3T1YO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3t1yO00
4GKJO 4LF6O 1IBLO 2UUCO 5BXZA 1NS1A 5A2QN 4OX9O 2Z0AA 3RT3C 3T1YO 4JI2O 2AGAA 4DR6O 5LL6Y 1F7YA 4LF7O 4AQYO 2DJVA 5IT9N 2E5LO 4DV3O 4DV7O 1HNZO 5H5NA 4X62O 4B3MO 4DV6O 3J81N 1R1BA 4LF4O 5IWAO 4DV2O 3J7AU 2UUAO 3O65A 1FYJA 4LFCO 4DV0O 3J80N 4DR1O 4DR2O 1YZBA 2UUBO 1IBMO 2UXBO 1KUQA 4LF9O 2UU9O 4LFBO 2UXDO 1HNWO 3R66A 4DR3O 5BR8O 2F4VO 4JI6O 2N74A 4B3RO 4YHHO 5LMUO 4DV4O 4YY3O 2DOSA 4JI3O 1G1XB 4NXMO 3F5TA 4B3TO 1A32A 3JAMN 2ZM6O 1XMQO 4LFAO 1XEQA 4X64O 3T1HO 4LF5O 4K0KO 2JRIA 4JYAO 1FKAO 1X59A 4B3SO 1R6TA 4A5UB 5LMNO 1N32O 2ZKOA 4DR7O 5FLXN 2UXCO 1D2DA 1AILA 1XNRO 4OPAA 4NXNO 1DK1A 4JI5O 4JI7O 1XNQO 5BY1A 4LF8O 4JV5O 4JI0O 1HNXO 1IBKO 2VQFO 1I94O 4OPHA 3SDLA 1J5EO 2FKXA 3OTOO 2HHHO 4KHPO 4X65O 1HR0O 1N33O 4JI8O 1N34O 4DUYO 4X66O 4DUZO 3M8AA 4DV1O 1XMOO 4DR5O 4GKKO 4DR4O 1AB3A 2LW7A 4JI4O 4DV5O 1FJGO 2VQEO 1N36O 4JI1O
chains in the Genus database with same CATH superfamily
4IIJA 4DRXA 3ASNC 4KP4A 1M90W 2E75B 3CC7V 5A2QN 3JAWB 4UCOA 2XAGA 2HJFC 1J5EB 3B77A 3E22B 2EBOA 1AR4A 4JYBA 2UXDB 2Z5UA 4FJCC 1KQSU 2H8PC 5LP6A 4DV6O 1FJGB 5H6QA 1K92A 1DGSA 3J81N 2YEVB 4QPJA 1NBMG 3J7AU 3EHBB 2WWWA 1VIBA 4HBNA 3I56V 2WA4A 4AILC 2ZXWC 4U3JB 3QO7A 2ZR2A 2UUBO 2ADPA 1KP2A 5J2TA 3SPCA 2UU9B 3VQWA 3MAQA 4B3RO 2ARHA 3APOA 4X1KA 4JI6B 2WLLB 2EIMC 3QG5A 4QE7A 3G6EV 1FXVA 3KZIZ 4JTAB 2WLLA 3ABTA 3K04A 2B1GA 1NVPD 5BR8B 5KHIA 3AG4B 2YXLA 1BQ0A 5LMNO 4J7JA 4ZBMA 3K79A 1PNKA 4O4LB 1TUEB 4MW8A 3AG1C 5K1XA 1SQGA 3K0DA 2OWOA 2QM4A 2ATKC 5J2TB 2IJKA 1RPRA 3IC7A 4R7CA 2FMLA 4LBEC 1F51A 2HHHO 5IJ9A 4X65O 1HNWB 4TV9A 3G4SV 2NLJC 1VQ4V 1M4UA 5LXTB 1ZWIC 2EZPA 4PA6A 5LP6B 2P4VA 5EK0A 3AG7A 1IZ3A 1UFIA 4X64B 5LMNB 3DTUB 1WN7A 5JH7A 2OCCB 1CEZA 4OX9O 5EZYA 3ZHQA 4NTXA 3RYCB 1F23A 1NR7A 5EIBD 1HNZO 1QNMA 4MVOA 1K5QA 2YS8A 3HKEA 2QKSA 5JCOA 3K58A 2EINC 4R8CA 1U96A 3CPWU 3CS5A 4LF9O 5K1PA 2QKAA 2W0XA 5L3CA 4JYCA 2Z3YA 3ABMC 2ZDIC 3OR7C 1N0JA 1RPOA 3CCJV 4H33A 4P9OA 1UPGA 5IYZA 2WLIB 3ZX6A 3L73H 4GT1A 4J11A 2AZ2A 1BHBA 4LF5O 2C2AA 4W4KA 2UUBB 5H6RA 2KG7B 4LFAB 1S0VA 4FZ0A 5FL7G 1MMMA 2UXCO 1OCCB 5IJ9B 2Q73A 3JARA 4EFEA 4FM1A 3JD3A 4WCEV 1K4DC 1IXMA 5LXTA 2VWKA 1AP5A 4FM2A 1W2BU 4YJ2B 2YIDA 1I08A 1GH6A 1M56B 3CRMA 2VQFO 2LQTA 3OEHG 3C3TA 1PV0A 2YSUB 3QO8A 4NTWA 1IBLB 1NJIW 5IDJA 4JV5B 3W7SA 1JOYA 2F4VB 2Y48A 4U7OA 4IL6Z 1W0JG 4DV1O 4DR5O 1T5EA 3JAKB 3CHXA 4HNAB 4O4JA 2MW2B 2VQEO 3ZMSA 3FX7A 1EZJA 1VQ8V 2UUCO 4X66B 5LMUB 3K08A 2UUCB 3LSUA 1BSMA 4CS2A 1Y74A 3FB6C 4GCZA 3AG4C 3JD0A 5JCOC 5DN6G 2QDOA 1MZFA 2JS5A 3L74H 4IYHA 4UV8A 3I55V 1NH2B 1AI6A 5FPRA 1L8DA 2X6AA 2AHZA 1N34B 1PNMA 1KU9A 1YZBA 2F93B 2GV9A 2NN4A 1DTOA 2PGGA 2F95B 3CXCU 1I5YA 3WG7C 1BE3H 2YIAA 2N74A 2PI5A 3L71H 3N2KA 4MVZA 1MZEA 1KKCA 1YI2V 4IIJB 4DRXB 5LA6B 1P7GA 4LF6B 1XMQO 3JAWA 3CCUV 4WBNB 3QNEA 2EZOA 1XL6A 4B3SO 4CBCA 2Q7HA 1WAZA 3FFQA 3CCVV 3H01A 4D7SA 4JI5O 5B1OA 5L3BA 1JFFA 3D8CA 4X8AA 4F6EA 3Q4HA 3CJHA 1H2NA 2ZE6A 4IHJB 1LNQA 3CC4V 5CA0B 4FLYA 1IURA 3ICXA 4I55A 4LNUB 3JD1A 1XMOO 1MSWD 5ITZA 2VRZA 1OCOB 4YIOA 1OV9A 1TUBB 2BTQB 4WFAV 3CCMV 2Y0IA 4UXNA 1DF5A 3AEIA 5JWPA 1SQBH 2QJ1A 2P6JA 4TOIA 1VQPV 4GKJB 3ABLB 3JSLA 2GTAA 2Q68A 1VQ9V 3JATB 3ZMZA 2CGNA 2DQ3A 3D36C 1L0LH 3STLC 4X65B 1PM9A 3WB2A 4TV9B 1YF2A 1NTKH 1Q6IA 2DYRC 3QO5A 2ITCC 2RJZA 3AK3A 2V4DA 2JJ2G 4MTFA 3CRCA 3D3QA 2P22C 5L3GA 4WFFA 1HNWO 2PF4E 1S77D 4JI8B 4DR2B 4CC6A 1S76D 4WFEA 5IYCO 4FK5C 2B1IA 4LFCB 1BGYH 3F5TA 4LC1A 1A32A 1Q6HA 2JRIA 1JCHA 4JYAO 5JQGA 1COWG 3ZEDA 5LHHA 2BE3A 3GVMA 1J95A 2CK3G 5TISZ 5GONA 1D2DA 1EN6A 3HPLC 3KG2A 4DV3B 4H0LB 3RYFB 3WB0A 1M57C 3RN4A 1W59A 4B08A 3CSXA 4UUJC 5B3SB 2AW9A 1GN4A 4P30A 2Q69A 1VF6A 3DXRA 1N34O 2H3OA 4X1IB 1QVGU 3M8AA 1MA1A 3EXAA 4GKKO 1NZ6A 1DF4A 2E74B 2JGUA 1PD3A 5KLVH 1RM1B 1IBLO 3ZMVA 1GAXA 2NR5A 3B40A 3O9OA 3LSSA 2JGDB 1XREA 4NXNB 1XQ8A 2DJVA 5IT9N 4PI2A 1B06A 2BTQA 1U97A 3CRAA 3FAVB 1G4YB 5CA1B 3CD6V 1R3JC 2IJHA 4PELA 1R1BA 2LFRA 3JALA 1Q6UA 3UM7A 1Y76A 2BOBC 5JVDB 5H9CA 4FFBA 3U11A 1S5JA 5FNVA 1SZTA 1NH2D 5IJ0A 5L3EA 3MD0A 1XOUA 1H2SB 5KA5A 2IBZH 4IHJA 3OW2U 5ITZB 2CAZC 3SPJA 1QHTA 4BIUA 3W7UA 1QR9A 5LMUO 4BIZA 2ZE8A 3ABKB 2DYRB 3P3NA 