3T1YO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3t1yO00
1XEQA 1XNRO 4DR6O 4K0KO 1IBLO 4GKJO 1XNQO 5LL6Y 3J7AU 3T1HO 4LF9O 4NXNO 4JI6O 2Z0AA 4JI5O 2N74A 5FLXN 3JAMN 3J81N 1DK1A 1XMOO 4JI7O 2AGAA 1HNWO 4DV1O 4GKKO 4NXMO 1F7YA 4YHHO 5H5NA 1FJGO 4B3MO 4DR5O 2UU9O 4JYAO 4DV4O 4DV6O 4LFAO 2UXBO 4DR7O 5LMNO 4B3SO 4DR1O 1N33O 2VQEO 4LFCO 1D2DA 4DUZO 1FKAO 2UUAO 1G1XB 4JV5O 2FKXA 1XMQO 4B3RO 3R66A 1I94O 5BR8O 4LF6O 2LW7A 1R6TA 1N34O 4DV2O 5BXZA 4A5UB 2UUBO 4JI4O 1IBKO 4YY3O 5IT9N 3T1YO 4JI1O 4OPHA 4DV7O 1AB3A 1J5EO 2ZKOA 1IBMO 1AILA 4DR3O 1KUQA 4OPAA 5LMUO 4KHPO 2F4VO 4DV3O 4X62O 4B3TO 3SDLA 4DV5O 2HHHO 4OX9O 4DV0O 2JRIA 2ZM6O 3O65A 1N36O 4LFBO 4JI0O 2UUCO 1NS1A 4X66O 4DR4O 2UXDO 3OTOO 1R1BA 2DJVA 4DR2O 4X64O 1HNXO 4LF7O 2UXCO 3M8AA 3RT3C 4JI2O 1N32O 4LF5O 1X59A 4X65O 2E5LO 4LF4O 4AQYO 2DOSA 1FYJA 1HNZO 5BY1A 1A32A 4JI3O 5IWAO 2VQFO 5A2QN 3F5TA 4LF8O 1HR0O 3J80N 4DUYO 4JI8O 1YZBA
chains in the Genus database with same CATH superfamily
1QR8A 2JGDB 3DC6A 3K57A 3WG7B 4FLXA 1YTFB 2Q0OC 2CDYA 3DSQA 1L0NH 1F4MA 1THZA 2L35A 3K5NA 4U7NA 1NVPD 5KA6A 2WPDG 1GN2A 4DR7O 3RW0A 2CK3G 2YUAA 3TXSA 4RQEA 2NNUA 2Y0IA 1JJOA 4IYIA 4TV8A 2VQEO 3A2FA 2YSUB 4B3RB 2UXXA 5L3FA 4F6RA 2FTKA 5CA1A 2YIBA 4OXSA 4B7KA 2MW2B 4A5UB 2ZDIA 4ZI7A 1GM8A 1VQ8V 4PD4F 3Q4HB 3HB3B 2JS3A 3L72H 2JEXA 1VQ6V 4X1IB 4J9YB 1M5IA 4O4LA 3ZMZA 1RM1B 4DR3O 4X9QA 3UT5B 3CP1A 3JSLA 2CTPA 4BIUA 3K08A 5EIBD 2QWPB 4GX5A 4FFBB 3IGAC 2JJ2G 2JRIA 3N2GB 2P7TC 2F1MA 4O4HB 4PA9A 1VQ7V 2EJ7A 2XAFA 4X1YB 3LNMB 4R6ZA 2AHYA 1R1BA 2ILMA 3T1HB 4UCOA 1IURA 4X89A 1WLEA 3JD4A 1EN4A 2LGQA 3G4SV 1XL6A 3G71V 4XDJA 2H8PC 4FFKA 1AJPA 3K9AA 3RBZA 5KUMA 3SGIA 4DV1B 3WB1A 4B3MB 4JI3O 4I0XA 1QLEC 2BTOA 4B7EA 3AG4B 4R7CA 3S3XA 4IIJB 4JI8O 2JIZG 2DWEC 3ML0A 5KMGB 4FM0A 3OR6C 4JAAA 5JJEB 5B1BC 4PA3A 2JEUA 4N23A 1YXBA 5BMVA 4EFEA 3FB6C 1NH2D 4NTYA 5J9PC 2WAMA 3H1JH 1YJWV 4UB8Z 4DV6O 5C8YB 3QO5A 2EILC 4DR1O 5LBQA 3CCVV 3T4ZA 2XAHA 1ZSPA 3I55V 2EINB 3SJAC 2FKXA 2Y0PA 1PNMA 5JCOA 4JGSA 3G6BA 1BSMA 4PI0A 1YTFD 1EBOA 3NXSA 3D36C 4U3JA 5CA0B 5IYZB 1KD1W 1RPOA 2P67A 1L0LH 2DWDC 3AK1A 2Q7EA 3AG3B 2LP7A 5H6QA 4CS4A 3G80A 3K59A 5GW7A 1BHAA 4UCVA 1M93A 3O65A 1EZVH 1KP2A 4FLYA 2QM4A 3X2QB 2IJJA 2PUSA 3MDSA 1U96A 1YSCA 1BGYH 1ZLZA 4QPJA 4GLXA 4DK1A 3H9VA 3ICXA 2W6IG 2CE4A 3VQVA 3ZHUA 4GUNA 2C2AA 1F4NA 5IYBO 1OV9A 1Q86W 1D5AA 2ZD9A 2ZDIC 1K33A 5A2QN 5CBFA 5EBLC 1H8EG 4PA4A 1WPBA 4ZKIA 1XNQB 2XAQA 1H2NA 3T1HO 5FPOA 5IY5B 2YEVB 2IJKA 2OYQA 1FXKB 2ITDC 4YJ2B 3S3WA 4DV1O 2O57A 1JJ2U 1AR5A 2YXYA 4O2BA 5EK0A 2EIKB 4B3MO 1JOYA 2CTWA 2EBOA 4YJ3A 5LHIA 4LFAO 1YI2V 3F7VC 4FJCC 4KUMA 2CGOA 4Z1MG 4NVPA 4U7OA 3K5MA 3B09A 5JH7A 1AP6A 1K5SA 3OGCC 1QVFU 1VEWA 2EIMC 2QKSA 4I5SA 1YHQV 2EIJC 5BR8O 1US6A 3BRCA 5EYPA 1SQGA 2AXTZ 2ITCC 4YY3O 4UXNA 2OCHA 2XUMA 1YIJV 3DC5A 5LHGA 4FLUA 4I55B 1TGOA 2W6JG 1K7DA 3HKDA 1VQOV 3GWOA 3OE7G 4NYKA 1QR9A 3CYOA 1Q82W 3LDEA 4LF7O 3C3SA 5JCOC 5B1AB 1FYJA 1OCRC 1KQSU 1HNZO 4PDVA 3SJBC 1DGSA 4K8ZA 5BY1A 1KBHA 1NR1A 1VF6C 3FYIB 1M57C 1Y76A 5C93A 2NLJC 5LXTB 2BOCC 3IFXA 4LF9B 2PGGA 3J7AU 1RFYA 5D5QA 5IJ0A 2OIGA 3ABTA 1JMKC 3OTFA 1UJWB 3JD0A 3ASOB 1HNWB 4IYHA 1VP7A 4LF6B 4PV1B 1Z5VA 2XTAA 1OCOC 1NKDA 5TISZ 4JF3A 4CC6A 1ZWIC 3JAKA 4ICGA 3MHHC 3G6EV 4X1KB 4MVQA 4HNAB 4JPRA 3L70H 1YJNV 1BQ0A 3R65A 2W0XA 4MVZA 1MNGA 5KHIA 4NTXA 4MS2A 1JVMA 3QTCA 1NZ6A 4WBNA 2P4KA 4R8CA 2LJ2A 1SQBH 3ZRWA 1Z2GA 4X64B 1KYOF 4KXRA 5EBMC 1W0KG 1BCCH 2XAJA 1N0NA 2YI8A 2WLLA 4TQDA 1AILA 4X62B 4TV8B 4OPAA 4P9OA 3ABLC 3SDLA 1TAEA 4DV0B 3AG2C 4PELA 2ZR2A 4F6RB 2Y4UA 4JI0O 3EFFK 5CA1B 1GRJA 1SESA 1Y4MA 1JCHA 3FKSG 4JI2B 4D7SA 3JYCA 3ZBHA 4ZI7B 3L73H 4QE7A 2AHZA 1Y67A 4W4KA 2XHBA 1Q6IA 3JCUZ 4O4LB 3P30A 1T5EA 2NR5A 1GN4A 4HZ3A 4TSFG 4FZ1A 4LF8B 3A0BZ 3M7MX 2KG7A 1RP3B 4DR6O 1KECA 3DGEA 2PTMA 1SZTA 3ABKC 5B1NA 2OTLV 3J81N 1DK1A 2FMLA 5JWPA 1HW7A 1E1RG 2AW9A 3AG1C 5GONA 4YHHO 5FPRA 2E3CA 1GH6A 3K06A 2RDCA 4I0XB 3BVOA 4QPKA 2LGWA 4UVAA 1OJHA 1VF5B 4ZHQA 2WWWA 2F23A 1P4RA 2JDIG 4LF6O 2BTQA 2DYRC 2X6CA 2Q0AA 2HG5C 2IW5A 2DW4A 2UXNA 4DR1B 1IX9A 4TQFA 5BMVB 3CJHA 3C90A 1IBKO 2X0LA 4UV9A 3RWRD 1N32B 2QJ1A 1SQPH 1GM7A 1V55B 1DF5A 2QM7A 5CB4A 3TK1A 1GM9A 2ADPA 3T4DA 