS8 A;  4J11 A;  3CRM A;  4W4K A;  2QWO B;  2GTS A;  4J7Z A;  5EK0 A;  4UCT A;  4FK5 C;  1A32 A;  3RYH B;  4UCU A;  4H13 B;  2Q7E A;  3RYH A;  1TVK B;  4UV9 A;  1TVK A;  4FMT A;  3JD2 A;  1SKV A;  4DV1 B;  5LL6 Y;  1YVW A;  2DE0 X;  2P22 C;  4LF4 O;  1ZWI C;  3RVY A;  2Z3Y A;  4BW9 A;  4MVU A;  1PD3 A;  2UUA O;  4JYY A;  3WB2 A;  1M56 C;  1ARO P;  1VF6 C;  2F43 G;  2Y0I A;  4O2A B;  2L6L A;  3OEE G;  5K1P A;  5H2F Z;  4O2A A;  3BY6 A;  4KFM A;  4DV5 B;  1F23 A;  3AG7 A;  5EBM C;  2QM7 A;  3VOU A;  1XNQ O;  5EZY B;  1S3J A;  5CA3 A;  4B7E A;  2IJJ A;  2AW9 A;  5EZY A;  3RVZ A;  5D5Q A;  3AG4 C;  2ZE5 A;  3J80 N;  2EIM B;  2HEP A;  4DV7 O;  2FL4 A;  5LGT A;  5GW7 A;  4DR7 O;  4Z1V A;  2LQT A;  3CRC A;  2DMX A;  2DYS C;  1W0J G;  3JD3 A;  3P30 A;  4LFB O;  4JI8 B;  4UVB A;  1JPX A;  4XDK A;  2ZD9 A;  5BMV B;  2QKC A;  3B4S A;  1Y6X A;  3JAW B;  3JAW A;  4PDM A;  4NYK A;  5LA6 B;  3QVN A;  5JCO C;  5LP6 B;  5LA6 A;  2ZNI A;  5LP6 A;  2B1G A;  1J5E B;  3L75 H;  2FYU H;  1Q43 A;  5BXZ A;  1Q8I A;  4I0X B;  4CH6 A;  5JJJ B;  4I0X A;  3CC7 V;  4O4H B;  1S76 D;  2A7W A;  4Q20 A;  2Z0A A;  5FPR A;  1X59 A;  3CRA A;  1EZV H;  4FFB B;  4O4H A;  1DK1 A;  4K8Z A;  1VQ6 V;  1B04 A;  4MVZ A;  4MS2 A;  1WAZ A;  4NVP A;  3SJA C;  1AI4 A;  2LJ2 A;  4PDL A;  1Z5V A;  1N33 O;  4TT3 G;  1NVP B;  4Q6G A;  2XND G;  3FB5 C;  4PA3 A;  5A2Q N;  2F1M A;  4B3M O;  4R6Z A;  1COW G;  1DF4 A;  4UUJ C;  1O9G A;  2GBO A;  1HNX O;  2QKS A;  1BQ0 A;  4X62 B;  2WA4 A;  5IE9 A;  1LUW A;  1FXK C;  4JGS A;  5J2T B;  4LCU C;  1HR0 B;  5J2T A;  2QGN A;  3ZJZ A;  1SQV H;  2PI4 A;  4X64 O;  3R66 A;  4DR3 B;  5BR8 O;  2JS5 A;  2H8P C;  2CTQ A;  1HP8 A;  4DV4 O;  1THZ A;  1R6T A;  3A0R A;  4F4L A;  2DQ3 A;  4X65 B;  3CE2 A;  3RT3 C;  3SYP A;  2NLJ C;  1GM7 A;  4LH7 A;  4PI0 A;  5FLX N;  5J9P C;  2ZE6 A;  2Z5U A;  2UXC B;  3L74 H;  3ABT A;  2Y4T A;  5FPO A;  1NKD A;  1FJG B;  2H94 A;  1P4R A;  2ADQ B;  3ABU A;  1NI8 A;  2QTS A;  3ZHQ A;  2DYR C;  5LMU B;  4U3J B;  2XAH A;  2WA3 A;  1PPJ H;  3UCS C;  1OJH A;  1AI5 A;  2BCC H;  1MG1 A;  5KHJ A;  4LC1 A;  5J2U A;  4K35 A;  4J9Y B;  3T2M A;  4DUY B;  4K0K O;  3BAA A;  2GHY A;  1IBM B;  5KMG B;  5IYZ B;  4PJ0 Z;  2OCC C;  4EFE A;  5IYZ A;  1AP5 A;  4ZKI A;  3NXS A;  4JAV A;  1V54 C;  2AHZ A;  4X9Q A;  1NT2 B;  5IWA O;  1VMG A;  3THO A;  4ZI7 A;  1JFF B;  3DXR B;  1JFF A;  3J7A U;  3DXR A;  4PEL A;  3ABK C;  4YXW G;  1L0N H;  2CGN A;  4XDL A;  3PN1 A;  3RYC B;  4GUN A;  3RYC A;  4GYC B;  3AK2 A;  1XMO O;  3ZMT A;  3CMA V;  3FAV A;  2JJ1 G;  5DN6 G;  1BE3 H;  2DYS B;  4TQD A;  4LH6 A;  1TAE A;  1JX9 A;  1S5H C;  1H2L A;  3AG1 B;  3CPW U;  4IGG A;  2VQE O;  4KUM A;  4I4T B;  1S5J A;  4I4T