1F4MA

P3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
56
structure length
56
Chain Sequence
GTKQEKTILNMARFIRSQALTILEKANELDADEIADIAESIHDHADEIYRSALARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords ROP ALA2ILE2-6
publication title Dramatic structural and thermodynamic consequences of repacking a protein's hydrophobic core.
pubmed doi rcsb
source organism Escherichia coli
total genus 25
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f4mA00
4DO2A 1B6QA 1GTOA 1NKDA 2IJHA 3K79A 2IJJA 1RPOA 1PD3A 1F4NA 2IJIA 2IJKA 1F4MA 2GHYA 1RPRA 1ROPA 1GMGA
chains in the Genus database with same CATH superfamily
1QCEA 4LFBB 2YS8A 1MABG 5BXZA 1Q7YW 3BFRA 5IYDO 2Q69A 3P32A 4U7OA 1XHXA 5JJEB 1SQGA 1SZTA 3D3IA 3OR6C 4FFBA 4DV7O 1PD3A 4PHZA 4CH6A 3PJSK 3AK1A 3OE7G 1K33A 1XILA 3ABUA 4GX1A 1Z5VA 4DV4B 1NBMG 1N32B 2QR4A 4UVCA 1SQVH 4O4LA 1M5IA 2XTAA 3T1HO 2UUBB 1XHZA 3ZN1A 1EZVH 5J2TB 3TXSA 1BZKA 2N05A 3RGBA 4GT1A 4LH6A 1I94O 2ZDIA 5IWAB 1H2SB 1DK1A 1THZA 3RFRA 2LW1A 1VQKV 3GB7C 1S5HC 4PI0A 4CH5A 1PNMA 2R72A 1XL4A 3ABTA 1IXBA 2CAZC 3BA9A 4I0XA 1AR5A 5CA1A 5LMNB 4TQFA 2YDEA 4FPPA 4DR2B 1MZEA 4DV0B 3JASA 3LSSA 1YSCA 4X66O 3LDEA 4G27B 5B5EZ 3CXCU 3W7XA 4O2BA 1WPXA 4IYHA 1VQ9V 2XT9A 5JQGB 3BCCH 1R73A 3RN4A 4BAYA 4IIJB 1IXMA 2H94A 4OGQB 5H6RA 5JVDA 1H8EG 2ZIMA 4DRXA 1ZL8A 5GTIZ 3UQ8A 1VIBA 4I5SA 2JK5C 3A2FA 3B09A 3QO7A 4O2AB 4MTGA 1QR9A 2EILB 2ZINA 3A0RA 1YIJV 1ENVA 1OCZB 3U0ZA 2ADQB 1OJHA 4F4LA 1R3JC 2VS0A 3ETQA 4JYBA 1K8AW 1FAFA 4FLXA 2OTLV 3BRCA 1N34B 2RN9A 1DF4A 3X2QB 4JI8B 1DF5A 3ZMSA 2A3QA 5KX5A 3FB6C 1VQ6V 3B8MA 2XOKG 5FNVB 2ZIOA 1KU9A 1M9NA 1XMQB 3LUTB 1O9HA 1S77D 4DR7B 1XREA 1NI8A 1IVSA 2DQ0A 4I9QA 1J5EB 2KG7A 2AZ2A 4EB6B 1IBKB 3CCQV 2CTRA 4B3SB 4B7EA 1AJPA 2HP8A 1TUBB 4NTXA 3J80N 2Q7EA 3EFFK 5B1OA 1AI7A 2Z0AA 3ABKB 4CS3A 1LR1A 1Q6IA 4X1KA 4XDJA 1NZ6A 1KQSU 2RJZA 1L0LH 1QQCA 2EINC 3T1CA 1CPYA 1X4TA 4FFKA 2YXLA 3VQXA 4O2BB 2BTQB 4DV5O 3CCLV 4DV2B 3IC9A 4JAUA 1GO3F 2O57A 1U97A 1HNXB 3JCUZ 4D7TA 1DGSA 2WPDG 2R9RB 4JF3A 1MNGA 2IU0A 1SRYA 5JVDB 1W59A 2F43G 4LF4B 1WJZA 4NTYA 1PP9H 2EIMB 4WFGA 4JI5O 2UU9O 2UXBB 3BHPA 2Q0AA 3STZC 2Q4PA 5L3CA 4UXNA 4WFAV 2PUSA 3RYFA 3APOA 4B3TO 1RM1B 3JD2A 2XAQA 4N21A 4DR1B 4FIPC 5CMUA 4DV3O 2V7QG 4Q20A 2YI8A 3OMIB 4TV9B 4RWUA 4DO2A 3U11A 4LF5O 3AG2C 1FXKC 4I7ZB 3QNEA 1K5QA 1DTOA 3K3WA 4OPAA 3OAAG 3AG4B 2A9HA 1XL6A 4CH3A 3F5TA 5KX5B 5L3GA 3ZJZA 1UPGA 2Q68A 3LSUA 4JI6B 1AJQA 2ZE7A 4H13B 4G28B 1R3IC 1ROPA 2OIGA 4LR3A 2QWNB 3MHHC 1KKCA 2DN9A 3JCZA 2WLIA 4JI3O 4YY3O 2CE4A 1LUWA 2WAMA 1R1BA 4UUJC 4AHCA 2P4KA 2VQFB 3ETGA 1RFYA 1GM9A 2E76B 3HKBB 5LMUB 5KMGA 1N0NA 2QJ1A 1HNWB 1HNZO 2Z5UA 2DYSC 3FAVB 4LF7O 3OTOO 3DTUB 4ZOLB 2X7RB 5KA6A 1XNQB 4BW9A 3HR0A 2HKOA 2A0LA 4F6RB 2BSKB 3JAKA 4P9OA 4B3MO 3ZEDA 3E8HA 2OIEA 3LDCA 4QJFB 4HNAA 5EIBC 1F23A 2Y69C 3SYOA 1M57B 1Y66A 1JMKC 2P22C 2GUZA 4AQYO 3E83A 3CC2V 1K4DC 4MSWC 1VEWA 5KLVH 3AK3A 2Q5ZA 3NR7A 2DOSA 1GM8A 3K79A 2XAJA 5B1AB 3O9OA 4PDVA 3RYFB 3MD0A 4JAVA 3RYIA 3UKMA 1JFFB 4JTDB 2X6CA 2NNUA 3L71H 1KB9F 1Y4MA 1M93A 1K73W 4UCRA 3ZMUA 5C8YB 3B2EE 3EHBB 3A0HZ 5H2FZ 4DR6O 3RT3C 1P49A 4K0KB 3H01A 5EC1C 1SZXA 1B06A 1NT2B 2ODMA 5L3BA 1VQNV 1XI1A 2AHYA 2PI5A 1TAEA 1VMGA 4MW8A 3D3QA 3H1IH 2E5LO 4DK1A 2WLLB 4GKKO 1OCCB 4I55A 1JVMA 4PDLA 1WA8B 4GKJB 4J11A 3K5MA 4J7KA 2CTWA 4K35A 2ZCEA 5DN6G 3CCVV 5D5PA 1OCRC 2YIBA 4UVAA 3D8CA 2K9PA 3DGEA 2P4VA 1HW7A 1V54C 2F4VB 5KMGB 3K0GA 2ZKOA 5IYZA 4LF6O 4LFAO 2QM8A 2IH3C 4JZ2A 4MTOA 4MTXA 3ML0A 3WU2Z 4K8ZA 2P67A 5LXTB 1KMIZ 1RSOA 2Y4TA 3K5NA 4YHHO 3ZMVA 2EZPA 4I50A 5EZYA 1SESA 3VOUA 3CC7V 4U7NA 3W7WA 2EIKC 3TCUA 1XMOO 4X65B 2LO1A 2EX3A 1FFXA 3ZMZA 3TGUH 5LP6C 4PJ0Z 4KFMA 3E89A 3FFQA 2IJIA 5KAFZ 2GUZB 1NJIW 1LUVA 1SETA 2IBZH 4TUYA 4QE9A 2WLNA 4FZ0A 1JA8A 2F1MA 1I5XA 3KG2A 2A79B 4HAMA 1W0JG 1YJWV 3CSXA 4XDLA 1IURA 1Q5OA 2F23A 3RBZA 2FKXA 2IM9A 3E8GA 1HDJA 3HKDA 2WSSG 3ZHSA 2IU3A 4I9WA 4BIZA 1NR7A 4DR4O 2Q9LA 1P7GA 2PYJA 4HBNA 5A9GA 4B3RB 1N33O 1QLEC 1SERA 4KL1A 4RQEA 4LF8B 1PPJH 1WN7A 3A0BZ 5LHIA 1KBHA 2UXCO 4P2ZA 5J2TA 5BZBA 2EJ7A 1U96A 4JI1B 1O9GA 3CRRA 3SJAC 2XAFA 3JARA 4PA9A 3ZRXA 2UXDB 1COWG 4H37A 1F4NA 4GUNA 1AP5A 3I5DA 5HFLA 4JI0O 3AG3C 4FJCC 3DC5A 3L70H 5CBGA 1YEWA 2FYUH 5LBQA 1HWYA 1PNLA 4TV8B 1FYJA 3AEIA 3CRCA 1NR1A 4O4HB 2LFRA 5LOVA 4FM2A 3BAAA 3C3TA 4H33A 4D6TH 3HKEB 3CCSV 2QWPB 2OCCC 3STLC 2ZXWC 2AXTZ 2DWDC 2HVJC 4P30A 3JYCA 1CP9A 1M56C 4Z2WA 4QPKA 4W4KA 1K34A 1SF9A 4TUYB 1NH2D 1FJGB 3R65A 2JGDB 4J10A 4O2AA 4OXSA 1XEQA 1AB3A 1QNMA 1YITV 3QF7A 3ZRSA 5BMVA 2OCHA 1Y76B 4KUMA 3HKDB 3K5LA 3LSQA 5JWPA 2HR3A 4UV8A 3KCXA 4KXRA 1AILA 1ZTEA 5L3FA 4KHPB 2BOCC 2EZOA 1IBMO 1PL0A 3CPWU 5FNVA 3T1YO 2AGAA 2QM7A 4ICGA 4NXNO 3OGCC 2OWOA 1G4YB 3N2GA 5EBWC 1Y6XA 2UUCO 4LFCB 4EB6A 3JARB 3E8BA 1TVKB 1S3JA 4JI4O 5CBFA 1BL8A 2ZQMA 1TUBA 3ASOC 2C2AA 1NVPB 5DM6V 2EINB 2ZM6B 4UVBA 3RYHA 2CDYA 1D2DA 2W0FC 4X64O 5J2UB 4CC6A 5LOVB 2ZNIA 1AROP 5K1XA 2CH7B 2YC0A 4LNUB 4CC5A 4CS4A 3TK1A 3TXQA 3CCJV 1FPOA 2BTQA 2W6IG 4LFBO 4CZZA 1VF6C 2Y4UA 3B77A 2X6BA 4B7KA 1BSMA 4LP8A 2F95B 5D5QA 2QTSA 2CGOA 3M8AA 5JCOC 4ASUG 2JJ2G 2CTQA 1PNKA 1JJ2U 4O4JA 3G4SV 1MA1A 2WWWA 4PDMA 4DV4O 1N32O 1SQPH 4R8CA 4IGGA 4J7ZA 2UUBO 