1K4DC

Potassium channel kcsa-fab complex in low concentration of k+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
publication title Chemistry of ion coordination and hydration revealed by a K+ channel-Fab complex at 2.0 A resolution.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k4dC00
4RUFA 3LDDA 5CBGA 3ZJZA 4QE7A 5KUKA 3LDEA 1K4DC 2YEVA 4PA6A 4WFEA 5EK0A 3AG2C 5B1BC 4EKWA 4QNHB 5EBMC 1OCZC 1M56C 1BL8A 4MW8A 4LCUC 2Q6AA 5EC2C 1OCCC 3EFFK 4J9YB 4PDRA 3E86A 3K0GA 2AHYA 2WLIA 3BEHA 4HYOA 4GX0A 2DYRC 2ZXWC 2WLIB 4RO2A 2X6AA 3SYOA 3T4ZA 4ZBMA 2EIKC 4MVOA 3F7YC 4X89A 3OR7C 3UKMA 3STZC 2X6BA 5B1AC 4HZ3A 4WFHA 4X88A 3SPIA 3AG3C 3SYAA 2EINC 3UM7A 3ASNC 3F7VC 4LBEC 4QE9A 3K06A 1OCOC 4P2ZA 2BOBC 3RBZA 2JK5C 2NLJC 3RW0A 2WLKA 1XL4A 2WLMA 4KFMA 3T2MA 2IH3C 3SPGA 3IFXA 3PJSK 4R7CA 3LDCA 4PDMA 4WFGA 2HVJC 4PDLA 1JVMA 4X8AA 3FB7C 2ATKC 2A79B 3ASOC 4GX5A 3K08A 2X6CA 5EC1C 2WLLA 1KKDA 5CBHA 3SJQC 2WLLB 3OR6C 4PA3A 2A9HA 2ITCC 2EIJC 2ITDC 2ZD9A 4MVZA 1LNQA 4G27B 4JTCB 4P9OA 4XDKA 2K1EA 4MVRA 3R65A 5BZBA 5IY5C 4F4LA 3AG1C 3E8BA 3IGAC 4MVUA 5J9PC 3VOUA 3FB8C 4R6ZA 5B3SC 1J95A 2H8PC 3WG7C 4H37A 2W0FC 3T1CA 3ABKC 4MTFA 3TCUA 3K04A 3K0DA 4MW3A 2OCCC 1S5HC 3RVZA 3HPLC 4LP8A 3TETA 2DWEC 1G4YB 4MVMA 1V54C 2Q69A 1ORQC 3AG4C 3SYCA 4TWKA 3E8HA 3E83A 3T4DA 1ZWIC 4UUJC 4P30A 1XL6A 4P9PA 3ZRSA 1V55C 3E8GA 2HFEC 4MTOA 1R3IC 4XDJA 1R3JC 4H33A 4R50A 3KG2A 4BW5A 4JTDB 4MTGA 3STLC 2DWDC 4GX1A 5CBFA 2R9RB 4JTAB 3OUFA 5EBLC 2DYSC 3ABMC 2EILC 3SPHA 4GX2A 2WLNA 4J9ZB 4RAIA 4XDLA 1K4CC 2QKSA 5KUMA 3FB5C 2HG5C 2P7TC 4PDVA 3SYPA 4PA7A 2Q68A 4PA4A 4R8CA 4I9WA 4MVSA 3GB7C 3SPJA 3SYQA 1M57C 2Q67A 4PA9A 3X2QC 4G28B 1QLEC 1R3KC 3OGCC 1P7BA 5EBWC 4OXSA 3K03A 4DXWA 3RVYA 4MS2A 2WLHA 3FB6C 4RUEA 1OCRC 2A0LA 3E8FA 2QTOA 3LUTB 4MVQA 3SPCA 1R3LC 4CBCA 4MSWC 4WFFA 2IH1C 2HJFC 2AHZA 3E89A 2BOCC 2HVKC 2KB1A 3F5WC 3JYCA 3LNMB 3OUSA 5E1AC 2EIMC 3ABLC 2Y69C 2WLJA
