3T1YO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3t1yO00
5LMNO 4LF7O 4JI8O 3M8AA 3JAMN 4JI1O 1HNZO 1XEQA 1FKAO 4LF8O 4YY3O 4DV7O 2ZM6O 3T1YO 4OPHA 4OX9O 1FYJA 4JI7O 2JRIA 2F4VO 4GKKO 2UUCO 4B3RO 2E5LO 4DV6O 2LW7A 3F5TA 1AB3A 3O65A 2Z0AA 1N34O 1I94O 5LMUO 1XNQO 1IBLO 5H5NA 4KHPO 4K0KO 4JI4O 4LF4O 1DK1A 4DR5O 5BY1A 1R6TA 5IWAO 3J81N 1X59A 4X64O 4DV3O 4AQYO 4JV5O 4YHHO 4DUYO 3T1HO 2ZKOA 1YZBA 4DR2O 1D2DA 4GKJO 4DV4O 2UXDO 1N33O 4LFAO 4LF5O 1XNRO 1HR0O 3RT3C 4JI6O 5A2QN 1XMQO 4OPAA 4NXNO 4DV1O 5LL6Y 4X65O 4DUZO 3R66A 2UXCO 5BXZA 4B3SO 1AILA 1KUQA 1XMOO 1F7YA 2N74A 4DV0O 4X62O 2UU9O 4JI2O 4A5UB 5FLXN 3SDLA 3J80N 4JYAO 1HNWO 1FJGO 1HNXO 4LFCO 1N32O 4JI0O 4NXMO 2VQFO 1IBKO 4DR1O 4DR6O 5BR8O 5IT9N 1A32A 1IBMO 4JI5O 2FKXA 4DR4O 2UXBO 4DV2O 4LFBO 3J7AU 4DR7O 2AGAA 2UUBO 1G1XB 2VQEO 1N36O 2DJVA 3OTOO 1R1BA 4JI3O 2DOSA 2UUAO 4X66O 4DR3O 4LF9O 2HHHO 1NS1A 4B3TO 4DV5O 4B3MO 1J5EO 4LF6O
chains in the Genus database with same CATH superfamily
4X1KA 2Q6AA 3CCLV 1AJQA 4JI1O 4R7CA 1ZWIC 3MDSA 1L1FA 1ORQC 3FFQA 3HKCB 3D8CA 1JQ0A 4YIOA 2F66C 3D3QA 1IBMB 3OR7C 1Y4MA 1Z5VA 3JASA 1R3LC 1O9HA 1NH2D 4Q20A 4O4HA 3ZBHA 4IYHA 4K0KB 4JI4B 5KUKA 5AG2A 2A0LA 3ABTA 3CPWU 3RT3C 4DR5B 1JMKC 1K8AW 1FXHA 1H2SB 3CCRV 3K08A 3ZHTA 2XT9A 1PV0A 1V55B 3RYFA 1PD3A 5C8YB 4DUZO 2IJHA 4YHHB 2WLLA 2QSAA 1QNMA 1TVKA 1XMOO 2CE4A 5JH7B 1G6UA 3ZEDA 4PA9A 2YI9A 2OTJV 5L3EA 2AZ0A 1I5XA 1HNXO 1CP9A 3BPZA 4X1IB 4WFFA 4EB6A 3ASOB 3SJQC 2PTMA 1IX9A 3K5NA 4DR6O 2XOKG 4I0XA 1IVSA 1K34A 1N32B 5B1BB 2B5UA 1G1XB 4HBNA 2H3OA 3AG1C 1R1BA 2V1DA 4JI3O 2DOSA 4LWSA 3H01A 4F6RB 3AG4B 2PGGA 1RM1B 4DV5O 2A06H 2E75B 5B3SB 1KMIZ 4YIPA 5B1NA 3SYAA 1GK9A 4IIJB 4YJ2B 3T4ZA 4FLVA 1Y67A 1XL6A 3NXSA 1M56B 5IJ9A 4PDLA 5IJ0A 2YICA 2VQFB 4B3MB 3OGCC 5D5QA 4OX9O 3ETGA 2Y4TA 3W7WA 1TUEB 5JJEB 4FLUA 2PY5A 1XNQO 2QKAA 3A8TA 4CH3A 1Q5OA 5TISZ 3A0BZ 5LBQA 3EXAA 2E5LB 1JR9A 4G27B 1K5SA 1EFRG 1P49A 4MSWC 2RCVA 1YZBA 1AR1B 1BL8A 4JYCA 4P9OA 4LF5O 4W4KA 1Q8IA 1XMQO 1Q90D 1NVPB 4UB8Z 2AZ2A 1UFIA 5HFLA 3STZC 4O4JB 2QTOA 3ETEA 4X65O 3LSUA 3GVMA 3SPHA 2OCHA 1HR0B 5KX5A 2YSUB 2BE3A 2UU9O 1AR5A 4XDJA 3SDLA 1JFFB 1AP5A 1K3EA 3CJHA 2FB5A 1ZLZA 1SQFA 1SQGA 2GHYA 4UCTA 3FB7C 2AGAA 2QKSA 4B08A 1X4TA 2WA4A 3W7XA 2EILB 1NJIW 4J42A 1SF9A 1P7GA 3CYOA 4UFZA 4I50A 1YIJV 1S5JA 2Y4UA 1VF6C 1NR1A 3DXRA 5EIBD 4H13B 4LFBB 2HJDA 4UVAA 1YJWV 3R66A 4G2KA 1BS3A 5KHGA 3ZN0A 1L0LH 3KKYA 2EIMB 1SZXA 3SYQA 3E8GA 4LF9B 2CGNA 1EZVH 2HHHB 1GAXA 1KP3A 1S76D 2L35A 4ZI7A 3AG2C 1VEWA 1KBHA 1SESA 3IC7A 4FZ0A 3OUFA 2KG7A 2UUCO 2DQ3A 4I55A 4JI1B 5EZYB 1AB3A 2DN9A 1VQ7V 1GM8A 4GX0A 4CC5A 3B77A 5EIBC 2DYSB 1H38A 4RUFA 5J2UB 3B8NA 4ZHQA 4X64O 3JD3A 1OCZC 4AQYO 3D36C 5B1AC 1E1QG 3CCSV 4J9ZB 3K3WA 3JAWB 3HKDB 3ZRWA 4K8XA 2F95B 5LL6Y 1D5AA 3OMNB 4I9QA 2LJ2A 2ATKC 1NVPD 3AK3A 5J9PC 3OW2U 2Z3YA 5JCOA 3KG2A 4A5UB 3CE2A 3T1CA 4DUZB 1H8HG 3UT5A 4JYAO 1R3KC 4I9WA 1FJGO 1R3JC 1XMOB 1Y76A 1P7BA 3CRAA 4ZOLB 4UCVA 4PA7A 3CCQV 1DGSA 4GCZA 3SJCC 4J11A 4MW3A 2EIJC 1GN2A 1VQ4V 1BT8A 4HNAA 1HNXB 4JF3A 1SQVH 2Q7EA 2JGUA 1ZTEA 2HKOA 3QF7A 2K1EA 1FAFA 2OT5A 4DR6B 3DGEA 3ABMB 2QTSA 4R50A 1VIBA 4JPRA 4X66O 2ZXWC 4P30A 1B06A 4IGGA 5IYDO 4JI3B 4DXWA 3CXCU 5CN0A 1QCEA 4O4LA 5KHKA 3QVNA 4DRXB 3ZCCA 1ZL8A 4PA3A 4DV5B 2DMXA 1FYJA 2XNDG 3RYHB 1XUQA 4NVPA 1EM1A 4U3FH 4NTXA 2EBOA 4TT3G 4RQEA 2IH1C 4KHPO 2HP8A 2JK5C 4OX9B 3Q4HA 4XBFA 1EN4A 5ITZB 4IHJA 4RWUA 1WAZA 5LA6A 3J81N 1X59A 2BOBC 1JX9A 4R6ZA 1XNQB 3ZX6A 3HKBB 4AHCA 4H37A 2JS5A 3WB0A 4DV1O 4K3AA 4I4TB 1FS0G 4DK1A 2PI4A 3ZHQA 4LF5B 3CD6V 4ASUG 1XMQB 4MS2A 4X65B 1K4CC 2VRZA 2QM8A 2XAGA 2OCCB 5FL7G 1COWG 5JJJB 2LGQA 4O4IA 1ZSPA 2W0XA 4FZ1A 1IBKO 1K97A 2UU9B 3FYIB 2A3QA 1PNMA 4DR4O 3VQVA 3WG7C 1FFXB 2UXBO 3EFFK 1JPXA 3G4SV 2HFEC 3J7AU 3JYCA 1AR4A 1H2NA 1BE3H 2AHZA 1KECA 2ZE5A 1VF5B 1NU1H 3AK1A 2CTQA 2BSKA 3ABLC 1MZFA 5C8YA 3SYPA 5KMGA 4FLYA 3OM3B 3K5MA 1BQZA 1VQ5V 1I5YA 1M9NA 2JRIA 4J7JA 2XUMA 2RDCA 4JI5B 5KAFZ 5K1XA 1N34O 1HP8A 4BIUA 2QWQB 2VS0A 5H5NA 4FM0A 1BHBA 2A7WA 3RW0A 3CRCA 2UUCB 4GX5A 4TQFA 4WF9V 3OAAG 3E2EA 4JTAB 4BIOA 4FM2A 1J95A 3ASNC 2PZSA 5LOVA 1OJHA 2OIGA 1M93A 2HEPA 2UXDO 4J10A 4TOIA 2BCCH 2OTLV 4X64B 3CSXA 3BFRA 3A0RA 4AQYB 