3D3QA

Crystal structure of trna delta(2)-isopentenylpyrophosphate transferase (se0981) from staphylococcus epidermidis. northeast structural genomics consortium target ser100
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
307
Chain Sequence
KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tRNA delta(2)-isopentenylpyrophosphate transferase (SE0981) from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis atcc 12228
molecule tags Transferase
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
total genus 102
structure length 307
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 3d3qA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d3qA01
2VHCA 3HYTA 2ZUBA 1SXJA 3LY5A 4O2LA 1R0XA 4C0LA 3BB3A 5CJPA 2GVDC 4JBXA 4OYHA 3IEVA 4OJKA 3DKVA 4IVPA 1ZP6A 1AS3A 4NDZA 4LRWA 4OHYA 1Z06A 1OH8A 4URZR 2QMOA 3CZQA 4UQOA 3VX3A 3AVWA 4DUGA 2CEAA 5LD2B 5FFMA 1VIAA 3N2IA 4HAYA 3I8SA 1GUAA 3NWJA 1XJ0A 3UWKA 2GXAA 4C0JA 5LD2C 1M2OB 3CRW1 4L5BA 4WXRA 5FI1B 1JPNA 4DDVA 2V1UA 3P26A 4AG5A 5JHGB 4HUQB 1C9KA 3CWQA 2FX3A 1BIFA 2GAOA 2QP3A 3KKOA 4U02A 1P9WA 4EAQA 3D7MA 1IN7A 4RD0A 5CIQA 1P75A 3QKUA 1RFLA 1E9SA 1YJ5A 2MSDB 3PUZA 4Z8XA 4MYTA 1E4VA 4FIDA 1UEJA 4US2R 4E22A 4CEIA 2LKDA 1ZRHA 5F9FA 1XJQA 5JS8A 1E9DA 4TMZA 3IBYA 3JZAA 2IYTA 3GJ3A 5B64A 1G291 2OFOA 4NU0A 1N6LA 2XITA 4A2QA 3P27A 1G3UA 1XX6A 4E03A 3TRFA 4D80A 2VF7A 2V7QD 5IK2A 3IIJA 5DE3A 1T5IA 1TF7A 3A6PC 2J59A 1SKQA 3O47A 3DL0A 2VP2A 1P5ZB 1L4UA 1PUJA 4OKSA 2DBYA 2A5FA 2WWIA 4NCJA 1ZM9A 2XSZA 2BC9A 2HT1A 4JYCA 1NSTA 3T12A 2AKYA 4GP7A 5EUMA 1VHTA 1PLJA 2OAP1 2R44A 1Z6YA 4NYMQ 2BBSA 2B92A 2LWIA 4YMSA 3BK7A 2ODBA 3VR4A 1I4DD 5E95A 4A6PA 5ELXA 5JMTA 3ND9A 3S1AA 2Z43A 1KK1A 5KSPA 4RY2A 1XTIA 2W00A 3LH5A 1P61B 2QL6A 2ZI5A 1S3SA 2EFHB 2VHTA 4YLGA 2WIBA 3I92A 4XSHA 5FTLA 4JIMA 6Q21A 3THXB 4RD6A 4PZZA 3B8HA 4PAQA 3OE7A 4V0ME 2ATXA 4C30A 3A1VA 1QHYA 2D3WA 1J8MF 2IA5A 4NYMR 2H18A 3PIRA 3QKRB 3FTQA 3T5DA 4QKQA 1EX7A 2X2FA 4Q7LA 4FMCB 1GOTA 1IN8A 3CRRA 1E2IA 1FP7A 2GA8A 3AGPA 4JL8A 3B5JA 3TQFA 3ZQJA 1XXHB 1ZIOA 2ZJYA 4AK9A 4LHXA 2DFTA 3KFVA 2O8EB 1QVRA 1IY0A 2DFNA 3ADBA 4IXNA 3KUDA 3C5HA 4NCIA 4Q1DA 4TT3D 1U81A 4G3XA 4F4CA 1OFTA 2C78A 3K9LA 4UJ3A 1X3SA 4M1OA 1DTSA 4OHXA 1YZLA 1Q1QA 2ZANA 3C8UA 5KPJA 3SHFA 4AKHA 4BE7B 2CLDX 2I1QA 2C9CA 1E0SA 2HF9A 5D3QA 3WP0A 4CW7A 1YKSA 1W4RA 3CZPA 1S9DA 5AUNB 2NO9A 3TNFA 2OXCA 3LD9A 2GNOA 2VF8A 4LPKA 3T35A 3ZYCA 3R9WA 4JT4A 2XNDA 3B9QA 3EA0A 4RZUA 1OLOA 4Z1MD 1KHTA 4PQYA 1DAFA 3TUZC 2BKEA 1BO6A 1M7HA 2HCBA 4JBYA 5FPYA 3H4MA 3GFPA 4B3XA 5JI2E 1Q44A 4JS0A 4IDPA 2CJWB 1W36B 4TL7A 3A4NA 3PCRB 2L0XA 2QI9C 2LKCA 2P6NA 4C0BA 2HF8A 2QP9X 1Y3AA 2G88A 4PHHA 1E2LA 2WAYA 4Q4JA 4C4PA 2YNMA 1RPZA 5C4MA 1XWIA 2R9VA 2J7PD 4H1VA 2VHQA 1E9FA 2GVZC 5E7JA 2IS6A 2GWHA 1ZD8A 3RDPA 2E9SA 5JHHB 4DLRA 3ETLA 1FUKA 4O3MA 1R5NA 4KAXA 1GDDA 1X1SA 3L0IB 1GRQA 4P4SB 1H65A 2AN9A 2ZYVX 2JLRA 4Q9LA 3LX5A 3QI2A 1U94A 1KO8A 1Q57A 1E4YA 1COWD 2PZGA 1DAMA 1U9IC 2PX0A 3M0EA 1J99A 1SXJE 2IS1A 4G5SA 1L7VC 3RRYA 4XTRA 2ZAMA 2DWOA 3IHWA 4JSTA 2NMVA 2Q9AA 3GLGE 4HB0A 1XCMA 4ABYA 5KNCA 3B13B 4GNKA 1N0WA 2QPOA 1N5LA 3SC3A 4TLDA 4I99A 3CPJB 3D8BA 3RC8A 2A5GA 2CL7X 3MWLA 3T1TA 3K0SA 4PSVA 1UKYA 2JAQA 1NN0A 1QHXA 2GF9A 4R2IA 1FL9A 1G19A 1Z0AA 4HLUC 1NVUQ 3U61B 1CP2A 3NC1C 1DAGA 2MMGA 4B43A 5GADl 1J2JA 2G3YA 1HT2E 4DUGD 2ZI7A 4ZKDA 2GILA 1KO1A 2HXYA 4M21A 2BCGY 3K0FB 3OIYA 4X8HA 4BUJA 2PT7A 1II8A 5CDFE 4PO9A 1EESA 2VTKA 2ZJZA 2FMXA 4RD3A 3K70C 3E70C 1SXJD 2NO7A 1H8EA 2RGAA 4TL6A 5EP3A 1VYVA 2ZRBA 1VTKA 3E2IA 1JEDA 3ZZUA 5L3SB 4XVUA 3CF0A 3AVPA 2QAJA 3ZH9B 4HYYA 4XH9B 3NH9A 3SR0A 2ZYUX 4M53A 5L3SA 4ILEA 2RGNA 5FUVA 4F7WA 2GEUA 5EP2A 5KTYA 1QHIA 1WDTA 2WZQA 2P2LA 1P3JA 3AP1A 1NNEA 2P65A 3A1WA 3U7FB 4LGMA 5HPYB 1FP6A 2ZU6A 2IT1A 4DLXA 5FOVA 1SVLA 2FV8A 1E32A 3DO6A 1T3LA 1TEXA 2AR7A 3NBXX 4WOPA 1E2QA 1IY2A 1UKEA 2Q0HA 4RFVA 1NMZA 4Q02A 4DLVA 2FWRA 1ZM7A 3CWZA 5LB4A 3GJ6A 8OHMA 5FL7D 1JNYA 3LV8A 4WW0A 2V1XA 2AXPA 1MRSA 2ZYTX 2V4ZA 4UNNA 1G4AE 4XD7D 3MAAC 1G5RA 3TBKA 2XXAA 4B73A 4A0FA 2BWJA 1U8ZA 2X2EA 2ZRGA 3H86A 4KFRA 1S2MA 1N6NA 4HEJA 5G41A 1E2MA 5IT5A 1OXUA 3WNDA 3FPAA 1ANKA 5CK5A 2F1HA 1BOFA 2O8FA 1RE0A 1KI2A 4MRNA 1UPTA 1T8UA 2W0MA 3ND8A 3LVQE 4LSGA 2QT0A 1RVDA 1XXHA 4MKFA 1HYQA 3CRMA 4CT4B 2F43A 4ASUA 4KYUA 4BLTA 2IYXA 821PA 2Q6TA 4LC0A 1GM5A 1G3MA 5HE9A 3WMGA 4NMMA 3ICEA 1W47A 2UVQA 2QMUA 4PTLA 2Q3MA 4TTPA 4Q1CA 3BORA 5EXTA 3RVBA 3O8RA 1HUQA 2FJUA 1E9RA 2IYRA 1G3IA 1QHSA 4I1SA 4LHVA 1AS2A 4M2LA 4W5WA 4DB4A 1UKZA 3R9IA 4G01B 1O87A 1ZJ6A 1MO3A 2CXXA 3IILA 1AZSC 3KJHA 2JASA 4ZIRB 4D4KA 1QHHA 2X77A 5D3MB 1E96A 2YWGA 2JJ2A 3GCGA 3VKWA 5DGXA 5CYPA 5FH9A 3SOPA 1HEIA 1CR1A 1XCPA 4O2RA 5IK2D 2FZ4A 3AKCA 2VQSA 2WJHA 1QRAA 5HE8A 1KI8A 2C9YA 2JJ1A 2XTNA 4EJSA 2PEYA 4NYJQ 1AS0A 1KI1A 3MD0A 4WXPA 1XDBA 4E09A 3LQRA 4HDOB 4CYMA 5C2JB 3B9PA 2NZJA 4NONA 2H8KA 5CIWA 1G20E 5GJVC 3VR5A 1PVOA 5K8TA 3HU1A 4YQFA 1Z8FA 2R6DA 3CX7A 5CLLA 2ZS9A 1OYWA 4G5QA 2DY1A 3MSXA 4C0KA 3E5HA 4KBFA 1T91A 3REGA 2VLIA 1G6HA 3HJNA 4RD4A 4X8LA 3O8CA 2IHYA 