3D3QA

Crystal structure of trna delta(2)-isopentenylpyrophosphate transferase (se0981) from staphylococcus epidermidis. northeast structural genomics consortium target ser100
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
307
Chain Sequence
KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tRNA delta(2)-isopentenylpyrophosphate transferase (SE0981) from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis atcc 12228
molecule tags Transferase
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
total genus 102
structure length 307
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 3d3qA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d3qA01
3G5UA 3BFKA 1F5NA 2GK7A 4CT4B 2JLVA 1ZD8A 2JASA 2NZJA 3SJAA 1KMHB 1NRJB 3O8RA 1G8HA 1KY3A 1EG7A 3WBKA 1S1MA 1PZNA 2F9MA 4HSEA 2AKAB 5HR5A 2J46A 5HE9A 3S1AB 3TR5A 2BCJQ 1ESNA 2WIAA 3RS2A 3K70D 1ZYUA 3I72A 1OB2A 4B3GA 5E7IA 2FMXA 5JWRA 1ZM9A 4HAXA 4LX0A 4BPBA 2AKYA 4KFTA 1SKQA 3ZD7A 2IYQA 2ZRGA 4PHGA 4FMDB 4KAXA 3BWDD 1E0KA 3O8DA 4FINA 1UJ2A 3LAWA 4LCBA 4PXAA 2AXNA 1Q1QA 3DVLA 4TYNA 1M2OB 3UIEA 3AQ4A 3GJ5A 2ODBA 2Z83A 2CL6X 3KTAA 1HEIA 1X6VA 1COWD 3NDBB 3VKWA 4DLSA 4C0AC 1SHZA 5M04A 3HU3A 3RS5A 3PEYA 2W2TA 1Q1ZA 2VP4A 4ITRC 1G20E 3QBTA 4UNQA 1XCMA 4DUGD 3K53A 2H57A 4MKFA 1II0A 4RSGA 2IWRA 3TKLA 2OBLA 4W5HA 1R5BA 4Q1FA 4U5XA 3CLVA 5K8IA 2J0UA 3RSOA 1W7AA 4GOJA 3OEED 5DISB 1OFTA 2REBA 4Q5IA 4V0MA 5AJXA 3P20A 3Q5EA 1KSJA 4B2PA 1NKTA 2EYUA 4ZI3A 2R8RA 2CBZA 2GJ9A 2J9RA 2GZHA 4AKIA 4DDUA 1KAGA 4Q01A 1W36B 4L8GA 2DBYA 1NI3A 4FCWA 5FOXA 3D7MA 3X1XA 2GXQA 1JJVA 1N6OA 2BMJA 2QNRA 4G01B 4QHSA 1U94A 4O2RA 3LW7A 5SZKB 4BUJA 3KQNA 2AWNA 4DZZA 1W44A 4B6EA 1NY5A 3GEEA 4HZIA 1XB2A 1XP8A 2QQEA 1ZP6A 1S1CA 3QKRA 3A4MA 1IY2A 4MRRA 1P2TA 2C9CA 5DGXA 2F3TA 2CCGA 4HAZA 4V0NA 3FKSD 4M1KA 5HKKA 1S0UA 1AKEA 5KSPA 4KLZA 1ZD9A 1UBFA 3GJ4A 3K0AA 1E2MA 3R7WB 1UFQA 4Q1EA 4TQ9A 2W83A 4D0GA 3M4YA 4ACAA 1P60A 3R8CA 4NCNA 5KNDA 3VKGA 1YRBA 4H9GA 1NVXQ 4MYHA 4DSOA 1DAGA 3GCGA 4OHWA 4A6PA 1DADA 2NO9A 1T3SA 2QROA 2OILA 4LY6A 4FCVA 2CJWA 2PT5A 4F4JA 1CRPA 4V0ME 5JS8A 4ZDJA 5FTKA 2YWFA 1TTTA 1KTVA 5DI9A 1J90A 3IPYA 1AGPA 5CDFA 1KI8A 3T1OA 1WB9A 3I73A 1JJ7A 1XWIA 4DC9A 4QM6A 2EFHB 2X8AA 3KKPA 4I81A 3THWB 4AKEA 2HCJB 2O0HA 5CM9C 1N0WA 3QOFA 4W7SA 1R0WA 2QORA 2PX3A 1MO6A 2JJ2D 3GLHA 4I4LA 621PA 2P6RA 3VR5A 1D8TA 1Q22A 2NZ8A 4JT2A 4BZXA 2RGGA 3FYHA 3GLGE 2C78A 2OT3B 2TMKA 4O2LA 4TTQA 1ETUA 4F38A 4KVGA 1GUAA 1IY1A 1T3HA 1E94E 1OH8A 2QA5A 3VMFA 3U4QB 1H8HA 4DT1A 1PJRA 2I1VB 2WPDA 4DCNA 3FHTA 3FKQA 2AD1A 2H17A 2ZJAA 1XMVA 4W5JA 4NPHA 1A82A 2QAGC 1L2TA 3GPLA 2Z43A 2ATXA 3GD7A 2OV2A 4V02A 4G5QA 4GT1A 1TF5A 421PA 2IHYA 3CO5A 3NEYA 1E9FA 3E70C 4EKDA 2PT7A 2WMOB 4DB2A 2FJUA 1HQYE 1JQLB 4Q1CA 3ONWA 4ZIRB 4NCIA 3SS8A 3EPKA 3VQTA 5IT5A 1JEEA 4A2PA 4A0FA 2O8BA 4CVNA 5D3QA 1OIVA 3QENA 3FGNA 3OEHD 5DLQC 1GRRA 3L0SA 2ZJYA 3OE7D 2GXAA 4KO8A 4PC1A 1ZUHA 2CCJA 4JL6A 1O87A 3U7EB 4F7WA 4RKFA 2NPFA 1CJVC 1MR3F 2R62A 5L3SA 2GBLA 3PFIA 1QHYA 3L2OB 4GOKA 5FBRB 1FNNA 2A7QA 4TMKA 4DWJA 3I61A 2W6JD 3U2QA 4GDFA 2FEMA 2Q9CA 4H1UA 2BCGY 3ZS9A 2VEDA 4EAQA 1RRGA 2V54A 3AGQA 3VNVA 1SVIA 4TQUS 3SFVA 3B60A 1NMXA 4NCKA 1AK2A 3UMRA 5G53C 1HT1E 821PA 5EXSA 3KXLA 3GFPA 2JIZA 2ZRPA 2HLDD 4NONA 3DM9B 5LBIA 1NN0A 2E9SA 3GJXC 1TQ2A 3D6TB 3TSWA 2WJIA 2F43B 5H70A 4CF7A 2ZUBA 3SJBA 1Z29A 4K46A 1KIMA 4RCYA 2IF0A 2ZJOA 1E6CA 2ZS7A 2MSEB 2F7SA 3UMFA 3QIAA 4URUR 4QKQA 4GMDA 5GJVC 4YXWD 2OLKA 2JDID 2VL7A 2IYTA 2OFOA 1Z6GA 4DIEA 2ZXUA 2FEOA 4Q4JB 2ODNA 2VF7A 4D82A 4A92A 3ADCA 2VSFA 3DL0A 4PANA 4YMTA 4Q66C 5KOYA 3LBHA 1Q3HA 2XXAA 3KB2A 1KKLA 1BH2A 3GLIA 5LD2B 2NPIA 4WXPA 1W1WA 1U81A 5FTJA 4PPQA 4CYMA 2BMFA 4DEXA 2V3CC 3CNLA 1RYFA 1K5DA 3HPQA 2WOJA 4ESVA 3KKMA 4RZUA 3EIQA 3P27A 3NH9A 4FN5A 2C8VA 3KZ1E 2VHCA 4G5SA 3CRQA 3WYGA 3I92A 3K0CC 4NBSA 1OB5A 1OT3A 4GRAA 3X1YA 1IXZA 1XU4A 1W49A 3EIHA 5AUQA 2PEZA 2QE7A 4OBEA 4N3NA 2WHXA 3CPHA 2WV9A 3KXIA 4DLUA 4FMDF 4UNPA 5J4KA 4MGKR 2J5XA 1AZTA 4QBHA 4OI1A 1HYQA 4B3XA 3C14C 2FH5B 3DKVA 1KNQA 2CK3D 5AJYA 4JBWA 1QF9A 3A37A 4F91B 4U7DA 1AGRA 3KDSE 1G6HA 1G3IA 4IKEA 1W36D 2PH1A 4AYTA 2VYFA 4P3YA 3TVDA 4MKIA 3REGA 4URWR 4DEYA 3H0KA 1KSGA 5J4LA 2RGNC 1MO5A 3IO3A 1G1MA 3KX2A 4LUCA 1XTRA 5L8VA 3QBVA 1BYUA 4NTZA 4E07A 3Q7QA 1XPRA 1G8YA 3KL4A 1M74A 2K5UA 5FBLB 1MO4A 2FNAA 3SEAA 5CB8A 2XSZD 2ZSDA 2ZJ8A 1JAHA 1G5PA 1L7VC 1XTKA 1CBUA 2VIIA 3NVAA 1E2IA 4RFVA 2ZEJA 5AJWA 1WBDA 5FOUA 1PV4A 1W4BA 4HZUA 4OHXA 4OK5A 1GILA 1MRNA 4LJYA 1Q20A 2XX3A 4PAOA 2NO0A 2GKSA 5FL7D 2QP3A 4EDHA 1G4UR 1GIAA 2JGNA 4GBMA 1N5IA 4MGZR 1OXUA 4KXFB 3DKPA 2FFHA 1YR8A 2FE4A 4EPYA 2RCNA 1XX6A 1XEWY 3BAFA 4DJTA 1D2MA 2ZJ5A 2CL0X 4DCUA 5JCPA 1G5TA 2D3WA 4GZMA 3GJ8A 3QXCA 3KFXA 2ZUDA 3NBFA 4XSHA 3I1FA 1G6OA 4P4SB 3CIOA 2JATA 5IRCD 4B47A 1PLJA 2LKCA 4OK6A 2W6ID 2QU8A 1TNDA 4HI0E 1HY3A 1KDRA 4OK3A 1GL7A 3NHBA 4Z8XA 5GJCA 4GNKA 2HJGA 5FBQB 1VIAA 2J59A 3VU9A 3AP2A 4Q4AB 1Z0DA 3EZ9A 2KJQA 5G41A 4EPRA 3TQCA 4DXAA 3ZVMA 4C2TA 1XD9A 2D74A 3K0EA 4II7A 2ANBA 5KNCA 1BYIA 1G3QA 5EE3A 3BFVA 4V0KA 