3T1YO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3t1yO00
4DV5O 5LL6Y 1XNRO 4B3MO 4JI2O 2DJVA 2UXBO 4DUZO 2F4VO 1FJGO 1HR0O 1G1XB 1A32A 5IWAO 3J80N 4B3TO 5LMUO 4DR1O 2AGAA 4YY3O 3J81N 4DV1O 1F7YA 4LF6O 2UU9O 4DV7O 2UUCO 2JRIA 1XMOO 1XNQO 2UXCO 3M8AA 1I94O 1HNZO 4DR4O 2LW7A 4LFBO 3F5TA 2HHHO 4JI6O 4AQYO 4DR2O 5BR8O 4X65O 3T1YO 4GKJO 1AB3A 3O65A 4JYAO 1YZBA 1N32O 1XMQO 4K0KO 1NS1A 1IBLO 4JI5O 2VQEO 4LFAO 4JI7O 4DR7O 3JAMN 2DOSA 4A5UB 4LF4O 4GKKO 1FYJA 1XEQA 2N74A 4JV5O 1IBMO 4DUYO 5FLXN 2UUBO 4DV0O 1R1BA 4B3RO 4LF8O 4X64O 4JI3O 2E5LO 4JI4O 1FKAO 4LF9O 1AILA 4OPAA 5A2QN 2FKXA 1DK1A 4DR6O 4NXNO 4X66O 2UXDO 3J7AU 4LFCO 4YHHO 2ZM6O 1N34O 4DV6O 3RT3C 4JI1O 4DV4O 3T1HO 5BY1A 4DV3O 4KHPO 2UUAO 4B3SO 1X59A 4JI0O 4JI8O 1KUQA 1N36O 4LF7O 5H5NA 3R66A 5BXZA 1D2DA 1J5EO 5LMNO 2VQFO 4OPHA 1N33O 5IT9N 4OX9O 4DV2O 1IBKO 4LF5O 2ZKOA 1HNXO 2Z0AA 4X62O 4DR5O 1R6TA 1HNWO 4NXMO 4DR3O 3OTOO 3SDLA
chains in the Genus database with same CATH superfamily
4DV5O 2ADPA 4DR6B 1PL0A 4LH7A 1GK9A 2EILC 3ZMTA 1QVFU 1P49A 1LUWA 4I50A 2OTJV 3G80A 4EB6A 4TT3G 2JS3A 5EK0A 3JAKA 4JI0B 1KKDA 4FIPC 4I9WA 4RQFA 1J5EB 4NR1A 2KQXA 2R9AA 2HVJC 5GONA 4MS2A 2ZINA 3ZX6A 1ZWIC 4IIJB 4EKWA 3LSUA 1K4CC 2P5OA 2F43G 3P30A 3HPLC 4UVAA 2FYUH 1YF2A 2WLJA 2P4VA 3JSLA 4DK0A 2FTKA 5FNVB 4JAUA 4WFHA 4DV0O 1E1RG 1YVWA 1DF5A 2C2AA 1PPJH 4D7TA 4NKGB 2HEPA 2WLLA 3KCYA 4J42A 2ZXWB 4WFFA 4X8AA 3VBBA 3M7MX 2OWOA 2JGDB 3DGEA 3GB7C 4PJ0Z 4JYAB 3T1HO 2WLMA 1N32B 1X59A 3ZMZA 4TSFG 1IXMA 1WPBA 1W0KG 5JJEB 3TJTA 1RSOA 3GWOA 4JI7B 4U7NA 4GX1A 2Z0AA 4O4IB 5IJ9B 1M90W 4JAAA 3QO8A 3FB6C 4R8CA 2XASA 4LWSA 4X1KB 4GZRB 1Q86W 4O4LB 1L0NH 1AR4A 3ZIAG 1Q5OA 3IC7A 1YJWV 3RYHB 3ABMB 1L1FA 2A3QA 2ZQMA 5JQGB 4FK5C 1QVGU 4X20B 1BQ0A 1GN2A 2IJKA 4UUJC 5LYJB 4JI3B 4FLVA 1JX9A 4HAMA 3K79A 5IYDO 4FMTA 4DR2O 4CS3A 4CC5A 3T1YO 4H37A 1FXVA 5KHIA 3WU2Z 1JPXA 1FAFA 3BCCH 4LCUC 3HB3B 4HBNA 5LP6C 5JJNB 1FFTB 1OCCC 5IYCO 3TXSA 3BA9A 5KAFZ 4MVZA 1Y76A 1XEQA 3AG3B 4B7EA 5LOVB 2MK3A 2A0LA 4B3TB 4DR1B 4UB8Z 4OXSA 1WNSA 1XNQB 3CRRA 4FLXA 1QNMA 4JYYA 1FXKC 1BGYH 1OCZC 3OW2U 1ROPA 3JD1A 4QPJA 3APOA 4JPRA 4DV6O 2BOCC 4FFBB 1M56C 2JJ2G 1V55B 4LF7O 2LGWA 2QWQB 3K08A 4X1IB 3K06A 1NTZH 4DV2O 4LF4B 3CXHF 3SJCC 1WLEA 1SF9A 4O2AA 4ZOLA 4DUYB 3JD3A 4B3RB 3A0BZ 3I56V 2XNDG 2HJDA 2KB1A 2ATKC 2UXBO 2ADQB 2F4VO 3HKDA 2LFSA 4AI8A 1BHAA 3OE7G 1IURA 4U3JA 5JCOC 2QGNA 1S5JA 3JD0A 1Q8IA 1NI8A 4JI1B 4DV4B 1AR5A 1G4YB 1K7DA 2UU9O 2H94A 2JS5A 2M7WA 2BOBC 2EZOA 3SJBC 1WA8B 4X62B 2V7QG 1NKDA 4WFGA 3K5OA 5BMVB 2LFRA 1F51A 2IBZH 1R3LC 1MSDA 2FL4A 4PDVA 2X6AA 1YTFD 1XNRB 4X1YA 5CN0A 2VQEO 4XBFA 4KUMA 1AJPA 4DUZB 4AHCA 1OCOB 3K57A 2GSMB 4J80A 4QPKA 3X2QB 1E79G 1KQSU 5IWAB 2V1DA 3QG5A 4CH4A 1VQPV 4GX5A 1NVPB 4NXMB 3QVNA 3OM3B 2UXCB 3IGAC 3J7AU 1I94B 4I50B 1HWYA 1K5SA 2BSKB 5L3FA 1H8HG 3JAKB 2WA4A 2YXHA 1VQKV 4J11A 3NXSA 1QQCA 3FYIB 3OMAB 2YEVB 2N04A 5LMNO 3BABA 4DR7B 2ZCEA 1TUBA 5GONB 1IBKO 2ZKOA 3ETDA 1HNWO 1FS0G 3E22A 2UUBB 3AK2A 3E2EA 1Y66A 3ZMSA 4KFMA 5LHIA 4GX0A 3L72H 3APQA 3ZHQA 1H2MA 5F2VO 1M57B 3OTFA 1R3KC 4GUNA 3RYIA 3T1CA 2F95B 3K03A 2XUMA 1SZTA 5E79Z 4P30A 5DEDA 3N2KA 4TV9A 1DLBA 2D3OW 4WFBV 4DV1O 3G6BA 4LP8A 3DC6A 2DN9A 3G4SV 2XAHA 1OHHG 2WLLB 1DTOA 2ILMA 2Y48A 3SPCA 4XDLA 2ZXWC 1N33B 4NVPA 2EINB 4OX9B 2WLIA 3SJAC 4MVOA 2BTQB 1P84F 3RVZA 3CJHA 2XTAA 5KMGA 4FM1A 1JMKC 1NS1A 4TWKA 3K5LA 3ABUA 1SQVH 2HFEC 1ENVA 2QWOB 1M5IA 1T5EA 2IJJA 5CBGA 3S3XA 4GKKO 1NR7A 2N74A 3JASA 4YJ2A 1IBMO 3L70H 2HP8A 1YI2V 1S72V 3QO7A 1WP8A 2RQ6A 3D3QA 2GDSA 3FX7A 1SKVA 4LWSB 3U10A 2RNBA 2FB5A 4BW9A 3N2GB 2GBOA 1WB7A 1MG1A 2ITDC 2XOKG 1SQGA 1PM9A 4FZ1A 3K59A 1MZFA 1PNMA 4G2KA 5GTIZ 3ABMC 4YHHO 4AQYB 5C8YB 3VQWA 1CXZB 1G8MA 1H2LA 3K0GA 1AI6A 2YUAA 4MTFA 2Q73A 3IFXA 1BS3A 3CMAV 3AG4B 3UKMA 4JI8O 2EBOA 2AZ2A 1D2DA 5KHJA 2VQFO 4OPHA 4DK1A 2P7TC 4N21A 3CC2V 1LR1A 3VOUA 3ZHUA 1YXBA 4DR3O 4DW0A 2HHHB 2E74B 3H01A 4I0XA 2GV9A 1MZEA 1SC5B 2Q67A 2A9HA 1Y76B 3PN1A 5LGUA 3AG3C 1BCCH 4BW5A 3J80N 1COWG 2OCCB 3RBZA 3HKCA 3RW0A 4L8JA 3W7UA 4X64B 2E3CA 1YCIA 2W6IG 4WBNA 3UT5A 4O2BA 5A9GA 5JWPA 1K8AW 4LF9B 3TCUA 2ZDIC 3E35A 4XDKA 1VIBA 4Z1MG 1AB3A 4X89A 1AVMA 4JZGA 3VQXA 1XMQO 1GM8A 2EIKB 1V55C 