3D3QA

Crystal structure of trna delta(2)-isopentenylpyrophosphate transferase (se0981) from staphylococcus epidermidis. northeast structural genomics consortium target ser100
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
307
Chain Sequence
KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Crystal structure of tRNA delta(2)-isopentenylpyrophosphate transferase (SE0981) from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis atcc 12228
molecule tags Transferase
total genus 102
structure length 307
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 3d3qA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d3qA01
5DO9A 1KI2A 3VX3A 1Z6YA 2OM2A 3VMFA 1N6KA 3RVBA 4IVPA 1L7VC 5FUWA 4JBXA 4TTPA 2I1QA 1CRPA 3PCRB 2IS1A 1OH8A 3RLFA 1DAMA 4ARZA 3OEHD 2IUUA 4M4SA 4QBGB 4ITRC 1ZVQA 2QP9X 3QXSA 1E9DA 4PAOA 5G3ZA 3P32A 3PEVA 4LYJA 4E22A 1KAOA 3D7MA 3TAUA 1VYTA 4RCZA 5KHOC 3IDQA 4ZDJA 2JDID 2HYIC 3K09A 3FFAA 1NKSA 1KK0A 1YVDA 4ZDKA 3TJZA 5DIFA 3BERA 1IXZA 2WWHA 3RRNA 3MLEA 2VHCA 4LPSA 5J5CA 2WAYA 4H9GA 5C2JB 5F9FA 2FFAA 1G19A 3A4LA 2PX3A 2FGKA 1QHIA 5CYOA 4IEEA 4LCBA 2JJ8A 2FN4A 4AKGA 5LB2A 1OE0A 4B71A 1GKIA 4TSFD 4P3YA 3W5JA 4N0EA 2X1VA 2OEPA 2QL6A 3BH0A 3EW9A 3ZZTA 2P5SA 3K9NA 2FZLA 1OIXA 2JIZD 3GJ0A 3AKDA 3DPUA 4TMKA 5FOTA 1LS6A 2ZSDA 3TE6A 1XTSA 2GETA 2F3RA 3MSXA 3SN6A 4NZYA 1ZUHA 5L3SA 2P6RA 3GLIA 3RANA 4NYIQ 1OXXK 3ASYA 1N6HA 1P3JA 1FX0B 1OB5A 3E1SA 3RNLA 4I1VA 1T8TA 3QKTA 3P1JA 2V6IA 4TMVA 1W1WA 4HDQB 1NI3A 2ZAMA 3TR5A 4LX0A 3TUIC 3UMFA 1YR9A 2PEZA 3LX5A 4AKIA 4Q66C 1RFLA 2IHBA 3P27A 4OBEA 3NEYA 4DXAA 3LFUA 5KTYA 2F43A 1GWNA 2Q9AA 2MMCA 5CIWA 1DAHA 3TK1A 1G8HA 3IHWA 2VP6A 1X8LA 4NCIA 1Z47A 1F48A 4FCVA 1J8MF 2HDNB 3T1OA 1IQPA 1ZM2A 3LXXA 2P65A 3CX7A 4QJ3A 2IWHA 4PQYA 1M7BA 2HXYA 4A6XA 1KK2A 3LBHA 4PHHA 3PUWA 521PA 2OFXA 1G20E 4OK6A 5FI1B 1XTIA 2YC2C 3OIVA 3KXIA 4MKHA 1AKYA 2NTYC 4BE7B 1IHUA 2NGRA 2R6DA 4IDHA 5DISB 4C2TA 2Z43A 2CMKA 2ZRPA 1ZNYA 3T1TA 4XD7D 5C1BA 3AP3A 1N5IA 3EC2A 4MYUA 1RRFA 2ODEA 2P6NA 5EUQB 3WBKA 1FZQA 5E3HA 4GOXA 4G0NA 2BHRA 4J0QA 5BN4A 4TWZA 4Q19A 2F9LA 1KY2A 2KBEA 3AF2A 3R8CA 4TZ0A 1QHHB 2GXQA 2GNOA 1S3GA 2WWFA 3DMNA 3A1TA 5EXSA 2QBYB 5DHAA 2EU8A 5CITA 4B44A 4WXPA 1SVWA 1SXJB 2VEDA 2ZI7A 1Q20A 4M0LA 2CL0X 3EA5A 2CE2X 3THOA 1Q0UA 1YZGA 1S1CA 2LCFA 2UZ3A 4A8JC 3V9PA 2FV8A 2GVZC 2WJIA 4QFMA 3H86A 3R9WA 1U81A 3R8FA 4BFUA 1X8JA 2RCNA 3WYGA 1BIFA 1UDXA 1NSFA 2OFWA 5J4KA 2QN6A 1FTNA 3LLUA 1XCMA 3NVAA 4KBGA 4P4UA 3FWYA 2GEUA 3RHFA 2OT3B 4NE2A 1PLKA 2OBLA 4RD2A 4KODA 1XEXB 4I99A 4EKDA 1WXQA 3U3MA 2OLJA 2Z4SA 4V0NA 1E9BA 3NDBB 2IA5A 4B2LA 5C46F 1IXRC 1DAIA 2FNAA 3TKLA 2ZJ2A 3W34A 4B2PA 3C4JA 3CONA 1HUQA 1OYWA 3MWYW 1OIWA 3ZGXA 3NBZC 3ONWA 2YC4C 4Q7MB 4LK2A 1E9SA 1NJFA 2GEVA 3CWZA 2BCGY 4ASUA 5D3MA 2F6RA 4BFZA 1Q3TA 3EA0A 2DWPA 2IYRA 1XXHA 2DFKB 2QAGC 4OHWA 1O87A 2QAJA 2YWGA 1IN8A 4B47A 2J87A 2WM9B 5TXGA 4G5RA 4PC7A 4BLRA 4D81A 5FUXA 1HEIA 1TQ2A 1CTQA 2NO6A 2ORIA 3KJGA 2JLUA 3B5JA 2NIPA 1EK0A 2R2AA 4LJ9A 2EQBA 3LVRE 4PZLA 1LB1B 3B1ZA 2XJ4A 3KKQA 1E2QA 1LF5A 4NCNA 2CVFA 3QKRB 3CO5A 2LWIA 1G7RA 2GZAA 1OPXA 2XNDA 3BOSA 4HAXA 3DZDA 1Z2CA 3DOFA 4TQ9A 3O8CA 5K8UA 4DSOA 1W5TA 5DN6A 1M34E 4HZUA 4Z51A 1YRBA 3LNCA 4DEXA 2RHDA 1U8AA 1XP8A 221PA 1U0JA 4BASA 2ONKA 4YMWA 4KI0A 3WRXC 5JI2E 4JVLA 4RKFA 1X8KA 2EFCB 4II7A 3JZMA 2BBWA 4B76A 4YQFA 4MGKR 4LY6A 2AHOA 4JKIA 1ZU4A 4Z8XA 2A5JA 4A0FA 4C4PA 5JFGA 1KSJA 1CJTC 3IGFA 2AWOA 3J81k 1XMJA 5EXPA 1W48A 1A2KC 4MA4A 4XWKA 4LBZA 3NC0C 1G5PA 4KFRA 3ZH9B 4US2R 3N2IA 1YU9A 1A1VA 1AN0A 1XMIA 5TDHA 4DLXA 4I4LA 1HYQA 2GRJA 1FP7A 2H18A 5FI0B 2IXFA 1W0KD 2Q3HA 5IK2D 3U4QA 1ZINA 3DHWC 3TLXA 3KTAB 4DVGA 4URVR 4MGZR 2J41A 1SZPA 3ADCA 1GRQA 4YMTA 1ZD8A 1DO2A 3QQ5A 1G8PA 1GM5A 4S35A 2XSZA 1OJLA 3EZ9A 4CEJA 2AXPA 2Y8EA 3KB2A 5G3YA 4BFXA 5AK0A 3FPAA 3KUDA 3BB4A 4M1MA 1BOFA 4QBIA 1UEJA 2VP5A 1QHNA 2VHTA 3K0FA 2ZU0C 2OBMA 5D3QA 3GLFE 3GLHE 1U9IA 1JALA 2J0UA 2H7VA 1P9WA 1Z8FA 2A3RA 4XSHA 4V0ME 4POAA 4IFEA 4GOJA 4JS0A 4X8LA 1FQJA 3S1AB 4EPRA 2B8TA 4A8JB 3CM0A 1SVSA 1DOAA 1QVAA 1X6VA 3VX4A 1DPFA 1XD2B 4Q9LA 3E2IA 4RVCA 3RC8A 3IUYA 2CNWA 4LJAA 3TSWA 5SZHB 3SDZA 1JEDA 3ND9A 3AQ4A 4XOIA 5TV2A 3H84A 4O2RA 3RS4A 2PLFA 4CEHB 1UJ2A 5FUYA 1R0WA 2V6JA 1YZNA 2Q0HA 1II0A 1D2NA 1TNDA 4C30A 3TQFA 2VP9A 4BZPA 3QSYA 1KK3A 3B82A 1CJKC 5JJLA 2FF7A 4OHXA 3PITA 3AGQA 2JLXA 1UKYA 3THYB 1US8B 3ZQ6A 4MDFA 1W7AA 2D3WA 2G83A 4QBFA 1D6JA 2QAGB 5J47A 4A6PA 1SHZA 3GLGB 1J90A 4M1WA 5DN6D 4JLNA 4LOAA 1OFHA 4ESHA 4C0KA 2REXB 1F2UA 2FX3A 4Z8YA 3W6OA 1GOTA 1T6NA 2C96A 1QRAA 1TU4A 3A36A 5BYJA 4DKXA 2HJGA 2O8BB 4TMZA 4JLDA 1CJUC 1ZM4A 1E2GA 4IVRA 4B3XA 2ZREA 4C9BA 1S3SA 4W5HA 2QP4A 3DM9B 4EPVA 4BECA 2P0EA 2PBRA 4WXRA 1XX6A 2IS6A 1A4RA 1KMHA 5JSZB 1Z0JA 3FGNA 4HAWA 4PC2A 2AD5A 4B3DA 3TNFA 4TLDA 3CW2A 2IYLD 4NONA 2BBSA 2YYZA 4M8NE 2MSDB 4F38A 4B2IA 5AUNB 4ZDWA 2W2TA 3QY0A 3NBXX 5FUVA 4CVNA 4F4JA 4DDUA 3RAPR 2R65A 3GLFA 4PXAA 5IDVA 2G0TA 4ZI3A 4P32A 1GL9B 2CL7X 1G64A 2IYSA 2FPLA 3QBTA 2IYZA 5FBRB 1GITA 1XNJA 3U6BA 2ZU6A 1G6HA 1MR3F 4V0MA 5TB5A 