1F4MA

P3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
56
structure length
56
Chain Sequence
GTKQEKTILNMARFIRSQALTILEKANELDADEIADIAESIHDHADEIYRSALARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dramatic structural and thermodynamic consequences of repacking a protein's hydrophobic core.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords ROP ALA2ILE2-6
total genus 25
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1f4mA00
2IJHA 1RPOA 2IJIA 1GTOA 1ROPA 1GMGA 1RPRA 3K79A 1F4NA 2GHYA 2IJKA 4DO2A 1PD3A 2IJJA 1B6QA 1F4MA 1NKDA
chains in the Genus database with same CATH superfamily
4JI4B 2WAMA 3QVNA 1JOYA 4MVQA 5LXTB 3RBZA 4MT8A 1UPGA 1N0JA 1YDXA 4WFAV 1G4YB 1KP2A 1N0NA 4JI4O 1IBKB 2QSAA 2GTSA 4I7ZB 4UVBA 3CCSV 2OTLV 2K9PA 4LF6B 5FNVB 1TUBB 1LNQA 5LYJB 4X9QA 3KCYA 4QPKA 5K1PA 1XNQO 1YJWV 4KL1A 5ITZB 3ZRXA 4YHHO 4MSWC 2C2AA 1SQXH 3RYCA 5JVDA 3FFQA 4DV6O 2XT9A 2QM4A 2ZINA 5IY5C 1H2KA 2Y0PA 1VQNV 1FXVA 1GN2A 3CCEV 5B1NA 2Q6AA 2EIJB 1Q7YW 3L9DA 3SPIA 2P4KA 2GSMB 2E3CA 4FLWA 3IC7A 1B6QA 4HNAB 4X8AA 3ABTA 2BSKB 4I50B 4O2AB 2VS0A 5EYPB 2YC0A 1D2DA 3SJBC 5KHHA 2OCCC 5GW7A 2JRIA 3C3TA 1VF5B 4TV8B 1SERA 4U7NA 4YXWG 4X20A 2UUBO 4RAIA 2F23A 5CBHA 4G2KA 4RUFA 5EIBD 1KECA 2Z5UA 2DOSA 1QU7A 1OV9A 4EB6A 5KMGB 1JA8A 4PHZA 3RYFB 3TXQA 1OCZB 1XDCA 1PL0A 5LGTA 3D3QA 4JI8O 4J9ZB 5LHHA 3ICXA 3HKCB 4X64B 3SYCA 3FYIB 5KA5A 3K59A 5B1AB 2LFRA 1PL4A 3RT3C 3VQVA 3JAMN 4LF5O 4TOIA 3H1KH 3AG1B 2E74B 3F7YC 4X64O 2ETNA 4MVSA 3OMAB 2UUCO 1O9HA 2F4VO 3BHPA 1AI4A 3TGUH 1VMGA 2PYJA 4QE7A 4DO2A 4WCEV 4UV9A 3JD1A 3AG2C 2CTPA 1JJ2U 4TWKA 2E76B 2V7QG 4KHPB 1MNGA 3AK1A 3JD2A 5FPRA 2NLJC 1GH6A 4LR3A 3L73H 3JASA 2QWPB 4PI0A 3FB7C 2UXCB 2CK3G 4H13B 4UCSA 5FLXN 3S3WA 4IHJB 1XNQB 2XAGA 3BABA 2Q7GA 5F2VO 1BCCH 1VF6A 4AHCA 2CH7B 1Z5VA 4BWAA 4AQYO 1BE3H 4RQEA 1FXHA 4D7TA 5GTHZ 3JD0A 1ZUQA 1M90W 2IH1C 4LNUA 4DR5B 4PD4F 4CC6A 4J7JA 4DUZO 3ZRVA 4ZOLA 4GT1A 3GWKC 3T1HB 2QDOA 1HR0O 4XDJA 5BMVB 1KQSU 2ITDC 4GKJO 3SPHA 1XL6A 3M8AA 3HKCA 4LFCB 1EBOA 1JCHA 1I5XA 3CMAV 3FD9A 4X1IB 2QM8A 4O4IA 5J9PC 2DYRB 3T1HO 1FXKA 1US6A 4ZHQA 2X7RB 2E75B 1YZBA 2FYUH 1HNZB 4DR4B 2JIZG 4DV4O 1QCEA 3QF7A 5BXZA 4DR1O 2RQ6A 2AW9A 4X88A 3JD3A 5C93A 3AG3B 3JARA 4FFKA 3CRMA 3NR7A 3MD0A 4JGSA 3ZHQA 2WA3A 2NNUA 2A9HA 2VWJA 1QBZA 4YIOA 3B8NA 1V54C 1YSCA 2HJFC 4DV3O 4QPJA 1AI7A 5FPOA 4FK5C 4CBCA 2Y4TA 1EN6A 3E22A 1ZTEA 2VWKA 4MTFA 1J5EO 1H2LA 3K79A 5CB4B 3T1CA 1LR1A 4FFBB 2DYSB 1XBLA 4CC5A 2HVJC 1JX9A 2QM7A 1SETA 4GCZA 3FB8C 5IWAB 4JYBA 1JQ0A 3CC4V 1BSMA 1JJOA 5CN0A 3KCXA 1NH2D 2UU9B 1TUEB 1S0VA 3FAVA 2ZM6B 4RUEA 2JDIG 1PM9A 2PTMA 4R6ZA 3N2GA 1DF5A 4QGPA 1X59A 3ZEDA 3CX5F 4JI7B 4R7CA 2HLDG 2WLKA 3CYOA 4LF9O 1I94O 1AP6A 2IM9A 4DV1O 1K4CC 1WP7A 1XILA 3N2KB 4JZGA 4EFEA 4P9OA 4DR3O 4JI2O 4JI5O 4MTOA 1KMIZ 5L3FA 1M56B 4P2ZA 4TV9B 5IJ0B 2GUZB 4W4LA 4BIUA 2LGQA 3D3IA 2E5LB 4J7ZA 2HJDA 4DR3B 3A8TA 1GM8A 3CS5A 2UXBB 2NR5A 3CCVV 3B4SA 2RMKB 3JYCA 3ETQA 4P30A 4DYLA 3I55V 5JQGA 1F4MA 1KKDA 1Y6XA 5DEDA 1RP3B 1IBMB 2BTOA 4WF9V 1YTFB 1ZWIC 4DW1A 3QG5A 2DYSC 3RN4A 2MW2B 1Q6HA 4LF4B 1UJWB 3H1HH 4RQFA 3DC5A 3AG4C 3B2EE 1XMOO 2F4VB 3DXRB 5H6RA 2QWOB 1XQ8A 2QJ1A 3T2MA 2OCCB 1FFTB 3QO8A 4KUMA 3LNMB 1KYOF 5B1OA 4NKGB 3LDEA 1L0NH 1QR9A 4MVMA 3E8BA 2O57A 5B1BC 1VEWA 2EIKB 2F95B 2BSKA 2ZE7A 3HKBA 2CDYA 2YXYA 3CJHB 2QTSA 4J9YB 3QO7A 3U10A 3IJ4A 2UU9O 1IXBA 2QWRB 2KG7B 1M5IA 4IYIA 4MW8A 4JZ2A 2FL4A 2KKWA 4YJ2B 3K0DA 4OPAA 2EBOA 1I5YA 2L6LA 2QR4A 1M9NA 1E79G 4ZI7A 3JAWA 2WWWA 4LH7A 1EN4A 3AG1C 1EFRG 3LSQA 4HZ3A 4A5UB 4F6RB 4DR5O 4HAMA 2PZSA 5KX5A 5JH7B 5J2UB 1GAXA 4OX9B 2YEVA 4U3JA 2LGWA 1NH2B 3H01A 1NTMH 1GM7A 4TT3G 3JCUZ 4J42A 1S72V 4PDVA 2EIMB 2P6JA 3AG2B 3HR0A 1XUQA 1R3KC 4GX2A 3CP1A 1WA8B 5B66Z 3A0RA 2PI5A 3BRCA 1SQGA 4O4JA 1FAFA 3B40A 2QKAA 1EZJA 3CB2A 1H8EG 4BIZA 3MHSC 4GKKO 2ZDIC 3ZRWA 1P49A 3K5MA 1H38A 3RWRD 3UO3A 2GTAA 4X1KA 4UUJC 2RDCA 5J2TA 4MVOA 1QNMA 3ASNC 2BOBC 5B1BB 3E22B 3SR2C 4LF7B 1MZFA 3CXCU 3ABKB 4FZ1A 2UUAB 1HNWB 4PA6A 2YIDA 2HFEC 4WBNB 1JFFB 2YUAA 4BW5A 3OM3B 2LQTA 4JTAB 1OCCC 3JAKA 3JALB 5IYCO 4J11A 1NI8A 4DW0A 3OAAG 4UCVA 1JR9A 1N36B 2VRZA 2ILMA 2JEUA 3CHXA 4R8CA 3RYHA 3VOUA 2OCHA 2DN9A 5BY1A 2Q69A 3AG3C 2FTKA 4DV2B 5J2UA 4X1IA 3BCCH 1TAEA 1H2SB 3K9AA 2CTQA 3C3SA 4U3JB 5JCOC 3O9OA 1DK1A 4ICGA 2VQEO 5IYDO 4DV5B 2LP7A 1SQPH 3ZHTA 4CZZA 5IJ9B 4PA9A 4ZOLB 3APQA 3GWOA 2XTAA 3K0GA 4PELA 1ZX3A 2P90A 2LFSA 3ZN1A 2YIBD 3CRQA 3CJHA 1HNXB 1D5NA 1QVFU 2KG7A 1J95A 3H1JH 1M57B 1IBLB 3F5TA 2CUGA 2R70A 2YDEA 2D2CB 3DSQA 5EZYB 3G4SV 2HP8A 2BE3A 4TV9A 1FPOA 3BEHA 1MABG 2RNBA 1AR5A 1AROP 1K3EA 1RM1B 1HNXO 1HDJA 4LWSB 1XHXA 4W4KA 3VBBA 3SPGA 2YS8A 3ABUA 1K8AW 3H1LH 3SDLA 4NXNB 1L8DA 4O4IB 1FFXB 1R6NA 4UCUA 5EBLC 4DV6B 1QHTA 2HHHO 1R6KA 3E2EA 1BL8A 3G80A 2Q8VA 2ADQB 1PP9H 2B5UA 1DLBA 1XMOB 4IL6Z 3ZMUA 1U97A 1H2MA 3KKYA 1SF9A 2HHHB 4NVPA 4JYAB 4GKJB 2WSSG 4OXSA 1K92A 3K5NA 1N36O 3CD6V 3BA9A 5DN6G 1U96A 5KLVH 1VQKV 1AI6A 3U11A 3DC6A 3CC7V 1HWYA 4UV8A 3EHBB 1Z5WA 2A3QA 1K7DA 1SQVH 4LF8B 2YI9A 5IJ0A 3RYIB 3OR7C 3OE7G 2EIJC 4X1KB 3UT5A 5IE9A 3QNEA 1IVSA 1KBHA 4CS2A 5L3DA 1P84F 2X0LA 4X20B 5LMNO 1RSOB 3ETGA 2CTRA 2V1DA 3ASOC 2JJ2G 1G6UA 4DV3B 1XHZA 3N2GB 1COWG 