4J9YB 2EINC 1NH2B 2P5OA 2GSMB 4X62O 2LFSA 2LW1A 4F6EA 3RYIA 5CMUA 4JAVA 3AG1B 3TK1A 2YIBA 1MZEA 2F1MA 1SETA 4D7SA 1B3QA 5CB4B 1A32A 4KFMA 4JYAB 2NNUA 1US6A 3HR0A 5LYJB 1FJGB 1NT2B 2GTAA 1VQLV 5JVDA 1YJNV 2ZDIA 5LP6B 2UUBO 2R9AA 4MVUA 3F7VC 1M4UA 1RFYA 2PUSA 4CC6A 1NS1A 1I08A 4UUJC 2YS8A 1K7DA 4X8AA 2ZD9A 4X66B 3L73H 2AHYA 1AI6A 4QNHB 3CB2A 2CK3G 3CCEV 2EJRA 4DV6O 2ITDC 2JIZG 2YXHA 5GTIZ 1MOFA 1W2BU 3N2GA 5LMUO 2D3OW 5KLVH 3RGBA 1SERA 3K59A 1RSOB 3H1IH 3CHXA 2WA3A 2FMLA 2AW9A 3CRMA 4H44B 3ZS8C 4KHPB 3HKEB 1VP7A 3AEIA 5B5EZ 5IYZB 1GH6A 1QBZA 1ROPA 1YITV 1CEZA 4L8JA 4FFBB 2V7QG 3JALA 1WA8A 2YXYA 1NTMH 2F93B 3SPGA 5CBHA 3ETQA 3A0HZ 4DV1B 1RPRA 1TUBA 5FLXN 3CMAV 2LP7A 1GTOA 5L3FA 1I7FA 4TV9A 1CPYA 4PHZA 3F5WC 3LDCA 5BR8O 2YEVB 4E4EA 3JAKA 2B1IA 2QJ1A 2WLMA 3D3IA 2QM7A 2Y69C 1IBKB 1KKCA 2Q9LA 4FLXA 1R73A 3MAQA 2Q0OC 4DR4B 1AI7A 3LUTB 1IDSA 4Q6GA 2UXBB 1GRJA 3E22A 3AG2B 1F51A 5JCOC 4J7KA 3HKDA 3UQ8A 3E35A 1M5IA 4LF7O 1YCIA 4UV9A 3UKMA 4E2LA 1VQ9V 3T4DA 2ZT9B 1HNZO 1UJWB 4LF8O 3BCCH 3K79A 3G67A 3FYEB 1N0JA 4GZRB 4X9QA 1OCZB 4YJ3A 3SYOA 4HYOA 2AXTZ 3CC2V 5C93A 4WBNB 1I94O 1AVMA 2R9IA 5B1AB 4G28B 3K9SA 2ITCC 1XI1A 2OWOA 1LUWA 4GX2A 1QLEC 5IWAO 1BCCH 4U3JB 3BA8A 1N34B 4JGSA 1KQSU 2JGDA 2ZKOA 4RAIA 1FXKC 2UXXA 4TUYA 4P9PA 4ZBMA 3OEHG 5E1AC 1P84F 2WSSG 3TXSA 3JATA 3TETA 1Q6HA 5CA1B 2GDSA 4HZ3A 1VF7A 3BABA 3ZN1A 4B3SO 1Q82W 1IXMA 4EKWA 2XHBA 2Q0AA 3QO8A 3WB1A 1Y74B 2YXLA 2YUAA 3OGIB 4JI2O 2EIJB 5FPOA 4P2ZA 4YXWG 1BMFG 2ZNJA 1XDCA 4LFCO 1OCRC 5KHIA 3ABKB 3NR7A 1LUVA 3JARA 1VQOV 4X62B 2JS3A 1BHAA 4MW8A 1S3JA 3SJBC 4J80A 4UCUA 2ZXWB 2FKXA 2EIKB 1JOYA 3RYCB 4UV8A 4DV2O 5J2TB 2VQEO 2EZOA 2QA4V 2RQ6A 2WLNA 3UO2A 1YJ9V 1YSCA 5IE9A 4DR3O 4WFAV 3IJ4A 2UUBB 5DEDA 1J5EO 1BGYH 1U96A 1Q43A 4JI8O 1JA8A 4N21A 4DO2A 3OR6C 3AG3B 3N2KB 2BTQA 2B1GA 1YXBA 4GKKO 5EYPA 1KC8W 3OE7G 2WAMA 3F5TA 3HPLC 4BIZA 4X1KB 2GBOA 4I5SA 3RN4A 2YC0A 2A79B 4UCSA 3DC5A 4B7KA 1RPOA 1WN7A 4DV6B 1XILA 5L3BA 3FB5C 5JQGA 2QGNA 1CXZB 5LMUB 4B3TB 5H6RA 1V55C 2ZCEA 1WJZA 2CTRA 4DV4O 2GTSA 5CBGA 1WP8A 2G38A 4UB6Z 1QR8A 3JASB 5LXTA 1SQXH 4FVMA 4X20A 2W6JG 1YTFD 3KCXA 2YI8A 4WFHA 5JJNB 2R9RB 4O4HB 1SA0A 5DM6V 2K9PA 5KAIZ 4DV0O 1XHZA 1G8MA 1L0NH 2ADPA 3L74H 1H2GA 1PL0A 3WG7B 2ZINA 2ZE7A 1VARA 3VBBA 1HNWO 4BAYA 1XQ8A 2CDYA 3RYFB 3C90A 5H6QA 1OCOC 4Z1VA 4X1YA 2WLLB 3E83A 5BMVA 2YIBD 3ZHUA 1SS3A 5B1BC 1TVKB 5FNVA 4Z1MG 3THOA 2ZQMA 2IH3C 4LC1A 4HAMA 3FAVA 4MVSA 2H8PC 2CH7A 2DJVA 1AI4A 3RBZA 2WLKA 3ABUA 5B3SC 1XL4A 5BR8B 4EB6B 2JDIG 1GN3A 5CA0A 3JCZA 5GONA 1V54B 2LO1A 2E74B 1QQCA 4LH7A 3HB3B 4I0XB 2QWNB 1VMGA 2F23A 1U97A 3B8MA 1OV9A 2ADQB 2YDEA 2Q73A 2PYLA 3OT7A 1ZUQA 3LSQA 3LDEA 4OPHA 4RUEA 2RNBA 1KYOF 4LF7B 2P4VA 2IM9A 2ZDIC 3CXHF 1OZ0A 3FX7A 3ASNB 1HNZB 4LF8B 1S5HC 1NZ6A 3R65A 2DQ0A 1VQKV 5IJ9B 5IJ0B 1FD9A 1WPBA 2XTAA 1FXKA 4DK0A 3ZMVA 1NBMG 1I94B 3M99B 4JI6O 5IWAB 4XDKA 4MVRA 4IL6Z 2GUZA 4J7ZA 1IURA 2JEXA 1F23A 3PJSK 2Q69A 3JD4A 1SQQH 3JCUZ 3G6EV 2ZR3A 2HR3A 2IU3A 4I7ZB 4B3SB 4PA4A 2H94A 4MTGA 3X2QC 4FFKA 2XAQA 3P30A 4JI2B 1GKFA 4UVBA 4LNUB 2QE7G 4TV8A 1IBMO 2PF4E 4LFCB 2ZE8A 3G6BA 1BSMA 1K33A 1YDXA 4MVMA 2QR4A 2UUAO 4CBCA 5CA3A 3IFXA 1NR7A 3HKCA 2EIMC 4DV2B 3CJHB 3BVOA 3VQYA 1K5QA 2P22C 4DR1O 3WU2Z 1EBOA 1PP9H 1B6QA 5IY5C 5HFMA 2IJJA 4DR3B 1IZ3A 4PI2A 1XEQA 2P4KA 1I0HA 4I50B 4DV7O 3T1YO 3DXRB 1J5EB 1KU9A 4RO2A 4TWKA 1M90W 3U0ZA 3O65A 1KB9F 3SJAC 4JAUA 1IBLO 2KKWA 4PDVA 3CMEV 4FM1A 4UCOA 4KUMA 5BY1A 1QHTA 3P3NA 4ZI7B 1S5LZ 1EN5A 3E8FA 3IC9A 2KG7B 3K57A 1M57C 4I55B 3I55V 3FKSG 5JH7A 3SYCA 1N33O 1XNRO 2B9ZA 1EZJA 4WFBV 1VQPV 1MA1A 4X1IA 5IDJA 4U7OA 4ZHQB 1AP6A 5KHHA 4MTFA 4DV4B 1AILA 2X0LA 1F7YA 2N74A 2ODMA 2WLIB 4O2AB 1Q7YW 3QO7A 2Y69B 1D5NA 2W6IG 2Y48A 5EC1C 4EEQA 4DV0B 4NTWA 2VQFO 4AI8A 1QLNA 4FPPA 4F6RA 1HNWB 3ABMC 2Q68A 4LP8A 4CH5A 2Q7HA 3WB2A 3UT5B 4IIJA 4D6TH 4YJ2A 5L3DA 2DE0X 3OUSA 2EJ7A 3RVYA 3I56V 3K58A 1Y76B 1GN4A 3STLC 1MMMA 4JZ2A 2FL4A 3TJTA 4GLXA 4HNAB 1T5EA 4K8ZA 4MVOA 2YIAA 2QWPB 3ZMTA 4EFEA 4PV1B 1GN6A 1QLEB 4H33A 1YI2V 1PNKA 1WPXA 4TQDA 1MABG 1S72V 4B3RO 2LW7A 2ZIMA 2Z0AA 1JJOA 4O4LB 3K9AA 1S77D 1ZL8B 1PKXA 4O4JA 4J41A 1R6TA 3KZIZ 4NR1A 4QE9A 1SZTA 5KA5A 5L3CA 1PL4A 4JV5O 2HLDG 1NKDA 5BZBA 