1BSMA 3VQYA 3OUSA 2WPDG 4JI5O 3DC5A 4LFAO 1H38A 1XOUA 2A06H 4MVQA 2ZNIA 5EBLC 1JVMA 4O2AB 1YJNV 4ZOLB 4RWUA 3STLC 1WJZA 1AP5A 1TAEA 4PI2A 3ZN1A 1PNLA 1VF7A 5FPOA 5L3EA 4OPAA 3LDCA 2UXDO 2A79B 3HKDB 4J7ZA 1AJQA 2EIMB 3OUFA 3H1LH 3OMIB 4QJFB 1TVKA 1YSCA 2IJIA 2WSSG 1XHZA 1FJGB 2Q69A 3MHSC 4DV3O 1VARA 3ASNB 4I9QA 4LC1A 3H9VA 2ZIMA 3E8HA 4CS4A 4W4LA 5LHHA 1U97A 3SPIA 5AG2A 1BQZA 3AK3A 1NTMH 4NTXA 4DV0B 3OTOO 1UJWB 2EX3A 4C7UA 3W7XA 4X1YB 3CXCU 3ZMUA 5KLVH 1QCEA 1OCOC 3JYCA 2ZE8A 4UB6Z 1GAXA 3NR7A 3X2QC 1M93A 1MSWD 4CH3A 4JASA 1RM1B 2QTSA 3T1HB 1SQFA 4DRXA 4PELA 1H8EG 1KB9F 1VQ4V 5D5PA 4ZHQA 3ABKB 3CX5F 4LNUA 4DR4O 5B1AB 1N0NA 3B8NA 4JI6O 3CMEV 2P06A 1NH2B 1SERA 1AI4A 2QKSA 1MA1A 1URFA 4TQDA 3SYCA 1VF5B 4K0KO 3ETQA 1N34B 1GMGA 1KP2A 1TUBB 4WF9V 3FFQA 3ZHRA 3EFFK 1L0LH 4PA3A 5JVDB 4IYIA 1UPGA 3E22B 4MT8A 3JALA 1I5XA 3TGUH 2IM9A 4JTCB 1IXBA 3ZS8C 1GTOA 5A2QN 3S3WA 2FKXA 2X7RB 1EN5A 3RYIB 2N05A 1M57C 3CCRV 2ARHA 3MAQA 2HVKC 3LNNA 3B4SA 1B06A 4MW8A 2Y4TA 3N2KB 4TV9B 2ZM6O 4DR2B 2PY5A 3HKBA 3T1YB 4ICGA 4BR6A 1W0JG 1MNGA 5CA1A 4KXRA 4H0LB 2WLIB 1X4TA 2YIBD 2EINC 4P9OA 1JFFA 2VS0A 1VQ5V 2YC0A 3A0RA 3JSNA 4I4TA 1K9MW 3CJHB 4RUEA 4FLTA 3W7SA 1R3JC 1GRJA 1GM7A 3ABLB 3MD0A 3Q4HA 4JI2O 3ZN0A 4JF3A 2DWEC 3CCSV 5J2TA 4K8ZA 1NTKH 1NVPD 5BZBA 5JH7B 3FB5C 2VWKA 4LF6O 2YIDA 4BIOA 4GT1A 1XMOO 1D5NA 1CPYA 3THOA 4LFBO 4AILC 5IY5C 3CEIA 3P3PA 4UCSA 2IJHA 4DV2B 4X65O 1YZBA 4X88A 4K8XA 2IU0A 3AG4C 3JATA 4Q6GA 4I55A 1D5AA 1LUVA 1DF4A 1B04A 3RN4A 2UXBB 1FPOA 5HFMA 2F4VB 1RPOA 4I0XB 5IYBO 1IDSA 4TV8A 4UVBA 4U7OA 1ZUQA 5K1PA 2Q0AA 4JTAB 4MW3A 4JI4O 2R70A 2Z5UA 3T4ZA 1QR8A 2WAMA 1DK1A 2UU9B 3UCSC 4X66O 4IHJB 3EXAA 1EN4A 2ZR3A 2RN9A 3MDSA 4J9YB 4PA4A 5B1OA 2HR3A 3HKCB 2OCCC 3SPHA 1PNKA 3W7TA 3ZHSA 5EBMC 4WBNB 1YEWA 1R6NA 1NZ6A 3UT5B 4O2BB 3IJ4A 2JDIG 1F23A 5BXZA 2VQEB 4UXNA 3AG1B 1AP6A 2PYJA 4R50A 3BRCA 5B1BB 3SDLA 2EIKC 4ZKIA 2PI5A 1QHTA 3HR0A 2GTAA 4B3MO 3CCMV 5B3SB 4GX2A 1JQ0A 2QWRB 4UCRA 1IVSA 3K04A 4JYBA 4F4LA 3T2MA 1H2GA 2QDOA 4ASUG 4CS2A 3AG2B 4ZIBA 3ZJZA 2QKAA 2EIMC 2P67A 2XAFA 1TVKB 4WCEV 5B1NA 1FXKA 5LMNB 2Q5ZA 1IBKB 4NXNB 2YIAA 5CA0A 2NNUA 1HNWB 2Q4PA 1S3JA 3ASNC 1L8DA 2AHZA 3B40A 3RYCA 1MOFA 1IBLO 1K4DC 2IH3C 2UXXA 2DQ0A 1S5LZ 1YDXA 3SPGA 4YIOA 3CS5A 1F4NA 2AHYA 4LF8O 2DMXA 1XREA 4JI3O 2E5LO 3H1JH 4U3FH 3U0ZA 3P32A 2Q6AA 4LFCO 3RYFA 4LBEC 4HZ3A 3O9OA 1RM1C 3UO2A 4O4HA 3TETA 2UXNA 4YXWG 2ZD9A 2UUAO 4B3SO 2KG7A 4Z2WA 4ZHQB 1NJIW 2LO1A 1N36O 3ABKC 1Q6HA 3D36A 5B1AC 3LUTB 3QTCA 2W0XA 4MTGA 1AR1B 3ICXA 3RGBA 1HW7A 1QLEB 1OCRB 1HNZB 1IBMB 1CP9A 3DXRA 5DECA 4EB6B 1SQPH 3FD9A 2OYQA 2NR5A 3CSXA 1OJHA 1SRYA 2BE3A 2E76B 2F66C 1VMGA 3ZRVA 2Y69B 4IL6Z 4F6RA 3IAYA 3H1HH 5ITZA 4EEQA 4ZBMA 1TUEB 3JALB 1RP3B 4FPPA 4QNHB 3JD4A 5LHGA 3J81N 4W4KA 4ZI7A 2P22C 4JI8B 4E2LA 2FMLA 1LNQA 2VQFB 3WG7B 3HKBB 2K1EA 3I5DA 3IC9A 4CZZA 4GKJO 2DW4A 5C93A 1KMIZ 4DR3B 2DWDC 4YIPA 5CA1B 2DYRB 3LSSA 4P2ZA 1XQ8A 1US6A 4MVRA 4FLWA 3CCUV 2HLDG 1JFFB 4IGGA 3FB8C 2BCCH 4I4TB 3CCLV 3OGCC 2LW1A 4UCUA 1YIJV 5CBHA 2ZE6A 1SA0A 3K0DA 1PD3A 1R1BA 4IIJA 4JZ2A 4NYKA 3SYAA 1WP7A 3ABLC 3D3IA 2LGQA 1SETA 2WA3A 3A2FA 5DN6G 4UV9A 3OGIB 2CH7A 1RSOB 5J2TB 1ORQC 4UV8A 4ABMA 1H2KA 2OT5A 2D2CB 4PDLA 3BY6A 3M99B 1XMQB 1EN6A 1Y6XA 4PI0A 5EIBC 3CWBH 1THZA 5LMUB 1NH2D 2LJ2A 4JI5B 3JAWA 1ZX3A 4QIWF 1RFYA 3OAAG 1HNXO 2ZNJA 4K3AA 2YXYA 2JEXA 3L75H 1Q7YW 4NXMO 4G28B 5CB4A 5IY5B 3JATB 2ZR2A 1WB8A 4I55B 1VQ6V 5LXTA 3I55V 2XHBA 1Z2GA 3C3TA 4EFEA 1AI7A 3CRCA 5H6RA 4QGPA 2B5UA 2OTLV 4TV8B 1G1XB 4HNAA 1J95A 3KCXA 2G38A 4FVMA 2AGAA 4G27B 2Y0IA 4YY3O 4F6EA 3BPZA 3OR6C 3E8FA 4DV3B 2XAJA 1JJOA 1Z5VA 2UUCO 3M8AA 2CGNA 4FZ0A 2WWWA 1PV0A 1VQNV 3PJSK 2PF4E 5BR8O 3LNMB 3O65A 5JQGA 3D8CA 3OTOB 1M4UA 4PDRA 5J2UA 1S77D 3G71V 2GHYA 3CB2A 3AG1C 3BAAA 2B1GA 1KU9A 3QO5A 3A8TA 5B1BC 3ZMVA 2PTMA 4LF5B 1BHBA 3ZRWA 1EFRG 4MTOA 3UQ8A 1JOYA 4JGSA 3DTUB 2A7WA 5B3SC 4DV5B 2LQTA 3E89A 4JI6B 5EIBD 3HKEA 3AG2C 1IZ3A 2AXTZ 1KUQA 4FM2A 1G6UA 1Y4MA 1BL8A 5CA0B 2ZDIA 4DR5O 5KHHA 2LP7A 4U3JB 2JGUA 2H3OA 4FFBA 3RYCB 1SZXA 5J9PC 3B2EE 5IE9A 4X1IA 2YI9A 4LH6A 1PP9H 3RVYA 1HR0O 1AROP 2ODMA 3CPWU 2B9ZA 3OR7C 1YITV 2CTRA 3F7YC 3L9DA 3G6EV 1FFXA 1NQTA 4DV7O 3QNEA 1H2SB 3RYFB 