1OHHG

Bovine mitochondrial f1-atpase complexed with the inhibitor protein if1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
272
structure length
94
Chain Sequence
ATLKDITRRLKSIKNIQKITKSMKMVAAAKLCGAIHSSVAKQTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit alpha, mitochondrial
publication title The Structure of Bovine F1-ATPase in Complex with its Regulatory Protein If1
pubmed doi rcsb
source organism Bos taurus
molecule tags Synthase
total genus 39
structure length 94
sequence length 272
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ohhG00
3OEHG 4UXNA 5H6RA 2W6IG 2EJRA 2WSSG 2Z5UA 4UVBA 3ZMVA 4KUMA 5LGTA 3ZMTA 2XAGA 3OE7G 2UXNA 2V1DA 3OFNG 2UXXA 2JJ2G 4UVAA 5L3BA 2JIZG 2H94A 5L3FA 2Y48A 3OAAG 5LHIA 5L3DA 2XOKG 2Z3YA 5L3EA 2WPDG 1E1RG 5LGNA 1H8HG 4UV8A 5LHGA 4CZZA 5L3CA 1E1QG 1BMFG 3OEEG 3ZN1A 1E79G 3ABUA 1NBMG 3ZN0A 2R9IA 4XBFA 5H6QA 1W0KG 2V7QG 4UVCA 3ZMZA 5L3GA 2W6JG 1MABG 2HLDG 4YXWG 4ASUG 2QE7G 3ZMSA 5LGUA 1EFRG 1W0JG 2CK3G 2F43G 2IW5A 5LHHA 1H8EG 2XNDG 1OHHG 2JJ1G 4BAYA 2DW4A 2XAQA 3ABTA 4UV9A 2XAHA 2HKOA 2XASA 5LBQA 1COWG 2JDIG 1FS0G 5DN6G 5FL7G 3FKSG 4TSFG 4Z1MG 2XAFA 4TT3G 3ZMUA 2XAJA 3ZIAG 2X0LA
chains in the Genus database with same CATH superfamily
1FFTB 4ABMA 3CCVV 5B3SB 4Z1VA 3S3XA 5IJ0B 2W6IG 3EVKA 4H33A 3G71V 4RQFA 4X1IB 1Q6IA 4FVMA 2E75B 2EX3A 3E8FA 2IU0A 4WBNB 3T1CA 4DO2A 3OE7G 4DRXA 3JASB 4DR1B 1FXVA 2AGAA 4PA7A 3T1HB 3SPCA 2RJZA 3N2GA 5B1AC 1SERA 5JWPA 1KBHA 4FZ1A 5FPOA 1XHZA 4DK0A 3OAAG 5L3EA 3E89A 2QWOB 3BHPA 2WPDG 2FYUH 4DV4O 1BHAA 2PGGA 4BIUA 1WA8A 1I0HA 5KHKA 5IYCO 2BOBC 3TETA 2CGOA 1NQTA 4YJ2A 3CC2V 1SQQH 1KKDA 4NTXA 3T1YO 1JFFA 1XMQB 2OIEA 3D8CA 3MHHC 2L35A 4X1KB 2ZNIA 4PHZA 4PA9A 3SYPA 4QNHB 2ODMA 3K3WA 5LP6A 1NR1A 1H38A 2MW2B 1S3JA 1BT8A 2X7RB 2QEXV 3W7UA 4EFEA 4I55A 3AG2B 3KCYA 2HHHB 1X59A 3ZHSA 1DK1A 4X8AA 4CH5A 1IBMB 4BAYA 2DW4A 3STZC 4DV3B 2Q68A 3QO7A 1ZWIC 3U10A 2A06H 2Q69A 1HNWB 3JAKB 2DYRB 3SJCC 1ZX3A 4FLUA 4PV1B 1RSOA 3ZRWA 2PTMA 4D7SA 4ZKIA 1NT2B 3QO5A 3IFXA 2YI8A 3RW0A 2O57A 5JQGB 3UO2A 3WB1A 1EN5A 2A79B 2ATKC 3BABA 5LGTA 5LP6C 1QLNA 2GDSA 1OCOC 1FXKC 3ZX6A 3J7AU 1VQMV 2CTQA 4X62O 1M1KW 3CRMA 2Q0AA 5IJ0A 2AHYA 3P30A 1ORQC 1YDXA 4X1IA 4WBNA 1G4YB 1M4UA 2YIDA 4PDVA 1Q82W 3BY6A 3JASA 1NKDA 2DYSC 2ZE7A 3AG3C 1LUVA 4FFBB 4BR6A 3CMEV 4RO2A 2ZINA 1YHQV 2UUCO 2AZ2A 4CH6A 4GLXA 1AI7A 2NNUA 1W2BU 2PI5A 4MTOA 4U3JA 2UXCB 5KHIA 2OWOA 1U96A 1B6QA 1BCCH 4F6RB 2EILC 1U97A 5EC1C 5B1OA 3SR2C 3RYHB 3E8BA 2OTLV 5KHJA 4AILC 3SPJA 3CJHA 4LH6A 3E86A 1AJPA 4X1KA 4JI1O 4LH7A 1MNGA 4O2AB 3K0GA 4CC6A 2YEVA 4DUZB 1QLEB 2LGQA 1A32A 5CBGA 1WP7A 3ASOC 3BEHA 4B3SO 4QPKA 4X64O 1EZJA 2QSAA 3LSQA 1K5SA 1BGYH 3UT5B 2RCVA 1NU1H 1VQNV 4Z1MG 3DSQA 2XT9A 4ZI7B 1N33B 4N23A 1M56B 4DR6B 2YC0A 3ZMUA 3IJ4A 2JEXA 3K5LA 1GN3A 2HG5C 4ZOLB 1NS1A 3X2QB 4WFHA 2VQFO 4DV2O 2P06A 4UCSA 1YF2A 1IXBA 3L72H 1K7DA 4MTGA 1HR0B 4I7ZB 2RN9A 2F93B 2IJKA 3A2FA 1Q90D 1XILA 2F4VO 1MSDA 2Y0PA 4UUJC 3SYAA 4UFZA 4U7OA 4H13B 1WPXA 4FM1A 4MT8A 1ZAUA 4O4LB 1MOFA 4E2LA 2ZT9B 3ETDA 3AG2C 5H5NA 4KP4A 3FAVB 3K9SA 1XUQA 3ZN0A 1HNXB 1BS3A 2DYRC 1SQFA 3JD4A 3EHBB 2ZE8A 3Q4HB 1XL6A 3VBBA 3ZCCA 4FFBA 1XDCA 3OGCC 1N36O 4ASUG 2QKSA 4I50B 1SA0B 4JYYA 1Q5OA 1FXHA 1OCCB 1JJ2U 1GAXA 2N05A 1BHBA 4F6RA 1OHHG 1VEWA 4DV6O 5EZYB 4X1YB 3RYHA 3DXRB 3T2MA 4IL6Z 2H3OA 4TV8A 4KHPB 2LGWA 4F4LA 1VMGA 1YXBA 4MVSA 1R1BA 4NXNB 1SESA 4TSFG 2ZKOA 2CDYA 3OW2U 2R9RB 1N8RW 1JQ0A 2QJ1A 2WLHA 1YCIA 5LXTB 5BR8B 1N34B 3CE2A 3JD2A 2EJRA 2WSSG 5FNVA 5A2QN 4CS2A 4DV7B 1EZVH 1GKFA 3HPLC 4UB8Z 3ASNB 1HDJA 1RM1B 5A9GA 1GH6A 4KFMA 4FPPA 2EZOA 4ZOLA 4LF6O 4JAUA 2H94A 2UXBO 4JI6B 1NVPB 3JAWB 3RT3C 3W7SA 4D7TA 4EFBA 1NI8A 4UCRA 5L3DA 4QPJA 3CC4V 1IBLO 2EJ7A 5LMUB 3ZHQA 4EB6A 3OGIB 1S5HC 4CZZA 2NLJC 4H44B 4JYBA 3FFQA 4MVRA 3SPIA 5IDJA 1QLEC 2IJJA 3PN1A 2GUZB 2IJHA 2A7WA 5BMVB 3M99B 1UPGA 1SF9A 3K58A 1IZ3A 4GKJO 4AQYO 4YXWG 5ITZB 2EULA 5LL6Y 4DR3O 1WB8A 2H8PC 4YY3O 2Y4UA 5IE9A 3Q4HA 1FD9A 1JA8A 2CK3G 3TGUH 3X2QC 3OUSA 1H8EG 4LFAO 2BCCH 3U11A 4JI2O 4H0LB 3SJAC 2WLLB 4XDJA 1VF6C 2PI4A 1SZXA 1PPJH 1V55C 4LFCO 1BE3H 1H2SB 3S3WA 2P90A 1F7YA 4B3RB 4HNAB 5H2FZ 3SYQA 5D5QA 4R50A 1TVKB 4TT3G 5IWAO 3B77A 1WNSA 1AR4A 1OCRC 4R7CA 1F4MA 2GTSA 1US6A 2LW1A 3CRRA 5AG2A 1MG1A 1WPBA 2XTAA 1TA8A 2V4DA 3OMAB 1KC8W 1JCHA 2FTKA 4NXMO 4IGGA 4PA6A 2FMLA 5LXTA 3D3IA 3CSXA 1AB3A 4UCOA 5B1BC 2ZXWC 2Q9LA 1SS3A 1WP8A 4DRXB 3IGAC 3HR0A 5DECA 3N2GB 5J9PC 1PL4A 1IXMA 1VF5B 1XNQB 2QDOA 3K5OA 2YXYA 3B8MA 4YHHO 1VQPV 5KA6A 2ZR2A 1BMFG 4CS4A 3O65A 4LR3A 4GUNA 3AG1C 3VQVA 3B09A 3AK3A 1J5EO 2QM7A 1XOUA 2CE4A 1JFFB 3CCEV 4HZ3A 2K9PA 3OMIB 3N27A 2HLDG 1QU7A 4NR1A 2MK3A 4UCTA 1K3EA 4JAVA 4DW1A 1Q86W 2ZCEA 4J7KA 5LP6B 4PI0A 1FXKB 3AEIA 4K0KB 3CB2A 3L70H 2P4KA 4I55B 2LFRA 2XAQA 5ITZA 2RDCA 1KECA 2ADPA 4DV5O 3VQWA 3ASNC 1COWG 1L8DA 4B3TO 1Z5WA 3IC7A 1RPRA 1YTFB 1GTOA 3LSSA 3K06A 3MD0A 2P4VA 2DWDC 3M8AA 1XL4A 1JOYA 4JV5B 1M9NA 2DYSB 1RSOB 1H2NA 2HVJC 4DV0B 4KL1A 4LF8O 1M93A 3SYCA 2X6AA 4MTXA 4J41A 4U7NA 2DQ3A 5GTIZ 4UVBA 3ABLC 4HAMA 1I94O 2GV9A 2YS8A 1JJOA 1VQOV 4FLZA 4MSWC 2JJ2G 4XDKA 3CD6V 2EIMC 2GTAA 1I5XA 4FLWA 3RWRD 4ZHQA 3JAMN 5LHIA 4JI5O 1P7BA 5IY5B 4GX1A 2NR5A 1S0VA 1O9HA 3ABMC 1QCEA 3AG7A 2Q7EA 3WU2Z 2VWKA 4GX0A 5L3CA 3ZRVA 3ASOB 3TXSA 4DV4B 3JSLA 1PP9H 2BTQB 2NN4A 3CXHF 3LSUA 1GK9A 3N2KA 2Q67A 4DR5B 3F7YC 1XNRB 2V7QG 1H2MA 