A;  4JI6 O;  4FFK A;  4B3S O;  1QLN A;  3N2G A;  4GLX A;  2IU3 A;  4X1K B;  2DOS A;  4AQY B;  2F23 A;  3ZCC A;  2HKO A;  1NR7 A;  3UM7 A;  1KKC A;  4LFC O;  2KQX A;  1OCR B;  3BRC A;  5B5E Z;  3CCJ V;  2A0L A;  1AB3 A;  3A8T A;  2R9A A;  5KA6 A;  2BOB C;  1ZSP A;  1TUE B;  3ABL C;  2EZP A;  1SQF A;  4CS2 A;  2DN9 A;  2Y69 C;  4P2Z A;  3UO2 A;  2ILM A;  4DK0 A;  1K9M W;  4EB6 B;  2CE4 A;  1YSC A;  1MA1 A;  5EBL C;  4EB6 A;  3W7T A;  4PA4 A;  5IYD O;  4FM1 A;  1GN3 A;  4I7Z B;  2LW7 A;  2PTM A;  1PP9 H;  2R72 A;  3P32 A;  1W0K G;  4JTD B;  1SQX H;  5FNV B;  1I94 O;  5FNV A;  3ZN0 A;  2LP7 A;  1N4C A;  5IJ0 B;  4KXR A;  5IJ0 A;  3WB0 A;  4FZ0 A;  1N0N A;  4X8A A;  1FXK B;  3JAL B;  1F4M A;  5LOV A;  1FXK A;  2XAJ A;  3JAL A;  4TUY B;  4CH3 A;  1R73 A;  2KG7 B;  4TUY A;  4WBN B;  2HVK C;  1WPB A;  3H1J H;  2XT9 A;  2KG7 A;  4WBN A;  2R9I A;  1AJN A;  3CCR V;  3PJS K;  4B3T O;  5EYP B;  3CCM V;  5L3D A;  4DV2 B;  1YIT V;  3TET A;  1SZX A;  1W2B U;  1HNZ B;  4JI2 B;  1RPR A;  1N36 B;  1OZ0 A;  4LFA B;  4D7T A;  3VQV A;  3CXC U;  1Q86 W;  4LF6 O;  4E4E A;  3HPL C;  2Q6A A;  1DLB A;  3OT7 A;  1XOU A;  3D3I A;  4PA6 A;  2ZR3 A;  3CYO A;  4OPA A;  2Q69 A;  4TV8 B;  1XMQ O;  3ML0 A;  4CC6 A;  4TV8 A;  3T4D A;  4ZIB A;  4JI7 B;  5IYC O;  4JI4 O;  2F4V B;  1MAB G;  1LR1 A;  5KHH A;  5JWP A;  3B8M A;  3ZX6 A;  1H38 A;  5LXT A;  4UCV A;  4I50 B;  1WP8 A;  2AZ0 A;  2JEX A;  3JAT B;  3SJB C;  4OX9 B;  3K0G A;  1AJQ A;  3CRR A;  4BIO A;  1VAR A;  2HLD G;  3JAT A;  3K57 A;  2UXD B;  2HFE C;  1W59 A;  3G6B A;  5B66 Z;  2OCC B;  4J41 A;  3LNM B;  5C8Y A;  5DM6 V;  4JI1 B;  3DGE A;  4QE7 A;  1UJW B;  3H1H H;  4DW0 A;  3LUT B;  1YHQ V;  1XHX A;  5CBG A;  2HHH O;  4GT1 A;  4DV0 B;  3DTU B;  5LBQ A;  3QO7 A;  4P9O A;  4UCS A;  4NXM O;  4KP4 A;  1ZX3 A;  3CS5 A;  4PHZ A;  4NTX A;  3ASO B;  5F2V O;  2ARH A;  3K3W A;  1BL8 A;  1QVF U;  3U10 A;  1BZK A;  4TWK A;  2W6I G;  3JAK B;  3JAM N;  3JAK A;  2QM4 A;  1BCC H;  4EFB A;  2YEV B;  2XAS A;  2YEV A;  4DV3 O;  1HNW O;  4DUZ B;  2EBO A;  2ITC C;  4F6E A;  2WLM A;  1WA8 A;  2YXH A;  3SJC C;  1K4C C;  2WLK A;  5L3B A;  5IYB O;  4LF5 O;  3W7U A;  1U96 A;  1XQ8 A;  2ZKO A;  4FJC C;  2UUC O;  3SPG A;  4DR1 O;  3CC2 V;  2ZE7 A;  3ABM C;  1SZT A;  2A06 H;  3O9O A;  3CJH B;  3FYI B;  1NH2 B;  4UV8 A;  3CJH A;  4WF9 V;  3HB3 B;  4GKJ O;  2ZT9 B;  3EFF K;  4G2K A;  1Z2G A;  4PA9 A;  3W7S A;  3L70 H;  2UUB O;  4YY3 O;  2HJD A;  1RP3 B;  1AI6 A;  4NR1 A;  3CCE V;  2DQ0 A;  2ITD C;  3HKE B;  5IJ9 B;  3Q4H B;  1Y66 A;  1Y74 B;  3Q4H A;  4ZOL B;  2BTO A;  4LF4 B;  1Y74 A;  4ZOL A;  1QQC A;  3LDC A;  1GK9 A;  3WFV A;  2UUA B;  1OCO C;  1VF7 A;  1KP3 A;  2YSU B;  4A5U B;  2E5L