3T1YO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3t1yO00
4OPAA 4DR2O 1N36O 5A2QN 2DJVA 4YY3O 1FYJA 1AB3A 1N33O 4JV5O 1NS1A 2ZM6O 4LF8O 4B3SO 1XMQO 3O65A 4B3RO 4DV4O 5LL6Y 2UUCO 4DUYO 5BR8O 4JI1O 5IWAO 2E5LO 4LFCO 4DV6O 4JYAO 5BY1A 1A32A 4GKJO 2VQEO 1XNRO 2JRIA 1G1XB 4JI5O 2DOSA 4NXMO 4JI3O 3SDLA 2VQFO 4DR6O 4JI0O 4LF7O 1IBLO 2UXCO 3JAMN 4DR4O 4LFAO 4LF5O 5IT9N 3F5TA 3OTOO 1KUQA 4X65O 4DR1O 1HNWO 4X62O 4K0KO 1FJGO 4LF4O 2N74A 3J81N 2F4VO 5LMNO 4YHHO 4OX9O 4DR3O 1XNQO 4LFBO 4JI7O 2AGAA 4DV1O 2UUAO 1D2DA 2HHHO 2Z0AA 1XEQA 4B3TO 4JI4O 2ZKOA 3M8AA 1HR0O 4X64O 3T1HO 5FLXN 4DV0O 4DV5O 4NXNO 3J7AU 4DV2O 5LMUO 1IBKO 2UXDO 4DR7O 1FKAO 3R66A 4DV7O 1N34O 5BXZA 4GKKO 1IBMO 1HNXO 3RT3C 4DV3O 1DK1A 4LF9O 4JI2O 1XMOO 1HNZO 1AILA 4A5UB 4LF6O 1R1BA 4X66O 2UU9O 1I94O 2UXBO 4DR5O 2FKXA 1R6TA 1YZBA 4KHPO 2UUBO 4JI8O 3T1YO 4B3MO 4OPHA 4AQYO 1F7YA 3J80N 1N32O 1J5EO 5H5NA 2LW7A 1X59A 4DUZO 4JI6O
chains in the Genus database with same CATH superfamily
2EZPA 3RVZA 3JD2A 4GCZA 1SZTA 3A0HZ 2UUBB 1MZFA 4YJ3A 5LL6Y 3SPHA 4GYCB 1KMIZ 5CA3A 5H6RA 4CH4A 4O4HA 2VQEO 2CH7A 2HG5C 1EBOA 2F43G 1IDSA 3CRQA 4W4LA 1FXHA 1XILA 2VQFO 4DR6O 3UQ8A 2YEVA 1E79G 3CJHB 4JZGA 3JAMN 3BA8A 1WP8A 2YXHA 5D5PA 2Q0OC 5C8YB 1PNKA 4NKGB 1WA8B 3FD9A 3JAWA 2E3CA 5KMGB 1NH2B 4I7ZB 1NTZH 2LGWA 2F4VO 3D36C 4GX5A 3JYCA 4JI5B 2GHYA 3N2KA 4NXMB 3LUTB 3C90A 1K73W 5IY5B 2RDCA 2RNBA 3ZRXA 2X7RB 3FB7C 3JD3A 2IJHA 2Q9LA 4BWAA 2NR5A 3CCRV 4NXNO 5KUKA 2P06A 1S5HC 1MA1A 2F66C 1N34O 4PDLA 2BTQA 2EBOA 1TUEB 4ASUG 2A9HA 3W7UA 1SRYA 3WG7C 2H3OA 4FMTA 3RYFA 4G28B 2QR4A 3ZHTA 4X1YB 2WLIB 1I5YA 5LMUB 3ABMB 1JA8A 2A0LA 4B3MO 1Z5WA 1HNXB 1FJGB 5JJJB 3VQVA 5B1NA 4PV1B 5EIBC 2ZIMA 1N32O 4K3AA 1NVPB 3K03A 4ZI7A 3CC2V 4ABMA 2UXNA 4FFKA 2PUSA 1I94B 3T2MA 4HYOA 3K5MA 3ZMZA 3SPJA 3ABKC 5CB4B 2XAHA 2QM7A 2ZT9B 2LW1A 1THZA 1VMGA 2F23A 1H2LA 4QGPA 5IWAO 5IJ0B 3E8FA 3CCEV 1YDXA 1YJWV 1ZX3A 1ZL8B 2DOSA 3H1KH 4DR2B 1EFRG 1N36B 4FK5C 3JD1A 4JV5B 2GUZB 5KHJA 4FJCC 2JJ2G 2OTJV 3ABUA 2E75B 1TUBB 4LF5O 1YHQV 4JAAA 4CS4A 2QTOA 2ARHA 2VWKA 4IHJB 3JAKA 2QTSA 3OMIB 4GKJB 1IXBA 4I0XA 1R6KA 2Q7GA 1XDCA 3ML0A 2AGAA 4DV1O 4J9YB 4B3TO 1JJ2U 3M8AA 4KXRA 3K0GA 4MTGA 3EVKA 5ITZB 5LA6B 3G4SV 3AG2C 3CCQV 5LP6C 5A9GA 1QVFU 1WP7A 5JWPA 3ZMVA 1VQ5V 4IGGA 4LC1A 4DO2A 4QPJA 3CRAA 1B04A 3TXQA 1NT2B 1DTOA 3HKBB 2FKXA 4G2KA 4WFGA 2CTQA 2OIEA 2QWPB 3ASOB 1IZ3A 4WFHA 1MOFA 2IBZH 3CP1A 2QJ1A 3UKMA 2MW2B 4FLZA 2OTLV 3WB1A 1NI8A 4X88A 4HBNA 3L71H 2LW7A 4JGSA 4BW9A 3BAAA 1YJ9V 3ZRVA 2ZIOA 4DR5B 1QR9A 1I5XA 1K9MW 4KUMA 2RN9A 1Q6UA 1H2SB 5B1OA 1MABG 2BE3A 4JI2B 2RMKB 3S3WA 4JASA 4O4IB 4D7TA 4DRXB 4FFBA 5LOVB 1OCCB 5GONA 5BMVB 5BR8B 1QLEB 5JH7B 1R3JC 2EIJB 2HLDG 3SPCA 3QF7A 4X62O 2ODMA 1F51A 3JD0A 4B08A 5CBHA 1IURA 4L87A 2HVJC 5EBLC 4H0LB 2GV9A 5LYJA 4JI7O 3B09A 1KC8W 3CC7V 2ZQMA 3BA9A 4QPKA 1W59A 5JVDA 1GN2A 1XBLA 4DV7O 4FM0A 1SQBH 3RYHA 2GBOA 2LFSA 4DR3B 1P84F 5GTHZ 4O4JA 5IJ9A 1XUQA 1CP9A 2B1GA 1Y66A 2KG7B 4DV5B 3JATB 1XQ8A 2F1MA 1P4RA 1WPBA 5B5EZ 4XDJA 1CEZA 2ZCEA 2Y4UA 4BR6A 4X1IA 1K33A 3ZEDA 3HKCB 3RGBA 2JS3A 4BIZA 3HR0A 2QA4V 3E2EA 2ZE5A 3UT5A 1H8EG 2W0FC 3ABTA 4JI6O 2D3OW 1V55B 1PL4A 4JYCA 3CC4V 3JARB 3DGEA 2GSMB 4DUYO 4JI1O 5J2TA 1NVPD 3JSNA 5DM6V 4DV6O 3RYCA 4JYAO 4X9QA 2CK3G 3DXRB 5F2VO 4GLXA 4WFAV 1SKVA 2IU3A 4U3JB 4PELA 4WFEA 3ASOC 3APQA 1Y76B 2DYSB 3CEIA 1AR1B 3WB2A 4B3RB 1QLNA 4WBNA 3MDSA 5IT9N 2IU0A 2DWEC 1ZAUA 2E5LB 4LFCB 1Q7YW 2QGNA 4K0KO 1Q6HA 3MHHC 5B3SB 3CCJV 3C3TA 1H2KA 3CB2A 5IYZB 1S0VA 1VARA 1MMMA 1Q43A 4IIJA 3ZRSA 4JI0B 4J7KA 4LF7B 1K4DC 2UUAO 1MSDA 4YIPA 2Z0AA 3BY6A 1JCHA 4LNUB 1CPYA 2ZM6B 3CRMA 5K1XA 1FXKC 4MVSA 1D5NA 2JEXA 4TUYA 1K5SA 3W7XA 5LMNB 1OJHA 5EZYA 1N4CA 3FFQA 2YXLA 2XT9A 2HP8A 2ZDIC 3CCMV 4JI4B 4GUNA 3LDDA 3SJAC 2OYQA 2EIJC 1TVKB 2EIMB 1K92A 1V54B 4ZOLB 4DR7B 2R72A 1SS3A 5KA6A 2X6BA 5JCOC 3BFRA 2YI8A 1IBMB 3P3PA 1SESA 4NB5A 1R3IC 3TGUH 4L8JA 2AZ2A 4CH6A 4X20A 4B7KA 2Q67A 2OCHA 2R70A 1GM7A 2ZE6A 2YIBD 1PP9H 2BSKB 3FB8C 2XAGA 1N33O 3PJSK 2QWQB 2JIZG 2WLHA 1KU9A 3N2GA 4AQYB 1XI1A 1DLBA 3HKEB 5C93A 1H2NA 1JMKC 4K8XA 5H2FZ 5IE9A 3FAVA 1K7DA 5CA1A 4O4LA 1Q3EA 4K35A 3OTOO 5IYCO 1S77D 2XTAA 4MW3A 3H9VA 2BCCH 3I56V 2VQEB 2DQ0A 