3D3QA

Crystal structure of trna delta(2)-isopentenylpyrophosphate transferase (se0981) from staphylococcus epidermidis. northeast structural genomics consortium target ser100
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
307
Chain Sequence
KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tRNA delta(2)-isopentenylpyrophosphate transferase (SE0981) from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis atcc 12228
molecule tags Transferase
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
total genus 102
structure length 307
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 3d3qA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d3qA01
5TDHA 2B6HA 4NP6A 2E87A 5FTKA 5G41A 2JLQA 3K09C 3ZQ6A 2LWIA 4C0KA 4OKSA 1R5OA 4MRPA 4TYNA 5J5CA 2NO1A 5JS7A 1A2BA 2ODEA 1J8MF 1K5GA 4GDFA 2O0JA 2QAGA 4B3FX 1DO2A 4DDWA 5JZVA 4CEHB 2O8EA 5FTMA 3UANA 2VH5R 4FWTA 2KE5A 3U3OA 4CW7A 4JKIA 4CEHA 2O8EB 4F4JA 2V6IA 2FSIA 3RYTC 4IVPA 4MRRA 4NKRA 4US1R 1G7TA 1MABA 1R6BX 1L4UA 2Q9BA 2O8DB 3U61B 2OAQ1 4A15A 4EPXA 3TSOA 2FPLA 1KKMA 5DYIA 4EUNA 1VHLA 1IN4A 4RFSB 1GKYA 2WKQA 4W5HA 3VR5A 3X1XA 5JJIA 1AZSC 3QEJA 3IEUA 1CLUA 4LGMA 5DNYB 5B64A 4ABYA 3W6PA 1YE8A 2MSCB 3W34A 3SC3A 2UVQA 4NH0A 2WWYA 1UBFA 4MUAA 4LHWA 3GD7A 4KLZA 4P0TA 4PPQA 5KNDA 1W4BA 1JBKA 4RJLA 1U8AA 2CCJA 3Q85A 1VYUA 4DLWA 1US8B 2ZVQX 4HB2A 4GL2A 4XVUA 4AG5A 1G5TA 4RD4A 1IXRC 3B78A 3HJNA 5HKKA 2KB0A 1S0UA 4Q1AA 2ONJA 3VX4A 1Z06A 4GSYA 5C4GB 5FBQB 2RGDA 1Z28A 1SHKA 2J87A 4IXMA 3T61A 2AXNA 4P4SA 1VMAA 2J45A 1F2TA 2J1LA 3WBKA 2FFHA 5J4YA 5L3QB 3ADBA 4XTRA 2GXAA 1GTVA 3PV0A 4DT1B 1DAMA 3OAAA 4KITB 4J0QA 1G7RA 3K70B 1CR0A 2CHQA 2R8RA 1U8ZA 3K09A 1SVLA 5C4MA 1X8JA 1FZQA 1A1VA 2ZUCA 1LV7A 3SJZA 4H1UA 2HEIA 1HE8B 1YR9A 2UZ3A 4HLQB 2OCPA 3BJIC 2ZU0C 1RRPA 1KI2A 1UEIA 3QKSB 1SHZA 2EFDB 3A1UA 4URXR 2Q0HA 4O0MA 3PCRB 2QT0A 3SYKA 4ZIRA 1ZUNB 4FW9A 1GVNB 1ZM7A 3IQXA 3OIUA 4BFSA 2ZS8A 5E3HA 1N6HA 2FPMA 3QXHA 1E0KA 5CIQA 3KKQA 4ESVA 1F48A 5JLJA 1YZLA 4URUR 2B8TA 2XOKA 4LJ9A 5JCZA 2XJ9A 2ASEA 1MO5A 4GP6A 3U6KA 4P3YA 2HJVA 1KTVA 1IN6A 3EAQA 2W6JD 4LBWA 2AX4A 2ZSBA 1OFHA 3TR5A 3GJ8A 1Z6XA 3LVQE 3MCAA 3MWLA 1E2NA 3SJCA 2W6ID 2JEOA 2WKPA 4GMXA 3PEVA 3VQTA 2GHIA 3H1TA 2V54A 2LKCA 1E2FA 4LV8B 1OB5A 1JB1A 1SXJA 3HWSA 3QXSA 1IM2A 3QKTA 4DUGD 5TV2A 1IAQA 3AUXA 3EWAA 1RYFA 4QC2A 3TMKA 3W3AA 2UKDA 4HI0E 1XTIA 3U7GA 3RWOA 4GOXA 5BN4A 1VYVA 4E07A 1XWIA 3DL0A 3MLEA 2PZFA 4D4KA 2CMKA 1W36C 5L3QA 2FF7A 2FX3A 4DCUA 3ZDQA 1GWNA 1WA5A 1OXUA 1V43A 1XB2A 4F7WA 4JL8A 3Q72A 4TMZA 1PUIA 3DMDA 1F60A 4BRWA 5G40A 1UKEA 2GA8A 3GJ3A 2JJ1A 2ANCA 3VHLB 1E3MA 3W6NA 1N3BA 1X86B 2W6IA 4XSGA 3TH5A 3SJAA 1EFUA 1AM4D 1KDPA 2QENA 3U5ZB 4XIGS 4DLYA 3VR1A 4JBWA 4IHQA 3H2YA 5JHHB 4NZYA 2BHRA 3ASYA 1ZCBA 5DI3B 1TQ6A 2HLDD 4DDVA 2VLIA 3VR6A 2GZAA 4BECA 4NCIA 4AYWA 2KSQA 1QHYA 2BEKA 2QMUA 2EWWA 2AK3A 4JJKA 3DVLA 1TQ4A 2YZ2A 3GJ7A 3GLIB 1W2HA 3A36A 1YR8A 4GZMA 1FOEB 4G5RA 3AF0A 2CE2X 2Q6TA 2NO9A 5KPJA 1Z47A 2RHMA 5KSYA 1P60A 4GRAA 3BB1A 3DZDA 1EX6A 2ZITA 4HZUB 5AR1A 8OHMA 1TUIA 2IUSA 1KO8A 5DN6A 4LBZA 1E1RD 3QSYA 4C30A 1JXMA 1ZD1A 2B21A 2P6RA 1GOTA 3CX8A 4KFRA 4DB2A 4D0GA 1YZQA 2DFLA 2XZPA 4LSGA 3C41J 2QAGC 3PQCA 1YVDA 4WXRA 3QF4A 1Z08A 2W83A 3SNHA 3PUVA 5SZJA 1IN7A 1E2JA 1HT2E 1NMZA 4JLVA 2R6CA 4QNRA 1FX0A 5LB4A 4GNKA 4RD6A 3ADDA 1UKVY 2JJ8A 1GP2A 4FCVA 2FV8A 1H8EA 3K0AA 2GJKA 2JGNA 1OXXK 2A5FA 1W48A 2QTHA 4LJAA 2FEOA 4PHFA 3L0IB 3TUJC 4BFUA 1IN8A 4DEYA 4BUJA 1ESMA 5AUQA 3QKRA 4JYBA 1EFHA 1HE1C 4MRVA 4AKHA 5HKKD 3LX8A 2GBLA 1II8B 2EYUA 3GLHB 5DH9A 5JWHA 4GMDA 5GJVC 4JBXA 2DHRA 1T3HA 1YR7A 2HT1A 3RAPR 1YJ5A 4Q4AB 2A78A 3U44A 4HZIA 4Q9KA 1ZVQA 3RRYA 1KDTA 1E4VA 3I32A 3NVAA 3LWNA 2P5SA 4BLQA 4OI1A 4AKGA 4B47A 4MDFA 4C0AC 1CJUC 2H7VA 2J0VA 4IOMA 2ANBA 3ONWA 3HU2A 1OH6A 2IYXA 1KMHB 1KNXA 3O8CA 4WZBE 4C0JA 4C0SA 3FOZA 4QJ4A 2P5TB 5K8LA 3QUSA 1DBSA 2XNDD 5AJWA 2QE7D 1Z2CA 2EFCB 4KBFA 2VSXA 4CYMA 1NY5A 2IYRA 1KYIA 2GAOA 1JI0A 2JAQA 2IXEA 2XOKD 5CLLA 4C2UA 3WRXC 4B35A 2QUZA 2BBWA 2EYQA 5EXSA 5L8VA 4W5WA 5BWMA 2W6JA 3ZVLA 2WTUA 4TLAA 3KJGA 1NG1A 3SR0A 1Z07A 2WPDA 2V1UA 3MWKA 2CLCX 4G0NA 4PQFA 2CNWA 1NIPA 5AJYA 3UMSA 3EPHA 1NN1A 4A36A 4FI3C 1J2JA 2WJGA 1P3JA 3R20A 2JIZD 1G21E 3VKWA 3AVWA 1TU4A 4GP7A 2YC2C 1JXOA 2Q3HA 2XNDA 3SDZA 1KHTA 1X1SA 1F6BA 3SBEA 1E1QA 3KZ1E 3H84A 4PR0A 1HUQA 2O8CB 2DWOA 1V5WA 1QBKC 3KKMA 3MD0A 4AK9A 4OBEA 4YMVA 1HURA 4B2IA 5CYPA 1X8KA 1U0HC 3OEHA 2W2VA 3SN6A 2ZREA 4Q4JB 3SYLA 1OIWA 3GEEA 3LBHA 4UQOA 1R0YA 4B2PA 5G3ZA 3ZVNA 3K0FB 5FR1A 1ZM4A 3GEHA 1DAEA 5L3VA 4AC9A 1U90A 2Z6VA 4BASA 1AGPA 3K9GA 1P9NA 2ZRGA 4JLOA 1KNQA 3FMFA 1SKQA 4FD2A 5JECA 1M2OB 1XDBA 5DGXA 1FQKA 1G8PA 2FGKA 4LJ8A 1JJ7A 5J4LA 3TBKA 3GMTA 2HLDA 3RC8A 2GJAA 4QOSA 3NG1A 2CLDX 1B0UA 2AKAB 3DOFA 3NXSA 3WBJA 4B32A 1G291 1GL6A 3CRQA 4NPHA 2BCJQ 3LD9A 4IEIA 2F3RA 2GCOB 1DPFA 2ZYUX 4NONA 4RZ2A 1Q20A 1W47A 4M1SA 4HLUA 1E9CA 1QHNA 1OSNA 3L2OB 1OFIA 5CIWA 2ZROA 4C0LA 3PJRA 4EFMA 4ERNA 1GNRA 5CM9C 4LYAA 1F2UB 2D7CA 3SQWA 2X8AA 3QBTA 5KU1A 2R6GA 4JLBA 1CF4A 2ZS7A 4LHVA 2YYZA 