3D3QA

Crystal structure of trna delta(2)-isopentenylpyrophosphate transferase (se0981) from staphylococcus epidermidis. northeast structural genomics consortium target ser100
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
307
Chain Sequence
KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Crystal structure of tRNA delta(2)-isopentenylpyrophosphate transferase (SE0981) from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis atcc 12228
total genus 102
structure length 307
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 3d3qA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3d3qA01
1ZD1A 1ZC3A 1F2TB 1E3MA 3LQQA 3UATA 1J2JA 4NCJA 3K70C 4UJ3A 2HYDA 3W5IA 3QNUA 2R6CA 4BPBA 1CTQA 4J0QA 4BECA 4FWTA 4IFEA 4EPRA 3PUYA 2D62A 2CVFA 3QI2A 1W2HA 2E1RA 1ZUNB 3EX7C 4IRUB 4DHEA 3TLXA 1T6NA 1G41A 5GJVC 3T61A 3GJ8A 1N5JA 2ZJOA 3FHOA 1CULC 3IPXA 1ETUA 2E87A 1QF9A 3KZ1E 3QENA 5EXPA 5BN3A 2YHSA 5KNCA 2J87A 5JRZA 1D5CA 5E7MA 3R8FA 2QSYA 3QVUA 4C9BA 4RZ3A 1JR6A 3W34A 4BFZA 4N3NA 3VNVA 1QHYA 4Q1BA 2SHKA 4RCYA 1KY3A 3M1IA 4V03A 3W6PA 4U7DA 1HH4A 2OO7A 3IQWA 3HYRA 2O8EB 2P2LA 1TQ2A 3EXAA 2D3WA 1E0KA 5CDFE 1D2NA 3BAFA 1AZTA 1AS3A 4YQFA 2J45A 4D4JA 3U6BA 1HT1E 2H1LA 4YONB 3TK1A 2QENA 1F2UB 2BJVA 1YR6A 3UXMA 4Y0VA 3U44A 1WXQA 1MABA 1IQPA 4Q03A 4PC3A 1XX6A 3NBFA 4L8GA 2HT6A 4NBSA 3BXZA 3VR1A 1SQ5A 1FFHA 3KUCA 2GF9A 4PQYA 3DOEA 1JQLB 5KO2A 5BYKA 2A5DA 3TAHA 3U7GA 1OHHD 1DG3A 4I81A 4PC6A 5EUMA 3A1SA 4D80A 1XJ0A 4AG5A 3NBYC 4JVSB 2ZRLA 1D9ZA 2CCJA 4UNPA 2XB2A 5IDVA 2AD5A 2CJWA 3BH7A 5JJLA 2JJ8A 2O5VA 3LBNA 2WWXA 4UXIA 3HU3A 4XWAA 1VECA 1G7CA 3MFYA 2J41A 1IY1A 4Q4JA 4A15A 1E9SA 2P5SA 4E07A 2A78A 3EPHA 5TB5A 3RS5A 1TNDA 3ZGXA 1Z0JA 3IUYA 5E95A 1E2QA 1J7KA 3CWQA 1JB1A 3R9IA 1NVUQ 1G64A 3CF2A 3KKMA 4MITA 3O8RA 4LV6A 5SZKB 5BN5A 5J4HA 5FBQB 2A9KA 2H57A 2DYKA 4JBXA 1GAJA 1G5PA 2OFWA 2QA5A 3B1YA 3CPJB 3PVSA 3VU9A 1FOEB 2FV8A 4LI0A 1IN5A 4RD6A 1LNZA 2IEYA 1Z63A 1S2MA 1X8JA 3TE6A 4TQUS 4RCZA 4POAA 4TMKA 4GFDA 4Q9LA 1RRGA 1Z6TA 2FFHA 3G82C 2JJ2D 1EG7A 4Q47A 2BOVA 1FMLA 1P2UA 2RGBA 4BGDA 2GJ9A 1PZNA 5DGXA 1VCIA 1OIVA 2J7PD 1NRJB 2CVHA 2W83A 4TTQA 1N5LA 3PIRA 4C0LA 4D81A 2V7QA 3BFKA 4LJ9A 1TQ6A 4US0R 4OJKA 1DAGA 4JVNA 4D0GA 3TUZC 3IIJA 1EWRA 2QMOA 2VBCA 3LW8A 3A6PC 4PQFA 3N2IA 3T1VA 2MSCB 3DZDA 3CRQA 3PUWA 2IXFA 1XB2A 4GOJA 1B23P 2GNOA 3FKSD 1IXZA 4PAQA 3TKLA 4JSYA 4DSTA 1E9BA 4TYYA 1J8MF 2ZI9A 5EQTA 3A1UA 2GEUA 4M1TA 4M1WA 3AP1A 4P31A 2IW3A 1OYWA 1TU3A 2IYZA 2QRNA 4Q5IA 2ZE5A 5AUPB 4A2QA 2ZTSA 4UXHA 1N3BA 2V1UA 1II8B 4TWZA 2VRWA 2GDJA 4B76A 3VNUA 2GBLA 3X1DA 4LC0A 4US2R 2FDCA 1A4RA 1TF5A 2FZLA 4DT1A 4EUNA 3C5CA 4KFRA 5CK5A 4HB0A 2ZSFA 2O8FA 4IDNA 4XJXA 3UWOA 2CEAA 1N6OA 1T5IA 4ESHA 3SJAA 4RZUA 4MDEA 5D3MA 1RYHA 1LV7A 2KJQA 4TL7A 1T91A 2C2HA 5SZHB 2VP4A 3TW4A 3QY0A 4GZMA 2PCLA 4V0KA 2ZITA 1L2TA 4XTCS 2BVNA 4A82A 2ZI5A 3CRVA 4EJSA 2FEMA 4LY6A 2W2VA 5A5GA 2XTMA 3A1TA 2G77B 3FWYA 3GLGA 2EWVA 4UNNA 4IVRA 1WB9A 1GNPA 4W5WA 2QGNA 2NZJA 3SFVA 1L7VC 1P4SA 1P60A 3EC2A 2QI9C 1RE0A 4KYUA 4LBVA 1E1QA 1MRNA 2QP3A 5FR1A 4OHZA 1PLLA 1VG1A 2C9OA 1FZQA 3CX6A 1Z83A 4LZZA 1HURA 1COWA 3CRMA 4RFSA 2JEOA 1F3OA 2PH1A 4CT4B 1CRPA 1UKVY 4L4UA 4C0AC 1XD2A 2Q3FA 4QC2A 2IYYA 2KBEA 4P33A 1JXMA 2VP6A 3UKDA 5FUWA 3ZZ0A 2VO1A 4MGYR 4MYUA 1FUKA 2ZR7A 4XD7D 3Q9LA 5IRCD 4OBEA 1LVGA 1E96A 1NG9A 1KSJA 2HJVA 1UF9A 1U9IA 2QZ4A 3WYGA 4PQRA 2PX3A 4AKIA 1Y3AA 4Q21A 5E7JA 3U60B 1IY2A 5HPYB 2E9SA 2J0UB 2ODNA 2OILA 3IEVA 1QHHB 3WBJA 3K0AB 1F5NA 4HEJA 1GKYA 2OSBA 3K70B 2OFOA 2HLDA 1K5GA 1GITA 4HDQB 2IHBA 4R2HA 1JNYA 4PAOA 4ZKDA 3EPKA 1E0JA 2WOJA 3K09C 3R7WB 1KNXA 3WNCA 3MJHA 4OQNA 4ZI2A 1NF3A 2CBZA 2IUUA 2GK7A 1VG9B 4BFVA 1G20E 1KMHB 1X6VA 1Z6AA 2JJ1D 2OXCA 1DARA 3A1VA 3BC1A 4NZYA 2A5YB 4NYIR 3WMGA 3WYFA 3LWNA 2J9RA 3B2EA 2WAXA 3LXRA 4TLEA 3RS2A 4MRSA 1IHUA 3L0PA 1Z0IA 3N2EA 4B2PA 3FMOB 3ZVRA 1ZUIA 2RB4A 4LJYA 2YNMA 3MGCA 2B92A 3S1AB 3ZZUA 2ERXA 2WWWA 2RCNA 3D31A 4IDOA 1KKMA 2IYTA 2PEZA 2FZ4A 1EESA 2BIFA 3GLHB 2A5FA 3X1WA 4IDHA 1MO5A 3SOPA 3AVUA 4P3YA 2OUKA 1JI0A 1E99A 2GJAA 1ZMXA 2PZFA 1R8SA 3MWJA 2R8RA 2HT1A 5FBLB 3SYNA 4AY2A 3WXMA 3AF4A 2ONKA 1G17A 4ZDKA 4GDFA 2ZRFA 3PEUA 3IEUA 4BQSA 2WOOA 2Q0HA 2R6AA 1YR7A 2DB3A 1VMAA 3OHMA 4P4TA 4ERNA 5BQ5A 3Q5DA 1GP2A 5IHPA 4NDZA 3CO5A 3K9GA 4MUBA 3HPQA 3V4FA 3OIVA 2YWGA 4P32A 2AX4A 5CM8B 3FHTA 2GTPA 2VSFA 2WICA 1G5TA 1Z28A 3CF6R 3F0TA 5FPSA 3UIEA 1CKEA 4B3GA 4QHSA 3VHXA 1AN0A 5CB6A 2CNWA 1E69A 1N0UA 3AGPA 3MRSA 4URWR 3GLFB 4MRRA 2X2FA 2CMKA 3GLIB 1FTSA 2DWQA 2VHUA 1E4VA 1EFHA 1HTWA 2AWOA 4XSGA 4IXNA 3AP2A 1G8YA 4DDTA 3VMFA 2WV9A 3FE2A 4PSKA 2BBWA 4RD0A 3WNBA 1OXVA 2X8AA 2FFQA 3KFXA 1NSFA 2ZUCA 1P75A 1AS2A 4U02A 3WY9A 4BLQA 1ZM7A 2FE4A 2ORVA 4DCSA 1ESMA 2WZQA 4P0TA 4QJ5A 4MA4A 5UKDA 5AUOB 3H1TA 1YZKA 1E32A 3F5FA 1DOAA 2ZSAA 1OPXA 3OESA 2ZAOA 1G6HA 1A5TA 1KJWA 1X8LA 2GJKA 4JZKA 5F98A 2P6NA 4XSHA 4TMZA 5ELXA 2C5LA 5FOSA 5FTNA 3QQ5A 1EWQA 4LJ4A 1VG8A 1OJLA 3BH6A 4DLRA 3LXXA 4JL8A 2OAP1 1W1WA 3SE0A 4Z8XA 4HZUA 2NGRA 1XTQA 3BFVA 2JATA 5ANRB 1T9HA 4IOLA 4AKEA 2ZXUA 