3D3QA

Crystal structure of trna delta(2)-isopentenylpyrophosphate transferase (se0981) from staphylococcus epidermidis. northeast structural genomics consortium target ser100
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
307
Chain Sequence
KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tRNA delta(2)-isopentenylpyrophosphate transferase (SE0981) from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis atcc 12228
molecule tags Transferase
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
total genus 102
structure length 307
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 3d3qA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d3qA01
2CLSA 3A37A 3DOEA 4FN5A 4BLOA 4H1UA 4MGIR 3GPLA 4PPNA 5M04A 1IXRC 5J4HA 1NJGA 5K8TA 2DY1A 2WAXA 2XEXA 4A0RA 3EA0A 4FW9A 4TL8A 5KYKA 1JAIA 4Z51A 3BH0A 2ZJOA 2GBLC 3T5DA 4WXPA 1XD2A 3L2OB 3UANA 1OF1A 3N70A 4KVAA 3TAUA 3IHWA 2P6NA 1LV7A 3C7KA 4B6FA 2QMHA 4XWAA 2QN6A 1SHKA 2ZJYA 2XGJA 5KDLA 2GJ8A 2FOLA 1A2BA 5LB4A 1MT0A 2YV5A 3NDPA 4M4SA 1Z6YA 3CRRA 4R2HA 2XXAA 2GDJA 1SVMA 2ZSFA 1H65A 1ZMXA 1OKKD 5CDFA 2NO7A 2CE7A 4Q1EA 1KO4A 3WHKA 1OV4A 1D6JA 2WIBA 4QBFA 3PCRB 2BKUA 4DT1A 5GJVC 4YMTA 5IHPA 4UJ3A 1PJRA 1NKSA 2BIFA 2RGEA 3C5CA 4M1TA 1GRRA 3KDSE 4MYCA 4D4KA 1TPZA 4ZPXA 1SQ5A 3QF4A 5IK2A 3A1UA 1I4LD 3THWA 2ORWA 3IIKA 4RVCA 5L3SB 2A5FA 4AYXA 1VKJA 1G8YA 1FFHA 2UKDA 5CK5A 1Q44A 4AKHA 1CS4C 1AZTA 3KB1A 1XTIA 2ZRJA 1Q0UA 4I4LA 1WB9A 1OHHA 1A1VA 5E7JA 1S8FA 4Q4AB 3U6BA 3QUSA 4E03A 4AY2A 4MKHA 1M6NA 3DHWC 1Z28A 1XRJA 4J0QA 2JGNA 3F3YA 2WMNB 2ZRNA 4DLUA 1NIJA 1QF9A 4NCJA 3IHLA 5EP2A 4NP6A 1P9NA 4PXAA 4IKEA 4RSGA 5DIFA 121PA 3W8NA 1A4RA 5BWMA 3GJ7A 2QGZA 4B3XA 1TQ6A 3K8YA 3PJRA 4JLOA 1WP9A 4BRWA 2X8AA 2CJWB 1YR6A 1LS6A 3LQQA 3MJHA 1DG3A 1OIWA 2VSXA 4DLXA 5L3RA 2OAQ1 2ZVPX 1DAHA 2EYQA 4UXIA 3L0PA 2P6UA 1UJ2A 2FV8A 3WNDA 4BE7B 3ZD6A 4M1MA 1DOAA 3L82B 4NPHA 1X86B 1DTSA 2EFEB 3AVPA 3B9QA 4D0NA 2F1HA 5C1BA 3QF4B 1OH7A 2F43A 2RHMA 1XPRA 4KVGA 4LBYA 4EPWA 4TMKA 2ERYA 3PXGA 2FPLA 3AVOA 3ND9A 2AWNA 1G5RA 3B1VA 4YMSA 3PUZA 3R8FA 1VCIA 4JLJA 5EP3A 1XU4A 4E09A 4K81B 1UDXA 1F60A 2IYUA 4PSKA 2ZUDA 1AM4D 4KU4A 4QKQA 1JJ7A 4F92B 5TMPA 2FF7A 3DPUA 5FTLA 3FOZA 4FCWA 3G82C 1C4OA 4M2LA 4R2IA 4II7A 4BZQA 3U7HB 1E2QA 1U99A 5EZ6B 4OHVA 3GLFA 3C5HA 3M6AA 2ZANA 4NZYA 3BXZA 1VIYA 2P67A 4DDTA 1W36D 4IDHA 3SJAA 3BFXA 3R9XA 4HDQB 1TEXA 1I2DA 2UZ3A 4KITB 2WWFA 4Z1MA 2O8BB 3K09C 3ADKA 2AX4A 1G5TA 5JECA 1NLYA 1NN5A 3DKVA 4G1UC 3WYFA 1UBEA 1SZPA 2Q21A 1W7AA 1E0KA 3ADBA 2QTFA 3CPEA 2VEDA 5J4YA 2J46A 1H8ED 1NVVR 3QKRB 4HDOB 2A5JA 4IDOA 4PPFA 1L4UA 3UG6A 4ZI2A 1WDTA 3RWMB 2RB4A 4POAA 3IQXA 1E2LA 3SHFA 4RJLA 3T15A 4Z8YA 3OEEA 3GFOA 3B9PA 1S4QA 2JJ8A 2R62A 3A58B 1TEVA 5F9HA 3MCAA 2FDCA 5H8WA 4V0KA 4XWKA 5JLJA 3GMTA 4Z1MD 3T12A 2C5LA 1KO7A 5E4FA 1T3SA 1LF0A 3T1OA 3GLHA 4XJXA 3SJZA 1RZ3A 2HXSA 1P72A 2CJWA 3BE4A 2WZQA 4NBSA 4KYIB 1EWQA 2LKCA 3CPHA 4LK2A 2VP4A 5FOSA 2H1LA 2WMOB 1KI3A 1F2UA 3VR6A 2ZRAA 1RRGA 2O8EA 2QUZA 4TLCA 4B3CA 4BZPA 2Z43A 5AJVB 2BEKA 3VR2A 5KPJA 4AG6A 4TMWA 1IN8A 3W3ZB 1PLKA 3IGFA 2AD5A 1JBKA 1XB2A 2UVQA 1MO4A 2ZRGA 2ZYUX 3A36A 3GJ0A 4LV5B 3W3AA 2V55B 4MKIA 4BUJA 2ZRFA 4CDGA 5B64A 5DGXA 3B1XA 2QZ4A 1NY5A 3M4YA 1M34E 1SXJC 2GA8A 3WY9A 2ORIA 3PEYA 1E69A 3KJIA 3B1YA 3QBVA 1PUIA 2IYZA 4YXWA 4A2QA 1ZP6A 4M1YA 3BJIC 1QHHA 2IW3A 2ZJ5A 1S2MA 4RCZA 2C95A 1TQ4A 2CL0X 4V02A 4V0ME 2EWVA 2YC2C 2OFXA 2FSGA 1MABA 4LBWA 1YQTA 1E6CA 4HUQB 4DJTA 3O47A 4MRVA 4A0HA 1IY1A 4LZZA 2L0XA 2QRNA 1JB1A 2ZR7A 3GLFB 5DI9A 4DHEA 2BM0A 1D8TA 4ZCMA 3RS7A 4DDWA 3FVQA 2OE2A 4Q7JB 1RRFA 1G9XA 4HI0E 4DLWA 4DIEA 4D82A 2AK2A 5JCPA 1R0WA 2QMEA 4BPBA 1CJTC 1E1RD 1SGWA 1T91A 5LB2A 1VCOA 1JPJA 1OXTA 2GZDA 2MSDB 1QVRA 2ZXUA 2C9CA 2PLRA 1P3JA 1Q12A 1RFLA 4TL6A 3CUEF 2IYVA 3BBPA 3L0OA 2RCNA 1XTSA 5FPYA 4A9AA 2J0UA 1CJUC 1R5OA 3ETLA 2F9MA 1GSIA 3VNVA 3P20A 5DISB 3VNUA 4MRRA 3K1JA 3PUXA 1ZINA 1XXHE 2OBNA 5ANRB 3DMNA 1CLUA 3GLGA 4NU0A 5UKDA 4LJAA 4ZO4A 2JLUA 3CZQA 3R8CA 2IYTA 3OESA 2YOGA 2OV2A 5JI2E 3ASYA 4NE2A 4FCTA 1YE8A 4QFMA 2C9OA 2W6ID 1TF7A 2FZLA 2QT1A 4LJ8A 4U5XA 2PBRA 3R9IA 4OHYA 3D31A 1ZYUA 3C8UA 2OCBA 3B1ZA 2V8OA 1JXMA 1A7JA 2IWHA 4C0BA 4BFWA 2O8DA 1N6PA 1GM5A 2QENA 4PX9A 3AVQA 2FX3A 2B7BA 1LVGA 1ZCBA 4GP6A 4DLZA 1YHNA 5KNCA 1EFTA 4G5QA 1Q3TA 1FUKA 1HT2E 3AKCA 4HLUA 4IW3B 5EQTA 4TQ9A 4OHZA 1NLZA 3QXJA 3GLIB 2FGJA 1MOZA 4E07A 1IONA 2IHYA 4CT5A 2CCKA 2W58A 1KKLA 3QXHA 1FQKA 4ESHA 2W6IA 3NBYC 5TV2A 2W2VA 1Z47A 3BERA 4QJ3A 1L2TA 5AJXA 2WWXA 2BHRA 1MO5A 2K5UA 1LF5A 3GLGE 2JJ2A 3KXIA 3VKGA 4PZYA 1HY3A 4MDEA 5FUYA 3BWDD 4DUGD 1E2FA 2ZETA 1KK2A 2RAPA 5JEEA 1G3IA 2BMJA 3B78A 1KK0A 3LBHA 4DLSA 1IJEA 2CLDX 3W34A 3TJZA 4OJKA 4ZDIA 3GLGB 4ABYA 2WJJA 1XEXA 1K5GA 2OESA 3ZVRA 1JR3D 5DN6D 5KOYA 4B3DA 1N6HA 1MR3F 3AVWA 1Q21A 2QGNA 5L3QB 2W6JA 2GNOA 4R98A 2ZAOA 4NONA 3NVAA 4V03A 1FUUA 1KHTA 3FFAA 2D7CA 1N0WA 3EZ7A 2XNDA 1OPXA 4B73A 3VR3A 4RKFA 4A8JB 2ZR9A 1DELA 4B2PA 3GJ6A 3C4JA 2WSSD 4KJZA 1JQJC 4GRAA 2FWRA 3NBXX 2FSFA 1GP2A 1SXJB 1OJLA 1MRSA 3T06B 2GEVA 2GF9A 1IAQA 4JT2A 