4GX1A 1CPYA 1VQMV 1NT2B 3TCUA 3K9SA 5DECA 1M57C 2B1GA 1GRJA 1WA8A 4OX9O 5LGUA 4LFAB 5LL6Y 2G38A 4WFHA 4GX0A 2IU3A 5LMUB 5H2FZ 2WLIB 1EZVH 1L1FA 1R3LC 2PF4E 1CP9A 1RM1C 3OD4A 1XMQB 3OUFA 4DR2B 3G71V 1MSDA 1NR7A 3T1YB 2L35A 3HKEA 2Y48A 4Z2WA 1TUBA 2H8PC 1VIBA 3CRRA 3UCSC 5CB4A 4KP4A 1O9GA 1WB8A 1YXBA 1BS3A 3T1YO 2UXNA 3STZC 1AR4A 4TUYB 2EJ7A 4JAAA 3K57A 2QKSA 1AP5A 1AJQA 1NU1H 4I0XA 3H1IH 3G67A 4XDLA 1F4NA 3G6BA 2GDSA 2YSUB 4PDMA 4O2AA 5EYPA 4B08A 2QGNA 3ZMVA 4AQYB 1NBMG 3JALA 1Y4MA 1QLEB 1Y76A 3OGIB 4DV0B 2ZXWC 3B8MA 3ML0A 4TSFG 4FVMA 2JJ1G 2JVDA 4WBNA 4FJCC 1SC5B 3OT7A 1BQ0A 1JPXA 3OMNB 1MOFA 3K3WA 4MVUA 1ZSPA 1VQOV 1P7GA 1OHHG 2KQXA 4DR4O 1BQZA 2ZNIA 2WA4A 4NB5A 4X62O 2F1MA 2Y4UA 4J41A 3ABMB 1B06A 4E4EA 1ZL8B 3WB2A 3BY6A 5IYBO 4N23A 1YJ9V 4F6EA 4WFBV 1FJGO 3UKMA 1Q6UA 2B1IA 4FPPA 5LXTA 3UQ8A 2OIGA 3FKSG 1GTOA 4OPHA 2WLLB 2AGAA 1MMMA 2P5OA 3RYFA 2YI8A 5GONA 2A0LA 1OCRB 1QVGU 4LFBB 4H44B 4IHJA 2W6IG 2YEVB 5IWAO 1D5AA 2R9AA 2ODMA 4FIPC 3UT5B 3CCMV 3E8FA 1R3JC 1S5LZ 5A9GA 1W2BU 4O2BA 4JI3B 4NXNO 5LGNA 1OJHA 4YJ2A 5IY5B 2QWQB 1I08A 2ZXWB 3OTOO 5EIBC 4XDKA 4JI7O 3ZN0A 3I5DA 2LW1A 3W7UA 4ASUG 1F7YA 2ZR2A 5IDJA 4IGGA 3OR6C 4CH3A 3ZHVA 1W59A 1N34O 2N05A 4JYAO 4Z1VA 1L0LH 3KG2A 4JI0O 4DR6O 3CCJV 3CPWU 1TVKA 5FNVA 1VF7A 1SQFA 5FL7G 3OUSA 2JGDA 2V4DA 3ZMSA 2DJVA 4F4LA 2XOKG 2UXBO 2IJIA 3CSXA 4B3TO 4YY3B 4JI8B 4LFCO 2X6AA 5AG2A 4I55B 2R72A 4UB6Z 4LBEC 1QQCA 5LHGA 3RYHB 5LMNB 4ZBMA 5CA3A 3PJSK 1K5QA 4DV4B 3A2FA 4B3SB 3M7MX 3AG7A 3RGBA 1Q86W 3SJAC 2Y69C 3FB6C 3E86A 3SJCC 2UUCB 2RN9A 5HFMA 4X1YA 3RYCB 2ZQMA 5EC1C 2XAFA 2ZE8A 2ZIOA 4MTXA 2ARHA 4C7UA 4K0KB 1I7FA 3S3XA 4UVAA 4O4LB 1Y66A 1S77D 3L72H 3CC2V 1AJPA 1IURA 5J2TB 5IYZB 3LSSA 5KUKA 3JD4A 2H3OA 4IIJB 3HKEB 2IJKA 1NQTA 2F66C 3KZIZ 4B7EA 2JEXA 4JV5B 3H9VA 1VQ7V 3CCLV 3J80N 3CE2A 3ZJZA 1MZEA 1DTOA 5EBWC 2AHYA 3SYPA 5K1XA 5LOVB 3ASOB 1FD9A 2QWNB 2LJ2A 2ZT9B 3VQYA 2GHYA 1YCIA 4DR7O 1FFXA 1KP3A 3J7AU 3B09A 4IIJA 5IYZA 1SRYA 4DK0A 1N34B 4LWSA 1THZA 2P06A 2W6JG 2W0FC 4B3MB 3BFRA 2PUSA 4LH6A 1T5EA 1I94B 1R6TA 4EKWA 1S5HC 3JAWB 3OEEG 3WFVA 4GLXA 1WAZA 1UFIA 2WLHA 2LW7A 4K35A 2N04A 1PNLA 1NVPB 2NN4A 1QR8A 4U7OA 4NTYA 5KA6A 3D36C 5EBMC 2K1EA 3FB5C 5IT9N 1WNSA 1YF2A 4JAUA 4LP8A 3JATA 4PV1B 3K5OA 4Z1MG 2ZE5A 3DTUB 2Z0AA 2DQ3A 4JPRA 4RO2A 3RFRA 1GO3F 1FJGB 2UXXA 3IGAC 2ZKOA 1X4TA 4KXRA 5L3EA 4JTDB 2JGDB 3GB7C 4CH6A 1AB3A 4R50A 2Q0AA 1TVKB 3JATB 2XUMA 3DGEA 4JI1O 2N74A 3K04A 3HB3B 1N4CA 1QLNA 4ZI7B 1M1KW 2EILC 4I4TA 3L71H 1NS1A 1PNMA 1KC8W 5LA6B 1S5JA 5JQGB 3GVMA 1VQ5V 1SA0B 5A2QN 1LUVA 5LP6C 3SYOA 4DV2O 2P7TC 4JI3O 3ZIAG 2RJZA 3O65A 1N33O 4TQDA 4J7KA 4JTCB 2YXLA 3CRAA 1RPRA 2ZDIA 2EZOA 4CH5A 1OCCB 3JASB 4LCUC 2B9ZA 2LO1A 3T4ZA 4DUYB 3DXRA 1WJZA 4YJ3A 1FXKC 1VQ6V 1K34A 1EN5A 1E1QG 5L3CA 1ROPA 5GONB 3TK1A 2WLNA 3K08A 4O4JB 1XMQO 1OCRC 1RPOA 2WLLA 4FLTA 1V55C 3K06A 1HW7A 1W0KG 4FLZA 2AHZA 3FAVB 3OTFA 4GYCB 1TA8A 3JSLA 1NTZH 3LUTB 4BAYA 1M4UA 3VQXA 2Q67A 1XL4A 4QNHB 1Q6IA 2UXDO 3W7TA 4I5SA 4MW3A 1B04A 1IBLO 3RVYA 3UO2A 4YHHB 1XI1A 4KHPO 3APOA 2EZPA 1G8MA 4WFGA 4F6RA 1RFYA 4X66O 5L3BA 1K4DC 1XOUA 2PI4A 5JCOA 2UXDB 3E89A 1CEZA 4HYOA 2HR3A 4ZKIA 5KMGA 4ZIBA 4X89A 1R3IC 1FS0G 2OWOA 4E2LA 2VQFB 3ZBHA 5LA6A 4DRXB 3MAQA 1NZ6A 2PY5A 3AEIA 1IDSA 1BZKA 4I4TB 4I9WA 2IW5A 3D8CA 3MHHC 3TJTA 1WB7A 1FYJA 3HKBB 4PA4A 4UCRA 1GKFA 1GN3A 5C8YB 1AVMA 3EXAA 2BOCC 3ZS8C 4B7KA 5KHIA 4FLXA 1AJNA 2OYQA 1GN6A 4LF8O 3F7VC 1KUQA 4I55A 4X65B 1YIJV 2JK5C 1N33B 1PNKA 2DYRC 1VQ9V 3BAAA 1Y74B 1KU9A 2AXTZ 2A06H 1FXKB 3CWBH 3CEIA 4L87A 5LP6A 2HG5C 5JH7A 1PPJH 1XEQA 2OT5A 2Y69B 2ZNJA 4X65O 1E1RG 1SQBH 4DUYO 3ZMZA 1BHAA 2OIEA 3HPLC 2Q9LA 2DW4A 1KB9F 4G27B 2A79B 4B3MO 5LMUO 3EVKA 4CS4A 4NTWA 5KUMA 1G1XB 2EX3A 5JJNB 2FKXA 3QTCA 4BR6A 5BR8B 3OW2U 2XAHA 4LFAO 1YITV 2FB5A 3B77A 2WLJA 2CH7A 4JAVA 2UXCO 3SPCA 2BTQB 3JSNA 4H37A 4DR2O 1GMGA 3ETDA 4J80A 4JASA 1K33A 1BMFG 3HKDB 3FX7A 4QJFB 2ZM6O 4LF7O 4NR1A 1GM9A 2XNDG 4FLVA 5JJJB 2XAQA 3OGCC 3NXSA 3Q4HA 1WPBA 4K3AA 2VQFO 3X2QB 4FLUA 1SS3A 1XREA 2CAZC 1ZL8A 2R9IA 1W0JG 1Q8IA 3L70H 3ZRSA 1AI5A 3WG7C 1YHQV 1XNRB 3R65A 5CA1B 2Q5ZA 3ABLB 2QA4V 1Y74A 2UUBB 1K97A 4G28B 2CE4A 3HKDA 3BPZA 3CMEV 3A0BZ 5CBGA 3U0ZA 3J81N 4TV8A 1Y76B 3LDDA 5B3SB 4JYCA 1QLEC 4DV5O 4B3SO 1K73W 4HNAA 1AR1B 4X62B 3PN1A 1MSWD 2HEPA 1IBMO 2GV9A 5KHKA 2ZD9A 4DRXA 5JJEB 2EULA 2X6BA 5EC2C 2HVKC 4TUYA 4ZHQB 5BZBA 4LFBO 2XHBA 2EILB 4GX5A 2Q7HA 5E79Z 1Q81W 3MDSA 1H2NA 5KHGA 1IXMA 3JCZA 4BIOA 4JV5O 5ITZA 3AK2A 4PDRA 5LP6B 1M93A 2EIKC 4UXNA 5LYJA 1MA1A 4FFBA 1CXZB 2FMLA 3LNNA 2Q68A 3ETEA 4LNUB 4X66B 2QTOA 2A7WA 3CCUV 5D5QA 2IJHA 5H6QA 3ZX6A 1VQ8V 2EINB 4NTXA 3OTOB 1KD1W 1Q5OA 3W7SA 3Q4HB 3VQWA 4I50A 1SZXA 2WLIA 3TETA 4DV1B 2QEXV 2YICA 4O2BB 5KAIZ 1SZTA 5B5EZ 4D7SA 1HR0B 2ZR3A 4L8JA 5CBFA 3WU2Z 3TXSA 3UM7A 2ZE6A 3E35A 4DR6B 1JFFA 1OCOB 1IZ3A 1A32A 4DUZB 1V55B 5HFLA 3A0HZ 2AZ0A 2H94A 2PGGA 3W7WA 4FM0A 2BTQA 3CCRV 5CA1A 1HNZO 3K58A 3P32A 1NTKH 3OFNG 4B3TB 3RYIA 4RWUA 1SESA 3ZHSA 4K8ZA 2WPDG 2KSDA 4H33A 1KKCA 3I56V 1YJNV 1S76D 4ABMA 4WFFA 3IAYA 1YVWA 1DF4A 2Y0IA 2EJRA 1N32O 4CS3A 3SJQC 4BW9A 1H2GA 3ZHRA 4IT5A 1NVPD 4JF3A 3QO5A 5LHIA 3F5WC 3P3NA 4WFEA 4K0KO 1IX9A 1JVMA 1S3JA 4J10A 4JI1B 1N32B 