4TT3G 3AG2B 1FXKB 2KKWA 4YJ3B 1YTFB 1VQPV 5BMVB 5ITZA 4TV9A 3OFNG 5IWAO 2W6JG 2JJ1G 3SJBC 1VF7A 5BR8O 4UCUA 1V55C 3K08A 1WAZA 3MHSC 5IYCO 3CJHB 4DUZB 1KC8W 5EBLC 1WP8A 3OM3B 5LMNO 1XUQA 2WLMA 4DV0O 3QO8A 3OW2U 3QO5A 5B1NA 4QPJA 3J7AU 3N2GB 4JYCA 4NR1A 1WNSA 4UCVA 3KKYA 4DUYB 3KCYA 1JX9A 3O65A 5KHJA 2DYSB 4JPRA 2E3CA 2YIBD 2ZD9A 3HKBA 1H8HG 1JCHA 4LC1A 1YZBA 2MW2B 1ZLZA 3RYHB 1YDXA 3FAVA 3JATA 1URFA 3JD1A 3CMEV 3Q4HA 4ZOLA 4G2KA 5LGUA 5CB4B 2HJDA 1MMMA 2HEPA 3ETDA 4IHJB 2EIJC 2XUMA 2AW9A 2YIAA 2Y69B 1AR1B 3QG5A 2PF4E 1PM9A 4F6RA 2BSKA 2NN4A 3CE2A 4LF9B 4NXMB 5IY5C 5EYPB 3UO3A 1N34O 4DXWA 3I55V 2JEUA 1A32A 4UV9A 3TETA 4DW0A 3CWBH 4JI8O 1Y67A 1ORQC 1GN3A 2ZT9B 4O4JB 5L3EA 4YY3B 3ZHTA 4FVMA 4DV6B 5EC2C 3NXSA 1XMQO 5AG2A 4DR7O 2IJKA 1JFFA 1DLBA 2XAGA 1QVGU 2JDIG 1CEZA 5ITZB 2H8PC 3K0DA 5C8YA 1IBKO 4JAAA 3GWKC 1N36B 4K8XA 3CS5A 4E2LA 3OEHG 4EFBA 4JYAB 3UCSC 1RP3B 3KZIZ 3K04A 4ZHQB 1EM1A 3IFXA 3VQYA 4JI2B 3TJTA 4JI7B 4JGSA 4FLZA 3JD3A 2WLLA 5F2VO 1OCRB 3WB0A 1WA8A 1V54B 2XAHA 1KUQA 1AI6A 4NTWA 4DV2O 1I08A 2DJVA 2ZE8A 1ZUQA 2LP7A 1IDSA 3E35A 1NS1A 5JH7B 3SJCC 1HNXO 3ASNC 4HYOA 4BW5A 3SGIA 1NVPD 4BIUA 1XNRB 1X59A 3JATB 3LNNA 1R3KC 3Q4HB 1IZ3A 2P06A 1GRJA 3APQA 2VQEO 2UXBO 4NVPA 2B1GA 2EIKB 3DC6A 2ADPA 2YI9A 4CBCA 4GYCB 1KP2A 5LXTA 2RMKB 4JV5B 5LP6B 2QDOA 4WFBV 3FB7C 4DR1O 1GH6A 4MVZA 3D36A 4W4LA 2JS5A 1EZJA 2ZDIC 2X6AA 1RPOA 2YXHA 2YXYA 4MT8A 4XDKA 3THOA 1Q8IA 3DXRB 2N04A 1K92A 2E5LB 2Z3YA 4NKGB 4EKWA 5EBMC 1SQQH 1KP3A 2V1DA 4X62B 3MDSA 4J80A 4OX9B 1M90W 2HFEC 4JI6O 2L6LA 5IJ0B 5LYJA 2IW5A 3K9SA 2QKAA 1YTFD 2IH1C 3GWOA 1PKXA 4UCOA 1N0JA 3SDLA 2MK3A 1MSWD 4NYKA 1M1KW 2CGNA 3WG7C 1QLEB 2M6YA 1QU7A 5B66Z 2VQFO 1NTZH 2P7TC 4DV1B 5FPOA 3ABLC 4A5UB 4UB6Z 1K5SA 3OUFA 5LMUO 1W2BU 5DECA 1WB7A 4BWAA 1HNWO 4DR5B 4PD4F 2UUAB 2P90A 3FB5C 2QA4V 1N4CA 2KSDA 3SYPA 2V4DA 3OD4A 1V9PA 4X8AA 1XNQO 1VQ8V 3IAYA 4IL6Z 3ZRWB 1LNQA 1K7DA 4FM0A 3H1HH 1US6A 3AG3B 2IJHA 4I4TA 1EBOA 1SA0B 3AG1C 1VQ7V 2XASA 3JALB 1FD9A 1HR0B 5FPRA 2OCCB 4TV8A 4U3JB 1VQ5V 4IYIA 2ZXWB 3P3NA 3JAWB 3FKSG 4O4HA 4MVRA 1VF6A 1E1QG 1PV0A 3M7MX 1ZWIC 3HKEA 1BCCH 1M56B 3W7SA 1GM7A 1YCIA 2PZSA 5B1BC 1P4RA 2ARHA 4QIWF 2D3OW 2UXNA 1Q90D 2QWOB 2LJ2A 4TOIA 1BMFG 4H44B 1Z5WA 1FXHA 3C3SA 3SYCA 4K0KO 5CA0A 4X88A 1YXBA 5KAIZ 4MVQA 1GN6A 3T2MA 2VRZA 2QKCA 1EFRG 4QGPA 3P3PA 2JVDA 4DR3B 2JGDA 3K06A 1F4MA 3OMAB 1R6TA 2HHHB 5LYJB 2YSUB 4GKJO 1GK9A 1Y76A 1K9MW 5E1AC 3G6BA 4X20B 5B3SC 1EN4A 3CD6V 2EULA 2A06H 4FLTA 4F6EA 2OT5A 2F4VO 1VQOV 4GCZA 4MVMA 3SPHA 1G8MA 4Z1VA 1R6KA 1JOYA 4MVUA 1R3LC 1KYOF 2LQTA 4ZI7B 2PY5A 1GKFA 3L72H 5CBHA 1IBLB 3EXAA 3SJQC 3T4DA 4MS2A 2WA4A 5C93A 2R70A 3F5WC 2DYRC 1QVFU 4P9PA 1MZFA 3BEHA 3L9DA 1H2KA 2Q8VA 3ASOB 3BPZA 4X65O 4I4TB 2KB1A 1TVKA 4OPHA 5FLXN 3IGAC 4RO2A 3WFVA 5GW7A 2VWKA 3K58A 2UXXA 2ZR2A 2Y48A 2QTOA 1D5NA 3SPGA 5J2UA 5H9CA 4GX0A 2WLHA 2HLDG 2JEXA 2CH7A 5LHHA 4LNUA 3CEIA 4DV7B 3R66A 5E79Z 3P30A 4J42A 4PV1B 4TWKA 1YHQV 1Q43A 4FM1A 4GZRB 5K1PA 2DWEC 4WBNB 1AI4A 2GTSA 3N27A 3G80A 1QHTA 4TSFG 3T1YB 3E8FA 5CA0B 3T1HB 4C7UA 1OHHG 2F93B 1VF5B 4GX2A 1MG1A 3RVYA 4B3RO 5KHKA 1SKVA 2NLJC 5KHGA 4ZKIA 1I94B 3HKCB 4LF8O 4KP4A 3EVKA 2DMXA 5HFMA 1FXKA 4YJ3A 3CB2A 3W7TA 1VQLV 1V55B 2PGGA 4JI1O 2QE7G 2UXDO 2GBOA 1AJNA 3CRQA 3ZIAG 1WB8A 4X66B 3ICXA 3OR7C 3AK2A 2GTAA 3CJHA 5LGNA 3K03A 2D2CB 2WLJA 4X89A 4FK5C 1B3QA 5GONB 3CC4V 2RDCA 1H2LA 3CX5F 3ZX6A 3K9AA 4X1IB 2R9IA 1SC5B 4JTCB 2RNBA 1SQFA 5J9PC 3VQWA 2HVKC 2BE3A 3CHXA 1WLEA 3RYCB 3CCEV 1VQ4V 3ABMC 4PI2A 3E22A 3VBBA 2EIJB 1F7YA 2QWQB 1BE3H 3L75H 2LFSA 4QNHB 1FJGO 2XHBA 4X1YA 1OCOC 5CB4A 1AI5A 3ZMTA 1P7BA 4IHJA 5BR8B 2E74B 2R9AA 3H1KH 3ZHUA 4WCEV 5IY5B 4YIPA 1S0VA 2FL4A 4FZ1A 3S3WA 2A7WA 1KKDA 1QLNA 1GN2A 3OT7A 4RQFA 4TQDA 3JAMN 3LNMB 5EYPA 3FD9A 1OZ0A 1GMGA 1B6QA 3E86A 5CN0A 4ZIBA 3ZCCA 4KHPO 4O4IA 2RCVA 4UCSA 3CRAA 3A8TA 2QGNA 3JD4A 4J41A 4DYLA 1K4CC 4Q6GA 1NTMH 3BA8A 2W0XA 2QWRB 4UFZA 1EN6A 2ITDC 3J81N 3RWRD 4LFCO 2Q0OC 1HP8A 2WA3A 1I7FA 3FYEB 4FLUA 1P84F 2G38A 2ZM6O 1Y74B 5KHHA 4DV5B 4DR2O 3ZHQA 4ZHQA 4FLVA 4AI8A 4LCUC 3MAQA 1SS3A 1WPBA 2ILMA 2BOBC 4FFBB 3ASNB 1GN4A 4LWSA 3S3XA 2PYLA 3K59A 4JI5B 2PI4A 2UU9B 5JH7A 3HPLC 4LH7A 1XQ8A 3E22B 4O4LB 3CP1A 1NQTA 4MW3A 3CMAV 4B3TB 2YUAA 2BTOA 4DV3B 4AILC 2FMLA 4X1YB 1N8RW 4EFEA 4HZ3A 4CS2A 4LF5B 2X0LA 5LP6A 2HJFC 1VQMV 2BCCH 4I0XB 5CA1B 1BS3A 5IE9A 4IT5A 5LGTA 3DXRA 3JASB 4UCTA 3ZN0A 4YXWG 2LGQA 5CA3A 3SPIA 4DUZO 4O4IB 4JI3B 1Q82W 2ITCC 3L74H 3GVMA 1RPRA 3G67A 1GAXA 1FFTB 2DQ3A 5IJ0A 1H2NA 2EJRA 3WG7B 2JGUA 3ABLB 3H9VA 1K3EA 5KA5A 4DUYO 1J5EO 1I0HA 1QR8A 1HNZB 4LF7B 2CTPA 3OTOB 3CYOA 4B3SO 1JQ0A 2LW7A 3L73H 4DRXB 1L8DA 1ZL8B 3H1JH 1S72V 2VQEB 2RQ6A 1YVWA 2YIDA 1Z2GA 5KHIA 2B1IA 4QE7A 4D7SA 1BT8A 1Q6UA 3G6EV 4L87A 2JIZG 2OTJV 4B3MB 3I56V 1BQ0A 2EILC 2K1EA 4JASA 1OCZC 2AZ0A 1FXVA 1S76D 2YICA 5DEDA 3AG1B 3ZRWA 4AQYB 2QSAA 4YIOA 4LWSB 2B9ZA 3WB1A 3B40A 4LF9O 1SA0A 4PA3A 4NXMO 3OUSA 1KECA 1H2MA 3X2QC 2EBOA 3U10A 5LA6A 2Q7HA 3H1LH 3JALA 3T4ZA 2Y0PA 2GDSA 4LF4O 4ZBMA 4U3JA 5IJ9A 3JAWA 3ETEA 1BQZA 3SPJA 4DV6O 2KG7B 1L1FA 5B1BB 4DR6B 5H6QA 2M7WA 3CCRV 2CUGA 2Q67A 1GTOA 3SPCA 3BABA 3AG7A 4J9YB 4R50A 3RVZA 1S5JA 3N2KA 1PL4A 3FYIB 1AR4A 4X1KB 1J95A 1N36O 