2ZYTX 4PPGA 4CF7A 3RS2A 4EDHA 5FOTA 3DKPA 2NOAA 3CR7A 1E9CA 1G41A 1QBKC 4ZDKA 3IPYA 5SZKB 4A92A 4M22A 3SZRA 1M7HA 1K8RA 2BJWA 1Z8FA 4HEJA 2IEZA 5TARA 3U6KA 4TT3A 3LLMA 2CXXA 3CWQA 1G4UR 3PUVA 4I1OA 2Q6TA 2Q3MA 4BWYA 2G9NA 1W5TA 5SZIA 4AWXA 1XD8A 1OXUA 1G7SA 1KMQA 3K0CA 1P5ZB 1U8YA 3TW8B 2AHOA 2IS1A 2O0HA 1VYTA 3QY0A 4OJQA 1QHXA 2GVDC 4O25A 1DO2A 2G1JA 1W4AA 3Q85A 2XSZD 2WM9B 4DZZA 2BC9A 2I1VB 3EZ6A 4B71A 3IPXA 3LXXA 1AIPA 1TF5A 2A3RA 5FL3A 3RLFA 1EWRA 1FL9A 3NIBA 2J0VA 5HPYB 3GLIE 3U3RA 3ASZA 3FHCB 3JZMA 4PSVA 2ZSAA 1HUQA 2BWJA 4M9XA 2CCJA 5A5GA 4GZLA 4RCYA 5L8VA 3GLIA 3AP3A 2VPPA 2HV8A 4P32A 1X8KA 4JLKA 2OEPA 4EFLA 3GLHB 3NKVA 3SDZA 2XTMA 3VR4A 3FMOB 2QQEA 2V1UA 3MWYW 4O2LA 3RS4A 2Y8EA 2XAUA 2CL7X 3CIOA 4UNQA 821PA 1DBSA 1FZQA 2FNAA 3DM9B 4RD3A 4YC7A 5JHGB 4FINA 2R6AA 3O8BA 4KV9A 1W4RA 2N46A 4BQSA 1NVVQ 1SVWA 3TUZC 1N0UA 2LWIA 3W5JA 5H70A 2ZU6A 3VQTA 1XJCA 3K9HA 4JL8A 2BCJQ 3U4QA 1J2JA 1XEXB 3IDQA 1RRPA 5FI1B 4B75A 2DWOA 3U44B 1IY0A 3EZ2A 3U2QA 1G7TA 1HTWA 4AURA 2IS4A 3DL0A 2JLSA 4MUBA 1OXSC 4Q4HB 2WAYA 3AM1A 2RGBA 4XVUA 1TF2A 2A7QA 5C2JB 4PQFA 2A5GA 4Q47A 3ZZ0A 5IRCD 4RY2A 1G291 1UBCA 4M0LA 2DFTA 2X77A 1NLFA 1U90A 2V4ZA 1SXJA 3QF7A 3RDPA 4XD7D 3WRYC 3CLVA 3EIEA 3ND8A 2VSFA 2KJQA 4YMUA 3TVDA 1P61B 1Z5ZA 1OH8A 3WMFA 3BFKA 3EWAA 4HUQA 3LLUA 4F4CA 1NP6A 1UKVY 1ZRHA 2QAGB 5HZKA 1IQPA 3F0TA 4QGHA 5F9FA 5DNYB 1MO3A 3OF5A 1FTNA 4CEJB 1GTVA 1E4VA 1T4GA 4FMDB 2F1RA 3CWZA 4Q21A 5FR1A 5GJCA 3TR5A 4F4IA 4IEEA 1YZLA 4DCSA 1P7CA 2YJTD 1KK3A 3FKQA 1EFUA 1Y63A 3QG1A 4KBGA 2IS6A 5EXTA 5KHOC 3AQ4A 3SE0A 1KI1A 5JJKA 1HEIA 1PUJA 4LJ9A 1TTTA 5JWHA 1EG7A 4IDNA 1SXJD 4BFVA 2Q9BA 1RVDA 3H4MA 4BEJA 3K0AB 3X1ZA 4P33A 4LCBA 1EX7A 1HT1E 5JMTA 3A1TA 3A6PC 3SR0A 2GJAA 2NTYC 1OXXK 4TMVA 2WJIA 4B74A 3PITA 4P4UA 1EFHA 4XTCS 5EE3A 4DKXA 3X1DA 4LHWA 1XFAA 2XB4A 1CR4A 1KAGA 1U0LA 2IYQA 5AUNB 3OIUA 2PMDA 3WYAA 2ODNA 4IJMA 2JLVA 3U3JA 3ADDA 3CNOA 2VP5A 3TSZA 4H1VA 4HB0A 5B57C 4OI0A 1S96A 2EWWA 3QIAA 3RHFA 1YR8A 3EZFA 4GSYA 4C9BA 4QBHA 3JVVA 2VSOA 2CEAA 3ECCA 3OFND 1XJ0A 2PJRA 2HF8A 3E2IA 5EE1A 3ZS9A 4XVRA 2QAGA 2YNMA 3EPJA 4M1KA 4LYFA 3UMRA 3IIMA 2HT1A 3J81k 2ZI6A 4NCKA 1GNRA 2P65A 2E87A 5F2EA 4CEJA 2HYIC 3DDCA 4JBXA 4TYPA 1Z63A 4AYTA 2VH5R 3PIRA 3T61A 3PV0A 1YVDA 2DFLA 3OIWA 4URUR 2BM1A 3RVBA 5GADl 2OLJA 3ZVMA 2AFHE 1XMJA 2A2ZA 3GJXC 3ZJYA 4KAXA 4B3BA 3NTUA 2DCUA 2ZUCA 1XCPA 5LBIA 2CHGA 2ZJBA 5JSZB 2OUKA 3QKRA 1J70A 3I72A 3ONWA 3O8RA 1FX0B 1XF9A 2ASEA 1I4DD 5FBWB 1AS3A 2NO0A 4GBMA 5BYJA 4B35A 4B3GA 3AF1A 4NCIA 1W48A 2C2HA 4DEXA 3QPVA 3PR1A 4DT1B 4FMCB 1OSNA 1CKEA 2J7KA 1NY6A 5JSZA 2R44A 3L8YA 3L0SA 4KLZA 3QI2A 2HLDD 1G8GA 5H68A 2WV9A 2MSCB 3HYRA 4C0LA 2H16A 2J5XA 1NSFA 1TMKA 3K0SA 1W0JD 3A1SA 4JLDA 5FL7A 4TMXA 1GRQA 4FWTA 3CW2A 3H0KA 4IOJA 2JJ1D 4JBWA 1OT3A 4XH9B 3ZLJA 1TQ2A 2PT7A 1A82A 1XPUA 2EFGA 4TYWA 1UDWA 2NMVA 1XMSA 4X8LA 4NL4H 2FFQA 4NYJR 1OFTA 5EE5B 1O87A 1ZCAA 3HR7A 2O5VA 5LD2C 4ZCLA 5K8UA 1VG9B 1T0JB 2QM7A 5EE9A 2P3SA 3ICEA 1MO6A 4EQ6A 1GOTA 2Z6VA 5FTNA 2JIZA 2PCJA 4RZUA 2FEOA 1XMIA 1QVAA 4HSEA 2P6RA 2O8DB 2ECKA 4B44A 3THXA 2ZE6A 2F6RA 3JZAA 4LPKA 1WMSA 4MGKR 2VHJA 1E2IA 4BFYA 1US8A 2GCOA 3CX8A 2HCJB 2WTUA 1S3SA 1VG1A 2AR7A 4JKIA 4MRNA 3AP2A 1UEIA 2ZR0A 2R2AA 1Z06A 2ORVA 1FW6A 1G3RA 2QPOA 5JJIA 1KDRA 3OE7A 3JVUA 5JHHB 4XVQA 1U98A 2VF7A 3IO3A 1A2KC 1TU3A 2OXCA 4EPXA 1F6BA 3WMEA 4A0FA 3AVYA 1E1RA 1Z6XA 3BORA 2VYFA 2IBMA 5G3YA 5TY0A 2CNWD 3HU1A 1N6RA 2OBLA 4LWZA 1ZUIA 1XZPA 3V9PA 3I8SA 2JIZD 2ZREA 3GEEA 4WZ6A 3KTAB 4L9WA 3TSWA 4K8OA 5EJEA 4ILEA 2ZRKA 3HU2A 2NO9A 1UKZA 3THWB 3LXRA 1H8HA 4Q18A 3C16C 4EPRA 4NYIR 4EPYA 1G7CA 3EASA 221PA 2RGCA 2A5YB 3OE7D 4HAUA 5E95A 5CLLA 2Q3FA 1HE8B 4L9SA 5DN6A 4N3NA 3I5XA 5AJYA 2WSMA 3WNBA 5CM8B 4AKIA 5J4KA 2WJHA 2J7PA 2W6JD 3QKUA 3RRZA 3FWYA 4D25A 2WICA 4LC0A 1KDTA 2FMXA 4D26A 2WOJA 2A30A 1DADA 3P4YA 2IYYA 3QXCA 1PZNA 2WKRA 1NI3A 3CKLA 1E2NA 1Z0JA 4GDFA 4N1AA 4DDVA 4QL3A 4V0NA 1OXVA 1CRPA 1NJFA 2Q3HA 2ZJZA 3QSYA 4TLAA 5KTYA 4LYJA 4HAWA 3EAQA 4FMDF 3ZZUA 5C46F 2QAGC 2ONJA 3K70D 3VKHA 3GQBA 3L8ZA 2OZEA 5G40A 2QL6A 5K8LA 2VF8A 2ZPTX 1WBDA 3FHTA 4RD0A 4M9ZA 4DLTA 1KOFA 2XZLA 1ZM2A 3EZ9A 1XTKA 3Q8XB 2X19A 1CULC 1G4AE 2O0JA 1OKKA 2CHVA 1KJYA 5D3QA 1W47A 3GJ4A 3B60A 4NH0A 4D4MA 3MWJA 5KDOA 3W8RA 2GCPA 2DWQA 3HDTA 5CIWA 1Z3IX 1G1MA 2VHTA 1VCNA 5KSZA 4JVSB 2GAOA 3P1JA 1M7BA 1N5KA 1OFUX 3B8HA 4C0JA 5LPNA 4DVGA 1XEWX 4JLPA 4BLQA 2GEUA 5D3MB 5A0FA 3VR1A 3SQWA 5EXXA 3CRMA 2ZRLA 1G20E 5IF9A 4UNNA 3KQKA 1M8PA 1R2QA 1YR7A 4MUAA 1OHHD 2FH5B 3H1TA 4BGDA 1S1CA 4P3YA 4UNSA 2JLYA 1M2OB 2YZ2A 4O2RA 4RFSA 4GFDA 1JR3A 3ADCA 2FFAA 2ZUBA 5TDHA 2DFKB 4ZI3A 4JYCA 4B76A 4ACBA 4C0KA 1IXZA 1EGAA 1U8ZA 5BN5A 2PT5A 3CONA 3TRFA 4PHFA 3VX3A 2ZS9A 3RWOA 1E2DA 4DCNA 5E3HA 1VMAA 2QNRA 3IILA 1JEDA 3QKTA 1QG2A 1T5LA 3K9LA 4D4LA 1G8FA 2OILA 3QPWA 3WRXC 2ZITA 1RKBA 2VO1A 3SNHA 4AD8A 5JS7A 3FMPB 1YZGA 5IDVA 1GRNA 2QMUA 3QNUA 5EE0A 1CU1A 2RKOA 4Q4JB 1W4BA 1E99A 4ACAA 4EJSA 4FMCF 1KYIA 2OAP1 4LPSA 4JIMA 1NN3A 2F1JA 1G3QA 3C15C 2DFNA 4IXNA 1OFHA 4B47A 4GPTA 1G6OA 1VIAA 4UKDA 2Q0HA 