4PA3A 4FZ0A 1NR1A 2IU0A 1YEWA 4PA7A 2XAJA 3K5LA 1GN4A 4YJ3B 1J5EB 3E8GA 4TQFA 4EFBA 1YTFD 5KX5B 2UUAO 1SKVA 4LC1A 5LBQA 1B3QA 4B3RO 1V9PA 4H0LB 2JGUA 1HP8A 4Q6GA 5JWPA 2YXHA 4QE9A 5CA0B 2KB1A 5EZYA 3IFXA 3IC9A 4FM1A 2DWEC 2W0XA 2PYLA 1M56C 1OZ0A 1WPXA 2HKOA 4I0XB 2Q73A 4Q20A 1P4RA 5JVDB 3E83A 4JYYA 5IJ9A 3C90A 4MS2A 5CA0A 2DQ0A 2CGOA 3ZHUA 2QKCA 4UFZA 4JI5B 3OEHG 4O4HB 1BGYH 3L74H 4LF9B 3SYAA 4MVRA 1ORQC 2OTJV 2D3OW 3STLC 4EB6B 2Q7EA 1F51A 1XNRO 2DE0X 1Q82W 4D6TH 4QIWF 5C8YA 4JI0B 4N21A 4NXMB 5EK0A 4MVZA 4UCTA 4PJ0Z 3K03A 3AG4B 3BA8A 1NKDA 4FLYA 2GBOA 3JAKB 4LF6O 4NYKA 5DM6V 1VP7A 4FM2A 4NXMO 3LDCA 1VQ4V 5TISZ 4LF4O 1RSOA 3EFFK 1GK9A 1PKXA 2WLMA 5B1AC 3X2QC 3THOA 3ZMTA 2GUZA 3WB0A 1VF6C 4EEQA 4KFMA 2DWDC 3CRCA 1JMKC 3ZRWB 4AILC 3P3PA 3WG7B 2DMXA 4PDLA 5D5PA 5H5NA 3W7XA 1SQQH 2AZ2A 4B3RB 3ABLC 3BVOA 3AK3A 1R1BA 2M6YA 5CMUA 3SYQA 2IJJA 1BT8A 4FMTA 2IBZH 1DGSA 1VQLV 5LOVA 2BCCH 2P67A 2ZCEA 3T4DA 1F23A 4IYHA 3ZCCA 5E1AC 5B3SC 1MG1A 3M99B 5L3GA 2EIMC 5KHJA 5KAFZ 2M7WA 2F43G 1ZAUA 4P9PA 3P30A 1Q43A 1VARA 3OMIB 1PV0A 4O4HA 1N8RW 2P4VA 1VQPV 2X6CA 4O4LA 4LF5B 5GTIZ 4I9QA 4GZRB 4AI8A 2RCVA 4DR7B 1URFA 1BHBA 4UB8Z 5BR8O 1SA0A 3N27A 3L75H 1ZLZA 1Z2GA 4MTGA 4JI2B 1Y67A 2P22C 1Q90D 1TGOA 4UVCA 4YY3O 1K5SA 3ASNB 2QE7G 1AILA 2MK3A 3RVZA 4XBFA 1IBKO 2E5LO 4GKKB 1I0HA 3CXHF 3ABKC 2JS5A 3SGIA 4DK1A 1WP8A 2CTWA 3JARB 1PD3A 2Q4PA 2CGNA 2EINC 4DXWA 2ITCC 2Q0OC 1K9MW 5H9CA 3D36A 3G6EV 1WN7A 1H8HG 3R66A 3E8HA 1HNWO 4PI2A 3FYEB 4DV7O 2XASA 2F93B 1V54B 2ADPA 1OCOC 4GUNA 1Q3EA 2YIBA 5BMVA 2Z3YA 1WLEA 4HBNA 4K8XA 4DV7B 4YIPA 1FKAO 4DV0O 4CH4A 1EM1A 4U3FH 1ENVA 3CCQV 4OGQB 1P7BA 2IH3C 2ATKC 1YI2V 2YIAA 2ZIMA 4DR1B 4JI6B 3RW0A 3LSUA 3ABMC 4X1YB 1R73A 2R9RB 4UCOA 3WB1A 1LUWA 1NJIW 3SPJA 3N2KA 2VQEB 1OCZC 4JI6O 2JS3A
chains in the Genus database with same CATH topology
2EIMB 2P6JA 1K73W 1AR1B 3AG2B 4LBEC 5LHGA 1R3KC 2WAMA 4GX2A 1MSWD 3CP1A 1JOYA 4MVQA 3A0RA 2PI5A 3RBZA 4ZBMA 5CA3A 3PJSK 4MT8A 2ZD9A 4WFAV 1K5QA 1G4YB 2X6BA 1KP2A 1EZJA 5EC2C 1Q86W 2HVKC 2Y69C 3FB6C 1H8EG 3E86A 3MHSC 4BIZA 2ZDIC 5BZBA 3ZRWA 5HFMA 1H38A 4UVBA 3CCSV 2EILB 4GX5A 2OTLV 2ZQMA 5EC1C 2XAFA 4UUJC 1Q81W 4MVOA 4MTXA 1LNQA 1IXMA 3JCZA 4UVAA 4QPKA 3ASNC 4PDRA 2BOBC 5B1BB 1YJWV 1Y66A 2EIKC 1S77D 3CC2V 4UXNA 1AJPA 3ZRXA 3CXCU 4MSWC 3ABKB 2C2AA 3LSSA 5KUKA 2Q68A 3JD4A 3ETEA 4PA6A 2IJKA 2HFEC 1NQTA 2QTOA 5IY5C 3CCUV 2IJHA 2JEXA 5H6QA 4BW5A 1VQNV 1FXVA 3OM3B 3CCEV 1VQ7V 3CCLV 5B1NA 4JTAB 1VQ8V 2EINB 1OCCC 2Q6AA 1KD1W 2EIJB 3ZJZA 5IYCO 1Q7YW 3SPIA 3W7SA 3OAAG 2GSMB 1DTOA 3TETA 2WLIA 2QEXV 3IC7A 1B6QA 5EBWC 2AHYA 3ABTA 4X8AA 1SZTA 3SYPA 2ZR3A 2JEUA 5CBFA 3ASOB 4R8CA 2OCCC 5GW7A 3VOUA 3UM7A 2GHYA 1SERA 3E35A 4U7NA 4YXWG 2Q69A 3AG3C 2FTKA 1OCOB 4RAIA 1KP3A 1V55B 5CBHA 4G2KA 4RUFA 5HFLA 1KECA 2Z5UA 2H94A 1SRYA 3K9AA 3W7WA 1THZA 2W6JG 3CCRV 2W0FC 1OCZB 1PL0A 3P32A 5LGTA 5IYDO 2LP7A 3OFNG 4J9ZB 4CZZA 5LHHA 4PA9A 3GWOA 4EKWA 1S5HC 1SESA 3SYCA 3FYIB 5KA5A 3K0GA 3OEEG 5B1AB 2LFRA 2WPDG 4PELA 2P90A 3WFVA 4H33A 2LFSA 3I56V 1YJNV 1S76D 3ZN1A 4WFFA 1DF4A 2EJRA 3AG1B 3SJQC 2WLHA 3F7YC 1QVFU 1H2GA 1PNLA 1J95A 1M57B 4MVSA 3OMAB 1NVPB 1QR8A 1NVPD 4JF3A 4U7OA 3QO5A 5KA6A 5LHIA 5EBMC 2K1EA 3FB5C 1AI4A 4JAUA 4LP8A 3G4SV 3F5WC 3BEHA 4QE7A 4DO2A 1MABG 4WFEA 4UV9A 4Z1MG 1JVMA 1S3JA 4WCEV 1AROP 1K3EA 1RM1B 3DTUB 2DQ3A 3JD1A 4JPRA 4PA3A 4RO2A 3AG2C 3SPGA 1NR1A 2IU0A 3VBBA 1GO3F 1JJ2U 4TWKA 3ABUA 2UXXA 4PA7A 2XAJA 1K8AW 2V7QG 3IGAC 3E8GA 3JD2A 5L3EA 2NLJC 4JTDB 1YTFD 3GB7C 1R6NA 5EBLC 4R50A 3FB7C 4LC1A 2CK3G 5LBQA 1R6KA 3DGEA 3E2EA 1BL8A 2XAGA 3K04A 3HB3B 2B5UA 4QE9A 1QLNA 1DLBA 1M1KW 3ZMUA 2EILC 2KB1A 3IFXA 4RQEA 1FXHA 2DWEC 1M56C 2WSSG 1PNMA 1OZ0A 1WPXA 2HKOA 3JD0A 4OXSA 1KC8W 1M90W 1K92A 1VQ5V 4Q20A 1P4RA 2IH1C 3SYOA 2P7TC 3ZIAG 3E83A 3ZRVA 3CD6V 4GT1A 5DN6G 4MS2A 2DQ0A 4XDJA 1VQKV 4JTCB 1KQSU 2ITDC 1AI6A 3CC7V 1HWYA 1RPRA 4UV8A 3SPHA 3OEHG 3EHBB 1XL6A 2ZDIA 1K7DA 2EZOA 1EBOA 1JCHA 1OCCB 3OR7C 3SYAA 3OE7G 1I5XA 2EIJC 4MVRA 3CMAV 4LCUC 2QM8A 3QNEA 3T4ZA 1ORQC 5J9PC 2DYRB 2X0LA 5L3DA 1FXKA 2OTJV 2D3OW 2X7RB 3ETGA 3STLC 1F51A 1FXKC 1Q82W 1VQ6V 1K34A 2V1DA 3ASOC 1E1QG 5L3CA 1ROPA 2JIZG 2JJ2G 3TK1A 4QIWF 2WLNA 3K08A 1QCEA 4N21A 4X88A 1COWG 3JD3A 1OCRC 4GX1A 1CPYA 1RPOA 2WLLA 3AG3B 4MVZA 5EK0A 3TCUA 1VQMV 3K03A 3AG4B 1M57C 1V55C 3K06A 3MD0A 2B1GA 1NKDA 4JGSA 1W0KG 5LGUA 2AHZA 2NNUA 4WFHA 2A9HA 5DM6V 4GX0A 1QBZA 2IU3A 2WLIB 3B8NA 3LUTB 4BAYA 1L1FA 1R3LC 1V54C 1YSCA 2HJFC 1CP9A 1RM1C 4QPJA 3LDCA 1AI7A 1XL4A 2Q67A 4QNHB 3OUFA 1VQ4V 4FK5C 4I5SA 4MW3A 3W7TA 4CBCA 3EFFK 3RVYA 3G71V 1NR7A 1GK9A 1PKXA 4MTFA 2WLMA 2EZPA 3K79A 5B1AC 2Y48A 1G8MA 4WFGA 3X2QC 3T1CA 3ZMTA 2H8PC 2DYSB 5L3BA 2HVJC 1K4DC 1JX9A 2QM7A 4KP4A 4KFMA 2PI4A 1SETA 2DWDC 3E89A 1CEZA 4HYOA 2HR3A 4GCZA 3ZRWB 4ZKIA 2UXNA 4X89A 3FB8C 3STZC 1R3IC 1FS0G 4JYBA 3WG7B 1JQ0A 4E2LA 4PDLA 3CC4V 5CN0A 2QKSA 3W7XA 1AJQA 1NH2D 3ABLC 4XDLA 1S0VA 1TUEB 1F4NA 5CMUA 3SYQA 2IJJA 3AEIA 4FMTA 2YSUB 4RUEA 1VQLV 4PDMA 2JDIG 4I9WA 2IW5A 2P67A 3MHHC 3T4DA 3ZMVA 1F23A 4R6ZA 4PA4A 1GKFA 3ZCCA 5E1AC 5B3SC 1MG1A 2BOCC 1NBMG 3M99B 1DF5A 1Y4MA 1QLEB 5L3GA 2ZXWC 3B8MA 1AJNA 3ML0A 4R7CA 4TSFG 2EIMC 2HLDG 2WLKA 3CYOA 2M7WA 3F7VC 2JJ1G 2F43G 