B;  4NKG B;  2MK3 A;  5IY5 C;  2XAF A;  2JK5 C;  3ETE A;  4RAI A;  1M93 A;  2OTJ V;  3L72 H;  1ZTE A;  1XNQ B;  3ASN C;  4BIU A;  3RWR D;  5EBW C;  2VQF O;  1VF5 B;  2UXB O;  4ABM A;  1ZAU A;  4UB8 Z;  3ZS8 C;  1L1F A;  1K5S A;  3L9D A;  2EIK C;  3BPZ A;  4DR2 B;  1RFY A;  4EKW A;  1BQZ A;  4H44 B;  4HZ3 A;  3CCV V;  4UFZ A;  4LFB B;  2PZS A;  1M57 B;  5KHI A;  3IAY A;  2OCH A;  1VQ4 V;  1YXB A;  3N27 A;  2DWE C;  3WB1 A;  4B3R O;  5L3E A;  1Q6H A;  3OGI B;  3E8H A;  2YUA A;  2ZR2 A;  3ZED A;  3P3P A;  3E89 A;  1JOY A;  3QNE A;  1S0V A;  4WFG A;  3ZMU A;  1AVM A;  4J7K A;  4ASU G;  1I0H A;  4TSF G;  2ZDI A;  1KC8 W;  5KHK A;  2FKX A;  1BMF G;  1SQB H;  2RDC A;  3W7X A;  1TA8 A;  3A0B Z;  5A9G A;  3OEH G;  3IJ4 A;  4CS3 A;  1NBM G;  2YXY A;  3GWO A;  3C3T A;  4DK1 A;  1AI7 A;  1VQ5 V;  2EIJ C;  3OW2 U;  2JJ2 G;  4JAU A;  1Y76 B;  1N33 B;  3VQY A;  1Y76 A;  1NZ6 A;  1N32 O;  1P49 A;  3FYE B;  3JYC A;  4Z2W A;  4L87 A;  1NH2 D;  5BMV A;  4DR4 O;  2Q8V A;  1VQ7 V;  3H1K H;  1HNX B;  4WFE A;  1BHB A;  4BW5 A;  2IJK A;  1IBK B;  2XOK G;  3T1C A;  4O4L B;  2QM8 A;  4HYO A;  2QWR B;  4O4L A;  3IFX A;  1H2K A;  2O57 A;  5FL7 G;  1OCZ B;  2VWK A;  2ZM6 O;  1N8R W;  5BR8 B;  4FFB A;  1Y4M A;  1X4T A;  4LF9 O;  2F66 C;  4DV4 B;  2WLL B;  1KBH A;  1DF5 A;  2N74 A;  2Q7G A;  1TUB B;  2WLL A;  2ZXW C;  1TUB A;  2QKA A;  4BWA A;  2Q9L A;  1MMM A;  2JGU A;  5B3S C;  1B06 A;  1DGS A;  2EJ7 A;  4O4I B;  1VQM V;  5B1A B;  4O4I A;  3OMA B;  4KHP O;  3KCY A;  1OHH G;  1VQL V;  3WU2 Z;  4ICG A;  3K59 A;  3OR6 C;  1RSO B;  3D36 C;  1NTZ H;  1GMG A;  1RSO A;  1YCI A;  3K9A A;  5KAI Z;  1JMK C;  4FPP A;  3HR0 A;  1WNS A;  2ZNJ A;  2A9H A;  4K0K B;  4QPJ A;  4YJ3 B;  5L3C A;  1K92 A;  1GN6 A;  2P67 A;  5CN0 A;  3AK3 A;  4DV6 O;  1YJW V;  2V4D A;  4YJ3 A;  5CB4 B;  1G6U A;  5CB4 A;  5JVD B;  2RMK B;  3LSQ A;  1R6K A;  5JVD A;  3N2K B;  5IWA B;  3HKC B;  3M99 B;  3N2K A;  4OXS A;  3HKC A;  5L3F A;  4FLV A;  4PD4 F;  3SPI A;  1P84 F;  2LO1 A;  4ZBM A;  3DC5 A;  3ETD A;  5BZB A;  3RN4 A;  3FB6 C;  1M9N A;  3FFQ A;  2JDI G;  2WLI B;  4X66 O;  2XTA A;  3WG7 C;  2WPD G;  1XMO B;  4MVR A;  1QLE C;  1GTO A;  5ITZ B;  2P06 A;  1NU1 H;  2KKW A;  3SPH A;  2W0X A;  5ITZ A;  2EIK B;  4DO2 A;  4U3J A;  3JCZ A;  5B1O A;  2Q73 A;  2Q68 A;  2IH3 C;  3CCQ V;  3G80 A;  1GM9 A;  2X6C A;  4J9Z B;  2DWD C;  3CXH F;  2M6Y A;  1IBL B;  1SQG A;  5KMG A;  1QHT A;  4JI6 B;  4AIL C;  4X62 O;  2P5O A;  1SES A;  5H6R A;  4DR5 O;  4U3F H;  4LWS B;  4LWS A;  1KYO F;  1M56 B;  3EVK A;  3U11 A;  1SQP H;  2E75 B;  4LFC B;  1JVM A;  1VF6 A;  1MSD A;  1D5N A;  1O9H A;  1OV9 A;  2UXN A;  3D8C A;  4X88 A;  2XUM A;  5GTI Z;  1XNR O;  4NTW A;  1MSW D;  