221PA 1Z22A 4M9QA 4CGZA 1X8KA 1FNMA 1KJZA 2XAUA 2UKDA 3GJ4A 2AK3A 4B3CA 1AKEA 4DVGA 2BMDA 2YWFA 4Q4HA 2ZRDA 3NIBA 4XIGS 5CYOA 1W4AA 1MKYA 4YMWA 3CRW1 2FGKA 3SS8A 2XJ4A 4F4JA 5EE9A 3QJYA 1ZYUA 4BFSA 2IS1A 2V7QD 3ZIAA 1WA5A 2TMKA 2Z83A 1DE0A 3KXLA 4PR0A 5KPJA 2R6DA 1XJCA 5M04A 1SKYB 1VHLA 4JLBA 2H5EA 3PEWA 3VKWA 2F1JA 2G0NA 4HLDA 1E0AA 3CBQA 4G5SA 2FPMA 1RRPA 2VHQA 2ZYWX 4B35A 1II8A 2XTZA 2FFAA 1GL6A 3RNLA 1GNQA 1TUIA 3T12A 1E98A 1G291 2A5JA 4B71A 1I2DA 3IPYA 4S35A 2R44A 1BMFD 4TYNA 4LRWA 4DLZA 4YMUA 4JL6A 1BO6A 2DCUA 5CM9C 1BIFA 4MGKR 4MYCA 2IWHA 1E0SA 1RZ3A 1F48A 3RHFA 5JCPA 3BJIC 4QNRA 4KYIB 3LH5A 4EFNA 2XGJA 3KB2A 4XVQA 4XVUA 5TXGA 2F3TA 5J47A 1GOTA 3QF7A 3TSOA 2B8WA 4CEJA 4BLRA 2RGDA 3RC3A 2W2XA 4B2LA 3IO5A 5DI3B 4JIMA 4D0LB 2GCNA 1ZD9A 1Z2AA 2W00A 3B1ZA 2FN4A 4PPFA 4XWKA 1IN7A 3IILA 3I5YA 5LDDC 4GBMA 4DUGA 2D7DA 4Q7LA 4A6XA 1E1QD 2ZS9A 4B6EA 1BKDR 4C0KA 4B47A 1COWD 1NN5A 3QKRB 1NVWQ 4HAYA 4ITRC 3NH9A 5K8IA 5CDFA 2JLVA 3KQLA 1MT0A 4CEHB 4JL5A 2C77A 4NYJR 1XEWX 4V0ME 3MWYW 3AP3A 2BC9A 1DS6A 1K6MA 2ATXA 1Q21A 3FTQA 3PR1A 3I1FA 1DVRA 4MYTA 1E2HA 2WWGA 2X1VA 3EZFA 3SBDA 1KO1A 1RJ9B 1CIPA 3KJEA 1NMXA 1D2EA 3E1SA 2WPDA 4KFSA 2PT5A 4UQOA 3ADBA 2WMNB 4L9SA 1CLUA 2O8CB 1S1CA 4F4IA 3AM1A 3C4JA 1UKZA 4Q1AA 2J0UA 2LKCA 3CNOA 1QHHA 5KSYA 1D2MA 1HQCA 3K0AA 1ZCBA 2YKGA 3BGWA 1Q57A 2G1KA 1E6CA 4QBHA 2XITA 2J0QA 1LW7A 5JI2E 1SXJC 1NLFA 3KDSE 1MO3A 3PQCA 1BYIA 3X1XA 1SVIA 4WZBE 5CLLA 3R7WA 1OKKD 3IIMA 3SR0A 3A36A 1DAKA 1YVDA 2C9YA 3A58B 3EAQA 2A2ZA 2Q6TA 1DAMA 2VQSA 2VF7A 4JVLA 3I61A 3EIEA 3ZVMA 1D8TA 3PEYA 2ZRCA 1YZNA 3R8CA 5L8VA 3ASYA 2WM9B 3LVQE 1LF0A 4B48A 4YMVA 3REFA 2IF2A 1NVXQ 1P2TA 2P67A 3EIHA 4C7OB 2J59A 1QRAA 2WBLC 4ZIRB 4B3BA 3QUSA 1NY5A 3D8BA 5EP3A 1EFRA 3QOFA 4YC7A 1XEXB 2WWFA 3S1AA 1W36C 3M6AA 4FN5A 3ZD6A 3UG6A 1ZM2A 2A3RA 2ANCA 5H1YA 4EQ6B 5FUXA 4A1FA 2XNDA 4BUJA 5A4JA 1VYUA 1Z06A 4JS0A 2HF9A 3UPUA 4Q4LA 4GMDA 2QT1A 1SVOA 4TYQA 4ZDWA 3V00A 1SVKA 1JJ7A 2BHRA 2QG6A 3CZPA 2GZHA 3V4RA 2N46A 1E94E 4PTLA 1ZM4A 4KU4A 4TQAA 3U5ZB 1D6JA 4RD3A 421PA 4II7A 4LYHA 1E2FA 1IOZA 2NQ2C 4Q4HB 4TSFA 1UBCA 5DN6A 3RRMA 2OZEA 3GPLA 1RKBA 3B1XA 5C4MA 1CJUC 3SU8A 4DSOA 2X2EA 4NU0A 1W47A 3OIWA 4KSBA 1IONA 4LHVA 1TADA 1YRAA 3GLFA 4RKFA 1VCNA 3W8RA 1KI8A 3DEFA 5AJZA 4H9GA 1X1SA 1KGDA 1XMIA 5J4LA 2RGCA 3I8SA 2NO0A 3GJ0A 2BM0A 5D3QA 4HUQA 5G3ZA 1KDRA 2ZE6A 1T3SA 2NG1A 4A92A 4EAQA 3LLUA 1P6XA 4HLUA 3KJGA 2CCGA 3PENA 1XXHB 4NE2A 1IXRC 2JDIA 2ZI4A 3EZ9A 1T0HB 3ASZA 1R10A 1M74A 2D7CA 2GA8A 1U2RA 3EWAA 4LDJA 2QSZA 2WWHA 3A4NA 3TSZA 2WJVA 2PLFA 4Z51A 5L3QB 2JGNA 4IXMA 1KK2A 1R0ZA 2ZRPA 1G5RA 1KAOA 3QXSA 4KHZA 4ZPXA 3X1ZA 1R5NA 5HZHA 2FFBA 4Q02A 5FL7A 3W3AA 4A6PA 4V0NA 2DFLA 4QJ3A 3DHWC 3FFBA 2W6IA 3QKSB 2BMFA 1W46A 2PJZA 3IHLA 5EZ5A 3LD9A 1W44A 2XX3A 3OFNA 2CCKA 1KAGA 3EG5A 3L82B 3FMFA 3AKYA 1P7CA 1YR9A 2GVDC 3IDQA 4BZPA 1M8PA 4M9ZA 3L0OA 3LFUA 5JSZB 5KHOC 2AKYA 2WKQA 2EVWX 1Z0FA 1NY6A 4ACBA 2D4HA 4CW7A 3MAAC 3E5HA 4O3MA 2BKUA 3SBEA 3LQRA 4FINA 2IXEA 5EZ6B 3B78A 3LVRE 5JMTA 2P6RA 1TAGA 2GILA 4EKDA 5FBRB 4OQLA 1XTIA 1AK2A 1ZU4A 4BFWA 2JLUA 4D4LA 1MO6A 3ZIAD 4G1UC 2QTVB 2RGAA 3SHFA 1VPLA 1XU4A 4XWOA 2BV3A 4KLZA 1HE1C 2NTYC 1WDTA 2H17A 3KFVA 5EP2A 4CYMA 1CR0A 1ZU5A 5JHGB 3U7FB 5TY0A 1G8GA 2Q3HA 3EA0A 3THOA 4KV9A 1UPTA 3NHAA 3F3YA 5AJXA 2FX3A 1S96A 4X8MA 4DLSA 4I99A 3U3JA 1RYFA 3AUXA 1SHKA 2AD1A 1CJMA 4M9XA 3KUDA 721PA 3K0FB 5G3YA 2IBMA 4ABYA 2ZSDA 4NCNA 1J70A 2WMOB 1IJEA 3CPEA 2ODWA 5JJIA 1QVAA 121PA 3OAAA 1VIYA 2LCFA 5H70A 5JEEA 1HUQA 3L0IB 4KITB 1H65A 2HJGA 3TR0A 2I1QA 3VHLB 1EFCA 2QPTA 4I4LA 3N5CA 4QKQA 4GPTA 5GJWC 1I4DD 1J90A 2JLQA 1XJQA 3SYKA 1AKYA 3GJ5A 3KX2A 4DSUA 2V3CC 1KK1A 3H0KA 4JBWA 2VHTA 3EPLA 2V1XA 3CF0A 3CX7A 2ZAMA 3BS4A 2ZRBA 1MR3F 4MRVA 3AVYA 4HAXA 3QKRA 4DUGD 1OV4A 4F38A 2NPFA 2ZJZA 3QPVA 4F91B 4CEHA 3VTKA 3RABA 2IYRA 5A0FA 1KSGA 2ZRJA 3LX5A 4LWZA 1J99A 2VHJA 4BZQA 1BYUA 1N6PA 3VKHA 2RHMA 1VHTA 1RJ9A 3QVVA 2OV2A 2ZYTX 5BW8A 1VYTA 5HZKA 3DPUA 5FOWA 2Z43A 2I3BA 3MWLA 3W6NA 1JECA 1T5LA 1SXJB 2O8CA 3GLHE 2FOLA 1TEXA 2RAPA 1E2NA 4M1YA 2ZETA 4LHXA 3TIFA 3K09A 4HDOB 1YHNA 3G5UA 1GNRA 1GRNA 4CRWB 4PANA 1H8EA 2W6JA 3PV0A 1JR3E 2VHCA 4M21A 4C0SA 3NHBA 1LF5A 3ZH9B 4ASUA 2XEXA 2AFIE 5K8LA 1W4RA 2KI5A 2ZRNA 1F60A 1FNNA 3CNLA 3IGFA 4HZIA 3RANA 4G0NA 3T1OA 4GP7A 5FUYA 1GKIA 3T35A 4BRUA 1CR4A 1GRQA 2PBRA 2V6JA 2ZUBA 2ZS7A 3MJRA 4RSGA 4JKYA 1KK3A 3EW9A 4JLDA 2ZVPX 5EJEA 1W36B 5FPTA 2EFHB 3FOZA 1G4AE 3AV0B 3U6KA 1KI3A 3GFPA 1AA9A 2DY1A 2YYZA 4W7SA 5J4KA 3IKJA 3OZXA 1DAEA 3L0SA 4C0BA 4HB3A 1G19A 1XEXA 3A37A 5LD2C 3GLFE 1P2VA 5JWHA 4IJMA 2HV8A 4URXR 1R4AA 1UBGA 3ZD7A 1SZPA 2NOAA 4CVNA 4TYWA 3GLIE 2QQEA 2L0XA 4EQ6A 2ZJBA 1EFRD 2FSFA 2DFKB 3AKEA 3U7EB 3VQTA 2DHRA 3LRPA 4P4SB 5GVSA 4HLQB 5HCIA 4QBFA 1NI3A 2GJ8A 4NONA 4BWYA 2BEKA 1E9FA 5E7IA 2EFDB 3OF5A 2CLDX 1GKUB 5JECA 2XNDD 3HR7A 1XWIA 4W5JA 4M1OA 1UEJA 1KTVA 1Q1BA 1XCGB 1Z29A 3EC1A 1AJEA 4ZV4A 1W48A 1T8UA 2BCJQ 4G5GA 2XXAB 3C7KA 2GJSA 2RGNC 4B34A 3W3ZB 4M0LA 2EYQA 3PJRA 2GAAA 3BRWD 4L15A 3TR5A 4FCWA 4KJZA 4S2EA 2UZ3A 2EFEB 