3D3QA

Crystal structure of trna delta(2)-isopentenylpyrophosphate transferase (se0981) from staphylococcus epidermidis. northeast structural genomics consortium target ser100
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
307
Chain Sequence
b'KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Crystal structure of tRNA delta(2)-isopentenylpyrophosphate transferase (SE0981) from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis atcc 12228
molecule tags Transferase
total genus 102
structure length 307
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 3d3qA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d3qA01
2GXSA 2WJJA 2BMJA 2GA8A 5A4JA 5GJWC 4YONB 2JJ2D 1GNQA 3UWOA 2QM7A 5JHHB 1XTRA 1BMFD 3RSLA 3UIEA 3THWB 4EFLA 4LYAA 3FKSD 4B44A 2F43A 1EWQA 3NIBA 1O3YA 3B82A 3ZD7A 1QVRA 3FKQA 5EUQB 3GJXC 4RZ3A 5H1YA 4P32A 3TSWA 2GF9A 4ZKEA 1O87A 2IYQA 2QPTA 3UMFA 1HE8B 2PZGA 2VTKA 1T5IA 1W47A 1IM2A 1II8A 4AYTA 1SKQA 3G82C 5FBVB 1G4UR 2RHDA 4JVSB 5EE9A 4LV6A 1G3IA 2OSBA 4YDHB 1E2PA 3WYGA 1XEFA 3B5JA 2QENA 4RKEA 4Z54A 2ZI5A 1TL7C 5FR1A 1MABB 4C0KA 1ZIOA 3K8YA 4QGFA 1E9BA 1W0JD 5KYKA 4DCVA 1IBRA 4DJTA 5CB8A 1G6HA 2HCJB 1CRQA 4B3FX 2QUZA 2PMKA 4OHVA 5FI0B 4KFTA 4UQOA 4JBXA 3W90A 3RS4A 4DLSA 2VL7A 5CIQA 2GXUA 2ZXUA 2ZS8A 3AQ4A 2PEYA 3H2YA 1Z0JA 4TLAA 4ZO4A 3H0KA 2ZRHA 1OE0A 1C9KA 1YU9A 5DIFA 3RNLA 1G19A 3KJIA 1XEXA 4MH0R 1ZM3A 1CXZA 1RRCA 4MQBA 3IKJA 5JRZA 4RFSA 3JVVA 3SBDA 4B2PA 2I1QA 3SHFA 5FPTA 1E1QA 5AJYA 4B2IA 4HDOB 2Z83A 4DHEA 1UBEA 3K09C 1G5TA 3VKGA 2RGBA 1JEDA 3H84A 5C4GB 2DB3A 2OZEA 4Q5IA 2GAAA 1GDDA 2Q21A 1QG4A 1Z6AA 1I2MA 1XEWX 1FUUA 1G8YA 3WXMA 5B58C 3KQHA 1HQCA 4IRUB 4D0LB 2F1HA 4HAWA 4DLVA 1KI6B 3ASYA 1KKMA 1T0HB 2RHMA 1OYYA 4JSYA 4US2R 4NTZA 1L4UA 2Z43A 3K70D 1NVVR 4PZLA 2CNWA 2H57A 2VF8A 4JLVA 3DPUA 4PFSA 3I8XA 1JBKA 4JYCA 1COWD 2VHJA 1BYIA 2IXEA 1GL9B 4TTQA 4WXRA 2XSZD 1UADA 2ZROA 2L0XA 2PMDA 2WWIA 5FPKA 3T15A 3JZMA 1YZGA 3LA6A 2O8CB 1N0WA 1MH1A 4BFZA 2I4IA 2IK8A 2ZI4A 3TVTA 4HDCA 1GRNA 1Z3IX 2R62A 3MFYA 3ONWA 1KY3A 2IXFA 5FH9A 4M4SA 2Q9BA 4F4CA 3FPAA 2RKOA 5L3QA 1ZNYA 4YMVA 2J41A 2ODBA 3CNLA 1OW3B 1YRBA 4W9MC 1E98A 4A82A 2G6BA 3IEVA 2D06A 5G53C 1AGRA 4IJMA 3X2SA 1RW4A 1R0WA 4EQ6B 5JI3E 2WIBA 2YWGA 4DLUA 3UG7A 3L2OB 5EE1A 5FOUA 4AKHA 2YOGA 1E4YA 2NQ2C 2J0UB 2WKQA 4Z1MD 2GK7A 1SVOA 1W1WA 4EPXA 2ZREA 4TYNA 3AVVA 1BIFA 1U0HC 3AF3A 2O8EB 3R9WA 5CYOA 5AUOB 4DSNA 2F9LA 4QHTA 2ZJYA 4E22A 2QL6A 1VMAA 2YZ2A 4Q4LA 3SBEA 2QAJA 3C16C 1KO7A 2XAUA 3LFUA 5E4FA 3OHMA 2N1BA 1OFUX 5LD2C 4GFDA 2PBRA 4DSUA 1RRFA 4Q7KA 3KL4A 4P4UA 3U4QA 1E94E 2BEJA 5EUMA 1N0UA 2RMKA 5GVSA 3WHLA 3GLFB 2OFXA 4A4DA 3CPJB 2OM2A 2EFHB 2IYSA 4W5HA 5JS7A 3I62A 3CX6A 3AVPA 4R9UC 3OEHA 3CIOA 4NE2A 1DAMA 3QNUA 5HKKA 1FZQA 1UBCA 2P6UA 3C7KA 2A5JA 4AKEA 3DM5A 1J99A 3AVTA 1OKKD 1NP6A 4W7SA 3ZZTA 1E9DA 2JDIA 4C0JA 4KU4A 1MABA 3BH6A 3L82B 1P72A 2AK3A 3M1IA 4Q48A 4HLUC 3EARA 2IXGA 4PTLA 1AIPA 3CNNA 5IF9A 4KO8A 3I3SR 3Q9LA 3R8CA 3VX4A 4B34A 3IHWA 3SYNA 5K8LA 3EZ6A 2IYXA 5A5GA 4C0BA 4LSGA 3NXSA 4C30A 4BFUA 2IHBA 2ZE6A 2WIAA 3UG6A 2VP2A 4DLXA 4IVQA 4DT1A 5KDOA 2CLSA 1OSNA 2DFLA 2NZJA 5BQ5A 5SZHB 1DS6A 5FTLA 1NG1A 1E0JA 3MMPA 4CRWB 4Q4JA 2F1JA 3GEIA 4JLMA 821PA 4UNPA 4B2LA 1F3OA 4QRHA 2PZFA 2GJSA 4R2IA 1KJZA 5CLLA 5SZKB 5M04A 2ZUDA 1KDRA 4L9SA 2OXCA 1QHHB 3D3QA 1DAEA 2AN9A 2BJVA 3CF0A 1E2QA 2Z5FA 2XB4A 2JEOA 4NCJA 4R7ZA 3DMNA 5DN6A 3B7GA 5AJZA 1W7AA 2ERYA 5K8UA 1R10A 4O25A 5B2ZA 4LHYA 1SHZA 2W83A 4Y0AA 4AIIA 2A78A 2JLQA 4Q9JA 4G5QA 3RDPA 1KI6A 3UXMA 4LHXA 1L7VC 1EFHA 1P7CA 3KQKA 1NJGA 3QQ5A 4TMTA 4OI4A 2Q3HA 1KI3A 2W2TA 1OJLA 4IOLA 4PQRA 2V3CC 3MJHA 5JJLA 3TLXA 1GRQA 1BS1A 4YLGA 2W00A 2ZSEA 3NHAA 4IOMA 3WMEA 4BLRA 1KSHA 1IQPA 5C18A 3HR7A 1RC8A 2I3BA 1RYHA 2QBYA 4HZIA 4MRPA 4L15A 2OE2A 3K0AB 1NMYA 4Z8XA 1E9RA 1SZPA 4WAUA 3IIKA 4XWKA 1ZD9A 2H16A 2R65A 1L8QA 5EP3A 4BZXA 1CRPA 1G3RA 2O8CA 4PXAA 4TT3A 4EPYA 3V4RA 2LCFA 2JLYA 2IW3A 3F0TA 1ZYUA 1TEVA 2P0EA 3FMIA 4TMXA 5FOWA 1Z0DA 2JLZA 1J70A 1E69A 2WMOB 2CE2X 2VH5R 3GLHA 1AGPA 2FOLA 2JAQA 2V7QD 1CU1A 2C2HA 2ZRBA 4ACBA 1GVNB 1OF1A 2J1LA 1P5ZB 4A6XA 2AX4A 1EFTA 2B21A 2EVWX 5FL7A 3THXB 4Q7MB 4OHXA 3QKSB 1XP8A 3A4NA 4QXAA 3RS0A 2VLIA 1XTSA 1JAIA 2C96A 2QEQA 2RAPA 2WICA 4FMBB 5FUVA 3VNUA 2OG2A 2J0UA 3HYTA 1G41A 3WP1B 3O8CA 3SN6A 1Z08A 3QKRB 2NO7A 2FPKA 1QDEA 2ZJ2A 4IFEA 4NYJR 3FMFA 4WZAE 3RWOA 1W48A 1D2MA 1NKTA 4GRAA 3MD0A 2G0NA 3KB1A 5BN3A 4PR0A 5BXQC 1D9XA 2WWFA 3U6BA 3PITA 1EFRD 3OAAD 4HB2A 1DG1G 3K9LA 3GJ5A 2CMKA 3U44B 3P4YA 4CF7A 2IS6A 3A36A 3GLGB 3D7MA 1NBMA 2GJKA 1JQLB 1FNNA 2NZ8A 1OYWA 2VPPA 3TQFA 4NMMA 3CLVA 3QVUA 3FE2A 2YWHA 4DUGD 5D3MB 5DO9A 5FBWB 4NPHA 1E2EA 2YYZA 3SJBA 3AVWA 3PENA 1VG8A 1G5PA 2A7QA 4JYBA 4DXAA 1VHLA 2OO7A 4XVQA 3DZ8A 5E7IA 2R9VA 5HZHA 1W2GA 3THYA 1JR3A 2ZE8A 4YMSA 3ZS9A 3PUWA 1C4OA 3FTQA 5IHPA 1ZUNB 1BOFA 4OQLA 5CITA 2IS1A 2NIPA 4DCUA 3GJ6A 3U3MA 5TMPA 4CEJA 1Z6GA 3BERA 4Q9IA 2FFBA 3UPUA 5LD2B 1HURA 1MO4A 4M8NE 1ANKA 4BLTA 5EXTA 1G7SA 1MO6A 2QORA 1UJ2A 2PZEA 2V4ZA 2X2EA 4FCTA 3TKLA 3GLIB 2GZHA 5JWRA 2MSEB 