1OHHG

Bovine mitochondrial f1-atpase complexed with the inhibitor protein if1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
272
structure length
94
Chain Sequence
ATLKDITRRLKSIKNIQKITKSMKMVAAAKLCGAIHSSVAKQTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit alpha, mitochondrial
publication title The Structure of Bovine F1-ATPase in Complex with its Regulatory Protein If1
pubmed doi rcsb
source organism Bos taurus
molecule tags Synthase
total genus 39
structure length 94
sequence length 272
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ohhG00
1OHHG 4Z1MG 1W0JG 5FL7G 4TT3G 2EJRA 2WSSG 3OEEG 4YXWG 5H6QA 1H8HG 4TSFG 2XAFA 2WPDG 2Z3YA 4XBFA 2JDIG 2X0LA 5LGNA 3ZMZA 2XNDG 5L3DA 2V1DA 5L3FA 1E1QG 3ABUA 1COWG 5L3BA 3ZMTA 1NBMG 5DN6G 3ZN0A 2UXXA 3ZN1A 1W0KG 1E1RG 3FKSG 1E79G 5L3GA 2XOKG 2R9IA 1BMFG 2XAQA 5LBQA 4CZZA 3ZMVA 4UVCA 1FS0G 4KUMA 5LHHA 5LHGA 2UXNA 4UV9A 2DW4A 2XASA 2H94A 2JIZG 4UXNA 2Z5UA 2QE7G 2XAGA 4BAYA 2W6IG 2JJ2G 3OFNG 5L3EA 3OEHG 2XAHA 2W6JG 2HKOA 1EFRG 2F43G 1H8EG 2HLDG 5L3CA 3ABTA 4ASUG 3OE7G 2CK3G 3ZIAG 4UV8A 5H6RA 4UVAA 2V7QG 2JJ1G 2XAJA 4UVBA 1MABG 3OAAG 5LHIA 5LGTA 5LGUA 3ZMSA 3ZMUA 2IW5A 2Y48A
chains in the Genus database with same CATH superfamily
2YIBA 4X1IA 3H1HH 2Q67A 3WG7B 1DF5A 2EJRA 2DE0X 3OT7A 2UXBB 3A8TA 2RDCA 4RQEA 3DC6A 3TK1A 1HR0O 2OCHA 4XBFA 1O9HA 4RUEA 2FL4A 2XNDG 4U7OA 1VQ9V 2YI8A 3X2QB 4B3RB 4LF9O 2DMXA 1P49A 2DWEC 4HBNA 4XDJA 4UCSA 3PJSK 4NXNO 4YJ2A 3H1KH 3JYCA 3UO2A 3CC2V 2HJDA 2YXHA 2ATKC 4KXRA 1SC5B 4X66O 1YSCA 1B04A 1SA0A 3CRQA 4HYOA 4JV5O 1XMQB 4JI7B 1JPXA 4WF9V 4CS3A 3JALB 5GTHZ 4PA9A 2P22C 1AROP 2UXCB 3JARA 1N34B 2JRIA 1QLEC 1NH2D 2QKSA 4LF8O 1K9MW 1XHZA 3R66A 4LF5O 2E74B 1M4UA 2ITCC 1FFTB 2Q69A 4GKKO 3CP1A 1NT2B 5KHJA 1BZKA 5JH7B 3K5LA 4YY3O 5EZYB 4IIJA 1M57B 2UUBO 3K79A 3X2QC 5LHIA 1WNSA 2WLNA 1YXBA 4DV6O 3OUFA 2IW5A 1BE3H 1FFXA 2A7WA 3G67A 2HVKC 1Y6XA 4GKJO 3MHSC 4P2ZA 2PI5A 1AJNA 4YXWG 3D8CA 4OPHA 2P6JA 3WB1A 1N32B 4JAVA 3TETA 5LYJB 2JDIG 4FM1A 3L73H 1K4DC 4I0XA 3SPHA 1SKVA 4MSWC 3I56V 3W7UA 3VBBA 2DJVA 3OR6C 1PV0A 1WA8A 1CP9A 1XL6A 1QR9A 4J41A 1VQPV 5BMVB 3J81N 4B7EA 4DV1B 1HNWO 3S3XA 2UU9B 3DSQA 1T5EA 1D5AA 2QGNA 3SYPA 1DGSA 1HP8A 1YI2V 2F1MA 4BIZA 4JI6B 2ZE5A 3ZRWA 4DK1A 1JFFA 2LP7A 5FPOA 3AG7A 1MZEA 4J7ZA 2YEVB 2R72A 4X1YB 4MVUA 3RBZA 2QE7G 4DV4B 4U3JB 4PD4F 4DR5B 3F7VC 4ICGA 2Q73A 5EIBD 3THOA 4BW9A 3RFRA 1I94O 2HKOA 5LP6C 3T2MA 1YJNV 3ZEDA 4NTYA 4IGGA 1OCOB 1AP5A 2Q0OC 3RYFA 2FMLA 1H8EG 4UCRA 4DYLA 3CPWU 5JWPA 4I9WA 2AGAA 1XDCA 1YTFB 4PA6A 3I5DA 5JVDA 2WLHA 1XOUA 1W59A 2Y48A 1BQ0A 1EN6A 1ZL8B 2EIMB 1BGYH 2EZPA 3JSNA 2Q0AA 2WA4A 4OXSA 2CH7A 2Z3YA 3FYEB 1XNQB 4YJ3B 1H2SB 3CE2A 3ZMZA 4AQYO 1VQ5V 3LDEA 1IBMO 4LWSA 5CBGA 3BA9A 5KX5A 4YHHB 2VWJA 4TV9B 2Q8VA 1NJIW 5B3SC 2ZDIA 5B5EZ 4ZOLA 1Q82W 1VIBA 5D5PA 3ABMB 4LF4O 4B3MB 1JJ2U 1DF4A 1FJGB 2B1GA 1N36B 1OCOC 3T1YB 5LA6A 5KHHA 3CCJV 3ZMVA 1BS3A 5ITZB 5LHHA 3ABLC 2CE4A 1FYJA 1Q7YW 1S5LZ 3K04A 4JTAB 3VQYA 3ZHSA 4LF6O 4UCVA 4CH3A 2UUAB 1Y74A 5L3EA 5LMUO 3UT5B 4LH7A 1GTOA 5J2TA 1MSDA 4JI4B 1SZXA 3CC4V 3EHBB 1Y76B 3E8GA 2EINC 4DV0B 5K1PA 1MMMA 1NVPB 1AVMA 5C8YB 2ZE8A 4XDKA 4K8ZA 3K5NA 2JEXA 3DXRB 4UB8Z 3JAKB 4O4JB 3ZMSA 1I5YA 1VF6C 1Z5VA 2WLJA 1FXKC 5IYZB 5B1OA 1PKXA 2CDYA 3RVZA 1W0JG 4B3SO 4C7UA 4DR6B 2IJKA 3ZRXA 1M56C 1XMOO 5FLXN 4DR3O 3HKCA 5LGNA 2EILC 2NNUA 2RN9A 3T1CA 3L74H 1CXZB 2H3OA 3AG1B 3BEHA 3HKEA 1E1QG 1VF7A 1LUWA 1QQCA 5CA1B 1M9NA 2OIEA 4UCOA 3CRMA 4FLXA 1SZTA 4B08A 3OR7C 4NXMO 1IBLO 4DR7B 1K73W 2NN4A 2N74A 3LDDA 4NVPA 4JYAB 1NS1A 2R9IA 1K97A 3MD0A 1TGOA 3LNNA 5JQGB 3ABKB 1S76D 4CZZA 1SS3A 2ODMA 2QTOA 2P06A 3BRCA 1RM1B 5IWAO 1FXKA 1N4CA 4JI0B 1GM8A 1TAEA 3CCQV 2QR4A 5J2UA 2XAGA 3BABA 3B77A 2EIJB 1B6QA 3ZRVA 2IJHA 4GLXA 4X64B 4DW0A 2JK5C 3E2EA 3DC5A 1PNMA 2IM9A 4LR3A 3B8NA 1MZFA 3RYHA 3MHHC 2PTMA 4K0KB 4JYBA 2IH3C 4JI1B 3D3IA 2ZXWC 4W4KA 5CB4B 1J5EO 1Q6UA 1YF2A 1HW7A 4JPRA 2CUGA 1HWYA 3AEIA 4DUZO 1HNXB 4TV8A 5KUKA 2F4VO 1UPGA 3TGUH 1VMGA 3D36C 4O4LA 1AB3A 4E4EA 1J95A 2KKWA 2XAFA 1L8DA 1ZWIC 4QGPA 2VQFO 1VQ8V 3OTOB 2KQXA 3T1HO 1S3JA 3T4ZA 3ZHRA 4LFAO 3SJBC 2DYSB 4W4LA 3AG3C 1SQXH 2ADPA 1WP7A 1OCCB 3ZN0A 3ZN1A 5BR8O 5A2QN 3B2EE 3CCEV 1QNMA 2GUZB 3HKDA 1G4YB 5L3GA 5TISZ 4FFBA 5IDJA 3HKBB 4YJ2B 2M7WA 1TUBA 4O2AA 4MVZA 4JI3O 3W7SA 1IBKB 1H2NA 4O4IB 2ZIOA 4E2LA 4ZI7A 2QWOB 2IU0A 2UXDB 2JS5A 1SA0B 2JIZG 5LXTA 1X4TA 3CRRA 4H37A 1PL4A 1KYOF 1QU7A 3L72H 3WU2Z 2X6BA 3JAMN 1R3LC 3E83A 1HR0B 1XNRO 2GHYA 5EC2C 3N27A 3M7MX 3ABTA 5L3CA 1JQ0A 4LP8A 3WB2A 2ADQB 2Q7GA 3OMNB 1N33B 5JJJB 1TUEB 4LF9B 1XILA 1AJPA 1OJHA 4IHJB 1QR8A 1M1KW 2Q68A 4DRXA 4X1KB 2BE3A 4KHPO 1WPBA 2YC0A 3CJHA 3IGAC 4PELA 2QWQB 1EM1A 2BTQB 4MVMA 3ASNC 4JYCA 3LSUA 4B3TO 4R8CA 3B4SA 1GMGA 4WFFA 5EYPA 1M90W 3OEEG 3K57A 1PNKA 2IH1C 3AG2C 5GTIZ 2DQ0A 4JV5B 3HPLC 1LR1A 1A32A 2F66C 1QCEA 2NLJC 1V9PA 3E22B 3KCXA 2QJ1A 1QLEB 4FPPA 2V1DA 4PA7A 3CMEV 1B06A 1K7DA 4I0XB 2HHHB 1NU1H 2HP8A 3K0GA 3APOA 5L3BA 4LF5B 3ZJZA 1NBMG 4LBEC 2Q4PA 2GTAA 4X62B 2BOCC 4MT8A 4MTFA 1BMFG 2LW7A 2VS0A 2UUBB 2X7RB 1R73A 4TOIA 3ZRWB 3OUSA 1JFFB 1MA1A 2ZKOA 2BSKA 3OTFA 1Q3EA 1Q81W 2ZD9A 4U7NA 4JI8O 3KKYA 2F43G 3RGBA 1UJWB 1FPOA 4DR1O 1VP7A 4GUNA 4FFKA 3JAWA 2NR5A 3JASA 5D5QA 5EK0A 2AZ2A 3RYFB 2CK3G 4F6RA 4DR2O 2E5LO 5JJEB 2CTWA 1SETA 4JYYA 1K4CC 2QKCA 2WLMA 2GV9A 1BHBA 5IJ0A 4LFCO 1FKAO 3U11A 1YITV 