1O9HA 1TA8A 1KKDA 4DV5O 1XHXA 3P3PA 2WSSG 4LR3A 4TV9A 2B5UA 2YXLA 3PJSK 4O4JA 3CCUV 1HNXO 3ZHQA 4X64O 1M57B 3ZHTA 1FXVA 2ZE8A 3HKCA 4JI5B 4U3JB 5LGTA 3JD2A 3QNEA 4AQYO 4RO2A 2ZNJA 4NTWA 2YIAA 4EFBA 1I7FA 2ODMA 4JI3B 2LW1A 3DXRA 5B1OA 3K04A 2QE7G 3BA9A 1QNMA 2V4DA 4P9PA 4K35A 3RYCA 2GUZA 1IBLO 2GBOA 1AR1B 1MOFA 1ROPA 1W59A 2YIBD 5IJ9A 1M56B 4JZGA 2IH3C 2IJIA 1NTMH 5IDJA 4P2ZA 3QF7A 3N27A 1EN6A 3JAWA 5CN0A 1H2KA 3PN1A 2WLMA 1R3IC 2WLJA 2YDEA 1XUQA 1J5EB 3D36A 2HP8A 3QO7A 3K0GA 4KHPB 4L87A 4DV3B 4AILC 2QWQB 1TUBA 1I94O 1H8HG 3ETQA 2LW7A 3BA8A 1R3KC 2QA4V 4X66B 4O2BB 1WP8A 4JI4O 2ZIOA 3QVNA 1ENVA 4MTXA 3FB8C 4ASUG 3T1YO 4YJ3B 2HLDG 3K79A 2E5LB 4XBFA 2R70A 2BOBC 2K1EA 5JH7B 1YDXA 5LP6C 4X88A 4EB6A 2E76B 2VRZA 5EYPB 1K3EA 2LFRA 1P84F 3OGIB 1R3LC 1N32O 3AG7A 1P7BA 1X59A 1I0HA 5H6RA 5F2VO 4NXMB 4E4EA 1ZUQA 1A32A 3GWKC 4WCEV 1BS3A 2F93B 3HKDB 1MG1A 1HR0O 2F66C 5KHHA 2K9PA 2GTAA 1S5HC 4KL1A 2Z0AA 4JI5O 1BT8A 2YIDA 3K0DA 1K4CC 2QDOA 1S76D 2QR4A 4DV2B 3JD3A 2HJDA 3LNNA 4LFAB 4CH3A 1Y76B 4GCZA 2Z3YA 2OT5A 1CXZB 3ZN1A 1ZL8A 2CAZC 3IJ4A 3CRMA 5EC1C 5IJ0B 2GDSA 5BR8B 2RN9A 3H1LH 3K9SA 1PD3A 3HKBA 3OTOB 4YY3B 4DR2B 3K58A 4O4IA 1M9NA 3JAKB 2Q69A 3ZIAG 1J5EO 5GTIZ 2M6YA 4GT1A 3CE2A 1OCCB 2XNDG 1AI5A 1KUQA 1UPGA 5E79Z 4KHPO 3AK3A 3CEIA 4DV3O 3CHXA 2P90A 3OD4A 1KKCA 1YEWA 3E8HA 1XBLA 1BE3H 1XQ8A 4WBNB 3UO3A 4DW1A 3UQ8A 2H3OA 2ZXWC 1VF6A 2B1IA 3ZRWB 4K3AA 3ZS8C 1H2MA 1ZTEA 4X66O 4LF7B 3M99B 3UCSC 3M8AA 5CBGA 3ZHRA 5L3CA 1K8AW 5B3SB 3JARA 4FVMA 2E5LO 1HNZB 4CZZA 2AZ0A 4DO2A 4H0LB 2OIEA 2WLLB 5KHJA 5LHHA 4FIPC 3BAAA 1QQCA 3OM3B 3A0HZ 2LQTA 5LMNB 2QEXV 4JTDB 3J80N 1I5YA 2ZNIA 1H38A 1QBZA 2DYSC 2D3OW 1SQVH 3NR7A 4H44B 4MSWC 2Q73A 1LNQA 2OCCB 3E22A 2Z5UA 5LOVA 1JFFA 4NXMO 2P06A 2PF4E 4EKWA 2ZT9B 3SJCC 1KC8W 1EZJA 3QO8A 4JI1B 3CRAA 2V1DA 3K5OA 4MVMA 2KG7B 2P5OA 1SS3A 3E89A 3OEEG 1JR9A 3TJTA 1YITV 3QG5A 5GONB 4LFBB 1X4TA 4G2KA 4YIOA 1FFXA 4DV2O 4QNHB 2CTQA 4JYBA 1GK9A 2JGDA 5GTHZ 3L9DA 4IHJA 4Q6GA 1R3JC 1PNLA 5E1AC 3B8NA 2MK3A 2IBZH 3MAQA 4J7KA 5HFMA 3TXQA 4ZHQB 4JI0B 2R9RB 2BTQB 3T2MA 5KUKA 3OTOO 4DR2O 2GHYA 3L74H 4J10A 1HP8A 3CJHB 4L8JA 1M90W 1QHTA 1GO3F 4LP8A 4FLVA 4LF4O 3CCLV 3CCSV 5CB4B 4JAVA 2YXHA 3D8CA 2Y69C 4UCRA 3CRQA 1K5QA 4DR6B 4JYCA 5DM6V 4TV9B 2PI4A 4WFEA 4O4JB 1TVKA 2PYJA 4P30A 4WFHA 2UUAB 1QLEB 1FFTB 3ZRSA 2N74A 4DYLA 1XMOO 3HKCB 4FZ0A 2JS5A 3JD1A 1YJ9V 1PV0A 1BQZA 1N4CA 4YHHB 2VWKA 1P49A 1SC5B 3WFVA 4PDMA 5B1BB 5EIBC 3DXRB 4MW3A 2V7QG 2Q9LA 5LMNO 4RWUA 5KX5A 4ZIBA 4LBEC 1N33O 3RYCB 1MABG 3A8TA 1W2BU 2GUZB 5LMUB 2F4VB 2X6AA 3FX7A 1FKAO 1S77D 5KHGA 4E2LA 5IJ9B 2EILB 2LFSA 4MTGA 4J9ZB 2UUCB 4MVUA 1IBKB 2UUBO 2IU0A 3JAWB 4MVRA 4QGPA 4IT5A 4JI1O 4DK0A 3B40A 3B2EE 1V9PA 1K4DC 4BW9A 5EZYA 5FL7G 4DV5B 1K34A 1NT2B 5IWAB 1ORQC 3CCMV 1OHHG 1TUBB 2VQFB 5H9CA 1G8MA 2Q7GA 4LFBO 2E74B 2W0FC 3ASNC 5HFLA 1HNXB 4LCUC 1FPOA 3E2EA 1F23A 5JVDA 4AQYB 3LSSA 4PJ0Z 1B06A 2KQXA 4WFGA 4DW0A 3CCRV 4TOIA 2IJHA 1Q43A 1WN7A 3ZMSA 4JYAB 1PM9A 2CH7A 3CC7V 3KKYA 4FLWA 3UKMA 1S3JA 3P3NA 1MMMA 1JA8A 4CS2A 4GX1A 2RCVA 5CA3A 3WG7C 3BHPA 1IBLB 2Q67A 2OTJV 2WA3A 1DLBA 1BHBA 4ZOLA 4EB6B 3ZHSA 1R6KA 1H2GA 1IDSA 4FM2A 2ARHA 1M4UA 4WFBV 4DXWA 1EN5A 1PL4A 4H13B 3TCUA 3CMEV 2A79B 1EFRG 1E1QG 4WF9V 1SZXA 4LFCO 3L75H 2ZCEA 3LSUA 1WPXA 3FAVA 3JCZA 2UUAO 1GKFA 5LYJA 1G1XB 1H2LA 2NN4A 2ADQB 2JVDA 3OMIB 4JTCB 1I94B 4OX9B 1XILA 2WLKA 2ZM6B 3CCEV 1VIBA 4HYOA 1HDJA 4GX2A 2RMKB 3SYPA 4DR4B 4JI4B 1RM1C 2EIMB 2UXCB 5LP6A 3T1YB 2EIJB 2XASA 1SKVA 2YEVA 2YICA 4LH7A 2EZPA 4MW8A 1PP9H 2ZE7A 4UCSA 4OGQB 2OWOA 1AVMA 2KSDA 3I5DA 5LMUO 1M1KW 2GV9A 2F4VO 3KCXA 4B3TO 2HVKC 1ZL8B 3BABA 4O2AA 3RYHA 3WB2A 4HBNA 4TWKA 1S0VA 1MZFA 3MD0A 2UUCO 3BCCH 3ZMUA 3UO2A 3E35A 3HKBB 1SERA 3H01A 5KA5A 1WB7A 4NXNB 3H1HH 4JI6B 4XDKA 1JX9A 4O4IB 3CC2V 5EBWC 1NU1H 3G67A 4MTOA 3TGUH 1Y74A 1JPXA 1B3QA 1LUVA 5IWAO 2VQFO 1HR0B 1OCRB 2UXBB 4PA6A 3B77A 1XEQA 2QM8A 3AEIA 4LC1A 4J11A 1COWG 3ZN0A 4GKJO 3D3IA 2Q5ZA 1SQQH 1XMQB 2VS0A 1NBMG 5FNVA 1QVGU 2WLNA 2PY5A 2BSKA 2QTSA 3JARB 3BEHA 4FLTA 2JJ1G 2CGNA 4DR5O 1Y6XA 3SYQA 1K73W 4JYAO 2KB1A 5JJJB 3SPCA 4DRXA 3E8BA 3K5LA 4YIPA 5EC2C 2EINC 3IAYA 1OCOB 3JALA 1KP3A 4JASA 2Y48A 1B6QA 2DN9A 2ZE6A 4QIWF 5KAFZ 