chains in the Genus database with same CATH superfamily
2IJKA 3LDDA 3CHXA 1BZKA 1H8EG 4DV2O 2CTQA 3HKDB 2B5UA 1WJZA 1AJNA 3ZN1A 2AZ0A 1F51A 1HNZO 2YI8A 4Q20A 3ZRWB 1KUQA 3EFFK 3K0GA 1MABG 4CS3A 1AI6A 2WLIA 4JYYA 4YXWG 1YTFD 2X6AA 2QEXV 1YF2A 4FLYA 3ZCCA 5H2FZ 5BR8B 1TVKB 3K58A 3SPIA 2RDCA 1NTZH 4QPJA 1KC8W 2PY5A 2Q9LA 2ZINA 3LDCA 4JYAO 3FB7C 1M93A 1XREA 3T1HB 1RM1B 3T1YO 3U11A 2XTAA 4LF7O 1NS1A 3CRCA 1O9GA 3D3IA 1SQFA 3VOUA 3FB8C 4R6ZA 2DJVA 5B3SC 2GHYA 1VF6C 3ZHVA 1RSOA 1THZA 4L8JA 1XNRO 2WSSG 1HR0O 1SQGA 1S5JA 1ORQC 2UXBB 2JVDA 3L75H 4I0XA 2UUCO 4FM0A 1N0JA 4R50A 1F4MA 5JVDB 3AG1B 5H5NA 1QQCA 4GX2A 4RAIA 4X1YB 2H94A 5HFMA 4JI0B 4DUYO 5CA1A 1BGYH 4PA9A 3CD6V 4YHHB 4ZOLB 2AZ2A 5JQGB 1XHZA 3ZMTA 4I55A 3G71V 1URFA 3VQVA 3JAMN 1Y74B 3JD4A 3OMAB 1O9HA 3LNMB 3IGAC 4LWSA 2EILB 4JI8O 2YEVA 3D36A 5LYJA 4U7NA 3CCRV 1HWYA 4I9QA 5FNVA 3I55V 1XMQB 2LO1A 3GVMA 2BSKA 3H1KH 2IJJA 2GTSA 4HNAA 1NQTA 3SYAA 3CB2A 3ASNC 2M6YA 4QE9A 1WNSA 4P2ZA 2BOBC 2UXCO 4JI3B 3A0BZ 5BY1A 5B1BB 4PDLA 2R70A 5LMNB 3OEHG 3K08A 3MD0A 4DV3O 1YCIA 5EC1C 5CBHA 4K3AA 4TSFG 4DW1A 1GM9A 1Y76A 2EIKB 2QE7G 3TCUA 4Z1MG 3DTUB 2DWEC 3A2FA 5GTHZ 1ZSPA 3JAKB 2WPDG 3JSLA 4TWKA 3AG4B 3E8HA 4PELA 3FD9A 1HNXO 4B3TO 5JH7B 4MTOA 4KUMA 3CE2A 1MMMA 3CCMV 1XOUA 5JWPA 1M5IA 3P30A 1VF6A 4JI2O 2IU0A 3ABKB 2Y0IA 2IU3A 2Q7EA 4UCOA 5IYZA 2UXBO 4JV5B 3ZBHA 3G80A 5EIBC 5E79Z 5IJ0A 5JJJB 1KBHA 4D7TA 1XEQA 1Q86W 3AK3A 3SPCA 1YJ9V 5LA6B 1MG1A 2R9IA 1H2LA 3B4SA 2AHZA 2EIMC 3ABMB 1GN4A 4H13B 1R6TA 1YZBA 4YHHO 4DV0B 1AB3A 2HKOA 4LF6O 4J9YB 1AILA 1M57B 1P7GA 5KAIZ 3GWKC 1P84F 1I5YA 2ZDIC 1VARA 3ZMZA 4FFKA 1PD3A 4IT5A 4UXNA 1SESA 1WAZA 1H2KA 2FTKA 3CC4V 4WFGA 4O4JA 3CWBH 1JPXA 2YXYA 3HKEA 3AK1A 4NYKA 4GKKO 4I50A 4LF8B 3UO2A 2WLLA 2JRIA 1GKFA 4X20A 3JAWA 4O4LA 2A9HA 1BQZA 2ITDC 3BAAA 