2ZNJA 4JYAO 3ABKC 4GKKB 1H2GA 1M4UA 3CCUV 1Q3EA 3E2EA 4GX5A 5IT9N 3SR2C 1AVMA 4H0LB 4JI2O 4FMTA 2NR5A 4JI7O 1Q6HA 1F51A 3BVOA 5B3SB 1H38A 2QM4A 3IJ4A 4E4EA 4UB8Z 4CH4A 1NH2B 4WFEA 2CK3G 4BIOA 4X20A 3CXHF 4LF6B 4LFAB 4MVOA 2ZE5A 1SQBH 2JS3A 3BY6A 1Q86W 2DYRB 4R6ZA 5FL7G 1XNRO 2AHZA 2EIMC 4YHHB 4ZI7A 2YEVA 2WLKA 3FX7A 4YJ2A 3ZHRA 1B04A 1XMOB 1RM1C 1TA8A 2Y0IA 1E79G 4JV5O 1TUEB 1JJOA 3ZHVA 4RUEA 1BHAA 3CCMV 2QEXV 1I5YA 1NTKH 5KUMA 1JR9A 3B4SA 4GLXA 3M99B 5EK0A 3SYAA 1NKDA 4J7JA 3AG4C 5LA6B 1WP7A 1EN5A 4X9QA 2XNDG 1ZX3A 4J9ZB 3W7UA 1L0NH 5IJ9B 2WLIB 5GTHZ 4X62O 1AP6A 4OX9O 3VQVA 2GHYA 3QTCA 4K3AA 4JTAB 4DR4B 1VARA 4DK0A 2JRIA 5JCOA 5LHGA 5EIBD 4NB5A 1MOFA 3F7VC 1N33B 3OTFA 3UT5A 5H5NA 4WBNA 3N2KB 3G71V 3ZS8C 4ABMA 4DV1O 4MVSA 2GSMB 2UXCB 2HG5C 4DR5O 4PELA 3ZBHA 2UUAO 3UM7A 1XBLA 3JAKB 1OV9A 4WF9V 2L35A 3IC7A 4LBEC 5IYBO 1FKAO 3C90A 3HKCA 4HNAB 1UJWB 4PDRA 3FB8C 2Q73A 5BY1A 4JI0B 1ZSPA 1W0KG 2KQXA 2GV9A 1M57C 4JZGA 4B08A 1Q81W 1G6UA 4Z1MG 2H3OA 3RYIB 4L8JA 1HR0O 1YI2V 2ZR3A 1KD1W 2YEVB 1NU1H 1YJ9V 1JPXA 4YJ2B 3DSQA 3ZRVA 4WFFA 5B1AC 5GONA 1CXZB 1T5EA 4MTFA 4X1IA 1K97A 4BR6A 5LL6Y 1G1XB 3OEEG 4U3FH 1SQXH 4PA7A 4XBFA 1YJNV 3ABMB 2Q6AA 2DE0X 2PTMA 3JD0A 1UFIA 5KUKA 3RYCA 4DW1A 2E75B 2N74A 5TISZ 1OCOB 2ATKC 2FTKA 1BHBA 3SYQA 4I55B 1TGOA 3UO2A 4DR3O 3LDDA 3K5OA 1OCCC 2P6JA 2HHHO 1S5LZ 1FS0G 3OGIB 1MSDA 2FB5A 3WB2A 1IX9A 1R6NA 2LGWA 2Q7GA 1VP7A 5JJNB 4EEQA 3UT5B 1IBMB 1XDCA 1E1RG 5IYZB 3QVNA 2B5UA 4N23A 3CRMA 3HB3B 3PN1A 4JYYA 3OMNB 4NXNB 1RSOB 4WFHA 1ZAUA 4RUFA 4I50B 5EZYB 1IBLO 2UUCB 5JQGA 3RW0A 1FFXB 1YF2A 4JI4B 4PA4A 5A2QN 2OYQA 3JSNA 3D36C 4RAIA 2F66C 2QKSA 4FLWA 2ETNA 4PA6A 4IIJA 1BGYH 5L3DA 2DW4A 4X64B 3F7YC 2P5OA 1D5AA 1XOUA 3K57A 4FLYA 3JSLA 1QBZA 2ZE6A 5JJJB 2IJJA 4R7CA 5IDJA 1Y74A 3B8NA 2VWJA
chains in the Genus database with same CATH topology
1QCEA 4CBCA 1NJIW 1MABG 1KP2A 2PI4A 1SETA 1Q7YW 5IYDO 2Q69A 4WFBV 3FB7C 3HPLC 2WLNA 3P32A 4QE9A 4U7OA 3CP1A 1NQTA 1I5XA 3KG2A 4MVZA 2A79B 3D36A 1W0JG 4HAMA 4MW3A 1SZTA 3CMAV 3D3IA 3OR6C 1YJWV 1EZJA 2ZDIC 2X6AA 1RPOA 1PD3A 4MT8A 3PJSK 4XDKA 4XDLA 3OE7G 1K92A 1N8RW 4HZ3A 1K33A 2Z3YA 3ABUA 3RBZA 4GX1A 4EKWA 5EBMC 2X0LA 1NBMG 1KP3A 3E8GA 4UVCA 2HJFC 2WSSG 1VQMV 2IU3A 4I9WA 2V1DA 4BIZA 1NR7A 3ZN1A 1M90W 2HFEC 5LGTA 4GT1A 2IW5A 1QLEC 2ZDIA 3ZN0A 4YXWG 1THZA 1VQKV 1YTFD 5CA3A 2IH1C 3GB7C 3GWOA 3SPIA 1S5HC 1SERA 1PKXA 1PNMA 4RQEA 3ABTA 1XL4A 2MK3A 1MSWD 1Q82W 3WG7C 1M1KW 1QLEB 5LHIA 2ITCC 2P7TC 3ABLC 1RPRA 4P2ZA 1K5SA 3OUFA 1FFTB 2DQ3A 5BZBA 1W2BU 4FPPA 2EJRA 3WG7B 3LSSA 2XAFA 1YSCA 4PA9A 3ZRXA 3ABLB 1COWG 2P90A 1K3EA 4H37A 3FB5C 1F4NA 3LDEA 4G27B 5KA5A 3CXCU 2QA4V 3W7XA 1QR8A 3SYPA 5HFLA 1WPXA 1VQ9V 3CYOA 4X8AA 1JQ0A 3AG3C 4FJCC 1VQ8V 1S72V 5CBGA 5LBQA 1HWYA 3ZRWB 1LNQA 1K7DA 1PNLA 3AEIA 1R73A 1NR1A 2LFRA 2B1IA 3AG3B 2IJHA 4QE7A 3G6EV 4BAYA 4H33A 1EBOA 2JIZG 4L87A 2OTJV 3CCSV 1IXMA 2H94A 3I56V 3AG1C 2OCCC 5H6RA 3STLC 1H8EG 1VQ7V 2ZXWC 2XASA 2EILC 2K1EA 4JASA 1OCZC 2DWDC 1FXVA 2HVJC 1S76D 4I5SA 2JK5C 3QO7A 3AG1B 2OCCB 3JYCA 4P30A 3ZRWA 1VQ5V 4MTGA 2ZXWB 1QR9A 1CP9A 1M56C 3FKSG 2EILB 3A0RA 1YIJV 4MVRA 1ENVA 1E1QG 1OCZB 4QPKA 1ZWIC 1K34A 4PA3A 3OUSA 1KECA 1M56B 3X2QC 1GM7A 3W7SA 4F4LA 1R3JC 2EBOA 4JYBA 1K8AW 3T4ZA 1NH2D 2OTLV 5B1BC 3R65A 1P4RA 1DF4A 4ZBMA 4QIWF 4OXSA 3X2QB 2D3OW 2UXNA 3ETEA 1YITV 3SPJA 1DF5A 1L1FA 1BMFG 3ZMSA 5B1BB 1FXHA 3SYCA 5H6QA 3FB6C 4X88A 2M7WA 3ZRSA 3CCRV 3B8MA 1VQ6V 4MVQA 2XOKG 4KUMA 2Q67A 1GTOA 3SPCA 3T2MA 1M9NA 1EFRG 3LSQA 3LUTB 4J9YB 4R50A 1S77D 3RVZA 2HR3A 3K06A 4UV8A 1F4MA 3FYIB 2DQ0A 1J95A 3OMAB 5L3FA 3CCQV 2YSUB 2BOCC 2EZOA 1AJPA 1PL0A 1GK9A 3ABKC 3CPWU 1H2GA 1K9MW 3CCUV 5E1AC 3E2EA 5B3SC 4GX5A 2QM7A 3EFFK 3CD6V 5B1OA 1AI7A 3OGCC 3ABKB 2OT5A 4FMTA 1G4YB 1VQOV 4GCZA 4MVMA 1F51A 5EBWC 4XDJA 3SPHA 1G8MA 5B3SB 1R6KA 1H38A 1JOYA 1KQSU 4MVUA 1R3LC 3T1CA 2EINC 1CPYA 3E8BA 1S3JA 5CBFA 1GKFA 5CBHA 1BL8A 2ZQMA 3SJQC 3ASOC 2C2AA 3T4DA 4WFEA 4MS2A 2CK3G 1NVPB 1NH2B 5C93A 3F5WC 2DYRC 1QVFU 4P9PA 5DM6V 2EINB 3CCLV 4UVBA 3BEHA 4MVOA 4JAUA 2W0FC 1GO3F 3ASOB 3BY6A 1Q86W 2DYRB 4R6ZA 5FL7G 2AHZA 2EIMC 1AROP 2KB1A 2WPDG 2R9RB 4JF3A 2YEVA 2WLKA 3TK1A 3IGAC 3CCJV 2IU0A 1SRYA 2F43G 4RO2A 3WFVA 5GW7A 2W6IG 2EIMB 2UXXA 4CZZA 1RM1C 4WFGA 3B77A 2X6BA 2ZR2A 1E79G 4LP8A 1TUEB 3STZC 2Y48A 2QTOA 4RUEA 3SPGA 4UXNA 5H9CA 4WFAV 5L3CA 3CCMV 2QEXV 4GX0A 1BHAA 1RM1B 1I5YA 5KUMA 3JD2A 2XAQA 2HLDG 2WLHA 2JEXA 5LHHA 3M99B 4N21A 5EK0A 2JJ2G 4ASUG 4FIPC 5CMUA 3SYAA 2V7QG 4Q20A 1NKDA 1PNKA 3OMIB 1JJ2U 3AG4C 3P30A 3G4SV 2WWWA 4PDMA 4TWKA 4DO2A 1YHQV 3AG2C 1FXKC 2XNDG 4J9ZB 3W7UA 3QNEA 1K5QA 2DWEC 1AI4A 4R8CA 1DTOA 3K3WA 3OAAG 3AG4B 2WLIB 2A9HA 1XL6A 4TSFG 4TT3G 3AG2B 1FXKB 1YTFB 3E8FA 5L3GA 3ZJZA 1VQPV 2GHYA 1OHHG 4GX2A 1MG1A 3RVYA 2Q68A 4JTAB 3OFNG 1AJQA 5LHGA 2NLJC 2W6JG 2JJ1G 1MOFA 3F7VC 1R3IC 4G28B 1ROPA 4ZKIA 1V55C 3MHHC 3K08A 3JCZA 3G71V 3MHSC 2WLIA 4KP4A 5IYCO 2WAMA 4UUJC 5HFMA 4MVSA 1FXKA 5EBLC 3OM3B 1KC8W 2GSMB 3W7TA 1VQLV 1V55B 2WLMA 2HG5C 3ETGA 4PELA 1GM9A 2QE7G 3QO8A 3OW2U 3UM7A 3QO5A 1AJNA 4WF9V 3IC7A 4LBEC 5B1NA 5IYBO 2Z5UA 2DYSC 4QPJA 3ZIAG 1UJWB 4JYCA 3OR7C 3DTUB 4PDRA 3FB8C 5LGNA 3K03A 1JX9A 2WLJA 2X7RB 4X89A 5KA6A 2DYSB 4FK5C 4JPRA 