1OHHG

Bovine mitochondrial f1-atpase complexed with the inhibitor protein if1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
272
structure length
94
Chain Sequence
ATLKDITRRLKSIKNIQKITKSMKMVAAAKLCGAIHSSVAKQTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Synthase
molecule keywords ATP synthase subunit alpha, mitochondrial
publication title The Structure of Bovine F1-ATPase in Complex with its Regulatory Protein If1
pubmed doi rcsb
source organism Bos taurus
total genus 39
structure length 94
sequence length 272
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ohhG00
4UV8A 2JJ1G 3OEHG 2XAJA 5L3DA 3ZMSA 2V1DA 1E79G 1E1QG 2IW5A 2XASA 2XOKG 4UVBA 2XAFA 2Z3YA 4UVCA 2EJRA 3ABTA 1FS0G 2XNDG 5FL7G 5L3CA 1OHHG 1E1RG 5LHIA 4YXWG 2W6JG 2R9IA 4TT3G 4UV9A 5LGNA 2X0LA 2JIZG 2F43G 2WPDG 5L3EA 5L3BA 5H6QA 4ASUG 2JJ2G 1BMFG 2XAGA 3ZIAG 5L3GA 2DW4A 2UXNA 1W0KG 3ZMUA 1NBMG 2CK3G 5LBQA 1H8EG 1COWG 4UVAA 2H94A 3OE7G 4TSFG 5L3FA 2UXXA 2HKOA 4BAYA 2V7QG 3OEEG 5H6RA 2W6IG 5LGTA 4CZZA 3ZMTA 2Z5UA 4XBFA 4UXNA 2Y48A 3ZN1A 3OAAG 1EFRG 2XAHA 2WSSG 1W0JG 5DN6G 2XAQA 2JDIG 2QE7G 3OFNG 5LHHA 5LHGA 4Z1MG 4KUMA 2HLDG 3ZMZA 3ZMVA 3FKSG 1H8HG 3ABUA 1MABG 3ZN0A 5LGUA
chains in the Genus database with same CATH superfamily
1IDSA 2ZR3A 1ZUQA 4D7TA 5BY1A 1QNMA 2IW5A 2ZXWB 5JJNB 4HBNA 5A9GA 4FPPA 1PP9H 3IAYA 5LOVA 3ZHRA 4YY3B 4U7NA 3SYQA 3JASB 1SA0B 4X20B 1Q82W 5GONB 1K3EA 1PV0A 3AG2C 4JGSA 1D2DA 1JQ0A 1NQTA 4DV4O 3JATB 4B3RO 1H2MA 2HP8A 4Z2WA 2YDEA 3MAQA 4CS2A 2QSAA 3ZEDA 4J9YB 2QKSA 5IDJA 3NXSA 4XDKA 4LFBO 3STZC 3JD1A 1N0NA 2XTAA 3JAKA 3WB1A 3G67A 3DXRA 4U3FH 1YF2A 2EJ7A 4BR6A 5IJ0A 4J7KA 2PYJA 1SF9A 3A2FA 2JGDA 3ML0A 4B7KA 2HR3A 4R6ZA 3E22A 3OE7G 4RO2A 4DXWA 1WLEA 2EIMB 5CB4A 4GZRB 1SRYA 4G28B 1R6KA 5CBHA 2VQEB 3EVKA 4BAYA 2ZCEA 4WBNA 3D8CA 1S72V 3T4DA 3P3NA 4JI7O 4XBFA 3CCRV 4J7JA 5LMUB 2BTOA 4X89A 1CXZB 1PKXA 4CH3A 4B3MO 4JYCA 2PZSA 3TGUH 4MVSA 2KG7A 3ZBHA 5KHHA 4JV5O 1H8HG 2DWEC 4MS2A 2WWWA 1NTZH 4EFBA 5IYZA 5LGUA 3CCSV 3ZHVA 3ZS8C 1VEWA 2UUAB 1XILA 1FAFA 2G38A 4BW9A 1QR9A 3T1YO 4U3JA 1ZLZA 1XNRO 4PA4A 2EIKB 5LXTB 1Q43A 2P4KA 2WLJA 2XASA 3ICXA 5KUMA 1WPBA 1XUQA 3F5TA 1WA8B 3RYFA 4X62O 4GKJB 1YEWA 3IJ4A 1KQSU 1I08A 5D5PA 5L3CA 3TXSA 5BMVA 3CCUV 5LHIA 1VQ5V 2N04A 1R3LC 4DV5O 3SJAC 1VQMV 1LUWA 1FXKA 3T4ZA 3ETEA 4K35A 1JFFB 2Y69C 1K4DC 1PL4A 4QGPA 1BCCH 3THOA 3TCUA 2OTJV 2OIEA 1J5EB 1IVSA 2UXNA 3JD3A 1GH6A 1NKDA 5H9CA 1SQVH 1QBZA 3OMAB 3D36A 2YIDA 2H94A 4YJ2A 3B8NA 4ZOLB 4XDJA 3H9VA 4H13B 2YUAA 3RYHA 2QA4V 2CTWA 3OEEG 3K3WA 2W6IG 1NI8A 4UCVA 4MT8A 3HKDA 5CA0B 1HR0B 2ADPA 5B1AC 4CH4A 5EBWC 1BQZA 4P30A 3HKCA 4GX0A 4X66B 1XREA 2RJZA 2X7RB 3S3XA 5DEDA 2QM7A 2VRZA 3W7UA 3JARA 4DR3B 3G6EV 4PHZA 4AQYO 4K0KB 1UJWB 2DN9A 3AG3B 5LA6A 4DK1A 2YICA 4MVZA 1YITV 2WA4A 1A32A 1YCIA 1OCRB 2HEPA 2ZE7A 4LF7B 2LGQA 1YTFB 3SPCA 3VOUA 3IFXA 1F51A 4YIOA 3SYCA 2YC0A 1ORQC 2GTAA 3FAVA 2HG5C 3RWRD 2JVDA 3K79A 2FYUH 2ZDIA 3WB2A 3K9SA 2Q6AA 1ZSPA 4JASA 5EBMC 1M56C 2W0FC 5C8YB 4ZHQA 3K59A 4LCUC 4X1IA 4DV6O 4JI5O 3B40A 1O9HA 5FPOA 2W6JG 4NXNB 2ZIOA 2QR4A 2EINB 4EFEA 1XDCA 3CRQA 1RPOA 1XHXA 1KKCA 2UUAO 4LF4B 4QE9A 1XL4A 1X59A 3CYOA 1BL8A 5L3EA 4LF5O 2X6CA 1AR5A 5H6QA 1N33B 2XAGA 4LF9O 2UXBB 5GTIZ 2AZ0A 1S0VA 1JR9A 3M99B 1COWG 2E5LO 1S77D 4NB5A 3CHXA 3SYOA 1Q8IA 2UU9B 4TSFG 4J80A 2L6LA 1DF5A 1Y76B 2VS0A 2N74A 3A0RA 1XOUA 3WG7C 5B5EZ 4ICGA 3FYEB 2O57A 3SPHA 2ITDC 5H6RA 1WP8A 4PD4F 4CH6A 4L87A 4UXNA 3D3IA 1M90W 1YIJV 3ZN1A 5B1OA 3TJTA 1NR1A 4E2LA 4A5UB 3JAMN 4IL6Z 1P84F 3WU2Z 2ADQB 2QE7G 4PI2A 3L71H 4LR3A 2Q8VA 4RWUA 5IJ0B 4TQFA 2RNBA 3SPGA 4H44B 4TV8B 5LP6C 2JJ1G 1THZA 3E22B 4P2ZA 1N0JA 3LSQA 5CB4B 3JASA 4B3TO 2ZKOA 3SGIA 4X20A 3ABLC 1DF4A 3CPWU 4NTWA 2ODMA 2Z3YA 4UVCA 2DYRB 1M5IA 5EC2C 1KD1W 1US6A 5GW7A 3FD9A 3FB8C 4CC5A 2KG7B 4YXWG 2CTQA 4JI1O 1PNLA 3VBBA 1D5AA 1VQNV 3BABA 3LDEA 5IYZB 3U11A 2FB5A 4DR7O 5B66Z 4MVOA 4U3JB 3AG4C 2ZE8A 1AI4A 3E8GA 3TK1A 4B7EA 1TAEA 4UCTA 3OR7C 1MOFA 3K06A 1HDJA 2EZPA 1OV9A 1Y67A 4NXNO 2HFEC 5ITZA 3JD4A 3O9OA 3G71V 3GWKC 3U0ZA 3CRCA 2V4DA 4FMTA 4QJFB 3GB7C 1FXKB 2WSSG 1NS1A 2FKXA 3CWBH 3EFFK 3CC2V 2JDIG 2JK5C 5EYPB 1N8RW 3QNEA 1FJGO 3ZHSA 2Q7GA 5BZBA 2A9HA 1GM9A 5B1NA 1SZXA 4UB8Z 5BR8B 1ZL8B 3ABMB 1MABG 5LXTA 1QR8A 2UUBO 3C3SA 3ZJZA 2ZE6A 4N21A 5IYCO 4DUZB 4JI0B 1WA8A 1AR4A 5L3DA 3F7YC 1Z2GA 2UXCO 1N36B 2EULA 1AI6A 4MTXA 3BRCA 3ASOB 3APOA 1GN4A 3ZRSA 4FLWA 1M57B 2DQ0A 3ZX6A 3FB5C 1HW7A 3ABTA 2IM9A 5LMNB 3OMNB 5CBGA 2WA3A 4H37A 4KFMA 1I94B 1XMQB 4DR5O 1OHHG 2K9PA 2VWJA 3OT7A 4JAAA 4LNUB 2A7WA 5HFMA 3FB6C 3J80N 5JJJB 4DR6B 4DV7O 3ASNB 1BT8A 5KHJA 1QQCA 3SPIA 2R9RB 4ZOLA 3ZIAG 4FVMA 2YI8A 1YHQV 5JCOA 4RQFA 4O4JB 2WLHA 5CA0A 4GCZA 5CBFA 3BEHA 2PI5A 4LFAO 2Q69A 1MA1A 2HHHO 1R6TA 1K92A 2V7QG 3QO5A 4CH5A 3ZMTA 4UCSA 2EZOA 3JSNA 2Y69B 1AJQA 2E3CA 1W0JG 1ZAUA 2LFSA 4H0LB 4WFFA 3MD0A 1PD3A 5LHGA 4JYBA 5KMGB 1NJIW 1P4RA 1VF6A 2HJFC 4LF6B 5IY5C 3ZN0A 2Q9LA 1BSMA 2BTQB 4BIZA 3ZRWB 4UV8A 1HNWO 2YXHA 1NT2B 1PNMA 1SESA 3E8HA 1Q5OA 4GKKO 1G4YB 2NN4A 1FFXB 2BOCC 4ZI7A 4UUJC 4DW1A 2KKWA 3H1LH 1V54C 4WCEV 2Y4UA 4UVBA 1R3IC 3VQVA 2YEVA 2YIAA 1K4CC 1VARA 2EIJB 1IBLB 1EZVH 3K5LA 1Q86W 2R9IA 3WFVA 5EZYA 2IBZH 2P4VA 5B1BB 4KHPB 1L0NH 4Q6GA 4G2KA 4JZGA 2YXLA 2RN9A 4JZ2A 3ZRXA 1WJZA 2JJ2G 4TWKA 2QWRB 2KQXA 5CN0A 1AR1B 4X1KB 3P32A 4DRXB 1Y76A 1KYOF 4WFHA 4FJCC 1JCHA 4IYHA 4UVAA 1N32B 