3BA9A 4FLXA 4FM0A 3T1YB 2HFEC 3MHSC 1XBLA 2CGNA 4U3JB 3B8NA 2YI9A 5KUKA 2D3OW 1XHXA 3G6EV 3ABKB 4I5SA 4JGSA 1D5AA 1VQ9V 1MZEA 2ZIMA 1R6TA 3G67A 1VF7A 3LDCA 3CP1A 2LW7A 3CJHB 4GKKO 1Q81W 5IYBO 1Y66A 1PNLA 2EZPA 3C90A 1JMKC 5LOVA 1VQ7V 2YEVB 4K8XA 2QR4A 1FXKA 3F7VC 3L75H 4DK1A 2HJFC 2C2AA 5CA0B 1SQXH 2W0XA 3D3QA 3L9DA 2VQEB 3WG7B 5C8YA 2QWRB 2L6LA 1GM7A 5JVDB 3ZMVA 1XQ8A 3J81N 4JF3A 1BQ0A 1SETA 2ILMA 1N32O 1EN6A 2VWJA 1HP8A 4F6EA 2LJ2A 1H2KA 2V1DA 2WLIA 1AILA 5L3BA 4X62B 1F4NA 4OX9O 1S76D 3OTFA 1ZLZA 3W7WA 3BRCA 2B9ZA 1CXZB 4X89A 3H1JH 1H2LA 2BSKB 2Y69C 3KKYA 4JTDB 5CA3A 1Q6UA 4JYCA 4DR2O 2QTOA 4WFBV 1RP3B 4DR7O 3STLC 3ZBHA 4DV3O 4JI8B 5LMNO 5BY1A 2R9IA 1HNWO 1G6UA 4WF9V 1K92A 2UUCB 4PELA 3CCQV 1SKVA 4ZIBA 2JRIA 4QGPA 2QWQB 3AK1A 4B7EA 1TUEB 4U3FH 2QE7G 1KMIZ 2QWNB 1ZSPA 1Q7YW 2BTQA 5LGUA 4W4KA 4GX2A 3D36A 4PD4F 1OZ0A 3H01A 4YIPA 1Y4MA 2IW5A 2WLKA 4JZ2A 3HKBB 1V9PA 1R73A 4PA4A 3FYEB 3FX7A 1HNZB 2IM9A 4TQFA 4PDLA 1QVGU 5EYPA 4FLVA 1TAEA 4BIZA 4TWKA 3OD4A 4JI0O 5LBQA 2Q73A 1Y67A 2P6JA 2OTJV 2PUSA 2UUBO 3JCZA 3E8HA 4TV8B 3CCMV 3TCUA 3ETQA 3ZHVA 4DUYO 4J42A 4QE7A 3QTCA 1S72V 1Y74B 5IY5C 2RMKB 2WA4A 2ZDIA 3SPGA 2LFSA 2ZE5A 2QM4A 5K1XA 2KG7B 2YXLA 5CA0A 1SZTA 3ETGA 5KHHA 2KB1A 1S5JA 5FNVB 3D36C 1MMMA 2Y4TA 3CRCA 3OFNG 5JVDA 3AK2A 5IJ9B 1YVWA 3LDDA 3SPHA 3GWKC 4CH4A 4EKWA 4D6TH 1VQKV 4X66B 1NH2B 3ABKC 1R3LC 2A0LA 3UQ8A 2F4VB 4TUYA 1H8HG 2DOSA 4X9QA 1FAFA 4N21A 3CRAA 1V55B 1FJGB 1JVMA 3E22B 4EB6B 2QKAA 1BQZA 2Q5ZA 4JYAO 5KMGA 2RQ6A 2BSKA 5CA1A 4FLTA 3BFRA 1W0KG 3E35A 3QO8A 1YEWA 3ZMZA 2ZDIC 1HW7A 1K33A 4O2BB 4MS2A 1ZL8A 1OCRB 4DR6O 2DN9A 2XUMA 3CRQA 3WG7C 4G27B 4W4LA 3SDLA 1IDSA 3HKDB 4BW9A 4NB5A 2Y0IA 2YIBA 5B1BB 2KKWA 2ZXWB 4DV6B 5JH7A 2HKOA 2XASA 5GW7A 1K4CC 2JDIG 4OGQB 1R6NA 3H1LH 4L87A 3K79A 3CXCU 3MDSA 5JJEB 5BZBA 3HKBA 1QQCA 4LCUC 2QWPB 3JARB 3JSNA 3NR7A 3SJBC 4UB6Z 1AR1B 1FYJA 1DLBA 4B3MO 3AG1B 4MW3A 3QVNA 1SQVH 4P2ZA 3ZMTA 1KKCA 2K1EA 1UFIA 5LYJA 1NR7A 1Q3EA 1BZKA 4NKGB 1Y74A 1I08A 1TUBA 3K04A 1K9MW 3WB0A 1QHTA 1D5NA 4LF6B 4LFBO 2KG7A 3OTOO 2Z3YA 2UXBB 5KX5B 2PYLA 3DC6A 5LGNA 1K5QA 3CCUV 1IBLB 2WWWA 3ICXA 1TGOA 4LF5O 5IJ9A 1FKAO 4P9PA 4RUEA 3M7MX 4DR4B 2LP7A 2GBOA 4I0XA 3K5MA 3CC7V 3OT7A 1L0NH 4UVCA 4I4TB 2ZNJA 1PNKA 5L3GA 3J80N 1UJWB 3CCJV 1VF6A 3FYIB 4A5UB 2B1IA 2IH3C 4UCUA 5GONB 3E22A 1L0LH 4JTAB 3OM3B 1CPYA 4DV1O 2P22C 4AQYB 3K59A 2QA4V 1O9GA 3ABLB 2P5OA 3E2EA 4YY3B 1NTKH 2E74B 1AROP 4O2BA 3AG4C 2HVKC 4FLYA 4LBEC 1F23A 4IHJA 3RVZA 5KLVH 4JTCB 5EIBD 4LFAB 4UCVA 2UU9B 4JI2B 2EIMB 2ZQMA 4LF9O 4K3AA 1Y76A 4KXRA 3FB8C 4IYIA 2M6YA 2W0FC 2E76B 4LFCB 3HKDA 4PI2A 3ZEDA 3E8GA 1WAZA 3HKEA 4J80A 3ABMB 4NVPA 5LMUO 5HFMA 3HKCB 4PA3A 5IWAB 3JD0A 4JI7O 1WJZA 4LP8A 3JARA 3C3TA 4I9WA 1MA1A 1RFYA 4NXMB 2FL4A 2UXXA 3EFFK 4UVAA 4JASA 2Y48A 1PNMA 2DE0X 1EBOA 2E5LO 1GM9A 4ZHQB 2ZM6O 1OCZB 2JVDA 2KQXA 1PM9A 2WLJA 2CTWA 4YHHB 5KX5A 5IYDO 2EINC 5EBMC 1AI6A 4B3RO 4TV9A 3N2KB 3OR7C 1L1FA 1MABG 2ZD9A 3TJTA 3RYCA 1J5EB 3K08A 4O4JB 1W0JG 4RAIA 3QNEA 3W7XA 2UXDO 2CTRA 3WFVA 2F43G 4I4TA 2DJVA 2HJDA 4JI4O 1VQ8V 2JJ1G 2AHZA 5GONA 2XAHA 1ZUQA 3L73H 4BW5A 1THZA 1FS0G 1IX9A 5DN6G 4DV5B 2FB5A 2WLNA 4G2KA 2PY5A 2Y69B 5LOVB 1ROPA 4JI3O 5CB4B 4CBCA 2YSUB 1IBKB 1Q6HA 2Q7HA 1GRJA 1AI5A 2X0LA 3JD3A 2Q7GA 1JPXA 4Q6GA 5C93A 3H1HH 4LF8B 1JX9A 5C8YB 2M7WA 1AVMA 4GCZA 5EBWC 2YDEA 2UUAO 3ETEA 1ENVA 3R66A 2GHYA 3HKCA 4P9OA 4X65O 1GM8A 2GSMB 4YIOA 1NH2D 2Q8VA 2AW9A 3I56V 1LUWA 2WLIB 4G28B 3GWOA 2XOKG 5LA6B 5CBFA 1V54B 4B7KA 1N0JA 3CEIA 4K0KO 4UV8A 2OIGA 3ZN1A 3KZIZ 3K57A 3ABUA 3IC9A 2JEUA 3IAYA 4DW0A 2CH7B 1FFXA 1N4CA 3DGEA 1AI4A 2YIAA 3OUFA 3UO3A 1H2GA 1DTOA 4B08A 4ICGA 5H9CA 3JCUZ 5CMUA 1NZ6A 1XMOO 4MTFA 2R9AA 2R72A 2ETNA 4LWSB 3QF7A 2F66C 1JR9A 1G8MA 4RQEA 4JPRA 4LF4O 1YJWV 3FB7C 3ZS8C 5EK0A 3OR6C 5TISZ 4LF7O 3BVOA 4O4JA 2N74A 4GKKB 1B06A 5K1PA 5CN0A 2WA3A 5FL7G 1X4TA 2VS0A 3ML0A 5E1AC 4MVZA 5EYPB 4O4IA 3RYFB 2F23A 3CHXA 1R3JC 2XAFA 1RPOA 3H1IH 2LQTA 4H37A 3U0ZA 2DWEC 4MVOA 1AJQA 2QTSA 3P3PA 5H6RA 1VARA 3DC5A 1OCZC 1R6KA 2Z5UA 3K03A 4KUMA 1R3IC 4J11A 4K8ZA 3ZHRA 1SC5B 4DR1O 5CB4A 3LUTB 3T1HO 1IURA 4GZRB 4DR5O 4J9ZB 1XNRO 1GMGA 1ZTEA 3A0RA 1N32B 4QIWF 2ZIOA 1R3KC 4BIOA 4OX9B 5BXZA 1LNQA 3ZHTA 4JAAA 1VQ4V 3W7TA 4NTWA 2DMXA 3T4DA 1CP9A 5IYZA 4J7JA 1XMQO 4DYLA 1E1QG 3OEEG 4DR2B 1NVPD 4TUYB 3CX5F 4FM2A 3GVMA 1M5IA 4DR7B 5LA6A 1K97A 3A0HZ 4LNUA 5LMNB 5KMGB 4GYCB 5CA1B 2PZSA 1YSCA 1M57C 2BE3A 2CUGA 1F51A 3ZMSA 1D2DA 4E4EA 1T5EA 5FLXN 2CH7A 1XI1A 2HHHO 4MVUA 2VQEO 2BOCC 1ZL8B 1IBMO 4DXWA 4MW8A 2XNDG 1DF5A 2JGDA 2B5UA 5GTHZ 1P49A 4O4HB 3RVYA 4MVMA 2E3CA 3ABTA 1VQ6V 3G80A 3THOA 5KAIZ 4LWSA 1YJNV 3P32A 1BSMA 4X20A 1KP2A 4JI0B 5JH7B 2PF4E 1OV9A 1VIBA 4X88A 2UUBB 3JYCA 1KP3A 2ARHA 1QVFU 2VRZA 2WLMA 3ZIAG 3LDEA 1Q43A 1V54C 4DUYB 4JI1B 4QJFB 3R65A 3EXAA 3RYFA 2XAGA 4JI8O 3NXSA 1W59A 2EIJC 1GN2A 1YI2V 5DEDA 4B3SB 2HEPA 4QE9A 4X64B 2OCHA 3VOUA 2Z0AA 2JIZG 5LYJB 1NTMH 1URFA 2EIKC 1TUBB 2X6CA 2ITCC 2OCCC 3LNNA 3AG4B 3UKMA 3F5TA 2F95B 4Z2WA 1K4DC 1J95A 2QM8A 5LHGA 2HR3A 3K9AA 2VQFB 3B2EE 4DV2B 4AHCA 1S5LZ 5B3SC 2UXCO 1GN4A 4OXSA 4J10A 1HNZO 1GO3F 2N04A 3K5NA 1QBZA 4HBNA 4XBFA 4YJ3B 1WLEA 4WFGA 1GN6A 4JYAB 5EC2C 3JALB 4I0XB 4RUFA 3P3NA 3E83A 4Q20A 1VQ5V 4TOIA 4L8JA 1IVSA 3RFRA 1XEQA 4DUZO 3B40A 3APQA 3JAKA 3TK1A 1YJ9V 4XDLA 1P84F 4BWAA 4ZBMA 1SRYA 2AZ0A 4IHJB 1N33O 1SQPH 5JQGA 1BL8A 1AJNA 4O4HA 