2ZD9A 3CC4V 2HKOA 1W0KG 2A0LA 1H8HG 3K9AA 1JCHA 4LC1A 4P9OA 1M57C 3E8HA 2R9IA 3LDCA 4JTCB 4QJFB 1Q81W 4Z1MG 3JD1A 3CMEV 5J9PC 1F23A 2Y69C 2HVKC 4G2KA 3SYOA 1M57B 1YI2V 1Y66A 2ZR3A 5LGUA 1KD1W 2YEVB 1YJ9V 3ETDA 3E83A 2EIJC 1JPXA 1WLEA 3ZRVA 4WFFA 3CCEV 1VQ4V 1K4DC 5B1AC 4MSWC 3CC2V 2Y69B 3ABMC 1AR1B 4MTFA 1K97A 3OEEG 1GM8A 3VBBA 2EIJB 3K79A 4PA7A 2XAJA 4XBFA 5B1AB 1YJNV 4PDVA 2LFSA 3ABMB 3MD0A 4JAVA 3UKMA 2Q6AA 4QNHB 5IY5C 1OCOC 4DXWA 3I55V 2JEUA 3JD0A 4JTDB 4UV9A 3TETA 2X6CA 1AI5A 2NNUA 1P7BA 3ZMTA 5KUKA 1Y4MA 1K73W 1ORQC 4WCEV 3ZMUA 5IY5B 3EHBB 1OCOB 5L3EA 1S0VA 2ATKC 2FTKA 1KKDA 1QLNA 1BHBA 3SYQA 5EC2C 3NXSA 4RQFA 3H01A 3LNMB 5EC1C 2IJKA 3LDDA 1OZ0A 1DLBA 1GMGA 5L3BA 1VQNV 2XAGA 1B6QA 1OCCC 1QVGU 2AHYA 2JDIG 1CEZA 2PI5A 2P6JA 3E86A 5CN0A 2H8PC 3K0DA 1FS0G 4MW8A 3ZCCA 2WLLB 1R6NA 1OCCB 1JVMA 4PDLA 4E2LA 3OEHG 1E1RG 3JD4A 2B5UA 4N23A 5DN6G 3CCVV 1K4CC 1OCRC 3HB3B 4UVAA 3DGEA 3K04A 2ITDC 3OMNB 1V54C 3IFXA 4WFHA 4JGSA 3JD3A 2WLLA 4RUFA 1OCRB 3FYEB 3K0GA 1V54B 3RW0A 2XAHA 1AI6A 4PA4A 2QM8A 2IH3C 4MTOA 4MTXA 3ML0A 2LP7A 4RAIA 2QKSA 4PA6A 3E35A 2P67A 4LCUC 5L3DA 3ASNC 2DW4A 4HYOA 4BW5A 3ZMVA 2EZPA 3F7YC 1SESA 3VOUA 1NVPD 3CC7V 4U7NA 3W7WA 2EIKC 2BOBC 3TCUA 4BIUA 3ASNB 3ZMZA 1QBZA 1R3KC 2IJJA 4KFMA 3E89A 4R7CA 2IJIA 5IDJA 3B8NA 2B1GA 2EIKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DO2 A;  1B6Q A;  1GTO A;  1NKD A;  2IJH A;  3K79 A;  2IJJ A;  1RPO A;  1PD3 A;  1F4N A;  2IJI A;  2IJK A;  1F4M A;  2GHY A;  1RPR A;  1ROP A;  1GMG A; 
#chains in the Genus database with same CATH topology
 1QCE A;  4LFB B;  2YS8 A;  1MAB G;  5BXZ A;  1Q7Y W;  3BFR A;  5IYD O;  2Q69 A;  3P32 A;  4U7O A;  1XHX A;  5JJE B;  1SQG A;  1SZT A;  3D3I A;  3OR6 C;  4FFB A;  4DV7 O;  1PD3 A;  4PHZ A;  4CH6 A;  3PJS K;  3AK1 A;  3OE7 G;  1K33 A;  1XIL A;  3ABU A;  4GX1 A;  1Z5V A;  4DV4 B;  1NBM G;  1N32 B;  2QR4 A;  4UVC A;  1SQV H;  4O4L A;  1M5I A;  2XTA A;  3T1H O;  2UUB B;  1XHZ A;  3ZN1 A;  1EZV H;  5J2T B;  3TXS A;  1BZK A;  2N05 A;  3RGB A;  4GT1 A;  4LH6 A;  1I94 O;  2ZDI A;  5IWA B;  1H2S B;  1DK1 A;  1THZ A;  3RFR A;  2LW1 A;  1VQK V;  3GB7 C;  1S5H C;  4PI0 A;  4CH5 A;  1PNM A;  2R72 A;  1XL4 A;  3ABT A;  1IXB A;  2CAZ C;  3BA9 A;  4I0X A;  1AR5 A;  5CA1 A;  5LMN B;  4TQF A;  2YDE A;  4FPP A;  4DR2 B;  1MZE A;  4DV0 B;  3JAS A;  3LSS A;  1YSC A;  4X66 O;  3LDE A;  4G27 B;  5B5E Z;  3CXC U;  3W7X A;  4O2B A;  1WPX A;  4IYH A;  1VQ9 V;  2XT9 A;  5JQG B;  3BCC H;  1R73 A;  3RN4 A;  4BAY A;  4IIJ B;  1IXM A;  2H94 A;  4OGQ B;  5H6R A;  5JVD A;  1H8E G;  2ZIM A;  4DRX A;  1ZL8 A;  5GTI Z;  3UQ8 A;  1VIB A;  4I5S A;  2JK5 C;  3A2F A;  3B09 A;  3QO7 A;  4O2A B;  4MTG A;  1QR9 A;  2EIL B;  2ZIN A;  3A0R A;  1YIJ V;  1ENV A;  1OCZ B;  3U0Z A;  2ADQ B;  1OJH A;  4F4L A;  1R3J C;  2VS0 A;  3ETQ A;  4JYB A;  1K8A W;  1FAF A;  4FLX A;  2OTL V;  3BRC A;  1N34 B;  2RN9 A;  1DF4 A;  3X2Q B;  4JI8 B;  1DF5 A;  3ZMS A;  2A3Q A;  5KX5 A;  3FB6 C;  1VQ6 V;  3B8M A;  2XOK G;  5FNV B;  2ZIO A;  1KU9 A;  1M9N A;  1XMQ B;  3LUT B;  1O9H A;  1S77 D;  4DR7 B;  1XRE A;  1NI8 A;  1IVS A;  2DQ0 A;  4I9Q A;  1J5E B;  2KG7 A;  2AZ2 A;  4EB6 B;  1IBK B;  3CCQ V;  2CTR A;  4B3S B;  4B7E A;  1AJP A;  2HP8 A;  1TUB B;  4NTX A;  3J80 N;  2Q7E A;  3EFF K;  5B1O A;  1AI7 A;  2Z0A A;  3ABK B;  4CS3 A;  1LR1 A;  1Q6I A;  4X1K A;  4XDJ A;  1NZ6 A;  1KQS U;  2RJZ A;  1L0L H;  1QQC A;  2EIN C;  3T1C A;  1CPY A;  1X4T A;  4FFK A;  2YXL A;  3VQX A;  4O2B B;  2BTQ B;  4DV5 O;  3CCL V;  4DV2 B;  3IC9 A;  4JAU A;  1GO3 F;  2O57 A;  1U97 A;  1HNX B;  3JCU Z;  4D7T A;  1DGS A;  2WPD G;  2R9R B;  4JF3 A;  1MNG A;  2IU0 A;  1SRY A;  5JVD B;  1W59 A;  2F43 G;  4LF4 B;  1WJZ A;  4NTY A;  1PP9 H;  2EIM B;  4WFG A;  4JI5 O;  2UU9 O;  2UXB B;  3BHP A;  2Q0A A;  3STZ C;  2Q4P A;  5L3C A;  4UXN A;  4WFA V;  2PUS A;  3RYF A;  3APO A;  4B3T O;  1RM1 B;  3JD2 A;  2XAQ A;  4N21 A;  4DR1 B;  4FIP C;  5CMU A;  4DV3 O;  2V7Q G;  4Q20 A;  2YI8 A;  3OMI B;  4TV9 B;  4RWU A;  4DO2 A;  3U11 A;  4LF5 O;  3AG2 C;  1FXK C;  4I7Z B;  3QNE A;  1K5Q A;  1DTO A;  3K3W A;  4OPA A;  3OAA G;  3AG4 B;  2A9H A;  1XL6 A;  4CH3 A;  3F5T A;  5KX5 B;  5L3G A;  3ZJZ A;  1UPG A;  2Q68 A;  3LSU A;  4JI6 B;  1AJQ A;  2ZE7 A;  4H13 B;  4G28 B;  1R3I C;  1ROP A;  2OIG A;  4LR3 A;  2QWN B;  3MHH C;  1KKC A;  2DN9 A;  3JCZ A;  2WLI A;  4JI3 O;  4YY3 O;  2CE4 A;  1LUW A;  2WAM A;  1R1B A;  4UUJ C;  4AHC A;  2P4K A;  2VQF B;  3ETG A;  1RFY A;  1GM9 A;  2E76 B;  3HKB B;  5LMU B;  5KMG A;  1N0N A;  2QJ1 A;  1HNW B;  1HNZ O;  2Z5U A;  2DYS C;  3FAV B;  4LF7 O;  3OTO O;  3DTU B;  4ZOL B;  2X7R B;  5KA6 A;  1XNQ B;  4BW9 A;  3HR0 A;  2HKO A;  2A0L A;  4F6R B;  2BSK B;  3JAK A;  4P9O A;  4B3M O;  3ZED A;  3E8H A;  2OIE A;  3LDC A;  4QJF B;  4HNA A;  5EIB C;  1F23 A;  2Y69 C;  3SYO A;  1M57 B;  1Y66 A;  1JMK C;  2P22 C;  2GUZ A;  4AQY O;  3E83 A;  3CC2 V;  1K4D C;  4MSW C;  1VEW A;  5KLV H;  3AK3 A;  2Q5Z A;  3NR7 A;  2DOS A;  1GM8 A;  3K79 A;  2XAJ A;  5B1A B;  3O9O A;  4PDV A;  3RYF B;  3MD0 A;  4JAV A;  3RYI A;  3UKM A;  1JFF B;  4JTD B;  2X6C A;  2NNU A;  3L71 H;  1KB9 F;  1Y4M A;  1M93 