3N2GB 4X64B 4L8JA 1S5LZ 4YHHO 1RM1B 3CCEV 2YXYA 4DR6O 2XT9A 4CZZA 4OX9B 2YIBA 2YSUB 3UM7A 1FPOA 1M1KW 1TGOA 2X6AA 1GM8A 1SQPH 1EFRG 4XDLA 3J81N 5KUKA 4J10A 2QGNA 4TV8A 3P30A 4O4LB 2HVKC 2F93B 1AI7A 1G8MA 2ZM6B 4OPHA 1H2LA 4EEQA 4QPKA 1ROPA 3CCJV 1GKFA 1MG1A 4QE7A 3SJCC 1XMOO 2Q4PA 3HR0A 3RT3C 3RYCB 2QM8A 2GV9A 3WG7B 5ITZB 2AHZA 1GAXA 5A2QN 3KG2A 2IU0A 2IJJA 4DR1B 1JJOA 2CUGA 3QVNA 4JAVA 5JQGB 4RAIA 2WLLA 1HNXB 1VQ6V 1SC5B 1TUBB 3ZHQA 4DUYO 4JYAO 3T1HB 5IWAO 5KAIZ 2E76B 2ZINA 1CPYA 4DV3B 1IBMO 1MZFA 1FXHA 2OCCB 4MW3A 2P5OA 2F1MA 2JIZG 4JI6B 3RVYA 3FFQA 3SPJA 3CXCU 4E4EA 4YIPA 5J9PC 1TUEB 3N27A 1HNZO 1MNGA 4GX5A 2OT5A 5CMUA 3L9DA 3SYPA 4GT1A 5EYPA 3DC5A 2BE3A 4JI8B 3J7AU 1YSCA 1OCZC 3B2EE 3CRMA 3CXHF 3O65A 4KHPO 1B06A 4DV0B 1ZL8A 2DMXA 3LUTB 4JI2B 3OAAG 3IC7A 2PGGA 1S76D 3B8MA 5JWPA 1ZTEA 4AHCA 4YY3O 1AVMA 1VQOV 1OCOC 5LL6Y 2UUCB 1XQ8A 4ZIBA 4YJ3B 1H2GA 5D5QA 3SDLA 1QLEB 1FKAO 3ABKC 3CCQV 1RP3B 2EBOA 2UXDB 5FNVB 1BGYH 1P7GA 4JI3B 3QTCA 1YJWV 4LP8A 1ENVA 2PI4A 2PTMA 4PV1B 4LH7A 5K1XA 2AW9A 2XOKG 1VQ7V 2JRIA 5AG2A 5BXZA 2DYSC 4BIUA 2OIGA 1B6QA 4LNUA 2NNUA 1YJ9V 3GVMA 4DR2B 2ZM6O 2EILB 3LDDA 1EN5A 2VQEO 3H1KH 1HWYA 3STLC 4DR4B 3UT5B 2DQ3A 4UV9A 5LMUO 4O4JA 2F43G 2ZXWC 4FIPC 2QWPB 2B1IA 4I9WA 4ZI7B 4EKWA 2JS5A 1G6UA 5KHGA 4AILC 1UPGA 1H8EG 1KBHA 4FLVA 3RBZA 5EC1C 3K0DA 3LNMB 2YEVB 5KHKA 4FM1A 4K3AA 4OXSA 2Q0AA 2QM4A 3KZIZ 5EZYB 4P9PA 2GHYA 2MK3A 5KMGA 1XL6A 1K33A 2BTQA 3HKEB 4GKJO 3BA8A 3ZRWA 4PELA 1XNQB 2P67A 4DV2B 2HVJC 5KX5B 1QCEA 3ZMVA 1FFXA 3L72H 4PDLA 2EIMC 3FB7C 4B3SB 4R7CA 1Z5VA 3CRAA 2EX3A 1SERA 5FLXN 4DYLA 3X2QB 4I55B 3ZMSA 1J5EO 5IT9N 3A0HZ 1ZX3A 4D6TH 2XAFA 1M93A 4BWAA 4I4TB 2EJRA 1FS0G 3UO3A 3CS5A 1YXBA 4NXMB 1K8AW 1NTMH 2IH1C 4LF8B 2JEUA 3K5OA 3CSXA 1XEQA 1GK9A 2NLJC 4FLXA 5EIBC 4X1KA 4LFCB 4DRXA 2OYQA 2GDSA 3CCVV 3JCZA 3I56V 4JI3O 4CS3A 1HR0O 4GYCB 4UCUA 3AG7A 2EIKC 4X66O 4AI8A 5J2TB 1YZBA 3N2GA 4X65B 3CC4V 4DR3O 1NZ6A 2RMKB 4K0KO 1WNSA 2HJDA 1T5EA 1CEZA 1O9GA 3E35A 2FMLA 2LJ2A 3K0GA 4DR2O 2WLLB 4IHJA 2L35A 4LF7O 1V55B 1JX9A 2F23A 3BA9A 3L73H 3E89A 5F2VO 4TUYB 1AILA 2UXXA 4MSWC 1IBKB 4O4LA 2GUZB 2VQFB 1JMKC 1L1FA 3DC6A 5CA1B 4FZ0A 2DWDC 2HLDG 3E86A 3RYCA 1P7BA 1F23A 3AG2B 3OGCC 2PY5A 3UO2A 4LF4O 2Q0OC 1UFIA 5JQGA 1GTOA 1JA8A 4U7OA 4LWSA 4IYIA 1N33O 1QVFU 2V1DA 1TUBA 1FYJA 3F7VC 2WLMA 2UXBO 4JI4B 3CJHB 2AGAA 3K08A 1ZWIC 2XNDG 5J2UB 2UU9O 4J7ZA 1EBOA 2ZR2A 3G80A 1OCRC 3B77A 4H33A 2JS3A 3H1JH 1BHBA 3OTOB 2QWOB 4QIWF 4ZKIA 1SQGA 2X0LA 4GX2A 5L3BA 2CTRA 2RCVA 2FTKA 3E8BA 1SQFA 4RUFA 1VF5B 5GTHZ 5JH7A 3FYIB 3QO8A 4DO2A 1MMMA 2CAZC 1NTKH 3HPLC 1BS3A 1VIBA 1VQ4V 1VP7A 1R3JC 1SZTA 5JVDA 1IX9A 3C90A 2BOBC 2EINC 4IIJB 2B1GA 3LNNA 3P3PA 4O4HB 4WFAV 3K04A 3CCMV 4YJ3A 1JJ2U 4B3RB 4QNHB 2AXTZ 3VQYA 3W7SA 1IXMA 4O2BA 1K5SA 2P7TC 1DLBA 5DN6G 4LFBB 3ETQA 1XI1A 1MSWD 3L70H 5FNVA 1YI2V 4JTAB 3OR6C 2CH7B 1KU9A 3ZMZA 3IC9A 3FKSG 4FK5C 2E74B 3OMIB 4WFEA 2KB1A 5H2FZ 1KUQA 5JJEB 5LYJA 4MTOA 4NTYA 3L74H 4NR1A 3W7XA 1L8DA 5IE9A 3ZRVA 1U96A 4PA3A 4JI7B 5IYBO 1SQXH 2P06A 1G1XB 1IURA 1H2NA 3UT5A 2ZQMA 3C3TA 4B3MB 2H8PC 2GTSA 4TV9B 4HNAA 1CP9A 4JTCB 3IGAC 4JV5B 3G4SV 1VQ9V 1OZ0A 3ZCCA 1I7FA 2LQTA 1R6NA 2ZD9A 4R8CA 4P9OA 3T1YB 3RVZA 5B1AB 2F4VB 3ZHUA 1XNRB 4JI4O 1SQBH 1YDXA 3A0BZ 1Q6UA 3QG5A 2QJ1A 1VQLV 1NH2D 1Z5WA 3ZMUA 4DW0A 1NBMG 5BR8O 2AHYA 3VQWA 5K1PA 5B3SC 4FLUA 1NU1H 4JI0O 4DUZO 2QWQB 1AJPA 3HKEA 1Q81W 1AROP 3ETGA 5L3FA 1N36O 4ABMA 3W7WA 2LW7A 2GBOA 1GRJA 1W2BU 4DV5B 3OUFA 5KX5A 3W7TA 2CDYA 3OTOO 3E8FA 5IJ9B 3H1IH 1LUVA 4CS4A 5LMNO 2LO1A 1Q3EA 4PA6A 3OFNG 1I94O 1XMQO 1SQQH 2Q7HA 1M56B 1KP2A 4I55A 4X88A 2XUMA 1VF7A 1WP7A 4IHJB 1V9PA 3OUSA 4I4TA 4ZBMA 1NVPD 1U97A 1E79G 1Y74A 3E83A 4FM0A 2DOSA 3RYIB 1FXKC 1B04A 3LSUA 5KLVH 4Q20A 1VQKV 1PPJH 1Q6HA 3OGIB 4MW8A 4FZ1A 5FL7G 5H5NA 1H38A 1VQPV 3MHHC 3ABMC 3F5WC 4HYOA 3CEIA 4AQYB 3E2EA 5J2TA 3CCLV 1K73W 4NKGB 3D36C 4FFKA 1JPXA 4F6RB 3SYAA 4O2AA 4IGGA 2AZ2A 3CRRA 4Z1VA 5TISZ 4ASUG 1DTOA 3ASOC 4LWSB 4O4IB 2DW4A 3JCUZ 1M57C 3AG1C 4TUYA 2ATKC 3HKBA 4C7UA 2QWNB 4LF6O 2BSKA 1NR7A 1N4CA 2ETNA 3BHPA 2GUZA 2WLIB 3K5MA 2IJIA 5LP6B 3PJSK 4JI5B 5CA1A 4DV6B 4I50B 1SKVA 4I7ZB 4FLZA 2HKOA 1MZEA 1WB7A 3ABLB 3LSSA 1GN6A 3JALB 2CTPA 3ASNC 4MTGA 2F4VO 1TVKA 3RW0A 4LF5B 3CMAV 3H01A 4LF9B 4Z1MG 1QVGU 2XHBA 1IBLO 2ZDIC 3N2KA 3CX5F 4FFBA 2JEXA 5JH7B 1VQ8V 1GO3F 1GMGA 2E5LB 3AK1A 1MSDA 5KAFZ 3CJHA 2DJVA 4MVUA 5JVDB 1F7YA 4JYYA 1N34B 3BFRA 2CGOA 1S5JA 2Y4TA 2ZIMA 1RSOB 3BY6A 1BQ0A 5J2UA 3ETDA 1I5XA 4I5SA 3CB2A 3AG4B 2R70A 4IT5A 1K34A 4O2BB 2B9ZA 1N32O 4X64O 2M7WA 4JF3A 4HAMA 4PA9A 4OX9O 4NVPA 2QKCA 2JGUA 4CC6A 1JVMA 3H1HH 5LYJB 4UFZA 2WPDG 4GLXA 3PN1A 1FXVA 4B3TB 3G6BA 4IIJA 2ZT9B 4O4HA 1YVWA 5LBQA 2F95B 1KB9F 5CA3A 1Y66A 3AEIA 3R66A 1F4MA 4PI0A 1OCCC 4JPRA 4LC1A 3L75H 2H3OA 3OD4A 2OWOA 2EIJC 3BCCH 2YI9A 1FD9A 2QKAA 4LH6A 1WB8A 2C2AA 4JI1B 4K8ZA 4HNAB 1H2SB 5B1BC 2K1EA 2CH7A 3DGEA 3JD2A 2ZNJA 4DR1O 1BZKA 3UKMA 2Q68A 1HNXO 4GUNA 3A8TA 2Q67A 4TOIA 3T2MA 4DR7B 2VWKA 4D7SA 4WFGA 4KUMA 4JAUA 4FLYA 4BIOA 2Q7EA 2IU3A 3T1HO 2P22C 2RQ6A 1SETA 4DV3O 3Q4HA 1PM9A 3TXQA 4X9QA 4FM2A 3JAWB 2A06H 4EB6A 4JI6O 1RM1C 1PL0A 2YS8A 4K8XA 1WPXA 3D3QA 4X1YA 1FFTB 4TV9A 2Q5ZA 4MVQA 1AP5A 1GN2A 2LGWA 1KECA 2OCHA 2IH3C 1XBLA 2LP7A 3NR7A 5KA5A 3AK2A 1FJGB 3JSLA 4HZ3A 4JI8O 5LOVB 4X8AA 4DV0O 2UUBB 1M4UA 4MVMA 2ZNIA 4JI2O 4J41A 1EZJA 2Y0IA 4QPJA 1N34O 1D5NA 1Q7YW 