4FJCC 1YIJV 2JK5C 1K4CC 4P9PA 1JPXA 1PNKA 2DYRC 3OMNB 3P30A 1VQ9V 4P9OA 1MOFA 3K3WA 3OMIB 4MVUA 1N8RW 1VQOV 1FXKB 4MTOA 4L87A 5L3FA 1VQPV 1OHHG 2X6CA 1M56B 2HG5C 4P2ZA 2Y69B 2OT5A 1BHBA 1E1RG 4BIUA 3D3IA 3ZMZA 1BHAA 3ABMB 3HPLC 4MTGA 1GM8A 2DW4A 4G27B 4UVCA 3CCVV 2A79B 1K5SA 5KUMA 3ASNB 3JYCA 5C93A 4P30A 2QE7G 3I55V 2MK3A 3BY6A 3RVZA 4XBFA 5IYBO 4N23A 1F4MA 1KKDA 1YJ9V 4WFBV 3OW2U 2B1IA 4FPPA 3ABKC 3UKMA 2XAHA 1YITV 4WF9V 1YTFB 1ZWIC 3B77A 2WLJA 3FKSG 1GTOA 2WLLB 1PD3A 4JAVA 2DYSC 3SPCA 2EINC 4DXWA 2ITCC 2A0LA 4H37A 1UJWB 1OCRB 4RQFA 1QVGU 1K9MW 3AG4C 2W6IG 2YEVB 5H9CA 1GMGA 3D36A 3ETDA 3G6EV 5H6RA 1H8HG 4JASA 4FIPC 1K33A 3E8HA 1BMFG 3T2MA 2OCCB 3CCMV 3E8FA 1FFTB 3QO8A 3FYEB 4KUMA 2XASA 3LNMB 1R3JC 5B1OA 4QJFB 1V54B 3LDEA 1QR9A 4MVMA 3E8BA 1OCOC 1W2BU 5B1BC 2EIKB 1GM9A 2Z3YA 2XNDG 1WLEA 4J9YB 2XAQA 3OGCC 3NXSA 3QO7A 5LGNA 3X2QB 5IY5B 2R9IA 1W0JG 2ZXWB 4XDKA 4MW8A 3ZN0A 3W7UA 3ZRSA 1AI5A 3K0DA 4ASUG 2ZR2A 5IDJA 1ENVA 2EBOA 1I5YA 3OR6C 3CCQV 1M9NA 1E79G 3WG7C 1P7BA 1YHQV 2IH3C 3R65A 2ATKC 1YI2V 2WWWA 3ABLB 3KG2A 2QA4V 3AG1C 1EFRG 3LSQA 4HZ3A 1K97A 3CCJV 3CPWU 4G28B 4HAMA 5FL7G 3OUSA 3CMEV 3RW0A 3ABMC 5CBGA 2YEVA 1R73A 3ZMSA 2R9RB 4F4LA 2XOKG 1NJIW 3LDDA 5B3SB 4JYCA 3SPJA 1NH2B 3H01A 1OCZC 1QLEC 2IJIA 1GM7A 4TT3G 1S72V 2X6AA 4PDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJH A;  1RPO A;  2IJI A;  1GTO A;  1ROP A;  1GMG A;  1RPR A;  3K79 A;  1F4N A;  2GHY A;  2IJK A;  4DO2 A;  1PD3 A;  2IJJ A;  1B6Q A;  1F4M A;  1NKD A; 
#chains in the Genus database with same CATH topology
 4JI4 B;  2WAM A;  3QVN A;  1JOY A;  4MVQ A;  5LXT B;  3RBZ A;  4MT8 A;  1UPG A;  1N0J A;  1YDX A;  4WFA V;  1G4Y B;  1KP2 A;  1N0N A;  4JI4 O;  1IBK B;  2QSA A;  2GTS A;  4I7Z B;  4UVB A;  3CCS V;  2OTL V;  2K9P A;  4LF6 B;  5FNV B;  1TUB B;  1LNQ A;  5LYJ B;  4X9Q A;  3KCY A;  4QPK A;  5K1P A;  1XNQ O;  1YJW V;  4KL1 A;  5ITZ B;  3ZRX A;  4YHH O;  4MSW C;  2C2A A;  1SQX H;  3RYC A;  5JVD A;  3FFQ A;  4DV6 O;  2XT9 A;  2QM4 A;  2ZIN A;  5IY5 C;  1H2K A;  2Y0P A;  1VQN V;  1FXV A;  1GN2 A;  3CCE V;  5B1N A;  2Q6A A;  2EIJ B;  1Q7Y W;  3L9D A;  3SPI A;  2P4K A;  2GSM B;  2E3C A;  4FLW A;  3IC7 A;  1B6Q A;  4HNA B;  4X8A A;  3ABT A;  2BSK B;  4I50 B;  4O2A B;  2VS0 A;  5EYP B;  2YC0 A;  1D2D A;  3SJB C;  5KHH A;  2OCC C;  5GW7 A;  2JRI A;  3C3T A;  1VF5 B;  4TV8 B;  1SER A;  4U7N A;  4YXW G;  4X20 A;  2UUB O;  4RAI A;  2F23 A;  5CBH A;  4G2K A;  4RUF A;  5EIB D;  1KEC A;  2Z5U A;  2DOS A;  1QU7 A;  1OV9 A;  4EB6 A;  5KMG B;  1JA8 A;  4PHZ A;  3RYF B;  3TXQ A;  1OCZ B;  1XDC A;  1PL0 A;  5LGT A;  3D3Q A;  4JI8 O;  4J9Z B;  5LHH A;  3ICX A;  3HKC B;  4X64 B;  3SYC A;  3FYI B;  5KA5 A;  3K59 A;  5B1A B;  2LFR A;  1PL4 A;  3RT3 C;  3VQV A;  3JAM N;  4LF5 O;  4TOI A;  3H1K H;  3AG1 B;  2E74 B;  3F7Y C;  4X64 O;  2ETN A;  4MVS A;  3OMA B;  2UUC O;  1O9H A;  2F4V O;  3BHP A;  1AI4 A;  3TGU H;  1VMG A;  2PYJ A;  4QE7 A;  4DO2 A;  4WCE V;  4UV9 A;  3JD1 A;  3AG2 C;  2CTP A;  1JJ2 U;  4TWK A;  2E76 B;  2V7Q G;  4KHP B;  1MNG A;  3AK1 A;  3JD2 A;  5FPR A;  2NLJ C;  1GH6 A;  4LR3 A;  3L73 H;  3JAS A;  2QWP B;  4PI0 A;  3FB7 C;  2UXC B;  2CK3 G;  4H13 B;  4UCS A;  5FLX N;  3S3W A;  4IHJ B;  1XNQ B;  2XAG A;  3BAB A;  2Q7G A;  5F2V O;  1BCC H;  1VF6 A;  4AHC A;  2CH7 B;  1Z5V A;  4BWA A;  4AQY O;  1BE3 H;  4RQE A;  1FXH A;  4D7T A;  5GTH Z;  3JD0 A;  1ZUQ A;  1M90 W;  2IH1 C;  4LNU A;  4DR5 B;  4PD4 F;  4CC6 A;  4J7J A;  4DUZ O;  3ZRV A;  4ZOL A;  4GT1 A;  3GWK C;  3T1H B;  2QDO A;  1HR0 O;  4XDJ A;  5BMV B;  1KQS U;  2ITD C;  4GKJ O;  3SPH A;  1XL6 A;  3M8A A;  3HKC A;  4LFC B;  1EBO A;  1JCH A;  1I5X A;  3CMA V;  3FD9 A;  4X1I B;  2QM8 A;  4O4I A;  5J9P C;  2DYR B;  3T1H O;  1FXK A;  1US6 A;  4ZHQ A;  2X7R B;  2E75 B;  1YZB A;  2FYU H;  1HNZ B;  4DR4 B;  2JIZ G;  4DV4 O;  1QCE A;  3QF7 A;  5BXZ A;  4DR1 O;  2RQ6 A;  2AW9 A;  4X88 A;  3JD3 A;  5C93 A;  3AG3 B;  3JAR A;  4FFK A;  3CRM A;  3NR7 A;  3MD0 A;  4JGS A;  3ZHQ A;  2WA3 A;  2NNU A;  2A9H A;  2VWJ A;  1QBZ A;  4YIO A;  3B8N A;  1V54 C;  1YSC A;  2HJF C;  4DV3 O;  4QPJ A;  1AI7 A;  5FPO A;  4FK5 C;  4CBC A;  2Y4T A;  1EN6 A;  3E22 A;  1ZTE A;  2VWK A;  4MTF A;  1J5E O;  1H2L A;  3K79 A;  5CB4 B;  3T1C A;  1LR1 A;  4FFB B;  2DYS B;  1XBL A;  4CC5 A;  2HVJ C;  1JX9 A;  2QM7 A;  1SET A;  4GCZ A;  3FB8 C;  5IWA B;  4JYB A;  1JQ0 A;  3CC4 V;  1BSM A;  1JJO A;  5CN0 A;  3KCX A;  1NH2 D;  2UU9 B;  1TUE B;  1S0V A;  3FAV A;  2ZM6 B;  4RUE A;  2JDI G;  1PM9 A;  2PTM A;  4R6Z A;  3N2G A;  1DF5 A;  4QGP A;  1X59 A;  3ZED A;  3CX5 F;  4JI7 B;  4R7C A;  2HLD G;  2WLK A;  3CYO A;  4LF9 O;  1I94 O;  1AP6 A;  2IM9 A;  4DV1 O;  1K4C C;  1WP7 A;  1XIL A;  3N2K B;  4JZG A;  4EFE A;  4P9O A;  4DR3 O;  4JI2 O;  4JI5 O;  4MTO A;  1KMI Z;  5L3F A;  1M56 B;  4P2Z A;  4TV9 B;  5IJ0 B;  2GUZ B;  4W4L A;  4BIU A;  2LGQ A;  3D3I A;  2E5L B;  4J7Z A;  2HJD A;  4DR3 B;  3A8T A;  1GM8 A;  3CS5 A;  2UXB B;  2NR5 A;  3CCV V;  3B4S A;  2RMK B;  3JYC A;  3ETQ A;  4P30 A;  4DYL A;  3I55 V;  5JQG A;  1F4M A;  1KKD A;  1Y6X A;  5DED A;  1RP3 B;  1IBM B;  2BTO A;  4WF9 V;  1YTF B;  1ZWI C;  4DW1 