4UFZA 1Q82W 5H2FZ 1KP3A 1F4MA 4UCTA 1AI5A 2HHHO 3L73H 4O4HB 1K5QA 1N4CA 2RCVA 2KG7B 4J7JA 1V54B 2X6CA 5L3CA 4RQEA 3L71H 4J41A 1K3EA 5LGTA 2RJZA 4JI2B 1K92A 1BZKA 3CC4V 1KKCA 3CHXA 3K58A 5IJ0A 2W0FC 1XBLA 4H44B 3B8MA 3C3SA 4YJ3A 1QLEC 1OCRC 1MMMA 2YIBA 1GKFA 3DXRB 4CH5A 1V9PA 4X64O 2P6JA 1VQ7V 1NR1A 3A0HZ 4FM0A 4F6RB 4LF9O 5ITZB 2Y69C 1IX9A 1XMOB 2E75B 1VF6A 3K5MA 3CCJV 5JJJB 4LFBB 1Q81W 2RDCA 3ZRSA 1DGSA 3DSQA 3L74H 4Q20A 4X65B 3FYEB 3E83A 4ZI7B 3CE2A 4KHPO 2GTSA 2P90A 3SGIA 2JEUA 2DQ3A 5H5NA 3CCQV 3R66A 1N0JA 3WG7C 5EC2C 2BSKA 1BE3H 1R6TA 1VQ8V 4B08A 1P7BA 3KKYA 2DYRC 1K33A 4JI4B 2YEVA 5KHKA 4X66B 4L87A 2F23A 4TUYA 5KUKA 1FJGO 3SPJA 1SA0B 4RUFA 3JCUZ 5EYPA 1A32A 2EIJB 3WB2A 2QE7G 3WFVA 3CCEV 3N27A 3JARA 5LA6A 5KMGB 1QLNA 2ZIOA 2CH7B 1TA8A 2P4KA 2LW7A 5KUMA 4MSWC 2R9RB 3FKSG 1EZVH 1FXHA 2CTWA 3R65A 1XUQA 3JASB 3AG7A 4P9PA 4YJ2B 1ZTEA 1Q6IA 4LR3A 1M1KW 4IT5A 3JAWB 2CE4A 4I5SA 4DV6B 3KG2A 4B3MB 3ZHVA 1FD9A 4A5UB 1BT8A 1Y74A 4LF7B 5CB4B 4JV5O 2ITCC 2CTQA 2BTQA 2JVDA 5FLXN 5LXTB 5CA3A 4FLUA 1HP8A 3E8BA 2PGGA 1AILA 3P3NA 4DR6O 1XILA 2PI4A 2QTOA 2KSDA 3OMNB 5KA6A 4HNAB 1EBOA 5CMUA 3VQVA 4K35A 1I5YA 1VP7A 2F93B 3BEHA 1N34O 3SYQA 1ZLZA 3JD2A 3K9SA 1GN6A 1W59A 4JI0O 2QM8A 3ETGA 3N2GA 2YDEA 4UCOA 4NB5A 1IBLB 1VQ9V 1GN3A 1J5EO 1SQBH 5KX5A 2QEXV 5D5QA 3OFNG 5C8YA 1I08A 2ZE7A 5J2UB 3C90A 1OZ0A 2YSUB 4H33A 4LF8B 1S0VA 3T4DA 1CEZA 2E5LB 1ZL8A 2ZT9B 3B77A 2DE0X 3LSQA 2X0LA 2PZSA 5FPRA 5IYZA 2CTPA 4LFCB 3SYOA 1B3QA 1YJ9V 2QKCA 3ZRWB 1O9HA 1K97A 2PUSA 2B1IA 3EVKA 1HDJA 3RFRA 3OT7A 1F7YA 2WLHA 2OIEA 3E8GA 2UUAB 4B3SB 2JJ1G 1N36B 1Q6UA 2NLJC 5EZYA 1VQMV 5LP6A 3FB7C 3CRMA 1NT2B 4JYAO 3HKEB 2O57A 4JAVA 1N32O 3FAVA 3ABTA 4WFEA 2HG5C 4JYCA 4Z1VA 4PA9A 4JI7O 2DOSA 4PV1B 1FYJA 2AZ0A 3BFRA 4MVSA 1RPRA 3KZIZ 5LGNA 2JIZG 2EULA 3K3WA 1O9GA 1PKXA 3ASOB 4EFBA 2GUZA 4J7KA 3TXQA 4DXWA 2YXLA 5KHGA 4QE9A 4GKJB 1FFXB 1P7GA 2OCHA 1JJ2U 4DYLA 2OIGA 3SJQC 1I0HA 3ZCCA 4RAIA 1VQOV 5GW7A 3OEHG 2W6JG 2EJRA 4DV1B 2XAQA 5B5EZ 3CYOA 1Q43A 2XAGA 4UCVA 5DM6V 4O4JA 1V54C 3TK1A 3D36C 5JCOA 2DYSB 4DRXB 4E4EA 5LL6Y 5E1AC 5IJ0B 3CCVV 1R3IC 4X9QA 3ZRXA 3EHBB 4HYOA 4YJ3B 2Q7EA 3SR2C 4LNUB 2IU3A 2V4DA 5HFLA 3ML0A 1M9NA 4B3TO 3G67A 2JK5C 1ZSPA 4DR1O 4GKKB 4KL1A 2Y4UA 1XNQO 2IW5A 2AW9A 3ZBHA 4R6ZA 1KD1W 2QWPB 1HNXB 4PHZA 5H9CA 1E1QG 5EC1C 4YHHB 3ZHTA 3CD6V 3B09A 1U96A 2HKOA 3AEIA 4H13B 1MABG 1N8RW 1H2NA 3JAMN 2EILB 4LF4O 3CRAA 1SQXH 4NTWA 5L3DA 3H1KH 4DUYO 4B3RO 4YY3B 4CH6A 1FKAO 3OD4A 3LDEA 4TUYB 4PDMA 4NXNO 2UUCB 4XDJA 1KC8W 2YICA 5JVDA 5EYPB 4J9ZB 2EIJC 5BR8B 2F1MA 3JARB 5LA6B 5B66Z 1KBHA 2EJ7A 3RT3C 4JI1O 4CBCA 4DV4O 1QR9A 4CC6A 1WN7A 2CK3G 1NBMG 3OEEG 3Q4HB 4D7SA 2CAZC 1GH6A 4X62O 2MW2B 4DW1A 5FNVA 4N23A 2BTOA 5EBWC 1GM9A 4D6TH 1NU1H 2R9IA 4PA7A 1YHQV 1XNRO 1Y74B 4DUZO 2ETNA 2Q9LA 4I7ZB 2Q8VA 3RWRD 2Q0OC 3STZC 4LFAB 1JR9A 5FL7G 5IWAO 2JGDA 5TISZ 2Y0PA 4FFKA 3AK1A 2UXCO 1TGOA 1I94O 2HJFC 1HNZO 3BA8A 4BIUA 2XT9A 5L3BA 3GVMA 1VEWA 3JCZA 2Q7HA 4DR5B 2UXDB 2X6BA 2H8PC 2WLKA 4O4IA 5JH7A 1SQQH 5IJ9A 5L3GA 2QM7A 1XI1A 5KX5B 2M6YA 3QF7A 3WB1A 4DR7O 2YI8A 1S76D 1Z5WA 4X1KA 4B7KA 4KP4A 1VQLV 4O4LA 2KKWA 1HR0B 1Q90D 1WPXA 2K9PA 1XL6A 3RYHA 2UUBO 1ZL8B 2RMKB 1XHXA 5CBFA 5KAIZ 5IYZB 4DV7B 1S5HC 1XL4A 2ZE5A 4DO2A 4X20A 2CUGA 4NTYA 1SS3A 5LYJA 1JA8A 1I7FA 1GO3F 2QJ1A 4IYHA 2WLNA 3WB0A 1AJNA 2EZPA 3E86A 4FLZA 2QR4A 3K5NA 1PL4A 5EZYB 2QWNB 5LP6B 5H6QA 4IHJA 4RO2A 2CGOA 1OCCB 5K1XA 1N33O 5IT9N 1GN4A 4OX9O 1YTFB 2L35A 3FAVB 3UM7A 4DR4B 3CRQA 3ETEA 5LOVA 1JCHA 2QM4A 3CP1A 3U11A 3LDDA 1B6QA 2QA4V 4PA6A 2NN4A 2DJVA 2VRZA 4K0KB 1FXKB 1P4RA 2PYLA 1KECA 4GLXA 1W2BU 4J10A 2L6LA 4OGQB 1OCZB 1EM1A 3K9AA 5LMUO 2GUZB 4MVMA 3ASOC 3CC7V 4KHPB 1M56B 1KYOF 2JRIA 1ZAUA 1OV9A 4WFAV 4TOIA 3F5TA 3BHPA 4AQYO 1Q3EA 4QE7A 1UFIA 4PD4F 2ZM6B 1K34A 1EZJA 4GYCB 1R6KA 4R7CA 2CDYA 1BMFG 4O4JB 4UVCA 3H1IH 4GCZA 1QBZA 4FLYA 2Q68A 2DYSC 2QSAA 3ZEDA 5IDJA 3UO3A 1Y67A 1K73W 2IH1C 3SYPA 1XDCA 3MHHC 5GTHZ 3F7VC 4JTDB 2Z3YA 5KA5A 2VWJA 1WA8A 3BVOA 5BY1A 1VF6C 5BMVA 4FJCC 2YS8A 5LBQA 4BWAA 3W7WA 3GWKC 1QU7A 4LF6B 4MTXA 4LF5O 1R73A 2R72A 4MVUA 2Q7GA 4BAYA 3F5WC 4JV5B 1WAZA 4TQFA 4BIZA 1SESA
chains in the Genus database with same CATH topology