1VPLA 1E9CA 4PZZA 5FOUA 2YVUA 4TYWA 4A2QA 4D0GA 2B21A 1WP9A 3F5FA 3FKSA 1M1YE 3LAWA 3TH5A 1KI7A 2A5YB 3P4XA 4DDTA 2XSZD 5J4LA 2YINC 3AKCA 1F6BA 3BWDD 2ASEA 1E9RA 1AGPA 4OHZA 5EJEA 1EESA 2I4IA 1F2TB 2QTVB 3NDPA 1NJGA 1XJQA 1CS4C 1G9XA 1HT2E 3UMSA 4DLTA 1G8YA 2XAUA 4LPKA 3QPVA 4XTRA 1XF9A 1R4AA 3JVVA 5JJKA 4CGZA 2JLVA 2NO7A 4QL3A 1VCIA 2YHSA 2PMDA 4I81A 5ANRB 3PUXA 2FG5A 3PEWA 1QHSA 1DELA 5FOSA 1NNEA 1XBTA 3I32A 4QC2A 4Q4HB 1P7CA 4CIDA 4NBSA 2ZJOA 4GBMA 1KTVA 2FE4A 3EIEA 4MUBA 3EX7C 1N25A 2ZVPX 1ZP6A 2O8CB 1ZD9A 4NPHA 1U8YA 1DAFA 2CEAA 1X1RA 3SYLA 1CF4A 1NMYA 1C4OA 5IF9A 5JEEA 3HU1A 4DT1A 2C95A 2CNWD 3EPLA 1HH4A 2CXXA 2VP0A 4OQNA 3W6NA 4AIIA 3K53A 2C9YA 1JQLB 1XCGB 1E0KA 3KKNA 5E95A 1AA9A 2WIBA 2ZJBA 1Q44A 4KV9A 4DDVA 4EUNA 4ZCMA 4BPBA 3CRQA 4OI4A 2D4HA 2ZR0A 2XTZA 1W36C 3H4MA 3BD9A 2A78A 3N70A 1T3SA 1QBKC 1KMQA 3NBYC 2V3CC 4CT4B 2BKEA 1NY6A 3W8NA 1RKBA 4UXIA 4LHWA 3TVTA 2BC9A 5A4JA 2ECKA 5DYIA 3HU2A 2ZTSA 3A4MA 2ZUCA 3U3RA 4B6FA 4KJZA 1OW3B 2B7BA 5J4VA 2ZE8A 3VAAA 4E09A 4GDFA 1T4GA 3G0HA 3B1YA 1RYFA 4A0HA 1NN1A 4B3GA 1MH1A 3TIFA 2J3EA 1NVVQ 3FMOB 4DSNA 4EJSA 5G41A 5SZIA 721PA 3L0SA 1NG9A 3I1FA 1KYIA 2BKUA 2XXAA 1VCNA 4MGIR 2C8VA 3A58B 2X77A 3K0AB 2Q3MA 2YOGA 4YDSA 2B92A 5CB6A 4OI1A 1UBFA 4LZZA 5GVSA 1H8EA 1VG8A 3NXSA 4DLZA 1E99A 4LHZA 1OFIA 4NYMQ 4G3XA 2WBLC 4DLWA 1WBDA 4PSKA 3SHWA 2AKAB 1HV8A 5TVKA 3N5CA 4B6EA 1G1MA 1MO4A 1E9AA 2KSQA 4KCGA 1TL7C 4G5GA 1HQYE 1PUJA 2VA8A 4E03A 1CLUA 2YOHA 3QG5A 2QENA 1IXSB 2Q6TA 2DHRA 1JXMA 5FL3A 3MMPA 5DE3A 4V0OA 4MH0R 1PJRA 2A9KA 5EXXA 2AK3A 2YJTD 1QG4A 2W58A 4PTLA 3IIKA 3QKUA 2GKSA 4QNMA 4NYIR 1LW7A 4Q9KA 5E7JA 3TMKA 1KO5A 2RAPA 4UNPA 3CB4A 3VFDA 3VR6A 621PA 4YXWA 5CDFE 1ZYUA 3AV0B 1FUKA 4U00A 1OFUX 5FTNA 2GF9A 1P61B 2ZRNA 1HTWA 1VYUA 2ANCA 1E2KA 5KOYA 2VP4A 3GFTA 2XITA 2VTKA 3KX2A 2GAAA 3VU9B 2OSBA 4IHQA 4AURA 1ZCBA 2GJKA 3GD7A 3EPHA 4CRWB 2RGXA 1COWD 3W90A 1VCOA 4HUQA 1L4UA 2GJ9A 5CK4A 1P5ZB 1I4DD 4OQMA 3I5YA 2QG6A 1UBEA 2QSYA 3TAHA 2JIZA 3IKJA 4DB4A 1GL6A 2O8EA 1NVWQ 1FX0A 1EWRA 2Z4RA 1OYYA 2FJUA 3QBVA 4XJXA 2FEOA 1GRRA 3GJ7A 3I92A 4KSCA 4K81B 3FHCB 4MYTA 1E1QA 4LV6A 3PUZA 2G0NA 3NH6A 3DVLA 4KU4A 3KUCA 3TSOA 1R5NA 2ZS7A 2BM1A 1YR6A 1CR0A 5H8WA 1XPUA 3K9GA 1SVKA 4DB2A 1OT3A 2H17A 2GILA 1T91A 4R2HA 4FMCB 4MKGA 2WVJA 3QPUA 4FINA 4B73A 4F91B 4PAMA 3L8ZA 3O8DA 1HY3A 1M74A 4I1SA 4Y0AA 2V9PA 2ZYVX 3T12A 4U7DA 4JBWA 3AVWA 1EX7A 3VKHA 1RVDA 1Z08A 4M9ZA 5G40A 1Z0DA 4C3ZA 1I2MA 1W36B 4A2WA 3HYRA 1ZBDA 3UK6A 1XD8A 2PT5A 2CL6X 2BMEA 1P2TA 1DADA 1SXJC 2FEMA 4M9QA 5EP1A 3PQCA 2GBLA 2PJRA 4QHSA 4YC7A 3WNBA 3NEJA 3Q9LA 4JLOA 1E0JA 4IDOA 4BZXA 1NIJA 4M9SA 4OQFA 4PC3A 1XCPA 1QHHA 4PO1A 3KKOA 2G6BA 3DZ8A 2QBYA 5JJIA 4O0MA 4EDHA 2YZ2A 4OK3A 2V1XA 2O5VA 2PZEA 3V00A 4S2EA 2XEXA 1M2OB 2ZRIA 1E0AA 1E2FA 1MO3A 4Q4AB 2Z5FA 3ETLA 4BLPA 2OO7A 1XB2A 4DEYA 2OBNA 1OH6A 5HTKA 3OAAD 3PEUA 1WE2A 1AQYA 4Q7KA 1G7TA 1NVUQ 3ZS8A 4YXWD 2G9NA 1D5CA 1N6RA 2P67A 2QI9C 5E7MA 2NQ2C 2P5TB 5HCIA 1UBGA 1KOFA 1NBMA 4XVUA 4HAUA 1G5RA 3THXB 5B58C 4Q4LA 2J0QA 4K8OA 1PLJA 3EASA 3OZXA 5J40A 3O8RA 2VH5R 1XEXA 1P62B 4E07A 1I2DA 1EWQA 1RW4A 4NCKA 1LFDB 3UKDA 2KWIA 2BWJA 3LRPA 1NKTA 3FVQA 4Q1EA 3A6PC 1IN4A 1ZAKA 1NMXA 4A1FA 4Q47A 3ZJYA 5LPNA 4Q1DA 1JQJC 1TAGA 2P2LA 1L2TA 4G5OA 2CLSA 3BGWA 5BW8A 1YZQA 3UXMA 4M2LA 4TYPA 3K8YA 3T5DA 3TUJC 4D82A 4KHZA 5JLJA 2C77A 2FSFA 2F7SA 4ZCIA 5F98A 1NG1A 2JAQA 4XH9B 5E7IA 3VNVA 3ADDA 3KKMA 2ZE7A 2AWNA 5A5GA 4ZI2A 2QTFA 4O25A 4UQOA 1IONA 1R8SA 2DWQA 5CM8B 1ZIPA 4ESVA 2QPAA 4TZ6A 4UNNA 1WDTA 5K8IA 4O3MA 3JZAA 2OAP1 1E1QD 4Q21A 3FKQA 1Z0IA 4LJ7A 3G5UA 1N6IA 2TMKA 1Q1BA 3W5IA 5CB8A 821PA 4KVGA 4QJ4A 2ZSBA 3IILA 4JLPA 3X1ZA 4A0RA 4BQSA 1XEFA 4LWZA 4B3BA 3FMFA 3K0CC 2JLYA 2ZPTX 4Q1CA 3RWMB 3TRFA 4YMSA 3SU8A 3EC1A 3CZPA 1GRNA 4XVQA 1LVGA 2IS2A 4NMMA 1MKYA 5EE3A 3QKSA 2C99A 1NVXQ 1SKYE 3QKRA 4PAQA 4R98A 1G3IA 1OH5A 1KO4A 1KJWA 2PEYA 4R9UC 1R7RA 3C16C 4NH0A 4LDJA 3LVQE 5L8VA 2HYDA 2ZRCA 5DI3B 5E4FA 4IXMA 4LJ8A 1TF2A 1XXHE 3UMRA 4WOPA 1T5IA 3FYHA 2HT6A 4LJ6A 4DJTA 2IYXA 3TGPA 4JBYA 4D26A 3NG1A 2OUKA 4JLBA 4Q02A 1WCV1 3GMTA 4DLUA 1IAQA 3UATA 1VTKA 4ZIRB 4CEIB 3VQTA 1BYIA 1AKEA 1UAAA 1E2LA 4RZ3A 3BFXA 4HB0A 2XZOA 2FH5B 1HT1E 1GNRA 2F9MA 2R6AA 4GL2A 5FR1A 4DDWA 1OXTA 2YWFA 4V03A 4JMPA 1UKZA 4KFSA 4Q00A 4D80A 5A0FA 4C2UA 2CLDX 5C18A 3RABA 1SXJD 1ESNA 1Z07A 1GKUB 1W5SA 2XTMA 3BORA 3BRWD 3OE7A 3LBNA 4TQAA 1JBKA 4KAXA 3NC1C 4TN1A 4DHEA 1G3MA 2VHQA 3K70C 3UPUA 1W0KA 5IK2A 3T06B 1SVLA 4PSAA 3MAAC 5CLLA 3KB1A 2J5XA 4UKDA 1Z0FA 4BFVA 3B1VA 5B30A 5KPJA 1FP6A 4Q03A 2ONJA 1NN5A 2GJAA 1XEWX 2IYWA 3GJ4A 1D2EA 4GFDA 3PXGA 3FE2A 3U44B 1NBMD 1FMLA 4Z1MA 2HEIA 2NO9A 2WPDD 5FTJA 2ZYWX 1T9HA 4YONB 2XZPA 3DL0A 3HR7A 2A5FA 2B8WA 5KSYA 4US1R 2A5GA 5HCNA 3ZVRA 1ANKA 3S1AA 1KJYA 2RGBA 4A8JA 2ZRDA 5KDDA 3EZ7A 4MQBA 1CRQA 3LQQA 1NN0A 1KGDA 1DG3A 1P4SA 3KJHA 2WMNB 2IF2A 4URWR 1XD2A 4EPWA 3WNDA 5DI9A 2ZSEA 2J0VA 4NTZA 3MG9A 3L8YA 2QMOA 4DIDA 1WBBA 2GCPA 5KDOA 4JLAA 1S4QA 4QHTA 4MRRA 3AVYA 4RD3A 3EXAA 4HI0E 2R6GA 4CEHA 2BIFA 3I8SA 2XX3A 3KFVA 3PEYA 4W5WA 5DNYB 