4FLZA 5BZBA 1AJQA 1B6QA 3ZHUA 4JI3O 1Q5OA 2QKCA 1Q3EA 1OCOB 2CTPA 4JZ2A 4DV5B 4DR5B 3KKYA 1F7YA 1ZX3A 2WA4A 3SYCA 2YUAA 3MHHC 1IX9A 1L0LH 4JYCA 1IXMA 2YSUB 4BW5A 2D2CB 3N2KA 5C8YB 4AI8A 2JGDA 1XDCA 1M9NA 4JTAB 1R6NA 1ZL8A 2F4VB 1G1XB 1Z5WA 3SYPA 3CRAA 1E79G 1L0NH 5JCOA 1EZVH 4DK1A 5JJNB 4DXWA 1IXBA 1NH2B 5GW7A 4DR1B 4IIJA 3TK1A 1FXKC 3OUSA 1TUBB 5ITZB 3LDEA 4HBNA 1KB9F 3C3TA 4JV5O 4OPHA 4UV8A 2YIBA 4BIUA 2HHHB 5LMUB 3X2QB 2XAQA 2Z0AA 1NR7A 1I94O 4FLTA 4IGGA 3A0HZ 4ZHQB 3RYCA 4UV9A 3FFQA 4TV9B 4JPRA 4X64O 3ABLB 2WLKA 2ZE5A 4DV0O 4F6RB 3CJHA 4DR7B 4PDMA 3JD1A 1MZEA 1RPOA 2AGAA 2ETNA 4FJCC 1FPOA 2PUSA 1T5EA 2ZDIA 1IBMB 4TQFA 4F4LA 4CH3A 5H6QA 1M4UA 1G6UA 2W6JG 5KAFZ 2B1IA 1I08A 5H9CA 2W0FC 1JFFA 2Q4PA 1VQ9V 1GRJA 1UPGA 3LNNA 4LP8A 1G4YB 5IT9N 2KKWA 5L3BA 1RFYA 4O4IB 3E83A 4DR2O 1ZWIC 4YY3O 2IJIA 5CN0A 3STLC 1WPXA 4GX1A 4H44B 5EBLC 3ZHSA 3ABUA 4LF5B 3BPZA 3ZRVA 1HP8A 1VF5B 2OCCB 3J80N 2ODMA 1H8HG 4DV4O 1QVGU 5IJ9B 2HP8A 5LGTA 4WF9V 2WLHA 4FVMA 3UT5A 3CMEV 2PZSA 3B2EE 1R3LC 1N32B 2KG7B 4AQYB 4LFCB 3OTFA 2RQ6A 4RUFA 3RWRD 4DUZO 1BMFG 1IDSA 2YICA 3HR0A 4EKWA 4MTXA 1FS0G 3DGEA 3JATA 1YJNV 1UJWB 4GT1A 3QO7A 4PDRA 5IE9A 3E86A 1H2MA 3JALA 1VIBA 2Q0OC 1EN6A 4RO2A 5J2TA 1J5EB 3ETDA 3G67A 3F7YC 4X89A 2LJ2A 4X62B 2RN9A 1NH2D 2EINC 2XT9A 3K06A 1SF9A 5J2UB 4WBNA 2WLMA 1XL4A 1Y4MA 4FLXA 3VQXA 2LFSA 2Q5ZA 1S72V 3N2GA 1JA8A 1W0KG 3OD4A 1XI1A 1SZXA 4O4HA 1H2NA 3MDSA 2P4VA 4UCTA 1I0HA 4O2AA 2G38A 1MZFA 3KCYA 5JVDA 5LXTA 1BSMA 1BCCH 2GV9A 3WFVA 4DV1B 5LHHA 1BHAA 2BE3A 4NXMB 4J42A 4K8XA 3SJCC 1N34B 3SGIA 1P49A 4CC6A 2XNDG 4W4LA 5H6RA 4EB6A 1Y74A 1QCEA 5K1PA 3DXRB 4X1KA 1XQ8A 3CYOA 2HEPA 2ZT9B 1GH6A 1FJGO 4FLUA 2HG5C 4PDVA 3GB7C 1AR1B 5LOVA 1SERA 2JGUA 3K9AA 2FB5A 1S3JA 2QTOA 4MVQA 1WN7A 4UFZA 1KD1W 2HJFC 5IWAB 4LF5O 2JJ1G 3VQYA 2EIMB 1XL6A 3CRMA 1NKDA 1JJ2U 5D5QA 4QE7A 3ZJZA 1QHTA 