4DV5O 5LL6Y 1XNRO 4B3MO 4JI2O 2DJVA 2UXBO 4DUZO 2F4VO 1FJGO 1HR0O 1G1XB 1A32A 5IWAO 3J80N 4B3TO 5LMUO 4DR1O 2AGAA 4YY3O 3J81N 4DV1O 1F7YA 4LF6O 2UU9O 4DV7O 2UUCO 2JRIA 1XMOO 1XNQO 2UXCO 3M8AA 1I94O 1HNZO 4DR4O 2LW7A 4LFBO 3F5TA 2HHHO 4JI6O 4AQYO 4DR2O 5BR8O 4X65O 3T1YO 4GKJO 1AB3A 3O65A 4JYAO 1YZBA 1N32O 1XMQO 4K0KO 1NS1A 1IBLO 4JI5O 2VQEO 4LFAO 4JI7O 4DR7O 3JAMN 2DOSA 4A5UB 4LF4O 4GKKO 1FYJA 1XEQA 2N74A 4JV5O 1IBMO 4DUYO 5FLXN 2UUBO 4DV0O 1R1BA 4B3RO 4LF8O 4X64O 4JI3O 2E5LO 4JI4O 1FKAO 4LF9O 1AILA 4OPAA 5A2QN 2FKXA 1DK1A 4DR6O 4NXNO 4X66O 2UXDO 3J7AU 4LFCO 4YHHO 2ZM6O 1N34O 4DV6O 3RT3C 4JI1O 4DV4O 3T1HO 5BY1A 4DV3O 4KHPO 2UUAO 4B3SO 1X59A 4JI0O 4JI8O 1KUQA 1N36O 4LF7O 5H5NA 3R66A 5BXZA 1D2DA 1J5EO 5LMNO 2VQFO 4OPHA 1N33O 5IT9N 4OX9O 4DV2O 1IBKO 4LF5O 2ZKOA 1HNXO 2Z0AA 4X62O 4DR5O 1R6TA 1HNWO 4NXMO 4DR3O 3OTOO 3SDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 O;  5LL6 Y;  1XNR O;  4B3M O;  4JI2 O;  2DJV A;  2UXB O;  4DUZ O;  2F4V O;  1FJG O;  1HR0 O;  1G1X B;  1A32 A;  5IWA O;  3J80 N;  4B3T O;  5LMU O;  4DR1 O;  2AGA A;  4YY3 O;  3J81 N;  4DV1 O;  1F7Y A;  4LF6 O;  2UU9 O;  4DV7 O;  2UUC O;  2JRI A;  1XMO O;  1XNQ O;  2UXC O;  3M8A A;  1I94 O;  1HNZ O;  4DR4 O;  2LW7 A;  4LFB O;  3F5T A;  2HHH O;  4JI6 O;  4AQY O;  4DR2 O;  5BR8 O;  4X65 O;  3T1Y O;  4GKJ O;  1AB3 A;  3O65 A;  4JYA O;  1YZB A;  1N32 O;  1XMQ O;  4K0K O;  1NS1 A;  1IBL O;  4JI5 O;  2VQE O;  4LFA O;  4JI7 O;  4DR7 O;  3JAM N;  2DOS A;  4A5U B;  4LF4 O;  4GKK O;  1FYJ A;  1XEQ A;  2N74 A;  4JV5 O;  1IBM O;  4DUY O;  5FLX N;  2UUB O;  4DV0 O;  1R1B A;  4B3R O;  4LF8 O;  4X64 O;  4JI3 O;  2E5L O;  4JI4 O;  1FKA O;  4LF9 O;  1AIL A;  4OPA A;  5A2Q N;  2FKX A;  1DK1 A;  4DR6 O;  4NXN O;  4X66 O;  2UXD O;  3J7A U;  4LFC O;  4YHH O;  2ZM6 O;  1N34 O;  4DV6 O;  3RT3 C;  4JI1 O;  4DV4 O;  3T1H O;  5BY1 A;  4DV3 O;  4KHP O;  2UUA O;  4B3S O;  1X59 A;  4JI0 O;  4JI8 O;  1KUQ A;  1N36 O;  4LF7 O;  5H5N A;  3R66 A;  5BXZ A;  1D2D A;  1J5E O;  5LMN O;  2VQF O;  4OPH A;  1N33 O;  5IT9 N;  4OX9 O;  4DV2 O;  1IBK O;  4LF5 O;  2ZKO A;  1HNX O;  2Z0A A;  4X62 O;  4DR5 O;  1R6T A;  1HNW O;  4NXM O;  4DR3 O;  3OTO O;  3SDL A; 
#chains in the Genus database with same CATH topology
 4DV5 O;  2ADP A;  4DR6 B;  1PL0 A;  4LH7 A;  1GK9 A;  2EIL C;  3ZMT A;  1QVF U;  1P49 A;  1LUW A;  4I50 A;  2OTJ V;  3G80 A;  4EB6 A;  4TT3 G;  2JS3 A;  5EK0 A;  3JAK A;  4JI0 B;  1KKD A;  4FIP C;  4I9W A;  4RQF A;  1J5E B;  4NR1 A;  2KQX A;  2R9A A;  2HVJ C;  5GON A;  4MS2 A;  2ZIN A;  3ZX6 A;  1ZWI C;  4IIJ B;  4EKW A;  3LSU A;  1K4C C;  2P5O A;  2F43 G;  3P30 A;  3HPL C;  4UVA A;  2FYU H;  1YF2 A;  2WLJ A;  2P4V A;  3JSL A;  4DK0 A;  2FTK A;  5FNV B;  4JAU A;  4WFH A;  4DV0 O;  1E1R G;  1YVW A;  1DF5 A;  2C2A A;  1PPJ H;  4D7T A;  4NKG B;  2HEP A;  2WLL A;  3KCY A;  4J42 A;  2ZXW B;  4WFF A;  4X8A A;  3VBB A;  3M7M X;  2OWO A;  2JGD B;  3DGE A;  3GB7 C;  4PJ0 Z;  4JYA B;  3T1H O;  2WLM A;  1N32 B;  1X59 A;  3ZMZ A;  4TSF G;  1IXM A;  1WPB A;  1W0K G;  5JJE B;  3TJT A;  1RSO A;  3GWO A;  4JI7 B;  4U7N A;  4GX1 A;  2Z0A A;  4O4I B;  5IJ9 B;  1M90 W;  4JAA A;  3QO8 A;  3FB6 C;  4R8C A;  2XAS A;  4LWS A;  4X1K B;  4GZR B;  1Q86 W;  4O4L B;  1L0N H;  1AR4 A;  3ZIA G;  1Q5O A;  3IC7 A;  1YJW V;  3RYH B;  3ABM B;  1L1F A;  2A3Q A;  2ZQM A;  5JQG B;  4FK5 C;  1QVG U;  4X20 B;  1BQ0 A;  1GN2 A;  2IJK A;  4UUJ C;  5LYJ B;  4JI3 B;  4FLV A;  1JX9 A;  4HAM A;  3K79 A;  5IYD O;  4FMT A;  4DR2 O;  4CS3 A;  4CC5 A;  3T1Y O;  4H37 A;  1FXV A;  5KHI A;  3WU2 Z;  1JPX A;  1FAF A;  3BCC H;  4LCU C;  3HB3 B;  4HBN A;  5LP6 C;  5JJN B;  1FFT B;  1OCC C;  5IYC O;  3TXS A;  3BA9 A;  5KAF Z;  4MVZ A;  1Y76 A;  1XEQ A;  3AG3 B;  4B7E A;  5LOV B;  2MK3 A;  2A0L A;  4B3T B;  4DR1 B;  4UB8 Z;  4OXS A;  1WNS A;  1XNQ B;  3CRR A;  4FLX A;  1QNM A;  4JYY A;  1FXK C;  1BGY H;  1OCZ C;  3OW2 U;  1ROP A;  3JD1 A;  4QPJ A;  3APO A;  4JPR A;  4DV6 O;  2BOC C;  4FFB B;  1M56 C;  2JJ2 G;  1V55 B;  4LF7 O;  2LGW A;  2QWQ B;  3K08 A;  4X1I B;  3K06 A;  1NTZ H;  4DV2 O;  4LF4 B;  3CXH F;  3SJC C;  1WLE A;  1SF9 A;  4O2A A;  4ZOL A;  4DUY B;  3JD3 A;  