4WAUA 2BCGY 2QAJA 2O0JA 2AKAB 1VIAA 1VYVA 3CNNA 1G7SA 2KSQA 2IYSA 2EYUA 3A4LA 4FMDF 4Q1CA 3NBXX 2HDNB 3I72A 3U3RA 3U4QA 2RHDA 5EXSA 1RC8A 1OW3B 5JJKA 1OXSC 3QPUA 4A0RA 4TSFD 1FQJA 1YZUA 4ZDIA 5DN6D 2NO1A 1U99A 2G88A 2MSEB 5HKKA 4LSGA 3C14C 2VLIA 3OEHA 1S3SA 3THWA 1TU4A 8OHMA 1HV8A 2V54A 4DRZA 4O0MA 1AIPA 2PX0A 1YE8A 3W90A 4B6FA 4NH0A 2V4ZA 1GL7A 2IUSA 1XRJA 3TVTA 2WIAA 3SDZA 2XTNA 4C30A 2K5UA 3CW2A 3GMTA 2ONJA 2QBYB 1KO8A 1XEFA 4DEXA 1G4UR 1XEWY 2Q21A 3RRNA 1XXHA 1U98A 1YJ5A 3F8TA 4FWIB 1YRBA 4KVGA 2VP9A 2IX3A 4D4KA 1SKYE 4YDSA 3RS3A 1XTKA 4N0EA 4Q66C 3B13B 5L3QA 5BXQC 2WTUA 2JDID 1NLYA 1KDOA 1PJRA 4FW9A 3K9LA 4HB2A 1Z6GA 2BMEA 2C98A 2G83A 2F7SA 3U3OA 2DPXA 2HUPA 4U5XA 3QKSA 1R8QA 2ZUDA 4NYMQ 1G16A 1Z0KA 5FI0B 5FL7D 1Q12A 2OM2A 4C3ZA 2MMCA 1CP2A 2W6ID 5IK2D 4JLOA 3M0EA 4M9SA 4MRPA 2H18A 4TYPA 2HCJB 4WW0A 1CF4A 1E79A 1S1MA 3AF3A 3GJ3A 1ZVQA 1UKYA 3QEJA 3HDTA 1F2TA 2QTHA 1U90A 3KQUA 4AWXA 3CX8A 4QG7A 4V0MA 3M4YA 2C78A 2QORA 2KE5A 5FPHA 2G3YA 4FMCF 3AKDA 1GUAA 1KDPA 2UVQA 3LA6A 4ON9A 1SVSA 4Q00A 2B7CA 4TL8A 1U94A 4D0NA 3B6EA 3QXXA 1NJFA 1OXXK 1ZD8A 1Z07A 1ZIOA 4LJ5A 1G7TA 5AK0A 3GJ6A 3C15C 2OCYC 4BLSA 1P5ZB 4R2IA 3OEEA 3ETLA 3KQKA 1TEVA 4HAZA 3H84A 3QBTA 4Q1EA 1OLOA 5KU1A 5KSPA 3RSOA 3NKVA 3LBHA 1XMJA 1M34E 4PAMA 1EX7A 2WKRA 1II0A 3GEHA 4Z54A 2O8EA 5G40A 1O87A 2FA9A 3THXB 1AGPA 3K0FA 5B30A 1X3SA 1F2UA 2OLJA 2F55A 4ILEA 3QF4B 1KI9A 4JVMA 3E70C 2XB4A 1VCMA 5CLQA 4G01B 4AKHA 3AEZA 1M7HA 2ZPTX 4PZLA 4DZZA 3SYLA 2ZROA 3C16C 2DBYA 1T8TA 1NJGA 2QUZA 3DOFA 1Z08A 2VTKA 2QMUA 4PPNA 3SNHA 1MRSA 2ZM5A 3NVAA 3OAAD 1C9KA 3ICEA 2PL3A 3O8DA 4DLTA 4E09A 2QMEA 3UMRA 4B32A 1NN1A 1E4YA 3K1JA 2JLRA 2RKOA 3SZRA 4OI2A 1Z5ZA 4KVAA 4JJZA 1XNJA 4PXAA 2QROA 1G8FA 2ZU6A 1W0JA 4TLCA 2HYIC 2WJGA 2YJTD 1G8PA 1OXUA 3K0CC 3O47A 2X77A 1M7GA 4AURA 1FPMA 4Q1FA 3SJCA 1VKJA 3D7MA 3ECCA 3L8ZA 4NCKA 4CZ2A 2C8VA 4OHYA 2F6RA 4OL0A 1WF3A 2GCPA 3K9HA 4LPSA 2PMKA 4AYWA 2JLYA 2NO9A 4DCVA 2O52A 2AK2A 2FNAA 3DVLA 5FTKA 3QE0A 4JKIA 1X1RA 1RPZA 4RKEA 3GP8A 5KDOA 5JLJA 2WWYA 2VA8A 1ZM9A 1SXJA 2RGGA 3ND9A 4FCVA 5AJYA 2CHVA 1CRQA 1ZW6A 2CL6X 4DIEA 1JAHA 2CE2X 1T4GA 3UANA 1OIXA 3P27A 4JT4A 2N1BA 5FBWB 4JLKA 5B57C 5KOYA 1N6NA 3ONWA 5KUTA 5FOTA 2C03A 1IN8A 1F6BA 2JA1A 2HEIA 2ZYVX 3Q3JB 3ND8A 1DO2A 2HF8A 1NSTA 2W6JD 3RWOA 1S8FA 2WSMA 3TNFA 4ARZB 2IHYA 1NL3A 2C95A 2ZRHA 2OFXA 1NN3A 4C0HA 5LD2B 2N42A 3RWMB 4C0JA 1W5TA 3BWDD 2ZJAA 2R6FA 1KJYA 5LB4A 2EFCB 5H68A 2LKDA 4NTZA 2VYFA 1U9IC 3LY5A 3TH5A 1FP7A 2JAQA 1EK0A 4JYCA 3HPRA 1G3IA 2CL0X 4AYTA 1N0WA 2QM8A 4FIDA 3GEIA 1C4OA 3PFIA 3P26A 3LV8A 4OYHA 2C04A 1R0YA 4EFMA 4XOIA 3B1WA 1ZJ6A 1P61B 1TUEA 2NO7A 1UEIA 3MG9A 3E2IA 1R6BX 1XXHE 1JALA 4UXJA 3DKPA 4ZKEA 2H92A 1I4LD 1E2DA 1N5KA 3B1VA 3K53A 3SJBA 1NN0A 3FKQA 1XCMA 2QPOA 2REOA 4V0OA 5G41A 4G5RA 4GMXA 1IBRA 2Q9BA 2ZU0C 4DDWA 4CF7A 2ZEJA 3CH5A 3HU2A 1KSFX 3WP0A 4MUAA 3U2QA 4DDVA 3AF0A 1AGRA 1G7RA 4TMTA 1E1RA 2QNRA 3MWKA 3BFXA 5BWMA 4ZCMA 1WP9A 4A2PA 3I32A 1NKSA 1GIAA 1E2EA 2IS2A 1E9CA 2NIPA 4LPKA 3U44B 4WXPA 4TZ6A 4I1OA 2C9CA 3QG5A 3P4XA 1QG2A 4EPWA 1PUJA 3FVQA 4DJTA 1GFIA 2F9LA 3OEHD 4QXAA 2CE7A 1E2IA 4IVQA 2QRZA 4LC1A 4Q48A 2FPKA 1NBME 1Q22A 3BB4A 3I4LA 1YQTA 4EIWA 1EGAA 3OIYA 4O2LA 1OFTA 1RVDA 3AVQA 1M6NA 3ZQJA 3NH6A 1SULA 5JEDA 5EXXA 4MGZR 2ZE8A 2ZS8A 2I4IA 2MMGA 1RRFA 4WOPA 4EDHA 2BBSA 2OEPA 4FXPA 1VG0B 5TVKA 2ZSEA 2P3SA 3X2SA 4JLAA 1PV4A 2GZAA 4LYJA 3ADKA 5B64A 1ZINA 4O25A 5DO9A 4TMWA 5EE3A 4A2WA 3KKOA 3LDAA 2Q9CA 1W4BA 2O0KA 2XNSA 1YZGA 4K8OA 4DLXA 1DAIA 1QHNA 3HJNA 3P1JA 4M1SA 1VTKA 1Q44A 2HLDD 1Q20A 4DSNA 5G53C 3L8YA 2PEYA 3N70A 1Q1ZA 2DR3A 3LX8A 4Q7KA 2IC5A 1KMHA 5AJWA 3QKTA 1E79D 4BFUA 5JBQA 1WE2A 4RD1A 2RGXA 3CKLA 4DDUA 1XD8A 5HE9A 4NYIQ 1QDEA 4E5UA 2D74A 4E22A 3KKPA 5B2ZA 3Q7PA 2QAGC 1EXMA 1XMSA 2WAYA 3AVXA 2D2FA 1B0UA 1XTJA 521PA 3NDPA 1GWNA 4I1UA 1IJFA 2FSHA 1CS4C 1N2CE 3BH0A 2C99A 2VP2A 3GLHA 4QOSA 3W9YA 2P0EA 4GOKA 3CPHA 3RS4A 1QHGA 3H86A 2FH5B 3C5HA 1OFIA 1JR3A 4TLAA 5FFMA 1YZLA 5DLQC 1A2KC 1MOZA 3NG1A 1C1YA 4IDQA 3MSXA 3THXA 1EX6A 3PUXA 4QM6A 5AWFC 3B8HA 4NMMA 1KO7A 2ECKA 1S9DA 4WXRA 3FMPB 1XP8A 1YKSA 4IOMA 3QF4A 2VH5R 2HCBA 3K0SA 3DDCA 2W0MA 4L5BA 3O8BA 2QMHA 2CDNA 4DT1B 1SXJE 4DLYA 5KSZA 3DZ8A 2Q9AA 4I1SA 2O8FB 4HI0E 2O8BB 3CR7A 4LBZA 3WMEA 4D2IA 3SI7A 1PLJA 4DCUA 2GCOB 4OHVA 4DLVA 1OT3A 3GLIA 1QHXA 5CYPA 1ZRHA 3FDIA 4FD2A 4YXWA 3EIQA 1UFQA 3FB4A 1JBKA 5FTMA 2CNWD 1ZM3A 3V9PA 1Y63A 3GLGB 5FTLA 1RW4A 1OXTA 4JSTA 1L4UA 2CXXA 4NHOA 3A4MA 1XDBA 3MD0A 3AB3A 4GRAA 4NCHA 1YU9A 4WBSA 3ZS8A 4PSVA 3W6OA 3ZZTA 1W0JD 2OT3B 4EPXA 4C2UA 3TMKA 1ZNZA 2ZSBA 3CLVA 4QL3A 4A9AA 2GESA 1DAFA 3BORA 3RVBA 5F2EA 1E2JA 4RFSB 3JZMA 3NTUA 4PO8A 3RSLA 3EARA 5C46F 4QBGB 4Q7MB 5HTKA 2FG5A 1JPNA 4DCNA 4OQMA 4TMVA 1XD2B 1E9RA 1Q3HA 2REBA 3ZVLA 1TTTA 1FQKA 2ZRGA 5CK4A 4TTRA 1U8AA 3ZQ6A 1RRCA 1KDTA 1S3GA 3QIAA 1SVMA 2GHIA 1ZNWA 3GJ7A 4TZ0A 5EP1A 1SGWA 1PVOA 1SXJD 2AXPA 1KMQA 1QHIA 3CH4B 2VPPA 1GVNB 5LB2A 1US8B 5P21A 4QRHA 3I5XA 4F4CA 3AVTA 2I1VB 1ODFA 3AQ4A 821PA 3HYTA 5DI9A 4EPTA 1NMYA 1ZCAA 2P65A 3LLMA 4RFVA 