2PZGA 1MRSA 4OYHA 5JRJA 4XWAA 3D31A 4PPFA 5FBQB 3ZDQA 1B0UA 2VF7A 4DLRA 3B9PA 2HCJB 3SC3A 3T34A 2DFTA 3R7WB 4X8OA 3CH5A 4HLUC 3THYA 1US8A 2GJ8A 3DM5A 4BFSA 2EFHB 4MITA 1VYVA 1NP6A 1CR1A 1FPMA 1DAGA 1N0UA 3UWKA 3RYTC 5TY0A 2XTNA 2C9CA 2QAGA 1E1RD 4PX9A 1K6MA 3I3SR 4JVNA 3GLGA 1E79A 1SVMA 1U94A 2NO1A 1XTJA 1E2EA 1JECA 1UKVY 2ZYTX 3BFVA 3OESA 2JLWA 2W83A 1G7CA 2ZITA 1Q57A 3ZVNA 1GAJA 3CF0A 4EPTA 2E9SA 2O8BA 1H65A 3RSLA 2VQSA 3AKEA 1A2BA 3CX8A 2WJYA 3EZ2A 3EPKA 1OXSC 2IYUA 1A5TA 3LBIA 4B74A 3SEAA 1J99A 1UFQA 3BB3A 2J0SA 5JSZA 4XIGS 1W2HA 3WMEA 2C78A 2IXGA 1OKKD 4ZDIA 3L2OB 2F43B 4D4LA 2JJ1A 1E69A 4IKEA 1Z83A 4GOKA 3U61B 1JR6A 1IN6A 4LRWA 1UDWA 4IEIA 2AFIE 1QZXA 2WSMA 1BKDR 2EWWA 4R7ZA 4RZXA 2JGNA 3W3AA 3OE7D 3WYFA 4HAVA 4N1AA 1TQ4A 4BFYA 1UM8A 4PANA 4DBLC 2ZQ5A 1E4YA 1Z5ZA 3VR5A 1DTSA 2EFEB 2FFHA 2FU5C 2VL7A 2ZROA 2L0XA 4TYYA 4KITB 4TYNA 1XD9A 2ZE5A 4JZKA 5CK5A 2ZRFA 1F2TA 5B2ZA 2GDJA 3QF4A 3T5GA 3VKGA 2WKQA 1ZU5A 1Z6XA 4HLCA 3CNOA 5EUMA 4B34A 3I61A 2DFLA 5JWHA 4M1SA 4Z1MD 2QEQA 1IY2A 8OHMA 2PH1A 1TUEA 4BLSA 3K70D 4IXNA 1D8TA 2Q3FA 4WZ6A 3T1QA 4JSYA 2C2HA 1G4AE 1NSTA 4B43A 5EZ6B 3SBDA 4BRUA 2YV5A 5CLQA 1J8YF 3K70B 1WMSA 2FSHA 1ETUA 2O52A 2O8CA 1L4YA 3GJ3A 1Z6AA 4KFUA 3X1YA 3AVVA 1JAIA 1O3YA 2CDNA 3KZ1E 4LUCA 2QE7A 3MGCA 4RY2A 1GL7A 4FWIB 2WKRA 4L8GA 4MKFA 1MOZA 4V02A 2X2EA 4AYWA 2ZRMA 3T15A 2WJVA 4Q1BA 1KI8A 1RRGA 1S1MA 4GMDA 4NYMR 4A15A 3CF6R 2B7CA 2WWIA 2XOKA 3GJ8A 3UG6A 3F3YA 4EFLA 3U5ZB 2DPXA 2GK7A 4PPGA 5HR5A 4DCUA 2XGJA 4FWTA 1P60A 4RFSB 2ZRJA 1BYUA 1ZUIA 5FTKA 5DSZA 5FOVA 3QOFA 2G77B 3FDIA 1E2HA 4GRAA 4M21A 5EP2A 3EPJA 2A7QA 5CYPA 3PUVA 3V4FA 3FFBA 3QIAA 3U60B 2GESA 4JYCA 2OCAA 2AD1A 1DEKA 1E79D 1DG1G 4GP7A 3CPEA 1Z29A 2ZANA 4A92A 3AVQA 5D3MB 1AS2A 1EFUA 3EARA 2IC5A 4AC9A 1HURA 1RPZA 3PJRA 3GQBA 3OIUA 3K0AA 3W6PA 4ILEA 4DC9A 1R6BX 4M1OA 2QM7A 3O8BA 2QPTA 1E2IA 5EE0A 3U6KA 2VIIA 5AUQA 2G1JA 2W00A 5F2EA 3VKWA 2QM8A 3WNCA 4NYJR 1N6PA 2KBFA 4UNRA 2XZLA 2GZHA 1XJCA 2QA5A 2GXSA 2PX0A 4QOSA 2GEDA 1HA3A 1Q1ZA 2WZQA 3IO3A 4TLAA 2JJ1D 2PJZA 5KPDA 1R5OA 1W49A 3DKVA 1LTQA 4FMDF 2FOLA 4H1VA 1N5LA 2FGJA 2WJHA 2OLKA 5LDDC 5BWMA 2I1VB 1W2GA 3M0EA 1II8A 2O0KA 4CYMA 1E2DA 1U2RA 2RKOA 4D4KA 4B32A 5FH9A 1KK1A 2JA1A 1YZTA 1P75A 4IJMA 5FR2A 1YZLA 1W0JD 4U5XA 5JEDA 1UBCA 1IM2A 2FA9A 3LX8A 4QGGA 1AIPA 2R8RA 4MRVA 2VSFA 4LYHA 4PQFA 1DVRA 1ZM9A 3GCGA 4A4DA 3R20A 4HZIA 4G1UC 3AB3A 3RC3A 2ZR7A 4Q1FA 3C5HA 1AS0A 4L5BA 2YKGA 1XZQA 2PCJA 1R2QA 1T0HB 3QEOA 1W4RA 1S96A 2IT1A 1ZM3A 3VU9A 3U7FB 2VSXA 2RGNC 1GG2A 5FFMA 3UIEA 1RZ3A 1A7JA 1NRJB 2QSZA 1UKEA 2YNMA 1XU4A 3HWSA 3MCAA 5DYGA 4F4IA 3AVTA 3FB4A 4L16A 1H8HD 4ZV4A 2IK8A 2RGCA 1P2SA 5J4YA 1SVOA 2HF8A 2IYTA 2HJVA 1COWA 1QHGA 4P31A 3FTQA 5LD2C 2FWRA 3VTKA 2PL3A 1Q12A 2QE7D 4N0DA 1GTVA 2OFOA 4LHVA 5CM9C 4EFMA 2YWEA 2CBZA 1AQUA 4K46A 1Z22A 4TLCA 4RD6A 3AP1A 4B75A 4TL7A 1LV7A 2F1RA 3CBQA 1VMAA 1RE0A 2ZJ5A 1GUAA 1N0WA 2ZJ8A 4HLDA 3PUYA 1KI3A 4HDOB 4JSTA 2VBCA 3WMGA 3ZD6A 2JCSA 2KJQA 3GEHA 1XPRA 4HB3A 2JATA 1ESMA 5EP3A 4R71A 1M8PA 2XOKD 4OI0A 1EXMA 5KDLA 2AFHE 1SQ5A 2JLQA 2ZJZA 1J70A 2ZEJA 2ZI4A 3HYTA 4HSEA 1YZKA 1EX6A 3TUZC 1BMFD 5EQTA 1R10A 1FW6A 4URYR 4MYHA 4KVAA 2ATXA 5KYKA 1W47A 5FPHA 2GCNA 4JJKA 3GFPA 5EZ5A 3SR0A 4IDNA 2D7CA 4G5SA 5KUTA 4IW3B 3X1XA 1XRJA 1U99A 3LA6A 3DKPA 4FMCF 3REGA 3CR8A 5FTMA 2JLSA 1KDOA 3KQNA 4UXJA 4YDHB 3CF2A 4OL0A 1GP2A 2FFQA 2Q9BA 2RGAA 5EXTA 1UPTA 2W0MA 4G5QA 2LKDA 4M22A 2ORWA 2F55A 2REOA 4QRHA 1XFAA 1KI6B 2OCYC 1SULA 2W6IA 2IEZA 3OIWA 4OK5A 5B64A 3MWJA 4A82A 3KJEA 3GP8A 3Q3JB 1D9ZA 3PG5A 4UJ5A 2NO0A 5FOXA 4Q9IA 2AX4A 4M1TA 1IOZA 2QQEA 1W4AA 2ZRAA 1IN5A 3H1TA 4W9MC 1Z63A 1T3HA 3MWLA 4LC0A 2AXNA 2YOFA 5AJXA 4B33A 2ZVQX 2P6UA 3OF5A 1YE8A 5KSPA 4C0JA 4DWJA 3SZRA 4Q4AA 5KO2A 1AJEA 1RJ9B 1OHHD 4XSGA 2ZE6A 2JEOA 1Q21A 2J7PA 1T8UA 1AM4D 1PUIA 3N2EA 1GNQA 3Q5DA 4US0R 3VR4A 4W7SA 3L0IB 4PC1A 2FPKA 3ZZ0A 4BGDA 2O8DB 2BVNA 5JBQA 3A1VA 1M7GA 3BAFA 3THWB 3OAAA 1E2NA 3JVUA 1MRNA 3ZZUA 4ABYA 3PV0A 3WHKA 5KNCA 2WWYA 1G4UR 3SQXA 2BMDA 2XJ9A 1DO0A 3LQRA 2GTPA 1BS1A 4AYXA 3L0OA 4URXR 3QXXA 2EWVA 3L82B 4KO8A 1CULC 1N6LA 2VSOA 3A8TA 1S9HA 5JZVA 2VYFA 3I73A 1SXJE 1Q1QA 2ZS9A 3ZVMA 2O8FB 4MRNA 3GLFB 3GLHB 1SGWA 3QI2A 4URUR 5DHFA 2PZFA 1N5JA 3SI7A 5LB4A 5JI3E 4EIWA 1N3BA 4D0LB 4NCHA 1RC8A 3FHTA 5L3RA 2WWGA 1Y63A 3ICEA 3QVVA 2WSSA 4C0LA 4C7OB 4PPNA 4JVMA 1NBME 3SBEA 1E94E 1P6XA 1XTQA 3ND8A 1TU3A 2OAQ1 5H68A 3SJZA 3AF1A 3I5XA 2EYUA 2AL7A 1AZSC 3RSOA 1N2CE 3PIRA 4M1KA 4LBWA 2AR7A 3DOEA 4DZZA 1DE0A 2BM0A 1YR8A 2F1IA 4ZCLA 3L43A 5LD2B 3RS5A 1G8GA 3LD9A 3ZD7A 2QPOA 3A1WA 3B6EA 1TUIA 2IYVA 2N46A 2J45A 3AKYA 1VECA 3KL4A 2H57A 1OB2A 5DI3A 4PFSA 3UANA 1W46A 1W4BA 2NG1A 3C7KA 2BBOA 4RD1A 1XJ0A 3WP1B 5FBVB 2QTHA 3CIOA 3RS0A 3HU3A 2B6HA 4WVFA 5K8TA 2N1BA 4CZ2A 1W36D 2HV8A 1SHKA 3PR1A 2A5DA 2H16A 4AG5A 2QT0A 1NLFA 4ZIRA 2W6ID 1DS6A 4CEIA 1MO5A 2X8AA 1X3SA 4H1UA 1WA5A 3W8RA 5SZJA 4BEBA 4DLSA 3A37A 3HPRA 2F1HA 5ELXA 2X2FA 5EP4A 1R5BA 3AGPA 3CNNA 4WBSA 4BLTA 1JR3D 3BJIC 3WP0A 4QM7A 1Y3AA 4LV8B 1WF3A 4HB2A 1IJFA 1EFHA 3OEEA 3RRZA 2BBTA 