4OQLA 4C7OA 2BBTA 3AKYA 4JS0A 3A1WA 1Z2CA 2CVHA 4XTRA 1XTJA 1VCMA 3B13B 2P2LA 1ZIOA 2XSZA 3GLFE 4PPQA 2JLQA 2B8TA 4HZIA 4NCNA 4XWOA 3K0FA 5FPHA 3IEVA 1E9BA 3B5JA 5AUOB 5JRZA 5FUXA 2XOKA 3EPHA 1XDBA 3TW4A 1TU4A 1UEJA 1DAMA 4YQFA 3NHBA 4HYYA 4DCVA 4JT4A 2VHQA 4TYQA 1W44A 1XWIA 3TH5A 4ESVA 2MSEB 4E5UA 3FYHA 4KYUA 5CIQA 5AR1A 3QPUA 2H92A 4GMDA 4S2EA 2EFDB 2BMEA 4XSHA 1BYIA 1L8QA 2VA8A 1NL3A 1II9A 1KGDA 1M74A 2OXRA 4WW0A 3AH8A 5DI3B 3RNLA 1F2TA 2IYXA 3RSOA 3THYA 2C99A 1SKYE 3K0CC 2WWGA 1M7GA 2W83A 3WHLA 1U8AA 5C4MA 4WBSA 1GIAA 3T1VA 1B23P 4DLVA 2OHFA 1SVLA 1ZW6A 2QSYA 2HXYA 3FTQA 3IIJA 3FKSD 4F91B 1MABB 2IT1A 2QP9X 3N2EA 2FJUA 2HJVA 2IXEA 2PH1A 4YMVA 1XD2B 5JFGA 2WPDA 2RGGA 3QBTA 3I3SR 4OKSA 4HB2A 3KQLA 2AXPA 1E79D 3AKDA 3BC1A 1E2HA 3NH6A 1KIMA 5JCZA 1M1YE 1SVKA 1ZM9A 4MQBA 3TNFA 3BFVA 4I1SA 2ZE7A 3OFNA 5B2ZA 3U4QB 1CTQA 3AP1A 4KHZA 1CR2A 2ONKA 1HQYE 4AG5A 1BYUA 521PA 1GAJA 1KSJA 2VP0A 4HATA 5EXPA 3ZDQA 3U44A 1ZC4A 4RZXA 1YZNA 2FN4A 3FMIA 2V3CC 3CM0A 1KSHA 1KMHB 3SN6A 4LHVA 4W9MC 3UG7A 1FQJA 4LGMA 4G5OA 4MH0R 3CBQA 1GL9B 4KFRA 1FP7A 3AGPA 3KJHA 3LBNA 4HB3A 3SS8A 1T8TA 1YRBA 4D2IA 3FMFA 3K0AA 2KB0A 3S1AB 2G3YA 4TZ6A 4CEIB 1WCV1 4JLNA 2XX3A 1VHTA 1GZSA 1KO1A 3WXMA 3PQCA 4PFSA 4C0HA 1T3HA 3A8TA 1RJ9B 3IBYA 2OFWA 721PA 4EIWA 1N5LA 3WP0A 1EFRD 2XTNA 3ZYCA 3Q9LA 1U9IA 2D2FA 4Q1AA 1CP2A 1KO5A 4TN1A 4O3MA 5FOWA 1KNQA 4XIGS 3O8DA 4ZDWA 4AYWA 1WA5A 4C2UA 3U7GA 5FFMA 2ZAMA 3GJ5A 4ON9A 3EW9A 3NG1A 4IRUB 3Q7QA 3TQCA 1AKYA 1W0JA 3K09A 1E4YA 4MRSA 4Q9JA 1D9XA 4UNRA 4B32A 2QTHA 4F4JA 3LW8A 3NWJA 2FSIA 2XZOA 4R7ZA 3M1IA 4HLUC 1J90A 4QNRA 3AF4A 2BVNA 3TSOA 4D81A 2PEYA 2BBSA 3D6TB 4DBLC 1SVSA 4IVRA 4DEYA 3TLXA 4Q9HA 3I5YA 3THXB 2QSZA 1DAKA 3PVSA 2FEMA 1NSTA 1P2TA 4KFSA 4I1VA 1N6IA 2QQ0A 1JEEA 1GITA 1R0YA 3LDAA 4KO8A 2H7VA 2ZE5A 4OK6A 4NTZA 3VTKA 3BGWA 4Q7MB 2DYKA 1AJEA 3AEZA 2IK8A 3AVVA 1GILA 3CF0A 4WA7A 4RZ2A 1SHZA 1W5SA 1XTQA 2J45A 4ZIRA 2YHSA 2R8RA 3Q5EA 1NVXQ 3SJCA 2KBFA 1RE0A 2G1KA 1NRJB 1NVUQ 3CRW1 4TTPA 2IL1A 1KI2A 1ZBDA 2DWPA 3GCGA 1RPZA 1L7VC 1T6NA 4G5GA 2QRZA 1OYWA 4LOAA 3LW7A 2PEZA 4FI3C 2F55A 2D3WA 1Z29A 2KBEA 1WF3A 3MWLA 4DSTA 1NMYA 3B2EA 4A2WA 4TTQA 3HPRA 4WIAA 4JZKA 1CBUA 3UPUA 4QHYA 3T35A 3REFA 4YONB 4HAVA 1F3OA 2Q9AA 1II8A 2QP3A 3Q5DA 1F2UB 1GKIA 3NEYA 1X1RA 1I2MA 2MMCA 1C1YA 1AGRA 2WKPA 1E0AA 3SBDA 4B6EA 3W90A 4ARZA 5FL7D 2I1QA 4URXR 2O52A 3R7WA 3MMPA 2NG1A 2GTPA 2F7SA 1S3GA 2IUSA 3BS4A 2FZ4A 2GCNA 5C4GB 5JWOA 3G0HA 1NVWQ 4JLBA 2QE7A 4JLMA 5FBQB 5ELXA 4FCVA 3B6EA 2J7PD 2P5SA 1A5TA 2PLFA 5HR5A 1UBGA 1G17A 2G88A 3X1XA 4AIIA 2QBYA 1IN5A 3C14C 1YJ5A 2F3RA 5CLQA 3I61A 5FTKA 1ZNXA 1JPNA 3QXXA 2J87A 4BFSA 4Q66C 2VP9A 2GAAA 2W2XA 4MKGA 4I81A 4MRPA 4DUGA 1DAGA 1UM8A 3RS5A 1IN6A 2H18A 2J3EA 4QBGB 5SZJA 1PV4A 4B3FX 1KTVA 4JYBA 4ERNA 1D2EA 1G7RA 1E9EA 2AFIE 1HV8A 1X3SA 1OH6A 4A6XA 3KTAA 2HUPA 4URVR 4KBFA 2F1IA 2DPXA 1GFIA 1YZKA 3OIYA 1GG2A 2XNDD 2C03A 4HLQB 1ANKA 2ZVQX 3UWKA 1IXSB 4JSTA 1HA3A 4P4TA 1N5JA 3W5IA 2REBA 2W0MA 4UNPA 2XITA 2WSSA 4M53A 4QGAA 2GJ9A 4PAOA 1N6KA 2OT3B 1BH2A 1ZD9A 3QXSA 4PO1A 4UQOA 4LYAA 4KFUA 1HYQA 1N6NA 4KSCA 3KX2A 2J0QA 1IY2A 1W1WA 2J0UB 3OZXA 4LX0A 3TQFA 2BDTA 3BB1A 5AJZA 3TUJC 2GBLA 2GZHA 1FX0A 4TYYA 1E3MA 2V6JA 3R20A 4PC2A 2BEJA 1XD9A 1U9IC 1UFQA 1R0ZA 4UJ5A 1Z6AA 2FA9A 3P32A 4NYMR 4AK9A 3SYNA 2JA1A 2QT0A 2N42A 3I32A 1P6XA 3A4NA 4DB2A 4AKGA 1Q1BA 2GRJA 4XOIA 3NXSA 2IYRA 1SVIA 1OYYA 1Q20A 1S1MA 2ODBA 3PEUA 1TADA 3LFUA 4WOPA 3W9YA 3O8CA 5B58C 2O8CB 1Z0KA 4A8JA 1RYFA 2V9PA 1E2KA 3U7FB 3THYB 1DAEA 2KI5A 2QEQA 4Y0AA 4B33A 4E22A 4Q48A 3EX7C 4QRHA 3CR8A 4FXPA 4HAXA 5EUMA 5AWFC 3TUIC 1P4SA 1S9DA 1XX6A 3PEWA 3AB3A 3LRPA 3RC8A 4TLDA 5JS8A 3OHMA 4CIDA 2JDIA 5FI0B 1KI4A 1ZM4A 3P26A 1QG4A 2Z4RA 1NMZA 5FPTA 2XJ9A 2HF9A 2PJZA 2CK3D 3KUCA 1KJWA 3ZQ6A 3IEUA 4ASUD 3IBGA 4CEHB 3SBEA 3EIHA 3KQUA 2IWRA 3CF6R 2P5TB 3KJGA 4GP7A 2ODWA 3MWKA 4JLAA 4JL5A 4PC3A 4TLEA 4JLVA 3UMFA 4ZKEA 1PLJA 4IHQA 4GOKA 3TAHA 2BMFA 4W5WA 4A1FA 1T3LA 2OM2A 2FPKA 5BN3A 1RRCA 1FNNA 2QPTA 4TLBA 2HT6A 1DG1G 4LJ6A 4P4SA 3M0EA 2CDNA 2H5EA 4TSFA 5FBVB 1U81A 3L43A 1ZJ6A 1WXQA 4L15A 3SQXA 4C30A 3VU9B 2IF2A 2ZYWX 4QGGA 5EZ5A 3ZVLA 3TKLA 4EJSB 1UPTA 2FG5A 1T9HA 2CVFA 3LBIA 4DC9A 2V54A 2CK3A 4L16A 3CF2A 4N0DA 2KE5A 4P4SB 4ASUA 1TQDA 1XBTA 4GOJA 4M8NE 5SZHB 4JL6A 4URYR 4U00A 3B1WA 3DM5A 1VHLA 5GVSA 5CJ2A 1KI8A 2QU8A 4DB4A 1G8HA 4NMMA 3LV8A 3BK7A 4Y0VA 3UXMA 3VHXA 2YWHA 5JI3E 2GF0A 4NDZA 2D06A 4PHGA 5KPDA 4TSFD 3X1YA 1Q1QA 2GJSA 2AN9A 5JJLA 2ODEA 1DAIA 3FB4A 2WKQA 4IDPA 5C18A 5F98A 4PC1A 2R6CA 4DCTA 2R6FA 4DSUA 2ZI4A 2ZRMA 2GVZC 3MUFA 2PZEA 5G41A 2H57A 1CJKC 5J47A 2WPDD 3HPQA 1XEFA 4LSGA 2GHIA 3H86A 2JCSA 2CE2X 4FD2A 4MKFA 4ARZB 3SFVA 1E79A 2RGAA 2LCFA 2VHUA 3LX8A 3ICQB 3HR8A 4IOLA 4B48A 4FIDA 3KZ1E 5E7MA 1Z83A 2WJGA 2XTZA 2NQ2C 3GEHA 1VYUA 4EPTA 1VTKA 2BMDA 4G3XA 1E9RA 1ZVQA 1X6VA 3ZQJA 1Q1ZA 3NHAA 4Q00A 2OLKA 1PLLA 3H84A 3LAWA 2E9SA 5KNBA 1E0JA 2ZE8A 2XOKD 2GXQA 3EARA 4GZMA 2IUUA 3UK6A 2R9VA 3KKMA 5DE3A 2ANBA 1D2NA 2D74A 4W5HA 1T8UA 5EUQB 4QM7A 5L3QA 1GWNA 3I92A 1UAAA 2RH5A 4QJ4A 1VYVA 