4JI2O 1R6NA 4J9ZB 1GN4A 1KBHA 2RJZA 2E75B 3TXQA 2K9PA 5FL7G 3J80N 4WBNB 2ZE6A 2YXLA 1AR5A 3CCVV 3G71V 3D3QA 1ROPA 1H2KA 2YIAA 2WA3A 4CC5A 1S5HC 4G28B 1F4MA 4LNUA 2WLKA 4FLZA 2UXBO 3ETGA 4DR4O 5LP6B 4LWSB 3W7XA 2CTQA 3F7YC 5KMGA 1R6TA 4NYKA 3L71H 4EFEA 1S5JA 3WFVA 1Q6HA 3AG4C 1Q86W 2P5OA 1KP3A 3CXCU 5A9GA 5LOVA 2BTOA 2GTSA 3SR2C 1WAZA 1Q6IA 1PNLA 1KU9A 1GM9A 3C90A 3A0HZ 3CWBH 1EZJA 3OD4A 1VF5B 3F5WC 1FS0G 1S0VA 1RP3B 5LA6B 3GB7C 4DV3B 2YICA 4DV5B 2Z0AA 3UO3A 1RSOB 4I5SA 3SPCA 4EKWA 3OFNG 1WP8A 4DO2A 3L75H 2B9ZA 3K5OA 2WAMA 3CEIA 1YTFD 4Q6GA 1QBZA 2W6JG 1HDJA 4O4HB 2N05A 2A9HA 3U0ZA 5J2TB 2QM8A 1D5NA 2R9AA 3SJQC 2A3QA 4KL1A 5IJ9A 5IYCO 1N34O 4AQYB 1IBMB 2B1IA 1V55C 4L87A 1D2DA 3ML0A 4FM2A 2PZSA 4J42A 2Y69C 5B3SB 1SQGA 4CH5A 2F93B 1OCZC 2DQ3A 5IY5B 1F51A 4LF4B 1MSWD 2VQEB 3JD1A 1FXVA 1OHHG 5EBMC 4ZIBA 2F23A 2P4VA 1I5XA 2ZDIC 3ABLB 5LMNB 5DECA 1SQQH 2KG7B 2JGDA 2P90A 1FAFA 2ETNA 2RMKB 4PDRA 1OCRC 3FB6C 2JS3A 1JJOA 2EBOA 3OGCC 3ZS8C 2IU3A 1NTMH 5BZBA 3CYOA 1WB7A 3FAVB 3JALA 1JR9A 5LMUB 1N32O 3LDCA 1COWG 1JCHA 5DN6G 4GX1A 4CH4A 2A79B 1VARA 3QF7A 2EINB 2Q5ZA 3A0RA 4OX9B 3OW2U 3RT3C 3VQVA 4DV1O 2XHBA 5LBQA 4FVMA 1R3KC 3EFFK 3CCRV 1R6KA 3M99B 2Y4UA 3K06A 1YJ9V 4CH6A 1FXKB 2HFEC 2CTPA 1KKDA 4JI6O 1U96A 1W2BU 2YSUB 4ABMA 4LF7O 4DK0A 5IY5C 5J2UB 4B3SB 1EZVH 4G2KA 1NVPD 1L1FA 5CMUA 1K34A 3WB0A 2V4DA 2ZM6B 1NR1A 1THZA 1M56B 2H8PC 2EILB 4DR3B 1G1XB 3JSLA 4JTCB 4EB6B 1IDSA 4DR5O 3OMAB 1R3JC 4I55B 1P4RA 5BY1A 3JD4A 5LYJA 2QM7A 3DTUB 3SGIA 3VQXA 3E8BA 3JCZA 2ZIMA 2LFSA 4I9QA 3FX7A 1NKDA 5LGUA 3B8MA 1URFA 5BMVA 4I4TA 4ZHQB 2MK3A 4TV8B 3JATB 2XUMA 2WLIA 1CEZA 5GONB 3E89A 2KB1A 1DLBA 1XQ8A 1H38A 2ITDC 4LCUC 2AW9A 4Z2WA 1TVKB 4D7SA 5KAIZ 2OTLV 2YEVA 4DW1A 4F4LA 1K5QA 1EN4A 3T4DA 4PI2A 4I50B 4RO2A 1HNZO 1JVMA 5EIBC 5B1BC 3NR7A 1KECA 2Q7HA 5B1NA 2QWPB 4O2BB 4AHCA 4D7TA 3ASOC 3UQ8A 3N2KB 3BFRA 4HNAB 4P9PA 2P4KA 4FM0A 3ZHQA 2ZXWB 3QNEA 2G38A 2WWWA 3SYCA 4GCZA 1UFIA 4FFBB 4QIWF 5JCOA 2LQTA 4H44B 2ILMA 1TUBB 4O2AB 4ZBMA 1VQKV 1L0NH 1Z2GA 2DN9A 3A2FA 1Y66A 3BY6A 5CA3A 4NR1A 5LXTB 3CMAV 1R3IC 2UUCO 4JAAA 1AI7A 4QJFB 2HEPA 3SYQA 2Q6AA 1AR1B 1SQFA 1YHQV 4R7CA 2VQFB 2JEUA 4ASUG 1GH6A 2WLLB 5BXZA 3ZIAG 1F4NA 3ICXA 4BWAA 2FKXA 3AG3B 5H6RA 3CRAA 1IZ3A 3DGEA 1XI1A 4MVSA 3Q4HA 1US6A 2L35A 2MW2B 3GWOA 4KFMA 4TV9A 3R65A 5EC1C 2GDSA 3BAAA 4QE7A 1K3EA 4WFGA 1SERA 1XUQA 4TUYB 1WB8A 4RUFA 4X89A 2P7TC 2QEXV 3LNMB 1AI6A 5IT9N 2K1EA 4N23A 3LSQA 5KHKA 2X0LA 5ITZA 4HAMA 3ZBHA 1DK1A 3TXSA 4JZ2A 5L3DA 3ZHTA 1IVSA 4DR6O 1V54C 3RW0A 1KUQA 1QVGU 1ZLZA 3UM7A 4X1IB 1XNRB 1XL4A 2Q9LA 3UT5A 4BIUA 4YIPA 3BCCH 3E8HA 1YIJV 3P3NA 2HVJC 1GN2A 1MOFA 3TJTA 3SPJA 2OCCB 4X9QA 3K59A 4X8AA 4JASA 1Y76A 3H1JH 3NXSA 3ASNB 1M5IA 1YJWV 5CA0A 5KAFZ 5C8YA 3SPIA 1YCIA 4B3TB 4JYAO 2PF4E 2ZQMA 3DXRA 2PUSA 3JAKA 4O4JA 2CAZC 1JA8A 4RQFA 3K03A 5FNVA 3AG2B 4JI0O 5IYZA 4PDMA 4PDLA 1NTKH 4H0LB 4OGQB 2X6AA 3KCYA 4X64O 1ZX3A 4DUYB 4K35A 2JVDA 4OPAA 2XT9A 3W7WA 1K8AW 1H2GA 4IYHA 4F6RB 5H5NA 3QG5A 2W0FC 1PPJH 3K58A 2V7QG 4MTXA 3JD2A 5KA5A 4NTWA 4DV2O 2HG5C 5IJ0B 3JARB 4K0KO 1BL8A 3UKMA 4FLUA 4X20A 3PN1A 4JI1O 3OMIB 4J7KA 4FJCC 2LFRA 4P9OA 2DYRC 1YZBA 1N8RW 3APQA 3FB8C 2WPDG 5JQGA 2OCCC 4IIJB 2Q7EA 1WPXA 2RNBA 2C2AA 3CD6V 4NXNB 3IAYA 4D6TH 2PY5A 4N21A 1GN3A 3FD9A 2X6CA 3ABUA 1WJZA 3RYCA 4LC1A 1FFXB 3C3TA 1BSMA 3OTOO 4J11A 4DR1B 4X66B 2IJIA 1GRJA 3N2GA 1AP6A 4PHZA 1BQZA 1W0KG 1G6UA 2KSDA 4GT1A 4LFBO 4DR2B 1I08A 5CBFA 4MTOA 5LL6Y 4UVCA 4K3AA 3KG2A 3O9OA 4LFCB 4LF8B 1PL0A 3QTCA 3H1IH 4FZ1A 1WA8B 5CB4A 2Z5UA 4Q20A 4GKKB 3OGIB 2A06H 1G8MA 5B66Z 1IBKO 4YY3B 2UXDO 1AI5A 5KLVH 5IE9A 2LW1A 2ZR3A 1IX9A 5CBHA 1QVFU 4X65O 1IXBA 4JI5O 4JF3A 1N0JA 3K3WA 4GZRB 2JGUA 4PJ0Z 3VOUA 1SESA 2OWOA 4DV6B 5E79Z 3L70H 4YIOA 5IJ9B 3QVNA 4DR4B 2Y0PA 4UB6Z 3LSSA 4MVOA 4QPJA 1NR7A 4AI8A 1YVWA 4UVAA 4GKJB 5C93A 3AG4B 4CS4A 4RWUA 4XDLA 1N33O 4PDVA 2BOBC 4EEQA 5KUMA 4B7KA 4DV7O 4Z1MG 4TT3G 3CC7V 3MDSA 2GUZA 2PI4A 2FYUH 3HKBA 4TSFG 1PP9H 3G80A 3CHXA 5B1AC 3JD3A 5DEDA 5JJNB 4IYIA 2OYQA 1L0LH 3EXAA 2JGDB 4O4IA 1HNWB 3K0DA 3S3WA 3ETDA 3RYIA 5FPRA 5L3FA 5JVDB 5DM6V 1H2MA 3L9DA 1BHAA 3IC7A 1MG1A 3ZMTA 2P67A 1N0NA 1F7YA 4PI0A 3BPZA 2D2CB 5EBWC 2HHHO 1V55B 1M93A 2Y69B 5GW7A 3WG7C 2CH7B 4X88A 2XAQA 1FD9A 2YDEA 2M6YA 2XTAA 3ZHVA 1OCZB 2GBOA 4UV9A 4X62O 3AK3A 1I94B 4IHJA 1VQNV 5KX5B 3EVKA 5AG2A 4X1KA 1XBLA 2JJ2G 2BTQA 4JZGA 3FFQA 1RPOA 1IURA 2CGNA 4ZOLB 4B3RO 3OEHG 1GN6A 2AZ0A 4NTXA 1S72V 1EFRG 1VQ7V 3K9SA 1OCRB 1R1BA 1ZUQA 3ZHUA 2YI9A 3OE7G 2IBZH 4JGSA 1Z5WA 3STZC 3CCLV 1NH2B 2AHYA 3E22A 4FLTA 4K8XA 1MABG 2PYLA 1X59A 3F5TA 5IYDO 3SJAC 3K9AA 1XMQO 4JI7O 1Y74B 4UUJC 3SJCC 1F23A 3B09A 2UXCO 1MNGA 3MAQA 1Y4MA 4I4TB 1JMKC 3ETEA 2Y0IA 2WLIB 3H9VA 4FZ0A 2YIDA 4MS2A 5KA6A 1BCCH 4LF7B 2D3OW 3CSXA 3HR0A 1AILA 2QA4V 1SQVH 3SYOA 1M57C 1ZTEA 3ZRSA 1P84F 2LJ2A 5F2VO 1VQ6V 1OV9A 2OIGA 2ZR2A 5EBLC 1K92A 3BVOA 3ETQA 3AK2A 2ZE7A 4PA4A 4LF6B 2OT5A 3HKCB 4KUMA 3QO8A 2UXNA 2ZT9B 3HKEB 1KKCA 1SQBH 1FXHA 1LNQA 3SYAA 4UXNA 3CS5A 3K08A 4FK5C 2QTSA 2XAHA 3A0BZ 4IT5A 4DV3O 4DV5O 1SF9A 5JH7A 4WBNA 2UU9O 3FB7C 4AILC 1Y67A 5EZYA 2ARHA 1XEQA 4RAIA 4QNHB 1HNZB 5B1BB 1BT8A 2QKAA 3STLC 5HFLA 3ASOB 5LGTA 4TQDA 2B5UA 4PV1B 3GVMA 5LP6A 3Q4HB 3CCSV 1XMOB 1Q5OA 2HJFC 4DV4O 3G4SV 2WSSG 4WFEA 3B40A 3P32A 3RYHB 2N04A 3VQWA 5H6QA 2VQEO 1VQOV 3RN4A 1VQMV 3K5MA 3ZX6A 1JOYA 1XREA 5JCOC 5LMNO 4J9YB 4NXMB 