4PHGA 3CX6A 5FUWA 4QM7A 4BLRA 1ZD1A 1W2HA 3U7GA 3BOSA 3B82A 4EQ6A 4B6FA 3I72A 1JQJC 5DYGA 4PO1A 1T6NA 4BEJA 1Z29A 3ZS8A 2QE7D 1N0VC 4C7OB 4HDQB 4I4LA 3HDTA 3K9NA 4JKYA 1F2TA 1E2GA 4CEJA 2A3RA 4B2PA 5AWFC 1W0JA 1Z0JA 1HQYE 2CVFA 3FFAA 2ZVPX 5J4YA 3FMIA 1VCIA 2QN6A 4AKGA 1DBSA 3DM9B 1K5DA 1DOAA 1XZPA 2XEXA 2YZ2A 2C98A 3TAHA 1XMSA 3ZZTA 2J0SA 2RHMA 3OFNA 4C0HA 2IUUA 1XPOA 3PITA 2A5JA 1T8TA 2ZE7A 4LWZA 5IRCD 5EP4A 4TN1A 5FUYA 4M1MA 1XRJA 1KJWA 4QBIA 1AQYA 4GZMA 4LY6A 4PC3A 4Q7MB 1F5NA 5JI3E 3FVQA 2WKQA 5KOYA 421PA 1N6PA 4DLWA 3LFUA 1UFQA 2BMFA 1EFCA 1NF3A 2AFHE 3VR2A 4D81A 5SZIA 5KPDA 1OXTA 3CR7A 4JBWA 4KFSA 5EE1A 1GWNA 3M1IA 3W9YA 2FNAA 2Q9CA 1SKYE 1KO5A 2B7BA 4EPXA 5E4FA 3GJ5A 5AJVB 4A0RA 2VBCA 4V0LA 4LYHA 4HZIA 3AUXA 4EKDA 2XNSA 3OESA 4MGIR 3KB2A 5E7IA 3A1TA 1YZNA 2BEJA 5DHFA 2P5SA 5L3RA 4PHTA 4URYR 3SE0A 5GJCA 2ZETA 4QG7A 2ZSFA 4D82A 4HLCA 4A0HA 3N70A 3AGQA 1E2FA 1HA3A 3CO5A 2ZS7A 2KWIA 2D06A 1FX0A 4ZDWA 3THYB 4B32A 4BLPA 2V54A 4TLCA 1L8QA 3W90A 2XZOA 1ZM2A 2VHUA 4NZYA 3WRXC 2FZLA 2ZRAA 3HP1A 2O0KA 4IDOA 1PLKA 1CLUA 2O0JA 5K8UA 1US8A 5A5GA 4DCSA 1FX0B 1DAEA 4OK6A 5FUXA 2JLYA 3THYA 4AKIA 2W83A 3A1UA 1SULA 4NCNA 5FTJA 4Z51A 4W9MC 3NXSA 4DC9A 2ANBA 1JR3A 5AJWA 4DWJA 1US8B 1G4UR 1TU4A 3DVLA 1TMKA 2ORWA 2J45A 3EC2A 4PSKA 1ZM3A 4P31A 3Q7PA 4QJ3A 2ZSAA 1XEXB 4C9BA 3W6NA 4BECA 3EIQA 4IEIA 2ONKA 5B58C 1Q0UA 2RGGA 3ADKA 1GAJA 3HU2A 4PZLA 1XEXA 3QVVA 2FE4A 3MJHA 4E5UA 1F6BA 4BZXA 4TQUS 3KB1A 1JB1A 2BV3A 3NTUA 4NHOA 5TXGA 1KGDA 4MUBA 4DLSA 3WXMA 3IPXA 4TYQA 4AWXA 4KLNA 5J4LA 2ZSBA 4H1UA 4JVMA 3NDBB 4HB4A 2OCYC 5BYJA 3A8TA 1KSGA 3HU3A 1Y63A 2H92A 3GLFA 2P3SA 2Y8EA 1G64A 4Q1EA 5CYOA 3FKQA 2ZR9A 1XMVA 4PX9A 2A5DA 4XJXA 1IOZA 1QHHB 5D3MA 4BRWA 2IS4A 3D3QA 5GVSA 4B75A 4YXWD 4F93B 4OJQA 3ZDQA 4KO8A 4IDHA 2A5YB 4HAUA 5KHOC 1FOEB 1NRJB 4DRZA 1VG1A 2IBMA 3QQ5A 4TTRA 3MFYA 4TT3A 4AC9A 3AUYA 4Q9KA 5BQ5A 2CK3D 4K81B 5DYIA 4ARZB 5TY0A 5FTKA 2JEOA 1JR6A 4DLZA 5J40A 1GL6A 2GXUA 3MWKA 1LB1B 4PSAA 4B2LA 2PCJA 4TYPA 1VYTA 1KY3A 3C41J 1SXJC 4F92B 1KSJA 1X8KA 2BBOA 4DEYA 3VNVA 4W7SA 3QPVA 2J5XA 4TQ9A 1G9XA 4QC2A 5EE3A 4AI6A 4JLJA 3WP1B 4L9WA 1NIPA 2P6RA 2BHRA 1CEEA 2ZE6A 1KDPA 2WAXA 1P73A 1G21E 2GAAA 4IJMA 1FQJA 3AF3A 3B1YA 4FD2A 4BQSA 4CVNA 2VPPA 221PA 3I32A 3SU8A 2BOVA 4C2UA 3VR6A 4WVFA 3HYRA 1YR6A 3VAAA 4DT1B 3THWB 3EZ6A 1TQ2A 4P33A 3LW7A 3WHLA 4LYJA 1HE1C 5G3ZA 5A4JA 2HDNB 5AUPB 2ZQ5A 2D4HA 3GJXC 2AK3A 1R5BA 4G0NA 5KU1A 3GLGB 4Q00A 5GJWC 1OIWA 2F1RA 1WQ1R 3GFTA 3GLIE 5AUOB 3GMTA 4RKEA 3ZD7A 1N25A 2RGDA 3GLHE 5JCPA 2F6RA 3LLUA 2ZU0C 2PJZA 3CW2A 2ZRFA 3EZFA 2E1RA 5EE9A 5F9HA 3KQNA 3G0HA 2ZSDA 2G0TA 1FZQA 5AR1A 2J0UA 2ZRCA 1AK2A 4PQRA 5FBRB 1W48A 1ZNYA 2FN4A 2NPIA 2V9PA 4FMCF 2B21A 1SVSA 1MO6A 2WBLC 3IO3A 2FPLA 1XTSA 1JAIA 3DHWC 3NBZC 4ZO4A 1S9HA 4OK5A 2NOAA 2I1VB 2DPXA 2PBRA 4TTQA 2QBYA 2PH1A 4A9AA 2VSFA 1I4TD 3CRVA 4N1AA 3EWAA 3AKEA 4M1TA 3U7HB 4GRAA 5SZKB 1KY2A 2NTYC 1QG2A 5EXPA 2O0HA 4POAA 4G1UC 1EWRA 5FPTA 3WMFA 4RZ2A 4Z54A 2R6AA 3FKSD 3U7EB 5FTMA 2XTZA 4P3YA 3U6KA 3AV0B 2O52A 4AYWA 4GL2A 1AGPA 2FSHA 1NP6A 3Q85A 2YOGA 2ZREA 4AG6A 4KITB 3IEUA 2PL3A 2PZEA 2JJ8A 2UKDA 2WSSA 4XSGA 2P67A 3U60B 4EPYA 1IXSB 2GZAA 3X2SA 1G7RA 2DFLA 5HZKA 4HDCA 3MJRA 3TIFA 3QENA 1TF5A 4D26A 2O8BA 1V43A 4QNMA 3NH6A 2AD1A 3A1SA 1U9IA 4KHZA 4LJ7A 3TSWA 1TUIA 2VRWA 2W0SA 2J9RA 1N6RA 2FFAA 1T5LA 3PR1A 4AYXA 1II8B 2RH5A 2V6JA 4KFUA 2EFDB 4Q03A 2KI5A 3RHFA 2YOFA 4TLBA 4HAVA 1WMSA 2JA1A 4M1WA 4R98A 3RRZA 1Z5ZA 1J70A 4IXMA 4OQNA 3W6OA 2I3BA 3VHLB 1CU1A 5J5CA 1FTSA 1SVOA 3F0TA 1GILA 4CF7A 2WKPA 3NG1A 1VMAA 4B33A 4IDQA 2AD5A 4QM6A 1Q3TA 1NN5A 2FGKA 4N0DA 4BFSA 1B0UA 3KKQA 4NYJR 4EPVA 4ACBA 4Q4AB 5DHAA 2XTMA 4FWTA 2J0VA 3LBHA 3OEEA 2JLXA 2E87A 1ZW6A 3AVXA 3LLMA 2BCJQ 3KL4A 5TDHA 1DPFA 1E9AA 2GTPA 2QORA 1KKMA 3MMPA 5DH9A 3VR3A 4OI2A 4HATA 5LB2A 4JZKA 1VECA 3CX8A 4KXFB 4GP6A 1EK0A 4IVRA 1J90A 4P0TA 2GHIA 5K8LA 1TQDA 3HR8A 4GPTA 3QPWA 3CPEA 1E6CA 1G5PA 1S8FA 2VP4A 3FMFA 3UXMA 3ZIAD 4M9QA 1HQCA 1IM2A 2SHKA 5FR2A 1OH6A 4A36A 3CBQA 5JECA 5EZ5A 3R20A 1R8QA 1XTRA 5EUQB 721PA 2CLSA 1UM8A 3L8ZA 4QHYA 3BFXA 3FHOA 3UIEA 1E2KA 2PZFA 4RD1A 2NPFA 3VKGA 4LZZA 5F3WB 1KYIA 1KIMA 1FQKA 1T3SA 1MABA 4URWR 2KE5A 1II9A 3QVUA 1Z6TA 1OFIA 2ZEJA 4GFDA 2BKUA 1E69A 2WWXA 4PXAA 2F9LA 2VO1A 3B1ZA 1SHKA 1WBBA 1U0JA 3E1SA 4AIIA 3K0CA 2AKAB 2JJ1D 1W0KD 5DNYB 3EW9A 2QGZA 3RRNA 4Q1AA 2XOKD 1R8SA 1OFUX 3W3ZB 1KK3A 1ZU4A 1D6JA 3W8NA 5EZ6B 1LY1A 1QVAA 4HZUB 2IK8A 2WWHA 3O8DA 3EAQA 1ZUNB 2ZAOA 4HZUA 4FCWA 1N0UA 1XXHE 1XTJA 1BYUA 1T0JB 3CNLA 4DIDA 4Z1MA 1RZ3A 2EWWA 1VYUA 2ORIA 4Q66C 4HAWA 3AF1A 2NQ2C 4PPFA 2WJYA 2PMKA 4QNRA 4OQFA 1RRFA 3R8CA 4TLEA 1ELOA 2C9OA 2EVWX 1U99A 5JS7A 2J7PA 1HH4A 1PUIA 2D2EA 2FU5C 1NBMA 4TMWA 1ODFA 5C4GB 2KSQA 4MGZR 2VH5R 1U90A 3V00A 1AKYA 1YZUA 1Z47A 3DZDA 1WP9A 3KJIA 3L0SA 4RZXA 3RSOA 3ZZ0A 2HJGA 1TPZA 2GK6A 2GJ9A 4PFSA 1JAHA 1GNQA 1ZCAA 1WBDA 3NBYC 1YZKA 3DMNA 5L8VA 1MH1A 1NVWQ 2IXEA 3OIWA 4RCZA 4MDFA 5K8IA 2ZRIA 1W4AA 3MG9A 4TLAA 2OLKA 3L0PA 2IYUA 3SDZA 1GG2A 4IVQA 1KDTA 2ODNA 4QGFA 2ASEA 3QXHA 3SYNA 3OE7D 4QFMA 