4V0OA 2IXFA 5DHAA 3SFZA 2JLQA 5JMTA 1Z6XA 5JBQA 2QY9A 5J4HA 1Z47A 1XF9A 1T8TA 2WWWA 1EFRA 1VHTA 1H65A 4UJ3A 4YMUA 2VF8A 4TT3A 4F92B 1OW3B 2JLWA 4KYIB 5CK4A 2KWIA 3CH5A 2QPOA 1XZPA 3RAPR 2OBNA 4BEJA 4JIMA 2ZS9A 2HEIA 4QJ3A 5BW8A 4CEHB 3W34A 2DR3A 2YOHA 3EX7C 2ZSBA 4NH0A 3A58B 3RANA 1IJEA 1XXHB 1BOFA 1NJGA 2ZJZA 4Q9KA 3UG7A 4ASUA 3QE0A 2GJSA 2HT1A 4B35A 2OCAA 1NBME 3LWNA 3ZVLA 2IBMA 2MSCB 4LV8B 3QXSA 2PJRA 3SQXA 1EFHA 2IW3A 1PUIA 1FOEB 2ZTSA 2OXRA 2Q9AA 2DB3A 1RW4A 4M1TA 3KQKA 2KSQA 3IDQA 1YZUA 4XWAA 2O8FB 4M9QA 3FMFA 3I8SA 1ZJ6A 4LHYA 1JI0A 5F3WB 4BFUA 1N5JA 2QRNA 3U60B 5F9HA 4UQOA 3FHCB 1N25A 4FMCF 4IFEA 3K0SA 5EP3A 4R71A 5BN4A 2GZDA 4DDTA 3K1JA 3OAAA 4WZ6A 3AF4A 2IYLD 3M6AA 5FPYA 4GP6A 1II9A 2R65A 2OLJA 2HJVA 2XAUA 1ZC3A 2AX4A 1E98A 1GITA 3IQXA 4AURA 4A0GA 4US0R 4BLQA 2PEYA 1D5CA 5SZHB 4BLPA 3QKTA 1G7CA 1VHLA 3OIWA 4TLBA 1FX0A 1NY6A 5FI0B 3TAUA 4JLOA 2IYWA 2ZSEA 1VYTA 4MH0R 5C2JB 3GFOA 2RH5A 3TVTA 1NKSA 1Q0UA 4FXPA 5KYKA 2DWOA 2JCSA 2LCFA 2Q3FA 4M8NE 2QTHA 2XITA 1XEWX 2VHJA 1TUIA 1SGWA 1XXHE 1XTQA 4AIIA 1YZGA 2IT1A 4B3DA 3THWA 3EAQA 2ZE6A 1S96A 1NVVQ 4F4IA 1E1RD 4RY2A 4C0HA 5JCZA 2RKOA 3OIVA 1Z07A 2ZSFA 5HZKA 1MO3A 5C1BA 4ASUD 1ZNZA 1KDPA 3U7FB 1SXJB 4TZ6A 1KYIA 1IAQA 3Q7PA 2J0SA 4P0TA 1V5WA 4PQFA 1AS3A 5BXQC 2UKDA 1OPXA 3AF3A 3U5ZB 1G5RA 2FZ4A 3LFUA 5H68A 1PUJA 2ZRDA 2EVWX 4GPTA 4TYQA 1EFRD 4US1R 1RFLA 5KDOA 3EZ7A 2Y8EA 4BECA 2ZU0C 3UANA 4DKXA 1DG1G 2FZLA 3CKLA 5EQTA 3MWKA 2VBCA 4UXIA 1SXJD 3B8HA 1ZINA 2JLSA 2VP0A 2YJTD 2BBOA 2R6AA 3FDIA 1KK2A 1W48A 3EWSA 4C0JA 2WKQA 3BJIC 1F48A 3CNNA 1EFCA 5AUPB 3BB4A 1WMSA 4ZI2A 1YR6A 5LDDC 1Z0KA 1XCPA 2YKGA 4UXJA 4XJXA 5JLJA 1KO7A 3KKQA 3KUDA 3O8BA 1FTSA 3B9QA 4IDOA 3LLMA 4LC0A 1EFUA 3KQLA 4HUQB 2VHTA 1NVVR 3AP3A 4MYCA 1E9DA 1P73A 4LC1A 3WHLA 3QF4B 4Q02A 4O0MA 4PZYA 3T1QA 4QHYA 3X2SA 4DLXA 4DBLC 2O8CB 5FL7A 2XTMA 4FI3C 1TQ4A 3KTAB 1GZSA 3RABA 1OXXK 2YZ2A 1ZRHA 4BQSA 4LBWA 4PSVA 2X2EA 3F3YA 5EXPA 2ONJA 3Q8XB 4BRWA 1X8LA 1JBKA 2EWWA 1WF3A 5UKDA 3PXGA 3CRW1 1DAHA 1UKYA 1E0AA 3B1ZA 5DHFA 2P2LA 5DI3A 2XSZA 2YVUA 4EJSB 1SXJC 1UEJA 3A1VA 2CL7X 3LNCA 2ZVPX 1FUKA 3BOSA 5CLLA 5FOTA 4YMVA 3B85A 1W0JA 2GRJA 3QEOA 4QBIA 2GETA 1E79A 1QBKC 2FPLA 4IJMA 5G3YA 3W8RA 4HUTA 3L0PA 1YZNA 2F43A 2XTZA 2QAJA 3UWOA 2WJVA 3G82C 1X1RA 4A9AA 4D4LA 1G8PA 4IEIA 2BM0A 3NHAA 5CYPA 1Q12A 1CIPA 2XJ9A 2ZI7A 4URZR 3U6BA 1GRNA 1KMHA 1IN4A 2RGCA 4GP7A 2G0TA 1MOZA 1ZW6A 4R2HA 3SYKA 5KHOC 3ND9A 3V4RA 1SZPA 2CK3A 4KJZA 4YMSA 3PR1A 1K6MA 3DO6A 4W5WA 3FFBA 3W6PA 3AVXA 3NXSA 3RC3A 2J87A 4BFWA 2J7KA 2DY1A 2EQBA 2I1QA 2RGNA 1AS2A 8OHMA 4QXAA 3CW2A 4UNSA 721PA 3VR1A 1P62B 5E3HA 3LVQE 5FPHA 2N42A 1UKZA 1CRQA 1KK1A 4RCZA 3ADBA 4CGZA 3ADDA 3T5GA 1E0JA 4ABYA 2AD5A 2FG5A 3GP8A 1WDTA 2UVQA 4PC7A 3T1TA 3CB4A 3K0FB 1EX6A 4NYJQ 5B2ZA 4PQRA 2MMGA 4DSTA 4QG7A 1Z0AA 1WE2A 1II8A 4JVMA 2QPTA 2REOA 1QVRA 1Z6TA 2QBYB 3R7WA 5KDDA 1E3MA 2D2EA 1MKYA 3DOFA 3P4XA 5IHPA 2BKEA 5EZ6B 2ZRNA 3NBZC 4ON9A 5EXXA 1NN5A 2JDIA 2V4ZA 4JKIA 2QAGA 3PENA 3OFNA 1GKYA 5H1YA 2IWHA 4Q4LA 3OF5A 3UKDA 4QJ5A 1G291 3ASZA 4B33A 4I99A 2WAYA 3IHLA 4JT4A 2I4IA 3W3AA 1Z2AA 1ELOA 1ZCBA 2WJHA 3IHWA 3M0EA 2IS1A 1NBMD 2ZI5A 2ORIA 4LWZA 4GMXA 4JVNA 2XZOA 4JL5A 2QUZA 3ICQB 2B92A 1D2NA 2JIZD 2QT1A 3CZPA 2C03A 5EE0A 2G83A 2X2FA 3H2YA 4WW0A 1R5NA 1TX4B 1LY1A 2ZR9A 3RDPA 1TU4A 3QKRB 2A5GA 1IY0A 4D4JA 1QZXA 3AUYA 2Z6VA 4KFSA 3T1VA 3SU8A 3NBXX 1G7SA 2GF0A 5CM8B 5BYJA 1GM5A 1L4YA 4D4MA 4YDHB 4QRHA 3ZGXA 2BHRA 2XB4A 4M9ZA 3K9LA 4TMWA 2P6NA 4CZ2A 4BFTA 2N46A 3EA0A 4ZO4A 1U99A 2G1JA 2KI5A 5HZHA 3K0AB 4Q03A 5CDFE 4TSFD 4NHOA 1F60A 1US8B 1ONBA 1R7RA 1UPTA 3OEHA 3L0IB 3V4FA 3W9YA 5DNYB 1YZLA 5H8WA 1W0JD 4ZIRA 3ZLJA 2ZE7A 1JB1A 2ZE8A 3HU1A 4JLBA 4LJ9A 4TSFA 1S2MA 3PITA 2PCJA 3GLFE 4KSBA 5JJIA 1AM4D 3M1IA 3B13B 4D4KA 1F2TB 3THYB 1N0UA 1UDWA 2CJWB 4KBGA 2H7VA 5D3MA 4PFSA 4M9SA 5FUXA 4OQFA 3WMGA 1X8KA 1KI9A 3L82B 3KB1A 2GJAA 2OESA 2WPDD 3AKYA 3SBDA 3THXB 1KI3A 2IX3A 1G64A 3B1YA 4MUBA 1JPJA 4TWZA 3FMPB 4X8OA 3WNCA 3FE2A 2DFTA 2ORVA 1T6NA 4M1WA 2C95A 1E9AA 3ZS8A 2YC4C 2NIPA 2NG1A 3RRMA 3ZYCA 4I1UA 5JI2E 3QUSA 4X8LA 4C0KA 1YQTA 1E69A 4G1UC 3WNBA 4U02A 4ZPXA 2F6RA 4JYCA 3BRWD 5JJLA 4M22A 2J0VA 3H4MA 1AQYA 1Q21A 3QPUA 1E2PA 2GVZC 4DB4A 2CHQA 3N5CA 1LS1A 2VSOA 3LQQA 1LS6A 3C8UA 4TMVA 3QXHA 1CR2A 4HLUC 2ZRFA 4HUQA 3FFAA 3T5DA 1UAAA 1XEXB 3AF2A 4Q48A 4C9BA 2QEQA 1J99A 1JQJC 3KQHA 4K8OA 1FMLA 1GFIA 2GVDC 2O8FA 2ZVQX 3DDCA 1E9BA 5KNBA 1KI4A 2IYUA 4XTRA 1R0XA 3SYNA 4E03A 2REXB 3IQWA 1Q44A 4N0DA 4Q4HA 1KDTA 2R6DA 1F3OA 2BVNA 3EZ6A 5C4GB 3NG1A 3MWYW 3EPJA 1J2JA 1E4VA 1N2CE 4DDWA 3VR2A 1XEFA 3CH4B 1ZIPA 1D6JA 2ZANA 3ND8A 1Z6YA 3MLEA 2ZE5A 1CJMA 2OCPA 3FKSA 1TEXA 4MGIR 3A1TA 3LXRA 1S8FA 5AK0A 2C9OA 2YHSA 5FUYA 5K8TA 4JLNA 4JLKA 2ZJ2A 1E2FA 4UNRA 5BN3A 4M1YA 3K09C 1M34E 1E9EA 1XTSA 3FPAA 3RSLA 2OFXA 1LVGA 1XD2B 4MITA 4PO9A 3QF7A 3A1UA 1N5KA 1SULA 1WBBA 3K70B 3HJNA 3KXKA 1E79D 1AN0A 2B7CA 1U8AA 4IOKA 2O52A 4JZKA 2BMDA 1CLUA 5CIQA 3L43A 4BEBA 4LPSA 4Q7MB 3OAAD 2FFAA 2XXAB 2PMKA 2V6JA 2P65A 1DE0A 4MRVA 4Q18A 1P9WA 1G16A 2IF2A 5L3SB 1ZM4A 