2A3QA 5KHGA 1N36B 1DF4A 1Y76B 4X66O 5EIBC 5E79Z 1KUQA 1HR0O 1AP5A 3HKEB 5JJNB 1YTFD 1FJGO 2ADQB 2KSDA 4FFKA 5J2UB 2EINB 1NJIW 3CWBH 1KQSU 4B3MB 1VP7A 3MAQA 3SJQC 1YIJV 3ZHUA 2EBOA 3CCRV 3C3SA 4MVQA 4WFFA 2PYJA 4LC1A 2R70A 5CBHA 5J2TB 4LFBB 3LNMB 1KYOF 3OTOB 5FPRA 5DM6V 1HNXO 3K0DA 1G1XB 4LF5B 1WN7A 2OT5A 5H6QA 3CPWU 3RYIB 1PL0A 3L71H 2W6JG 1YITV 3F5WC 3O9OA 4O2AA 2P67A 5F2VO 4TV9B 4YJ3A 3RBZA 1SQGA 3RYCB 2F1MA 3QG5A 4DV1B 2ITDC 3JALA 4IYHA 4KHPO 3VQYA 5HFLA 3BAAA 2P7TC 3UT5A 1PV0A 3OMNB 4NXNO 1B3QA 5KAFZ 3HB3B 4WFEA 4ZI7A 4FZ0A 3BPZA 3FKSG 3CCSV 4GKJB 4LF9B 3G6BA 5BR8O 3FD9A 1N34O 1P4RA 4DR3B 1NTZH 4AI8A 2JS5A 4UXNA 4DV7O 3CS5A 4I9QA 1Q8IA 4NTYA 4DR4O 2OYQA 2ZE6A 4FJCC 4IIJB 3CCLV 4JI6O 4P30A 4JI7B 2FKXA 3JATB 4JZGA 3BCCH 3KG2A 4O4LA 5L3FA 1XREA 1HWYA 5J2UA 3G4SV 4HYOA 4FK5C 3APOA 5JCOA 3I55V 2B1GA 3FAVA 1QR9A 1KD1W 4PDRA 2CTPA 2QKCA 1M56C 1Y6XA 3KCXA 4OPHA 5B66Z 5KA5A 1AP6A 4OPAA 1E79G 2E5LB 4PJ0Z 1NBMG 2Q4PA 2ZM6B 2UU9O 5EBLC 1YZBA 3L74H 4EEQA 5J2TA 4I50A 1SA0A 1FFXB 5B1AB 5D5PA 4K35A 5B5EZ 1FPOA 1N0NA 2CAZC 4R6ZA 4R8CA 1EFRG 3TXQA 5EZYA 3A8TA 3B4SA 4X1YA 3DXRA 3RYIA 2LO1A 3SGIA 2YUAA 2YICA 3ZRSA 1WB7A 1Z5VA 1K8AW 1M90W 2UXDB 1B04A 2QGNA 4CC5A 2A9HA 4UV9A 3SYOA 1PKXA 5JCOC 2IH1C 4GT1A 4YJ2B 2YIBD 4JI4B 3VQXA 2Q0OC 3T4ZA 2YXHA 5JJJB 3JD1A 2JGUA 3ZJZA 2XAJA 3RN4A 1KB9F 4O4IB 1Z2GA 4WFAV 4JI3B 3OEHG 3PJSK 2DQ0A 3ZRXA 3GB7C 1P7GA 2JS3A 1OCCC 3BA8A 2X6BA 4GX5A 4RWUA 2UXNA 3JAWA 4B3TB 3UM7A 4PDMA 1EM1A 1M57B 4CS3A 1I5YA 2D2CB 5IT9N 2UUAB 1K73W 1WA8B 2ZR3A 4TQDA 4WCEV 4X65B 1S77D 1K34A 3H9VA 1XNQO 4C7UA 4FIPC 4IIJA 3WB2A 2XHBA 1E1RG 3JATA 3A0BZ 1AR5A 2GUZA 1OJHA 1OCOB 5BMVA 1PD3A 3CYOA 1I94B 5IYZB 1CEZA 2BTOA 1I7FA 1SQBH 1VQLV 2JK5C 1RM1C 3CMAV 1MSWD 1EN4A 4LNUB 1IBKO 4JI5B 4CH3A 3ZRWB 2AXTZ 2IJIA 1XMOB 2WLLA 3AG3B 5LHHA 4FMTA 1QR8A 3FB6C 2EIJB 3H1KH 1KU9A 3DTUB 2G38A 2WAMA 4LF4B 4J9YB 4HNAA 2JGDB 4J7ZA 2Q6AA 1QNMA 1MZFA 3FB5C 5B1NA 1TVKA 2EIKB 4JV5O 2IU3A 3UCSC 4LF7B 2OCCB 4IT5A 1DGSA 2EILB 2HP8A 4DV0O 2IBZH 1LR1A 4NYKA 3RGBA 3I5DA 5KUMA 4X20B 2RNBA
chains in the Genus database with same CATH topology
1FFTB 3LDEA 1OCRC 4R7CA 1F4MA 5B3SB 3CCVV 1V54C 4QJFB 1AR1B 2W6IG 3R65A 1DLBA 4H33A 3G71V 3AG1B 4RQFA 1MG1A 4MW3A 4P2ZA 3OMAB 1KC8W 3ZMTA 2XAGA 1JCHA 2FTKA 3NXSA 2K1EA 4PA6A 3E8FA 2IU0A 1NR7A 3T1CA 2EIJC 4DO2A 3OE7G 3D3IA 1YI2V 4QE9A 3K04A 1FXVA 4PA7A 5B1BC 3SPCA 3VOUA 2ZXWC 1K9MW 2JIZG 5B1AC 1SERA 2EIKC 3IGAC 3OAAG 2X6CA 2ITCC 2OCCC 2Z3YA 5L3EA 3E89A 3AG4B 3UKMA 5J9PC 2WPDG 1IXMA 5LGNA 1K4DC 1BHAA 1J95A 1K5QA 2QM8A 5LHGA 3CCUV 2HR3A 2WWWA 3B8MA 3K9AA 4BIUA 1VQPV 5KA6A 2ZR2A 1BMFG 5IYCO 2BOBC 3TETA 1NQTA 4P9PA 5B3SC 4OXSA 3CC2V 4RUEA 1GO3F 1KKDA 2LP7A 1QBZA 4XBFA 3AG1C 3CC7V 3MHHC 1WLEA 4UVCA 4WFGA 4PA9A 1PNKA 3SYPA 5EC2C 5L3GA 2QM7A 4QNHB 3CCEV 1UJWB 3CCJV 3K3WA 4HZ3A 3FYIB 3OMIB 4RUFA 2B1IA 3E83A 2HLDG 2IH3C 1NR1A 4Q20A 2MK3A 1H38A 1VQ5V 4JTAB 3OM3B 1CPYA 1S3JA 2X7RB 1K3EA 4JAVA 2QEXV 3W7UA 1Q86W 2QA4V 3ABLB 3E2EA 3AG2B 1FXKB 3AEIA 1AROP 3TK1A 3AG4C 1YJ9V 2HVKC 4X8AA 4LBEC 1F23A 4BAYA 2DW4A 4XDLA 3RVZA 2LFRA 4JTCB 2XAQA 3STZC 2Q68A 3QO7A 1ZWIC 1KECA 4ZBMA 1SRYA 2Q69A 3ASNC 2DYRB 2EIMB 2ZQMA 1COWG 3IC7A 1RPRA 1YTFB 3ZRWA 1GTOA 3LSSA 3FB8C 3K06A 3MD0A 1BL8A 2DWDC 4ZKIA 1AJNA 2W0FC 1XL4A 3QO5A 1JOYA 3E8GA 3IFXA 1M9NA 2DYSB 3RW0A 1DF4A 3ABMB 2HVJC 5HFMA 4PA3A 3SYCA 2X6AA 4MTXA 2A79B 2ATKC 1YTFD 4U7NA 2DQ3A 4UVBA 3JD0A 5LGTA 3ABLC 2EINB 1QLNA 4LP8A 1OCOC 1NJIW 1FXKC 4HAMA 1KQSU 1VQMV 4I9WA 1M1KW 3SJQC 1VQOV 2UXXA 4MSWC 2AHYA 3EFFK 2JJ2G 4UVAA 4JASA 3P30A 1YIJV 1ORQC 4XDKA 3CD6V 2EBOA 2EIMC 2Y48A 1I5XA 3CCRV 4MVQA 4WFFA 4LC1A 5LHIA 1G4YB 1PNMA 1P7BA 4PDVA 1Q82W 5IY5B 4GX1A 5CBHA 3BY6A 1S0VA 1EBOA 1NKDA 2DYSC 1GM9A 3ABMC 3LNMB 3AG3C 1QCEA 1OCZB 4GX0A 5L3CA 5DM6V 3ZRVA 3K0DA 3CMEV 3ASOB 4RO2A 1YHQV 2WLJA 1GK9A 1AI7A 2NNUA 1W2BU 2PI5A 2Q67A 4MTOA 2OT5A 5H6QA 3CPWU 5IYDO 3F7YC 1PL0A 2EINC 2V7QG 1B6QA 5EBMC 2HFEC 1AI6A 3MHSC 3OR7C 2W6JG 1YITV 1L1FA 1MABG 2EILC 5EC1C 5B1OA 3F5WC 3B8NA 2ZD9A 3E8BA 5KUKA 2OTLV 2D3OW 3G6EV 3ABKB 2P67A 3K08A 4I5SA 4JGSA 1VQ9V 3SPJA 1W0JG 4RAIA 3QNEA 3W7XA 3E86A 3RBZA 1AJPA 3WFVA 2F43G 2ITDC 3LDCA 3K0GA 3CP1A 2YEVA 1VQ8V 2JJ1G 1Q81W 5HFLA 5IYBO 2AHZA 1Y66A 1PNLA 1QLEB 2P7TC 2EZPA 5CBGA 2XAHA 3OMNB 3BEHA 3ASOC 1VQ7V 2YEVB 3HB3B 1THZA 4QPKA 4WFEA 1FS0G 4BW5A 5DN6G 1EZJA 1FXKA 3F7VC 3LSQA 1K5SA 2WLNA 3FKSG 4G2KA 3CCSV 2Y69B 1VQNV 4Z1MG 1ROPA 1P4RA 2HJFC 4N23A 2C2AA 4CBCA 1M56B 2YSUB 3ZMUA 1AI5A 2X0LA 2JEXA 3JD3A 3WG7B 1JPXA 2HG5C 4UXNA 3X2QB 5C93A 1GM7A 4WFHA 3ZMVA 1JX9A 4MTGA 1K7DA 4JF3A 2M7WA 1SETA 4GCZA 5EBWC 4FJCC 3CCLV 3ETEA 1ENVA 2GHYA 2IJKA 4P30A 4P9OA 1GM8A 2GSMB 2V1DA 2WLIA 5L3BA 1F4NA 1NH2D 3KG2A 5L3FA 1S76D 3W7WA 1HWYA 3I56V 4UUJC 3G4SV 4HYOA 4FK5C 3SYAA 4U7OA 4X89A 2WLIB 4G28B 1WPXA 3GWOA 2XOKG 2Y69C 4MT8A 3I55V 2B1GA 1QR9A 4JTDB 5CBFA 1MOFA 5CA3A 1KD1W 1V54B 4JYCA 4E2LA 2QTOA 4PDRA 3ETDA 4WFBV 3AG2C 1M56C 4UV8A 4KP4A 5KA5A 3ZN1A 1E79G 3ABUA 3STLC 2JEUA 1NBMG 3ZN0A 2R9IA 4WF9V 3DGEA 5EBLC 1AI4A 1K92A 2DYRC 3JD4A 3OUFA 3EHBB 1XL6A 1H2GA 3VBBA 3ZCCA 1DTOA 4PELA 3CCQV 5B1AB 5H9CA 5CMUA 1TUEB 3OGCC 4ASUG 2QE7G 1Q7YW 2QKSA 4MTFA 4R6ZA 4R8CA 5LGUA 1EFRG 1FXHA 1OCCB 1JJ2U 4GX2A 3D36A 1OZ0A 3H01A 1G8MA 1Y4MA 2IW5A 4RQEA 2WLKA 1BHBA 3ZRSA 4JPRA 1OHHG 1K8AW 1M90W 1R73A 1YJWV 3FB7C 4PA4A 3FYEB 5EK0A 3OR6C 3T2MA 2A9HA 4PDLA 