1ZL8A 1AJPA 4B3TO 1MNGA 1N0NA 4UV9A 1Q8IA 1M5IA 5EZYB 1HWYA 4K0KO 4J9ZB 1P7BA 1H8HG 1VQLV 3OMIB 3OMAB 2EILC 3C90A 3CYOA 1VF7A 2V1DA 2EIJC 4DW1A 3F7VC 4WFGA 5C8YB 4MVMA 1HNXB 4O2BA 3SJCC 3F7YC 1SERA 2DE0X 1JVMA 5EBWC 5B1NA 4O4HB 4N21A 1SA0B 2R9AA 2FL4A 2KB1A 4X20A 3ZRWA 4B3MB 3QTCA 1N33B 1YTFD 1AB3A 2ZDIA 4JF3A 2OIGA 5JJEB 3U0ZA 4ABMA 4GYCB 4JI1O 1YSCA 1F4NA 1K73W 2PTMA 1OCCC 4R50A 1K33A 3R65A 2YICA 4PJ0Z 1JMKC 5JQGB 1KD1W 1FFXA 2UXNA 5B1AC 3A0BZ 3OM3B 2XT9A 2KSDA 2PZSA 2CTRA 4OGQB 5IJ0B 3OFNG 4E2LA 4X1KB 4KUMA 1YTFB 1Q81W 3IC9A 1E79G 3ZMTA 2UUAO 2WAMA 1H2MA 4UCRA 4D6TH 1XDCA 2WA3A 1VF5B 2F1MA 1HNZB 3AG2B 1HDJA 5B1BB 1TAEA 3I5DA 3CCRV 4B3TB 1N8RW 5CB4A 1BCCH 2DOSA 4P9PA 4GX0A 2HLDG 4U3JA 1IDSA 1GM9A 3CCQV 5CB4B 3G67A 1ZLZA 3QF7A 2RDCA 3S3XA 2OCHA 1YJNV 2QGNA 5C8YA 2ETNA 3RW0A 5J2UA 2EIJB 1N32O 1AVMA 3L70H 2HP8A 2F43G 2HG5C 2HKOA 3JASB 5HFLA 3H1IH 2L6LA 5J9PC 3E2EA 1L1FA 1KYOF 2IW5A 2DYSB 4B3RB 1YITV 2Y4UA 3IGAC 1EN4A 3BPZA 5A9GA 2G38A 1XILA 1PP9H 1NTZH 2Q5ZA 4XDKA 3WG7B 5LYJA 2PYLA 4JZGA 2FKXA 3AK1A 3SR2C 4PDRA 5AG2A 5B1BC 2XAQA 4ICGA 3T4DA 3FD9A 2UXBB 2XAHA 4UCUA 1FJGO 1NVPB 2WLJA 3CEIA 2JIZG 4DK0A 4EB6A 4TV8B 2RMKB 4ZOLA 3CCEV 4ZKIA 3PJSK 4FFKA 1V55B 1K5SA 4JI2O 4QNHB 2WSSG 2Y4TA 4AQYO 2OYQA 1GMGA 2X6CA 1VQMV 4J10A 3FAVA 5KHJA 4NB5A 4FLUA 1AI4A 1V9PA 3SYCA 4H37A 1KKDA 3TXSA 3RYCA 4TT3G 4DV2O 1ZTEA 5LA6A 2IH3C 2YI8A 4YXWG 4FPPA 4DV6B 2EILB 1GTOA 3B09A 2RQ6A 4JYYA 3G71V 3T1CA 3VOUA 2P06A 2R72A 1EM1A 2F4VO 1AJQA 5HFMA 4JI5B 4YY3O 3BCCH 1NKDA 4OX9B 2A06H 1UJWB 2PI4A 4Z2WA 5LOVA 1XEQA 4X64O 4IYIA 4ASUG 4J41A 1O9GA 5GTHZ 2ZE5A 3WU2Z 5BMVA 3T2MA 2LGWA 2ZKOA 3SYQA 1FAFA 1DK1A 2R70A 2CTWA 5BY1A 4LF8O 3E8BA 4PA3A 3TJTA 3K03A 1AJNA 1Q5OA 2E3CA 1Z2GA 1JFFB 2Q7EA 1RFYA 3SDLA 3M99B 2PYJA 3K9SA 4FMTA 4NKGB 3B2EE 3ASOC 4DUYO 1OCRC 5J2UB 1ZUQA 4GX1A 1FD9A 3E8FA 4DR6B 2M6YA 4X88A 3E89A 3H1JH 2KG7A 4LP8A 3L9DA 1XNQB 2LGQA 1E1QG 1FXKB 1P84F 3OAAG 4QPKA 4JYAB 3K57A 4LF4O 3ZHRA 5IY5B 4LWSA 4I7ZB 4NXMB 2YUAA 4YIPA 4MW3A 4DR2O 3RVZA 4P2ZA 2DWEC 1TUBA 4AHCA 4LF7B 4J42A 4XDJA 1WB7A 3UT5A 2QE7G 4WFBV 5KMGB 1X4TA 2BSKB 4PV1B 2DYSC 2K1EA 1E1RG 5H2FZ 1K4CC 3SPIA 1IX9A 3RGBA 3VQYA 3FB7C 1Q7YW 1QBZA 4NXMO 1LR1A 4MVQA 1K8AW 2XNDG 4HNAA 4O4JB 3W7XA 4RUEA 4HZ3A 1XI1A 1M57B 2P4KA 3JASA 4DR7O 2OTJV 1EN5A 4C7UA 4UCVA 4CS3A 2WLNA 1GN2A 5B5EZ 1H2GA 1YCIA 4CH3A 3E8HA 1SRYA 1VQNV 5IYDO 4WBNA 5CA3A 1JA8A 3ZRWB 1OZ0A 4X20B 3ABMB 1SETA 2IU3A 2N05A 1BQZA 4CZZA 2JDIG 3ZHUA 5EIBC 4ZHQA 1XHXA 1OCRB 4GX2A 4EKWA 2JVDA 1M56C 4BW9A 2MK3A 3G80A 4JI8O 1Y66A 2YXHA 3LSQA 1B04A 1G6UA 1V54B 4ZHQB 2NNUA 2O57A 4DR4O 5B3SC 4X1IA 2LW7A 3SGIA 3T4ZA 5D5PA 3AG3C 4PI0A 4LF6O 1QR8A 4MVUA 2JK5C 2ZD9A 4WFHA 3SJBC 3P30A 2FTKA 5B1AB 4LF7O 3A2FA 2Q6AA 1WP8A 2W0FC 3B4SA 3BABA 1O9HA 3K0GA 3BHPA 3SPGA 4FFBB 4K35A 2WLHA 1VEWA 1HR0B 4NVPA 1Y76B 5JVDA 1OJHA 3Q4HB 2YIBA 3ETQA 1LUVA 2D3OW 1GN3A 1OHHG 3J80N 1TVKB 3CRRA 5LYJB 5IE9A 2XOKG 1RSOA 3TCUA 4JI3B 1VQ6V 5DM6V 4YY3B 2EJ7A 1WPXA 5IY5C 4RAIA 4I4TA 3KCXA 2RCVA 2GTSA 1AI5A 2XAJA 1EZVH 3F5WC 3E8GA 3CMAV 2Q0AA 2OTLV 4MTGA 4BIOA 5DECA 3HKBB 3A0RA 3CCSV 3ABUA 4DR5B 1SESA 4DV2B 1AILA 1P4RA 4JI7O 3OTOB 1WLEA 4DV7B 1KMIZ 3RWRD 4F6RB 2WLIA 2DWDC 4YJ3B 4X89A 1I0HA 1JQ0A 1VARA 4X1YB 1N33O 3K06A 1I94B 1MABG 3MHSC 1Y74B 2HJDA 3ZCCA 2JJ1G 1R3KC 1SS3A 2A79B 4PDLA 1YJ9V 5BXZA 4CH6A 1IBKB 4GUNA 4DO2A 1M1KW 1K97A 2YIBD 3ABLC 4RQFA 1AR5A 4X62O 4JAUA 1IBMB 2JEUA 3JD2A 4LF9B 3NXSA 3AG3B 1PPJH 4NTYA 2PY5A 1BL8A 1K7DA 3T1HB 1K3EA 4DV0O 4QGPA 1R3IC 4QIWF 2IM9A 3DGEA 1KUQA 3IAYA 1R6KA 2BOCC 3E22A 2ZNJA 4MTXA 2ZR3A 2AZ0A 1Q82W 1TGOA 2HEPA 5LHGA 3BVOA 2ZCEA 1KBHA 4JI3O 1G1XB 3UO2A 1URFA 1WNSA 3VQXA 4Z1VA 1IXBA 1FPOA 1SKVA 5GTIZ 3TXQA 3CCLV 4O2AA 4DR7B 4A5UB 1TA8A 4HYOA 5KA6A 5IWAB 1HP8A 3T1YB 3JD4A 3UO3A 4NXNO 4MVSA 3ZN1A 4BWAA 2FB5A 3OTFA 4DR4B 2F66C 4JAVA 4IT5A 2VWJA 2N04A 2P5OA 5DEDA 5EYPB 5KMGA 3N2GB 2P7TC 3OMNB 2Q4PA 4H44B 4BR6A 1H38A 4DUZB 1S5HC 4GLXA 1L0NH 3CX5F 4Z1MG 5CA1A 3BRCA 2HVJC 3JALB 1YVWA 1SQQH 1M9NA 2CTPA 3JAKA 4TUYA 3UQ8A 1GRJA 2QWOB 1SQFA 2ZQMA 3ASOB 4DV5O 5EC2C 1WJZA 1RM1C 2XAFA 1MSDA 2JGDA 4DV4B 3T1YO 3N2KB 1GM8A 2CE4A 4DR6O 4DV5B 1YDXA 3OD4A 4U7NA 3TGUH 4CS4A 4K8XA 3GWOA 