1FTSA 3KQHA 5K8TA 1S1MA 2IK8A 1BO6A 1LNZA 2R9VA 2IYYA 1BYUA 2FJUA 4B76A 2W2XA 2A5YB 1KI9A 1OLOA 3OFND 4WOPA 2XJ4A 5HCNA 5KYKA 1OYWA 3BOSA 4II7A 5KSPA 4DDUA 1TX4B 4ARZB 3SE0A 1F5NA 4KVGA 1S1CA 2NO6A 3IHWA 2GCOA 4JYCA 3OESA 5J4VA 1XJCA 3NC1C 5FPKA 1DO0A 3B1XA 3F8TA 4P32A 2ZRJA 4PQRA 4UJ3A 1WP9A 4QJ5A 2CCGA 4JLKA 1N6PA 1P75A 1KMHA 4M0LA 4QNMA 3ETLA 1RIFA 5JRJA 4MH0R 3WMEA 3I5YA 2HXYA 3EWSA 2ZANA 3FKQA 2GAAA 4HAZA 5LPNA 2VSFA 4JVLA 3QPVA 3UMFA 3K8YA 4PC6A 3ZZ0A 1R4AA 4B3BA 4MYHA 1P9WA 3MMPA 3VU9B 4BLOA 1YU9A 2JCSA 3Q7QA 2FFQA 4M1TA 5HZKA 3QEOA 5HTKA 1YR6A 3BD9A 1G19A 1NN3A 2BV3A 3BB4A 2ZUDA 4Q1FA 3X2SA 4LJ5A 4XOIA 3VU9A 1BOFA 2NZJA 2GJ9A 3ZLJA 3FVQA 4BLTA 4Q7JB 2JLUA 3AM1A 4JLAA 2IUUA 4EDHA 2VIIA 3TW8B 1TEXA 3CZQA 3A37A 3P26A 2WM9B 4PAQA 4EJSC 3BFVA 1XEFA 3IBGA 2BIFA 4DKXA 5IHPA 2J41A 3M6AA 4B3XA 4W9MC 1TEVA 4U00A 1X1RA 1R0XA 3TSWA 1MO3A 2ZI9A 2J0SA 5A0FA 5ANRB 1JNYA 1LS1A 4MRNA 3FMPB 4D82A 5EJEA 1IJEA 2G1JA 2JLSA 3LW8A 4BWYA 4QM7A 4FMCB 3LLUA 3VR2A 2BC9A 3KJHA 1O87A 1W5TA 1S2MA 5J4KA 2CXXA 4QGFA 3B9PA 3GLGA 4RKFA 3QOFA 1FX0B 1KI6B 3VTKA 1GL9B 2QEQA 1EK0A 1G4UR 2ZJOA 1NG9A 2CL7X 4QHTA 1H65A 2ZI7A 1J90A 3TJZA 5KDLA 4CF7A 4EPRA 3QJYA 4NCKA 4DLVA 3THOA 4EPWA 2D7DA 3QPWA 2WWHA 1G7CA 3PVSA 2BCGY 4LC0A 1U94A 2GVDC 2D4HA 3FHTA 3RWMB 1TQDA 1W2GA 2GJSA 2QI9C 1A7JA 4US0R 1E32A 4PSVA 5FI1B 1XBTA 3HR8A 3AVVA 1UM8A 1Z83A 2C9OA 4L9SA 2IYSA 2J46A 4ESHA 2O5VA 2G6BA 4N0DA 3U44B 5LD2B 1W36B 4B3CA 1N6NA 2D06A 2ZJ2A 3NHBA 4ZO4A 2G88A 4URWR 2H92A 2ZE5A 4XH9B 1VIYA 1RJ9A 3EIHA 2MSEB 4AKEA 4Q9LA 2O8BB 2TMKA 4MYTA 4TQUS 3VAAA 2GEUA 4HDCA 4L16A 2QNRA 3T12A 3AQ4A 2A7QA 4EIWA 1G5RA 3WP1B 2R44A 1IQPA 3AH8A 3DO6A 4G5SA 3KUDA 4QBGB 4TL9A 4Q9JA 3GPLA 1B23P 4LV6A 3JZAA 2ZRFA 4RFSA 3X1YA 2P0EA 4YC7A 4OHWA 1BMFA 4UXIA 1KY2A 2BBSA 2JLYA 1NJFA 2ZI3A 1Q1QA 3FFBA 1NKTA 1X8LA 1XMVA 2KJQA 4Q1BA 4Q9IA 1T6NA 5FOUA 4BZXA 3TW4A 3GJ6A 2X1VA 1HTWA 1SVOA 2YOHA 3O8DA 4R9UC 1SXJB 3IO3A 2EVWX 2CE7A 4G01B 1A5TA 4B74A 5C46F 4IVRA 1HA3A 3QQ5A 4GBMA 4QKQA 1NVWQ 2WWIA 2DFKB 4Q5IA 2O8CA 2ZRPA 4DLSA 1XCPA 4DCSA 2P65A 2ZYVX 2JIZA 4PC2A 1D9XA 4U5XA 3U3KA 4M1MA 2ZM5A 2XXAA 3V9PA 1JPJA 2QBYB 1YZUA 2ATXA 2WIBA 1CR1A 2DFTA 1Y63A 5GJWC 1SVSA 5A5GA 1SVMA 1CBUA 2HYIC 1NI3A 1QG4A 1QVRA 3PUXA 3WY9A 2RAPA 3NC0C 1RVDA 4UKDA 4A0RA 2XB4A 3AKEA 2G0NA 1RW4A 2VYFA 1IONA 1N5IA 2RH5A 1E9DA 1Q3HA 3BXZA 3HU3A 4KBGA 2QQ0A 4TMVA 4HB3A 3WHKA 2QRZA 3CRW1 1N6RA 2QRNA 4EPTA 1Z8FA 1D2MA 2IBMA 4Q19A 3WNCA 4B71A 4IDHA 1JR3A 1RKBA 2WZQA 5C1BA 2F1JA 2PJZA 4TLEA 2WAXA 3QVVA 2W0SA 4A0HA 1COWA 3T1TA 1ZU5A 2KI5A 4JLNA 2G9NA 4JL6A 5CJ2A 4Q00A 1P73A 4JBYA 5FBLB 2XXAB 4OHYA 1HQCA 3Q3JB 1RRCA 3MAAC 4KV9A 2JASA 5A4JA 4MKGA 4WA7A 2FPKA 3V4FA 1RC8A 1P2SA 2V6JA 3R7WB 2PBRA 1DEKA 3FPAA 4LBVA 1W0JA 3SJBA 2QTFA 4P4SB 1XRJA 3VR4A 1XNJA 4KFSA 2FA9A 3SEAA 3W5IA 1G1MA 3I72A 2YWHA 3L0PA 3DZ8A 2E1RA 2QT1A 4KSBA 4PC3A 4PPGA 3HPQA 1D2NA 3K1JA 5TB5A 3CO5A 1JAIA 3NDPA 5FBVB 2ZYTX 1T5LA 3CWZA 4MYCA 3BWDD 4K8OA 4JMPA 3GFTA 2CHGA 2OM2A 3BBPA 2ZRNA 1IHUA 4HDOB 1E2IA 1XD2A 3B60A 4DRZA 2PLRA 4DDTA 1KSFX 3B1ZA 2VPPA 3K0SA 3LW7A 4DLXA 1PJRA 4FMDF 1N5LA 2GILA 2FMXA 1MR3F 2YWEA 3WYAA 3TNFA 3W8NA 3THXB 3QI2A 4QJ3A 3Q8XB 1K5DA 2B92A 3CNNA 3O8RA 4EQ6A 4Q02A 2A3RA 1D6JA 3IBYA 4TTRA 3T1VA 3A4NA 3RRMA 4NHOA 1OH5A 3TUIC 5JI2E 3B8HA 2V1XA 5FTLA 4TTPA 4BFZA 4C3ZA 4M9XA 4KFTA 4DWJA 2XZLA 1Z0JA 4Q1EA 4Q4LA 3FMIA 4D2IA 2OHFA 2VSOA 2ZU6A 4KJZA 1OW3B 2N42A 1JALA 3LBNA 1KZ7B 4UNSA 5FBRB 4A2QA 5FBWB 4KFUA 4DCVA 1YZKA 1XMSA 4Z54A 2REXB 4P33A 4LV5B 2BMJA 1P9RA 3P4YA 2W0MA 3B7GA 3HR7A 1AA9A 2RKOA 2WIAA 3ND9A 3QF7A 4NTZA 3ZS8A 2DWPA 3CM0A 4G5GA 4Z8YA 4Q21A 3NDBB 3AVYA 4DCTA 4DHEA 1LS6A 2QAJA 3LBIA 3B1VA 3UWKA 3R8FA 3TSZA 1G64A 2PZEA 4M8NE 1YRBA 1KK3A 3TIFA 2DB3A 5KSZA 4Q4HB 5BXQC 1GDDA 1VECA 2VHQA 1DG3A 4ASUD 4IOKA 4NYMQ 3IKJA 1AKEA 4HAXA 1G16A 1XF9A 1CJTC 1Z0AA 1H8ED 1SQ5A 1P2UA 1XXHE 1DAHA 4JL5A 3EA0A 3SS8A 1HV8A 1N6KA 2Q21A 1LF5A 1OIXA 1R0WA 3D8BA 4BFYA 2J59A 2VO1A 4LHYA 5D3MA 3A1SA 3KQLA 3EZ6A 2DFNA 1ZM9A 5EP2A 2F1RA 1ZD9A 1FNNA 2Z83A 5ELXA 2J0UB 5FL3A 4JLJA 1R0ZA 3LXRA 2ORVA 1RJ9B 1S4QA 1JR3E 3VKHA 2I1QA 1I2MA 1LB1B 3A58B 1II9A 3EZFA 3MGCA 2YKGA 3EG5A 3L0SA 1E9SA 2VRWA 3R9WA 2ZYWX 4P4TA 1TNDA 1ZUHA 2R6FA 2QTVB 2Z4SA 3CX7A 4Q7KA 4IW3B 3TR0A 4DT1A 2AXPA 3R7WA 1Q1BA 3LH5A 4JVMA 4BE7B 4B73A 2QGNA 4OK6A 4R71A 1XEXA 4LY6A 2V4ZA 1GUAA 2G1KA 3GQBA 2HDNB 1KDOA 1T3SA 2V7QD 3AKCA 3D7MA 1FL9A 2GRJA 2PLFA 3KB1A 3T06B 3B5JA 1C4OA 1QZXA 2GXQA 2PT5A 5CDFE 2F1HA 2NOAA 1CKEA 3ZD6A 5EE3A 2GJ8A 4BFTA 4F93B 4DSUA 3PFIA 4WIAA 5KPDA 2ZRAA 4QBFA 2NZ8A 4EFLA 3HU1A 4ZI2A 5JMTA 1FQJA 1E99A 1KK0A 3CPHA 1TAGA 3Q5EA 3EC1A 2H16A 2ZSFA 3HYTA 2QMEA 4R98A 4OJKA 2O8BA 3ASZA 4DSNA 4ZDKA 2QE7A 2WBLC 2QP4A 3N2EA 1CS4C 5KDDA 2IHBA 2ZRBA 3QIAA 3SHFA 2D74A 2VP0A 2PMDA 5FUVA 4M9SA 4PZLA 4B44A 1QHSA 1KI8A 4ON9A 1JEEA 4LZZA 3KJEA 2OV2A 5M04A 1BS1A 2RCNA 3CWQA 1W0KA 2OCBA 3PIRA 3ZD7A 2PMKA 4PTLA 5CK4A 1XFAA 4FCTA 3ZVMA 4TZ0A 1VCNA 1UBCA 2F1IA 5H8WA 2MMCA 4PC7A 2IYLD 4TMTA 1DE0A 1T0HB 4KHZA 4BFXA 2OSBA 4BEBA 4LBYA 1M1YE 3T34A 