4B3R B;  3A0B Z;  3I56 V;  2XND G;  2HJD A;  2KB1 A;  2ATK C;  2UXB O;  2ADQ B;  2F4V O;  3HKD A;  2LFS A;  4AI8 A;  1BHA A;  3OE7 G;  1IUR A;  4U3J A;  5JCO C;  2QGN A;  1S5J A;  3JD0 A;  1Q8I A;  1NI8 A;  4JI1 B;  4DV4 B;  1AR5 A;  1G4Y B;  1K7D A;  2UU9 O;  2H94 A;  2JS5 A;  2M7W A;  2BOB C;  2EZO A;  3SJB C;  1WA8 B;  4X62 B;  2V7Q G;  1NKD A;  4WFG A;  3K5O A;  5BMV B;  2LFR A;  1F51 A;  2IBZ H;  1R3L C;  1MSD A;  2FL4 A;  4PDV A;  2X6A A;  1YTF D;  1XNR B;  4X1Y A;  5CN0 A;  2VQE O;  4XBF A;  4KUM A;  1AJP A;  4DUZ B;  4AHC A;  1OCO B;  3K57 A;  2GSM B;  4J80 A;  4QPK A;  3X2Q B;  1E79 G;  1KQS U;  5IWA B;  2V1D A;  3QG5 A;  4CH4 A;  1VQP V;  4GX5 A;  1NVP B;  4NXM B;  3QVN A;  3OM3 B;  2UXC B;  3IGA C;  3J7A U;  1I94 B;  4I50 B;  1HWY A;  1K5S A;  2BSK B;  5L3F A;  1H8H G;  3JAK B;  2WA4 A;  2YXH A;  1VQK V;  4J11 A;  3NXS A;  1QQC A;  3FYI B;  3OMA B;  2YEV B;  2N04 A;  5LMN O;  3BAB A;  4DR7 B;  2ZCE A;  1TUB A;  5GON B;  1IBK O;  2ZKO A;  3ETD A;  1HNW O;  1FS0 G;  3E22 A;  2UUB B;  3AK2 A;  3E2E A;  1Y66 A;  3ZMS A;  4KFM A;  5LHI A;  4GX0 A;  3L72 H;  3APQ A;  3ZHQ A;  1H2M A;  5F2V O;  1M57 B;  3OTF A;  1R3K C;  4GUN A;  3RYI A;  3T1C A;  2F95 B;  3K03 A;  2XUM A;  1SZT A;  5E79 Z;  4P30 A;  5DED A;  3N2K A;  4TV9 A;  1DLB A;  2D3O W;  4WFB V;  4DV1 O;  3G6B A;  4LP8 A;  3DC6 A;  2DN9 A;  3G4S V;  2XAH A;  1OHH G;  2WLL B;  1DTO A;  2ILM A;  2Y48 A;  3SPC A;  4XDL A;  2ZXW C;  1N33 B;  4NVP A;  2EIN B;  4OX9 B;  2WLI A;  3SJA C;  4MVO A;  2BTQ B;  1P84 F;  3RVZ A;  3CJH A;  2XTA A;  5KMG A;  4FM1 A;  1JMK C;  1NS1 A;  4TWK A;  3K5L A;  3ABU A;  1SQV H;  2HFE C;  1ENV A;  2QWO B;  1M5I A;  1T5E A;  2IJJ A;  5CBG A;  3S3X A;  4GKK O;  1NR7 A;  2N74 A;  3JAS A;  4YJ2 A;  1IBM O;  3L70 H;  2HP8 A;  1YI2 V;  1S72 V;  3QO7 A;  1WP8 A;  2RQ6 A;  3D3Q A;  2GDS A;  3FX7 A;  1SKV A;  4LWS B;  3U10 A;  2RNB A;  2FB5 A;  4BW9 A;  3N2G B;  2GBO A;  1WB7 A;  1MG1 A;  2ITD C;  2XOK G;  1SQG A;  1PM9 A;  4FZ1 A;  3K59 A;  1MZF A;  1PNM A;  4G2K A;  5GTI Z;  3ABM C;  4YHH O;  4AQY B;  5C8Y B;  3VQW A;  1CXZ B;  1G8M A;  1H2L A;  3K0G A;  1AI6 A;  2YUA A;  4MTF A;  2Q73 A;  3IFX A;  1BS3 A;  3CMA V;  3AG4 B;  3UKM A;  4JI8 O;  2EBO A;  2AZ2 A;  1D2D A;  5KHJ A;  2VQF O;  4OPH A;  4DK1 A;  2P7T C;  4N21 A;  3CC2 V;  1LR1 A;  3VOU A;  3ZHU A;  1YXB A;  4DR3 O;  4DW0 A;  2HHH B;  2E74 B;  3H01 A;  4I0X A;  2GV9 A;  1MZE A;  1SC5 B;  2Q67 A;  2A9H A;  1Y76 B;  3PN1 A;  5LGU A;  3AG3 C;  1BCC H;  4BW5 A;  3J80 N;  1COW G;  2OCC B;  3RBZ A;  3HKC A;  3RW0 A;  4L8J A;  3W7U A;  4X64 B;  2E3C A;  1YCI A;  2W6I G;  4WBN A;  3UT5 A;  4O2B A;  5A9G A;  5JWP A;  1K8A W;  4LF9 B;  3TCU A;  2ZDI C;  3E35 A;  4XDK A;  1VIB A;  4Z1M G;  1AB3 A;  4X89 A;  1AVM A;  4JZG A;  3VQX A;  1XMQ O;  1GM8 A;  2EIK B;  1V55 C;  1BSM A;  3VQY A;  3OUS A;  2WPD G;  4JI5 O;  3DC5 A;  4LFA O;  1H38 A;  1XOU A;  2A06 H;  4MVQ A;  2ZNI A;  5EBL C;  1JVM A;  4O2A B;  1YJN V;  4ZOL B;  4RWU A;  3STL C;  1WJZ A;  1AP5 A;  1TAE A;  4PI2 A;  3ZN1 A;  1PNL A;  1VF7 A;  5FPO A;  5L3E A;  4OPA A;  3LDC A;  2UXD O;  2A79 B;  3HKD B;  4J7Z A;  1AJQ A;  2EIM B;  3OUF A;  3H1L H;  3OMI B;  4QJF B;  1TVK A;  1YSC A;  2IJI A;  2WSS G;  1XHZ A;  1FJG B;  2Q69 A;  3MHS C;  4DV3 O;  1VAR A;  3ASN B;  4I9Q A;  4LC1 A;  3H9V A;  2ZIM A;  3E8H A;  4CS4 A;  4W4L A;  5LHH A;  1U97 A;  3SPI A;  5AG2 A;  1BQZ A;  3AK3 A;  1NTM H;  4NTX A;  4DV0 B;  3OTO O;  1UJW B;  2EX3 A;  4C7U A;  3W7X A;  4X1Y B;  3CXC U;  3ZMU A;  5KLV H;  1QCE A;  1OCO C;  3JYC A;  2ZE8 A;  4UB6 Z;  1GAX A;  3NR7 A;  3X2Q C;  1M93 A;  1MSW D;  4CH3 A;  4JAS A;  1RM1 B;  2QTS A;  3T1H B;  1SQF A;  4DRX A;  4PEL A;  1H8E G;  1KB9 F;  1VQ4 V;  5D5P A;  4ZHQ A;  3ABK B;  3CX5 F;  4LNU A;  4DR4 O;  5B1A B;  1N0N A;  3B8N A;  4JI6 O;  3CME V;  2P06 A;  1NH2 B;  1SER A;  1AI4 A;  2QKS A;  1MA1 A;  1URF A;  4TQD A;  3SYC A;  1VF5 B;  4K0K O;  3ETQ A;  1N34 B;  1GMG A;  1KP2 A;  1TUB B;  4WF9 V;  3FFQ A;  3ZHR A;  3EFF K;  1L0L H;  4PA3 A;  5JVD B;  4IYI A;  1UPG A;  3E22 B;  4MT8 A;  3JAL A;  1I5X A;  3TGU H;  2IM9 A;  4JTC B;  1IXB