2VQEB 4FVMA 4PDMA 2LO1A 1QVFU 3RBZA 2W6JG 4QJFB 1WA8A 3K5OA 2EULA 2UU9O 2UXDO 4UCSA 2IJIA 2A0LA 3B8NA 4FLWA 3FYIB 4DR3O 2QWPB 2QSAA 5LOVB 1SF9A 5GONB 5LHIA 3C3SA 4TQFA 4J9YB 4GX5A 5KX5A 3SYAA 3AG1B 3LNMB 2WLMA 3H9VA 3OGCC 2IJJA 3RFRA 4OPAA 1QU7A 2XUMA 4JASA 5CBHA 1VF6C 3MHHC 1ROPA 1BS3A 2A7WA 1YHQV 2QA4V 4JI0O 3IFXA 4I9QA 2ITDC 4JTDB 2QTSA 3W7WA 1VQKV 3APQA 4LF8B 3K59A 1NQTA 4DUYB 4DW0A 4DV0B 3ML0A 1WPBA 2KKWA 4LH6A 5C93A 1VMGA 4Q6GA 2ZM6B 2HFEC 1BHAA 1NS1A 2Q67A 1VP7A 3RT3C 4FLVA 4LR3A 4R6ZA 3CP1A 1V55C 3OT7A 4J7ZA 4DV3O 1GKFA 3RYHB 4I55B 4LNUA 3ZMUA 4DYLA 1MG1A 3HKDB 3RYIB 4TV8A 4ZOLB 5IYBO 1SQVH 5CBGA 2EINB 2DW4A 1Q86W 3LDDA 1NU1H 4LFCO 1PL4A 3A0HZ 3BA9A 4K8ZA 1NTMH 4CH5A 1R3LC 3TK1A 2DN9A 3EVKA 3LDCA 4PA4A 5D5QA 3R66A 3OUSA 1ORQC 3UT5B 3CRQA 3X2QB 1NT2B 2JS3A 5JJJB 2IH1C 1HW7A 3P32A 3VQVA 4DXWA 4LH7A 3CB2A 5JH7B 2QM7A 1Y67A 4PD4F 5LGNA 2K9PA 1FKAO 3SPHA 3ZRVA 3ZHSA 4I4TB 2B5UA 1FXKA 4FIPC 3FB5C 2RNBA 5CN0A 3K5NA 2R9RB 4KHPB 2EIMB 4XBFA 3ZHVA 3H1HH 3WB1A 4ZI7B 3BEHA 1XL4A 1WB8A 2UUAB 1Q43A 5LBQA 4JI2B 4KHPO 1HR0O 1QLEB 4IGGA 1TVKA 4TUYB 2JEXA 2EIKB 3BA8A 4DK1A 5BZBA 4RO2A 1N32B 3RYHA 1XUQA 2F23A 5L3FA 1BT8A 1I7FA 2E5LB 4OXSA 1PKXA 3UKMA 1IVSA 3EFFK 2XTAA 1F7YA 4HAMA 3HKEB 4YHHB 4CC5A 4L8JA 4FZ1A 2E76B 2ZINA 5GW7A 4B3MO 4XDLA 1S3JA 4B3SB 1AP6A 1D5AA 1AR1B 1QCEA 3WFVA 3QVNA 4O2BB 5JJNB 4DR3B 1P49A 4LF4B 4NR1A 3E83A 1SZXA 2RN9A 4UB8Z 3DC6A 2ILMA 3UCSC 4KFMA 1XHZA 5KUKA 2QR4A 5BR8O 2ZIMA 4B7EA 4JAAA 4DV4O 4FLXA 2LP7A 3SJQC 3FKSG 2WLKA 4JI4B 2GDSA 4EB6B 4J7KA 4I50A 1FXKC 2KQXA 3JAMN 5KX5B 1F4MA 3T1HO 4K3AA 1B3QA 1I5XA 3ETEA 4Q20A 4PA7A 3DSQA 2QWNB 3H1KH 2Q9LA 2EX3A 5FLXN 2L35A 3E35A 5FNVB 2B9ZA 1KC8W 1DLBA 4D7TA 1OCZC 3GB7C 2HVKC 3B8MA 2V7QG 4X1YA 3K3WA 4G2KA 4UFZA 2CUGA 5CA0A 2QKCA 1H2KA 2YI9A 4O4IA 3HKDA 3CE2A 1B6QA 1WA8B 4LWSB 3SJAC 4EEQA 1FS0G 3SYOA 4DUZO 1OCOC 1QQCA 1Q90D 3AG2C 2Q0OC 4FLTA 2GSMB 1S5LZ 3BAAA 1K9MW 3ABKC 3ZRXA 2Y69C 4I50B 3K9AA 2M7WA 2ZE7A 5CMUA 1PL0A 4ZI7A 5LP6C 2AGAA 3L72H 3JSNA 1KB9F 2E5LO 3TETA 4DV7O 5KHGA 4F4LA 2ZIOA 5H5NA 2AHYA 4MS2A 4PA9A 1GO3F 1N36B 4EFBA 2QWQB 1H8EG 1ZAUA 3JCZA 3FB8C 3ZN0A 2X0LA 1WP7A 4MTOA 3O65A 1FYJA 4N23A 2ZNIA 3DC5A 3FYEB 1IBMO 4LF5B 4LCUC 1VQ7V 4LFBO 1ZX3A 3SYPA 5LGUA 1MOFA 3MDSA 2GHYA 4LFBB 4JPRA 5F2VO 2LJ2A 5KAIZ 1NR1A 5EYPA 4BAYA 4E4EA 1FFXB 4O4LA 5KHKA 3ZHTA 4J80A 3OGIB 2Y0PA 4W4LA 2R9IA 2Q8VA 4LFAO 4I0XB 5CBFA 1EBOA 1CPYA 4B7KA 4UCTA 1R6TA 2OCCC 4O2AB 2Y69B 1SC5B 3H1LH 5EBLC 4RQEA 3E86A 1K34A 2CDYA 3D3IA 2HHHB 4L87A 1JR9A 2P67A 3ETDA 1I94O 4OPHA 3BFRA 1D5NA 1CP9A 4GKKB 2P90A 3CC2V 5KHHA 2EJRA 1SQXH 2AXTZ 1OCZB 1LUWA 3G6BA 4AQYB 4O4HA 4GKJO 2QWRB 3JATA 4UVCA 1JJ2U 3CWBH 1PNLA 3L75H 3X2QC 3GWKC 2H94A 5FPOA 3LDEA 4WF9V 1QLNA 3LNNA 2WPDG 5EBMC 3HKCB 4PDVA 3KCYA 2FYUH 3HB3B 2CTQA 2IU0A 2LFSA 3STZC 5E79Z 3JCUZ 3NR7A 1JPXA 1ZSPA 4GZRB 1Y6XA 2ADQB 2QEXV 2CH7B 4TQDA 4TSFG 2BSKA 1GN6A 3ASNB 5LGTA 3D36A 2UXBO 2QM8A 1US6A 1XMOB 3S3WA 2BTOA 1Q3EA 2CGOA 5KUMA 4JI0B 4I9WA 3CJHB 4F6RA 4JI6O 4JI1B 4YHHO 2X6BA 4MVRA 2DQ0A 3HKCA 1AROP 2VS0A 1JJOA 3VBBA 4AI8A 4KXRA 1THZA 3HKBA 3W7TA 4I5SA 1XNRO 2XASA 1FFTB 1XMQB 2PUSA 1XNQO 1VQOV 3OEEG 4MT8A 3P3PA 1S72V 1HNXO 4H13B 2YXYA 1J5EO 2LW1A 3CXHF 3OTOO 4JZ2A 4RUFA 1SQPH 1ENVA 1EFRG 3JYCA 1AI7A 5KAFZ 4TWKA 3RVYA 3RYFA 3THOA 4PHZA 3CMEV 1N36O 1VQ5V 5E1AC 3DXRB 4ZIBA 1M93A 2X7RB 2QTOA 3ETGA 4FLZA 2GUZB 1YEWA 2Z0AA 2YDEA 3ZJZA 4I0XA 5BMVB 2HR3A 3U10A 5LL6Y 1JX9A 4JGSA 3OE7G 3PN1A 4K0KB 1Z5VA 3LUTB 3RYIA 3ZS8C 1YJWV 1R6NA 3ZRSA 2GUZA 3IJ4A 1KECA 2ODMA 4G27B 1CXZB 3K5LA 4QE9A 1R73A 1H2LA 4YJ3A 5IWAO 1YIJV 1GK9A 4NYKA 2OT5A 1N4CA 4CH4A 1KP3A 4UB6Z 1GM7A 4DR1O 1G8MA 1XBLA 4FM0A 2ZT9B 3JARB 3K5MA 1SA0A 2EIKC 4DV1B 5L3DA 2ZXWB 2DMXA 4G28B 4BW5A 2YEVA 1V54C 2UXCB 4YJ2A 4JTCB 3HR0A 2VQFB 2YC0A 5IYZB 4MSWC 2ZM6O 5B66Z 1BMFG 4UVBA 2XHBA 3OR6C 1Y4MA 1X59A 2OIEA 4JI7B 1RSOB 1W0KG 3M7MX 1ZL8B 4O4IB 1RP3B 4X62B 1NI8A 4KL1A 2BCCH 5EC1C 4JV5O 3ZIAG 2A3QA 3KKYA 3N2GA 2UXXA 2GBOA 4U3FH 1IBKO 3A8TA 3OUFA 2W6IG 1Z5WA 1QLEC 3AK2A 2A9HA 4DR1B 1FXHA 3N27A 4X66O 2CH7A 1YXBA 3ZBHA 1BZKA 2Q7GA 4RWUA 4X9QA 2D2CB 1XNRB 3BY6A 4JI4O 4UVAA
chains in the Genus database with same CATH topology