4FMDB 3B82A 3OIVA 1PLLA 3NBZC 4OK5A 1R5NA 1Y3AA 1OXVA 5EUQB 2J0QA 3SU8A 1L7VC 2OBLA 4B2LA 1F2UA 3AP1A 3DKPA 5AWFC 5L3RA 1U9IA 2F7SA 4IFBA 2NGRA 4LWZA 1E1QD 2GVZC 4WVFA 4ACAA 3AKYA 2GESA 2PCJA 3THYA 2XB2A 1E6CA 4UNQA 4V0NA 1U0JA 2FZ4A 4ZCLA 5AUOB 4UXHA 1OHHA 1US8A 2GDJA 4XSHA 1KK2A 1NSFA 3QXJA 2VA8A 4HYYA 4EQ6B 1XEWX 4FMBB 2XITA 3IIJA 5BQ5A 3T1QA 5FH9A 5EP1A 1Q21A 2GK6A 1K6MA 5F9HA 2ZTSA 1YHNA 4BLRA 4A92A 3DPUA 2A5GA 4RZUA 1ETUA 1EX7A 3WNBA 4DLUA 5B2ZA 1GG2A 4IFEA 2BMDA 3I8XA 1S3GA 1UDWA 3V4RA 4F38A 4BRUA 4DSOA 2J9RA 5G3YA 2C03A 4BGDA 4ZCIA 1G20E 1TUEA 2DWQA 4NBSA 1XTKA 2H57A 4BZQA 2GKSA 1ZD8A 1XD9A 3KTAA 4CDGA 1M7BA 2PH1A 2WAYA 1GRRA 1ZUIA 3DOEA 4IDNA 2YOFA 5J4HA 1VIAA 4V03A 1UKYA 4GOJA 1COWD 3QY0A 1QG2A 1LF0A 5EZ5A 3U2QA 3GEIA 3KXKA 3OE7A 2F9MA 5EE9A 1UKZA 1WMSA 2AWOA 4QXAA 5CDFA 4Q18A 4PFSA 1F3OA 3VNVA 4UXJA 1XP8A 2GF9A 4I81A 1CTQA 3ZQJA 3CF6R 1CR4A 4N0EA 4B48A 2PEZA 2QSZA 5AK0A 2WMNB 3FHOA 3T5GA 5HE9A 2O0KA 2ZI4A 4MKFA 1P62B 1L2TA 1G9XA 4OI2A 3I8SA 2RGXA 4HB4A 2WJIA 1A82A 2I4IA 2WOOA 3FWYA 4I1UA 4IEEA 2QROA 3M4YA 5FOVA 3WYGA 1T3LA 4PHHA 5DI9A 6Q21A 3I62A 2IEZA 2YV5A 3K0EA 4A6XA 2QGZA 1MT0A 3PEYA 4TMXA 5HR5A 4POAA 1GIAA 2AFHE 2VP2A 5KNBA 4AG6A 1T8TA 2WJHA 1WBDA 2W00A 2C77A 1YQTA 2BMFA 1OIVA 1NIJA 3B1YA 4V0LA 4ZDJA 4IVQA 1IJFA 1XPUA 4M53A 3RDPA 2OXRA 4OI0A 3OEEA 1E2MA 4MUBA 2JATA 1NP6A 1Q22A 3Q7PA 4TYWA 1Z29A 3AP3A 3RABA 2XTNA 3EX7C 4HAVA 3T15A 3OF5A 1H8HD 4Q1CA 4YDSA 4PAMA 4HUTA 1P2TA 1XCGB 4DLZA 3KQKA 1UDXA 1GL7A 4DIEA 1KO4A 5TARA 1UF9A 4RD3A 4Y0VA 4ZI3A 4MGYR 5CB6A 2WWWA 1DADA 4OQMA 5B30A 3VNUA 3RLFA 3GJ0A 1WQ1R 4B75A 5K8IA 4R7ZA 2JJ1D 3SFZA 5JSZA 1DG1G 1A2KC 3AF3A 4DIDA 1R8QA 3LNCA 3H86A 4GI7A 3D6TB 2QM8A 3W9YA 1QDEA 4FIDA 4Q48A 4MYUA 1XTQA 3SYNA 4WXPA 1ODFA 1JPNA 4IKEA 3L8ZA 5D3MB 4RVCA 1W4RA 2XEXA 4KAXA 5TVKA 4RD1A 5FPYA 2N1BA 4V0KA 2YJTD 4DJTA 1I4LD 2ZJ8A 4BFWA 3TVTA 1T8UA 5E7JA 1ZNZA 2VHTA 4KVAA 1FUKA 1P2VA 4V0ME 1I4TD 3W90A 2IX3A 4JSTA 3AVOA 2F43A 4LI0A 4MGZR 3EZ7A 3F5FA 4HUQB 4F91B 2IEYA 4RZXA 4A8JB 2AK2A 4M9ZA 2A30A 4MA4A 5FOWA 1VYTA 4B6FA 1XTRA 4FWIB 4NDZA 1XEXB 2IS4A 4D4MA 3V00A 1QHXA 4PXAA 3RANA 2QSYA 5FUWA 1YKSA 2FE4A 1TQ2A 2WWGA 1AGRA 1KI6A 3UKDA 2ERXA 3OAAD 4M1YA 3NBYC 2ATVA 2H18A 4HLDA 1RRFA 2KBFA 2OESA 1FP6A 1KI4A 2YNMA 4TL8A 4TL7A 1II8A 2IS6A 1NVVR 2RGAA 1CJVC 1N6OA 3EASA 1DS6A 1Z0IA 2WMOB 1D2EA 2IYQA 2RGCA 2W58A 3KKNA 4P4UA 3LO5A 4LCBA 2CNWD 1CJMA 5AJXA 1E0AA 1VTKA 1VDZA 3LX5A 2CVFA 2J7KA 4G5OA 4G5QA 4NU0A 3NKVA 4OYHA 4TSFA 2MSDB 5JCPA 3IEVA 1TMKA 4TTQA 4AIIA 1QHGA 4PO1A 1NNEA 4QBHA 5CLQA 3CIOA 3P20A 3KFVA 2IA5A 5AJVB 3C5HA 3TAHA 3R9XA 1EG7A 2GK7A 1E2GA 3LQQA 3FDIA 3AF2A 4MQBA 5DHAA 1XX6A 2ERYA 2YC4C 5E7IA 4ILEA 2WVJA 3IUYA 5SZHB 1XD8A 2O8DA 1IXSB 5JFGA 1AS3A 4OQNA 3OIWA 1KY3A 2QMHA 4JJZA 1N5JA 5JEDA 1W5SA 1FNMA 1DAKA 4TYQA 4A8JA 1T5IA 2GCPA 4QL3A 4YXWD 3P1JA 3SZRA 1GRQA 2HV8A 4FN5A 1EWQA 2NPFA 1G8GA 4C0QC 5KNCA 3I4LA 1Q0UA 4OQXA 5BN5A 5EE1A 3EPJA 3LFUA 3CZPA 4OQFA 1U0LA 1VG0B 1GILA 4CT5A 1KO7A 2RB4A 4OHZA 3SFVA 2CLSA 4B33A 4RZ3A 521PA 2C5LA 3ZZUA 4TN1A 4BEJA 3PG5A 3EZ2A 2GF0A 4DUGA 5TMPA 1XXHA 4HAYA 5EE0A 2QPAA 1N2CE 4TMWA 1W1WA 2QP9X 5FI0B 3TQFA 1U9IC 3K9HA 3MSXA 4HDQB 3EARA 2OFXA 4LC1A 3THWB 2F6RA 2GZDA 3ECCA 4NYJQ 3UMRA 2AN9A 4TT3A 4DSTA 4BQSA 4X8HA 4U7DA 1DOAA 3CONA 4PSAA 4L5BA 1JR3D 2CEAA 4ZIRB 1L8QA 2AKYA 3UATA 5JSZB 3CB4A 2VL7A 2RGGA 1M74A 3C8UA 3KXIA 1MO4A 2FSFA 2OO7A 1VPLA 2ZE8A 4Q03A 5KHOC 2WPDD 3I5XA 4WZ6A 1EXMA 1RYHA 1ZIPA 1TF5A 3L43A 2OLKA 4M4SA 3CBQA 3NHAA 4XJXA 1MRNA 5GADl 1T91A 2P67A 3GLFA 4OQLA 1LY1A 2YWGA 1UPTA 1XTSA 1ZINA 2HF8A 1DARA 3TE6A 3ICEA 1WB9A 1CRQA 1S9HA 3G5UA 3CF0A 2OAP1 1AKYA 1XPOA 4U02A 4RFVA 1OPXA 3HPRA 4D80A 1N0UA 2Z43A 1Q3TA 4RCZA 4XVQA 4JZKA 3RSLA 1W36D 2GEDA 1BIFA 3LVRE 2ZE7A 3AVPA 4BLSA 2O52A 5IK2A 4KU4A 1KO1A 1FFHA 2PEYA 2AHOA 3WMGA 5JI3E 5EXXA 3R8CA 3EXAA 4B3DA 4A2PA 1XCMA 2VHCA 1TF7A 4CEIB 2OZEA 3K9NA 4NYIQ 2R65A 3NIBA 4WW0A 1VHTA 1QF9A 4EJSB 2G77B 5DN6D 1SVWA 4C9BA 2FNAA 2P3SA 5KO2A 2C9YA 3E5HA 3CLVA 1TL7C 1U8YA 1S8FA 2H8KA 4ITRC 3LDAA 1OE0A 4B6EA 4A4DA 3THWA 1G8FA 3U7HB 2IYVA 4EPYA 3AKDA 4XVRA 3WMFA 3ZYCA 4Q4JA 3LXXA 1FPMA 4CT4B 2I1VB 2ZIAA 5IK2D 1G3RA 3IQWA 1II0A 2O8FB 2G3YA 1MRSA 5D3QA 3KKPA 4TLDA 2R6DA 3EIEA 4M9QA 4M1KA 1ESNA 4UNNA 3DM5A 2FEMA 1NBME 2CVHA 4Q01A 1E79A 3U4QB 4AY2A 4N3NA 4MRSA 2B8WA 2FU5C 3K70D 1E2KA 3DEFA 2PL3A 4HLUC 3GLIA 2IC5A 621PA 5EP4A 3I61A 3VR3A 5LBIA 3P4XA 4D0NA 4ASUA 4L9WA 2P6NA 3WXMA 3TVDA 2GXSA 3OFNA 5B58C 2XX3A 3CF2A 5TY0A 4A1FA 1F2TB 4CVNA 1KZGB 3H4MA 3WHLA 1ZJ6A 2VBCA 2B7BA 2YWFA 4LYJA 2WWXA 2OCAA 1T4GA 2AWNA 4JIMA 3S1AA 3GLGB 1G3QA 3BAFA 1IY2A 3NH6A 3AVTA 2ZRKA 4YMWA 2YVUA 4WAUA 4H1VA 1IY0A 1RRGA 1S9DA 4PZYA 4R2IA 1CP2A 1MV5A 4X8LA 3T1OA 4EJSA 1EESA 1YRAA 4Z51A 3FMOB 1FMLA 2GCNA 2RGNA 1G3IA 4E03A 3THXA 4OJQA 4FINA 5H70A 4EKDA 2F3TA 1Q1ZA 2ZRHA 1KAOA 1ONBA 4A9AA 1C1YA 3GCGA 2SHKA 1NMXA 4LUCA 1DAIA 4AD8A 2IXGA 3H0KA 5J47A 1Q57A 4L4UA 1IXZA 3NWJA 5BN3A 2DYKA 4TQAA 4ZKEA 3TKLA 4D26A 5C18A 2IS1A 1Z22A 4YXWA 4XTCS 2VQSA 2HF9A 3VFDA 2QMOA 2JDIA 4KLNA 