1W0JG 4PA3A 4AILC 1SC5B 1Y74A 4H37A 4BIOA 2VQFB 4DR6B 4I9WA 1YJNV 2RCVA 4HZ3A 4W4KA 1D2DA 4KP4A 4PJ0Z 5FNVB 3VBBA 3JSLA 4PHZA 5KLVH 3CWBH 3WG7B 2XOKG 2UXDO 2QKCA 2F4VB 1MZEA 2D2CB 1BHAA 1QQCA 3N27A 3SYQA 2NN4A 4NXNB 1L0NH 1FFTB 5CMUA 2HJDA 4CBCA 1HDJA 1N34B 1AJPA 1B06A 1VQ4V 3OMAB 4EB6A 2F95B 2V4DA 5CBFA 4GT1A 1EZJA 3L73H 1FXVA 1BMFG 2XHBA 1NR7A 2QWNB 4U7NA 1PNMA 2PY5A 4EEQA 1ROPA 4B3MB 4FLTA 1XMQO 2DWDC 1GO3F 4RAIA 1N32B 2CTWA 4R6ZA 2AHZA 3JCZA 1F23A 5BZBA 4CC6A 3SJQC 3SYOA 2JGDB 1RPRA 2G38A 4O2BA 3SPIA 4FZ1A 4LWSA 4FIPC 3T4DA 3C3SA 3CXCU 2ZR2A 2CGNA 1AROP 1AP5A 3OR7C 1WNSA 1JFFB 3G80A 4EKWA 4TV9A 3A8TA 5IWAB 4NR1A 1S5JA 3U10A 1GMGA 1HNWO 1L0LH 1PD3A 2WWWA 1J5EB 2DE0X 3K9AA 5HFLA 2Y0PA 4AHCA 3AG2B 2JK5C 1XHXA 2ITCC 5LP6B 2ZKOA 1FFXA 1Q81W 4LF5B 2R9AA 3QNEA 5JQGA 3K58A 4KFMA 1G8MA 2YS8A 4JAUA 1K5QA 1URFA 2ZR3A 1HNZO 4DV1B 4JAVA 4B3TB 1JPXA 1XHZA 4LF6O 3ZS8C 1K8AW 1AI7A 1VF7A 4UCSA 4FLYA 2UXBO 3CE2A 3B4SA 4I4TA 2XAJA 1VF6C 1WB7A 4TSFG 4H13B 4EFBA 2B1IA 1NBMG 2Q73A 2KKWA 3UO3A 1H8HG 3VQXA 3JALA 2WLLA 1XL4A 4BAYA 1LUWA 3K08A 1M1KW 4WCEV 4DUZO 3AK1A 3E83A 2ZD9A 4N23A 5A2QN 1YI2V 2DJVA 5B66Z 4C7UA 4YIOA 4IYIA 4O2AB 4B3SO 1NTKH 4BW5A 2IM9A 2QE7G 1YTFD 1ORQC 5KX5A 1BQ0A 4B7EA 3A0RA 2LJ2A 4PA6A 1PM9A 4CH3A 1SQVH 4ZHQA 1CXZB 3K5LA 3CCSV 1G4YB 2ZE8A 1S76D 4I50B 2UXCO 2LO1A 4K8ZA 1OCZB 2Y0IA 2GTSA 1DGSA 3J81N 3BRCA 2AZ0A 4JYBA 3RYIA 4JTDB 2HHHO 1RSOA 4NTXA 2KB1A 1NQTA 4DV0O 2Q68A 3ZRWB 3BHPA 4X1KB 3ETGA 4UB8Z 2XAFA 4X62B 1D5AA 2EILC 4TV8A 2Q69A 3OGIB 4RQEA 2Q7EA 2CE4A 4DV3O 1QCEA 3G71V 4QNHB 4JI7B 1Q90D 5EYPA 4A5UB 2ADPA 3JASB 3SYPA 3D3QA 1SA0A 3E22B 2DYRC 3HKDB 4F6RB 1S3JA 3KG2A 3OE7G 3ZN0A 4D6TH 2O57A 3LSQA 3OM3B 4DV7B 3OEEG 1IVSA 1O9HA 2Z3YA 1YEWA 1VQMV 4NTWA 2YSUB 4PI0A 3I5DA 2WPDG 1QHTA 2P4KA 1AJNA 5EIBD 4OGQB 1BZKA 4OPAA 1SF9A 3ETDA 1OCOC 4TOIA 3TETA 3EHBB 3OR6C 4Q20A 2QWRB 4WF9V 5KA5A 4FPPA 1ZTEA 1ZLZA 2BOBC 3KCYA 3P3NA 2HEPA 4LR3A 2NLJC 3AG7A 4JI6B 3B8MA 2HVKC 1GH6A 5E79Z 1Y67A 2VWJA 1BQZA 3SJCC 2Y69C 2EULA 1HP8A 3CJHA 3IFXA 4DUYB 2YIAA 2Q0AA 4JI1B 3PN1A 4UCTA 1PKXA 4DV6B 4JYAB 1L8DA 1VIBA 1FJGO 5C8YA 2ATKC 2EX3A 1WA8A 2ADQB 3W7WA 2DN9A 3K3WA 3ASNC 5KMGA 1FXKB 3UM7A 3Q4HB 2P7TC 4H44B 1GKFA 1OZ0A 2Z5UA 1HWYA 1OV9A 1VEWA 3CRRA 4IYHA 4K0KB 5J2UB 5CN0A 1FKAO 3T1CA 5EC2C 3UCSC 1T5EA 1DK1A 2OT5A 4Q6GA 1OCZC 1M90W 2UUAB 2F93B 2JS5A 4UCUA 1KP3A 5L3EA 2X6CA 1Q86W 1VP7A 1VQNV 1I0HA 3I55V 2LQTA 2UU9O 4MTOA 5IYBO 3BCCH 4X1YA 2WLIA 5KAFZ 4UVBA 4OPHA 3AK2A 2A3QA 5H5NA 3AG1C 4LCUC 5LXTB 3CCLV 1RFYA 5CA0B 1IX9A 3BPZA 1SZXA 1BGYH 4XDKA 4YJ2B 3STLC 1BT8A 5CB4A 2UUCO 1HW7A 1SQQH 5IYDO 4DXWA 4Z1VA 1N0NA 2WLNA 1XNRO 5KAIZ 4I55B 5IJ0A 1U97A 2X6AA 3BVOA 1IXMA 5EBWC 4F4LA 3CS5A 1Q5OA 1ZL8A 1N33B 4FVMA 1US6A 2IJKA 5B1BB 2W6JG 2WAMA 3FYIB 2GUZA 3SYAA 3LSUA 2P22C 1TUBA 5DN6G 2QM4A 2AW9A 4IHJA 5FPOA 3RW0A 2EIKC 2FL4A 2X0LA 3FX7A 1BHBA 3M99B 4YY3B 3T1HO 1JOYA 4UCRA 4RQFA 3VQWA 1PV0A 3OMNB 5EC1C 3K06A 3ETEA 3U0ZA 4CS2A 5ITZA 5LA6A 3ZN1A 5DECA 4UCVA 4LF9O 3X2QC 2DW4A 4JI2O 1XMOO 1RM1C 1BS3A 1YIJV 4ZKIA 4MT8A 5B1AC 2UXDB 3E89A 4HNAB 3HKBA 3AG3C 4DK1A 5LBQA 2XAQA 3W7TA 3RBZA 1FAFA 1QVGU 1EN6A 5FPRA 3DC5A 4H33A 4YJ3B 4R8CA 5L3FA 1NS1A 4PDMA 1MSWD 4DV4O 4TWKA 1GK9A 1GN3A 4XDLA 2ZE7A 4O4HB 2P67A 3A0BZ 2CH7B 4PA4A 1YTFB 2HJFC 5BY1A 3G6BA 1M56C 2YEVB 4TQFA 3E8HA 3CYOA 3NR7A 4O4IA 4E4EA 2GDSA 4AI8A 3ZBHA 4DRXA 1IBLO 1TAEA 2VS0A 1XMQB 1ZWIC 3JAWB 1I7FA 5LOVA 3VQYA 4ZIBA 2XUMA 2IJJA 4CC5A 2ZDIA 5KHIA 3ZHVA 4DR1O 5BMVA 4GX0A 3N2KB 5JH7A 4I9QA 4U7OA 2IH3C 1BL8A 2ETNA 4JTAB 2N05A 5JCOA 1TA8A 2W0XA 3ZCCA 4X64O 4U3FH 2YUAA 4MVQA 1FS0G 1Y6XA 4LP8A 1R73A 1HNWB 2BTQB 1GM9A 2PYJA 4UFZA 2E76B 2JGUA 3RT3C 2L35A 3RYFB 3H1IH 2PGGA 1K97A 1AILA 1F4NA 5B1BC 1WN7A 2AHYA 1P7BA 4E2LA 4X66O 2KG7A 5E1AC 1FPOA 3FKSG 3JATA 2P90A 1R6TA 2KSDA 4JTCB 4TT3G 1YZBA 4KHPO 3IGAC 4JI8O 3OEHG 3SPGA 2XASA 3T1YO 4ZI7B 4JYYA 5FL7G 2DMXA 1W0KG 1HNZB 2B9ZA 2WSSG 3HKCA 2K1EA 3ZIAG 5CBGA 4LF6B 1Q6IA 3D3IA 1H2GA 1XL6A 4P9OA 3AEIA 1GRJA 4P2ZA 3CRCA 1RPOA 1EN5A 2L6LA 1VQ7V 5EK0A 3OUFA 2EJRA 1PL0A 2PTMA 2YI9A 1RP3B 2ZNJA 2C2AA 2QWOB 4UXNA 2ZM6O 3RFRA 3K59A 1QU7A 1BE3H 3W7SA 4PA9A 3RN4A 1AI6A 3JARA 4RWUA 2Q5ZA 1L1FA 3OFNG 4DUZB 