3MAQA 3AG2C 3OMNB 5CMUA 1L8DA 1M56C 1YXBA 4LCUC 2ADPA 3CCJV 2Q7GA 5DECA 2ZXWC 1KP3A 1IBKB 3JARA 1SQPH 4NXNB 1DK1A 5LHGA 1PV0A 3F7VC 1N8RW 4LFBB 3B09A 2Y69B 3HKBA 1TAEA 3SPGA 4X66B 1QR9A 3P3NA 2DMXA 1OCZB 4X8AA 2A79B 4Q6GA 2X6CA 5JH7A 2QM7A 3O9OA 2ITCC 5IY5C 4DYLA 2B9ZA 4X62O 1CXZB 1NBMG 2GUZA 2FKXA 1EBOA 2E76B 3K04A 4PI0A 1YVWA 2JIZG 1YI2V 3AEIA 2GTAA 1OZ0A 2Q73A 3H9VA 4JI1B 4JZGA 3ASOB 4P9PA 2P6JA 4LF9O 2HFEC 4J41A 2QR4A 2QDOA 4DV1O 1R3JC 5EYPA 2GSMB 2ZE6A 1SA0A 4UCRA 4GKJB 1N34O 1XHXA 3BCCH 1PM9A 1JQ0A 1GK9A 4U3JB 3ZX6A 2NN4A 1XILA 3FKSG 1N33O 1IZ3A 3S3WA 4UB8Z 2Q8VA 4I4TB 3ZEDA 1FXKB 3RYIB 4TUYB 1MOFA 3B77A 2DYSB 4CS2A 2YIDA 5EK0A 1ZAUA 2OIEA 3M99B 3ZS8C 3TJTA 2Q6AA 4C7UA 5EC2C 1IBLO 4W4KA 4JI7O 3I5DA 4AILC 1H2GA 2YIBD 5EIBD 5B1OA 1M90W 4HAMA 4ZI7A 3Q4HA 2ZE7A 3AG3C 1Q43A 2EJ7A 5CA3A 2UU9B 1VQNV 2ZR3A 1QR8A 4JYBA 5FLXN 2YS8A 2VQEB 2V7QG 4FFBA 3ETGA 1Y67A 1KKCA 3BA9A 5KX5A 1NR1A 1CEZA 4JI6B 4NXNO 4KL1A 3IC7A 4G27B 4P9OA 1IVSA 3R65A 4QJFB 2X0LA 1X59A 4MVUA 3SJAC 4WCEV 4BIZA 4H37A 5F2VO 4OGQB 3AK2A 3TETA 3BABA 3CCQV 1KMIZ 2VQFB 2V4DA 3RGBA 2ZIOA 4I5SA 2UXDB 3L9DA 1V55C 3OEEG 5BR8O 1R3IC 2GBOA 1TUBA 2DWDC 5LBQA 2F66C 5ITZA 4X65B 1FFXB 4QPKA 2EZPA 1DLBA 4DW0A 2YIAA 4EFEA 3APOA 2Q7HA 4X1IB 4PA4A 1DGSA 4FPPA 2E75B 5JCOC 2OTLV 3T1HO 3RYFB 4KHPB 3NR7A 3ZHQA 3ICXA 2VRZA 4WFFA 2IH1C 2Z3YA 3E89A 5E1AC 5D5PA 5L3EA 2UUBB 4F6RA 1VQ5V 4B08A 2BTQB 4RQFA 5CB4A 3UQ8A 4G2KA 2CE4A 3THOA 3APQA 5KLVH 5LP6B 2WLIB 4NVPA 4BWAA 4DO2A 4NKGB 3H01A 1MSDA 2X6BA 5B1AC 4E2LA 1XUQA 3JD0A 4LH7A 1BQ0A 1FD9A 3RW0A 1YJWV 4JI0O 1Q8IA 1K33A 2JDIG 1JX9A 4R7CA 4X9QA 1OCCB 1GMGA 4J10A 4CC5A 3CS5A 4K0KB 4XDKA 2K1EA 2JS3A 2JS5A 3DC6A 4OPAA 3E8BA 2CH7B 4E4EA 5L3CA 2OYQA 3JCUZ 4JI5B 2CK3G 2CDYA 1H2SB 4DRXA 1RSOB 5KHIA 2HLDG 3C90A 4CH6A 1AP6A 2FL4A 2KQXA 5B1NA 4WFBV 2K9PA 3K9SA 3HKCA 1XMQO 3B8NA 3CSXA 4P30A 