3TCU A;  1FXH A;  4HBN A;  3U0Z A;  4JI0 O;  2BSK B;  3AG4 B;  3S3X A;  2BSK A;  1R3J C;  1HW7 A;  2ODM A;  2QEX V;  1BSM A;  1XRE A;  3ZHT A;  2EX3 A;  2IBZ H;  2RJZ A;  2UXC O;  3IC7 A;  3RFR A;  1VP7 A;  1KD1 W;  3AG2 C;  4PDR A;  1E1Q G;  4FLU A;  3LSU A;  1H8H G;  2RNB A;  4O4J B;  5L3G A;  1I94 B;  4O4J A;  2PGG A;  5LMU O;  3T1H O;  1YIJ V;  3APQ A;  4MVS A;  2LFS A;  1QU7 A;  4X1K A;  5JCO A;  2EUL A;  1T5E A;  4LF7 B;  1XL4 A;  4TOI A;  1QR8 A;  3OMI B;  1VQK V;  2QJ1 A;  4YIP A;  3QTC A;  3OM3 B;  1EM1 A;  2K1E A;  2D2C B;  2EZO A;  4PDV A;  4IYI A;  5B1N A;  4B3T B;  1GAX A;  4H0L B;  5KLV H;  1I5Y A;  2OTL V;  4JAA A;  2JIZ G;  5C93 A;  3B2E E;  3ICX A;  4IHJ B;  2CK3 G;  4RQF A;  1FFX B;  2HR3 A;  2G38 A;  4IHJ A;  1FFX A;  2B9Z A;  2JGD B;  1Q5O A;  3JD4 A;  4NB5 A;  4LF6 B;  1PL4 A;  1AR1 B;  5EC2 C;  2JGD A;  2ZXW B;  3TXQ A;  1N34 O;  4LF8 O;  1S77 D;  4DR6 O;  2JRI A;  3SYC A;  2V7Q G;  3X2Q C;  5B3S B;  1PNK A;  3TK1 A;  3MD0 A;  5BY1 A;  1IUR A;  2CDY A;  1SC5 B;  1XEQ A;  3CSX A;  4JI4 B;  2ZCE A;  3MHH C;  2FTK A;  5H9C A;  3LNN A;  1JJO A;  3ZRX A;  4IL6 Z;  1H2S B;  5TIS Z;  3RW0 A;  2N04 A;  4JV5 O;  3AG3 C;  3ZRV A;  4MVM A;  2DW4 A;  5EYP A;  2WLN A;  3OD4 A;  5E79 Z;  3CC4 V;  2W0F C;  1I7F A;  3SGI A;  2HHH B;  1PM9 A;  3ETQ A;  3JD1 A;  5CBH A;  1S72 V;  1PNL A;  4YIO A;  1LNQ A;  4EEQ A;  4B7K A;  1M5I A;  3CX5 F;  1F7Y A;  1Q7Y W;  4JI5 O;  1I5X A;  1ZLZ A;  4AHC A;  3AK1 A;  3WG7 B;  1FD9 A;  5LHG A;  1M1K W;  3ZN1 A;  1Q81 W;  4D6T H;  2X7R B;  4AI8 A;  1F51 A;  2ZIM A;  2DYR B;  2HVJ C;  3D3Q A;  3OTO B;  4DV3 B;  1HNW B;  3ZHS A;  4GCZ A;  4JTA B;  4RUF A;  2R70 A;  4I50 A;  3JSL A;  4MW8 A;  2OT5 A;  4B08 A;  4LF5 B;  2VRZ A;  3B40 A;  2R9R B;  4E2L A;  4RO2 A;  4WFA V;  2AXT Z;  3JAR B;  4GKK O;  3JAR A;  4C7U A;  4ZHQ B;  1V54 B;  2QWN B;  2ZIO A;  1XUQ A;  2OYQ A;  4ZHQ A;  3APO A;  1KEC A;  1EFR G;  3SPJ A;  4K3A A;  1XBL A;  4JZ2 A;  3C3S A;  4FLY A;  2EIM C;  2P7T C;  4QE9 A;  3H1L H;  1I08 A;  3ABK B;  4UCR A;  2JEU A;  2Y4U A;  4RUE A;  4UXN A;  4DV2 O;  4JI2 O;  2EIL C;  2UUB B;  4RWU A;  4YY3 B;  2ADP A;  1N36 O;  3L73 H;  5LMN O;  1JR9 A;  1WN7 A;  4YHH B;  2QWP B;  2F93 B;  2OIG A;  5LP6 C;  2EJR A;  4LP8 A;  2Q4P A;  3E8F A;  1QNM A;  1YDX A;  2K9P A;  2NNU A;  1YI2 V;  2XAQ A;  4O2B B;  2Y48 A;  2JS3 A;  1Q90 D;  4O2B A;  3RYI B;  3VQX A;  1JJ2 U;  4JI3 B;  3RYI A;  2YI9 A;  3SYQ A;  2IM9 A;  1KUQ A;  4CS4 A;  1M90 W;  4P9P A;  2ZIN A;  3CP1 A;  1KMI Z;  4OX9 O;  2UXB B;  5H5N A;  2UXD O;  2ZQM A;  1VIB A;  4WFH A;  1IX9 A;  1NTM H;  1H2G A;  4NXN O;  4LBE C;  1B6Q A;  3UQ8 A;  2MW2 B;  1E1R G;  3ABL B;  1R3I C;  1R3L C;  4RQE A;  