3UCSC 2NR5A 2UXCB 2UUCO 3KCYA 4I0XA 3LDCA 1Y74B 3SR2C 1DGSA 3CP1A 3CC7V 3B09A 3DTUB 1WAZA 2CK3G 2QEXV 4WF9V 3TETA 3EHBB 5IY5B 5IJ9A 3I5DA 2UXDO 4DK0A 1I5YA 3JAKB 3M8AA 4KP4A 5EIBD 1X4TA 2CE4A 3K5NA 4DR5B 5HFLA 1PNKA 3DXRB 4DV1B 5DECA 1QLNA 1R3KC 3WB0A 1YJNV 2ARHA 1BHAA 2CGNA 1GM7A 4TQDA 2JGDB 2OCCC 1V54B 1B3QA 1M9NA 4O2AB 1SA0A 3RFRA 4DV7B 1HP8A 5GONA 4LBEC 2ITCC 4WBNB 1NH2B 4PDMA 4KXRA 3EXAA 1AP6A 3JATA 2IJKA 3OM3B 3RYIA 1W59A 3UQ8A 4DR4O 4OGQB 3HKBB 1QU7A 4MVRA 2LW1A 2A79B 2BSKB 4NTXA 5B3SB 4LFAB 2Q73A 2WAMA 5EK0A 4GX1A 1Y6XA 3OEHG 1K5QA 2HHHB 3KKYA 4PDRA 3HB3B 2F66C 4KL1A 1H2KA 3RN4A 2KSDA 4F6RA 4UB6Z 2DE0X 2P90A 1TVKB 3I55V 4OPAA 3ZHTA 1Q90D 3K58A 1QLEC 4O4IA 1OJHA 5JCOC 4TT3G 4CBCA 3N2KB 3RYFB 4FFBB 2R72A 1AJNA 1L0LH 3S3WA 2WLKA 1HNWB 5BMVB 1NVPB 5LGNA 3BVOA 1S3JA 2WLIA 4GKKB 1XNQO 4DV2O 3K03A 5FPRA 5L3GA 2QTOA 5LP6A 1F4NA 1R1BA 2A0LA 4I50A 1S5HC 2WLNA 4J9ZB 1IZ3A 2FL4A 3AG3C 4MTFA 2D3OW 3M7MX 3OTFA 3APQA 3FX7A 2R9AA 2W0XA 2EILC 4PDVA 3JALA 3U10A 4B3SO 1LR1A 1YTFD 1TA8A 4G27B 3B4SA 5IYDO 1AB3A 4BW5A 1VF6C 4N23A 4B08A 4R50A 3SJQC 3MHSC 4YJ2B 1KMIZ 3AK3A 2B5UA 2D2CB 2XAQA 4FLTA 2N05A 3DSQA 2E75B 3VQXA 3OW2U 3RYHB 4NXMO 4UCRA 3AG1B 4LF8O 1BE3H 3RGBA 3HKDB 3ABUA 1I0HA 2QTSA 4LFCO 1RSOA 2ZE5A 3HKCB 1JFFA 4DV4B 2ILMA 1K7DA 4RUEA 3R65A 1K9MW 4DV1O 3JARB 4W4LA 2Y0PA 2XAJA 4RQEA 3BPZA 3CD6V 4YHHB 1E1QG 4X65O 5LA6B 2PUSA 5EBLC 4F4LA 1AI5A 4PA7A 3K57A 4J11A 4F6EA 5KA6A 5C93A 1EN6A 2PF4E 5E1AC 1EN4A 3CMEV 3FAVB 1E1RG 1LNQA 3GWOA 1IBKO 2LFRA 1OCZB 2VQFO 3Q4HB 2Z0AA 2P6JA 3X2QC 3SJBC 4ZHQB 1XMOB 1J95A 3JYCA 4X1IB 1IXBA 2MW2B 1Y4MA 4EB6B 1JOYA 1BMFG 1EM1A 3QF7A 1OCOB 1RPRA 1W0KG 1KKDA 2A3QA 2BCCH 4UCOA 4X1YB 4PJ0Z 1XHZA 1DK1A 2YIBD 4W4KA 3MDSA 4J42A 2IJHA 4WFBV 2M6YA 5DM6V 4DUYB 3T1CA 4JYAB 3ABKB 3JD0A 2X6BA 5IWAB 3KCXA 1VMGA 2QDOA 5LGTA 1IBMB 2Z5UA 3QO7A 2Y48A 1URFA 2GSMB 2DYSB 2DYRC 3K9AA 2XAHA 1WN7A 3BAAA 1KC8W 5C8YA 4JTDB 5LHHA 3JAWA 4X62B 1KP3A 1RFYA 2RDCA 1Q6IA 1QHTA 1R73A 4I0XB 2OTLV 2PYLA 3CE2A 4I9QA 1GN3A 5E79Z 1HNZB 1SS3A 1P49A 1V55C 4NYKA 5KHIA 1OCCB 1K97A
chains in the Genus database with same CATH topology
2EIMC 3FB7C 2ZR3A 4MVUA 4R7CA 1SERA 3X2QB 5L3DA 3ZMSA 3F7YC 2IW5A 2ZXWB 1AI6A 4MTXA 3BY6A 3ASOB 3ETDA 4FPPA 1I5XA 4I5SA 3ZRSA 1M57B 2DQ0A 2XAFA 3AG4B 3FB5C 2EJRA 1K34A 3ABTA 1FS0G 3OMNB 5CBGA 4H37A 4U7NA 3SYQA 4KFMA 1Q82W 2M7WA 1OHHG 1K8AW 4JF3A 1K3EA 2IH1C 2JEUA 3AG2C 4JGSA 1GK9A 2NLJC 1JQ0A 1NQTA 4HAMA 4PA9A 5HFMA 3FB6C 3CCVV 3JCZA 3I56V 1JVMA 4J9YB 2QKSA 2WPDG 5IDJA 3NXSA 3ASNB 4XDKA 3STZC 2EIKC 3JD1A 1FXVA 3CC4V 3SPIA 2R9RB 3ZIAG 5LBQA 1YHQV 5CA3A 4RQFA 1Y66A 3AEIA 1CEZA 3E35A 3K0GA 1F4MA 2WLLB 3ML0A 1OCCC 2HR3A 4R6ZA 4JPRA 1V55B 1JX9A 2WLHA 3OE7G 4GCZA 4LC1A 3BEHA 4RO2A 5CBFA 2PI5A 2EIJC 3E89A 4DXWA 1WLEA 2EIMB 2Q69A 1SRYA 4G28B 1R6KA 5CBHA 2C2AA 2UXXA 1K92A 4MSWC 4BAYA 5B1BC 2V7QG 1S72V 3QO5A 2K1EA 3DGEA 3ZMTA 3T4DA 3JD2A 2EZOA 4XBFA 3CCRV 1L1FA 3UKMA 2Q68A 2Y69B 4X89A 1AJQA 2Q67A 1W0JG 2LFSA 3T2MA 1PKXA 4WFFA 3MD0A 4WFGA 4JYCA 1PD3A 2DWDC 5LHGA 4MVSA 4KUMA 4JAUA 2IU3A 2HLDG 4JYBA 3E86A 1SETA 1H8HG 1NJIW 2DWEC 1P7BA 1P4RA 4MS2A 2WWWA 2HJFC 1F23A 3AG2B 5IY5C 3OGCC 3ZN0A 5LGUA 3CCSV 4BIZA 3ZRWB 4UV8A 1GTOA 1QR9A 1PNMA 4U7OA 1SESA 3E8HA 1QVFU 1RM1C 2V1DA 1PL0A 1G4YB 2WLMA 3F7VC 4PA4A 2EIKB 1WPXA 2BOCC 2WLJA 1FFTB 2XASA 5KUMA 4UUJC 4MVQA 1V54C 4WCEV 1KECA 4UVBA 2IH3C 2LP7A 1R3IC 3K08A 1ZWIC 2XNDG 5KA5A 1KQSU 2YEVA 5L3CA 1K4CC 4HZ3A 3CCUV 2EIJB 5LHIA 1VQ5V 1Q86W 2R9IA 3WFVA 1EBOA 2ZR2A 4X8AA 1R3LC 1OCRC 3B77A 4H33A 1VQMV 5B1BB 4MVMA 1FXKA 3T4ZA 3ETEA 1EZJA 1BHBA 4QPJA 4G2KA 1Q7YW 2Y69C 4QIWF 1K4DC 4ZKIA 3ZRXA 2X0LA 4GX2A 5L3BA 2JJ2G 4TWKA 3TCUA 2FTKA 2OTJV 3E8BA 3LDCA 5CN0A 1AR1B 3P32A 2UXNA 3CP1A 4RUFA 3CC7V 3DTUB 2CK3G 3JD3A 2QEXV 3FYIB 1NKDA 5H9CA 3QO8A 4DO2A 4WFHA 4WF9V 3TETA 1QBZA 3OMAB 3D36A 3EHBB 3HPLC 5IY5B 4FJCC 1JCHA 4UVAA 2H94A 1VQ4V 1R3JC 1SZTA 1I5YA 4KP4A 3B8NA 5HFLA 4XDJA 1PNKA 2BOBC 2EINC 2B1GA 1QLNA 4WFAV 3K04A 3CCMV 1R3KC 2QA4V 1YJNV 1RM1B 1BHAA 3CCEV 3OEEG 3K3WA 2W6IG 1GM7A 4CZZA 1JJ2U 4QNHB 2OCCC 2YSUB 4MT8A 3UM7A 3W7SA 1IXMA 1M1KW 2X6AA 1GM8A 1V54B 1EFRG 4XDLA 1K5SA 2P7TC 1DLBA 5B1AC 5EBWC 5KUKA 1M9NA 4P30A 5DN6G 1MSWD 4GX0A 2X7RB 3P30A 4LBEC 2ITCC 1NH2B 2HVKC 2QM7A 4PDMA 1YI2V 4JTAB 3W7UA 3OR6C 1AI7A 3G6EV 3ZMZA 1G8MA 3FKSG 1UJWB 2IJKA 3OM3B 3AG3B 4FK5C 4QPKA 1ROPA 3OMIB 4WFEA 2KB1A 4MVZA 3CCJV 4MVRA 1YITV 1GKFA 2A79B 1MG1A 1OCRB 4QE7A 5B3SB 1YTFB 3SPCA 3VOUA 2WAMA 1F51A 3IFXA 4GX1A 4MTOA 5EK0A 3SYCA 3OEHG 1K5QA 1ORQC 3W7XA 4PDRA 3HB3B 2QM8A 3WG7B 2AHZA 3ZRVA 3KG2A 2HG5C 2IU0A 4PA3A 3K79A 2ZDIA 5IYBO 2IJJA 4JAVA 4RAIA 2WLLA 2Q6AA 4JASA 5EBMC 1VQ6V 2ZQMA 2P90A 1M56C 2H8PC 2W0FC 3I55V 4LCUC 1CP9A 4JTCB 3IGAC 2W6JG 3G4SV 1VQ9V 2EINB 1QLEC 1CPYA 1OZ0A 1RPOA 4TT3G 3ZCCA 1R6NA 4CBCA 2ZD9A 4R8CA 4QE9A 1FXHA 1AJNA 2OCCB 2WLKA 4MW3A 1XL4A 4P9OA 1NVPB 5LGNA 3CYOA 1BL8A 2JIZG 3RVYA 5L3EA 2X6CA 1S3JA 5H6QA 5B1AB 3RVZA 2WLIA 3SPJA 2XAGA 3CXCU 3K03A 5L3GA 2QTOA 1F4NA 1VQLV 1NH2D 2A0LA 3ZMUA 1NBMG 1S5HC 2WLNA 4J9ZB 5J9PC 3AG3C 4MTFA 1TUEB 2D3OW 1S0VA 3M99B 2AHYA 1COWG 1S77D 4GX5A 2EILC 4PDVA 2OT5A 3SYOA 5CMUA 5B3SC 3SYPA 4GT1A 1YTFD 1AJPA 4G27B 4TSFG 1Q81W 1DF5A 1AROP 5IYDO 3ETGA 3A0RA 5L3FA 1YSCA 3WG7C 3W7WA 1OCZC 4BW5A 3FYEB 3SPHA 2ITDC 4N23A 5H6RA 1W2BU 3OUFA 4R50A 3W7TA 3SJQC 3LUTB 4L87A 3D3IA 4UXNA 1M90W 1YIJV 