4UV9A 3SYOA 1PKXA 1QVGU 2IH1C 4GT1A 4BIZA 4TWKA 5LBQA 4F4LA 2P6JA 2OTJV 5CN0A 4MVSA 3JCZA 5FL7G 3T4ZA 3ML0A 5E1AC 4MVZA 3E8HA 1SESA 4TSFG 3CCMV 3TCUA 1R3JC 2XAFA 1RPOA 3OW2U 4H37A 2R9RB 1N8RW 3JD1A 2DWEC 1JQ0A 4QE7A 2WLHA 4MVOA 2XAJA 3ZJZA 1S72V 4WFAV 5IY5C 1AJQA 3OEHG 3PJSK 2DQ0A 2ZDIA 5H6RA 3ZRXA 3GB7C 3JD2A 2EJRA 2WSSG 1OCZC 1R6KA 2Z5UA 3SPGA 2LFSA 3K03A 1OCCC 4KUMA 1R3IC 2X6BA 1GKFA 3HPLC 3LUTB 1SZTA 4GX5A 3ASNB 3ETGA 1RM1B 2KB1A 2UXNA 4KFMA 4J9ZB 4FPPA 2EZOA 4PDMA 3UM7A 1GMGA 1M57B 1I5YA 3OFNG 3A0RA 4JAUA 4QIWF 2ZR3A 1K73W 2H94A 1R3KC 3LDDA 4WCEV 1NVPB 1S77D 3SPHA 3W7SA 1K34A 4EKWA 1VQKV 1NH2B 5L3DA 4QPJA 3ABKC 1R3LC 2A0LA 4FIPC 3CC4V 1LNQA 1E1RG 1VQ4V 3W7TA 1H8HG 3T4DA 1S5HC 1CP9A 4CZZA 4N21A 2NLJC 1V55B 1E1QG 1JVMA 3OEEG 4JYBA 4MVRA 1OCOB 1NVPD 1PD3A 3SPIA 5IDJA 3CYOA 1QLEC 2IJJA 1CEZA 1W0KG 3E35A 2IJHA 3QO8A 1K97A 3ZMZA 2ZDIC 3M99B 1VQLV 2JK5C 1K33A 1RM1C 3CMAV 4MS2A 1MSWD 1YSCA 1OCRB 4YXWG 1M57C 1F51A 3ZMSA 2H8PC 4MVUA 2BOCC 3WG7C 4G27B 3ZRWB 2IJIA 2WLLA 4DXWA 3AG3B 2CK3G 4MW8A 3X2QC 3OUSA 1H8EG 2XNDG 1QR8A 4FMTA 5LHHA 1DF5A 3FB6C 2EIJB 2B5UA 3RVYA 4MVMA 3ABTA 3DTUB 2WLLB 4XDJA 1VQ6V 2WAMA 5B1BB 2ZXWB 4J9YB 2PI4A 1V55C 2HKOA 2XASA 5GW7A 1K4CC 2Q6AA 3FB5C 2JDIG 1YJNV 5B1NA 1R6NA 4L87A 3P32A 2EIKB 3K79A 2IU3A 3CXCU 2P90A 5BZBA 2OCCB 1KP2A 2EILB 3SYQA 4LCUC 4R50A 4X88A 4TT3G 3JYCA 1KP3A 1QVFU 2WLMA 5KUMA 3ZIAG 3B77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OEH G;  4UXN A;  5H6R A;  2W6I G;  2EJR A;  2WSS G;  2Z5U A;  4UVB A;  3ZMV A;  4KUM A;  5LGT A;  3ZMT A;  2XAG A;  3OE7 G;  2UXN A;  2V1D A;  3OFN G;  2UXX A;  2JJ2 G;  4UVA A;  5L3B A;  2JIZ G;  2H94 A;  5L3F A;  2Y48 A;  3OAA G;  5LHI A;  5L3D A;  2XOK G;  2Z3Y A;  5L3E A;  2WPD G;  1E1R G;  5LGN A;  1H8H G;  4UV8 A;  5LHG A;  4CZZ A;  5L3C A;  1E1Q G;  1BMF G;  3OEE G;  3ZN1 A;  1E79 G;  3ABU A;  1NBM G;  3ZN0 A;  2R9I A;  4XBF A;  5H6Q A;  1W0K G;  2V7Q G;  4UVC A;  3ZMZ A;  5L3G A;  2W6J G;  1MAB G;  2HLD G;  4YXW G;  4ASU G;  2QE7 G;  3ZMS A;  5LGU A;  1EFR G;  1W0J G;  2CK3 G;  2F43 G;  2IW5 A;  5LHH A;  1H8E G;  2XND G;  1OHH G;  2JJ1 G;  4BAY A;  2DW4 A;  2XAQ A;  3ABT A;  4UV9 A;  2XAH A;  2HKO A;  2XAS A;  5LBQ A;  1COW G;  2JDI G;  1FS0 G;  5DN6 G;  5FL7 G;  3FKS G;  4TSF G;  4Z1M G;  2XAF A;  4TT3 G;  3ZMU A;  2XAJ A;  3ZIA G;  2X0L A; 
#chains in the Genus database with same CATH topology
 1FFT B;  4ABM A;  3CCV V;  5B3S B;  4Z1V A;  3S3X A;  5IJ0 B;  2W6I G;  3EVK A;  4H33 A;  3G71 V;  4RQF A;  4X1I B;  1Q6I A;  4FVM A;  2E75 B;  2EX3 A;  3E8F A;  2IU0 A;  4WBN B;  3T1C A;  4DO2 A;  3OE7 G;  4DRX A;  3JAS B;  4DR1 B;  1FXV A;  2AGA A;  4PA7 A;  3T1H B;  3SPC A;  2RJZ A;  3N2G A;  5B1A C;  1SER A;  5JWP A;  1KBH A;  4FZ1 A;  5FPO A;  1XHZ A;  4DK0 A;  3OAA G;  5L3E A;  3E89 A;  2QWO B;  3BHP A;  2WPD G;  2FYU H;  4DV4 O;  1BHA A;  2PGG A;  4BIU A;  1WA8 A;  1I0H A;  5KHK A;  5IYC O;  2BOB C;  3TET A;  2CGO A;  1NQT A;  4YJ2 A;  3CC2 V;  1SQQ H;  1KKD A;  4NTX A;  3T1Y O;  1JFF A;  1XMQ B;  2OIE A;  3D8C A;  3MHH C;  2L35 A;  4X1K B;  2ZNI A;  4PHZ A;  4PA9 A;  3SYP A;  4QNH B;  2ODM A;  3K3W A;  5LP6 A;  1NR1 A;  1H38 A;  2MW2 B;  1S3J A;  1BT8 A;  2X7R B;  2QEX V;  3W7U A;  4EFE A;  4I55 A;  3AG2 B;  3KCY A;  2HHH B;  1X59 A;  3ZHS A;  1DK1 A;  4X8A A;  4CH5 A;  1IBM B;  4BAY A;  2DW4 A;  3STZ C;  4DV3 B;  2Q68 A;  3QO7 A;  1ZWI C;  3U10 A;  2A06 H;  2Q69 A;  1HNW B;  3JAK B;  2DYR B;  3SJC C;  1ZX3 A;  4FLU A;  4PV1 B;  1RSO A;  3ZRW A;  2PTM A;  4D7S A;  4ZKI A;  1NT2 B;  3QO5 A;  3IFX A;  2YI8 A;  3RW0 A;  2O57 A;  5JQG B;  3UO2 A;  3WB1 A;  1EN5 A;  2A79 B;  2ATK C;  3BAB A;  5LGT A;  5LP6 C;  1QLN A;  2GDS A;  1OCO C;  1FXK C;  3ZX6 A;  3J7A U;  1VQM V;  2CTQ A;  4X62 O;  1M1K W;  3CRM A;  2Q0A A;  5IJ0 A;  2AHY A;  3P30 A;  1ORQ C;  1YDX A;  4X1I A;  4WBN A;  1G4Y B;  1M4U A;  2YID A;  4PDV A;  1Q82 W;  3BY6 A;  3JAS A;  1NKD A;  2DYS C;  2ZE7 A;  3AG3 C;  1LUV A;  4FFB B;  4BR6 A;  3CME V;  4RO2 A;  2ZIN A;  1YHQ V;  2UUC O;  2AZ2 A;  4CH6 A;  4GLX A;  1AI7 A;  2NNU A;  1W2B U;  2PI5 A;  4MTO A;  4U3J A;  2UXC B;  5KHI A;  2OWO A;  1U96 A;  1B6Q A;  1BCC H;  4F6R B;  2EIL C;  1U97 A;  5EC1 C;  5B1O A;  3SR2 C;  3RYH B;  3E8B A;  2OTL V;  5KHJ A;  4AIL C;  3SPJ A;  3CJH A;  4LH6 A;  3E86 A;  1AJP A;  4X1K A;  4JI1 O;  4LH7 A;  1MNG A;  4O2A B;  3K0G A;  4CC6 A;  2YEV A;  4DUZ B;  1QLE B;  2LGQ A;  1A32 A;  5CBG A;  1WP7 A;  3ASO C;  3BEH A;  4B3S O;  4QPK A;  4X64 O;  1EZJ A;  2QSA A;  3LSQ A;  1K5S A;  1BGY H;  3UT5 B;  2RCV A;  1NU1 H;  1VQN V;  4Z1M G;  3DSQ A;  2XT9 A;  4ZI7 B;  1N33 B;  4N23 A;  1M56 B;  4DR6 B;  2YC0 A;  3ZMU A;  3IJ4 A;  2JEX A;  3K5L A;  1GN3 A;  2HG5 C;  4ZOL B;  1NS1 A;  3X2Q B;  4WFH A;  2VQF O;  4DV2 O;  2P06 A;  4UCS A;  1YF2 A;  1IXB A;  3L72 H;  1K7D A;  4MTG A;  1HR0 B;  4I7Z B;  2RN9 A;  2F93 B;  2IJK A;  3A2F A;  1Q90 D;  1XIL A;  2F4V O;  1MSD A;  2Y0P A;  4UUJ C;  3SYA A;  4UFZ A;  4U7O A;  4H13 B;  1WPX A;  4FM1 A;  4MT8 A;  1ZAU A;  4O4L B;  1MOF A;  4E2L A;  2ZT9 B;  3ETD A;  3AG2 C;  5H5N A;  4KP4 A;  3FAV B;  3K9S A;  1XUQ A;  3ZN0 A;  1HNX B;  1BS3 A;  2DYR C;  1SQF A;  3JD4 A;  3EHB B;  2ZE8 A;  3Q4H B;  1XL6 A;  3VBB A;  3ZCC A;  4FFB A;  1XDC A;  3OGC C;  1N36 O;  4ASU G;  2QKS A;  4I50 B;  