1KECA 3DXRA 5H9CA 2AXTZ 1X4TA 4U3JA 1QNMA 4B3SB 1JR9A 3SR2C 4DR4O 3QTCA 3JAKB 1Y76A 5LGNA 3R65A 2H8PC 3F5TA 4FLVA 1ZSPA 4I0XB 3F7YC 2WLMA 1KB9F 2NNUA 2WLJA 1YCIA 4YHHO 2P5OA 1KYOF 1I08A 3G67A 2JJ1G 4NVPA 4LFBO 4FM1A 5IYZA 3FYEB 2EILB 2UXCB 1Q8IA 1VQ6V 2CDYA 4ZBMA 1G6UA 2EINC 5KUMA 5D5QA 4FLUA 4LNUA 4DV2O 1IBKO 2A79B 2DYRB 5BXZA 4GKKO 1ZUQA 3K57A 3TJTA 2M6YA 2HHHB 4J80A 3ABLB 1GAXA 2Q8VA 4DV0B 4G27B 3ZHRA 1TVKA 2Q4PA 4ZOLA 4PA7A 2OIGA 4DV3B 1JX9A 1OCOB 3B8NA 4J10A 1M9NA 1B6QA 1VQOV 4UVAA 1WPXA 1M5IA 4MS2A 1NKDA 1OHHG 4FLWA 4J41A 3GVMA 3OGCC 3ZJZA 4LF8O 2BSKA 3L74H 4MVZA 1UJWB 1GN6A 3MAQA 4WFBV 4MW8A 3OT7A 4J7ZA 4FFBB 5AG2A 2LGQA 2Y69B 2BOCC 3ZHSA 4WFFA 2N04A 2QKSA 3HKEA 4JI3O 1YXBA 3JCUZ 5GONB 3D8CA 5GTIZ 3K5NA 2E74B 1JQ0A 3APOA 3ASNB 1AVMA 4LFAO 3G6EV 4DK0A 3D36A 1M57C 1PNLA 1P49A 5IDJA 4X65O 3F5WC 4LF4O 2YXYA 5LYJB 4D7SA 4OX9O 1XNQO 3WB0A 1SETA 1NU1H 1VF6A 3QVNA 3AG4C 4MVUA 1HR0O 1R3KC 4MSWC 3WU2Z 3KKYA 5JVDB 2R9RB 1YITV 4QE9A 5FNVA 3RYHB 1J95A 2HKOA 3R66A 4PDRA 2IH1C 4O4JB 2QSAA 5IJ9B 4JZ2A 3P32A 2Q7HA 1AJQA 3SJBC 1N8RW 5LGTA 1R1BA 4RUFA 5LHGA 1TGOA 1SQFA 3HB3B 4X1IB 3AG1B 2BTOA 2UUBO 1DF4A 4CS3A 3P30A 1F7YA 3BABA 4Z1MG 3UT5B 1J5EO 2YC0A 2DQ3A 2V7QG 1UPGA 3THOA 4I5SA 4UV8A 2UU9B 2FMLA 4MVOA 1YVWA 1M4UA 1SQXH 2EZOA 3GWKC 4MTXA 5J2TB 1BSMA 1MNGA 4MTFA 3RYCB 3ABLC 3L9DA 1QBZA 3FB5C 4NTYA 3CCUV 4JI5O 4QJFB 3QG5A 1MG1A 4NXMO 2IW5A 1NJIW 2V1DA 4TQDA 3QO5A 2JGDA 3E86A 4OXSA 3MHSC 2FYUH 4WBNB 1LNQA 4QIWF 2HFEC 1SQPH 4UB6Z 2UUCB 1VQ9V 2EIKB 3ZHQA 2GTAA 3ICXA 1KD1W 3OD4A 2A7WA 1JFFA 4F6EA 1XNRB 4IIJB 5LHIA 1BCCH 4GZRB 3KCXA 1K4CC 3ZMUA 5FLXN 4TUYB 3X2QB 3SGIA 5LP6A 5IY5C 2R9IA 1RM1B 5LMUO 1E1QG 2WA4A 5EZYB 1OCRB 3DC6A 3E8BA 3SYCA 1LUVA 1HNXO 1H2MA 5K1PA 5B1AB 1NZ6A 2ZNIA 3O9OA 1VQ8V 3AG3B 2JDIG 1ENVA 4MVMA 3T1HB 3CCVV 3EXAA 5L3GA 3CX5F 1I94O 1EZVH 1AR5A 4PD4F 3RVYA 3QO8A 1VQKV 3CHXA 4X20B 4LF9B 2QEXV 3L70H 3HPLC 1XMOB 4N21A 5EBMC 1S5LZ 3ABMC 3GB7C 1R6NA 2ZXWB 1Y4MA 4FM2A 4DR2O 1N36O 1K3EA 3CXHF 3N2GB 1M56B 2FB5A 4JV5O 4RO2A 4X8AA 3F7VC 2CTPA 3H01A 3UO2A 1KQSU 2VRZA 3IJ4A 4DYLA 3K79A 4O2AA 4YXWG 4FZ0A 4R50A 2IJIA 4GKJO 2JRIA 1WB8A 4JPRA 2Y48A 3ETQA 3FAVB 5LGUA 3K9SA 3H1LH 4DW1A 4CH5A 5CA1B 4O4LB 2RJZA 4DV4B 3OAAG 1EM1A 4I50A 2CTRA 1NH2D 2P6JA 4GX1A 1S72V 2N74A 1Y74B 4J9ZB 2PZSA 3B2EE 1IBLB 2UXXA 4P9PA 2H94A 5HFMA 5KHKA 4Z2WA 1AP6A 5KHHA 4DR1B 1VQPV 3B40A 2WLKA 4GX2A 2QKAA 3LSSA 3ZRWA 2PI5A 3OTFA 3BEHA 4X1KA 4IL6Z 3ZMTA 4R7CA 5KHGA 4PI2A 3LDEA 2CGOA 2K9PA 3VOUA 4X64B 1V9PA 3JASA 3E22A 4DR5O 3HKDA 4F6RA 3OTOB 4LH7A 4CZZA 4UVCA 3LNNA 2Y4TA 4EB6B 1YSCA 3L75H 1K34A 2B5UA 2QDOA 2MK3A 4X66B 3LDCA 3TK1A 2OCCB 1NTMH 1OCRC 1GTOA 2ILMA 4QE7A 4KHPB 4JI8B 3T1YB 3ZX6A 2YIBA 5BR8O 3TXSA 1EN4A 3CD6V 4O2BB 1O9GA 4LWSB 1G1XB 1U96A 2A06H 3AK3A 3H1JH 1AI5A 2YDEA 3T4ZA 3SDLA 3ZMSA 4DW0A 2YIDA 2CUGA 2RQ6A 4TV9B 4RUEA 2W6IG 2FTKA 1W2BU 2ZXWC 1GM8A 5H6QA 2PI4A 2EINB 2YICA 1OCCC 1NR1A 4DR3O 1QLEC 1B3QA 3OW2U 1FFXB 4FLXA 3IAYA 2HR3A 1FXKA 1XEQA 3E8GA 2EJ7A 4P30A 4DR4B 3Q4HA 1XOUA 5JQGB 5JJEB 4DV5O 1AI4A 4HAMA 3J7AU 1M93A 4MVRA 4YHHB 1KP2A 4KL1A 5L3DA 5J2UA 3E35A 4LBEC 2PYLA 4LFBB 1QR8A 3MD0A 3K5OA 5TISZ 4J42A 1LR1A 1UFIA 3NXSA 4I4TB 1WLEA 3K04A 1H38A 4UV9A 4DV2B 1IBKB 1YF2A 3S3XA 5LHHA 1R3LC 3CMEV 4GKKB 3JALB 2WLLB 1P7GA 2QM8A 3J80N 1X59A 1AR4A 1SQGA 5L3CA 2LFRA 2PF4E 4J7JA 3CSXA 5LXTA 2Q6AA 2P4VA 1DF5A 1Z2GA 4YY3O 3B77A 5DEDA 5CA0A 2ITDC 3EFFK 2OWOA 1AB3A 2XNDG 1FYJA 3LNMB 3RWRD 5KX5B 3GWOA 3IC7A 3O65A 4B3RO 3CPWU 4YJ2A 4ZHQB 2E5LO 4LFCO 1V55C 4XBFA 1A32A 1VQLV 1M57B 4BIUA 5J9PC 4I55A 4JI0O 4LF7O 2UXBB 3IC9A 4LF8B 4UCOA 4LH6A 4ICGA 2CAZC 4IT5A 3DSQA 1PPJH 3JD4A 1KUQA 3AG4B 2OCCC 3RYIB 2DYSC 2LP7A 1WJZA 5LMNO 2ZINA 1WAZA 4JI3B 2KQXA 1RSOB 4J11A 4X89A 4JI4O 3U11A 5B3SC 4LFAB 1N0JA 4TV8B 4X65B 1Q82W 1VF5B 4DR7O 4LF4B 3TCUA 1GN4A 1KKCA 2WA3A 5EYPB 1IBMO 4OX9B 3ABKB 1XNQB 3WFVA 1FD9A 1SA0B 2JEUA 4PDVA 1XREA 4NYKA 1E1RG 1KBHA 2M7WA 1KKDA 3CMAV 1HR0B 3STZC 3M7MX 3KZIZ 1Z5VA 1SERA 5GW7A 3OUSA 1F4MA 1JJOA 2JVDA 4UUJC 3K0DA 2EIMC 3H1HH 4HNAA 4AQYO 1V54C 1COWG 4EFEA 3A2FA 5JJNB 3QO7A 5L3BA 3FB6C 3L72H 1JVMA 4JF3A 3DTUB 3ZHUA
chains in the Genus database with same CATH topology