3APQA 4H37A 4JV5O 3SYOA 4LNUA 3E22B 4FM1A 4FPPA 1N36B 4EEQA 3SPGA 1VARA 5LOVB 1JFFB 1IZ3A 3AG3C 3JSNA 3CMAV 2HKOA 2A9HA 4X20A 5BZBA 4D7TA 2EX3A 1NH2B 2QWOB 3X2QC 1WP7A 2G38A 5J2UA 4OX9O 3FB7C 2Q8VA 2ZM6O 4JYYA 4QJFB 2N05A 1XNRB 3LDDA 4G28B 4NB5A 3ABLB 4DR4O 1FFXB 1Q6HA 4IGGA 3UM7A 3LSQA 3AG2B 5JQGA 1VQ9V 1FXHA 2UXCO 1CPYA 4IHJB 1F51A 3THOA 1Q3EA 3STZC 4F4LA 1CP9A 2IH1C 3BFRA 4MVSA 2L6LA 2IM9A 4B08A 4DV4B 2HR3A 4K8XA 4I4TA 1PKXA 5IY5C 1P7GA 4B3SB 2CUGA 1TUEB 1YZBA 1FXKC 4D6TH 4UUJC 4DUZB 4NXNO 1BMFG 4JI6O 1PPJH 2EIKC 5B5EZ 1OCZC 4I9WA 3CX5F 3LUTB 3KCYA 4GKKO 3ABKB 3APOA 4KFMA 1SA0A 5H5NA 5IE9A 1SRYA 3ZRVA 4F6EA 3AG1B 1FAFA 4J42A 1H2SB 4I7ZB 2UXBO 1IBMB 4NR1A 1YCIA 1TVKB 4CS3A 3VQYA 1WA8A 1XMQO 2RNBA 2HHHB 1AJNA 2X7RB 3R66A 2M7WA 2B9ZA 4BWAA 4LWSA 2RJZA 1YVWA 2DQ3A 1Z5WA 5BXZA 1AI4A 4H33A 4FMTA 3E86A 5LA6A 2DYRB 1R6NA 4J80A 1IVSA 3JATA 4W4LA 4PDLA 3ABMC 3HKEA 5KX5B 2PZSA 1XHZA 3CCJV 1NI8A 3HR0A 2HVJC 1SF9A 1GMGA 2BE3A 1XDCA 3LDCA 1WJZA 1MSDA 3OAAG 1N36O 4ZBMA 2VWJA 3KZIZ 3MHSC 3ZX6A 5B1AC 5K1XA 1D5NA 3OEHG 3RVZA 3RT3C 1L8DA 5KHKA 4LF4B 1DTOA 1GN6A 2WLIA 5A9GA 2KKWA 1Q81W 2Q7HA 1FJGB 4UFZA 5EZYB 2A0LA 2UU9B 1Q5OA 1QCEA 3CSXA 2A06H 3SPJA 1Q6UA 5IYDO 2R9IA 3CPWU 5J2TA 2H94A 1XNRO 3ASOC 3N2KA 4RUEA 4K0KO 4UCUA 2ZR3A 2P4VA 4Q20A 1XMOB 2QWRB 1ZAUA 3F7YC 5JJNB 3W7SA 4GYCB 5JVDB 3SJQC 3CB2A 4C7UA 3HPLC 2DQ0A 1RPRA 3H1KH 2E75B 1QU7A 1VQ4V 4BW5A 3ZRXA 3ZHVA 4DV4O 1SQFA 4AI8A 1NTZH 2CH7B 1OZ0A 3I56V 1N33B 4B3SO 3JASA 1J95A 2XOKG 1W0JG 3CXCU 4I50A 4GZRB 4DUZO 1Y66A 1RSOA 4ZOLB 3K03A 3D3QA 3CS5A 4QE9A 4B3RO 3L71H 3RYFA 4FLZA 3K3WA 3RYIA 2UUBB 1AI6A 2IU3A 4BR6A 3CCQV 4N21A 5ITZA 2D2CB 1NR7A 2ZKOA 1R73A 1IBMO 1K9MW 1GTOA 1VQLV 3OFNG 4PA7A 4TUYA 4PHZA 4RQFA 3FAVB 5L3GA 2HHHO 2QWNB 5B66Z 5LYJB 2WLHA 3OW2U 1VQNV 3VQWA 1K97A 5LP6B 4JI7B 5KAIZ 3VOUA 4RUFA 3CC4V 1G6UA 1XL4A 3W7XA 3E8GA 1OCZB 4O2AB 1Q8IA 3SPHA 3RYHB 1VQ5V 2JK5C 4UV8A 1XOUA 1VF7A 1N0JA 2HFEC 1LR1A 5LL6Y 2QKAA 5KLVH 2WA4A 3JAMN 1NQTA 3H1IH 3ETGA 4CC5A 3TETA 1N34B 3B4SA 3W7TA 1NJIW 1FJGO 3Q4HA 1Y74B 2UU9O 4X1IA 2ZE5A 3ETDA 4LFCB 3UT5A 3WB0A 2RQ6A 4J7ZA 2XT9A 3O9OA 1SQXH 4FFBA 4AHCA 2A3QA 5CMUA 3N2GA 4O4HA 1GAXA 5FNVB 1DF4A 3ABMB 3IC7A 3SPIA 4CBCA 3E8FA 2BSKB 1V54C 4X1YA 1R6TA 3C3TA 5L3BA 2EZOA 1V55C 3ZEDA 3OMNB 2UXDB 4TT3G 2ZINA 1Q90D 4U3FH 4R50A 4DRXB 4OPHA 4LF5B 1U97A 4X65B 4CH5A 3JALB 5H2FZ 4CH6A 4B3TB 2DE0X 1IXMA 1AJQA 1SETA 3OUFA 4IL6Z 4I9QA 4LNUB 4IIJA 1MZEA 2EULA 5KMGA 1JQ0A 5AG2A 4BAYA 2PI5A 1MA1A 3WU2Z 4CH4A 3CRRA 4UVCA 2ZIMA 2ZXWB 1ZX3A 2QKCA 4X20B 3DTUB 2Y4TA 2YC0A 5C8YA 1BZKA 3FB5C 1AROP 1BL8A 2DMXA 5J2UB 4BIOA 1M56C 1N8RW 4GKJB 2N04A 2PYLA 3W7UA 1KB9F 3IC9A 1XNQO 2X6BA 2AZ2A 2LO1A 2P6JA 5JQGB 2R9AA 4JI7O 2AGAA 1K92A 2DYSB 1F7YA 1VMGA 3CWBH 4DR5B 2Q6AA 1PL0A 5CA0A 2EJRA 2P22C 5IYZA 2B1GA 4DV7B 4I4TB 2ZQMA 3W7WA 1XREA 1IXBA 1O9GA 3RN4A 4WFAV 4JV5B 4FK5C 1D2DA 1YF2A 1B04A 2Q68A 3OT7A 1VQMV 4XDLA 1AI7A 1VQPV 4NKGB 3U0ZA 1KMIZ 3CRCA 1N34O 2FB5A 3F5WC 1SA0B 4X8AA 4J7JA 4HAMA 1S5JA 2QSAA 1QLNA 4JTAB 3SYAA 4UVBA 4PDRA 2HEPA 3ZMTA 2FYUH 2ATKC 4YXWG 3ABUA 3SR2C 1G4YB 2BCCH 1WA8B 5DN6G 1L1FA 4DUYB 5DEDA 3EVKA 4LWSB 3U10A 3U11A 1PNKA 1NS1A 2UXDO 2DJVA 3VBBA 4MT8A 3E83A 2QGNA 1FXKA 4JZ2A 4YJ2A 4LF5O 1S5LZ 5LA6B 1WB8A 4X65O 3A0RA 1I5XA 3JATB 2GTSA 3OMAB 1NVPB 1FS0G 3HKEB 5L3EA 3RGBA 5IYCO 3GVMA 4J41A 4DR7B 3RFRA 2VQEB 1S72V 3CD6V 2R72A 4LF9O 2Y69B 1E79G 1WNSA 4G27B 5FLXN 4GKKB 2YS8A 2A7WA 2FL4A 2XAGA 1HNWO 3AG4C 1LUWA 2WLIB 1MSWD 2QTOA 3ZCCA 3FYEB 3AK2A 1V54B 5D5PA 4I55A 5J2TB 4DR3B 3RVYA 4KP4A 5L3DA 3N2KB 1EM1A 2HJFC 4UB6Z 4UCTA 1UFIA 1OCCC 5IT9N 2ETNA 3FD9A 4DV7O 1FD9A 4MVOA 4BIZA 1AB3A 4PI2A 3ZMVA 2Q4PA 4RAIA 3JASB 1WAZA 5LGUA 1KU9A 1VQKV 4LH6A 3VQXA 3EXAA 4WFFA 4ABMA 3ETEA 4I50B 4X62O 1I08A 1XI1A 1RSOB 5K1PA 3P32A 4DV0O 5LXTA 3BY6A 4JAUA 4GX0A 4MTFA 3RYFB 5B3SC 4JI8B 4Z1VA 3SYCA 1CEZA 3CXHF 3OUSA 1AR4A 3B8MA 4Z2WA 5CBHA 3RYIB 1URFA 2CTRA 3KG2A 4JI2O 3FFQA 1GN3A 1AP5A 1Q7YW 1NTKH 5ITZB 2F43G 3ASNB 5LGNA 2F95B 3STLC 5DECA 3T1CA 2DOSA 2JGUA 2GSMB 3OR7C 2YI9A 1HWYA 4TUYB 3BPZA 4X1KA 4DV6B 3F5TA 4HNAA 3GB7C 3ZJZA 4LF8O 2OCCC 3EHBB 4DUYO 4K0KB
chains in the Genus database with same CATH topology