3U7FB 4S2EA 4JLPA 3TRFA 3K9LA 5EXTA 3A8TA 3GLFB 3C14C 2V7QA 3WNDA 2ZSDA 4HAWA 1OH8A 4B34A 4Q7LA 2K5UA 3GLIE 1ZU4A 1IN5A 2EWVA 4QHSA 2A2ZA 4ZCMA 3C16C 1E9RA 1FTNA 3RHFA 1Z0KA 2NQ2C 1NBMA 1W7AA 1N6IA 2W2TA 3IPXA 821PA 1QHHA 5CB8A 3U7EB 3AVQA 2IYTA 2VHUA 2REOA 4LPSA 1GNPA 4I1SA 2ZI5A 3ZJYA 2GZHA 1CR2A 2HCJB 3VHXA 2FH5B 4UNRA 4LYHA 5KOYA 1E9AA 4CIDA 1R2QA 2ZEJA 1LFDB 3Q5DA 4TWZA 5SZIA 4IDQA 4E09A 5IF9A 4BPBA 4ARZA 4I99A 3GFOA 2NO7A 1MABB 3CRVA 3C7KA 2JDID 4AURA 4YMUA 3AGQA 3WP0A 1Q44A 3T35A 1W0KD 1OXTA 5DIFA 1XPRA 4FXPA 3N2IA 5H1YA 1G3MA 2F43B 2NG1A 1KMQA 1SXJD 2C78A 3BFKA 2CK3A 3GP8A 4L15A 3PUYA 2X19A 1AIPA 3RS3A 1AK2A 1CIPA 3AUYA 3IO5A 4G3XA 1Q12A 2O8FA 1HEIA 1SVKA 3KQUA 5JJLA 1JAHA 4YQFA 2F55A 2C8VA 3I92A 3E70C 2H17A 221PA 1S3SA 1O3YA 2QPOA 1ANKA 1W49A 1I2DA 3BC1A 2RGNC 5EZ6B 1KI3A 2GXUA 5FTNA 1NJGA 1ZC4A 3D3QA 3KL4A 3PENA 3QKRB 1OF1A 1MKYA 4I1OA 2ZETA 3K53A 1R5BA 2B7CA 3GJ4A 3KDSE 3RS7A 5KTYA 3UG7A 2GWHA 2WOJA 4OHXA 5JRZA 1DAGA 3IPYA 3K0CA 5H68A 1XEWY 4H9GA 4IDPA 1XZQA 1G3UA 4TLCA 1S96A 3K0FA 1P5ZB 3GLFE 4O2RA 5B57C 2GNOA 2G83A 4Q7MB 1ZNXA 4YMTA 5GJBA 4IOJA 5IRCD 3M0EA 3TLXA 1PVOA 5AUNB 2CL0X 2Z0MA 3BORA 2J7PD 1OFUX 2ODBA 2ZRCA 1NRJB 3OEHD 5JBQA 3B13B 5FUYA 4X8OA 4C7OB 2F9LA 2PX0A 3BH6A 2BKUA 1XZPA 5KDOA 1JR6A 4HUQA 2H1LA 4MGKR 1MH1A 1HQYE 1E0JA 5IT5A 3J81k 4DLRA 1E79D 1GNQA 2ZUBA 1OFTA 2PZGA 1YZNA 3P27A 3W3ZB 4K46A 1SKYE 2HJGA 4PO8A 1AS0A 2A9KA 5FPTA 4AI6A 2ZPTX 4LHXA 1SULA 1NN0A 2HT6A 1OJLA 1R10A 2CJWA 3NEJA 4PAOA 3CRRA 2XNSA 4L8GA 3PITA 1JJVA 3UG6A 4BFVA 1R8SA 2OFOA 4PANA 1E9EA 1GFIA 4HAUA 2BM1A 5GVSA 3GLHE 3U3MA 3WYFA 4LX0A 4A6PA 5DE3A 1D9ZA 1RPZA 3O47A 4D4LA 5E4FA 2J7PA 2A5JA 4AKIA 2JLVA 2WJYA 3L8YA 3JZMA 4LYFA 4D6PA 2QPTA 4I4LA 4P31A 4QRHA 3PEUA 5EP3A 4KI0A 3HDTA 2ZR9A 1DTSA 4R2HA 4MKHA 1PZNA 2ZAOA 1VKJA 1P4SA 4OI4A 5F98A 4HLCA 4DVGA 1N0VC 5DSZA 4DZZA 4NYMR 3AF1A 5FFMA 4QG7A 1IOZA 1ZBDA 3AV0B 3MWYW 4M1WA 2FSHA 5EUMA 4JSYA 1E2EA 3QNUA 5GVRA 4US2R 2EW1A 3OEED 2ZJBA 3VMFA 1GSIA 1Z3IX 1FMJA 3DDCA 2OBNA 121PA 3F0TA 3BERA 1KDRA 1W0JD 4IDOA 1OV4A 4PO9A 4JVNA 1SGWA 2FG5A 2QORA 2QL6A 1TF2A 4X8MA 2FFBA 3ZIAD 2R2AA 4ZV4A 3A6PC 4LJ6A 1P7CA 1WRBA 2IL1A 1KSGA 3C15C 1DAFA 4JKYA 4I1VA 5DHFA 1TTTA 1BKDR 3GJXC 4RSGA 2WSMA 2X2EA 1Z6TA 2Q3FA 1M6NA 5DISB 3X1ZA 1G6HA 4M22A 4W7SA 5AJZA 3EW9A 5LB2A 1PLKA 3S1AB 5KUTA 1FW6A 2XTMA 5EXPA 1X6VA 3CH5A 5FTJA 2ZR7A 2OUKA 2ZJ5A 2V9PA 1QHIA 4IJMA 1GKUB 1ZM3A 2AD5A 2IW3A 1AQYA 2WHXA 2ZQ5A 2BKEA 4MGIR 3JVVA 4V0MA 4E22A 1KJZA 5EE5B 4KYUA 2ZAMA 1OYYA 1VG1A 2VP9A 3ZIAA 3DKVA 3QF4B 1A4RA 4NCJA 3GFPA 4D4JA 5BYJA 1HYQA 1UFQA 1ZNYA 4EAQA 4GFDA 2BMEA 3QKUA 3E1SA 1G18A 2CJWB 4O3MA 2MMGA 3A4MA 2IYUA 2DBYA 4C2TA 4E5UA 3BK7A 5CYOA 1VG8A 4HEJA 3I73A 4DBLC 1E94E 1E4YA 1TADA 3FFAA 3KUCA 2RMKA 2XTZA 3EC2A 3ZGXA 1GZSA 3B2EA 3FYHA 3CPEA 1SVIA 3EIQA 3KJIA 2GETA 1K8RA 1KI7A 4JT2A 2GEVA 3GLHA 4JVSB 2JLWA 2YOGA 3E2IA 4W5JA 3PR1A 3TQCA 3EA5A 2ZRDA 1E98A 1NVUQ 5F2EA 4Q47A 4KODA 3VX3A 3O8BA 1XD2B 1ZYUA 5CJPA 1VCOA 1EFRA 1IBRA 2IYZA 4DEXA 1M8PA 1N25A 4A2WA 4V02A 1G7SA 1WCV1 1FUUA 4NCHA 5LD2C 3LY5A 4TSFD 2ZXUA 1JECA 1Z63A 1NVVQ 2CL6X 4CEIA 3D31A 1NF3A 1UJ2A 2WJVA 4PX9A 1G8YA 4DCNA 2X2FA 2IF2A 1EFCA 1ZW6A 1QVAA 1L4YA 4PHGA 1CULC 2C96A 1M34E 2OFWA 4KXFB 5FOSA 1W4CA 5K8UA 2HYDA 1NLYA 5GJCA 1NLFA 2BJWA 3LQRA 1OHHD 2QP3A 3REFA 4B43A 3MFYA 1WXQA 1P61B 4YMSA 3U4QA 3IHLA 2P6UA 1GM5A 3DM9B 4ZPXA 1OH7A 1XMJA 2E9SA 1XU4A 1EFRD 4URYR 3UXMA 3KX2A 4Y0AA 2QZ4A 2CCKA 2C9CA 4BZPA 2OILA 3W6OA 3X1DA 3RRZA 2NPIA 3LRPA 4LPKA 3A1VA 5J40A 2DPXA 3CNOA 1UEJA 4OHVA 3CX6A 4KCGA 3IIMA 3U60B 2P2LA 4QBIA 3QVUA 1ZAKA 3FB4A 3EPKA 4JT4A 2BM0A 2NMVA 5DI3A 1UAAA 3CR7A 4ACBA 2L0XA 3CUEF 4RD0A 4Q4HA 2IUTA 3NBFA 2ORIA 4DLTA 1RFLA 4URVR 3BGWA 4OK3A 2AR7A 2V3CC 5DO9A 4QGAA 2BBOA 5JHGB 1U81A 4EFNA 3LV8A 2ORWA 3BS4A 4NYJR 4CGZA 1KKLA 4NYIR 1NN5A 2ZRIA 3UK6A 4LDJA 1MO6A 2LCFA 3IGFA 1U98A 3IDQA 4D0LB 2HCBA 1G8HA 3B9QA 3QENA 2BEJA 3A1WA 2BOVA 4NE2A 4UNPA 4LOAA 4PPNA 2KWIA 2J5XA 2EU8A 1E2LA 2FZLA 4MKIA 5FUXA 4M2LA 1TPZA 4RY2A 2Q9AA 5FR2A 5IDVA 2PCLA 2AL7A 2WWFA 3QG1A 1U99A 3CR8A 1I4DD 2CHVA 4Z1MD 2JJ2A 3FKSA 1NSTA 2R6AA 1CJKC 2JA1A 4EPVA 3TAUA 1BYIA 1KJWA 5L3SA 3K0CC 2CBZA 4XD7D 5DLQC 5F3WB 1AZTA 721PA 2G0TA 5AUPB 2XGJA 1DELA 4RCYA 2OT3B 5BYKA 3NBXX 3L82B 4NCNA 3ZH9B 1Z6YA 4C4PA 1GRNA 2ZS9A 2ZJZA 2ZRLA 1AQUA 5SZKB 3RRNA 3ZZTA 1SKYB 3UIEA 5FOXA 3TUZC 1E69A 1NY6A 1Z6AA 2J3EA 3A1TA 5FL7A 1KOFA 2D3WA 4PPFA 5P21A 4AWXA 2BBTA 1AS2A 3CNLA 4QHYA 3HP1A 4QFMA 2XZOA 1KI1A 2BJVA 2WSSA 3B85A 5JJKA 1G4AE 2WKRA 4C0HA 2RGBA 3SI7A 3RC3A 2JJ2D 3FKSD 1J99A 1Z6GA 3MJHA 3OE7D 3W8RA 3CW2A 4NMMA 1HY3A 1LTQA 3AF4A 3FTQA 3I1FA 1E1RA 4F92B 4XD7A 3NH9A 1N5KA 4A0GA 5UKDA 4FCWA 2QQEA 4S35A 2ZJYA 5HZHA 3BIFA 2VF7A 1E2HA 2V55B 4N1AA 3AGPA 1E96A 5FPHA 1YZGA 5CM8B 1TU3A 2NO0A 1P6XA 1J8YF 1ZRHA 1XJ0A 2IHYA 2WICA 1QHHB 3RNLA 1EFTA 3PUWA 4Q66C 3DMNA 2X77A 1P72A 2XSZA 1BH2A 4PHTA 4LJYA 1IY1A 2UZIR 2DCUA 1NMYA 4BLPA 1RZ3A 4A8JC 4NL4H 1KSHA 3B6EA 4Z8XA 1M7HA 2QN6A 3QG5A 4O2LA 4KYIB 2Z5FA 1R7RA 1YZTA 2ZR0A 3PEWA 2RGEA 3PXGA 1WE2A 