4OKSA 4JLVA 3VR3A 3B78A 3IBYA 4LBVA 2J59A 1TEVA 2J7PD 3G82C 4BLQA 1SXJA 5FOWA 2GF0A 1S0UA 1Q22A 2ZS8A 4HAYA 1G18A 4U02A 2QGNA 3QG1A 1F5NA 5F9HA 1J7KA 4KFTA 4TLEA 1XTKA 2VP2A 3U44A 1EGAA 2Q21A 1K8RA 3QNUA 5GJWC 3VHLB 3VNUA 2VF8A 4AKEA 1IN7A 4GP6A 5BXQC 4RKEA 2NMVA 2QMUA 3K09C 1RRPA 3A1SA 1WRBA 1EFRD 1M7HA 1E4VA 2IUSA 2WPDA 3QXCA 3T1VA 3Q85A 1CIPA 4TT3A 1ZUNB 4ZKEA 4FIDA 1KKMA 4M9XA 1U98A 3FMPB 3MWKA 3TSZA 2BMFA 2ZYUX 1U0LA 2FZ4A 3IQXA 4EPYA 1BH2A 2IL1A 4NP6A 4AG6A 1G21E 4P4SB 2QRNA 2EFDB 2GWHA 4Q4JB 4TTQA 2XB4A 1CJVC 4HLQB 2D7DA 1KI1A 2ZRKA 2WSSD 3WMFA 4OI2A 4Q7LA 1G17A 4QHYA 3IIJA 4JL5A 2AK2A 1P2UA 1KDPA 1JXOA 1CEEA 3DEFA 3BBPA 1L8QA 3LWNA 2VHJA 1S9DA 1K5GA 4NDZA 2ZIAA 4Q48A 4CF7A 4GSYA 1T5LA 3WXMA 3MJHA 4A2PA 4Q9HA 4GT1A 4C0SA 5GJBA 4NU0A 3IPXA 3Q5EA 1MABB 1V5WA 3GFOA 1C1YA 5AR1A 121PA 2BCJQ 3R7WA 1RIFA 2GVDC 2WAXA 2MSCB 4PR0A 3SJAA 1OV4A 5JS8A 2IWRA 2HXSA 3H0KA 2ERXA 3AF0A 4I1OA 4HUQB 4MRSA 4DCTA 1YHNA 1EFTA 3RDPA 2H92A 3PENA 2DWOA 1P73A 1W44A 3AH8A 3HR8A 4M53A 4LSGA 1NN3A 2O0JA 1Q1EA 4BWYA 1TMKA 4HATA 1E1RA 1VHTA 3KQLA 2O8EB 3CWQA 2FSGA 2ZJYA 4Q5IA 1KO1A 3QUSA 4XWOA 3SOPA 3ZS9A 4BFTA 5GADl 4FCWA 1JI0A 1X1SA 3K0CA 1Z06A 3EIHA 1X86B 4QG7A 3U2QA 1RYHA 3GJ5A 2QY9A 3DDCA 4L15A 3LDAA 4YMVA 2GCOB 2RGDA 3M4YA 5FPKA 4AY2A 2BEKA 2OESA 1G7SA 5CIQA 2ZI5A 2WOJA 4QGHA 3CZQA 5FTLA 1OH7A 3B85A 5DLQC 2CK3A 3OFNA 2JJ2A 1Z6GA 1KZGB 3OEED 5L3VA 1OKKA 1YJ5A 3AUYA 4UNQA 3GLGE 1S8FA 3KKPA 1AS3A 4BRWA 3D8BA 3NHBA 5GJVC 1YQTA 2GK6A 2PT7A 1R0YA 4XTCS 2QNRA 4EQ6B 2C5LA 2PLRA 2R6FA 5EE5B 1P9NA 3X2SA 4LHXA 4TMWA 3KXKA 4F92B 3ADKA 4CT5A 3BXZA 1I4TD 3KTAA 4P4TA 4Q1AA 3NHAA 4TLBA 1XWIA 2J7KA 2HF9A 4RJLA 3RRMA 5L3QB 2ZRGA 3CPJB 3EWSA 4JT4A 3SHFA 1E3MA 3WRYC 2CJWB 2FPMA 3CH4B 1ODFA 5HKKA 2ZJAA 4WZAE 2IYYA 3WY9A 1GNPA 3CRVA 1IY0A 2IEYA 4QBHA 5DGXA 3F0TA 1WQ1R 3E70C 3LW7A 1QHXA 2FMXA 2ZI6A 4TT3D 2J46A 2OILA 1AGRA 3Q7QA 2R62A 3AVOA 4IOLA 4X8MA 3NWJA 2H1LA 1QF9A 3SJBA 2OCPA 1AK2A 4JVSB 4URZR 1FNNA 4NL4H 2DR3A 4RFVA 1IBRA 2WWXA 4ARZB 3ASZA 3B7GA 3Q72A 4AWXA 4X8HA 1NLYA 2OXRA 4V0LA 1NL3A 5M04A 1OLOA 4RZUA 3B8HA 1TEXA 1ZMXA 4CW7A 3I62A 3L0PA 1P2VA 4KYUA 5FL7A 2OCBA 2RGGA 4LI0A 3ZLJA 2IS4A 1OXUA 2HLDA 1E9FA 2R44A 2YWHA 5J4HA 1JNYA 4JL8A 4D4MA 6Q21A 4QJ5A 4F7WA 3QJYA 2REBA 1GVNB 1R0XA 3IQWA 1VG9B 4EPXA 2HT1A 1ZM7A 2DFNA 2Z83A 2QORA 1Z3IX 4RFSA 4TMTA 2XNSA 2ORVA 1G291 3TR0A 4BFWA 3SYKA 5IHPA 1VDZA 3KFXA 3E5HA 2ZM5A 2NZ8A 2BMJA 3U7GA 3LV8A 2C03A 2D2EA 2NPFA 2DY1A 5AJVB 1IJEA 4B3FX 5KU1A 2ZR9A 3AVPA 4IOKA 1VKJA 3SFVA 3CUEF 4P0TA 1HE1C 1SKQA 1FNMA 3LO5A 4M1YA 3U7EB 1XDBA 5FPSA 1XPOA 4GPTA 1N6NA 5JCPA 5DH9A 5FBWB 2V8OA 4MYCA 3I4LA 2D62A 5AJYA 2JASA 3QXJA 1ZNXA 3I8XA 5HZKA 3QPWA 5L3SB 3GLIB 1AZTA 5JHHB 4QNRA 1G6OA 4LYFA 4HLUA 1JJ7A 1KKLA 2JLRA 2E1RA 3AEZA 4HYYA 4TL9A 4D2IA 4WZBE 2A2ZA 4Q7JB 1ZNWA 2QGZA 3FMIA 1ZJ6A 1E2MA 4PPQA 4LJ5A 2CK3D 3OFND 2JJ2D 4D6PA 3GEIA 3QKSB 2CHVA 5AJZA 5H1YA 2CCGA 4DSTA 3AVUA 1A82A 3PFIA 5BYKA 4L9WA 2R9VA 2RHMA 2BDTA 1DBSA 2ZSFA 4KXFB 4WW0A 4AKHA 4MUAA 1JJVA 3IEVA 1CP2A 4DUGA 4OJQA 3LW8A 4UNSA 2CLCX 1G3RA 3U3OA 2W2XA 2NPIA 1LY1A 1W0JA 4DLVA 4PHTA 2VO1A 5AUPB 1PZNA 3TVDA 3B1WA 3M6AA 4WA7A 2QUZA 3CRMA 2A30A 5HKKD 4EAQA 4PHFA 3CRW1 3M1IA 1YRAA 3RS2A 1CR2A 2EFGA 2FDCA 1Q3HA 1Z0KA 4HEJA 4LC1A 4Q9JA 2IHYA 2W2VA 4QXAA 3MUFA 1VCMA 4Q4HA 2WOOA 2X19A 4WIAA 1CJMA 2V4ZA 3QXHA 4LGMA 4CDGA 1H8HA 3AF4A 3LLMA 1U9IC 1G41A 1E96A 2D06A 2WJGA 2WHXA 1OSNA 5JWRA 1ELOA 1NVVR 2GXAA 1E2JA 1XEWY 2GA8A 4WAUA 3GEEA 3BH7A 5FL7D 4IOMA 3RS7A 2HLDD 2ZXUA 3RRYA 4HB4A 2H8KA 3WYAA 1KDRA 4KSBA 2C98A 4DLYA 1IY1A 2CE7A 4DRZA 4GNKA 5HE8A 3UWOA 2G88A 2J1LA 4JLMA 1VG1A 2VLIA 1ZC4A 2D2FA 3Q8XB 1TPZA 2UVQA 3KQHA 4B48A 1BMFA 2ODNA 3TW4A 1ZD1A 1E2PA 3BE4A 1FUUA 3LY5A 5HZHA 4IDQA 2KI5A 3TW8B 4KYIB 3T35A 4ASUD 1SKYB 3ADBA 4C0HA 1ZW6A 2V55B 1KI6A 3TQCA 3IHLA 3OIYA 2F1JA 3UG7A 1XXHB 2VHUA 3AUXA 4PO9A 3AF3A 1VIYA 1KAGA 1F3OA 3RS3A 4YMUA 1CU1A 5G53C 5KSOA 4N3NA 4FN5A 4UJ3A 4FXPA 4MDEA 5JMTA 5KNBA 3IIMA 2ATVA 2PCLA 4AYTA 5BN5A 2QQ0A 2K5UA 2Z6VA 1KSFX 2RMKA 4LV5B 3Q7PA 2HUPA 2EW1A 4EFNA 2GAOA 1U0HC 4QGAA 3AVXA 5AUOB 1XMSA 1MV5A 2XNDD 1RJ9A 5JWOA 2QZ4A 3ICQB 3K0EA 2NZJA 2OE2A 3KJIA 5HE9A 4KLNA 1KHTA 2G3YA 4NHOA 5GVRA 4BZQA 5EE9A 4B3CA 3GJXC 2W0SA 2O8DA 1OHHA 1TX4B 1XZPA 5K8LA 4E5UA 1G3UA 3ZIAA 3KQUA 3AP2A 5P21A 4DUGD 3THWA 1PVOA 4HZUB 4D25A 2O0HA 3BB1A 3MFYA 3QEJA 2BEJA 4PQRA 3KQKA 3C8UA 3HPQA 4I1UA 2IYQA 1CBUA 3GJ6A 3IO5A 2ZRHA 2AKYA 1GFIA 4PSVA 1J2JA 3CNLA 3WHLA 1GSIA 5KNDA 2GHIA 1JR3E 2H5EA 2UKDA 1QVRA 3EZFA 4RSGA 1N0VC 1S2MA 4TQUS 4XVRA 4ZKDA 1PV4A 1FFHA 1V43A 3VR2A 4ERNA 3NH9A 4B35A 3LH5A 4O2LA 4ON9A 1KI4A 2WMOB 2ZETA 1E6CA 1M6NA 3MRSA 1NF3A 2WIAA 2O8FA 2I3BA 3GLHA 2C9OA 3C41J 3IBGA 4L9SA 4AD8A 1ZCAA 2WTUA 2RGEA 1JPNA 2V7QA 4V0KA 3IPYA 3GPLA 4QKQA 2GJSA 4P33A 3NKVA 4GMXA 2ODBA 4BLOA 1KI9A 1ZRHA 5IRCD 5CJPA 1Z28A 1FL9A 3X1WA 3U4QB 4C7OA 3FHOA 3BK7A 3HJNA 1Z2AA 2KE5A 1QHYA 4RZ2A 3MD0A 3SFZA 4RD4A 2RGNA 3B1XA 3QF4B 2QRZA 4OQXA 2ZUBA 2BJWA 4PHGA 1GIAA 2CCJA 4HAZA 4MGYR 3U7HB 1KNXA 1DAEA 3I72A 4ACAA 4DCNA 