4UCO A;  2P4K A;  1DTO A;  3S3W A;  2VS0 A;  3OGC C;  2Y69 B;  2AHY A;  3CHX A;  2QA4 V;  4PV1 B;  1EZJ A;  1K5Q A;  3HKE A;  3K03 A;  5IJ9 A;  4B3R B;  5KA5 A;  2YC0 A;  1YZB A;  5JH7 B;  4BIZ A;  1VQO V;  4R50 A;  5JH7 A;  2RQ6 A;  4Z1M G;  1FKA O;  1OCC C;  2WLJ A;  4UVC A;  1FFT B;  2GUZ B;  2RN9 A;  2LGW A;  1S5L Z;  4I9W A;  5KAF Z;  1ENV A;  4JF3 A;  2CAZ C;  1NTK H;  5LGN A;  4FLW A;  2CTR A;  2QWQ B;  1H2N A;  4J7J A;  2Q67 A;  3SYA A;  3W7W A;  3K5N A;  3J81 N;  1Y67 A;  4JYA O;  3AG3 B;  5LYJ B;  4DV7 B;  2UU9 O;  4TQF A;  4DR7 B;  5LYJ A;  1N32 B;  5GON B;  1GN2 A;  3QO5 A;  2XHB A;  1Q82 W;  5GON A;  3GVM A;  4DYL A;  2YIB D;  4NTY A;  4DR4 B;  2YIC A;  2CUG A;  4I5S A;  4TV9 B;  4TV9 A;  1E79 G;  2CTP A;  2FB5 A;  2LGQ A;  3OUF A;  1WB8 A;  5GTH Z;  4H37 A;  1YTF B;  5LHI A;  3CME V;  3B8N A;  4DRX B;  2ZM6 B;  2YXL A;  4P30 A;  4DRX A;  4JTC B;  2YIA A;  3ZMS A;  4X20 B;  3ETG A;  4FIP C;  2HJF C;  3OAA G;  5CA0 B;  4X20 A;  3IC9 A;  3DC6 A;  5CA0 A;  2QE7 G;  3OUS A;  4LF9 B;  2E5L O;  1IDS A;  1V55 C;  4I9Q A;  4CBC A;  2M7W A;  3T1Y O;  2UXX A;  1AR5 A;  3I5D A;  1AJP A;  1R6N A;  2EIN C;  1WB7 A;  3E86 A;  4B3M B;  1VQN V;  5IDJ A;  3OE7 G;  4G27 B;  4KHP B;  1SQQ H;  1RPO A;  4FM0 A;  1KB9 F;  1NS1 A;  4MVQ A;  3HKB B;  1AR4 A;  2ETN A;  5JQG B;  4MTG A;  4DR2 O;  3HKB A;  5KHG A;  2NR5 A;  3OMN B;  5JQG A;  4MTF A;  3UKM A;  3H9V A;  1K4D C;  3AG1 C;  2EIL B;  3EXA A;  3E35 A;  5EIB C;  3E8G A;  3FB8 C;  5K1X A;  4IT5 A;  2ZE8 A;  4DXW A;  1EN4 A;  4DV1 O;  4X64 B;  4XDJ A;  1JA8 A;  2B5U A;  2IW5 A;  4DV6 B;  3B77 A;  1QR9 A;  2E3C A;  1XL6 A;  1UFI A;  3UO3 A;  4GZR B;  1PV0 A;  5D5P A;  1JCH A;  3KZI Z;  3SPC A;  4K8X A;  1OCR C;  1KKD A;  1MNG A;  2W6J G;  2BTQ B;  4LNU B;  4DV5 O;  2BTQ A;  4LNU A;  1N0J A;  3O65 A;  5DED A;  3BVO A;  4F6R B;  3ABM B;  3K0D A;  3EHB B;  4F6R A;  2QTO A;  1EN5 A;  4X66 B;  1VQP V;  3OTF A;  3FB7 C;  3KCX A;  3M7M X;  4FLX A;  3STZ C;  3TJT A;  2IU0 A;  1XIL A;  3K06 A;  4CZZ A;  1NJI W;  4HAM A;  1K7D A;  4U7O A;  4HNA B;  4JI8 O;  1VEW A;  4HNA A;  2WAM A;  2P90 A;  3F5T A;  3ZMZ A;  1RM1 C;  5KUK A;  1MZF A;  3ZHR A;  3QF7 A;  4CC5 A;  2NN4 A;  2CH7 B;  2XAG A;  1D5A A;  1US6 A;  2YDE A;  3I56 V;  2CH7 A;  4DR5 B;  1IBK O;  1J5E O;  1OCO B;  2IJI A;  2QSA A;  3JSN A;  1YTF D;  3MHS C;  5IY5 B;  2HG5 C;  1OCC B;  4UVA A;  1K3E A;  1SET A;  3CB2 A;  1F4N A;  4FVM A;  4MVO A;  3BEH A;  1XNR B;  4QPK A;  2C2A A;  1QBZ A;  3ASN B;  2WLI A;  3CCL V;  2X6A A;  4JI0 B;  1BGY H;  3E83 A;  1WP7 A;  3E22 B;  1GN4 A;  1LUV A;  1TGO A;  4FZ1 A;  3ZIA G;  2E76 B;  3E22 A;  2DJV A;  2HP8 A;  2PUS A;  1FAF A;  3AEI A;  4FLZ A;  1FXV A;  2B1I