2FE4A 2GDJA 1ZC4A 4PHGA 2FSIA 2OLKA 4XTRA 2WKRA 1GFIA 3QKUA 4ASUA 4JKYA 1HE1C 4XSHA 4DCTA 4U5XA 5A0FA 2A5FA 4EPWA 3WY9A 1G7TA 2XNSA 5FOTA 1A7JA 1YHNA 1EXMA 2WOJA 3AF0A 1Z0KA 3C5HA 1UBGA 4POAA 1YRAA 2QPOA 4B33A 4DLRA 4Q1FA 1ELOA 2LKDA 1LF0A 1R8QA 2OCYC 3I4LA 2OCBA 4DLWA 3QXCA 1SVMA 3KTAA 4ZCLA 3PG5A 2NMVA 1FPMA 5G41A 4B6FA 2HCBA 3KX2A 3BH0A 1OH6A 1OT3A 1G4AE 2BBTA 4MGZR 1NRJB 3SJCA 1FW6A 3T06B 4LYJA 3QVVA 4F92B 1R6BX 3U2QA 3W6PA 3O47A 1KI7A 1E2LA 1UEIA 2P5TB 2D3WA 1T9HA 1TPZA 3PCRB 3TSOA 4KI0A 4JVLA 1C1YA 4M1KA 1OHHD 1S8FA 4A92A 4AYWA 1VG1A 5FOVA 2ZYVX 4QBHA 4TL7A 1SULA 2C99A 4A0RA 4MKFA 5JMTA 1CR0A 2HXSA 2FSGA 3SYKA 1GAJA 4RZXA 5CJ2A 3K09A 3GJ3A 1FUKA 3FMOB 1QHNA 4O0MA 4WIAA 4HAZA 3PQCA 5KU1A 2VSOA 1SGWA 4QHYA 4JT2A 2KWIA 3N5CA 3K9NA 2AWOA 4XD7D 2OBLA 3TH5A 1E1RD 1JPJA 3V9PA 5JFGA 4BFSA 2JLXA 4NKRA 3PJRA 4PAOA 4D4KA 1T0JB 2RGCA 2Z4RA 3EWAA 4GP6A 1ZMXA 2JJ1A 1E2HA 1XPRA 1XMSA 4HAXA 5LB2A 3ZZ0A 3CWZA 4BE7B 3BXZA 2CBZA 2J0VA 4H1UA 3X1YA 4MRRA 3KKOA 4HB4A 2HV8A 4PPQA 3TUZC 1TUEA 1Q12A 3THXA 3ZH9B 4PO9A 5J4LA 4YMWA 4XWOA 1G6OA 1TEXA 4D2IA 1UBFA 3U7GA 3VNVA 4LBYA 1E2DA 3NTUA 3M0EA 621PA 1TMKA 3QKRA 2C04A 4MYCA 1WE2A 1X8JA 4X8HA 5AJVB 2FDCA 2IUSA 4A0GA 4US0R 4JL5A 2D2EA 1YR7A 1W44A 1IXRC 2FGKA 4QGGA 2MSCB 3K1JA 4O2RA 1T6NA 1YZQA 4A0FA 4LDJA 4QOSA 3U44A 1OH8A 4KYIB 3GLGA 2W58A 1QHIA 1E0SA 4QBFA 4UNQA 4ZKDA 3GQBA 4L5BA 5FOSA 2C77A 4RJLA 3SNHA 1ZRHA 4QL3A 4XIGS 1QF9A 5D3MA 1S1MA 1Z6XA 2O8DB 1W4CA 4YMTA 2RGEA 1YKSA 3P26A 4B71A 2O8BB 2XZPA 1JXOA 3ZGXA 4HB0A 3ICEA 2CL6X 2IHYA 4PC3A 3QENA 5JRJA 2HLDA 5CJPA 1LVGA 2FX3A 2X77A 3NDPA 5KOYA 4II7A 1H8EA 1IN5A 1A1VA 1MR3F 4N0EA 521PA 3A8TA 2CL0X 1EESA 5DI3B 1MO5A 1NI3A 3GFTA 1Z6YA 3ADKA 4TTRA 4BLPA 2VHCA 1QHSA 4RZUA 1CF4A 1GNRA 3HPRA 3I8SA 4RD2A 4TYQA 1KK2A 1CJUC 1DAFA 2JA1A 2ODWA 3B1VA 4P0TA 3GLIA 3UK6A 2CJWB 2G1KA 1CTQA 2B7CA 1W49A 1S1CA 2XNDA 4F4IA 4JLJA 3RRZA 1U0JA 3V4FA 2GKSA 5CM9C 3U3OA 3BE4A 1Z6TA 2Q6TA 2QP4A 4C7OA 3HU2A 2FJUA 1X1SA 2R2AA 2ZE7A 2WSSA 3MLEA 4F91B 4NYIQ 2QROA 3T1QA 4PHHA 1ZU5A 1GIAA 3DEFA 4Y0VA 3VR2A 3CX8A 3K53A 5KDDA 1CR4A 4LY6A 2PT7A 3GJ8A 4UNSA 1VHTA 4OL0A 1UF9A 4LJ5A 4B32A 4BFTA 2IUUA 3HDTA 1Z5ZA 4GP7A 4C0SA 2DWPA 4PC1A 2ZJBA 3TNFA 4BLOA 2XEXA 1LS1A 3K0EA 3CPEA 5K8TA 2WWYA 4DVGA 3B13B 3B9PA 3A37A 4JLDA 3VTKA 2BKEA 2BM0A 4BZPA 2IT1A 1TF7A 1E2FA 1UKYA 1ZD1A 5LPNA 2FFHA 3F5FA 1U98A 3K0CA 1KMQA 2ZR0A 1ESMA 4P33A 4D6PA 2E87A 1GSIA 2ZUBA 5IRCD 1FNMA 5E7JA 2O8FB 4RZ2A 4ZCMA 1DARA 3DHWC 4JMPA 1R4AA 3P32A 5EXSA 2NG1A 1S3GA 4N0DA 3VR4A 1N6OA 3A1WA 1G8GA 3AKCA 3WRXC 3K70C 4BEBA 3NEYA 4TTPA 4OQXA 2C9OA 3ZLJA 3DO6A 4L9WA 2CXXA 1OH7A 3IQWA 4DDVA 1Y3AA 4V0MA 4A1FA 4RVCA 3D8BA 1JECA 3KJGA 3EX7C 1MT0A 1XTQA 1F2TB 2A30A 4P3YA 4QGAA 4ITRC 3RC8A 1JEEA 3Q7PA 1EGAA 1E9EA 2JDID 5J4VA 1RKBA 2VYFA 2RGNC 1GOTA 2J45A 1DADA 3KQUA 3WMGA 2OAP1 4V0LA 1F60A 5FBQB 3EC1A 3KKMA 2VO1A 4D4JA 3L8ZA 4LC1A 4D4LA 1P4SA 5JSZA 3AP3A 4LJ6A 2XOKD 1XMJA 3H1TA 2WBLC 3I61A 1OIVA 2AK2A 2F3TA 1XJQA 3SU8A 4DIDA 4OK5A 3I5XA 3PR1A 2EU8A 3EASA 4L4UA 3B1WA 4RFVA 2EQBA 4Q1BA 4QM7A 3CNOA 1L2TA 2GVDC 3AKEA 4LHVA 3AGPA 3WYFA 2JLVA 1XNJA 4A2PA 1E9SA 1ZNWA 3TR0A 3LW7A 1A2BA 4OQNA 4D25A 2W0MA 2DWOA 2J0QA 4JZKA 1AZSC 5SZJA 1NY5A 221PA 2BBOA 2CEAA 2Q3MA 2WWHA 2ZRLA 1IN7A 2IL1A 3RVBA 3RABA 3EIHA 4GNKA 3T12A 2H1LA 3EAQA 3I72A 1U9IC 4ZV4A 1Q1ZA 3U3RA 2PLFA 3BAFA 3BD9A 3QPWA 2O5VA 1Z0IA 1ZNXA 2ZEJA 2VP5A 3FDIA 3M4YA 4GMDA 4P4SB 4HAVA 5IDVA 5EP1A 2GCNA 4WBSA 3AVUA 4L8GA 2O8DA 3E5HA 2GJ8A 2JIZA 3AUXA 3TE6A 1N6HA 1US8B 2E9SA 4PSAA 4FWIB 5F9HA 1XCGB 4PANA 4TLBA 3V00A 4I1SA 2I1VB 2IEZA 2IF0A 3PXGA 2AXPA 1M7BA 3QPUA 3C41J 4I99A 2ERXA 1NIJA 1M74A 2V55B 4KHZA 2QAGC 2OEPA 1Z0FA 4Q01A 1P9NA 2O0JA 2OLJA 4TYPA 4IEIA 3A1VA 2B8TA 3K9HA 2EWWA 4GSYA 4CGZA 3SQXA 2XX3A 3AB3A 5UKDA 3DZDA 3WHKA 4PC2A 3AVYA 1E96A 4CYMA 2QNRA 3QEOA 1KMHB 3HP1A 3LNCA 4JLOA 2J7PD 3J81k 1TF2A 4NDZA 4G5RA 4IVPA 4NBSA 4U7DA 3LXXA 4B73A 1K5GA 1FQJA 3GEHA 4TT3D 4HUQB 4B75A 5G40A 2DYKA 4U02A 3FOZA 1SXJC 3H4MA 3IPYA 3DVLA 4MYTA 1WMSA 4FMCF 2YC4C 1CR1A 1SXJE 4LJYA 4BFVA 1Q0UA 3CRW1 3QF7A 4DB4A 1S9DA 5DHFA 1P2VA 2OCPA 2KSQA 4PO1A 5KSPA 4B35A 2WPDD 1GL7A 3RSOA 1LW7A 1JR6A 1X8LA 3WMFA 3EC2A 4C3ZA 4ESHA 2YWEA 2IS2A 1P73A 5B64A 121PA 2B6HA 2K5UA 4P31A 2REBA 4YQFA 1XMIA 2FFQA 5JCPA 4Q4HA 2IYRA 3ZIAA 1NSTA 2EYQA 3AP1A 3VHXA 4C0HA 1G5RA 5BWMA 1WBDA 5G3YA 5EJEA 3IBYA 2C98A 4Q47A 3B85A 4LK2A 4MYUA 1MV5A 2HDNB 3ND9A 4XVRA 3SHWA 1N5IA 3SC3A 5JEDA 3DOFA 1VYUA 2W6JA 1NIPA 2D4HA 2XB2A 5EE5B 1GUAA 5DNYB 2O8FA 4CT5A 4Q9HA 1P62B 1XFAA 2J7KA 2FA9A 5C2JB 3RHFA 3REGA 2IYZA 3E2IA 3QBTA 3UANA 1FOEB 1FMLA 5DLQC 1OB2A 2JLRA 4URYR 2EW1A 3RLFA 1LY1A 1XX6A 1RE0A 4OQFA 2GRJA 2KI5A 5HR5A 3CRMA 2ZU6A 2CVFA 3B1XA 1W4RA 3I73A 4JLAA 3SFVA 4A2QA 1OXTA 4ARZB 5IT5A 1EFCA 1QBKC 1UDXA 3W8NA 4EDHA 2X2FA 3LXRA 4HSEA 4UNRA 1SKYB 1KK0A 4JLPA 1TX4B 4BLQA 2ZPTX 4EFMA 2TMKA 4UJ3A 4N3NA 2ZI3A 3AF1A 3KXLA 2KJQA 4D26A 1YZLA 3RWMB 2JLWA 5J4HA 3AF4A 1HH4A 1JXMA 3UATA 1SVSA 4Q1EA 5B57C 4QNMA 1XXHB 3THWA 1KHTA 3CB4A 2KE5A 1N6IA 4A0HA 2PT5A 2R6CA 