3E8FA 3ZN1A 3OAAG 3MHSC 5B1OA 3IC7A 1S76D 1NR1A 2B5UA 4E2LA 3B8MA 2XAQA 1VQOV 1OCOC 4PA6A 2QE7G 3OFNG 3OW2U 1M56B 1KP2A 3AG1B 1H2GA 3ABUA 1QLEB 4X88A 3ABKC 3SPGA 3CCQV 1K7DA 2EBOA 2JJ1G 4RUEA 1THZA 3OUSA 3R65A 1K9MW 4ZBMA 4P2ZA 1YJWV 2XAJA 4RQEA 3LSQA 3CD6V 1NVPD 1E79G 4LP8A 1E1QG 1ENVA 3E83A 2PI4A 3ABLC 5EBLC 2XOKG 4F4LA 1VQ7V 1DF4A 3CPWU 1AI5A 1FXKC 2DYSC 4BIUA 1B6QA 4PA7A 2Z3YA 4Q20A 4UVCA 2DYRB 5EC2C 1VQKV 2NNUA 1YJ9V 1KD1W 5GW7A 3FB8C 4MW8A 5FL7G 5KA6A 1H38A 1VQPV 5C93A 5E1AC 3MHHC 3CMEV 2EILB 3ABMC 3F5WC 4HYOA 1E1RG 3LDDA 4YXWG 1LNQA 3E2EA 3CCLV 3GWOA 2LFRA 1K73W 1HWYA 1PNLA 3STLC 3VBBA 1OCZB 1JPXA 2DQ3A 1VQNV 3LDEA 3SYAA 2P6JA 4UV9A 3X2QC 1J95A 3JYCA 2F43G 4ASUG 2ZXWC 4FIPC 1Y4MA 1JOYA 1BMFG 1DTOA 2B1IA 3ASOC 4I9WA 4MVOA 1OCOB 2DW4A 1M57C 1RPRA 1W0KG 3AG4C 3AG1C 1KKDA 4EKWA 2ATKC 1AI4A 3E8GA 1H8EG 1NR7A 3TK1A 2IJHA 4WFBV 2WLIB 5DM6V 3OR7C 1MOFA 3RBZA 3K06A 3T1CA 3ABKB 5EC1C 3JD0A 3K0DA 3LNMB 2EZPA 2IJIA 2X6BA 2HFEC 2YEVB 3PJSK 3JD4A 4OXSA 3G71V 2HKOA 5LGTA 4FMTA 4P9PA 2GHYA 2MK3A 2Z5UA 3ABLB 3QO7A 4QJFB 3LSSA 3GB7C 2Y48A 2GSMB 1FXKB 3ASNC 1XL6A 2DYRC 2DYSB 2XAHA 2WSSG 3K9AA 4MTGA 3CC2V 1K33A 3EFFK 2JDIG 2JK5C 3RW0A 1N8RW 3QNEA 3CMAV 1KC8W 4JTDB 5BZBA 3ZRWA 4PELA 2A9HA 3H01A 5LHHA 1KP3A 1GM9A 2P67A 4Z1MG 5B1NA 1R73A 2HVJC 1QVGU 1QCEA 2OTLV 3ZMVA 2ZDIC 3ABMB 1MABG 2JEXA 1QR8A 1VQ8V 1GO3F 4PDLA 1GMGA 1V55C 3ZJZA 4N21A 1OCCB 5IYCO 1K97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UV8 A;  2JJ1 G;  3OEH G;  2XAJ A;  5L3D A;  3ZMS A;  2V1D A;  1E79 G;  1E1Q G;  2IW5 A;  2XAS A;  2XOK G;  4UVB A;  2XAF A;  2Z3Y A;  4UVC A;  2EJR A;  3ABT A;  1FS0 G;  2XND G;  5FL7 G;  5L3C A;  1OHH G;  1E1R G;  5LHI A;  4YXW G;  2W6J G;  2R9I A;  4TT3 G;  4UV9 A;  5LGN A;  2X0L A;  2JIZ G;  2F43 G;  2WPD G;  5L3E A;  5L3B A;  5H6Q A;  4ASU G;  2JJ2 G;  1BMF G;  2XAG A;  3ZIA G;  5L3G A;  2DW4 A;  2UXN A;  1W0K G;  3ZMU A;  1NBM G;  2CK3 G;  5LBQ A;  1H8E G;  1COW G;  4UVA A;  2H94 A;  3OE7 G;  4TSF G;  5L3F A;  2UXX A;  2HKO A;  4BAY A;  2V7Q G;  3OEE G;  5H6R A;  2W6I G;  5LGT A;  4CZZ A;  3ZMT A;  2Z5U A;  4XBF A;  4UXN A;  2Y48 A;  3ZN1 A;  3OAA G;  1EFR G;  2XAH A;  2WSS G;  1W0J G;  5DN6 G;  2XAQ A;  2JDI G;  2QE7 G;  3OFN G;  5LHH A;  5LHG A;  4Z1M G;  4KUM A;  2HLD G;  3ZMZ A;  3ZMV A;  3FKS G;  1H8H G;  3ABU A;  1MAB G;  3ZN0 A;  5LGU A; 
#chains in the Genus database with same CATH topology
 1IDS A;  2ZR3 A;  1ZUQ A;  4D7T A;  5BY1 A;  1QNM A;  2IW5 A;  2ZXW B;  5JJN B;  4HBN A;  5A9G A;  4FPP A;  1PP9 H;  3IAY A;  5LOV A;  3ZHR A;  4YY3 B;  4U7N A;  3SYQ A;  3JAS B;  1SA0 B;  4X20 B;  1Q82 W;  5GON B;  1K3E A;  1PV0 A;  3AG2 C;  4JGS A;  1D2D A;  1JQ0 A;  1NQT A;  4DV4 O;  3JAT B;  4B3R O;  1H2M A;  2HP8 A;  4Z2W A;  2YDE A;  3MAQ A;  4CS2 A;  2QSA A;  3ZED A;  4J9Y B;  2QKS A;  5IDJ A;  3NXS A;  4XDK A;  4LFB O;  3STZ C;  3JD1 A;  1N0N A;  2XTA A;  3JAK A;  3WB1 A;  3G67 A;  3DXR A;  4U3F H;  1YF2 A;  2EJ7 A;  4BR6 A;  5IJ0 A;  4J7K A;  2PYJ A;  1SF9 A;  3A2F A;  2JGD A;  3ML0 A;  4B7K A;  2HR3 A;  4R6Z A;  3E22 A;  3OE7 G;  4RO2 A;  4DXW A;  1WLE A;  2EIM B;  5CB4 A;  4GZR B;  1SRY A;  4G28 B;  1R6K A;  5CBH A;  2VQE B;  3EVK A;  4BAY A;  2ZCE A;  4WBN A;  3D8C A;  1S72 V;  3T4D A;  3P3N A;  4JI7 O;  4XBF A;  3CCR V;  4J7J A;  5LMU B;  2BTO A;  4X89 A;  1CXZ B;  1PKX A;  4CH3 A;  4B3M O;  4JYC A;  2PZS A;  3TGU H;  4MVS A;  2KG7 A;  3ZBH A;  5KHH A;  4JV5 O;  1H8H G;  2DWE C;  4MS2 A;  2WWW A;  1NTZ H;  4EFB A;  5IYZ A;  5LGU A;  3CCS V;  3ZHV A;  3ZS8 C;  1VEW A;  2UUA B;  1XIL A;  1FAF A;  2G38 A;  4BW9 A;  1QR9 A;  3T1Y O;  4U3J A;  1ZLZ A;  1XNR O;  4PA4 A;  2EIK B;  5LXT B;  1Q43 A;  2P4K A;  2WLJ A;  2XAS A;  3ICX A;  5KUM A;  1WPB A;  1XUQ A;  3F5T A;  1WA8 B;  3RYF A;  4X62 O;  4GKJ B;  1YEW A;  3IJ4 A;  1KQS U;  1I08 A;  5D5P A;  5L3C A;  3TXS A;  5BMV A;  3CCU V;  5LHI A;  1VQ5 V;  2N04 A;  1R3L C;  4DV5 O;  3SJA C;  1VQM V;  1LUW A;  1FXK A;  3T4Z A;  3ETE A;  4K35 A;  1JFF B;  2Y69 C;  1K4D C;  1PL4 A;  4QGP A;  1BCC H;  3THO A;  3TCU A;  2OTJ V;  2OIE A;  1J5E B;  1IVS A;  2UXN A;  3JD3 A;  1GH6 A;  1NKD A;  5H9C A;  1SQV H;  1QBZ A;  3OMA B;  3D36 A;  2YID A;  2H94 A;  4YJ2 A;  3B8N A;  4ZOL B;  4XDJ A;  3H9V A;  4H13 B;  2YUA A;  3RYH A;  2QA4 V;  2CTW A;  3OEE G;  3K3W A;  2W6I G;  1NI8 A;  4UCV A;  4MT8 A;  3HKD A;  5CA0 B;  1HR0 B;  2ADP A;  5B1A C;  4CH4 A;  5EBW C;  1BQZ A;  4P30 A;  3HKC A;  4GX0 A;  4X66 B;  1XRE A;  2RJZ A;  2X7R B;  3S3X A;  5DED A;  2QM7 A;  2VRZ A;  3W7U A;  3JAR A;  4DR3 B;  3G6E V;  4PHZ A;  4AQY O;  4K0K B;  1UJW B;  2DN9 A;  3AG3 B;  5LA6 A;  4DK1 A;  2YIC A;  4MVZ A;  1YIT V;  2WA4 A;  1A32 A;  1YCI A;  1OCR B;  2HEP A;  2ZE7 A;  4LF7 B;  2LGQ A;  1YTF B;  3SPC A;  3VOU A;  3IFX A;  1F51 A;  4YIO A;  3SYC A;  2YC0 A;  1ORQ C;  2GTA A;  3FAV A;  2HG5 C;  3RWR D;  2JVD A;  3K79 A;  2FYU H;  2ZDI A;  3WB2 A;  3K9S A;  2Q6A A;  1ZSP A;  4JAS A;  5EBM C;  1M56 C;  2W0F C;  5C8Y B;  4ZHQ A;  3K59 A;  4LCU C;  4X1I A;  4DV6 O;  4JI5 O;  3B40 A;  1O9H A;  5FPO A;  2W6J G;  4NXN B;  2ZIO A;  2QR4 A;  2EIN B;  4EFE A;  1XDC A;  3CRQ A;  1RPO A;  1XHX A;  1KKC A;  2UUA O;  4LF4 B;  4QE9 A;  1XL4 A;  1X59 A;  3CYO A;  1BL8 A;  5L3E A;  4LF5 O;  2X6C A;  1AR5 A;  5H6Q A;  1N33 B;  2XAG A;  4LF9 O;  