1JR3E 1Q1BA 2WZQA 3W6NA 1OE0A 3AM1A 2VPPA 4PX9A 3R9IA 2FSFA 1YRAA 2IYXA 2BBTA 1HV8A 5TMPA 2CE2X 2P0EA 3GFTA 3NDPA 1NN3A 3CRVA 5DYIA 4AI6A 4TMTA 4DLVA 3QKUA 4A6XA 2FFBA 4K81B 3B2EA 4ESHA 3LA6A 1W4AA 3LY5A 1N5LA 3UXMA 1PLLA 4MUAA 1Z63A 1YZKA 1W2GA 2BBSA 1UBGA 2YINC 2CLDX 1ESMA 4WAUA 4B32A 3MJHA 5KTYA 1RRPA 2ZR7A 3R9XA 521PA 4OI4A 4QGHA 3TK1A 3C5CA 1KNXA 5CLQA 4GFDA 1P75A 3AVYA 1R10A 2C99A 4MKGA 1KSHA 1Z83A 3AF0A 4TLAA 2HT6A 5FR1A 3SHFA 5HCIA 4IW3B 5BN5A 3A4NA 2PLFA 3MD0A 5GJWC 4M1SA 2VP5A 2WOOA 1Z08A 1SXJA 3B7GA 4HAUA 2VHQA 5FTNA 4BRUA 4LYAA 4YDSA 3V00A 3BK7A 1OXVA 4EFNA 2GZAA 1XFAA 4Q4JA 2ERXA 2Z4RA 4LOAA 1A7JA 2B6HA 2OSBA 3EC2A 4LK2A 1RVDA 2B8WA 3IBGA 4FWIB 5G3ZA 3UWKA 3MJRA 3GLGA 3KKOA 1HE8B 3T61A 1G21E 2W6IA 2ZI3A 4PQYA 1NMZA 2GEVA 5DYGA 3EPHA 5FFMA 3HU2A 1I4TD 4LJ7A 5SZIA 3CM0A 2FOLA 1NSTA 4MRNA 5G40A 5FOWA 3VNUA 2UZIR 3U3MA 1E99A 1JXMA 3GLHB 4P33A 1GRQA 4UJ5A 1IHUA 1CKEA 5TARA 4AG6A 3D3QA 2LWIA 3K09A 1GVNB 1E9SA 2AXPA 1FUUA 2L0XA 4XVQA 1FQJA 1F2UB 2DWPA 4WVFA 5AJZA 4FMBB 3QY0A 2O5VA 4PPFA 4S2EA 2IXGA 1RRCA 3QG1A 3LVRE 3CNOA 3THYA 3J81k 1E96A 1I2MA 1TEVA 2OCBA 3AVPA 3UMSA 4TZ0A 3HP1A 5D3MB 2BJWA 5EJEA 3TH5A 3U7GA 2R9VA 5DIFA 5K8UA 2F1JA 4NDZA 2GAAA 3PEVA 4NMMA 1OJLA 2ZRIA 4KYUA 1E2NA 2R44A 3U44B 4XOIA 3CRRA 4AYWA 1IXRC 1YE8A 3PG5A 2ZRKA 4RFSA 1XJCA 1R2QA 1MV5A 1DG3A 4PHTA 1SVWA 4TL8A 4U00A 1CP2A 2AR7A 3SJZA 3VX3A 5CB6A 4JMPA 1DARA 4PC3A 2EW1A 1QRAA 4C0QC 2X1VA 5L3VA 1R4AA 1MABA 4M1MA 3RRZA 4B75A 3RRYA 5JHGB 1N6PA 4G0NA 2Q0HA 2BEKA 4GL2A 4DHEA 1WRBA 2QP4A 1HQCA 2GEDA 2GILA 3B1XA 2HDNB 5CIWA 4EFMA 1KAOA 3L8ZA 3CWZA 3REFA 4EPWA 6Q21A 4ZCIA 2HF9A 4L9WA 4XVRA 4OJQA 3WRYC 5P21A 1U0LA 2QMUA 2WAXA 3CWQA 2V1UA 2N1BA 1Z3IX 1ZVQA 3IBYA 1HH4A 1UBCA 3A1SA 2X19A 2P6UA 3U3RA 4CEHA 1O3YA 2YV5A 3EIEA 3KKNA 1IOZA 2ODWA 4EUNA 2OAQ1 2O0JA 1DBSA 4DLZA 4TMXA 4XWOA 5AUOB 1NG9A 2ZJBA 4LHXA 2FPMA 2QGZA 2W0MA 5JS7A 5KSOA 4NU0A 3CX7A 1QHHB 4UXHA 1QG4A 5KUTA 2XGJA 1UBEA 4KI0A 4C7OA 1KGDA 4FWTA 5AUNB 2ZRMA 3VHXA 5C4MA 4F93B 4D81A 4PO8A 5FL3A 1NN1A 2C98A 3QXXA 4MDFA 4JSYA 2CLSA 1U90A 2WSMA 1KI6A 2HYIC 3I62A 1NNEA 3N2IA 4LJAA 2ZRHA 1RJ9A 3TAHA 3GLHE 2ZR0A 3TW4A 4LYJA 4PZZA 5L3QB 2OAP1 1OFHA 2WWXA 2HLDA 2ZI6A 2FN4A 3AKDA 3A36A 4DCVA 1DEKA 1P7CA 1WXQA 5KPJA 2GWHA 4EIWA 1SVMA 4QGAA 4IDHA 3JVUA 2F55A 2W0SA 3SQWA 3GJ3A 2PBRA 2NO1A 2AN9A 1OFIA 5BWMA 3GJ6A 3EG5A 1VYVA 1ZM3A 3I32A 5DN6A 2WM9B 2QTVB 4P4UA 2HXSA 3SC3A 3K9HA 4M2LA 1ZBDA 3H1TA 3RS4A 4KU4A 1ZMXA 1A5TA 4IOMA 4TYPA 5B57C 3OE7A 4NE2A 4ZDWA 2WJYA 2O8CA 1IN7A 2CVFA 4LGMA 2AK2A 1IXSB 3OZXA 4X8MA 2C77A 1AA9A 1NVUQ 1J70A 3T35A 1C4OA 2VLIA 4RZXA 3S1AA 1I4LD 1NLYA 2A30A 3IILA 4QHTA 4FMCB 4CEJA 2A3RA 3L0OA 5TV2A 2GCNA 2GBLC 1TU3A 3NH6A 2W2VA 3PIRA 1ZNXA 2Z4SA 1R8SA 4LBZA 5FBWB 3DZDA 4A8JC 1FP7A 1OF1A 4LHVA 2QZ4A 3KJGA 3IIMA 4BZPA 4JLJA 2J3EA 1KY2A 2GDJA 1C1YA 1KI7A 3VFDA 1GSIA 4MRSA 1W2HA 1IONA 4AKHA 1LNZA 5EZ5A 1P3JA 2AFHE 1F2TA 2QE7D 2NGRA 2DCUA 4IFBA 1YKSA 1K8RA 1Z8FA 4Q00A 1OH5A 4IOLA 1N6HA 2ZU6A 2IK8A 2IUUA 2BIFA 3IEVA 1E2KA 1NBMA 1NG1A 1OYWA 1XMIA 2H1LA 4WA7A 5J4YA 2JLXA 4LRWA 4DLRA 2CHVA 1VG0B 5A4JA 4LYHA 4YONB 4AWXA 3K0CA 2VA8A 5FUVA 2J45A 4Z54A 3QPWA 2BKUA 1G41A 1FP6A 3VR3A 3FTQA 3OFND 1DVRA 2QRZA 4OI0A 3SYLA 2WWFA 4D25A 3IIKA 4C30A 3ASYA 3UG6A 1XNJA 1TL7C 1XD2A 2WJGA 4BFXA 4Q4AA 4D80A 2V6IA 1K5GA 1G8FA 1VG8A 4BGDA 1KO1A 5DE3A 1JALA 4BLRA 1PLKA 4Q1BA 2NOAA 1FW6A 3NC0C 3PVSA 4R98A 2IXEA 2P67A 4OQMA 121PA 1OFUX 2J7PD 1R0ZA 3SE0A 1NLZA 3QKSA 2HV8A 2RB4A 2RGXA 1E2EA 2GESA 1IN8A 1CULC 2VQSA 3PUVA 4XH9B 1OV4A 2G77B 2XOKA 4B71A 3H86A 4FIDA 1J8MF 1OHHD 3UATA 4ARZA 1G4AE 2QT0A 2IL1A 3DMDA 1L8QA 4M53A 4PHFA 4TQAA 1TAGA 3PCRB 5HE8A 2ZI4A 4PC6A 4IDNA 2ZSAA 1KMQA 2A9KA 2EFCB 3WP1B 2UZ3A 5KO2A 2OE2A 4HB3A 3DZ8A 5C18A 4OQNA 4OQLA 4HDCA 2W6JA 1FZQA 3CUEF 2KB0A 4URVR 4Q9IA 4NYIR 3CPJB 3CF6R 1YVDA 1M7HA 1UEIA 3VHLB 4QOSA 1Z06A 3AUXA 4B3FX 1E2HA 1NIPA 2DFNA 3HR8A 3ZZUA 1SKYE 3TE6A 2C96A 4PPGA 3VU9B 4C0LA 1EESA 3K0FA 4NCHA 4YMWA 3A1WA 1E9CA 1DAKA 1XRJA 2IUTA 1GP2A 3LQRA 2HF8A 2J41A 2OBMA 3CR7A 2XZLA 1TMKA 3RS7A 3QI2A 3SOPA 4DLTA 3OEEA 2GK6A 3GLIB 1G9XA 3UK6A 5JSZA 3ZH9B 3QSYA 4KVAA 3AF1A 1IJFA 3TGPA 2O8DA 4DIDA 3AVOA 3MRSA 3U3OA 3BS4A 4EPXA 3QG5A 2ORWA 3JZAA 1FX0B 3X1DA 2FF7A 5HCNA 4DUGA 3BFXA 3GJ0A 5TY0A 4AY2A 5JWHA 4YQFA 3GLGB 1E4YA 2ECKA 4HB2A 4DLYA 2AK3A 4AKGA 5FOSA 1L4UA 2GAOA 3H84A 4GOXA 3ICEA 4TMZA 4RJLA 1P72A 2R2AA 2RHDA 4HLDA 1XCGB 1XBTA 5FPKA 1OXTA 3LLUA 3C41J 2DHRA 4JVSB 3T15A 2IYYA 3TUZC 2H92A 1N6IA 1XPOA 1WP9A 1E2JA 3OIYA 1W5SA 2GJ8A 3R20A 1VKJA 1N0VC 2PZFA 4JLAA 3LDAA 5KSZA 5HPYB 3AVQA 2PZGA 4LBVA 4MQBA 1VYUA 4BLTA 5EUQB 4A0RA 2IYRA 3RYTC 4RD0A 3AVTA 1LF5A 3RLFA 1ODFA 2VRWA 4CT5A 2ZYUX 2QTFA 4D26A 3GQBA 1CU1A 2QM7A 4MKHA 4E5UA 4Z51A 4QJ4A 5L3RA 5GJBA 5J40A 4Q7LA 4HB4A 1Z5ZA 4PC2A 1A4RA 1EFTA 1T9HA 1Z0IA 5FTMA 1JEDA 2XZPA 3KJIA 4PSKA 2D4HA 4EFLA 3FHOA 1US8A 1ZU4A 2Q21A 1W36C 1CJUC 2JLZA 4PAQA 1GL9B 3MGCA 3O8CA 3ZD6A 4QGGA 2XEXA 3SHWA 4EQ6B 4RVCA 2ZRJA 4QM7A 1W47A 3B82A 5AJVB 5GVSA 2ZRCA 1MT0A 4JLPA 3W8NA 2YNMA 1AJEA 4C0BA 