1GITA 2YHSA 3RS4A 4AYXA 1GKIA 1ZIOA 1ZM2A 4RD2A 3ADCA 3MUFA 4D25A 2ODNA 3ZS9A 1G5PA 3LLMA 1GAJA 5KSOA 5G53C 4A0FA 3FE2A 5JWOA 4TQ9A 2OG2A 4TYPA 2FSGA 4UJ5A 5FPSA 2OE2A 5BW8A 5C2JB 2XSZD 1NVXQ 3RVBA 3TGPA 3SHWA 1NBMD 1EGAA 2DR3A 4MITA 2JLZA 2EQBA 2IXFA 5DYGA 3NEYA 4GZLA 2IT1A 3BB3A 2Z4RA 3REGA 3W5JA 1E9BA 3AVXA 1T0JB 2ZSEA 4WBSA 5TXGA 2OXCA 2EFEB 3VKGA 1E2PA 4GOKA 1KO5A 1W4AA 3RS2A 3WRYC 2ONKA 5LDDC 1KK1A 4D81A 2QA5A 1W46A 4CRWB 3QE0A 3TK1A 1Z2AA 4TLBA 3LA6A 4F4CA 2KBEA 1AJEA 5E7MA 2CK3D 1PV4A 3C4JA 2VP5A 2D62A 1SXJC 3QXCA 2O0HA 3BFXA 4TYYA 2RHDA 3CPJB 3U3RA 2EFGA 1T9HA 2CDNA 3SOPA 1ZP6A 3OIYA 4HZUA 4IRUB 4TMKA 1QRAA 1NLZA 2PX3A 1ZNWA 2ZJAA 2Q3MA 3N70A 4URZR 4IOLA 2PJRA 4MDEA 2OLJA 1RE0A 1OKKD 3BRWD 3T5DA 1BMFD 2Y8EA 3G0HA 2OEPA 2I3BA 4HATA 2HXSA 2PT7A 1UBGA 3AP2A 4TL6A 2N46A 2IF0A 1C9KA 1VCIA 2OCYC 2IWRA 5F9FA 2WJJA 2VTKA 2FGJA 2NTYC 4PQYA 1KGDA 3OZXA 3BH7A 3MG9A 4TT3D 2FWRA 2BWJA 4GT1A 4QGGA 4ZDWA 3BE4A 2Q9CA 4CZ2A 1KIMA 2VHJA 3SBDA 5JS8A 4Z1MA 3A4LA 4K81B 2C99A 5JEEA 1UADA 1N6LA 3RS0A 3KKOA 3B1WA 3EPLA 1J7KA 1KAGA 3CKLA 4JLMA 3U6BA 3N5CA 4HB0A 1ZCAA 2JLXA 1UBEA 2FDCA 3SQXA 3Q9LA 4DC9A 3ND8A 1CXZA 4YDHB 2BDTA 1OKKA 2HUPA 3JVUA 3THYB 4TZ6A 2AD1A 3NTUA 4C0BA 4XWAA 3FHCB 3KFXA 2ZI6A 5CITA 1XJQA 4AYTA 5HPYB 2C2HA 1ZC3A 1WDTA 2ODWA 2QU8A 1JQJC 2GBLC 5CK5A 3C5CA 3CH4B 4QGHA 4GPTA 3OHMA 3MRSA 3IIKA 1LVGA 4FMCF 3DHWC 3ICQB 4A82A 4WZAE 3HYRA 5HE8A 4O25A 1E2DA 2QAGB 1ELOA 5E95A 1CEEA 4F4IA 4ZDIA 2FFAA 1G6OA 2XAUA 2QG6A 4YLGA 3RS5A 421PA 3F3YA 3R9IA 1U2RA 1WF3A 1N0WA 1JEDA 3QBVA 4QM6A 3RSOA 3I3SR 3QPUA 2QY9A 3KTAB 4RKEA 2V8OA 3KXLA 4G1UC 1HH4A 2VP6A 2AFIE 4KSCA 3UWOA 4JS0A 4PSKA 5JWRA 4ZKDA 1SXJE 2FOLA 1H8HA 3P32A 4Q1DA 3ZVRA 4LJ4A 5EQTA 2C98A 1ZMXA 2C95A 4KO8A 4V0OA 2H5EA 2NIPA 4HSEA 4PZZA 5L3SB 1KSJA 4Q9HA 2DY1A 4XWOA 2IWHA 5HCIA 2ZE6A 1Z5ZA 3KB2A 3AVUA 3CRMA 3IILA 4DB4A 1XXHB 1JQLB 2D2FA 4DXAA 3LAWA 4LJ7A 1X3SA 3GLGE 1D5CA 2QBYA 1CU1A 4LHZA 3L0OA 4YONB 3X1WA 2GTPA 3QKSA 1Z0FA 2REBA 1E2QA 1J70A 1OT3A 2QM7A 4OL0A 1XMIA 1Z0DA 1VG9B 2C04A 4Q4AA 1KJYA 1M7GA 2LKDA 4XWKA 2JLRA 3MWJA 4C7OA 3QXXA 4CEJB 1OB2A 3BH0A 3KQNA 1NKSA 1Q1EA 1DVRA 2ECKA 3K70C 1G41A 4M21A 3EZ9A 1PUJA 4LK2A 1XTJA 1W44A 5FL7D 3ADKA 3UPUA 3G82C 4CEJA 2A5DA 1NL3A 3GJ5A 1G17A 4PC1A 2WSSD 2YINC 1PLJA 1LW7A 3M1IA 2ZSAA 2WV9A 2IYWA 2ZRMA 2D2EA 2VEDA 1VCMA 1EWRA 1FP7A 1SZPA 4LRWA 1MOZA 1E9FA 1AN0A 2BVNA 2OBMA 1WBBA 3K0AB 2FN4A 1D8TA 2J0UA 1OXSC 2R62A 4B3GA 2ZVPX 3AB3A 3MJRA 1E0SA 2VF8A 3FGNA 3PUZA 4M1OA 1HT1E 2VP4A 4IXNA 5FOTA 4JLDA 3AEZA 1CRPA 2IS2A 3U3JA 2EFHB
chains in the Genus database with same CATH superfamily
4F6RB 4JI8O 4NBTA 1T25A 5FTKA 2DYRB 1I3MA 4CT0A 4KQ2A 4JAAA 4BAYA 4UCQA 4QLAA 4OKSA 2Y48A 3KPVA 4H7PA 3PBKA 4P5PA 4MKZA 2NO1A 4D9NA 3HDYA 4C05A 1SD2A 1GJRA 3KR9A 5JS7A 1BWPA 1JQKA 3B3QA 1A2BA 3LCCA 4OHRA 4OBWA 2Q7HA 4XR9A 3PR2B 2I3DA 1VBMA 2O0JA 3BVPA 1DO2A 1CZOA 2QL9A 3ELWA 2O8EA 4ZALA 3ZLTA 3UANA 4KPYA 3NAGA 2P0YA 2X1LA 2P41A 3G0BA 4FYVA 5EPOA 4HCJA 3U3OA 3A1FA 1UPCA 3BF8A 3WG7B 4B6QA 2X5KO 2ALJA 2ATEA 2F1KA 2FSIA 4NVPA 2IZ1A 2OQ2A 4D7SA 3O0DA 4IVPA 3TEJA 5K8VA 5KOJB 1R6BX 3ZRSA 1I2BA 2FN8A 5LU8A 3K59A 3J80A 4HGOA 4LSMA 2OAQ1 3TSOA 3FVWA 4B3RB 3ZR4B 4R7TA 4HNUA 5CLIA 4RV9A 3UA4A 2CFTA 2VWHA 2FRDA 1E20A 3MMZA 2IZ0A 4CMIB 4HYEA 1ISIA 2AFRA 4IYHA 4DW0A 4B1FA 1XT6A 2HADA 3OC0A 2YHUA 3K1ZA 2GERA 1YZBA 3W34A 3OEYA 2WFAA 2UVQA 4YRRA 4EHDA 3L7KA 4A5SA 5IULC 1JLRA 1D1PA 3E9RA 5ICSA 2H2DA 3WHPA 3HEAA 3I9V6 4KLZA 1HWYA 4OB8A 5KNDA 1I7SB 1Z56C 1IBSA 3CYFA 2DZDA 4QODA 3SHVA 4QUIA 1U63A 1FQWA 2CCJA 3FAVA 1G5IA 3ODGA 3AF6A 5A7GA 2ZVQX 3O8NA 4HB2A 4XX0A 4XVUA 1JKMA 2OYQA 1AK9A 3MINB 4AG5A 1IXRC 2HMSA 1S2OA 3HJNA 3VX4A 5HKKA 1PS8A 1OBVA 1SUFA 4CG0A 4LF8O 4REQB 2J87A 1KEKA 2PUBA 3ZUPA 2BR3A 3SZGA 2BYTA 1IOLA 2LIVA 3GRZA 2FFHA 4O4JA 3HKDA 2P9JA 1QAOA 3IT0A 4XTRA 3TINA 1CUHA 1GTVA 4EMUA 1O0CA 3VOSA 1C9YA 1FDIA 2IYAA 1G7RA 1GCGA 2C3UA 4V1CA 4FHFA 1BVRA 5ES4B 3H5WA 3K09A 3IMFA 3W0LB 1FZQA 1N7GA 3C3YA 4IDGA 5CXSA 4WD3A 1VMGA 3ZHBA 3L6OO 4NDNE 5H6QA 3TXAA 1JIVA 3BJIC 4JQCA 4DR5O 2H1HA 3QKSB 3BCCH 4BO2A 2VNKA 1VMDA 3PFBA 2G5GX 3HJHA 4O0MA 4AIRA 4B3HA 1JDUA 4FI3F 4REOA 4R1PA 3BWCA 1HR0B 2R70A 4FW9A 3IQXA 5M3BA 4BFSA 2ZS8A 4QUJA 4JR1A 2FYTA 3QXHA 1L7XA 4I1RA 5CIQA 4BXOB 3GARA 4BQNA 4ESVA 4XJSA 1LBQA 4H37A 2C2OA 3HSYA 4URUR 1GFSA 3K70B 4FLUA 2XOKA 1XAIA 2EG9A 2V7VA 3FCAA 1QUFA 2B2XA 2QZ9A 3PC3A 1B8PA 2XJ9A 1KYVA 3GP3A 4INJA 1RADA 1WXEA 4GP6A 3CVXA 1NUUA 4MW9A 4R51A 4P3YA 4QTYA 3B53X 5KMGA 4N5DA 3BWVA 2HHLA 5E1MA 4B85A 5IX8A 3VR0A 1QH1A 2CNDA 3PNOA 2W6JD 3ESDA 4RMGA 4JI1O 2AX4A 3I23A 2ZSBA 3LO8A 4X92A 4DPMA 1OY1A 2B0CA 1I0HA 3GJ8A 3CCQV 4MVCA 5IMBA 2H4WA 2VWPA 1NXTA 2HK6A 3MWLA 3ZMSA 1E2NA 3RYFA 3L72H 1C8LA 3J81N 1J5EO 4LF6B 2JEOA 2WKPA 3I9MA 1XHFA 5COBA 3UB3A 5BR8O 2GHIA 3QV1A 4EB3A 2V54A 3V8NA 5LP6C 1JFVA 1E2FA 3AJRA 1V2HE 4EABA 1SXJA 2ID4A 4F5ZA 2AV6A 1IM2A 2AH5A 3FRHA 1RWXA 2HH9A 2X9LA 2I3AA 3W3AA 2UKDA 4B4VA 3TGUH 2KHZA 3FF4A 4IMPA 4OUKX 5AKIA 2Y0DA 3DT9A 1XWIA 1UL1X 4UVGA 4UFZA 2WE7A 5HUQA 3MIIA 4QO7A 