3EARA 1AM4D 2WICA 4I1OA 1XPRA 3AVTA 3QOFA 4US0R 2Q9BA 4IOKA 3LWNA 2JCSA 3I73A 4UXJA 4ZI2A 1EGAA 1CJTC 3BE4A 1QBKC 1G3RA 2X8AA 1XJCA 1YZTA 3QKSB 3IIMA 1ZIPA 4MRRA 1I4LD 2EFGA 2O8EA 2Q3HA 1NN1A 2ODWA 2ZRHA 3QPUA 1YHNA 1NVVQ 1M7GA 3B60A 3PFIA 3PVSA 5JJIA 2FFHA 2CL0X 1G7SA 3EZ2A 3RWOA 2F1IA 1IXRC 1W1WA 1Z0DA 1S1MA 2WJGA 3BD9A 3FB4A 4KI0A 3RANA 3SI7A 3VFDA 1OV4A 3W6PA 3GJ8A 2O8CB 3FYHA 4NYIR 2QTVB 1NVXQ 1RRCA 1RYFA 3U44B 1MT0A 3OF5A 3GD7A 2O8CA 5DISB 5GJBA 4TYNA 2FSIA 1E99A 4QJ5A 4RVCA 3CNNA 1X1RA 1EFRA 5KNDA 1KDRA 4PPGA 1OJLA 1XFAA 3RRMA 2RHDA 4RJLA 3IUYA 3PV0A 2BIFA 2R8RA 3D31A 4JVLA 1KNQA 1KO7A 3QJYA 3OEHD 1CTQA 4D0NA 3KZ1E 4ESVA 1GKIA 2R6CA 1C1YA 1H8HA 3AKYA 4LBVA 4MUAA 3SJZA 4V0OA 1YRBA 3F8TA 2JDIA 2AXNA 1NG1A 4Q1FA 1S3GA 3CR8A 1Z6AA 1NMXA 2Z83A 3A36A 1G8PA 1CF4A 3KDSE 4A0GA 1IN6A 4Q1BA 5DN6D 4KFTA 3GEEA 5JWHA 3LXRA 1PZNA 2RGXA 1G1MA 4URVR 2ZRJA 3IBGA 3DOFA 4ZI3A 2A9KA 3MRSA 2YYZA 5CLQA 2YC4C 5KDLA 4M1SA 3QF7A 2CL6X 4K46A 1LS6A 3CUEF 5HR5A 4PR0A 1YQTA 2QQEA 3N2EA 2JGNA 4BFTA 2H7VA 2ZR0A 4LOAA 2QM8A 4W5HA 4CIDA 5G40A 1OSNA 5JCZA 1E1QD 5BW8A 2JLWA 4LDJA 1AQUA 5DLQC 2ERYA 2JLUA 3CIOA 2OCBA 3IO5A 4C7OA 2J1LA 2G1KA 3AVYA 2IWHA 3SBEA 4IHQA 2JLQA 4M1YA 4JLVA 5JEEA 2Z4RA 1G6OA 2EFCB 1BYIA 2WMNB 4OK3A 1W36C 4PAOA 2FA9A 2ZITA 3V4RA 5KDDA 4FWIB 2OLJA 4CEHB 4Y0AA 3RS5A 5CITA 2AX4A 1EFTA 1KZ7B 3WY9A 3QSYA 1W49A 2QSZA 3IGFA 1KOFA 1VG9B 4B3FX 2ATVA 4GDFA 2REBA 1NKTA 1DAKA 1IAQA 4B3CA 1E2HA 3J81k 2Z4SA 1E79D 3ZIAA 2QPAA 1LW7A 3AQ4A 2ORVA 2YVUA 3U4QB 3WNCA 2VSOA 1F2UB 2CDNA 2RKOA 1Z83A 4MYUA 4XVQA 3UMFA 1HT1E 2ODEA 1TL7C 4LJ8A 1KMHB 3QF4A 4Q9HA 1WF3A 5L3QA 3SQXA 2HT6A 4G5OA 5FBQB 1JR3D 5CDFA 5FPKA 4OQXA 3UPUA 2H5EA 1AJEA 2PJRA 1QZXA 1NIJA 5B30A 1WRBA 2C77A 2TMKA 3LDAA 4TZ6A 3U3RA 3BIFA 1UADA 2ZI9A 2HCJB 3QY0A 4ZPXA 3T06B 4YMUA 4U7DA 3U5ZB 2ZJ8A 3OEED 4HB2A 1UDWA 4KJZA 1E1RA 1XNJA 4MGYR 5ANRB 1JXOA 1Z0IA 1ZNZA 2BJWA 2X19A 4LV5B 1E1QA 1N3BA 3M4YA 4JLBA 5EE0A 1JQLB 1NVVR 4JMPA 4HUQA 4NH0A 3UATA 4B44A 4KLZA 1DG1G 1VPLA 3B1VA 3BRWD 1Q1EA 2HUPA 3P1JA 4DHEA 4LYFA 5TVKA 4DT1A 3CRQA 1G8YA 1EWQA 3R9XA 4D4JA 1XD2B 5JRZA 2QNRA 2OM2A 3LQQA 4C0SA 1NLYA 2IYYA 4JKIA 4NTZA 4F4IA 4R71A 2HYIC 4CEIB 3EX7C 2ZSEA 3W5IA 3I8XA 1Q22A 2YOHA 4KSCA 1JPJA 3FMPB 4BEBA 3AF2A 2RGEA 1CRPA 2PEZA 1COWA 2F3TA 3LRPA 4KV9A 121PA 4JLPA 2A2ZA 2F9MA 2R62A 2XSZD 2B8TA 1E1RD 1D2NA 4UNQA 4UXIA 4FMDF 4PPNA 1A1VA 2ZI6A 3THOA 1E2EA 1CJMA 5CM9C 2ZJAA 4DJTA 2DWQA 1WCV1 2J0UB 3X1YA 4ESHA 1GL7A 2OXRA 2GZDA 2ZTSA 3AVVA 3C7KA 5BN4A 2N1BA 2QGNA 1XCGB 1IN5A 2K5UA 4Q21A 1BKDR 1GNRA 1EFRD 4JLMA 3U3KA 4FMDB 1JBKA 4TQAA 1UKVY 4TMKA 4Y0VA 4MRVA 1KAOA 2XB2A 3LAWA 4BFUA 2A7QA 1D2EA 3I62A 2OAQ1 1DAHA 1TADA 2CCGA 3PUWA 1CR2A 2ZI4A 2IYSA 3OZXA 4X8MA 3AF0A 3GFOA 2WJJA 5J4VA 5JRJA 5KUTA 1IBRA 3B78A 4DCUA 3BGWA 2QT1A 1CR4A 2BM0A 2GEVA 4RZ3A 2P5TB 5IHPA 2XNDD 4PC2A 4PHFA 1ZMXA 4EPRA 1OE0A 2YC2C 3UG7A 3KKNA 3W8RA 4O25A 1ZINA 4D4MA 4ZCMA 3K9HA 3OAAD 4P32A 2G9NA 1LV7A 3SEAA 1R10A 5TMPA 3EG5A 1I2MA 2ZJOA 4WA7A 5CJ2A 2VP5A 3BH6A 5CK4A 1QG4A 4JJKA 3EWSA 4DDWA 4HAXA 1ZM4A 4A15A 1N6HA 2AWNA 4AKEA 1P2VA 1E2JA 2QY9A 1GVNB 3BB4A 4C3ZA 3IHLA 4GOJA 5HZHA 3T34A 4I1VA 4BFXA 3SYKA 1G7TA 3GEIA 5CM8B 1DE0A 2ZM5A 3AEZA 5FOWA 4YMTA 3LX8A 2WWGA 4EQ6B 1E98A 3LA6A 4OL0A 5DI3A 3AVOA 5FOXA 4DKXA 3PUXA 3QXSA 4GMDA 4Q47A 1XU4A 4BZPA 4AD8A 2GF0A 2QTFA 4F38A 621PA 4LV6A 3EASA 1K6MA 4M22A 4BFWA 2DWPA 3LW8A 2DCUA 3SJCA 2YINC 2WJIA 2CBZA 2QRNA 2HLDA 2V55B 3TK1A 3RABA 4K8OA 4EUNA 1A2BA 2C04A 2IEYA 5FTNA 2GJKA 5J4HA 1OF1A 1TF2A 2AK2A 4IFBA 3KUCA 4M8NE 1TNDA 1A5TA 3RS7A 2QAGC 1OH5A 4Q7KA 4V0NA 2GEDA 1JECA 2FPMA 1T3HA 2QSYA 1DELA 2QRZA 4L8GA 1LTQA 4V0KA 3ASYA 2RAPA 5DN6A 3UMRA 4YC7A 3BFKA 4XVRA 2FPKA 3QXCA 4DZZA 2RGCA 2HXSA 4FCTA 1E9EA 2IF0A 2XX3A 3U4QA 1AKEA 1R0ZA 1OFHA 2XJ4A 5KO2A 4JL6A 3V4FA 1JEEA 2PLRA 1M7BA 1R0WA 1E0JA 2OG2A 1GRRA 2IYWA 3MUFA 1P7CA 4NPHA 1ZYUA 4A2WA 4FW9A 3WHKA 1N6KA 3I61A 2OSBA 4XOIA 4KVGA 4ON9A 1WB9A 3CKLA 5TV2A 3GLIB 4BRUA 1IONA 4KYIB 2FFQA 2DFKB 1EFHA 2YJTD 3SFVA 3TUIC 4DCVA 4MQBA 2JATA 3L8YA 1Q1ZA 1U8YA 5H1YA 1VKJA 1SVKA 2V3CC 2IEZA 2DYKA 1P6XA 2W6ID 4EFMA 4ITRC 2I4IA 5BYKA 2OILA 1F2TB 2ZE8A 3A4LA 1TUEA 1ZNWA 2G6BA 2QTHA 3GJ0A 3RS4A 1T0HB 1ZVQA 3VR1A 2IF2A 1W36D 1NG9A 1U0LA 1DS6A 2QMEA 1VCMA 1UBFA 3DZ8A 3N5CA 2VP9A 4YDSA 4UNRA 3VU9B 1YR7A 5F98A 4ZCLA 5IDVA 1Z0FA 1OPXA 2O8BB 4DLTA 2H17A 4D4LA 2IYLD 4PAMA 4LBZA 4ZDKA 4BFZA 4XTCS 1PV4A 4DIEA 4R7ZA 1GP2A 2FEMA 4QGHA 4OHVA 4LUCA 1G8FA 1O3YA 2GXQA 2PMDA 4Z8YA 2ZRMA 3EPHA 1P9NA 4C2TA 2KJQA 5EQTA 4U00A 1N6OA 3KJGA 4B76A 1L2TA 1SKYB 2QG6A 5JSZA 2VP6A 4R9UC 3L0OA 4RFSA 1OIVA 4E07A 3CLVA 4CGZA 4A6XA 1KDOA 1OHHA 3RWMB 3SS8A 3EPLA 3KXKA 1YR9A 2AWOA 4M9XA 4HLDA 3AP3A 1FUUA 3CH5A 2CE7A 1YVDA 1RYHA 4EPTA 1G8GA 4F91B 4B47A 3MCAA 3OFND 3JVVA 3M6AA 1JALA 2ZRPA 1X8LA 2V6IA 2R65A 1KK2A 3HPQA 4OHWA 1YE8A 1NJFA 5EE5B 1GITA 2DR3A 2PX3A 3CF6R 1M1YE 3K09A 1P72A 4UNPA 2QM7A 1G18A 2BM1A 4NE2A 3ZVMA 2XXAB 2JLSA 3F3YA 2ZS8A 4BFVA 4JLKA 4TWZA 4BASA 1Z07A 2IWRA 1R2QA 2GJAA 2NIPA 2C99A 3Q5EA 1E9BA 3BBPA 3PEYA 1D5CA 