4JLVA 2F9MA 4PX9A 4ZCIA 4N0DA 2ZRAA 4XTRA 4PC1A 4BLPA 4JMPA 2PZEA 3BERA 1AZSC 2W58A 2ZJYA 1QVRA 4LJ6A 5JS7A 1Q0UA 2WSSA 3RC8A 2V55B 3IBGA 4HDCA 5J40A 3VKGA 4QFMA 1M1YE 1IY0A 3SEAA 4OKSA 2ZRKA 5JI3E 4HATA 2QP4A 1IAQA 4W5HA 2JJ1A 1HQYE 2WJYA 3I73A 4XH9B 3T1QA 3PUZA 2B6HA 3CR8A 3D6TB 4QM7A 3H2YA 5LPNA 5CJPA 5DE3A 1Z6YA 4A8JC 4DLWA 2RH5A 2FWRA 2GWHA 1UBEA 1XD9A 2RGNA 5IF9A 1E9AA 3QEOA 1PUIA 4X8LA 4B44A 1JAIA 4MGIR 2IK8A 3PITA 5DH9A 1AQUA 4AKGA 3BE4A 2IS4A 2IWRA 4JYBA 4KCGA 3SQXA 2OBNA 3L2OB 1WMSA 4IW3B 2F43B 2ODEA 4LV8B 3WMFA 3T5DA 1OE0A 5JZVA 3DMNA 1TX4B 5CIWA 3TVDA 4DB4A 1ZNXA 1E2GA 2YZ2A 4JLJA 4Q4AB 2QU8A 2IEZA 2P5TB 1MH1A 3ZYCA 1KI4A 5DYGA 3ADDA 3AVVA 5EE0A 2CLSA 2IYVA 4ZCLA 1M7BA 4A4DA 4JLPA 2PT7A 2C96A 1OIWA 3TUJC 1DELA 2ODBA 4WA7A 5DI3A 4LJAA 5TDHA 4NL4H 1OH7A 3I3SR 4DEYA 1P9RA 3AGQA 4Z8YA 1NG1A 2HXYA 2AR7A 3CM0A 1E1RD 3IHWA 4LCBA 5AUQA 2ATVA 1LS1A 2ZE7A 4FMDB 1HYQA 2V9PA 1II9A 1P2SA 4X8OA 2JASA 3B9QA 4PFSA 5DHAA 3RRYA 3NC0C 1LS6A 1G1MA 3B7GA 4MYHA 2JLXA 3CRRA 1G18A 1M2OB 3WRYC 3VR4A 1A1VA 5F9FA 2VSOA 4AK9A 1W4CA 2KWIA 4I1VA 2FU5C 1KI6B 3AVWA 4JJKA 2H8KA 2NZ8A 3T06B 4NYJQ 2QP9X 2F1IA 1WCV1 3JVUA 4B73A 4URVR 4W9MC 4K46A 4KSCA 2FJUA 2BKEA 4LK2A 1W7AA 3IO3A 2XSZA 3K0EA 5K8TA 5DIFA 5KDLA 3EASA 4OHWA 1JQJC 5JCZA 4F93B 3TJZA 1ZIPA 3KL4A 4TLBA 2A30A 4BASA 4HSEA 1P73A 4DLUA 1VCOA 1W2GA 1A82A 3UG7A 3AVOA 2WKPA 1GDDA 3CB4A 3QXJA 2WPDD 1Q3TA 3GD7A 3U61B 2CHQA 2OHFA 4QHTA 5KNBA 3K9NA 1L8QA 4UNRA 4F7WA 3SQWA 4BEJA 5DSZA 5L3RA 2EWWA 3I92A 1XPRA 3K70D 1XCPA 4HLUC 1GTVA 2ZR0A 5C4GB 4Z1MA 4LV5B 2DFNA 3MMPA 1Z47A 2QAGB 3THYB 1U0JA 4LJ7A 4GNKA 4KFUA 5GJBA 2JIZA 3VR6A 2QQ0A 4HZUB 2GAOA 4N1AA 3T1TA 3UMSA 4DC9A 1S0UA 4URZR 4C7OA 2F1HA 1ONBA 1ZAKA 4ZIRA 3PXGA 3BK7A 3B9PA 2XZOA 1UJ2A 4LUCA 3C41J 2PZGA 4AYXA 3A1WA 1XPOA 3RRZA 4EFLA 4A36A 5KNDA 1N5IA 2YC2C 2B8TA 3Q7QA 1XPUA 1W5SA 2ANBA 4OK6A 1UM8A 2OBMA 4FMCB 2WHXA 2Z4RA 4JBYA 5J4YA 4OI0A 1CJVC 3IBYA 5GADl 2KB0A 1UDWA 2VP5A 2DWOA 1TQDA 5E3HA 1AQYA 3RLFA 2OG2A 1JR3D 2H7VA 3TQFA 3ZJYA 3FHCB 1ANKA 3HU1A 2QE7A 4GZLA 5C1BA 4OJQA 2B21A 3DM9B 1R5OA 4Q7JB 1KZ7B 2GVZC 1MO4A 1P3JA 5FH9A 3HR8A 1E2KA 1BMFA 4YMSA 5F9HA 1PLKA 4OI1A 1XTSA 2ZJ8A 3ZDQA 1FMJA 4US1R 1ZUHA 1R2QA 1U8YA 4URYR 4EPYA 2GK6A 2O8BA 1TF7A 1GSIA 3NXSA 2J0SA 1KKLA 2ZRMA 2GCOA 3K0CA 5AR1A 2QN6A 4GL2A 1T3LA 1N0VC 2KBFA 4MKGA 3TRFA 4XVRA 1XZPA 2O8DB 2J0VA 3W8NA 1JPJA 2ZANA 3OE7A 3H4MA 2VIIA 3EZ2A 1KHTA 2R65A 4YXWD 5L3VA 4NP6A 4G5QA 4U00A 4PO1A 2CLCX 2QM7A 4M2LA 4PHFA 1SHZA 4IOJA 4CEJB 2CL7X 4YMTA 3NBZC 4HLCA 3LO5A 3TQCA 1S9HA 4HYYA 4LYAA 1CBUA 1W0KA 1HEIA 6Q21A 3I62A 2YWHA 2AFHE 4D82A 3U3MA 4UJ5A 4B43A 1NKTA 4NKRA 1FX0B 1Z8FA 4QGGA 1QG4A 1KI2A 4LX0A 1AM4D 1DPFA 3KTAB 2IYWA 5FI1B 3BIFA 1Z0AA 1KK0A 2V6IA 1NMZA 3GFOA 3MCAA 4KLNA 4M53A 3KKNA 5JWRA 2Y8EA 1KO4A 4E03A 1I2MA 1UDXA 3KJIA 2G1JA 2QT0A 2ASEA 1US8A 4CIDA 3QPWA 5J4VA 3RS0A 3WP1B 1KNQA 3EWSA 4K81B 3GQBA 5L3SB 4RVCA 1G8HA 3OFND 2IF0A 1CR1A 2A5GA 2GXUA 4Q19A 5JSZA 2ZI6A 4PZZA 3FYHA 4UKDA 2QGZA 4M1KA 1NBMA 2WWIA 2XOKA 4CT5A 1KIMA 3EPJA 3L43A 1W49A 2J5XA 2EU8A 3AUYA 3NEJA 5FPKA 5C18A 3KKQA 4A8JB 4OHXA 4TQ9A 3R9XA 3NDBB 1GILA 1OKKA 2IYLD 2REXB 4LJ8A 1GG2A 3RS7A 3EA5A 1K5DA 3PUVA 4DIDA 4MDFA 1KI1A 2WSSD 3WNDA 3ADCA 5CIQA 1GM5A 3SFZA 3QG1A 1U0HC 1QHSA 1S4QA 2A7QA 1FP6A 4TMXA 4BE7B 1Z2CA 2WIBA 2OXRA 4EPVA 4M8NE 1Z6XA 2ZIAA 1OYYA 5FOUA 5CITA 1N25A 4IFBA 2FSGA 4QJ4A 1R7RA 2W2TA 1TF2A 4BEBA 1SVLA 1UBFA 3VX4A 1ZBDA 1WBBA 2F43A 4IEEA 1N6KA 3WBKA 2ZJ5A 5JFGA 5K8UA 1A2BA 5TMPA 3WHLA 1LB1B 4M22A 3QKUA 3TUIC 2IS6A 3FPAA 4OI4A 2YVUA 1G3QA 3QXHA 5DISB 1XMVA 4Q4AA 4R98A 5FTJA 5HE8A 2P6UA 3UK6A 4F92B 3P20A 3PCRB 3QSYA 1DAHA 2IYQA 1FL9A 3IIKA 3AVPA 2CK3A 4JLNA 1BH2A 4TT3A 4TTPA 2OCPA 1EFTA 2IA5A 4HAWA 2AHOA 4RD2A 2ZVQX 5TV2A 4DB2A 2GEDA 3SN6A 4MKFA 1HE8B 1JEDA 2G0TA 3Q72A 2Z4SA 4URUR 2GBLC 4RZ2A 3BB1A 2RMKA 2Z5FA 4RJLA 2AN9A 2VL7A 3SHWA 1ESNA 5BN4A 4KO8A 2JLSA 4FCTA 2JLZA 1Q1QA 3A8TA 3VR3A 5FBVB 2GXQA 1IN6A 3B85A 3EZ6A 2JCSA 4OQFA 1KI6A 4EJSC 4CEIB 1G6OA 5FOVA 1N6LA 2D06A 4PO9A 2IYUA 4UNQA 3Q8XB 1LY1A 1JXOA 2GF0A 4HUQB 4P4UA 3WYAA 4BRWA 5J5CA 3NC1C 4KBFA 4LYFA 2B7BA 1NVVR 2XSZD 4LHZA 1ELOA 3WRXC 1U81A 4QGFA 2V8OA 3B82A 3KJHA 4MQBA 4TL6A 4LHWA 2OE2A 2OCAA 4V0LA 1JEEA 1JJVA 1ZP6A 1NIPA 4D6PA 1WRBA 3OIUA 1A7JA 3AH8A 1KY2A 4LBYA 5KSOA 3BB3A 1BOFA 1H8ED 2BEJA 3U7HB 5KDDA 2WJHA 5KYKA 1RIFA 2QAGA 2OBLA 4A0FA 1KOFA 4ASUD 5F3WB 5EUQB 2NO6A 3THYA 5DNYB 3PG5A 5JHHB 3TSWA 4BFTA 1Q1EA 1T0JB 5GJCA 4A0GA 3P32A 1RFLA 2IT1A 2R2AA 5E4FA 3TBKA 4MKHA 4Z1MD 1G3UA 1H8HA 3BD9A 2FGJA 2YV5A 2IL1A 1KYIA 4IVPA 1X86B 2VF8A 4B74A 1P9WA 4BLOA 1UAAA 4QHYA 1SKQA 3DL0A 2JIZD 3O8CA 1OH8A 3KXKA 4OK3A 1HY3A 3VX3A 3JVVA 4TN1A 4WZ6A 3CUEF 5DYIA 4B3FX 3RYTC 2FPLA 4HB4A 1OH6A 1BS1A 3ICQB 3P4YA 5H8WA 3CIOA 1U8ZA 1CR2A 3MUFA 2ORWA 4P4SA 4PHHA 2FSIA 2OESA 3GLGE 1KSHA 2BWJA 1R5BA 1R0WA 1E9DA 2FEOA 2HXSA 4HAUA 3U3KA 3AKCA 3HWSA 5EE1A 4B2IA 4D4MA 4ZDJA 3UWKA 2YWEA 2AXNA 4NCIA 4R7ZA 2XXAA 2Z6VA 1O3YA 2ZI3A 4KFTA 3DM5A 2OLKA 3MLEA 2AWNA 4JT2A 4Y0AA 2XZLA 2DFTA 4WVFA 5DHFA 