4OPAA 4DR2O 1N36O 5A2QN 2DJVA 4YY3O 1FYJA 1AB3A 1N33O 4JV5O 1NS1A 2ZM6O 4LF8O 4B3SO 1XMQO 3O65A 4B3RO 4DV4O 5LL6Y 2UUCO 4DUYO 5BR8O 4JI1O 5IWAO 2E5LO 4LFCO 4DV6O 4JYAO 5BY1A 1A32A 4GKJO 2VQEO 1XNRO 2JRIA 1G1XB 4JI5O 2DOSA 4NXMO 4JI3O 3SDLA 2VQFO 4DR6O 4JI0O 4LF7O 1IBLO 2UXCO 3JAMN 4DR4O 4LFAO 4LF5O 5IT9N 3F5TA 3OTOO 1KUQA 4X65O 4DR1O 1HNWO 4X62O 4K0KO 1FJGO 4LF4O 2N74A 3J81N 2F4VO 5LMNO 4YHHO 4OX9O 4DR3O 1XNQO 4LFBO 4JI7O 2AGAA 4DV1O 2UUAO 1D2DA 2HHHO 2Z0AA 1XEQA 4B3TO 4JI4O 2ZKOA 3M8AA 1HR0O 4X64O 3T1HO 5FLXN 4DV0O 4DV5O 4NXNO 3J7AU 4DV2O 5LMUO 1IBKO 2UXDO 4DR7O 1FKAO 3R66A 4DV7O 1N34O 5BXZA 4GKKO 1IBMO 1HNXO 3RT3C 4DV3O 1DK1A 4LF9O 4JI2O 1XMOO 1HNZO 1AILA 4A5UB 4LF6O 1R1BA 4X66O 2UU9O 1I94O 2UXBO 4DR5O 2FKXA 1R6TA 1YZBA 4KHPO 2UUBO 4JI8O 3T1YO 4B3MO 4OPHA 4AQYO 1F7YA 3J80N 1N32O 1J5EO 5H5NA 2LW7A 1X59A 4DUZO 4JI6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPA A;  4DR2 O;  1N36 O;  5A2Q N;  2DJV A;  4YY3 O;  1FYJ A;  1AB3 A;  1N33 O;  4JV5 O;  1NS1 A;  2ZM6 O;  4LF8 O;  4B3S O;  1XMQ O;  3O65 A;  4B3R O;  4DV4 O;  5LL6 Y;  2UUC O;  4DUY O;  5BR8 O;  4JI1 O;  5IWA O;  2E5L O;  4LFC O;  4DV6 O;  4JYA O;  5BY1 A;  1A32 A;  4GKJ O;  2VQE O;  1XNR O;  2JRI A;  1G1X B;  4JI5 O;  2DOS A;  4NXM O;  4JI3 O;  3SDL A;  2VQF O;  4DR6 O;  4JI0 O;  4LF7 O;  1IBL O;  2UXC O;  3JAM N;  4DR4 O;  4LFA O;  4LF5 O;  5IT9 N;  3F5T A;  3OTO O;  1KUQ A;  4X65 O;  4DR1 O;  1HNW O;  4X62 O;  4K0K O;  1FJG O;  4LF4 O;  2N74 A;  3J81 N;  2F4V O;  5LMN O;  4YHH O;  4OX9 O;  4DR3 O;  1XNQ O;  4LFB O;  4JI7 O;  2AGA A;  4DV1 O;  2UUA O;  1D2D A;  2HHH O;  2Z0A A;  1XEQ A;  4B3T O;  4JI4 O;  2ZKO A;  3M8A A;  1HR0 O;  4X64 O;  3T1H O;  5FLX N;  4DV0 O;  4DV5 O;  4NXN O;  3J7A U;  4DV2 O;  5LMU O;  1IBK O;  2UXD O;  4DR7 O;  1FKA O;  3R66 A;  4DV7 O;  1N34 O;  5BXZ A;  4GKK O;  1IBM O;  1HNX O;  3RT3 C;  4DV3 O;  1DK1 A;  4LF9 O;  4JI2 O;  1XMO O;  1HNZ O;  1AIL A;  4A5U B;  4LF6 O;  1R1B A;  4X66 O;  2UU9 O;  1I94 O;  2UXB O;  4DR5 O;  2FKX A;  1R6T A;  1YZB A;  4KHP O;  2UUB O;  4JI8 O;  3T1Y O;  4B3M O;  4OPH A;  4AQY O;  1F7Y A;  3J80 N;  1N32 O;  1J5E O;  5H5N A;  2LW7 A;  1X59 A;  4DUZ O;  4JI6 O; 
#chains in the Genus database with same CATH topology
 2EZP A;  3RVZ A;  3JD2 A;  4GCZ A;  1SZT A;  3A0H Z;  2UUB B;  1MZF A;  4YJ3 A;  5LL6 Y;  3SPH A;  4GYC B;  1KMI Z;  5CA3 A;  5H6R A;  4CH4 A;  4O4H A;  2VQE O;  2CH7 A;  2HG5 C;  1EBO A;  2F43 G;  1IDS A;  3CRQ A;  4W4L A;  1FXH A;  1XIL A;  2VQF O;  4DR6 O;  3UQ8 A;  2YEV A;  1E79 G;  3CJH B;  4JZG A;  3JAM N;  3BA8 A;  1WP8 A;  2YXH A;  5D5P A;  2Q0O C;  5C8Y B;  1PNK A;  4NKG B;  1WA8 B;  3FD9 A;  3JAW A;  2E3C A;  5KMG B;  1NH2 B;  4I7Z B;  1NTZ H;  2LGW A;  2F4V O;  3D36 C;  4GX5 A;  3JYC A;  4JI5 B;  2GHY A;  3N2K A;  4NXM B;  3LUT B;  3C90 A;  1K73 W;  5IY5 B;  2RDC A;  2RNB A;  3ZRX A;  2X7R B;  3FB7 C;  3JD3 A;  2IJH A;  2Q9L A;  4BWA A;  2NR5 A;  3CCR V;  4NXN O;  5KUK A;  2P06 A;  1S5H C;  1MA1 A;  2F66 C;  1N34 O;  4PDL A;  2BTQ A;  2EBO A;  1TUE B;  4ASU G;  2A9H A;  3W7U A;  1SRY A;  3WG7 C;  2H3O A;  4FMT A;  3RYF A;  4G28 B;  2QR4 A;  3ZHT A;  4X1Y B;  2WLI B;  1I5Y A;  5LMU B;  3ABM B;  1JA8 A;  2A0L A;  4B3M O;  1Z5W A;  1HNX B;  1FJG B;  5JJJ B;  3VQV A;  5B1N A;  4PV1 B;  5EIB C;  2ZIM A;  1N32 O;  4K3A A;  1NVP B;  3K03 A;  4ZI7 A;  3CC2 V;  4ABM A;  2UXN A;  4FFK A;  2PUS A;  1I94 B;  3T2M A;  4HYO A;  3K5M A;  3ZMZ A;  3SPJ A;  3ABK C;  5CB4 B;  2XAH A;  2QM7 A;  2ZT9 B;  2LW1 A;  1THZ A;  1VMG A;  2F23 A;  1H2L A;  4QGP A;  5IWA O;  5IJ0 B;  3E8F A;  3CCE V;  1YDX A;  1YJW V;  1ZX3 A;  1ZL8 B;  2DOS A;  3H1K H;  4DR2 B;  1EFR G;  1N36 B;  4FK5 C;  3JD1 A;  4JV5 B;  2GUZ B;  5KHJ A;  4FJC C;  2JJ2 G;  2OTJ V;  3ABU A;  2E75 B;  1TUB B;  4LF5 O;  1YHQ V;  4JAA A;  4CS4 A;  2QTO A;  2ARH A;  2VWK A;  4IHJ B;  3JAK A;  2QTS A;  3OMI B;  4GKJ B;  1IXB A;  4I0X A;  1R6K A;  2Q7G A;  1XDC A;  3ML0 A;  2AGA A;  4DV1 O;  4J9Y B;  4B3T O;  1JJ2 U;  3M8A A;  4KXR A;  3K0G A;  4MTG A;  3EVK A;  5ITZ B;  5LA6 B;  3G4S V;  3AG2 C;  3CCQ V;  5LP6 C;  5A9G A;  1QVF U;  1WP7 A;  5JWP A;  3ZMV A;  1VQ5 