A;  1YEW A;  4CH5 A;  2A3Q A;  5EC1 C;  2VQE B;  1K33 A;  4BAY A;  1CXZ B;  4YJ2 B;  2FML A;  2RCV A;  4B3S B;  1R3K C;  3TXS A;  3T1H B;  4YJ2 A;  1WLE A;  1YF2 A;  2JVD A;  5J2U B;  1HR0 O;  4FLT A;  4CH4 A;  2LW1 A;  3K58 A;  4LR3 A;  3RGB A;  3BFR A;  3QG5 A;  3VBB A;  4QIW F;  1UPG A;  2X6B A;  2KSD A;  4DR3 O;  1BS3 A;  1CEZ A;  1H2M A;  3BA8 A;  4MTO A;  5KX5 B;  4ZI7 B;  1K34 A;  1ZL8 B;  5KX5 A;  1ZL8 A;  5CA1 B;  4X65 O;  2EIJ B;  2GSM B;  5CBF A;  1V55 B;  4DW1 A;  5CA1 A;  2PF4 E;  1K8A W;  1N34 B;  4LF8 B;  4DR6 B;  2WWW A;  1MZE A;  1D2D A;  3ASO C;  1CPY A;  2EIN B;  1H8E G;  4UB6 Z;  3FKS G;  1L0L H;  1FJG O;  3FX7 A;  3H01 A;  1WJZ A;  5IT9 N;  4L8J A;  3HKD B;  1HDJ A;  3FAV B;  3HKD A;  2YI8 A;  1NVP D;  3L71 H;  1G1X B;  3VQW A;  3SJQ C;  4X89 A;  4QJF B;  3BA9 A;  2Y0P A;  2VWJ A;  4N23 A;  1ORQ C;  4XBF A;  3LDE A;  3RYF B;  4DUY O;  4MSW C;  4JV5 B;  1IBL O;  3RYF A;  1IBM O;  5CMU A;  5JJE B;  2PY5 A;  4H33 A;  3N2G B;  1ZUQ A;  2E74 B;  3LSS A;  2X0L A;  4J10 A;  3ZRS A;  4QGP A;  4J80 A;  4G28 B;  1P7B A;  3K5O A;  1CP9 A;  5HFL A;  1XI1 A;  3A2F A;  3G6E V;  2H3O A;  4WCE V; 
#chains in the Genus database with same CATH homology
 1YJN V;  3A0R A;  4TSF G;  2ZDI A;  1KC8 W;  4F4L A;  2DQ3 A;  2EJR A;  4LP8 A;  1BMF G;  3E8F A;  4U7N A;  2KB1 A;  2NLJ C;  3SYP A;  1GM7 A;  3W7X A;  2NNU A;  1FS0 G;  5J9P C;  3OEH G;  1YI2 V;  2XAQ A;  2Z5U A;  1NBM G;  2Y48 A;  4N21 A;  2WLH A;  1VQ8 V;  3ABT A;  3GWO A;  1VQ9 V;  3F5W C;  1AI7 A;  5E1A C;  1NKD A;  5LGU A;  1VQ5 V;  2EIJ C;  3LDD A;  3GB7 C;  1JJ2 U;  3OW2 U;  3D36 A;  2H94 A;  3T4Z A;  2JJ2 G;  4JAU A;  1P4R A;  3SYQ A;  3ABU A;  2DYR C;  1M90 W;  4P9P A;  3FYE B;  4GX1 A;  1RM1 B;  3CP1 A;  3JD0 A;  5B1B C;  2XAH A;  3JYC A;  4L87 A;  3K04 A;  1NH2 D;  2ZQM A;  1AI5 A;  4WFH A;  3G4S V;  1MG1 A;  4LC1 A;  1H2G A;  1VQ7 V;  4J9Y B;  4LBE C;  3T2M A;  1B6Q A;  4WFE A;  1BHB A;  2GHY A;  2LFR A;  1E1R G;  4BW5 A;  3ABL B;  1R3I C;  2OCC C;  1R3L C;  4RQE A;  2IJK A;  2A79 B;  1K73 W;  1DTO A;  4ZKI A;  2XOK G;  3E8B A;  3NXS A;  4JAV A;  4QNH B;  1GKF A;  3T1C A;  3OGC C;  2QM8 A;  2Y69 B;  4HYO A;  2AHY A;  2QA4 V;  1V54 C;  1EZJ A;  1K5Q A;  3IFX A;  3K03 A;  1EBO A;  2AHZ A;  3ZRW B;  5KA5 A;  5FL7 G;  1BHA A;  1OCZ B;  3ZRW A;  5LHH A;  1M57 C;  1N8R W;  3F7V C;  4BIZ A;  1VQO V;  4R50 A;  4PEL A;  3ABK C;  4YXW G;  1G4Y B;  4Z1M G;  1KQS U;  1QLE B;  1Y4M A;  4JPR A;  1OCC C;  2WLJ A;  4UVC A;  1FFT B;  4XDL A;  1PL0 A;  2WLL B;  3IGA C;  1DF5 A;  4I9W A;  1ENV A;  2WLL A;  4JF3 A;  2ZXW C;  5LGN A;  3RBZ A;  3ZMT A;  3CMA V;  4GX5 A;  3ZMV A;  2Q67 A;  2ZDI C;  3SYA A;  3W7W A;  2JJ1 G;  5B3S C;  5DN6 