4I0XB 4CZZA 4UVCA 3OUFA 4JASA 2PYLA 3FB5C 2XASA 2OCHA 5LMNO 4GYCB 2XOKG 1HNWB 1GN6A 1V54B 1WLEA 1YDXA 2UXDO 5CA1B 2RCVA 4O2BB 4TT3G 3A8TA 3K5NA 5KHKA 2QM8A 4I55B 3JYCA 3C3SA 1WA8A 4JGSA 1XMOB 4LWSB 4PA6A 4NB5A 2YEVB 5K1XA 1KECA 5EZYB 1BL8A 4B7EA 1RM1C 3ETQA 5LYJB 2QKAA 4FIPC 5FNVB 1SC5B 3SYOA 4UB6Z 2BSKB 4OX9B 4PHZA 5KMGA 5LGNA 4LBEC 4HNAB 2OWOA 2ADQB 5KA5A 4DR4B 3RYHB 1AI7A 1F4NA 2DN9A 5BMVA 3E2EA 1GO3F 1K92A 4DV7B 3OR6C 4IHJA 3W7XA 2EIJC 4J80A 4K8ZA 1PL4A 3AG1C 4H0LB 4ASUG 4FLVA 4YJ2A 4KP4A 3G6EV 1RPRA 4LNUA 4JAUA 3DSQA 4IL6Z 2NR5A 3MHSC 1XNQB 1IURA 4UVBA 1GTOA 2LGWA 3IJ4A 2HR3A 2A3QA 3OT7A 3E22A 3CC7V 5CBFA 3L74H 4FZ1A 4JI5O 5L3FA 2EILC 1Y6XA 1KU9A 5B3SB 4XDLA 5L3GA 3WB1A 1ZUQA 2P7TC 4J7KA 1SQXH 3W7TA 2YC0A 4I9WA 4LF8O 5IYZB 2Q67A 2E74B 3K3WA 1E1QG 4UVAA 3ZN0A 3FB6C 5IJ0B 1KP2A 1OCRC 2A0LA 5LHIA 3PN1A 4CH4A 1AROP 3F5WC 4RWUA 3VQWA 3HKDA 2H3OA 2EX3A 1QU7A 4DV5O 1K4DC 5IYBO 2ZIMA 2YXLA 4DR5O 5B1BC 1CP9A 4QNHB 2OTJV 4YJ3B 3ZRWA 4MW8A 2Y0PA 1OV9A 2QWQB 1H38A 1TVKA 2PTMA 2EIKC 2F1MA 1G8MA 1NT2B 1QNMA 2ILMA 4IYHA 2F4VO 3UM7A 2OIGA 3RBZA 1N36B 3OTOB 2Q0AA 4UCVA 3T2MA 4LH6A 2IH3C 3IFXA 3BRCA 1L1FA 4O4JB 2ATKC 4B3RB 4DR6B 4TQDA 2FMLA 4I50B 3WU2Z 1LR1A 2WLLB 3W7SA 4DR1O 1WP8A 2UUAB 4DR3B 4X20B 3JAWB 1PNMA 3QO8A 5TISZ 1SQQH 1OHHG 4JAAA 3ZHRA 4B3SB 5AG2A 1Q6UA 3ABKC 3ASNB 4MW3A 3ZMSA 4DV2B 2WA3A 1LUWA 4U3JA 4NTYA 3UO3A 1B06A 3CX5F 4LR3A 5IYCO 5LMUO 4DV7O 2HHHO 1HNZB 1D5AA 1JR9A 2DQ3A 3R66A 4UUJC 3S3XA 1VQ7V 4WFAV 1GN3A 1V55B 2OT5A 5A9GA 1FAFA 5DM6V 5CA0B 4X1YA 4DV6B 3ABMC 3CMAV 2XHBA 3QVNA 1K4CC 1ZL8B 2IJHA 4DR7O 2QSAA 4B7KA 4ZOLA 1M57C 5JQGA 3ZMVA 2PI4A 1QLEC 1JOYA 4MS2A 1IBMO 3D8CA 4IIJB 3P32A 1WPBA 2VS0A 4LF7B 4PI2A 1ZTEA 4WFHA 2WLJA 4PA7A 3D3QA 2EZOA 1Q6IA 1QVFU 1COWG 1XNRB 1HR0B 1NVPB 4A5UB 2B1GA 3B8MA 2DYRC 1W0JG 2UUCB 1D2DA 1YEWA 2Z5UA 3M8AA 3STZC 4HZ3A 3RYCB 