2UXB B;  5GTI Z;  2AZ0 A;  1S0V A;  1JR9 A;  3M99 B;  1COW G;  2E5L O;  1S77 D;  4NB5 A;  3CHX A;  3SYO A;  1Q8I A;  2UU9 B;  4TSF G;  4J80 A;  2L6L A;  1DF5 A;  1Y76 B;  2VS0 A;  2N74 A;  3A0R A;  1XOU A;  3WG7 C;  5B5E Z;  4ICG A;  3FYE B;  2O57 A;  3SPH A;  2ITD C;  5H6R A;  1WP8 A;  4PD4 F;  4CH6 A;  4L87 A;  4UXN A;  3D3I A;  1M90 W;  1YIJ V;  3ZN1 A;  5B1O A;  3TJT A;  1NR1 A;  4E2L A;  4A5U B;  3JAM N;  4IL6 Z;  1P84 F;  3WU2 Z;  2ADQ B;  2QE7 G;  4PI2 A;  3L71 H;  4LR3 A;  2Q8V A;  4RWU A;  5IJ0 B;  4TQF A;  2RNB A;  3SPG A;  4H44 B;  4TV8 B;  5LP6 C;  2JJ1 G;  1THZ A;  3E22 B;  4P2Z A;  1N0J A;  3LSQ A;  5CB4 B;  3JAS A;  4B3T O;  2ZKO A;  3SGI A;  4X20 A;  3ABL C;  1DF4 A;  3CPW U;  4NTW A;  2ODM A;  2Z3Y A;  4UVC A;  2DYR B;  1M5I A;  5EC2 C;  1KD1 W;  1US6 A;  5GW7 A;  3FD9 A;  3FB8 C;  4CC5 A;  2KG7 B;  4YXW G;  2CTQ A;  4JI1 O;  1PNL A;  3VBB A;  1D5A A;  1VQN V;  3BAB A;  3LDE A;  5IYZ B;  3U11 A;  2FB5 A;  4DR7 O;  5B66 Z;  4MVO A;  4U3J B;  3AG4 C;  2ZE8 A;  1AI4 A;  3E8G A;  3TK1 A;  4B7E A;  1TAE A;  4UCT A;  3OR7 C;  1MOF A;  3K06 A;  1HDJ A;  2EZP A;  1OV9 A;  1Y67 A;  4NXN O;  2HFE C;  5ITZ A;  3JD4 A;  3O9O A;  3G71 V;  3GWK C;  3U0Z A;  3CRC A;  2V4D A;  4FMT A;  4QJF B;  3GB7 C;  1FXK B;  2WSS G;  1NS1 A;  2FKX A;  3CWB H;  3EFF K;  3CC2 V;  2JDI G;  2JK5 C;  5EYP B;  1N8R W;  3QNE A;  1FJG O;  3ZHS A;  2Q7G A;  5BZB A;  2A9H A;  1GM9 A;  5B1N A;  1SZX A;  4UB8 Z;  5BR8 B;  1ZL8 B;  3ABM B;  1MAB G;  5LXT A;  1QR8 A;  2UUB O;  3C3S A;  3ZJZ A;  2ZE6 A;  4N21 A;  5IYC O;  4DUZ B;  4JI0 B;  1WA8 A;  1AR4 A;  5L3D A;  3F7Y C;  1Z2G A;  2UXC O;  1N36 B;  2EUL A;  1AI6 A;  4MTX A;  3BRC A;  3ASO B;  3APO A;  1GN4 A;  3ZRS A;  4FLW A;  1M57 B;  2DQ0 A;  3ZX6 A;  3FB5 C;  1HW7 A;  3ABT A;  2IM9 A;  5LMN B;  3OMN B;  5CBG A;  2WA3 A;  4H37 A;  4KFM A;  1I94 B;  1XMQ B;  4DR5 O;  1OHH G;  2K9P A;  2VWJ A;  3OT7 A;  4JAA A;  4LNU B;  2A7W A;  5HFM A;  3FB6 C;  3J80 N;  5JJJ B;  4DR6 B;  4DV7 O;  3ASN B;  1BT8 A;  5KHJ A;  1QQC A;  3SPI A;  2R9R B;  4ZOL A;  3ZIA G;  4FVM A;  2YI8 A;  1YHQ V;  5JCO A;  4RQF A;  4O4J B;  2WLH A;  5CA0 A;  4GCZ A;  5CBF A;  3BEH A;  2PI5 A;  4LFA O;  2Q69 A;  1MA1 A;  2HHH O;  1R6T A;  1K92 A;  2V7Q G;  3QO5 A;  4CH5 A;  3ZMT A;  4UCS A;  2EZO A;  3JSN A;  2Y69 B;  1AJQ A;  2E3C A;  1W0J G;  1ZAU A;  2LFS A;  4H0L B;  4WFF A;  3MD0 A;  1PD3 A;  5LHG A;  4JYB A;  5KMG B;  1NJI W;  1P4R A;  1VF6 A;  2HJF C;  4LF6 B;  5IY5 C;  3ZN0 A;  2Q9L A;  1BSM A;  2BTQ B;  4BIZ A;  3ZRW B;  4UV8 A;  1HNW O;  2YXH A;  1NT2 B;  1PNM A;  1SES A;  3E8H A;  1Q5O A;  4GKK O;  1G4Y B;  2NN4 A;  1FFX B;  2BOC C;  4ZI7 A;  4UUJ C;  4DW1 A;  2KKW A;  3H1L H;  1V54 C;  4WCE V;  2Y4U A;  4UVB A;  1R3I C;  3VQV A;  2YEV A;  2YIA A;  1K4C C;  1VAR A;  2EIJ B;  1IBL B;  1EZV H;  3K5L A;  1Q86 W;  2R9I A;  3WFV A;  5EZY A;  2IBZ H;  2P4V A;  5B1B B;  4KHP B;  1L0N H;  4Q6G A;  4G2K A;  4JZG A;  2YXL A;  2RN9 A;  4JZ2 A;  3ZRX A;  1WJZ A;  2JJ2 G;  4TWK A;  2QWR B;  2KQX A;  5CN0 A;  1AR1 B;  4X1K B;  3P32 A;  4DRX B;  1Y76 A;  1KYO F;  4WFH A;  4FJC C;  1JCH A;  4IYH A;  4UVA A;  1N32 B;  3N2G B;  4X64 B;  4L8J A;  1S5L Z;  4YHH O;  1RM1 B;  3CCE V;  2YXY A;  4DR6 O;  2XT9 A;  4CZZ A;  4OX9 B;  2YIB A;  2YSU B;  3UM7 A;  1FPO A;  1M1K W;  1TGO A;  2X6A A;  1GM8 A;  1SQP H;  1EFR G;  4XDL A;  3J81 N;  5KUK A;  4J10 A;  2QGN A;  4TV8 A;  3P30 A;  4O4L B;  2HVK C;  2F93 B;  1AI7 A;  1G8M A;  2ZM6 B;  4OPH A;  1H2L A;  4EEQ A;  4QPK A;  1ROP A;  3CCJ V;  1GKF A;  1MG1 A;  4QE7 A;  3SJC C;  1XMO O;  2Q4P A;  3HR0 A;  3RT3 C;  3RYC B;  2QM8 A;  2GV9 A;  3WG7 B;  5ITZ B;  2AHZ A;  1GAX A;  5A2Q N;  3KG2 A;  2IU0 A;  2IJJ A;  4DR1 B;  1JJO A;  2CUG A;  3QVN A;  4JAV A;  5JQG B;  4RAI A;  2WLL A;  1HNX B;  1VQ6 V;  1SC5 B;  1TUB B;  3ZHQ A;  4DUY O;  4JYA O;  3T1H B;  5IWA O;  5KAI Z;  2E76 B;  2ZIN A;  1CPY A;  4DV3 B;  1IBM O;  1MZF A;  1FXH A;  2OCC B;  4MW3 A;  2P5O A;  2F1M A;  2JIZ G;  4JI6 B;  3RVY A;  3FFQ A;  3SPJ A;  3CXC U;  4E4E A;  4YIP A;  5J9P C;  1TUE B;  3N27 A;  1HNZ O;  1MNG A;  4GX5 A;  2OT5 A;  5CMU A;  3L9D A;  3SYP A;  4GT1 A;  5EYP A;  3DC5 A;  2BE3 A;  4JI8 B;  3J7A U;  1YSC A;  1OCZ C;  3B2E E;  3CRM A;  3CXH F;  3O65 A;  4KHP O;  1B06 A;  4DV0 B;  1ZL8 A;  2DMX A;  3LUT B;  4JI2 B;  3OAA G;  3IC7 A;  2PGG A;  1S76 D;  3B8M A;  5JWP A;  1ZTE A;  4AHC A;  4YY3 O;  1AVM A;  1VQO V;  1OCO C;  5LL6 Y;  2UUC B;  1XQ8 A;  4ZIB A;  4YJ3 B;  1H2G A;  5D5Q A;  3SDL A;  1QLE B;  1FKA O;  3ABK C;  3CCQ V;  1RP3 B;  2EBO A;  2UXD B;  5FNV B;  1BGY H;  1P7G A;  4JI3 B;  3QTC A;  1YJW V;  4LP8 A;  1ENV A;  2PI4 A;  2PTM A;  4PV1 B;  4LH7 A;  5K1X A;  2AW9 A;  2XOK G;  1VQ7 V;  2JRI A;  5AG2 A;  5BXZ A;  2DYS C;  4BIU A;  2OIG A;  1B6Q A;  4LNU A;  2NNU A;  1YJ9 V;  3GVM A;  4DR2 B;  2ZM6 O;  2EIL B;  3LDD A;  1EN5 A;  2VQE O;  3H1K H;  1HWY A;  3STL C;  4DR4 B;  3UT5 B;  2DQ3 A;  4UV9 A;  5LMU O;  4O4J A;  2F43 G;  2ZXW C;  4FIP C;  2QWP B;  2B1I A;  4I9W A;  4ZI7 B;  4EKW A;  2JS5 A;  1G6U A;  5KHG A;  4AIL C;  1UPG A;  1H8E G;  1KBH A;  4FLV A;  3RBZ A;  5EC1 C;  3K0D A;  3LNM B;  2YEV B;  5KHK A;  4FM1 A;  4K3A A;  4OXS A;  2Q0A A;  2QM4 A;  3KZI Z;  5EZY B;  4P9P A;  2GHY A;  2MK3 A;  5KMG A;  1XL6 A;  1K33 