A;  3QG5 A;  2DYS C;  3RN4 A;  2MW2 B;  1Q6H A;  4LF4 B;  1UJW B;  3H1H H;  4RQF A;  3DC5 A;  3AG4 C;  3B2E E;  1XMO O;  2F4V B;  3DXR B;  5H6R A;  2QWO B;  1XQ8 A;  2QJ1 A;  3T2M A;  2OCC B;  1FFT B;  3QO8 A;  4KUM A;  3LNM B;  1KYO F;  5B1O A;  4NKG B;  3LDE A;  1L0N H;  1QR9 A;  4MVM A;  3E8B A;  2O57 A;  5B1B C;  1VEW A;  2EIK B;  2F95 B;  2BSK A;  2ZE7 A;  3HKB A;  2CDY A;  2YXY A;  3CJH B;  2QTS A;  4J9Y B;  3QO7 A;  3U10 A;  3IJ4 A;  2UU9 O;  1IXB A;  2QWR B;  2KG7 B;  1M5I A;  4IYI A;  4MW8 A;  4JZ2 A;  2FL4 A;  2KKW A;  4YJ2 B;  3K0D A;  4OPA A;  2EBO A;  1I5Y A;  2L6L A;  2QR4 A;  1M9N A;  1E79 G;  4ZI7 A;  3JAW A;  2WWW A;  4LH7 A;  1EN4 A;  3AG1 C;  1EFR G;  3LSQ A;  4HZ3 A;  4A5U B;  4F6R B;  4DR5 O;  4HAM A;  2PZS A;  5KX5 A;  5JH7 B;  5J2U B;  1GAX A;  4OX9 B;  2YEV A;  4U3J A;  2LGW A;  1NH2 B;  3H01 A;  1NTM H;  1GM7 A;  4TT3 G;  3JCU Z;  4J42 A;  1S72 V;  4PDV A;  2EIM B;  2P6J A;  3AG2 B;  3HR0 A;  1XUQ A;  1R3K C;  4GX2 A;  3CP1 A;  1WA8 B;  5B66 Z;  3A0R A;  2PI5 A;  3BRC A;  1SQG A;  4O4J A;  1FAF A;  3B40 A;  2QKA A;  1EZJ A;  3CB2 A;  1H8E G;  4BIZ A;  3MHS C;  4GKK O;  2ZDI C;  3ZRW A;  1P49 A;  3K5M A;  1H38 A;  3RWR D;  3UO3 A;  2GTA A;  4X1K A;  4UUJ C;  2RDC A;  5J2T A;  4MVO A;  1QNM A;  3ASN C;  2BOB C;  5B1B B;  3E22 B;  3SR2 C;  4LF7 B;  1MZF A;  3CXC U;  3ABK B;  4FZ1 A;  2UUA B;  1HNW B;  4PA6 A;  2YID A;  2HFE C;  4WBN B;  1JFF B;  2YUA A;  4BW5 A;  3OM3 B;  2LQT A;  4JTA B;  1OCC C;  3JAK A;  3JAL B;  5IYC O;  4J11 A;  1NI8 A;  4DW0 A;  3OAA G;  4UCV A;  1JR9 A;  1N36 B;  2VRZ A;  2ILM A;  2JEU A;  3CHX A;  4R8C A;  3RYH A;  3VOU A;  2OCH A;  2DN9 A;  5BY1 A;  2Q69 A;  3AG3 C;  2FTK A;  4DV2 B;  5J2U A;  4X1I A;  3BCC H;  1TAE A;  1H2S B;  3K9A A;  2CTQ A;  3C3S A;  4U3J B;  5JCO C;  3O9O A;  1DK1 A;  4ICG A;  2VQE O;  5IYD O;  4DV5 B;  2LP7 A;  1SQP H;  3ZHT A;  4CZZ A;  5IJ9 B;  4PA9 A;  4ZOL B;  3APQ A;  3GWO A;  2XTA A;  3K0G A;  4PEL A;  1ZX3 A;  2P90 A;  2LFS A;  3ZN1 A;  2YIB D;  3CRQ A;  3CJH A;  1HNX B;  1D5N A;  1QVF U;  2KG7 A;  1J95 A;  3H1J H;  1M57 B;  1IBL B;  3F5T A;  2CUG A;  2R70 A;  2YDE A;  2D2C B;  3DSQ A;  5EZY B;  3G4S V;  2HP8 A;  2BE3 A;  4TV9 A;  1FPO A;  3BEH A;  1MAB G;  2RNB A;  1AR5 A;  1ARO P;  1K3E A;  1RM1 B;  1HNX O;  1HDJ A;  4LWS B;  1XHX A;  4W4K A;  3VBB A;  3SPG A;  2YS8 A;  3ABU A;  1K8A W;  3H1L H;  3SDL A;  4NXN B;  1L8D A;  4O4I B;  1FFX B;  1R6N A;  4UCU A;  5EBL C;  4DV6 B;  1QHT A;  2HHH O;  1R6K A;  3E2E A;  1BL8 A;  3G80 A;  2Q8V A;  2ADQ B;  1PP9 H;  2B5U A;  1DLB A;  1XMO B;  4IL6 Z;  3ZMU A;  1U97 A;  1H2M A;  3KKY A;  1SF9 A;  2HHH B;  4NVP A;  4JYA B;  4GKJ B;  2WSS G;  4OXS A;  1K92 A;  3K5N A;  1N36 O;  3CD6 V;  3BA9 A;  5DN6 G;  1U96 A;  5KLV H;  1VQK V;  1AI6 A;  3U11 A;  3DC6 A;  3CC7 V;  1HWY A;  4UV8 A;  3EHB B;  1Z5W A;  2A3Q A;  1K7D A;  1SQV H;  4LF8 B;  2YI9 A;  5IJ0 A;  3RYI B;  3OR7 C;  3OE7 G;  2EIJ C;  4X1K B;  3UT5 A;  5IE9 A;  3QNE A;  1IVS A;  1KBH A;  4CS2 A;  5L3D A;  1P84 F;  2X0L A;  4X20 B;  5LMN O;  1RSO B;  3ETG A;  2CTR A;  2V1D A;  3ASO C;  2JJ2 G;  1G6U A;  4DV3 B;  1XHZ A;  3N2G B;  1COW G;  4GX1 A;  1CPY A;  1VQM V;  1NT2 B;  3TCU A;  3K9S A;  5DEC A;  1M57 C;  2B1G A;  1GRJ A;  1WA8 A;  4OX9 O;  5LGU A;  4LFA B;  5LL6 Y;  2G38 A;  4WFH A;  4GX0 A;  2IU3 A;  5LMU B;  5H2F Z;  2WLI B;  1EZV H;  1L1F A;  1R3L C;  2PF4 E;  1CP9 A;  1RM1 C;  3OD4 A;  1XMQ B;  3OUF A;  4DR2 B;  3G71 V;  1MSD A;  1NR7 A;  3T1Y B;  2L35 A;  3HKE A;  2Y48 A;  4Z2W A;  1TUB A;  2H8P C;  1VIB A;  3CRR A;  3UCS C;  5CB4 A;  4KP4 A;  1O9G A;  1WB8 A;  1YXB A;  1BS3 A;  3T1Y O;  2UXN A;  3STZ C;  1AR4 A;  4TUY B;  2EJ7 A;  4JAA A;  3K57 A;  2QKS A;  1AP5 A;  1AJQ A;  1NU1 H;  4I0X A;  3H1I H;  3G67 A;  4XDL A;  1F4N A;  3G6B A;  2GDS A;  2YSU B;  4PDM A;  4O2A A;  5EYP A;  4B08 A;  2QGN A;  3ZMV A;  4AQY B;  1NBM G;  3JAL A;  1Y4M A;  1QLE B;  1Y76 A;  3OGI B;  4DV0 B;  2ZXW C;  3B8M A;  3ML0 A;  4TSF G;  4FVM A;  2JJ1 G;  2JVD A;  4WBN A;  4FJC C;  1SC5 B;  3OT7 A;  1BQ0 A;  1JPX A;  3OMN B;  1MOF A;  3K3W A;  4MVU A;  1ZSP A;  1VQO V;  1P7G A;  1OHH G;  2KQX A;  4DR4 O;  1BQZ A;  2ZNI A;  2WA4 A;  4NB5 A;  4X62 O;  2F1M A;  2Y4U A;  4J41 A;  3ABM B;  1B06 A;  4E4E A;  1ZL8 B;  3WB2 A;  3BY6 A;  5IYB O;  4N23 A;  1YJ9 V;  4F6E A;  4WFB V;  1FJG O;  3UKM A;  1Q6U A;  2B1I A;  4FPP A;  5LXT A;  3UQ8 A;  2OIG A;  3FKS G;  1GTO A;  4OPH A;  2WLL B;  2AGA A;  1MMM A;  2P5O A;  3RYF A;  2YI8 A;  5GON A;  2A0L A;  1OCR B;  1QVG U;  4LFB B;  4H44 B;  4IHJ A;  2W6I G;  2YEV B;  5IWA O;  1D5A A;  2R9A A;  2ODM A;  4FIP C;  3UT5 B;  3CCM V;  3E8F A;  1R3J C;  1S5L Z;  5A9G A;  1W2B U;  4O2B A;  4JI3 B;  4NXN O;  5LGN A;  1OJH A;  4YJ2 A;  5IY5 B;  2QWQ B;  1I08 A;  2ZXW B;  3OTO O;  5EIB C;  4XDK A;  4JI7 O;  3ZN0 A;  3I5D A;  2LW1 A;  3W7U A;  4ASU G;  1F7Y A;  2ZR2 A;  5IDJ A;  4IGG A;  3OR6 C;  4CH3 A;  3ZHV A;  1W59 A;  1N34 O;  2N05 A;  4JYA O;  4Z1V A;  1L0L H;  3KG2 A;  4JI0 O;  4DR6 O;  3CCJ V;  3CPW U;  1TVK A;  5FNV A;  1VF7 A;  1SQF A;  5FL7 G;  3OUS A;  2JGD A;  2V4D A;  3ZMS A;  