G;  1VQM V;  1NR1 A;  2DYS B;  5B1A B;  3OMA B;  1JX9 A;  3AG3 B;  1OHH G;  1S5H C;  3AG1 B;  1SER A;  4MT8 A;  3CPW U;  1VQL V;  4KUM A;  3OR6 C;  1GMG A;  3QO5 A;  1Q82 W;  3K9A A;  1QLN A;  4FPP A;  1MOF A;  2IU3 A;  2A9H A;  3OFN G;  1NQT A;  3ZCC A;  2HKO A;  1NR7 A;  4I5S A;  4QPJ A;  3UM7 A;  2IH1 C;  1E79 G;  5L3C A;  1K92 A;  2P67 A;  5CN0 A;  1YJW V;  1OCR B;  3CCJ V;  2A0L A;  1K97 A;  3OUF A;  5KA6 A;  3KG2 A;  3K79 A;  4H37 A;  3LSQ A;  1YTF B;  1R6K A;  5LHI A;  2BOB C;  1G8M A;  1TUE B;  3CME V;  3M99 B;  1IXM A;  3ABL C;  2EZP A;  3B8N A;  4OXS A;  1J95 A;  1QCE A;  5L3F A;  4P30 A;  4JTC B;  3SPI A;  3SYO A;  3ZMS A;  2Y69 C;  4P2Z A;  3ETG A;  4FIP C;  3AG2 B;  3STL C;  4ZBM A;  2HJF C;  3OAA G;  3ETD A;  5BZB A;  1K9M W;  1YSC A;  1SRY A;  5EBL C;  3FB6 C;  2QE7 G;  1OCZ C;  3OUS A;  1M9N A;  4WFF A;  3W7T A;  4PA4 A;  5IYD O;  4PA7 A;  2JDI G;  4R8C A;  1V55 C;  2WLI B;  3WG7 C;  2WPD G;  4CBC A;  2M7W A;  3F7Y C;  5H6Q A;  4MVR A;  1QLE C;  3CCS V;  1GM8 A;  1GTO A;  4R7C A;  2UXX A;  3P32 A;  3SPH A;  1AJP A;  1W0K G;  4JTD B;  1R6N A;  2EIN C;  2EIK B;  4WFB V;  3E86 A;  4DO2 A;  3JCZ A;  1VQN V;  5IDJ A;  5B1O A;  1YJ9 V;  2Q68 A;  1KP2 A;  2IH3 C;  3ZN0 A;  2LP7 A;  3OE7 G;  1PNM A;  1JQ0 A;  4G27 B;  3CCQ V;  3CD6 V;  2BOC C;  1RPO A;  1GM9 A;  2X6C A;  4J9Z B;  1HWY A;  2DWD C;  4MVQ A;  4X8A A;  1FXK B;  1F4M A;  4MTG A;  1FXK A;  2XAJ A;  3OMN B;  2P6J A;  1R73 A;  5B1A C;  4MTF A;  3UKM A;  2ATK C;  2HVK C;  1SES A;  1K4D C;  3AG1 C;  2EIL B;  5H6R A;  1GO3 F;  2R9I A;  3E35 A;  1AJN A;  3CCR V;  3CCU V;  3PJS K;  3OR7 C;  3E8G A;  3FB8 C;  5L3D A;  4MW3 A;  3CCM V;  1YIT V;  4DXW A;  1M56 B;  3TET A;  1PKX A;  1W2B U;  4XDJ A;  1RPR A;  2B5U A;  2IW5 A;  1JVM A;  1OZ0 A;  3B77 A;  1QR9 A;  3QO8 A;  3X2Q B;  1XL6 A;  1QVG U;  3CXC U;  1WPX A;  1Q86 W;  3E2E A;  2UXN A;  3HPL C;  4JYB A;  4X88 A;  2Q6A A;  1DLB A;  1JCH A;  3D3I A;  4PA6 A;  4JYC A;  3G71 V;  3SPC A;  1MSW D;  3TCU A;  1FXH A;  2ZR3 A;  1OCR C;  1KKD A;  3CYO A;  2PI5 A;  4MTX A;  2Q69 A;  2W6J G;  3K08 A;  3AG4 B;  3ML0 A;  1R3J C;  3T4D A;  5IYC O;  2IJH A;  2D3O W;  2QEX V;  5KUM A;  3ABM B;  1MAB G;  3K0D A;  3EHB B;  2V1D A;  1ROP A;  2QTO A;  3IC7 A;  2WSS G;  3I55 V;  1VQP V;  3B8M A;  5B1B B;  1KD1 W;  3FB7 C;  3AG2 C;  3R65 A;  4GX2 A;  4PDR A;  1E1Q G;  3STZ C;  1H38 A;  4GX0 A;  2IU0 A;  1H8H G;  3K06 A;  4CZZ A;  5HFM A;  1NJI W;  4HAM A;  5L3G A;  1K7D A;  4U7O A;  2JEX A;  4JAS A;  3K0G A;  1AJQ A;  1YIJ V;  2HLD G;  4MVS A;  2HFE C;  2OCC B;  2LFS A;  3LNM B;  2WAM A;  2P90 A;  5DM6 V;  3ZMZ A;  1RM1 C;  3DGE A;  4QE7 A;  5KUK A;  1UJW B;  5EK0 A;  1XL4 A;  3LUT B;  1QR8 