V;  4IGG A;  4LC1 A;  4DO2 A;  4QPJ A;  3CRA A;  1B04 A;  3TXQ A;  1NT2 B;  1DTO A;  3HKB B;  2FKX A;  4G2K A;  4WFG A;  2CTQ A;  2OIE A;  2QWP B;  3ASO B;  1IZ3 A;  4WFH A;  1MOF A;  2IBZ H;  3CP1 A;  2QJ1 A;  3UKM A;  2MW2 B;  4FLZ A;  2OTL V;  3WB1 A;  1NI8 A;  4X88 A;  4HBN A;  3L71 H;  2LW7 A;  4JGS A;  4BW9 A;  3BAA A;  1YJ9 V;  3ZRV A;  2ZIO A;  4DR5 B;  1QR9 A;  1I5X A;  1K9M W;  4KUM A;  2RN9 A;  1Q6U A;  1H2S B;  5B1O A;  1MAB G;  2BE3 A;  4JI2 B;  2RMK B;  3S3W A;  4JAS A;  4O4I B;  4D7T A;  4DRX B;  4FFB A;  5LOV B;  1OCC B;  5GON A;  5BMV B;  5BR8 B;  1QLE B;  5JH7 B;  1R3J C;  2EIJ B;  2HLD G;  3SPC A;  3QF7 A;  4X62 O;  2ODM A;  1F51 A;  3JD0 A;  4B08 A;  5CBH A;  1IUR A;  4L87 A;  2HVJ C;  5EBL C;  4H0L B;  2GV9 A;  5LYJ A;  4JI7 O;  3B09 A;  1KC8 W;  3CC7 V;  2ZQM A;  3BA9 A;  4QPK A;  1W59 A;  5JVD A;  1GN2 A;  1XBL A;  4DV7 O;  4FM0 A;  1SQB H;  3RYH A;  2GBO A;  2LFS A;  4DR3 B;  1P84 F;  5GTH Z;  4O4J A;  5IJ9 A;  1XUQ A;  1CP9 A;  2B1G A;  1Y66 A;  2KG7 B;  4DV5 B;  3JAT B;  1XQ8 A;  2F1M A;  1P4R A;  1WPB A;  5B5E Z;  4XDJ A;  1CEZ A;  2ZCE A;  2Y4U A;  4BR6 A;  4X1I A;  1K33 A;  3ZED A;  3HKC B;  3RGB A;  2JS3 A;  4BIZ A;  3HR0 A;  2QA4 V;  3E2E A;  2ZE5 A;  3UT5 A;  1H8E G;  2W0F C;  3ABT A;  4JI6 O;  2D3O W;  1V55 B;  1PL4 A;  4JYC A;  3CC4 V;  3JAR B;  3DGE A;  2GSM B;  4DUY O;  4JI1 O;  5J2T A;  1NVP D;  3JSN A;  5DM6 V;  4DV6 O;  3RYC A;  4JYA O;  4X9Q A;  2CK3 G;  3DXR B;  5F2V O;  4GLX A;  4WFA V;  1SKV A;  2IU3 A;  4U3J B;  4PEL A;  4WFE A;  3ASO C;  3APQ A;  1Y76 B;  2DYS B;  3CEI A;  1AR1 B;  3WB2 A;  4B3R B;  1QLN A;  4WBN A;  3MDS A;  5IT9 N;  2IU0 A;  2DWE C;  1ZAU A;  2E5L B;  4LFC B;  1Q7Y W;  2QGN A;  4K0K O;  1Q6H A;  3MHH C;  5B3S B;  3CCJ V;  3C3T A;  1H2K A;  3CB2 A;  5IYZ B;  1S0V A;  1VAR A;  1MMM A;  1Q43 A;  4IIJ A;  3ZRS A;  4JI0 B;  4J7K A;  4LF7 B;  1K4D C;  2UUA O;  1MSD A;  4YIP A;  2Z0A A;  3BY6 A;  1JCH A;  4LNU B;  1CPY A;  2ZM6 B;  3CRM A;  5K1X A;  1FXK C;  4MVS A;  1D5N A;  2JEX A;  4TUY A;  1K5S A;  3W7X A;  5LMN B;  1OJH A;  5EZY A;  1N4C A;  3FFQ A;  2YXL A;  2XT9 A;  2HP8 A;  2ZDI C;  3CCM V;  4JI4 B;  4GUN A;  3LDD A;  3SJA C;  2OYQ A;  2EIJ C;  1TVK B;  2EIM B;  1K92 A;  1V54 B;  4ZOL B;  4DR7 B;  2R72 A;  1SS3 A;  5KA6 A;  2X6B A;  5JCO C;  3BFR A;  2YI8 A;  1IBM B;  3P3P A;  1SES A;  4NB5 A;  1R3I C;  3TGU H;  4L8J A;  2AZ2 A;  4CH6 A;  4X20 A;  4B7K A;  2Q67 A;  2OCH A;  2R70 A;  1GM7 A;  2ZE6 A;  2YIB D;  1PP9 H;  2BSK B;  3FB8 C;  2XAG A;  1N33 O;  3PJS K;  2QWQ B;  2JIZ G;  2WLH A;  1KU9 A;  3N2G A;  4AQY B;  1XI1 A;  1DLB A;  3HKE B;  5C93 A;  1H2N A;  1JMK C;  4K8X A;  5H2F Z;  5IE9 A;  3FAV A;  1K7D A;  5CA1 A;  4O4L A;  1Q3E A;  4K35 A;  3OTO O;  5IYC O;  1S77 D;  2XTA A;  4MW3 A;  3H9V A;  2BCC H;  3I56 V;  2VQE B;  2DQ0 A;  1W0J G;  4PA3 A;  4AIL C;  1SC5 B;  1Y74 A;  4H37 A;  4BIO A;  2VQF B;  4DR6 B;  4I9W A;  1YJN V;  2RCV A;  4HZ3 A;  4W4K A;  1D2D A;  4KP4 A;  4PJ0 Z;  5FNV B;  3VBB A;  3JSL A;  4PHZ A;  5KLV H;  3CWB H;  3WG7 B;  2XOK G;  2UXD O;  2QKC A;  2F4V B;  1MZE A;  2D2C B;  1BHA A;  1QQC A;  3N27 A;  3SYQ A;  2NN4 A;  4NXN B;  1L0N H;  1FFT B;  5CMU A;  2HJD A;  4CBC A;  1HDJ A;  1N34 B;  1AJP A;  1B06 A;  1VQ4 V;  3OMA B;  4EB6 A;  2F95 B;  2V4D A;  5CBF A;  4GT1 A;  1EZJ A;  3L73 H;  1FXV A;  1BMF G;  2XHB A;  1NR7 A;  2QWN B;  4U7N A;  1PNM A;  2PY5 A;  4EEQ A;  1ROP A;  4B3M B;  4FLT A;  1XMQ O;  2DWD C;  1GO3 F;  4RAI A;  1N32 B;  2CTW A;  4R6Z A;  2AHZ A;  3JCZ A;  1F23 A;  5BZB A;  4CC6 A;  3SJQ C;  3SYO A;  2JGD B;  1RPR A;  2G38 A;  4O2B A;  3SPI A;  4FZ1 A;  4LWS A;  4FIP C;  3T4D A;  3C3S A;  3CXC U;  2ZR2 A;  2CGN A;  1ARO P;  1AP5 A;  3OR7 C;  1WNS A;  1JFF B;  3G80 A;  4EKW A;  4TV9 A;  3A8T A;  5IWA B;  4NR1 A;  1S5J A;  3U10 A;  1GMG A;  1HNW O;  1L0L H;  1PD3 A;  2WWW A;  1J5E B;  2DE0 X;  3K9A A;  5HFL A;  2Y0P A;  4AHC A;  3AG2 B;  2JK5 C;  1XHX A;  2ITC C;  5LP6 B;  2ZKO A;  1FFX A;  1Q81 W;  4LF5 B;  2R9A A;  3QNE A;  5JQG A;  3K58 A;  4KFM A;  1G8M A;  2YS8 A;  4JAU A;  1K5Q A;  1URF A;  2ZR3 A;  1HNZ O;  4DV1 B;  4JAV A;  4B3T