4GKJO 4LF6O 1IBLO 2UUCO 5BXZA 1NS1A 5A2QN 4OX9O 2Z0AA 3RT3C 3T1YO 4JI2O 2AGAA 4DR6O 5LL6Y 1F7YA 4LF7O 4AQYO 2DJVA 5IT9N 2E5LO 4DV3O 4DV7O 1HNZO 5H5NA 4X62O 4B3MO 4DV6O 3J81N 1R1BA 4LF4O 5IWAO 4DV2O 3J7AU 2UUAO 3O65A 1FYJA 4LFCO 4DV0O 3J80N 4DR1O 4DR2O 1YZBA 2UUBO 1IBMO 2UXBO 1KUQA 4LF9O 2UU9O 4LFBO 2UXDO 1HNWO 3R66A 4DR3O 5BR8O 2F4VO 4JI6O 2N74A 4B3RO 4YHHO 5LMUO 4DV4O 4YY3O 2DOSA 4JI3O 1G1XB 4NXMO 3F5TA 4B3TO 1A32A 3JAMN 2ZM6O 1XMQO 4LFAO 1XEQA 4X64O 3T1HO 4LF5O 4K0KO 2JRIA 4JYAO 1FKAO 1X59A 4B3SO 1R6TA 4A5UB 5LMNO 1N32O 2ZKOA 4DR7O 5FLXN 2UXCO 1D2DA 1AILA 1XNRO 4OPAA 4NXNO 1DK1A 4JI5O 4JI7O 1XNQO 5BY1A 4LF8O 4JV5O 4JI0O 1HNXO 1IBKO 2VQFO 1I94O 4OPHA 3SDLA 1J5EO 2FKXA 3OTOO 2HHHO 4KHPO 4X65O 1HR0O 1N33O 4JI8O 1N34O 4DUYO 4X66O 4DUZO 3M8AA 4DV1O 1XMOO 4DR5O 4GKKO 4DR4O 1AB3A 2LW7A 4JI4O 4DV5O 1FJGO 2VQEO 1N36O 4JI1O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ O;  4LF6 O;  1IBL O;  2UUC O;  5BXZ A;  1NS1 A;  5A2Q N;  4OX9 O;  2Z0A A;  3RT3 C;  3T1Y O;  4JI2 O;  2AGA A;  4DR6 O;  5LL6 Y;  1F7Y A;  4LF7 O;  4AQY O;  2DJV A;  5IT9 N;  2E5L O;  4DV3 O;  4DV7 O;  1HNZ O;  5H5N A;  4X62 O;  4B3M O;  4DV6 O;  3J81 N;  1R1B A;  4LF4 O;  5IWA O;  4DV2 O;  3J7A U;  2UUA O;  3O65 A;  1FYJ A;  4LFC O;  4DV0 O;  3J80 N;  4DR1 O;  4DR2 O;  1YZB A;  2UUB O;  1IBM O;  2UXB O;  1KUQ A;  4LF9 O;  2UU9 O;  4LFB O;  2UXD O;  1HNW O;  3R66 A;  4DR3 O;  5BR8 O;  2F4V O;  4JI6 O;  2N74 A;  4B3R O;  4YHH O;  5LMU O;  4DV4 O;  4YY3 O;  2DOS A;  4JI3 O;  1G1X B;  4NXM O;  3F5T A;  4B3T O;  1A32 A;  3JAM N;  2ZM6 O;  1XMQ O;  4LFA O;  1XEQ A;  4X64 O;  3T1H O;  4LF5 O;  4K0K O;  2JRI A;  4JYA O;  1FKA O;  1X59 A;  4B3S O;  1R6T A;  4A5U B;  5LMN O;  1N32 O;  2ZKO A;  4DR7 O;  5FLX N;  2UXC O;  1D2D A;  1AIL A;  1XNR O;  4OPA A;  4NXN O;  1DK1 A;  4JI5 O;  4JI7 O;  1XNQ O;  5BY1 A;  4LF8 O;  4JV5 O;  4JI0 O;  1HNX O;  1IBK O;  2VQF O;  1I94 O;  4OPH A;  3SDL A;  1J5E O;  2FKX A;  3OTO O;  2HHH O;  4KHP O;  4X65 O;  1HR0 O;  1N33 O;  4JI8 O;  1N34 O;  4DUY O;  4X66 O;  4DUZ O;  3M8A A;  4DV1 O;  1XMO O;  4DR5 O;  4GKK O;  4DR4 O;  1AB3 A;  2LW7 A;  4JI4 O;  4DV5 O;  1FJG O;  2VQE O;  1N36 O;  4JI1 O; 
#chains in the Genus database with same CATH topology
 4IIJ A;  4DRX A;  3ASN C;  4KP4 A;  1M90 W;  2E75 B;  3CC7 V;  5A2Q N;  3JAW B;  4UCO A;  2XAG A;  2HJF C;  1J5E B;  3B77 A;  3E22 B;  2EBO A;  1AR4 A;  4JYB A;  2UXD B;  2Z5U A;  4FJC C;  1KQS U;  2H8P C;  5LP6 A;  4DV6 O;  1FJG B;  5H6Q A;  1K92 A;  1DGS A;  3J81 N;  2YEV B;  4QPJ A;  1NBM G;  3J7A U;  3EHB B;  2WWW A;  1VIB A;  4HBN A;  3I56 V;  2WA4 A;  4AIL C;  2ZXW C;  4U3J B;  3QO7 A;  2ZR2 A;  2UUB O;  2ADP A;  1KP2 A;  5J2T A;  3SPC A;  2UU9 B;  3VQW A;  3MAQ A;  4B3R O;  2ARH A;  3APO A;  4X1K A;  4JI6 B;  2WLL B;  2EIM C;  3QG5 A;  4QE7 A;  3G6E V;  1FXV A;  3KZI Z;  4JTA B;  2WLL A;  3ABT A;  3K04 A;  2B1G A;  1NVP D;  5BR8 B;  5KHI A;  3AG4 B;  2YXL A;  1BQ0 A;  5LMN O;  4J7J A;  4ZBM A;  3K79 A;  1PNK A;  4O4L B;  1TUE B;  4MW8 A;  3AG1 C;  5K1X A;  1SQG A;  3K0D A;  2OWO A;  2QM4 A;  2ATK C;  5J2T B;  2IJK A;  1RPR A;  3IC7 A;  4R7C A;  2FML A;  4LBE C;  1F51 A;  2HHH O;  5IJ9 A;  4X65 O;  1HNW B;  4TV9 A;  3G4S V;  2NLJ C;  1VQ4 V;  1M4U A;  5LXT B;  1ZWI C;  2EZP A;  4PA6 A;  5LP6 B;  2P4V A;  5EK0 A;  3AG7 A;  1IZ3 A;  1UFI A;  4X64 B;  5LMN B;  3DTU B;  1WN7 A;  5JH7 A;  2OCC B;  1CEZ A;  4OX9 O;  5EZY A;  3ZHQ A;  4NTX A;  3RYC B;  1F23 A;  1NR7 A;  5EIB D;  1HNZ O;  1QNM A;  4MVO A;  1K5Q A;  2YS8 A;  3HKE A;  2QKS A;  5JCO A;  3K58 A;  2EIN C;  4R8C A;  1U96 A;  3CPW U;  3CS5 A;  4LF9 O;  5K1P A;  2QKA A;  2W0X A;  5L3C A;  4JYC A;  2Z3Y A;  3ABM C;  2ZDI C;  3OR7 C;  1N0J A;  1RPO A;  3CCJ V;  4H33 A;  4P9O A;  1UPG A;  5IYZ A;  2WLI B;  3ZX6 A;  3L73 H;  4GT1 A;  4J11 A;  2AZ2 A;  1BHB A;  4LF5 O;  2C2A A;  4W4K A;  2UUB B;  5H6R A;  2KG7 B;  4LFA B;  1S0V A;  4FZ0 A;  5FL7 G;  1MMM A;  2UXC O;  1OCC B;  5IJ9 B;  2Q73 A;  3JAR A;  4EFE A;  4FM1 A;  3JD3 A;  4WCE V;  1K4D C;  1IXM A;  5LXT A;  2VWK A;  1AP5 A;  4FM2 A;  1W2B U;  4YJ2 B;  2YID A;  1I08 A;  1GH6 A;  1M56 B;  3CRM A;  2VQF O;  