3T7EA 3QO7A 2FF7A 3EWNA 1USGA 3RS9A 1SKUA 2BONA 1R4MB 3PC8C 1GWNA 3R5FA 3VUFA 4BV3A 4RM2A 1OXUA 2JHCA 5ALQA 1XB2A 2AI3A 3DBVO 3L4EA 3DBHB 1IBKO 1V5FA 2XT9A 3Q72A 3N39C 1G0OA 2GYUA 3D4BA 3SZ3A 4BQIA 4DWOA 5JFOA 1C9NA 4WOBA 2GA8A 2NO4A 1GTG1 3IUPA 4G5YA 4OLHA 1PJQA 4QFDA 3TRKA 4AJPA 1QYRA 5E1DA 1N3BA 1KXJA 2BFCA 1EFUA 1Y9ZA 1XQVA 2V58A 4HDKB 3VJKA 4JBWA 4IHQA 3H2YA 1JHVA 5JHHB 1YUNA 2JEXA 1NTRA 2QTSA 2Q27A 1MVLA 2BHRA 4JTAB 3EDYA 4OKNA 3RF6A 1HYBA 3EZXA 3T9FA 5EC1C 4UMFA 2WK1A 2PU5A 3DEYX 1GPKA 4J4TA 3QYJA 3NRJA 4H3KB 4NCIA 5FUBA 4M0CA 4JDUA 3WQHA 1P4GA 4UUAA 5DB4A 4AYWA 3FSGA 2XE8A 1QHYA 1GPUA 3L7LA 2BEKA 3QRWA 3TL2A 2RHGB 2XHEA 3DBIA 3T95A 3DVLA 1DTWA 3OA0A 3FUCA 3TEFA 3MZ0A 2YZ2A 3EUAA 3AB7A 4MS2A 1W2HA 3KT8A 2ZRQA 3RSFA 2BKAA 4JAVA 1KL7A 1I5XA 3X44A 1B4DA 5KPJA 1IVYA 3VU3A 4BLUA 2O2JA 5EJMA 2R1TA 4W9RA 3K57A 3DZDA 3SKVA 2FTKA 1GUFA 1O54A 2ZITA 4QOJA 4DLBA 1Z0ZA 3L7DA 3CUYA 4XPIA 5DN6A 4LBZA 2DJIA 3QSYA 3MS2A 3FMGA 4ZCSA 3I2FA 1LGYA 3N8KA 4C30A 1OILA 5LQUA 3M83A 2EKPA 2LO1A 2VK1A 1Z5GA 1X7ZA 2LDXA 2O05A 2XZPA 4R2MA 3FYDA 1OFUA 1YB1A 3RT7A 2P22C 3LSSA 3ZV7A 3QVJA 3HKEB 3QF4A 4KN8A 4E6EA 5MHTA 1WXWA 1BXRA 1F6DA 3PUVA 1AE1A 1E2JA 3TG2A 4O59O 1Z8DA 1QH9A 1W6RA 4QNRA 1FX0A 9ATCA 5K6TA 3BVOA 2PAFA 2RGUA 4K9OA 3CCSV 1ES9A 1NU8A 3EJ6A 2A86A 1M34B 1WXFA 4JC4A 3UJ6A 3NWOA 3UJDA 1WKCA 4BO5A 1K7YA 1C1DB 1JS1X 4DA4A 1OXXK 2HA4A 5EIOA 5DFAA 1WXHA 1GRVA 4DNFA 4PHFA 1PEAA 3D36A 1D2GA 3L0IB 3ZJZA 1IN8A 4BUJA 1ZPDA 3FPLA 5DX1A 3ER9A 3E3AA 1OLSB 5AUQA 4QQRA 3QKRA 2GDSA 4K3AA 2P35A 4W9NA 3N2NA 2WB4A 4ZKIA 4RL6A 4OA8A 4PN7A 2EYUA 1R4NB 2V03A 3A31A 2RJ3A 3KG2A 2YVLA 3NUQA 4GMDA 3E7XA 3ROPA 3UA3A 3Q2IA 1PJTA 1EDEA 4IKPA 2DHRA 2PFSA 3LDEA 1RPAA 4Q3LA 5HKOA 1X2EA 3T6KA 1T3HA 1JBEA 3RAPR 2HMAA 3BZBA 4CUZA 1H3EA 3HL4A 1BGWA 2JI7A 4Q9KA 5KTSA 2IU4A 1Q0RA 1U1EA 4WKBA 2AI2A 3MMXA 3CTPA 4RIIA 2A1UA 3LPMA 1RKVA 3UT6A 1KE1A 3G5LA 2W4MA 3QPBA 1K8XB 5LUBA 1E4VA 5LOVB 3R6TA 4C14A 2FPPA 1IG3A 1LSUA 2XA9A 1V4VA 4CM9D 3OQPA 1WVIA 1B41A 4DRXB 3E0QA 4DREA 4L4SA 1C0LA 1H2FA 4FR0A 1S2NA 4Y2QA 4IS3A 2GSDA 5ADHA 1KNXA 1Q0TA 4WZBE 1EAYA 2A4KA 3OQVA 4C0SA 4DDKA 4XWWA 1HDIA 4DIUA 3QUSA 1E3DA 5ITZB 3JATB 3VBBA 2P2DA 3EHBB 2M1ZA 5L3DA 4Q12A 4BMZA 4ZTUB 1NY5A 2IYRA 3IE0A 2GAOA 2XEDA 1JI0A 1P4JA 3JQ7B 4K05A 2CDAA 2XOKD 4P80A 4ZREA 1AJPA 1XE3A 4DPLA 1XVVA 1YBFA 3IP8A 5EIAA 2GHQA 2GPTA 1ODCA 1W19A 2G80A 4DV6O 1B6SA 2WYIA 1AD2A 3CSDA 2P90A 2FI1A 2QN2A 3GH3A 3ICCA 4IJ6A 5DMXA 4W5WA 4F2PA 1WB8A 5BWMA 4GZRB 2QMZA 2W6JA 2WIKA 4G0MA 1AKUA 4RLSA 4FGUA 4TLAA 2CV2A 3GIDA 3JQDA 3UK1A 3KJGA 3S4YA 2YVKA 1EA5A 4EI9A 1SRQA 4RTQA 4HVAA 5G0TA 3MWKA 4OQZA 3AJ9A 5F1YA 4PG8A 4PQFA 4CDNA 1RWQA 2WSBA 3UMSA 3AEKA 4P3PA 3EPHA 1NN1A 3JZFA 1Y6GA 2WTBA 1Q8IA 2H9AA 4WASA 2ARKA 3KOXA 1DEOA 5BNFA 3TLGB 1M0TA 1V95A 2EZ4A 3MCTA 1SB9A 1JE1A 1TU4A 3I1JA 2A33A 3KPUA 5DBFA 1BL8A 1JIQA 3CW9A 3CJTA 1JMKC 4Z2WA 2FB5A 1JXOA 2Q3HA 3W3AD 1KAEA 1YQDA 1F6BA 3V7UA 2QIPA 1PRYA 3QU2A 4JXJA 4PR0A 3G2QA 2DWOA 4X54A 3ML0A 2YS8A 1WUTA 3KKMA 4INOA 4B40A 2RDCA 4NBRA 4OBEA 4B2IA 1Q1AA 1L7AA 5EC8A 3PC8A 1U0HC 2W2VA 4OBXA 1EFKA 5E6UB 5I7AA 1LWNA 3SYLA 4F72A 3LBHA 2ZXWB 4MB6A 1K5HA 1R0YA 2DFVA 3CRAA 1C4KA 3K35A 3K0FB 3ZVNA 3F2IA 3I56V 1Q6UA 3BHJA 4R8SA 5A2GA 1DAEA 2JK0A 2IBSA 4YV1A 1CQJA 3GBPA 1OWOA 2PK3A 4AY6A 3C87A 3UFBA 5CG2A 5C0OE 1M2FA 4X88A 3FMFA 1E7QA 5F21A 1M2OB 4NATA 1JV2B 3QM1A 3TE7A 5JE8A 3OCUA 3IOYA 3BA1A 4NWIA 4RORA 1H4SA 1ULBA 3PF8A 4Y6RA 4I1PA 2FGKA 1P2BA 4HQRA 1IJBA 5ED0A 2B8EA 4RX1A 1FU4A 1N33O 4AF7A 4EUKA 2W6MA 1B00A 3NG1A 3LUKA 1XU7A 2AKAB 3BFJA 5B7NA 4HYOA 1G291 1GL6A 4YJDA 4FBMA 2A94A 1E5DA 2K7FA 3RW0A 1FEZA 4OX9O 1Y81A 1T8RA 2BCJQ 2F3RA 3HCEA 3LD9A 2PTHA 1DMSA 4GPD1 1S8OA 1N2ZA 4Y9TA 3VC2A 4DN6A 1PCXA 3OLVA 4WJKB 1W47A 4BNZA 4WTOA 4HLUA 3L2OB 4UM5A 1FVOA 1T10A 2QX9A 2VYCA 5CD9A 3ULKA 1N1DA 2YMMA 5B4VA 4X1YB 3KSUA 5LQDA 1JEJA 1HTBA 3RFCA 4ERNA 4Y2UA 4RTSA 4U9HS 1VZ2A 3PJRA 5CM9C 4LYAA 2HREA 3V8RA 1JQ3A 1Y5IA 1SWWA 5KU1A 5L45A 3U39A 4H7DA 2ZSJA 1A8PA 1CF4A 1G6KA 1AY0A 1XLVA 2YYZA 4WCFC 3NTRA 5ILGA 3U17A 3DHVA 4RKRA 3NC4A 1N1MA 1S1MA 5IDQA 1THTA 1I4EB 1K2VN 1JHUA 4G23A 3A7EA 2EILB 4D5GA 3QITA 1XNRB 2W2XA 3C3SA 3N1UA 1KI9A 1R73A 2FEAA 3QIVA 3P0RA 1A9QA 5HCNA 4MR7B 5KYKA 2E55A 2NNUA 1OYWA 2UUBB 1TIBA 3M4XA 5AHXA 4ZQFA 4PNPA 2IQ5A 5KSPA 4DDUA 3WO0A 1TX4B 4JXKA 4ECAA 5A5DA 1F5NA 3TKAA 1M5IA 1MB9A 1S1CA 2NO6A 3AR2A 4KVGA 4G8JA 2C2XA 3FPHA 4K26A 1R3DA 2JAHA 4AVYA 4ZIBA 3NC1C 3O3MB 3AM1A 3F8TA 3C3WA 5ABPA 3C6YA 5DZSA 2JLBA 4L78A 1UR5A 1QH8A 1XA0A 3R3SA 3CV3A 5BRJA 2GM4A 3JYLA 3Q6IA 4JB3A 1E0DA 1NQ5A 2C3PA 1DJOA 2Q4RA 3M2TA 1RIFA 4RESA 2REQA 3A27A 4J43A 4BN4A 1KECA 1OJ7A 1QUEA 1VF5B 2BFAA 1Z4IA 1WCIA 1XEQA 1DIRA 1T5SA 3ZEAA 1UK8A 3U7QB 3SSAA 1IM8A 3FKQA 3VSAA 1F17A 2MR6A 2IH3C 2X9QA 3A4IA 4JOBA 3QPVA 4MWSA 3TX6A 2VXCA 3VDRA 1HDCA 2BOCC 4PC6A 4XA8A 1NQOA 1V26A 4WJZA 3G79A 4WN9A 5EESA 4XCQA 2PI4A 1DJQA 4RTJA 3V2HA 1JAXA 1P9WA 3QBJA 3JVDA 1YF3A 2VQFO 1MZPA 2BHSA 3I5UA 2FFQA 4M1TA 2GH1A 5HFNA 4E08A 5AI8A 4J7JA 1R6NA 2TS1A 1A4XA 3IAS6 3LT5A 