B;  1JPX A;  1XHZ A;  4LF6 O;  3ZS8 C;  1K8A W;  1AI7 A;  1VF7 A;  4UCS A;  4FLY A;  2UXB O;  3CE2 A;  3B4S A;  4I4T A;  2XAJ A;  1VF6 C;  1WB7 A;  4TSF G;  4H13 B;  4EFB A;  2B1I A;  1NBM G;  2Q73 A;  2KKW A;  3UO3 A;  1H8H G;  3VQX A;  3JAL A;  2WLL A;  1XL4 A;  4BAY A;  1LUW A;  3K08 A;  1M1K W;  4WCE V;  4DUZ O;  3AK1 A;  3E83 A;  2ZD9 A;  4N23 A;  5A2Q N;  1YI2 V;  2DJV A;  5B66 Z;  4C7U A;  4YIO A;  4IYI A;  4O2A B;  4B3S O;  1NTK H;  4BW5 A;  2IM9 A;  2QE7 G;  1YTF D;  1ORQ C;  5KX5 A;  1BQ0 A;  4B7E A;  3A0R A;  2LJ2 A;  4PA6 A;  1PM9 A;  4CH3 A;  1SQV H;  4ZHQ A;  1CXZ B;  3K5L A;  3CCS V;  1G4Y B;  2ZE8 A;  1S76 D;  4I50 B;  2UXC O;  2LO1 A;  4K8Z A;  1OCZ B;  2Y0I A;  2GTS A;  1DGS A;  3J81 N;  3BRC A;  2AZ0 A;  4JYB A;  3RYI A;  4JTD B;  2HHH O;  1RSO A;  4NTX A;  2KB1 A;  1NQT A;  4DV0 O;  2Q68 A;  3ZRW B;  3BHP A;  4X1K B;  3ETG A;  4UB8 Z;  2XAF A;  4X62 B;  1D5A A;  2EIL C;  4TV8 A;  2Q69 A;  3OGI B;  4RQE A;  2Q7E A;  2CE4 A;  4DV3 O;  1QCE A;  3G71 V;  4QNH B;  4JI7 B;  1Q90 D;  5EYP A;  4A5U B;  2ADP A;  3JAS B;  3SYP A;  3D3Q A;  1SA0 A;  3E22 B;  2DYR C;  3HKD B;  4F6R B;  1S3J A;  3KG2 A;  3OE7 G;  3ZN0 A;  4D6T H;  2O57 A;  3LSQ A;  3OM3 B;  4DV7 B;  3OEE G;  1IVS A;  1O9H A;  2Z3Y A;  1YEW A;  1VQM V;  4NTW A;  2YSU B;  4PI0 A;  3I5D A;  2WPD G;  1QHT A;  2P4K A;  1AJN A;  5EIB D;  4OGQ B;  1BZK A;  4OPA A;  1SF9 A;  3ETD A;  1OCO C;  4TOI A;  3TET A;  3EHB B;  3OR6 C;  4Q20 A;  2QWR B;  4WF9 V;  5KA5 A;  4FPP A;  1ZTE A;  1ZLZ A;  2BOB C;  3KCY A;  3P3N A;  2HEP A;  4LR3 A;  2NLJ C;  3AG7 A;  4JI6 B;  3B8M A;  2HVK C;  1GH6 A;  5E79 Z;  1Y67 A;  2VWJ A;  1BQZ A;  3SJC C;  2Y69 C;  2EUL A;  1HP8 A;  3CJH A;  3IFX A;  4DUY B;  2YIA A;  2Q0A A;  4JI1 B;  3PN1 A;  4UCT A;  1PKX A;  4DV6 B;  4JYA B;  1L8D A;  1VIB A;  1FJG O;  5C8Y A;  2ATK C;  2EX3 A;  1WA8 A;  2ADQ B;  3W7W A;  2DN9 A;  3K3W A;  3ASN C;  5KMG A;  1FXK B;  3UM7 A;  3Q4H B;  2P7T C;  4H44 B;  1GKF A;  1OZ0 A;  2Z5U A;  1HWY A;  1OV9 A;  1VEW A;  3CRR A;  4IYH A;  4K0K B;  5J2U B;  5CN0 A;  1FKA O;  3T1C A;  5EC2 C;  3UCS C;  1T5E A;  1DK1 A;  2OT5 A;  4Q6G A;  1OCZ C;  1M90 W;  2UUA B;  2F93 B;  2JS5 A;  4UCU A;  1KP3 A;  5L3E A;  2X6C A;  1Q86 W;  1VP7 A;  1VQN V;  1I0H A;  3I55 V;  2LQT A;  2UU9 O;  4MTO A;  5IYB O;  3BCC H;  4X1Y A;  2WLI A;  5KAF Z;  4UVB A;  4OPH A;  3AK2 A;  2A3Q A;  5H5N A;  3AG1 C;  4LCU C;  5LXT B;  3CCL V;  1RFY A;  5CA0 B;  1IX9 A;  3BPZ A;  1SZX A;  1BGY H;  4XDK A;  4YJ2 B;  3STL C;  1BT8 A;  5CB4 A;  2UUC O;  1HW7 A;  1SQQ H;  5IYD O;  4DXW A;  4Z1V A;  1N0N A;  2WLN A;  1XNR O;  5KAI Z;  4I55 B;  5IJ0 A;  1U97 A;  2X6A A;  3BVO A;  1IXM A;  5EBW C;  4F4L A;  3CS5 A;  1Q5O A;  1ZL8 A;  1N33 B;  4FVM A;  1US6 A;  2IJK A;  5B1B B;  2W6J G;  2WAM A;  3FYI B;  2GUZ A;  3SYA A;  3LSU A;  2P22 C;  1TUB A;  5DN6 G;  2QM4 A;  2AW9 A;  4IHJ A;  5FPO A;  3RW0 A;  2EIK C;  2FL4 A;  2X0L A;  3FX7 A;  1BHB A;  3M99 B;  4YY3 B;  3T1H O;  1JOY A;  4UCR A;  4RQF A;  3VQW A;  1PV0 A;  3OMN B;  5EC1 C;  3K06 A;  3ETE A;  3U0Z A;  4CS2 A;  5ITZ A;  5LA6 A;  3ZN1 A;  5DEC A;  4UCV A;  4LF9 O;  3X2Q C;  2DW4 A;  4JI2 O;  1XMO O;  1RM1 C;  1BS3 A;  1YIJ V;  4ZKI A;  4MT8 A;  5B1A C;  2UXD B;  3E89 A;  4HNA B;  3HKB A;  3AG3 C;  4DK1 A;  5LBQ A;  2XAQ A;  3W7T A;  3RBZ A;  1FAF A;  1QVG U;  1EN6 A;  5FPR A;  3DC5 A;  4H33 A;  4YJ3 B;  4R8C A;  5L3F A;  1NS1 A;  4PDM A;  1MSW D;  4DV4 O;  4TWK A;  1GK9 A;  1GN3 A;  4XDL A;  2ZE7 A;  4O4H B;  2P67 A;  3A0B Z;  2CH7 B;  4PA4 A;  1YTF B;  2HJF C;  5BY1 A;  3G6B A;  1M56 C;  2YEV B;  4TQF A;  3E8H A;  3CYO A;  3NR7 A;  4O4I A;  4E4E A;  2GDS A;  4AI8 A;  3ZBH A;  4DRX A;  1IBL O;  1TAE A;  2VS0 A;  1XMQ B;  1ZWI C;  3JAW B;  1I7F A;  5LOV A;  3VQY A;  4ZIB A;  2XUM A;  2IJJ A;  4CC5 A;  2ZDI A;  5KHI A;  3ZHV A;  4DR1 O;  5BMV A;  4GX0 A;  3N2K B;  5JH7 A;  4I9Q A;  4U7O A;  2IH3 C;  1BL8 A;  2ETN A;  4JTA B;  2N05 A;  5JCO A;  1TA8 A;  2W0X A;  3ZCC A;  4X64 O;  4U3F H;  2YUA A;  4MVQ A;  1FS0 G;  1Y6X A;  4LP8 A;  1R73 A;  1HNW B;  2BTQ B;  1GM9 A;  2PYJ A;  4UFZ A;  2E76 B;  2JGU A;  3RT3 C;  