4IEEA 4ARZA 2RGNC 2F55A 2ECKA 3NHAA 4JSYA 3ZLJA 1KZGB 3B6EA 4TMVA 1FMJA 3RC3A 2ZXUA 2XJ9A 3D6TB 2OFXA 1CXZA 2F43B 1I2DA 4NYIQ 3KTAB 1UBEA 1MO4A 1W2GA 1G3QA 1HTWA 3EXAA 2WVJA 5AK0A 3W5JA 3FE2A 4GOKA 5JBQA 1NY6A 1XD8A 3LBIA 4Q19A 2OBMA 4QGGA 4OQLA 4DCNA 4MKGA 2ZJ2A 1QHGA 2BVNA 2GCPA 2REOA 4FN5A 1UEIA 2F1JA 5UKDA 5FBLB 1RRPA 1Z6GA 5J4KA 3AH8A 2EW1A 2C03A 1EXMA 4KODA 1UJ2A 1W4BA 3SJAA 1VIYA 2IXGA 3DOEA 1MRNA 4MYHA 3VTKA 2P0EA 4IOLA 3QUSA 3GLGA 4LJ9A 4XWAA 2ZIAA 2GBLC 4QXAA 4NCKA 2PCLA 4B48A 1IQPA 5B57C 5C18A 1FMLA 4TSFA 3TE6A 4A92A 5L3VA 4JLOA 2J3EA 5BN3A 2KB0A 5KYKA 3CM0A 4TZ0A 4U5XA 2A30A 4HUTA 3Q3JB 4WZBE 5JWOA 3ADDA 1P62B 5EJEA 3A4MA 1ZUIA 5HCNA 2QENA 1GKUB 2G83A 4QOSA 3WBKA 1S1CA 1GIAA 1JXMA 1P60A 1BMFA 2B8WA 2GCOB 3R8FA 1S4QA 2WWFA 4ZDJA 2QE7A 4TYWA 1HURA 1IJFA 5EP1A 4LJYA 3SJBA 4RSGA 1GFIA 3C15C 2W2XA 2VP0A 2BEKA 1SHZA 5FOTA 1IJEA 3ZVNA 5LDDC 3FMOB 3OIVA 1XPUA 1XTQA 4LBWA 5BN5A 1GNPA 3GLHA 4KSBA 1JI0A 4NL4H 1TTTA 4D0LB 3BXZA 2D7DA 1E0AA 2FH5B 4DSUA 2G0NA 2D2FA 3TVDA 4BGDA 2BMDA 3GLIA 4LI0A 5C1BA 4XIGS 2AHOA 2HLDD 4WZAE 5DO9A 1GKYA 3K0AB 4ERNA 3KJEA 2FFBA 2WPDA 4IKEA 4L16A 1RKBA 2VHJA 1OIXA 1SZPA 4Q9IA 5J47A 3B85A 4D0GA 5FBVB 1YRAA 1UAAA 4EPWA 3K0CC 3C5CA 4S35A 1X8JA 3ZS9A 3TR0A 2JIZA 4TL8A 4QRHA 5CB8A 4LCBA 2CJWA 3H1TA 3T5GA 1SGWA 1PLLA 3X1ZA 3TJZA 1M8PA 1FW6A 1M74A 5E7MA 3TR5A 2ANCA 3P4XA 4XD7A 3ZGXA 3TMKA 1AGRA 3PUYA 3TUJC 3K0FA 3LXXA 1U8AA 1D9XA 2HEIA 2Q3FA 3B1WA 3F5FA 2GESA 4WIAA 1F2UA 4OI0A 1CKEA 1U98A 1TAGA 1YZGA 1FTNA 1Q21A 1OT3A 4BLOA 4IOMA 2YWFA 4B3BA 1G7CA 2WWWA 1AIPA 3DMDA 4P4SA 4B6EA 5JFGA 2ZJ5A 2CCKA 3PENA 3QEJA 4A82A 2GZHA 2VA8A 4Q9JA 5F2EA 3T1VA 4HSEA 4HLUA 4LYAA 2FDCA 4BPBA 2HV8A 2B7CA 1DADA 4MRPA 3KXIA 1ZD9A 1IHUA 1XMIA 1XZQA 2IYVA 4TSFD 2AL7A 2D74A 3K9GA 3NKVA 5FOUA 1A4RA 4LV8B 5JEDA 1DO2A 2IYZA 2YWEA 5SZJA 4MDEA 3EPKA 3R7WA 1KSHA 4FINA 3TSOA 4M9SA 4O0MA 2BBTA 3GQBA 1Q1BA 4RD2A 4GI7A 3C14C 4EFNA 1F60A 1A7JA 1YZQA 3K70B 4P4TA 1KKLA 2F3RA 3TKLA 3AB3A 2CK3A 2QROA 3WYFA 1TEVA 3QG1A 5FI0B 3LNCA 4DXAA 1E2NA 2G1JA 3DEFA 3DM5A 1NBMD 1P2SA 3ZVRA 1E9CA 1R5OA 3K09C 2OCPA 3THWA 1CIPA 1XEWY 2R6GA 4IDNA 4JJZA 5AJYA 3U6BA 3L43A 3MWJA 2W2TA 4JLDA 1R0YA 4B74A 2WTUA 1V5WA 4M0LA 4D2IA 4D6PA 5KNBA 1NLFA 1XEWX 4DVGA 3EIEA 2W6JD 3AM1A 3KXLA 2ZJBA 3GP8A 2UZIR 1Z3IX 1DG3A 2J87A 4Q7JB 3OHMA 5CB6A 3NHBA 3K1JA 1RJ9B 5EXSA 1W5TA 4EJSC 2KBEA 3SZRA 2R6FA 2GXSA 4FMBB 4ZV4A 3SFZA 1KO4A 1ZU5A 4JVNA 3IKJA 4DDTA 3RAPR 4XWOA 4MYCA 3TH5A 2XGJA 1OKKD 2JIZD 2WM9B 4J0QA 1GRNA 1S96A 4DLUA 3KKPA 1XTKA 1KI3A 3AF4A 3A37A 5GVRA 2WOOA 4LK2A 1KI9A 1Z22A 2VIIA 3TW8B 4LBYA 4B3DA 1UBCA 3THXA 2VL7A 2C8VA 3BJIC 4PQFA 1VDZA 2FEOA 2VYFA 3U2QA 2VSXA 4Q01A 3RS3A 4A1FA 2BDTA 2Q21A 3Q7QA 2CE2X 1JR3E 2CHQA 3H2YA 3K0EA 3VX4A 3QKRA 1DARA 4EJSB 4MRSA 4DCTA 2D7CA 4LJ5A 5H68A 1E94E 3NBFA 4PC1A 2ZROA 1W7AA 2QZ4A 4V03A 2B6HA 5TB5A 2IUTA 3P20A 1ZNXA 3EA5A 2Z6VA 2O8FB 1ZC4A 2NZ8A 2YWHA 1LNZA 3U3JA 3VKHA 4WBSA 3QE0A 1ZAKA 3PEWA 2H1LA 1G17A 3IIKA 4URUR 3X1WA 4AY2A 2ERXA 1QHNA 3FWYA 1KTVA 2WSSD 3L82B 4US1R 3PEUA 3X1XA 1M34E 2ZUCA 3KQUA 5G3YA 4KU4A 2CVHA 1WA5A 4Q4HB 5LBIA 4B34A 1QF9A 1H8ED 2CCJA 4BLQA 1SQ5A 3U3OA 1EX6A 2QEQA 5E3HA 4Q4HA 3BH0A 5HKKD 3FGNA 3FHCB 1MKYA 3NVAA 1KJYA 5HTKA 4UJ5A 2O5VA 2JLZA 1KI4A 1P2TA 2BJVA 3QBTA 3EZ7A 2A78A 3SN6A 4TMXA 3FOZA 1VCOA 2IUSA 3GJ7A 3BWDD 3KKMA 4JT2A 2YKGA 3VNUA 3BFVA 1GZSA 1R6BX 5AJZA 3LBNA 1CJVC 5P21A 2J41A 4GZLA 2XZPA 1U2RA 5KSZA 1E2DA 3ASZA 3TLXA 1OXSC 1BMFD 1CBUA 1JJVA 3GLFE 1Z6XA 1T9HA 3Q72A 4QBGB 2W6JA 4YMVA 2LCFA 4QHSA 5JJLA 2REXB 3DDCA 3U44A 4MH0R 2EFEB 3L2OB 3W3AA 2BBWA 2EU8A 3HR7A 5M04A 4MA4A 3MWYW 3GEHA 4FXPA 3ICQB 2EYUA 3UKDA 1CS4C 4LJ6A 3SYLA 3UMSA 2XOKA 4GT1A 1F48A 1WXQA 4MITA 1D9ZA 1OXVA 3TGPA 1Q12A 2D62A 3H84A 4L4UA 4EDHA 1X86B 1NI3A 2IC5A 4I1UA 2DHRA 1XF9A 2PLFA 5FL3A 2FOLA 1NN3A 3FKSA 1D2MA 3UK6A 1XP8A 1XMJA 4N3NA 4MGKR 1P9RA 1OYYA 3UWOA 4ASUD 4QHTA 4BZQA 4C0AC 1VCNA 1Z0KA 1N6IA 2J0QA 1H8HD 2CNWA 3QXJA 4MKIA 5FPSA 5G53C 1XB2A 3ZJYA 2ZRNA 5HKKA 4YDHB 1E0KA 1OKKA 1W0JD 2MSCB 4DSOA 2W58A 3KQHA 2DB3A 4LHZA 1PJRA 3C4JA 1F3OA 1II0A 1KMQA 2C96A 4GOXA 4L9SA 5C46F 4KBGA 2RB4A 3HPRA 3KX2A 1UDXA 4BWYA 2ZYWX 4V02A 3EC1A 2J7KA 4QJ4A 4S2EA 4DSNA 3I4LA 2R2AA 2ONJA 2BMEA 3FHTA 2EYQA 1K8RA 4M4SA 1TQ6A 3W34A 1LFDB 4Q18A 4IOJA 3UANA 1Z2CA 3REFA 1OHHD 3V9PA 1VHLA 4GMXA 4HB3A 1D8TA 2ZVQX 3B1XA 2OO7A 3QNUA 4M9ZA 5DI3B 3TQCA 4CRWB 2JDID 1CJKC 4NBSA 1FNNA 4QBFA 5FPHA 3CPHA 4IW3B 1HE8B 2WOJA 1NY5A 3RYTC 4F4JA 5IF9A 1P4SA 3Q5DA 1IN4A 4B3GA 5JSZB 2ZPTX 3WRYC 3A58B 2QA5A 4Q4AA 2OCAA 4YXWA 1NL3A 1K5GA 5BXQC 2N42A 1ONBA 3U3MA 3PUVA 3MLEA 1KI7A 2QAGA 2QQ0A 4KCGA 4A8JB 4FI3C 4MKHA 1HY3A 4ZCIA 4B2IA 1RJ9A 2HJVA 4BFYA 4EFLA 3SQWA 4OQMA 2GKSA 1ETUA 4A8JC 3DKPA 4QGAA 1AN0A 5EXXA 1RRGA 4PO8A 1J7KA 4WAUA 1G5TA 2OFWA 1RIFA 2OESA 2XB4A 3TSZA 4D25A 2IS2A 1LF0A 2X1VA 2CMKA 4LPSA 4AURA 2JJ2D 3CONA 3RNLA 2EQBA 1ZBDA 3BS4A 3RLFA 4OI1A 1KNXA 3VMFA 4UKDA 4UXHA 3T61A 2ZI3A 3GJ4A 3BERA 3NIBA 1C4OA 4Q48A 3B2EA 1G8HA 2PT5A 2WKRA 4GBMA 1LF5A 1T4GA 3ZD6A 2IW3A 4HI0E 4KVAA 2O8DA 2QP4A 