2FTKA 4AILC 4X88A 4DR2O 4CS2A 2QDOA 3CRRA 4B7EA 3EHBB 3B09A 3Q4HB 1HW7A 3CCUV 1JFFA 4IHJB 1KKDA 3PN1A 1OCRB 3QG5A 2OCCC 3K03A 4JI6B 3JD0A 3CP1A 3AG7A 1FFTB 4FMTA 2ARHA 3DSQA 1O9GA 4QJFB 4GUNA 3QNEA 4TSFG 2JJ2G 4CZZA 1SRYA 1QVFU 1QU7A 2X6AA 3A2FA 1NQTA 1DTOA 2EX3A 3ZRSA 5H9CA 1OCCC 1SKVA 1H8EG 3SGIA 3OFNG 1VQ6V 4FLTA 2W0FC 4O2BB 3N27A 3ZMUA 4O4IB 4W4LA 1AI5A 1TAEA 3SPCA 3L72H 3LSSA 3SPIA 5B66Z 3CX5F 3CCVV 2NLJC 2IJKA 3K04A 4CS4A 3CCJV 2QWRB 1F4MA 4PD4F 2Q67A 4LF6O 5EZYA 1ZAUA 2UUAB 3W7TA 2Q5ZA 2JVDA 3TGUH 1XHXA 1Q6UA 2ZM6O 2M6YA 5J2UA 1GMGA 4DR1B 3W7SA 3L75H 2X6CA 2F4VO 3B40A 1TA8A 3U10A 3APQA 4LCUC 2Z5UA 5CBFA 4KP4A 2BSKB 2ZIOA 3JAWA 4DV7B 3T1YB 1JJ2U 3W7UA 4PI0A 2F43G 5KMGB 1FXVA 1MSDA 2RMKB 5GTHZ 4UVCA 3B2EE 4JAAA 3CC4V 1IBLB 3QO5A 3ML0A 1N4CA 4CS3A 4DUYO 4GKJO 3LDDA 2PYJA 2ETNA 2XAHA 1MG1A 1MSWD 3UCSC 3WFVA 2QM4A 4PDMA 2UXCO 5E79Z 1OCOB 2WLJA 4ZOLA 1XNRB 1N33B 2YIDA 3H1KH 4DW0A 5L3GA 5LOVB 3T2MA 2L6LA 2DYRC 4MTXA 4FIPC 3ZHVA 3H1LH 1F4NA 1YTFB 5LP6C 1W0JG 2A9HA 4NB5A 5IT9N 5DECA 2UXDB 3E8HA 2HG5C 3QTCA 4DR7O 4PJ0Z 4DRXA 2M7WA 3RYIB 4MVQA 1UPGA 1Y6XA 3ZHRA 4NYKA 3RYHA 4LH6A 4IYIA 5LHGA 5JVDB 2R72A 5LMNO 2GV9A 4BR6A 3SR2C 4U7NA 2LQTA 1WLEA 5KUMA 5LHHA 2QEXV 2WPDG 5ITZA 3OD4A 3RFRA 2E3CA 4H0LB 2N04A 3HKBA 3DC6A 1WP7A 3BEHA 2XAJA 3S3WA 1H2MA 2V4DA 3ZRVA 5EC2C 2BTOA 5F2VO 4LNUA 4B3RB 4I4TA 2P90A 4ABMA 4NKGB 3GWKC 4QE7A 5IYBO 1H2LA 3N2GB 4UCRA 3VOUA 1K9MW 3S3XA 4LFAO 3EVKA 1YHQV 4KXRA 4RQFA 3BHPA 4OPAA 1HDJA 2OYQA 4JV5B 1THZA 3K5OA 1LNQA 5LGTA 3P32A 5BXZA 1Q3EA 4DR2B 3X2QB 2UXNA 3OTFA 4GT1A 1KUQA 3ETDA 2QKCA 1FFXA 2JEUA 4MTOA 2P7TC 1BQ0A 3CEIA 4ICGA 4QIWF 5FPRA 3ZJZA 4JI0O 4FLWA 4NXMO 4R8CA 3JALB 1WA8B 1GM7A 1Q86W 4QGPA 4JI5O 2C2AA 4GYCB 1AJNA 1TUBB 2Q7GA 1N36O 5IY5B 3OTOO 5B1OA 3ASOC 2VWKA 1WB8A 4QPKA 1YVWA 4TV9B 1AJPA 3CS5A 1VQNV 1KD1W 1GO3F 4KL1A 4L87A 1DF4A 3JAKB 1V9PA 2XAFA 3JAMN 3E86A 3K06A 3B4SA 2E76B 4YY3O 4JZGA 3ABLB 3AG4C 4LF6B 2NR5A 5LGUA 1RM1C 3E22B 4JI7O 1JVMA 2WLIA 2DWEC 2KSDA 4O2AA 3MD0A 1NTKH 1TGOA 1M57B 1H2KA 1W59A 2DW4A 1M1KW 2CUGA 1M56C 1R3IC 3CC7V 2ZM6B 4D7TA 3VQXA 1PPJH 4LF4O 3FD9A 3OMAB 3DTUB 2F4VB 4MVZA 4DV3O 2EULA 3KCYA 5K1PA 4YJ3B 4LWSB 2Q4PA 4CH4A 1AROP 3T1HO 1G4YB 1GM9A 5A9GA 3G71V 5H2FZ 3CWBH 1ENVA 1VQMV 4NXNO 3C3SA 4JTCB 3P3PA 2O57A 3UO3A 4DUYB 2D2CB 2ZE6A 4GKJB 2Y0PA 3M7MX 4JYYA 5CB4A 4WFGA 2JGDB 1N8RW 3ABKC 2EINB 5IYCO 2VWJA 1SQBH 3BA9A 5LYJA 3L9DA 4TUYB 5LP6A 1XOUA 3JSLA 3J80N 2UXCB 1OHHG 2ZR2A 3JATB 2EIKC 2Y0IA 4CH6A 5GW7A 1YF2A 1E1RG 1QR9A 3BRCA 3IGAC 3E89A 4BWAA 1EN6A 5DN6G 3U11A 2P6JA 1LR1A 3JARB 1SQPH 3APOA 1ZX3A 3IAYA 4PDRA 4DR7B 2P06A 1IXBA 3TXQA 3AG3C 1PM9A 3LNNA 1XREA 3ZIAG 5KX5B 2EILC 4X89A 3CRQA 2JJ1G 3MHSC 2HVKC 4Z2WA 1FKAO 1RSOA 1R6NA 1Z2GA 1QVGU 5LMNB 1R6KA 4BW5A 3HKEA 1L8DA 1K4DC 2VQEB 4ZIBA 4K0KO 4WFEA 4JI4O 5IYZA 5LGNA 3K0GA 1B04A 1P4RA 3RVZA 2BTQB 3E8BA 4DR5O 1S0VA 4FFBA 1K73W 4LR3A 5EYPB 2CGOA 2X6BA 3JSNA 4YHHO 1K92A 3OEEG 2CTPA 4O2BA 1BZKA 4EFBA 3BY6A 2RN9A 2DYSC 4JI8B 4JTDB 4MT8A 1DF5A 4FLZA 1Z5WA 5EBMC 2KQXA 5JQGB 4LFAB 4GKKB 1VF6A 5EBWC 2MK3A 1OCCB 2YEVA 4WCEV 1NTZH 3ZMSA 3ZHSA 5EK0A 2P67A 1PNLA 2IW5A 1URFA 2DWDC 4JASA 1RP3B 3ZMZA 5LXTB 3O9OA 1N32O 4X20B 1YEWA 1Y66A 4DYLA 4N23A 1E79G 3UM7A 2CTWA 2N05A 2HJFC 1SA0B 1WNSA 1Q6IA 3GB7C 3K0DA 1V54C 3ICXA 4JI0B 4NXMB 3MHHC 5EBLC 2LGWA 1Q81W 4K35A 3ZRWB 3H1HH 4X1YB 5BMVB 1SC5B 2Q8VA 3OMIB 5FNVB 5JWPA 2CAZC 5D5PA 4IT5A 1N36B 3JD2A 4B3MO 1D2DA 2X7RB 3OTOB 3D36A 4WBNA 3FAVB 3LNMB 1JCHA 3AK2A 3M8AA 2CH7B 3BAAA 1XBLA 5CA0B 5GONB 4U3JA 3L70H 3JD1A 2E5LO 2IBZH 1MNGA 4FJCC 1W0KG 4YY3B 2MW2B 1DK1A 4JI7B 1WB7A 4LBEC 5CA1A 2KB1A 4OGQB 5KA6A 2PI5A 3GWOA 1NI8A 2LFRA 2ILMA 2HVJC 3FB8C 4XDLA 1Y74A 5LHIA 4LF4B 4JYBA 3CCMV 3VQWA 1HR0O 3H1JH 3H9VA 2EZPA 2FYUH 2NN4A 2QWOB 4UXNA 4GX1A 4OXSA 3ZRXA 5A2QN 4DV3B 3K5LA 2DYRB 4BW9A 4NTYA 2BOCC 1FXKB 3T1HB 4C7UA 1HWYA 4FK5C 3SPJA 4QPJA 3G80A 4NXNB 2IJIA 3RYCA 2ZNIA 5J2TA 4PELA 1N0NA 3FB6C 3RWRD 2OIEA 3I5DA 2GUZB 4F4LA 3TCUA 5LA6B 4ZKIA 4LFBO 1KP2A 5KHJA 3N2KA 3F7YC 3L71H 2WLHA 4DW1A 2WWWA 4LF9O 2RJZA 2XASA 4TV8B 1VQ8V 2IU0A 3C3TA 2HHHO 4B3TO 2R70A 1DLBA 1FPOA 4PA6A
chains in the Genus database with same CATH topology