A;  3ZS8 C;  1GTO A;  5A2Q N;  3S3W A;  2FKX A;  2X7R B;  1EN5 A;  3RYI B;  2N05 A;  1M57 C;  3CCR V;  2ARH A;  3MAQ A;  2HVK C;  3LNN A;  3B4S A;  1B06 A;  4MW8 A;  2Y4T A;  3N2K B;  4TV9 B;  2ZM6 O;  4DR2 B;  2PY5 A;  3HKB A;  3T1Y B;  4ICG A;  4BR6 A;  1W0J G;  1MNG A;  5CA1 A;  4KXR A;  4H0L B;  2WLI B;  1X4T A;  2YIB D;  2EIN C;  4P9O A;  1JFF A;  2VS0 A;  1VQ5 V;  2YC0 A;  3A0R A;  3JSN A;  4I4T A;  1K9M W;  3CJH B;  4RUE A;  4FLT A;  3W7S A;  1R3J C;  1GRJ A;  1GM7 A;  3ABL B;  3MD0 A;  3Q4H A;  4JI2 O;  3ZN0 A;  4JF3 A;  2DWE C;  3CCS V;  5J2T A;  4K8Z A;  1NTK H;  1NVP D;  5BZB A;  5JH7 B;  3FB5 C;  2VWK A;  4LF6 O;  2YID A;  4BIO A;  4GT1 A;  1XMO O;  1D5N A;  1CPY A;  3THO A;  4LFB O;  4AIL C;  5IY5 C;  3CEI A;  3P3P A;  4UCS A;  2IJH A;  4DV2 B;  4X65 O;  1YZB A;  4X88 A;  4K8X A;  2IU0 A;  3AG4 C;  3JAT A;  4Q6G A;  4I55 A;  1D5A A;  1LUV A;  1DF4 A;  1B04 A;  3RN4 A;  2UXB B;  1FPO A;  5HFM A;  2F4V B;  1RPO A;  4I0X B;  5IYB O;  1IDS A;  4TV8 A;  4UVB A;  4U7O A;  1ZUQ A;  5K1P A;  2Q0A A;  4JTA B;  4MW3 A;  4JI4 O;  2R70 A;  2Z5U A;  3T4Z A;  1QR8 A;  2WAM A;  1DK1 A;  2UU9 B;  3UCS C;  4X66 O;  4IHJ B;  3EXA A;  1EN4 A;  2ZR3 A;  2RN9 A;  3MDS A;  4J9Y B;  4PA4 A;  5B1O A;  2HR3 A;  3HKC B;  2OCC C;  3SPH A;  1PNK A;  3W7T A;  3ZHS A;  5EBM C;  4WBN B;  1YEW A;  1R6N A;  1NZ6 A;  3UT5 B;  4O2B B;  3IJ4 A;  2JDI G;  1F23 A;  5BXZ A;  2VQE B;  4UXN A;  3AG1 B;  1AP6 A;  2PYJ A;  4R50 A;  3BRC A;  5B1B B;  3SDL A;  2EIK C;  4ZKI A;  2PI5 A;  1QHT A;  3HR0 A;  2GTA A;  4B3M O;  3CCM V;  5B3S B;  4GX2 A;  1JQ0 A;  2QWR B;  4UCR A;  1IVS A;  3K04 A;  4JYB A;  4F4L A;  3T2M A;  1H2G A;  2QDO A;  4ASU G;  4CS2 A;  3AG2 B;  4ZIB A;  3ZJZ A;  2QKA A;  2EIM C;  2P67 A;  2XAF A;  1TVK B;  4WCE V;  5B1N A;  1FXK A;  5LMN B;  2Q5Z A;  1IBK B;  4NXN B;  2YIA A;  5CA0 A;  2NNU A;  1HNW B;  2Q4P A;  1S3J A;  3ASN C;  1L8D A;  2AHZ A;  3B40 A;  3RYC A;  1MOF A;  1IBL O;  1K4D C;  2IH3 C;  2UXX A;  2DQ0 A;  1S5L Z;  1YDX A;  3SPG A;  4YIO A;  3CS5 A;  1F4N A;  2AHY A;  4LF8 O;  2DMX A;  1XRE A;  4JI3 O;  2E5L O;  3H1J H;  4U3F H;  3U0Z A;  3P32 A;  2Q6A A;  4LFC O;  3RYF A;  4LBE C;  4HZ3 A;  3O9O A;  1RM1 C;  3UO2 A;  4O4H A;  3TET A;  2UXN A;  4YXW G;  2ZD9 A;  2UUA O;  4B3S O;  2KG7 A;  4Z2W A;  4ZHQ B;  1NJI W;  2LO1 A;  1N36 O;  3ABK C;  1Q6H A;  3D36 A;  5B1A C;  3LUT B;  3QTC A;  2W0X A;  4MTG A;  1AR1 B;  3ICX A;  3RGB A;  1HW7 A;  1QLE B;  1OCR B;  1HNZ B;  1IBM B;  1CP9 A;  3DXR A;  5DEC A;  4EB6 B;  1SQP H;  3FD9 A;  2OYQ A;  2NR5 A;  3CSX A;  1OJH A;  1SRY A;  2BE3 A;  2E76 B;  2F66 C;  1VMG A;  3ZRV A;  2Y69 B;  4IL6 Z;  4F6R A;  3IAY A;  3H1H H;  5ITZ A;  4EEQ A;  4ZBM A;  1TUE B;  3JAL B;  1RP3 B;  4FPP A;  4QNH B;  3JD4 A;  5LHG A;  3J81 N;  4W4K A;  4ZI7 A;  2P22 C;  4JI8 B;  4E2L A;  2FML A;  1LNQ A;  2VQF B;  3WG7 B;  3HKB B;  2K1E A;  3I5D A;  3IC9 A;  4CZZ A;  4GKJ O;  2DW4 A;  5C93 A;  1KMI Z;  4DR3 B;  2DWD C;  4YIP A;  5CA1 B;  2DYR B;  3LSS A;  4P2Z A;  1XQ8 A;  1US6 A;  4MVR A;  4FLW A;  3CCU V;  2HLD G;  1JFF B;  4IGG A;  3FB8 C;  2BCC H;  4I4T B;  3CCL V;  3OGC C;  2LW1 A;  4UCU A;  1YIJ V;  5CBH A;  2ZE6 A;  1SA0 A;  3K0D A;  1PD3 A;  1R1B A;  4IIJ A;  4JZ2 A;  4NYK A;  3SYA A;  1WP7 A;  3ABL C;  3D3I A;  2LGQ A;  1SET A;  2WA3 A;  3A2F A;  5DN6 G;  4UV9 A;  3OGI B;  2CH7 A;  1RSO B;  5J2T B;  1ORQ C;  4UV8 A;  4ABM A;  1H2K A;  2OT5 A;  2D2C B;  4PDL A;  3BY6 A;  3M99 B;  1XMQ B;  1EN6 A;  1Y6X A;  4PI0 A;  5EIB C;  3CWB H;  1THZ A;  5LMU B;  1NH2 D;  2LJ2 A;  4JI5 B;  3JAW A;  1ZX3 A;  4QIW F;  1RFY A;  3OAA G;  1HNX O;  2ZNJ A;  4K3A A;  2YXY A;  2JEX A;  3L75 H;  1Q7Y W;  4NXM O;  4G28 B;  5CB4 A;  5IY5 B;  3JAT B;  2ZR2 A;  1WB8 A;  4I55 B;  1VQ6 V;  5LXT A;  3I55 V;  2XHB A;  1Z2G A;  3C3T A;  4EFE A;  1AI7 A;  3CRC A;  5H6R A;  4QGP A;  2B5U A;  2OTL V;  4TV8 B;  1G1X B;  4HNA A;  1J95 A;  3KCX A;  2G38 A;  4FVM A;  2AGA A;  4G27 B;  2Y0I A;  4YY3 O;  4F6E A;  3BPZ A;  3OR6 C;  3E8F A;  4DV3 B;  2XAJ A;  1JJO A;  1Z5V A;  2UUC O;  3M8A A;  2CGN A;  4FZ0 A;  2WWW A;  1PV0 A;  1VQN V;  3PJS K;  2PF4 E;  