1XJQA 4N1AA 2FGJA 1E1RA 4IOJA 1KJZA 1U9IA 5DO9A 3U7HB 3SI7A 2JJ1A 2OXCA 1D2EA 1RE0A 3WXMA 4BASA 2O8EB 3E1SA 1FL9A 3GEHA 1YHNA 2MSDB 2QP9X 4RD4A 3MMPA 2A5JA 3Q85A 4DLWA 3TSZA 1MH1A 3RVBA 2CXXA 4KBFA 1DO2A 4A8JB 1OYYA 4A4DA 3RS3A 3ZQJA 2QM8A 1VG9B 1ZIOA 3D8BA 4LDJA 3BE4A 2IYVA 2CEAA 1T5IA 5ANRB 1RZ3A 4LZZA 1KDOA 3EARA 4NYMR 4BFZA 2NO6A 2A5YB 1OKKA 3L8YA 2KBEA 1Z0JA 1QDEA 3Q72A 2F1IA 2OFWA 2JJ8A 2F1RA 2ODEA 1EX7A 1QHGA 3KJHA 1QHSA 3NBYC 3MUFA 4Q4HB 1KI6B 2W00A 1T5LA 4HEJA 3TUJC 2Q6TA 3ADKA 3T06B 3PJRA 2WIBA 1COWA 1SVLA 1LV7A 2X77A 3JZMA 3ZVRA 3T12A 1I4DD 1XD8A 3MFYA 3TNFA 1Z6AA 3B6EA 1NSFA 2PLRA 4TL9A 2FA9A 4B43A 1ZD1A 4BZQA 4YC7A 4LJ6A 5FR2A 4CEIB 1M6NA 1XPUA 1LW7A 2WBLC 5J5CA 4PO1A 1KO8A 2OEPA 4TTPA 2NMVA 2E87A 1G19A 5FBVB 4TT3D 5EP4A 2ZUCA 1EXMA 3CRMA 2GTPA 2W2XA 1GKUB 2VP2A 1IQPA 1UF9A 4Z1MD 3PUWA 3WMFA 3GEIA 1RIFA 1Z22A 2VHUA 4ARZB 3NC1C 5FOVA 3W5IA 3EWAA 2V8OA 1XEXA 1P6XA 2YOFA 2QBYA 4EJSC 4RD2A 3CR8A 4X8HA 2G9NA 4IDPA 4JLVA 4DCTA 1CR4A 1X1SA 3FMOB 4US2R 1OLOA 1WA5A 1T0HB 3WNDA 1NIJA 1W4RA 4WZAE 1XMJA 2V7QD 1WQ1R 2IC5A 3A8TA 2D2FA 2JA1A 4CRWB 4L16A 1E1QA 3OIUA 5JRZA 2ZYVX 1UKVY 2QMHA 3LRPA 3GLFA 5JHHB 4AK9A 4RD6A 4E09A 1E2QA 2VP6A 2C9YA 4JS0A 2R6FA 2ZRAA 5F98A 2Z0MA 3TQFA 4A36A 3LBNA 1VMAA 4O3MA 3ZIAD 2BBWA 4JBXA 5EXTA 4NZYA 1ZAKA 3RWOA 2YWGA 1Z2CA 2BJVA 2DWQA 1DAIA 3DPUA 3QVUA 3RC8A 1LF0A 1JNYA 2EFGA 2A78A 2QMEA 3GMTA 3B5JA 5FTLA 3IGFA 3P1JA 3QKSB 4RD3A 3P32A 3GLFB 2GNOA 1S9HA 1BS1A 4QFMA 3B1VA 1DTSA 5BYKA 5JECA 1C9KA 3RS0A 4OL0A 1KZGB 4HAYA 1BMFA 1NF3A 2W58A 3BB3A 4IXNA 2FDCA 1IN5A 5IDVA 1BMFD 2CHGA 3EZFA 4QL3A 4PPNA 4POAA 4CW7A 1KOFA 4XIGS 1T8UA 4I1VA 2F3RA 3VR4A 3FWYA 4C0SA 1UDXA 1TF7A 2DPXA 4MGYR 3RWMB 2ZI9A 3QEJA 4EPVA 1KJYA 1EK0A 1G7RA 1QHXA 3PV0A 2J1LA 3ECCA 4Q21A 4D0NA 2EFDB 1JXOA 1ZM7A 2HYDA 1HA3A 2ZRLA 2PJZA 1BKDR 1VCNA 1W4CA 3HDTA 3U3KA 3WY9A 4I1SA 3LX5A 1QVAA 4UNNA 1B0UA 1GWNA 1ZM2A 3TR0A 4DVGA 2G6BA 3D31A 3LD9A 3Q3JB 2J0UB 3HR7A 1GDDA 3C4JA 4A2QA 2GXSA 1GG2A 4KHZA 2YOGA 3V9PA 5JEEA 4OHYA 5SZJA 2PL3A 1TUEA 3QXJA 1VDZA 2PX0A 4HLUA 4NYMQ 3HYTA 1OH7A 2MMCA 1XMSA 3TBKA 4D6PA 4WBSA 5FH9A 1S4QA 1ANKA 4HLQB 5DI3B 2KBFA 4EJSA 3ETLA 3E5HA 2F1HA 4LBYA 4KFRA 3KFVA 1QHIA 2QPAA 1NL3A 2ZREA 3P26A 2ZETA 4IRUB 4V0LA 1DAFA 1N6KA 4G5RA 4YXWA 4Z1MA 4N0EA 2O8EA 1JAIA 2C04A 3SZRA 4B3CA 2XNSA 4Q1AA 1W46A 5DSZA 5CITA 2OZEA 4Q9HA 4RZ2A 1D9XA 4HZUB 4HB0A 2WTUA 3AKEA 3EASA 1VIYA 3BD9A 1B23P 4PTLA 4QNMA 3SDZA 3WP0A 4B2LA 4HDQB 1TQDA 2ZYTX 1MABB 4IVRA 4LJ5A 4Q7JB 2HUPA 4C7OB 1KJWA 2A2ZA 1HUQA 3X1WA 1KI1A 1KZ7B 3PQCA 3MWJA 3RNLA 3Q9LA 5TB5A 2Z5FA 3C7KA 3AVUA 1TADA 4F4CA 1Z0FA 1G18A 2IS6A 4YLGA 4NYIQ 2GA8A 5CJPA 2QGNA 2G0NA 3FB4A 4PAMA 1A2KC 1UKEA 5B64A 1P2SA 3DM5A 4OHVA 4P4TA 4TN1A 1KKMA 4JJZA 2A5DA 2PZEA 2WWIA 3WYAA 1YR7A 3QNUA 4EQ6A 5CJ2A 1OKKD 1P9NA 4J0QA 1X86B 2IUSA 4L9SA 1M8PA 5KDLA 4ACBA 2C5LA 5EP2A 3GLIE 1II8B 2ZS8A 1AS0A 1J8YF 4FD2A 5HTKA 4DSUA 1R0YA 1W0KD 4JSTA 4Q9LA 1QG2A 2H5EA 1CF4A 1CR0A 4C2UA 3AV0B 2IEZA 3WRXC 2BMEA 2VO1A 4NP6A 1SKYB 2QAGB 4QC2A 4HATA 3EPLA 1Q57A 2J0QA 4CEIA 1XTIA 1SXJE 3I5YA 1FTNA 1GNRA 4IDQA 3C15C 4XVUA 5JJKA 3CX6A 3KUCA 2WKPA 3F8TA 2ZROA 3BXZA 1SQ5A 4WXRA 4Q9JA 1HT2E 1IBRA 2OO7A 4HYYA 4KSCA 5IF9A 2XNDA 1WCV1 4AD8A 1G3MA 4CEJB 4M9XA 4DCSA 1U8YA 3B1WA 1IM2A 2DFKB 3BH6A 3E2IA 4TTRA 2JJ1D 1U9IC 1CS4C 5IK2D 1H8HD 3THXA 4G5GA 1LB1B 2GCOA 1VCIA 4DT1B 3LX8A 1SVKA 3EW9A 4ZDKA 4P4SA 4B74A 3CZQA 2QENA 4BFVA 4TYYA 2QSYA 1AQUA 1FNMA 2RGDA 4TLDA 5EE9A 2QI9C 4XSGA 2JJ2A 3QJYA 1YR9A 2WWGA 3FVQA 4Z8YA 3OHMA 4ILEA 3A6PC 2V55B 2BC9A 5EUMA 3SR0A 1Q3TA 2AHOA 4Q1DA 5E7MA 4DDVA 5B30A 4LHZA 1TPZA 5GADl 2FPKA 1AZSC 3SNHA 1V43A 4GI7A 2CMKA 5FI1B 3ZZTA 1G17A 5A0FA 1NMYA 2EFEB 2C2HA 3HWSA 4JKYA 5C46F 1YZQA 4IVPA 1OH6A 3EC1A 2WKRA 4G5OA 1KI2A 1XTJA 2BEJA 5E95A 3K70C 3C16C 5ELXA 1ZUIA 1JR6A 3NWJA 1OSNA 2JEOA 4QGFA 2IYZA 3IEUA 2B8TA 4KCGA 2P5SA 1E32A 3N70A 2JLYA 1R5OA 2H18A 3AH8A 4V03A 3CF0A 1OXSC 3BGWA 3K9NA 2QMOA 1T3LA 5KPDA 2OM2A 1AIPA 1DPFA 4G3XA 4PR0A 2FV8A 1FQKA 4MYUA 5L3QA 3ZVNA 4OYHA 5HKKD 2CNWA 1G8GA 1OIWA 1T0JB 1U2RA 1Y63A 5LD2C 2VH5R 2GXUA 1RRFA 2V9PA 5IK2A 4AYXA 1EWQA 3QVVA 1PVOA 1SHKA 3LBIA 5J47A 3UPUA 1E0SA 1GAJA 3BH0A 4RZ3A 3U3JA 2LKDA 2QQ0A 1JR3D 3LXXA 2ASEA 3TRFA 2JLRA 3WMEA 5JFGA 1U0HC 2H16A 5FPSA 3TMKA 4BLOA 4IEEA 1KK3A 5TVKA 4MA4A 3MG9A 4QBGB 3NEJA 1NP6A 2G88A 1EWRA 3BH7A 1BIFA 1KHTA 2NTYC 4XTCS 3FOZA 2YYZA 4LJ4A 4TLCA 3W5JA 5JZVA 3DEFA 4OJKA 1E2GA 2D7CA 3O47A 2BM1A 2F9LA 3I4LA 1GNQA 4TLEA 4Y0AA 4ZDIA 3U44A 1W5TA 2XTNA 3W6OA 2Q3HA 2D06A 3CF2A 5AR1A 2ZIAA 5J4VA 3KQUA 4JLDA 1ZU5A 4HLCA 2ZM5A 1A1VA 1JR3A 1R6BX 2IS4A 3A4LA 4M4SA 1HTWA 1Q1EA 1Y3AA 4O25A 4HAWA 5BQ5A 4TL6A 4Q47A 3ZDQA 1QHNA 4B48A 3EXAA 2CNWD 1U98A 3AP1A 2OCYC 2RGBA 1OHHA 4KV9A 5EE1A 4DSNA 3U6KA 3LV8A 2XOKD 4M0LA 4KLNA 4OI2A 1FMJA 3AB3A 4R9UC 4CIDA 3IO5A 3LO5A 4WOPA 4M1OA 2B7BA 3W3ZB 3BERA 2J7PA 1P9RA 1RYHA 5DH9A 2D7DA 5FUWA 4MDEA 5E7JA 3AVVA 2SHKA 2FSGA 3DHWC 2NQ2C 4A15A 3VX4A 4EPTA 4L15A 5KU1A 4IVQA 3KJEA 3AGPA 1NJFA 4JYBA 2XB2A 2FU5C 2GF9A 4JL8A 1DELA 1E2DA 2QN6A 4R2IA 