2LQT A;  3OEH G;  3C3T A;  1PV0 A;  2YSU B;  3QO8 A;  4NTW A;  1IBL B;  1NJI W;  5IDJ A;  4JV5 B;  3W7S A;  1JOY A;  2F4V B;  2Y48 A;  4U7O A;  4IL6 Z;  1W0J G;  4DV1 O;  4DR5 O;  1T5E A;  3JAK B;  3CHX A;  4HNA B;  4O4J A;  2MW2 B;  2VQE O;  3ZMS A;  3FX7 A;  1EZJ A;  1VQ8 V;  2UUC O;  4X66 B;  5LMU B;  3K08 A;  2UUC B;  3LSU A;  1BSM A;  4CS2 A;  1Y74 A;  3FB6 C;  4GCZ A;  3AG4 C;  3JD0 A;  5JCO C;  5DN6 G;  2QDO A;  1MZF A;  2JS5 A;  3L74 H;  4IYH A;  4UV8 A;  3I55 V;  1NH2 B;  1AI6 A;  5FPR A;  1L8D A;  2X6A A;  2AHZ A;  1N34 B;  1PNM A;  1KU9 A;  1YZB A;  2F93 B;  2GV9 A;  2NN4 A;  1DTO A;  2PGG A;  2F95 B;  3CXC U;  1I5Y A;  3WG7 C;  1BE3 H;  2YIA A;  2N74 A;  2PI5 A;  3L71 H;  3N2K A;  4MVZ A;  1MZE A;  1KKC A;  1YI2 V;  4IIJ B;  4DRX B;  5LA6 B;  1P7G A;  4LF6 B;  1XMQ O;  3JAW A;  3CCU V;  4WBN B;  3QNE A;  2EZO A;  1XL6 A;  4B3S O;  4CBC A;  2Q7H A;  1WAZ A;  3FFQ A;  3CCV V;  3H01 A;  4D7S A;  4JI5 O;  5B1O A;  5L3B A;  1JFF A;  3D8C A;  4X8A A;  4F6E A;  3Q4H A;  3CJH A;  1H2N A;  2ZE6 A;  4IHJ B;  1LNQ A;  3CC4 V;  5CA0 B;  4FLY A;  1IUR A;  3ICX A;  4I55 A;  4LNU B;  3JD1 A;  1XMO O;  1MSW D;  5ITZ A;  2VRZ A;  1OCO B;  4YIO A;  1OV9 A;  1TUB B;  2BTQ B;  4WFA V;  3CCM V;  2Y0I A;  4UXN A;  1DF5 A;  3AEI A;  5JWP A;  1SQB H;  2QJ1 A;  2P6J A;  4TOI A;  1VQP V;  4GKJ B;  3ABL B;  3JSL A;  2GTA A;  2Q68 A;  1VQ9 V;  3JAT B;  3ZMZ A;  2CGN A;  2DQ3 A;  3D36 C;  1L0L H;  3STL C;  4X65 B;  1PM9 A;  3WB2 A;  4TV9 B;  1YF2 A;  1NTK H;  1Q6I A;  2DYR C;  3QO5 A;  2ITC C;  2RJZ A;  3AK3 A;  2V4D A;  2JJ2 G;  4MTF A;  3CRC A;  3D3Q A;  2P22 C;  5L3G A;  4WFF A;  1HNW O;  2PF4 E;  1S77 D;  4JI8 B;  4DR2 B;  4CC6 A;  1S76 D;  4WFE A;  5IYC O;  4FK5 C;  2B1I A;  4LFC B;  1BGY H;  3F5T A;  4LC1 A;  1A32 A;  1Q6H A;  2JRI A;  1JCH A;  4JYA O;  5JQG A;  1COW G;  3ZED A;  5LHH A;  2BE3 A;  3GVM A;  1J95 A;  2CK3 G;  5TIS Z;  5GON A;  1D2D A;  1EN6 A;  3HPL C;  3KG2 A;  4DV3 B;  4H0L B;  3RYF B;  3WB0 A;  1M57 C;  3RN4 A;  1W59 A;  4B08 A;  3CSX A;  4UUJ C;  5B3S B;  2AW9 A;  1GN4 A;  4P30 A;  2Q69 A;  1VF6 A;  3DXR A;  1N34 O;  2H3O A;  4X1I B;  1QVG U;  3M8A A;  1MA1 A;  3EXA A;  4GKK O;  1NZ6 A;  1DF4 A;  2E74 B;  2JGU A;  1PD3 A;  5KLV H;  1RM1 B;  1IBL O;  3ZMV A;  1GAX A;  2NR5 A;  3B40 A;  3O9O A;  3LSS A;  2JGD B;  1XRE A;  4NXN B;  1XQ8 A;  2DJV A;  5IT9 N;  4PI2 A;  1B06 A;  2BTQ A;  1U97 A;  3CRA A;  3FAV B;  1G4Y B;  5CA1 B;  3CD6 V;  1R3J C;  2IJH A;  4PEL A;  1R1B A;  2LFR A;  3JAL A;  1Q6U A;  3UM7 A;  1Y76 A;  2BOB C;  5JVD B;  5H9C A;  4FFB A;  3U11 A;  1S5J A;  5FNV A;  1SZT A;  1NH2 D;  5IJ0 A;  5L3E A;  3MD0 A;  1XOU A;  1H2S B;  5KA5 A;  2IBZ H;  4IHJ A;  3OW2 U;  5ITZ B;  2CAZ C;  3SPJ A;  1QHT A;  4BIU A;  3W7U A;  1QR9 A;  5LMU O;  4BIZ A;  2ZE8 A;  3ABK B;  2DYR B;  3P3N A;  1ZL8 A;  1AJP A;  4B3T O;  1MNG A;  1N0N A;  4UV9 A;  1Q8I A;  1M5I A;  5EZY B;  1HWY A;  4K0K O;  4J9Z B;  1P7B A;  1H8H G;  1VQL V;  3OMI B;  3OMA B;  2EIL C;  3C90 A;  3CYO A;  1VF7 A;  2V1D A;  2EIJ C;  4DW1 A;  3F7V C;  4WFG A;  5C8Y B;  4MVM A;  1HNX B;  4O2B A;  3SJC C;  3F7Y C;  1SER A;  2DE0 X;  1JVM A;  5EBW C;  5B1N A;  4O4H B;  4N21 A;  1SA0 B;  2R9A A;  2FL4 A;  2KB1 A;  4X20 A;  3ZRW A;  4B3M B;  3QTC A;  1N33 B;  1YTF D;  1AB3 A;  2ZDI A;  4JF3 A;  2OIG A;  5JJE B;  3U0Z A;  4ABM A;  4GYC B;  4JI1 O;  1YSC A;  1F4N A;  1K73 W;  2PTM A;  1OCC C;  4R50 A;  1K33 A;  3R65 A;  2YIC A;  4PJ0 Z;  1JMK C;  5JQG B;  1KD1 W;  1FFX A;  2UXN A;  5B1A C;  3A0B Z;  3OM3 B;  2XT9 A;  2KSD A;  2PZS A;  2CTR A;  4OGQ B;  5IJ0 B;  3OFN G;  4E2L A;  4X1K B;  4KUM A;  1YTF B;  1Q81 W;  3IC9 A;  1E79 G;  3ZMT A;  2UUA O;  2WAM A;  1H2M A;  4UCR A;  4D6T H;  1XDC A;  2WA3 A;  1VF5 B;  2F1M A;  1HNZ B;  3AG2 B;  1HDJ A;  5B1B B;  1TAE A;  3I5D A;  3CCR V;  4B3T B;  1N8R W;  5CB4 A;  1BCC H;  2DOS A;  4P9P A;  4GX0 A;  2HLD G;  4U3J A;  1IDS A;  1GM9 A;  3CCQ V;  5CB4 B;  3G67 A;  1ZLZ A;  3QF7 A;  2RDC A;  3S3X A;  2OCH A;  1YJN V;  2QGN A;  5C8Y A;  2ETN A;  3RW0 A;  5J2U A;  2EIJ B;  1N32 O;  1AVM A;  3L70 H;  2HP8 A;  2F43 G;  2HG5 C;  2HKO A;  3JAS