5LMNO 4LF7O 4JI8O 3M8AA 3JAMN 4JI1O 1HNZO 1XEQA 1FKAO 4LF8O 4YY3O 4DV7O 2ZM6O 3T1YO 4OPHA 4OX9O 1FYJA 4JI7O 2JRIA 2F4VO 4GKKO 2UUCO 4B3RO 2E5LO 4DV6O 2LW7A 3F5TA 1AB3A 3O65A 2Z0AA 1N34O 1I94O 5LMUO 1XNQO 1IBLO 5H5NA 4KHPO 4K0KO 4JI4O 4LF4O 1DK1A 4DR5O 5BY1A 1R6TA 5IWAO 3J81N 1X59A 4X64O 4DV3O 4AQYO 4JV5O 4YHHO 4DUYO 3T1HO 2ZKOA 1YZBA 4DR2O 1D2DA 4GKJO 4DV4O 2UXDO 1N33O 4LFAO 4LF5O 1XNRO 1HR0O 3RT3C 4JI6O 5A2QN 1XMQO 4OPAA 4NXNO 4DV1O 5LL6Y 4X65O 4DUZO 3R66A 2UXCO 5BXZA 4B3SO 1AILA 1KUQA 1XMOO 1F7YA 2N74A 4DV0O 4X62O 2UU9O 4JI2O 4A5UB 5FLXN 3SDLA 3J80N 4JYAO 1HNWO 1FJGO 1HNXO 4LFCO 1N32O 4JI0O 4NXMO 2VQFO 1IBKO 4DR1O 4DR6O 5BR8O 5IT9N 1A32A 1IBMO 4JI5O 2FKXA 4DR4O 2UXBO 4DV2O 4LFBO 3J7AU 4DR7O 2AGAA 2UUBO 1G1XB 2VQEO 1N36O 2DJVA 3OTOO 1R1BA 4JI3O 2DOSA 2UUAO 4X66O 4DR3O 4LF9O 2HHHO 1NS1A 4B3TO 4DV5O 4B3MO 1J5EO 4LF6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN O;  4LF7 O;  4JI8 O;  3M8A A;  3JAM N;  4JI1 O;  1HNZ O;  1XEQ A;  1FKA O;  4LF8 O;  4YY3 O;  4DV7 O;  2ZM6 O;  3T1Y O;  4OPH A;  4OX9 O;  1FYJ A;  4JI7 O;  2JRI A;  2F4V O;  4GKK O;  2UUC O;  4B3R O;  2E5L O;  4DV6 O;  2LW7 A;  3F5T A;  1AB3 A;  3O65 A;  2Z0A A;  1N34 O;  1I94 O;  5LMU O;  1XNQ O;  1IBL O;  5H5N A;  4KHP O;  4K0K O;  4JI4 O;  4LF4 O;  1DK1 A;  4DR5 O;  5BY1 A;  1R6T A;  5IWA O;  3J81 N;  1X59 A;  4X64 O;  4DV3 O;  4AQY O;  4JV5 O;  4YHH O;  4DUY O;  3T1H O;  2ZKO A;  1YZB A;  4DR2 O;  1D2D A;  4GKJ O;  4DV4 O;  2UXD O;  1N33 O;  4LFA O;  4LF5 O;  1XNR O;  1HR0 O;  3RT3 C;  4JI6 O;  5A2Q N;  1XMQ O;  4OPA A;  4NXN O;  4DV1 O;  5LL6 Y;  4X65 O;  4DUZ O;  3R66 A;  2UXC O;  5BXZ A;  4B3S O;  1AIL A;  1KUQ A;  1XMO O;  1F7Y A;  2N74 A;  4DV0 O;  4X62 O;  2UU9 O;  4JI2 O;  4A5U B;  5FLX N;  3SDL A;  3J80 N;  4JYA O;  1HNW O;  1FJG O;  1HNX O;  4LFC O;  1N32 O;  4JI0 O;  4NXM O;  2VQF O;  1IBK O;  4DR1 O;  4DR6 O;  5BR8 O;  5IT9 N;  1A32 A;  1IBM O;  4JI5 O;  2FKX A;  4DR4 O;  2UXB O;  4DV2 O;  4LFB O;  3J7A U;  4DR7 O;  2AGA A;  2UUB O;  1G1X B;  2VQE O;  1N36 O;  2DJV A;  3OTO O;  1R1B A;  4JI3 O;  2DOS A;  2UUA O;  4X66 O;  4DR3 O;  4LF9 O;  2HHH O;  1NS1 A;  4B3T O;  4DV5 O;  4B3M O;  1J5E O;  4LF6 O; 
#chains in the Genus database with same CATH topology
 4X1K A;  2Q6A A;  3CCL V;  1AJQ A;  4JI1 O;  4R7C A;  1ZWI C;  3MDS A;  1L1F A;  1ORQ C;  3FFQ A;  3HKC B;  3D8C A;  1JQ0 A;  4YIO A;  2F66 C;  3D3Q A;  1IBM B;  3OR7 C;  1Y4M A;  1Z5V A;  3JAS A;  1R3L C;  1O9H A;  1NH2 D;  4Q20 A;  4O4H A;  3ZBH A;  4IYH A;  4K0K B;  4JI4 B;  5KUK A;  5AG2 A;  2A0L A;  3ABT A;  3CPW U;  3RT3 C;  4DR5 B;  1JMK C;  1K8A W;  1FXH A;  1H2S B;  3CCR V;  3K08 A;  3ZHT A;  2XT9 A;  1PV0 A;  1V55 B;  3RYF A;  1PD3 A;  5C8Y B;  4DUZ O;  2IJH A;  4YHH B;  2WLL A;  2QSA A;  1QNM A;  1TVK A;  1XMO O;  2CE4 A;  5JH7 B;  1G6U A;  3ZED A;  4PA9 A;  2YI9 A;  2OTJ V;  5L3E A;  2AZ0 A;  1I5X A;  1HNX O;  1CP9 A;  3BPZ A;  4X1I B;  4WFF A;  4EB6 A;  3ASO B;  3SJQ C;  2PTM A;  1IX9 A;  3K5N A;  4DR6 O;  2XOK G;  4I0X A;  1IVS A;  1K34 A;  1N32 B;  5B1B B;  2B5U A;  1G1X B;  4HBN A;  2H3O A;  3AG1 C;  1R1B A;  2V1D A;  4JI3 O;  2DOS A;  4LWS A;  3H01 A;  4F6R B;  3AG4 B;  2PGG A;  1RM1 B;  4DV5 O;  2A06 H;  2E75 B;  5B3S B;  1KMI Z;  4YIP A;  5B1N A;  3SYA A;  1GK9 A;  4IIJ B;  4YJ2 B;  3T4Z A;  4FLV A;  1Y67 A;  1XL6 A;  3NXS A;  1M56 B;  5IJ9 A;  4PDL A;  5IJ0 A;  2YIC A;  2VQF B;  4B3M B;  3OGC C;  5D5Q A;  4OX9 O;  3ETG A;  2Y4T A;  3W7W A;  1TUE B;  5JJE B;  4FLU A;  2PY5 A;  1XNQ O;  2QKA A;  3A8T A;  4CH3 A;  1Q5O A;  5TIS Z;  3A0B Z;  5LBQ A;  3EXA A;  2E5L B;  1JR9 A;  4G27 B;  1K5S A;  1EFR G;  1P49 A;  4MSW C;  2RCV A;  1YZB A;  1AR1 B;  1BL8 A;  4JYC A;  4P9O A;  4LF5 O;  4W4K A;  1Q8I A;  1XMQ O;  1Q90 D;  1NVP B;  4UB8 Z;  2AZ2 A;  1UFI A;  5HFL A;  3STZ C;  4O4J B;  2QTO A;  3ETE A;  4X65 O;  3LSU A;  3GVM A;  3SPH A;  2OCH A;  1HR0 B;  5KX5 A;  2YSU B;  2BE3 A;  2UU9 O;  1AR5 A;  4XDJ A;  3SDL A;  1JFF B;  1AP5 A;  1K3E A;  3CJH A;  2FB5 A;  1ZLZ A;  1SQF A;  1SQG A;  2GHY A;  4UCT A;  3FB7 C;  2AGA A;  2QKS A;  4B08 A;  1X4T A;  2WA4 A;  3W7X A;  2EIL B;  1NJI W;  4J42 A;  1SF9 