1EFCA 2LKDA 2VP6A 2Z0MA 1FOEB 4YDHB 4RD1A 3TR0A 1R7RA 3QE0A 2W2TA 2WWHA 1G64A 2G0NA 1T0HB 1R8SA 4EPVA 4TWZA 1CJMA 1AS0A 1AN0A 2H8KA 1GL7A 1E0SA 4NYIQ 1CF4A 1GL6A 3ZIAD 2WWIA 3RC3A 1JQLB 5GJBA 3HP1A 4TQUS 1UBFA 3LX5A 1ONBA 5GJWC 4C4PA 2J59A 3PEVA 4LC1A 4O0MA 3QKSA 1W2GA 2ZROA 4QNMA 3AUXA 3SI7A 3WBKA 1JNYA 3CNLA 1E98A 2C98A 1G5PA 4D4JA 3GP8A 1HQCA 5FBRB 3PENA 3VX4A 4EUNA 3WYGA 4PQRA 2A5DA 4BFUA 1K6MA 4LHXA 3UIEA 1KI7A 4PZLA 4IFEA 4LDJA 2AD1A 1VG8A 3MFYA 3EC2A 1TNDA 3ZGXA 3LNCA 3X1WA 2HDNB 3BIFA 1W36C 1FNMA 1QHNA 5J4VA 2A78A 3RRMA 4ZCIA 5KSYA 1R8QA 1E9AA 1DARA 3LO5A 2ZI5A 5TXGA 1Q1EA 2NO6A 3KQHA 1RYHA 1XJQA 3FE2A 3NBFA 5CITA 1DE0A 4LJ4A 1QZXA 3ZD7A 4QHTA 4CZ2A 4GI7A 3NC0C 1SKYB 2EW1A 1CR1A 2V6IA 3N2IA 1W4CA 2V7QA 3EC1A 3MSXA 3QVVA 2GKSA 1XXHA 3KFXA 4OYHA 5AK0A 5HZHA 2X1VA 3R9WA 5HTKA 5EP1A 1NBMD 3BAFA 1MH1A 1P60A 3OEHD 1YZTA 1OIVA 2X2EA 4NYMQ 2YYZA 3T1QA 1OIXA 4RZ3A 3AVUA 5HCIA 1EFRA 2FFBA 3EPKA 4US1R 1J8MF 3QEJA 3AF2A 4D0GA 3AVTA 4Q9IA 3RSLA 4M1SA 3LVQE 4L5BA 4N0EA 1R6BX 2WWWA 2BBWA 4OK5A 1RC8A 1R4AA 1S9HA 2VTKA 4U7DA 1JECA 2GXAA 1BIFA 1BS1A 1XEWY 2YVUA 2JLRA 2WHXA 2V1XA 3LD9A 2ZS8A 1Z0DA 2XXAB 3P27A 2IXFA 2IUTA 3DO6A 3V4RA 2B21A 1SXJE 4B2LA 2ZI7A 1ZNWA 1KI6A 2KSQA 1F2TB 2OFOA 2QE7D 4Q03A 2R6GA 4MA4A 1B0UA 3OEHA 1J7KA 4OQMA 1II0A 3GD7A 4Q5IA 1P73A 4PZZA 2YOHA 1ZUNB 2ZJ8A 1Z22A 2YKGA 4QJ5A 2WBLC 4D0LB 1C9KA 3I1FA 5DI3A 1AS2A 1ZD8A 4US2R 4PAMA 1E2EA 3ZZTA 2G77B 3LY5A 1GNQA 3LH5A 5KNDA 4DWJA 1TX4B 3Q72A 4MYHA 4A2PA 3MLEA 1PVOA 1P9RA 1LNZA 5B30A 1XCGB 1QHYA 3QKSB 3PFIA 4MITA 3QQ5A 3QJYA 1Z07A 4JKYA 4WZBE 5BW8A 1VDZA 4KI0A 1YR9A 5CYOA 2FPMA 5HE8A 2VBCA 3E1SA 3VFDA 1V43A 1G18A 1ZU4A 1FP6A 4Q1BA 3FGNA 3FFBA 1IJFA 1Y3AA 4WVFA 4DSOA 3KJEA 4B34A 1Z0IA 4S35A 4KODA 1N5IA 4D80A 2PZGA 4P31A 3NEJA 2OCAA 3WP1B 2WIAA 4TL9A 5KUTA 5FPKA 1AGPA 1NN0A 3TBKA 1F48A 4YDSA 2GESA 4URWR 3VMFA 3GLHE 2NPIA 1G3MA 2GILA 1EXMA 4U02A 4Q7LA 2ERXA 1K5DA 1LFDB 3SJBA 4W5JA 4PO8A 5HKKD 1XTRA 1KDOA 1DVRA 1LS1A 2FSHA 1TAGA 2EFHB 2VQSA 3LA6A 4L8GA 1QHSA 1JR6A 4Q19A 1P75A 4JVNA 1Q57A 4PO9A 2ANCA 1ETUA 2RGXA 3TGPA 4TMZA 3K53A 3LWNA 2IF0A 2ZTSA 2ZRDA 3AF3A 4QM6A 1QHHB 3UMSA 3SEAA 2Z83A 1DPFA 2HYDA 3VKWA 4OQXA 3K70C 1N2CE 1AQYA 3E5HA 1CJVC 4V0MA 3G5UA 2QROA 4PHHA 1LW7A 2GETA 3K0EA 4B2IA 1KJZA 4Q9KA 3W6NA 2EQBA 1D2MA 2ZQ5A 1BMFD 2WWYA 1II8B 2B7CA 3SFZA 1NG1A 3ZS8A 3PG5A 5EXSA 3QVUA 2XZPA 2IXGA 4WZAE 1R10A 5DH9A 3SYKA 1JXOA 1E1QA 3GFTA 3A4LA 3KKQA 1HE1C 1TUEA 2NIPA 1Z0AA 2QI9C 1E94E 5D3MA 4G5SA 4JVLA 4YXWD 4HAYA 4C0AC 4HB4A 4BECA 5LDDC 4OL0A 3RANA 1D5CA 2PZFA 4KSBA 1COWA 1UF9A 4H9GA 2AKYA 2JAQA 4QC2A 5JZVA 1BMFA 3THOA 3E70C 3D7MA 2PX3A 4BLSA 2IC5A 4L4UA 2RHDA 2DR3A 4D6PA 2XB2A 3CRQA 1MRNA 2AL7A 5G53C 2DB3A 1X8JA 4OK3A 3I62A 1FMLA 3GJ3A 2ATVA 2ZJ2A 1KK1A 4M21A 1XZQA 4RD6A 3OAAA 4CEHA 1I4TD 3RAPR 3F5FA 4MDFA 4C0QC 1ESNA 3Q7PA 3K0FB 2OSBA 2JEOA 621PA 1NN1A 5FOXA 5AUPB 4V0OA 3U3OA 4OI4A 1W46A 2ZJAA 1AK2A 1COWD 1US8B 2GCOB 2IYWA 2SHKA 4EFNA 5FPSA 2CL6X 4F93B 1YU9A 4RKEA 2J41A 4V0LA 2RGNA 3AV0B 2JDID 2KWIA 2W0SA 3SU8A 1OB2A 2GJKA 2PCLA 5GVRA 2O8FB 2VLIA 2A9KA 4C3ZA 4URZR 3BRWD 2WVJA 1G19A 4G01B 2I3BA 2QMOA 1P2SA 4Z8XA 4NCHA 1DAFA 4EKDA 1VPLA 4OI1A 2ZRIA 1J99A 3EWSA 2B6HA 4ZV4A 3OAAD 1UADA 1BOFA 1OW3B 2HJGA 3HJNA 4QGFA 4DLYA 1W0KA 2HCBA 1NG9A 3DVLA 2XNSA 3TE6A 1GDDA 2P0EA 5EP4A 3L0IB 1KY3A 1O3YA 3CZPA 4WAUA 5KSOA 4PR0A 5CYPA 1CR0A 1W36B 1P62B 4A8JC 3V00A 4CW7A 1Q3HA 1OH5A 1FTSA 1NF3A 1XPOA 5H1YA 1P2UA 3BB3A 3BH7A 3C41J 5FUVA 3AVXA 1ZC3A 421PA 3QEOA 2AXNA 2JLZA 2D7DA 2C04A 4LHYA 3MD0A 4BFXA 2X2FA 3TVTA 2N1BA 1W49A 3FKSA 4YLGA 3I8XA 2ZRCA 3CPJB 2REXB 1GVNB 1E9DA 2YINC 3DZDA 3R7WB 4LBVA 3RYTC 3KKOA 3HYTA 5TVKA 5K8IA 3QENA 2VHCA 4QXAA 1J8YF 1P9WA 1W0KD 3B82A 4RD4A 5DYGA 1KZGB 3MG9A 4DIDA 2G83A 3HU3A 4IVPA 2QY9A 5IK2D 3AUYA 1W2HA 1NMXA 1Z08A 4MYUA 2JJ2D 1N25A 2QORA 1P2VA 2GK7A 2ZSEA 3K9GA 2I4IA 4FMBB 4HZUA 2RMKA 1G6HA 1WQ1R 1DO0A 2GZAA 2OO7A 2GWHA 4G5RA 1ZNYA 3UWOA 2C96A 4GT1A 1RIFA 1IN7A 3HWSA 1HURA 3KB2A 3UATA 1UKYA 1TUIA 2REOA 1RW4A 4F7WA 1EESA 1NKTA 3REGA 4A0GA 1KY2A 1Z0FA 4A6PA 1G16A 3D8BA 4Q01A 4Q1DA 2GXSA 2YWGA 4TYNA 2E1RA 3SOPA 2RGDA 3KQNA 5BYKA 3NDBB 2OG2A 4P0TA 5DLQC 2BCGY 2G0TA 4KCGA 2ZYVX 3D3QA 2QPAA 5DYIA 5E7IA 2BJVA 3SYLA 1OE0A 4JVMA 5JBQA 4IDQA 5KDDA 2NGRA 4PC6A 2UZIR 4W7SA 4DSNA 5FH9A 4PTLA 2Q9CA 5KU1A 4LV6A 3AF0A 1NIPA 1G3UA 2JLXA 1QDEA 3NC1C 3P4XA 3TIFA 3WBJA 1CRQA 1FMJA 2ZIAA 4DCUA 1ELOA 4MYTA 4TT3D 1NBMA 3DZ8A 1WRBA 4ITRC 4Q1FA 5A4JA 3BD9A 2F9LA 5FOVA 3ZIAA 4JMPA 3T1TA 1RJ9A 4I99A 5JEDA 4PSAA 3AGQA 3GJ8A 4R71A 5FTMA 4LBZA 1ZU5A 2R6DA 2J0SA 3EXAA 1KMHA 3RRNA 1SULA 3CB4A 1AKEA 4ZKDA 1IOZA 1BKDR 4EJSC 2D62A 4KFTA 5HCNA 2WJVA 3MRSA 3B85A 4IVQA 1Z6TA 3CO5A 1KSFX 2BOVA 2ATXA 4Q4HA 4CVNA 5JWRA 4TZ0A 3I4LA 2R65A 4LI0A 4PC7A 1ODFA 2EU8A 5BN4A 1N0VC 4I1UA 3K9NA 4LJ7A 5JRJA 1LTQA 5J40A 2QA5A 1DS6A 4UXHA 3VHLB 4EQ6B 2WOOA 3SHWA 2PL3A 4HDCA 5DSZA 1VECA 4A82A 4BRUA 4CYMA 4CRWB 4TL7A 4BZXA 1KNXA 4NHOA 2D4HA 1IN4A 4OI2A 4HUTA 2O8BA 1AA9A 3IO5A 2HEIA 2V7QD 4BLTA 3WMGA 1ZM7A 4CT4B 4WXRA 1KI6B 2O8EB 