2DYKA 1OIXA 1FPMA 2FX3A 4JBYA 4MYTA 4ZCMA 4KITB 4BWYA 4LJ8A 1ZUNB 2EWVA 3C5HA 2V1XA 4ZCLA 4P32A 1DS6A 2EYQA 3WYFA 4C4PA 5AWFC 4LI0A 2R6GA 3CONA 3U4QA 3VAAA 1VECA 4C3ZA 4JJKA 1Z28A 1S3GA 2H8KA 4JVLA 1IN6A 4ERNA 3HPRA 2GHIA 4OKSA 3X1ZA 4BFYA 2I3BA 1XXHA 5GVRA 1LFDB 1ZNYA 4TYWA 1UADA 2R6CA 2AL7A 3B9PA 4QBFA 5JSZB 1S3SA 1VPLA 5TXGA 3NTUA 2FGKA 3NKVA 3I5XA 1E9RA 4WZBE 2WSSA 4CDGA 3PUXA 221PA 2P5TB 4KODA 1XDBA 5EE5B 2RGEA 1N6NA 2XJ4A 1YU9A 2ATVA 1F2UA 4GSYA 2WMNB 4B76A 1ZCAA 2YWHA 4MRPA 1RPZA 2XNDD 3QPVA 2ZRBA 1G3UA 4DRZA 4P31A 2YWEA 1GNPA 4FW9A 1HE1C 1MRSA 3B78A 5B58C 1DAMA 3K9GA 2EU8A 3THOA 1M7BA 3VTKA 2Q9BA 1VCOA 1ZNWA 1RC8A 4LHWA 3SJCA 2IYSA 3G0HA 3BC1A 4OQXA 1EGAA 2BOVA 2VTKA 4PHHA 1DOAA 1E2LA 1P2VA 1W0KA 5LB4A 4AG5A 1YZTA 1VCMA 4RFSB 2WVJA 4B44A 2WWHA 4A8JA 3PUYA 3BBPA 3U61B 1T4GA 1X3SA 4TL7A 4I1OA 1KO5A 3I3SR 1KK0A 1U8ZA 5DN6D 2O8DB 2IS2A 2OG2A 5CK5A 3MWLA 2NO7A 1N6LA 1CJKC 4W9MC 2HCBA 4E22A 3HYRA 2GCPA 4NKRA 1GL6A 4WIAA 3EA5A 1GOTA 3IIJA 4PZLA 2QL6A 3T34A 4QNRA 3VR6A 3ZIAA 1HURA 1XZQA 1G7TA 3OESA 4Q19A 1D9ZA 1CEEA 2YC2C 1JECA 1DO0A 2QG6A 1H8ED 1P61B 2QSZA 4LYFA 4URYR 1R8QA 4AC9A 3CX8A 4XD7D 1E1QD 1DAEA 3LW8A 1NVWQ 2B21A 4B6FA 5JWOA 4B3BA 2RMKA 1ZC4A 3DOEA 3N2EA 2RHMA 2VP9A 3ZJYA 2RGAA 1U0JA 2O8BB 3AKCA 3CPEA 3EZ2A 2ZAMA 2FWRA 1TQ6A 2RAPA 2WJJA 3MAAC 2E1RA 1YJ5A 1N6RA 3MCAA 1M1YE 2FFQA 2ZQ5A 4GZLA 1TF2A 2FSIA 2ERYA 3FMIA 1QHHA 3NIBA 4A2WA 4IXMA 4Y0VA 5F2EA 4NYJR 3AEZA 3BORA 3F5FA 1UM8A 2CE7A 5E4FA 3PUZA 1KSFX 1I2DA 3PEUA 1P4SA 2A5FA 2HXYA 4NL4H 4Q7KA 2BWJA 2CCKA 3QQ5A 5K8LA 3RRNA 3PEWA 4HDOB 2OUKA 1P2UA 4XD7A 5F9FA 3IKJA 3TIFA 2AWOA 2IHBA 1BO6A 1H8EA 3P4YA 3AVWA 1RKBA 1AKYA 2IA5A 1FFHA 4A1FA 1KO4A 4LV5B 1N3BA 4KFUA 2PCLA 4HAVA 3TJZA 1S9DA 2GCOB 4S35A 2ZPTX 3IUYA 5EP1A 1SVSA 2ANCA 5FPTA 3BB1A 2PMDA 3TW8B 3IPXA 2JLUA 1P5ZB 2IEYA 1SVOA 2GEUA 4A82A 4R7ZA 1NLFA 2P3SA 1F6BA 4LV6A 4L5BA 3F0TA 2CDNA 2ONKA 3VKHA 5JRJA 2DFLA 1J7KA 4BFSA 2CVHA 2FSHA 3GJ7A 4LPKA 1VG1A 3DMNA 4B2IA 3RHFA 3WBJA 2JAQA 4H1VA 4BLSA 3TSOA 4NCJA 3R9WA 1VTKA 1A2BA 3TUIC 4UKDA 5KSYA 4BE7B 4JLMA 2G3YA 1M7GA 3TLXA 4L4UA 3ZZ0A 2AFIE 4B73A 2BV3A 2GJKA 5JI3E 3ZQ6A 2ZYWX 5CYOA 3I8XA 3MSXA 5TDHA 3W90A 1CTQA 1T91A 2Q3MA 3SN6A 3BIFA 2WICA 3LH5A 4B34A 4D2IA 1RJ9B 2ZITA 4PSAA 3CBQA 5LPNA 4ZKDA 1XJ0A 1LTQA 2KE5A 4OHZA 3K8YA 1JPNA 3QF4A 4IHQA 4RKEA 5A5GA 3R8FA 1CXZA 3WHKA 4ZKEA 2OHFA 2WSSD 2O0KA 1GKIA 4D0LB 2WWYA 4A0HA 1X8JA 4XWKA 1GTVA 4LSGA 1G3RA 1CR1A 5LB2A 4URXR 1CJTC 3JVVA 5JEDA 2CLCX 2D62A 2G1KA 2VSXA 4RD1A 2V7QA 2ZAOA 4ZV4A 3SBEA 4M21A 2BDTA 3Q5DA 4FCTA
chains in the Genus database with same CATH superfamily
1B6RA 4EKYA 1JDVA 1PEAA 2GK7A 3BFKA 2RBKA 5LZ4A 3G71V 1MIHA 3EYWA 4AZTA 5L4LA 1YJBA 3GP5A 4CODB 4Q6BA 1BN6A 4ER6A 1IJBA 3KVNA 4JHXA 1NLMA 2I54A 1NRJB 3TL6A 2D0PB 3EVNA 3WIDA 1KY3A 4RULA 3OG9A 1S1MA 5CNJA 4B6QA 5C4IA 4OQZA 2J46A 5HE9A 3BIXA 1DAOA 4GOND 3MCTA 5D00A 1M56C 1K3UB 3GGSA 4HRXA 2IV2X 3S1AB 2Q4PA 1ESNA 3AY6A 4B08A 3AHCA 5DNAA 3ZWAA 3K70D 4LSWA 5HQTA 1OB2A 4YI3A 4QJIA 4B3GA 1T1EA 2FMXA 2PLAA 1NPYA 3G0OA 5JWRA 1ZRMA 3O38A 4PG8A 1T5BA 1NW7A 4BQOA 3VR6H 5CLJA 3K5IA 3CEMA 3BMNB 5L4NA 1SQPH 5EZYB 3K03A 4I36A 4PZ9A 3B53X 5JD3A 5FWYB 3O8DA 2DXIA 4Z53A 3HUUA 4YYZA 4WESB 5DSXA 4O4LA 1THZA 4DMMA 3DVLA 3E3AA 4XIFA 1D2DA 3A0RB 4FLEA 1VQMV 2IU0A 1J25A 1OV6A 1PAUA 1GG9A 1PV2A 2B9EA 3AQ4A 3C39A 3NBQA 4KDRA 2CD7A 4IIHA 3DC5A 4R2JA 1JYSA 1COWD 2C7PA 3MJSA 1TO6A 4C4RA 4G63A 1MJNA 4MTOA 1Z68A 1F14A 1YULA 3SJQC 1MVNA 1BHAA 4KPEC 3FFWA 2DSNA 1V4VA 2AYXA 4MPTA 2VP4A 2ZB4A 2ZUTA 4DK1A 2ZYAA 3SIXA 1J9EA 3H1AA 3F1KA 1XCMA 2R4TA 3K53A 4ZC1A 4AJIA 1FW8A 2H57A 1P2BA 1T1JA 4MKFA 4PAGA 4RNCA 5H9WA 5IWAO 2VS0A 3TKLA 1P7BA 1COWG 3T0IA 2OBLA 3APQA 3EUAA 4NIMA 3BRQA 1HL7A 3CLVA 1T8PA 2IP1A 2J0UA 4LF7O 4IMPA 4GOJA 1JEYB 1CWUA 3QV1A 5A06A 3EFHA 1RM0A 4V0MA 5B7NA 5AJXA 3U4MA 2QL5A 5EHXA 1YJ8A 1BDBA 2LTAA 2QV0A 3P9QA 1AHHA 1NKTA 1QVFU 1P31A 3FWPA 5LQKA 2GJ9A 3DHVA 3BK2A 1K3TA 4OKNA 1C1DB 4AKIA 4LZLA 5TQ0B 1U2GC 4Y2QA 3LBAA 1N1EA 4MCIA 3WJ7A 1XYVA 1LC0A 2DG2A 3H7AA 4I3HA 2O8EA 3TF5A 4QHSA 3UZUA 2EL9A 3LW7A 4B7EA 4MCAA 5K4AA 5SZKB 2HI0A 4BUJA 2ARKA 4DZZA 3ZCQA 4B6EA 2C3PA 3OCUA 4BO4A 1C8VB 4DYLA 1XB2A 2RHCA 4HZIA 4HGNA 4C20A 3HXQA 1Z38A 3L6DA 4NNJA 3TB4A 2WZDA 3QKRA 1SQ6A 3A4MA 1T0UA 1DIAA 2C9CA 2ZIUB 1FLVA 5HKKA 3O0TA 2EQAA 1UFRA 2ECQA 3IOEA 3K0AA 3V8EA 4D3DA 1AB5A 1ACLA 2IZ7A 4PGFA 1D6NA 3QFFA 5C1PA 2NU9A 2WR8A 4NJEB 4DMUB 1U0EA 1RI5A 2E76B 1GGJA 4A7PA 5GM1A 3VYVA 2HMSA 1YAHA 2PZMA 3L06A 1MAVA 5A9SA 4K2HA 1P4JA 1OVMA 1X9GA 4JEMA 4BHTA 2GA9A 2C5AA 2P11A 4NFYA 4EUEA 3I5UA 2C1EA 2FZ5A 1DAGA 3KT3A 1P5RA 1SCNE 4KQHA 5EKSA 5LOVA 1DADA 2NO9A 2OILA 3L84A 4MCJA 1QR2A 3WWPA 2UXNA 1XRMA 2GWRA 2HPVA 3L7CA 3HB5X 4FCVA 4QXQA 3W06A 2WG0A 1KKDA 1DEXA 2R7KA 4V0ME 1IBMB 1J5XA 4ZDJA 3E9MA 2O7VA 1ZJJA 3GC6A 1UFVA 4ALJA 3ZZ1A 5DI9A 5KYYA 3HVHA 5C5EA 5IDXA 2ZKIA 1HI9A 3RUIA 1MX9A 3GAMA 3STUA 4NNPA 1BMDA 4WVLA 3P7MA 4ZPJA 5E1MA 3T1OA 1AMOA 1LH0A 3NO4A 4GM0A 1WB9A 3LK6A 1TTQB 3GCDA 4DC9A 2X8AA 1XVTA 3THWB 2OO5C 1TECE 1N5OX 3T7SA 1FS5A 