B;  5HFL A;  3H1I H;  2L6L A;  5J9P C;  3E2E A;  1L1F A;  1KYO F;  2IW5 A;  2DYS B;  4B3R B;  1YIT V;  2Y4U A;  3IGA C;  1EN4 A;  3BPZ A;  5A9G A;  2G38 A;  1XIL A;  1PP9 H;  1NTZ H;  2Q5Z A;  4XDK A;  3WG7 B;  5LYJ A;  2PYL A;  4JZG A;  2FKX A;  3AK1 A;  3SR2 C;  4PDR A;  5AG2 A;  5B1B C;  2XAQ A;  4ICG A;  3T4D A;  3FD9 A;  2UXB B;  2XAH A;  4UCU A;  1FJG O;  1NVP B;  2WLJ A;  3CEI A;  2JIZ G;  4DK0 A;  4EB6 A;  4TV8 B;  2RMK B;  4ZOL A;  3CCE V;  4ZKI A;  3PJS K;  4FFK A;  1V55 B;  1K5S A;  4JI2 O;  4QNH B;  2WSS G;  2Y4T A;  4AQY O;  2OYQ A;  1GMG A;  2X6C A;  1VQM V;  4J10 A;  3FAV A;  5KHJ A;  4NB5 A;  4FLU A;  1AI4 A;  1V9P A;  3SYC A;  4H37 A;  1KKD A;  3TXS A;  3RYC A;  4TT3 G;  4DV2 O;  1ZTE A;  5LA6 A;  2IH3 C;  2YI8 A;  4YXW G;  4FPP A;  4DV6 B;  2EIL B;  1GTO A;  3B09 A;  2RQ6 A;  4JYY A;  3G71 V;  3T1C A;  3VOU A;  2P06 A;  2R72 A;  1EM1 A;  2F4V O;  1AJQ A;  5HFM A;  4JI5 B;  4YY3 O;  3BCC H;  1NKD A;  4OX9 B;  2A06 H;  1UJW B;  2PI4 A;  4Z2W A;  5LOV A;  1XEQ A;  4X64 O;  4IYI A;  4ASU G;  4J41 A;  1O9G A;  5GTH Z;  2ZE5 A;  3WU2 Z;  5BMV A;  3T2M A;  2LGW A;  2ZKO A;  3SYQ A;  1FAF A;  1DK1 A;  2R70 A;  2CTW A;  5BY1 A;  4LF8 O;  3E8B A;  4PA3 A;  3TJT A;  3K03 A;  1AJN A;  1Q5O A;  2E3C A;  1Z2G A;  1JFF B;  2Q7E A;  1RFY A;  3SDL A;  3M99 B;  2PYJ A;  3K9S A;  4FMT A;  4NKG B;  3B2E E;  3ASO C;  4DUY O;  1OCR C;  5J2U B;  1ZUQ A;  4GX1 A;  1FD9 A;  3E8F A;  4DR6 B;  2M6Y A;  4X88 A;  3E89 A;  3H1J H;  2KG7 A;  4LP8 A;  3L9D A;  1XNQ B;  2LGQ A;  1E1Q G;  1FXK B;  1P84 F;  3OAA G;  4QPK A;  4JYA B;  3K57 A;  4LF4 O;  3ZHR A;  5IY5 B;  4LWS A;  4I7Z B;  4NXM B;  2YUA A;  4YIP A;  4MW3 A;  4DR2 O;  3RVZ A;  4P2Z A;  2DWE C;  1TUB A;  4AHC A;  4LF7 B;  4J42 A;  4XDJ A;  1WB7 A;  3UT5 A;  2QE7 G;  4WFB V;  5KMG B;  1X4T A;  2BSK B;  4PV1 B;  2DYS C;  2K1E A;  1E1R G;  5H2F Z;  1K4C C;  3SPI A;  1IX9 A;  3RGB A;  3VQY A;  3FB7 C;  1Q7Y W;  1QBZ A;  4NXM O;  1LR1 A;  4MVQ A;  1K8A W;  2XND G;  4HNA A;  4O4J B;  3W7X A;  4RUE A;  4HZ3 A;  1XI1 A;  1M57 B;  2P4K A;  3JAS A;  4DR7 O;  2OTJ V;  1EN5 A;  4C7U A;  4UCV A;  4CS3 A;  2WLN A;  1GN2 A;  5B5E Z;  1H2G A;  1YCI A;  4CH3 A;  3E8H A;  1SRY A;  1VQN V;  5IYD O;  4WBN A;  5CA3 A;  1JA8 A;  3ZRW B;  1OZ0 A;  4X20 B;  3ABM B;  1SET A;  2IU3 A;  2N05 A;  1BQZ A;  4CZZ A;  2JDI G;  3ZHU A;  5EIB C;  4ZHQ A;  1XHX A;  1OCR B;  4GX2 A;  4EKW A;  2JVD A;  1M56 C;  4BW9 A;  2MK3 A;  3G80 A;  4JI8 O;  1Y66 A;  2YXH A;  3LSQ A;  1B04 A;  1G6U A;  1V54 B;  4ZHQ B;  2NNU A;  2O57 A;  4DR4 O;  5B3S C;  4X1I A;  2LW7 A;  3SGI A;  3T4Z A;  5D5P A;  3AG3 C;  4PI0 A;  4LF6 O;  1QR8 A;  4MVU A;  2JK5 C;  2ZD9 A;  4WFH A;  3SJB C;  3P30 A;  2FTK A;  5B1A B;  4LF7 O;  3A2F A;  2Q6A A;  1WP8 A;  2W0F C;  3B4S A;  3BAB A;  1O9H A;  3K0G A;  3BHP A;  3SPG A;  4FFB B;  4K35 A;  2WLH A;  1VEW A;  1HR0 B;  4NVP A;  1Y76 B;  5JVD A;  1OJH A;  3Q4H B;  2YIB A;  3ETQ A;  1LUV A;  2D3O W;  1GN3 A;  1OHH G;  3J80 N;  1TVK B;  3CRR A;  5LYJ B;  5IE9 A;  2XOK G;  1RSO A;  3TCU A;  4JI3 B;  1VQ6 V;  5DM6 V;  4YY3 B;  2EJ7 A;  1WPX A;  5IY5 C;  4RAI A;  4I4T A;  3KCX A;  2RCV A;  2GTS A;  1AI5 A;  2XAJ A;  1EZV H;  3F5W C;  3E8G A;  3CMA V;  2Q0A A;  2OTL V;  4MTG A;  4BIO A;  5DEC A;  3HKB B;  3A0R A;  3CCS V;  3ABU A;  4DR5 B;  1SES A;  4DV2 B;  1AIL A;  1P4R A;  4JI7 O;  3OTO B;  1WLE A;  4DV7 B;  1KMI Z;  3RWR D;  4F6R B;  2WLI A;  2DWD C;  4YJ3 B;  4X89 A;  1I0H A;  1JQ0 A;  1VAR A;  4X1Y B;  1N33 O;  3K06 A;  1I94 B;  1MAB G;  3MHS C;  1Y74 B;  2HJD A;  3ZCC A;  2JJ1 G;  1R3K C;  1SS3 A;  2A79 B;  4PDL A;  1YJ9 V;  5BXZ A;  4CH6 A;  1IBK B;  4GUN A;  4DO2 A;  1M1K W;  1K97 A;  2YIB D;  3ABL C;  4RQF A;  1AR5 A;  4X62 O;  4JAU A;  1IBM B;  2JEU A;  3JD2 A;  4LF9 B;  3NXS A;  3AG3 B;  1PPJ H;  4NTY A;  2PY5 A;  1BL8 A;  1K7D A;  3T1H B;  1K3E A;  4DV0 O;  4QGP A;  1R3I C;  4QIW F;  2IM9 A;  3DGE A;  1KUQ A;  3IAY A;  1R6K A;  2BOC C;  3E22 A;  2ZNJ A;  4MTX A;  2ZR3 A;  2AZ0 A;  1Q82 W;  1TGO A;  2HEP A;  5LHG A;  3BVO A;  2ZCE A;  1KBH A;  4JI3 O;  1G1X B;  3UO2 A;  1URF A;  1WNS A;  3VQX A;  4Z1V A;  1IXB