A;  1K73 W;  4UCR A;  3ZMU A;  5C8Y B;  3B2E E;  3EHB B;  3A0H Z;  5H2F Z;  4DR6 O;  3RT3 C;  1P49 A;  4K0K B;  3H01 A;  5EC1 C;  1SZX A;  1B06 A;  1NT2 B;  2ODM A;  5L3B A;  1VQN V;  1XI1 A;  2AHY A;  2PI5 A;  1TAE A;  1VMG A;  4MW8 A;  3D3Q A;  3H1I H;  2E5L O;  4DK1 A;  2WLL B;  4GKK O;  1OCC B;  4I55 A;  1JVM A;  4PDL A;  1WA8 B;  4GKJ B;  4J11 A;  3K5M A;  4J7K A;  2CTW A;  4K35 A;  2ZCE A;  5DN6 G;  3CCV V;  5D5P A;  1OCR C;  2YIB A;  4UVA A;  3D8C A;  2K9P A;  3DGE A;  2P4V A;  1HW7 A;  1V54 C;  2F4V B;  5KMG B;  3K0G A;  2ZKO A;  5IYZ A;  4LF6 O;  4LFA O;  2QM8 A;  2IH3 C;  4JZ2 A;  4MTO A;  4MTX A;  3ML0 A;  3WU2 Z;  4K8Z A;  2P67 A;  5LXT B;  1KMI Z;  1RSO A;  2Y4T A;  3K5N A;  4YHH O;  3ZMV A;  2EZP A;  4I50 A;  5EZY A;  1SES A;  3VOU A;  3CC7 V;  4U7N A;  3W7W A;  2EIK C;  3TCU A;  1XMO O;  4X65 B;  2LO1 A;  2EX3 A;  1FFX A;  3ZMZ A;  3TGU H;  5LP6 C;  4PJ0 Z;  4KFM A;  3E89 A;  3FFQ A;  2IJI A;  5KAF Z;  2GUZ B;  1NJI W;  1LUV A;  1SET A;  2IBZ H;  4TUY A;  4QE9 A;  2WLN A;  4FZ0 A;  1JA8 A;  2F1M A;  1I5X A;  3KG2 A;  2A79 B;  4HAM A;  1W0J G;  1YJW V;  3CSX A;  4XDL A;  1IUR A;  1Q5O A;  2F23 A;  3RBZ A;  2FKX A;  2IM9 A;  3E8G A;  1HDJ A;  3HKD A;  2WSS G;  3ZHS A;  2IU3 A;  4I9W A;  4BIZ A;  1NR7 A;  4DR4 O;  2Q9L A;  1P7G A;  2PYJ A;  4HBN A;  5A9G A;  4B3R B;  1N33 O;  1QLE C;  1SER A;  4KL1 A;  4RQE A;  4LF8 B;  1PPJ H;  1WN7 A;  3A0B Z;  5LHI A;  1KBH A;  2UXC O;  4P2Z A;  5J2T A;  5BZB A;  2EJ7 A;  1U96 A;  4JI1 B;  1O9G A;  3CRR A;  3SJA C;  2XAF A;  3JAR A;  4PA9 A;  3ZRX A;  2UXD B;  1COW G;  4H37 A;  1F4N A;  4GUN A;  1AP5 A;  3I5D A;  5HFL A;  4JI0 O;  3AG3 C;  4FJC C;  3DC5 A;  3L70 H;  5CBG A;  1YEW A;  2FYU H;  5LBQ A;  1HWY A;  1PNL A;  4TV8 B;  1FYJ A;  3AEI A;  3CRC A;  1NR1 A;  4O4H B;  2LFR A;  5LOV A;  4FM2 A;  3BAA A;  3C3T A;  4H33 A;  4D6T H;  3HKE B;  3CCS V;  2QWP B;  2OCC C;  3STL C;  2ZXW C;  2AXT Z;  2DWD C;  2HVJ C;  4P30 A;  3JYC A;  1CP9 A;  1M56 C;  4Z2W A;  4QPK A;  4W4K A;  1K34 A;  1SF9 A;  4TUY B;  1NH2 D;  1FJG B;  3R65 A;  2JGD B;  4J10 A;  4O2A A;  4OXS A;  1XEQ A;  1AB3 A;  1QNM A;  1YIT V;  3QF7 A;  3ZRS A;  5BMV A;  2OCH A;  1Y76 B;  4KUM A;  3HKD B;  3K5L A;  3LSQ A;  5JWP A;  2HR3 A;  4UV8 A;  3KCX A;  4KXR A;  1AIL A;  1ZTE A;  5L3F A;  4KHP B;  2BOC C;  2EZO A;  1IBM O;  1PL0 A;  3CPW U;  5FNV A;  3T1Y O;  2AGA A;  2QM7 A;  4ICG A;  4NXN O;  3OGC C;  2OWO A;  1G4Y B;  3N2G A;  5EBW C;  1Y6X A;  2UUC O;  4LFC B;  4EB6 A;  3JAR B;  3E8B A;  1TVK B;  1S3J A;  4JI4 O;  5CBF A;  1BL8 A;  2ZQM A;  1TUB A;  3ASO C;  2C2A A;  1NVP B;  5DM6 V;  2EIN B;  2ZM6 B;  4UVB A;  3RYH A;  2CDY A;  1D2D A;  2W0F C;  4X64 O;  5J2U B;  4CC6 A;  5LOV B;  2ZNI A;  1ARO P;  5K1X A;  2CH7 B;  2YC0 A;  4LNU B;  4CC5 A;  4CS4 A;  3TK1 A;  3TXQ A;  3CCJ V;  1FPO A;  2BTQ A;  2W6I G;  4LFB O;  4CZZ A;  1VF6 C;  2Y4U A;  3B77 A;  2X6B A;  4B7K A;  1BSM A;  4LP8 A;  2F95 B;  5D5Q A;  2QTS A;  2CGO A;  3M8A A;  5JCO C;  4ASU G;  2JJ2 G;  2CTQ A;  1PNK A;  1JJ2 U;  4O4J A;  3G4S V;  1MA1 A;  2WWW A;  4PDM A;  4DV4 O;  1N32 O;  1SQP H;  4R8C A;  4IGG A;  4J7Z A;  2UUB O;  4TT3 G;  3AG2 B;  1FXK B;  2KKW A;  4YJ3 B;  1YTF B;  1VQP V;  5BMV B;  5ITZ A;  4TV9 A;  3OFN G;  5IWA O;  2W6J G;  2JJ1 G;  3SJB C;  1VF7 A;  5BR8 O;  4UCU A;  1V55 C;  3K08 A;  1WAZ A;  3MHS C;  5IYC O;  3CJH B;  4DUZ B;  1KC8 W;  5EBL C;  1WP8 A;  3OM3 B;  5LMN O;  1XUQ A;  2WLM A;  4DV0 O;  3QO8 A;  3OW2 U;  3QO5 A;  5B1N A;  4QPJ A;  3J7A U;  3N2G B;  4JYC A;  4NR1 A;  1WNS A;  4UCV A;  3KKY A;  4DUY B;  3KCY A;  1JX9 A;  3O65 A;  5KHJ A;  2DYS B;  4JPR A;  2E3C A;  2YIB D;  2ZD9 A;  3HKB A;  1H8H G;  1JCH A;  4LC1 A;  1YZB A;  2MW2 B;  1ZLZ A;  3RYH B;  1YDX A;  3FAV A;  3JAT A;  1URF A;  3JD1 A;  3CME V;  3Q4H A;  4ZOL A;  4G2K A;  5LGU A;  5CB4 B;  2HJD A;  1MMM A;  2HEP A;  3ETD A;  4IHJ B;  2EIJ C;  2XUM A;  2AW9 A;  2YIA A;  2Y69 B;  1AR1 B;  3QG5 A;  2PF4 E;  1PM9 A;  4F6R A;  2BSK A;  2NN4 A;  3CE2 A;  4LF9 B;  4NXM B;  5IY5 C;  5EYP B;  3UO3 A;  1N34 O;  4DXW A;  3I55 V;  2JEU A;  1A32 A;  4UV9 A;  3TET A;  4DW0 A;  3CWB H;  4JI8 O;  1Y67 A;  1ORQ C;  1GN3 A;  2ZT9 B;  4O4J B;  5L3E A;  4YY3 B;  3ZHT A;  4FVM A;  4DV6 B;  5EC2 C;  3NXS A;  1XMQ O;  5AG2 A;  4DR7 O;  2IJK A;  1JFF A;  1DLB A;  2XAG A;  1QVG U;  2JDI G;  1CEZ A;  5ITZ B;  2H8P C;  3K0D A;  5C8Y A;  1IBK O;  4JAA A;  3GWK C;  1N36 B;  4K8X A;  3CS5 A;  4E2L A;  3OEH G;  4EFB A;  4JYA B;  3UCS C;  1RP3 B;  3KZI Z;  3K04 A;  4ZHQ B;  1EM1 A;  3IFX A;  3VQY A;  4JI2 B;  3TJT A;  4JI7 B;  4JGS A;  4FLZ A;  3JD3 A;  2WLL A;  5F2V O;  1OCR B;  3WB0 A;  1WA8 A;  1V54 B;  2XAH A;  1KUQ A;  1AI6 A;  4NTW A;  4DV2 O;  1I08 A;  2DJV A;  2ZE8 A;  1ZUQ A;  2LP7 A;  1IDS A;  3E35 A;  1NS1 A;  5JH7 B;  3SJC C;  1HNX O;  3ASN C;  4HYO A;  4BW5 A;  3SGI A;  1NVP D;  4BIU A;  1XNR B;  1X59 A;  3JAT B;  3LNN A;  1R3K C;  3Q4H B;  1IZ3 A;  2P06 A;  1GRJ A;  3APQ A;  2VQE O;  2UXB O;  4NVP A;  2B1G A;  2EIK B;  3DC6 A;  2ADP A;  2YI9 A;  4CBC A;  4GYC B;  1KP2 A;  5LXT A;  2RMK B;  4JV5 B;  5LP6 B;  2QDO A;  4WFB V;  