1OCOC 3QG5A 4J11A 2YXHA 3H1LH 2M7WA 3H1HH 3PJSK 4DUYB 1YSCA 2HVJC 1VQ6V 3CJHB 1Q81W 1EM1A 3RN4A 2F23A 2ZCEA 2JJ2G 5C93A 1N4CA 1GAXA 4MVZA 1N32O 2IW5A 4AQYO 4D6TH 3QTCA 4LFCO 4LFAB 4AHCA 3OTOO 1FFTB 2XAFA 3WG7C 4X1IA 3JASB 2RMKB 1JFFB 5DN6G 3JAKA 3K79A 4JI8B 4I7ZB 4JF3A 1PNKA 3FX7A 3RYFA 1NJIW 1HDJA 4K35A 2UUAO 4NTWA 1W59A 4RQEA 2ZKOA 1J5EO 2LGQA 2BTOA 2RJZA 3L72H 2F93B 4B3SO 2R9RB 5B5EZ 5GTIZ 1GM7A 2BTQA 1AVMA 2P4KA 2A06H 2UXCB 4QGPA 1NZ6A 1N0NA 2XAGA 4GCZA 3U0ZA 5LP6A 1RP3B 3X2QC 4TV8B 1P4RA 5EBWC 3ZRXA 4DV3B 2DOSA 3LUTB 5LA6A 3UT5B 2GDSA 3BA8A 5GONB 3HB3B 1A32A 3JD3A 4DV6O 1VQMV 4NXMO 2DW4A 3ABLC 3J81N 5IYDO 5DEDA 1MA1A 3BY6A 1VQOV 1OJHA 2PI5A 4MT8A 1BHBA 4DK0A 3JATB 1AR5A 1ZLZA 4FK5C 1I5XA 2AHYA 2LP7A 3RFRA 2R9AA 1HNXB 3OM3B 3T4ZA 4B3TB 3JALB 1F23A 2QJ1A 4MVOA 2CH7A 5J2TB 4FM1A 3K5OA 2YDEA 4Z2WA 1PP9H 2N04A 4U3FH 3ZMUA 4JI2B 4WBNB 1AP5A 3N2GB 2P67A 4JI4B 1AI5A 1JVMA 2F43G 3OW2U 4EFBA 4GLXA 1K9MW 4O4HB 4GUNA 2EIJB 4O2AB 1NVPD 5IWAO 2EULA 1D5NA 5LXTB 3ML0A 3LSUA 1K7DA 1VQ4V 4MTFA 2OCCC 1VEWA 5FPOA 3QO5A 2Q69A 1PKXA 1QLNA 3K59A 4O2BA 4LF6B 1GM8A 1IBKO 3E8GA 4XDJA 2PGGA 4EB6B 4LFAO 2AXTZ 5C8YA 3EVKA 1FYJA 3L73H 4F6EA 1BE3H 4LFBO 1MSWD 3GWOA 4X1KB 1JMKC 4TOIA 4X66O 2P22C 5EZYA 2Y4TA 4R8CA 1Q90D 2N74A 1BS3A 1YITV 3SYQA 3CEIA 1R6KA 4GKKB 1P7BA 5LOVB 1OCRB 2DE0X 3FYEB 1TA8A 2HVKC 4GZRB 3CXHF 1S5LZ 1W2BU 2QWRB 3O65A 4BR6A 4BW9A 1Y66A 3RYHA 5KUKA 2QA4V 4U7OA 1TGOA 5EBMC 1SQVH 4JAVA 1K97A 4UCUA 4FMTA 4JI1O 1EFRG 2YI9A 3FAVB 3M7MX 1SZTA 3JD2A 4ZHQA 1VMGA 4QIWF 4TV9A 3JARB 3CCVV 1U97A 1K5QA 3NXSA 4GKJO 4Z1VA 3LSQA 2XUMA 3CRQA 3RT3C 3K5MA 3HKBB 4N23A 5KHGA 1YIJV 3B40A 2UXXA 3ZIAG 4J7ZA 1CPYA 3BVOA 1SS3A 3WB0A 3LSSA 4YIPA 2ZM6B 1B3QA 3DC5A 3CCLV 1K34A 3WB2A 2ZR2A 2GUZB 1SRYA 2EINB 2F95B 1DF4A 2NNUA 4JI4O 2A7WA 3I56V 4O4IA 3ZRSA 3N27A 1VF7A 4FLWA 1U96A 3KZIZ 4CH5A 3OFNG 5EYPB 