2CYAA 5ESWA 4W7SA 1R0WA 3T9DA 1YTLA 4PNHA 1J24A 3OO1A 1Z39A 2NTNA 3HZHA 4TWJA 1QIEA 3U10A 2H00A 1X7DA 1U8XX 3LPNA 5B1OA 4X97A 1D8TA 2OCHA 2G7ZA 4JT2A 1TQHA 1R3IC 1QONA 2RGGA 3BTSA 3IAHA 4O2LA 1SKVA 1NI8A 1WZNA 3QNMA 4FZ5A 4NABA 4PYRA 3RYFA 5DOZA 5C52B 1E94E 1GRJA 2BF7A 1XNGA 3QVTA 4E7OA 2UYCA 1M1UA 2AD1A 3ITDA 1I94O 5K0EA 4G9GA 4ZHQF 1PWYE 3ZDBA 4QGBA 2BF4A 3KR0A 3L8FA 3K9QO 1A7UA 3PT5A 4RA9B 4JV5O 5EHGA 4H7KA 3T7IA 1HSOA 3WMWA 1UIRA 3CO5A 1E9FA 4RUFA 2B37A 3W5HA 5F21A 2WMOB 4DB2A 4JI6B 3A2NA 2QY6A 3CJHB 1HQYE 1QAMA 3WWDA 4EB0A 2IU3A 5AVQA 1IIRA 2WK1A 2VNIA 3U5TA 2QVGA 1D8AA 5JARA 1DTOA 3H2SA 2VSNA 5EFZA 3VQTA 2W6IG 4MWEA 5C8XA 1AVMA 3EPKA 2O8BA 1SQFA 3A2KA 4R4JA 2XE6A 4G5FA 1IHPA 4KFMA 2HWUA 3OZWA 5D3QA 1Z4JA 1JQ0A 3D6HA 3RV4A 3FGNA 2AHZA 3OEHD 2YRXA 2R79A 1YC5A 2GCEA 1P91A 3O84A 4OJMX 1TAUA 4Z7NB 2VRNA 2CCJA 2L42A 1QS0B 3UJ8A 1B8NA 1N7GA 2FDXA 2NLJC 4NXNO 2GZSA 2VPYA 5B66Z 4NXMB 1CJVC 3I2GA 3PFIA 2EP5A 2WIKA 3F4BA 4B79A 3MJVA 1AR1B 1I0LA 2A7QA 2QK4A 4M3NA 1Y9DA 4EOGA 2K87A 3E9YA 2AZDA 3BA1A 2QMQA 4FDMA 1ZH2A 4DR1B 4JT8A 3QU4A 3BGVA 2PMBA 1NV9A 1V9PA 4FKBA 4HEA1 3P96A 1RCTE 3OQOA 2BCGY 1NJ2A 2VEDA 2RN9A 2Z3VA 3P9XA 5CJJA 3FUUA 1Y7LA 2CMGA 1R8JA 3F6SA 4P81A 2XMBA 3P5SA 1HTBA 1IFXA 2P4KA 5F78A 2M6LA 2D2IA 3HCNA 3VNVA 5A6VA 3OZCA 2PH5A 4RM2A 1Z2GA 4NCKA 4HN2A 5BOVA 4CLXA 2IH5A 1AK2A 2VZEA 1N2BA 821PA 1H2HA 4FYIA 3JR7A 5IJZA 1E6EA 4NY1A 5JAMA 4MS3A 3R0XA 2UUAB 1NN0A 1WEKA 1VIMA 4RXUA 2WD9A 3QVOA 3CCLV 2H3HA 3HVKA 3MNFA 1VSUA 3AX6A 5LM3A 4O5AA 1EKXA 3FAKA 2Q49A 3ZI0A 3BA6A 3QLUA 4N8EA 2ZJOA 4HNRA 1E6CA 1JKIA 1O94C 3T1HB 1FXVA 2E75B 1FDWA 2F7SA 1TMYA 4PA9A 3GA7A 1PJAA 4HGYA 3W9BA 3ZDFA 5GJVC 1T34A 2EX4A 2X0LA 4A03A 4GPEA 2OLKA 2PI5A 4DIEA 2FN9A 4M0PA 4UULA 2HJSA 1M54A 1RT9A 1K0UA 1U7UA 1WXGA 2Q6LA 2XOEA 3OF2A 4MWCA 4Q4JB 2YX1A 1I4WA 3AUAA 4P84A 4CKXA 1Y98A 3ADCA 1IDN1 3GLUA 2DC1A 1TJPB 4EG0A 3HC7A 4YA6A 1XTTA 4WXPA 5AHXA 5F2NA 5JNRA 2G1PA 1GZ4A 3THRA 1JGTA 2IE0A 4BGIA 3O3MB 4X64O 5JMPA 1T3TA 3QBJA 3RYHA 2O9JA 1WU8A 3KV1A 3PC8C 4RZUA 1DQRA 3P27A 1OC4A 1ZHFA 1GCOA 2LVBA 2ZJFA 3D36C 2C8VA 3I45A 3NEPX 1Q90D 3QX9A 5ESDA 2YDYA 3I92A 5KX5F 3BXEA 1SY7A 1U2ZA 1IXZA 4J0KA 3EDCA 3EIHA 4MV0A 3KJNA 4BJ3A 4WADA 5EWMA 4UNPA 4DLUA 3MHTA 5KTOA 2R86A 1R12A 2YIJA 5J2UA 1XDUA 4WKGA 4XBFA 1EWYA 1X1QA 2ZKOA 1ZGCA 2OHVA 4MGKR 2LW7A 1JH8A 2EP7A 3UOGA 4B3XA 1PQYA 2Y6UA 3P0IA 4QUKA 3JCZA 2FH5B 4J9UE 1EXVA 1KNQA 4NVRA 4PS0A 2WPDG 1X3LA 3SXUB 4Y1RA 3VZBA 1ZBQA 2QRVB 3C3EA 1E5DA 5B1BC 2UVPB 3NJ4A 4GG1A 4HRAA 1G3IA 4G81A 1NDHA 3RBAA 1W36D 4I0XB 3M9XA 1GUDA 4LWQA 3R44A 3REGA 4ZCTA 1K92A 4LUCA 4O4LB 1XTRA 3RPEA 4NWIA 5LQMA 3QBVA 1BYUA 4F5EA 4P3XA 4CQNA 4W7IA 3MWEB 2ZIXA 4ENVA 3DVQX 1G8YA 1XHXA 1U0TA 3SD7A 3KSRA 1SQGA 1X39A 1M74A 2JANA 2K5UA 4H7PA 4YH1A 3BA8A 4J16C 2I6QA 1MSDA 3QP9A 4PLPA 4ZI7B 3LY9A 3M5CA 2Y4OA 4WBNA 1HL3A 3MUNA 4RXTA 4FC6A 3SEAA 3PP8A 3UH0A 3VDXA 1U7HA 3ZDZB 3BD6A 1G5PA 1CNFA 1L7VC 2YS7A 5LUAA 4G1CA 4RAIA 4GF5A 3T94A 1TJ3A 2IIBA 2WHEA 2PYLA 1C3OB 1CBUA 1K9VF 1OA1A 2P9GA 1A9RA 4FSDA 2CKDA 4M1EA 5G0SA 4ALIA 4ZYLA 3HVJA 2BYTA 1RQ7A 3KWJA 1WBDA 1PV4A 4DV5B 4RADA 4R2LA 1GILA 3D5QA 3W6PA 3VZRA 4LJYA 1S72V 3GCWA 2OK8A 3TO5A 2LIVA 4GBMA 1EZ1A 4CUZA 3COSA 4TXMA 4AFNA 5BV7A 4O5OA 3KVRA 3DEZA 4JU8A 2RCNA 3H5RA 1P5FA 3IVAA 2W70A 3GMIA 1D2MA 3KE8A 3KOZA 3ZWCA 4PN7A 2CL0X 2VVTA 3GJ8A 1NI4B 1SD2A 1M2HA 3ES9A 1J56A 3NBFA 3GLTA 4XSHA 2EFYA 4FYYA 1Z4QA 3H1PA 5IRCD 1PLJA 3IV6A 3RYIB 2EBWA 2LKCA 3DH0A 4EO9A 4W5NA 2JRIA 3NCHA 3ILXA 4HI0E 4IQFA 5A7HA 1B00A 3KYCB 4QPZA 3C3WA 5G4KA 4JWTA 3HI6A 1NUSA 3RVYA 5B5EZ 2JIOA 3OMAB 2PS1A 3NHBA 4GNKA 3FUCA 4RK0A 3I1IA 2OYSA 4ES6A 2VDOB 1XMQO 2F62A 2KJQA 3TQCA 3WE7A 1QTQA 2WYUA 1XD9A 4MEJA 5H59A 3K0EA 3LMKA 2Q45A 1CCWA 4II7A 3GRAA 1ZL2A 4JITA 4KQIA 4MB0A 4J07A 4OX9O 5E79Z 1XK7A 2VPZA 2WJPA 5CTJA 5EE3A 2CYCA 1QC5B 2E6UX 3OQMA 4NTXA 4RACA 4TWRA 5DHAA 1GUBA 2Q9LA 3ROPA 5I45A 5JMTA 2QY9A 5J4HA 1J2RA 1Z47A 4C7KA 1T8TA 4OHRA 1FFWA 4MQ4A 5KNLA 3SQMA 1EAMA 1X7ZB 2E4YA 5AVZA 1I0HA 3WB1A 3BQNB 4KYIB 2WU8A 2I6GA 4ML3A 3UUEA 5G4KB 2QYHA 2HJFC 1AKQA 2ZS9A 2HEIA 4QJ3A 4E2FA 1ICEA 2HRDA 4NBTA 2DGDA 1BXRB 1PZMA 2D5LA 1AJPA 5FUMA 3EX7C 3UH1A 3RKRA 5ALOA 3RANA 3LUGA 5EJ6A 3IAS6 2HGZA 1IJEA 4ASUA 1KYTA 5BVHB 1XCLA 1Z15A 1ZMOA 4EFDA 3P2EA 2HT1A 2OKGA 1UT8A 3ZVLA 4DV1O 4NCAA 3W8FA 4ND6A 2IBMA 4LP8A 1UBSB 2ILVA 2MSCB 2QDXA 1V48A 1N33O 2YMPA 3RTEA 3SY8A 4IHAA 3V4LA 4MP8A 4CLHA 5IUNC 5CDSA 2Q9AA 3HFGA 2PR7A 3N28A 3BSSA 5B2EA 4GYJA 1EBOA 2EIMC 2O0LA 2KSQA 1YZUA 1YACA 1PR6A 2BFMA 3D7KA 3AEXA 1NXWA 3GFFA 3I8SA 4AY6A 3KSZO 4YAJA 3FHCB 3BMOB 1MX1A 4NR0A 4IFEA 3VC3A 4J16A 1PBTA 1BAPA 2IHNA 3GDHA 4ETIA 2C4HA 2GZDA 4IFTA 4EVSA 4DDTA 5HM8A 5KNBH 4R1TA 3DDOA 5K03A 2QTAA 4GP6A 3RTDA 4FK5C 1YV9A 4L8YA 2ENUA 1YUNA 1ZC3A 2AX4A 1EI9A 3B4SA 1D5CA 1FPQA 3EVFA 2JL1A 4HMPA 3L7JA 3QKTA 3X1MA 1VHLA 4ARUA 4XQ0A 4PG6A 2OXTA 1QZUA 4EI9A 4F84A 2P9CA 2IYWA 2JDIG 2ZSEA 2QW1A 3ETCA 3GFOA 2RH5A 1KAMA 1R0RE 3A2MA 3ICWA 3LC0A 4TKUA 4FXPA 1ITZA 3O2QB 4R3UC 2JCSA 2AN1A 1W0CA 2WYWA 3IAAA 1GSAA 1WDMA 