2DJV A;  4F4L A;  2XOK G;  2UXB O;  2IJI A;  3CSX A;  4B3T O;  4YY3 B;  4JI8 B;  4LFC O;  2X6A A;  5AG2 A;  4I55 B;  2R72 A;  4UB6 Z;  4LBE C;  1QQC A;  5LHG A;  3RYH B;  5LMN B;  4ZBM A;  5CA3 A;  3PJS K;  1K5Q A;  4DV4 B;  3A2F A;  4B3S B;  3M7M X;  3AG7 A;  3RGB A;  1Q86 W;  3SJA C;  2Y69 C;  3FB6 C;  3E86 A;  3SJC C;  2UUC B;  2RN9 A;  5HFM A;  4X1Y A;  3RYC B;  2ZQM A;  5EC1 C;  2XAF A;  2ZE8 A;  2ZIO A;  4MTX A;  2ARH A;  4C7U A;  4K0K B;  1I7F A;  3S3X A;  4UVA A;  4O4L B;  1Y66 A;  1S77 D;  3L72 H;  3CC2 V;  1AJP A;  1IUR A;  5J2T B;  5IYZ B;  3LSS A;  5KUK A;  3JD4 A;  2H3O A;  4IIJ B;  3HKE B;  2IJK A;  1NQT A;  2F66 C;  3KZI Z;  4B7E A;  2JEX A;  4JV5 B;  3H9V A;  1VQ7 V;  3CCL V;  3J80 N;  3CE2 A;  3ZJZ A;  1MZE A;  1DTO A;  5EBW C;  2AHY A;  3SYP A;  5K1X A;  5LOV B;  3ASO B;  1FD9 A;  2QWN B;  2LJ2 A;  2ZT9 B;  3VQY A;  2GHY A;  1YCI A;  4DR7 O;  1FFX A;  1KP3 A;  3J7A U;  3B09 A;  4IIJ A;  5IYZ A;  1SRY A;  4DK0 A;  1N34 B;  4LWS A;  1THZ A;  2P06 A;  2W6J G;  2W0F C;  4B3M B;  3BFR A;  2PUS A;  4LH6 A;  1T5E A;  1I94 B;  1R6T A;  4EKW A;  1S5H C;  3JAW B;  3OEE G;  3WFV A;  4GLX A;  1WAZ A;  1UFI A;  2WLH A;  2LW7 A;  4K35 A;  2N04 A;  1PNL A;  1NVP B;  2NN4 A;  1QR8 A;  4U7O A;  4NTY A;  5KA6 A;  3D36 C;  5EBM C;  2K1E A;  3FB5 C;  5IT9 N;  1WNS A;  1YF2 A;  4JAU A;  4LP8 A;  3JAT A;  4PV1 B;  3K5O A;  4Z1M G;  2ZE5 A;  3DTU B;  2Z0A A;  2DQ3 A;  4JPR A;  4RO2 A;  3RFR A;  1GO3 F;  1FJG B;  2UXX A;  3IGA C;  2ZKO A;  1X4T A;  4KXR A;  5L3E A;  4JTD B;  2JGD B;  3GB7 C;  4CH6 A;  1AB3 A;  4R50 A;  2Q0A A;  1TVK B;  3JAT B;  2XUM A;  3DGE A;  4JI1 O;  2N74 A;  3K04 A;  3HB3 B;  1N4C A;  1QLN A;  4ZI7 B;  1M1K W;  2EIL C;  4I4T A;  3L71 H;  1NS1 A;  1PNM A;  1KC8 W;  5LA6 B;  1S5J A;  5JQG B;  3GVM A;  1VQ5 V;  1SA0 B;  5A2Q N;  1LUV A;  5LP6 C;  3SYO A;  4DV2 O;  2P7T C;  4JI3 O;  3ZIA G;  2RJZ A;  3O65 A;  1N33 O;  4TQD A;  4J7K A;  4JTC B;  2YXL A;  3CRA A;  1RPR A;  2ZDI A;  2EZO A;  4CH5 A;  1OCC B;  3JAS B;  4LCU C;  2B9Z A;  2LO1 A;  3T4Z A;  4DUY B;  3DXR A;  1WJZ A;  4YJ3 A;  1FXK C;  1VQ6 V;  1K34 A;  1EN5 A;  1E1Q G;  5L3C A;  1ROP A;  5GON B;  3TK1 A;  2WLN A;  3K08 A;  4O4J B;  1XMQ O;  1OCR C;  1RPO A;  2WLL A;  4FLT A;  1V55 C;  3K06 A;  1HW7 A;  1W0K G;  4FLZ A;  2AHZ A;  3FAV B;  3OTF A;  4GYC B;  1TA8 A;  3JSL A;  1NTZ H;  3LUT B;  4BAY A;  1M4U A;  3VQX A;  2Q67 A;  1XL4 A;  4QNH B;  1Q6I A;  2UXD O;  3W7T A;  4I5S A;  4MW3 A;  1B04 A;  1IBL O;  3RVY A;  3UO2 A;  4YHH B;  1XI1 A;  4KHP O;  3APO A;  2EZP A;  1G8M A;  4WFG A;  4F6R A;  1RFY A;  4X66 O;  5L3B A;  1K4D C;  1XOU A;  2PI4 A;  5JCO A;  2UXD B;  3E89 A;  1CEZ A;  4HYO A;  2HR3 A;  4ZKI A;  5KMG A;  4ZIB A;  4X89 A;  1R3I C;  1FS0 G;  2OWO A;  4E2L A;  2VQF B;  3ZBH A;  5LA6 A;  4DRX B;  3MAQ A;  1NZ6 A;  2PY5 A;  3AEI A;  1IDS A;  1BZK A;  4I4T B;  4I9W A;  2IW5 A;  3D8C A;  3MHH C;  3TJT A;  1WB7 A;  1FYJ A;  3HKB B;  4PA4 A;  4UCR A;  1GKF A;  1GN3 A;  5C8Y B;  1AVM A;  3EXA A;  2BOC C;  3ZS8 C;  4B7K A;  5KHI A;  4FLX A;  1AJN A;  2OYQ A;  1GN6 A;  4LF8 O;  3F7V C;  1KUQ A;  4I55 A;  4X65 B;  1YIJ V;  2JK5 C;  1N33 B;  1PNK A;  2DYR C;  1VQ9 V;  3BAA A;  1Y74 B;  1KU9 A;  2AXT Z;  2A06 H;  1FXK B;  3CWB H;  3CEI A;  4L87 A;  5LP6 A;  2HG5 C;  5JH7 A;  1PPJ H;  1XEQ A;  2OT5 A;  2Y69 B;  2ZNJ A;  4X65 O;  1E1R G;  1SQB H;  4DUY O;  3ZMZ A;  1BHA A;  2OIE A;  3HPL C;  2Q9L A;  2DW4 A;  1KB9 F;  4G27 B;  2A79 B;  4B3M O;  5LMU O;  3EVK A;  4CS4 A;  4NTW A;  5KUM A;  1G1X B;  2EX3 A;  5JJN B;  2FKX A;  3QTC A;  4BR6 A;  5BR8 B;  3OW2 U;  2XAH A;  4LFA O;  1YIT V;  2FB5 A;  3B77 A;  2WLJ A;  2CH7 A;  4JAV A;  2UXC O;  3SPC A;  2BTQ B;  3JSN A;  4H37 A;  4DR2 O;  1GMG A;  3ETD A;  4J80 A;  4JAS A;  1K33 A;  1BMF G;  3HKD B;  3FX7 A;  4QJF B;  2ZM6 O;  4LF7 O;  4NR1 A;  1GM9 A;  2XND G;  4FLV A;  5JJJ B;  2XAQ A;  3OGC C;  3NXS A;  3Q4H A;  1WPB A;  4K3A A;  2VQF O;  3X2Q B;  4FLU A;  1SS3 A;  1XRE A;  2CAZ C;  1ZL8 A;  2R9I A;  1W0J G;  1Q8I A;  3L70 H;  3ZRS A;  1AI5 A;  3WG7 C;  1YHQ V;  1XNR B;  3R65 A;  5CA1 B;  2Q5Z A;  3ABL B;  2QA4 V;  1Y74 A;  2UUB B;  1K97 A;  4G28 B;  2CE4 A;  3HKD A;  3BPZ A;  3CME V;  3A0B Z;  5CBG A;  3U0Z A;  3J81 N;  4TV8 A;  1Y76 B;  3LDD A;  5B3S B;  4JYC A;  1QLE C;  4DV5 O;  4B3S O;  1K73 W;  4HNA A;  1AR1 B;  4X62 B;  3PN1 A;  1MSW D;  2HEP A;  1IBM O;  2GV9 A;  5KHK A;  2ZD9 A;  4DRX A;  5JJE B;  2EUL A;  2X6B A;  5EC2 C;  2HVK C;  4TUY A;  4ZHQ B;  5BZB A;  4LFB O;  2XHB A;  2EIL B;  4GX5 A;  2Q7H A;  5E79 Z;  1Q81 W;  3MDS A;  1H2N A;  5KHG A;  1IXM A;  3JCZ A;  4BIO A;  4JV5 O;  5ITZ A;  3AK2 A;  4PDR A;  5LP6 B;  1M93 A;  2EIK C;  4UXN A;  5LYJ A;  1MA1 A;  4FFB A;  1CXZ B;  2FML A;  3LNN A;  2Q68 A;  3ETE A;  4LNU B;  4X66 B;  2QTO A;  2A7W A;  3CCU V;  5D5Q A;  2IJH A;  5H6Q A;  3ZX6 A;  1VQ8 V;  2EIN B;  4NTX A;  3OTO B;  1KD1 W;  1Q5O A;  3W7S A;  3Q4H B;  3VQW A;  4I50 A;  1SZX A;  2WLI A;  3TET A;  4DV1 B;  2QEX V;  2YIC A;  4O2B B;  5KAI Z;  1SZT A;  5B5E Z;  4D7S A;  1HR0 B;  2ZR3 A;  4L8J A;  5CBF A;  3WU2 Z;  3TXS A;  3UM7 A;  