2IXFA 3KTAA 1A82A 3I3SR 1FNMA 2Z0MA 3EIHA 1Z2AA 2O8DB 1YU9A 1RW4A 1TU3A 4ZDIA 2CLCX 1UF9A 4W5JA 3ADCA 1CULC 1Z28A 1KAGA 3NEJA 4R2HA 4FCVA 2OE2A 5JLJA 3C16C 3ONWA 2JLVA 4CEHA 5KDOA 1MV5A 2XAUA 1DEKA 3WMEA 3CNOA 3VU9A 1NKSA 2CHVA 3EPJA 2ZR7A 4CT5A 1CRQA 4TYYA 1XD2A 3FDIA 1QDEA 2CHGA 2FGJA 5FL7A 2FSGA 3HWSA 4PANA 1TQ4A 3KQKA 2WIAA 3NDPA 2CNWD 2WWYA 3O8BA 1CJUC 4UNSA 1VG0B 4TL9A 4DDUA 3PJRA 2V8OA 5DI9A 1EG7A 1SXJB 3NC0C 1IXZA 3PQCA 1JJ7A 3B7GA 2ZUDA 3AP2A 4JLNA 1CR0A 2H16A 5FR1A 4AYTA 1RC8A 1NJGA 1DO0A 1TX4B 1ZC3A 2Z5FA 521PA 4RFSB 1WE2A 1XD9A 3G82C 2H57A 3H0KA 3BB1A 1LVGA 1W44A 2OUKA 3BAFA 3IQWA 4P4UA 2GCOA 4HLQB 3BC1A 5SZHB 5KSYA 1KSFX 1XBTA 1SVIA 1W5SA 1HV8A 2WMOB 4RCYA 4DLYA 1R7RA 3S1AB 2GJSA 1Q20A 3WBJA 1SVMA 4IFEA 4OBEA 1S0UA 1N5JA 1OW3B 3OIUA 3CB4A 2YV5A 2QMHA 1W46A 1GTVA 2W2VA 2OBNA 5DIFA 4RKFA 3SHWA 2QBYB 1NBME 3OAAA 2NO1A 4LHWA 4YONB 2GRJA 5TARA 4DBLC 2GK7A 4QBHA 3VHXA 1SVWA 3DPUA 3WYAA 1R4AA 2C2HA 3JVUA 1N5IA 1BS1A 1X6VA 5AJXA 1LS1A 3K0AA 3IPYA 1GL9B 1KJZA 4CDGA 4WZ6A 2HYDA 4OHZA 2FG5A 4JYBA 2WPDD 4IRUB 3QKSA 4PPQA 3FFBA 3T1QA 1OB2A 4ZKEA 4G5GA 1ESNA 2WV9A 4QL3A 5AUQA 3VQTA 2GETA 4A2PA 4JL5A 3IQXA 3ZQ6A 4X8OA 3RS0A 4LHYA 3SBDA 4JVSB 4B35A 3I1FA 3LVRE 3T1OA 1G41A 3KFXA 2OHFA 3T15A 4NKRA 2RMKA 4DEXA 1DAIA 5FBWB 4URXR 2F7SA 4A4DA 2ZE5A 2GCNA 3QXXA 4I81A 2OBLA 2KBFA 1NSFA 3KQLA 1A2KC 4ACAA 4BLSA 1OXXK 1OB5A 4HAZA 5HCIA 5BWMA 1J8YF 2WHXA 5JZVA 1L4YA 5A0FA 3CF2A 5LPNA 1GSIA 1OH7A 2WJVA 1IY1A 3Q9LA 4GSYA 4ZIRA 1ZUHA 4PC6A 3AVQA 1ZCBA 4H9GA 2WSMA 4XWKA 2XZLA 1MO5A 5FOSA 3QKTA 1MR3F 1W0KA 2EWVA 4LJAA 4Q4LA 2NO6A 3CH4B 3TVTA 3OEHA 3TAUA 1KK0A 4G5RA 2IX3A 5H70A 2N46A 3RSLA 4Q5IA 5B2ZA 5KSOA 1E2PA 3I5YA 3AKDA 3QG5A 3R7WB 1ESMA 2V7QA 2QUZA 4OI4A 5JJKA 1FFHA 3QEOA 1Z63A 2AFIE 1XEFA 4PZYA 2P6UA 2GDJA 3NEYA 3UG6A 3K70D 2GBLA 4M1KA 4L15A 1KI6B 1Q3HA 1YR8A 1MOZA 4N0EA 1FPMA 3WNBA 4DSTA 2W6IA 3ZVLA 1E79A 1KI6A 1P2UA 3GPLA 2BMJA 1U0HC 2VEDA 2G77B 2IHBA 2RGBA 4LC1A 1W4CA 3GLHB 4LX0A 4B71A 3BH7A 3RS2A 4V0MA 3PXGA 3AVUA 5H8WA 1MABB 2QPTA 2OEPA 2OV2A 2OZEA 3Q8XB 1VG8A 3PG5A 4LJ4A 1AA9A 1N5KA 2MSEB 3LO5A 3WYGA 5JWRA 2FF7A 2YHSA 2OT3B 3TW4A 2RCNA 3G5UA 4TMTA 1B23P 2GJ8A 3K53A 2QAGB 2IL1A 3QBVA 4A8JA 4CEJB 1M6NA 1NLZA 1Z08A 4PC7A 1DVRA 3X1DA 1NMYA 3EZ9A 4YMWA 3IDQA 4NCHA 2QU8A 2FSFA 4DB2A 1AZTA 2NGRA 4Q4JB 3MGCA 3SNHA 4C0QC 3GLFB 5DSZA 1E3MA 3K8YA 3QIAA 3I5XA 1G16A 3JZMA 1N2CE 2NG1A 3P32A 2ZRKA 2MMCA 1BH2A 3PEVA 2IYQA 3P4YA 4NP6A 1EFUA 2ZRDA 4EIWA 1UBGA 2ZRLA 1KMHA 2NO0A 2UZ3A 3QF4B 4JLAA 2C95A 3ECCA 5L3QB 4II7A 4CZ2A 2J46A 2C5LA
chains in the Genus database with same CATH superfamily
1PT7A 1O2DA 1WHSB 3KEOA 5DCUA 4I2VA 4QXPA 1SXJA 5ERGB 1RLIA 2OV1A 5FBHA 1R0XA 2VSQA 3G02A 3ZN2A 5I7HA 1N5MA 5AVTA 3IEVA 2R7LA 5AW0A 4PBSA 4N4AA 1NRXA 1VHWA 4L73A 3EF3A 1M1ZA 1T6ZA 1X1CA 3ZE2B 3REFA 4HFMA 1FFSA 4URZR 1RJFA 2CEAA 1T9CA 5FFMA 5LD2B 5LHIA 2A0FA 1PK7A 3I8SA 1GUAA 1IURA 3P71T 4HAYA 4KE8A 1QRTA 3FB6C 3EGDA 3PDJA 3CRW1 2Y2UA 4WXRA 5FI1B 2V1UA 5DBHX 1UXGA 2C2MA 2TRSB 4FJ1A 3P26A 3L7NA 4XIYA 3H2IA 3STXA 2P27A 2VHEA 1UBTS 3CWQA 4MW2A 2FX3A 2QP3A 3AHEA 4U02A 5IF3A 4N0MA 1IN7A 1EVLA 3VDRA 5CIQA 1BD4A 1MEJA 5L3EA 3IT0A 3UYKA 5KQMA 4K88A 1DK1A 4Z8XA 5AM5A 4FZ5A 3IP7A 4PYIA 4E22A 5JARA 2H51A 3ICOA 3RLIA 2RC5A 4E4TA 4IMJB 1XJQA 2HEPA 2XMCA 5BWBA 1FCJA 3REOA 5B64A 2TMYA 3ISVA 3A26A 3ZDXB 5C9ZA 2OC9A 2REQA 4ZHQA 1SOVA 3P27A 3OOYA 4B6GA 2X8BA 3I1JA 1DJLA 1EFPB 2YXHA 2V7QD 3PXBA 5DE3A 1GPUA 4GEGA 1GGEA 1KOGA 1Y76A 5TIIA 4Y6GB 3FUUA 2A5FA 2WWIA 1CK4A 4OJMX 1ZM9A 1G2IA 2BC9A 2XSZA 4JYCA 3UO2A 1NSTA 4I3GA 3GJRA 2HT1A 1H38A 3H8JA 4N7RA 2OFPA 2J0EA 5DCWA 2VTEA 5EUMA 1VHTA 1TTQB 5A0TA 1PLJA 2NU8B 2R2GA 1YNSA 1BD3A 2P7TC 2BBSA 3KTOA 1EFRG 1U3CA 2LZ0A 4YMSA 1SXGA 1A50B 3HCFA 3RUAA 1MAHA 1IPFA 1ZISA 4I9HA 4OU5A 1AI4A 2WYHA 5FULA 3S1AA 4EVIA 1WMBA 1KK1A 2FVXA 2VDLB 2ENUA 4RY2A 5ALSA 3UYLA 4YXWG 1ZN8A 2W00A 3GBPA 1WXIA 5ILGA 5A9SA 3LH5A 4Q6WA 4FM0A 2Q1YA 4N5LA 4R31A 4BJ6A 3OMNB 5CTJA 1A4IA 2NZUG 2QNBA 2VHTA 2X3FA 3DFKA 3PA8A 3T8YA 3UFBA 4XSHA 2XCTB 4YAWA 5IULC 5MN4A 1EDBA 2CZQA 3TS1A 2GTAA 3BL5A 3QV1A 2PK3A 1A9SA 1BCRB 3GUZA 3L05A 3O4FA 1U7WA 3P9XA 1Q0ZA 4QQNA 3SQOA 4RZQA 1SWWA 1ZVVA 2ZT7A 1WEKA 4V0ME 4C30A 3LUGA 4LHEA 2EKDA 1QHYA 4MI9A 5AKHA 2D3WA 1J8MF 2RGYA 4ZANA 2F8LA 2C4TA 2NZYA 3IB3A 3FTQA 4BNGA 4N18A 4R0MA 2QX8A 1JPXA 1D5WA 2FR0A 4MVOA 3QPBA 4I5EA 4ZEMA 4UUPA 5LHHA 1XRLA 1FP7A 3AGPA 3CRAA 1ES9A 4LKRA 5K3SA 2BEVB 3TQFA 1YVEI 3K8QA 3QFRA 2ZJYA 3ZQJA 5AHXA 1P2BA 1E77A 4PWYA 3QX8A 4EJ2A 2WU8A 2DFNA 2R96A 3DNPA 3N6XA 4IXNA 2DT8A 4X64O 3DAHA 1NGSA 4KO3S 3C5HA 4F4CA 3RT9A 3K9LA 3TNJA 1ZN7A 4FOLA 5BP7A 2Z09A 4MUFA 3TXAA 1DTSA 2ATEA 3IYLW 4Q9NA 3A2KA 2YRFA 1Q1QA 4EVQA 5KPJA 1VSVA 2AF3C 5LBTA 3MGKA 4IJ5A 2YWRA 1WAZA 3L71H 2AC4A 2CSXA 3P5BA 2I1QA 2C9CA 1E0SA 2AS0A 2POQX 1SJ9A 2WMDA 1YKSA 2X9QA 3ETCA 4HFJA 5D3QA 4XQ9A 1W4RA 3WZMA 1EJBA 5F1PA 2IEAA 4JROA 3HCNA 2HLDG 4BO1A 1GN6A 1WCWA 2YWBA 1T1GA 3DD5A 3RODA 1NYQA 2HRBA 2VT2A 2A94A 2GNOA 3BVPA 4EHDA 1RKVA 3B52X 2O6LA 4ZIBA 2YASA 3AERA 3B9QA 3H9EO 4QUBA 