3A1VA 1QRAA 2BV3A 2NZ8A 4LUCA 4US0R 3DOFA 2ZRPA 2ZU0C 2B92A 2QM8A 2PMKA 3QG5A 1LY1A 1KAOA 5CK4A 4GL2A 4AI6A 2XJ4A 1R5BA 2AKAB 2ZS7A 3KXKA 3U7EB 1ZNZA 3BOSA 1UKEA 4Z54A 3ZVNA 2ZI3A 5FUWA 2QAJA 2IEYA 2F43B 3MAAC 4HAZA 3F8TA 2QTVB 2CLCX 4QG7A 1MV5A 4Q4AA 4XD7A 4OHWA 5BQ5A 2IS2A 1E9FA 3T34A 1R5NA 2WJYA 1YZUA 3BH6A 3NBZC 3W6PA 4RD2A 4IOKA 4KLNA 5AUQA 4LYHA 5HKKA 4KXFB 5KO2A 2BKEA 3H2YA 1XXHB 1E2MA 3KXLA 3IUYA 4CGZA 2ZM5A 1CXZA 4FWIB 1U2RA 1SVOA 2YWEA 3RABA 1G8PA 1ZIPA 4C7OB 1NNEA 2NPFA 1AZSC 1IHUA 5J4LA 1KSGA 2C78A 4B43A 4Q9LA 2ZRHA 5DHAA 2TMKA 4YMWA 2Z4SA 4M1OA 3SC3A 3VR5A 1JJVA 4C0SA 1H8EA 4DDUA 1WE2A 3CX6A 4OBEA 2CBZA 2FU5C 3RS0A 4ZDJA 4G0NA 1Q22A 2DHRA 4LHZA 3S1AA 2IYLD 3PUWA 1E2GA 4QBIA 2FE4A 3DEFA 3OEED 2C77A 4M9SA 2O8FA 3EIQA 4IXMA 3U5ZB 3WNCA 1U0HC 1XNJA 4ZIRB 3CNNA 2BBOA 4AC9A 4BEBA 2ZI9A 1E2JA 1N6LA 4OQNA 2OBMA 1ZM3A 3GFPA 3BB4A 5BXQC 2VP2A 3OIVA 4LJ5A 3I73A 1T5IA 5P21A 3NH9A 1IBRA 3N5CA 4IEIA 4LV8B 1F5NA 2FFHA 1U94A 4NKRA 1KO8A 1WBBA 1OLOA 4HLDA 1X1SA 4BASA 4TTRA 2O0KA 1HH4A 2AWOA 1KKMA 4A15A 3VAAA 4LY6A 1E32A 1Z6GA 5CM9C 2C8VA 5J5CA 1E96A 4JBYA 4X8OA 1YKSA 1JR3E 3CX7A 3W6OA 3UKDA 3KKNA 3GEIA 4IFBA 1KDPA 1XMVA 4RFSB 2AK3A 2J1LA 2QP4A 3X2SA 1GKUB 1ZAKA 1QHIA 2GEDA 3FHOA 2IHBA 3KL4A 4M1WA 5DO9A 5CB8A 4PANA 1N6OA 2G6BA 2IA5A 3CRVA 2CHQA 2ZSBA 1JAHA 1LB1B 1XP8A 4X8HA 4F38A 3TMKA 5F3WB 2IX3A 2ZEJA 5HE9A 1QHGA 3K70B 4UXJA 2EVWX 4HZUB 2MMGA 3U3KA 4JJZA 3EPLA 2O8CA 4IOMA 2C9YA 4K46A 3TK1A 4PQYA 1CEEA 1ZD1A 1G21E 4QHSA 4TMTA 3CH4B 5AJWA 4BLRA 4OQFA 4Q02A 4PAQA 4CEIA 4EAQA 2HLDA 2NO1A 8OHMA 3CH5A 3MJRA 4BFTA 3FPAA 1OB5A 1V5WA 2J9RA 1DEKA 3VU9A 2CCGA 3V4FA 3MGCA 1XCMA 1U0JA 4Q4JA 1X8LA 3LQRA 6Q21A 1VG0B 4Q4LA 2JJ1A 5CJPA 4OHXA 2F3TA 2VRWA 1E1QD 3IQWA 2YC4C 4GNKA 3PUYA 4HLCA 3ZH9B 5IT5A 5TB5A 5L3VA 3U3MA 2Z5FA 1EX6A 3B7GA 1GUAA 1FPMA 3EA5A 3KKPA 4PHTA 4TQAA 3Q3JB 2YOFA 4X8MA 5DHFA 4MGZR 1R0XA 2IYSA 1TL7C 3KFVA 3EG5A 5CB6A 1JI0A 3LVRE 4C2TA 2JATA 4XSGA 1SKQA 2RGNC 1MKYA 2D2EA 3KUDA 3QOFA 1CIPA 1D9ZA 4R9UC 1NBME 3T5GA 4BLPA 2FGKA 2OCPA 4LJYA 4QOSA 5FOUA 1BO6A 4NYJQ 5FR2A 4M9QA 2CMKA 1JALA 1KZ7B 1L4YA 2H17A 1IM2A 4MGYR 1GKYA 5G3ZA 5CDFE 1GNPA 4DRZA 3RRYA 2PX0A 2NZJA 4JSYA 2CNWA 2ZRBA 2YWFA 2QBYB 4Q7KA 4RFVA 4DLRA 2GK6A 1OFIA 3RS3A 5KSPA 3U61B 5FBLB 2EYUA 4A4DA 1E2PA 1ESMA 1ZUHA 2GXUA 2ZSDA 4Q1CA 1YRAA 5LD2B 5FTJA 4AKEA 4GOXA 2JASA 4JJKA 2JLWA 2EFCB 4BFZA 1N3BA 2OCYC 1EK0A 2DBYA 1YZQA 2VIIA 3U60B 3DMDA 4EFMA 4DXAA 1E9SA 4A36A 1H8HD 1S0UA 2VL7A 3IKJA 4LRWA 2B8WA 1AQUA 3FDIA 3A4MA 4GMXA 3AKEA 1Z2AA 2QG6A 5L3SA 2W00A 1KI9A
chains in the Genus database with same CATH superfamily
4BKQA 3HM9A 4BLOA 3GPLA 2JBHA 2WD8A 4MGIR 3K04A 1ZG3A 4PPNA 5LMNB 3IXMA 4UEQA 3T7SA 5J4HA 5M04A 3PPXA 5K8TA 4Q20A 2WAXA 2P7TC 3JAWB 4O4IA 1QGZA 2QWXA 2XGOA 3IUSA 3LWDA 4EBBA 3TG8A 1GCOA 3EA0A 3NEPX 1Y8QB 1P5FA 3EGVA 3JQRA 1K4MA 5KYKA 3F8WA 4R8LA 3SXUA 5JZ9A 1PK9A 2FOXA 5B7NA 3TD6A 2FLWA 2ZJOA 7GPBA 1XMQO 4KBYA 1XD2A 3MGGA 1ESZA 4L07A 4KWHA 4QDJA 5AMXA 1T5OA 4J3NA 4JI5O 4Z9FA 4B6FA 3OEEG 4ONEA 4RGVA 4Z49A 4EMUA 1JSRA 3W5CA 2ZJYA 2Q28A 3FOFC 2GJ8A 1H93A 2FOLA 1U9CA 1A2BA 2QUBA 3WOHA 2O6LA 4AUEA 2ZJ3A 1P29A 5AKJA 1Z6YA 4OHPA 3CRRA 3G3EA 2XXAA 4Y2SA 1H65A 1KFCB 1QCYA 2EIHA 1ZMXA 5F5LA 1OKKD 2X0EA 3T3DA 5JY6A 3UGJA 5K3OA 4MKXA 4UCOA 1D4OA 4QBFA 5IHPA 3ZHUA 1NVGA 1NKSA 2BOCC 1PJRA 2JKYA 3GA5A 4MYCA 1C3OB 3KDSE 4ADSG 4YV7A 5K1ZA 4TXHA 4YHBA 4RHCA 4U3JB 2IZOA 1U2GC 4IIVA 3DE2X 3BAAA 1ZRSA 3LWZA 5ESRA 5EOVA 4G0ZA 2PGXA 3NWBA 4E94A 5L4NA 3BFPA 7REQA 5H3CA 1QF7A 3HVHA 4AYXA 3L4SO 3GQVA 1MP0A 2C59A 2FP4A 1BGWA 1IYZA 1FFHA 1XRLA 2UKDA 3I6QA 5CK5A 2VHWA 1JHQA 3DA8A 3HA5A 4J1SA 3SPGA 4F4LA 1KU9A 1SUPA 3MA0A 3IX7A 4JXJA 3V2HA 4DMMA 5IABA 4DUYB 4IHJB 2Q3EA 3LNTA 1FPQA 1GT91 5D8DA 1XRJA 4DHWA 4Z7OB 4DR5B 2X5OA 1QQAA 1DCMA 4KR0A 2EGUA 1E5XA 4KWCA 3SPJA 1K88A 1QF9A 3AWDA 4F06A 3IHLA 5DHSA 1O8CA 4PXAA 1A50B 5BWMA 3KCNA 1A4RA 3KYJB 4FEGA 2QWPB 4MVOA 1XXLA 1E3JA 4C4AA 4DC1A 4EFDA 1CQPA 1WP9A 5JH7A 2C4HA 2PYLA 2AGAA 4LH7A 1ZWLA 1XHZA 1DZ3A 4U7FA 1YR6A 16PKA 1ORWA 3RVQA 1Z5OA 1QBZA 2VSXA 1FLDA 4KGZA 1EFLA 4XJSA 3G2LA 4DLXA 1GQYA 1DAHA 1P1CA 3CNHA 5CT9A 4A8TA 5K3AA 4BS9A 2VF2A 3L0PA 1FDOA 3HJGA 3MJDA 5C7IO 3JTMA 4YAWA 4G2KA 3TNJA 2QSUA 2RMKB 1NVBA 3MRXA 4OM8A 3WA7A 1H1LB 4K6FA 4M1MA 2WUEA 1RJGA 2APJA 4X20B 1QE3A 3T9FA 2IELA 3TZQA 3A32A 5COQA 1C7RA 4B6OA 5BOSA 1FFGA 3N6VA 4B7KA 3BMQB 4RHTA 4Y18A 5DBFA 1TA9A 5EJ5A 4ZT6A 3N7AA 2GYUA 1MNGA 4BO1A 1OZAA 4N7MA 3PU6A 1D6SA 4HPJB 4IH9A 1IZ3A 4KVGA 4EPWA 5KNDH 2XNJA 4TMKA 5P8WA 4DNFA 3N39C 2Q1TA 3B1VA 3S2FA 4F2PA 1QGAA 4LZAA 1P7WA 2ZVJA 2IZZA 3PXUA 4JLJA 5EP3A 3WLJA 1QONA 3HB0A 1F60A 3LOQA 4J11A 4FM2A 1C9NA 1Z5GA 3PZRA 4KU4A 2G40A 3H97A 2FF7A 4KV7A 4F92B 1FCJA 4OYRA 3OM0A 4JI6B 4BMPB 4R8SA 3M4JA 4WPGA 3V8MA 4FCWA 3DSQA 1LI4A 3G82C 3GAFA 4KN9S 4M2LA 4QYIB 1CFJA 4II7A 1P45A 3PPVA 2DCMA 5ICCA 3TETA 3ZX5A 5IT9A 5JVDB 4U2DA 4YQZA 5JDIA 5IUJC 5IJXA 4XAQA 1M73E 3FB6C 1KF0A 3C7DB 1P5RA 2QSJA 2X8WA 3GLUA 3TLZA 1WCIB 4EG1A 3QZUA 4JB0A 3W04A 1TEXA 2ZBVA 4JY7A 5K8CA 5BT8A 4ZU6X 