A;  1P7G A;  3CYO A;  4UFZ A;  4I50 A;  1YIJ V;  1S5J A;  2Y4U A;  1VF6 C;  1NR1 A;  3DXR A;  5EIB D;  4H13 B;  4LFB B;  2HJD A;  4UVA A;  1YJW V;  3R66 A;  4G2K A;  1BS3 A;  5KHG A;  3ZN0 A;  1L0L H;  3KKY A;  2EIM B;  1SZX A;  3SYQ A;  3E8G A;  4LF9 B;  2CGN A;  1EZV H;  2HHH B;  1GAX A;  1KP3 A;  1S76 D;  2L35 A;  4ZI7 A;  3AG2 C;  1VEW A;  1KBH A;  1SES A;  3IC7 A;  4FZ0 A;  3OUF A;  2KG7 A;  2UUC O;  2DQ3 A;  4I55 A;  4JI1 B;  5EZY B;  1AB3 A;  2DN9 A;  1VQ7 V;  1GM8 A;  4GX0 A;  4CC5 A;  3B77 A;  5EIB C;  2DYS B;  1H38 A;  4RUF A;  5J2U B;  3B8N A;  4ZHQ A;  4X64 O;  3JD3 A;  1OCZ C;  4AQY O;  3D36 C;  5B1A C;  1E1Q G;  3CCS V;  4J9Z B;  3K3W A;  3JAW B;  3HKD B;  3ZRW A;  4K8X A;  2F95 B;  5LL6 Y;  1D5A A;  3OMN B;  4I9Q A;  2LJ2 A;  2ATK C;  1NVP D;  3AK3 A;  5J9P C;  3OW2 U;  2Z3Y A;  5JCO A;  3KG2 A;  4A5U B;  3CE2 A;  3T1C A;  4DUZ B;  1H8H G;  3UT5 A;  4JYA O;  1R3K C;  4I9W A;  1FJG O;  1R3J C;  1XMO B;  1Y76 A;  1P7B A;  3CRA A;  4ZOL B;  4UCV A;  4PA7 A;  3CCQ V;  1DGS A;  4GCZ A;  3SJC C;  4J11 A;  4MW3 A;  2EIJ C;  1GN2 A;  1VQ4 V;  1BT8 A;  4HNA A;  1HNX B;  4JF3 A;  1SQV H;  2Q7E A;  2JGU A;  1ZTE A;  2HKO A;  3QF7 A;  2K1E A;  1FAF A;  2OT5 A;  4DR6 B;  3DGE A;  3ABM B;  2QTS A;  4R50 A;  1VIB A;  4JPR A;  4X66 O;  2ZXW C;  4P30 A;  1B06 A;  4IGG A;  5IYD O;  4JI3 B;  4DXW A;  3CXC U;  5CN0 A;  1QCE A;  4O4L A;  5KHK A;  3QVN A;  4DRX B;  3ZCC A;  1ZL8 A;  4PA3 A;  4DV5 B;  2DMX A;  1FYJ A;  2XND G;  3RYH B;  1XUQ A;  4NVP A;  1EM1 A;  4U3F H;  4NTX A;  2EBO A;  4TT3 G;  4RQE A;  2IH1 C;  4KHP O;  2HP8 A;  2JK5 C;  4OX9 B;  3Q4H A;  4XBF A;  1EN4 A;  5ITZ B;  4IHJ A;  4RWU A;  1WAZ A;  5LA6 A;  3J81 N;  1X59 A;  2BOB C;  1JX9 A;  4R6Z A;  1XNQ B;  3ZX6 A;  3HKB B;  4AHC A;  4H37 A;  2JS5 A;  3WB0 A;  4DV1 O;  4K3A A;  4I4T B;  1FS0 G;  4DK1 A;  2PI4 A;  3ZHQ A;  4LF5 B;  3CD6 V;  4ASU G;  1XMQ B;  4MS2 A;  4X65 B;  1K4C C;  2VRZ A;  2QM8 A;  2XAG A;  2OCC B;  5FL7 G;  1COW G;  5JJJ B;  2LGQ A;  4O4I A;  1ZSP A;  2W0X A;  4FZ1 A;  1IBK O;  1K97 A;  2UU9 B;  3FYI B;  2A3Q A;  1PNM A;  4DR4 O;  3VQV A;  3WG7 C;  1FFX B;  2UXB O;  3EFF K;  1JPX A;  3G4S V;  2HFE C;  3J7A U;  3JYC A;  1AR4 A;  1H2N A;  1BE3 H;  2AHZ A;  1KEC A;  2ZE5 A;  1VF5 B;  1NU1 H;  3AK1 A;  2CTQ A;  2BSK A;  3ABL C;  1MZF A;  5C8Y A;  3SYP A;  5KMG A;  4FLY A;  3OM3 B;  3K5M A;  1BQZ A;  1VQ5 V;  1I5Y A;  1M9N A;  2JRI A;  4J7J A;  2XUM A;  2RDC A;  4JI5 B;  5KAF Z;  5K1X A;  1N34 O;  1HP8 A;  4BIU A;  2QWQ B;  2VS0 A;  5H5N A;  4FM0 A;  1BHB A;  2A7W A;  3RW0 A;  3CRC A;  2UUC B;  4GX5 A;  4TQF A;  4WF9 V;  3OAA G;  3E2E A;  4JTA B;  4BIO A;  4FM2 A;  1J95 A;  3ASN C;  2PZS A;  5LOV A;  1OJH A;  2OIG A;  1M93 A;  2HEP A;  2UXD O;  4J10 A;  4TOI A;  2BCC H;  2OTL V;  4X64 B;  3CSX A;  3BFR A;  3A0R A;  4AQY B;  4J9Y B;  2EIN C;  1NH2 B;  2P5O A;  2GSM B;  4X62 O;  2LFS A;  2LW1 A;  4F6E A;  3RYI A;  5CMU A;  4JAV A;  3AG1 B;  3TK1 A;  2YIB A;  1MZE A;  2F1M A;  1SET A;  4D7S A;  1B3Q A;  5CB4 B;  1A32 A;  4KFM A;  4JYA B;  2NNU A;  1US6 A;  3HR0 A;  5LYJ B;  1FJG B;  1NT2 B;  2GTA A;  1VQL V;  5JVD A;  1YJN V;  2ZDI A;  5LP6 B;  2UUB O;  2R9A A;  4MVU A;  3F7V C;  1M4U A;  1RFY A;  2PUS A;  4CC6 A;  1NS1 A;  1I08 A;  4UUJ C;  2YS8 A;  1K7D A;  4X8A A;  2ZD9 A;  4X66 B;  3L73 H;  2AHY A;  1AI6 A;  4QNH B;  3CB2 A;  2CK3 G;  3CCE V;  2EJR A;  4DV6 O;  2ITD C;  2JIZ G;  2YXH A;  5GTI Z;  1MOF A;  1W2B U;  3N2G A;  5LMU O;  2D3O W;  5KLV H;  3RGB A;  1SER A;  3K59 A;  1RSO B;  3H1I H;  3CHX A;  2WA3 A;  2FML A;  2AW9 A;  3CRM A;  4H44 B;  3ZS8 C;  4KHP B;  3HKE B;  1VP7 A;  3AEI A;  5B5E Z;  5IYZ B;  1GH6 A;  1QBZ A;  1ROP A;  1YIT V;  1CEZ A;  4L8J A;  4FFB B;  2V7Q G;  3JAL A;  1WA8 A;  2YXY A;  1NTM H;  2F93 B;  3SPG A;  5CBH A;  3ETQ A;  3A0H Z;  4DV1 B;  1RPR A;  1TUB A;  5FLX N;  3CMA V;  2LP7 A;  1GTO A;  5L3F A;  1I7F A;  4TV9 A;  1CPY A;  4PHZ A;  3F5W C;  3LDC A;  5BR8 O;  2YEV B;  4E4E A;  3JAK A;  2B1I A;  2QJ1 A;  2WLM A;  3D3I A;  2QM7 A;  2Y69 C;  1IBK B;  1KKC A;  2Q9L A;  4FLX A;  1R73 A;  3MAQ A;  2Q0O C;  4DR4 B;  1AI7 A;  3LUT B;  1IDS