4M86A 4PCVA 5EGNA 3TMYA 5HWSA 1GZVA 5LJIA 4Q1FA 2EZUA 3GUUA 2ILMA 3ZLJA 1R4NA 4PG5A 1UJ4A 4EMBA 1NF9A 3EXIA 4KZKA 4V2IA 4JLAA 4RK5A 2HRDA 4IT5A 1U2EA 5AM2A 1RMQA 4PZPA 3A37A 3P26A 4RAOA 4UBLA 5DMHA 1EFRG 5H9CA 2BIFA 1OCOB 1M5UA 4UCVA 2J41A 2P2ZA 5ALKA 5AVVA 1I94B 1TEVA 3TSWA 3DYIA 2ZI9A 4EF4A 4L75A 5CB4F 1J56A 4DUPA 1C1HA 5ANRB 4B81A 4I9FA 1LS1A 4UPEA 4J41A 2A79B 4EGAA 1Z4NA 4D82A 2X6BA 1VE6A 2JLSA 3PT5A 3UAWA 4F8YA 2AZ2A 1SQSA 3LLUA 3GX1A 4RJ2A 4LDNA 4B84A 2GUGA 3EA4A 2D2XA 2VZ8A 4QDOA 1J9GA 2CXXA 4IJUA 3AKZA 1QHTA 1AZLA 1CUXA 4IJVA 4JJ7A 5BSUA 3MAGA 5J58A 1FX0B 4NG5A 1LUVA 1Z6ZA 3CLRD 2JVKA 4G0UA 1ZJYA 2CL7X 2JFPA 2QTTA 4UEWA 2JGAA 4WOJA 5HFMA 3INYA 1QV9A 2ZI7A 3H4TA 3TJZA 3VKUA 4EPRA 1X7DA 1DX9A 1E63A 4OYLA 4Y98A 1EE9A 3HL0A 4C7OB 7ADHA 3EIOA 5EJ5A 1V3QE 3QPWA 1IN1A 3ZE6A 3F5TA 1PJZA 2ZVJA 3PVSA 5F2KA 1IDN1 2QM3A 4FFNA 3RWMB 1W2GA 4CQMB 1ZFNA 1XKQA 2GJSA 4D3ZA 4YMSA 3IJEB 5BV0A 1LPPA 3RRBA 5HJEA 1R8YA 2VBIA 4FT4A 4PYQA 1E32A 3APOA 1XQ6A 2MSWA 3NOXA 4L08A 5KNLA 2PSHA 4H6WA 1FAFA 2QD3A 1UM8A 4IF6A 2QKCA 2C9OA 4N7BA 1KZHA 1SBHA 4BMOB 2J46A 3I2GA 4WADA 1N2HA 4O0LA 1RTKA 4HYTA 1JG7A 4IUYA 1A8IA 4GRIA 5JZMA 3N75A 4I50F 3WLQA 1O94A 2WTEA 1Q95A 2B2CA 2WYHA 1AMUA 4MPRA 3ENQA 2ZJ2A 4PLHA 2FQ1A 1C14A 2B5WA 2RGYA 4DMMA 4N48A 1SBTA 1XROA 1RKUA 3DV0A 1VIYA 1UIMA 4KE9A 4AJLA 1Y8ZA 1EZ4A 1MNAA 3PI6A 2MSEB 2YWXA 3IAM6 1TJ4A 2K7ZA 4Q9LA 4AKEA 4CG1A 3HB0A 4MYTA 4NJEA 4U3JB 4G5XA 4ABMA 3L06A 4TXNA 3T12A 5IDWA 4E3WA 3AFGA 4ID3A 2R44A 5CX1B 1IQPA 3B7PA 3RVLA 4ICIA 1Z82A 1QH0A 2G7MC 1C81A 1OX4B 3KUDA 4CI0B 3RFVA 2QJWA 3EQ2A 3NMUF 1NQUA 4TLLB 2X3UA 3ONNA 1XLWA 1GTOA 2P0EA 4JCCA 4KGVA 1RTTA 4L76A 4PLFA 4OHWA 4RFSA 1BMFA 4UXIA 4DIFA 3PHJA 3ZXYA 1Q7YW 2ZI3A 1MV8A 1Q1QA 1NKTA 2VTEA 4PYRA 1VKNA 1WOYA 1T6NA 1Y8QA 3KZCA 5YASA 4F2GA 2RBGA 2AS0A 3GJ6A 4OQQA 4EL5A 2R79A 1P7VA 1AI6A 3IO3A 2N0SA 3SQLA 5J1TB 1HC7A 2CE7A 2EVWX 3RHSA 4Q4CA 3NATA 4GBMA 4GM0A 4HFNA 4Q5IA 1RMTA 3B6KA 2YXEA 4E5DA 1HZZC 3MOSA 4DLPA 5IS2A 3KJNA 2BM9A 2JIZA 3CCVV 2ZYVX 3P9PA 3PX2A 2PT6A 4PC2A 1AMOA 4AILC 4BL5A 3DZJA 5KZMB 2ZM5A 4G1MB 1TMGE 2XXAA 2WNSA 6ABPA 3FTEA 3V9PA 3A2KA 4K8RB 3NPMA 2R11A 3E22B 4OH7A 4P7GA 1K5SA 4O5OA 2DFTA 5GJWC 1SVSA 4MI1A 5LUAA 1SMKA 4ZPJA 2R86A 3N8HA 4UATA 1MZEA 1NI3A 3T9BA 3PUXA 2B4RO 4DZRA 1DF4A 2RAPA 3DF9A 1XOIA 2Q3JA 3AKEA 4H17A 3DV2A 3RU9A 1J0BA 2VYFA 5DOVA 5IJ0A 1AU9A 2XXBA 4EVRA 3BXZA 5EYPA 5DYWA 3JTMA 5THXA 4KV7A 4XDJA 4YASA 2QQ0A 2XIJA 3C98A 3SG0A 1K63A 3ZX4A 4QO8A 2QK4A 3P52A 2ACKA 3CRW1 3ZLVA 3FSEA 1WMDA 2ST1A 3DSRA 4V2UA 2GVNA 1D2MA 3CWBH 3WNCA 2WA4A 1I7PA 4IDHA 1JR3A 4B71A 3KTDA 4L8FA 2PJZA 3QVVA 2QSJA 3GZNB 4A0HA 3TR6A 3UFXB 2GQ0A 2CMFA 4GR9A 4XQEA 1ZSVA 2ZKIA 1Y4SA 2AG8A 2Z8YM 4JL6A 4Q00A 3PRJA 4JBYA 5CJ2A 3UGKA 3WLFA 5JT1A 2GTAA 2E3JA 4KV9A 4OP1A 4WV3A 3NHKA 2ADOA 5A4JA 4MKGA 4FWBA 4WA7A 1ZZGA 2XE7A 5K1ZA 5LLSA 4MQMA 4PDLA 2PN1A 3JQ6A 5TPZA 3G13A 2V6JA 2ODAA 3R7WB 2H1OA 3FPAA 1W0JA 1IK4A 3OTQA 2QTFA 4N6OA 4DV2O 3SJBA 1XRJA 2PSJA 1XNJA 1I32A 3HV0A 4UXNA 3OD1A 4KFSA 1G1MA 1K3UB 3LK7A 1VI6A 3K5WA 2E1RA 2QT1A 5DU2A 2ESRA 4IV8A 3CO5A 1V8BA 2X5OA 3HR4A 1J24A 3NDPA 4R8VA 1H1LB 2IW1A 4S1OA 4MYCA 4ZODA 3PWZA 4QOHA 5DGHA 4CM6A 2JZNA 3BBPA 3HVJA 4KLAA 2XCTB 5G1NA 4HGRA 1X59A 4MW4A 1H94A 2PLRA 2LD4A 2R3SA 4FGKA 4UAJA 3B1ZA 4PV1B 1M66A 4G9EA 4LJSA 3AK2A 4CU2A 1YTFB 1P4HA 3LW7A 1PJRA 4MVJM 3TTYA 4DLXA 1N5LA 3K0SA 4YRAA 5L3CA 2GILA 5I9BA 1ZJWA 2GB4A 3SP1A 1J97A 2Q6VA 3TNFA 4MS1A 4FFRA 2WFMA 1JKXA 5FWAA 3W8NA 4QJ3A 3O2NA 3L4JA 2Q7OE 1V25A 2AB0A 2B92A 3V2IA 1YCHA 4QUHA 5HIJA 5FV7A 4IG4A 3CFYA 2A3RA 4IXDA 3OOYA 1J20A 3D7NA 5IBRA 1UANA 5F2VO 3LM8A 2J6BA 3PYXA 3R0IA 3TUIC 5T6MA 4ZGWA 1FS0G 3OAAG 3UMMA 5IDYA 3HR0A 2INGX 1YJ8A 1CEXA 1V39A 3G2PA 4BFZA 4CS4A 1G98A 3S8MA 3CX3A 3M5WA 4Q1EA 5ILOA 4KNYA 2VSOA 2ZU6A 5CH3A 1RHJA 3LBNA 1JALA 5FBRB 4DCVA 1ZUNA 3B12A 1NW9B 5FBWB 2VTBA 1UXGA 4TROA 4XLLA 3HGTA 3P0HA 3M6XA 3KOUA 3D36C 3WZMA 5E9AA 1XZKA 2VYVD 4IZ6A 2GMWA 5J2TB 3B7GA 3HR7A 3ND9A 4K03A 4U7HA 3ZS8A 1RM1C 4CM4B 5JZ9A 1A7KA 4WQMA 3FFWA 5C1PA 1GQRA 1I8TA 2CLOB 3TXSA 2W71A 3FB5C 3UM7A 5CVJA 2RH4A 2PVSA 4RVDA 3SGLA 2DQ0A 5HMLA 3O7MA 4DHEA 5KX5F 1H2ZA 5AXBA 4M8NE 4R1OA 4WX2B 5L7WA 4UCXA 3QKWA 2PO7A 3HYSA 3BE8A 2NTVA 4LDZA 1Y1KE 2H2WA 2PUTA 4QU0A 3WWZA 2DYRC 3AFOA 2VHQA 5G0UA 4PYIA 3ZRVA 1DG3A 1RLTA 1GZ6A 1Y8AA 2FX5A 2OK8A 3JQGB 1G16A 4J0FA 1XF9A 1CJTC 5JMPA 1DIHA 4R6ZA 1DAHA 1H0HA 1TM2A 1N6KA 3T4PA 4BBPA 3IJRA 2VO1A 3MBOA 3ANSA 4COOA 2ODMA 2A1TS 2HIGA 1HFEL 2BN4A 3A1SA 2GK4A 3BK1A 2BGMA 3ONDA 3ZI7A 3ZW7A 3W8DA 2DFNA 1ZM9A 1KWGA 3CMAV 2IEIA 1HDEA 1KMMA 1RJEA 1SBYA 1ZD9A 3DE2X 4FYKA 4BO8A 3CG0A 4U3JA 1Z45A 3AR3A 2FR1A 1QJ4A 1BQZA 5AM3A 5KTOA 3QO5A 2YY5A 3JALB 2I1QA 5FYQA 3WGUA 1SXPA 1N34O 1QPBA 3VNRA 1E9SA 3R9WA 2CB9A 3PHLA 4V3BA 4CR7A 4FQ5A 4P4TA 4PRKA 3B70A 1Q77A 3F5MA 2HA7A 1Q90D 3CMEV 1OX5A 4UUOA 4DT1A 3CA8A 4FZ3A 1SUSA 3LH5A 4H7FA 1BHJA 2BTEA 4YEDA 1EHIA 1Q3KA 4R71A 4YJ2B 4O1MA 4BU0A 1U0OC 3DXRA 3QEKA 4LY6A 3GQBA 1WDWB 4M6WB 1Q6YA 2QX8A 3VZPA 3T06B 1TRHA 2AE1A 3IVMA 3DBLA 3B5JA 3Q4HA 