A;  1FPO A;  1SKV A;  5GTI Z;  3TXQ A;  3CCL V;  4O2A A;  4DR7 B;  4A5U B;  1TA8 A;  4HYO A;  5KA6 A;  5IWA B;  1HP8 A;  3T1Y B;  3JD4 A;  3UO3 A;  4NXN O;  4MVS A;  3ZN1 A;  4BWA A;  2FB5 A;  3OTF A;  4DR4 B;  2F66 C;  4JAV A;  4IT5 A;  2VWJ A;  2N04 A;  2P5O A;  5DED A;  5EYP B;  5KMG A;  3N2G B;  2P7T C;  3OMN B;  2Q4P A;  4H44 B;  4BR6 A;  1H38 A;  4DUZ B;  1S5H C;  4GLX A;  1L0N H;  3CX5 F;  4Z1M G;  5CA1 A;  3BRC A;  2HVJ C;  3JAL B;  1YVW A;  1SQQ H;  1M9N A;  2CTP A;  3JAK A;  4TUY A;  3UQ8 A;  1GRJ A;  2QWO B;  1SQF A;  2ZQM A;  3ASO B;  4DV5 O;  5EC2 C;  1WJZ A;  1RM1 C;  2XAF A;  1MSD A;  2JGD A;  4DV4 B;  3T1Y O;  3N2K B;  1GM8 A;  2CE4 A;  4DR6 O;  4DV5 B;  1YDX A;  3OD4 A;  4U7N A;  3TGU H;  4CS4 A;  4K8X A;  3GWO A;  2VQE B;  4FVM A;  4PDM A;  2LO1 A;  1QVF U;  3RBZ A;  2W6J G;  4QJF B;  1WA8 A;  3K5O A;  2EUL A;  2UU9 O;  2UXD O;  4UCS A;  2IJI A;  2A0L A;  3B8N A;  4FLW A;  3FYI B;  4DR3 O;  2QWP B;  2QSA A;  5LOV B;  1SF9 A;  5GON B;  5LHI A;  3C3S A;  4TQF A;  4J9Y B;  4GX5 A;  5KX5 A;  3SYA A;  3AG1 B;  3LNM B;  2WLM A;  3H9V A;  3OGC C;  2IJJ A;  3RFR A;  4OPA A;  1QU7 A;  2XUM A;  4JAS A;  5CBH A;  1VF6 C;  3MHH C;  1ROP A;  1BS3 A;  2A7W A;  1YHQ V;  2QA4 V;  4JI0 O;  3IFX A;  4I9Q A;  2ITD C;  4JTD B;  2QTS A;  3W7W A;  1VQK V;  3APQ A;  4LF8 B;  3K59 A;  1NQT A;  4DUY B;  4DW0 A;  4DV0 B;  3ML0 A;  1WPB A;  2KKW A;  4LH6 A;  5C93 A;  1VMG A;  4Q6G A;  2ZM6 B;  2HFE C;  1BHA A;  1NS1 A;  2Q67 A;  1VP7 A;  3RT3 C;  4FLV A;  4LR3 A;  4R6Z A;  3CP1 A;  1V55 C;  3OT7 A;  4J7Z A;  4DV3 O;  1GKF A;  3RYH B;  4I55 B;  4LNU A;  3ZMU A;  4DYL A;  1MG1 A;  3HKD B;  3RYI B;  4TV8 A;  4ZOL B;  5IYB O;  1SQV H;  5CBG A;  2EIN B;  2DW4 A;  1Q86 W;  3LDD A;  1NU1 H;  4LFC O;  1PL4 A;  3A0H Z;  3BA9 A;  4K8Z A;  1NTM H;  4CH5 A;  1R3L C;  3TK1 A;  2DN9 A;  3EVK A;  3LDC A;  4PA4 A;  5D5Q A;  3R66 A;  3OUS A;  1ORQ C;  3UT5 B;  3CRQ A;  3X2Q B;  1NT2 B;  2JS3 A;  5JJJ B;  2IH1 C;  1HW7 A;  3P32 A;  3VQV A;  4DXW A;  4LH7 A;  3CB2 A;  5JH7 B;  2QM7 A;  1Y67 A;  4PD4 F;  5LGN A;  2K9P A;  1FKA O;  3SPH A;  3ZRV A;  3ZHS A;  4I4T B;  2B5U A;  1FXK A;  4FIP C;  3FB5 C;  2RNB A;  5CN0 A;  3K5N A;  2R9R B;  4KHP B;  2EIM B;  4XBF A;  3ZHV A;  3H1H H;  3WB1 A;  4ZI7 B;  3BEH A;  1XL4 A;  1WB8 A;  2UUA B;  1Q43 A;  5LBQ A;  4JI2 B;  4KHP O;  1HR0 O;  1QLE B;  4IGG A;  1TVK A;  4TUY B;  2JEX A;  2EIK B;  3BA8 A;  4DK1 A;  5BZB A;  4RO2 A;  1N32 B;  3RYH A;  1XUQ A;  2F23 A;  5L3F A;  1BT8 A;  1I7F A;  2E5L B;  4OXS A;  1PKX A;  3UKM A;  1IVS A;  3EFF K;  2XTA A;  1F7Y A;  4HAM A;  3HKE B;  4YHH B;  4CC5 A;  4L8J A;  4FZ1 A;  2E76 B;  2ZIN A;  5GW7 A;  4B3M O;  4XDL A;  1S3J A;  4B3S B;  1AP6 A;  1D5A A;  1AR1 B;  1QCE A;  3WFV A;  3QVN A;  4O2B B;  5JJN B;  4DR3 B;  1P49 A;  4LF4 B;  4NR1 A;  3E83 A;  1SZX A;  2RN9 A;  4UB8 Z;  3DC6 A;  2ILM A;  3UCS C;  4KFM A;  1XHZ A;  5KUK A;  2QR4 A;  5BR8 O;  2ZIM A;  4B7E A;  4JAA A;  4DV4 O;  4FLX A;  2LP7 A;  3SJQ C;  3FKS G;  2WLK A;  4JI4 B;  2GDS A;  4EB6 B;  4J7K A;  4I50 A;  1FXK C;  2KQX A;  3JAM N;  5KX5 B;  1F4M A;  3T1H O;  4K3A A;  1B3Q A;  1I5X A;  3ETE A;  4Q20 A;  4PA7 A;  3DSQ A;  2QWN B;  3H1K H;  2Q9L A;  2EX3 A;  5FLX N;  2L35 A;  3E35 A;  5FNV B;  2B9Z A;  1KC8 W;  1DLB A;  4D7T A;  1OCZ C;  3GB7 C;  2HVK C;  3B8M A;  2V7Q G;  4X1Y A;  3K3W A;  4G2K A;  4UFZ A;  2CUG A;  5CA0 A;  2QKC A;  1H2K A;  2YI9 A;  4O4I A;  3HKD A;  3CE2 A;  1B6Q A;  1WA8 B;  4LWS B;  3SJA C;  4EEQ A;  1FS0 G;  3SYO A;  4DUZ O;  1OCO C;  1QQC A;  1Q90 D;  3AG2 C;  2Q0O C;  4FLT A;  2GSM B;  1S5L Z;  3BAA A;  1K9M W;  3ABK C;  3ZRX A;  2Y69 C;  4I50 B;  3K9A A;  2M7W A;  2ZE7 A;  5CMU A;  1PL0 A;  4ZI7 A;  5LP6 C;  2AGA A;  3L72 H;  3JSN A;  1KB9 F;  2E5L O;  3TET A;  4DV7 O;  5KHG A;  4F4L A;  2ZIO A;  5H5N A;  2AHY A;  4MS2 A;  4PA9 A;  1GO3 F;  1N36 B;  4EFB A;  2QWQ B;  1H8E G;  1ZAU A;  3JCZ A;  3FB8 C;  3ZN0 A;  2X0L A;  1WP7 A;  4MTO A;  3O65 A;  1FYJ A;  4N23 A;  2ZNI A;  3DC5 A;  3FYE B;  1IBM O;  4LF5 B;  4LCU C;  1VQ7 V;  4LFB O;  1ZX3 A;  3SYP A;  5LGU A;  1MOF A;  3MDS A;  2GHY A;  4LFB B;  