A;  2BTQ A;  3HKE B;  4GKJ O;  3BA8 A;  3ZRW A;  4PEL A;  1XNQ B;  2P67 A;  4DV2 B;  2HVJ C;  5KX5 B;  1QCE A;  3ZMV A;  1FFX A;  3L72 H;  4PDL A;  2EIM C;  3FB7 C;  4B3S B;  4R7C A;  1Z5V A;  3CRA A;  2EX3 A;  1SER A;  5FLX N;  4DYL A;  3X2Q B;  4I55 B;  3ZMS A;  1J5E O;  5IT9 N;  3A0H Z;  1ZX3 A;  4D6T H;  2XAF A;  1M93 A;  4BWA A;  4I4T B;  2EJR A;  1FS0 G;  3UO3 A;  3CS5 A;  1YXB A;  4NXM B;  1K8A W;  1NTM H;  2IH1 C;  4LF8 B;  2JEU A;  3K5O A;  3CSX A;  1XEQ A;  1GK9 A;  2NLJ C;  4FLX A;  5EIB C;  4X1K A;  4LFC B;  4DRX A;  2OYQ A;  2GDS A;  3CCV V;  3JCZ A;  3I56 V;  4JI3 O;  4CS3 A;  1HR0 O;  4GYC B;  4UCU A;  3AG7 A;  2EIK C;  4X66 O;  4AI8 A;  5J2T B;  1YZB A;  3N2G A;  4X65 B;  3CC4 V;  4DR3 O;  1NZ6 A;  2RMK B;  4K0K O;  1WNS A;  2HJD A;  1T5E A;  1CEZ A;  1O9G A;  3E35 A;  2FML A;  2LJ2 A;  3K0G A;  4DR2 O;  2WLL B;  4IHJ A;  2L35 A;  4LF7 O;  1V55 B;  1JX9 A;  2F23 A;  3BA9 A;  3L73 H;  3E89 A;  5F2V O;  4TUY B;  1AIL A;  2UXX A;  4MSW C;  1IBK B;  4O4L A;  2GUZ B;  2VQF B;  1JMK C;  1L1F A;  3DC6 A;  5CA1 B;  4FZ0 A;  2DWD C;  2HLD G;  3E86 A;  3RYC A;  1P7B A;  1F23 A;  3AG2 B;  3OGC C;  2PY5 A;  3UO2 A;  4LF4 O;  2Q0O C;  1UFI A;  5JQG A;  1GTO A;  1JA8 A;  4U7O A;  4LWS A;  4IYI A;  1N33 O;  1QVF U;  2V1D A;  1TUB A;  1FYJ A;  3F7V C;  2WLM A;  2UXB O;  4JI4 B;  3CJH B;  2AGA A;  3K08 A;  1ZWI C;  2XND G;  5J2U B;  2UU9 O;  4J7Z A;  1EBO A;  2ZR2 A;  3G80 A;  1OCR C;  3B77 A;  4H33 A;  2JS3 A;  3H1J H;  1BHB A;  3OTO B;  2QWO B;  4QIW F;  4ZKI A;  1SQG A;  2X0L A;  4GX2 A;  5L3B A;  2CTR A;  2RCV A;  2FTK A;  3E8B A;  1SQF A;  4RUF A;  1VF5 B;  5GTH Z;  5JH7 A;  3FYI B;  3QO8 A;  4DO2 A;  1MMM A;  2CAZ C;  1NTK H;  3HPL C;  1BS3 A;  1VIB A;  1VQ4 V;  1VP7 A;  1R3J C;  1SZT A;  5JVD A;  1IX9 A;  3C90 A;  2BOB C;  2EIN C;  4IIJ B;  2B1G A;  3LNN A;  3P3P A;  4O4H B;  4WFA V;  3K04 A;  3CCM V;  4YJ3 A;  1JJ2 U;  4B3R B;  4QNH B;  2AXT Z;  3VQY A;  3W7S A;  1IXM A;  4O2B A;  1K5S A;  2P7T C;  1DLB A;  5DN6 G;  4LFB B;  3ETQ A;  1XI1 A;  1MSW D;  3L70 H;  5FNV A;  1YI2 V;  4JTA B;  3OR6 C;  2CH7 B;  1KU9 A;  3ZMZ A;  3IC9 A;  3FKS G;  4FK5 C;  2E74 B;  3OMI B;  4WFE A;  2KB1 A;  5H2F Z;  1KUQ A;  5JJE B;  5LYJ A;  4MTO A;  4NTY A;  3L74 H;  4NR1 A;  3W7X A;  1L8D A;  5IE9 A;  3ZRV A;  1U96 A;  4PA3 A;  4JI7 B;  5IYB O;  1SQX H;  2P06 A;  1G1X B;  1IUR A;  1H2N A;  3UT5 A;  2ZQM A;  3C3T A;  4B3M B;  2H8P C;  2GTS A;  4TV9 B;  4HNA A;  1CP9 A;  4JTC B;  3IGA C;  4JV5 B;  3G4S V;  1VQ9 V;  1OZ0 A;  3ZCC A;  1I7F A;  2LQT A;  1R6N A;  2ZD9 A;  4R8C A;  4P9O A;  3T1Y B;  3RVZ A;  5B1A B;  2F4V B;  3ZHU A;  1XNR B;  4JI4 O;  1SQB H;  1YDX A;  3A0B Z;  1Q6U A;  3QG5 A;  2QJ1 A;  1VQL V;  1NH2 D;  1Z5W A;  3ZMU A;  4DW0 A;  1NBM G;  5BR8 O;  2AHY A;  3VQW A;  5K1P A;  5B3S C;  4FLU A;  1NU1 H;  4JI0 O;  4DUZ O;  2QWQ B;  1AJP A;  3HKE A;  1Q81 W;  1ARO P;  3ETG A;  5L3F A;  1N36 O;  4ABM A;  3W7W A;  2LW7 A;  2GBO A;  1GRJ A;  1W2B U;  4DV5 B;  3OUF A;  5KX5 A;  3W7T A;  2CDY A;  3OTO O;  3E8F A;  5IJ9 B;  3H1I H;  1LUV A;  4CS4 A;  5LMN O;  2LO1 A;  1Q3E A;  4PA6 A;  3OFN G;  1I94 O;  1XMQ O;  1SQQ H;  2Q7H A;  1M56 B;  1KP2 A;  4I55 A;  4X88 A;  2XUM A;  1VF7 A;  1WP7 A;  4IHJ B;  1V9P A;  3OUS A;  4I4T A;  4ZBM A;  1NVP D;  1U97 A;  1E79 G;  1Y74 A;  3E83 A;  4FM0 A;  2DOS A;  3RYI B;  1FXK C;  1B04 A;  3LSU A;  5KLV H;  4Q20 A;  1VQK V;  1PPJ H;  1Q6H A;  3OGI B;  4MW8 A;  4FZ1 A;  5FL7 G;  5H5N A;  1H38 A;  1VQP V;  3MHH C;  3ABM C;  3F5W C;  4HYO A;  3CEI A;  4AQY B;  3E2E A;  5J2T A;  3CCL V;  1K73 W;  4NKG B;  3D36 C;  4FFK A;  1JPX A;  4F6R B;  3SYA A;  4O2A A;  4IGG A;  2AZ2 A;  3CRR A;  4Z1V A;  5TIS Z;  4ASU G;  1DTO A;  3ASO C;  4LWS B;  4O4I B;  2DW4 A;  3JCU Z;  1M57 C;  3AG1 C;  4TUY A;  2ATK C;  3HKB A;  4C7U A;  2QWN B;  4LF6 O;  2BSK A;  1NR7 A;  1N4C A;  2ETN A;  3BHP A;  2GUZ A;  2WLI B;  3K5M A;  2IJI A;  5LP6 B;  3PJS K;  4JI5 B;  5CA1 A;  4DV6 B;  4I50 B;  1SKV A;  4I7Z B;  4FLZ A;  2HKO A;  1MZE A;  1WB7 A;  3ABL B;  3LSS A;  1GN6 A;  3JAL B;  2CTP A;  3ASN C;  4MTG A;  2F4V O;  1TVK A;  3RW0 A;  4LF5 B;  3CMA V;  3H01 A;  4LF9 B;  4Z1M G;  1QVG U;  2XHB A;  1IBL O;  2ZDI C;  3N2K A;  3CX5 F;  4FFB A;  2JEX A;  5JH7 B;  1VQ8 V;  1GO3 F;  1GMG A;  2E5L B;  3AK1 A;  1MSD A;  5KAF Z;  3CJH A;  2DJV A;  4MVU A;  5JVD B;  1F7Y A;  4JYY A;  1N34 B;  3BFR A;  2CGO A;  1S5J A;  2Y4T A;  2ZIM A;  1RSO B;  3BY6 A;  1BQ0 A;  5J2U A;  3ETD A;  1I5X A;  4I5S A;  3CB2 A;  3AG4 B;  2R70 A;  4IT5 A;  1K34 A;  4O2B B;  2B9Z A;  1N32 O;  4X64 O;  2M7W A;  4JF3 A;  4HAM A;  4PA9 A;  4OX9 O;  4NVP A;  2QKC A;  2JGU A;  4CC6 A;  1JVM A;  3H1H H;  5LYJ B;  4UFZ A;  2WPD G;  4GLX A;  3PN1 A;  1FXV A;  4B3T B;  3G6B A;  4IIJ A;  2ZT9 B;  4O4H A;  1YVW A;  5LBQ A;  2F95 B;  1KB9 F;  5CA3 A;  1Y66 A;  3AEI A;  3R66 A;  1F4M A;  4PI0 A;  1OCC C;  4JPR A;  4LC1 A;  3L75 H;  2H3O A;  3OD4 A;  2OWO A;  2EIJ C;  3BCC H;  2YI9 A;  1FD9 A;  2QKA A;  4LH6 A;  1WB8 A;  2C2A A;  4JI1 B;  4K8Z A;  4HNA B;  1H2S B;  5B1B C;  2K1E A;  2CH7 A;  3DGE A;  3JD2 A;  2ZNJ A;  4DR1 O;  1BZK A;  3UKM A;  2Q68 A;  1HNX O;  4GUN A;  3A8T A;  2Q67 A;  4TOI A;  3T2M A;  4DR7 B;  2VWK A;  4D7S A;  4WFG A;  4KUM A;  4JAU A;  4FLY A;  4BIO A;  2Q7E A;  2IU3 