1SA0 B;  4JYY A;  1Q5O A;  1FXH A;  1OCC B;  1JJ2 U;  1GAX A;  2N05 A;  1BHB A;  4F6R A;  1OHH G;  1VEW A;  4DV6 O;  5EZY B;  4X1Y B;  3RYH A;  3DXR B;  3T2M A;  4IL6 Z;  2H3O A;  4TV8 A;  4KHP B;  2LGW A;  4F4L A;  1VMG A;  1YXB A;  4MVS A;  1R1B A;  4NXN B;  1SES A;  4TSF G;  2ZKO A;  2CDY A;  3OW2 U;  2R9R B;  1N8R W;  1JQ0 A;  2QJ1 A;  2WLH A;  1YCI A;  5LXT B;  5BR8 B;  1N34 B;  3CE2 A;  3JD2 A;  2EJR A;  2WSS G;  5FNV A;  5A2Q N;  4CS2 A;  4DV7 B;  1EZV H;  1GKF A;  3HPL C;  4UB8 Z;  3ASN B;  1HDJ A;  1RM1 B;  5A9G A;  1GH6 A;  4KFM A;  4FPP A;  2EZO A;  4ZOL A;  4LF6 O;  4JAU A;  2H94 A;  2UXB O;  4JI6 B;  1NVP B;  3JAW B;  3RT3 C;  3W7S A;  4D7T A;  4EFB A;  1NI8 A;  4UCR A;  5L3D A;  4QPJ A;  3CC4 V;  1IBL O;  2EJ7 A;  5LMU B;  3ZHQ A;  4EB6 A;  3OGI B;  1S5H C;  4CZZ A;  2NLJ C;  4H44 B;  4JYB A;  3FFQ A;  4MVR A;  3SPI A;  5IDJ A;  1QLE C;  2IJJ A;  3PN1 A;  2GUZ B;  2IJH A;  2A7W A;  5BMV B;  3M99 B;  1UPG A;  1SF9 A;  3K58 A;  1IZ3 A;  4GKJ O;  4AQY O;  4YXW G;  5ITZ B;  2EUL A;  5LL6 Y;  4DR3 O;  1WB8 A;  2H8P C;  4YY3 O;  2Y4U A;  5IE9 A;  3Q4H A;  1FD9 A;  1JA8 A;  2CK3 G;  3TGU H;  3X2Q C;  3OUS A;  1H8E G;  4LFA O;  2BCC H;  3U11 A;  4JI2 O;  4H0L B;  3SJA C;  2WLL B;  4XDJ A;  1VF6 C;  2PI4 A;  1SZX A;  1PPJ H;  1V55 C;  4LFC O;  1BE3 H;  1H2S B;  3S3W A;  2P90 A;  1F7Y A;  4B3R B;  4HNA B;  5H2F Z;  3SYQ A;  5D5Q A;  4R50 A;  1TVK B;  4TT3 G;  5IWA O;  3B77 A;  1WNS A;  1AR4 A;  1OCR C;  4R7C A;  1F4M A;  2GTS A;  1US6 A;  2LW1 A;  3CRR A;  5AG2 A;  1MG1 A;  1WPB A;  2XTA A;  1TA8 A;  2V4D A;  3OMA B;  1KC8 W;  1JCH A;  2FTK A;  4NXM O;  4IGG A;  4PA6 A;  2FML A;  5LXT A;  3D3I A;  3CSX A;  1AB3 A;  4UCO A;  5B1B C;  2ZXW C;  2Q9L A;  1SS3 A;  1WP8 A;  4DRX B;  3IGA C;  3HR0 A;  5DEC A;  3N2G B;  5J9P C;  1PL4 A;  1IXM A;  1VF5 B;  1XNQ B;  2QDO A;  3K5O A;  2YXY A;  3B8M A;  4YHH O;  1VQP V;  5KA6 A;  2ZR2 A;  1BMF G;  4CS4 A;  3O65 A;  4LR3 A;  4GUN A;  3AG1 C;  3VQV A;  3B09 A;  3AK3 A;  1J5E O;  2QM7 A;  1XOU A;  2CE4 A;  1JFF B;  3CCE V;  4HZ3 A;  2K9P A;  3OMI B;  3N27 A;  2HLD G;  1QU7 A;  4NR1 A;  2MK3 A;  4UCT A;  1K3E A;  4JAV A;  4DW1 A;  1Q86 W;  2ZCE A;  4J7K A;  5LP6 B;  4PI0 A;  1FXK B;  3AEI A;  4K0K B;  3CB2 A;  3L70 H;  2P4K A;  4I55 B;  2LFR A;  2XAQ A;  5ITZ A;  2RDC A;  1KEC A;  2ADP A;  4DV5 O;  3VQW A;  3ASN C;  1COW G;  1L8D A;  4B3T O;  1Z5W A;  3IC7 A;  1RPR A;  1YTF B;  1GTO A;  3LSS A;  3K06 A;  3MD0 A;  2P4V A;  2DWD C;  3M8A A;  1XL4 A;  1JOY A;  4JV5 B;  1M9N A;  2DYS B;  1RSO B;  1H2N A;  2HVJ C;  4DV0 B;  4KL1 A;  4LF8 O;  1M93 A;  3SYC A;  2X6A A;  4MTX A;  4J41 A;  4U7N A;  2DQ3 A;  5GTI Z;  4UVB A;  3ABL C;  4HAM A;  1I94 O;  2GV9 A;  2YS8 A;  1JJO A;  1VQO V;  4FLZ A;  4MSW C;  2JJ2 G;  4XDK A;  3CD6 V;  2EIM C;  2GTA A;  1I5X A;  4FLW A;  3RWR D;  4ZHQ A;  3JAM N;  5LHI A;  4JI5 O;  1P7B A;  5IY5 B;  4GX1 A;  2NR5 A;  1S0V A;  1O9H A;  3ABM C;  1QCE A;  3AG7 A;  2Q7E A;  3WU2 Z;  2VWK A;  4GX0 A;  5L3C A;  3ZRV A;  3ASO B;  3TXS A;  4DV4 B;  3JSL A;  1PP9 H;  2BTQ B;  2NN4 A;  3CXH F;  3LSU A;  1GK9 A;  3N2K A;  2Q67 A;  4DR5 B;  3F7Y C;  1XNR B;  2V7Q G;  1H2M A;  3BA9 A;  4FLX A;  4FM0 A;  3T1Y B;  2HFE C;  3MHS C;  1XBL A;  2CGN A;  4U3J B;  3B8N A;  2YI9 A;  5KUK A;  2D3O W;  1XHX A;  3G6E V;  3ABK B;  4I5S A;  4JGS A;  1D5A A;  1VQ9 V;  1MZE A;  2ZIM A;  1R6T A;  3G67 A;  1VF7 A;  3LDC A;  3CP1 A;  2LW7 A;  3CJH B;  4GKK O;  1Q81 W;  5IYB O;  1Y66 A;  1PNL A;  2EZP A;  3C90 A;  1JMK C;  5LOV A;  1VQ7 V;  2YEV B;  4K8X A;  2QR4 A;  1FXK A;  3F7V C;  3L75 H;  4DK1 A;  2HJF C;  2C2A A;  5CA0 B;  1SQX H;  2W0X A;  3D3Q A;  3L9D A;  2VQE B;  3WG7 B;  5C8Y A;  2QWR B;  2L6L A;  1GM7 A;  5JVD B;  3ZMV A;  1XQ8 A;  3J81 N;  4JF3 A;  1BQ0 A;  1SET A;  2ILM A;  1N32 O;  1EN6 A;  2VWJ A;  1HP8 A;  4F6E A;  2LJ2 A;  1H2K A;  2V1D A;  2WLI A;  1AIL A;  5L3B A;  4X62 B;  1F4N A;  4OX9 O;  1S76 D;  3OTF A;  1ZLZ A;  3W7W A;  3BRC A;  2B9Z A;  1CXZ B;  4X89 A;  3H1J H;  1H2L A;  2BSK B;  2Y69 C;  3KKY A;  4JTD B;  5CA3 A;  1Q6U A;  4JYC A;  4DR2 O;  2QTO A;  4WFB V;  1RP3 B;  4DR7 O;  3STL C;  3ZBH A;  4DV3 O;  4JI8 B;  5LMN O;  5BY1 A;  2R9I A;  1HNW O;  1G6U A;  4WF9 V;  1K92 A;  2UUC B;  4PEL A;  3CCQ V;  1SKV A;  4ZIB A;  2JRI A;  4QGP A;  2QWQ B;  3AK1 A;  4B7E A;  1TUE B;  4U3F H;  2QE7 G;  1KMI Z;  2QWN B;  1ZSP A;  1Q7Y W;  2BTQ A;  5LGU A;  4W4K A;  4GX2 A;  3D36 A;  4PD4 F;  1OZ0 A;  3H01 A;  4YIP A;  1Y4M A;  2IW5 A;  2WLK A;  4JZ2 A;  3HKB B;  1V9P A;  1R73 A;  4PA4 A;  3FYE B;  3FX7 A;  1HNZ B;  2IM9 A;  4TQF A;  4PDL A;  1QVG U;  5EYP A;  4FLV A;  1TAE A;  4BIZ A;  4TWK A;  3OD4 A;  4JI0 O;  5LBQ A;  2Q73 A;  1Y67 A;  2P6J A;  2OTJ V;  2PUS A;  2UUB O;  3JCZ A;  3E8H A;  4TV8 B;  3CCM V;  3TCU A;  3ETQ A;  3ZHV A;  4DUY O;  4J42 A;  4QE7 A;  3QTC A;  1S72 V;  1Y74 B;  5IY5 C;  2RMK B;  2WA4 A;  2ZDI A;  3SPG A;  2LFS A;  2ZE5 A;  2QM4 A;  5K1X A;  2KG7 B;  2YXL A;  5CA0 A;  1SZT A;  3ETG A;  5KHH A;  2KB1 A;  1S5J A;  5FNV B;  3D36 C;  1MMM A;  2Y4T A;  3CRC A;  3OFN G;  5JVD A;  3AK2 A;  5IJ9 B;  1YVW A;  3LDD A;  3SPH A;  3GWK C;  4CH4 A;  4EKW A;  4D6T H;  1VQK V;  4X66 B;  1NH2 B;  3ABK C;  1R3L C;  2A0L A;  3UQ8 A;  2F4V B;  4TUY A;  1H8H G;  2DOS A;  4X9Q A;  1FAF