A;  4Q6G A;  2UXB B;  1GRJ A;  3E22 A;  3AG2 B;  1F51 A;  5JCO C;  4J7K A;  3HKD A;  3UQ8 A;  3E35 A;  1M5I A;  4LF7 O;  1YCI A;  4UV9 A;  3UKM A;  4E2L A;  1VQ9 V;  3T4D A;  2ZT9 B;  1HNZ O;  1UJW B;  4LF8 O;  3BCC H;  3K79 A;  3G67 A;  3FYE B;  1N0J A;  4GZR B;  4X9Q A;  1OCZ B;  4YJ3 A;  3SYO A;  4HYO A;  2AXT Z;  3CC2 V;  5C93 A;  4WBN B;  1I94 O;  1AVM A;  2R9I A;  5B1A B;  4G28 B;  3K9S A;  2ITC C;  1XI1 A;  2OWO A;  1LUW A;  4GX2 A;  1QLE C;  5IWA O;  1BCC H;  4U3J B;  3BA8 A;  1N34 B;  4JGS A;  1KQS U;  2JGD A;  2ZKO A;  4RAI A;  1FXK C;  2UXX A;  4TUY A;  4P9P A;  4ZBM A;  3OEH G;  5E1A C;  1P84 F;  2WSS G;  3TXS A;  3JAT A;  3TET A;  1Q6H A;  5CA1 B;  2GDS A;  4HZ3 A;  1VF7 A;  3BAB A;  3ZN1 A;  4B3S O;  1Q82 W;  1IXM A;  4EKW A;  2XHB A;  2Q0A A;  3QO8 A;  3WB1 A;  1Y74 B;  2YXL A;  2YUA A;  3OGI B;  4JI2 O;  2EIJ B;  5FPO A;  4P2Z A;  4YXW G;  1BMF G;  2ZNJ A;  1XDC A;  4LFC O;  1OCR C;  5KHI A;  3ABK B;  3NR7 A;  1LUV A;  3JAR A;  1VQO V;  4X62 B;  2JS3 A;  1BHA A;  4MW8 A;  1S3J A;  3SJB C;  4J80 A;  4UCU A;  2ZXW B;  2FKX A;  2EIK B;  1JOY A;  3RYC B;  4UV8 A;  4DV2 O;  5J2T B;  2VQE O;  2EZO A;  2QA4 V;  2RQ6 A;  2WLN A;  3UO2 A;  1YJ9 V;  1YSC A;  5IE9 A;  4DR3 O;  4WFA V;  3IJ4 A;  2UUB B;  5DED A;  1J5E O;  1BGY H;  1U96 A;  1Q43 A;  4JI8 O;  1JA8 A;  4N21 A;  4DO2 A;  3OR6 C;  3AG3 B;  3N2K B;  2BTQ A;  2B1G A;  1YXB A;  4GKK O;  5EYP A;  1KC8 W;  3OE7 G;  2WAM A;  3F5T A;  3HPL C;  4BIZ A;  4X1K B;  2GBO A;  4I5S A;  3RN4 A;  2YC0 A;  2A79 B;  4UCS A;  3DC5 A;  4B7K A;  1RPO A;  1WN7 A;  4DV6 B;  1XIL A;  5L3B A;  3FB5 C;  5JQG A;  2QGN A;  1CXZ B;  5LMU B;  4B3T B;  5H6R A;  1V55 C;  2ZCE A;  1WJZ A;  2CTR A;  4DV4 O;  2GTS A;  5CBG A;  1WP8 A;  2G38 A;  4UB6 Z;  1QR8 A;  3JAS B;  5LXT A;  1SQX H;  4FVM A;  4X20 A;  2W6J G;  1YTF D;  3KCX A;  2YI8 A;  4WFH A;  5JJN B;  2R9R B;  4O4H B;  1SA0 A;  5DM6 V;  2K9P A;  5KAI Z;  4DV0 O;  1XHZ A;  1G8M A;  1L0N H;  2ADP A;  3L74 H;  1H2G A;  1PL0 A;  3WG7 B;  2ZIN A;  2ZE7 A;  1VAR A;  3VBB A;  1HNW O;  4BAY A;  1XQ8 A;  2CDY A;  3RYF B;  3C90 A;  5H6Q A;  1OCO C;  4Z1V A;  4X1Y A;  2WLL B;  3E83 A;  5BMV A;  2YIB D;  3ZHU A;  1SS3 A;  5B1B C;  1TVK B;  5FNV A;  4Z1M G;  3THO A;  2ZQM A;  2IH3 C;  4LC1 A;  4HAM A;  3FAV A;  4MVS A;  2H8P C;  2CH7 A;  2DJV A;  1AI4 A;  3RBZ A;  2WLK A;  3ABU A;  5B3S C;  1XL4 A;  5BR8 B;  4EB6 B;  2JDI G;  1GN3 A;  5CA0 A;  3JCZ A;  5GON A;  1V54 B;  2LO1 A;  2E74 B;  1QQC A;  4LH7 A;  3HB3 B;  4I0X B;  2QWN B;  1VMG A;  2F23 A;  1U97 A;  3B8M A;  1OV9 A;  2ADQ B;  2YDE A;  2Q73 A;  2PYL A;  3OT7 A;  1ZUQ A;  3LSQ A;  3LDE A;  4OPH A;  4RUE A;  2RNB A;  1KYO F;  4LF7 B;  2P4V A;  2IM9 A;  2ZDI C;  3CXH F;  1OZ0 A;  3FX7 A;  3ASN B;  1HNZ B;  4LF8 B;  1S5H C;  1NZ6 A;  3R65 A;  2DQ0 A;  1VQK V;  5IJ9 B;  5IJ0 B;  1FD9 A;  1WPB A;  2XTA A;  1FXK A;  4DK0 A;  3ZMV A;  1NBM G;  1I94 B;  3M99 B;  4JI6 O;  5IWA B;  4XDK A;  4MVR A;  4IL6 Z;  2GUZ A;  4J7Z A;  1IUR A;  2JEX A;  1F23 A;  3PJS K;  2Q69 A;  3JD4 A;  1SQQ H;  3JCU Z;  3G6E V;  2ZR3 A;  2HR3 A;  2IU3 A;  4I7Z B;  4B3S B;  4PA4 A;  2H94 A;  4MTG A;  3X2Q C;  4FFK A;  2XAQ A;  3P30 A;  4JI2 B;  1GKF A;  4UVB A;  4LNU B;  2QE7 G;  4TV8 A;  1IBM O;  2PF4 E;  4LFC B;  2ZE8 A;  3G6B A;  1BSM A;  1K33 A;  1YDX A;  4MVM A;  2QR4 A;  2UUA O;  4CBC A;  5CA3 A;  3IFX A;  1NR7 A;  3HKC A;  2EIM C;  4DV2 B;  3CJH B;  3BVO A;  3VQY A;  1K5Q A;  2P22 C;  4DR1 O;  3WU2 Z;  1EBO A;  1PP9 H;  1B6Q A;  5IY5 C;  5HFM A;  2IJJ A;  4DR3 B;  1IZ3 A;  4PI2 A;  1XEQ A;  2P4K A;  1I0H A;  4I50 B;  4DV7 O;  3T1Y O;  3DXR B;  1J5E B;  1KU9 A;  4RO2 A;  4TWK A;  1M90 W;  3U0Z A;  3O65 A;  1KB9 F;  3SJA C;  4JAU A;  1IBL O;  2KKW A;  4PDV A;  3CME V;  4FM1 A;  4UCO A;  4KUM A;  5BY1 A;  1QHT A;  3P3N A;  4ZI7 B;  1S5L Z;  1EN5 A;  3E8F A;  3IC9 A;  2KG7 B;  3K57 A;  1M57 C;  4I55 B;  3I55 V;  3FKS G;  5JH7 A;  3SYC A;  1N33 O;  1XNR O;  2B9Z A;  1EZJ A;  4WFB V;  1VQP V;  1MA1 A;  4X1I A;  5IDJ A;  4U7O A;  4ZHQ B;  1AP6 A;  5KHH A;  4MTF A;  4DV4 B;  1AIL A;  2X0L A;  1F7Y A;  2N74 A;  2ODM A;  2WLI B;  4O2A B;  