1IBLB 2UUCB 1RSOA 1I7FA 4L8JA 1KQSU 4FLWA 3KZIZ 1ENVA 2CGOA 4O4LB 5IWAB 4H13B 5CN0A 1E79G 4O4HA 1EBOA 2XOKG 3I55V 1NI8A 2YXYA 4J7JA 1YDXA 2EIMC 4X1YA 2QWNB 4G27B 3M8AA 4GX0A 1QLNA 4OX9O 2VWKA 2RQ6A 4U3JA 1XNQO 1B3QA 2EULA 5CA0B 2W6IG 4MVRA 1O9GA 3IJ4A 4CBCA 4YHHO 2QM4A 3IC9A 3CRCA 4TWKA 4UCUA 5FNVB 3RWRD 3HKDB 3FYIB 2LGQA 1RFYA 2EZOA 2ZINA 1J5EB 1RPRA 4WCEV 3QO5A 2L6LA 5J9PC 1V54B 3ABMC 4GYCB 4B3MO 1FJGO 2HR3A 3BHPA 2KG7A 2ZM6O 1N36O 4DUZB 4ZI7B 2F4VB 3T1YO 1VQ4V 3JD0A 1Q43A 1JX9A 3OAAG 5H9CA 4MTGA 2ZNJA 5KHGA 3FAVA 4NB5A 4CC6A 1ZL8A 2QWRB 1IXMA 5KHIA 1CPYA 4X20B 4I7ZB 2UUAO 3T1HB 4FIPC 4LFAB 1WLEA 4UFZA 3H1LH 2YIBD 4YJ3A 1EN5A 4JI4O 1KMIZ 3OM3B 1H2LA 4FLYA 1NZ6A 5BR8B 1K33A 5H2FZ 4DRXB 4DV0O 2QSAA 1VF6A 3CJHB 4NKGB 4Z1VA 4KP4A 2A0LA 4J80A 1AR4A 3RVYA 1ZSPA 1NTZH 4U3FH 4A5UB 3RYCB 2IJJA 4JI3B 4CS2A 2ZNIA 3LUTB 3E8FA 5EYPB 3CCMV 1E1RG 4QPKA 4WFBV 4MVQA 3N2GB 3G6BA 3C3SA 2FB5A 4EB6A 4WFAV 2EX3A 4I55A 2O57A 4MW8A 2RCVA 4DV2B 2DW4A 1OZ0A 2BCCH 2AXTZ 4BAYA 1GKFA 1KP2A 4BR6A 2DYRB 3AG1C 2F95B 4H33A 1SRYA 1P7GA 4ZHQA 3IFXA 3U10A 1ORQC 3JATA 2E76B 1LUVA 1K5SA 2HLDG 5GONA 4PA3A 4KHPB 2Y4TA 1TA8A 4GX5A 1GO3F 4DR7O 2ZCEA 2E3CA 4FLVA 1TVKA 2YS8A 4ZKIA 2BSKB 3P30A 4HZ3A 1U97A 4LH6A 2PYJA 3ABKC 2XAJA 3H01A 5E1AC 4R6ZA 1RM1C 4I50A 3BA8A 1GAXA 3ZMUA 1P7BA 3CX5F 1VQLV 4LFBB 1PM9A 4GX2A 3O65A 4O2BA 3QO7A 2EIKB 2FTKA 2EIJC 3N2KA 1GK9A 5HFMA 3JAWB 4HNAA 4J10A 3JASB 4BIOA 4EFBA 1H8HG 4JAUA 2R9RB 4MW3A 3SDLA 3J7AU 1SQPH 2YUAA 2W0XA 3HB3B 4WFHA 4F6EA 5CA1A 1YEWA 2LO1A 4P30A 1AI4A 1KC8W 3RYIB 1ZAUA 1S77D 3D36A 1Q90D 4X65B 3AK1A 5IYBO 2UXXA 2OTJV 2LGWA 3JCUZ 4JI5B 3CCUV 3FKSG 1HNXO 1WN7A 1QHTA 3E86A 3GWKC 1DTOA 2QDOA 3ZCCA 4JTDB 4TQFA 2WLLA 4UCTA 2DOSA 5LHGA 4LNUB 3CXHF 3W7TA 4JI8B 2XASA 2H94A 4DV7B 2R70A 5KMGB 1KD1W 1NQTA 2VRZA 5K1XA 5LOVB 2DYSC 2E5LB 4FMTA 2CTRA 3UCSC 3FB5C 5B1AB 2EIKC 4TUYA 3TCUA 1OCCC 4R50A 1I0HA 4BW5A 1XHXA 2DWDC 4UV8A 1Q8IA 1VEWA 2PGGA 4DXWA 4JI2B 2EJ7A 1GM7A 2GSMB 1KB9F 4IL6Z 4UVBA 2JJ1G 3G6EV 1AJQA 2AHZA 4QE9A 1PD3A 3CB2A 4DUYO 3SPGA 3P3PA 3E35A
chains in the Genus database with same CATH topology
4UUJC 2MK3A 2Q67A 1F23A 3WG7B 1DF5A 2WLIA 1Y4MA 2EJRA 1CEZA 1J95A 3ETEA 3E89A 4RQEA 2WLIB 2KB1A 1DLBA 2XAFA 1ZWIC 3TK1A 1H38A 4MS2A 1VQ8V 2ITDC 4LCUC 4XBFA 4RUEA 2OTLV 2YEVA 5KA6A 2XNDG 1S3JA 4U7OA 3T4ZA 4F4LA 1VQ9V 2D3OW 3X2QB 1K5QA 3T4DA 2DYSB 4RO2A 2QA4V 1JVMA 2DWEC 3SYOA 1M57C 3AG3C 5B1BC 3ZRSA 4XDJA 1KECA 1OCCB 5B1NA 3ZN0A 3ZN1A 1VQ6V 3ASOC 2ZR2A 3PJSK 5EBLC 3CCEV 1K92A 3JYCA 4P9PA 3CC2V 1G4YB 5L3GA 5IDJA 2ZXWB 2ATKC 3QNEA 2M7WA 2WWWA 3SYCA 4GCZA 4PA4A 2OT5A 4MVZA 4QIWF 3W7SA 1YSCA 4KUMA 3QO8A 4E2LA 2IU0A 2UXNA 4HYOA 4ZBMA 1VQKV 1JPXA 4WF9V 2JIZG 1FXHA 1LNQA 3SYAA 4UXNA 1Y66A 3BY6A 4PA9A 5CA3A 4H37A 1AROP 3K08A 3CMAV 1R3IC 4FK5C 1QLEC 1NH2D 2QKSA 1AI7A 2XAHA 4QJFB 2X6BA 1K9MW 1R3LC 3SYQA 2Q6AA 3E83A 1AR1B 2ITCC 1FFTB 2Q69A 1YHQV 2GHYA 4R7CA 2JEUA 5EC2C 5L3CA 3ABTA 3CP1A 3FB7C 1JQ0A 4ASUG 2WLLB 4LP8A 4RAIA 3ZIAG 4QNHB 1F4NA 3OMNB 1TUEB 5H6RA 1M57B 3AG3B 1AJPA 5B1BB 3STLC 1QR8A 1M1KW 5HFLA 3DGEA 2Q68A 4MVSA 3K79A 3IGAC 4PELA 3ASOB 3X2QC 5LHIA 5LGTA 2WLNA 3GWOA 4MVMA 2B5UA 3ASNC 3OUFA 4JYCA 2IW5A 4KFMA 3CCSV 3R65A 5EC1C 4QE7A 2HVKC 2HJFC 1K3EA 4R8CA 1GMGA 4WFFA 4WFGA 1SERA 3G4SV 5KUKA 2WSSG 3MHSC 4WFEA 3OEEG 4P2ZA 1M90W 2PI5A 1PNKA 4RUFA 1AJNA 4X89A 2IH1C 3P32A 3AG2C 4YXWG 5H6QA 2P7TC 2QEXV 1VQOV 2DQ0A 1VQMV 2P6JA 4JAVA 3LNMB 1AI6A 3TETA 3HPLC 2K1EA 4N23A 3LSQA 2JDIG 2X0LA 1QCEA 2NLJC 1K4DC 4HAMA 3SPHA 1JOYA 4MSWC 3I56V 5L3DA 3W7UA 1V54C 4J9YB 1QLEB 4FPPA 3VBBA 2V1DA 4PA7A 3CMEV 3RW0A 1K7DA 3OR6C 1KQSU 1QVGU 3K0GA 1CP9A 1XL6A 1QR9A 1VQPV 5L3BA 3ZJZA 3UM7A 1NBMG 1ENVA 1XL4A 4LBEC 4BIUA 3E8HA 5CN0A 1YIJV 1E79G 2HVJC 3SYPA 2BOCC 1YI2V 4MT8A 1MOFA 4MTFA 1EBOA 2XOKG 4BIZA 3I55V 3ZRWA 3SPJA 2OCCB 1BMFG 2LP7A 2X7RB 1R73A 2EIMC 4JASA 4X8AA 4G27B 3NXSA 3ZRWB 3OUSA 3ASNB 2YEVB 4GX0A 1YJWV 1QLNA 3SPIA 4MVUA 3RBZA 2ZQMA 2QE7G 2W6IG 1Q81W 4MVRA 3F7VC 4RQFA 2ZD9A 3K03A 3AG2B 4CBCA 4U7NA 4PDMA 4TWKA 2HKOA 4PDLA 3T2MA 1YJNV 2F43G 3FYIB 2X6AA 1UJWB 1OCOB 1H8EG 2EZOA 3CPWU 4I9WA 1RPRA 4WCEV 5EK0A 3QO5A 5J9PC 1V54B 3ABMC 2CK3G 2HR3A 3W7WA 1K8AW 1H2GA 1SETA 1VQ4V 1YTFB 1K4CC 2WLMA 3JD0A 2W0FC 1BHBA 2V7QG 4PA6A 4MTXA 1JX9A 3OAAG 5H9CA 4MTGA 3JD2A 5KA5A 2WLHA 2HG5C 1BL8A 3UKMA 1YITV 1R6NA 2Y48A 3OMIB 4J9ZB 4FJCC 1IXMA 2LFRA 1CPYA 4P9OA 5FL7G 2EIMB 4FIPC 2DYRC 1N8RW 2EZPA 1WLEA 3CCVV 3FB8C 2WPDG 4OXSA 2OCCC 3G71V 2Z3YA 3FYEB 1ROPA 1WPXA 3OM3B 1S5HC 4G28B 3ZMZA 1F4MA 1K33A 2C2AA 3CD6V 1VQ5V 2WLKA 3LDEA 3ETGA 4N21A 2X6CA 3ABUA 5CBGA 4KP4A 4LC1A 2A0LA 3W7XA 3F7YC 3RVYA 1NJIW 5B3SC 2ZDIA 2IJJA 2IJIA 3LUTB 3WFVA 3E8FA 3AG4C 1Q82W 1Q86W 1KP3A 3ABMB 3CXCU 1W0KG 1E1RG 4QPKA 4WFBV 3CCMV 1JJ2U 4MVQA 1DF4A 4GT1A 2B1GA 1PNLA 1OCOC 1GM9A 5CBFA 4MTOA 1EZJA 4WFAV 3ZMVA 4UVCA 3CCJV 3F5WC 1FS0G 5LHHA 1S0VA 3ABLC 3KG2A 4MW8A 1PL0A 1Q7YW 3GB7C 2DW4A 3K04A 4JTAB 1OZ0A 2Z5UA 4I5SA 4Q20A 4BAYA 3SPCA 4EKWA 1GKFA 1KP2A 3OFNG 1G8MA 2DYRB 3AG1C 4DO2A 5L3EA 2WAMA 4H33A 1SRYA 1AI5A 1YTFD 2ZR3A 1GTOA 1QBZA 2W6JG 3IFXA 5CBHA 1ORQC 1QVFU 2A9HA 1K5SA 2HLDG 2QM8A 4JF3A 4PA3A 3SJQC 5IYCO 3K3WA 3CC4V 3EHBB 3VOUA 1SESA 4GX5A 1GO3F 3E8GA 2EINC 2B1IA 1V55C 1NVPB 4L87A 3ML0A 3LSSA 4XDKA 4ZKIA 4MVOA 4QPJA 3P30A 1NR7A 2Y69C 4HZ3A 5B3SB 4UVAA 3ABKC 2XAJA 5C93A 3AG4B 3H01A 2JEXA 5E1AC 4R6ZA 1RM1C 1OCZC 