2ZE6 A;  3E35 A;  4DR6 B;  1JFF A;  1OCO B;  1IZ3 A;  1A32 A;  4DUZ B;  1V55 B;  5HFL A;  3A0H Z;  2AZ0 A;  2H94 A;  2PGG A;  3W7W A;  4FM0 A;  2BTQ A;  3CCR V;  5CA1 A;  1HNZ O;  3K58 A;  3P32 A;  1NTK H;  3OFN G;  4B3T B;  3RYI A;  4RWU A;  1SES A;  3ZHS A;  4K8Z A;  2WPD G;  2KSD A;  4H33 A;  1KKC A;  3I56 V;  1YJN V;  1S76 D;  4ABM A;  4WFF A;  3IAY A;  1YVW A;  1DF4 A;  2Y0I A;  2EJR A;  1N32 O;  4CS3 A;  3SJQ C;  4BW9 A;  1H2G A;  3ZHR A;  4IT5 A;  1NVP D;  4JF3 A;  3QO5 A;  5LHI A;  3F5W C;  3P3N A;  4WFE A;  4K0K O;  1IX9 A;  1JVM A;  1S3J A;  4J10 A;  4JI1 B;  1N32 B;  4PA3 A;  4FZ0 A;  1NR1 A;  2IU0 A;  1YEW A;  4PA7 A;  2XAJ A;  3K5L A;  1GN4 A;  4YJ3 B;  1J5E B;  3E8G A;  4TQF A;  4EFB A;  1YTF D;  5KX5 B;  2UUA O;  1SKV A;  4LC1 A;  5LBQ A;  1B3Q A;  4B3R O;  1V9P A;  4H0L B;  2JGU A;  1HP8 A;  4Q6G A;  5JWP A;  2YXH A;  4QE9 A;  5CA0 B;  2KB1 A;  5EZY A;  3IFX A;  3IC9 A;  4FM1 A;  2DWE C;  2W0X A;  2PYL A;  1M56 C;  1OZ0 A;  1WPX A;  2HKO A;  4I0X B;  2Q73 A;  4Q20 A;  1P4R A;  5JVD B;  3E83 A;  4JYY A;  5IJ9 A;  3C90 A;  4MS2 A;  5CA0 A;  2DQ0 A;  2CGO A;  3ZHU A;  2QKC A;  4UFZ A;  4JI5 B;  3OEH G;  4O4H B;  1BGY H;  3L74 H;  4LF9 B;  3SYA A;  4MVR A;  1ORQ C;  2OTJ V;  2D3O W;  3STL C;  4EB6 B;  2Q7E A;  1F51 A;  1XNR O;  2DE0 X;  1Q82 W;  4D6T H;  4QIW F;  5C8Y A;  4JI0 B;  4N21 A;  4NXM B;  5EK0 A;  4MVZ A;  4UCT A;  4PJ0 Z;  3K03 A;  3AG4 B;  3BA8 A;  1NKD A;  4FLY A;  2GBO A;  3JAK B;  4LF6 O;  4NYK A;  5DM6 V;  1VP7 A;  4FM2 A;  4NXM O;  3LDC A;  1VQ4 V;  5TIS Z;  4LF4 O;  1RSO A;  3EFF K;  1GK9 A;  1PKX A;  2WLM A;  5B1A C;  3X2Q C;  3THO A;  3ZMT A;  2GUZ A;  3WB0 A;  1VF6 C;  4EEQ A;  4KFM A;  2DWD C;  3CRC A;  1JMK C;  3ZRW B;  4AIL C;  3P3P A;  3WG7 B;  2DMX A;  4PDL A;  5D5P A;  5H5N A;  3W7X A;  1SQQ H;  2AZ2 A;  4B3R B;  3ABL C;  3BVO A;  3AK3 A;  1R1B A;  2M6Y A;  5CMU A;  3SYQ A;  2IJJ A;  1BT8 A;  4FMT A;  2IBZ H;  1DGS A;  1VQL V;  5LOV A;  2BCC H;  2P67 A;  2ZCE A;  3T4D A;  1F23 A;  4IYH A;  3ZCC A;  5E1A C;  5B3S C;  1MG1 A;  3M99 B;  5L3G A;  2EIM C;  5KHJ A;  5KAF Z;  2M7W A;  2F43 G;  1ZAU A;  4P9P A;  3P30 A;  1Q43 A;  1VAR A;  3OMI B;  1PV0 A;  4O4H A;  1N8R W;  2P4V A;  1VQP V;  2X6C A;  4O4L A;  4LF5 B;  5GTI Z;  4I9Q A;  4GZR B;  4AI8 A;  2RCV A;  4DR7 B;  1URF A;  1BHB A;  4UB8 Z;  5BR8 O;  1SA0 A;  3N27 A;  3L75 H;  1ZLZ A;  1Z2G A;  4MTG A;  4JI2 B;  1Y67 A;  2P22 C;  1Q90 D;  1TGO A;  4UVC A;  4YY3 O;  1K5S A;  3ASN B;  2QE7 G;  1AIL A;  2MK3 A;  3RVZ A;  4XBF A;  1IBK O;  2E5L O;  4GKK B;  1I0H A;  3CXH F;  3ABK C;  2JS5 A;  3SGI A;  4DK1 A;  1WP8 A;  2CTW A;  3JAR B;  1PD3 A;  2Q4P A;  2CGN A;  2EIN C;  4DXW A;  2ITC C;  2Q0O C;  1K9M W;  5H9C A;  3D36 A;  3G6E V;  1WN7 A;  1H8H G;  3R66 A;  3E8H A;  1HNW O;  4PI2 A;  3FYE B;  4DV7 O;  2XAS A;  2F93 B;  1V54 B;  2ADP A;  1OCO C;  4GUN A;  1Q3E A;  2YIB A;  5BMV A;  2Z3Y A;  1WLE A;  4HBN A;  4K8X A;  4DV7 B;  4YIP A;  1FKA O;  4DV0 O;  4CH4 A;  1EM1 A;  4U3F H;  1ENV A;  3CCQ V;  4OGQ B;  1P7B A;  2IH3 C;  2ATK C;  1YI2 V;  2YIA A;  2ZIM A;  4DR1 B;  4JI6 B;  3RW0 A;  3LSU A;  3ABM C;  4X1Y B;  1R73 A;  2R9R B;  4UCO A;  3WB1 A;  1LUW A;  1NJI W;  3SPJ A;  3N2K A;  2VQE B;  1OCZ C;  4JI6 O;  2JS3 A; 
#chains in the Genus database with same CATH homology
 2EIM B;  2P6J A;  1K73 W;  1AR1 B;  3AG2 B;  4LBE C;  5LHG A;  1R3K C;  2WAM A;  4GX2 A;  1MSW D;  3CP1 A;  1JOY A;  4MVQ A;  3A0R A;  2PI5 A;  3RBZ A;  4ZBM A;  5CA3 A;  3PJS K;  4MT8 A;  2ZD9 A;  4WFA V;  1K5Q A;  1G4Y B;  2X6B A;  1KP2 A;  1EZJ A;  5EC2 C;  1Q86 W;  2HVK C;  2Y69 C;  3FB6 C;  1H8E G;  3E86 A;  3MHS C;  4BIZ A;  2ZDI C;  5BZB A;  3ZRW A;  5HFM A;  1H38 A;  4UVB A;  3CCS V;  2EIL B;  4GX5 A;  2OTL V;  2ZQM A;  5EC1 C;  2XAF A;  4UUJ C;  1Q81 W;  4MVO A;  4MTX A;  1LNQ A;  1IXM A;  3JCZ A;  4UVA A;  4QPK A;  3ASN C;  4PDR A;  2BOB C;  5B1B B;  1YJW V;  1Y66 A;  2EIK C;  1S77 D;  3CC2 V;  4UXN A;  1AJP A;  3ZRX A;  3CXC U;  4MSW C;  3ABK B;  2C2A A;  3LSS A;  5KUK A;  2Q68 A;  3JD4 A;  3ETE A;  4PA6 A;  2IJK A;  2HFE C;  1NQT A;  2QTO A;  5IY5 C;  3CCU V;  2IJH A;  2JEX A;  5H6Q A;  4BW5 A;  1VQN V;  1FXV A;  3OM3 B;  3CCE V;  1VQ7 V;  3CCL V;  5B1N A;  4JTA B;  1VQ8 V;  2EIN B;  1OCC C;  2Q6A A;  1KD1 W;  2EIJ B;  3ZJZ A;  5IYC O;  1Q7Y W;  3SPI A;  3W7S A;  3OAA G;  2GSM B;  1DTO A;  3TET A;  2WLI A;  2QEX V;  3IC7 A;  1B6Q A;  5EBW C;  2AHY A;  3ABT A;  4X8A A;  1SZT A;  3SYP A;  2ZR3 A;  2JEU A;  5CBF A;  3ASO B;  4R8C A;  2OCC C;  5GW7 A;  3VOU A;  3UM7 A;  2GHY A;  1SER A;  3E35 A;  4U7N A;  4YXW G;  2Q69 A;  3AG3 C;  2FTK A;  1OCO B;  4RAI A;  1KP3 A;  1V55 B;  5CBH A;  4G2K A;  4RUF A;  5HFL A;  1KEC A;  2Z5U A;  2H94 A;  1SRY A;  3K9A A;  3W7W A;  1THZ A;  2W6J G;  3CCR V;  2W0F C;  1OCZ B;  1PL0 A;  3P32 A;  5LGT A;  5IYD O;  2LP7 A;  3OFN G;  4J9Z B;  4CZZ A;  5LHH A;  4PA9 A;  3GWO A;  4EKW A;  1S5H C;  1SES A;  3SYC A;  3FYI B;  5KA5 A;  3K0G A;  3OEE G;  5B1A B;  2LFR A;  2WPD G;  4PEL A;  2P90 A;  3WFV A;  4H33 A;  2LFS A;  3I56 V;  1YJN V;  1S76 D;  3ZN1 A;  4WFF A;  1DF4 A;  2EJR A;  