1Q7Y W;  3QO7 A;  2Y69 B;  1D5N A;  2W6I G;  2Y48 A;  5EC1 C;  4EEQ A;  4DV0 B;  4NTW A;  2VQF O;  4AI8 A;  1QLN A;  4FPP A;  4F6R A;  1HNW B;  3ABM C;  2Q68 A;  4LP8 A;  4CH5 A;  2Q7H A;  3WB2 A;  3UT5 B;  4IIJ A;  4D6T H;  4YJ2 A;  5L3D A;  2DE0 X;  3OUS A;  2EJ7 A;  3RVY A;  3I56 V;  3K58 A;  1Y76 B;  1GN4 A;  3STL C;  1MMM A;  4JZ2 A;  2FL4 A;  3TJT A;  4GLX A;  4HNA B;  1T5E A;  4K8Z A;  4MVO A;  2YIA A;  2QWP B;  3ZMT A;  4EFE A;  4PV1 B;  1GN6 A;  1QLE B;  4H33 A;  1YI2 V;  1PNK A;  1WPX A;  4TQD A;  1MAB G;  1S72 V;  4B3R O;  2LW7 A;  2ZIM A;  2Z0A A;  1JJO A;  4O4L B;  3K9A A;  1S77 D;  1ZL8 B;  1PKX A;  4O4J A;  4J41 A;  1R6T A;  3KZI Z;  4NR1 A;  4QE9 A;  1SZT A;  5KA5 A;  5L3C A;  1PL4 A;  4JV5 O;  2HLD G;  1NKD A;  5BZB A;  2FTK A;  4AIL C;  4X88 A;  4DR2 O;  4CS2 A;  2QDO A;  3CRR A;  4B7E A;  3EHB B;  3B09 A;  3Q4H B;  1HW7 A;  3CCU V;  1JFF A;  4IHJ B;  1KKD A;  3PN1 A;  1OCR B;  3QG5 A;  2OCC C;  3K03 A;  4JI6 B;  3JD0 A;  3CP1 A;  3AG7 A;  1FFT B;  4FMT A;  2ARH A;  3DSQ A;  1O9G A;  4QJF B;  4GUN A;  3QNE A;  4TSF G;  2JJ2 G;  4CZZ A;  1SRY A;  1QVF U;  1QU7 A;  2X6A A;  3A2F A;  1NQT A;  1DTO A;  2EX3 A;  3ZRS A;  5H9C A;  1OCC C;  1SKV A;  1H8E G;  3SGI A;  3OFN G;  1VQ6 V;  4FLT A;  2W0F C;  4O2B B;  3N27 A;  3ZMU A;  4O4I B;  4W4L A;  1AI5 A;  1TAE A;  3SPC A;  3L72 H;  3LSS A;  3SPI A;  5B66 Z;  3CX5 F;  3CCV V;  2NLJ C;  2IJK A;  3K04 A;  4CS4 A;  3CCJ V;  2QWR B;  1F4M A;  4PD4 F;  2Q67 A;  4LF6 O;  5EZY A;  1ZAU A;  2UUA B;  3W7T A;  2Q5Z A;  2JVD A;  3TGU H;  1XHX A;  1Q6U A;  2ZM6 O;  2M6Y A;  5J2U A;  1GMG A;  4DR1 B;  3W7S A;  3L75 H;  2X6C A;  2F4V O;  3B40 A;  1TA8 A;  3U10 A;  3APQ A;  4LCU C;  2Z5U A;  5CBF A;  4KP4 A;  2BSK B;  2ZIO A;  3JAW A;  4DV7 B;  3T1Y B;  1JJ2 U;  3W7U A;  4PI0 A;  2F43 G;  5KMG B;  1FXV A;  1MSD A;  2RMK B;  5GTH Z;  4UVC A;  3B2E E;  4JAA A;  3CC4 V;  1IBL B;  3QO5 A;  3ML0 A;  1N4C A;  4CS3 A;  4DUY O;  4GKJ O;  3LDD A;  2PYJ A;  2ETN A;  2XAH A;  1MG1 A;  1MSW D;  3UCS C;  3WFV A;  2QM4 A;  4PDM A;  2UXC O;  5E79 Z;  1OCO B;  2WLJ A;  4ZOL A;  1XNR B;  1N33 B;  2YID A;  3H1K H;  4DW0 A;  5L3G A;  5LOV B;  3T2M A;  2L6L A;  2DYR C;  4MTX A;  4FIP C;  3ZHV A;  3H1L H;  1F4N A;  1YTF B;  5LP6 C;  1W0J G;  2A9H A;  4NB5 A;  5IT9 N;  5DEC A;  2UXD B;  3E8H A;  2HG5 C;  3QTC A;  4DR7 O;  4PJ0 Z;  4DRX A;  2M7W A;  3RYI B;  4MVQ A;  1UPG A;  1Y6X A;  3ZHR A;  4NYK A;  3RYH A;  4LH6 A;  4IYI A;  5LHG A;  5JVD B;  2R72 A;  5LMN O;  2GV9 A;  4BR6 A;  3SR2 C;  4U7N A;  2LQT A;  1WLE A;  5KUM A;  5LHH A;  2QEX V;  2WPD G;  5ITZ A;  3OD4 A;  3RFR A;  2E3C A;  4H0L B;  2N04 A;  3HKB A;  3DC6 A;  1WP7 A;  3BEH A;  2XAJ A;  3S3W A;  1H2M A;  2V4D A;  3ZRV A;  5EC2 C;  2BTO A;  5F2V O;  4LNU A;  4B3R B;  4I4T A;  2P90 A;  4ABM A;  4NKG B;  3GWK C;  4QE7 A;  5IYB O;  1H2L A;  3N2G B;  4UCR A;  3VOU A;  1K9M W;  3S3X A;  4LFA O;  3EVK A;  1YHQ V;  4KXR A;  4RQF A;  3BHP A;  4OPA A;  1HDJ A;  2OYQ A;  4JV5 B;  1THZ A;  3K5O A;  1LNQ A;  5LGT A;  3P32 A;  5BXZ A;  1Q3E A;  4DR2 B;  3X2Q B;  2UXN A;  3OTF A;  4GT1 A;  1KUQ A;  3ETD A;  2QKC A;  1FFX A;  2JEU A;  4MTO A;  2P7T C;  1BQ0 A;  3CEI A;  4ICG A;  4QIW F;  5FPR A;  3ZJZ A;  4JI0 O;  4FLW A;  4NXM O;  4R8C A;  3JAL B;  1WA8 B;  1GM7 A;  1Q86 W;  4QGP A;  4JI5 O;  2C2A A;  4GYC B;  1AJN A;  1TUB B;  2Q7G A;  1N36 O;  5IY5 B;  3OTO O;  5B1O A;  3ASO C;  2VWK A;  1WB8 A;  4QPK A;  1YVW A;  4TV9 B;  1AJP A;  3CS5 A;  1VQN V;  1KD1 W;  1GO3 F;  4KL1 A;  4L87 A;  1DF4 A;  3JAK B;  1V9P A;  2XAF A;  3JAM N;  3E86 A;  3K06 A;  3B4S A;  2E76 B;  4YY3 O;  4JZG A;  3ABL B;  3AG4 C;  4LF6 B;  2NR5 A;  5LGU A;  1RM1 C;  3E22 B;  4JI7 O;  1JVM A;  2WLI A;  2DWE C;  2KSD A;  4O2A A;  3MD0 A;  1NTK H;  1TGO A;  1M57 B;  1H2K A;  1W59 A;  2DW4 A;  1M1K W;  2CUG A;  1M56 C;  1R3I C;  3CC7 V;  2ZM6 B;  4D7T A;  3VQX A;  1PPJ H;  4LF4 O;  3FD9 A;  3OMA B;  3DTU B;  2F4V B;  4MVZ A;  4DV3 O;  2EUL A;  3KCY A;  5K1P A;  4YJ3 B;  4LWS B;  2Q4P A;  4CH4 A;  1ARO P;  3T1H O;  1G4Y B;  1GM9 A;  5A9G A;  3G71 V;  5H2F Z;  3CWB H;  1ENV A;  1VQM V;  4NXN O;  3C3S A;  