2DQ3A 5IY5B 1F51A 3ZMSA 3ZMUA 1MSWD 4XDLA 1I5YA 3JD1A 4PDVA 2BOBC 2WLJA 1P7BA 1FXVA 1VQLV 1FXKC 1OHHG 5EBMC 5KUMA 5B1OA 4GX2A 1PKXA 3RVZA 3QO7A 4Z1MG 1W0JG 2EIKB 4TT3G 2FTKA 2EIJC 1GK9A 5HFMA 3CC7V 1I5XA 2ZDIC 3ABLB 2IJKA 2PI4A 1H8HG 4TSFG 3ZRXA 2P90A 1M56C 4JAUA 3JD3A 2R9RB 4MW3A 5B1AC 4PDRA 5LGNA 1OCRC 2EILC 3K0DA 2NNUA 3FB6C 3T1CA 3AG1B 3ETDA 2EBOA 3BEHA 3HB3B 3OGCC 4WFHA 2IU3A 5L3FA 1E1QG 4P30A 5BZBA 1AI4A 5DM6V 3CYOA 1KC8W 1BHAA 3IC7A 3LDCA 1MG1A 1S77D 1COWG 3D36A 3ZMTA 1M9NA 1JCHA 2P67A 5DN6G 5IYBO 2UXXA 2OTJV 4GX1A 1SZTA 2A79B 3OR7C 3CCUV 3FKSG 2EINB 5EBWC 1V55B 3A0RA 1K73W 3OW2U 3LDDA 3E86A 1DTOA 2R9IA 2Y69B 1K97A 3MD0A 5GW7A 3WG7C 3ZCCA 3ABKB 4JTDB 4X88A 2XAQA 5LBQA 4CZZA 1S76D 1R3KC 2WLLA 3EFFK 2QTOA 1RM1B 1OCZB 3CCRV 5LHGA 1FXKA 1R6KA 3M99B 4UV9A 3K06A 1GM8A 3W7TA 1YJ9V 2XASA 2H94A 1VQNV 1FXKB 3CCQV 2HFEC 1KKDA 2XAGA 1W2BU 2YSUB 2JJ2G 3B77A 2EIJB 1B6QA 3ZRVA 2IJHA 1RPOA 5IY5C 1KD1W 1NVPD 1NQTA 4G2KA 1L1FA 5CMUA 1K34A 2JK5C 3OEHG 3E2EA 1PNMA 2DYSC 1NR1A 1S72V 1EFRG 1THZA 4FMTA 1M56B 1VQ7V 3FB5C 5B1AB 2EIKC 3B8NA 1OCRB 2H8PC 2EILB 3TCUA 1OCCC 4JTCB 4R50A 4BW5A 3OMAB 3OE7G 3MHHC 1R3JC 2DWDC 4UV8A 4JGSA 3STZC 1P4RA 3CCLV 4JYBA 4DXWA 3JD4A 2IH3C 1NH2B 3D3IA 2QM7A 2ZXWC 1GM7A 2GSMB 3DTUB 2AHYA 3E8BA 4UVBA 2JJ1G 3JCZA 1AJQA 3G6EV 1MABG 2LFSA 2AHZA 4JPRA 1NKDA 1PD3A 1HWYA 4QE9A 5LGUA 3K9AA 3AEIA 3B8MA 3SPGA 5IYDO 3E35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHH G;  4Z1M G;  1W0J G;  5FL7 G;  4TT3 G;  2EJR A;  2WSS G;  3OEE G;  4YXW G;  5H6Q A;  1H8H G;  4TSF G;  2XAF A;  2WPD G;  2Z3Y A;  4XBF A;  2JDI G;  2X0L A;  5LGN A;  3ZMZ A;  2XND G;  5L3D A;  2V1D A;  5L3F A;  1E1Q G;  3ABU A;  1COW G;  5L3B A;  3ZMT A;  1NBM G;  5DN6 G;  3ZN0 A;  2UXX A;  3ZN1 A;  1W0K G;  1E1R G;  3FKS G;  1E79 G;  5L3G A;  2XOK G;  2R9I A;  1BMF G;  2XAQ A;  5LBQ A;  4CZZ A;  3ZMV A;  4UVC A;  1FS0 G;  4KUM A;  5LHH A;  5LHG A;  2UXN A;  4UV9 A;  2DW4 A;  2XAS A;  2H94 A;  2JIZ G;  4UXN A;  2Z5U A;  2QE7 G;  2XAG A;  4BAY A;  2W6I G;  2JJ2 G;  3OFN G;  5L3E A;  3OEH G;  2XAH A;  2W6J G;  2HKO A;  1EFR G;  2F43 G;  1H8E G;  2HLD G;  5L3C A;  3ABT A;  4ASU G;  3OE7 G;  2CK3 G;  3ZIA G;  4UV8 A;  5H6R A;  4UVA A;  2V7Q G;  2JJ1 G;  2XAJ A;  4UVB A;  1MAB G;  3OAA G;  5LHI A;  5LGT A;  5LGU A;  3ZMS A;  3ZMU A;  2IW5 A;  2Y48 A; 
#chains in the Genus database with same CATH topology
 2YIB A;  4X1I A;  3H1H H;  2Q67 A;  3WG7 B;  1DF5 A;  2EJR A;  2DE0 X;  3OT7 A;  2UXB B;  3A8T A;  2RDC A;  4RQE A;  3DC6 A;  3TK1 A;  1HR0 O;  2OCH A;  4XBF A;  1O9H A;  4RUE A;  2FL4 A;  2XND G;  4U7O A;  1VQ9 V;  2YI8 A;  3X2Q B;  4B3R B;  4LF9 O;  2DMX A;  1P49 A;  2DWE C;  4HBN A;  4XDJ A;  4UCS A;  3PJS K;  4NXN O;  4YJ2 A;  3H1K H;  3JYC A;  3UO2 A;  3CC2 V;  2HJD A;  2YXH A;  2ATK C;  4KXR A;  1SC5 B;  4X66 O;  1YSC A;  1B04 A;  1SA0 A;  3CRQ A;  4HYO A;  4JV5 O;  1XMQ B;  4JI7 B;  1JPX A;  4WF9 V;  4CS3 A;  3JAL B;  5GTH Z;  4PA9 A;  2P22 C;  1ARO P;  2UXC B;  3JAR A;  1N34 B;  2JRI A;  1QLE C;  1NH2 D;  2QKS A;  4LF8 O;  1K9M W;  1XHZ A;  3R66 A;  4LF5 O;  2E74 B;  1M4U A;  2ITC C;  1FFT B;  2Q69 A;  4GKK O;  3CP1 A;  1NT2 B;  5KHJ A;  1BZK A;  5JH7 B;  3K5L A;  4YY3 O;  5EZY B;  4IIJ A;  1M57 B;  2UUB O;  3K79 A;  3X2Q C;  5LHI A;  1WNS A;  2WLN A;  1YXB A;  4DV6 O;  3OUF A;  2IW5 A;  1BE3 H;  1FFX A;  2A7W A;  3G67 A;  2HVK C;  1Y6X A;  4GKJ O;  3MHS C;  4P2Z A;  2PI5 A;  1AJN A;  4YXW G;  3D8C A;  4OPH A;  2P6J A;  3WB1 A;  1N32 B;  4JAV A;  3TET A;  5LYJ B;  2JDI G;  4FM1 A;  3L73 H;  1K4D C;  4I0X A;  3SPH A;  1SKV A;  4MSW C;  3I56 V;  3W7U A;  3VBB A;  2DJV A;  3OR6 C;  1PV0 A;  1WA8 A;  1CP9 A;  1XL6 A;  1QR9 A;  4J41 A;  1VQP V;  5BMV B;  3J81 N;  4B7E A;  4DV1 B;  1HNW O;  3S3X A;  2UU9 B;  3DSQ A;  1T5E A;  1D5A A;  2QGN A;  3SYP A;  1DGS A;  1HP8 A;  1YI2 V;  2F1M A;  4BIZ A;  4JI6 B;  2ZE5 A;  3ZRW A;  4DK1 A;  1JFF A;  2LP7 A;  5FPO A;  3AG7 A;  1MZE A;  4J7Z A;  2YEV B;  2R72 A;  4X1Y B;  4MVU A;  3RBZ A;  2QE7 G;  4DV4 B;  4U3J B;  4PD4 F;  4DR5 B;  3F7V C;  4ICG A;  2Q73 A;  5EIB D;  3THO A;  4BW9 A;  3RFR A;  1I94 O;  2HKO A;  5LP6 C;  3T2M A;  1YJN V;  3ZED A;  4NTY A;  4IGG A;  1OCO B;  1AP5 A;  2Q0O C;  3RYF A;  2FML A;  1H8E G;  4UCR A;  4DYL A;  3CPW U;  5JWP A;  4I9W A;  2AGA A;  1XDC A;  1YTF B;  4PA6 A;  3I5D A;  5JVD A;  2WLH A;  1XOU A;  1W59 A;  2Y48 A;  1BQ0 A;  1EN6 A;  1ZL8 B;  2EIM B;  1BGY H;  2EZP A;  3JSN A;  2Q0A A;  2WA4 A;  4OXS A;  2CH7 A;  2Z3Y A;  3FYE B;  1XNQ B;  4YJ3 B;  1H2S B;  3CE2 A;  3ZMZ A;  4AQY O;  1VQ5 V;  3LDE A;  1IBM O;  4LWS A;  5CBG A;  3BA9 A;  5KX5 A;  4YHH B;  2VWJ A;  4TV9 B;  2Q8V A;  1NJI W;  5B3S C;  2ZDI A;  5B5E Z;  4ZOL A;  1Q82 W;  1VIB A;  5D5P A;  3ABM B;  4LF4 O;  4B3M B;  1JJ2 U;  1DF4 A;  1FJG B;  2B1G A;  1N36 B;  1OCO C;  3T1Y B;  5LA6 A;  5KHH A;  3CCJ V;  3ZMV A;  1BS3 A;  5ITZ B;  5LHH A;  3ABL C;  2CE4 A;  1FYJ A;  1Q7Y W;  1S5L Z;  3K04 A;  4JTA B;  3VQY A;  3ZHS A;  4LF6 O;  4UCV A;  4CH3 A;  2UUA B;  1Y74 A;  5L3E A;  5LMU O;  3UT5 B;  4LH7 A;  1GTO A;  5J2T A;  1MSD A;  4JI4 B;  1SZX A;  3CC4 V;  3EHB B;  1Y76 B;  3E8G A;  2EIN C;  4DV0 B;  5K1P A;  1MMM A;  1NVP B;  1AVM A;  5C8Y B;  2ZE8 A;  4XDK A;  4K8Z A;  3K5N A;  2JEX A;  3DXR B;  4UB8 Z;  3JAK B;  4O4J B;  