4MITA 4ZIRB 1CJMA 1QRAA 5G3ZA 1LF5A 3A1UA 1UKZA 2BDTA 2WWXA 3KFVA 4KJZA 4CDGA 3K70B 4V0OA 5TVKA 3MRSA 5TXGA 1E2IA 2BHRA 5L8VA 1LV7A 1WA5A 2R6FA 3OE7A 4C0AC 1R8SA 1FX0B 1VIAA 2ASEA 2IYUA 2CL7X 1Q1QA 1PLKA 1VG9B 3QXHA 1YZNA 3TW8B 2J87A 2V9PA 3EZFA 4EJSC 4PHTA 4C4PA 4IFBA 1Z29A 4L16A 3LWNA 5J40A 4FMDF 1IOZA 5FL3A 5GJCA 1OLOA 3ND8A 4EUNA 2F1IA 2FPMA 5DH9A 5KO2A 4FCWA 4Q7LA 3LLMA 1TTTA 5E3HA 4DEYA 4AYXA 4NZYA 1G21E 1H8HD 3L43A 4LJ4A 2FGJA 4D81A 3TR5A 2ZM5A 1Z8FA 4ZDKA 1P3JA 2G88A 5TB5A 1SXJD 1HA3A 1A4RA 1W2HA 2DFKB 3CW2A 3IDQA 1J8YF 4OJQA 4AG5A 4KITB 1J7KA 1E0KA 2CVHA 2DFNA 4PC6A 3NWJA 2QMHA 2VP6A 4DWJA 2PCJA 1PJRA 3QG1A 3EPLA 3CRQA 1W36D 2WWWA 1T4GA 2KBEA 2IX3A 1U99A 2NO1A 3P4XA 1TNDA 3SYLA 2J0SA 1OFHA 3IQXA 2JJ2A 1W5TA 2QN6A 1KMHA 1NNEA 2GBLA 1YR9A 1U94A 3FKSA 5ELXA 2ZIAA 1ZM4A 5DE3A 2OV2A 4MYHA 1P60A 4OK6A 4C9BA 3VQTA 3W8RA 3ADCA 1IXSB 4V03A 3RRNA 2ZRDA 2F3RA 4GOKA 2A3RA 2ATVA 1G16A 5FPYA 4TMVA 2P67A 3CH5A 5AR1A 5CLQA 2FN4A 4BFXA 5AUPB 4AI6A 1UFQA 3NHBA 3MWLA 1G9XA 3MUFA 2QAGB 1U2RA 1ZCBA 5KDLA 3UMRA 3FGNA 3TK1A 2GK6A 3LBNA 3OIYA 4LV5B 2GXQA 1HYQA 1DOAA 1XZPA 4LRWA 3AV0B 2QTHA 4R98A 3NBZC 1AK2A 4UXHA 2G1JA 3RC3A 4EPRA 3CKLA 3WRYC 2ZVPX 1W0JA 4CEIB 3FMPB 4QNRA 3OFNA 5FUYA 5KNCA 3SJAA 3O8RA 1KKLA 3MGCA 3HU3A 721PA 1DO2A 4MUBA 2CCGA 2X1VA 4TZ0A 1P61B 1SXJB 3BFVA 2ZRFA 2XXAB 1X8KA 3KDSE 2WTUA 4NP6A 2YC2C 1OH5A 4ZI3A 2XTNA 1NSFA 3VR1A 1WBBA 3BH7A 4RD4A 1Y63A 2OBNA 5GVRA 2PL3A 4AWXA 3LO5A 1OV4A 1JPNA 4F38A 3SQWA 3OEED 3AVOA 5JHGB 1Z07A 4DSTA 2F6RA 2ZJOA 2ORVA 2VQSA 3TVDA 2IWHA 2WJGA 1Q1BA 2BEKA 3AEZA 4TLEA 4EPVA 4ZI2A 4CW7A 4EQ6A 1KTVA 4YXWD 1J8MF 4DB2A 1E32A 4LBVA 4TSFD 1KOFA 2HLDD 2B8WA 1G8FA 4PC7A 3TRFA 4IDOA 2OFOA 3VR3A 5L3SB 2ZRGA 1K6MA 5HCIA 2O8EA 5KSZA 3LQQA 4KODA 4Q7JB 1XF9A 3QKTA 4FN5A 4JJKA 3D31A 4A9AA 2C9CA 2WAYA 2W6ID 5AJXA 1TF5A 2FFAA 5L3RA 1BKDR 1XXHA 4UXIA 1AN0A 4X8MA 4M1WA 5FBRB 1NLYA 3F3YA 4GL2A 3K0FB 2XNDD 3ETLA 1A5TA 1SVIA 5KUTA 3U5ZB 4KYUA 2GJ9A 5AUQA 3RS5A 3GLFA 2B92A 5CYPA 1KSJA 5IK2D 1COWA 2ZANA 2NO6A 1FX0A 1Z0AA 2A9KA 4C0QC 2YNMA 1YZTA 1OFTA 1RZ3A 2QE7A 4KVGA 5C46F 4P4TA 2XSZA 3KKPA 4NYMR 5KTYA 1N5LA 1CP2A 1I4DD 1DPFA 1YVDA 3IEUA 3TAHA 5EZ6B 2DR3A 2QY9A 1I4LD 1ZJ6A 4GOJA 4ZPXA 3A6PC 2A5YB 1WRBA 2CCKA 1L4YA 1GL6A 2FSFA 2ZSDA 4LYHA 5FFMA 3W6NA 2QM8A 5EXPA 2ZSAA 1LTQA 2IF2A 3HU1A 3TUIC 5DSZA 4CT4B 1TQ2A 1OIXA 2GCPA 2ZRIA 3B2EA 4B3DA 4B43A 1KIMA 1E0AA 5FUXA 1PUIA 5BN5A 1UM8A 5TDHA 1UPTA 2DY1A 1KJWA 2QI9C 4BECA 1KO4A 1NVWQ 1T3SA 3ZS8A 1AKYA 1D9ZA 1HY3A 2VHQA 5FOXA 3BOSA 3E70C 1NN0A 4MA4A 1TAGA 2UVQA 4HLQB 4Z1MA 1W4BA 5BYJA 2NO9A 4LCBA 3ZVLA 4B3BA 4EJSB 1F2UB 4GDFA 1KAGA 2GJAA 3WNBA 2C95A 2ZI7A 2WSMA 4B76A 2JLSA 1EK0A 4AKGA 6Q21A 5EP4A 3TQCA 1M7GA 2FSHA 1E79D 1QHHA 3TIFA 3X1WA 3LH5A 3AGQA 3QXJA 2QQ0A 2GWHA 2JASA 3EWSA 1XD2B 1ZU4A 1R5OA 4A8JC 4EFNA 5FTMA 1TADA 3B1YA 4Q03A 1M6NA 1NL3A 4TYYA 3BWDD 2ZSBA 1G3MA 3RAPR 3Q8XB 3ECCA 1XPUA 3KKNA 4M0LA 1XJ0A 2G83A 4DDWA 2QQEA 1HT1E 3KUCA 2QT0A 2R6GA 1Z2CA 3NVAA 1SVKA 2F1RA 2D62A 3R8FA 1EG7A 3PV0A 5JCZA 1KDPA 1II9A 1Q44A 4HLDA 2EYUA 1OKKA 3BBPA 3KUDA 2WJHA 4IDNA 1OXVA 1ZD8A 4CIDA 1ZW6A 4KXFB 2YHSA 2F9MA 4CEIA 2DWQA 3PVSA 1IXZA 3QIAA 2VHTA 3KJEA 3LD9A 3RYTC 4A6PA 5AK0A 2F55A 2Z6VA 2NPFA 3SOPA 2R6DA 3K0AA 4JVMA 1XD8A 3EZ7A 4MGYR 1XB2A 4G5SA 2XXAA 4M9QA 2CHGA 3P1JA 3CRVA 2ZYTX 4A15A 4G1UC 2HJVA 4F7WA 4WZBE 4PPNA 2C8VA 5HPYB 3CUEF 1H65A 1A2KC 1E2NA 3GEEA 3TGPA 4QJ5A 4W5JA 1N5KA 4HB3A 1CS4C 3LVQE 3FFAA 5H68A 5GADl 3KQNA 3AM1A 1PUJA 3NBFA 1EFUA 2PX3A 2XJ9A 4WW0A 5FTJA 1FTSA 4EIWA 5B30A 5ANRB 3SR0A 5BN4A 1GG2A 4LJ9A 2G3YA 3QKSA 2WJYA 3QBVA 5E95A 3ADDA 4TN1A 3VAAA 2GETA 4ZCIA 1FTNA 4URXR 5DGXA 4TLDA 3ICQB 2GILA 1OXUA 1X3SA 5FTKA 3T61A 4FXPA 3EPKA 1XRJA 2VP0A 4PX9A 3GP8A 1D2EA 1VIYA 3AF2A 1VTKA 2CK3A 5EZ5A 4M9SA 3U7HB 4DBLC 3PEWA 1E1QD 2IYLD 2DCUA 2QA5A 1VYVA 2ZR9A 5FBLB 1LB1B 2GCOB 4BASA 2H5EA 3K0FA 1OFIA 2F43B 4M9ZA 3CWQA 1KSFX 3WNDA 2JGNA 3TUJC 2CCJA 3KKQA 4HEJA 1WF3A 3W3AA 2ZYWX 1W46A 3SZRA 2WOOA 1FL9A 1GTVA 3MAAC 4FWTA 2V1XA 2QP3A 3CPHA 4AK9A 1GRRA 3QUSA 1II8B 2UKDA 4R2HA 5E7MA 1AQUA 4GZLA 1IAQA 2P5SA 1Q57A 3P20A 2GEUA 3MJRA 1GWNA 1KO8A 2XITA 1U0LA 2ZQ5A 4OBEA 1GILA 3ADBA 1WDTA 2BMDA 1ODFA 2CNWD 4K8OA 4ESVA 5CB6A 1NLZA 5F2EA 1KI9A 2HT1A 1F5NA 3UMSA 4I1VA 4MDFA 3ZQJA 2V7QA 2QGNA 2BV3A 3TW4A 4BUJA 5EE3A 3AUYA 2OHFA 4XJXA 4HUTA 1N6NA 1S96A 1D6JA 1P2UA 5F9FA 1N25A 1KYIA 1N6PA 3Q85A 4M1SA 2IUTA 3RS3A 1Q3TA 1AKEA 4MUAA 2O0HA 4B74A 2UZIR 3SJZA 3R20A 4FCVA 4Q1CA 2IYWA 4C2UA 3DOEA 4LBWA 4PSKA 2BWJA 1CJKC 3NBXX 4M22A 1XEXB 1TQDA 4DLZA 3PUXA 1MO3A 4IXMA 2N46A 4RFSB 1QVAA 2IEYA 4FI3C 2QMEA 2Q3FA 4HLUA 2GZAA 2ORWA 1EFRA 2WHXA 3OAAA 1ZIPA 4OI2A 5CDFA 4LV8B 4DLYA 4W5WA 2JCSA 4URWR 1PLLA 1W0KA 2AFHE 2NGRA 3B6EA 4PZZA 1NN1A 5J4KA 4UJ5A 4DUGA 3RRYA 4TQUS 3NG1A 1GZSA 1GKYA 2BIFA 5KPJA 2BOVA 2AHOA 1J90A 3X1XA 3E1SA 4KSBA 1LNZA 4ZDIA 3I5YA 2HF9A 4JSTA 3CH4B 4OI0A 3A4MA 4QJ3A 2MMGA 2PLRA 2IBMA 3EW9A 2C78A 3WNCA 4AC9A 3JZAA 1NVVQ 3GLHE 4NU0A 4DLTA 2ZI9A 1Z06A 5JS8A 4URUR 4Q00A 4LPKA 2F7SA 3QSYA 2ZUCA 3OEHD 4A8JB 