3U4GA 2O3QA 2QN9A 2OD9A 4N54A 1OGIA 3L72H 4GRDA 3SMVA 1P80A 3LBYA 3THWA 5TC4A 5DWDA 4C6RA 5LBQA 2XBUA 4DA6A 2QKYA 4UM7A 4N01A 1S96A 3E5NA 4HLNA 4CHTA 3GEMA 1RWMA 3T4DA 4DXDA 2XVZA 3ULKA 3WGYA 1J1ZA 4YV1A 4D8TA 3X3HA 2BJHA 2FG6C 4D7TA 2HNAA 2X5JO 4I1IA 4S12A 3RC2A 4IFIA 1PT9A 3R65A 1Z07A 3AHIA 1SD5A 1MO3A 4NE7A 4ASUD 4C4YA 1U0OC 1WDLA 2J48A 3E5RA 2I6UA 6REQA 3WL5A 2V6GA 1GLVA 4MAAA 2YXEA 4P0TA 4UVIA 1RYNA 4M21A 4FR5A 1YJWV 1AS3A 3I9V1 4YT5A 2EDCA 5FD8A 3AF3A 3B20A 4RTJA 3H16A 5LIRA 2XGGA 3LFUA 4P1ZA 4PDLA 3EGCA 4D99A 3V1TC 4HNUA 3ORYA 1KWGA 1EFRD 3ZBHA 5JO0A 4US1R 1RFLA 4IF6A 5HJEA 2BSKB 2DYSB 2PUJA 3UJ9A 2FPPA 1US6A 1B06A 3I52A 1DG1G 1GZ5A 2BR3A 4ZAZA 4TS9A 4B3HA 4BX8A 2P1DA 4UXIA 2HHAA 1PKEA 1CUHA 1I4EB 2OGUA 3PQEA 2YJTD 3FDIA 3RUCA 4YAUA 2F43G 3ABQB 1KK2A 2ZB3A 2B4YA 2P35A 3EGWA 3AR2A 2DLDA 1UK8A 3LDGA 1DMRA 3ENVA 1F48A 1M10A 4GKKB 3S3TA 2WJ6A 1IPEA 2FW8A 3HO6A 2Q7OE 1I36A 3UC5A 3ESCA 4TV9F 4WCDA 4KXRA 5EEGA 2FOIA 2YKGA 1KO7A 3KG2A 5SY9A 2Q1YA 2R8BA 3A10A 2Y1DA 3MBOA 3RG8A 2GQ0A 2C57A 4IDOA 2FPGB 3LVBA 4JP8A 4IX1A 4E3ZA 3Q4HA 4FHEA 4GLBA 4HUQB 1NVVR 2WD7B 4GZRB 3S1SA 3QF4B 1I5RA 1R0CA 3V3KA 2BZ0A 2FF5A 2IZ6A 1A8SA 2BFOA 2K1EA 2O2IA 2VDLB 2ZWOA 4M8LA 1BG6A 1CQJB 1Q7CA 2XTMA 3AO0B 1XAGA 4HDSB 4B8WA 2ACVA 4MW4A 1T4DA 1KZ4A 2EKZA 1Y3FE 2WHPA 3PCTA 3RABA 4C6SA 1ZRHA 4BQSA 3PNYA 1QTRA 5HBRA 4NCBA 1QU7A 1V1MB 3Q8XB 1C0KA 2ZBVA 5K0LA 1JBKA 1G5HA 4UTRA 4Q20A 1UBOS 3DAOA 1UKYA 1E0AA 3PYMA 3DF7A 4KPFC 3UA4A 4JQYA 1VA5A 1QVVA 5LNK1 5DI3A 2XSZA 1QO0A 2YVUA 3MS4A 1UEJA 1M1NB 5AKEA 2ZVPX 3UJHA 3OTGA 4Q3BA 2ADPA 4MINA 1B8OA 1BMFG 1SVUA 4F1WA 1XJWA 3L9DA 1KU0A 2JH8A 3W8RA 3WFJA 4CM9A 3I2HA 2BGTA 4Y6OA 3L0PA 1D09A 1YQWA 3P2KA 3UWOA 3E82A 4D4LA 4L9AA 4RC9A 2Q07A 2AOUB 2ZGVA 3ZW9A 4TVKA 1CUUA 3SPHA 2BM0A 5CYPA 3DGFC 4CL8A 3DE3X 4CV0A 4DGSA 2XJ9A 1YQGA 3G23A 1JIUA 1O97C 1EK6A 3DPSA 3U6BA 2RGCA 4GP7A 3AWIA 3RSZA 3WRVA 1TZCA 4NV1A 4BB5A 3K9SA 2HWKA 1MOZA 3DC2A 5KHOC 3EY4A 2PWBA 2GN9A 1DRJA 1SC4A 2YEVA 5K1PA 3BIJA 2XZTA 4QDTA 4OEHA 5FDFA 3PR1A 2G9QA 3OD1A 3KB8A 4BNDB 1NR7A 2FTKA 2G08A 4MVUA 3NXSA 1YZFA 4S1PA 2J87A 4D4HA 2OZVA 3AETA 1E3JA 4WLFA 4XX0B 2HGSA 2BGLA 1AQLA 3WGZA 1D2AA 3CMMA 4LTDA 4QREA 2XYPA 5DPMA 5JSKA 4ZU3A 5AW8A 8OHMA 2LGJA 4X6YA 4NZ9A 4DNFA 3ZLBA 1F6DA 1P62B 2HPZA 5BNIA 2IM9A 1Z2NX 3F7MA 5FPHA 3FPFA 1GZVA 2V96A 4EYKA 1WETA 3CBGA 2DJVA 3ZDXB 2GN4A 3B7PA 3IJRA 5ICEA 3GP8A 2PRKA 2UVQA 4FFRA 4BKOA 3CB4A 1N1DA 4AP9A 4CL0A 4ZGGA 5KHGA 5JDIA 4D74A 1PTJC 2MMGA 2Y2VA 4JYMA 3U40A 1YTUA 4QEKA 1Z0AA 1UBHS 1II8A 1WE2A 2A58A 1PR1A 1HDEA 2IY8A 2QPTA 2X5OA 4JVMA 5C8DA 3LSUA 1Z6TA 5B3LA 3CCSV 3R7WA 1G1XB 2D2EA 3HB9A 3EHDA 1VIDA 5HK8A 1FFBA 2BKEA 1YZHA 1YI8A 4J0JA 5EZ6B 1NN5A 3I04M 2QVLA 2QAGA 3KPVA 1W59A 1H2XA 2WHPB 5ERYA 2GM4A 3P0FA 3GZNA 3T4EA 5F3DA 5TEWA 1WNSA 3QELA 2MT9A 3ASZA 3IHLA 1E3TA 1V8OA 1FNCA 4AB1A 1ZCBA 1ELOA 1NZJA 2QF7A 3IHWA 3JW8A 4D3XA 2ORIA 2NV2B 4JVNA 3GAZA 5EWLA 2OBFA 3UWPA 3FCEA 1PDVA 3BCRA 4CIXA 2DQ4A 3ZCPA 2B92A 3OAAG 2J3IA 1CQXA 1D2NA 2C84A 3CZPA 2C03A 4G6ZA 3RUFA 1IHOA 2DQSA 4WQMA 3UMCA 2B1GA 4WW0A 1R5NA 1L5MA 4YECA 1LY1A 1KF0A 3WJAA 2FWBA 2IHJA 3PXXA 3MOGA 4QRDA 1FS4A 3QKRB 1DRUA 1K5QA 1IY0A 4YYEA 3VJKA 1QZXA 4JI5O 4D4JA 3AUYA 3FIJA 4CIBA 3A6GA 3T1VA 3NBXX 4JYAB 1G7SA 1ML4A 1WZEA 4EEXA 4HVLA 4IH9A 1GLGA 1HRKA 4AJNA 4ECEA 3SXJA 3W78A 3F8SA 3Q10A 2MIIA 4MWGA 4QOEA 5AVXA 1JRLA 4OF4A 1R3KC 2OZKA 2W4IA 5T6MA 3RJ5A 4DWOA 1U7PA 4D4MA 4YDHB 4BWAA 2BHRA 3B9RA 2IJHA 3HCCA 3K9LA 2EBFX 3E27A 4J1QA 4JASA 3NP9A 1SHLA 1W4LA 1COZA 1TGYA 4W8HA 3RVOA 1RPNA 2KI5A 2C29D 4UVCA 1E1LA 1WVMA 2IYNA 4TSFD 5LBTA 5CDFE 3SYOA 4I4TB 4PICA 5DTRA 1GTRA 3VR0A 3L0IB 4MP6A 4V0RA 3B6MA 4MI6A 5DNYB 3TOSA 2UYYA 4PF1A 2OV6A 4TT8A 2QN1A 4DLNA 4RIGA 5HKLA 4AZ3A 3HSYA 1JB1A 1ZXBA 1WMEA 3HU1A 1MOFA 4I8IA 4WHMA 1DCFA 1PEDA 2W37A 3PITA 2E4WA 3W7WA 4DLKA 5JJIA 1AF4A 1XLVA 1Y8QB 1GDHA 3JQQA 3RUDA 4DREA 4E51A 4QU9A 1KRHA 4BX0A 2BL4A 2EF0A 2XYGA 3D59A 4GYKA 1F2TB 2A9HA 5CT9A 3SF8B 3DONA 1AKRA 2ZAYA 3FSGD 3IAUA 2H7VA 1EE1A 4KBGA 4RPCA 5D3MA 2OVBA 3N59A 4M9SA 2ZJ1A 2I65A 4YI5A 1SRRA 5FUXA 5JSFA 1EWTA 4WFFA 1GGFA 3WMGA 2FJ0A 2X86A 3LTEA 1X8KA 1U6JA 3ONFA 4IJUA 3RHSA 1IPHA 1Y33E 1TU0A 3SBDA 3THXB 1CY8A 1W9HA 3ABTA 1GRVA 1PNVA 2CFCA 2Y6VA 1KR2A 1LVUA 4K8XA 5MN5A 3LDEA 4OKIA 3FMPB 4X8OA 5IEJA 2VSQA 3WNCA 4I8XA 1RI2A 1GR1A 4EGCB 1E9AA 3G80A 4PONA 3PU6A 4ARVA 1GTMA 8ADHA 1BA3A 1WQ4A 3DZBA 1AR5A 5T41A 5A4AA 4QYWA 4C0KA 4MYRA 3DMGA 3LUAA 2AW5A 4RF3A 2XMQA 3HV2A 4NTYA 1WXEA 1XUQA 1V5IA 4AICA 1YAJA 4WFBV 3W3AD 2O2XA 4KQMA 1CZNA 2J0VA 3H4MA 4P92A 1K3EA 1GPYA 4BKQA 1JHYA 2VHVA 3N05A 4JA0A 2VDUE 3DDNA 5T3UA 1V8ZA 1XELA 4D45A 1LS1A 2VSOA 1Z2OX 2P9QA 4G86A 1LS6A 1PSDA 4TMVA 3PHHA 4B87A 4HLUC 2BGJA 2W2PA 1H0RA 2AOXA 2PH7A 3I6IA 4YAWA 1OASA 1UAAA 5LXTB 1XEXB 3AF2A 1N36B 4IYHA 1IAVA 4S0ZA 4XWYA 3T7DA 2GPNA 4YFVA 2HQSA 3V7WA 2D2VA 4ZQIA 5IZ4A 2HCFA 2IFTA 3AM3A 3ZGLA 3TZEA 4DAOA 5KKCA 1DBRA 3H11B 2ZDIA 2QXUA 3ZBUA 1KI4A 4W5OA 3HN6A 1V8DA 1W29A 2CH7A 4WY5A 4XTRA 4Y2VA 1JVNA 4LBEC 1J39A 4BNMA 2HDWA 3IQWA 5C8YB 