3FB7 C;  4DR1 O;  1GH6 A;  4MVZ A;  3D36 A;  4W4L A;  2JS5 A;  1EZJ A;  2ZDI C;  2X6A A;  1RPO A;  2YXH A;  2YXY A;  4MT8 A;  4XDK A;  3THO A;  1Q8I A;  3DXR B;  2N04 A;  1K92 A;  2E5L B;  2Z3Y A;  4NKG B;  4EKW A;  5EBM C;  1SQQ H;  1KP3 A;  2V1D A;  4X62 B;  3MDS A;  4J80 A;  4OX9 B;  1M90 W;  2HFE C;  4JI6 O;  2L6L A;  5IJ0 B;  5LYJ A;  2IW5 A;  3K9S A;  2QKA A;  1YTF D;  2IH1 C;  3GWO A;  1PKX A;  4UCO A;  1N0J A;  3SDL A;  2MK3 A;  1MSW D;  4NYK A;  1M1K W;  2CGN A;  3WG7 C;  1QLE B;  2M6Y A;  1QU7 A;  5B66 Z;  2VQF O;  1NTZ H;  2P7T C;  4DV1 B;  5FPO A;  3ABL C;  4A5U B;  4UB6 Z;  1K5S A;  3OUF A;  5LMU O;  1W2B U;  5DEC A;  1WB7 A;  4BWA A;  1HNW O;  4DR5 B;  4PD4 F;  2UUA B;  2P90 A;  3FB5 C;  2QA4 V;  1N4C A;  2KSD A;  3SYP A;  2V4D A;  3OD4 A;  1V9P A;  4X8A A;  1XNQ O;  1VQ8 V;  3IAY A;  4IL6 Z;  3ZRW B;  1LNQ A;  1K7D A;  4FM0 A;  3H1H H;  1US6 A;  3AG3 B;  2IJH A;  4I4T A;  1EBO A;  1SA0 B;  3AG1 C;  1VQ7 V;  2XAS A;  3JAL B;  1FD9 A;  1HR0 B;  5FPR A;  2OCC B;  4TV8 A;  4U3J B;  1VQ5 V;  4IYI A;  2ZXW B;  3P3N A;  3JAW B;  3FKS G;  4O4H A;  4MVR A;  1VF6 A;  1E1Q G;  1PV0 A;  3M7M X;  1ZWI C;  3HKE A;  1BCC H;  1M56 B;  3W7S A;  1GM7 A;  1YCI A;  2PZS A;  5B1B C;  1P4R A;  2ARH A;  4QIW F;  2D3O W;  2UXN A;  1Q90 D;  2QWO B;  2LJ2 A;  4TOI A;  1BMF G;  4H44 B;  1Z5W A;  1FXH A;  3C3S A;  3SYC A;  4K0K O;  5CA0 A;  4X88 A;  1YXB A;  5KAI Z;  4MVQ A;  1GN6 A;  3T2M A;  2VRZ A;  2QKC A;  1EFR G;  4QGP A;  3P3P A;  2JVD A;  4DR3 B;  2JGD A;  3K06 A;  1F4M A;  3OMA B;  1R6T A;  2HHH B;  5LYJ B;  2YSU B;  4GKJ O;  1GK9 A;  1Y76 A;  1K9M W;  5E1A C;  3G6B A;  4X20 B;  5B3S C;  1EN4 A;  3CD6 V;  2EUL A;  2A06 H;  4FLT A;  4F6E A;  2OT5 A;  2F4V O;  1VQO V;  4GCZ A;  4MVM A;  3SPH A;  1G8M A;  4Z1V A;  1R6K A;  1JOY A;  4MVU A;  1R3L C;  1KYO F;  2LQT A;  4ZI7 B;  2PY5 A;  1GKF A;  3L72 H;  5CBH A;  1IBL B;  3EXA A;  3SJQ C;  3T4D A;  4MS2 A;  2WA4 A;  5C93 A;  2R70 A;  3F5W C;  2DYR C;  1QVF U;  4P9P A;  1MZF A;  3BEH A;  3L9D A;  1H2K A;  2Q8V A;  3ASO B;  3BPZ A;  4X65 O;  4I4T B;  2KB1 A;  1TVK A;  4OPH A;  5FLX N;  3IGA C;  4RO2 A;  3WFV A;  5GW7 A;  2VWK A;  3K58 A;  2UXX A;  2ZR2 A;  2Y48 A;  2QTO A;  1D5N A;  3SPG A;  5J2U A;  5H9C A;  4GX0 A;  2WLH A;  2HLD G;  2JEX A;  2CH7 A;  5LHH A;  4LNU A;  3CEI A;  4DV7 B;  3R66 A;  5E79 Z;  3P30 A;  4J42 A;  4PV1 B;  4TWK A;  1YHQ V;  1Q43 A;  4FM1 A;  4GZR B;  5K1P A;  2DWE C;  4WBN B;  1AI4 A;  2GTS A;  3N27 A;  3G80 A;  1QHT A;  4TSF G;  3T1Y B;  3E8F A;  5CA0 B;  3T1H B;  4C7U A;  1OHH G;  2F93 B;  1VF5 B;  4GX2 A;  1MG1 A;  3RVY A;  4B3R O;  5KHK A;  1SKV A;  2NLJ C;  5KHG A;  4ZKI A;  1I94 B;  3HKC B;  4LF8 O;  4KP4 A;  3EVK A;  2DMX A;  5HFM A;  1FXK A;  4YJ3 A;  3CB2 A;  3W7T A;  1VQL V;  1V55 B;  2PGG A;  4JI1 O;  2QE7 G;  2UXD O;  2GBO A;  1AJN A;  3CRQ A;  3ZIA G;  1WB8 A;  4X66 B;  3ICX A;  3OR7 C;  3AK2 A;  2GTA A;  3CJH A;  5LGN A;  3K03 A;  2D2C B;  2WLJ A;  4X89 A;  4FK5 C;  1B3Q A;  5GON B;  3CC4 V;  2RDC A;  1H2L A;  3CX5 F;  3ZX6 A;  3K9A A;  4X1I B;  2R9I A;  1SC5 B;  4JTC B;  2RNB A;  1SQF A;  5J9P C;  3VQW A;  2HVK C;  2BE3 A;  3CHX A;  1WLE A;  3RYC B;  3CCE V;  1VQ4 V;  3ABM C;  4PI2 A;  3E22 A;  3VBB A;  2EIJ B;  1F7Y A;  2QWQ B;  1BE3 H;  3L75 H;  2LFS A;  4QNH B;  1FJG O;  2XHB A;  4X1Y A;  1OCO C;  5CB4 A;  1AI5 A;  3ZMT A;  1P7B A;  4IHJ A;  5BR8 B;  2E74 B;  2R9A A;  3H1K H;  3ZHU A;  4WCE V;  5IY5 B;  4YIP A;  1S0V A;  2FL4 A;  4FZ1 A;  3S3W A;  2A7W A;  1KKD A;  1QLN A;  1GN2 A;  3OT7 A;  4RQF A;  4TQD A;  3JAM N;  3LNM B;  5EYP A;  3FD9 A;  1OZ0 A;  1GMG A;  1B6Q A;  3E86 A;  5CN0 A;  4ZIB A;  3ZCC A;  4KHP O;  4O4I A;  2RCV A;  4UCS A;  3CRA A;  3A8T A;  2QGN A;  3JD4 A;  4J41 A;  4DYL A;  1K4C C;  4Q6G A;  1NTM H;  3BA8 A;  2W0X A;  2QWR B;  4UFZ A;  1EN6 A;  2ITD C;  3J81 N;  3RWR D;  4LFC O;  2Q0O C;  1HP8 A;  2WA3 A;  1I7F A;  3FYE B;  4FLU A;  1P84 F;  2G38 A;  2ZM6 O;  1Y74 B;  5KHH A;  4DV5 B;  4DR2 O;  3ZHQ A;  4ZHQ A;  4FLV A;  4AI8 A;  4LCU C;  3MAQ A;  1SS3 A;  1WPB A;  2ILM A;  2BOB C;  4FFB B;  3ASN B;  1GN4 A;  4LWS A;  3S3X A;  2PYL A;  3K59 A;  4JI5 B;  2PI4 A;  2UU9 B;  5JH7 A;  3HPL C;  4LH7 A;  1XQ8 A;  3E22 B;  4O4L B;  3CP1 A;  1NQT A;  4MW3 A;  3CMA V;  4B3T B;  2YUA A;  2BTO A;  4DV3 B;  4AIL C;  2FML A;  4X1Y B;  1N8R W;  4EFE A;  4HZ3 A;  4CS2 A;  4LF5 B;  2X0L A;  5LP6 A;  2HJF C;  1VQM V;  2BCC H;  4I0X B;  5CA1 B;  1BS3 A;  5IE9 A;  4IT5 A;  5LGT A;  3DXR A;  3JAS B;  4UCT A;  3ZN0 A;  4YXW G;  2LGQ A;  5CA3 A;  3SPI A;  4DUZ O;  4O4I B;  4JI3 B;  1Q82 W;  2ITC C;  3L74 H;  3GVM A;  1RPR A;  3G67 A;  1GAX A;  1FFT B;  2DQ3 A;  5IJ0 A;  1H2N A;  2EJR A;  3WG7 B;  2JGU A;  3ABL B;  3H9V A;  1K3E A;  5KA5 A;  4DUY O;  1J5E O;  1I0H A;  1QR8 A;  1HNZ B;  4LF7 B;  2CTP A;  3OTO B;  3CYO A;  4B3S O;  1JQ0 A;  2LW7 A;  3L73 H;  4DRX B;  1L8D A;  1ZL8 B;  3H1J H;  1S72 V;  2VQE B;  2RQ6 A;  1YVW A;  2YID A;  1Z2G A;  5KHI A;  2B1I A;  4QE7 A;  4D7S A;  1BT8 A;  1Q6U A;  3G6E V;  4L87 A;  2JIZ G;  2OTJ V;  4B3M B;  3I56 V;  1BQ0 A;  2EIL C;  2K1E A;  4JAS A;  1OCZ C;  2AZ0 A;  1FXV A;  1S76 D;  2YIC A;  5DED A;  3AG1 B;  3ZRW A;  4AQY B;  2QSA A;  4YIO A;  4LWS B;  2B9Z A;  3WB1 A;  3B40 A;  4LF9 O;  1SA0 A;  4PA3 A;  4NXM O;  3OUS A;  1KEC A;  1H2M A;  3X2Q C;  2EBO A;  3U10 A;  5LA6 A;  2Q7H A;  3H1L H;  3JAL A;  3T4Z A;  2Y0P A;  2GDS A;  4LF4 O;  4ZBM A;  4U3J A;  5IJ9 A;  3JAW A;  3ETE A;  1BQZ A;  3SPJ A;  4DV6 O;  2KG7 B;  1L1F A;  5B1B B;  4DR6 B;  5H6Q A;  2M7W A;  3CCR V;  2CUG A;  2Q67 A;  1GTO A;  3SPC A;  3BAB A;  3AG7 A;  4J9Y B;  4R50 A;  3RVZ A;  1S5J A;  3N2K A;  1PL4 A;  3FYI B;  1AR4 A;  4X1K B;  1J95 A;  1N36 O;  2ZNJ A;  4JYA O;  3ABK C;  4GKK B;  1H2G A;  1M4U A;  3CCU V;  1Q3E A;  3E2E A;  4GX5 A;  5IT9 N;  3SR2 C;  1AVM A;  4H0L B;  4JI2 O;  4FMT A;  2NR5 A;  4JI7 O;  1Q6H A;  1F51 A;  3BVO A;  5B3S B;  1H38 A;  2QM4 A;  3IJ4 A;  4E4E A;  4UB8 Z;  4CH4 A;  1NH2 B;  4WFE A;  2CK3 G;  4BIO A;  4X20 A;  3CXH F;  4LF6 B;  4LFA B;  4MVO A;  2ZE5 A;  1SQB H;  2JS3 A;  3BY6 A;  1Q86 W;  2DYR B;  4R6Z A;  5FL7 G;  1XNR O;  2AHZ A;  2EIM C;  4YHH B;  4ZI7 A;  2YEV A;  2WLK A;  3FX7 A;  4YJ2 A;  3ZHR A;  1B04 A;  1XMO B;  1RM1 C;  1TA8 A;  2Y0I A;  1E79 G;  4JV5 O;  1TUE B;  1JJO A;  3ZHV A;  4RUE A;  1BHA A;  3CCM V;  2QEX V;  1I5Y A;  1NTK H;  5KUM A;  1JR9 A;  3B4S A;  4GLX A;  3M99 B;  5EK0 A;  3SYA A;  1NKD A;  4J7J A;  3AG4 C;  5LA6 B;  1WP7 A;  1EN5 A;  4X9Q A;  2XND G;  1ZX3 A;  4J9Z B;  3W7U A;  1L0N H;  5IJ9 B;  2WLI B;  5GTH Z;  4X62 O;  1AP6 A;  4OX9 O;  3VQV A;  2GHY A;  3QTC A;  4K3A A;  4JTA B;  4DR4 B;  1VAR A;  4DK0 A;  2JRI A;  5JCO A;  5LHG A;  5EIB D;  4NB5 A;  1MOF A;  3F7V C;  1N33 B;  3OTF A;  3UT5 A;  5H5N A;  4WBN A;  3N2K B;  3G71 V;  3ZS8 C;  4ABM A;  4DV1 O;  4MVS A;  2GSM B;  2UXC B;  2HG5 C;  4DR5 O;  4PEL A;  3ZBH A;  2UUA O;  3UM7 A;  1XBL A;  3JAK B;  1OV9 A;  4WF9 V;  2L35 A;  3IC7 A;  4LBE C;  5IYB O;  1FKA O;  3C90 A;  3HKC A;  4HNA B;  1UJW B;  4PDR A;  3FB8 C;  2Q73 A;  5BY1 A;  4JI0 B;  1ZSP A;  1W0K G;  2KQX A;  2GV9 A;  1M57 C;  4JZG A;  4B08 A;  1Q81 W;  1G6U A;  4Z1M G;  2H3O A;  3RYI B;  4L8J A;  1HR0 O;  1YI2 V;  2ZR3 A;  1KD1 W;  2YEV B;  1NU1 H;  1YJ9 V;  1JPX A;  4YJ2 B;  3DSQ A;  3ZRV A;  4WFF A;  5B1A C;  5GON A;  1CXZ B;  1T5E A;  4MTF A;  4X1I A;  1K97 A;  4BR6 A;  5LL6 Y;  1G1X B;  3OEE G;  4U3F H;  1SQX H;  4PA7 A;  4XBF A;  1YJN V;  3ABM B;  2Q6A A;  2DE0 X;  2PTM A;  3JD0 A;  1UFI A;  5KUK A;  3RYC A;  4DW1 A;  2E75 B;  2N74 A;  5TIS Z;  1OCO B;  2ATK C;  2FTK A;  1BHB A;  3SYQ A;  4I55 B;  1TGO A;  3UO2 A;  4DR3 O;  3LDD A;  3K5O A;  1OCC C;  2P6J A;  2HHH O;  1S5L Z;  1FS0 G;  3OGI B;  1MSD A;  2FB5 A;  3WB2 A;  1IX9 A;  1R6N A;  2LGW A;  2Q7G A;  1VP7 A;  5JJN B;  4EEQ A;  3UT5 B;  1IBM B;  1XDC A;  1E1R G;  5IYZ B;  3QVN A;  2B5U A;  4N23 A;  3CRM A;  3HB3 B;  3PN1 A;  4JYY A;  3OMN B;  4NXN B;  1RSO B;  4WFH A;  1ZAU A;  4RUF A;  4I50 B;  5EZY B;  1IBL O;  2UUC B;  5JQG A;  3RW0 A;  1FFX B;  1YF2 A;  4JI4 B;  4PA4 A;  5A2Q N;  2OYQ A;  3JSN A;  3D36 C;  4RAI A;  2F66 C;  2QKS A;  4FLW A;  2ETN A;  4PA6 A;  4IIJ A;  1BGY H;  5L3D A;  2DW4 A;  4X64 B;  3F7Y C;  2P5O A;  1D5A A;  1XOU A;  3K57 A;  4FLY A;  3JSL A;  1QBZ A;  2ZE6 A;  5JJJ B;  2IJJ A;  4R7C A;  5IDJ A;  1Y74 A;  3B8N A;  2VWJ A; 
#chains in the Genus database with same CATH homology
 1QCE A;  4CBC A;  1NJI W;  1MAB G;  1KP2 A;  2PI4 A;  1SET A;  1Q7Y W;  5IYD O;  2Q69 A;  4WFB V;  3FB7 C;  3HPL C;  2WLN A;  3P32 A;  4QE9 A;  4U7O A;  3CP1 A;  1NQT A;  1I5X A;  3KG2 A;  4MVZ A;  2A79 B;  3D36 A;  1W0J G;  4HAM A;  4MW3 A;  1SZT A;  3CMA V;  3D3I A;  3OR6 C;  1YJW V;  1EZJ A;  2ZDI C;  2X6A A;  1RPO A;  1PD3 A;  4MT8 A;  3PJS K;  4XDK A;  4XDL A;  3OE7 G;  1K92 A;  1N8R W;  4HZ3 A;  1K33 A;  2Z3Y A;  3ABU A;  3RBZ A;  4GX1 A;  4EKW A;  5EBM C;  2X0L A;  1NBM G;  1KP3 A;  3E8G A;  4UVC A;  2HJF C;  2WSS G;  1VQM V;  2IU3 A;  4I9W A;  2V1D A;  4BIZ A;  1NR7 A;  3ZN1 A;  1M90 W;  2HFE C;  5LGT A;  4GT1 A;  2IW5 A;  1QLE C;  2ZDI A;  3ZN0 A;  4YXW G;  1THZ A;  1VQK V;  1YTF D;  5CA3 A;  2IH1 C;  3GB7 C;  3GWO A;  3SPI A;  1S5H C;  1SER A;  1PKX A;  1PNM A;  4RQE A;  3ABT A;  1XL4 A;  2MK3 A;  1MSW D;  1Q82 W;  3WG7 C;  1M1K W;  1QLE B;  5LHI A;  2ITC C;  2P7T C;  3ABL C;  1RPR A;  4P2Z A;  1K5S A;  3OUF A;  1FFT B;  2DQ3 A;  5BZB A;  1W2B U;  4FPP A;  2EJR A;  3WG7 B;  3LSS A;  2XAF A;  1YSC A;  4PA9 A;  3ZRX A;  3ABL B;  1COW G;  2P90 A;  1K3E A;  4H37 A;  3FB5 C;  1F4N A;  3LDE A;  4G27 B;  5KA5 A;  3CXC U;  2QA4 V;  3W7X A;  1QR8 A;  3SYP A;  5HFL A;  1WPX A;  1VQ9 V;  3CYO A;  4X8A A;  1JQ0 A;  3AG3 C;  4FJC C;  1VQ8 V;  1S72 V;  5CBG A;  5LBQ A;  1HWY A;  3ZRW B;  1LNQ A;  1K7D A;  1PNL A;  3AEI A;  1R73 A;  1NR1 A;  2LFR A;  2B1I A;  3AG3 B;  2IJH A;  4QE7 A;  3G6E V;  4BAY A;  4H33 A;  1EBO A;  2JIZ G;  4L87 A;  2OTJ V;  3CCS V;  1IXM A;  2H94 A;  3I56 V;  3AG1 C;  2OCC C;  5H6R A;  3STL C;  1H8E G;  1VQ7 V;  2ZXW C;  2XAS A;  2EIL C;  2K1E A;  4JAS A;  1OCZ C;  2DWD C;  1FXV A;  2HVJ C;  1S76 D;  4I5S A;  2JK5 C;  3QO7 A;  3AG1 B;  2OCC B;  3JYC A;  4P30 A;  3ZRW A;  1VQ5 V;  4MTG A;  2ZXW B;  