2XTZA 3IBGA 2PJZA 1G7RA 4LHWA 4LPSA 1VYTA 2VF7A 4GPTA 5HKKD 1M2OB 1E9CA 1HEIA 2Z4SA 1AQYA 4OKSA 5GJBA 4D82A 1XU4A 1YQTA 3C14C 3U3KA 1T8TA 2BKUA 1E2JA 1G3QA 2ONJA 3LY5A 1P9WA 8OHMA 2CHQA 1IJFA 1JALA 3ZVRA 3PFIA 1P6XA 5AWFC 5L3QB 4TQAA 1W5SA 4ILEA 3HPQA 5J47A 3CRRA 4V02A 4R71A 2KBFA 1TQ4A 4ZDJA 1S9HA 2QSYA 2ZVQX 1NBME 4Q66C 3TAUA 1CIPA 1UDWA 3PIRA 2FF7A 4S35A 5CIWA 3W34A 3GLFE 2H17A 3LX8A 5K8IA 3PEYA 4XSGA 4EKDA 2AWNA 2CLDX 3ASZA 1QG2A 3W5IA 2SHKA 1SQ5A 4IOKA 1KJYA 4GI7A 3B8HA 4JIMA 1OHHA 3VR6A 5EE0A 2P65A 2BC9A 1OPXA 1ZBDA 4OHZA 4IDQA 1JR3E 3TSZA 1AA9A 1D2NA 2GCOA 4LX0A 2P6RA 5KNBA 3PUVA 5KHOC 4JT4A 4DDTA 3C4JA 3KB2A 4LZZA 3NBYC 3DL0A 3I32A 3VU9B 3KJHA 2Y8EA 5DN6D 2IYTA 3U4QB 5H8WA 1MRNA 2OESA 4LHZA 1FQKA 3SS8A 1ZM2A 3BRWD 3KXKA 4XD7A 4PHFA 1E1RA 3ZVNA 4Q9LA 1R7RA 2O8BA 1DAIA 3HWSA 4GT1A 4KAXA 4QC2A 1AS0A 4AD8A 1DELA 2VRWA 3LBIA 3IO3A 3RRMA 1JI0A 3L0OA 2XGJA 2FZLA 4ABYA 4OHWA 3LX5A 4JL8A 4JBWA 2WVJA 3ZYCA 4BZQA 2FWRA 1NY6A 1W4AA 4Q4AB 5DI3A 2ZTSA 3Q3JB 1N3BA 2GF0A 4NCIA 5H70A 2YOHA 2AL7A 2H92A 1G8HA 1U81A 3OFND 4NH0A 2ZYUX 4OJKA 2HYDA 1R0ZA 4BFYA 1ZM7A 2V54A 1RFLA 4QBGB 4MKHA 2QZ4A 3OF5A 2G77B 2CJWA 3VMFA 1ONBA 1S2MA 1KDTA 4B48A 3QE0A 5DISB 2ZE5A 1SVWA 1IJEA 2YVUA 2NOAA 4DT1B 4AY2A 1ZNZA 4KBFA 1NVUQ 2J46A 2WKPA 3CONA 4NYIR 1CJVC 5JWHA 5J4YA 2ZJ8A 4U00A 5KPDA 3QXSA 4Q4JB 1T3LA 3AKYA 1ZC3A 1NJFA 3W5JA 1JNYA 4M1YA 3THOA 1R0YA 1VCNA 4TL9A 5F98A 3IILA 1RIFA 3DKPA 4IHQA 5FL7D 2ZAOA 4OHYA 4DSOA 4DRZA 1AZTA 2J3EA 1GNPA 2ZRNA 1W36C 1TUIA 3EXAA 4FIDA 1JAHA 5AJWA 4M1OA 5DI9A 2RH5A 2RGGA 1UKVY 1XTIA 3Q5EA 2EFEB 2ECKA 4LJ8A 4NCKA 3REFA 2J9RA 1E2KA 4URZR 1RRPA 3T35A 3LQRA 2OILA 4LBZA 1ZUHA 3IGFA 1A82A 3B60A 2UZ3A 1P75A 3ZQ6A 2JATA 4IXNA 1WP9A 2DBYA 3R9XA 3VKWA 2VEDA 3RS7A 3DMDA 2C9YA 1HTWA 2IA5A 2ORIA 2QTFA 1GKUB 1NBMD 1KSGA 3CM0A 5C4MA 3U7EB 4ERNA 1YE8A 3CR7A 2FH5B 2A5DA 2QE7D 2V8OA 3PUYA 4MRSA 5CK5A 2RGAA 4A8JA 2QBYB 1XTKA 4TWZA 4V0NA 4B6EA 1V43A 4TMWA 1UAAA 2VSFA 3GFPA 1F2TA 3OESA 4TL8A 3KZ1E 4IKEA 2VP4A 1JR3D 3BORA 4HI0E 3LAWA 4AG6A 2BM1A 4KCGA 2ODNA 2ZITA 4BGDA 4WA7A 2JLUA 2R6AA 3NEJA 2ZRJA 4LJAA 5DHAA 5C1BA 4TLCA 1PLJA 1OB5A 3GLHB 1PVOA 1DO0A 4Q9KA 2QGZA 2IYYA 4MGKR 4RKFA 2FG5A 5JECA 4DCNA 5JZVA 2G0TA 3GMTA 1X86B 4IVRA 4YMUA 3A1TA 3GLGE 2ANCA 1EWRA 3FWYA 4BRWA 1DEKA 4M1TA 4ASUD 4BRUA 1Q21A 2FU5C 1NMXA 3FYHA 4C0LA 1HT2E 2OBMA 2WM9B 3LRPA 3Q72A 4NCHA 3EPJA 3TJZA 2WWGA 2D7DA 1GITA 3MWKA 4I1UA 4HYYA 3IIMA 3QY0A 2CDNA 4NYJQ 2AD1A 1EX6A 5KNDA 1NG9A 1ZP6A 3T1TA 3RS2A 4A36A 3QF4B 4XH9B 5L3VA 1EX7A 1T5LA 1G8PA 4MKIA 4XVUA 4F4JA 2D7CA 1XDBA 2OUKA 2REXB 2ZS9A 3IO5A 4LYFA 3D6TB 3VU9A 4P4SA 2HXYA 1T3HA 3B1ZA 2RGDA 1P2TA 1OIWA 4KVAA 2W2VA 4Q21A 2X8AA 4E07A 3QPVA 3GLIE 4TMZA 4Q19A 1US8A 4RD1A 5FR2A 1IN8A 1KI2A 1RPZA 3B9QA 4MKGA 4OI1A 3BGWA 3CBQA 4LUCA 4AURA 1DAGA 4NYMQ 3KXIA 1F6BA 3UWKA 5JI2E 4PPFA 3LV8A 1DE0A 4D4MA 1KO5A 1E2GA 3THYB 2NPIA 1QHXA 2HYIC 4Q4AA 1BO6A 1KO1A 1KI8A 1JB1A 4K46A 1G17A 3A1SA 3IHLA 3LDAA 4CEJB 4FD2A 3VKHA 3MWJA 3VHLB 1G20E 2DPXA 3R7WB 1Q3HA 3R9IA 2J5XA 1AJEA 4M21A 2XOKA 2ANBA 1BMFA 2BMEA 1V5WA 3VX3A 5JJKA 2DFTA 3L8YA 5CDFE 4I1OA 1N6KA 2AR7A 1X1RA 2BCJQ 3EIQA 2GZDA 5LDDC 4HUQA 2JJ1D 3GPLA 3K0CC 4GBMA 4ON9A 1KK3A 1PZNA 2QMUA 2GEDA 1U8ZA 1FFHA 3BB3A 1N6LA 2CLCX 4KFUA 2RCNA 3BJIC 4PPGA 4TMKA 2ZJAA 1FMJA 4G01B 1ESNA 1ZINA 4HZUB 2VIIA 3TMKA 2WV9A 1Z28A 2EFGA 3N2IA 4JLBA 3MG9A 3N70A 3KTAB 3AH8A 1D5CA 1E3MA 4PQYA 5JLJA 2OXRA 2Z0MA 1LFDB 1CKEA 2WMNB 1CJTC 1JJVA 4Q18A 2VP9A 1DBSA 2D74A 1G291 3FVQA 3VR5A 1SVLA 4KFSA 4UNNA 4DIEA 3BS4A 1KAOA 3GCGA 5F3WB 4V0ME 1XCPA 2QT1A 4JBYA 4BFWA 3IUYA 2CK3D 2A2ZA 2YOFA 1IN6A 1AS2A 3QI2A 1DAKA 1IHUA 4DZZA 4QG7A 1T91A 2ZRCA 2GAOA 1XJCA 4JL6A 3NC1C 4G5GA 4IOJA 3DDCA 4TYWA 2ZETA 4BLSA 1W36B 2C03A 2ZI6A 1R5NA 3GJ0A 1DG3A 3M6AA 1KDOA 2KB0A 3NKVA 4G3XA 1FP7A 1NMZA 2J7PA 5GJVC 4E09A 2WZQA 3EA5A 4NCNA 4ARZA 2FMXA 4O2LA 4X8OA 1GM5A 1NN5A 5EP2A 3CX7A 4M1MA 1YR6A 1H8ED 4KFRA 4AKIA 1WQ1R 1IY0A 1WXQA 4D0GA 1XBTA 1U90A 1XWIA 2H7VA 3Q7QA 5FPHA 2O52A 4YDSA 1U8AA 3BB1A 2HF8A 5JBQA 3QXXA 4GOXA 3SFZA 2FV8A 4DKXA 2LWIA 1JQJC 1RJ9B 2WPDA 2FEOA 4ZIRA 1J2JA 1CULC 2WJVA 2ZU0C 1U8YA 3CZPA 4LOAA 2VBCA 2OAQ1 5BYKA 4US1R 1P2SA 5AUNB 1JJ7A 1VCMA 2XZOA 5P21A 2GTPA 5TY0A 2WSSD 4MRVA 4RY2A 4E03A 2WAXA 2VSXA 3X1DA 1X6VA 3K9GA 2ODEA 2C5LA 3L0PA 3NDBB 1IY1A 4B3CA 1QZXA 4LI0A 3LW8A 2RGNA 2QTVB 1G18A 3QF4A 4CZ2A 3BFKA 4B3GA 2FPLA 2V6IA 4UKDA 3C5CA 3I1FA 1E99A 2HJGA 2YWFA 1XMVA 3NH9A 1TU3A 1QHYA 1CEEA 1FP6A 1YZKA 3GJ7A 4DEXA 1VG0B 1E9FA 1MKYA 3U6KA 1IONA 2ATXA 1W0KD 1M34E 3X1ZA 1G3UA 3CF2A 1Q22A 3F8TA 1KZGB 3H86A 3LVRE 4LWZA 3T34A 3UKDA 4Z51A 5JJIA 3G0HA 3IPXA 4ZDWA 4G0NA 3U61B 3AKDA 4XWAA 4NHOA 5FTNA 2IWRA 3L0SA 2Q0HA 3FHOA 4NONA 3FFBA 2GEVA 1TU4A 3P27A 1S3SA 2PJRA 1N0VC 3SEAA 4A2WA 3K0SA 3OIVA 3RANA 1N2CE 3S1AB 3BK7A 4IEEA 4M2LA 4RCYA 5SZIA 3R7WA 5JEEA 1U9IA 4NL4H 4MDEA 1NKSA 2EFDB 1ZUIA 4I4LA 1E2MA 1YR8A 1VCIA 3U7FB 4JJZA 5EQTA 1E9AA 1R0XA 1G7CA 4FMCB 3QOFA 1KY2A 1M7HA 3TBKA 2Q9AA 4EPTA 3BIFA 2OT3B 3CZQA 1WB9A 1Q1EA 3VFDA 1HQYE 1KK1A 2QMOA 1K8RA 3NH6A 4C7OB 2R44A 1UKEA 2EWVA 1BYUA 5JWOA 3QEJA 3SE0A 4LC0A 3PEUA 4MGIR 4RCZA 4B3XA 2MMCA 1G1MA 3Q5DA 1KI4A 1KNQA 4HZUA 5DYIA 2QAGA 3T5DA 4BPBA 3EA0A 1VCOA 3PEVA 2QRZA 2XZLA 2XTMA 2AD5A 4BEJA 1F48A 2YJTD 4OYHA 4LGMA 2QP9X 3W3ZB 1Q20A 2GNOA 2P3SA 2BMFA 3AVQA 2O0KA 1N6RA 2AXNA 4WOPA 2GESA 2LKCA 1H8HA 1DAHA 3EG5A 5BW8A 1ZAKA 1RVDA 2FEMA 2J59A 5D3QA 4CEHB 1SXJA 4DDUA 3I92A 4KLNA 2GXAA 1ZM9A 2IYVA 3QG5A 5FI1B 4JLKA 3BFXA 4M53A 4H9GA 1IY2A 1R5BA 2EFCB 2ZR7A 1D8TA 4TQ9A 2QU8A 2PEZA 4XTCS 2YINC 1OXSC 1VPLA 4N1AA 4OK3A 4QHSA 5CM8B 2WJIA 4PO8A 3DM9B 4KLZA 2JIZD 4IDHA 1ETUA 421PA 1QHGA 5HE8A 1HUQA 1RYFA 1SHKA 2XJ4A 3L0IB 4DC9A 2G9NA 3MCAA 5HCNA 3GJ4A 3T1VA 2HEIA 3FHTA 2NTYC 2PH1A 5TARA 2D2FA 3A4LA 5L3SA 4I81A 1B0UA 1DTSA 3HR8A 1G64A 4TL6A 4Z8YA 1OXXK 4PSVA 1MOZA 4D80A 4XOIA 4MRNA 4D0NA 5JSZB 2QPAA 1CLUA 1RJ9A 4WXPA 2B7BA 3KQLA 1ZCAA 3HJNA 5LB4A 2OCAA 4QGHA 2CE7A 2QG6A 3JVUA 5LBIA 2P2LA 1XCMA 2AKAB 5HE9A 3LBHA 3N2EA 4C2TA 3W6OA 4YC7A 5KSOA 2IS4A 2BVNA 1RRGA 5DYGA 1WCV1 1BH2A 2YV5A 2Q9CA 3PUZA 1R2QA 2W0SA 2QRNA 4RD3A 3QJYA 4FMDB 3CR8A 1LS6A 1VDZA 4S2EA 3CO5A 4QM6A 1M1YE 4J0QA 2HT6A 3OIWA 1YJ5A 1XPOA 4QBIA 3ZD6A 4PAMA 3EIEA 3DKVA 1KI1A 4DCSA 2BCGY 1NN3A 4BQSA 4UXJA 1NVXQ 2BJWA 1Z2AA 4JS0A 4BWYA 3OEEA 4CVNA 1UEJA 2GBLC 1XD9A 3ZIAD 1CR2A 1DVRA 2R8RA 4WVFA 1PV4A 3EPHA 4LJ7A 4B47A 4PQFA 3CF6R 2JJ8A 2ZRPA 2ZS7A 4F93B 3OZXA 3A58B 3ZDQA 2BBSA 1AM4D 2IC5A 3B78A 3FB4A 1Z63A 2E1RA 2H18A 2PCLA 2W6JD 4YXWA 3MWYW 3BB4A 1CBUA 4TSFA 3WYAA 3ZVMA 2X19A 1NF3A 2NO0A 2QSZA 4HDQB 2AKYA 2FNAA 5EXXA 4EJSA 1F2UA 3S1AA 1S0UA 5J5CA 2VHUA 3T1OA 4TZ6A 4WZ6A 3KFXA 1Z47A 2ZJ5A 4O3MA 2V6JA 3AVXA 1YZUA 2W6IA 3LLUA 4RSGA 2PX0A 2W2XA 4IW3B 4JVNA 4RD0A 4URVR 3O8BA 1KZ7B 3BC1A 1I2DA 2ONKA 2ZRMA 1XD2A 1Z83A 2H8KA 1IN4A 2REOA 1XTJA 1P9RA 4KBGA 2ZRKA 1VECA 4HATA 4QFMA 4KV9A 5IK2A 5CK4A 1E4VA 2RB4A 4EAQA 3WBKA 4G5OA 4GMXA 4HAYA 4V0KA 3SI7A 3GD7A 3IIJA 2FZ4A 4E5UA 1NLFA 3WP0A 2OFWA 2RGXA 3AP2A 4ACAA 4Q1DA 4PZYA 5FUWA 2YKGA 3WBJA 2GHIA 1TQ6A 4IDPA 4FINA 1T8UA 1N5JA 2ZJZA 4HAUA 1ZVQA 3ZJYA 2V1UA 4QJ4A 1B23P 3NC0C 3U3JA 1E6CA 3U60B 4K81B 4Q4HB 1S4QA 3OE7D 2N42A 1II0A 4QKQA 4KSCA 2ZSFA 4CEHA 1GP2A 4OQMA 3SDZA 1VKJA 5HZKA 1I4TD 1SKYE 3ZZUA 1K5DA 5TV2A 3O8DA 1GKIA 4H1VA 1XEWY 1Z22A 4JKIA 1HV8A 4JLNA 1M8PA 5HTKA 3GFOA 4X8LA 2ZAMA 4PAQA 4RD6A 4Q1AA 1XXHE 4Q02A 1KNXA 4GZMA 2MSDB 3HYRA 3C15C 3EZ2A 3FHCB 1MRSA 3OIUA 1E79A 2HUPA 3W9YA 4FW9A 2A5GA 3MSXA 3EZ9A 4M9XA 1KGDA 1XZQA 1AS3A 2DHRA 2P6NA 2ZRAA 2VA8A 3C8UA 3T5GA 4HLCA 5KSYA 2BBWA 3G5UA 5FPSA 2GVZC 2CHVA 2AFIE
chains in the Genus database with same CATH superfamily
3I52A 1PN3A 4YONB 1BMFD 4J9VA 2R96A 4BO2A 1Q16A 2A1TR 4C7MA 4HGNA 4P32A 3B2EE 5JSQA 2Z9DA 5LUAA 4GR4A 3ZS8C 1FY2A 1T8RA 4I0XA 1GT6A 1M2VB 2RJ3A 5DSXA 3FLBA 3K8YA 5H82A 4M7OA 1O5IA 4OHVA 3LCRA 3W90A 3OX2A 1NF8A 3ZW9A 2BHSA 3QFTA 2CF5A 3S8YA 3KPJA 3P2EA 3F74A 4MH0R 1RRCA 4RFSA 4Y67A 1PT5A 5F51A 4HDOB 1UBEA 3EW7A 1FJGO 4FZ5A 5CD1A 3AY7A 2DUMA 1QG4A 5IFLA 1JZQA 1HQCA 1Z35A 4JSYA 1OYYA 1Q1AA 4WN3A 4FKZA 2R4TA 2J4DA 3PHLA 4Z9AA 3OZSA 2XSZD 1N33O 3I9MA 4D7SA 3JZMA 1YZGA 1WUTA 2FX2A 3KVVA 1GRNA 1Z3IX 4MAFA 1HGXA 2ODBA 4A82A 2G6BA 2D06A 3IEIA 3ZHSA 3PC7A 3WIVA 1BFKA 3RVDA 4N7JA 1DU4A 1E60A 1INLA 3CC7V 1VLMA 4QHTA 2FPWA 4BNJA 3NAZA 4L72A 1SUBA 1WNSA 1A9YA 1T3GA 3WBBA 1CUCA 3GJTA 1DKMA 2QLTA 1S0VA 1WUHS 5LYJF 1E9DA 1X77A 3IH5A 4LF8B 1NGSA 3OCUA 4HJRA 3MELA 5EIBC 3WMWA 2RH4A 4JYPA 4EG7A 1Z33A 1Y6ZA 4J94A 3KKZA 1A9SA 2A94A 3IR7A 2ZE6A 2D1TA 1GA4A 4G8CA 1SK8A 2O1WA 1JOYA 5SZKB 1XEQA 1TIKA 3B3FA 4GM0A 2E49A 3D3QA 4PHZA 2DRIA 4CMCA 3ZXIA 1SXIA 3KE8A 3FCEA 1PR2A 4GF5A 4I4CA 1KI6A 3HFSA 3W5DA 3HI4A 4FFRA 2VDMB 1A7UA 3BIWA 3BK2A 3TLXA 3EOZA 2W00A 3KPWA 1KSHA 1QDUA 4R1QA 1C9YA 3SJ7A 4J0DA 1L8QA 1G3RA 3ITKA 4EPYA 3JQ9A 3PSAA 2IW3A 1Z7GA 4YUYA 1ULAA 1N1EA 2VH5R 3W78A 1AGPA 3N7AA 1WKCA 2ZRBA 2C7PA 2Q4OA 4JB3A 3CLUD 5BN4B 4P53A 4NULA 2CXTA 3RS0A 5M5BA 5HM8A 2ODPA 4LXYA 5TPWA 2FPKA 1VL0A 5BSGA 1FRVA 4GWLA 4N0MA 2J9GA 4JC4A 3PITA 3EUAA 1YS7A 1ISHA 3E4CA 4DNFA 3D7MA 4HQOA 2NZ8A 1OYWA 2I6GA 1PDVA 1G5PA 3VMMA 1GCUA 4BFLA 1AY0A 4KK3A 3J80A 5HZHA 1JR3A 4KQJA 1FDVA 4JYAO 4N6GA 4WADA 1AT1A 4DCUA 4CEJA 2HK9A 1P1CA 1NU1H 1UJ2A 2V4ZA 3UHJA 4ASUA 1OC2A 1NAHA 2XT9A 4DR2O 4O5AA 1LCIA 3ESRA 3OT1A 4B33A 2NR5A 1GN6A 4DV6O 2WE7A 4ER6A 2HCBA 4J43A 3CHYA 3V1UA 3EPRA 5IJXA 3IAAA 1I08A 4KSYA 4M1KA 5ER9A 4ID3A 2ZYVX 1N2JA 5FLXN 1YULA 4KPUA 1JYSA 5DNDA 2C1EA 3OTFA 3VSCA 4RZXA 2VDNB 4HAZA 3N5CA 1W6RA 4CI9A 3KUXA 1VJDA 1HR0O 4HRYA 2JGDA 1QS0B 4Q3AA 4GP6A 2EC5A 1V0JA 1LLDA 3GGGA 4MMXB 4LJSA 3TLGB 3HDQA 5DLPA 4YAFA 3VR4H 5TVGA 4NWIA 2AQIA 1ZKDA 4FJ1A 4D2IA 2F4NA 4DMKA 3DAFA 4CMJA 3QKRA 1OBHA 5KLVH 3QYJA 4A0GA 4JF3A 1TCAA 3A1DA 3M7MX 4QBKA 2YMLA 3A7EA 1OH8A 2DKOA 3GQBA 1OGJA 1H1LB 3ISVA 1TO6A 3HI6A 2G9ZA 3HY3A 3JWPA 3OQ6A 1GZVA 2RDCA 1MR3F 4U7PB 521PA 1MO5A 4LZJA 2X76A 1E66A 1LA2A 4XLZA 4RIGA 4OA5A 1Y1KE 3HWWA 3EH1A 3RE1A 4H31A 1CUJA 2XAAA 2ZE7A 2B36A 3DEFA 4KUGA 1JTEA 5KDDA 3D64A 4U2CA 5JNVA 5KZMB 4MEJA 2FG7C 1YH3A 2P4QA 1COWG 2GCIA 4W99A 4Q3LA 