5IT5A 4L9WA 1TQ4A 2ERYA 4D26A 1J8YF 5AJVB 3R9WA 4MH0R 2PCJA 2QE7D 2VEDA 3GFTA 3B60A 4IKEA 3QXCA 4RY2A 5CJ2A 1R0XA 4DWJA 5B58C 1XZQA 4QNMA 1CXZA 2FMXA 5FPYA 3KQHA 3Q85A 4B3DA 1E2LA 2VP0A 4H1VA 1VDZA 5FL3A 1NIJA 4PC7A 1MABB 1OFHA 3FGNA 621PA 1CJTC 4ACAA 2O8DA 5HR5A 4QBIA 1NLZA 2OCBA 1OHHA 4RD4A 3VR2A 5HKKD 4G5OA 2JLWA 4A0HA 3UMFA 2QBYA 2QTFA 2X19A 4Q9HA 3OE7D 4V02A 3LBIA 4FMBB 1ZC4A 4QGHA 1N6HA 2CJWB 4BFYA 2DWPA 1P62B 2QY9A 4IEIA 1FX0A 4OK5A 1OB5A 1W0KD 4CDGA 2QL6A 4Q4JB 3KTAA 3KXIA 4PSAA 4DXAA 1Z0DA 3C8UA 3GJXC 4O2RA 4PPGA 2YOGA 2IYXA 4FI3C 2YOHA 4MKIA 1XTRA 5FR2A 2EQBA 4TLDA 1YZQA 1XBTA 5EXTA 4AC9A 2GRJA 3NEYA 4LBWA 5EE5B 2BBOA 4H1UA 3SJZA 2BMJA 4GOXA 1IN4A 4Q1DA 2NPIA 2H16A 3X1YA 4LOAA 3VU9B 1EFUA 2R9VA 1TMKA 3BBPA 4IDPA 1GZSA 4DBLC 2YC4C 1QBKC 5L3SA 1UKEA 3REGA 4Q18A 2JJ2A 5TARA 1N6IA 1UADA 1YZTA 2RGEA 1DO0A 1FUUA 1KO5A 4RZXA 2QEQA 4JLMA 2PJRA 3KQNA 2IUTA 2OAQ1 2EW1A 1OSNA 3T15A 3CONA 1HA3A 2J7PA 1DADA 5JS8A 2BM1A 4A8JA 1L4YA 3I8XA 1P9NA 3NWJA 4IHQA 2UZIR 1NBMD 2XOKD 2GKSA 2LWIA 4PPQA 1KI7A 3CWZA 4QGAA 2XJ9A 3DKVA 4X8HA 1XF9A 1OFUX 4WIAA 3EZ7A 3QBVA 2PMDA 5EP4A 3WHKA 1WBDA 2BJWA 1IM2A 4M4SA 3FKSA 2GETA 4B3XA 1FTNA 2MSDB 3OEED 1U0LA 4DCTA 2ZQ5A 4M1MA 1Z3IX 3SC3A 2ORIA 2BDTA 4PZYA 1KZGB 2R6GA 3PEVA 1CEEA 4C2TA 4AI6A 1G3MA 2F1RA 1IXSB 4IOKA 2J46A 3ZS9A 3AF1A 4Q01A 3R20A 1E2PA 2O0HA 2IXGA 1FW6A 4HUTA 4D25A 2W0SA 5CB8A 1DEKA 1LFDB 2WJJA 5C2JB 3AF2A 4Q9IA 1QZXA 2GEVA 3KB1A 4L16A 4YLGA 3VFDA 4UNSA 4AD8A 5HCNA 2NMVA 4B33A 1E2MA 4BZXA 3LAWA 1E9EA 5D3MB 3GCGA 2VSXA 2CK3D 5JRJA 4TT3D 3VAAA 3LW7A 4NPHA 4G3XA 5BYJA 4EJSB 1DBSA 3DMDA 4R9UC 4KXFB 3ZVNA 2FF7A 3J81k 4GSYA 3FFAA 1G3RA 1YR8A 3HP1A 2ZR9A 3TW8B 4BLTA 3RDPA 2BBTA 2XZPA 3Q5EA 2R62A 3LNCA 2AL7A 3U4QB 3DO6A 1CU1A 4GI7A 4LGMA 1T3HA 2GXAA 1ZNYA 4LHYA 4CEIA 4KBGA 4GP6A 1G9XA 4Q9KA 4BFXA 1V5WA 2YINC 3IQXA 4KODA 1P72A 1NP6A 3RAPR 1OH5A 2QPAA 4ESVA 1TL7C 4AG6A 3THWB 1I4TD 4HAVA 1CJKC 4MRNA 3T5GA 1GRRA 1K8RA 5FUVA 4KAXA 3GEEA 1AS0A 4PC2A 2Z0MA 3B5JA 4C4PA 5KPDA 1DG1G 3JZAA 1NVVQ 4C0QC 3TAUA 4B75A 4R71A 1HT2E 2Q3MA 3T34A 3G0HA 1OF1A 3CZQA 4XD7A 5SZJA 1LTQA 2ZYUX 3FMIA 5FOXA 2F3RA 2YOFA 5AUNB 4GT1A 3BOSA 2G9NA 2ZREA 3K8YA 4TL9A 1V43A 2WJIA 2J3EA 5JWOA 1D9XA 1GL9B 4WZAE 5KTYA 3D3QA 2ZJ2A 4PHTA 2EFGA 4ARZA 2WVJA 1SVWA 4ZI3A 2GZDA 3ZLJA 4DKXA 2D2EA 5GVRA 1NNEA 4Q9JA 1MV5A 1WQ1R 5IK2A 1N6RA 4NYMR 3W5JA 3TGPA 4YDHB 3VR5A 4PHGA 2ZRIA 2ZI7A 1W36D 4OQXA 2G6BA 1G21E 2GXSA 4AIIA 1TPZA 5SZIA 1DTSA 2CHGA 5LBIA 1H8HD 2PLRA 1OB2A 2J1LA 2J7KA 4KI0A 4ZO4A 1XFAA
chains in the Genus database with same CATH superfamily
4YRCA 2HRRA 4ZCRA 2R6CA 2O48X 1H6CA 5K0EA 5GJVC 4N8EA 3J80A 3OSZA 5LA6A 3QJ5A 2QN2A 3VNVA 3UAWA 2H7YA 2A9QA 1E0KA 3OLZA 3BAFA 2J3HA 5IASA 2C83A 4YONB 3UXMA 1MABA 4PYRA 2ID7A 3NBFA 1PNTA 2XQGA 1P0PA 2PMCA 3VR2D 2GPYA 3BDVA 1NMQA 5IDVA 2PO7A 5IEBA 1VJ5A 5CLGA 3HUTA 2HA4A 2CJFA 1U9CA 4RDXA 2Q49A 4I5FA 1TLFA 2CH7B 5BN5A 3PNPA 3B1YA 1YDXA 4JGSA 3A3YA 4Q39A 3AZQA 4GFDA 3P9XA 5IYZF 3G82C 4CUZA 1EG7A 2Q1SA 4QYXA 1L8LA 1Y9ZA 3RFTA 2ZQYA 5H9CA 2P2YA 5LQKA 3QEBZ 2UVPB 2FW7A 2VXYA 1NI4A 1WB6A 3G85A 4TWKA 2I54A 2FPWA 1B23P 2WJAA 4KQ9A 4JSYA 1E9BA 2FWNA 1JEOA 2GEKA 2IW3A 2R7LA 3MWEA 2C4HA 3TLCA 3O1HB 1GZVA 2BE3A 4FYYA 5DXAA 2KB1A 5DWQA 1NH2D 2D1SA 1T0PA 4J0DA 4US2R 3AUKA 1E60A 4DT1A 1TUEB 5CK5A 4MR8B 2AQHA 2O8FA 4W8OA 5SZHB 3DL2A 4P2GA 1L2TA 4PI0A 2PRKA 1FQWA 5LLSA 4NATA 1NYLA 1SQXH 2GN8A 4D98A 4TRMA 4UFNA 1P4SA 2G67A 3X1MA 4WEOA 1X1QA 1VL0A 2JEOA 1KE1A 5HCUA 3C39A 1KYZA 4FDMA 3L9DA 2VPTA 4UXNA 4RPLA 4G09A 3FWZA 1W0JG 2W6ZA 5HPYB 3UJ9A 1F20A 3GP5A 1GITA 4NF2A 1FFCA 3I2KA 4R3WA 1RTTA 1SQGA 5HIMA 3BSSA 2F93B 1XQ6A 2JJ1D 4NZYA 1I3CA 3RPEA 5GONF 1ZUNA 1E0DA 2DFVA 3S1AB 3WGYA 3KVRA 2PEZA 4JR0A 2E6KA 3OD1A 1L4GA 3JZIA 5KYYA 3WFZA 2BUCA 1V5FA 4FHGA 3DE1X 3JD0A 3SYPA 3AF4A 4ID9A 1NTMH 3PEUA 2G25A 3FG9A 3UJBA 2DJIA 4MPDA 1L7MA 3M8KA 2BN4A 1ZZGA 2YWGA 1OFVA 1ISFA 3OPVA 4GM1A 3CF6R 1AN0A 2H4HA 2DWQA 1B06A 3KWJA 4GXNA 2V7EA 3EK2A 3AR9A 1JL3A 1T2CA 2FFQA 2YEVA 1VP9A 4XM1A 1J39A 4FYHA 1YZKA 4TZTA 4MRMB 4MJXA 4YP5A 1NDQA 3MN1A 2R8PA 3KT6A 1GN8A 2W6PA 4I4NA 3EPRA 3F5SA 4I5GA 1P91A 2Y1LA 3BWMA 221PA 3VNQA 1VLMA 1X8KA 1KJZA 3ML1A 2CE4A 4BNHA 2HSWA 3CZ4A 4TROA 2XRFA 3LUFA 4F2GA 3HKEA 4TOIA 2DQSA 4Z4FA 5B3KA 4E1VA 1I2CA 3ICPA 1TUIA 4ZALA 3V3KA 4G1VA 4WNYA 5LM3A 5K6TA 3LH5A 2C7GA 1T1JA 1V47A 1YL6A 4AX8A 5AW0A 1S2DA 3UB4A 3ABTA 2GBCA 2QTLA 4L0CA 4EFEA 3IR7A 2BGRA 3PDIB 2X40A 1ZPDA 3W8EA 4AY3A 4MZXA 1EVKA 4U0KA 5K8IA 5LN1A 4KJXA 3E9EA 1NF9A 2KPOA 2F3SA 2X1VA 1CIPA 2C2XA 2PTMA 5FBHA 3UJ7A 2WMNB 5JD5A 3H01A 3I5AA 3ZWCA 3TCUA 5JI2E 3EHEA 3KDSE 1J42A 3WLNA 4PS0A 1RRKA 3TZHA 1D8TA 2HCFA 2OOKA 2VYQA 4KHPO 4ZOLF 4MP6A 1PNQA 4CLOB 4ZIRB 3S28A 3D8BA 2ETXA 1UBMS 3DBHA 5KQGA 4RDIA 4X1KA 1ULTA 1CUYA 3O0TA 1DLBA 2HF9A 5TNXA 4Q4LA 1FDTA 1H4SA 2E0IA 4IR7A 4YQEA 4DV0B 3VGPA 4Q4CA 3RADC 1Q95A 3NHJA 1L0BA 4ECAA 2HF7A 2IGBA 3VYVA 3B1XA 4JXXA 3W1VA 1M2FA 3PDHA 1H3FA 1ZGJA 2V6FA 1HBJA 2XMGA 3WWDA 2Q0AA 2I7VA 1PEYA 5J4LA 1CY2A 4KR2A 4BQIA 1EHYA 1GPBA 3HGMA 1AB3A 