A;  4N21 A;  3CRA A;  1V55 B;  1FJG B;  1JVM A;  3E22 B;  4EB6 B;  2QKA A;  1BQZ A;  2Q5Z A;  4JYA O;  5KMG A;  2RQ6 A;  2BSK A;  5CA1 A;  4FLT A;  3BFR A;  1W0K G;  3E35 A;  3QO8 A;  1YEW A;  3ZMZ A;  2ZDI C;  1HW7 A;  1K33 A;  4O2B B;  4MS2 A;  1ZL8 A;  1OCR B;  4DR6 O;  2DN9 A;  2XUM A;  3CRQ A;  3WG7 C;  4G27 B;  4W4L A;  3SDL A;  1IDS A;  3HKD B;  4BW9 A;  4NB5 A;  2Y0I A;  2YIB A;  5B1B B;  2KKW A;  2ZXW B;  4DV6 B;  5JH7 A;  2HKO A;  2XAS A;  5GW7 A;  1K4C C;  2JDI G;  4OGQ B;  1R6N A;  3H1L H;  4L87 A;  3K79 A;  3CXC U;  3MDS A;  5JJE B;  5BZB A;  3HKB A;  1QQC A;  4LCU C;  2QWP B;  3JAR B;  3JSN A;  3NR7 A;  3SJB C;  4UB6 Z;  1AR1 B;  1FYJ A;  1DLB A;  4B3M O;  3AG1 B;  4MW3 A;  3QVN A;  1SQV H;  4P2Z A;  3ZMT A;  1KKC A;  2K1E A;  1UFI A;  5LYJ A;  1NR7 A;  1Q3E A;  1BZK A;  4NKG B;  1Y74 A;  1I08 A;  1TUB A;  3K04 A;  1K9M W;  3WB0 A;  1QHT A;  1D5N A;  4LF6 B;  4LFB O;  2KG7 A;  3OTO O;  2Z3Y A;  2UXB B;  5KX5 B;  2PYL A;  3DC6 A;  5LGN A;  1K5Q A;  3CCU V;  1IBL B;  2WWW A;  3ICX A;  1TGO A;  4LF5 O;  5IJ9 A;  1FKA O;  4P9P A;  4RUE A;  3M7M X;  4DR4 B;  2LP7 A;  2GBO A;  4I0X A;  3K5M A;  3CC7 V;  3OT7 A;  1L0N H;  4UVC A;  4I4T B;  2ZNJ A;  1PNK A;  5L3G A;  3J80 N;  1UJW B;  3CCJ V;  1VF6 A;  3FYI B;  4A5U B;  2B1I A;  2IH3 C;  4UCU A;  5GON B;  3E22 A;  1L0L H;  4JTA B;  3OM3 B;  1CPY A;  4DV1 O;  2P22 C;  4AQY B;  3K59 A;  2QA4 V;  1O9G A;  3ABL B;  2P5O A;  3E2E A;  4YY3 B;  1NTK H;  2E74 B;  1ARO P;  4O2B A;  3AG4 C;  2HVK C;  4FLY A;  4LBE C;  1F23 A;  4IHJ A;  3RVZ A;  5KLV H;  4JTC B;  5EIB D;  4LFA B;  4UCV A;  2UU9 B;  4JI2 B;  2EIM B;  2ZQM A;  4LF9 O;  4K3A A;  1Y76 A;  4KXR A;  3FB8 C;  4IYI A;  2M6Y A;  2W0F C;  2E76 B;  4LFC B;  3HKD A;  4PI2 A;  3ZED A;  3E8G A;  1WAZ A;  3HKE A;  4J80 A;  3ABM B;  4NVP A;  5LMU O;  5HFM A;  3HKC B;  4PA3 A;  5IWA B;  3JD0 A;  4JI7 O;  1WJZ A;  4LP8 A;  3JAR A;  3C3T A;  4I9W A;  1MA1 A;  1RFY A;  4NXM B;  2FL4 A;  2UXX A;  3EFF K;  4UVA A;  4JAS A;  2Y48 A;  1PNM A;  2DE0 X;  1EBO A;  2E5L O;  1GM9 A;  4ZHQ B;  2ZM6 O;  1OCZ B;  2JVD A;  2KQX A;  1PM9 A;  2WLJ A;  2CTW A;  4YHH B;  5KX5 A;  5IYD O;  2EIN C;  5EBM C;  1AI6 A;  4B3R O;  4TV9 A;  3N2K B;  3OR7 C;  1L1F A;  1MAB G;  2ZD9 A;  3TJT A;  3RYC A;  1J5E B;  3K08 A;  4O4J B;  1W0J G;  4RAI A;  3QNE A;  3W7X A;  2UXD O;  2CTR A;  3WFV A;  2F43 G;  4I4T A;  2DJV A;  2HJD A;  4JI4 O;  1VQ8 V;  2JJ1 G;  2AHZ A;  5GON A;  2XAH A;  1ZUQ A;  3L73 H;  4BW5 A;  1THZ A;  1FS0 G;  1IX9 A;  5DN6 G;  4DV5 B;  2FB5 A;  2WLN A;  4G2K A;  2PY5 A;  2Y69 B;  5LOV B;  1ROP A;  4JI3 O;  5CB4 B;  4CBC A;  2YSU B;  1IBK B;  1Q6H A;  2Q7H A;  1GRJ A;  1AI5 A;  2X0L A;  3JD3 A;  2Q7G A;  1JPX A;  4Q6G A;  5C93 A;  3H1H H;  4LF8 B;  1JX9 A;  5C8Y B;  2M7W A;  1AVM A;  4GCZ A;  5EBW C;  2YDE A;  2UUA O;  3ETE A;  1ENV A;  3R66 A;  2GHY A;  3HKC A;  4P9O A;  4X65 O;  1GM8 A;  2GSM B;  4YIO A;  1NH2 D;  2Q8V A;  2AW9 A;  3I56 V;  1LUW A;  2WLI B;  4G28 B;  3GWO A;  2XOK G;  5LA6 B;  5CBF A;  1V54 B;  4B7K A;  1N0J A;  3CEI A;  4K0K O;  4UV8 A;  2OIG A;  3ZN1 A;  3KZI Z;  3K57 A;  3ABU A;  3IC9 A;  2JEU A;  3IAY A;  4DW0 A;  2CH7 B;  1FFX A;  1N4C A;  3DGE A;  1AI4 A;  2YIA A;  3OUF A;  3UO3 A;  1H2G A;  1DTO A;  4B08 A;  4ICG A;  5H9C A;  3JCU Z;  5CMU A;  1NZ6 A;  1XMO O;  4MTF A;  2R9A A;  2R72 A;  2ETN A;  4LWS B;  3QF7 A;  2F66 C;  1JR9 A;  1G8M A;  4RQE A;  4JPR A;  4LF4 O;  1YJW V;  3FB7 C;  3ZS8 C;  5EK0 A;  3OR6 C;  5TIS Z;  4LF7 O;  3BVO A;  4O4J A;  2N74 A;  4GKK B;  1B06 A;  5K1P A;  5CN0 A;  2WA3 A;  5FL7 G;  1X4T A;  2VS0 A;  3ML0 A;  5E1A C;  4MVZ A;  5EYP B;  4O4I A;  3RYF B;  2F23 A;  3CHX A;  1R3J C;  2XAF A;  1RPO A;  3H1I H;  2LQT A;  4H37 A;  3U0Z A;  2DWE C;  4MVO A;  1AJQ A;  2QTS A;  3P3P A;  5H6R A;  1VAR A;  3DC5 A;  1OCZ C;  1R6K A;  2Z5U A;  3K03 A;  4KUM A;  1R3I C;  4J11 A;  4K8Z A;  3ZHR A;  1SC5 B;  4DR1 O;  5CB4 A;  3LUT B;  3T1H O;  1IUR A;  4GZR B;  4DR5 O;  4J9Z B;  1XNR O;  1GMG A;  1ZTE A;  3A0R A;  1N32 B;  4QIW F;  2ZIO A;  1R3K C;  4BIO A;  4OX9 B;  5BXZ A;  1LNQ A;  3ZHT A;  4JAA A;  1VQ4 V;  3W7T A;  4NTW A;  2DMX A;  3T4D A;  1CP9 A;  5IYZ A;  4J7J A;  1XMQ O;  4DYL A;  1E1Q G;  3OEE G;  4DR2 B;  1NVP D;  4TUY B;  3CX5 F;  4FM2 A;  3GVM A;  1M5I A;  4DR7 B;  5LA6 A;  1K97 A;  3A0H Z;  4LNU A;  5LMN B;  5KMG B;  4GYC B;  5CA1 B;  2PZS A;  1YSC A;  1M57 C;  2BE3 A;  2CUG A;  1F51 A;  3ZMS A;  1D2D A;  4E4E A;  1T5E A;  5FLX N;  2CH7 A;  1XI1 A;  2HHH O;  4MVU A;  2VQE O;  2BOC C;  1ZL8 B;  1IBM O;  4DXW A;  4MW8 A;  2XND G;  1DF5 A;  2JGD A;  2B5U A;  5GTH Z;  1P49 A;  4O4H B;  3RVY A;  4MVM A;  2E3C A;  3ABT A;  1VQ6 V;  3G80 A;  3THO A;  5KAI Z;  4LWS A;  1YJN V;  3P32 A;  1BSM A;  4X20 A;  1KP2 A;  4JI0 B;  5JH7 B;  2PF4 E;  1OV9 A;  1VIB A;  4X88 A;  2UUB B;  3JYC A;  1KP3 A;  2ARH A;  1QVF U;  2VRZ A;  2WLM A;  3ZIA G;  3LDE A;  1Q43 A;  1V54 C;  4DUY B;  4JI1 B;  4QJF B;  3R65 A;  3EXA A;  3RYF A;  2XAG A;  4JI8 O;  3NXS A;  1W59 A;  2EIJ C;  1GN2 A;  1YI2 V;  5DED A;  4B3S B;  2HEP A;  4QE9 A;  4X64 B;  2OCH A;  3VOU A;  2Z0A A;  2JIZ G;  5LYJ B;  1NTM H;  1URF A;  2EIK C;  1TUB B;  2X6C A;  2ITC C;  2OCC C;  3LNN A;  3AG4 B;  3UKM A;  3F5T A;  2F95 B;  4Z2W A;  1K4D C;  1J95 A;  2QM8 A;  