3AG1 B;  3SJQ C;  2WLH A;  3F7Y C;  1QVF U;  1H2G A;  1PNL A;  1J95 A;  1M57 B;  4MVS A;  3OMA B;  1NVP B;  1QR8 A;  1NVP D;  4JF3 A;  4U7O A;  3QO5 A;  5KA6 A;  5LHI A;  5EBM C;  2K1E A;  3FB5 C;  1AI4 A;  4JAU A;  4LP8 A;  3G4S V;  3F5W C;  3BEH A;  4QE7 A;  4DO2 A;  1MAB G;  4WFE A;  4UV9 A;  4Z1M G;  1JVM A;  1S3J A;  4WCE V;  1ARO P;  1K3E A;  1RM1 B;  3DTU B;  2DQ3 A;  3JD1 A;  4JPR A;  4PA3 A;  4RO2 A;  3AG2 C;  3SPG A;  1NR1 A;  2IU0 A;  3VBB A;  1GO3 F;  1JJ2 U;  4TWK A;  3ABU A;  2UXX A;  4PA7 A;  2XAJ A;  1K8A W;  2V7Q G;  3IGA C;  3E8G A;  3JD2 A;  5L3E A;  2NLJ C;  4JTD B;  1YTF D;  3GB7 C;  1R6N A;  5EBL C;  4R50 A;  3FB7 C;  4LC1 A;  2CK3 G;  5LBQ A;  1R6K A;  3DGE A;  3E2E A;  1BL8 A;  2XAG A;  3K04 A;  3HB3 B;  2B5U A;  4QE9 A;  1QLN A;  1DLB A;  1M1K W;  3ZMU A;  2EIL C;  2KB1 A;  3IFX A;  4RQE A;  1FXH A;  2DWE C;  1M56 C;  2WSS G;  1PNM A;  1OZ0 A;  1WPX A;  2HKO A;  3JD0 A;  4OXS A;  1KC8 W;  1M90 W;  1K92 A;  1VQ5 V;  4Q20 A;  1P4R A;  2IH1 C;  3SYO A;  2P7T C;  3ZIA G;  3E83 A;  3ZRV A;  3CD6 V;  4GT1 A;  5DN6 G;  4MS2 A;  2DQ0 A;  4XDJ A;  1VQK V;  4JTC B;  1KQS U;  2ITD C;  1AI6 A;  3CC7 V;  1HWY A;  1RPR A;  4UV8 A;  3SPH A;  3OEH G;  3EHB B;  1XL6 A;  2ZDI A;  1K7D A;  2EZO A;  1EBO A;  1JCH A;  1OCC B;  3OR7 C;  3SYA A;  3OE7 G;  1I5X A;  2EIJ C;  4MVR A;  3CMA V;  4LCU C;  2QM8 A;  3QNE A;  3T4Z A;  1ORQ C;  5J9P C;  2DYR B;  2X0L A;  5L3D A;  1FXK A;  2OTJ V;  2D3O W;  2X7R B;  3ETG A;  3STL C;  1F51 A;  1FXK C;  1Q82 W;  1VQ6 V;  1K34 A;  2V1D A;  3ASO C;  1E1Q G;  5L3C A;  1ROP A;  2JIZ G;  2JJ2 G;  3TK1 A;  4QIW F;  2WLN A;  3K08 A;  1QCE A;  4N21 A;  4X88 A;  1COW G;  3JD3 A;  1OCR C;  4GX1 A;  1CPY A;  1RPO A;  2WLL A;  3AG3 B;  4MVZ A;  5EK0 A;  3TCU A;  1VQM V;  3K03 A;  3AG4 B;  1M57 C;  1V55 C;  3K06 A;  3MD0 A;  2B1G A;  1NKD A;  4JGS A;  1W0K G;  5LGU A;  2AHZ A;  2NNU A;  4WFH A;  2A9H A;  5DM6 V;  4GX0 A;  1QBZ A;  2IU3 A;  2WLI B;  3B8N A;  3LUT B;  4BAY A;  1L1F A;  1R3L C;  1V54 C;  1YSC A;  2HJF C;  1CP9 A;  1RM1 C;  4QPJ A;  3LDC A;  1AI7 A;  1XL4 A;  2Q67 A;  4QNH B;  3OUF A;  1VQ4 V;  4FK5 C;  4I5S A;  4MW3 A;  3W7T A;  4CBC A;  3EFF K;  3RVY A;  3G71 V;  1NR7 A;  1GK9 A;  1PKX A;  4MTF A;  2WLM A;  2EZP A;  3K79 A;  5B1A C;  2Y48 A;  1G8M A;  4WFG A;  3X2Q C;  3T1C A;  3ZMT A;  2H8P C;  2DYS B;  5L3B A;  2HVJ C;  1K4D C;  1JX9 A;  2QM7 A;  4KP4 A;  4KFM A;  2PI4 A;  1SET A;  2DWD C;  3E89 A;  1CEZ A;  4HYO A;  2HR3 A;  4GCZ A;  3ZRW B;  4ZKI A;  2UXN A;  4X89 A;  3FB8 C;  3STZ C;  1R3I C;  1FS0 G;  4JYB A;  3WG7 B;  1JQ0 A;  4E2L A;  4PDL A;  3CC4 V;  5CN0 A;  2QKS A;  3W7X A;  1AJQ A;  1NH2 D;  3ABL C;  4XDL A;  1S0V A;  1TUE B;  1F4N A;  5CMU A;  3SYQ A;  2IJJ A;  3AEI A;  4FMT A;  2YSU B;  4RUE A;  1VQL V;  4PDM A;  2JDI G;  4I9W A;  2IW5 A;  2P67 A;  3MHH C;  3T4D A;  3ZMV A;  1F23 A;  4R6Z A;  4PA4 A;  1GKF A;  3ZCC A;  5E1A C;  5B3S C;  1MG1 A;  2BOC C;  1NBM G;  3M99 B;  1DF5 A;  1Y4M A;  1QLE B;  5L3G A;  2ZXW C;  3B8M A;  1AJN A;  3ML0 A;  4R7C A;  4TSF G;  2EIM C;  2HLD G;  2WLK A;  3CYO A;  2M7W A;  3F7V C;  2JJ1 G;  2F43 G;  4FJC C;  1YIJ V;  2JK5 C;  1K4C C;  4P9P A;  1JPX A;  1PNK A;  2DYR C;  3OMN B;  3P30 A;  1VQ9 V;  4P9O A;  1MOF A;  3K3W A;  3OMI B;  4MVU A;  1N8R W;  1VQO V;  1FXK B;  4MTO A;  4L87 A;  5L3F A;  1VQP V;  1OHH G;  2X6C A;  1M56 B;  2HG5 C;  4P2Z A;  2Y69 B;  2OT5 A;  1BHB A;  1E1R G;  4BIU A;  3D3I A;  3ZMZ A;  1BHA A;  3ABM B;  3HPL C;  4MTG A;  1GM8 A;  2DW4 A;  4G27 B;  4UVC A;  3CCV V;  2A79 B;  1K5S A;  5KUM A;  3ASN B;  3JYC A;  5C93 A;  4P30 A;  2QE7 G;  3I55 V;  2MK3 A;  3BY6 A;  3RVZ A;  4XBF A;  5IYB O;  4N23 A;  1F4M A;  1KKD A;  1YJ9 V;  4WFB V;  3OW2 U;  2B1I A;  4FPP A;  3ABK C;  3UKM A;  2XAH A;  1YIT V;  4WF9 V;  1YTF B;  1ZWI C;  3B77 A;  2WLJ A;  3FKS G;  1GTO A;  2WLL B;  1PD3 A;  4JAV A;  2DYS C;  3SPC A;  2EIN C;  4DXW A;  2ITC C;  2A0L A;  4H37 A;  1UJW B;  1OCR B;  4RQF A;  1QVG U;  1K9M W;  3AG4 C;  2W6I G;  2YEV B;  5H9C A;  1GMG A;  3D36 A;  3ETD A;  3G6E V;  5H6R A;  1H8H G;  4JAS A;  4FIP C;  1K33 A;  3E8H A;  1BMF G;  3T2M A;  2OCC B;  3CCM V;  3E8F A;  1FFT B;  3QO8 A;  3FYE B;  4KUM A;  2XAS A;  3LNM B;  1R3J C;  5B1O A;  4QJF B;  1V54 B;  3LDE A;  1QR9 A;  4MVM A;  3E8B A;  1OCO C;  1W2B U;  5B1B C;  2EIK B;  1GM9 A;  2Z3Y A;  2XND G;  1WLE A;  4J9Y B;  2XAQ A;  3OGC C;  3NXS A;  3QO7 A;  5LGN A;  3X2Q B;  5IY5 B;  2R9I A;  1W0J G;  2ZXW B;  4XDK A;  4MW8 A;  3ZN0 A;  3W7U A;  3ZRS A;  1AI5 A;  3K0D A;  4ASU G;  2ZR2 A;  5IDJ A;  1ENV A;  2EBO A;  1I5Y A;  3OR6 C;  3CCQ V;  1M9N A;  1E79 G;  3WG7 C;  1P7B A;  1YHQ V;  2IH3 C;  3R65 A;  2ATK C;  1YI2 V;  2WWW A;  3ABL B;  3KG2 A;  2QA4 V;  3AG1 C;  1EFR G;  3LSQ A;  4HZ3 A;  1K97 A;  3CCJ V;  3CPW U;  4G28 B;  4HAM A;  5FL7 G;  3OUS A;  3CME V;  3RW0 A;  3ABM C;  5CBG A;  2YEV A;  1R73 A;  3ZMS A;  2R9R B;  4F4L A;  2XOK G;  1NJI W;  3LDD A;  5B3S B;  4JYC A;  3SPJ A;  1NH2 B;  3H01 A;  1OCZ C;  1QLE C;  2IJI A;  1GM7 A;  4TT3 G;  1S72 V;  2X6A A;  4PDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...