2L35 A;  3RYF B;  3H1I H;  2PGG A;  1K97 A;  1AIL A;  1F4N A;  5B1B C;  1WN7 A;  2AHY A;  1P7B A;  4E2L A;  4X66 O;  2KG7 A;  5E1A C;  1FPO A;  3FKS G;  3JAT A;  2P90 A;  1R6T A;  2KSD A;  4JTC B;  4TT3 G;  1YZB A;  4KHP O;  3IGA C;  4JI8 O;  3OEH G;  3SPG A;  2XAS A;  3T1Y O;  4ZI7 B;  4JYY A;  5FL7 G;  2DMX A;  1W0K G;  1HNZ B;  2B9Z A;  2WSS G;  3HKC A;  2K1E A;  3ZIA G;  5CBG A;  4LF6 B;  1Q6I A;  3D3I A;  1H2G A;  1XL6 A;  4P9O A;  3AEI A;  1GRJ A;  4P2Z A;  3CRC A;  1RPO A;  1EN5 A;  2L6L A;  1VQ7 V;  5EK0 A;  3OUF A;  2EJR A;  1PL0 A;  2PTM A;  2YI9 A;  1RP3 B;  2ZNJ A;  2C2A A;  2QWO B;  4UXN A;  2ZM6 O;  3RFR A;  3K59 A;  1QU7 A;  1BE3 H;  3W7S A;  4PA9 A;  3RN4 A;  1AI6 A;  3JAR A;  4RWU A;  2Q5Z A;  1L1F A;  3OFN G;  4DUZ B;  1KEC A;  3DXR A;  5H9C A;  2AXT Z;  1X4T A;  4U3J A;  1QNM A;  4B3S B;  1JR9 A;  3SR2 C;  4DR4 O;  3QTC A;  3JAK B;  1Y76 A;  5LGN A;  3R65 A;  2H8P C;  3F5T A;  4FLV A;  1ZSP A;  4I0X B;  3F7Y C;  2WLM A;  1KB9 F;  2NNU A;  2WLJ A;  1YCI A;  4YHH O;  2P5O A;  1KYO F;  1I08 A;  3G67 A;  2JJ1 G;  4NVP A;  4LFB O;  4FM1 A;  5IYZ A;  3FYE B;  2EIL B;  2UXC B;  1Q8I A;  1VQ6 V;  2CDY A;  4ZBM A;  1G6U A;  2EIN C;  5KUM A;  5D5Q A;  4FLU A;  4LNU A;  4DV2 O;  1IBK O;  2A79 B;  2DYR B;  5BXZ A;  4GKK O;  1ZUQ A;  3K57 A;  3TJT A;  2M6Y A;  2HHH B;  4J80 A;  3ABL B;  1GAX A;  2Q8V A;  4DV0 B;  4G27 B;  3ZHR A;  1TVK A;  2Q4P A;  4ZOL A;  4PA7 A;  2OIG A;  4DV3 B;  1JX9 A;  1OCO B;  3B8N A;  4J10 A;  1M9N A;  1B6Q A;  1VQO V;  4UVA A;  1WPX A;  1M5I A;  4MS2 A;  1NKD A;  1OHH G;  4FLW A;  4J41 A;  3GVM A;  3OGC C;  3ZJZ A;  4LF8 O;  2BSK A;  3L74 H;  4MVZ A;  1UJW B;  1GN6 A;  3MAQ A;  4WFB V;  4MW8 A;  3OT7 A;  4J7Z A;  4FFB B;  5AG2 A;  2LGQ A;  2Y69 B;  2BOC C;  3ZHS A;  4WFF A;  2N04 A;  2QKS A;  3HKE A;  4JI3 O;  1YXB A;  3JCU Z;  5GON B;  3D8C A;  5GTI Z;  3K5N A;  2E74 B;  1JQ0 A;  3APO A;  3ASN B;  1AVM A;  4LFA O;  3G6E V;  4DK0 A;  3D36 A;  1M57 C;  1PNL A;  1P49 A;  5IDJ A;  4X65 O;  3F5W C;  4LF4 O;  2YXY A;  5LYJ B;  4D7S A;  4OX9 O;  1XNQ O;  3WB0 A;  1SET A;  1NU1 H;  1VF6 A;  3QVN A;  3AG4 C;  4MVU A;  1HR0 O;  1R3K C;  4MSW C;  3WU2 Z;  3KKY A;  5JVD B;  2R9R B;  1YIT V;  4QE9 A;  5FNV A;  3RYH B;  1J95 A;  2HKO A;  3R66 A;  4PDR A;  2IH1 C;  4O4J B;  2QSA A;  5IJ9 B;  4JZ2 A;  3P32 A;  2Q7H A;  1AJQ A;  3SJB C;  1N8R W;  5LGT A;  1R1B A;  4RUF A;  5LHG A;  1TGO A;  1SQF A;  3HB3 B;  4X1I B;  3AG1 B;  2BTO A;  2UUB O;  1DF4 A;  4CS3 A;  3P30 A;  1F7Y A;  3BAB A;  4Z1M G;  3UT5 B;  1J5E O;  2YC0 A;  2DQ3 A;  2V7Q G;  1UPG A;  3THO A;  4I5S A;  4UV8 A;  2UU9 B;  2FML A;  4MVO A;  1YVW A;  1M4U A;  1SQX H;  2EZO A;  3GWK C;  4MTX A;  5J2T B;  1BSM A;  1MNG A;  4MTF A;  3RYC B;  3ABL C;  3L9D A;  1QBZ A;  3FB5 C;  4NTY A;  3CCU V;  4JI5 O;  4QJF B;  3QG5 A;  1MG1 A;  4NXM O;  2IW5 A;  1NJI W;  2V1D A;  4TQD A;  3QO5 A;  2JGD A;  3E86 A;  4OXS A;  3MHS C;  2FYU H;  4WBN B;  1LNQ A;  4QIW F;  2HFE C;  1SQP H;  4UB6 Z;  2UUC B;  1VQ9 V;  2EIK B;  3ZHQ A;  2GTA A;  3ICX A;  1KD1 W;  3OD4 A;  2A7W A;  1JFF A;  4F6E A;  1XNR B;  4IIJ B;  5LHI A;  1BCC H;  4GZR B;  3KCX A;  1K4C C;  3ZMU A;  5FLX N;  4TUY B;  3X2Q B;  3SGI A;  5LP6 A;  5IY5 C;  2R9I A;  1RM1 B;  5LMU O;  1E1Q G;  2WA4 A;  5EZY B;  1OCR B;  3DC6 A;  3E8B A;  3SYC A;  1LUV A;  1HNX O;  1H2M A;  5K1P A;  5B1A B;  1NZ6 A;  2ZNI A;  3O9O A;  1VQ8 V;  3AG3 B;  2JDI G;  1ENV A;  4MVM A;  3T1H B;  3CCV V;  3EXA A;  5L3G A;  3CX5 F;  1I94 O;  1EZV H;  1AR5 A;  4PD4 F;  3RVY A;  3QO8 A;  1VQK V;  3CHX A;  4X20 B;  4LF9 B;  2QEX V;  3L70 H;  3HPL C;  1XMO B;  4N21 A;  5EBM C;  1S5L Z;  3ABM C;  3GB7 C;  1R6N A;  2ZXW B;  1Y4M A;  4FM2 A;  4DR2 O;  1N36 O;  1K3E A;  3CXH F;  3N2G B;  1M56 B;  2FB5 A;  4JV5 O;  4RO2 A;  4X8A A;  3F7V C;  2CTP A;  3H01 A;  3UO2 A;  1KQS U;  2VRZ A;  3IJ4 A;  4DYL A;  3K79 A;  4O2A A;  4YXW G;  4FZ0 A;  4R50 A;  2IJI A;  4GKJ O;  2JRI A;  1WB8 A;  4JPR A;  2Y48 A;  3ETQ A;  3FAV B;  5LGU A;  3K9S A;  3H1L H;  4DW1 A;  4CH5 A;  5CA1 B;  4O4L B;  2RJZ A;  4DV4 B;  3OAA G;  1EM1 A;  4I50 A;  2CTR A;  1NH2 D;  2P6J A;  4GX1 A;  