3SYNA 4CEJB 3LXRA 4Q18A 4FD2A 3NBFA 4C0AC 1KO8A 2ZI3A 3BH6A 2ODWA 2DCUA 3VR1A 5JRZA 2OHFA 2DYKA 3K0FB 4W5JA 1ZNZA 4ACBA 2J0UB 5B57C 1KY3A 3CX6A 4JKYA 4UXHA 1R0ZA 1U8ZA 2WJJA 2ZAOA 3B60A 1PLLA 1ZIOA 4JL6A 4AK9A 1CKEA 2W6JA 4IDPA 2HCBA 4L4UA 5AWFC 3W9YA 3EZ6A 1D9XA 1I4LD 4JJZA 5BN3A 2VPPA 4YLGA 2WV9A 4QM6A 1E98A 2NOAA 4PC6A 3B9QA 3F8TA 4D4JA 5JCZA 1T0JB 2MMGA 5HPYB 1DARA 3BC1A 3ZYCA 2J9RA 3DMDA 3KDSE 4Y0VA 3ZQJA 1KDTA 1DAKA 2DBYA 4TMXA 1XTRA 3K9LA 3W3ZB 3U3KA 4EJSC 4FMBB 4DCVA 4LJYA 1N5KA 3EIQA 2QU8A 1XMVA 4TYQA 1G3QA 5FBLB 1JAHA 1MT0A 4NKRA 2IW3A 5KSZA 1P72A 3CPHA 3QE0A 3CRRA 2ZI9A 2OXCA 3ZVLA 1JR3A 2F3TA 3U3JA 3X1DA 1T3LA 4ZPXA 2ANBA 1B23P 3FOZA 421PA 1W4CA 3EAQA 4JIMA 1QG2A 5CJ2A 5FPYA 5TMPA 1GILA 3ECCA 3D3QA 4JLKA 2N42A 1NLZA 2ZUDA 1GDDA 3BS4A 3ZIAD 1Z0AA 5JECA 3R9XA 2D74A 2CHQA 1VG0B 1BO6A 3HDTA 1EG7A 1N6OA 1P9RA 3BIFA 1G5TA 5LBIA 1F2UB 4LYAA 2DB3A 5C4GB 1TF7A 2IBMA 4IRUB 4Z54A 1FTSA 2FSIA 4PO8A 1TQDA 3THXA 1RRCA 4OQLA 4LHYA 4LBYA 4FMDB 1KJZA 1JPJA 4DSUA 4AI6A 3BFKA 1KMHB 1MO6A 1VHLA 3KXLA 1LS1A 2OG2A 2R6CA 4R2IA 1KO7A 1JEEA 1KSHA 4IFBA 1TF5A 4IVQA 2LKCA 1EFRA 5JS7A 1UEIA 4RCYA 2MSEB 1D2MA 1FOEB 3QVUA 3RWOA 3PVSA 1KNQA 1UF9A 2OZEA 1II8B 2V7QD 4P4SA 3OEHA 1CXZA 4Q4JA 3C5CA 2BV3A 1Z6TA 3NTUA 2IXEA 1YR7A 3FKSD 4OJKA 3TBKA 4KBFA 3V4RA 2E87A 2V54A 2QMEA 2JDIA 3DO6A 2QT1A 3SJCA 3T61A 3K9HA 1NIPA 2WICA 1KSGA 3REFA 3D6TB 1HQCA 4NCJA 4A9AA 2XB2A 1KIMA 4GZLA 4JLJA 1OIVA 4FCTA 1MABA 1OFTA 2RB4A 4KLZA 3HP1A 2Q9CA 4NYJQ 2QROA 3B2EA 3CLVA 5IT5A 3P4YA 1E32A 3P26A 1U90A 5JHGB 1VIAA 4GZMA 1K5DA 5UKDA 1NMZA 2GXUA 2VRWA 1OF1A 4RD0A 3C14C 4TL8A 4QGFA 2UZIR 4TSFA 2BJVA 4OHVA 1R8QA 2P3SA 1OXVA 2SHKA 2IUTA 1JB1A 4TTRA 4MKIA 4A0GA 4F4CA 3K1JA 1GZSA 1CR4A 1UADA 2W6JD 3EG5A 4F93B 4DCSA 4LJ4A 4FW9A 1ZC3A 5EE1A 1WB9A 4D0NA 2V1UA 1GKYA 3CKLA 1YKSA 2PMKA 3QF7A 2GZDA 2KB0A 3CR7A 2G1KA 4DT1B 3OHMA 1TQ6A 5C4MA 2C04A 2GCOA 1FMJA 4TL6A 3A4NA 1KZ7B 2Z0MA 3VHXA 5H70A 1SVIA 3SQWA 2QP3A 2BOVA 4C0BA 5GJCA 4ZO4A 1HE8B 1QDEA 4GI7A 1ONBA 3SE0A 5F3WB 4JT2A 2EYQA 4OHYA 2CCKA 2WWWA 2IX3A 2RH5A 3EWAA 3R9IA 4C0QC 2GBLC 2ZRBA 1FQKA 3B13B 4EQ6A 3WBJA 3GLIE 2JLZA 4FI3C 5TARA 2CVHA 2AN9A 1C9KA 4PZYA 2ZSAA 2ERYA 4BUJA 4MRPA 4IOJA 3K0SA 4BEJA 1II9A 4DIEA 3AM1A 5FPTA 5L3QA 2IF0A 3H2YA 3SS8A 1TTTA 4G01B 3O47A 3C15C 3MJRA 3P20A 3QENA 4HDCA 3A1UA 1F60A 1G8FA 1LF0A 2WKPA 1H8ED 3SNHA 4EJSB 2ZRLA 2XXAB 1NY5A 2CJWA 5CDFA 2QMHA 4A36A 1E0SA 5SZKB 1E9EA 5BQ5A 4JYBA 4Q01A 4XD7A 1G16A 1TADA 2CHGA 2OV2A 3IEUA 2FFBA 5AJWA 3NIBA 4HUTA 1YZUA 1LNZA 2EVWX 1EFCA
chains in the Genus database with same CATH superfamily
3AUUA 1RT9A 4S24A 4ZAYA 1L7VC 4TTPA 4NBKA 1DT5A 2QM3A 2O05A 2AHYA 2QP9X 2ATKC 3P32A 3CCVV 4D8VA 4YP5A 5A6SA 2BFCB 3ZWMA 2QI9F 4FGZA 5IDXA 5IDQA 4D97A 5C2JB 4B3HA 3JASB 1G6Q1 4JTDB 3NC4A 1OE0A 1NVEA 2V6GA 5DDIP 3EW9A 2DFPA 4CKEB 4Q93A 2NZXA 3FPEA 4X88A 4WDQA 3D5QA 1PG2A 1P3JA 5DNEA 2J67A 3TI7A 3HWX1 1GPUA 1CDZA 4HAIA 5K3DA 2OWOA 5IS2A 1YV9A 4PYLA 3PTAA 3ZGLA 5C32A 3LHFA 3OE4A 3CX7A 2G4VA 4L74A 3B51X 4PQYA 1OLXA 1KVTA 1G20E 1UODA 4IDHA 4X61A 1N5IA 3EC2A 1RRFA 3RGBA 3A9UA 3AHDA 4GKKO 1AGYA 3PRYA 3SKXA 5BVHA 2OTJV 1ZR4A 4LNHA 5B53A 2ZI7A 2A4MA 1WXXA 2FXVA 4P5EA 2J6CA 2RCNA 4EJ2A 1IBSA 4U7TB 3FWYA 4FMTA 3ZHCA 3NDBB 4V3BA 4M9CA 2GAJA 1FFYA 3D36A 1T4CB 5DM1A 2CTQA 3EGVA 1UT6A 2MYUA 2O3RA 2QXTA 1PR2A 4ME6A 4UVDA 5AW4A 3QEBZ 3HB3B 4AXXA 3CE2A 4DADA 3B8NA 5GIPE 3AIMA 3UKOA 4MJLA 2NN3C 4KXMA 1E2QA 3L6OO 1OPXA 4BLUA 3HP7A 4L0QA 3I83A 3IHTA 3O8CA 1WLSA 2JEUA 4FGUA 4YRGA 3H18A 4ENPA 4RKFA 4WKBA 4RLHA 2Q6AA 4L5CA 3R24A 4GL4A 1YBHA 4G4JA 3E1KA 5TIIA 4LMBA 2F23A 3WL4A 3R3UA 3SF8B 2AQIA 3LC2O 5FI0B 1QZUA 5KWVA 4R81A 1SWWA 2RJOA 3DE5X 2D1TA 5EHIA 5KTTA 1GM5A 3HXPA 4L6CA 3OC0A 1TIPA 5ALXA 2JHAA 2HLHA 1UL1X 2XE4A 4NOMA 5IU6A 4ZICA 4XIIA 4POAA 4EPRA 3SIWA 3KZOA 4Z0NA 2RNBA 4QEDA 1X6VA 3U3ZA 5GTDA 1SZTA 4LF9O 5LOVF 3RS4A 1ABFA 5EWMB 1EJ2A 1YWGO 5BSUA 5TPZD 2VAPA 5BW4A 3WK4A 5FAXA 1TNDA 2D0OB 3HCCA 4BY9E 3L46A 3PITA 2QL5A 5LP6A 1XGKA 4CLDA 2YFKA 4DQDA 1SU4A 1P0CA 5T8KA 5LWQA 3KQTA 3OTGA 3DMTC 4HL6A 2OZVA 2REXB 2VAVA 5IYBO 4JLDA 3UO8B 2CDBA 1PJ3A 4MMYB 1R6VA 2G4LA 3CW2A 3V1NA 4B4KA 2YYZA 2IEAA 3VUFA 4ZDWA 1T2NA 4V0MA 2IZ0A 1SY7A 4ZC8A 4D0GA 5H5JA 3FKSA 2P3QA 3TSYA 2IXDA 3V7UA 4GQIA 4D44A 2EIXA 1G9XA 2ZXEA 3IE2A 4QL3A 2HEGA 3F1KA 2X3YA 4X1KA 4CIDA 4Z0TA 2XYPA 4P35A 4QTTB 1C4KA 1I24A 4NPHA 3MT0A 1REQB 4G9BA 4FK5C 4FYHA 3HXLA 5LHGA 3NHSA 3QHPA 2I8AA 3UJBA 4HTAA 2R7KA 4PQGA 2BC9A 3VC2A 1PX2A 1FJHA 4RMJA 3U3RA 3ICPA 1N8NA 1XQWA 4NMLA 4UVCA 4RPKA 1GDTA 3OP1A 1SG6A 1AA6A 5I6DA 5T67A 1WBDA 1MO4A 3ZMZA 4B6QA 4PLZA 3IQHX 1XJ5A 2A9FA 2O59A 2X8LA 2W58A 1VP3A 4NYIR 4UB8Z 3LQYA 1GQSA 3UPTA 2I71A 3UOAB 2OBYA 3QUAA 1XLWA 3C4QA 3WXBA 5LMUB 1L3IA 2XITA 1MIOB 4ZZ0A 2X2OA 1T3TA 1XT6A 2YZ7A 3W90A 4H77A 3RNOA 1IXBA 1P0QA 3PFBA 1JDVA 2H48A 4L51A 4CUKA 5BNZA 1ARZA 2G25A 2QG6A 3I9V1 4CCAA 2ES4A 2O8EA 4E1VA 1EWRA 1FQOA 1DFHA 4P3NA 3AX6A 2IM9A 3AUAA 3FHCB 2YV4A 1GGVA 2C54A 3E8HA 3PN1A 1SVKA 3KT3A 4JV5B 5DNDA 4TM8A 2NVUB 2X7JA 3VPSA 4OPMA 1UMDA 