3ZMS A;  1I5Y A;  1VF6 C;  1Z5V A;  2WLJ A;  1FXK C;  5IYZ B;  5B1O A;  1PKX A;  2CDY A;  3RVZ A;  1W0J G;  4B3S O;  4C7U A;  4DR6 B;  2IJK A;  3ZRX A;  1M56 C;  1XMO O;  5FLX N;  4DR3 O;  3HKC A;  5LGN A;  2EIL C;  2NNU A;  2RN9 A;  3T1C A;  3L74 H;  1CXZ B;  2H3O A;  3AG1 B;  3BEH A;  3HKE A;  1E1Q G;  1VF7 A;  1LUW A;  1QQC A;  5CA1 B;  1M9N A;  2OIE A;  4UCO A;  3CRM A;  4FLX A;  1SZT A;  4B08 A;  3OR7 C;  4NXM O;  1IBL O;  4DR7 B;  1K73 W;  2NN4 A;  2N74 A;  3LDD A;  4NVP A;  4JYA B;  1NS1 A;  2R9I A;  1K97 A;  3MD0 A;  1TGO A;  3LNN A;  5JQG B;  3ABK B;  1S76 D;  4CZZ A;  1SS3 A;  2ODM A;  2QTO A;  2P06 A;  3BRC A;  1RM1 B;  5IWA O;  1FXK A;  1N4C A;  4JI0 B;  1GM8 A;  1TAE A;  3CCQ V;  2QR4 A;  5J2U A;  2XAG A;  3BAB A;  3B77 A;  2EIJ B;  1B6Q A;  3ZRV A;  2IJH A;  4GLX A;  4X64 B;  4DW0 A;  2JK5 C;  3E2E A;  3DC5 A;  1PNM A;  2IM9 A;  4LR3 A;  3B8N A;  1MZF A;  3RYH A;  3MHH C;  2PTM A;  4K0K B;  4JYB A;  2IH3 C;  4JI1 B;  3D3I A;  2ZXW C;  4W4K A;  5CB4 B;  1J5E O;  1Q6U A;  1YF2 A;  1HW7 A;  4JPR A;  2CUG A;  1HWY A;  3AEI A;  4DUZ O;  1HNX B;  4TV8 A;  5KUK A;  2F4V O;  1UPG A;  3TGU H;  1VMG A;  3D36 C;  4O4L A;  1AB3 A;  4E4E A;  1J95 A;  2KKW A;  2XAF A;  1L8D A;  1ZWI C;  4QGP A;  2VQF O;  1VQ8 V;  3OTO B;  2KQX A;  3T1H O;  1S3J A;  3T4Z A;  3ZHR A;  4LFA O;  3SJB C;  2DYS B;  4W4L A;  3AG3 C;  1SQX H;  2ADP A;  1WP7 A;  1OCC B;  3ZN0 A;  3ZN1 A;  5BR8 O;  5A2Q N;  3B2E E;  3CCE V;  1QNM A;  2GUZ B;  3HKD A;  1G4Y B;  5L3G A;  5TIS Z;  4FFB A;  5IDJ A;  3HKB B;  4YJ2 B;  2M7W A;  1TUB A;  4O2A A;  4MVZ A;  4JI3 O;  3W7S A;  1IBK B;  1H2N A;  4O4I B;  2ZIO A;  4E2L A;  4ZI7 A;  2QWO B;  2IU0 A;  2UXD B;  2JS5 A;  1SA0 B;  2JIZ G;  5LXT A;  1X4T A;  3CRR A;  4H37 A;  1PL4 A;  1KYO F;  1QU7 A;  3L72 H;  3WU2 Z;  2X6B A;  3JAM N;  1R3L C;  3E83 A;  1HR0 B;  1XNR O;  2GHY A;  5EC2 C;  3N27 A;  3M7M X;  3ABT A;  5L3C A;  1JQ0 A;  4LP8 A;  3WB2 A;  2ADQ B;  2Q7G A;  3OMN B;  1N33 B;  5JJJ B;  1TUE B;  4LF9 B;  1XIL A;  1AJP A;  1OJH A;  4IHJ B;  1QR8 A;  1M1K W;  2Q68 A;  4DRX A;  4X1K B;  2BE3 A;  4KHP O;  1WPB A;  2YC0 A;  3CJH A;  3IGA C;  4PEL A;  2QWQ B;  1EM1 A;  2BTQ B;  4MVM A;  3ASN C;  4JYC A;  3LSU A;  4B3T O;  4R8C A;  3B4S A;  1GMG A;  4WFF A;  5EYP A;  1M90 W;  3OEE G;  3K57 A;  1PNK A;  2IH1 C;  3AG2 C;  5GTI Z;  2DQ0 A;  4JV5 B;  3HPL C;  1LR1 A;  1A32 A;  2F66 C;  1QCE A;  2NLJ C;  1V9P A;  3E22 B;  3KCX A;  2QJ1 A;  1QLE B;  4FPP A;  2V1D A;  4PA7 A;  3CME V;  1B06 A;  1K7D A;  4I0X B;  2HHH B;  1NU1 H;  2HP8 A;  3K0G A;  3APO A;  5L3B A;  4LF5 B;  3ZJZ A;  1NBM G;  4LBE C;  2Q4P A;  2GTA A;  4X62 B;  2BOC C;  4MT8 A;  4MTF A;  1BMF G;  2LW7 A;  2VS0 A;  2UUB B;  2X7R B;  1R73 A;  4TOI A;  3ZRW B;  3OUS A;  1JFF B;  1MA1 A;  2ZKO A;  2BSK A;  3OTF A;  1Q3E A;  1Q81 W;  2ZD9 A;  4U7N A;  4JI8 O;  3KKY A;  2F43 G;  3RGB A;  1UJW B;  1FPO A;  4DR1 O;  1VP7 A;  4GUN A;  4FFK A;  3JAW A;  2NR5 A;  3JAS A;  5D5Q A;  5EK0 A;  2AZ2 A;  3RYF B;  2CK3 G;  4F6R A;  4DR2 O;  2E5L O;  5JJE B;  2CTW A;  1SET A;  4JYY A;  1K4C C;  2QKC A;  2WLM A;  2GV9 A;  1BHB A;  5IJ0 A;  4LFC O;  1FKA O;  3U11 A;  1YIT V;  4JI2 O;  1R6N A;  4J9Z B;  1GN4 A;  1KBH A;  2RJZ A;  2E75 B;  3TXQ A;  2K9P A;  5FL7 G;  3J80 N;  4WBN B;  2ZE6 A;  2YXL A;  1AR5 A;  3CCV V;  3G71 V;  3D3Q A;  1ROP A;  1H2K A;  2YIA A;  2WA3 A;  4CC5 A;  1S5H C;  4G28 B;  1F4M A;  4LNU A;  2WLK A;  4FLZ A;  2UXB O;  3ETG A;  4DR4 O;  5LP6 B;  4LWS B;  3W7X A;  2CTQ A;  3F7Y C;  5KMG A;  1R6T A;  4NYK A;  3L71 H;  4EFE A;  1S5J A;  3WFV A;  1Q6H A;  3AG4 C;  1Q86 W;  2P5O A;  1KP3 A;  3CXC U;  5A9G A;  5LOV A;  2BTO A;  2GTS A;  3SR2 C;  1WAZ A;  1Q6I A;  1PNL A;  1KU9 A;  1GM9 A;  3C90 A;  3A0H Z;  3CWB H;  1EZJ A;  3OD4 A;  1VF5 B;  3F5W C;  1FS0 G;  1S0V A;  1RP3 B;  5LA6 B;  3GB7 C;  4DV3 B;  2YIC A;  4DV5 B;  2Z0A A;  3UO3 A;  1RSO B;  4I5S A;  3SPC A;  4EKW A;  3OFN G;  1WP8 A;  4DO2 A;  3L75 H;  2B9Z A;  3K5O A;  2WAM A;  3CEI A;  1YTF D;  4Q6G A;  1QBZ A;  2W6J G;  1HDJ A;  4O4H B;  2N05 A;  2A9H A;  3U0Z A;  5J2T B;  2QM8 A;  1D5N A;  2R9A A;  3SJQ C;  2A3Q A;  4KL1 A;  5IJ9 A;  5IYC O;  1N34 O;  4AQY B;  1IBM B;  2B1I A;  1V55 C;  4L87 A;  1D2D A;  3ML0 A;  4FM2 A;  2PZS A;  4J42 A;  2Y69 C;  5B3S B;  1SQG A;  4CH5 A;  2F93 B;  1OCZ C;  2DQ3 A;  5IY5 B;  1F51 A;  4LF4 B;  1MSW D;  2VQE B;  3JD1 A;  1FXV A;  1OHH G;  5EBM C;  4ZIB A;  2F23 A;  2P4V A;  1I5X A;  2ZDI C;  3ABL B;  5LMN B;  5DEC A;  1SQQ H;  2KG7 B;  2JGD A;  2P90 A;  1FAF A;  2ETN A;  2RMK B;  4PDR A;  1OCR C;  3FB6 C;  2JS3 A;  1JJO A;  2EBO A;  3OGC C;  3ZS8 C;  2IU3 A;  1NTM H;  5BZB A;  3CYO A;  1WB7 A;  3FAV B;  3JAL A;  1JR9 A;  5LMU B;  1N32 O;  3LDC A;  1COW G;  1JCH A;  5DN6 G;  4GX1 A;  4CH4 A;  2A79 B;  1VAR A;  3QF7 A;  2EIN B;  2Q5Z A;  3A0R A;  4OX9 B;  3OW2 U;  3RT3 C;  3VQV A;  4DV1 O;  2XHB A;  5LBQ A;  4FVM A;  1R3K C;  3EFF K;  3CCR V;  1R6K A;  3M99 B;  2Y4U A;  3K06 A;  1YJ9 V;  4CH6 A;  1FXK B;  2HFE C;  2CTP A;  1KKD A;  4JI6 O;  1U96 A;  1W2B U;  2YSU B;  4ABM A;  4LF7 O;  4DK0 A;  5IY5 C;  5J2U B;  4B3S B;  1EZV H;  4G2K A;  1NVP D;  1L1F A;  5CMU A;  1K34 A;  3WB0 A;  2V4D A;  2ZM6 B;  1NR1 A;  1THZ A;  1M56 B;  2H8P C;  2EIL B;  4DR3 B;  1G1X B;  3JSL A;  4JTC