A;  3T1H O;  2P22 C;  2RQ6 A;  1SET A;  4DV3 O;  3Q4H A;  1PM9 A;  3TXQ A;  4X9Q A;  4FM2 A;  3JAW B;  2A06 H;  4EB6 A;  4JI6 O;  1RM1 C;  1PL0 A;  2YS8 A;  4K8X A;  1WPX A;  3D3Q A;  4X1Y A;  1FFT B;  4TV9 A;  2Q5Z A;  4MVQ A;  1AP5 A;  1GN2 A;  2LGW A;  1KEC A;  2OCH A;  2IH3 C;  1XBL A;  2LP7 A;  3NR7 A;  5KA5 A;  3AK2 A;  1FJG B;  3JSL A;  4HZ3 A;  4JI8 O;  5LOV B;  4X8A A;  4DV0 O;  2UUB B;  1M4U A;  4MVM A;  2ZNI A;  4JI2 O;  4J41 A;  1EZJ A;  2Y0I A;  4QPJ A;  1N34 O;  1D5N A;  1Q7Y W;  3UCS C;  2NR5 A;  2UXC B;  2UUC O;  3KCY A;  4I0X A;  3LDC A;  1Y74 B;  3SR2 C;  1DGS A;  3CP1 A;  3CC7 V;  3B09 A;  3DTU B;  1WAZ A;  2CK3 G;  2QEX V;  4WF9 V;  3TET A;  3EHB B;  5IY5 B;  5IJ9 A;  3I5D A;  2UXD O;  4DK0 A;  1I5Y A;  3JAK B;  3M8A A;  4KP4 A;  5EIB D;  1X4T A;  2CE4 A;  3K5N A;  4DR5 B;  5HFL A;  1PNK A;  3DXR B;  4DV1 B;  5DEC A;  1QLN A;  1R3K C;  3WB0 A;  1YJN V;  2ARH A;  1BHA A;  2CGN A;  1GM7 A;  4TQD A;  2JGD B;  2OCC C;  1V54 B;  1B3Q A;  1M9N A;  4O2A B;  1SA0 A;  3RFR A;  4DV7 B;  1HP8 A;  5GON A;  4LBE C;  2ITC C;  4WBN B;  1NH2 B;  4PDM A;  4KXR A;  3EXA A;  1AP6 A;  3JAT A;  2IJK A;  3OM3 B;  3RYI A;  1W59 A;  3UQ8 A;  4DR4 O;  4OGQ B;  3HKB B;  1QU7 A;  4MVR A;  2LW1 A;  2A79 B;  2BSK B;  4NTX A;  5B3S B;  4LFA B;  2Q73 A;  2WAM A;  5EK0 A;  4GX1 A;  1Y6X A;  3OEH G;  1K5Q A;  2HHH B;  3KKY A;  4PDR A;  3HB3 B;  2F66 C;  4KL1 A;  1H2K A;  3RN4 A;  2KSD A;  4F6R A;  4UB6 Z;  2DE0 X;  2P90 A;  1TVK B;  3I55 V;  4OPA A;  3ZHT A;  1Q90 D;  3K58 A;  1QLE C;  4O4I A;  1OJH A;  5JCO C;  4TT3 G;  4CBC A;  3N2K B;  3RYF B;  4FFB B;  2R72 A;  1AJN A;  1L0L H;  3S3W A;  2WLK A;  1HNW B;  5BMV B;  1NVP B;  5LGN A;  3BVO A;  1S3J A;  2WLI A;  4GKK B;  1XNQ O;  4DV2 O;  3K03 A;  5FPR A;  5L3G A;  2QTO A;  5LP6 A;  1F4N A;  1R1B A;  2A0L A;  4I50 A;  1S5H C;  2WLN A;  4J9Z B;  1IZ3 A;  2FL4 A;  3AG3 C;  4MTF A;  2D3O W;  3M7M X;  3OTF A;  3APQ A;  3FX7 A;  2R9A A;  2W0X A;  2EIL C;  4PDV A;  3JAL A;  3U10 A;  4B3S O;  1LR1 A;  1YTF D;  1TA8 A;  4G27 B;  3B4S A;  5IYD O;  1AB3 A;  4BW5 A;  1VF6 C;  4N23 A;  4B08 A;  4R50 A;  3SJQ C;  3MHS C;  4YJ2 B;  1KMI Z;  3AK3 A;  2B5U A;  2D2C B;  2XAQ A;  4FLT A;  2N05 A;  3DSQ A;  2E75 B;  3VQX A;  3OW2 U;  3RYH B;  4NXM O;  4UCR A;  3AG1 B;  4LF8 O;  1BE3 H;  3RGB A;  3HKD B;  3ABU A;  1I0H A;  2QTS A;  4LFC O;  1RSO A;  2ZE5 A;  3HKC B;  1JFF A;  4DV4 B;  2ILM A;  1K7D A;  4RUE A;  3R65 A;  1K9M W;  4DV1 O;  3JAR B;  4W4L A;  2Y0P A;  2XAJ A;  4RQE A;  3BPZ A;  3CD6 V;  4YHH B;  1E1Q G;  4X65 O;  5LA6 B;  2PUS A;  5EBL C;  4F4L A;  1AI5 A;  4PA7 A;  3K57 A;  4J11 A;  4F6E A;  5KA6 A;  5C93 A;  1EN6 A;  2PF4 E;  5E1A C;  1EN4 A;  3CME V;  3FAV B;  1E1R G;  1LNQ A;  3GWO A;  1IBK O;  2LFR A;  1OCZ B;  2VQF O;  3Q4H B;  2Z0A A;  2P6J A;  3X2Q C;  3SJB C;  4ZHQ B;  1XMO B;  1J95 A;  3JYC A;  4X1I B;  1IXB A;  2MW2 B;  1Y4M A;  4EB6 B;  1JOY A;  1BMF G;  1EM1 A;  3QF7 A;  1OCO B;  1RPR A;  1W0K G;  1KKD A;  2A3Q A;  2BCC H;  4UCO A;  4X1Y B;  4PJ0 Z;  1XHZ A;  1DK1 A;  2YIB D;  4W4K A;  3MDS A;  4J42 A;  2IJH A;  4WFB V;  2M6Y A;  5DM6 V;  4DUY B;  3T1C A;  4JYA B;  3ABK B;  3JD0 A;  2X6B A;  5IWA B;  3KCX A;  1VMG A;  2QDO A;  5LGT A;  1IBM B;  2Z5U A;  3QO7 A;  2Y48 A;  1URF A;  2GSM B;  2DYS B;  2DYR C;  3K9A A;  2XAH A;  1WN7 A;  3BAA A;  1KC8 W;  5C8Y A;  4JTD B;  5LHH A;  3JAW A;  4X62 B;  1KP3 A;  1RFY A;  2RDC A;  1Q6I A;  1QHT A;  1R73 A;  4I0X B;  2OTL V;  2PYL A;  3CE2 A;  4I9Q A;  1GN3 A;  5E79 Z;  1HNZ B;  1SS3 A;  1P49 A;  1V55 C;  4NYK A;  5KHI A;  1OCC B;  1K97 A; 
#chains in the Genus database with same CATH homology
 2EIM C;  3FB7 C;  2ZR3 A;  4MVU A;  4R7C A;  1SER A;  3X2Q B;  5L3D A;  3ZMS A;  3F7Y C;  2IW5 A;  2ZXW B;  1AI6 A;  4MTX A;  3BY6 A;  3ASO B;  3ETD A;  4FPP A;  1I5X A;  4I5S A;  3ZRS A;  1M57 B;  2DQ0 A;  2XAF A;  3AG4 B;  3FB5 C;  2EJR A;  1K34 A;  3ABT A;  1FS0 G;  3OMN B;  5CBG A;  4H37 A;  4U7N A;  3SYQ A;  4KFM A;  1Q82 W;  2M7W A;  1OHH G;  1K8A W;  4JF3 A;  1K3E A;  2IH1 C;  2JEU A;  3AG2 C;  4JGS A;  1GK9 A;  2NLJ C;  1JQ0 A;  1NQT A;  4HAM A;  4PA9 A;  5HFM A;  3FB6 C;  3CCV V;  3JCZ A;  3I56 V;  1JVM A;  4J9Y B;  2QKS A;  2WPD G;  5IDJ A;  3NXS A;  3ASN B;  4XDK A;  3STZ C;  2EIK C;  3JD1 A;  1FXV A;  3CC4 V;  3SPI A;  2R9R B;  3ZIA G;  5LBQ A;  1YHQ V;  5CA3 A;  4RQF A;  1Y66 A;  3AEI A;  1CEZ A;  3E35 A;  3K0G A;  1F4M A;  2WLL B;  3ML0 A;  1OCC C;  2HR3 A;  4R6Z A;  4JPR A;  1V55 B;  1JX9 A;  2WLH A;  3OE7 G;  4GCZ A;  4LC1 A;  3BEH A;  4RO2 A;  5CBF A;  2PI5 A;  2EIJ C;  3E89 A;  4DXW A;  1WLE A;  2EIM B;  2Q69 A;  1SRY A;  4G28 B;  1R6K A;  5CBH A;  2C2A A;  2UXX A;  1K92 A;  4MSW C;  4BAY A;  5B1B C;  2V7Q G;  1S72 V;  3QO5 A;  2K1E A;  3DGE A;  3ZMT A;  3T4D A;  3JD2 A;  2EZO A;  4XBF A;  3CCR V;  1L1F A;  3UKM A;  2Q68 A;  2Y69 B;  4X89 A;  1AJQ A;  2Q67 A;  1W0J G;  2LFS A;  3T2M A;  1PKX A;  4WFF A;  3MD0 A;  4WFG A;  4JYC A;  1PD3 A;  2DWD C;  5LHG A;  4MVS A;  4KUM A;  4JAU A;  2IU3 A;  2HLD G;  4JYB A;  3E86 A;  1SET A;  1H8H G;  1NJI W;  2DWE C;  1P7B A;  1P4R A;  4MS2 A;  2WWW A;  2HJF C;  1F23 A;  3AG2 B;  5IY5 C;  3OGC C;  3ZN0 A;  5LGU A;  3CCS V;  4BIZ A;  3ZRW B;  4UV8 A;  1GTO A;  1QR9 A;  1PNM A;  4U7O A;  1SES A;  3E8H A;  