1XNHA 3BAZA 2XB9A 5CDFE 2C5AA 1EM8A 1IEXA 5EE3A 4BFTA 3AERA 3SBOA 2JI6A 4Y1FA 5ESXA 1MQ8B 1K88A 4Y7DA 4RQBA 5BNIA 2DPYA 4AWAA 4L2IB 3E6AA 2Q8VA 1YSCA 1JHZA 3TRDA 4ZI2A 1XR3A 4MB2A 5IU6A 3F9RA 3DCIA 4KP7A 3VU1A 3ZNOA 1PE0A 1IHYA 1LA2A 2WQ7A 4XQ0A 2W6JG 2ZSFA 5EHNA 2DBQA 3CNQS 3KWFA 2P4QA 4IAOA 4R98A 3C39A 3HEBA 4HX9A 4PFKA 4D9KA 2O8BA 1QFJA 6CHYA 3GP5A 4IHAA 2DPHA 3N2EA 3OOEA 5KDDA 2WJ3A 3NWPA 5MGNA 5JAPA 2ACVA 3E9MA 2I2CA 4O1HA 2PMDA 3K92A 4M9SA 1A9TA 4BB9A 3M9LA 3E58A 4MV4A 4X65B 3MMNA 2ZYIA 4B44A 3SYQA 2CF6A 5DX8A 4EY8A 5BVHB 4K9MA 3JZIA 5M04A 4M3NA 4IBOA 4LKRA 2RCNA 3UH0A 5DNCA 5KWVA 3PTAA 3OM8A 3ZD7A 1QANA 4IIHA 4CFSA 1K92A 1XFAA 3DNPA 3MBIA 2XZDA 4ZQIA 5J59A 2F1IA 4DLAA 2JBAA 3IVGA 4Z6KA 2J32A 1S0VA 3WMXA 1DE0A 2OSBA 1VP7A 1O0SA 2CLKB 1FZTA 2YVQA 1Z9BA 3D6FA 1LVUA 2G4LA 4V38A 1LPBB 4WKOA 5BUZA 3IOCA 4WCVA 3ZCXA 8ATCA 1R5NA 2J0QA 1OLUA 3SU8A 1L7VC 2H1CA 3GRCA 4KPUB 4DXHA 1AXEA 2OBLA 4P6VF 3HBLA 1AUOA 3H16A 2QLLA 4Y2JA 3FB6C 1TA0A 5L3RA 4LWZA 1TFRA 4CC5A 1VKHA 2GVZC 3T1HO 3B4SA 1J21A 3D3WA 3NONA 1ST3A 4EOGA 4EVIA 4U0KA 1KVQA 1QPGA 2PCJA 3KWMA 4RUKA 3GZTB 4UNQA 3UGJA 2C42A 3QX7A 4HRAA 4HC4A 3Q6NA 4N9WA 5ECYA 4ZCLA 1P1FA 1OTYA 4F6RA 3AR6A 4CKXA 4CBCA 1X80A 2EWMA 2VP3A 3KAJA 4DC1A 3QXJA 2H2IA 2VA8A 1E5VA 1N8NA 1QIMA 3IP9A 3MHPA 4FMBB 2RAVA 4HYYA 4YJ3F 5FH9A 5LZ2A 2PSDA 5EP1A 3R9XB 1U31A 1Q21A 3N0WA 3QY9A 3VM6A 4X93A 1JX6A 1K7XB 4KEAA 3DBRB 4EHFA 4BLRA 4A92A 3DPUA 2HHHO 1BFKA 4XFDA 2HQ1A 1U6JA 1EX7A 3ETJA 3LSYA 4GUDA 4CLXA 3ADOA 3IUJA 5B2ZA 1GG2A 2PO5A 4AUNA 1OBFO 3G0OA 1UDWA 2H2GA 5TJ9A 3KVOA 4I5GA 1XKXA 3FB8C 3U4HA 5G3YA 3UJCA 1NATA 2O2EA 3SC2B 2ZR3A 1TUEA 3AK4A 1QIEA 3M6VA 2CJPA 4BZQA 4LWPA 5I9LA 4EHIA 2ZYHA 1HX7A 3DP9A 3O9OA 3FOWA 4D56A 6LDHA 3SJUA 1YA4A 1M7BA 3B20A 2RAUA 2WAYA 1RFYA 4JB2A 5KYYB 1PWZA 2P9EA 3H5NA 2VRNA 5KX5B 3DOEA 4L27A 3T4DA 3S6JA 5L4NA 3P0EA 4WGGA 4RSRA 1QP7A 3BA6A 1UBTS 3GZJA 2EP8A 4UUBA 1DHRA 4JJ8A 4OLAA 4GLXA 3QY0A 1DQRA 3U2QA 1H1DA 1Y89A 1FYJA 1X7HA 3NIFB 5HF6A 4D45A 1V5GA 4X1OA 4KHPB 2F9MA 4G67A 5IABA 4IS2A 4TV8F 5AW8A 2QZZA 4YP6A 5CEEA 4QXAA 3N86A 1CUYA 3AHIA 3RIHA 3KKEA 4NEHB 4XARA 1F3OA 3GZNA 3SAJA 2P27A 5BSRA 3ANXA 3FVVA 3DEIA 4QTTB 1PW7A 3EFOA 4XI9A 4XDKA 4NZMA 3CZCA 1YVEI 4YBRA 2BM8A 1CZNA 3FHOA 3T5GA 3VO1A 1JEQB 4XYMA 3ZV3A 4BMVA 3VR6D 3VMMA 3DTYA 4MKFA 2EBOA 3MUEA 2NM0A 2FPXA 3QFCA 3T5TA 3R0VA 4MUYA 1G9XA 1DBIA 3ZWMA 4WBNB 4KIJA 4XDHA 4D02A 1SIOA 5KBYA 4I1UA 1A82A 3DTUB 5FOVA 1HKUA 1DINA 3PUJA 3KSDO 5K0GA 4R8KA 6Q21A 1SUWA 3I62A 4IL5A 1BFDA 5CDTA 1GN4A 1ODKA 3JSNA 1J7JA 2ECQA 4MJLA 4TMXA 2QT9A 1NGSA 3HA5A 1KJ8A 3SGIA 4L51A 2JARA 5IW8A 3G1WA 4MQUA 1VQ6V 1VSUA 2J3HA 3ZX6A 1L8AA 2VP2A 1T8TA 4EF5A 1BMDA 2WJHA 1XG5A 2X8WA 2W00A 2FMIA 3ZY3A 3INNA 1OIVA 1AUXA 4IVQA 1IJFA 4IGIA 4S0ZA 4M53A 2BTQA 2OXRA 4OI0A 3UBMA 3TM5A 1TJYA 4IJKA 2WLLA 3PC2A 4TOIA 2QD1A 3N58A 1E2MA 4MUBA 5BN3B 4S1VA 3LOQA 7REQB 3E15A 1U4OA 4JYAO 2CZGA 5FXMA 4CV3A 1D3AA 2MW2B 1FYDA 4W4KA 1PT8A 1WULS 1Y1QA 3DE6X 2ZG6A 5LLTA 1XN1A 3OF5A 4Q1CA 5FYDA 1HG1A 4UTRA 1SEPA 1PR5A 2J31A 2D0DA 3EFFK 1XCGB 3GT3A 4RV4A 4TTVA 5THQA 4AMZA 1HP8A 3FY4A 3SS9X 4DLZA 1W94A 2ZR8A 1YZYA 5H5NA 3ZXIA 4DIEA 5MFPA 1A69A 5JH7A 2M6RA 5IHXA 5IE9A 1I6WA 1DFGA 1NOJA 2ZB3A 4D8WA 4BKUA 5D01A 3DZIA 5TARA 1UF9A 3TL6A 5BPFA 5JCJD 2FWMX 3GRVA 3EODA 4EEZA 4N23A 4K6KA 5CB6A 1Y4DE 1OH5A 4KUMA 5KNCH 3H87A 3ZUGA 1DRWA 3CVUA 3VNUA 3RVOA 3GJ0A 3DW3X 4FFKA 1XBLA 1WZNA 2JJ1D 3SFZA 1UMDA 2OA0A 3AY3A 3ELBA 1UWLA 1F7YA 1B6RA 3AF3A 3FCYA 4NOMA 3T5CA 4K1LA 2RHLA 3H86A 1H85A 4X24A 4PV7A 4HWTA 4FIDA 4C2BA 4MYUA 2WQ6A 1TQHA 4HNAA 2VJQA 4IKEA 1NZ6A 4PWZA 4ADSG 5B7QA 2HIHA 5LU9A 3X2QB 3MGGA 4Q24A 3FI0A 4YROA 4I14A 4KAXA 4QPZA 4PO3X 5TVKA 3WSVA 3QLVA 4PCUA 1GTMA 4DV4O 5FPYA 4V0KA 1D0IA 4ZU3A 3WQSB 3U49A 2Q45A 3G3EA 1T8UA 2NWQA 1DKRA 1K1EA 4L72A 1L1FA 1EP2B 1RCUA 4E88A 2R6R1 3K30A 2P3OA 3RFFA 2VCHA 1JIKA 3PB3A 1R3UA 2DBVO 3I9V1 1Y76A 2FWIA 4K1XA 4P58A 3W5UA 3WV4A 1EN5A 4G1VA 3TCXB 5BSFA 4EYSA 4Z7JA 6AT1A 1KVUA 5IYZB 3AVOA 3R77A 4CMCA 1WA8A 1WKVA 1W0KG 1Q82W 1H42A 2BE9A 2GR9A 1VIMA 1ZGGA 3F5FA 3N74A 4XOUA 1JDTA 1GT6A 2AK2A 1VYTA 2QHXA 4ZAZA 4B6FA 3T7AA 1N9GA 4G0OA 5KVQA 5KHLB 2G8NA 3O2QB 3F5QA 4C4AA 2ZINA 3EQ7A 3NWBA 4C1BA 1KQNA 1AGXA 2B6NA 4YIOA 3D3JA 3E8BA 1YKSA 1ZCJA 2W6CX 3L05A 3SJ7A 2WWGA 4PGMA 4YQYA 4B4KA 1KI6A 1KP3A 1HNZB 1CQIB 2WW8A 3FKJA 1EN6A 4NJOA 4PS1A 2IPLA 3FZGA 4QQKA 4B6SA 2YNMA 2Q29A 4C76A 1FLDA 5CURA 2E89A 4DK0A 1V1JA 3RC2A 3P9CA 3FYTA 4L28A 3MTJA 2WMOB 4IIVA 4N18A 3CT4A 4ZT3A 3HMKA 5BY1A 1QAMA 3ILHA 2CNWD 2CUZA 4H0LB 1JOYA 5C1IA 5AJXA 5F2OA 1A8SA 1B7GO 1VTKA 2CFIA 3VH1A 2CVFA 3LLSA 3NDJA 4NU0A 4D5EA 1TZCA 2CLFB 4TSFA 3SDLA 2WZDA 2YS6A 2IJHA 3GBVA 1E3WA 1X80B 1IXBA 3I9OA 3KYBA 4N5LA 1ZOPA 4WZAA 4AIIA 4CTNA 1NNEA 3AERB 2NYAA 3TIXB 2NN4A 3P20A 3N6XA 3C1AA 5CA0A 1XP5A 3C5HA 2H3HA 3TAHA 3R9XA 3GUYA 3NGXA 4QXRA 3IDAA 4MUXA 2Q5FA 3LS2A 2V7GA 3FDIA 1QMPA 2Q4BA 4DUZB 4IICA 4ZRMA 3L8HA 5E7IA 4ILEA 2JIRA 3T5MA 4KG7A 2ETXA 1NOKA 3A1CA 5SZHB 3AZOA 1MX3A 3W2TA 4AMYA 4LIPD 4OQNA 3OIWA 3HXMA 1L5RA 1KY3A