1OPRA 2HJWA 2R6DA 1N2GA 3GT4A 1JN0A 3CVOA 4BATA 1KDVA 5A4KA 5GW7A 3EPJA 1ZJWA 5AO9A 2ZK7A 3CH7A 4MARA 1P0PA 1Z5VA 4ABMA 1D5AA 1XZCA 3LC2O 4GO1A 2ZANA 1K2WA 3TLKA 1J1IA 3X2QC 1JHRA 1DV2A 2H7CA 3MLEA 5H9VA 4AQYB 1UZLA 4OA8A 4R40A 4DMCA 1X1TA 3OPVA 1XEAA 1YL5A 1VM6A 3HACA 2RJ3A 3G4SV 3FCYA 3LXRA 2ZYGA 3ONNA 2IDMA 3PWKA 4MR7B 3WISA 3MF4A 5FUYA 4Z1MG 2E2WA 1A5ZA 3KLPX 4KAFA 4A0SA 4LF6O 1DWQA 3IV7A 1W93A 2WF5A 1E8NA 1R3DA 3HYSA 4RDCA 1QQCA 1XTSA 1K8ZB 3OZGA 2OFXA 3RSLA 2C07A 4KR6A 3T4UA 1IDSA 5D7NA 4CM4A 1SULA 3K70B 3EEYA 1P1FA 2OVFA 3D3KA 3HJNA 1P2DA 3VSAA 1AN0A 4ALKA 4DQKA 4EECA 2BUBA 4F92B 5FCDA 4MZDA 4IOKA 2FW7A 2X9LA 1XZEA 2O52A 1CLUA 2H1CA 5CCEA 3W5AA 2OGZA 3IC7A 5EN4A 2HRBA 2IPOA 3L43A 1QO0D 1NH2D 2C4VA 3M70A 3WIOA 3CEIA 3LCRA 3HEBA 3K5MA 1YVEI 4HVAA 4IIXA 1X1BA 2CLHB 4INZA 4Q82A 3EW7A 4Q18A 4WEOA 4DTCA 1P9WA 4YAOA 5F5XA 3CZMA 5LDHA 3FZQA 2IJIA 4JUBA 1LZLA 5JCJA 1T4CB 3NHZA 1E4EB 1E4OA 1KH1A 2DBQA 2I2AA 3OPYI 4UFNA 3R9IA 3UHPA 1H38A 1YRAA 1KECA 3LOQA 1HV8A 2EBHX 5E0KB 5F52A 4D41A 4PGMA 2FEXA 3NDPA 2BFDB 2D0DA 3WDKA 5IF3A 2OORA 2YWJA 2FXVA 1E3LA 4A6XA 1FDVA 2HHJA 3BILA 4K81B 4L5IA 3LA6A 3B48A 4RSRA 1N5LA 3W7TA 5J2TA 3U7QB 4WXEA 4PM4A 1YZKA 4B32A 2NQ8A 1UBGA 5KOHA 4Y6SA 4G5XA 4W1QA 2HA5A 1C3OA 5A5VA 3R9XA 3Q4HB 5AQ1A 4RZSA 2Y69C 2Q28A 1H5UA 3U7JA 3NGXA 2V7TA 1P1IA 3BF8A 4GIBA 2APJA 4F45A 4FYWA 2CE4A 2BEWA 2P75A 3AVYA 2WTAA 3T7CA 1XMOO 2XDWA 2XMRA 2B78A 2RHGB 1ZISA 1ZY2A 3SYTA 2JS5A 1IOLA 4TLAA 4K3AA 2X1MA 2EZPA 2WZCA 4IAOA 5HCIA 3SZOA 4U39A 1K73W 1FBNA 5GJWC 2HRQA 5F1KA 3KJQA 4DYHA 2ETNA 2HMTA 1U6IA 1NW3A 2VP5A 2MYPA 1A9ZA 2WF8A 3PEFA 3B51X 4HAUA 4MLDA 4J11A 5FTNA 4IUYA 2CHEA 4F2PA 4LYAA 5TE9A 4TV8A 1CUJA 4YDSA 4LEIA 1Z4PX 1OXVA 3V00A 3DCYA 4R1OA 2GZAA 3F6BX 3L0BA 1CQIA 3FY4A 2PU7A 1JAZA 2PXXA 3PQ5A 2VC2B 4QASA 4FZ3A 3PJGA 2O14A 1A7JA 3EC2A 3L7BA 5EUCA 5B4VA 2JG3A 2QKSA 1RVDA 5LQCA 4FBGA 5G3ZA 4F5DA 4NS4A 1GH6A 3PZRA 3KQPA 2ASVA 4UCVA 1FFSA 3KKOA 2PGAA 2YYYA 4X95A 5DM0A 1G21E 1NOJA 4ZOQI 1FSFA 5DYGA 2P9FA 4WZZA 1B76A 2PSSA 1XTPA 4IRMA 5HVNA 1R9GA 1PVVA 2W2OA 4W1SA 1H93A 4MRNA 4BLPA 4RTMA 4BVJA 2CDCA 1VOTA 1E61A 2Y1OA 2F8TA 3GEDA 3JSLA 1XLUA 3ZI7A 3T3NA 3D3QA 3J7AU 2DTXA 3W1VA 1XQ8A 1JIVA 4BQFA 1RBQA 1XL4A 4ER7A 2QIPA 1Q84A 4H0FA 5AJZA 3CKMA 1WOYA 3JQEA 3LUFA 4OHCA 1NU8A 4S2EA 2PTHA 3FDJA 1P3Y1 2VUUA 3U1BA 4X00A 2PD4A 4M49A 5E9JA 4JBIA 1V96A 5BZBA 1I2MA 2XT0A 2FPGA 3COYA 4N39A 3GVHA 1G38A 3N39C 1YH3A 2YICA 3K94A 4Q34A 5I7OA 2R9VA 5DIFA 1KEUA 3I76A 1VKZA 3IPLA 5F73A 3SSNA 4YB8A 1QGOA 3A0HZ 2BOCC 2RJNA 1YA6A 3PDJA 1OJLA 3TLBA 3E53A 3DHEA 3O73A 5EK0A 1IXRC 4TV8F 4OP3A 1EFVA 1M83A 1LZKA 4NCXA 1WUJS 4KSYA 4JBNA 1ID1A 1MV5A 1WXHA 4PHTA 1SVWA 2PSHA 3VYWA 4TL8A 4OJYA 1CP2A 1JYFA 2COUA 4KXXA 5CB6A 4U9IS 4UCFA 3TR6A 3P4UA 1NVPB 4FOSA 4B6GA 5CVDA 1N1MA 4C0QC 4BXOA 1HBJA 4DZTA 3G2LA 3M2TA 2EJUA 2XCUA 3IMKA 2PY6A 4L2IB 2BMVA 1HNWO 4MIYA 1HNXB 1N6PA 2OWEA 3UJPA 4G0NA 2Q0HA 4Y18A 3CRCA 4JXJA 4DHEA 1WRBA 3R6GA 3KE9A 2P1ZA 2GEDA 3OZFA 3I04A 5C93A 4MVCA 1L5YA 2E0IA 5EG5A 3L49A 3HUDA 3WOHA 3R6LA 1I51A 4IG9A 3WADA 3B2QA 5I8PA 1WA8A 3REFA 4F3KA 3FUTA 4O4HF 3RT3C 3I42A 1U5BA 1Z2DA 4JGGA 4L9WA 1XRNA 1MZFA 3MVEA 4LOLA 1V4NA 2X5XA 3GUZA 1FA9A 3OEHG 5KI6A 5GY7A 3WRYC 4DNPA 2R4QA 2XRYA 3CWQA 3HYNA 4B4UA 1Z3IX 3I34X 1ZVQA 2OOKA 1DKRA 3QFRA 3DR3A 3H75A 5DP1A 3SDLA 4WCFC 3UM9A 3G2OA 1GYQA 2P6UA 2X19A 4KEAA 4OHBA 3LUDA 3EIEA 1RPRA 3F2VA 3TEMA 2L18A 1XHFA 2PNFA 3E8GA 3AY3A 4R0NA 1LBIA 3D0OA 1I14A 3PGJA 3Q3EA 4DC1A 2Z2KA 3L5KA 5AUOB 2PX6A 5DGHA 2Q6IA 2ZJBA 4Z1OA 3QA3E 2FPMA 4LHXA 1ZHHA 1LA2A 3A9WA 4P7JA 1QHHB 2X0FA 5BN4B 1QG4A 2JCXA 4MVZA 5KNCD 1NVFA 4FJ2A 2XGJA 1EXDA 1UBEA 4KI0A 1KGDA 3LG2A 2OQ2A 4DYDA 4YJ2A 1PFWA 5LLDA 2R7LA 3WG7B 3MN1A 3VHXA 3KXDA 1F6WA 5F5NA 4FM0A 2NTVA 1SQSA 1AB6A 4JSYA 4MDFA 2KLHA 1GPJA 5I4BA 5CT8A 4CS4A 1KI6A 3VKVA 1EFAA 3I62A 4OPAA 4DR4O 1D0VA 3BGDA 2D8MA 4K88A 2P27A 3ZWVA 1SBCA 3BA9A 1O9BA 2RHJA 1VF5B 3DQZA 4D7AA 1UK7A 3ZOZA 3GZTB 5L3QB 2OAP1 1AKUA 3K7EA 2N74A 3TB6A 2FN4A 3L6EA 1JLLA 1WL8A 4MV4A 2QOEA 1X4TA 3SIRA 1JIJA 3QPCA 4IDFA 1SK8A 5EMHA 1P7CA 3DTVD 3AL2A 2FUG1 4J29A 3SLGA 5IZCC 4JJEA 5KPJA 2HRZA 1SCIA 4EIWA 4NECA 2Y66A 1NZDA 2YHBA 4BV2A 2DE0X 1I3MA 1Z74A 2HSDA 3JVUA 4F56A 3LNMB 4LF7B 2YH2A 1H2SB 3FVRA 4Z9AA 1J9GA 4ZMSA 3UPTA 5LHIA 2NO1A 1VYHA 2OZLB 3DV0B 2WP0A 5BWMA 3FSGA 3GJ6A 1ZK1A 4GECA 1PHRA 4LZWA 4UDXX 1OCZC 2EF1A 4P4UA 3P9RA 1P81A 1QFZA 3GWGA 3RS4A 4L4RA 3IH5A 4KU4A 2J0EA 2GAJA 3AG2C 4NFLA 5CVUA 4IOMA 3UENA 1X87A 4B4KA 2ZQYA 4K35A 1K66A 3OE7A 3W0LB 5B57C 5HUHA 1I2BA 1X1DA 2FMHA 2JGKA 2O8CA 1IN7A 2XCIA 3ZIAG 3L8EA 3DE6X 2AK2A 2BGKA 3EOBI 1IXSB 2F3UA 3KCQA 3OZXA 5K0BA 1EM8B 1J70A 1AUXA 1AG9A 5HG0A 3T35A 4B0OA 4F8YA 1FFXA 1S5JA 1C4OA 3FRJA 4RZXA 3ZCVA 2A30A 1NLYA 4DV5O 4G1EB 4C03A 4CV3A 2GHQA 1JT2A 1I3LA 3LL4A 3EFOB 4JXKA 3A9UA 4B85A 5JZBA 2GCNA 5IC4A 1NXOA 2O3SA 2V7EA 3NH6A 3VJLA 3MJDA 5KQRA 4MWSA 1JWLA 4J10A 1ZNXA 1UPAA 2QWOB 1U3TA 1FTGA 3VISA 4F5YA 1G20B 1JLSA 2O54A 3B3AA 3IQZA 1FP7A 4LHVA 1QCDA 4NAUA 2MU1A 2QZ4A 3MHPA 4X41A 1Q43A 3DXRB