3ZYCA 1HR0B 1OLOA 5JAIA 5K6AC 3LDCA 1KHTA 2EARA 4WK2B 4PQYA 1VMEA 3NHUA 1RAGA 1DAFA 1UC4B 4IIYA 3F6RA 4IM7A 1T1JA 4MVJI 5L4NA 2SKDA 4JBYA 4FFOA 4B3XA 3JYQA 2HHAA 2OKCA 3H5OA 3NAMA 3OPXA 1Q44A 1GZVA 4JS0A 4LZAA 3WAJA 3LT0A 1DV2A 1DG9A 3RU2A 2GO1A 4BBPA 3PCRB 4OXKA 2L0XA 3IXMA 2QI9C 5BWLA 2FUKA 3EISA 1TEHA 2FMHA 4H7FA 4IWYA 4EGJA 1PL8A 4Q4JA 2IYEA 4ID9A 4MVJE 4XUCA 2IKQA 1ZY2A 4RABA 4E70A 2QWRB 5FT9A 2Q4PA 3TECE 3RC9A 2IODA 2X23A 1E9FA 4I5IA 5BV0A 4WFBV 2EF0A 4QLOA 4CH6A 2P6MA 1YVRA 5DN6G 1XJ5A 4P3XA 4XRRA 1JV2B 2FCRA 1RFYA 1S0VA 4XCQA 4FYMA 3RBXA 3WX0A 2V59A 1UK9A 4DLRA 2B25A 1X70A 3GRUA 1R5NA 1I9GA 4R5MA 3GK3A 5IT9A 1GDDA 4YRLA 1N33B 5BSUA 1QO9A 2AN9A 2DUUA 4KXWA 1RWBA 2MSLA 1AKQA 1GHTA 1QAOA 2P9FA 1LTHR 3P97A 4IQ0A 1SQ6A 4RNDB 1E4YA 4LRSB 1SXJE 4G5SA 1L7VC 2V6MA 2HJHA 4PICA 3CCLV 3HP4A 3WYDA 3GWKC 5B1BC 4DM4A 4TRMA 2C7BA 3K58A 3K3WA 4HB0A 1RMYA 4ABYA 3IP5A 2X41A 2CUTA 3K2BA 3JQGB 1N2EA 2H2DA 2ILTA 4LVNA 4YP6A 3OOEA 4ZQCB 4JNCA 3SC3A 4YPFA 1O6GA 3D8BA 5LMNO 4W7IA 5DOVA 2A5GA 2GYYA 3MWLA 2DBZA 3ZBHA 3IE2A 3AWDA 4ZRNA 1UKYA 1B4DA 2IPXA 1NN0A 1QHXA 3I55V 2JAQA 2NVBA 3C6KA 3HDVA 1G19A 4R2IA 3CTPA 1JOYA 3DJFA 1JEYB 1FYWA 1ODKA 2W6NA 2PT9A 5I4BA 1P5JA 1J2JA 5K01A 5GOZA 4MVCA 1HT2E 1KO1A 1T9DA 4QUGA 1JLLB 1O94A 2QN1A 3OIYA 2FG6C 3Q2KA 3QWFA 5GONF 2YFYA 1WU7A 1XC7A 3FSRA 4N21A 4L74A 4W6ZA 5LMCA 3KP1A 1EESA 5MDHA 1X13A 5K7SA 1PQ4A 1SXJD 2WM3A 3E70C 2JRLA 2C2WA 2RGAA 3K1YA 5SICE 1SB8A 1XFDA 1I4EB 2PRYA 3E2IA 1JEDA 2OIEA 4J75A 4V0QA 1RJEA 3CR3C 3ZZUA 4XVUA 2C00A 1EX9A 2YBEA 4LZOA 3B1KA 4X62B 5EKDA 4XH9B 3NH9A 5I47A 5KNDD 5DULA 4H3VA 4Z4GA 4M9UA 1IZ0A 2ZYUX 3HN7A 4M53A 4OGWA 1R6NA 2RGNA 1G4YB 2WT8A 1Z5GA 2W0FC 5FUVA 3UOAB 1PZHA 1PGJA 3HYCA 3UGKA 2EINB 1T0UA 5A4AA 4HNTA 2Y67A 3CVXA 5FLKA 2D1SA 3UUGA 4MHSA 2VRNA 1KQNA 3A1WA 4YAKA 3ER9A 1LDGA 1OCRC 1FP6A 2FPSA 1XNHA 1A4XA 4R8VA 1N2BA 5K1XA 5AXDA 3DO6A 3R41A 1IAVA 3I3OA 5DMXA 1CJSA 5KNBH 2MINB 3IR5A 1H22A 1I4OA 1VL2A 4DA4A 3NBXX 3Q9NA 3LXMA 1H2EA 1E2QA 1AK9A 2Q0HA 2Y4TA 1NMZA 2DWEC 1ZM7A 3WAKA 5LB4A 1GGNA 5IVPA 1DFHA 1OXMA 3IGAC 4DR7B 2VJYA 3BG5A 1JNYA 1YA4A 3GJ6A 3U39A 2PBZA 4WW0A 4ENTA 3CLSD 1PDWA 1NP7A 4UNNA 1QIJA 1SOMA 3H1AA 1B74A 3FDJA 3A1DA 2GPYA 3NDJA 5IAGA 1VJ0A 2Z3WA 3BEHA 5AHKA 2AKEA 1N5DA 3PDCA 1N8RW 1IOLA 2BWJA 1KPGA 3WIVA 4BGVA 4YQYA 5G41A 3OM8A 2WG2A 1NXWA 4PLGA 4EFKA 1NVTA 5EHXA 4TVBA 2AOUA 1CS0B 1QFJA 2GN2A 1UPTA 3E7XA 5FPPA 1FVFA 1BSVA 2V7EA 2W0MA 2M7WA 3ND8A 3WLIA 4UTNA 1TXGA 4LSGA 5AHOA 4PFQA 2FKNA 3CRMA 3ZUPA 3QEKA 4U2GA 3VHQA 2VUHB 4FYPA 4CT4B 2IQ5A 1MB2A 2R8PA 2Y48A 2YVAA 2PWZA 4KYUA 3CLKA 4ASUA 4BLTA 4KI7A 5B6JA 3CUSA 1FFYA 4LC0A 2NU6B 3FZQA 1G3MA 1GM5A 5EN4A 3KD3A 1IVSA 4BB9A 5CFRA 4XQCA 3OZ7A 4NLLA 3USCS 4UPEA 2C7RA 4PTLA 2Q3MA 4Q39A 1L7RA 3RVBA 4AW9A 4ED9A 3O2SB 4WZBB 1HUQA 2FJUA 1E9RA 1VKHA 1G3IA 2JJYA 3DEYX 3PQ3A 1KQOA 4I1SA 5ESRA 1H5UA 2YMMA 3N0TA 2HNAA 1ID1A 3R9IA 4G01B 2ZJ3A 4ZEVA 2RHOA 2JAUA 3LY7A 4IHJF 4P35A 3IILA 2YMQA 1V39A 1AZSC 2HRCA 3ANXA 2I3ZA 3QK7A 2F3PA 4LY9A 1EWYA 2JASA 4ZIRB 1QHHA 5C7LO 3R0VA 3LL7A 4LMAA 2OWOA 4U9IS 1FXKB 3HBNA 5AW6A 3GYBA 3PVCA 1KARA 4X44A 1OWNA 4BMYA 3GCWA 4JC0A 4R2JA 1CR1A 1Y1KE 3ZD8A 2ZXFA 3AEKA 3FDZA 5ENZA 5IKOA 1MU0A 2WJHA 3AETB 2J9ZB 3LZCA 4RKWA 5AOCA 5HE8A 3ZDCA 2JJ1A 2XTNA 3ILHA 1V48A 1V1RB 2RSLA 3V48A 4ABTA 3PL5A 3PT9A 1M90W 1ZKDA 3IX7A 2PEYA 4JU8A 1RJDA 2ATCA 2PAFA 4H59A 1Q84A 1QH1B 2YZGA 3OBIA 1AS0A 2CGNA 4NYJQ 1KI1A 1MMFB 2PWPA 4RIIA 4CF3A 1Y8AA 3LQRA 4CYMA 4XJTA 3AZPA 4FNGA 4YCBA 4H37A 2H8KA 5LZ8A 3PTLA 5K8TA 3HU1A 1Z8FA 1NW9B 1BU5A 4H3SA 4MTLA 3C5WP 1KYZA 3QUAA 1WVMA 1BKSB 3RV3A 5HIAA 2DY1A 3MSXA 4C0KA 1VPVA 1DTOA 1JEAA 1OXKB 3R6DA 3ROMA 5K0CA 4F3CA 2X0JA 4PJ0Z 2PT6A 1I7SB 1H0RA 3ZWPA 5CLFA 4BP3A 3CX6A 2EW8A 1HDOA 3PI7A 2A79B 3OUZA 4OQZA 4Y6QA 3RVKA 1TAQA 4GR9A 2HFEC 3X2FA 3BOSA 1G55A 4Z4QA 3KD2A 3NHYA 3NM6B 3DLIA 1R1DA 2C84A 3IDAA 1T6NA 1ODLA 1PGOA 1KZYC 2QE7D 4N12A 3V8EA 2EKBA 4QTZA 3CJRA 4U63A 2K1EA 2A7WA 1RYEA 4X6UA 4QICA 2QJRA 2YIMA 1ORIA 1DIGA 3RD5A 4BGIA 1HWYA 4JKYA 1EUDB 3HRHA 4GR4A 4TWJA 4YREA 1QQAA 2E76B 4BXOA 4UHCA 1JKXA 3WGIA 1HDRA 5J4YA 2ZVPX 2CLLB 3DOUA 2E7ZA 2CNLA 3DWIA 3FMIA 3OX2A 2IXTA 4RV9A 4LQLA 4ICIA 4D7TA 1YV9A 4L4XA 1JT2A 5JNVA 3QE9Y 3C0KA 1YVPA 2O3QA 2F9FA 2JFQA 3OZAA 4QXMA 1LSOA 3NHKA 1DOAA 4RQEA 2XEXA 3TAHA 1GPLA 1E1RG 1XMSA 2CBXA 4UVHA 5FIUA 3COYA 3ZZTA 5A6SB 1C1HA 2PR7A 4C0HA 5BQXA 1XPOA 2C3UA 1FJGB 1DWUA 1MIHA 3NR2A 1T8TA 5IRCD 2C54A 4TN1A 4M1MA 3ZWDA 3L1UA 2R8YA 4QBIA 1AQYA 4GZMA 4LY6A 2AW3A 4P81A 4X3OA 3OQOA 3FVQA 2WKQA 3L7JA 4C89A 3LWDA 1Z2NX 4MYSA 1T1SA 4A03A 4CWAA 4I8XA 2BF7A 1F7VA 1UFQA 1NF3A 3EQ6A 4DQLA 1XRSB 2OIGA 1ZCZA 2WU4A 2ZTMA 5EAIA 4R8MA 5SZIA 3RJTA 1OXTA 3ILYA 3E5NA 4LY3A 2ZXWB 1H1TA 4YI3A 2ZB2A 3O7WA 5FTWA 4OP3A 2QTGA 1GWNA 3M1IA 5LDGA 4CMKA 4LCJA 4PVDA 1NDHA 1SKYE 2B7BA 3AV3A 4F4DA 2PF4E 3I9FA 3PYMA 4KWIA 2CGEA 3HY6A 4EPXA 3BL8A 1BA2A 3ZW7A 2J3HA 4LYHA 2G0AA 4A5UB 1RQNA 2XNSA 3SYAA 1U11A 3K1TA 1NMEA 1SG6A 2GF2A 3I9KA 2C4HA 3A1TA 3M5CA 3A9WA 4LTNA 3VPXA 4RF3A 1P0FA 4ETMA 5DHFA 2P5SA 1ATIA 