1I94B 3VBBA 3SDLA 2UU9O 1R73A 2P5OA 4NTXA 4X64B 1SA0B 1WB7A 4YJ3A 1FKAO 4L87A 2CTWA 4EEQA 2VQEO 5IJ9A 2FYUH 3CCSV 2ZNJA 1ENVA 1UFIA 3OGCC 3CCEV 1QLEB 3K03A 4JI6O 4RUEA 4XBFA 2KG7A 4MSWC 4ZIBA 3G4SV 2Y69C 1NTMH 2CAZC 5KHHA 2VQFO 2LW1A 1OCZC 1KYOF 3A0RA 3IC9A 4BAYA 1V9PA 3FYIB 4DR2B 2QTSA 2O57A 4IYIA 4FZ0A 2DYRB 4YY3B 4X65O 3UKMA 4X88A 1EZJA 1K5SA 5J2UA 2ZNIA 2QGNA 4ZI7B 3Q4HB 2JK5C 3EHBB 2QM4A 1HW7A 1GN2A 3AG2B 1K3EA 1M56B 4DV4B 3ASOC 4KHPO 4B3MB 3UCSC 4FFBB 3J7AU 3BHPA 5KX5B 2ZD9A 3RVZA 2ZXWB 1LNQA 4JTCB 5CA0A 4YIOA 2PYJA 2ZQMA 1Z5VA 4PD4F 2X7RB 2UUBO 4LC1A 4BIOA 1J95A 3WG7B 1QBZA 3K0DA 4DUZB 3HPLC 2MK3A 3SJBC 2ARHA 2N05A 4J7JA 2ZM6O 2VWJA 4H33A 3DXRA 1VQ8V 3KG2A 3K5LA 5IY5B 1NTKH 4PJ0Z 1SETA 2DYSC 1Y76B 4J9ZB 2XAHA 5KUMA 2QKSA 5LGUA 2Q68A 5A2QN 4MVSA 3OE7G 3QF7A 3IAYA 4K0KO 2DQ0A 3E8FA 2P90A 1JCHA 1Q6HA 4ZKIA 2BOCC 2KB1A 2V1DA 3SPJA 2P06A 1FXVA 5KA6A 1YHQV 3CRRA 5CB4B 4FM2A 2QWPB 3KCXA 3BEHA 4GX0A 4ZBMA 5JJEB 2UXNA 1VQKV 1X4TA 3P3PA 3JASA 1SKVA 1I7FA 2LFRA 1PPJH 3AG7A 4KFMA 3TGUH 3W7UA 1FJGB 3ZHTA 3OAAG 4LF4B 1HNWO 2QWNB 4GX5A 2CGNA 3SR2C 1WP7A 2MW2B 3QNEA 1VQLV 1US6A 2RNBA 4PV1B 2E5LB 4MVRA 5HFLA 1ROPA 1XMOO 3AG3B 2CTRA 2C2AA 3CC2V 1S5HC 2ZE8A 4DRXB 4MVMA 1M1KW 4TV8A 4B3MO 3H1IH 1DF5A 3AG4C 2WAMA 3T4DA 2W6IG 3F5TA 3HKEB 3HKCB 5GONA 3CPWU 1PL0A 4OX9O 4O4LB 4JTDB 1R1BA 3CCUV 2WLNA 1EN5A 4N21A 1S0VA 2L35A 4DR4O 1YTFB 1XBLA 5LP6C 1AI4A 2QWOB 1Z2GA 2L6LA 2Y48A 1NU1H 2IM9A 1Q82W 2LW7A 3TXQA 4I4TA 2BCCH 1B04A 1FXKA 4CBCA 3RYIA 4ICGA 4TUYA 5BXZA 2CGOA 5L3DA 3N2KB 1S76D 1WA8B 2JGDB 5CBGA 4WFEA 1S77D 2HJDA 2KSDA 1WB8A 4KXRA 4UCSA 1XNQO 1OCCC 1AR4A 4JYAB 3L70H 4HYOA 1JJOA 3OMIB 4LF9B 3TXSA 2JEXA 1KQSU 3ETEA 3OR7C 1LUVA 5FPRA 3T1YB 3OGIB 3EXAA 1FXHA 1NI8A 5KMGB 2NLJC 4CS4A 1DTOA 2E3CA 3JSNA 2R72A 4NR1A 3W7WA 3K57A 5BMVB 1SQBH 1KKDA 2XAJA 3SJQC 4ABMA 1N33B 4PA3A 3E35A 