5LHG A;  2HR3 A;  3K9A A;  2VQF B;  3B2E E;  4DV2 B;  4AHC A;  1S5L Z;  5B3S C;  2UXC O;  1GN4 A;  4OXS A;  4J10 A;  1HNZ O;  1GO3 F;  2N04 A;  3K5N A;  1QBZ A;  4HBN A;  4XBF A;  4YJ3 B;  1WLE A;  4WFG A;  1GN6 A;  4JYA B;  5EC2 C;  3JAL B;  4I0X B;  4RUF A;  3P3N A;  3E83 A;  4Q20 A;  1VQ5 V;  4TOI A;  4L8J A;  1IVS A;  3RFR A;  1XEQ A;  4DUZ O;  3B40 A;  3APQ A;  3JAK A;  3TK1 A;  1YJ9 V;  4XDL A;  1P84 F;  4BWA A;  4ZBM A;  1SRY A;  2AZ0 A;  4IHJ B;  1N33 O;  1SQP H;  5JQG A;  1BL8 A;  1AJN A;  4O4H A;  2A3Q A;  5KHG A;  1N36 B;  1DF4 A;  1Y76 B;  4X66 O;  5EIB C;  5E79 Z;  1KUQ A;  1HR0 O;  1AP5 A;  3HKE B;  5JJN B;  1YTF D;  1FJG O;  2ADQ B;  2KSD A;  4FFK A;  5J2U B;  2EIN B;  1NJI W;  3CWB H;  1KQS U;  4B3M B;  1VP7 A;  3MAQ A;  3SJQ C;  1YIJ V;  3ZHU A;  2EBO A;  3CCR V;  3C3S A;  4MVQ A;  4WFF A;  2PYJ A;  4LC1 A;  2R70 A;  5CBH A;  5J2T B;  4LFB B;  3LNM B;  1KYO F;  3OTO B;  5FPR A;  5DM6 V;  1HNX O;  3K0D A;  1G1X B;  4LF5 B;  1WN7 A;  2OT5 A;  5H6Q A;  3CPW U;  3RYI B;  1PL0 A;  3L71 H;  2W6J G;  1YIT V;  3F5W C;  3O9O A;  4O2A A;  2P67 A;  5F2V O;  4TV9 B;  4YJ3 A;  3RBZ A;  1SQG A;  3RYC B;  2F1M A;  3QG5 A;  4DV1 B;  2ITD C;  3JAL A;  4IYH A;  4KHP O;  3VQY A;  5HFL A;  3BAA A;  2P7T C;  3UT5 A;  1PV0 A;  3OMN B;  4NXN O;  1B3Q A;  5KAF Z;  3HB3 B;  4WFE A;  4ZI7 A;  4FZ0 A;  3BPZ A;  3FKS G;  3CCS V;  4GKJ B;  4LF9 B;  3G6B A;  5BR8 O;  3FD9 A;  1N34 O;  1P4R A;  4DR3 B;  1NTZ H;  4AI8 A;  2JS5 A;  4UXN A;  4DV7 O;  3CS5 A;  4I9Q A;  1Q8I A;  4NTY A;  4DR4 O;  2OYQ A;  2ZE6 A;  4FJC C;  4IIJ B;  3CCL V;  4JI6 O;  4P30 A;  4JI7 B;  2FKX A;  3JAT B;  4JZG A;  3BCC H;  3KG2 A;  4O4L A;  5L3F A;  1XRE A;  1HWY A;  5J2U A;  3G4S V;  4HYO A;  4FK5 C;  3APO A;  5JCO A;  3I55 V;  2B1G A;  3FAV A;  1QR9 A;  1KD1 W;  4PDR A;  2CTP A;  2QKC A;  1M56 C;  1Y6X A;  3KCX A;  4OPH A;  5B66 Z;  5KA5 A;  1AP6 A;  4OPA A;  1E79 G;  2E5L B;  4PJ0 Z;  1NBM G;  2Q4P A;  2ZM6 B;  2UU9 O;  5EBL C;  1YZB A;  3L74 H;  4EEQ A;  5J2T A;  4I50 A;  1SA0 A;  1FFX B;  5B1A B;  5D5P A;  4K35 A;  5B5E Z;  1FPO A;  1N0N A;  2CAZ C;  4R6Z A;  4R8C A;  1EFR G;  3TXQ A;  5EZY A;  3A8T A;  3B4S A;  4X1Y A;  3DXR A;  3RYI A;  2LO1 A;  3SGI A;  2YUA A;  2YIC A;  3ZRS A;  1WB7 A;  1Z5V A;  1K8A W;  1M90 W;  2UXD B;  1B04 A;  2QGN A;  4CC5 A;  2A9H A;  4UV9 A;  3SYO A;  1PKX A;  5JCO C;  2IH1 C;  4GT1 A;  4YJ2 B;  2YIB D;  4JI4 B;  3VQX A;  2Q0O C;  3T4Z A;  2YXH A;  5JJJ B;  3JD1 A;  2JGU A;  3ZJZ A;  2XAJ A;  3RN4 A;  1KB9 F;  4O4I B;  1Z2G A;  4WFA V;  4JI3 B;  3OEH G;  3PJS K;  2DQ0 A;  3ZRX A;  3GB7 C;  1P7G A;  2JS3 A;  1OCC C;  3BA8 A;  2X6B A;  4GX5 A;  4RWU A;  2UXN A;  3JAW A;  4B3T B;  3UM7 A;  4PDM A;  1EM1 A;  1M57 B;  4CS3 A;  1I5Y A;  2D2C B;  5IT9 N;  2UUA B;  1K73 W;  1WA8 B;  2ZR3 A;  4TQD A;  4WCE V;  4X65 B;  1S77 D;  1K34 A;  3H9V A;  1XNQ O;  4C7U A;  4FIP C;  4IIJ A;  3WB2 A;  2XHB A;  1E1R G;  3JAT A;  3A0B Z;  1AR5 A;  2GUZ A;  1OJH A;  1OCO B;  5BMV A;  1PD3 A;  3CYO A;  1I94 B;  5IYZ B;  1CEZ A;  2BTO A;  1I7F A;  1SQB H;  1VQL V;  2JK5 C;  1RM1 C;  3CMA V;  1MSW D;  1EN4 A;  4LNU B;  1IBK O;  4JI5 B;  4CH3 A;  3ZRW B;  2AXT Z;  2IJI A;  1XMO B;  2WLL A;  3AG3 B;  5LHH A;  4FMT A;  1QR8 A;  3FB6 C;  2EIJ B;  3H1K H;  1KU9 A;  3DTU B;  2G38 A;  2WAM A;  4LF4 B;  4J9Y B;  4HNA A;  2JGD B;  4J7Z A;  2Q6A A;  1QNM A;  1MZF A;  3FB5 C;  5B1N A;  1TVK A;  2EIK B;  4JV5 O;  2IU3 A;  3UCS C;  4LF7 B;  2OCC B;  4IT5 A;  1DGS A;  2EIL B;  2HP8 A;  4DV0 O;  2IBZ H;  1LR1 A;  4NYK A;  3RGB A;  3I5D A;  5KUM A;  4X20 B;  2RNB A; 
#chains in the Genus database with same CATH homology
 1FFT B;  3LDE A;  1OCR C;  4R7C A;  1F4M A;  5B3S B;  3CCV V;  1V54 C;  4QJF B;  1AR1 B;  2W6I G;  3R65 A;  1DLB A;  4H33 A;  3G71 V;  3AG1 B;  4RQF A;  1MG1 A;  4MW3 A;  4P2Z A;  3OMA B;  1KC8 W;  3ZMT A;  2XAG A;  1JCH A;  2FTK A;  3NXS A;  2K1E A;  4PA6 A;  3E8F A;  2IU0 A;  1NR7 A;  3T1C A;  2EIJ C;  4DO2 A;  3OE7 G;  3D3I A;  1YI2 V;  4QE9 A;  3K04 A;  1FXV A;  4PA7 A;  5B1B C;  3SPC A;  3VOU A;  2ZXW C;  1K9M W;  2JIZ G;  5B1A C;  1SER A;  2EIK C;  3IGA C;  3OAA G;  2X6C A;  2ITC C;  2OCC C;  2Z3Y A;  5L3E A;  3E89 A;  3AG4 B;  3UKM A;  5J9P C;  2WPD G;  1IXM A;  5LGN A;  1K4D C;  1BHA A;  1J95 A;  1K5Q A;  2QM8 A;  5LHG A;  3CCU V;  2HR3 A;  2WWW A;  3B8M A;  3K9A A;  4BIU A;  1VQP V;  5KA6 A;  2ZR2 A;  1BMF G;  5IYC O;  2BOB C;  3TET A;  1NQT A;  4P9P A;  5B3S C;  4OXS A;  3CC2 V;  4RUE A;  1GO3 F;  1KKD A;  2LP7 A;  1QBZ A;  4XBF A;  3AG1 C;  3CC7 V;  3MHH C;  1WLE A;  4UVC A;  4WFG A;  4PA9 A;  1PNK A;  3SYP A;  5EC2 C;  5L3G A;  2QM7 A;  4QNH B;  3CCE V;  1UJW B;  3CCJ V;  3K3W A;  4HZ3 A;  3FYI B;  3OMI B;  4RUF A;  2B1I A;  3E83 A;  2HLD G;  2IH3 C;  1NR1 A;  4Q20 A;  2MK3 A;  1H38 A;  1VQ5 V;  4JTA B;  3OM3 B;  1CPY A;  1S3J A;  2X7R B;  1K3E A;  4JAV A;  2QEX V;  3W7U A;  1Q86 W;  2QA4 V;  3ABL B;  3E2E A;  3AG2 B;  1FXK B;  3AEI A;  1ARO P;  3TK1 A;  3AG4 C;  1YJ9 V;  2HVK C;  4X8A A;  4LBE C;  1F23 A;  4BAY A;  2DW4 A;  4XDL A;  3RVZ A;  2LFR A;  4JTC B;  2XAQ A;  3STZ C;  2Q68 A;  3QO7 A;  1ZWI C;  1KEC A;  4ZBM A;  1SRY A;  2Q69 A;  3ASN C;  2DYR B;  2EIM B;  2ZQM A;  1COW G;  3IC7 A;  1RPR A;  1YTF B;  3ZRW A;  1GTO A;  3LSS A;  3FB8 C;  