1XEQA 1XNRO 4DR6O 4K0KO 1IBLO 4GKJO 1XNQO 5LL6Y 3J7AU 3T1HO 4LF9O 4NXNO 4JI6O 2Z0AA 4JI5O 2N74A 5FLXN 3JAMN 3J81N 1DK1A 1XMOO 4JI7O 2AGAA 1HNWO 4DV1O 4GKKO 4NXMO 1F7YA 4YHHO 5H5NA 1FJGO 4B3MO 4DR5O 2UU9O 4JYAO 4DV4O 4DV6O 4LFAO 2UXBO 4DR7O 5LMNO 4B3SO 4DR1O 1N33O 2VQEO 4LFCO 1D2DA 4DUZO 1FKAO 2UUAO 1G1XB 4JV5O 2FKXA 1XMQO 4B3RO 3R66A 1I94O 5BR8O 4LF6O 2LW7A 1R6TA 1N34O 4DV2O 5BXZA 4A5UB 2UUBO 4JI4O 1IBKO 4YY3O 5IT9N 3T1YO 4JI1O 4OPHA 4DV7O 1AB3A 1J5EO 2ZKOA 1IBMO 1AILA 4DR3O 1KUQA 4OPAA 5LMUO 4KHPO 2F4VO 4DV3O 4X62O 4B3TO 3SDLA 4DV5O 2HHHO 4OX9O 4DV0O 2JRIA 2ZM6O 3O65A 1N36O 4LFBO 4JI0O 2UUCO 1NS1A 4X66O 4DR4O 2UXDO 3OTOO 1R1BA 2DJVA 4DR2O 4X64O 1HNXO 4LF7O 2UXCO 3M8AA 3RT3C 4JI2O 1N32O 4LF5O 1X59A 4X65O 2E5LO 4LF4O 4AQYO 2DOSA 1FYJA 1HNZO 5BY1A 1A32A 4JI3O 5IWAO 2VQFO 5A2QN 3F5TA 4LF8O 1HR0O 3J80N 4DUYO 4JI8O 1YZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XEQ A;  1XNR O;  4DR6 O;  4K0K O;  1IBL O;  4GKJ O;  1XNQ O;  5LL6 Y;  3J7A U;  3T1H O;  4LF9 O;  4NXN O;  4JI6 O;  2Z0A A;  4JI5 O;  2N74 A;  5FLX N;  3JAM N;  3J81 N;  1DK1 A;  1XMO O;  4JI7 O;  2AGA A;  1HNW O;  4DV1 O;  4GKK O;  4NXM O;  1F7Y A;  4YHH O;  5H5N A;  1FJG O;  4B3M O;  4DR5 O;  2UU9 O;  4JYA O;  4DV4 O;  4DV6 O;  4LFA O;  2UXB O;  4DR7 O;  5LMN O;  4B3S O;  4DR1 O;  1N33 O;  2VQE O;  4LFC O;  1D2D A;  4DUZ O;  1FKA O;  2UUA O;  1G1X B;  4JV5 O;  2FKX A;  1XMQ O;  4B3R O;  3R66 A;  1I94 O;  5BR8 O;  4LF6 O;  2LW7 A;  1R6T A;  1N34 O;  4DV2 O;  5BXZ A;  4A5U B;  2UUB O;  4JI4 O;  1IBK O;  4YY3 O;  5IT9 N;  3T1Y O;  4JI1 O;  4OPH A;  4DV7 O;  1AB3 A;  1J5E O;  2ZKO A;  1IBM O;  1AIL A;  4DR3 O;  1KUQ A;  4OPA A;  5LMU O;  4KHP O;  2F4V O;  4DV3 O;  4X62 O;  4B3T O;  3SDL A;  4DV5 O;  2HHH O;  4OX9 O;  4DV0 O;  2JRI A;  2ZM6 O;  3O65 A;  1N36 O;  4LFB O;  4JI0 O;  2UUC O;  1NS1 A;  4X66 O;  4DR4 O;  2UXD O;  3OTO O;  1R1B A;  2DJV A;  4DR2 O;  4X64 O;  1HNX O;  4LF7 O;  2UXC O;  3M8A A;  3RT3 C;  4JI2 O;  1N32 O;  4LF5 O;  1X59 A;  4X65 O;  2E5L O;  4LF4 O;  4AQY O;  2DOS A;  1FYJ A;  1HNZ O;  5BY1 A;  1A32 A;  4JI3 O;  5IWA O;  2VQF O;  5A2Q N;  3F5T A;  4LF8 O;  1HR0 O;  3J80 N;  4DUY O;  4JI8 O;  1YZB A; 
#chains in the Genus database with same CATH topology
 1QR8 A;  2JGD B;  3DC6 A;  3K57 A;  3WG7 B;  4FLX A;  1YTF B;  2Q0O C;  2CDY A;  3DSQ A;  1L0N H;  1F4M A;  1THZ A;  2L35 A;  3K5N A;  4U7N A;  1NVP D;  5KA6 A;  2WPD G;  1GN2 A;  4DR7 O;  3RW0 A;  2CK3 G;  2YUA A;  3TXS A;  4RQE A;  2NNU A;  2Y0I A;  1JJO A;  4IYI A;  4TV8 A;  2VQE O;  3A2F A;  2YSU B;  4B3R B;  2UXX A;  5L3F A;  4F6R A;  2FTK A;  5CA1 A;  2YIB A;  4OXS A;  4B7K A;  2MW2 B;  4A5U B;  2ZDI A;  4ZI7 A;  1GM8 A;  1VQ8 V;  4PD4 F;  3Q4H B;  3HB3 B;  2JS3 A;  3L72 H;  2JEX A;  1VQ6 V;  4X1I B;  4J9Y B;  1M5I A;  4O4L A;  3ZMZ A;  1RM1 B;  4DR3 O;  4X9Q A;  3UT5 B;  3CP1 A;  3JSL A;  2CTP A;  4BIU A;  3K08 A;  5EIB D;  2QWP B;  4GX5 A;  4FFB B;  3IGA C;  2JJ2 G;  2JRI A;  3N2G B;  2P7T C;  2F1M A;  4O4H B;  4PA9 A;  1VQ7 V;  2EJ7 A;  2XAF A;  4X1Y B;  3LNM B;  4R6Z A;  2AHY A;  1R1B A;  2ILM A;  3T1H B;  4UCO A;  1IUR A;  4X89 A;  1WLE A;  3JD4 A;  1EN4 A;  2LGQ A;  3G4S V;  1XL6 A;  3G71 V;  4XDJ A;  2H8P C;  4FFK A;  1AJP A;  3K9A A;  3RBZ A;  5KUM A;  3SGI A;  4DV1 B;  3WB1 A;  4B3M B;  4JI3 O;  4I0X A;  1QLE C;  2BTO A;  4B7E A;  3AG4 B;  4R7C A;  3S3X A;  4IIJ B;  4JI8 O;  2JIZ G;  2DWE C;  3ML0 A;  5KMG B;  4FM0 A;  3OR6 C;  4JAA A;  5JJE B;  5B1B C;  4PA3 A;  2JEU A;  4N23 A;  1YXB A;  5BMV A;  4EFE A;  3FB6 C;  1NH2 D;  4NTY A;  5J9P C;  2WAM A;  3H1J H;  1YJW V;  4UB8 Z;  4DV6 O;  5C8Y B;  3QO5 A;  2EIL C;  4DR1 O;  5LBQ A;  3CCV V;  3T4Z A;  2XAH A;  1ZSP A;  3I55 V;  2EIN B;  3SJA C;  2FKX A;  2Y0P A;  1PNM A;  5JCO A;  4JGS A;  3G6B A;  1BSM A;  4PI0 A;  1YTF D;  1EBO A;  3NXS A;  3D36 C;  4U3J A;  5CA0 B;  5IYZ B;  1KD1 W;  1RPO A;  2P67 A;  1L0L H;  2DWD C;  3AK1 A;  2Q7E A;  3AG3 B;  2LP7 A;  5H6Q A;  4CS4 A;  3G80 A;  3K59 A;  5GW7 A;  1BHA A;  4UCV A;  1M93 A;  3O65 A;  1EZV H;  1KP2 A;  4FLY A;  2QM4 A;  3X2Q B;  2IJJ A;  2PUS A;  3MDS A;  1U96 A;  1YSC A;  1BGY H;  1ZLZ A;  4QPJ A;  4GLX A;  4DK1 A;  3H9V A;  3ICX A;  2W6I G;  2CE4 A;  3VQV A;  3ZHU A;  4GUN A;  2C2A A;  1F4N A;  5IYB O;  1OV9 A;  1Q86 W;  1D5A A;  2ZD9 A;  2ZDI C;  1K33 A;  5A2Q N;  5CBF A;  5EBL C;  1H8E G;  4PA4 A;  1WPB A;  4ZKI A;  1XNQ B;  2XAQ A;  1H2N A;  3T1H O;  5FPO A;  5IY5 B;  2YEV B;  2IJK A;  2OYQ A;  1FXK B;  2ITD C;  4YJ2 B;  3S3W A;  4DV1 O;  2O57 A;  1JJ2 U;  1AR5 A;  2YXY A;  4O2B A;  5EK0 A;  2EIK B;  4B3M O;  1JOY A;  2CTW A;  2EBO A;  4YJ3 A;  5LHI A;  4LFA O;  1YI2 V;  3F7V C;  4FJC C;  4KUM A;  2CGO A;  4Z1M G;  4NVP A;  4U7O A;  3K5M A;  3B09 A;  5JH7 A;  1AP6 A;  1K5S A;  3OGC C;  1QVF U;  1VEW A;  2EIM C;  2QKS A;  4I5S A;  1YHQ V;  2EIJ C;  5BR8 O;  1US6 A;  3BRC A;  5EYP A;  1SQG A;  2AXT Z;  2ITC C;  4YY3 O;  4UXN A;  2OCH A;  2XUM A;  1YIJ V;  3DC5 A;  5LHG A;  4FLU A;  4I55 B;  1TGO A;  2W6J G;  1K7D A;  3HKD A;  1VQO V;  3GWO A;  3OE7 G;  4NYK A;  1QR9 A;  3CYO A;  1Q82 W;  3LDE A;  4LF7 O;  3C3S A;  5JCO C;  5B1A B;  1FYJ A;  1OCR C;  1KQS U;  1HNZ O;  4PDV A;  3SJB C;  1DGS A;  4K8Z A;  5BY1 A;  1KBH A;  1NR1 A;  1VF6 C;  3FYI B;  1M57 C;  1Y76 A;  5C93 A;  2NLJ C;  5LXT B;  2BOC C;  3IFX A;  4LF9 B;  2PGG A;  3J7A U;  1RFY A;  5D5Q A;  5IJ0 A;  2OIG A;  3ABT A;  1JMK C;  3OTF A;  1UJW B;  3JD0 A;  3ASO B;  1HNW B;  4IYH A;  1VP7 A;  4LF6 B;  4PV1 B;  1Z5V A;  2XTA A;  1OCO C;  1NKD A;  5TIS Z;  4JF3 A;  4CC6 A;  1ZWI C;  3JAK A;  4ICG A;  3MHH C;  3G6E V;  4X1K B;  4MVQ A;  4HNA B;  4JPR A;  3L70 H;  1YJN V;  1BQ0 A;  3R65 A;  2W0X A;  4MVZ A;  1MNG A;  5KHI A;  4NTX A;  4MS2 A;  1JVM A;  3QTC A;  1NZ6 A;  4WBN A;  2P4K A;  4R8C A;  2LJ2 A;  1SQB H;  3ZRW A;  1Z2G A;  4X64 B;  1KYO F;  4KXR A;  5EBM C;  1W0K G;  1BCC H;  2XAJ A;  1N0N A;  2YI8 A;  2WLL A;  4TQD A;  1AIL A;  4X62 B;  4TV8 B;  4OPA A;  4P9O A;  3ABL C;  3SDL A;  1TAE A;  4DV0 B;  3AG2 C;  4PEL A;  2ZR2 A;  4F6R B;  2Y4U A;  4JI0 O;  3EFF K;  5CA1 B;  1GRJ A;  1SES A;  1Y4M A;  1JCH A;  3FKS G;  4JI2 B;  4D7S A;  3JYC A;  3ZBH A;  4ZI7 B;  3L73 H;  4QE7 A;  2AHZ A;  1Y67 A;  4W4K A;  2XHB A;  1Q6I A;  3JCU Z;  4O4L B;  3P30 A;  1T5E A;  2NR5 A;  1GN4 A;  4HZ3 A;  4TSF G;  4FZ1 A;  4LF8 B;  3A0B Z;  3M7M X;  2KG7 A;  1RP3 B;  4DR6 O;  1KEC A;  3DGE A;  2PTM A;  1SZT A;  3ABK C;  5B1N A;  2OTL V;  3J81 N;  1DK1 A;  2FML A;  5JWP A;  1HW7 A;  1E1R G;  2AW9 A;  3AG1 C;  5GON A;  4YHH O;  5FPR A;  2E3C A;  1GH6 A;  3K06 A;  2RDC A;  4I0X B;  3BVO A;  4QPK A;  2LGW A;  4UVA A;  1OJH A;  1VF5 B;  4ZHQ A;  2WWW A;  2F23 A;  1P4R A;  2JDI G;  4LF6 O;  2BTQ A;  2DYR C;  2X6C A;  2Q0A A;  2HG5 C;  2IW5 A;  2DW4 A;  2UXN A;  4DR1 B;  1IX9 A;  4TQF A;  5BMV B;  3CJH A;  3C90 A;  1IBK O;  2X0L A;  4UV9 A;  3RWR D;  1N32 B;  2QJ1 A;  1SQP H;  1GM7 A;  1V55 B;  1DF5 A;  2QM7 A;  5CB4 A;  3TK1 A;  1GM9 A;  2ADP A;  3T4D A;  1O9H A;  1TA8 A;  1KKD A;  4DV5 O;  1XHX A;  3P3P A;  2WSS G;  4LR3 A;  4TV9 A;  2B5U A;  2YXL A;  3PJS K;  4O4J A;  3CCU V;  1HNX O;  3ZHQ A;  4X64 O;  1M57 B;  3ZHT A;  1FXV A;  2ZE8 A;  3HKC A;  4JI5 B;  4U3J B;  5LGT A;  3JD2 A;  3QNE A;  4AQY O;  4RO2 A;  2ZNJ A;  4NTW A;  2YIA A;  4EFB A;  1I7F A;  2ODM A;  4JI3 B;  2LW1 A;  3DXR A;  5B1O A;  3K04 A;  2QE7 G;  3BA9 A;  1QNM A;  2V4D A;  4P9P A;  4K35 A;  3RYC A;  2GUZ A;  1IBL O;  2GBO A;  1AR1 B;  1MOF A;  1ROP A;  1W59 A;  2YIB D;  5IJ9 A;  1M56 B;  4JZG A;  2IH3 C;  2IJI A;  1NTM H;  5IDJ A;  4P2Z A;  3QF7 A;  3N27 A;  1EN6 A;  3JAW A;  5CN0 A;  1H2K A;  3PN1 A;  2WLM A;  1R3I C;  2WLJ A;  2YDE A;  1XUQ A;  1J5E B;  3D36 A;  2HP8 A;  3QO7 A;  3K0G A;  4KHP B;  4L87 A;  4DV3 B;  4AIL C;  2QWQ B;  1TUB A;  1I94 O;  1H8H G;  3ETQ A;  2LW7 A;  3BA8 A;  1R3K C;  2QA4 V;  4X66 B;  4O2B B;  1WP8 A;  4JI4 O;  2ZIO A;  3QVN A;  1ENV A;  4MTX A;  3FB8 C;  4ASU G;  3T1Y O;  4YJ3 B;  2HLD G;  3K79 A;  2E5L B;  4XBF A;  2R70 A;  2BOB C;  2K1E A;  5JH7 B;  1YDX A;  5LP6 C;  4X88 A;  4EB6 A;  2E76 B;  2VRZ A;  5EYP B;  1K3E A;  2LFR A;  1P84 F;  3OGI B;  1R3L C;  1N32 O;  3AG7 A;  1P7B A;  1X59 A;  1I0H A;  5H6R A;  5F2V O;  4NXM B;  4E4E A;  1ZUQ A;  1A32 A;  3GWK C;  4WCE V;  1BS3 A;  2F93 B;  3HKD