4JTC B;  3P3P A;  2O57 A;  3UO3 A;  4DUY B;  2D2C B;  2ZE6 A;  4GKJ B;  2Y0P A;  3M7M X;  4JYY A;  5CB4 A;  4WFG A;  2JGD B;  1N8R W;  3ABK C;  2EIN B;  5IYC O;  2VWJ A;  1SQB H;  3BA9 A;  5LYJ A;  3L9D A;  4TUY B;  5LP6 A;  1XOU A;  3JSL A;  3J80 N;  2UXC B;  1OHH G;  2ZR2 A;  3JAT B;  2EIK C;  2Y0I A;  4CH6 A;  5GW7 A;  1YF2 A;  1E1R G;  1QR9 A;  3BRC A;  3IGA C;  3E89 A;  4BWA A;  1EN6 A;  5DN6 G;  3U11 A;  2P6J A;  1LR1 A;  3JAR B;  1SQP H;  3APO A;  1ZX3 A;  3IAY A;  4PDR A;  4DR7 B;  2P06 A;  1IXB A;  3TXQ A;  3AG3 C;  1PM9 A;  3LNN A;  1XRE A;  3ZIA G;  5KX5 B;  2EIL C;  4X89 A;  3CRQ A;  2JJ1 G;  3MHS C;  2HVK C;  4Z2W A;  1FKA O;  1RSO A;  1R6N A;  1Z2G A;  1QVG U;  5LMN B;  1R6K A;  4BW5 A;  3HKE A;  1L8D A;  1K4D C;  2VQE B;  4ZIB A;  4K0K O;  4WFE A;  4JI4 O;  5IYZ A;  5LGN A;  3K0G A;  1B04 A;  1P4R A;  3RVZ A;  2BTQ B;  3E8B A;  4DR5 O;  1S0V A;  4FFB A;  1K73 W;  4LR3 A;  5EYP B;  2CGO A;  2X6B A;  3JSN A;  4YHH O;  1K92 A;  3OEE G;  2CTP A;  4O2B A;  1BZK A;  4EFB A;  3BY6 A;  2RN9 A;  2DYS C;  4JI8 B;  4JTD B;  4MT8 A;  1DF5 A;  4FLZ A;  1Z5W A;  5EBM C;  2KQX A;  5JQG B;  4LFA B;  4GKK B;  1VF6 A;  5EBW C;  2MK3 A;  1OCC B;  2YEV A;  4WCE V;  1NTZ H;  3ZMS A;  3ZHS A;  5EK0 A;  2P67 A;  1PNL A;  2IW5 A;  1URF A;  2DWD C;  4JAS A;  1RP3 B;  3ZMZ A;  5LXT B;  3O9O A;  1N32 O;  4X20 B;  1YEW A;  1Y66 A;  4DYL A;  4N23 A;  1E79 G;  3UM7 A;  2CTW A;  2N05 A;  2HJF C;  1SA0 B;  1WNS A;  1Q6I A;  3GB7 C;  3K0D A;  1V54 C;  3ICX A;  4JI0 B;  4NXM B;  3MHH C;  5EBL C;  2LGW A;  1Q81 W;  4K35 A;  3ZRW B;  3H1H H;  4X1Y B;  5BMV B;  1SC5 B;  2Q8V A;  3OMI B;  5FNV B;  5JWP A;  2CAZ C;  5D5P A;  4IT5 A;  1N36 B;  3JD2 A;  4B3M O;  1D2D A;  2X7R B;  3OTO B;  3D36 A;  4WBN A;  3FAV B;  3LNM B;  1JCH A;  3AK2 A;  3M8A A;  2CH7 B;  3BAA A;  1XBL A;  5CA0 B;  5GON B;  4U3J A;  3L70 H;  3JD1 A;  2E5L O;  2IBZ H;  1MNG A;  4FJC C;  1W0K G;  4YY3 B;  2MW2 B;  1DK1 A;  4JI7 B;  1WB7 A;  4LBE C;  5CA1 A;  2KB1 A;  4OGQ B;  5KA6 A;  2PI5 A;  3GWO A;  1NI8 A;  2LFR A;  2ILM A;  2HVJ C;  3FB8 C;  4XDL A;  1Y74 A;  5LHI A;  4LF4 B;  4JYB A;  3CCM V;  3VQW A;  1HR0 O;  3H1J H;  3H9V A;  2EZP A;  2FYU H;  2NN4 A;  2QWO B;  4UXN A;  4GX1 A;  4OXS A;  3ZRX A;  5A2Q N;  4DV3 B;  3K5L A;  2DYR B;  4BW9 A;  4NTY A;  2BOC C;  1FXK B;  3T1H B;  4C7U A;  1HWY A;  4FK5 C;  3SPJ A;  4QPJ A;  3G80 A;  4NXN B;  2IJI A;  3RYC A;  2ZNI A;  5J2T A;  4PEL A;  1N0N A;  3FB6 C;  3RWR D;  2OIE A;  3I5D A;  2GUZ B;  4F4L A;  3TCU A;  5LA6 B;  4ZKI A;  4LFB O;  1KP2 A;  5KHJ A;  3N2K A;  3F7Y C;  3L71 H;  2WLH A;  4DW1 A;  2WWW A;  4LF9 O;  2RJZ A;  2XAS A;  4TV8 B;  1VQ8 V;  2IU0 A;  3C3T A;  2HHH O;  4B3T O;  2R70 A;  1DLB A;  1FPO A;  4PA6 A; 
#chains in the Genus database with same CATH homology
 5LMN O;  4LF7 O;  4JI8 O;  3M8A A;  3JAM N;  4JI1 O;  1HNZ O;  1XEQ A;  1FKA O;  4LF8 O;  4YY3 O;  4DV7 O;  2ZM6 O;  3T1Y O;  4OPH A;  4OX9 O;  1FYJ A;  4JI7 O;  2JRI A;  2F4V O;  4GKK O;  2UUC O;  4B3R O;  2E5L O;  4DV6 O;  2LW7 A;  3F5T A;  1AB3 A;  3O65 A;  2Z0A A;  1N34 O;  1I94 O;  5LMU O;  1XNQ O;  1IBL O;  5H5N A;  4KHP O;  4K0K O;  4JI4 O;  4LF4 O;  1DK1 A;  4DR5 O;  5BY1 A;  1R6T A;  5IWA O;  3J81 N;  1X59 A;  4X64 O;  4DV3 O;  4AQY O;  4JV5 O;  4YHH O;  4DUY O;  3T1H O;  2ZKO A;  1YZB A;  4DR2 O;  1D2D A;  4GKJ O;  4DV4 O;  2UXD O;  1N33 O;  4LFA O;  4LF5 O;  1XNR O;  1HR0 O;  3RT3 C;  4JI6 O;  5A2Q N;  1XMQ O;  4OPA A;  4NXN O;  4DV1 O;  5LL6 Y;  4X65 O;  4DUZ O;  3R66 A;  2UXC O;  5BXZ A;  4B3S O;  1AIL A;  1KUQ A;  1XMO O;  1F7Y A;  2N74 A;  4DV0 O;  4X62 O;  2UU9 O;  4JI2 O;  4A5U B;  5FLX N;  3SDL A;  3J80 N;  4JYA O;  1HNW O;  1FJG O;  1HNX O;  4LFC O;  1N32 O;  4JI0 O;  4NXM O;  2VQF O;  1IBK O;  4DR1 O;  4DR6 O;  5BR8 O;  5IT9 N;  1A32 A;  1IBM O;  4JI5 O;  2FKX A;  4DR4 O;  2UXB O;  4DV2 O;  4LFB O;  3J7A U;  4DR7 O;  2AGA A;  2UUB O;  1G1X B;  2VQE O;  1N36 O;  2DJV A;  3OTO O;  1R1B A;  4JI3 O;  2DOS A;  2UUA O;  4X66 O;  4DR3 O;  4LF9 O;  2HHH O;  1NS1 A;  4B3T O;  4DV5 O;  4B3M O;  1J5E O;  4LF6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...