1S72 V;  2N74 A;  1Y74 B;  4J9Z B;  2PZS A;  3B2E E;  1IBL B;  2UXX A;  4P9P A;  2H94 A;  5HFM A;  5KHK A;  4Z2W A;  1AP6 A;  5KHH A;  4DR1 B;  1VQP V;  3B40 A;  2WLK A;  4GX2 A;  2QKA A;  3LSS A;  3ZRW A;  2PI5 A;  3OTF A;  3BEH A;  4X1K A;  4IL6 Z;  3ZMT A;  4R7C A;  5KHG A;  4PI2 A;  3LDE A;  2CGO A;  2K9P A;  3VOU A;  4X64 B;  1V9P A;  3JAS A;  3E22 A;  4DR5 O;  3HKD A;  4F6R A;  3OTO B;  4LH7 A;  4CZZ A;  4UVC A;  3LNN A;  2Y4T A;  4EB6 B;  1YSC A;  3L75 H;  1K34 A;  2B5U A;  2QDO A;  2MK3 A;  4X66 B;  3LDC A;  3TK1 A;  2OCC B;  1NTM H;  1OCR C;  1GTO A;  2ILM A;  4QE7 A;  4KHP B;  4JI8 B;  3T1Y B;  3ZX6 A;  2YIB A;  5BR8 O;  3TXS A;  1EN4 A;  3CD6 V;  4O2B B;  1O9G A;  4LWS B;  1G1X B;  1U96 A;  2A06 H;  3AK3 A;  3H1J H;  1AI5 A;  2YDE A;  3T4Z A;  3SDL A;  3ZMS A;  4DW0 A;  2YID A;  2CUG A;  2RQ6 A;  4TV9 B;  4RUE A;  2W6I G;  2FTK A;  1W2B U;  2ZXW C;  1GM8 A;  5H6Q A;  2PI4 A;  2EIN B;  2YIC A;  1OCC C;  1NR1 A;  4DR3 O;  1QLE C;  1B3Q A;  3OW2 U;  1FFX B;  4FLX A;  3IAY A;  2HR3 A;  1FXK A;  1XEQ A;  3E8G A;  2EJ7 A;  4P30 A;  4DR4 B;  3Q4H A;  1XOU A;  5JQG B;  5JJE B;  4DV5 O;  1AI4 A;  4HAM A;  3J7A U;  1M93 A;  4MVR A;  4YHH B;  1KP2 A;  4KL1 A;  5L3D A;  5J2U A;  3E35 A;  4LBE C;  2PYL A;  4LFB B;  1QR8 A;  3MD0 A;  3K5O A;  5TIS Z;  4J42 A;  1LR1 A;  1UFI A;  3NXS A;  4I4T B;  1WLE A;  3K04 A;  1H38 A;  4UV9 A;  4DV2 B;  1IBK B;  1YF2 A;  3S3X A;  5LHH A;  1R3L C;  3CME V;  4GKK B;  3JAL B;  2WLL B;  1P7G A;  2QM8 A;  3J80 N;  1X59 A;  1AR4 A;  1SQG A;  5L3C A;  2LFR A;  2PF4 E;  4J7J A;  3CSX A;  5LXT A;  2Q6A A;  2P4V A;  1DF5 A;  1Z2G A;  4YY3 O;  3B77 A;  5DED A;  5CA0 A;  2ITD C;  3EFF K;  2OWO A;  1AB3 A;  2XND G;  1FYJ A;  3LNM B;  3RWR D;  5KX5 B;  3GWO A;  3IC7 A;  3O65 A;  4B3R O;  3CPW U;  4YJ2 A;  4ZHQ B;  2E5L O;  4LFC O;  1V55 C;  4XBF A;  1A32 A;  1VQL V;  1M57 B;  4BIU A;  5J9P C;  4I55 A;  4JI0 O;  4LF7 O;  2UXB B;  3IC9 A;  4LF8 B;  4UCO A;  4LH6 A;  4ICG A;  2CAZ C;  4IT5 A;  3DSQ A;  1PPJ H;  3JD4 A;  1KUQ A;  3AG4 B;  2OCC C;  3RYI B;  2DYS C;  2LP7 A;  1WJZ A;  5LMN O;  2ZIN A;  1WAZ A;  4JI3 B;  2KQX A;  1RSO B;  4J11 A;  4X89 A;  4JI4 O;  3U11 A;  5B3S C;  4LFA B;  1N0J A;  4TV8 B;  4X65 B;  1Q82 W;  1VF5 B;  4DR7 O;  4LF4 B;  3TCU A;  1GN4 A;  1KKC A;  2WA3 A;  5EYP B;  1IBM O;  4OX9 B;  3ABK B;  1XNQ B;  3WFV A;  1FD9 A;  1SA0 B;  2JEU A;  4PDV A;  1XRE A;  4NYK A;  1E1R G;  1KBH A;  2M7W A;  1KKD A;  3CMA V;  1HR0 B;  3STZ C;  3M7M X;  3KZI Z;  1Z5V A;  1SER A;  5GW7 A;  3OUS A;  1F4M A;  1JJO A;  2JVD A;  4UUJ C;  3K0D A;  2EIM C;  3H1H H;  4HNA A;  4AQY O;  1V54 C;  1COW G;  4EFE A;  3A2F A;  5JJN B;  3QO7 A;  5L3B A;  3FB6 C;  3L72 H;  1JVM A;  4JF3 A;  3DTU B;  3ZHU A; 
#chains in the Genus database with same CATH homology
 4OPA A;  4DR2 O;  1N36 O;  5A2Q N;  2DJV A;  4YY3 O;  1FYJ A;  1AB3 A;  1N33 O;  4JV5 O;  1NS1 A;  2ZM6 O;  4LF8 O;  4B3S O;  1XMQ O;  3O65 A;  4B3R O;  4DV4 O;  5LL6 Y;  2UUC O;  4DUY O;  5BR8 O;  4JI1 O;  5IWA O;  2E5L O;  4LFC O;  4DV6 O;  4JYA O;  5BY1 A;  1A32 A;  4GKJ O;  2VQE O;  1XNR O;  2JRI A;  1G1X B;  4JI5 O;  2DOS A;  4NXM O;  4JI3 O;  3SDL A;  2VQF O;  4DR6 O;  4JI0 O;  4LF7 O;  1IBL O;  2UXC O;  3JAM N;  4DR4 O;  4LFA O;  4LF5 O;  5IT9 N;  3F5T A;  3OTO O;  1KUQ A;  4X65 O;  4DR1 O;  1HNW O;  4X62 O;  4K0K O;  1FJG O;  4LF4 O;  2N74 A;  3J81 N;  2F4V O;  5LMN O;  4YHH O;  4OX9 O;  4DR3 O;  1XNQ O;  4LFB O;  4JI7 O;  2AGA A;  4DV1 O;  2UUA O;  1D2D A;  2HHH O;  2Z0A A;  1XEQ A;  4B3T O;  4JI4 O;  2ZKO A;  3M8A A;  1HR0 O;  4X64 O;  3T1H O;  5FLX N;  4DV0 O;  4DV5 O;  4NXN O;  3J7A U;  4DV2 O;  5LMU O;  1IBK O;  2UXD O;  4DR7 O;  1FKA O;  3R66 A;  4DV7 O;  1N34 O;  5BXZ A;  4GKK O;  1IBM O;  1HNX O;  3RT3 C;  4DV3 O;  1DK1 A;  4LF9 O;  4JI2 O;  1XMO O;  1HNZ O;  1AIL A;  4A5U B;  4LF6 O;  1R1B A;  4X66 O;  2UU9 O;  1I94 O;  2UXB O;  4DR5 O;  2FKX A;  1R6T A;  1YZB A;  4KHP O;  2UUB O;  4JI8 O;  3T1Y O;  4B3M O;  4OPH A;  4AQY O;  1F7Y A;  3J80 N;  1N32 O;  1J5E O;  5H5N A;  2LW7 A;  1X59 A;  4DUZ O;  4JI6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...