B;  1MG1 A;  1HR0 O;  2F66 C;  5KHH A;  2K9P A;  2GTA A;  1S5H C;  4KL1 A;  2Z0A A;  4JI5 O;  1BT8 A;  2YID A;  3K0D A;  1K4C C;  2QDO A;  1S76 D;  2QR4 A;  4DV2 B;  3JD3 A;  2HJD A;  3LNN A;  4LFA B;  4CH3 A;  1Y76 B;  4GCZ A;  2Z3Y A;  2OT5 A;  1CXZ B;  3ZN1 A;  1ZL8 A;  2CAZ C;  3IJ4 A;  3CRM A;  5EC1 C;  5IJ0 B;  2GDS A;  5BR8 B;  2RN9 A;  3H1L H;  3K9S A;  1PD3 A;  3HKB A;  3OTO B;  4YY3 B;  4DR2 B;  3K58 A;  4O4I A;  1M9N A;  3JAK B;  2Q69 A;  3ZIA G;  1J5E O;  5GTI Z;  2M6Y A;  4GT1 A;  3CE2 A;  1OCC B;  2XND G;  1AI5 A;  1KUQ A;  1UPG A;  5E79 Z;  4KHP O;  3AK3 A;  3CEI A;  4DV3 O;  3CHX A;  2P90 A;  3OD4 A;  1KKC A;  1YEW A;  3E8H A;  1XBL A;  1BE3 H;  1XQ8 A;  4WBN B;  3UO3 A;  4DW1 A;  3UQ8 A;  2H3O A;  2ZXW C;  1VF6 A;  2B1I A;  3ZRW B;  4K3A A;  3ZS8 C;  1H2M A;  1ZTE A;  4X66 O;  4LF7 B;  3M99 B;  3UCS C;  3M8A A;  5CBG A;  3ZHR A;  5L3C A;  1K8A W;  5B3S B;  3JAR A;  4FVM A;  2E5L O;  1HNZ B;  4CZZ A;  2AZ0 A;  4DO2 A;  4H0L B;  2OIE A;  2WLL B;  5KHJ A;  5LHH A;  4FIP C;  3BAA A;  1QQC A;  3OM3 B;  3A0H Z;  2LQT A;  5LMN B;  2QEX V;  4JTD B;  3J80 N;  1I5Y A;  2ZNI A;  1H38 A;  1QBZ A;  2DYS C;  2D3O W;  1SQV H;  3NR7 A;  4H44 B;  4MSW C;  2Q73 A;  1LNQ A;  2OCC B;  3E22 A;  2Z5U A;  5LOV A;  1JFF A;  4NXM O;  2P06 A;  2PF4 E;  4EKW A;  2ZT9 B;  3SJC C;  1KC8 W;  1EZJ A;  3QO8 A;  4JI1 B;  3CRA A;  2V1D A;  3K5O A;  4MVM A;  2KG7 B;  2P5O A;  1SS3 A;  3E89 A;  3OEE G;  1JR9 A;  3TJT A;  1YIT V;  3QG5 A;  5GON B;  4LFB B;  1X4T A;  4G2K A;  4YIO A;  1FFX A;  4DV2 O;  4QNH B;  2CTQ A;  4JYB A;  1GK9 A;  2JGD A;  5GTH Z;  3L9D A;  4IHJ A;  4Q6G A;  1R3J C;  1PNL A;  5E1A C;  3B8N A;  2MK3 A;  2IBZ H;  3MAQ A;  4J7K A;  5HFM A;  3TXQ A;  4ZHQ B;  4JI0 B;  2R9R B;  2BTQ B;  3T2M A;  5KUK A;  3OTO O;  4DR2 O;  2GHY A;  3L74 H;  4J10 A;  1HP8 A;  3CJH B;  4L8J A;  1M90 W;  1QHT A;  1GO3 F;  4LP8 A;  4FLV A;  4LF4 O;  3CCL V;  3CCS V;  5CB4 B;  4JAV A;  2YXH A;  3D8C A;  2Y69 C;  4UCR A;  3CRQ A;  1K5Q A;  4DR6 B;  4JYC A;  5DM6 V;  4TV9 B;  2PI4 A;  4WFE A;  4O4J B;  1TVK A;  2PYJ A;  4P30 A;  4WFH A;  2UUA B;  1QLE B;  1FFT B;  3ZRS A;  2N74 A;  4DYL A;  1XMO O;  3HKC B;  4FZ0 A;  2JS5 A;  3JD1 A;  1YJ9 V;  1PV0 A;  1BQZ A;  1N4C A;  4YHH B;  2VWK A;  1P49 A;  1SC5 B;  3WFV A;  4PDM A;  5B1B B;  5EIB C;  3DXR B;  4MW3 A;  2V7Q G;  2Q9L A;  5LMN O;  4RWU A;  5KX5 A;  4ZIB A;  4LBE C;  1N33 O;  3RYC B;  1MAB G;  3A8T A;  1W2B U;  2GUZ B;  5LMU B;  2F4V B;  2X6A A;  3FX7 A;  1FKA O;  1S77 D;  5KHG A;  4E2L A;  5IJ9 B;  2EIL B;  2LFS A;  4MTG A;  4J9Z B;  2UUC B;  4MVU A;  1IBK B;  2UUB O;  2IU0 A;  3JAW B;  4MVR A;  4QGP A;  4IT5 A;  4JI1 O;  4DK0 A;  3B40 A;  3B2E E;  1V9P A;  1K4D C;  4BW9 A;  5EZY A;  5FL7 G;  4DV5 B;  1K34 A;  1NT2 B;  5IWA B;  1ORQ C;  3CCM V;  1OHH G;  1TUB B;  2VQF B;  5H9C A;  1G8M A;  2Q7G A;  4LFB O;  2E74 B;  2W0F C;  3ASN C;  5HFL A;  1HNX B;  4LCU C;  1FPO A;  3E2E A;  1F23 A;  5JVD A;  4AQY B;  3LSS A;  4PJ0 Z;  1B06 A;  2KQX A;  4WFG A;  4DW0 A;  3CCR V;  4TOI A;  2IJH A;  1Q43 A;  1WN7 A;  3ZMS A;  4JYA B;  1PM9 A;  2CH7 A;  3CC7 V;  3KKY A;  4FLW A;  3UKM A;  1S3J A;  3P3N A;  1MMM A;  1JA8 A;  4CS2 A;  4GX1 A;  2RCV A;  5CA3 A;  3WG7 C;  3BHP A;  1IBL B;  2Q67 A;  2OTJ V;  2WA3 A;  1DLB A;  1BHB A;  4ZOL A;  4EB6 B;  3ZHS A;  1R6K A;  1H2G A;  1IDS A;  4FM2 A;  2ARH A;  1M4U A;  4WFB V;  4DXW A;  1EN5 A;  1PL4 A;  4H13 B;  3TCU A;  3CME V;  2A79 B;  1EFR G;  1E1Q G;  4WF9 V;  1SZX A;  4LFC O;  3L75 H;  2ZCE A;  3LSU A;  1WPX A;  3FAV A;  3JCZ A;  2UUA O;  1GKF A;  5LYJ A;  1G1X B;  1H2L A;  2NN4 A;  2ADQ B;  2JVD A;  3OMI B;  4JTC B;  1I94 B;  4OX9 B;  1XIL A;  2WLK A;  2ZM6 B;  3CCE V;  1VIB A;  4HYO A;  1HDJ A;  4GX2 A;  2RMK B;  3SYP A;  4DR4 B;  4JI4 B;  1RM1 C;  2EIM B;  2UXC B;  5LP6 A;  3T1Y B;  2EIJ B;  2XAS A;  1SKV A;  2YEV A;  2YIC A;  4LH7 A;  2EZP A;  4MW8 A;  1PP9 H;  2ZE7 A;  4UCS A;  4OGQ B;  2OWO A;  1AVM A;  2KSD A;  3I5D A;  5LMU O;  1M1K W;  2GV9 A;  2F4V O;  3KCX A;  4B3T O;  2HVK C;  1ZL8 B;  3BAB A;  4O2A A;  3RYH A;  3WB2 A;  4HBN A;  4TWK A;  1S0V A;  1MZF A;  3MD0 A;  