4L3WA 4Y7DA 4UUAA 3LLUA 2Q7EA 3RYFB 5EQFA 3UHFA 2D7CA 5ES3A 2ZTHA 1Y8CA 5DM0A 4S1PA 3RK4A 2YXPX 1U9YA 3AK4A 4G56A 1DCMA 1Y66A 4IXTA 1TK2A 3L82B 4U7GA 1YR9A 1UDCA 2K87A 5CFRA 2ZK7A 3R4CA 3IQGX 3R0XA 2I33A 5IS2A 1OC2A 1TAGA 3T5AA 2DQZA 2QTVB 5A71A 4ASUG 3I4CA 3DWIA 2VAMA 2LGWA 4E32A 2ZXEA 5AOAA 2DPMA 2NTYC 3KFVA 3I1JA 3U3JA 1XAIA 2C2KA 1O94A 1FS0G 3L02A 3K0FB 1L7OA 3F73A 1I2BA 1PK8A 5AW4A 4YRDA 1T1IA 4ZGBA 5BN1A 4N49A 1EFCA 4GPTA 1IWOA 1AKYA 2CGNA 4ZRMA 5CPBA 3AVYA 4HXYA 3V5NA 2H11A 4IIUA 1JJAA 1PAUA 3GLSA 3PSAA 3VKHA 4RMGA 1WUYA 4GUNA 3W6NA 4I5IA 2COEA 3WNZA 4IF4A 2X8BA 2OGUA 4P7GA 1WAZA 1YS4A 2QWRB 4EW3A 3X44A 4Y1GA 1I80A 2W0FC 2FDXA 4HZIA 5HF6A 2VWQA 4QVGA 4GP7A 5FUYA 1TT7A 1GRQA 5FAKA 3KSMA 4MW9A 1RKUA 4Y1RA 1L5SA 4KXNA 3N8HA 3OZXA 1U02A 5GAJA 3DEAA 2VRBA 3OQMA 3ZD7A 1UC5B 4H3HB 1E2UA 4R1OA 4DUYB 5GVSA 3D8RA 4EECA 2EBOA 1AJEA 5BV2P 4B34A 4M0LA 2W0XA 5AVKA 4EMBA 1VYVA 1MLDA 4KQMA 3A4LA 3HV2A 3BZBA 4ZAGA 1PK9A 3CRZA 1OXSC 1KBOA 3QPUA 1XA4A 1XFDA 2B99A 5CNMA 4F2DA 2VLIA 1MZFA 3OEHA 2P4EA 1MENA 3OG9A 1Z8NA 1YDMA 4NJMA 2Q5IA 4NH0A 3RUCA 4BQFA 3WLIA 1S8NA 3HCRA 3E23A 3DLIA 4L4SA 1YJQA 1OCEA 4UDOA 5B7GA 4YIHA 1CUGA 3S4YA 2EEZA 2WTUA 4QPJA 4L75A 4NZNA 4FW9A 3MCUA 3PIIA 3Q3IA 3A06A 1R0RE 2XQFA 1V3TA 4NAVA 3N87A 4JOCA 4KWEA 5FI0B 4P0PB 1QH1A 2B0CA 1A50B 2DHCA 4IQ4A 2FUNB 1NAIA 2CXUA 4NBLA 4ZP1A 3C6ZA 1GUAA 1NJFA 3IKLA 5AK0A 3DLHA 3OEEA 3DXYA 5BR4A 4W5TA 4HNGA 5KHIA 3HSSA 2WSLA 2YX1A 3FAVA 3A0BZ 7ADHA 1O94D 2IKSA 4G01B 3AEZA 9LDTA 1F7UA 5ALZA 3AUJB 2VTKA 3T5PA 1EFKA 1VQ7V 4GOND 2IUFA 5AKLA 1YIAA 4KUGA 1L4LA 5TF0A 1JGTA 4MVWA 4D9KA 4ZEMA 3PGXA 1IK4A 3CNEA 4LS3A 1KY5A 3EGDA 1RPZA 2IBZH 1MXFA 2ZVJA 4FFSA 4R1QA 3COZA 3GMSA 1E6MA 3AB7A 4BX0A 4L76A 2RK6A 4X7MA 4Q3OA 3PJDA 2XVXA 1OIXA 1FLAA 4FR2A 2HEIA 3HDQA 5BSEA 3LM8A 5LD2B 4J16C 1M8JA 1P5JA 3ANLA 3VPGA 3NHWA 2Z57A 4X62O 5LB4A 2AFHB 2A9OA 3KZNA 4AQYB 3WZMA 1XMPA 4H2DA 5JY6A 1E4EB 2QB5A 2R1UA 3OZUA 2FZCA 3E9QA 3SJBA 3ZC3A 2A88A 5KKCA 3EWIA 2PUSA 1EUQA 1G7RA 3KAPA 4DR4O 4ZCMA 3AF5A 5FUMA 4WXPA 3DTVA 1QR2A 2GN1A 3OEHD 3KJXA 2DWCA 3ETEA 3LJKA 4AW9A 1Y9DA 1K6EA 3QEMA 1P2BA 3MTEA 3ICXA 2B1IA 5B1DA 2OD7A 1ICEA 2YVAA 2ON6A 4LF5B 1OCZB 1FA9A 3IAS6 1DAIA 2FSSA 3LSSA 3H19A 5KWSA 2PEYA 5FFFA 1W5BA 4DDUA 3OKAA 5SYNA 2VZEA 2C20A 2BFCB 1GTZA 3MD9A 1RM4A 2YIDA 1SG9A 1VMEA 5CCBA 1QQBA 2WLLA 2I3DA 4EITA 1YZLA 1OCOB 1J2RA 4MCAA 4IDQA 5ADWA 1POXA 1ILWA 4WXRA 3H1BA 5LZ8A 1JAXA 2E49A 1XMQB 3ZV3A 5KSZA 5E6RA 3CR7A 4YRMA 2EZ9A 2Q5OA 4IHJF 2WUDA 4L8YA 1GPDG 2PD4A 1SUWA 3NRCA 3ZCXA 2VJYA 2AHZA 5K3AA 4Y2TA 3I6MA 3KO8A 2NUAB 4ZCTA 4J4BA 1L0LH 5C46F 3AEIA 3ZJ4A 3ZCSA 3RHTA 1XD2B 2NSJA 2ZRGA 5CK4A 3DTTA 1QC5B 4Y6RA 4TZ0A 3I2HA 5BRAA 1US8B 1A9YA 2G82A 2VH1A 1JRLA 2P4UA 4RK0A 4N0DA 1RPRA 4QPKA 1WPRA 3R9XB 4QFMA 1RPAA 1UBOS 5JI3E 2X6CA 4HATA 5HIAA 3SX2A 3RVDA 3CR8A 4A8JC 3EGWA 1DP4A 2RH5A 1F5SA 1BDMA 2RDCA 5B12A 4B85A 2BZSA 1AQUA 1RADA 4LFAO 1IE3A 3GELA 1GFZA 1OI7A 5JZVA 5EWLB 2ZWVA 1ACJA 5LZ9A 1AQ6A 1FTYA 4WN9A 5LBQA 3GG9A 4ED9A 3SPGA 3S99A 1PM9A 2AR7A 2V9PA 2V0CA 3JW8A 1C3LA 2IRWA 5LQNA 2NWQA 3DTVD 2KWIA 3CVOA 4LRUA 1XNGA 1U2GA 4YT4A 4BVLA 3AQIA 3GVMA 4ARIA 3VZDA 4HSEA 4GI5A 5KHGA 4DLUA 1OI3A 4DR7B 1JT9A 4HPWA 3K4PA 1FXVA 1EBBA 2PUJA 4G1BA 3P5BA 5C4GB 5EIEA 5G0WA 1B74A 1WAMA 1U0JA 1VKRA 4R8RA 3NCTA 3F6SA 3EXFA 5BWOA 3SZMA 3J81A 4C4YA 4P5DA 2XVYA 3CFYA 5CDYA 4PN3A 4HKTA 2NP7A 4JB0A 2CT8A 4OVKA 1ZEJA 4NDNE 3BTUA 2WUEA 1R15A 2YUAA 3JVIA 2FKXA 4KL1A 1FDSA 1L5GB 3LFHA 3PQ5A 3B3FA 1DF5A 4LRYA 4HDSA 2QLFA 3DM9B 4EJ6A 1DTWB 4D0SA 2I3GA 1R66A 3VU1A 1TF7A 1KKLA 3KUUA 4WL0A 1Z4LA 1JXQA 3UWMA 3EIFA 4G5QA 1RI1A 1VMKA 1KRWA 3ITNA 1YZVA 2ONZA 2D0IA 4HLCA 1HEIA 2PR2A 4UJ5A 4OPAA 3PC8A 5C32A 2PAFA 3KTAB 4P58A 4HHEA 5FI1B 1NMZA 3QX3A 1BRTA 3IQIX 1X1EA 2B98A 3FB5C 4G0VA 1UFOA 4TTSA 4QUDA 1FNSA 1Q1GA 3MMSA 1NKDA 2QGZA 3IXLA 2WWIA 4TMFA 1U4SA 4XLTA 1PS9A 2CWWA 2W8BA 2A33A 3E48A 1SUSA 1GG2A 1JFFA 1EJBA 2PLAA 3EA5A 3R3YA 4DUPA 3ZWAA 4GEGA 2GPWA 5CIQA 3UWDA 3SFZA 4WFHA 4KR0A 1PQWA 4JC4A 1Z2CA 3H11A 4PFJA 1JDVA 4CDRA 4YV1A 3ED1A 4BVEA 4TKUB 1DCTA 2YVUA 4Q4AA 1I7QB 3RFRA 4DB2A 4QUGA 2XCTB 2Z5FA 2CFOA 1UPXA 2H07A 4QPZA 5FNVA 4V1CB 2Y0IA 3M9XA 3A8TA 2GZMA 4HS9A 2BGWA 1Z12A 4JAVC 1ZVJA 4DR5B 2JJYA 4EJSC 2LDBA 3GRZA 3PI6A 1AR1B 2NUPA 1QFMA 3T9FA 1Z2EA 1T5DX 4BMSA 5AFSA 1ZY2A 2IHVA 1UBNA 4B9AA 4HYOA 3RVQA 4QGFA 3MCVA 2W71A 4QQNA 1SQQH 4KR6A 4V0LA 3OIUA 1KVSA 3VOTA 2JHCA 3N8IA 5DWDA 2QAGA 2OBLA 4JC5A 5EINA 1GMGA 4I19A 4CKXA 3M34A 3C5VA 2R66A 1KP9A 1P29A 1Z4KA 1IX9A 1FDVA 4FSXA 4OK3A 4EB6A 1I5YA 3H9QA 4AMZA 1ZONA 3ICQB 3CIOA 3LUCA 1JMKC 1R5BA 1A4IA 2AVNA 1P4AA 3HL4A 5AKKA 3GBVA 2YWEA 4X41A 2ZUVA 2D1QA 4JTCB 3K58A 1XJWA 2RK3A 5IT5A 4L9WA 1J8YF 5D7NA 4CMKA 1JDUA 1Q91A 2Q0QA 1E2LA 2PGOA 3EIOA 1EE1A 4TPKA 1YBVA 3UJ8A 1STOA 4Q9HA 2OHVA 4TXLA 1FU8A 2XUZA 3F7VC 2G08A 1HETA 2IPNA 1Y4ZA 2BGKA 1SELA 1ULSA 1QZZA 1WPGA 2J3LA 3IUJA 3AEKA 1USUA 2GRJA 1EFVB 1KR5A 3D7RA 2NPIA 3LPDA 2GM5A 3RKSA 3EGEA 3I5MA 2ZQMA 3PEEA 2RGEA 1KO5A 4GD3Q 1OSNA 5DPMA 3EVAA 3AETB 3PHCA 1CT9A 