B;  4EB6 B;  1IDS A;  4DR5 O;  3OMA B;  1R3J C;  4I55 B;  1P4R A;  5BY1 A;  3JD4 A;  5LYJ A;  2QM7 A;  3DTU B;  3SGI A;  3VQX A;  3E8B A;  3JCZ A;  2ZIM A;  2LFS A;  4I9Q A;  3FX7 A;  1NKD A;  5LGU A;  3B8M A;  1URF A;  5BMV A;  4I4T A;  4ZHQ B;  2MK3 A;  4TV8 B;  3JAT B;  2XUM A;  2WLI A;  1CEZ A;  5GON B;  3E89 A;  2KB1 A;  1DLB A;  1XQ8 A;  1H38 A;  2ITD C;  4LCU C;  2AW9 A;  4Z2W A;  1TVK B;  4D7S A;  5KAI Z;  2OTL V;  2YEV A;  4DW1 A;  4F4L A;  1K5Q A;  1EN4 A;  3T4D A;  4PI2 A;  4I50 B;  4RO2 A;  1HNZ O;  1JVM A;  5EIB C;  5B1B C;  3NR7 A;  1KEC A;  2Q7H A;  5B1N A;  2QWP B;  4O2B B;  4AHC A;  4D7T A;  3ASO C;  3UQ8 A;  3N2K B;  3BFR A;  4HNA B;  4P9P A;  2P4K A;  4FM0 A;  3ZHQ A;  2ZXW B;  3QNE A;  2G38 A;  2WWW A;  3SYC A;  4GCZ A;  1UFI A;  4FFB B;  4QIW F;  5JCO A;  2LQT A;  4H44 B;  2ILM A;  1TUB B;  4O2A B;  4ZBM A;  1VQK V;  1L0N H;  1Z2G A;  2DN9 A;  3A2F A;  1Y66 A;  3BY6 A;  5CA3 A;  4NR1 A;  5LXT B;  3CMA V;  1R3I C;  2UUC O;  4JAA A;  1AI7 A;  4QJF B;  2HEP A;  3SYQ A;  2Q6A A;  1AR1 B;  1SQF A;  1YHQ V;  4R7C A;  2VQF B;  2JEU A;  4ASU G;  1GH6 A;  2WLL B;  5BXZ A;  3ZIA G;  1F4N A;  3ICX A;  4BWA A;  2FKX A;  3AG3 B;  5H6R A;  3CRA A;  1IZ3 A;  3DGE A;  1XI1 A;  4MVS A;  3Q4H A;  1US6 A;  2L35 A;  2MW2 B;  3GWO A;  4KFM A;  4TV9 A;  3R65 A;  5EC1 C;  2GDS A;  3BAA A;  4QE7 A;  1K3E A;  4WFG A;  1SER A;  1XUQ A;  4TUY B;  1WB8 A;  4RUF A;  4X89 A;  2P7T C;  2QEX V;  3LNM B;  1AI6 A;  5IT9 N;  2K1E A;  4N23 A;  3LSQ A;  5KHK A;  2X0L A;  5ITZ A;  4HAM A;  3ZBH A;  1DK1 A;  3TXS A;  4JZ2 A;  5L3D A;  3ZHT A;  1IVS A;  4DR6 O;  1V54 C;  3RW0 A;  1KUQ A;  1QVG U;  1ZLZ A;  3UM7 A;  4X1I B;  1XNR B;  1XL4 A;  2Q9L A;  3UT5 A;  4BIU A;  4YIP A;  3BCC H;  3E8H A;  1YIJ V;  3P3N A;  2HVJ C;  1GN2 A;  1MOF A;  3TJT A;  3SPJ A;  2OCC B;  4X9Q A;  3K59 A;  4X8A A;  4JAS A;  1Y76 A;  3H1J H;  3NXS A;  3ASN B;  1M5I A;  1YJW V;  5CA0 A;  5KAF Z;  5C8Y A;  3SPI A;  1YCI A;  4B3T B;  4JYA O;  2PF4 E;  2ZQM A;  3DXR A;  2PUS A;  3JAK A;  4O4J A;  2CAZ C;  1JA8 A;  4RQF A;  3K03 A;  5FNV A;  3AG2 B;  4JI0 O;  5IYZ A;  4PDM A;  4PDL A;  1NTK H;  4H0L B;  4OGQ B;  2X6A A;  3KCY A;  4X64 O;  1ZX3 A;  4DUY B;  4K35 A;  2JVD A;  4OPA A;  2XT9 A;  3W7W A;  1K8A W;  1H2G A;  4IYH A;  4F6R B;  5H5N A;  3QG5 A;  2W0F C;  1PPJ H;  3K58 A;  2V7Q G;  4MTX A;  3JD2 A;  5KA5 A;  4NTW A;  4DV2 O;  2HG5 C;  5IJ0 B;  3JAR B;  4K0K O;  1BL8 A;  3UKM A;  4FLU A;  4X20 A;  3PN1 A;  4JI1 O;  3OMI B;  4J7K A;  4FJC C;  2LFR A;  4P9O A;  2DYR C;  1YZB A;  1N8R W;  3APQ A;  3FB8 C;  2WPD G;  5JQG A;  2OCC C;  4IIJ B;  2Q7E A;  1WPX A;  2RNB A;  2C2A A;  3CD6 V;  4NXN B;  3IAY A;  4D6T H;  2PY5 A;  4N21 A;  1GN3 A;  3FD9 A;  2X6C A;  3ABU A;  1WJZ A;  3RYC A;  4LC1 A;  1FFX B;  3C3T A;  1BSM A;  3OTO O;  4J11 A;  4DR1 B;  4X66 B;  2IJI A;  1GRJ A;  3N2G A;  1AP6 A;  4PHZ A;  1BQZ A;  1W0K G;  1G6U A;  2KSD A;  4GT1 A;  4LFB O;  4DR2 B;  1I08 A;  5CBF A;  4MTO A;  5LL6 Y;  4UVC A;  4K3A A;  3KG2 A;  3O9O A;  4LFC B;  4LF8 B;  1PL0 A;  3QTC A;  3H1I H;  4FZ1 A;  1WA8 B;  5CB4 A;  2Z5U A;  4Q20 A;  4GKK B;  3OGI B;  2A06 H;  1G8M A;  5B66 Z;  1IBK O;  4YY3 B;  2UXD O;  1AI5 A;  5KLV H;  5IE9 A;  2LW1 A;  2ZR3 A;  1IX9 A;  5CBH A;  1QVF U;  4X65 O;  1IXB A;  4JI5 O;  4JF3 A;  1N0J A;  3K3W A;  4GZR B;  2JGU A;  4PJ0 Z;  3VOU A;  1SES A;  2OWO A;  4DV6 B;  5E79 Z;  3L70 H;  4YIO A;  5IJ9 B;  3QVN A;  4DR4 B;  2Y0P A;  4UB6 Z;  3LSS A;  4MVO A;  4QPJ A;  1NR7 A;  4AI8 A;  1YVW A;  4UVA A;  4GKJ B;  5C93 A;  3AG4 B;  4CS4 A;  4RWU A;  4XDL A;  1N33 O;  4PDV A;  2BOB C;  4EEQ A;  5KUM A;  4B7K A;  4DV7 O;  4Z1M G;  4TT3 G;  3CC7 V;  3MDS A;  2GUZ A;  2PI4 A;  2FYU H;  3HKB A;  4TSF G;  1PP9 H;  3G80 A;  3CHX A;  5B1A C;  3JD3 A;  5DED A;  5JJN B;  4IYI A;  2OYQ A;  1L0L H;  3EXA A;  2JGD B;  4O4I A;  1HNW B;  3K0D A;  3S3W A;  3ETD A;  3RYI A;  5FPR A;  5L3F A;  5JVD B;  5DM6 V;  1H2M A;  3L9D A;  1BHA A;  3IC7 A;  1MG1 A;  3ZMT A;  2P67 A;  1N0N A;  1F7Y A;  4PI0 A;  3BPZ A;  2D2C B;  5EBW C;  2HHH O;  1V55 B;  1M93 A;  2Y69 B;  5GW7 A;  3WG7 C;  2CH7 B;  4X88 A;  2XAQ A;  1FD9 A;  2YDE A;  2M6Y A;  2XTA A;  3ZHV A;  1OCZ B;  2GBO A;  4UV9 A;  4X62 O;  3AK3 A;  1I94 B;  4IHJ A;  1VQN V;  5KX5 B;  3EVK A;  5AG2 A;  4X1K A;  1XBL A;  2JJ2 G;  2BTQ A;  4JZG A;  3FFQ A;  1RPO A;  1IUR A;  2CGN A;  4ZOL B;  4B3R O;  3OEH G;  1GN6 A;  2AZ0 A;  4NTX A;  1S72 V;  1EFR G;  1VQ7 V;  3K9S A;  1OCR B;  1R1B A;  1ZUQ A;  3ZHU A;  2YI9 A;  3OE7 G;  2IBZ H;  4JGS A;  1Z5W A;  3STZ C;  3CCL V;  1NH2 B;  2AHY A;  3E22 A;  4FLT A;  4K8X A;  1MAB G;  2PYL A;  1X59 A;  3F5T A;  5IYD O;  3SJA C;  3K9A A;  1XMQ O;  4JI7 O;  1Y74 B;  4UUJ C;  3SJC C;  1F23 A;  3B09 A;  2UXC O;  1MNG A;  3MAQ A;  1Y4M A;  4I4T B;  1JMK C;  3ETE A;  2Y0I A;  2WLI B;  3H9V A;  4FZ0 A;  2YID A;  4MS2 A;  5KA6 A;  1BCC H;  4LF7 B;  2D3O W;  3CSX A;  3HR0 A;  1AIL A;  2QA4 V;  1SQV H;  3SYO A;  1M57 C;  1ZTE A;  3ZRS A;  1P84 F;  2LJ2 A;  5F2V O;  1VQ6 V;  1OV9 A;  2OIG A;  2ZR2 A;  5EBL C;  1K92 A;  3BVO A;  3ETQ A;  3AK2 A;  2ZE7 A;  4PA4 A;  4LF6 B;  2OT5 A;  3HKC B;  4KUM A;  3QO8 A;  2UXN A;  2ZT9 B;  3HKE B;  1KKC A;  1SQB H;  1FXH A;  1LNQ A;  3SYA A;  4UXN A;  3CS5 A;  3K08 A;  4FK5 C;  2QTS A;  