2WWFA 3NV9A 4BYMA 5B1IA 4WCEV 2O8BB 4XIFA 3ADKA 2AX4A 4MV9A 2LW7A 1U0OC 3F67A 1NLYA 2ODAA 3L6EA 3OCCA 1UBEA 4ZVNA 3WAJA 3CHYA 1JDNA 1QOQB 3W4KA 1PD3A 4MAAA 3QVXA 4J29A 2QTFA 1L4MA 2Q7HA 3CPEA 4TKZA 3C7AA 2J46A 4HVCA 3PCTA 1E6LA 1NVVR 3GAMA 1KOJA 3K9SA 1QGDA 2A5JA 3ZRXA 3OCWA 2HSDA 4PPFA 3AG2C 2E4ZA 1WDTA 5DYNA 5EPUA 3GJRA 2NU6B 1YCDA 4X61A 1K3UB 5HZGA 2VJLA 2ADMA 3SHFA 1JOYA 1UH5A 4X3CA 1P33A 1UJBA 1KOLA 1QLWA 2XE7A 1S4QA 1NI4B 3FZQA 4NTYA 3O8LA 4PZCA 4EGQA 2FDCA 3DE0X 3EZXA 3WLIA 3GGJA 3QV1A 5JLJA 2FN7A 3EXIB 3GMTA 1QH1A 2FP3A 5HA5A 3T3PB 2R8XA 2C5LA 4LVCA 1ND6A 4JC5A 5FR1A 4F85A 1KO7A 2XMDA 1S3FA 3T1OA 3MELA 1PW5A 2EGGA 2BONA 3GLHA 3O2QB 4I1RA 4Q3AA 1SNYA 2CJWA 3I2FA 4KDEA 2Q3LA 2Z95A 3S8MA 3KBBA 3WS7A 4U7NA 3C90A 4ZI7A 3FW1A 3I04M 4MPTA 4XFDA 2WMOB 3DOHA 2PVPA 1J2TA 1F2UA 4IVNA 4J4BA 3RTBA 3KKLA 5I4KA 1H1DA 4U1RA 4B3CA 1H2FA 4EB6B 2Z43A 2BEKA 4JQCA 4MULA 1DEOA 1LK0A 3H99A 4M0MA 3ZWKA 1QRSA 5LQJA 1PL8A 5J2UB 3IHTA 2AF3C 4GM0A 1BD4A 2HEGA 3BA8A 4ISBA 4TTAA 2OCDA 3GJZA 3PDCA 2AD5A 2ZRGA 3GJ0A 2UVQA 1BVUA 1E8NA 2CNLA 4QFBA 3RKUA 4EDFA 2HCFA 2V55B 3W3AA 1U9JA 4BUJA 4CDGA 5BWBA 1U0BB 4FIZA 1E5TA 1WQ3A 3PI6A 1YF2A 4F3YA 4DR1B 3M4YA 2AJLI 3BRCA 3B5EA 3G8BA 3RT9A 4NU5A 4J1NA 1UP4A 5IC4A 3WY9A 3HXPA 3VZRA 2ORIA 1U1DA 5KOHA 4DSZA 1K4DC 2CLKB 4UARA 2XMBA 4X1IA 2IYZA 1T9GS 3D4PA 1CQIA 4YXWA 3ZE0B 4AAYA 5EZYB 3LDUA 4M1YA 3EXG1 1LLQA 3OE1A 4J0CA 2ZUEA 3GWGA 4YRIA 3ASOC 5B3LA 2OM6A 4X9QA 1TQ4A 4H7KA 4QSHA 5AI8A 1Y3FE 1TKAA 2CL0X 1NT2B 4E4YA 2AJTA 3FGPA 1NR7A 1H2AS 2XF8A 3SLRA 1A9QA 1K68A 5A02A 3O73A 3WQHA 4LBWA 1NWHA 3AHGA 3A3PA 3GVXA 3V1LA 2E74B 1TXGA 3VR3A 4LZZA 5FXMA 1JB1A 2EJCA 2YZNA 4DHEA 3STVA 5H80A 2NUBA 2NXWA 3MAJA 2DVMA 4DDWA 4D8WA 1LLFA 1U5BB 3JQBC 3FVQA 3GYBA 3NXKA 4Q7JB 1I3CA 3UENA 3KAJA 4DIEA 5JSFA 2OYRA 2QMEA 1I8TA 1T91A 4RL6A 1AB6A 2QW1A 3H04A 1JPJA 1TO6A 3ND6A 4TTVA 5JCJA 4QT4A 2HJSA 5FFNA 3MINA 4DQKA 5JAHA 1Z68A 1XKTA 2PGLA 3H3FA 1M6HA 4IGFA 5E6RA 1CUCA 3WR5A 3X1MA 2C7QA 3IH5A 5ALPA 2VWGA 3FOBA 4CMBA 1YB7A 3CUEF 3DE6X 3ZGVA 2P8SA 1EFRG 4R3NA 5EL0A 5EXDA 4RULA 3BBPA 4OX9O 4WY8A 2LR0A 2P6OA 3UAYA 2Z56A 4C76A 3JWIA 1COWG 4M49A 5DISB 3VNUA 5KMGA 1WB6A 2YZMA 3F6BX 2W0XA 4NNJA 2WTEA 3ZJUA 1YAJA 5LZ2A 1GNTA 1XXHE 3EXFA 4UPDA 1N3IA 1P91A 1CLUA 5FEMA 3UQZA 2QGFA 1JHPA 4Z86A 4XSVA 1CUYA 3ZU5A 5LBTA 4B6QA 4L5YA 4PZ0A 1IPHA 4FB5A 1LC3A 3WB1A 4ZK2A 3ZHTA 2ORYA 2IYTA 4AJ9A 1HW7A 2YOGA 4B87A 4PZAA 2X6RA 2FWMX 5JAOA 1Y4ZA 3KK0A 3OEWA 4FCTA 2WY2D 4BNUA 3U9TA 3DVAA 4W4TA 5CLGA 2N3ZA 1KYOF 2C9OA 1TF7A 3SJCC 2YWXA 3NUQA 4L0QA 1R18A 2GERA 2GD1O 2GFHA 1CUFA 3I28A 3C8UA 3OT5A 1KAQA 4LC9A 4ZO7A 4GMKA 3K5LA 4Z1OA 3ZMVA 1FD9A 2V8OA 2XNHA 3GXOA 1VIBA 3U1BA 1GEGA 3M1AA 5LOVB 2DWUA 2O3UA 4RVNA 2A0LA 3Q6IA 4P92A 3RG2A 4ML3A 3D6HA 5E2BA 5BSFA 1S8NA 2P22C 2XAHA 2JLCA 3OTQA 4G1CA 2B1QA 4I6GA 1GG5A 4HQKA 1V37A 1XRQA 1R1BA 1W8DA 2B7BA 3IV9A 5IFLA 2PGAA 4P8RA 4RAOA 3TNYA 4WXEA 5H3HA 2X2OA 3OHSX 2VZEA 4G5QA 1HT2E 4HLUA 2F67A 2X0JA 4MW1A 5EQTA 4DJDC 1NLZA 3BHIA 2MU1A 4XGNA 3FHLA 1MOZA 1RTTA 4HGOA 4ZK6A 3I55V 3N8HA 1QQCA 1U3CA 1ZRNA 2PKQP 3ICXA 5FULA 1SC1A 1MFPA 1QYDA 3ZRSA 2W6IA 3NBYC 4LISA 1ITZA 1L5OA 4I2NA 5TV2A 4H44B 1VZ3A 3QEMA 3EJ6A 1Z47A 1RBZA 3BERA 2BI7A 2Q2VA 2WWXA 2BHRA 1MO5A 4QXOA 5KX5A 2YW2A 3VKGA 1HY3A 4G9GA 2G9UA 1PZHA 4J4TA 4MDEA 1E1RG 1FSGA 4MVCA 4LGYA 5JTTA 5C8YB 1Q1AA 1YMVA 5IBPA 2Z2ZA 1BKYA 4INJA 3E8HA 1AUPA 2WF5A 3ETJA 3OWHA 4R2WA 4MB6A 4QPKA 3DDHA 5KOJB 4BKPA 5HQ3B 3TSAA 5DXJA 3WNZA 2GN4A 3GIDA 3M7IA 4X54A 5FJIA 2VNIA 1MR3F 1V11B 4RL4A 3A1NA 5IY5B 1DHTA 1C3OA 4P80A 2ZAOA 4V03A 3NVAA 2AYXA 1FUUA 3RLIA 1DLIA 5DCLA 1KHTA 3FFAA 2D7CA 3IT1A 4OYLA 3TRDA 3UMYA 3CU5A 3F74A 3VZDA 4BL5A 3WJ1A 1K06A 2X0KA 2JRLA 3EMBA 1P0IA 2MT9A 1QFYA 3GJ6A 1G6UA 3AV3A 3JQAA 4OA8A 5EHXA 2EF1A 5A7HA 1JQJC 3AFGA 4I5DA 3MF4A 4HFMA 1GP2A 1VLHA 1TJNA 3RVMA 1SXJB 1OJLA 1W96A 4L0MA 2XDQB 3WKAA 3QYFA 4D9IA 2GEVA 1Y8RA 2O2DA 5DOVA 1UJNA 3P5BA 1N8NA 4FONA 5DLDA 2RBEA 1PG0A 4NU6A 3IKVA 3DBOB 1JE0A 1GAXA 3RS2A 5IJ9B 1OR8A 1Z0ZA 2CDCA 2XD4A 4P4GA 1IXKA 4EDHA 4PYLA 3ZWAA 3KJXA 1E9CA 1H6CA 5LQRA 3IPCA 3VDRA 4MO2A 1L5MA 4LNUA 1M7HA 2I1LA 3AERB 4NOLA 5FO0A 1TTQB 5EN4A 3SK0A 1P4GA 3AK1A 4YQEA 3I5AA 3L7MA 4K6OA 2YTZA 4TKMA 3K1ZA 3U6KA 4TT3A 1U6JA 2H0AA 3EUWA 3EVGA 1I0IA 1TUGA 1GHTA 3GNSA 2Z8YM 1G4UR 4RZSA 3PP8A 3C3XA 3ETCA 3NBMA 4S12A 5KTPA 1Z6PA 1IDN1 2SCUB 1W5TA 5SZIA 1DDIA 2I62A 5FADA 1I4WA 1OXUA 4EJ6A 1E1MA 2XWBF 4HDNA 3K0CA 5CXXA 5FWAA 3ED5A 1J06A 3SIWA 4HNUA 2AHOA 1VYTA 3OFKA 4NI5A 4OJQA 4L7QA 4ZPJA 1QHXA 5H0IA 4DYDA 1W4AA 1B4DA 3CNBA 4D3XA 1AHPA 3CLSC 1XEQA 3EZ6A 3K35A 5LUBA 2EX1A 5AVYA 4JJ7A 4L5BA 4GOMD 3A7EA 1DFHA 2O9JA 3TLEA 4EUHA 4YAKA 1HYBA 3FHCB 4BNJA 3O84A 1JG7A 3G1WA 1QO7A 1V96A 2GRAA 1X7XB 2HKOA 3GLIA 1JDPA 1YASA 4WI1A 2HV8A 5BOVA 4LE1A 3DZFA 3GOQA 1MMMA 2GFIA 2OMEA 3GLHB 4HWSA 3SMVA 4EFLA 3GCWA 1V16B 1JU3A 2PGIA 3VR4A 2XTMA 5IP5A 2EGHA 4WA8A 3EEOA 2QQEA 4LVUA 2AX3A 2V1UA 1ZW1A 1XTTA 1TM3E 3OT4A 5EIOA 1CY4A 1K8ZB 4PLWA 4XM1A 1L0NH 1PN3A 2XD9A 1VF7A 1EWVA 4RH3A 3EOAI 3C3PA 2IJJA 4ZBMA 