5BR8 O;  3LNM B;  3O65 A;  5JQG A;  3D8C A;  3OTO B;  1M4U A;  4PDR A;  5J2U A;  1S77 D;  3G71 V;  2GHY A;  3CB2 A;  3AG1 C;  3BAA A;  2B1G A;  1KU9 A;  3QO5 A;  3A8T A;  5B1B C;  3ZMV A;  2PTM A;  4LF5 B;  1BHB A;  3ZRW A;  1EFR G;  4MTO A;  3UQ8 A;  1JOY A;  4JGS A;  3DTU B;  2A7W A;  5B3S C;  4DV5 B;  2LQT A;  3E89 A;  4JI6 B;  5EIB D;  3HKE A;  3AG2 C;  1IZ3 A;  2AXT Z;  1KUQ A;  4FM2 A;  1G6U A;  1Y4M A;  1BL8 A;  5CA0 B;  2ZDI A;  4DR5 O;  5KHH A;  2LP7 A;  4U3J B;  2JGU A;  2H3O A;  4FFB A;  3RYC B;  1SZX A;  5J9P C;  3B2E E;  5IE9 A;  4X1I A;  2YI9 A;  4LH6 A;  1PP9 H;  3RVY A;  1HR0 O;  1ARO P;  2ODM A;  3CPW U;  2B9Z A;  3OR7 C;  1YIT V;  2CTR A;  3F7Y C;  3L9D A;  3G6E V;  1FFX A;  1NQT A;  4DV7 O;  3QNE A;  1H2S B;  3RYF B;  4UFZ A;  1Q82 W;  5H2F Z;  1KP3 A;  1F4M A;  4UCT A;  1AI5 A;  2HHH O;  3L73 H;  4O4H B;  1K5Q A;  1N4C A;  2RCV A;  2KG7 B;  4J7J A;  1V54 B;  2X6C A;  5L3C A;  4RQE A;  3L71 H;  4J41 A;  1K3E A;  5LGT A;  2RJZ A;  4JI2 B;  1K92 A;  1BZK A;  3CC4 V;  1KKC A;  3CHX A;  3K58 A;  5IJ0 A;  2W0F C;  1XBL A;  4H44 B;  3B8M A;  3C3S A;  4YJ3 A;  1QLE C;  1OCR C;  1MMM A;  2YIB A;  1GKF A;  3DXR B;  4CH5 A;  1V9P A;  4X64 O;  2P6J A;  1VQ7 V;  1NR1 A;  3A0H Z;  4FM0 A;  4F6R B;  4LF9 O;  5ITZ B;  2Y69 C;  1IX9 A;  1XMO B;  2E75 B;  1VF6 A;  3K5M A;  3CCJ V;  5JJJ B;  4LFB B;  1Q81 W;  2RDC A;  3ZRS A;  1DGS A;  3DSQ A;  3L74 H;  4Q20 A;  4X65 B;  3FYE B;  3E83 A;  4ZI7 B;  3CE2 A;  4KHP O;  2GTS A;  2P90 A;  3SGI A;  2JEU A;  2DQ3 A;  5H5N A;  3CCQ V;  3R66 A;  1N0J A;  3WG7 C;  5EC2 C;  2BSK A;  1BE3 H;  1R6T A;  1VQ8 V;  4B08 A;  1P7B A;  3KKY A;  2DYR C;  1K33 A;  4JI4 B;  2YEV A;  5KHK A;  4X66 B;  4L87 A;  2F23 A;  4TUY A;  5KUK A;  1FJG O;  3SPJ A;  1SA0 B;  4RUF A;  3JCU Z;  5EYP A;  1A32 A;  2EIJ B;  3WB2 A;  2QE7 G;  3WFV A;  3CCE V;  3N27 A;  3JAR A;  5LA6 A;  5KMG B;  1QLN A;  2ZIO A;  2CH7 B;  1TA8 A;  2P4K A;  2LW7 A;  5KUM A;  4MSW C;  2R9R B;  3FKS G;  1EZV H;  1FXH A;  2CTW A;  3R65 A;  1XUQ A;  3JAS B;  3AG7 A;  4P9P A;  4YJ2 B;  1ZTE A;  1Q6I A;  4LR3 A;  1M1K W;  4IT5 A;  3JAW B;  2CE4 A;  4I5S A;  4DV6 B;  3KG2 A;  4B3M B;  3ZHV A;  1FD9 A;  4A5U B;  1BT8 A;  1Y74 A;  4LF7 B;  5CB4 B;  4JV5 O;  2ITC C;  2CTQ A;  2BTQ A;  2JVD A;  5FLX N;  5LXT B;  5CA3 A;  4FLU A;  1HP8 A;  3E8B A;  2PGG A;  1AIL A;  3P3N A;  4DR6 O;  1XIL A;  2PI4 A;  2QTO A;  2KSD A;  3OMN B;  5KA6 A;  4HNA B;  1EBO A;  5CMU A;  3VQV A;  4K35 A;  1I5Y A;  1VP7 A;  2F93 B;  3BEH A;  1N34 O;  3SYQ A;  1ZLZ A;  3JD2 A;  3K9S A;  1GN6 A;  1W59 A;  4JI0 O;  2QM8 A;  3ETG A;  3N2G A;  2YDE A;  4UCO A;  4NB5 A;  1IBL B;  1VQ9 V;  1GN3 A;  1J5E O;  1SQB H;  5KX5 A;  2QEX V;  5D5Q A;  3OFN G;  5C8Y A;  1I08 A;  2ZE7 A;  5J2U B;  3C90 A;  1OZ0 A;  2YSU B;  4H33 A;  4LF8 B;  1S0V A;  3T4D A;  1CEZ A;  2E5L B;  1ZL8 A;  2ZT9 B;  3B77 A;  2DE0 X;  3LSQ A;  2X0L A;  2PZS A;  5FPR A;  5IYZ A;  2CTP A;  4LFC B;  3SYO A;  1B3Q A;  1YJ9 V;  2QKC A;  3ZRW B;  1O9H A;  1K97 A;  2PUS A;  2B1I A;  3EVK A;  1HDJ A;  3RFR A;  3OT7 A;  1F7Y A;  2WLH A;  2OIE A;  3E8G A;  2UUA B;  4B3S B;  2JJ1 G;  1N36 B;  1Q6U A;  2NLJ C;  5EZY A;  1VQM V;  5LP6 A;  3FB7 C;  3CRM A;  1NT2 B;  4JYA O;  3HKE B;  2O57 A;  4JAV A;  1N32 O;  3FAV A;  3ABT A;  4WFE A;  2HG5 C;  4JYC A;  4Z1V A;  4PA9 A;  4JI7 O;  2DOS A;  4PV1 B;  1FYJ A;  2AZ0 A;  3BFR A;  4MVS A;  1RPR A;  3KZI Z;  5LGN A;  2JIZ G;  2EUL A;  3K3W A;  1O9G A;  1PKX A;  3ASO B;  4EFB A;  2GUZ A;  4J7K A;  3TXQ A;  4DXW A;  2YXL A;  5KHG A;  4QE9 A;  4GKJ B;  1FFX B;  1P7G A;  2OCH A;  1JJ2 U;  4DYL A;  2OIG A;  3SJQ C;  1I0H A;  3ZCC A;  4RAI A;  1VQO V;  5GW7 A;  3OEH G;  2W6J G;  2EJR A;  4DV1 B;  2XAQ A;  5B5E Z;  3CYO A;  1Q43 A;  2XAG A;  4UCV A;  5DM6 V;  4O4J A;  1V54 C;  3TK1 A;  3D36 C;  5JCO A;  2DYS B;  4DRX B;  4E4E A;  5LL6 Y;  5E1A C;  5IJ0 B;  3CCV V;  1R3I C;  4X9Q A;  3ZRX A;  3EHB B;  4HYO A;  4YJ3 B;  2Q7E A;  3SR2 C;  4LNU B;  2IU3 A;  2V4D A;  5HFL A;  3ML0 A;  1M9N A;  4B3T O;  3G67 A;  2JK5 C;  1ZSP A;  4DR1 O;  4GKK B;  4KL1 A;  2Y4U A;  1XNQ O;  2IW5 A;  2AW9 A;  3ZBH A;  4R6Z A;  1KD1 W;  2QWP B;  1HNX B;  4PHZ A;  5H9C A;  1E1Q G;  5EC1 C;  4YHH B;  3ZHT A;  3CD6 V;  3B09 A;  1U96 A;  2HKO A;  3AEI A;  4H13 B;  1MAB G;  1N8R W;  1H2N A;  3JAM N;  2EIL B;  4LF4 O;  3CRA A;  1SQX H;  4NTW A;  5L3D A;  3H1K H;  4DUY O;  4B3R O;  4YY3 B;  4CH6 A;  1FKA O;  3OD4 A;  3LDE A;  4TUY B;  4PDM A;  4NXN O;  2UUC B;  4XDJ A;  1KC8 W;  2YIC A;  5JVD A;  5EYP B;  4J9Z B;  2EIJ C;  5BR8 B;  2F1M A;  3JAR B;  5LA6 B;  5B66 Z;  1KBH A;  2EJ7 A;  3RT3 C;  4JI1 O;  4CBC A;  4DV4 O;  1QR9 A;  4CC6 A;  1WN7 A;  2CK3 G;  1NBM G;  3OEE G;  3Q4H B;  4D7S A;  2CAZ C;  1GH6 A;  4X62 O;  2MW2 B;  4DW1 A;  5FNV A;  4N23 A;  2BTO A;  5EBW C;  1GM9 A;  4D6T H;  1NU1 H;  2R9I A;  4PA7 A;  1YHQ V;  1XNR O;  1Y74 B;  4DUZ O;  2ETN A;  2Q9L A;  4I7Z B;  2Q8V A;  3RWR D;  2Q0O C;  3STZ C;  4LFA B;  1JR9 A;  5FL7 G;  5IWA O;  2JGD A;  5TIS Z;  2Y0P A;  4FFK A;  3AK1 A;  2UXC O;  1TGO A;  1I94 O;  2HJF C;  1HNZ O;  3BA8 A;  4BIU A;  2XT9 A;  5L3B A;  3GVM A;  1VEW A;  3JCZ A;  2Q7H A;  4DR5 B;  2UXD B;  2X6B A;  2H8P C;  2WLK A;  4O4I A;  5JH7 A;  1SQQ H;  5IJ9 A;  5L3G A;  2QM7 A;  1XI1 A;  5KX5 B;  2M6Y A;  3QF7 A;  3WB1 A;  4DR7 O;  2YI8 A;  1S76 D;  1Z5W A;  4X1K A;  4B7K A;  4KP4 A;  1VQL V;  4O4L A;  2KKW A;  1HR0 B;  1Q90 D;  1WPX A;  2K9P A;  1XL6 A;  3RYH A;  2UUB O;  1ZL8 B;  2RMK B;  1XHX A;  5CBF A;  5KAI Z;  5IYZ B;  4DV7 B;  1S5H C;  1XL4 A;  2ZE5 A;  4DO2 A;  4X20 A;  2CUG A;  4NTY A;  1SS3 A;  5LYJ A;  1JA8 A;  1I7F A;  1GO3 F;  2QJ1 A;  4IYH A;  2WLN A;  3WB0 A;  1AJN A;  2EZP A;  3E86 A;  4FLZ A;  2QR4 A;  3K5N A;  1PL4 A;  5EZY B;  2QWN B;  5LP6 B;  5H6Q A;  4IHJ A;  4RO2 A;  2CGO A;  1OCC B;  5K1X A;  1N33 O;  5IT9 N;  1GN4 A;  4OX9 O;  1YTF B;  2L35 A;  3FAV B;  3UM7 A;  4DR4 B;  3CRQ A;  3ETE A;  5LOV A;  1JCH A;  2QM4 A;  3CP1 A;  3U11 A;  3LDD A;  1B6Q A;  2QA4 V;  4PA6 A;  2NN4 A;  2DJV A;  2VRZ A;  4K0K B;  1FXK B;  1P4R A;  2PYL A;  1KEC A;  4GLX A;  1W2B U;  4J10 A;  2L6L A;  4OGQ B;  1OCZ B;  1EM1 A;  3K9A A;  5LMU O;  2GUZ B;  4MVM A;  3ASO C;  3CC7 V;  4KHP B;  1M56 B;  1KYO F;  2JRI A;  1ZAU A;  1OV9 A;  4WFA V;  4TOI A;  3F5T A;  3BHP A;  4AQY O;  1Q3E A;  4QE7 A;  1UFI A;  4PD4 F;  2ZM6 B;  1K34 A;  1EZJ A;  4GYC B;  1R6K A;  4R7C A;  2CDY A;  1BMF G;  4O4J B;  4UVC A;  3H1I H;  4GCZ A;  1QBZ A;  4FLY A;  2Q68 A;  2DYS C;  2QSA A;  3ZED A;  5IDJ A;  3UO3 A;  1Y67 A;  1K73 W;  2IH1 C;  3SYP A;  1XDC A;  3MHH C;  5GTH Z;  3F7V C;  4JTD B;  2Z3Y A;  5KA5 A;  2VWJ A;  1WA8 A;  3BVO A;  5BY1 A;  1VF6 C;  5BMV A;  4FJC C;  2YS8 A;  5LBQ A;  4BWA A;  3W7W A;  3GWK C;  1QU7 A;  4LF6 B;  4MTX A;  4LF5 O;  1R73 A;  2R72 A;  4MVU A;  2Q7G A;  4BAY A;  3F5W C;  4JV5 B;  1WAZ A;  4TQF A;  4BIZ A;  1SES A; 
#chains in the Genus database with same CATH homology
 4DV5 O;  5LL6 Y;  1XNR O;  4B3M O;  4JI2 O;  2DJV A;  2UXB O;  4DUZ O;  2F4V O;  1FJG O;  1HR0 O;  1G1X B;  1A32 A;  5IWA O;  3J80 N;  4B3T O;  5LMU O;  4DR1 O;  2AGA A;  4YY3 O;  3J81 N;  4DV1 O;  1F7Y A;  4LF6 O;  2UU9 O;  4DV7 O;  2UUC O;  2JRI A;  1XMO O;  1XNQ O;  2UXC O;  3M8A A;  1I94 O;  1HNZ O;  4DR4 O;  2LW7 A;  4LFB O;  3F5T A;  2HHH O;  4JI6 O;  4AQY O;  4DR2 O;  5BR8 O;  4X65 O;  3T1Y O;  4GKJ O;  1AB3 A;  3O65 A;  4JYA O;  1YZB A;  1N32 O;  1XMQ O;  4K0K O;  1NS1 A;  1IBL O;  4JI5 O;  2VQE O;  4LFA O;  4JI7 O;  4DR7 O;  3JAM N;  2DOS A;  4A5U B;  4LF4 O;  4GKK O;  1FYJ A;  1XEQ A;  2N74 A;  4JV5 O;  1IBM O;  4DUY O;  5FLX N;  2UUB O;  4DV0 O;  1R1B A;  4B3R O;  4LF8 O;  4X64 O;  4JI3 O;  2E5L O;  4JI4 O;  1FKA O;  4LF9 O;  1AIL A;  4OPA A;  5A2Q N;  2FKX A;  1DK1 A;  4DR6 O;  4NXN O;  4X66 O;  2UXD O;  3J7A U;  4LFC O;  4YHH O;  2ZM6 O;  1N34 O;  4DV6 O;  3RT3 C;  4JI1 O;  4DV4 O;  3T1H O;  5BY1 A;  4DV3 O;  4KHP O;  2UUA O;  4B3S O;  1X59 A;  4JI0 O;  4JI8 O;  1KUQ A;  1N36 O;  4LF7 O;  5H5N A;  3R66 A;  5BXZ A;  1D2D A;  1J5E O;  5LMN O;  2VQF O;  4OPH A;  1N33 O;  5IT9 N;  4OX9 O;  4DV2 O;  1IBK O;  4LF5 O;  2ZKO A;  1HNX O;  2Z0A A;  4X62 O;  4DR5 O;  1R6T A;  1HNW O;  4NXM O;  4DR3 O;  3OTO O;  3SDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...