2I4OA 5L3RA 4RMIA 3E2PA 1UPBA 2OY0A 1OWMA 2XMSA 2FUG6 2PV0A 4PLCA 4RMGA 4WV3A 3Q3IA 5GJCA 2QOEA 5F7XA 1VBKA 4J7CA 4D82A 1N32B 5BW5A 3D4IA 4JYZA 3NNSA 3WRYA 2Q3CA 5CT6A 3CCRV 2XRYA 2D06A 1D1TA 1JSLA 1TC2A 1TO6A 4CG2A 3DYBA 2V54A 3JQAD 3THYB 4ZO6A 3PHBE 1FS4A 4FX2A 4QPDA 3CNEA 5EGNA 1LUWA 4HLNA 1CLUA 1ZN2A 2O0JA 1US8A 3VDXA 5A5GA 4J4BA 1FX0B 2ZIMA 2JLYA 4AKIA 2QT9A 1T5EA 4HWTA 3JRNA 4RXUA 3SYMA 3LUBA 1DIRA 3TEMA 5D85A 5CXXA 4FFBA 4DC9A 3ID6C 1TYAE 1ZGZA 1XOIA 4O4HB 2R25B 2AZDA 4IYRA 4PSKA 1YNOA 1ZM3A 4NJMB 2DSNA 3BKXA 4FYKA 2JFGA 3CXRA 5CCXA 1W8DA 3KVRA 3NTVA 3TCKA 1XEXB 4JC4A 4MO9A 4GNRA 3W6NA 3ZZNA 5B58C 3QEBZ 4UVCA 1Q0UA 2ECFA 2CDBA 3OM0A 1GZ6A 3QX9A 4JOSA 5HFLA 1N0HA 3QVVA 1A76A 2FE4A 3MJHA 1QTRA 2FG7C 1JIJA 3E6AA 2NO5A 4BVFA 1UZNA 3CCJV 2BV3A 3NTUA 1XZNA 2JGUA 4MYRA 1WG8A 2DJVA 1MJ5A 1Z0UA 4HGQA 5TXGA 2DXIA 5EOVA 4K35A 5CDSA 3ISTA 4TYQA 2UYGA 4DNPA 3N7TA 3RW0A 4W4KA 2ZSBA 4C7VA 1Y8RA 1E6MA 2PPLA 2PZJA 4ZT3A 3A8TA 2D13A 4YWJA 1KSGA 2H92A 1H3EA 1NJIW 1KMIZ 1J24A 1U2TA 1U9ZA 2H9AA 2Y8EA 4JC8A 4OREX 5FUBA 3SYCA 4ATNA 3LCCA 1K27A 4PRYA 3TDMA 3OQMA 4FDVA 5D87A 4E5MA 4B75A 5A03A 3RK4A 4ZTUB 2WLIA 2DW4A 2EXXA 2JS7A 3GGJA 3WG7C 1CQIA 4BAZA 4KO8A 5CLJA 3NPAA 3OZWA 4IHAA 4YROA 3GROA 1H2NA 1WZ2A 1Y5MA 1FOEB 3UXYA 4F4LA 2IBMA 2RE8A 4I4TA 5GM2A 2UUBO 2YDXA 1ISMA 3RTEA 1QQBA 2OZLA 2DR2A 3MWDA 3HUEA 4C20A 2P91A 5DYIA 4ZT2A 3GP5A 4ARZB 5TY0A 5K20A 1IQUA 1W93A 2GN1A 3MC1A 5B12A 5J40A 1JR6A 1WUHS 5D00A 1OC4A 4B2LA 5LLSA 3NR7A 1H66A 1JHAA 2FUCA 1V45E 4KR9A 1X8KA 3S70A 4P0QB 2KSDA 4W7SA 3H7IA 4BYMA 1L0BA 2YY6A 2A57A 2J5XA 1OGYA 1G9XA 4QWMA 4X00A 5EE3A 3WP1B 4H2DA 2BHRA 4J16A 1TZBA 1KDPA 2VYQA 4X65B 4YRFA 4RW0A 1UCFA 4YY3O 4IJMA 4CVNA 4KR6A 4M1ZA 4UHBA 2X6CA 1FS6A 2NU6A 3NI2A 5JUWA 221PA 2BUBA 2OQIA 3I32A 4C08A 4IDGA 1KQGA 4REOA 2V45A 5TGZA 4J1SA 4OJYA 4U0JA 3K2QA 4OH1A 4PYKA 3JARA 1ZRNA 3JALB 4WFIA 1R8JA 2VVTA 4JT8A 3VAAA 3WHLA 1QP4A 1R3IC 3ZTTA 3HJTA 4MLCA 1E3WB 5I7SA 1XQ9A 3GJXC 2AK3A 3GUHA 4AJOA 2WTAA 1CNMA 3N0WA 2L18A 1QRRA 1JXAA 1NF2A 2XUDA 4NZ9A 4Q00A 5DGTA 2O2YA 1J0CA 5IH3A 4HN4B 2WLSA 3HU5A 4MSUA 4RDCA 2F1RA 3AEUB 3T9DA 3PGA1 2AI3A 1Z73A 3CINA 1SF9A 2J3JA 2BGGA 4J11A 2EC5A 3LCUA 2W6PA 1UOEA 2VJCA 4LWSB 3DVAA 2G5CA 5A4IS 1ZESA 1M34A 2ODTX 5EJ2A 3I6YA 4YHBA 5JDCC 5EE9A 1XCOA 5F9HA 4HGYA 3KQNA 1LK7A 3AB7A 3GL9A 1PSDA 2E21A 2J0UA 4UBJA 3LUCA 3F8SA 2NPIA 1ZNYA 1V6SA 2IPOA 4K6CA 5M3BA 2PGXA 4MTXA 3LPNA 4FE7A 1OV6A 1FDWA 1ZWLA 3OH8A 1ZUWA 1S8AA 2WBLC 2XYVA 5AI6A 1K5HA 1JAIA 3A3NA 2F90A 2GVNA 4FMTA 2WIGA 5CT9A 2I1VB 3E58A 2PBRA 3EOBI 3HB4X 1B6RA 3LSQA 1HKUA 2DWCA 2QBYA 3CT6A 3DF7A 3EXIB 1EBBA 2VSFA 4N1AA 4M83A 5GZ3A 2C8LA 2UU9O 3QTBA 5BN5B 1I3NA 2IFTA 1M6VB 5CHYA 5EXPA 1B14A 5GY7A 2H5LA 3H9UA 4JQZA 1O9BA 5AHRA 4Z54A 3PKZA 2Q6KA 5HK9A 4LX8A 4LOHA 3SGLA 5JXGA 3PX2A 4CC6A 5IYZA 1IPHA 2Y93A 1RKUA 4FR0A 4P3YA 5BPFA 1IEQA 2O52A 5JBNA 5LQDA 2OO3A 2FSHA 2BL4A 2ZYGA 1NP6A 3GA0A 4PLYA 2YOGA 2ZREA 4LXHA 4KITB 3ABOB 3R09A 1I94O 3IEUA 2XCRB 3JAMA 2V6GA 1EN5A 1KOLA 2PL3A 4MS3A 1N34O 4A6DA 4BDTA 2GMWA 2DQYA 3EVEA 3Q2OA 2R7NA 1CEZA 2DFLA 1U5AA 4FX5A 4MVJD 1JLSA 1I7LA 4UEWA 4XSVA 3HL4A 4BJ5A 3MJRA 1PFWA 4LTMA 3LT5A 1NE2A 1BGXT 4HTFB 1HL3A 4YIHA 3S81A 2AD1A 1HDJA 3ABUA 2XCOA 2C2BA 5EKUA 5ELMA 3UAWA 4BNZA 3PNQA 5L4LA 3VRHA 2VRWA 4JP3A 2X1HA 3SX2A 5ADHA 1Z0ZA 2J9RA 1N6RA 3IQHX 4AYXA 4H6VA 4MWDA 4KFUA 1JPVA 1MG5A 1O03A 5KU7A 2NNUA 2OQ2A 3MUOA 4Q03A 3LQFA 5K3BA 1NJ6A 3A1EA 4FM9A 1O95C 2QW0X 3LF2A 3L75H 4HXGA 4TLBA 2PMEA 3U16A 2JA1A 4R98A 1RQ7A 2X6RA 2D0DA 4KEAA 4JTDB 1ZFNA 2C2GA 2PL1A 2QUJA 3W6OA 2I3BA 2FWPA 4AUMA 4RPIA 4G0YA 4L85A 3MTIA 3AL3A 2BFOA 4RA9B 1SVOA 1TZKA 1YJ8A 2NZWA 2YZ7A 3P94A 4ETIA 4CF7A 1BFKA 1WQ3A 1S72V 2JCXA 2WKPA 5CH5A 3OTFA 2VI5A 1U8EA 4K8ZA 1QV6A 2WFAA 3JTMA 1L4GA 1RPNA 3OBBA 4UREA 4WGGA 5ALGA 4QM6A 4U3JB 1NN5A 1V9LA 4TS9A 1KYQA 3PC7A 2NN3C 3I2HA 3I5UA 4DMCA 4ZCQA 4QPPA 3GH3A 3RJ5A 2J0VA 2WDZA 2JLXA 2DF8A 2PR2A 1DGSA 3LLMA 3DV0A 1QCEA 1M10A 4I7EA 4K1LA 1WY7A 1QIGA 3ZDEA 4ANFA 4ARCA 5KA6A 3IVXA 4DMFA 5CXQA 1N7HA 5EIWA 3TW6A 3EF1A 2GTPA 2QORA 4D44A 5KYXB 1DZ3A 4CS2A 3FVRA 3CY6A 4NNOA 2QJ1A 3NBKA 1FTYA 2EX1A 1VECA 2QUBA 3E7PA 4HATA 5LB2A 2YW9A 3CX8A 4HDKB 3T3GA 4IVRA 2F3UA 3V6MA 3QELA 3CKYA 2GHIA 5K8LA 1XZMA 1X7XA 1XN1A 3N2KB 2VQEB 3CPEA 3FMFA 4ZT7A 1S8FA 2AG0A 2VP4A 3R77A 5THKA 4M9QA 1K1EA 3ZIAD 2SHKA 1HW7A 3KOUA 2PX6A 1SS3A 3IVCA 2QVZX 5I51A 4QDOA 2VQDA 2GTIA 3E8FA 2PXHA 3HVUA 3QYJA 1JQBA 3Q8LA 1N8SA 5CDTA 1V4BA 5TPWA 2QVYX 2CLKB 2A9JA 2IOHA 1VQ4V 2PMBA 1TA4A 1XQVA 4MRMA 1AA6A 1R73A 4RD1A 3VKGA 1MCZA 4CM7A 2UXCB 2FMIA 3OZVA 2HU7A 4URWR 4W9RA 1ONOA 1YAHA 1ZI6A 3N86A 5CYFA 5GINE 1H2KA 1R8YA 3OLVA 5CG1A 5K0ZA 1Z6TA 3KNZA 1NAIA 2Q5JA 3H04A 4ZVPA 4JASB 3R5HA 1E69A 2ORYA 2PKRA 2WWXA 2XYRA 1SHKA 1NJ8A 1U0JA 4AIIA 1L8DA 2KHZA 1VMIA 1NVPB 3K0CA 2A92A 2J9FB 2FSSA 2GYWA 2JJ1D 3PKJA 4YAFA 1DL5A 4DV2B 3IHTA 1U9JA 2XOKD 1FFEA 3HO8A 1ZX1A 2IUEA 3OTOO 3WFIA 2O19A 1VF7A 1M56B 1YT5A 3W8NA 5F9MA 1QVAA 3OHSX 2R11A 3J7TA 2IK8A 1P0IA 1IBCA 5BV2P 1HLFA 1L3IA 1DIHA 2HLHA 4MEJA 1UZAA 