2IT1A 2RN9A 4IWNA 4DWVA 3GT0A 3WBFA 2I9PA 4L2IB 3FYUA 3KE9A 2JVDA 3DHWC 1Y4UA 3M70A 1ENOA 1RI5A 1JHZA 1Q11A 5JD3A 4L9WA 5KU7A 3L02A 1OY1A 3IGAC 3SQMA 4FGWA 1Y7HA 5IWAB 3MT9A 3WL3A 3H1HH 4DV7O 4HFMA 5FBQB 4AU1A 3LF2A 1ULBA 3S5JA 3TRJA 1ZMOA 2WBLC 2AK2A 4TTAA 5T67A 4YCDA 1XJQA 1PG0A 2XGGA 4L4UA 1HE2A 2BGKA 2VYND 3ED5A 3L79A 4BX9A 2FX5A 3G0BA 1AZSC 5CEFA 5SZJA 4MVJA 3IKTA 4K87A 2ETXA 1SELA 1MB2A 4HYOA 3ZWPA 4ZV4A 1XVUA 4CMAA 2VP5A 3LLCA 1HTTA 3VJMA 2GCNA 4FK5C 2HO5A 2HA6A 4OB6A 5LMNB 1THGA 2E9SA 5ES3A 2VJOA 1XELA 2Q3LA 2Y93A 3C41J 2FQQA 4RHFA 2OEPA 3ZHCA 3A06A 2HXGA 5CNJA 1AMOA 4TT3D 1U5BA 4ND1A 3HY4A 5HF9A 2C83A 1F0NA 3VYUB 4OU4A 3KR2A 5LP6A 5DK4A 1XNQB 1P2VA 2WPDD 1Q6ZA 3BPZA 1XFDA 1XMIA 1I7FA 1P5JA 5FI3A 3E9YA 2C98A 1JSLA 4TN5A 3RAGA 4XDKA 3VAYA 4L8LA 2OBYA 5CXQA 2FA9A 3BMCB 2JLRA 2C4MA 4EWLA 3CCVV 3ZI0A 2HG5C 4MVSA 2VT6A 2ZU6A 2PMWB 1A50B 4TKLA 3RVPA 3QUCA 1W4RA 4IP0A 4NH4A 4KYTA 4DQDA 1E3QA 3ES9A 2ZI3A 2BSKB 4D26A 3ABRB 3MN1A 3B8MA 4MITA 1LF5A 1V95A 3OD4A 2DUJA 2IXDA 1LV7A 1PZGA 3ZWCA 4EVSA 3NJRA 5FJJA 1R4MB 3JSAA 1Z6PA 3BG5A 4MO2A 2GYWA 3AWDA 4FCWA 4Q7LA 5GQSA 3L43A 4R2KA 4Z0PA 5A6SA 1CQIB 2OXIA 2DFKB 3OZVA 1Q0LA 2GHYA 1W36D 1CVIA 7YASA 3N6RA 4HS9A 3GBSA 3MXOA 1QLHA 2C20A 1FE8A 2ATVA 1R4NA 4TMVA 4DJEC 3R8XA 5HOQA 1JDBC 5TF4A 1UXKA 1XZKA 2ZVPX 3L75H 1W0JA 3ZLBA 4AAYA 4BW9A 4RVNA 1DKUA 4B87A 2W6NA 1GXSB 3QWIA 2XMDA 4II3A 3BFVA 4N23A 1O94C 1OH5A 3VUEA 3BH7A 1Y63A 3A7DA 1PFUA 2X4LA 2QWQB 3U1TA 1ZUD1 2ORVA 3DSRA 4N03A 2Z2IA 4FNMA 4KDRA 4WOJA 4CW7A 3T3GA 4HGOA 4M0MA 1O6FA 2HLDD 3M7IA 3R24A 4DQLA 4KNVA 4QU5A 2GD1O 3DOIA 3QKTA 1ATIA 3PNQA 5AM2A 4UXIA 2CXUA 3RFXA 1T36A 2EWMA 1A5TA 3OLXA 3RS5A 2B92A 1OLUA 3KKPA 1WA8A 3QTCA 3WHPA 3ESZA 1DC5A 3FCOA 3UT5A 4GOJA 1FMFA 2QZSA 3MGKA 2JHPA 4OIFA 2FPSA 2PZ8A 3QWFA 4LHSA 1OA0A 4NR1A 2EF0A 5FUXA 4AJ2A 1ULZA 3PC6A 5IABA 3OWXA 2XMRA 3DMGA 4M76B 3HKDA 4AKGA 5CA3A 1OCCB 3OX1A 3EGVA 3KB6A 2FSUA 5CG2A 3QXJA 4ZVLA 1CY2A 2XVZA 3L8DA 5FTMA 1HNZO 1PG5A 3KKNA 3TZKA 3K31A 2PGXA 4I08A 1UPUA 2D62A 1II9A 4J0GA 3PDIA 2BFBA 1N8RW 2VT7A 2WSYB 5BURA 2CYCA 4DIFA 5ICSA 4RQTA 3MTBA 4MGYR 2XXAA 3P1JA 4HD8A 3FHLA 5LXTA 1IVNA 1EFUA 4YQZA 2G3YA 2GZRA 5E95A 3DBVO 2GETA 3GEPA 2ECPA 3NHRA 4P58A 3O1LA 3L4BA 4D56A 3I1IA 4N6OA 4INPA 4Q93A 3KTDA 2CCJA 1QZ3A 4D99A 3TO5A 3L6UA 1FSFA 1EN4A 1J23A 3BMXA 5AW0A 2V5VA 4B3TO 3HXPA 4RL6A 2IH3C 3FNBA 4RY0A 1SU4A 4ZO6A 1TVCA 4J29A 5LGUA 3E1KA 1F5NA 3BJRA 4LZWA 5EE3A 5JSUA 2QV0A 5U9CA 4PYOA 3WGVA 5IAOA 4DY4A 3LIIA 2QJRA 3UW1A 4XIFA 3G8BA 5KAIZ 4DXWA 5IE9A 4HAMA 2EOAA 4OQZA 3TLJA 1N9GB 1AI6A 3EBPA 4X65O 2PZBA 1NN1A 1DOHA 1Z56C 3TPCA 3PUKA 3X1KA 1XQYA 2BOVA 4V2UA 3N6VA 1I9GA 2P9EA 2UU9B 4KSBA 3I5YA 1Z18A 2W8BB 3M3PA 3J7AU 1QGDA 3ECSA 2D8MA 1XDSA 4LPSA 3EHEA 1YE5A 1M2OB 1HEIA 4MPTA 5GJBA 4D82A 4ITUA 7ADHA 4YCCA 3DH0A 1W5SA 2IJIA 3AOEA 3SR3A 4F4DA 3FFTA 1ZSNA 2M7WA 4GXNA 2AWNA 1RI3A 4DVJA 1NI4B 3CRNA 3L77A 3FUTA 1JR3E 1L5HA 4JT4A 1K5HA 5JU6A 3GRRA 4LZZA 4DA7A 1LPSA 1YAHA 5F64A 2RMKB 1ZM2A 2GBFA 4BIIA 5LN1A 2EULA 5FA5A 2BFAA 1K3EA 1TJ3A 4BNUA 3TI7A 3LBIA 3RRMA 2XGJA 1OU4A 2Z8XA 4JBWA 2WP0A 3C70A 2GF0A 1I6KA 3K30A 4R05A 3SJCC 4UD2A 4C6SA 3R9KA 1RXUA 3ZCXA 1KDTA 2P06A 2GCEA 2ZE5A 2Q1SA 4JDUA 2WT8A 3PGLA 3DMYA 2UXCO 4MRMA 1ZL8B 2VOJA 4Q4JB 4AY6A 4CKBA 3RUFA 1LPPA 3OPYB 1RYNA 4OHYA 3IILA 3LFHA 5FL7D 4EK9A 1XZ8A 2YEVA 4EFEA 4UCVA 1RLTA 3AINA 2FB9A 2UYHA 4YO7A 1TJPB 1QV9A 4HMPA 2HC9A 1CQXA 1GKFA 2WIFA 4KN9S 4D43A 4PSUA 1F1BA 1JPVA 1J07A 1XTKA 3AETA 3ANMA 4CDMA 3FCAA 1ZSVA 4V0NA 3GFPA 3OESA 1CR6A 3F98A 4KCGA 2AZ4A 1ZO8A 1M1NB 2FP4B 2R6AA 4FEEA 4ND4A 5JECA 5F7JA 4KJXA 1X86B 3ESQA 4BRUA 2Q68A 1U2GC 1K2WA 2QA4V 1EX6A 2PKWA 3LX6A 1YUBA 5DEOA 2LCQA 3VZCA 2OUKA 3IO5A 3GFSA 4E11A 3LOQA 1P2TA 4MAMA 2AN3A 2R11A 5FR2A 3ORHA 2BTQA 1ZK1A 1RPZA 1B26A 4PPFA 1W34A 2BGIA 3FAVB 3IHLA 1XNRO 1YJWV 3OBIA 3R9IA 1AJEA 4WSOA 3E81A 4WJZA 5CDFE 2DBQA 1M2EA 4HUQA 1E89A 3K0CC 2XECA 1OMOA 1N2BA 3OUFA 2CEKA 4YV1A 1ODJA 4L4ZA 2OXRA 3O93A 3IOMA 2I34A 1EUCB 3I55V 1JVSA 1F3LA 4GZRB 2FSPA 3VYRB 4I50F 4AMGA 4DMMA 4MQFA 3VTAA 2CTPA 4QG7A 4BVHA 2B82A 1AB3A 1CUAA 1YA8A 3QV2A 1QGAA 1B7GO 3E3MA 1JQEA 1QLEC 1NMZA 2QTNA 4FVTA 5TRTA 1NUTA 4UHBA 2VG8A 4MVJE 3BREA 4R8VA 1WW8A 1RJ9B 1Z36A 2X7JA 1GYRA 4QRDA 1I4OA 4GX1A 5M34A 2O20A 2KQXA 5B1EA 6REQA 3GT3A 3NH9A 2XH8A 2VNSA 3KEMA 1QP7A 4O1HA 2QVXX 3G0HA 3HDVA 3AKDA 1AXGA 5K3AA 5IPFA 2C5EA 2IE8A 4GC9A 1TLFA 1WVMA 4MQ5A 1ZITA 5DKFA 1A8QA 3PQ4A 3C3YA 1U9IA 4CV1A 3JZIA 2UZ0A 1JILA 5TQ2A 3TECE 5DWQA 1A2QA 4O4LA 1KK1A 1MH9A 4C7OB 1NQOA 2EWVA 5DGCA 1UQUA 4CBCA 1HEUA 2H4ZA 1EI9A 4AQDA 1KI4A 2QTCA 2QAGA 5EMMA 4DV2O 3L5KA 2XTMA 4JY7A 3W3ZB 4AROA 3D7SA 4RHUA 4CF6A 3IUNA 5B4TA 2Y4OA 4NV3A 1EAYA 1S4MA 4F3CA 1KJNA 2WJIA 4RLFA 3DWFA 3UJ8A 3AZPA 1ABFA 3MCAA 2QEXV 1H9BA 1A8HA 1J8FA 2MYPA 1GU1A 1OLSA 3EQ9A 1JJAA 2P9QA 1ZN8A 2PZJA 1AZLA 2JFVA 2F23A 3FRHA 5LB4A 4QE7A 1EWKA 1U1DA 3CQ9A 2CE7A 3DAYA 1ECLA 2E7ZA 4XQ0A 4FMDB 5TJHA 4JD5A 2OHVA 1XPOA 3PQFA 5M3BA 5BY1A 4LW8A 3GLVA 5KWEA 1CR2A 5HTOA 1RYYA 3P45A 4PQFA 5B53A 5CBPA 3ZDQA 