5AXAA 4F91B 4PAMA 1EAYA 1RWKA 1MPTA 1PD3A 4U7DA 1W36B 2PT5A 1UCFA 1Y5RA 1O5TA 1S89A 1VYHA 4LF4B 2AW3A 3CJQA 4PO1A 2O5VA 1GUBA 4TSFG 2RG7A 4W82A 4H08A 1OH6A 1WE2A 2PGJA 1NVUQ 1TCUA 3DKRA 2P5TB 5HCIA 2E4ZA 1UBGA 4X62O 3ABTA 3MWDB 5LGNA 5ALOA 2WKSA 1LFDB 4PZAA 2XYGA 4Q1EA 3A6PC 4DR7O 1DEAA 2BE3A 3IEIA 2UXCB 1YEWA 1WOMA 1C3LA 2PZMA 2HPZA 4B7AA 3RBZA 3AK2A 4WA8A 3JWHA 3K20A 5DTMA 2EF0A 4QUDA 1F6DA 2JIDA 3HR4A 2DU8A 5CB8A 2TMKA 3GBVA 4GR9A 1F2DA 4JLPA 2VZ0A 2QVXX 3CUWA 1PR6A 1FJGO 4R9UC 3PSHA 3AV3A 4BWGA 2YEVA 3E84A 5KVAA 3TGPA 4JBYA 1DK1A 3O8QB 2W2NA 3UJ9A 4JI3B 3BFXA 2BJHA 3KUXA 3UV6A 3NIGB 3FNRA 3AZPA 1JQAA 2ZBVA 1U1IA 1B2LA 1K3FA 2XHBA 1ESNA 4V0QA 5C53B 1ZD3A 1SPBS 2XAJA 4B4VA 1G3MA 3VOUA 2P5YA 5L40A 4Y1GA 1QR9A 4Z1VA 1UKBA 2PZJA 5A9GA 1KAEA 2YIVX 4L95C 2G1UA 1JIJA 4IO1A 1J0XO 4YONB 2WA1A 4FBGA 4RA9B 2EZUA 3CISA 7ADHA 3R5HA 1KGDA 4ZALA 1DV2A 3IJ5A 3L8YA 4V1CB 3UT0A 3PC4A 2RB5A 3QEAZ 4RD3A 5DW0A 3IALA 4P98A 5FWYB 3K8OE 3SQDA 4EYEA 5BOSA 1DCFA 3ZDQA 1B0UA 4EYGA 1FMCA 3W9BA 2JFGA 2EFHB 4Q16A 4L28A 1I7QB 4O3FA 4BNJA 1CUVA 2JLWA 3IV9A 3GJYA 3CKYA 3AXTA 1JX6A 2BTQB 2XRMA 4OG2A 1NAIA 4JQYA 1ZVVA 4L2IA 4WZAA 4TKZA 5JT1A 2JJ1A 3BCCH 1UDWA 1XOIA 4UDOA 5I5EA 2A86A 2VS1A 3BILA 4X84A 1VL1A 1ICIA 3TMYA 1YJ8A 4RM2A 5LJLA 2IP4A 4TXHA 2JFWA 3QF4A 1RFGE 3GT4A 4M1SA 4L8WB 2Q8VA 1I51A 4LY9A 2YUTA 3ZUPA 2PFSA 4P6VF 2CDNA 4F7DA 4XQ9A 4MKFA 3IDZA 3F5QA 1PS0A 1RRGA 1FPOA 1SC1A 3HYLA 3KR0A 1KEWA 4R8MA 2JGRA 2OIGA 3LBFA 4QT0A 3PXCX 3KVNA 4PAGA 2G77B 4GRAA 5EP2A 3QIAA 3DJYA 1DEKA 1K2WA 4GP7A 4KOAA 4JD5A 2IC5A 1AKNA 3WV5A 4CLEA 3GQBA 1NJ5A 5HILA 1P9LA 3R5KA 1DEXA 4AN4A 3KQWA 2HHHB 1GVHA 1ZGHA 1T5SA 1IUKA 3VC3A 4MV0A 4N76A 1C0IA 1SBTA 2BHNA 4RVDA 2FFRA 2XWSA 4RGBA 1IZ9A 2Z3VA 2KG7A 4DCJA 1K98A 2QD3A 4M6WB 4L8YA 4HN4B 4PQFA 4RGVA 3TLZA 1ZM9A 3DCYA 4EKWA 4Q1FA 3G5TA 5I8ZA 1L4EA 2Q6KA 2RGNC 5FFMA 3E22B 5D5QA 1RZ3A 1NRJB 1FXVA 4BNUA 4F4IA 1S8NA 4MA0A 4PYIA 4FMPA 1U4OA 1M72A 1V5FA 4BU0A 4Q3NA 4DV6O 1Z4NA 3AC0A 2WLHA 4RK6A 4Y2XA 1MW9X 1J70A 4EGFA 4KDEA 5EI5A 4LE2A 3U7QA 2I2FA 2C2BA 3L5OA 4QTYA 1JKJB 3LOUA 5T57A 1RM4A 5LQRA 4EI7A 2Q9BA 1M2FA 3HGQA 3O4IA 3DV0B 5IN5A 2Q4RA 4QRHA 4LN1A 4YGXB 5I7VA 2WM8A 1BCSA 2DULA 4KX3A 2D6FA 4ODIA 4HJRA 2LD4A 2P6MA 4D7AA 1E2UA 4RVGA 2YCLA 4DQ0A 4C1BA 3MTAA 3AK1A 3N2EA 1IDOA 3RBXA 3KO8A 5ER6A 5GTIZ 4IEFB 3Q4GA 3A1VA 4DMKA 3BAFA 1VPEA 1MRNA 4ZZ3A 5EJ9A 1YDHA 1DO0A 4P30A 2AG6A 1D0SA 1HLFA 2IU6A 2EWVA 1HLGA 2DBVO 1DSSG 4JEHA 3FZYA 1M3SA 4URUR 4L5IA 3H19A 2D5AA 1O9HA 5FLYA 1E94E 1B00A 5FUQA 4N7BA 2EYUA 3F3MA 2YVKA 4QGPA 3ZXUB 1PJSA 3EXEA 1V3TA 5KREA 3VPAA 1A32A 3PC8C 3A1WA 5IARA 1K3EA 4Y6LA 5KNLA 5KYWB 3WP1B 3PYLA 5CT9A 3VV3A 2LFRA 1BXGB 3NNNA 4KXNA 3HU3A 4JXKA 3BDAA 1MO5A 1P1CA 2ON6A 3A37A 1H2RS 3PT5A 4W5TA 3OHPA 1K0FA 1QIGA 2XMPA 1GD1O 1BWQA 1USGA 2F90A 5CPFA 2W2PA 1OCOB 1TDJA 4HAYA 5LMNO 1YB1A 1J7KA 4LTDA 1UC4B 1A04A 3KZIZ 2HO4A 1ZCJA 4IS2A 2K9PA 1H2YA 1DFGA 5E9JA 4QATA 2WTMA 1MX1A 1BRMA 2ZSIA 3NXKA 1CXZB 4HPXB 2R8XA 1EBOA 1L8QA 3FLMA 2YZNA 5T6BA 4NQRA 5AR1A 5ERGB 1TAEA 3IAEA 2IWRA 4C7VA 5ALPA 5CB0A 3RDPA 2VQDA 4J7CA 4JK3A 3RKRA 1X7HA 2PGAA 4FEGA 2PZLA 4FCWA 5ULLA 7YASA 3GJ5A 1JU4A 3CZQA 1Q83A 2V0GA 1Z6GA 3RYIB 3JD0A 5GJVC 1WD5A 5TGDA 3ADKA 4Y2VA 1XDDA 2HWKA 2HQRA 2FRDA 1S8AA 1EB8A 3L1VA 4EITA 2AOTA 4JI6B 2P78A 5I7EA 1U0EA 1E3MA 4D3FA 1ODFA 4H6PA 4WZAE 3R2JA 4CJXA 3TFWA 3NWJA 2Q5EA 1QF9A 3RRXA 1DDOA 1YNOA 3B7GA 3HKDB 4Z9FA 4Q15A 1RWPA 2Q3EA 1QHEA 4QJ5A 1R0XA 1VG9B 4EPXA 3G8DA 3G8BA 1ZM7A 3G7NA 3QW2A 2P41A 4WDRA 3SYKA 4EFBA 4BKPA 1ZAUA 2C4TA 3SLGA 1RHQA 3IFSA 4QOJA 4ZT4A 3U7EB 5FPSA 3IJRA 1X94A 3R7FA 1UANA 3PQ4A 1FFEA 4PHZA 1DX4A 4Z1MG 1L5HB 5ADHA 3EQ8A 3IPAA 3BGVA 4HEA6 4EKEA 3WSVA 3M81A 4L9WA 5K45A 2HA6A 1GQOA 4LF5B 2QV0A 2NPIA 2VO1A 1C7RA 5B1DA 4PHFA 5BN4B 1U0TA 4Z2AA 3RVKA 3AG3B 2HPVA 3CZ9A 3DPSA 3T5TA 1LSJA 1H6AA 3NIDB 1LEHA 3ER6A 3IEXA 5DW3A 5F35A 2JJYA 4K9DA 3BH7A 5ICFA 1JFSA 1W5EA 1HDZA 1GZ6A 4G1BA 1SH7A 3A2LA 1GTJ1 1TPZA 4UC0A 5HYVA 1IL0A 1EIWA 4MWOA 2QLFA 5F12A 4CNQA 3UAWA 3ABKB 1LWOA 1ULZA 1VQ1A 2X13A 2H07A 5EJ8A 4UPEA 4N3NA 2JW5A 1TZ2A 4MDEA 5JMTA 3IIMA 4JHLA 1XMSA 2Y71A 2NZJA 2P8JA 2G3YA 5TISZ 3O5AA 4HQNA 3S2FA 3GAFA 4Q7QA 3U81A 4HZUB 4XVCA 4YRQA 2AJTA 3C8UA 3IP1A 1YDWA 2O3UA 5LQJA 3WHLA 3GEDA 4W8GA 3H1IH 4XVRA 5EWJB 3E35A 1OJ7A 3M2PA 3ORYA 3VR2A 1ISGA 1QUFA 3SOZA 1ODSA 2GJSA 3X1WA 1LK0A 1NC1A 3NHKA 2XUZA 3RFFA 4DNPA 4PHGA 2CCJA 4HAZA 4QE3A 1U7ZA 4BO7A 3SFTA 2WSBA 1EDEA 5KYVA 3MJFA 1E3WB 2DCUA 3RT9A 3LCMA 3W4KA 1Y7PA 2OSVA 5B57C 1LDNA 4UCRA 4PN7A 4V1CI 4MUFA 4GC5A 1BH6A 1EA7A 3ORFA 5BN3A 3LT2A 1V71A 3KTDA 1V2GA 1TQ8A 5FBHA 1RPRA 2QLJA 4RPGA 4JI8O 2ADOA 3U3KA 4HNTA 2EZTA 1N5KA 1N0JA 2WIFA 3HSSA 1LX7A 5B1EA 3U3JA 1E1MA 1LW6E 2WB2A 3FOZA 2CY0A 1SBHA 4KXYA 4W5RA 3SNKA 2AFIB 4X20A 2ID7A 3EJWA 2CHQA 3EZYA 4JR1A 1MC1A 2BH2A 5BVGB 1XNHA 1EK2A 4RTSA 3E05A 3ROXA 2ET6A 5TJHA 2V6MA 3KXLA 4CWAA 1KNQA 1BE1A 3EFOA 3OEHA 3VPBA 1IBLB 1H2AS 2E3CA 2PQ2A 3F3KA 4K9NA 2Z6UA 4TOIA 3DFFA 3OZFA 4GM0A 2R66A 4QUAA 4AJLA 4FOOA 1OIVA 3ROGA 1OFTA 3R40A 3HP1A 