2XAH A;  3A0B Z;  4IT5 A;  4DV3 O;  4DV5 O;  1SF9 A;  5JH7 A;  4WBN A;  2UU9 O;  3FB7 C;  4AIL C;  1Y67 A;  5EZY A;  2ARH A;  1XEQ A;  4RAI A;  4QNH B;  1HNZ B;  5B1B B;  1BT8 A;  2QKA A;  3STL C;  5HFL A;  3ASO B;  5LGT A;  4TQD A;  2B5U A;  4PV1 B;  3GVM A;  5LP6 A;  3Q4H B;  3CCS V;  1XMO B;  1Q5O A;  2HJF C;  4DV4 O;  3G4S V;  2WSS G;  4WFE A;  3B40 A;  3P32 A;  3RYH B;  2N04 A;  3VQW A;  5H6Q A;  2VQE O;  1VQO V;  3RN4 A;  1VQM V;  3K5M A;  3ZX6 A;  1JOY A;  1XRE A;  5JCO C;  5LMN O;  4J9Y B;  4NXM B;  1IBL B;  2UUC B;  1RSO A;  1I7F A;  4L8J A;  1KQS U;  4FLW A;  3KZI Z;  1ENV A;  2CGO A;  4O4L B;  5IWA B;  4H13 B;  5CN0 A;  1E79 G;  4O4H A;  1EBO A;  2XOK G;  3I55 V;  1NI8 A;  2YXY A;  4J7J A;  1YDX A;  2EIM C;  4X1Y A;  2QWN B;  4G27 B;  3M8A A;  4GX0 A;  1QLN A;  4OX9 O;  2VWK A;  2RQ6 A;  4U3J A;  1XNQ O;  1B3Q A;  2EUL A;  5CA0 B;  2W6I G;  4MVR A;  1O9G A;  3IJ4 A;  4CBC A;  4YHH O;  2QM4 A;  3IC9 A;  3CRC A;  4TWK A;  4UCU A;  5FNV B;  3RWR D;  3HKD B;  3FYI B;  2LGQ A;  1RFY A;  2EZO A;  2ZIN A;  1J5E B;  1RPR A;  4WCE V;  3QO5 A;  2L6L A;  5J9P C;  1V54 B;  3ABM C;  4GYC B;  4B3M O;  1FJG O;  2HR3 A;  3BHP A;  2KG7 A;  2ZM6 O;  1N36 O;  4DUZ B;  4ZI7 B;  2F4V B;  3T1Y O;  1VQ4 V;  3JD0 A;  1Q43 A;  1JX9 A;  3OAA G;  5H9C A;  4MTG A;  2ZNJ A;  5KHG A;  3FAV A;  4NB5 A;  4CC6 A;  1ZL8 A;  2QWR B;  1IXM A;  5KHI A;  1CPY A;  4X20 B;  4I7Z B;  2UUA O;  3T1H B;  4FIP C;  4LFA B;  1WLE A;  4UFZ A;  3H1L H;  2YIB D;  4YJ3 A;  1EN5 A;  4JI4 O;  1KMI Z;  3OM3 B;  1H2L A;  4FLY A;  1NZ6 A;  5BR8 B;  1K33 A;  5H2F Z;  4DRX B;  4DV0 O;  2QSA A;  1VF6 A;  3CJH B;  4NKG B;  4Z1V A;  4KP4 A;  2A0L A;  4J80 A;  1AR4 A;  3RVY A;  1ZSP A;  1NTZ H;  4U3F H;  4A5U B;  3RYC B;  2IJJ A;  4JI3 B;  4CS2 A;  2ZNI A;  3LUT B;  3E8F A;  5EYP B;  3CCM V;  1E1R G;  4QPK A;  4WFB V;  4MVQ A;  3N2G B;  3G6B A;  3C3S A;  2FB5 A;  4EB6 A;  4WFA V;  2EX3 A;  4I55 A;  2O57 A;  4MW8 A;  2RCV A;  4DV2 B;  2DW4 A;  1OZ0 A;  2BCC H;  2AXT Z;  4BAY A;  1GKF A;  1KP2 A;  4BR6 A;  2DYR B;  3AG1 C;  2F95 B;  4H33 A;  1SRY A;  1P7G A;  4ZHQ A;  3IFX A;  3U10 A;  1ORQ C;  3JAT A;  2E76 B;  1LUV A;  1K5S A;  2HLD G;  5GON A;  4PA3 A;  4KHP B;  2Y4T A;  1TA8 A;  4GX5 A;  1GO3 F;  4DR7 O;  2ZCE A;  2E3C A;  4FLV A;  1TVK A;  2YS8 A;  4ZKI A;  2BSK B;  3P30 A;  4HZ3 A;  1U97 A;  4LH6 A;  2PYJ A;  3ABK C;  2XAJ A;  3H01 A;  5E1A C;  4R6Z A;  1RM1 C;  4I50 A;  3BA8 A;  1GAX A;  3ZMU A;  1P7B A;  3CX5 F;  1VQL V;  4LFB B;  1PM9 A;  4GX2 A;  3O65 A;  4O2B A;  3QO7 A;  2EIK B;  2FTK A;  2EIJ C;  3N2K A;  1GK9 A;  5HFM A;  3JAW B;  4HNA A;  4J10 A;  3JAS B;  4BIO A;  4EFB A;  1H8H G;  4JAU A;  2R9R B;  4MW3 A;  3SDL A;  3J7A U;  1SQP H;  2YUA A;  2W0X A;  3HB3 B;  4WFH A;  4F6E A;  5CA1 A;  1YEW A;  2LO1 A;  4P30 A;  1AI4 A;  1KC8 W;  3RYI B;  1ZAU A;  1S77 D;  3D36 A;  1Q90 D;  4X65 B;  3AK1 A;  5IYB O;  2UXX A;  2OTJ V;  2LGW A;  3JCU Z;  4JI5 B;  3CCU V;  3FKS G;  1HNX O;  1WN7 A;  1QHT A;  3E86 A;  3GWK C;  1DTO A;  2QDO A;  3ZCC A;  4JTD B;  4TQF A;  2WLL A;  4UCT A;  2DOS A;  5LHG A;  4LNU B;  3CXH F;  3W7T A;  4JI8 B;  2XAS A;  2H94 A;  4DV7 B;  2R70 A;  5KMG B;  1KD1 W;  1NQT A;  2VRZ A;  5K1X A;  5LOV B;  2DYS C;  2E5L B;  4FMT A;  2CTR A;  3UCS C;  3FB5 C;  5B1A B;  2EIK C;  4TUY A;  3TCU A;  1OCC C;  4R50 A;  1I0H A;  4BW5 A;  1XHX A;  2DWD C;  4UV8 A;  1Q8I A;  1VEW A;  2PGG A;  4DXW A;  4JI2 B;  2EJ7 A;  1GM7 A;  2GSM B;  1KB9 F;  4IL6 Z;  4UVB A;  2JJ1 G;  3G6E V;  1AJQ A;  2AHZ A;  4QE9 A;  1PD3 A;  3CB2 A;  4DUY O;  3SPG A;  3P3P A;  3E35 A; 
#chains in the Genus database with same CATH homology
 4UUJ C;  2MK3 A;  2Q67 A;  1F23 A;  3WG7 B;  1DF5 A;  2WLI A;  1Y4M A;  2EJR A;  1CEZ A;  1J95 A;  3ETE A;  3E89 A;  4RQE A;  2WLI B;  2KB1 A;  1DLB A;  2XAF A;  1ZWI C;  3TK1 A;  1H38 A;  4MS2 A;  1VQ8 V;  2ITD C;  4LCU C;  4XBF A;  4RUE A;  2OTL V;  2YEV A;  5KA6 A;  2XND G;  1S3J A;  4U7O A;  3T4Z A;  4F4L A;  1VQ9 V;  2D3O W;  3X2Q B;  1K5Q A;  3T4D A;  2DYS B;  4RO2 A;  2QA4 V;  1JVM A;  2DWE C;  3SYO A;  1M57 C;  3AG3 C;  5B1B C;  3ZRS A;  4XDJ A;  1KEC A;  1OCC B;  5B1N A;  3ZN0 A;  3ZN1 A;  1VQ6 V;  3ASO C;  2ZR2 A;  3PJS K;  5EBL C;  3CCE V;  1K92 A;  3JYC A;  4P9P A;  3CC2 V;  1G4Y B;  5L3G A;  5IDJ A;  2ZXW B;  2ATK C;  3QNE A;  2M7W A;  2WWW A;  3SYC A;  4GCZ A;  4PA4 A;  2OT5 A;  4MVZ A;  4QIW F;  3W7S A;  1YSC A;  4KUM A;  3QO8 A;  4E2L A;  2IU0 A;  2UXN A;  4HYO A;  4ZBM A;  1VQK V;  1JPX A;  4WF9 V;  2JIZ G;  1FXH A;  1LNQ A;  3SYA A;  4UXN A;  1Y66 A;  3BY6 A;  4PA9 A;  5CA3 A;  4H37 A;  1ARO P;  3K08 A;  3CMA V;  1R3I C;  4FK5 C;  1QLE C;  1NH2 D;  2QKS A;  1AI7 A;  2XAH A;  4QJF B;  2X6B A;  1K9M W;  1R3L C;  3SYQ A;  2Q6A A;  3E83 A;  1AR1 B;  2ITC C;  1FFT B;  2Q69 A;  1YHQ V;  2GHY A;  4R7C A;  2JEU A;  5EC2 C;  5L3C A;  3ABT A;  3CP1 A;  3FB7 C;  1JQ0 A;  4ASU G;  2WLL B;  4LP8 A;  4RAI A;  3ZIA G;  4QNH B;  1F4N A;  3OMN B;  1TUE B;  5H6R A;  1M57 B;  3AG3 B;  1AJP A;  5B1B B;  3STL C;  1QR8 A;  1M1K W;  5HFL A;  3DGE A;  2Q68 A;  4MVS A;  3K79 A;  3IGA C;  4PEL A;  3ASO B;  3X2Q C;  5LHI A;  5LGT A;  2WLN A;  3GWO A;  4MVM A;  2B5U A;  3ASN C;  3OUF A;  4JYC A;  2IW5 A;  4KFM A;  3CCS V;  3R65 A;  5EC1 C;  4QE7 A;  2HVK C;  2HJF C;  