3QA9A 4EX7A 2Y69B 4C21A 1ZLZA 2FUEA 4JP2A 3N27A 1N0UA 1YMUA 2WIGA 4RKRA 4E30A 1A9XA 4H13B 5A9SA 3CIFA 5JNLA 3ZTYA 2NVWA 1QB7A 1BC5A 1RYYA 1QCZA 1DAOA 1XJCA 3FLAA 4HH3C 3ABOB 5CB0A 1Y1QA 2DOKA 2QG9A 1SK8A 3IDQA 2FDXA 1RRPA 3LT2A 4C6SA 5KREA 3SGIA 2DWOA 5JXIA 4GYWA 1BWPA 4N5LA 1Z56C 1FU8A 3LWBA 3DJFA 3W9SA 5EE9A 3HVUA 3HE3A 3FTEA 4MUBA 1EP1B 3FZEA 4MINA 4LF7O 4AW9A 2G09A 3AM1A 3PN1A 4ABMA 3TDNA 1ZUD1 5C8DA 4UE2A 3MERA 3N8GA 2GEBA 1RQPA 4Q47A 3ZZ0A 5IRCD 4MAFA 1N2CA 4JOQA 4M0LA 2PNFA 4DIKA 4H6XA 6ADHA 2X77A 4XD2A 4MMZB 2HWWA 1D1SA 4G1FA 2R7NA 4QPCA 5IJWA 2V4ZA 1AN9A 1KKUA 4NG4A 4D43A 2RKWA 2ZB4A 1UK9A 1XMQB 2ECFA 3CLVA 2R3SA 5TISZ 3LC2O 3CT4A 2ZJFA 4YMUA 3TVDA 4QULA 5KQLA 2PGGA 1JU9A 1S2LA 1ZMRA 2JS5A 1LBEA 1QQTA 5EWMA 3WMFA 4OLAA 5DBGA 3PX7A 3P9NA 4V0RA 3MRTA 4IHJF 2BMAA 5HZKA 1HNWB 2OPHA 3REQA 4O4IB 5F9FA 4IDBA 3VH2A 1MO3A 1U97A 4EHNA 1B3BA 1PHPA 4UREA 1JLLB 4YP0A 1E4VA 1T4GA 2FPPA 4PG5A 3PGLA 4Q21A 3LC1O 4ZAXA 3HACA 3IJ5A 3TR5A 3PQFA 1S2GA 1YZLA 2HNAA 4Y9TA 5JSQA 1W59A 1G5QA 2YJTD 1U2ZA 2YY7A 4ZMSA 5L53A 1Y63A 2VPIA 3LY9A 4N01A 4KBGA 5E0OA 5AW6A 2YXEA 2PUTA 4EECA 4BCCA 5J63A 3K9AA 2R1TB 3GARA 4RH1A 1TTTA 1UP6A 3K0BA 4IDNA 1ZD3A 1JZQA 2IDMA 3ZXIA 3PDUA 4BDTA 3H4MA 4RIFA 4BEJA 3KTOA 4DOMA 3K0AB 1YL5A 1EDBA 4P33A 4U39A 5JMTA 2OO3A 3H13A 3Q7RA 1D4FA 5CG1A 3ESQA 2Y71A 4XE5A 2VDQB 1G0OA 2GARA 5IXYA 4ZHQB 2HWKA 4LRTB 4YY3B 1QUFA 1UT6A 4LS3A 4YR9A 4KREA 3S40A 3AF6A 2OVBA 3FPKA 3PITA 1EFHA 3H5OA 4HDNB 4J7UA 3PNBA 4UEOA 5EE3A 3H8SA 1KBZA 4A26A 3L7KA 2XB4A 4RJTA 2IYQA 3ZHXA 3RU3A 5KTSA 1XRSB 1F0YA 1NQAO 3ABIA 5TVGA 2JLVA 3R3VA 1IOWA 3I76A 3TSZA 2JK5C 4BGUA 2GEJA 1RPOA 1JZSA 2J33A 1PW7A 2XA2A 3OIDA 3G80A 2EWWA 4GGPA 3DP9A 1HL3A 3UAVA 2L69A 4QBHA 3JVVA 5KTOA 3ECCA 3QHPA 3PT9A 3EB9A 4YJKA 3PQ8A 4LYFA 3UMRA 4AZ0B 4YT4A 3RYCB 2HT1A 1CEYA 4NCKA 1GNRA 4EM6A 5BN1A 5ALXA 3HNPA 4F4DA 5TQ2B 1I5EA 1OX4B 5ESDA 1TMGE 1AK1A 4P58A 5DRTA 2VH5R 3V48A 1KE1A 3PGMA 2AMFA 3PDIB 5HW0A 1EX1A 1A8SA 2DFLA 5C0OE 5IDQA 4PF1A 1E6WA 3I9V6 3ET4A 4RVUA 4TS3A 3W1VA 5GADl 4DR2B 2D5CA 2OLJA 3GZNA 3PXAA 5CCXA 1L4BA 2E2WA 1XMJA 1U5BA 2QTMA 4MI6A 4WN3A 3YASA 1FLNA 1N2SA 2I2XB 3DLBA 2W6CX 4E2ZA 1FFYA 3HV2A 3DE4X 5LBIA 1BXGB 1XYGA 2ZJBA 2HQOA 5KA5A 1EHCA 1U3WA 2ID9A 3I72A 3O4GA 3ONWA 1A5ZA 2OORC 4TZKA 5HK8A 1DL5A 3BF8A 1ZK4A 2H65A 1AS3A 4GBMA 5JCJD 4UMDA 2E3CA 2AYZA 2PRJA 3DAPA 3SC4A 4NCIA 4B6PA 5TJHA 4HT3B 4K28A 5CDHA 3BMNA 1F4MA 1KU0A 4P2GA 5H83A 1EGQA 4FX5A 4R5MA 4HNAA 4YRDA 1QC5B 3DXFA 1IBKO 5H9CA 1AP6A 2GCEA 1RWPA 3T9CA 2R44A 3I37X 4KLZA 3QI2A 4PRKA 3K5WA 2HLDD 4QUAA 4O1IA 4P3XA 5AVSA 1L5FA 2BDUA 3HYRA 4C0LA 2H16A 2C9DA 1RAIA 3KOUA 3E9ZA 1N78A 1Z12A 4KX5A 1V4NA 3A1SA 4JLDA 2C31A 1Y8ZA 4TMXA 1ZVVA 1M33A 3H0KA 4LWQA 3ZJ5A 4IOJA 1BROA 3D3WA 2QM0A 5ADHA 1OT3A 1E1DA 3B3FA 2YSUB 3RN4A 1Y5NA 1UDWA 1GY8A 3K1AB 1E1CA 1XMSA 3DPSA 2XDQA 2E75B 3A0RB 5EE5B 1LUWA 4DK1A 1EQAA 1O87A 2D3TA 2RAUA 3BGIA 3K5HA 4TZTA 2BGJA 4TWAA 3WQRA 4AS2A 3Q9NA 1MPXA 5FV7A 3R6DA 4ZCLA 4DYHA 1Z15A 5DHPA 5IN5A 3RQSA 2TMGA 2RD2A 3ICEA 4ZT7A 1NLUA 1RAHA 4AXBA 5JV5A 1WSDA 4HSEA 2P6RA 5ITZB 2O2JA 3THXA 5CDGA 1UPUA 2F6RA 3JZAA 2KQUA 4K9DA 1K6EA 1MC1A 2NVUB 5KTTA 1H9CA 3BQ9A 3NIWA 1NMQA 2EINC 1CRZA 3R44A 3UAOA 4S04A 2FWPA 4MRNA 3AP2A 1GYRA 5DBHX 3UAGA 1Z06A 2ORVA 2V6BA 3VBEA 1CYEA 4PPGA 2QPOA 1FW6A 3CW8X 1KDRA 2XUFA 3HN7A 3DBLA 3JVUA 5JHHB 4JI8B 3CJHB 1FTYA 1UOOA 3PFFA 1A2KC 2HSGA 4OBWA 4IM7A 4S24A 3U19A 2I6QA 4A0FA 3WFVA 2HMVA 3C6QA 2I2AA 1UFVA 3L1JA 2V5VA 3DEAA 1CS0B 3SS7X 3TKAA 5C5EA 3I6YA 4J43A 1F0PA 3AUTA 4MA5A 1RABA 5LGUA 1RADA 4LWZA 1UAYA 4J3FA 3TLBA 2QOEA 1W6RA 4TGLA 3V9PA 4CPDA 4PQEA 1GLGA 1UZNA 2AZ4A 1CC1S 2JIZD 1T9ZA 3BYZA 3KTAB 6REQB 3DR3A 3AG4C 1I1QB 3KEGA 1DJLA 4L9WA 4MARA 4TV8A 1RACA 2WLIA 2H2IA 4PFKA 5AM5A 3RKSA 3E61A 4XWTA 4ERXA 1GPMA 1UKZA 1RI5A 2VXOA 2ZSIA 5EPEA 5J2TF 1VLVA 1XSEA 3QU2A 1MHPA 4RX1A 1W5AA 1MX5A 2DWCA 2DQSA 2PVCA 1J0XO 3DZCA 221PA 3KSZO 4E5KA 4YRGA 4KHPB 1M2VB 2RGCA 3G9XA 3LKZA 2JHFA 3IV7A 5CRIA 2HMUA 4HAUA 3ZXUB 1L5NA 1UBSB 3OUUA 1JG4A 1MX3A 2ZCJA 4L9SA 5DN6A 3I5XA 5AJYA 1NYQA 3WNBA 4LJRA 3C2QA 3ODGA 5J4KA 2WJHA 4DR1O 4AO7A 2Q5LA 3E2MA 4RQEA 3FCSB 3LYLA 3OWOA 3GUUA 1NUPA 2FMXA 1O6ZA 1QOZA 4IY1A 4IIUA 4WKPA 4UVIA 4MVUA 1E2NA 4NULA 4N1AA 3HK2A 3G9ZA 1RMTA 2VATA 4H6PA 5EKXA 2EP8A 3B3QA 3ICVA 4CMCA 3VYWA 1AVMA 1MW8X 1LPBB 5K99A 3L5OA 1WJGA 3FM9A 3H0CA 4YNBA 3RSGA 6YASA 3QSYA 4Z1VA 1NDQA 4QYSA 3IVRA 1D1PA 5HJ2A 3ETHA 4BMYA 3OKPA 4RUFA 1PJ8A 2QAGC 1MIOB 4OXRA 1ZD4A 5I9TA 1IB6A 3K70D 3GQBA 3L8ZA 2OZEA 5G40A 2QL6A 3AJ9A 3DBHA 4GX2A 5L40A 1WPXA 1YWGO 1KOFA 5TJ9A 4PICA 3RVOA 1Q95A 3EZ9A 4PHCA 4HXEB 5JBNA 1SRRA 1CULC 4YJ2A 4MIOA 4KQ2A 3UMCA 1OKKA 3UJAA 1K63A 1EK6A 3FYTA 3KZXA 2OAGA 3X1JA 5CBGA 3H1EA 4F5WA 2FQYA 3EFBA 2GCPA 3T4PA 3FI0A 1CWUA 3J7AC 4BB0A 2UYOA 1VM6A 3RH0A 2GN6A 4NK4A 5DM2A 1GM8A 5KVQA 2R1VA 3LHIA 1YH3A 3B8HA 4DQUA 4EJ0A 2HHAA 1BA2A 4ZHSA 4JLPA 2UYHA 2JARA 3PC2A 2GEUA 3AYZB 4GZRB 5EXXA 3H5VA 5JWPA 2ZRLA 3AONB 1XA0A 2UYQA 3INTA 3N59A 4LNHA 4UNNA 4EZBA 5K09A 1I5OA 4DMHA 3ORFA 2HADA 1NBWB 4ID3A 