1SHJA 4IAOA 3H2GA 1T4BA 4G1CA 1PJCA 1OCCC 1J6UA 3JQ7B 3L0ZA 1UADA 2YMQA 4Q4DA 4ZOLB 1KEUA 1LLFA 3HLTA 1CY8A 1E3TA 1FMJA 2HK8A 3A4NA 5TT1A 2I91A 3WL6A 3JQGA 1AMOA 3EH2A 2QP3A 4UBMA 2PS1A 3AU8A 5GJCA 1ONBA 4OHYA 2AZTA 3EWAA 3R9IA 1FQKA 3P2EA 4RTLA 1IHYA 2HCFA 5GM2A 3T5BA 2QUJA 4EZBA 2P9TA 1TFUA 5FPTA 2HRQA 3VZCA 1TTTA 3MJRA 4UUNA 4HDCA 1JWAB 4R84A 2WKPA 1P17A 4CIWA 1FTGA 2BMVA 2CWDA 1Q7RA 1BEUB 3VX3A 1NVBA 5PGMA 2E18A 2IXBA 4G63A 4ARZA 3ETJA 4MTLA 3HUUA 2HYIC 4HFJA 1YFJA 3TJZA 3V33A 3JARA 2I4LA 1WM1A 3H5LA 4UUBA 1YU6A 3ZMSA 3AG5A 3K31A 4WK6A 5LB2A 2BOBC 3B20A 1ISIA 2G5PA 2RHJA 3U9TA 1ZA1A 4O4IB 4W5OA 4TMKA 1ORQC 1RHJA 4XYGA 2X4GA 3MSXA 1VLQA 4X93A 2AEFA 1PDWA 4ND5A 3VPCA 3QWFA 1NTZH 3LBYA 3KVYA 4X94A 5KTYA 1QO7A 1YJBA 4RQFA 2WE8A 4PNHA 4JBGA 1JLMA 1JDNA 4QJ3A 2P65A 3TL2A 6CHYA 5HRUA 3ZIDA 5F7XA 3LRXA 1MB3A 3M6WA 2AIRA 5KQRA 3GFGA 4MKHA 3A4VA 2ZRPA 2VZLA 4BP8A 3B1JA 4EVIA 4F21A 4GOXA 4WFHA 1YD7A 4YAJA 4QX6A 2GD6A 2WU3A 2EU8A 3IULA 3TTWA 3JSLA 1SXJB 3HO1A 6ADHA 4M0LA 2FSVA 1S1CA 2LCFA 2HTFA 4XARA 3GU3A 1SZCA 1UDXA 3VQWA 3W8FA 3NVAA 4KBGA 1FTQA 1FDIA 5JYDA 2OBLA 1YHZA 2HHAA 3OFNG 1C3EA 4MS4A 1V1JA 1GN9A 3FOBA 2QVCA 3ZGXA 3D8HA 2X0EA 1UPCA 3ONWA 3L1IA 3IUJA 4DIUA 5IG2A 1EVEA 1KIFA 3YASA 3KJXA 2ISCA 4D81A 1TM4E 1GPYA 2NO6A 4UAGA 4IO0A 3B1ZA 5ALNA 3F90A 2XNDA 3L4JA 4EI8A 2FPIB 4YMWA 1UWLA 5KJ1A 3C3BA 2HLDG 1E1DA 2AHOA 1PG5A 4JN6B 1NW4A 2Q69A 2AMLA 1CJTC 4UVAA 2CFTA 4WEQA 2C84A 1RR6A 1F14A 2AEEA 1J8DA 1E6EA 3N2IA 5CHEA 4J6FA 1QIEA 3WGZA 4H7KA 2PGOA 4WN3A 2O3JA 4FGSA 3H8VA 3L4KA 1GRQA 3O4FA 1N32B 5G1NA 1E66A 1B41A 1JCHA 2OBMA 1SA0B 3IC7A 2IOFA 1Z34A 1LDBA 2YJGA 5TQ0A 1MJHA 2IV7A 4DQKA 4BJHB 1WDLA 4FHGA 1I1QB 1W0JG 1RXVA 5AI8A 1YZNA 3C2QA 3HKCB 3NFYA 1CJKC 5JJLA 5ILOA 2J0EA 1VJ0A 2QKAA 1GPDG 3BA6A 3DT8A 3U9LA 1VXOA 4M1WA 4QOIA 5EINA 2ZZKA 4B0PA 1Y33E 4J2TA 2FQQA 3FD8A 5EIXA 1PK7A 2AJCA 2HJGA 4EGQA 1CJUC 3D6UA 3FFWA 2ZREA 3E5MA 3K5HA 1VJCA 2B5UA 2ZBEA 1SR8A 1I32A 4C6HA 1L1RA 4FZ5A 2FZEA 4YI5A 4CI9A 4NONA 1UJBA 4EGSA 1OYOA 5TS2A 2I99A 3D43A 3NBXX 3PJEA 1Y76A 2QN2A 3FPKA 4PXAA 5IDVA 3QBTA 4MUJA 3KWLA 1VPLA 5TB5A 4ETIA 2X9VA 4C3OB 4LMRA 2YXLA 2XMCA 4D9JA 3LAWA 4K0RA 5AVKA 3AKCA 2ASEA 2VF5X 3M7MX 3JVVA 5JJKA 3ORRA 1ZS9A 3DKIA 1M0SA 5JS1A 1DELA 1UJ6A 2ZJOA 4V3CA 4IJWA 5BWLA 3TNLA 1DAFA 2EJUA 2R8YA 4DT1A 4F2GA 3ZIAG 2XASA 4RSRA 5CFQA 4DV4O 3WL8A 1AA9A 4RPHA 3D5EA 1DCMA 4EJFA 1EFVB 1C3OB 1YF2A 2A78A 4YCNA 1QBKC 2FOIA 4GEKA 4DR5B 4NB5A 4G65A 3RSFA 5G41A 4KP7A 5JTUA 4C20A 2GOYA 1LD3A 1FXKB 5GMOA 3ZWAA 5KQGA 1H8EA 2QQ5A 4JLUA 2XMSA 4TM7A 3Q2KA 5DBIA 5TVKA 4B6EA 4G5GA 1A27A 1U2GA 5CLGA 4AZTA 1QANA 1X80B 3OO1A 1AQLA 2OCXA 4X7PA 3ZWXA 5EXXA 4QJFB 3K3PA 2E5FA 2YJTD 2DRIA 4KXVA 3KZVA 2PUGA 1XLTA 3VR6A 3SYCA 2BGMA 3KT8A 1YAJA 2BZ0A 1VYUA 2ATCA 1YTLA 2ZQMA 3ODGA 3VZSA 3KX2A 3BICA 5DOZA 2GS9A 1GADO 4NHEA 1ESEA 1VCOA 4I5EA 3MLBA 2GGSA 4B3SB 3G1TA 2IP1A 2YRFA 1ZQ1A 4QIHA 4MK4A 3L1KA 1PR3A 1UUFA 3PJDA 3PKJA 4DMUB 3TSOA 1R5NA 2CN1A 2P3LA 4BUCA 5DU2A 3W79A 4HNHA 2RIPA 3LY7A 3ZV7A 3BJMA 1DKUA 1KVQA 1D5AA 1JXQA 1Z0DA 4I5IA 1XD8A 2OHOA 2LGQA 3VR6H 1V1RA 2GBLA 1PQUA 3BMNB 4YC7A 3LOQA 4BNHA 3RJZA 5TGTA 2ZTMA 3QHQA 1BU8A 2ZBDA 1NUTA 2ECQA 3AG4C 3QEMB 2NP7A 3PUJA 1MO3A 4KNWA 2J9FB 2AHZA 1H22A 2WNHA 1OXKB 1XEQA 3T4PA 4ROTA 1KOFA 3QU5A 4XVUA 4G4GA 1T9KA 3EHBB 5J40A 3Q2OA 1IBCA 1HC7A 1R4ZA 1JDJA 1Y98A 3QELB 4Q1DA 1VF6A 5BW8A 4BMVA 3E6AA 4TYPA 1RYMA 5CH8A 4EG5A 3LA8A 2HMTA 4C5AA 3N8GA 4TV9B 3TTTA 4ZI2A 4ARAA 4UTNA 10MHA 2JGUA 3JZAA 3FKQA 821PA 2FP4B 3IILA 1YA8A 1T2UA 2EKZA 4J11A 3EC1A 3DDHA 1M93A 4HP8A 1G3IA 1PZXA 1PS8A 1BSVA 2BFBB 3VU0A 1V9PA 5L8VA 2ZRCA 4QPJA 3NHJA 2RK3A 3OZCA 4LJ6A 1AXEA 1GH6A 1Q74A 2OUKA 4JLBA 1L7RA 3GMTA 1VTKA 2C31A 1XZDA 2P9FA 4DCCA 3VJLA 4J42A 3C87A 2R6AA 2PWZA 2F59A 4Q82A 1IM5A 5A0FA 3RSQA 4EMUA 4TQAA 3N74A 2FI1A 2VHQA 3T06B 1NYTA 2CNKA 3GLKA 2FMLA 5KSYA 5IVIA 3S1AA 2E1PA 2F43G 3RJTA 3FOFC 1P4SA 1K66A 4YAEA 3K5OA 4JLAA 1YI8A 4GWLA 3I8SA 3K94A 1U2DA 3TXQA 4W5WA 1MAHA 2PZGA 4RV5A 4CT0A 1PJ8A 1LK5A 3ZCUA 2NU7A 4IX1A 4LR3A 4Y9UA 3SPXA 1FPMA 4HNUA 3CPWU 3W2EA 2FWIA 3G59A 1GAJA 2O8BA 4OH7A 3RSLA 5C1DA 3EFBA 3AKEA 3D8CA 3EPKA 5J9FA 3T6KA 1RQNA 4H2DA 3UH1A 1LPBB 2Q5CA 3N0RA 2Y6VA 4O2AB 1VLHA 2Z8YA 3WB9A 2B0JA 4AJNA 1Y6ZA 1Z83A 2OBFA 2B5WA 1NX6A 4UCQA 4R2XA 2PQ0A 4B5KA 3P0RA 1P3DA 3MTEA 4ASUG 2L0XA 1Q8IA 1XAJA 1DKLA 2P9CA 1F2TA 4K0KB 1BHAA 1Q6ZA 1PTKA 2D1FA 3K70D 1DWUA 3A7DA 2QYHA 3RYFB 4KAFA 4XLLA 3THRA 4RWEA 1BQEA 2VQFB 2ZM6O 2EBFX 3T15A 3SXPA 1E8DA 1KBHA 3ZLTA 1GT91 4K6FA 3ZRWA 3BCSA 3JQAB 3BMOB 3EPRA 2Y1GA 3O9ZA 3EUEA 2AD1A 5D3MB 4PCAA 2O0LA 2B94A 4DQLA 4XDLA 1L7BA 2HIGA 1MEJA 1NWCA 2HDOA 1XQ1A 3KOOA 4UDYX 1XQ8A 3C8MA 2VAXA 3RT3C 4JJ8A 2IE8A 1QNMA 1II8A 3KM0A 2JA1A 1QVFU 2IODA 4JQCA 4U5XA 2VTVA 1SIUA 4MHOA 2R9RB 2DFDA 3UC5A 3C5HA 4KYVA 4UFOA 3CH7A 3CRZA 5DNCA 4GPAA 2B83A 2QSZA 4YJFB 1BG6A 4R0NA 2X8JB 1DC8A 5FNVB 5C5IA 3R6GA 3OKCA 3AYZB 3D0OA 1GCAA 4B75A 2ZJ5A 2OO5A 5B1AB 4J0FA 4HNVA 1MOQA 5IPFA 1DQYA 1OMOA 4RBNA 4YAIA 3HYTA 2EJTA 1BMFD 4XQGA 3GFPA 4POOA 2D7CA 4LZAA 