1QVF U;  1RM1 C;  2V1D A;  1PL0 A;  1G4Y B;  2WLM A;  3F7V C;  4PA4 A;  2EIK B;  1WPX A;  2BOC C;  2WLJ A;  1FFT B;  2XAS A;  5KUM A;  4UUJ C;  4MVQ A;  1V54 C;  4WCE V;  1KEC A;  4UVB A;  2IH3 C;  2LP7 A;  1R3I C;  3K08 A;  1ZWI C;  2XND G;  5KA5 A;  1KQS U;  2YEV A;  5L3C A;  1K4C C;  4HZ3 A;  3CCU V;  2EIJ B;  5LHI A;  1VQ5 V;  1Q86 W;  2R9I A;  3WFV A;  1EBO A;  2ZR2 A;  4X8A A;  1R3L C;  1OCR C;  3B77 A;  4H33 A;  1VQM V;  5B1B B;  4MVM A;  1FXK A;  3T4Z A;  3ETE A;  1EZJ A;  1BHB A;  4QPJ A;  4G2K A;  1Q7Y W;  2Y69 C;  4QIW F;  1K4D C;  4ZKI A;  3ZRX A;  2X0L A;  4GX2 A;  5L3B A;  2JJ2 G;  4TWK A;  3TCU A;  2FTK A;  2OTJ V;  3E8B A;  3LDC A;  5CN0 A;  1AR1 B;  3P32 A;  2UXN A;  3CP1 A;  4RUF A;  3CC7 V;  3DTU B;  2CK3 G;  3JD3 A;  2QEX V;  3FYI B;  1NKD A;  5H9C A;  3QO8 A;  4DO2 A;  4WFH A;  4WF9 V;  3TET A;  1QBZ A;  3OMA B;  3D36 A;  3EHB B;  3HPL C;  5IY5 B;  4FJC C;  1JCH A;  4UVA A;  2H94 A;  1VQ4 V;  1R3J C;  1SZT A;  1I5Y A;  4KP4 A;  3B8N A;  5HFL A;  4XDJ A;  1PNK A;  2BOB C;  2EIN C;  2B1G A;  1QLN A;  4WFA V;  3K04 A;  3CCM V;  1R3K C;  2QA4 V;  1YJN V;  1RM1 B;  1BHA A;  3CCE V;  3OEE G;  3K3W A;  2W6I G;  1GM7 A;  4CZZ A;  1JJ2 U;  4QNH B;  2OCC C;  2YSU B;  4MT8 A;  3UM7 A;  3W7S A;  1IXM A;  1M1K W;  2X6A A;  1GM8 A;  1V54 B;  1EFR G;  4XDL A;  1K5S A;  2P7T C;  1DLB A;  5B1A C;  5EBW C;  5KUK A;  1M9N A;  4P30 A;  5DN6 G;  1MSW D;  4GX0 A;  2X7R B;  3P30 A;  4LBE C;  2ITC C;  1NH2 B;  2HVK C;  2QM7 A;  4PDM A;  1YI2 V;  4JTA B;  3W7U A;  3OR6 C;  1AI7 A;  3G6E V;  3ZMZ A;  1G8M A;  3FKS G;  1UJW B;  2IJK A;  3OM3 B;  3AG3 B;  4FK5 C;  4QPK A;  1ROP A;  3OMI B;  4WFE A;  2KB1 A;  4MVZ A;  3CCJ V;  4MVR A;  1YIT V;  1GKF A;  2A79 B;  1MG1 A;  1OCR B;  4QE7 A;  5B3S B;  1YTF B;  3SPC A;  3VOU A;  2WAM A;  1F51 A;  3IFX A;  4GX1 A;  4MTO A;  5EK0 A;  3SYC A;  3OEH G;  1K5Q A;  1ORQ C;  3W7X A;  4PDR A;  3HB3 B;  2QM8 A;  3WG7 B;  2AHZ A;  3ZRV A;  3KG2 A;  2HG5 C;  2IU0 A;  4PA3 A;  3K79 A;  2ZDI A;  5IYB O;  2IJJ A;  4JAV A;  4RAI A;  2WLL A;  2Q6A A;  4JAS A;  5EBM C;  1VQ6 V;  2ZQM A;  2P90 A;  1M56 C;  2H8P C;  2W0F C;  3I55 V;  4LCU C;  1CP9 A;  4JTC B;  3IGA C;  2W6J G;  3G4S V;  1VQ9 V;  2EIN B;  1QLE C;  1CPY A;  1OZ0 A;  1RPO A;  4TT3 G;  3ZCC A;  1R6N A;  4CBC A;  2ZD9 A;  4R8C A;  4QE9 A;  1FXH A;  1AJN A;  2OCC B;  2WLK A;  4MW3 A;  1XL4 A;  4P9O A;  1NVP B;  5LGN A;  3CYO A;  1BL8 A;  2JIZ G;  3RVY A;  5L3E A;  2X6C A;  1S3J A;  5H6Q A;  5B1A B;  3RVZ A;  2WLI A;  3SPJ A;  2XAG A;  3CXC U;  3K03 A;  5L3G A;  2QTO A;  1F4N A;  1VQL V;  1NH2 D;  2A0L A;  3ZMU A;  1NBM G;  1S5H C;  2WLN A;  4J9Z B;  5J9P C;  3AG3 C;  4MTF A;  1TUE B;  2D3O W;  1S0V A;  3M99 B;  2AHY A;  1COW G;  1S77 D;  4GX5 A;  2EIL C;  4PDV A;  2OT5 A;  3SYO A;  5CMU A;  5B3S C;  3SYP A;  4GT1 A;  1YTF D;  1AJP A;  4G27 B;  4TSF G;  1Q81 W;  1DF5 A;  1ARO P;  5IYD O;  3ETG A;  3A0R A;  5L3F A;  1YSC A;  3WG7 C;  3W7W A;  1OCZ C;  4BW5 A;  3FYE B;  3SPH A;  2ITD C;  4N23 A;  5H6R A;  1W2B U;  3OUF A;  4R50 A;  3W7T A;  3SJQ C;  3LUT B;  4L87 A;  3D3I A;  4UXN A;  1M90 W;  1YIJ V;  3E8F A;  3ZN1 A;  3OAA G;  3MHS C;  5B1O A;  3IC7 A;  1S76 D;  1NR1 A;  2B5U A;  4E2L A;  3B8M A;  2XAQ A;  1VQO V;  1OCO C;  4PA6 A;  2QE7 G;  3OFN G;  3OW2 U;  1M56 B;  1KP2 A;  3AG1 B;  1H2G A;  3ABU A;  1QLE B;  4X88 A;  3ABK C;  3SPG A;  3CCQ V;  1K7D A;  2EBO A;  2JJ1 G;  4RUE A;  1THZ A;  3OUS A;  3R65 A;  1K9M W;  4ZBM A;  4P2Z A;  1YJW V;  2XAJ A;  4RQE A;  3LSQ A;  3CD6 V;  1NVP D;  1E79 G;  4LP8 A;  1E1Q G;  1ENV A;  3E83 A;  2PI4 A;  3ABL C;  5EBL C;  2XOK G;  4F4L A;  1VQ7 V;  1DF4 A;  3CPW U;  1AI5 A;  1FXK C;  2DYS C;  4BIU A;  1B6Q A;  4PA7 A;  2Z3Y A;  4Q20 A;  4UVC A;  2DYR B;  5EC2 C;  1VQK V;  2NNU A;  1YJ9 V;  1KD1 W;  5GW7 A;  3FB8 C;  4MW8 A;  5FL7 G;  5KA6 A;  1H38 A;  1VQP V;  5C93 A;  5E1A C;  3MHH C;  3CME V;  2EIL B;  3ABM C;  3F5W C;  4HYO A;  1E1R G;  3LDD A;  4YXW G;  1LNQ A;  3E2E A;  3CCL V;  3GWO A;  2LFR A;  1K73 W;  1HWY A;  1PNL A;  3STL C;  3VBB A;  1OCZ B;  1JPX A;  2DQ3 A;  1VQN V;  3LDE A;  3SYA A;  2P6J A;  4UV9 A;  3X2Q C;  1J95 A;  3JYC A;  2F43 G;  4ASU G;  2ZXW C;  4FIP C;  1Y4M A;  1JOY A;  1BMF G;  1DTO A;  2B1I A;  3ASO C;  4I9W A;  4MVO A;  1OCO B;  2DW4 A;  1M57 C;  1RPR A;  1W0K G;  3AG4 C;  3AG1 C;  1KKD A;  4EKW A;  2ATK C;  1AI4 A;  3E8G A;  1H8E G;  1NR7 A;  3TK1 A;  2IJH A;  4WFB V;  2WLI B;  5DM6 V;  3OR7 C;  1MOF A;  3RBZ A;  3K06 A;  3T1C A;  3ABK B;  5EC1 C;  3JD0 A;  3K0D A;  3LNM B;  2EZP A;  2IJI A;  2X6B A;  2HFE C;  2YEV B;  3PJS K;  3JD4 A;  4OXS A;  3G71 V;  2HKO A;  5LGT A;  4FMT A;  4P9P A;  2GHY A;  2MK3 A;  2Z5U A;  3ABL B;  3QO7 A;  4QJF B;  3LSS A;  3GB7 C;  2Y48 A;  2GSM B;  1FXK B;  3ASN C;  1XL6 A;  2DYR C;  2DYS B;  2XAH A;  2WSS G;  3K9A A;  4MTG A;  3CC2 V;  1K33 A;  3EFF K;  2JDI G;  2JK5 C;  3RW0 A;  1N8R W;  3QNE A;  3CMA V;  1KC8 W;  4JTD B;  5BZB A;  3ZRW A;  4PEL A;  2A9H A;  3H01 A;  5LHH A;  1KP3 A;  1GM9 A;  2P67 A;  4Z1M G;  5B1N A;  1R73 A;  2HVJ C;  1QVG U;  1QCE A;  2OTL V;  3ZMV A;  2ZDI C;  3ABM B;  1MAB G;  2JEX A;  1QR8 A;  1VQ8 V;  1GO3 F;  4PDL A;  1GMG A;  1V55 C;  3ZJZ A;  4N21 A;  1OCC B;  5IYC O;  1K97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...