4QGAA 4X8HA 2WINI 3EZ7A 3NEAA 4OUDB 1JSXA 1WBDA 4M4SA 4XWWA 1JR2A 3RV4A 4FC6A 3JYPA 2HHHB 1FTNA 4DCTA 1TVCA 3IURA 3PEVA 1G3MA 4GX2A 1E2PA 4FMPA 4OMUA 2Q68A 1F0NA 3LAWA 5EA2A 5EMHA 1OFUA 2WNSA 1VSQA 3KSDO 2PL9A 4M3NA 3NPMA 1G3RA 3Q5EA 1XILA 4DMGA 1WDKA 2ZCJA 3Q3CA 3OJCA 3OQNA 2YTZA 3IQXA 1RHRA 3G59A 1QP8A 3ETGA 4HNSA 4MRNA 5LP6C 1DG1G 4B75A 3LCUA 1LKZA 5SZJA 5E1OA 1A8HA 1R4MA 4ZVNA 1ZITA 3K8YA 3MWFA 2WJIA 5KTYA 1PL7A 4NOJA 3LUAA 2CGEA 2DJ5A 4KUMA 1RM3A 1WQ1R 4G5XA 5IK2A 2NZ2A 4FM2A 2QSAA 2QT9A 1TXGA 2XUGA 1H9AA 1SUPA 1W9HA 3FSRA 1BHJA 4LTMA 5CMUA 1VJCA 2Q62A 3RSCA 2APJA 2BEWA 4BO0A 3EX7C 1KS2A 4MQFB 1E5VA 3UUFA 2XY4A 2J87A 4N7JA 4L73A 3QVUA 2BFBB 1NW5A 4BFZA 1DOHA 4GECA 4N8SA 3M1IA 5LOVB 1YQEA 4YQFA 2J45A 1H6DA 4ALIA 1YR6A 1H5QA 1WXQA 5I7FA 1QRTA 1CE8A 3LL7A 3IAM6 2ZYSA 4FYVA 1C29B 1TE2A 5ER9A 2FAXA 3SLRA 5JJLA 3TQOA 3LBNA 2WJ4A 4QEZA 4OLBA 4X20B 2A78A 1Z0JA 1XMQO 2F8TA 1G64A 3KKMA 4ER5A 3O8RA 2IU6A 2Q4BA 3V2IA 3PVSA 5EBLC 4INZA 5DVZA 1AUXA 4HUJA 1TYDE 4WK6A 4POAA 1DFGA 1ZQ1A 2UYOA 1D1QA 5GWXA 5GM1A 4BGDA 1OIVA 1NRJB 5EXDA 2H1IA 1EWRA 2VBCA 4PQFA 5CRIA 4C2BA 1K3UB 1B7GO 5AH0A 2MW2B 2WLNA 3L5KA 2NLOA 3OQHA 4UOEA 3R5FA 4DCJA 2P2SA 4FYMA 2IYZA 2OQ2A 5GPBA 3ZDYB 4WKGA 3C5CA 3KBOA 4KW7A 4HQFA 2KJQA 1FFSA 5E9QA 3CRVA 4LF9B 2UYCA 2X8JA 1K7XB 5KJ1A 4MDYA 3W6UA 1RE0A 4LBVA 2QP3A 4OHZA 1X7WA 1COWA 2PH1A 1JLLB 5A9TA 1XLVA 4BVBA 5LWHA 3R3UA 1OTHA 2E75B 3W6ZA 4GKAA 5IFLA 1NXQA 3AR3A 3T7RA 4AROA 3NYIA 3CCMV 4HX9A 1EGHA 3JQBA 4Q21A 5E7JA 3MJTA 3I55V 3D5EA 3ENVA 2V4DA 2C42A 3K0AB 3P9RA 2JBAB 1Q15A 4HDQB 3S70A 4O4JF 3RYCA 3UXEA 1PJTA 1KMNA 2WOJA 4FB5A 3TSAA 5ALYA 3CF4A 4AMVA 1KMHB 2RHWA 1L5NA 3RS2A 2VDJA 4FE3A 3G80A 3MGCA 2B92A 1KAMA 2A5FA 3H1KH 3PNMA 1ZMXA 2PYZA 1XOUA 3CKMA 3Q5DA 3QJGA 1KFEB 3LKVA 3LK6A 3OIVA 3FHTA 2Z5VA 3GFFA 3F0TA 2W2NA 3ANMA 4HGNA 4ADSG 1FTSA 1JQAA 2AWOA 2WUVA 1BWSA 4CNBA 4G27B 1K06A 3LT4A 2VP3A 2AOTA 2GYWA 3CUWA 1TPYA 1DQPA 4R83A 5BR8B 3OKCA 2B3DA 2JFOA 1H2YA 4Y6LA 2VLBA 3FGZA 3SE0A 1ESEA 3OQBA 4Z8XA 2NGRA 1T9HA 4IOLA 3LHKA 3D0KA 2XAUA 4D96A 1MW9X 1MNGA 5DNVA 1ZYUA 4YHBA 1BCSB 4ARAA 4DILA 5GW7A 3EUFA 1HDEA 3TD6A 5HM6A 2F1JA 1YH3A 4TUYA 3LS2A 1ODLA 4R1NA 2XTZA 2VXCA 5ES4B 4QVKA 1S7GA 1ZD3A 2NYAA 2P4HX 1QCEA 4OV6B 4GX0A 1CUDA 4YCBA 1G21A 3SIWA 5ALFA 2BR3A 4TYNA 5CEEA 3A0RA 3H6KA 3SQLA 3HM9A 3QLVA 4MGKR 4C7KA 3V1TC 2Q5FA 3MJCA 3R3JA 2XNDG 1PGNA 3TSOA 2F95B 4W5NA 1P0CA 4A16A 4JIMA 3VPDA 5LDDC 4BP1A 3LDUA 4C4ZA 4ZOAA 4M8KA 4NZMA 5E1AC 2Q5QA 1COWD 1CUCA 5AVSA 4UB6Z 3AP3A 1V6SA 4QUKA 4FGJA 2PWZA 1E2HA 2H1VA 4C5CA 1RJ9B 1NMXA 4BAUA 2WD9A 3SPJA 4BIIA 1VQKV 4WFEA 1W5FA 3QMPA 1UKZA 2VJLA 4EZIA 5I9SA 2UUAB 2CVPA 3M5DA 4RLHA 5CNJA 2PV7A 2B3TA 4B79A 1SERA 4XYGA 2DRIA 3BMNB 4A73A 3ENZA 4X8AA 1MJGA 3ZVMA 4AMGA 2OV1A 2O3JA 2LP7A 4AWBA 4Q6WA 1WNTA 3DD5A 2ERCA 1W36C 2H9AA 1W35A 4FOSA 1HW7A 2A3RA 4CG1A 2GTHA 3FYDA 1SVOA 1YQGA 3FOFC 7GPBA 2E7ZA 3GT0A 4M0MA 5M3BA 2QD1A 1D6JA 3D8NA 4DY4A 2NQ2C 3ROGA 4HH1A 1CJUC 1E8NA 1L4BA 2VVTA 3OIWA 2V4MA 4X7BA 2NLJC 3WL4A 2JGRA 4QOFA 5TVGA 2VZ9A 1LU9A 3EISA 5DBIA 2ZI4A 1M74A 1JWLA 2JHGA 4MQLA 1A88A 3QMWA 4JC8A 4PLWA 1G5RA 1TVKB 1RP7A 2WA4A 2DFLA 2W6IA 3L1VA 3P3NA 3EEYA 4W9NC 5C0OE 2VF4X 2WIGA 2EZ4A 3IEKA 4NIMA 3T3EA 1Z0FA 1NY6A 4JYAB 4PVDA 3ZHTA 4CW7A 1UMCB 4N40A 2HK7A 1X80A 4EKDA 4D4LA 2XDYA 5G1NA 1JSLA 2UVDA 1XU4A 4XWOA 1HE1C 5JHGB 4Z1MG 3DF7A 2PHZA 4ZQFA 3PC3A 4N0QA 1T5TA 3AWDA 3F3YA 4QGSA 4LTDA 4PZUA 4BMCA 2CXNA 3OTOO 2WMOB 2AUNA 3CCCA 4ER3A 3JQCA 2A92A 2UXBB 2B6NA 2ODAA 7YASA 4WFJA 4BB5A 3DR5A 3FZGA 3FCAA 2NPFA 2VHJA 1KJIA 2ZGVA 4UTRA 2J30A 2Z43A 3U7JA 1VQ5V 2P9CA 2IHZA 3I01M 3KL2A 3KDPA 4NFHA 1NZ6A 3TLKA 2XEXA 2KI5A 3OFKA 4JSRA 4JI4B 1IWPB 1NOIA 1WMDA 3QVWA 1YZ3A 4JLDA 1YR3A 3CSDA 1CETA 2YYZA 2B82A 4NNJA 4C0BA 1FPQA 2A94A 2EX4A 5DOVA 3VSEA 3IPLA 1XYYA 2ZJBA 4R51A 1N77A 3CCLV 5HCIA 1TAEA 4F6EA 4NTXA 5CB4F 1SRQA 4JIGA 4RJKA 2GRUA 2AYYA 2XXAB 3GP3A 3VOUA 5JPCA 2JS3A 1MRZA 1L4KA 2BCGY 4GKKB 2CEKA 5EUCA 3SLGA 2PXHA 4LXGA 1D03A 1R6XA 1NC3A 5DDIP 4Y1EA 3SYAA 3Q98A 2WIDA 3DKRA 3LUHA 2PVCA 1AHHA 3M4XA 3W90A 3B4SA 4HL6A 3TVTA 4ZVRA 4REOA 3CSXA 1XEWY 4RUKA 3WLMA 4QU5A 1N1MA 1GN3A 4N0EA 5DCLA 3VXKA 3OX2A 3IVRA 1I3KA 4BAGA 4K6KA 3ZXXA 2YJ6A 2F23A 2AS0A 4NYMQ 1FVOA 5IXYA 1ZN2A 3EUWA 2W6ID 3R74A 2FPIB 4EENA 3H1PA 1CF2O 2PA3A 4RFLA 4MS1A 1HDYA 1JZQA 3B3JA 4V0MA 4HEA1 4DDMA 3AL3A 1PKXA 2KE5A 2OENG 1U96A 1G7TA 1BN6A 3H3FA 4J0HA 5I3CA 1U0SY 3Q3GE 3P71T 2CHEA 5JCJD 3A4VA 4HGOA 3NRJA 3MOGA 5IZCC 4HOYA 3Q3HA 2ITCC 1KKCA 3ZXUB 3VH1A 2JK1A 5A2GA 4PZLA 2H2WA 3EXG2 4MQUA 5ITVA 5B36A 3G1WA 4F8JA 4C43A 3DBIA 2BI8A 1OXUA 1UDBA 1W4ZA 1KXZA 5K2OA 4O4HA 2XHBA 3DLPX 3LDFA 3L6RA 3PYXA 1P39A 1ZW6A 2CL6X 4DIEA 4HDMB 1T4GA 2ZDIA 4JT4A 5KOYA 1MZPA 1V3VA 1ONSA 1F0PA 5CG1A 1M1NA 2ZRHA 4RTKA 1I51A 5A9GA 3ST7A 4U6QA 5DYNA 2QW1A 3ZKWA 2GFIA 1PTJA 4W5RA 1OI2A 2UYYA 1L9XA 5HKOA 3A32A 1C9MA 2HFJA 3BMCA 4OYHA 1NUHA 1ZJ6A 2AJDA 4B6QA 2HIGA 4PS1A 1UEIA 3R75A 1F23A 4WWHA 1MJGM 3KTOA 3FTDA 2NXEA 3EGXB 2QPOA 1PS8A 4PLHA 3O21A 3AY6A 5BR7A 5EVCA 3WP0A 1Q0SA 5EFZA 