A;  3OMI B;  4FK5 C;  1VQK V;  1YHQ V;  2XAG A;  3OM3 B;  5CBG A;  4UV9 A;  2K1E A;  3I56 V;  2EZO A;  4GT1 A;  4PDV A;  3DTU B;  5B1N A;  5LBQ A;  3QO7 A;  1OCO B;  2IJI A;  4P9O A;  1I5Y A;  1YTF D;  4FMT A;  2OTL V;  3JD2 A;  3MHS C;  4KP4 A;  2JIZ G;  5C93 A;  5IY5 B;  2HG5 C;  1OCC B;  4UVA A;  2CK3 G;  4RQF A;  1K3E A;  1SET A;  2HR3 A;  3ASO B;  1ZWI C;  3RVY A;  3K3W A;  1BL8 A;  1QVF U;  2Z3Y A;  4MVU A;  4TWK A;  1PD3 A;  1F4N A;  2W6I G;  3JD4 A;  1AR1 B;  5EC2 C;  1M56 C;  2ZXW B;  1ARO P;  4MVO A;  3BEH A;  4QPK A;  2C2A A;  1S77 D;  2F43 G;  1QBZ A;  2YEV B;  3OEE G;  3SYC A;  3ASN B;  2V7Q G;  2WLI A;  2X6A A;  2XAS A;  3X2Q C;  2YEV A;  3BY6 A;  1PNK A;  5B3S B;  3CCL V;  4KFM A;  3MD0 A;  3TK1 A;  2EBO A;  2ITC C;  3E83 A;  2WLM A;  1F23 A;  2QM7 A;  5EBM C;  3VOU A;  3ZIA G;  3MHH C;  1K4C C;  1S3J A;  2WLK A;  5CA3 A;  5L3B A;  2IJJ A;  5IYB O;  2FTK A;  5H9C A;  3AEI A;  3RVZ A;  3AG4 C;  1FXV A;  3W7U A;  2B1I A;  4FJC C;  2EIM B;  5EC1 C;  3ZRX A;  3SPG A;  3CC2 V;  5LGT A;  5GW7 A;  3ABM C;  1K33 A;  1SZT A;  3RW0 A;  4BAY A;  2DYS C;  1W0J G;  1R3K C;  3JD3 A;  3P30 A;  1WLE A;  3AG3 C;  3ZRV A;  4MVM A;  2DW4 A;  3FYI B;  1NH2 B;  4UVB A;  4UV8 A;  4WF9 V;  3HB3 B;  1JPX A;  4XDK A;  2ZD9 A;  2WLN A;  3EFF K;  4G2K A;  4PDM A;  4PA9 A;  3W7S A;  3CC4 V;  2W0F C;  3VBB A;  4QIW F;  2X6B A;  3JD1 A;  5CBH A;  1AI6 A;  1CEZ A;  1S72 V;  2B1G A;  3CCE V;  2DQ0 A;  2ITD C;  4MTO A;  1PNL A;  1LNQ A;  1K34 A;  1Y66 A;  1Q7Y W;  1I5X A;  2EIJ B;  3CC7 V;  2GSM B;  5CBF A;  1V55 B;  1S76 D;  4Q20 A;  3LDC A;  1GK9 A;  3WFV A;  3WG7 B;  5LHG A;  1M1K W;  1OCO C;  3ZN1 A;  1KP3 A;  2YSU B;  1VQ6 V;  1Q81 W;  1K8A W;  2MK3 A;  4MVZ A;  2X7R B;  4MS2 A;  1F51 A;  5IY5 C;  2DYR B;  2WWW A;  2XAF A;  3ASO C;  1CPY A;  2HVJ C;  1AI4 A;  2EIN B;  1H8E G;  2JK5 C;  3ETE A;  4RAI A;  3FKS G;  4PDL A;  3H01 A;  4GCZ A;  4TT3 G;  2OTJ V;  1NVP B;  4JTA B;  4RUF A;  2XND G;  3FB5 C;  1NVP D;  3ASN C;  4BIU A;  4PA3 A;  4MW8 A;  2OT5 A;  4X89 A;  3SJQ C;  5EBW C;  4QJF B;  4R6Z A;  2R9R B;  4E2L A;  1COW G;  1DF4 A;  4N23 A;  4RO2 A;  4UUJ C;  1ORQ C;  4WFA V;  1L1F A;  1K5S A;  4XBF A;  2EIK C;  3LDE A;  1V54 B;  4MSW C;  2QKS A;  4EKW A;  1KEC A;  1EFR G;  3SPJ A;  5CMU A;  4HZ3 A;  3CCV V;  4H33 A;  1M57 B;  2EIM C;  2P7T C;  1FXK C;  4JGS A;  4QE9 A;  1VQ4 V;  4LCU C;  3ABK B;  2X0L A;  3LSS A;  2JEU A;  2DWE C;  4RUE A;  3ZRS A;  5L3E A;  4UXN A;  3ZJZ A;  3E8H A;  2PI4 A;  2EIL C;  2ZR2 A;  4G28 B;  3E89 A;  1P7B A;  1JOY A;  3QNE A;  1S0V A;  1CP9 A;  2H8P C;  5HFL A;  4WFG A;  3ZMU A;  3G6E V;  4ASU G;  1THZ A;  4WCE V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...