4JPR A;  5F2V O;  2LJ2 A;  5KAI Z;  1NR1 A;  5EYP A;  4BAY A;  4E4E A;  1FFX B;  4O4L A;  5KHK A;  3ZHT A;  4J80 A;  3OGI B;  2Y0P A;  4W4L A;  2R9I A;  2Q8V A;  4LFA O;  4I0X B;  5CBF A;  1EBO A;  1CPY A;  4B7K A;  4UCT A;  1R6T A;  2OCC C;  4O2A B;  2Y69 B;  1SC5 B;  3H1L H;  5EBL C;  4RQE A;  3E86 A;  1K34 A;  2CDY A;  3D3I A;  2HHH B;  4L87 A;  1JR9 A;  2P67 A;  3ETD A;  1I94 O;  4OPH A;  3BFR A;  1D5N A;  1CP9 A;  4GKK B;  2P90 A;  3CC2 V;  5KHH A;  2EJR A;  1SQX H;  2AXT Z;  1OCZ B;  1LUW A;  3G6B A;  4AQY B;  4O4H A;  4GKJ O;  2QWR B;  3JAT A;  4UVC A;  1JJ2 U;  3CWB H;  1PNL A;  3L75 H;  3X2Q C;  3GWK C;  2H94 A;  5FPO A;  3LDE A;  4WF9 V;  1QLN A;  3LNN A;  2WPD G;  5EBM C;  3HKC B;  4PDV A;  3KCY A;  2FYU H;  3HB3 B;  2CTQ A;  2IU0 A;  2LFS A;  3STZ C;  5E79 Z;  3JCU Z;  3NR7 A;  1JPX A;  1ZSP A;  4GZR B;  1Y6X A;  2ADQ B;  2QEX V;  2CH7 B;  4TQD A;  4TSF G;  2BSK A;  1GN6 A;  3ASN B;  5LGT A;  3D36 A;  2UXB O;  2QM8 A;  1US6 A;  1XMO B;  3S3W A;  2BTO A;  1Q3E A;  2CGO A;  5KUM A;  4JI0 B;  4I9W A;  3CJH B;  4F6R A;  4JI6 O;  4JI1 B;  4YHH O;  2X6B A;  4MVR A;  2DQ0 A;  3HKC A;  1ARO P;  2VS0 A;  1JJO A;  3VBB A;  4AI8 A;  4KXR A;  1THZ A;  3HKB A;  3W7T A;  4I5S A;  1XNR O;  2XAS A;  1FFT B;  1XMQ B;  2PUS A;  1XNQ O;  1VQO V;  3OEE G;  4MT8 A;  3P3P A;  1S72 V;  1HNX O;  4H13 B;  2YXY A;  1J5E O;  2LW1 A;  3CXH F;  3OTO O;  4JZ2 A;  4RUF A;  1SQP H;  1ENV A;  1EFR G;  3JYC A;  1AI7 A;  5KAF Z;  4TWK A;  3RVY A;  3RYF A;  3THO A;  4PHZ A;  3CME V;  1N36 O;  1VQ5 V;  5E1A C;  3DXR B;  4ZIB A;  1M93 A;  2X7R B;  2QTO A;  3ETG A;  4FLZ A;  2GUZ B;  1YEW A;  2Z0A A;  2YDE A;  3ZJZ A;  4I0X A;  5BMV B;  2HR3 A;  3U10 A;  5LL6 Y;  1JX9 A;  4JGS A;  3OE7 G;  3PN1 A;  4K0K B;  1Z5V A;  3LUT B;  3RYI A;  3ZS8 C;  1YJW V;  1R6N A;  3ZRS A;  2GUZ A;  3IJ4 A;  1KEC A;  2ODM A;  4G27 B;  1CXZ B;  3K5L A;  4QE9 A;  1R73 A;  1H2L A;  4YJ3 A;  5IWA O;  1YIJ V;  1GK9 A;  4NYK A;  2OT5 A;  1N4C A;  4CH4 A;  1KP3 A;  4UB6 Z;  1GM7 A;  4DR1 O;  1G8M A;  1XBL A;  4FM0 A;  2ZT9 B;  3JAR B;  3K5M A;  1SA0 A;  2EIK C;  4DV1 B;  5L3D A;  2ZXW B;  2DMX A;  4G28 B;  4BW5 A;  2YEV A;  1V54 C;  2UXC B;  4YJ2 A;  4JTC B;  3HR0 A;  2VQF B;  2YC0 A;  5IYZ B;  4MSW C;  2ZM6 O;  5B66 Z;  1BMF G;  4UVB A;  2XHB A;  3OR6 C;  1Y4M A;  1X59 A;  2OIE A;  4JI7 B;  1RSO B;  1W0K G;  3M7M X;  1ZL8 B;  4O4I B;  1RP3 B;  4X62 B;  1NI8 A;  4KL1 A;  2BCC H;  5EC1 C;  4JV5 O;  3ZIA G;  2A3Q A;  3KKY A;  3N2G A;  2UXX A;  2GBO A;  4U3F H;  1IBK O;  3A8T A;  3OUF A;  2W6I G;  1Z5W A;  1QLE C;  3AK2 A;  2A9H A;  4DR1 B;  1FXH A;  3N27 A;  4X66 O;  2CH7 A;  1YXB A;  3ZBH A;  1BZK A;  2Q7G A;  4RWU A;  4X9Q A;  2D2C B;  1XNR B;  3BY6 A;  4JI4 O;  4UVA A; 
#chains in the Genus database with same CATH homology
 4GKJ O;  4LF6 O;  1IBL O;  2UUC O;  5BXZ A;  1NS1 A;  5A2Q N;  4OX9 O;  2Z0A A;  3RT3 C;  3T1Y O;  4JI2 O;  2AGA A;  4DR6 O;  5LL6 Y;  1F7Y A;  4LF7 O;  4AQY O;  2DJV A;  5IT9 N;  2E5L O;  4DV3 O;  4DV7 O;  1HNZ O;  5H5N A;  4X62 O;  4B3M O;  4DV6 O;  3J81 N;  1R1B A;  4LF4 O;  5IWA O;  4DV2 O;  3J7A U;  2UUA O;  3O65 A;  1FYJ A;  4LFC O;  4DV0 O;  3J80 N;  4DR1 O;  4DR2 O;  1YZB A;  2UUB O;  1IBM O;  2UXB O;  1KUQ A;  4LF9 O;  2UU9 O;  4LFB O;  2UXD O;  1HNW O;  3R66 A;  4DR3 O;  5BR8 O;  2F4V O;  4JI6 O;  2N74 A;  4B3R O;  4YHH O;  5LMU O;  4DV4 O;  4YY3 O;  2DOS A;  4JI3 O;  1G1X B;  4NXM O;  3F5T A;  4B3T O;  1A32 A;  3JAM N;  2ZM6 O;  1XMQ O;  4LFA O;  1XEQ A;  4X64 O;  3T1H O;  4LF5 O;  4K0K O;  2JRI A;  4JYA O;  1FKA O;  1X59 A;  4B3S O;  1R6T A;  4A5U B;  5LMN O;  1N32 O;  2ZKO A;  4DR7 O;  5FLX N;  2UXC O;  1D2D A;  1AIL A;  1XNR O;  4OPA A;  4NXN O;  1DK1 A;  4JI5 O;  4JI7 O;  1XNQ O;  5BY1 A;  4LF8 O;  4JV5 O;  4JI0 O;  1HNX O;  1IBK O;  2VQF O;  1I94 O;  4OPH A;  3SDL A;  1J5E O;  2FKX A;  3OTO O;  2HHH O;  4KHP O;  4X65 O;  1HR0 O;  1N33 O;  4JI8 O;  1N34 O;  4DUY O;  4X66 O;  4DUZ O;  3M8A A;  4DV1 O;  1XMO O;  4DR5 O;  4GKK O;  4DR4 O;  1AB3 A;  2LW7 A;  4JI4 O;  4DV5 O;  1FJG O;  2VQE O;  1N36 O;  4JI1 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...