2UUC O;  3BCC H;  3ZMU A;  3UO2 A;  3E35 A;  3HKB B;  1SER A;  3H01 A;  5KA5 A;  1WB7 A;  4NXN B;  3H1H H;  4JI6 B;  4XDK A;  1JX9 A;  4O4I B;  3CC2 V;  5EBW C;  1NU1 H;  3G67 A;  4MTO A;  3TGU H;  1Y74 A;  1JPX A;  1B3Q A;  1LUV A;  5IWA O;  2VQF O;  1HR0 B;  1OCR B;  2UXB B;  4PA6 A;  3B77 A;  1XEQ A;  2QM8 A;  3AEI A;  4LC1 A;  4J11 A;  1COW G;  3ZN0 A;  4GKJ O;  3D3I A;  2Q5Z A;  1SQQ H;  1XMQ B;  2VS0 A;  1NBM G;  5FNV A;  1QVG U;  2WLN A;  2PY5 A;  2BSK A;  2QTS A;  3JAR B;  3BEH A;  4FLT A;  2JJ1 G;  2CGN A;  4DR5 O;  1Y6X A;  3SYQ A;  1K73 W;  4JYA O;  2KB1 A;  5JJJ B;  3SPC A;  4DRX A;  3E8B A;  3K5L A;  4YIP A;  5EC2 C;  2EIN C;  3IAY A;  1OCO B;  3JAL A;  1KP3 A;  4JAS A;  2Y48 A;  1B6Q A;  2DN9 A;  2ZE6 A;  4QIW F;  5KAF Z;  3APQ A;  4H37 A;  4JV5 O;  3SYO A;  4LNU A;  3E22 B;  4FM1 A;  4FPP A;  1N36 B;  4EEQ A;  3SPG A;  1VAR A;  5LOV B;  1JFF B;  1IZ3 A;  3AG3 C;  3JSN A;  3CMA V;  2HKO A;  2A9H A;  4X20 A;  5BZB A;  4D7T A;  2EX3 A;  1NH2 B;  2QWO B;  3X2Q C;  1WP7 A;  2G38 A;  5J2U A;  4OX9 O;  3FB7 C;  2Q8V A;  2ZM6 O;  4JYY A;  4QJF B;  2N05 A;  1XNR B;  3LDD A;  4G28 B;  4NB5 A;  3ABL B;  4DR4 O;  1FFX B;  1Q6H A;  4IGG A;  3UM7 A;  3LSQ A;  3AG2 B;  5JQG A;  1VQ9 V;  1FXH A;  2UXC O;  1CPY A;  4IHJ B;  1F51 A;  3THO A;  1Q3E A;  3STZ C;  4F4L A;  1CP9 A;  2IH1 C;  3BFR A;  4MVS A;  2L6L A;  2IM9 A;  4B08 A;  4DV4 B;  2HR3 A;  4K8X A;  4I4T A;  1PKX A;  5IY5 C;  1P7G A;  4B3S B;  2CUG A;  1TUE B;  1YZB A;  1FXK C;  4D6T H;  4UUJ C;  4DUZ B;  4NXN O;  1BMF G;  4JI6 O;  1PPJ H;  2EIK C;  5B5E Z;  1OCZ C;  4I9W A;  3CX5 F;  3LUT B;  3KCY A;  4GKK O;  3ABK B;  3APO A;  4KFM A;  1SA0 A;  5H5N A;  5IE9 A;  1SRY A;  3ZRV A;  4F6E A;  3AG1 B;  1FAF A;  4J42 A;  1H2S B;  4I7Z B;  2UXB O;  1IBM B;  4NR1 A;  1YCI A;  1TVK B;  4CS3 A;  3VQY A;  1WA8 A;  1XMQ O;  2RNB A;  2HHH B;  1AJN A;  2X7R B;  3R66 A;  2M7W A;  2B9Z A;  4BWA A;  4LWS A;  2RJZ A;  1YVW A;  2DQ3 A;  1Z5W A;  5BXZ A;  1AI4 A;  4H33 A;  4FMT A;  3E86 A;  5LA6 A;  2DYR B;  1R6N A;  4J80 A;  1IVS A;  3JAT A;  4W4L A;  4PDL A;  3ABM C;  3HKE A;  5KX5 B;  2PZS A;  1XHZ A;  3CCJ V;  1NI8 A;  3HR0 A;  2HVJ C;  1SF9 A;  1GMG A;  2BE3 A;  1XDC A;  3LDC A;  1WJZ A;  1MSD A;  3OAA G;  1N36 O;  4ZBM A;  2VWJ A;  3KZI Z;  3MHS C;  3ZX6 A;  5B1A C;  5K1X A;  1D5N A;  3OEH G;  3RVZ A;  3RT3 C;  1L8D A;  5KHK A;  4LF4 B;  1DTO A;  1GN6 A;  2WLI A;  5A9G A;  2KKW A;  1Q81 W;  2Q7H A;  1FJG B;  4UFZ A;  5EZY B;  2A0L A;  2UU9 B;  1Q5O A;  1QCE A;  3CSX A;  2A06 H;  3SPJ A;  1Q6U A;  5IYD O;  2R9I A;  3CPW U;  5J2T A;  2H94 A;  1XNR O;  3ASO C;  3N2K A;  4RUE A;  4K0K O;  4UCU A;  2ZR3 A;  2P4V A;  4Q20 A;  1XMO B;  2QWR B;  1ZAU A;  3F7Y C;  5JJN B;  3W7S A;  4GYC B;  5JVD B;  3SJQ C;  3CB2 A;  4C7U A;  3HPL C;  2DQ0 A;  1RPR A;  3H1K H;  2E75 B;  1QU7 A;  1VQ4 V;  4BW5 A;  3ZRX A;  3ZHV A;  4DV4 O;  1SQF A;  4AI8 A;  1NTZ H;  2CH7 B;  1OZ0 A;  3I56 V;  1N33 B;  4B3S O;  3JAS A;  1J95 A;  2XOK G;  1W0J G;  3CXC U;  4I50 A;  4GZR B;  4DUZ O;  1Y66 A;  1RSO A;  4ZOL B;  3K03 A;  3D3Q A;  3CS5 A;  4QE9 A;  4B3R O;  3L71 H;  3RYF A;  4FLZ A;  3K3W A;  3RYI A;  2UUB B;  1AI6 A;  2IU3 A;  4BR6 A;  3CCQ V;  4N21 A;  5ITZ A;  2D2C B;  1NR7 A;  2ZKO A;  1R73 A;  1IBM O;  1K9M W;  1GTO A;  1VQL V;  3OFN G;  4PA7 A;  4TUY A;  4PHZ A;  4RQF A;  3FAV B;  5L3G A;  2HHH O;  2QWN B;  5B66 Z;  5LYJ B;  2WLH A;  3OW2 U;  1VQN V;  3VQW A;  1K97 A;  5LP6 B;  4JI7 B;  5KAI Z;  3VOU A;  4RUF A;  3CC4 V;  1G6U A;  1XL4 A;  3W7X A;  3E8G A;  1OCZ B;  4O2A B;  1Q8I A;  3SPH A;  3RYH B;  1VQ5 V;  2JK5 C;  4UV8 A;  1XOU A;  1VF7 A;  1N0J A;  2HFE C;  1LR1 A;  5LL6 Y;  2QKA A;  5KLV H;  2WA4 A;  3JAM N;  1NQT A;  3H1I H;  3ETG A;  4CC5 A;  3TET A;  1N34 B;  3B4S A;  3W7T A;  1NJI W;  1FJG O;  3Q4H A;  1Y74 B;  2UU9 O;  4X1I A;  2ZE5 A;  3ETD A;  4LFC B;  3UT5 A;  3WB0 A;  2RQ6 A;  4J7Z A;  2XT9 A;  3O9O A;  1SQX H;  4FFB A;  4AHC A;  2A3Q A;  5CMU A;  3N2G A;  4O4H A;  1GAX A;  5FNV B;  1DF4 A;  3ABM B;  3IC7 A;  3SPI A;  4CBC A;  3E8F A;  2BSK B;  1V54 C;  4X1Y A;  1R6T A;  3C3T A;  5L3B A;  2EZO A;  1V55 C;  