3K06 A;  3MD0 A;  1BL8 A;  2DWD C;  4ZKI A;  1AJN A;  2W0F C;  1XL4 A;  3QO5 A;  1JOY A;  3E8G A;  3IFX A;  1M9N A;  2DYS B;  3RW0 A;  1DF4 A;  3ABM B;  2HVJ C;  5HFM A;  4PA3 A;  3SYC A;  2X6A A;  4MTX A;  2A79 B;  2ATK C;  1YTF D;  4U7N A;  2DQ3 A;  4UVB A;  3JD0 A;  5LGT A;  3ABL C;  2EIN B;  1QLN A;  4LP8 A;  1OCO C;  1NJI W;  1FXK C;  4HAM A;  1KQS U;  1VQM V;  4I9W A;  1M1K W;  3SJQ C;  1VQO V;  2UXX A;  4MSW C;  2AHY A;  3EFF K;  2JJ2 G;  4UVA A;  4JAS A;  3P30 A;  1YIJ V;  1ORQ C;  4XDK A;  3CD6 V;  2EBO A;  2EIM C;  2Y48 A;  1I5X A;  3CCR V;  4MVQ A;  4WFF A;  4LC1 A;  5LHI A;  1G4Y B;  1PNM A;  1P7B A;  4PDV A;  1Q82 W;  5IY5 B;  4GX1 A;  5CBH A;  3BY6 A;  1S0V A;  1EBO A;  1NKD A;  2DYS C;  1GM9 A;  3ABM C;  3LNM B;  3AG3 C;  1QCE A;  1OCZ B;  4GX0 A;  5L3C A;  5DM6 V;  3ZRV A;  3K0D A;  3CME V;  3ASO B;  4RO2 A;  1YHQ V;  2WLJ A;  1GK9 A;  1AI7 A;  2NNU A;  1W2B U;  2PI5 A;  2Q67 A;  4MTO A;  2OT5 A;  5H6Q A;  3CPW U;  5IYD O;  3F7Y C;  1PL0 A;  2EIN C;  2V7Q G;  1B6Q A;  5EBM C;  2HFE C;  1AI6 A;  3MHS C;  3OR7 C;  2W6J G;  1YIT V;  1L1F A;  1MAB G;  2EIL C;  5EC1 C;  5B1O A;  3F5W C;  3B8N A;  2ZD9 A;  3E8B A;  5KUK A;  2OTL V;  2D3O W;  3G6E V;  3ABK B;  2P67 A;  3K08 A;  4I5S A;  4JGS A;  1VQ9 V;  3SPJ A;  1W0J G;  4RAI A;  3QNE A;  3W7X A;  3E86 A;  3RBZ A;  1AJP A;  3WFV A;  2F43 G;  2ITD C;  3LDC A;  3K0G A;  3CP1 A;  2YEV A;  1VQ8 V;  2JJ1 G;  1Q81 W;  5HFL A;  5IYB O;  2AHZ A;  1Y66 A;  1PNL A;  1QLE B;  2P7T C;  2EZP A;  5CBG A;  2XAH A;  3OMN B;  3BEH A;  3ASO C;  1VQ7 V;  2YEV B;  3HB3 B;  1THZ A;  4QPK A;  4WFE A;  1FS0 G;  4BW5 A;  5DN6 G;  1EZJ A;  1FXK A;  3F7V C;  3LSQ A;  1K5S A;  2WLN A;  3FKS G;  4G2K A;  3CCS V;  2Y69 B;  1VQN V;  4Z1M G;  1ROP A;  1P4R A;  2HJF C;  4N23 A;  2C2A A;  4CBC A;  1M56 B;  2YSU B;  3ZMU A;  1AI5 A;  2X0L A;  2JEX A;  3JD3 A;  3WG7 B;  1JPX A;  2HG5 C;  4UXN A;  3X2Q B;  5C93 A;  1GM7 A;  4WFH A;  3ZMV A;  1JX9 A;  4MTG A;  1K7D A;  4JF3 A;  2M7W A;  1SET A;  4GCZ A;  5EBW C;  4FJC C;  3CCL V;  3ETE A;  1ENV A;  2GHY A;  2IJK A;  4P30 A;  4P9O A;  1GM8 A;  2GSM B;  2V1D A;  2WLI A;  5L3B A;  1F4N A;  1NH2 D;  3KG2 A;  5L3F A;  1S76 D;  3W7W A;  1HWY A;  3I56 V;  4UUJ C;  3G4S V;  4HYO A;  4FK5 C;  3SYA A;  4U7O A;  4X89 A;  2WLI B;  4G28 B;  1WPX A;  3GWO A;  2XOK G;  2Y69 C;  4MT8 A;  3I55 V;  2B1G A;  1QR9 A;  4JTD B;  5CBF A;  1MOF A;  5CA3 A;  1KD1 W;  1V54 B;  4JYC A;  4E2L A;  2QTO A;  4PDR A;  3ETD A;  4WFB V;  3AG2 C;  1M56 C;  4UV8 A;  4KP4 A;  5KA5 A;  3ZN1 A;  1E79 G;  3ABU A;  3STL C;  2JEU A;  1NBM G;  3ZN0 A;  2R9I A;  4WF9 V;  3DGE A;  5EBL C;  1AI4 A;  1K92 A;  2DYR C;  3JD4 A;  3OUF A;  3EHB B;  1XL6 A;  1H2G A;  3VBB A;  3ZCC A;  1DTO A;  4PEL A;  3CCQ V;  5B1A B;  5H9C A;  5CMU A;  1TUE B;  3OGC C;  4ASU G;  2QE7 G;  1Q7Y W;  2QKS A;  4MTF A;  4R6Z A;  4R8C A;  5LGU A;  1EFR G;  1FXH A;  1OCC B;  1JJ2 U;  4GX2 A;  3D36 A;  1OZ0 A;  3H01 A;  1G8M A;  1Y4M A;  2IW5 A;  4RQE A;  2WLK A;  1BHB A;  3ZRS A;  4JPR A;  1OHH G;  1K8A W;  1M90 W;  1R73 A;  1YJW V;  3FB7 C;  4PA4 A;  3FYE B;  5EK0 A;  3OR6 C;  3T2M A;  2A9H A;  4PDL A;  4UV9 A;  3SYO A;  1PKX A;  1QVG U;  2IH1 C;  4GT1 A;  4BIZ A;  4TWK A;  5LBQ A;  4F4L A;  2P6J A;  2OTJ V;  5CN0 A;  4MVS A;  3JCZ A;  5FL7 G;  3T4Z A;  3ML0 A;  5E1A C;  4MVZ A;  3E8H A;  1SES A;  4TSF G;  3CCM V;  3TCU A;  1R3J C;  2XAF A;  1RPO A;  3OW2 U;  4H37 A;  2R9R B;  1N8R W;  3JD1 A;  2DWE C;  1JQ0 A;  4QE7 A;  2WLH A;  4MVO A;  2XAJ A;  3ZJZ A;  1S72 V;  4WFA V;  5IY5 C;  1AJQ A;  3OEH G;  3PJS K;  2DQ0 A;  2ZDI A;  5H6R A;  3ZRX A;  3GB7 C;  3JD2 A;  2EJR A;  2WSS G;  1OCZ C;  1R6K A;  2Z5U A;  3SPG A;  2LFS A;  3K03 A;  1OCC C;  4KUM A;  1R3I C;  2X6B A;  1GKF A;  3HPL C;  3LUT B;  1SZT A;  4GX5 A;  3ASN B;  3ETG A;  1RM1 B;  2KB1 A;  2UXN A;  4KFM A;  4J9Z B;  4FPP A;  2EZO A;  4PDM A;  3UM7 A;  1GMG A;  1M57 B;  1I5Y A;  3OFN G;  3A0R A;  4JAU A;  4QIW F;  2ZR3 A;  1K73 W;  2H94 A;  1R3K C;  3LDD A;  4WCE V;  1NVP B;  1S77 D;  3SPH A;  3W7S A;  1K34 A;  4EKW A;  1VQK V;  1NH2 B;  5L3D A;  4QPJ A;  3ABK C;  1R3L C;  2A0L A;  4FIP C;  3CC4 V;  1LNQ A;  1E1R G;  1VQ4 V;  3W7T A;  1H8H G;  3T4D A;  1S5H C;  1CP9 A;  4CZZ A;  4N21 A;  2NLJ C;  1V55 B;  1E1Q G;  1JVM A;  3OEE G;  4JYB A;  4MVR A;  1OCO B;  1NVP D;  1PD3 A;  3SPI A;  5IDJ A;  3CYO A;  1QLE C;  2IJJ A;  1CEZ A;  1W0K G;  3E35 A;  2IJH A;  3QO8 A;  1K97 A;  3ZMZ A;  2ZDI C;  3M99 B;  1VQL V;  2JK5 C;  1K33 A;  1RM1 C;  3CMA V;  4MS2 A;  1MSW D;  1YSC A;  1OCR B;  4YXW G;  1M57 C;  1F51 A;  3ZMS A;  2H8P C;  4MVU A;  2BOC C;  3WG7 C;  4G27 B;  3ZRW B;  2IJI A;  2WLL A;  4DXW A;  3AG3 B;  2CK3 G;  4MW8 A;  3X2Q C;  3OUS A;  1H8E G;  2XND G;  1QR8 A;  4FMT A;  5LHH A;  1DF5 A;  3FB6 C;  2EIJ B;  2B5U A;  3RVY A;  4MVM A;  3ABT A;  3DTU B;  2WLL B;  4XDJ A;  1VQ6 V;  2WAM A;  5B1B B;  2ZXW B;  4J9Y B;  2PI4 A;  1V55 C;  2HKO A;  2XAS A;  5GW7 A;  1K4C C;  2Q6A A;  3FB5 C;  2JDI G;  1YJN V;  5B1N A;  1R6N A;  4L87 A;  3P32 A;  2EIK B;  3K79 A;  2IU3 A;  3CXC U;  2P90 A;  5BZB A;  2OCC B;  1KP2 A;  2EIL B;  3SYQ A;  4LCU C;  4R50 A;  4X88 A;  4TT3 G;  3JYC A;  1KP3 A;  1QVF U;  2WLM A;  5KUM A;  3ZIA G;  3B77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...