2X6TA 5B3JA 3NV7A 1KDOA 3DAYA 4JGGA 1YS1X 3L5KA 1NXTA 4Q3KA 2F55A 3G3EA 2OV8A 3ROKA 4A82A 4EG1A 5C3MA 1ODIA 1Z62A 5FOXA 1C8BA 2V3WA 2ZRAA 3H1TA 3G2MA 3ESCA 2PMWB 2DPHA 4DWJA 4MTGA 4D9IA 2BE9A 2ZE6A 2R48A 1AM4D 1GGFA 3QPDA 3QFTA 1BROA 4B4OA 4XYEA 3JVUA 3C39A 2MOKA 1NBEA 2J9ZB 4L8LA 1FU8A 2WW8A 3LQRA 5IW8A 1ENPA 1EKXA 2FEWB 4R1LA 4ZQFA 4F97A 1ZWLA 1NOJA 2PPVA 1XELA 2IIBA 2PIDA 2D5IA 1GKFA 3S81A 3JCUZ 2Q50A 4FNMA 3FHTA 2WWGA 1VJGA 4YHHB 1RHKA 1JEYA 2WQ6A 1JHRA 1M6VA 1L4FA 4NABA 5H68A 3TOCA 1ZHHA 2PJUA 2VA9A 3BJZA 4ALJA 3M9XA 3JWGA 1EDBA 4PFSA 1TK2A 1IB6A 2NG1A 1DP4A 3CLTC 3GYBA 4BU1A 3BVOA 4DJDC 4ND8B 1NASA 2CNOA 4G5XA 4LNUB 1ODLA 1GN6A 3UY4A 3GROA 3PJFA 5JADA 5HX7A 1R5BA 1J9GA 5ALMA 1K7EB 2O2GA 4OGKA 3ENWA 4OKSA 1SZDA 3IBYA 2F17A 4C6RA 3ABRB 1XTKA 2WWRA 3PKZA 5C5CA 4YMIA 1AUXA 5T4BA 1IN7A 2XUPA 4RGYA 1LBQA 1UBHS 2LIPA 3KCYA 2FMHA 2FX2A 3T1VA 3CCUV 1N2CA 4FIDA 4ROSA 1VE9A 3K3WA 2GM9A 4H6VA 4P4SB 3A10A 3S3WA 2H4JA 1CWUA 2EFDB 2GWHA 5C7YA 2QR2A 3DR3A 3BBPA 1S9DA 3TEFA 5JVDA 4KNVA 1T5LA 1HE3A 3X2FA 3R7WA 4ESOA 3AF0A 3CN9A 4S04A 2FKXA 5HZMA 1FNBA 4FFLA 4MWGA 3ETNA 2FSGA 3L4BC 1ADBA 4INZA 3SOPA 3VO9A 1NJIW 1IDSA 3EIHA 3U2QA 3U4HA 3ZI4A 4DA8A 2ZUUA 2PNFA 4Y67A 4Y2GA 2I8CA 4UE3S 4M87A 3O2JA 2YRWA 1I01A 4UHDA 4GLFA 1N2OA 3CKKA 1ID1A 1RI1A 1YJ5A 3AUYA 5DV9A 3D8BA 1MH9A 1YQTA 2GK6A 3ROFA 1XMOO 3T5PA 3JAMN 2E4XA 4TLBA 4ZVQA 3D0QA 3IBCA 4IV0A 1T2CA 3BSSA 1J5EB 2CBGA 1UH5A 2ZJAA 3AI2A 2IYYA 2R1TB 1BRTA 4DWVA 2HMAA 2EP5A 4KAAA 5FHQA 4P58A 4RFVA 5DYTA 2Z2JA 3ASZA 4U2BA 3CEAA 3OQIA 5CNKA 4OXIA 3IBSA 1JPVA 4JA2A 5I9BA 4KRYA 1ZH0A 3PFCA 5CXXA 4JL8A 1IURA 4IIGA 3H9EO 3SZGA 2VDWB 1W29A 3MXOA 1KRWA 2JGFA 2WIDA 1SKQA 3RK1A 3K9SA 3K0HA 2V8OA 3I4LA 3O1LA 4IT5A 4C05A 3KR1A 4QNRA 2JLRA 3OMAB 4D2IA 3I6BA 2NU8A 3ZWNA 1NXSA 4XVHA 4DSTA 4AWBA 4E4EA 1ZOLA 3MEQA 4NCXA 4I4TA 2PQ6A 2BDTA 4IHKA 2QX9A 1FFGA 3P9QA 2G8NA 4N21A 5TQVA 1L5WA 2VYVD 4DLVA 4NJOA 5HKKD 2B1RA 5TMEA 4WEOA 4J7ZA 3JQBA 1IDN1 3ZGOA 1IWBB 3H9GA 1JJIA 3IAYA 2VQEO 3D8UA 1E2JA 4NMXB 2AN3A 4WAUA 1CCWA 3AG1C 4KSBA 4DFDA 1L7NA 2AN4A 1YCHA 2OXEA 1WA8A 3KQHA 4WXMA 4IDQA 3TW8B 5TMBA 3ESAA 4MB6A 3R0XA 1JE0A 1C8KA 3RBVA 2A88A 2Z5GA 4PGAA 4AYTA 4YV0A 2W2LA 1B2RA 4LV5B 1TQHA 2KLBA 3A1NA 1KHTA 3A9RA 2FOXA 1UBTS 3TB6A 3M6IA 1Y34E 5P21A 4DCOA 1JJ2U 3QVMA 5HF5A 3PUHA 2VDUE 1QC5A 2NADA 3NYRA 1J2JA 1UQRA 1S2GA 1T1GA 2E6KA 1QR8A 4TQUS 3U0BA 1JA8A 3NH9A 1KI4A 4RQTA 2GN9A 3VVCA 4D99A 2WTUA 3NWBA 1GTRA 4W9RA 2XMQA 5D01A 4GMXA 2VWGA 2C0PA 3RREA 3H5TA 5C52B 1FCJA 1OOEA 2R9IA 1VSBA 5AVYA 3M8KA 3ZBTA 3NM5A 4JZ2A 2JF0A 2DYKA 4BX8A 5AW8A 3ZY4A 4A6EA 1ZIOA 5TPWB 5HCUA 2P79A 4EI9A 3E18A 2O6LA 2ZINA 1H05A 3R3ZA 3DXXA 1ULUA 3SICE 3RK4A 2PO5A 4B5LA 1RCUA 4ND3A 3E15A 3D3EA 4EJSC 3FSEA 4IIJA 2QU8A 3BE8A 2MU1A 4X7MA 5ALGA 4RK1A 1QQTA 4AJ1A 2W6ZA 4Z49A 1Y3FE 4CTMA 2H1OA 4P54A 4QPCA 4HUJA 4UUJC 3WI7A 4LYAA 4OD0A 2MR6A 4Z54A 4FB4A 1KJZA 3G6EV 3EXHC 1E4EA 1KO7A 2N9UA 4BJ5A 2W4MA 3KHKA 3QYAA 3HWRA 2XYRA 4IMIB 2JPDA 4UPDA 2PA0A 1YR7A 2E87A 3OH8A 5MF6A 4J1NA 2OHXA 3ZJZA 2C42A 1EUDB 1HQCA 4JLJA 3SIPA 2X76A 4NENA 3CLVA 2Q67A 2I7DA 1JDPA 4MPJA 3ZEDA 4BW5A 1P4AA 1OF1A 1FXSA 2OO3A 4M0MA 2UZIR 2ZBPA 1QDLB 2BJVA 2R96A 4H60A 3INYA 1Y80A 4PZEA 4D41A 4GPZA 2KB0A 4FEYA 1TQ6A 4XA8A 4PELA 4KE9A 1OZGA 4LMAA 3FB7C 3B89A 1K68A 5A3RA 1KRXA 1UFKA 2BFFA 5F3WB 3HEBA 1JIIA 5EHZA 1O0SA 3PC7A 5HNKA 1VSQA 2ERYA 3K0SA 3GY0A 1Z7GA 3IURA 4WCFC 5THXA 3FDZA 3C15C 3SNHA 1KKCA 1VMIA 4D0RA 5M7EA 2CJWA 3EQ6A 4CMGA 1GV1A 2CHGA 1M76A 3MTQA 4YMGA 3BY6A 1EFCA 4CG0A 2BOCC 2Y4UA 1AF7A 2BP7A 3OFKA 5IASA 8ABPA 1RSOA 1SD1A 1IMJA 5G1OA 5G3ZA 1AGXA 4UCSA 3ZGYA 2UXBB 1JBQA 4XLTA 1B6GA 3ETEA 4OFWA 3BERA 1LNQA 2WAYA 2PI4A 2PX3A 1ZCZA 3HB1A 3IBFA 2QL6A 1U0OC 3I2IA 1QFMA 1LS6A 4DGQA 1J2TA 2P2ZA 3A3KA 4OY3A 2ZYHA 5CXUA 4EMSA 1OB5A 3EVEA 4IVNA 4I1VA 4OREX 2BUCA 3P3NA 5HJ2A 1EVLA 3PPYA 3LX5A 5FPQA 3P27A 1NU8A 1S5LZ 4WLFA 2MMCA 5CIWA 3PFFA 4B7CA 2P4KA 4FCVA 5BT8A 1JLHA 1I2AA 1C41A 4G67A 4QDKA 4E15A 5DMXA 2OCHA 1QK4A 1Q92A 5K0SA 2X41A 4K2HA 2NGRA 2O06A 4LRXA 3U4AA 2ODEA 1GRCA 3PWSA 1D2RA 2ZKOA 2O2XA 4MVJM 3AOEA 4I0WB 2P40A 1P1BA 4B1FA 1M2KA 1E1RG 1NQUA 1Z6QA 4N5HX 3R9WA 3CRCA 1BIFA 3LWBA 4TVSA 5IBRA 3MSCA 4FYVA 3C4JA 1XDGA 1B8UA 5K1ZA 2HWWA 2GTIA 3GT7A 1G42A 2WM9B 3BF8A 1EE2A 3L7KA 1V9LA 3ZHVA 3T7CA 3F9RA 4QUBA 3BRSA 5AM1A 2YV1A 4RUEA 2EQBA 1KH3A 3H5WA 3LC1O 3T9CA 1G7RA 3BOSA 2O54A 3CGWA 4DSOA 3NW9A 5JJNB 1YAHA 5CP8A 4CMIB 1WXGA 5C5DA 4Y18A 4KI0A 1SUPA 5E8RA 4MGKR 3I2GA 1R4NA 4BIIA 3IGFA 5AMXA 4UZFA 1W48A 3CZMA 4US2R 4Y6RA 1YZ3A 4WFKA 5CT6A 2QLMA 1H69A 4J80A 4FFVA 4FB5A 4YMTA 4LIPD 1OAOC 3EZ9A 4GI3A 4YRLA 2AXPA 4BO3A 3IE0A 3PJGA 3Q0TA 1BOFA 4QBIA 3MC1A 3SC2A 5LYJF 4C6TA 2CJFA 2A3RA 5BUQA 4V0ME 4ZEWA 4IFEA 4QDOA 2IQIA 2X1HA 1QVAA 2XB8A 4KYTA 4D5EA 4MPPA 3SDZA 3W5AA 3U56A 1MAWA 4I55B 3CCJV 1IFXA 2V6JA 5F2KA 2A3NA 1GUDA 4WWHA 1OX4A 4R8VA 4Z3OA 1Y42X 4NMHA 4P0PB 5AK3A 2QRVB 1U5CA 1NQWA 1WIWA 3ZV5A 2VDOB 3FUXA 5K0BA 4OLJA 1ES9A 2FQYA 2WYHA 4IIFA 4Z8YA 4TUYA 2C96A 4BR6A 3KYCA 1ZM4A 1E2GA 2XA9A 1CUDA 4RVNA