5CNJA 3H75A 3ZEIA 1HT3A 3VPBA 4CN8A 3WMWA 2DQ3A 4NWIA 1ZS9A 3A6KA 4CR6A 3UGQA 5C53B 2CUKA 3DE5X 2EJVA 4YCLA 2Q8VA 1H2XA 2H4YA 2ZUBA 5TDHA 4I9WA 3FNIA 1ZJZA 4IZHA 4RF5A 3RK0A 4B76A 3M34A 1AD2A 3ZWDA 5FA8A 4BE4A 3FRIA 1SOWA 5CA1F 5ITWA 5MF6A 2PT5A 5ADWA 3I8OA 4PHFA 1RP3B 1EGHA 1K8XB 2FPOA 2XYPA 3D5EA 2CB0A 5CA1B 4U0JA 2WQ6A 4Y9RA 3WLNA 1XGKA 1UJ6A 1XMOB 4RYLA 3RWOA 5C51B 2X8LA 1QPGA 1BXGA 4J2TA 1AG9A 4ZO9A 2QZJA 4KRGA 2ZIMA 1VMAA 1DP4A 5T67A 2N75A 3VNAA 2VK4A 3WK9A 4KDFA 4YDQA 1LCIA 3IDAA 2UUCB 1JEDA 2JHCA 3WDMA 3GB7C 3JQGA 2Z8XA 1QZTA 5DDIP 1VL2A 4D4LA 2W6ZA 4JU8A 5A2QA 1K7EB 5JS1A 3JPWA 2Y4OA 2ZITA 1I5RA 5GZ1A 4OU4A 1JQ3A 5JQGB 1FJXA 3A4YA 1IEVA 1DNPA 3HUFA 3V32A 5C5CA 1A04A 2WM8A 1TLLA 4OG2A 3AFHA 4S0XA 1QVZA 3G8AA 2DXIA 4Q4JB 4O2AA 1IOVA 1EQ2A 1E99A 1PBTA 2X58A 1ZMTA 3DTVD 3HXLA 4QPNA 4RJIA 5EUCA 2H8GA 4ACAA 3U3XA 3TS1A 1UOPA 4OPHA 1S7CA 1CNMA 3ABMC 3V80A 4W1SA 4RIHA 4JDUA 1K5SA 5KC9A 3U56A 2W2OA 3C1UA 2DFNA 4FGZA 1OFHA 1NHGA 2DN9A 1MZEA 2NVOA 3WKEA 4O02B 4QUGA 1UDRA 1CNFA 2VDOB 1QYIA 1ZICA 1VIAA 2FWBA 1V6AA 2OGWA 4GRIA 4FZVA 5CUQA 3TIXB 4D3FA 4U2GA 2BBTA 4QYWA 2WUVA 4DAOA 4EHLA 4JFAA 1XIVA 1USIA 2AOUB 2EJBA 4RKWA 1XTJA 4C7JA 2RE8A 1VCMA 5C1IA 3B13B 4DR2O 4PSUA 4G97A 4JMLA 2A0WA 4WXYB 2O8NA 2Z09A 3WV4A 1GPAA 1DIOB 5KLVH 4GPD1 4IMPA 4PPQA 4BGIA 5BV0A 1GV1A 2LDXA 3VPSA 4YCMA 2WHYA 3HCPA 5IVDA 1Y6FA 4MR8A 3IEVA 1E9BA 3B5JA 5AUOB 5JRZA 1A71A 3RC2A 1XDBA 3E9NA 3K8ZA 1EVEA 3EMDA 2PM8A 3MT8A 2VTEA 4YRLA 3U9LA 3G02A 1DAMA 3IQFA 1CUDA 3VM6A 4YQFA 1T4DA 4JT4A 1ABBA 4EHHA 2KX7A 3HYLA 3OH8A 1WB4A 3VUEA 2WSYB 2P5UA 4MW4A 2A9OA 4XKJA 1BRMA 3EVTA 2MSEB 2CDYA 3NCTA 4GEKA 3BIJA 4OHFA 4ZMRA 1C4KA 1OT5A 4ALMA 3KZCA 2BHSA 3A9RA 5AR1A 3FB5C 1LUVA 3CBGA 1EZVH 4AKIA 3B1KA 5DI3B 2WB4A 4KVFA 3EN0A 3RNLA 5CFRA 4AJHA 3IV6A 4R54A 1WHTB 4PA4A 1QFMA 4WKNA 5HIJA 1M7GA 1CYDA 2W83A 3CEPB 2FRXA 3WHLA 1U8AA 3O65A 3T1VA 2XUAA 1Q2UA 2OHFA 3BCHA 1SVLA 2H52A 2HXYA 1ZISA 2OHHA 1YIAA 2AG1A 3AEIA 1IWBB 1TCCA 3CCCA 4NFHA 4ZC1A 3NWOA 5TX7A 4F91B 2ZUUA 5FV4A 1Z6QA 3EHBB 1N7IA 5THQA 5M7EA 2IT1A 3N2EA 4UEJA 1WCWA 3FYCA 2X8JB 4HEHA 4DY4A 3RJMA 2QWNB 2I2DA 4WN9A 2P2YA 3I3SR 3SDSA 3DCYA 3V1TC 2V4DA 1PX2A 5BY1A 3PKJA 3AKDA 2NU7B 1B8PA 3BC1A 3TW0A 2IZ5A 2Z5VA 1WD7A 2HVKC 2R60A 1BDIA 2Z0AA 3E8XA 1MAHA 4AJKA 1SVKA 1L7EA 3BILA 2ARHA 1U96A 3IVXA 2Z2IA 3OURA 2ZE7A 4FHFA 3OT7A 4MK4A 4OHUA 1RM1C 2C61A 2PWBA 3BL8A 3P30A 4KHZA 4PGMA 1HQYE 4PV7A 3VO1A 1VJGA 4W1QA 1PFWA 4AG5A 5KNLA 5KKAA 1F06A 2VP0A 2C8LA 4EA8A 5HMMA 4PYRA 4TT3G 3DTUB 1KJQA 1J25A 3E3AA 3CM0A 2PD4A 1KIFA 1O6FA 3K1YA 3QVMA 1TA8A 1RM3A 1U1FA 4F6EA 2G8NA 3L79A 4G5OA 4LQLA 2BI4A 3CBQA 4QUKA 1AO0A 4RXTA 5LQNA 3KJHA 2VRNA 2ODQA 1F51E 3FMFA 2EIKC 5E9AA 1D2AA 3CINA 1TCAA 2EZPA 2H00A 2WVGA 1GZSA 2GKOA 9GPBA 4ZGWA 1VKRA 3E15A 3IB6A 3MOIA 2CF6A 4LZPA 4OKNA 3V4ZA 2FFJA 5C52B 2OFWA 4EIWA 3L6DA 2WIJA 4N18A 5AVRA 1NPDA 4M8SA 4E1VA 1XI1A 3THRA 4CFYA 1IIBA 2XTNA 2GSMB 2MSWA 1GXSB 3L92A 3Q3HA 4F5DA 2D2FA 1G4HA 4C7VA 1XTVA 2M6RA 2BCEA 4O3MA 1KNQA 3HGMA 2FXVA 5D3KA 4ZDWA 3BHJA 2Q0QA 1UP7A 3B2EE 2HU2A 5FFMA 4F93B 4RTKA 2FCAA 4FGSA 3RT1A 3GJ5A 4V3BA 3ST7A 5FL7G 2V0CA 3I9FA 3TQCA 2E4WA 1YBHA 3AEYA 3UV7A 1XL0A 1D9XA 5B3SC 5DP1A 1MG5A 1U2SA 1U31A 1VQLV 2XUOA 1YTFB 3LW8A 5LDDC 3G88A 3IDSA 2XZOA 1VQ8V 2ZIXB 4CBCA 2FSSA 3V46A 4WLFA 4CI9A 3C43A 1OUMA 3RREA 5DTEA 4D81A 5JDIC 1U7ZA 3PC4A 5DCWA 4S1WA 5GOTA 4DBLC 4ZCTA 1NC3A 3E82A 1FDTA 2A58A 4QRIA 3AL2A 2IYPA 4BX9A 3PRJA 2PU7A 2HU5A 4Q9HA 2H4XA 4F9GA 3AR5A 2VUUA 3T3IA 4EELA 1YQ9A 1DX6A 5D5HA 2WU0A 1USWA 1P2TA 1YA4A 1Q7CA 3O9OA 3D8HA 4K26A 3I9KA 1N6IA 4KFSA 1JEEA 1GITA 1PJ3A 1ZY2A 4HMQA 4KQ9A 4PLVA 2ZE5A 2R6HA 1EVYA 3OE4A 4Q39A 4BQPA 4ZQFA 1LSOA 4NTZA 5AKIA 5KNDD 2IEDA 1TAUA 3EIXA 3AEZA 3GN2A 5DNAA 3GELA 3FTNA 4MAMA 4YRFA 4INOA 1UJ4A 4ZOBA 3ROQA 2ZBPA 3ON5A 4ZIRA 1XTQA 2J45A 2J9YB 6CHYA 5A62A 4BW9A 4JUCA 4BVJA 5J59A 1ZGZA 4TKVB 1NRJB 5F1YA 1ZBDA 1OC4A 1MJNA 4EGSA 1L7VC 1T6NA 2QRZA 4LOAA 4RU1A 1R3IC 3HMKA 3HKDB 2F55A 2KMLA 4E08A 1AMUA 3ZJTA 2D8AA 1MB9A 5FDFA 3MWLA 4BNNA 2ZIVB 1V8DA 4WIAA 1IC6A 3COPA 1CBUA 2X40A 3DV9A 4G0UA 1G1XB 4AXXA 1ZL0A 3T35A 2JI4A 3RYCA 1OTHA 1NZDA 1P0MA 2ZTHA 1F3OA 3HVIA 1II8A 4YONB 2JI7A 2A0FA 5TPZD 4WXMA 4WZBB 2BEWB 2E18A 5BN4B 4E7PA 2MMCA 4MMXB 1AGRA 3AJEA 2HPHA 5PGMA 4B6EA 1CUZA 1QKIA 1RMQA 2ZIXA 2F9FA 5CN0A 2H11A 3KHKA 1HFKA 2AZMA 3H5NA 4I6JA 5E8RA 3IP5A 4URXR 1G8KA 3T4UA 1KEWA 2PRZA 3MMPA 3R7WA 1SQSA 3ONFA 2AFHA 3PC7A 3BS4A 4MTLA 5ICMA 3JQ7A 4N03A 4JLBA 3ZZ1A 5LL6P 4JD5A 5BYAA 2PS3A 1YGPA 2J7PD 3B6EA 2D2XA 1Q6IA 3CCUV 3KDAA 1YUBA 5CDYA 2PXXA 1UBGA 1J1UA 1PM9A 2W2PA 3X1XA 1G1AA 2WJWA 4J91A 4LH6A 2AR0A 4F11A 3KQYA 2CVZA 1NUQA 3TNLA 5I7VA 3I61A 1VLJA 1RCUA 5ER9A 2EW2A 2GAAA 2OYCA 3ZUPA 4ZJPA 4WHMA 4MRPA 4QQNA 2DULA 4WKBA 4DY6A 3A2NA 1L5GB 3OJCA 3RVYA 3AK2A 2YQZA 4H35A 2H18A 4KQGA 4KMRA 2CMGA 4KR2A 2CB9A 3D6NB 1D2EA 2O2YA 3NTVA 3TQQA 2AFIE 3VISA 1BJKA 1YRWA 1LDGA 4NHEA 4R4JA 3PQEA 4M1ZA 3NHSA 5CNKA 5E1OA 1OZHA 4PD4F 1OA1A 4URVR 4FBGA 3JAKB 1U2QA 5A7FA 3T3OA 1PEYA 3PTLA 4RPKA 1GFIA 3CNQS 1GCIA