1QR9 A;  1CP9 A;  1M56 C;  3FKS G;  2EIL B;  3A0R A;  1YIJ V;  4MVR A;  1ENV A;  1E1Q G;  1OCZ B;  4QPK A;  1ZWI C;  1K34 A;  4PA3 A;  3OUS A;  1KEC A;  1M56 B;  3X2Q C;  1GM7 A;  3W7S A;  4F4L A;  1R3J C;  2EBO A;  4JYB A;  1K8A W;  3T4Z A;  1NH2 D;  2OTL V;  5B1B C;  3R65 A;  1P4R A;  1DF4 A;  4ZBM A;  4QIW F;  4OXS A;  3X2Q B;  2D3O W;  2UXN A;  3ETE A;  1YIT V;  3SPJ A;  1DF5 A;  1L1F A;  1BMF G;  3ZMS A;  5B1B B;  1FXH A;  3SYC A;  5H6Q A;  3FB6 C;  4X88 A;  2M7W A;  3ZRS A;  3CCR V;  3B8M A;  1VQ6 V;  4MVQ A;  2XOK G;  4KUM A;  2Q67 A;  1GTO A;  3SPC A;  3T2M A;  1M9N A;  1EFR G;  3LSQ A;  3LUT B;  4J9Y B;  4R50 A;  1S77 D;  3RVZ A;  2HR3 A;  3K06 A;  4UV8 A;  1F4M A;  3FYI B;  2DQ0 A;  1J95 A;  3OMA B;  5L3F A;  3CCQ V;  2YSU B;  2BOC C;  2EZO A;  1AJP A;  1PL0 A;  1GK9 A;  3ABK C;  3CPW U;  1H2G A;  1K9M W;  3CCU V;  5E1A C;  3E2E A;  5B3S C;  4GX5 A;  2QM7 A;  3EFF K;  3CD6 V;  5B1O A;  1AI7 A;  3OGC C;  3ABK B;  2OT5 A;  4FMT A;  1G4Y B;  1VQO V;  4GCZ A;  4MVM A;  1F51 A;  5EBW C;  4XDJ A;  3SPH A;  1G8M A;  5B3S B;  1R6K A;  1H38 A;  1JOY A;  1KQS U;  4MVU A;  1R3L C;  3T1C A;  2EIN C;  1CPY A;  3E8B A;  1S3J A;  5CBF A;  1GKF A;  5CBH A;  1BL8 A;  2ZQM A;  3SJQ C;  3ASO C;  2C2A A;  3T4D A;  4WFE A;  4MS2 A;  2CK3 G;  1NVP B;  1NH2 B;  5C93 A;  3F5W C;  2DYR C;  1QVF U;  4P9P A;  5DM6 V;  2EIN B;  3CCL V;  4UVB A;  3BEH A;  4MVO A;  4JAU A;  2W0F C;  1GO3 F;  3ASO B;  3BY6 A;  1Q86 W;  2DYR B;  4R6Z A;  5FL7 G;  2AHZ A;  2EIM C;  1ARO P;  2KB1 A;  2WPD G;  2R9R B;  4JF3 A;  2YEV A;  2WLK A;  3TK1 A;  3IGA C;  3CCJ V;  2IU0 A;  1SRY A;  2F43 G;  4RO2 A;  3WFV A;  5GW7 A;  2W6I G;  2EIM B;  2UXX A;  4CZZ A;  1RM1 C;  4WFG A;  3B77 A;  2X6B A;  2ZR2 A;  1E79 G;  4LP8 A;  1TUE B;  3STZ C;  2Y48 A;  2QTO A;  4RUE A;  3SPG A;  4UXN A;  5H9C A;  4WFA V;  5L3C A;  3CCM V;  2QEX V;  4GX0 A;  1BHA A;  1RM1 B;  1I5Y A;  5KUM A;  3JD2 A;  2XAQ A;  2HLD G;  2WLH A;  2JEX A;  5LHH A;  3M99 B;  4N21 A;  5EK0 A;  2JJ2 G;  4ASU G;  4FIP C;  5CMU A;  3SYA A;  2V7Q G;  4Q20 A;  1NKD A;  1PNK A;  3OMI B;  1JJ2 U;  3AG4 C;  3P30 A;  3G4S V;  2WWW A;  4PDM A;  4TWK A;  4DO2 A;  1YHQ V;  3AG2 C;  1FXK C;  2XND G;  4J9Z B;  3W7U A;  3QNE A;  1K5Q A;  2DWE C;  1AI4 A;  4R8C A;  1DTO A;  3K3W A;  3OAA G;  3AG4 B;  2WLI B;  2A9H A;  1XL6 A;  4TSF G;  4TT3 G;  3AG2 B;  1FXK B;  1YTF B;  3E8F A;  5L3G A;  3ZJZ A;  1VQP V;  2GHY A;  1OHH G;  4GX2 A;  1MG1 A;  3RVY A;  2Q68 A;  4JTA B;  3OFN G;  1AJQ A;  5LHG A;  2NLJ C;  2W6J G;  2JJ1 G;  1MOF A;  3F7V C;  1R3I C;  4G28 B;  1ROP A;  4ZKI A;  1V55 C;  3MHH C;  3K08 A;  3JCZ A;  3G71 V;  3MHS C;  2WLI A;  4KP4 A;  5IYC O;  2WAM A;  4UUJ C;  5HFM A;  4MVS A;  1FXK A;  5EBL C;  3OM3 B;  1KC8 W;  2GSM B;  3W7T A;  1VQL V;  1V55 B;  2WLM A;  2HG5 C;  3ETG A;  4PEL A;  1GM9 A;  2QE7 G;  3QO8 A;  3OW2 U;  3UM7 A;  3QO5 A;  1AJN A;  4WF9 V;  3IC7 A;  4LBE C;  5B1N A;  5IYB O;  2Z5U A;  2DYS C;  4QPJ A;  3ZIA G;  1UJW B;  4JYC A;  3OR7 C;  3DTU B;  4PDR A;  3FB8 C;  5LGN A;  3K03 A;  1JX9 A;  2WLJ A;  2X7R B;  4X89 A;  5KA6 A;  2DYS B;  4FK5 C;  4JPR A;  2ZD9 A;  3CC4 V;  2HKO A;  1W0K G;  2A0L A;  1H8H G;  3K9A A;  1JCH A;  4LC1 A;  4P9O A;  1M57 C;  3E8H A;  2R9I A;  3LDC A;  4JTC B;  4QJF B;  1Q81 W;  4Z1M G;  3JD1 A;  3CME V;  5J9P C;  1F23 A;  2Y69 C;  2HVK C;  4G2K A;  3SYO A;  1M57 B;  1YI2 V;  1Y66 A;  2ZR3 A;  5LGU A;  1KD1 W;  2YEV B;  1YJ9 V;  3ETD A;  3E83 A;  2EIJ C;  1JPX A;  1WLE A;  3ZRV A;  4WFF A;  3CCE V;  1VQ4 V;  1K4D C;  5B1A C;  4MSW C;  3CC2 V;  2Y69 B;  3ABM C;  1AR1 B;  4MTF A;  1K97 A;  3OEE G;  1GM8 A;  3VBB A;  2EIJ B;  3K79 A;  4PA7 A;  2XAJ A;  4XBF A;  5B1A B;  1YJN V;  4PDV A;  2LFS A;  3ABM B;  3MD0 A;  4JAV A;  3UKM A;  2Q6A A;  4QNH B;  5IY5 C;  1OCO C;  4DXW A;  3I55 V;  2JEU A;  3JD0 A;  4JTD B;  4UV9 A;  3TET A;  2X6C A;  1AI5 A;  2NNU A;  1P7B A;  3ZMT A;  5KUK A;  1Y4M A;  1K73 W;  1ORQ C;  4WCE V;  3ZMU A;  5IY5 B;  3EHB B;  1OCO B;  5L3E A;  1S0V A;  2ATK C;  2FTK A;  1KKD A;  1QLN A;  1BHB A;  3SYQ A;  5EC2 C;  3NXS A;  4RQF A;  3H01 A;  3LNM B;  5EC1 C;  2IJK A;  3LDD A;  1OZ0 A;  1DLB A;  1GMG A;  5L3B A;  1VQN V;  2XAG A;  1B6Q A;  1OCC C;  1QVG U;  2AHY A;  2JDI G;  1CEZ A;  2PI5 A;  2P6J A;  3E86 A;  5CN0 A;  2H8P C;  3K0D A;  1FS0 G;  4MW8 A;  3ZCC A;  2WLL B;  1R6N A;  1OCC B;  1JVM A;  4PDL A;  4E2L A;  3OEH G;  1E1R G;  3JD4 A;  2B5U A;  4N23 A;  5DN6 G;  3CCV V;  1K4C C;  1OCR C;  3HB3 B;  4UVA A;  3DGE A;  3K04 A;  2ITD C;  3OMN B;  1V54 C;  3IFX A;  4WFH A;  4JGS A;  3JD3 A;  2WLL A;  4RUF A;  1OCR B;  3FYE B;  3K0G A;  1V54 B;  3RW0 A;  2XAH A;  1AI6 A;  4PA4 A;  2QM8 A;  2IH3 C;  4MTO A;  4MTX A;  3ML0 A;  2LP7 A;  4RAI A;  2QKS A;  4PA6 A;  3E35 A;  2P67 A;  4LCU C;  5L3D A;  3ASN C;  2DW4 A;  4HYO A;  4BW5 A;  3ZMV A;  2EZP A;  3F7Y C;  1SES A;  3VOU A;  1NVP D;  3CC7 V;  4U7N A;  3W7W A;  2EIK C;  2BOB C;  3TCU A;  4BIU A;  3ASN B;  3ZMZ A;  1QBZ A;  1R3K C;  2IJJ A;  4KFM A;  3E89 A;  4R7C A;  2IJI A;  5IDJ A;  3B8N A;  2B1G A;  2EIK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...