4WECA 4IH1A 2E1RA 4AZ0B 1JYEA 2HHHB 2HPAA 4TZ6A 3KV1A 2ZSJA 4RSGA 4HYTA 4ZZ1A 1YV9A 3R75A 3T7JA 4OHRA 3ZDCA 1P9RA 1V5EA 2ZRKA 4R40A 5IK2A 3CH6A 3SI7A 4V0SA 3G8CA 1XREA 4PNEA 2VEOA 3TN7A 1AUXA 1MVNA 3TE7A 4LOKA 1M56C 1ZUWA 4DL9A 2RBEA 1I1NA 4XYLA 4G1EB 1GZUA 5BWCA 1G8SA 4BXOB 4HXFB 4M46A 2EX3A 3IVMA 1RHMA 1XEWY 1HV8A 1QIHA 2Q46A 5AVXA 1GQQA 4Q1AA 5KOHA 1EDZA 2BFMA 4DRXA 1NBHA 4FW9A 2P4HX 4QSHA 1VRWA 2JB9A 1JEQB 2OORC 3W5BA 4WZBB 3T0GA 1R6KA 3RSHA 4R8LA 3IBFA 4MV4A 1JNXX 1XIVA 4LYAA 2DCMA 1YHYA 4MCIA 2AT1A 1IFXA 4DUYB 1K27A 1O87A 1T5IA 2D59A 2PV7A 5CT5A 1ZH8A 2YRFA 3I9V6 3W1EA 3NIFB 4QGFA 1SOUA 5KJEA 1V26A 4F8EA 3IQFA 1W85A 3X2FA 4KFTA 4JBXA 3RS4A 1J0AA 5FUMA 1HFEL 4UZFA 1RXYA 2JGIA 4RTNA 4ZO4A 4YCLA 2ZRHA 3FDJA 3H3FA 1LDYA 1ZM3A 2HJ9A 2ZM6O 5FV4A 1O4WA 4IO0A 4LDZA 1ZUQA 3SXUB 2I7DA 4XR4A 5I5GA 3K09C 2RGBA 4ROTA 1U6IA 2DB3A 3B3AA 4Q5IA 5H6RA 1V71A 5B58C 1FXVA 3DBLA 4GX5A 1D2GA 4US2R 2H0QA 4I4NA 2JIBA 2Q50A 4Q9DA 2YNMD 1LPNA 2WWIA 1ZK0A 2YXYA 5JZSA 2PVSA 4IIGA 3GUHA 2VJMB 2I6UA 3HC7A 3PNYA 1KY3A 3JQAB 2V45A 4M8SA 3Q3HA 2J41A 3OH8A 5NLLA 1EMDA 1YSCA 4BDTA 1JRLA 4QAQA 1MB4A 3SLRA 4IH4A 5DU2A 4OCZA 5IC4A 1EE2A 2QL6A 4NHEA 1KO7A 3MUOA 3PSHA 1QE5A 2ZUEA 3Q3IA 4YAKA 3GD5A 4S0ZA 3NPAA 1XMPA 4N76A 4CMHA 1T29A 3UJBA 3GLFB 1O8BA 2XQFA 3QVOA 1Z0ZA 3CMCO 1I2BA 5AXCA 2DX7A 1R5JA 1SXHA 1PGJA 3C7KA 3ZY3A 1OKKD 4ER3A 2J0EA 3LTEA 4BO0A 5HGXA 2H1SA 2FWBA 5IVHA 1AGNA 1D5AA 4UM8B 3PDUA 2Q7DA 5LA6F 3BF7A 5K8LA 3EZ6A 4IX9A 2QD2A 2O7RA 4XVHA 4DT1A 3QO8A 2DPLA 3IA2A 2E48A 1NW4A 1UXIA 5KHHA 2IU0A 1KJZA 1YVPA 3ZD9A 4AZVA 4HXYA 3ZNNA 1DMRA 1P7GA 1YFJA 2E4ZA 3H1BA 4W5QA 3LZDA 4FS3A 4O2BA 1SBCA 4LHXA 1SBNE 2OHOA 4PQRA 2WWTA 1SN7A 1RYHA 1E9RA 1ODIA 3VQXA 1Q3KA 3KSZO 4DMGA 3EOBI 5KMGB 4I7EA 4FIZA 2DTXA 5AKIA 2EGGA 4F5WA 1D1TA 1E7YA 1U96A 4UOEA 3HYTA 1CRWG 4DXDA 4GOOD 5CEJA 3SPXA 2ZIVB 2M98A 2E4YA 2EIJB 1GUZA 4ZN6A 2XE6A 2BUBA 4NMMA 4XBFA 4FS8A 4M7PA 2IV3A 1CV2A 1E2EA 3AEUA 1WKBA 3THYA 4ZYWA 3A04A 1OCZB 2IS1A 4HFNA 3R5JA 4JI5O 2OHXA 3PRYA 3JAKA 3GZNB 1A9RA 3K7EA 3HFJA 4HN2A 2NACA 4PHGA 3RKRA 5EIOA 1FDRA 4JKYA 4AO8A 2V5AA 4QFBA 4Q1FA 2A6PA 1Z4KA 3O95A 4AZTA 1VSTA 3ETJA 4OHFA 3K20A 2NMVA 4FGZA 4Y2UA 4P7BA 4BBZA 2QX8A 4ZVKA 4MV8A 4IDAA 1E2LA 4BCCA 5GZ3A 2P5TB 1VDMA 4AYWA 5KNLA 3IJEB 4EH1A 3G13A 1CIVA 4WIAA 1NXWA 4OHMA 1E2HA 1ONPA 4I4IA 5HKLA 1X1TA 4WCFB 3HJFA 2AI1A 4IUBS 4H7JA 1TUEA 3IHKA 3TNYA 4M9UA 4B3MB 4D9HA 1E8DA 3ZE8A 5FB3A 5KQRA 1RI2A 4CIWA 4I3HA 2BI8A 1BDMA 1CK4A 2Z1NA 2A1IA 4US0R 1H2WA 1B3RA 3LKVA 2FGKA 2Z04A 2MSCB 4IUYA 4Y2TA 1X9GA 2AW5A 3LYLA 4DWWA 4QBFA 1QF9A 5IT9N 3TEFA 4JR1A 1ZOSA 2XZTA 5DVZA 4DV1O 2WNSA 1QWOA 3I9FA 3ZGXA 2IYEA 1C1DB 1MAVA 2JBAA 4RZUA 3SEFA 2O5EA 1CJUC 3PGXA 3KYDB 3B2QA 4F4IA 1KFBB 4GR5A 4DNPA 3HCEA 5CM9C 1GPJA 4F4UA 3FUXA 5CBFA 3Q6IA 3MLEA 4V1CI 1BXGB 1N2CB 4NYIQ 1UFRA 4NEHB 4RPKA 3VR2A 3I04A 2UXBO 4L73A 2XKJE 3E5NA 1J6UA 3KQVA 4A16A 4BFTA 3IC9A 2DWPA 2VK2A 4CKCA 4BLOA 2PS9A 3OE4A 1PT8A 4BZPA 1SQBH 1E2FA 3CZ5A 1V8OA 3DT6A 3DMRA 3ZDBA 2FFHA 1WDWB 5C31A 2H2GA 3L0DA 1GSIA 3KQSA 5DRYA 3UJPA 3G2QA 2ZKOA 1PRYA 4RZQA 1QGED 3LRXA 1MPXA 4LXTA 5F2KA 2HHCA 3QI7A 3ZW8A 5EPUA 1J09A 4A1FA 4JQZA 1IMOA 5IM4F 4Y2RA 4NQRA 1DAOA 3I53A 1FB5A 4X6UA 1JIUA 2X0DA 3X2QB 1SWWA 3S44A 3B1JA 1NFQA 2RK3A 3HB7A 3SU8A 3U09A 1PNLA 2EU8A 2GVDC 2R8EA 2OOSA 3LW7A 2WFLB 2XVAA 2WLHA 3WK4A 1EXWA 221PA 1IB0A 1G60A 4CLOA 4Z53A 3QU4A 3VA7A 3EVKA 3FDIA 1YAJA 2PUFA 5EMNA 1N6HA 1US8B 4FWIB 5F9HA 1QR8A 2I1VB 1EFPA 1M7BA 1V1RA 1IN1A 1IHOA 3T7RA 3MNFA 4KHZA 3N8HA 5FA6A 1YCGA 3PJGA 3CD6V 2DTDA 1JFRA 2X9NA 1VPEA 3NNDA 1AHPA 2J7PD 4IVPA 2P6JA 4ZOLA 2XRYA 1OU0A 4P7KA 1T9CA 5LCXA 2ZR8A 3G9XA 3EFOA 3OOYA 3DJYA 2OHHA 4LJYA 4EHLA 4BFVA 3MCVA 3L7IA 2J9ZB 1GL7A 2BD0A 3RSOA 2PGJA 4RTSA 4JDPA 4L6IA 2BRUA 1JR6A 3WMFA 3UFBA 3G2LA 4Q3DA 3HXTA 2Q2OA 5EJEA 3IBYA 3ORYA 4GRDA 3TKAA 5I4IA 4XGQA 4Y8VA 1J5PA 5IBCA 3F7VC 2A14A 2HM7A 3RHTA 4AG3A 3QBTA 4BQOA 1FMLA 5DLQC 4URYR 4IWYA 4D4IA 2MU1A 5ARDA 1LY1A 2BTEA 3M6WA 1SO8A 4L0CA 4JJFA 3WLAA 5DJ5A 1YZLA 3H18A 4W5TA 3WLKX 3ZKWA 1NOKA 1PD0A 3AF4A 1UKCA 1Q7GA 2IIPA 4JV5B 2IPLA 2ZG6A 1XCOA 3R5HA 4EA7A 4G37A 1DGQA 3AL2A 3DOCA 3H13A 1XU9A 3AI2A 1OJHA 4AY5A 5A1JA 3HKCA 3ND8A 4EUNA 2X4IA 3EVAA 4PSDA 1FLNA 4LVUA 2YMPA 3CXCU 3PGMA 3OHSX 1V16A 1JPUA 1J8YF 4PFJA 2FL4A 3NWJA 2VP6A 3BABA 1K33A 4UVEA 2G1AA 3QBJA 3S7TA 2I80A 4OV6B 2Q5LA 1C7JA 1RPJA 5IM5A 4HDKA 5DE3A 4MYHA 3VYTB 3F7NA 4WFFA 3VQTA 3TGLA 3WGZA 4GQBA 1Q50A 3GQVA 4LWSA 5HGJA 3OQMA 5CLQA 4LOJA 4AI6A 3NHBA 3RKUA 3MUFA 1U2RA 2X41A 1N7IA 3LBNA 1WS6A 4RTJA 1MJ5A 3CKLA 5TPZD 3QW2A 4HX9A 2AVNA 3O3NB 4J7CA 3FFWA 2PZMA 2I6TA 1L0LH 4PRKA 5JXWA 1DQRA 4BR6A 4YJFB 1PU2A 1WBBA 4AB1A 3LPDA 2W6ZA 3F67A 3OEED 4JOQA 4LCJA 3OTOO 2VH1A 3LL4A 1TZCA 2PUWA 3AEZA 1KFJB 4RK5A 3K04A 5BW6B 1KOFA 2JA2A 4J7XA 1G8FA 1I94O 1CUIA 3LQQA 3ROQA 4RMHA 1XXHA 3A32A 2BGWA 2YZKA 1DKLA 3U5ZB 2X1LA 3L04A 3BMQA 2VXCA 2I6XA 1MBZA 1MX9A 1DPFA 3KLPX 5CFQA 1AF4A 3RVZA 3NWEA 5FFMA 5I8WA 5LU9A 4IV5A 1VA5A 2EEPA 2JD2A 1JLMA 1T2NA 2RG7A 5TDHA 1UPTA 1NVWQ 3ZS8A 4YLYA 