2PD3A 5C1IA 2B35A 5BWMA 1Y8ZA 5H6QA 3ZMVA 2W4IA 1TM4E 3I32A 1E2EA 3A2MA 3KAKA 1IPHA 3QG5A 4F12A 2YIJA 1U80A 3MVEA 1T5EA 2CE7A 1Q22A 4BDTA 3I4LA 3TTWA 5E0KB 1MB0A 1ZL8B 3WL5A 5KNBH 1V9PA 2PPVA 3DV0A 4B3RB 4DZRA 2IY9A 2DG2A 4H33A 1SBIA 3M6XA 5LMCA 4EYKA 5JADA 1FYEA 1YHYA 4E30A 2G8NA 4PXSA 2OD2A 1MVOA 2K7FA 2FK8A 3LDHA 3QY9A 2N05A 4ND2A 3AHEA 1TA9A 2HSZA 3JXEA 2CV0A 2ZAYA 3MGKA 1RWOA 4E22A 5KOJB 1IJFA 2FSHA 1ATIA 2AH5A 3RS4A 1QHGA 3H86A 4N8DA 2H1WA 5DLQC 1A2KC 3C85A 4HYEA 2JH8A 3Q4GA 5AWFC 3BHNA 4IOMA 3K0SA 2QI9F 1NT4A 2W0MA 4DFDA 5AVQA 5K4AA 4GXTA 2CVZA 1BA2A 2VCEA 1QHXA 1TJPB 2Q0OC 1XZ8A 1JA1A 2DT8A 2Z30A 3TRJA 1P49A 2ZM6B 3GLGB 2QM4A 3OPYI 1CYDA 1XDBA 4WFBV 3F8WA 3HFSA 2ADQB 4G36A 4LCUC 3TMKA 1OCCC 4GVPA 1DAFA 2H1FA 4RFSB 1KJNA 1XRQA 3X2EA 2X9GA 3C3DA 5ALVA 2GHIA 3ZLUA 3PD7A 4P34A 2QYSA 2DU8A 3PDUA 4RLQA 4CMIA 821PA 2XMBA 4O2AB 1U9JA 4N12A 2HR1A 2W58A 1A04A 4YUXA 3UJAA 1X1DA 2WSSA 2QYTA 4MUKA 3WTBA 4D9NA 1DWOA 3HJGA 2JJ1A 4QM7A 1OYVA 3L4BC 1E9AA 3QUAA 4X8LA 3MRTA 1PT7A 5C8DA 3TEMA 3TLMA 1DC3A 4DYHA 5AKYA 4EVIA 1NNUA 2GKGA 1NNLA 4B6PA 4MMYB 1QCCA 5AVYA 2BEVA 3TUJC 4PYQA 1X59A 3L6BA 4H08A 5C5EA 3PLRA 2EIMC 2ZE7A 3EUAA 3R2JA 2JASA 1VMGA 3JQFC 4MYHA 3LX4A 2H8KA 2QP9X 1WCV1 2F00A 1W7AA 5ALHA 4DV6O 3L7LA 3UAVA 3ZU6A 2TMYA 4DWOA 1VCOA 3B3QA 4ECEA 3NHLA 3S2ZA 3WJ1A 1FU4A 3I2FA 3NT5A 3N76A 3MXTA 4DA0A 1WULS 5HDQA 2Y71A 1XEAA 3IOYA 1T9KA 1HC7A 5ILGA 5GJBA 2G9QA 3HCOA 4HZUB 1E5TA 1U8CB 5IMSA 1BXZA 2Y66A 3CJHB 4Y2VA 3L0CA 1KEUA 3A6GA 2ODTX 5KNDA 5F1YA 3I53A 1A9TA 1W5SA 1BX1A 2QY6A 1LI5A 3WA7A 1Q7EA 3DBRA 3HUEA 1ZEMA 1AQYA 2OG2A 3TQFA 1Q2XA 4GHWA 1HGXA 1R5OA 3CVUA 1P3JA 3OLQA 5F9HA 1XTSA 4UVCA 3SD7A 5C5IA 1R2QA 2J0SA 3W2IA 5MF6A 3K0CA 1T3LA 1Z16A 1YVWA 1U4OA 2QN3A 2YN2A 1S2OA 3H8WA 4TLLB 2Q4PA 1JHPA 4BO8A 4TT3G 4DV1B 2FFJA 4IYJA 4S1NA 1W0KA 1RLJA 2AR9A 3U3MA 1SG0A 1NR5A 4WFIA 2BFPA 4CM8A 5I8PA 2GZ3A 3BXEA 3A2FA 4G6ZA 3MCAA 1TKAA 1KU6A 5JWRA 2Y8EA 3L74H 3ZHSA 1M54A 2I0FA 2UXBO 3E3MA 3KJIA 3SPIA 3M89A 3H2ZA 3SWWA 3LZDA 1M2JA 1KNQA 2AJ8A 4AP9A 4D6XA 4MNTA 2Z04A 5IYZA 3V4VB 4GOLD 3I12A 4OHXA 4MV8A 2IYLD 3ICCA 4Q9DA 4MDFA 2WSSD 4CFZA 1UINA 1KVQA 2F62A 1WVIA 4RHCA 1Q82W 1FRZA 4BEBA 1F14A 3U13A 2F43A 4U2EA 1F4PA 4Y8VA 2JJMA 1XMVA 4PG7A 2UUCO 3UMGA 2XCUA 2AHOA 5JAHA 3VAZA 4L8VA 1U8TA 2YV4A 1T2UA 2UYGA 2YHIA 1N1GA 3ME5A 5IEJA 3FNBA 2MYPA 1J09A 1NA5A 3FPHA 1JQ0A 3VC2A 3L0BA 3WQSB 3EJWA 13PKA 2WNHA 3Q8XB 3QTBA 1LY1A 2G9VA 3PWZA 2B7BA 3M5CA 3ZWDA 3CKKA 4LHZA 3B82A 5I4BA 4RIIA 1LPSA 4K5QA 1A7JA 1HDGO 2XYVA 5K1ZA 4M0UA 2CMDA 2CNBA 4MYRA 3TSWA 3WGIA 1T0JB 1E4OA 5E4FA 3BGVA 2IL1A 2VF8A 2O2DA 3IKVA 4WXYB 3VX3A 4BN0A 1GARA 1BKSB 1B16A 2ORWA 4UV9A 4LDNA 2VDMB 3R6TA 5KNDD 5BW6B 1YBHA 2I2XB 1AK1A 3GOQA 3OIGA 2NSYA 3MUEA 4E14A 2N0SA 1XL1A 5DM70 4K2AA 1JFRA 3PJGA 5LQRA 2Y1EA 1FXKA 1KAEA 3HO6A 3TAXA 1QQ7A 4H1VA 4PC7A 3FGPA 2GHQA 4ACAA 1GU0A 1TRKA 3MT8A 2QBYA 2VJOA 3QBDA 1W0KD 3DSRA 4QQKA 4UU0A 2HA7A 4TLDA 1CG6A 1EZ1A 3SJZA 4AUNA 4ATNA 3F5WC 1FSSA 4G28B 3VU9B 1TMKA 5FLXA 1M56C 1OROA 4K9SA 4UVBA 5ITSA 4KXWA 1PJSA 1R50A 3NTXA 3FB1A 3K2QA 4AP5A 5JXJA 1GYRA 3WG9A 3DTUB 4KAJA 1SU8A 2VN8A 1YBFA 2GPNA 2B20A 4GG1A 3DFFA 2OHGA 2F1RA 4NFSA 1U1FA 3FROA 5DK4A 3R20A 1FW6A 3H17A 1PZHA 3HXMA 1TI7A 3F7TA 4B6GA 4CMEC 1P6UA 4MUMA 2P2GA 1KMCA 3VV3A 1XZNA 4R9UC 4H35A 3RASA 3X0DA 3O1JC 4YHHB 4GI7A 2EGGA 4Z4HA 1H2ZA 3ZE0B 4GP6A 1G9XA 3PFHA 3D2CA 4G24A 1I4TD 2CLKB 3L6EA 3Q6NA 3B5JA 4RK5A 1LTQA 4GT1A 1V5GA 3BOSA 2G9NA 1UXIA 5JWOA 2YW2A 2NSLA 1TAHA 1JQBA 4UCUA 2EGHA 1G21E 2CHGA 1N8SA 2YY7A 1JMVA 2BJHA 2VSNA 4MWCA 1CEYA 3ZMZA 3A3PA 4II2A 3BWYA 3K70C 2JZNA 1CTQA 2QIOA 4BGEA 5KJ6A 2VDUE 3UJ6A 2KX7A 5JRZA 1T5BA 3R8FA 4RZ3A 1CIJA 4KO2S 4IRXA 4V03A 3A6ZA 2WVGA 3U6BA 3I9MA 1HT1E 2QUBA 1RM0A 1GM9A 1F2UB 4FM9A 4UBJA 3KS9A 3BXZA 2ES4A 1PUXA 2V6MA 2A5DA 2CZCA 4LZOA 3WLJA 4D80A 3N07A 5HFNA 3SDBA 3EDRA 3IIEA 2GHTA 3K92A 1JJBA 4KN5A 3IDFA 3GB7C 4HGQA 3IUYA 3CLKA 5E6SA 3K9BA 4LV6A 2OK7A 1DG9A 1U8XX 4CIAA 5L6MB 1ICIA 3OZGA 3EZYA 2A9JA 1Y3CE 4XGRA 1OJ7A 1SD2A 3P0RA 2ZQZA 1FTQA 2WW8A 3MEQA 2PGJA 2QD4A 4JY7A 2VQ6A 3T1VA 2A0UA 3FPCA 1C30A 3DZDA 2Q3BA 3HNRA 3AUAA 1FC0A 2JIPA 4WECA 5AUPB 3RD5A 2EIKB 3C6YA 2OB2A 2IE8A 1JMYA 5TEWA 3YASA 1GHTA 3R0IA 1A4RA 4E5NA 2RAFA 1IM5A 1EXWA 4IDNA 4OQYA 3IJEB 3QY0A 4GZMA 4V0KA 4LY6A 5A5GA 1M2HA 1YHQV 2G77B 3DDWA 1A96A 4Q05A 2FETA 3BBLA 4OMDA 2ZTLA 4Q3AA 4XYBA 3OD5A 3CBGA 5K3CA 3W2TA 4QGPA 3TRKA 2X15A 3KKYA 1DUVG 1RCTE 3MWDB 4QJBA 3A1CA 2X23A 2KG7A 3IMCA 4BMPB 1QIMA 4JP2A 4JB3A 4L74A 5ECDA 3KKLA 1K5QA 1V6AA 2I2CA 5LWQA 1TO6A 4O4LA 3AHCA 3R7WB 2ZCEA 4BBPA 4ZHQB 4X90A 3CUTA 3LFTA 5A3VA 1NMEA 1G20E 1Z6AA 2BFEA 4YYZA 4X88A 4HDRA 2DYRB 1JVMA 4MGEA 4XVHA 3ZW7A 3RJ5A 2P8SA 4OXIA 1JI0A 1R8SA 1PEDA 1OLXA 3VYRB 2ZRFA 2J3QA 4DQUA 4FFBB 4BQSA 1EGVB 2P1RA 4TQGA 3UC9A 5BQ5A 4PGFA 1D1PA 1ODTC 4DANA 4C1BA 1UBRS 5KBYA 2J4DA 2AX4A 2VJKA 4UBLA 1Z28A 2Y27A 2P4QA 1IRIA 1NFRA 1LI4A 1ZKDA 2CMKA 1APBA 5AKZA 4QUBA 5EJ8A 1CUEA 4FDAA 2B4YA 4QJ5A 2C5GA 2ZAOA 1G6HA 2F2TA 1U5AA 1A95A 2I8CA 3D5QA 2P6NA 4E70A 2VYVD