1K3E A;  4R8C A;  1GMG A;  4WFF A;  4WFG A;  1SER A;  3G4S V;  5KUK A;  2WSS G;  3MHS C;  4WFE A;  3OEE G;  4P2Z A;  1M90 W;  2PI5 A;  1PNK A;  4RUF A;  1AJN A;  4X89 A;  2IH1 C;  3P32 A;  3AG2 C;  4YXW G;  5H6Q A;  2P7T C;  2QEX V;  1VQO V;  2DQ0 A;  1VQM V;  2P6J A;  4JAV A;  3LNM B;  1AI6 A;  3TET A;  3HPL C;  2K1E A;  4N23 A;  3LSQ A;  2JDI G;  2X0L A;  1QCE A;  2NLJ C;  1K4D C;  4HAM A;  3SPH A;  1JOY A;  4MSW C;  3I56 V;  5L3D A;  3W7U A;  1V54 C;  4J9Y B;  1QLE B;  4FPP A;  3VBB A;  2V1D A;  4PA7 A;  3CME V;  3RW0 A;  1K7D A;  3OR6 C;  1KQS U;  1QVG U;  3K0G A;  1CP9 A;  1XL6 A;  1QR9 A;  1VQP V;  5L3B A;  3ZJZ A;  3UM7 A;  1NBM G;  1ENV A;  1XL4 A;  4LBE C;  4BIU A;  3E8H A;  5CN0 A;  1YIJ V;  1E79 G;  2HVJ C;  3SYP A;  2BOC C;  1YI2 V;  4MT8 A;  1MOF A;  4MTF A;  1EBO A;  2XOK G;  4BIZ A;  3I55 V;  3ZRW A;  3SPJ A;  2OCC B;  1BMF G;  2LP7 A;  2X7R B;  1R73 A;  2EIM C;  4JAS A;  4X8A A;  4G27 B;  3NXS A;  3ZRW B;  3OUS A;  3ASN B;  2YEV B;  4GX0 A;  1YJW V;  1QLN A;  3SPI A;  4MVU A;  3RBZ A;  2ZQM A;  2QE7 G;  2W6I G;  1Q81 W;  4MVR A;  3F7V C;  4RQF A;  2ZD9 A;  3K03 A;  3AG2 B;  4CBC A;  4U7N A;  4PDM A;  4TWK A;  2HKO A;  4PDL A;  3T2M A;  1YJN V;  2F43 G;  3FYI B;  2X6A A;  1UJW B;  1OCO B;  1H8E G;  2EZO A;  3CPW U;  4I9W A;  1RPR A;  4WCE V;  5EK0 A;  3QO5 A;  5J9P C;  1V54 B;  3ABM C;  2CK3 G;  2HR3 A;  3W7W A;  1K8A W;  1H2G A;  1SET A;  1VQ4 V;  1YTF B;  1K4C C;  2WLM A;  3JD0 A;  2W0F C;  1BHB A;  2V7Q G;  4PA6 A;  4MTX A;  1JX9 A;  3OAA G;  5H9C A;  4MTG A;  3JD2 A;  5KA5 A;  2WLH A;  2HG5 C;  1BL8 A;  3UKM A;  1YIT V;  1R6N A;  2Y48 A;  3OMI B;  4J9Z B;  4FJC C;  1IXM A;  2LFR A;  1CPY A;  4P9O A;  5FL7 G;  2EIM B;  4FIP C;  2DYR C;  1N8R W;  2EZP A;  1WLE A;  3CCV V;  3FB8 C;  2WPD G;  4OXS A;  2OCC C;  3G71 V;  2Z3Y A;  3FYE B;  1ROP A;  1WPX A;  3OM3 B;  1S5H C;  4G28 B;  3ZMZ A;  1F4M A;  1K33 A;  2C2A A;  3CD6 V;  1VQ5 V;  2WLK A;  3LDE A;  3ETG A;  4N21 A;  2X6C A;  3ABU A;  5CBG A;  4KP4 A;  4LC1 A;  2A0L A;  3W7X A;  3F7Y C;  3RVY A;  1NJI W;  5B3S C;  2ZDI A;  2IJJ A;  2IJI A;  3LUT B;  3WFV A;  3E8F A;  3AG4 C;  1Q82 W;  1Q86 W;  1KP3 A;  3ABM B;  3CXC U;  1W0K G;  1E1R G;  4QPK A;  4WFB V;  3CCM V;  1JJ2 U;  4MVQ A;  1DF4 A;  4GT1 A;  2B1G A;  1PNL A;  1OCO C;  1GM9 A;  5CBF A;  4MTO A;  1EZJ A;  4WFA V;  3ZMV A;  4UVC A;  3CCJ V;  3F5W C;  1FS0 G;  5LHH A;  1S0V A;  3ABL C;  3KG2 A;  4MW8 A;  1PL0 A;  1Q7Y W;  3GB7 C;  2DW4 A;  3K04 A;  4JTA B;  1OZ0 A;  2Z5U A;  4I5S A;  4Q20 A;  4BAY A;  3SPC A;  4EKW A;  1GKF A;  1KP2 A;  3OFN G;  1G8M A;  2DYR B;  3AG1 C;  4DO2 A;  5L3E A;  2WAM A;  4H33 A;  1SRY A;  1AI5 A;  1YTF D;  2ZR3 A;  1GTO A;  1QBZ A;  2W6J G;  3IFX A;  5CBH A;  1ORQ C;  1QVF U;  2A9H A;  1K5S A;  2HLD G;  2QM8 A;  4JF3 A;  4PA3 A;  3SJQ C;  5IYC O;  3K3W A;  3CC4 V;  3EHB B;  3VOU A;  1SES A;  4GX5 A;  1GO3 F;  3E8G A;  2EIN C;  2B1I A;  1V55 C;  1NVP B;  4L87 A;  3ML0 A;  3LSS A;  4XDK A;  4ZKI A;  4MVO A;  4QPJ A;  3P30 A;  1NR7 A;  2Y69 C;  4HZ3 A;  5B3S B;  4UVA A;  3ABK C;  2XAJ A;  5C93 A;  3AG4 B;  3H01 A;  2JEX A;  5E1A C;  4R6Z A;  1RM1 C;  1OCZ C;  2DQ3 A;  5IY5 B;  1F51 A;  3ZMS A;  3ZMU A;  1MSW D;  4XDL A;  1I5Y A;  3JD1 A;  4PDV A;  2BOB C;  2WLJ A;  1P7B A;  1FXV A;  1VQL V;  1FXK C;  1OHH G;  5EBM C;  5KUM A;  5B1O A;  4GX2 A;  1PKX A;  3RVZ A;  3QO7 A;  4Z1M G;  1W0J G;  2EIK B;  4TT3 G;  2FTK A;  2EIJ C;  1GK9 A;  5HFM A;  3CC7 V;  1I5X A;  2ZDI C;  3ABL B;  2IJK A;  2PI4 A;  1H8H G;  4TSF G;  3ZRX A;  2P90 A;  1M56 C;  4JAU A;  3JD3 A;  2R9R B;  4MW3 A;  5B1A C;  4PDR A;  5LGN A;  1OCR C;  2EIL C;  3K0D A;  2NNU A;  3FB6 C;  3T1C A;  3AG1 B;  3ETD A;  2EBO A;  3BEH A;  3HB3 B;  3OGC C;  4WFH A;  2IU3 A;  5L3F A;  1E1Q G;  4P30 A;  5BZB A;  1AI4 A;  5DM6 V;  3CYO A;  1KC8 W;  1BHA A;  3IC7 A;  3LDC A;  1MG1 A;  1S77 D;  1COW G;  3D36 A;  3ZMT A;  1M9N A;  1JCH A;  2P67 A;  5DN6 G;  5IYB O;  2UXX A;  2OTJ V;  4GX1 A;  1SZT A;  2A79 B;  3OR7 C;  3CCU V;  3FKS G;  2EIN B;  5EBW C;  1V55 B;  3A0R A;  1K73 W;  3OW2 U;  3LDD A;  3E86 A;  1DTO A;  2R9I A;  2Y69 B;  1K97 A;  3MD0 A;  5GW7 A;  3WG7 C;  3ZCC A;  3ABK B;  4JTD B;  4X88 A;  2XAQ A;  5LBQ A;  4CZZ A;  1S76 D;  1R3K C;  2WLL A;  3EFF K;  2QTO A;  1RM1 B;  1OCZ B;  3CCR V;  5LHG A;  1FXK A;  1R6K A;  3M99 B;  4UV9 A;  3K06 A;  1GM8 A;  3W7T A;  1YJ9 V;  2XAS A;  2H94 A;  1VQN V;  1FXK B;  3CCQ V;  2HFE C;  1KKD A;  2XAG A;  1W2B U;  2YSU B;  2JJ2 G;  3B77 A;  2EIJ B;  1B6Q A;  3ZRV A;  2IJH A;  1RPO A;  5IY5 C;  1KD1 W;  1NVP D;  1NQT A;  4G2K A;  1L1F A;  5CMU A;  1K34 A;  2JK5 C;  3OEH G;  3E2E A;  1PNM A;  2DYS C;  1NR1 A;  1S72 V;  1EFR G;  1THZ A;  4FMT A;  1M56 B;  1VQ7 V;  3FB5 C;  5B1A B;  2EIK C;  3B8N A;  1OCR B;  2H8P C;  2EIL B;  3TCU A;  1OCC C;  4JTC B;  4R50 A;  4BW5 A;  3OMA B;  3OE7 G;  3MHH C;  1R3J C;  2DWD C;  4UV8 A;  4JGS A;  3STZ C;  1P4R A;  3CCL V;  4JYB A;  4DXW A;  3JD4 A;  2IH3 C;  1NH2 B;  3D3I A;  2QM7 A;  2ZXW C;  1GM7 A;  2GSM B;  3DTU B;  2AHY A;  3E8B A;  4UVB A;  2JJ1 G;  3JCZ A;  1AJQ A;  3G6E V;  1MAB G;  2LFS A;  2AHZ A;  4JPR A;  1NKD A;  1PD3 A;  1HWY A;  4QE9 A;  5LGU A;  3K9A A;  3AEI A;  3B8M A;  3SPG A;  5IYD O;  3E35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...