3EAQA 1WUTA 1ZUNB 2DN9A 3L8MA 4DM7A 2IYAA 1TOAA 5KQGA 1N0UA 1OCOB 3MELA 4R81A 5DM4A 4CKBB 1PT8A 5J63A 1W0CA 1BYUA 5HQTA 3CNLA 5KAPA 3S6JA 4KRXA 1A7AA 1YB6A 2P1DA 2EWWA 2ORIA 3JQ7B 3JXEA 4QD3A 4HDRA 3ZEDA 4GLJA 4HAWA 4UQLA 4I50A 2NQ2C 4PPFA 1T8RA 2P40A 2WJYA 1VKOA 1DAOA 1ZZEA 3FPEA 3MGBA 4JMLA 2XYGA 4DR7O 1G0OA 1L6IA 1S3IA 2Z9BA 4MIOA 3TQIA 4C2BA 4G1MB 3T0GA 1YEWA 4OHKA 1UP4A 4HH4A 4WLFA 1V95A 5F76A 2K2QB 1M6HA 1VBMA 2X58A 1N8TA 5B4UA 5IDWA 4M54A 4ZEWA 4R9VA 2HFJA 3PQFA 4P86A 3ZHCA 1YFJA 3EWNA 2C4MA 3OOJA 2XMZA 4JJGA 1BEZA 1BN7A 3MWDB 4E4YA 1ODFA 2FN9A 2UZ0A 4JB2A 5AW3A 2E4VA 2VH5R 4G1FA 4D9NA 1R3JC 4NVPA 3V00A 2WNIA 1JG7A 3KJIA 4WBNB 4E12A 3D3WA 3GAZA 2WP0A 1N1GA 3RSOA 1X7HA 2KG7A 3DTVB 3LC0A 5B1SA 2WHPA 3R7AA 3VYWA 1K2WA 1FK8A 2GJ9A 3NBMA 4FW8A 4P22A 1GNQA 3MWGA 3VQXA 3E2EA 1LJ8A 1Y1PA 2ODPA 4MA5A 5JSFA 4ZOCA 3KAKA 4X5OA 5CXUA 3A9TA 1WBDA 1R15A 3NEAA 4M7RA 4I1PA 2PGNA 1LWOA 1BWQA 5AVSA 1E7YA 4MVZA 1H2WA 1HZZC 1M5IA 1MSDA 3ROPA 5ALEA 2Q8NA 1KDTA 2ODNA 1WP8A 2XNCA 3DAGA 3DH0A 3FCUB 4QGFA 4QQKA 4MDHA 4G8JA 3IBCA 3QXHA 4KQ9A 3K08A 2FOXA 3GYGA 4O1HA 4WFHA 2WICA 2QRLA 3EODA 4DO2A 3A31A 1UDCA 1V37A 4GECA 4ENRA 3N2NA 1XZDA 2G4LA 3G0OA 2REQB 3I73A 4OA8A 3S99A 4CDRA 1EP2B 4QVIA 3UT5B 3A0BZ 1QBKC 5ITWA 4HX2A 4OUKX 3VU8A 4DILA 3NYIA 4G0MA 4GAEA 1HNWB 1I4LD 2PVSA 2PYDA 3E9MA 4RWUA 4Z9FA 2CV2A 1YTFB 3I83A 4TQFA 2HRQA 2ZRHA 2O2JA 2PGLA 1YHNA 2VTVA 4N0QA 5ESXA 3ZJVA 1DQZA 2IX9A 4IV8A 4UCXA 2Y69B 2YY7A 2RI1A 1G7SA 1AXEA 2E5WA 4FKZA 4G4JA 4HGPA 1Z39A 5A02A 2D0IA 2I62A 1W1WA 2CJFA 1S1MA 2WJGA 1QZ3A 3GFGA 3KYJB 5AOVA 3SI7A 3PRYA 3VFDA 4BZXA 4RTOA 4IDBA 3L0BA 5IJZA 2IU4A 2G40A 2ZPAA 3GFBA 3LSUA 1AVTA 3HY4A 3O8OB 1NYLA 4LYYA 4W6QA 3U17A 3VO9A 1QDLB 2AG5A 2FSIA 4KQ6A 5ICCA 1E99A 1O77A 3L1VA 4A23A 1GCUA 1MEEA 2EFJA 4QJ5A 3A1FA 1M72A 3KCYA 2QTCA 1DDIA 5CGQB 3GG9A 1N33O 1XFAA 2CJXA 1GRCA 3MQFA 1YIDA 4J7ZA 3RRMA 3TRJA 1SO8A 1UJ4A 3RKSA 3KOMA 4C06A 3IUYA 4YHHO 2IBSA 2PY5A 2BIFA 3H9JA 2XA9A 2GEJA 2VXBA 1E6UA 3UHFA 3EEQA 4CTNA 5E9QA 1NT2B 1RRVA 2G80A 1LC3A 2Y6VA 1POWA 3K92A 1CTQA 1W88B 3OEHD 3QJYA 4O0LA 4XDHA 2C9MA 3VVBA 4ESVA 1OJ7A 4UU8A 3RVDA 4H77A 2JFHA 4YUAA 3NAQA 4U2FA 3ZVKA 1GNTA 3F8TA 5ALJA 5L51A 4N3AA 4NYKA 2E4WA 3C7TA 4AJIA 3WNQA 3DFMA 1WULS 1MQAA 1DIAA 1YMUA 4A8TA 1HDEA 2P2SA 4F2DA 2JAHA 1MOFA 2W2OA 4Q3AA 3ZNPA 2QN9A 4BDSA 1ICIA 3RYIA 2PAAA 4UULA 3LNMB 3F98A 3S2SA 4JN6B 2VDVE 2BE9A 4PGMA 3A2LA 1DRVA 4NR0A 4OJTA 1NQTA 4ZOQI 1OCOC 1H1DA 3I2KA 4OD0A 5JRDS 1ENOA 4RX1A 3V4PB 1FFWA 1LS6A 1KKCA 1I5RA 4RHTA 4HJRA 4K9NA 1YQTA 4MZDA 1R6AA 3MJCA 5AVJA 4J7AA 2JGNA 1WA8B 1XMOO 5JTUA 1GCOA 2H7VA 2ZR0A 2QX9A 3RFXA 1L0LH 3Q0TA 5B3SB 3WGMA 3CPWU 4B4WA 2FUG1 3MAQA 1GZ5A 3A4IA 1E1QD 2GLXA 4ALNA 5JCZA 4JYAO 4LCUC 2FZCA 2Q6IA 4YT5A 4LDJA 2JLWA 5DLQC 1K34A 3CEAA 3HKDA 3EB9A 2VWJA 1QLHA 4DR4B 3QLUA 1SD5A 5M29A 2IIQA 4CH5A 4C4RA 2PUGA 4GU5A 1M2WA 4JELA 4JEMA 1PZEA 3VV3A 2JLQA 3Q4GA 1BVRA 5AW7A 3AESB 5CIYA 1FB5A 6PFKA 4OH7A 4BNHA 4ARSA 2FA9A 1UBSB 2EQ5A 2R8ZA 3CVWA 2YJNA 2ZITA 1LPPA 3NNNA 4WLNA 1GRJA 2IJGX 4FWIB 4PFKA 4CEHB 4QBTA 5DNEA 4X88A 3CLSC 2A9OA 3RS5A 3T7AA 5CITA 1U8UA 1SQBH 2DG2A 4GI5A 1EFTA 1KZ7B 3PVZA 5JAPA 4JCOA 4UCTA 2BGIA 5ALVA 3IULA 1MC8A 4L7QA 5JALA 4M8KA 2EG5A 2Z2YA 3LF1A 1JDSA 3R7LA 3JATA 5G0VA 1O0BA 1UC5B 3EMDA 4OFWA 3T7RA 2PG3A 2EJWA 3K6JA 1IEXA 2ZSHA 1JDNA 2Y4OA 3C2QA 3ESQA 4HXFB 2KS6A 3ZIAA 1KVTA 2QPAA 4H4DA 1P0CA 2YVUA 1J8QA 3U4QB 1S8OA 1PYGA 1KFJB 1EDOA 4D1YA 2P2CA 1HT1E 3D1JA 4QFCA 3GJTA 5L3QA 4BNNA 2NAFA 1EBFA 4RKRA 5C35A 4G5OA 2VEOA 1XUQA 3QWHA 5FBQB 3SQXA 2YIBD 2N04A 2H5EA 1T29A 1PWXA 3ONVA 4IYJA 1MTOA 1QZXA 1YULA 1NIJA 2BGWA 3INGA 2OPBA 3R3VA 3JQ9C 4WECA 3AI7A 3BIFA 3ENVA 3HV0A 4RF5A 2ZI9A 4LF4O 3H1JH 3T06B 1QP7A 4YMUA 3UV3A 1YONA 2ID8A 1WLEA 4ILKA 2L35A 3EIFA 4WASA 1E1RA 1I7DA 3WXBA 4RSHA 2H4YA 2XNJA 3DL4A 5COAA 1P18A 3IV9A 1PV2A 1SN7A 2X19A 1KY5A 2C88A 4JI5O 1N3BA 3M4YA 4R1QA 5CM2Z 4BO9A 5LYJB 3HB0A 4JC5A 3K5NA 1W0KG 3D3IA 1JDBC 2DLNA 4B7XA 3J7AU 1JSXA 5IYDO 1MX9A 4NH0A 3UO8B 3CCUV 4LP8A 3SPHA 2I7DA 3AUTA 4KLZA 1VPLA 3B1VA 2H4XA 1SQ0A 2I78A 1XCJA 2WF9A 1WMFA 1BT8A 1Q1EA 1XL1A 2YV1A 5ERXA 2X14A 3VH1A 1SMKA 2HFKA 1VKRA 3DZGA 2HNBA 4LYFA 4RQBA 3OJ0A 1G8YA 4H44B 3MT7A 5PGMA 4MUXA 4FFLA 3TR6A 4BR6A 1L7DA 4RYDA 4L72A 4E2YA 1TECE 2O57A 2OM2A 3LQQA 1IJBA 4JKIA 2YXDA 2KQXA 4I1RA 4TSRA 1G60A 5ECWA 2CUGA 1BROA 5ENVA 2HYIC 1ZXLA 3A1NA 3CYFA 2CLIB 2PJUA 2DOSA 2CW5A 1HORA 4O5AA 1WQ4A 4O2BB 3AF2A 3FHLA 4DRXB 2R72A 1N1DA 2Q0QA 2RGEA 2PEZA 3WL5A 4AMGA 3LRPA 5NLLA 1CRPA 121PA 4I36A 3O92A 2A2ZA 1R27A 2F9MA 2LDXA 1YBVA 3HE3A 2HL6A 3OP1A 4GQBA 3HP7A 2XSZD 1Y67A 1Q0QA 1NUSA 3G2IA 4UNQA 1D2NA 1PV0A 5DNDA 1M2HA 1HLDA 1R37A 4H35A 2H07A 4RVSA 3F6BX 1MXFA 3VBBA 3PR2B 2DWQA 1WCV1 3X1YA 4QOIA 4Z4HA 2QA4V 3JPWA 4D0RA 2PSEA 3AVVA 3N2YA 1YQ9A 3EPPA 3HBAA 3LUJA 1Z5WA 4KR7A 1NSYA 4JHLA 2NACA 2YHIB 3I6BA 3ZK9A 1AXRA 1U7DA 1U63A 3RC2A 4NBTA 4Q21A 2NU8A 1GNRA 4BBZA 4JXKA 4EA8A 2KG7B 3DTVA 4TQAA 1ZKMA 4J29A 3ZCTA 4DV1B 4E11A 2ZR2A 4MRVA 3TXYA 4MVJM 1AQNA 2XB2A 3I62A 1D2EA 4KXLA 4MUHA 1PG5A