2DN9A 1NN0A 3UUGA 4MQ4A 5LP1A 2WNIA 4MLCA 5IXSA 4XZ3A 2HD4A 3THRA 1MW8X 1EWVA 2DERA 5IUNC 4RLHA 2NSLA 4IYIA 4P08A 5CFOA 4EFNA 1P7VA 3ORQA 4LH7A 1NSYA 4Z7JA 4LBEC 1EQAA 4D4HA 5BV2P 3CHXA 3MXTA 3R3VA 4X1KA 3PVSA 5HUJA 3JYOA 2XA9A 5C8YF 4MQLA 3V1LA 1XD8A 1B00A 3L6RA 4NEGA 4UTRA 4A15A 1P74A 3HM9A 5BMVB 4F7WA 1IUNA 3H9CA 4PPNA 1WPQA 2KG7B 2C3MA 4FPPA 3CUEF 2XOEA 4MW0A 3LVQE 4WF9V 4NBKA 3AM1A 1PUJA 1UXHA 1FTSA 3KAQA 4HQ6A 1JDTA 2JFWA 3QLVC 5B66Z 4EECA 3ICQB 1KOJA 3R40A 3FH0A 3Q2OA 1PS8A 2IBTA 3CH7A 3LO8A 1X9HA 2CLFB 3QVWA 2QXUA 1RWMA 2I2BA 4E4TA 4MWSA 5B1AB 1IBKB 2BKVA 2ZYWX 2QP3A 2G72A 1B6SA 2CGNA 5IZ4A 4C5BA 1SCUB 4GGOA 1JQDA 3DNFA 3CCQV 4X7RA 1HNXO 3VQWA 1TJYA 4F45A 4K86A 1MQ8B 4DLBA 3AUYA 1MEOA 4LOLA 1QVWA 2E6UX 2UZIR 5DCYA 1CXZB 4K9QA 4MKRA 3T3DA 1Y6FA 2FQXA 2Q3FA 4DQ0A 1S6YA 3KTFA 2I2DA 3K2QA 1PLLA 3MTQA 1CP3A 2GGSA 4NOLA 3IOBA 1GZSA 4LJLA 3AEIA 5CDTA 1UBOS 1A9XA 1JZSA 3ZD8A 5IJ9A 4Q00A 2C1ZA 2F7SA 1E18A 4D42A 1WLYA 1MIOB 2YICA 5BQXA 4I6EA 1EBBA 4MV5A 3JWJA 2QNIA 3OU2A 5IEBA 3NYWA 1IJFA 2CYAA 4IDEA 3BZWA 3IEPA 2HBRA 1BJKA 4MR7A 2KBFA 3UJ6A 3RUDA 1UDWA 2F8MA 3WKDA 1U7PA 1ISGA 1NUSA 5IYCO 2NUAB 2HR3A 3QLEA 1LBEA 3DZHA 1ZBDA 3S2GA 4WN9B 1KAMA 2AC7A 5IC5A 1ORIA 4YA6A 2OESA 3JARA 3WZMA 4KIWA 2QRMA 2X5NA 2P2YA 3CMAV 1WSWA 1ATZA 3UTDA 3DQQA 1L4LA 4PRLA 4C89A 5F1YA 1IPFA 4CMBA 4Y2PA 4R0VA 4IF4A 3VMFA 4IZOA 4CETA 1AKUA 3GG9A 1JJ2U 1J5XA 4LF9B 1PEDA 4DIUA 5KPDA 1NJFA 4M1YA 4XM0A 3DDUA 4YAIA 4HFRA 4IHQA 4HCJA 3S2IA 2IELA 3M4NA 4B7AA 2O2IA 2H9IA 2I2FA 2OIGA 3T35A 2DBVO 1YUMA 5J2TA 3B60A 3FTFA 3F2VA 2YIMA 3FWKA 4ZEOA 4ZYVA 5JJNB 2QTFA 1PI3A 4ZRMA 1NBMD 5BORA 5IUKC 5A4AA 4ETWA 5JASA 2V8OA 2X40A 2QBYB 2RGAA 3O4GA 1UJNA 1H8EG 1YDMA 1COZA 4KMMA 1RP1A 3NEJA 4ADSG 3VAZA 1PLJA 1OB5A 5J9PC 3DUFB 4DTIA 1QHTA 1GTOA 4M87A 1MENA 1EWRA 1VQNV 1IY8A 1Q21A 4W8HA 3R0IA 1N5RA 3IL2A 4REQA 3P9ZA 5I4CA 1IULA 4MLDA 1ZP6A 2OUIA 2HJWA 3ICOA 4J03A 2XT6A 1XXLA 4F3RA 1U4SA 3Q5GA 4KVAA 3NNSA 4E07A 2GI4A 2ZSUA 3UH0A 3U39A 3I6MA 3BGWA 4AURA 5GZ6A 3IVAA 3KXIA 3DE0X 2YN4A 2D0DA 4IL6Z 5EINA 1KI8A 3UJDA 1H0HA 1PFKA 5K0TA 3FBGA 1QC5A 4Q6GA 4M21A 2XOKA 4CC5A 3L8YA 2GZDA 3HCOA 2WA1A 3R41A 3HU5A 3OHPA 3EIFA 4PV1B 1ZMTA 2AMLA 1BQ4A 5CLFA 1ZINA 1WO8A 4PG5A 2FN9A 2SCUA 1HQDA 1M2HA 1JG1A 2PQ2A 4GQAA 3MCWA 3TJTA 1EQUA 4DIEA 2HY7A 1PSDA 4N4AA 1VPDA 3GCGA 2NZXA 3IKMB 1BQEA 3MAGA 4DZZA 3HB0A 4H0CA 3PI7A 2DUNA 4BTVA 1G0NA 4FYHA 3O9VA 2FI1A 2QUBA 3SLKA 1T9GR 5EQDA 2FMXA 4X8OA 2Y6UA 1AE1A 3CX7A 3WB2A 3HV0A 2EIKC 2ZB8A 1RMYA 4E7PA 4LWPA 3SZLA 2HRZA 3KZNA 2H00A 1U4OA 4JJAA 5J3JA 4PGMA 1ZNQO 2JAXA 1AHIA 5EWMB 1DIBA 4TZTA 1KXZA 2QMZA 3TJMA 3PPVA 4JI3O 1W25A 2O6LA 2WAXA 4CM7A 5F33A 3CA8A 3AI3A 3DYBA 1LTKA 1PS0A 4CL2A 1QHYA 1ADYA 1QTRA 3I2YX 2J9FB 3BCUA 2YDXA 2FUG1 3LVRE 4ANFA 4NDAA 1Y76A 2FXVA 2IDMA 4HK4A 1GSAA 1H6CA 4AWBA 2PNFA 2OZVA 3ZDZB 1TEZA 1UWKA 4AS2A 4PDLA 4PLWA 3SEAA 4YRGA 2ZJ4A 3ROMA 1YR1A 2ZBVA 1KVSA 3W79A 5DECA 4UCUA 1PZMA 2W6OA 5LQNA 2UVDA 5AP9A 2O57A 3C1TA 4RF3A 2ZXWC 3MERA 4ZYZA 1RWQA 1AKNA 1UKEA 4I55B 3O9OA 4QWMA 5IYDO 2CNOA 4HH3C 4M37A 3Q5DA 1R6AA 1KNQA 1JXAA 2C9MA 2AD5A 1F48A 3OE7G 3AO0B 5KC9A 2UZ1B 2GESA 1GQYA 3WQRA 2K4MA 4M49A 2OR3A 3EXEA 4AZ3B 5KYWB 2UUBB 1K98A 4R7GA 2QU8A 4RTQA 3GA5A 3S2YA 2JIZD 2CMHA 1R18A 3FHTA 3EGDB 5TARA 2X6AA 4HDSA 5L3SA 3ZHTA 3VH3A 2FN7A 1IHYA 3CNHA 1RDFA 3GGJA 1TA0A 2BVNA 2WB2A 3RYFB 1JLRA 5I6DA 1ZJYA 1VRCA 3FGZA 3L9WA 4ZARA 3CLTC 1R3IC 1WV1A 2WILA 3VYWA 1Z88A 2BJWA 4DNXA 3OE1A 3UCFA 3LDHA 4LJ7A 1Y74B 3TLCA 5SY6A 3DWGA 3DVSX 3L93A 3DAGA 2G82A 3W7BA 3GWZA 2HW8A 4PWYA 4JTDB 1WQ4A 3UAGA 5LQDA 1ONOA 4ZJYA 3FR8A 1YZUA 3TPFA 2FR1A 4JVNA 2PRIA 2E37A 1P2GA 2QTRA 2YIBD 2ONKA 1XD2A 4QUEA 2ZK7A 1Z5WA 2ABWA 3MS4A 3OIFA 2OFWA 4Q3BA 1N34O 1GGMA 3OZWA 2H3HA 3LDDA 3PPWA 3ABUA 2ON6A 2FFJA 4XPZA 4CKWA 3PWSA 2ZQZA 2JGFA 4PG8A 1WEHA 5F2NA 2VSYA 5THQA 3IP7A 1LQTA 1XXHE 1AP5A 2MSDB 2WLIB 2ZCEA 3EZ2A 2HUPA 4O29A 4JI2O 2ZPAA 4M9XA 1A4IA 1JLLB 2VA8A 4PBRA 1ADGA 4O2AF 3KUDA 3FSJX 4WOKA 4BAUA 1O94A 3WVNA 2BKAA 3VDRA 4PS1A 2JJ2D 3GA0A 4OP2A 1Z82A 5C52B 1K8ZB 2YQ5A 5LDHA 1MC5A 2XDAA 3KSRA 1HNWB 5JH7A 3WL6A 4KXNA 2VJYA 1NMEA 1U0RA 4KKVA 4GZ5A 1SD1A 2RAUA 4IJQA 4TRRA 2RHDA 4JVSB 2DAPA 1XEFA 3NDRA 4K9NA 4QNNA 1AHNA 3H1FA 5CEEA 5DXFA 2HCJB 1JUDA 2UVPB 2I6FA 4YRDA 3IV6A 1ENVA 1JCHA 3KOWA 4Q82A 2ZXUA 4Q6WA 1UMDA 2GTIA 3E03A 3RVMA 2BI7A 2G36A 5MDHA 1RHKA 3CX3A 3R65A 2W2LD 2DKFA 1I2MA 4F6CA 4BW5A 3PNVA 1XC7A 1C5KA 2Z43A 4JP8A 3OM9A 1F4MA 1JBKA 5LOVA 1PD1A 4MV1A 3SJUA 4JIGA 3CCFA 5I8ZA 1AQJA 5KX5B 3PT9A 2O8CB 3E9NA 2ZI4A 3TVTA 4F06A 1YBVA 5L4SA 1SXQA 3FFQA 4F4CA 2B30A 4YMVA 4MQEA 4M0FA 2E3CA 4KAFA 3IAXA 1BIFA 1U0HC 3F71A 2ZJYA 1BCSA 3SDSA 1QIKA 2O5CA 2BLNA 4P2GA 1YZBA 1CEZA 1K86A 1PGQA 2J48A 1PEAA 4P4UA 4DIOA 1H2FA 4RGBA 2B3DA 2GHRA 1C7EA 2C84A 3JR3A 2W98A 3TG8A 1YI0A 3GOHA 4C0JA 2IZZA 4HT3B 5HUQA 1AIPA 3CSXA 3S70A 5BN5B 1AH2A 3F46A 4LSGA 4OBWA 3AG2C 2CH7A 4G0WA 3IDAA 2P0AA 3D4PA 2PZFA 4KPYA 1ISSA 4J0HA 3V2UA 3P9PA 2OD7A 3DC5A 1XP5A 2BJVA 4CM1A 4AF6A 2WFAA 4G89A 1NJ5A 1OHHG 4MS3A 4E5KA 1A32A 5A5VA