3ZED A;  3OMN B;  2UXD B;  4TT3 G;  2ZIN A;  1Q90 D;  4U3F H;  4R50 A;  4DRX B;  4OPH A;  4LF5 B;  1U97 A;  4X65 B;  4CH5 A;  3JAL B;  5H2F Z;  4CH6 A;  4B3T B;  2DE0 X;  1IXM A;  1AJQ A;  1SET A;  3OUF A;  4IL6 Z;  4I9Q A;  4LNU B;  4IIJ A;  1MZE A;  2EUL A;  5KMG A;  1JQ0 A;  5AG2 A;  4BAY A;  2PI5 A;  1MA1 A;  3WU2 Z;  4CH4 A;  3CRR A;  4UVC A;  2ZIM A;  2ZXW B;  1ZX3 A;  2QKC A;  4X20 B;  3DTU B;  2Y4T A;  2YC0 A;  5C8Y A;  1BZK A;  3FB5 C;  1ARO P;  1BL8 A;  2DMX A;  5J2U B;  4BIO A;  1M56 C;  1N8R W;  4GKJ B;  2N04 A;  2PYL A;  3W7U A;  1KB9 F;  3IC9 A;  1XNQ O;  2X6B A;  2AZ2 A;  2LO1 A;  2P6J A;  5JQG B;  2R9A A;  4JI7 O;  2AGA A;  1K92 A;  2DYS B;  1F7Y A;  1VMG A;  3CWB H;  4DR5 B;  2Q6A A;  1PL0 A;  5CA0 A;  2EJR A;  2P22 C;  5IYZ A;  2B1G A;  4DV7 B;  4I4T B;  2ZQM A;  3W7W A;  1XRE A;  1IXB A;  1O9G A;  3RN4 A;  4WFA V;  4JV5 B;  4FK5 C;  1D2D A;  1YF2 A;  1B04 A;  2Q68 A;  3OT7 A;  1VQM V;  4XDL A;  1AI7 A;  1VQP V;  4NKG B;  3U0Z A;  1KMI Z;  3CRC A;  1N34 O;  2FB5 A;  3F5W C;  1SA0 B;  4X8A A;  4J7J A;  4HAM A;  1S5J A;  2QSA A;  1QLN A;  4JTA B;  3SYA A;  4UVB A;  4PDR A;  2HEP A;  3ZMT A;  2FYU H;  2ATK C;  4YXW G;  3ABU A;  3SR2 C;  1G4Y B;  2BCC H;  1WA8 B;  5DN6 G;  1L1F A;  4DUY B;  5DED A;  3EVK A;  4LWS B;  3U10 A;  3U11 A;  1PNK A;  1NS1 A;  2UXD O;  2DJV A;  3VBB A;  4MT8 A;  3E83 A;  2QGN A;  1FXK A;  4JZ2 A;  4YJ2 A;  4LF5 O;  1S5L Z;  5LA6 B;  1WB8 A;  4X65 O;  3A0R A;  1I5X A;  3JAT B;  2GTS A;  3OMA B;  1NVP B;  1FS0 G;  3HKE B;  5L3E A;  3RGB A;  5IYC O;  3GVM A;  4J41 A;  4DR7 B;  3RFR A;  2VQE B;  1S72 V;  3CD6 V;  2R72 A;  4LF9 O;  2Y69 B;  1E79 G;  1WNS A;  4G27 B;  5FLX N;  4GKK B;  2YS8 A;  2A7W A;  2FL4 A;  2XAG A;  1HNW O;  3AG4 C;  1LUW A;  2WLI B;  1MSW D;  2QTO A;  3ZCC A;  3FYE B;  3AK2 A;  1V54 B;  5D5P A;  4I55 A;  5J2T B;  4DR3 B;  3RVY A;  4KP4 A;  5L3D A;  3N2K B;  1EM1 A;  2HJF C;  4UB6 Z;  4UCT A;  1UFI A;  1OCC C;  5IT9 N;  2ETN A;  3FD9 A;  4DV7 O;  1FD9 A;  4MVO A;  4BIZ A;  1AB3 A;  4PI2 A;  3ZMV A;  2Q4P A;  4RAI A;  3JAS B;  1WAZ A;  5LGU A;  1KU9 A;  1VQK V;  4LH6 A;  3VQX A;  3EXA A;  4WFF A;  4ABM A;  3ETE A;  4I50 B;  4X62 O;  1I08 A;  1XI1 A;  1RSO B;  5K1P A;  3P32 A;  4DV0 O;  5LXT A;  3BY6 A;  4JAU A;  4GX0 A;  4MTF A;  3RYF B;  5B3S C;  4JI8 B;  4Z1V A;  3SYC A;  1CEZ A;  3CXH F;  3OUS A;  1AR4 A;  3B8M A;  4Z2W A;  5CBH A;  3RYI B;  1URF A;  2CTR A;  3KG2 A;  4JI2 O;  3FFQ A;  1GN3 A;  1AP5 A;  1Q7Y W;  1NTK H;  5ITZ B;  2F43 G;  3ASN B;  5LGN A;  2F95 B;  3STL C;  5DEC A;  3T1C A;  2DOS A;  2JGU A;  2GSM B;  3OR7 C;  2YI9 A;  1HWY A;  4TUY B;  3BPZ A;  4X1K A;  4DV6 B;  3F5T A;  4HNA A;  3GB7 C;  3ZJZ A;  4LF8 O;  2OCC C;  3EHB B;  4DUY O;  4K0K B; 
#chains in the Genus database with same CATH homology
 1XEQ A;  1XNR O;  4DR6 O;  4K0K O;  1IBL O;  4GKJ O;  1XNQ O;  5LL6 Y;  3J7A U;  3T1H O;  4LF9 O;  4NXN O;  4JI6 O;  2Z0A A;  4JI5 O;  2N74 A;  5FLX N;  3JAM N;  3J81 N;  1DK1 A;  1XMO O;  4JI7 O;  2AGA A;  1HNW O;  4DV1 O;  4GKK O;  4NXM O;  1F7Y A;  4YHH O;  5H5N A;  1FJG O;  4B3M O;  4DR5 O;  2UU9 O;  4JYA O;  4DV4 O;  4DV6 O;  4LFA O;  2UXB O;  4DR7 O;  5LMN O;  4B3S O;  4DR1 O;  1N33 O;  2VQE O;  4LFC O;  1D2D A;  4DUZ O;  1FKA O;  2UUA O;  1G1X B;  4JV5 O;  2FKX A;  1XMQ O;  4B3R O;  3R66 A;  1I94 O;  5BR8 O;  4LF6 O;  2LW7 A;  1R6T A;  1N34 O;  4DV2 O;  5BXZ A;  4A5U B;  2UUB O;  4JI4 O;  1IBK O;  4YY3 O;  5IT9 N;  3T1Y O;  4JI1 O;  4OPH A;  4DV7 O;  1AB3 A;  1J5E O;  2ZKO A;  1IBM O;  1AIL A;  4DR3 O;  1KUQ A;  4OPA A;  5LMU O;  4KHP O;  2F4V O;  4DV3 O;  4X62 O;  4B3T O;  3SDL A;  4DV5 O;  2HHH O;  4OX9 O;  4DV0 O;  2JRI A;  2ZM6 O;  3O65 A;  1N36 O;  4LFB O;  4JI0 O;  2UUC O;  1NS1 A;  4X66 O;  4DR4 O;  2UXD O;  3OTO O;  1R1B A;  2DJV A;  4DR2 O;  4X64 O;  1HNX O;  4LF7 O;  2UXC O;  3M8A A;  3RT3 C;  4JI2 O;  1N32 O;  4LF5 O;  1X59 A;  4X65 O;  2E5L O;  4LF4 O;  4AQY O;  2DOS A;  1FYJ A;  1HNZ O;  5BY1 A;  1A32 A;  4JI3 O;  5IWA O;  2VQF O;  5A2Q N;  3F5T A;  4LF8 O;  1HR0 O;  3J80 N;  4DUY O;  4JI8 O;  1YZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...