4IHJB 5KHJA 2D3OW 3CXCU 3U10A 5J9PC 5B1AB 2H8PC 1VQPV 3T1CA 3JCZA 4YJ2B 4LF4O 1EN4A 1K73W 1V54C 4LNUB 2IBZH 2LQTA 1IBLB 1K8AW 5B66Z 2CUGA 1E1RG 2E5LO 3G6BA 3ABTA 3L71H 4JI7B 3H1JH 4D7SA 2WWWA 4MTGA 1FFXA 1N36O 3E22B 3SPHA 2EJRA 2W0XA 5IDJA 5FL7G 2VWKA 3FAVA 3D36C 5LL6Y 4DR6O 4B3RO 2PF4E 3CP1A 4G28B 1R3KC 2EBOA 1VP7A 1TUEB 4OXSA 1AJPA 2AW9A 3RVYA 4DR3O 3BFRA 2Y4UA 1MNGA 1PNLA 1BT8A 2JEUA 1Q7YW
chains in the Genus database with same CATH topology
4RUFA 1W2BU 2IJKA 3LDDA 4JGSA 5KUKA 1BMFG 1H8EG 1Y66A 4PA6A 2QA4V 2B5UA 4U7OA 4EKWA 4MTXA 1FS0G 2YEVB 1AJNA 5EBMC 3DGEA 1KECA 3ZN1A 1BL8A 1F51A 4JAVA 1YJNV 1UJWB 1K97A 4FMTA 4Q20A 4GT1A 1EFRG 3ZRWB 3QO7A 3EFFK 1RM1C 4PDRA 3E86A 3K0GA 1MABG 1AI6A 2WLIA 4YXWG 1YTFD 4FIPC 4RO2A 2X6AA 1SZTA 3SYOA 2QEXV 3JD2A 3ZCCA 3ETDA 3F7YC 4X89A 4QIWF 3SPIA 5LGNA 1NH2D 3CCVV 2EINC 4LBEC 1K5QA 3K06A 3NXSA 4QPJA 1KC8W 2WLMA 1XL4A 1Y4MA 3LSQA 2LFSA 4N23A 1S72V 1YIJV 5KA5A 1W0KG 2UXXA 1AI7A 3LDCA 1F4NA 3E2EA 1GO3F 3FB7C 3ZIAG 1CPYA 1K92A 1RM1B 3OR6C 3LSSA 3W7XA 2EIJC 3D3IA 3AG1C 1K34A 3WFVA 3CCLV 5LHHA 1BHAA 2ZR2A 3VOUA 3FB8C 4R6ZA 5B3SC 2GHYA 4ASUG 1SRYA 1THZA 2EINB 4KP4A 3G6EV 1RPRA 1DF4A 2NNUA 2WSSG 3I56V 4JAUA 1ORQC 3MHSC 2XNDG 4UVBA 1GTOA 5H6RA 3ZRSA 1QCEA 4R50A 1F4MA 2HR3A 3OFNG 3CC7V 3VBBA 5CBFA 3AG1B 5L3FA 1R73A 2EILC 3CYOA 4GX2A 4RAIA 5B3SB 4XDLA 5L3GA 2HG5C 2H94A 2P7TC 4PDVA 5HFMA 4L87A 3W7TA 4I9WA 3GB7C 1AR1B 3CCSV 4PA9A 2Q67A 3K3WA 1ENVA 1SERA 3CD6V 1E1QG 3OGCC 4UVAA 3CCEV 1QLEB 3K03A 3K9AA 3ZN0A 1S3JA 3FB6C 4RUEA 1KP2A 1OCRC 2A0LA 2QTOA 3ZMTA 4MVQA 5LHIA 4XBFA 1KD1W 3G71V 1AROP 4MSWC 2HJFC 3JD4A 3F5WC 3OMAB 3LNMB 3G4SV 2JJ1G 3IGAC 2EIMB 2Y69C 1XL6A 1NKDA 2EILB 3ZJZA 4QE7A 1JJ2U 1K4DC 2YEVA 5IYBO 5B1BC 1CP9A 3AG2C 3OMNB 4QNHB 2OTJV 1OCZC 1M56C 5CMUA 3ZRWA 3D36A 4MW8A 3A0RA 4LCUC 4U7NA 4BAYA 3CCRV 3CCJV 1HWYA 3FYIB 3I55V 2ZXWC 2DYRB 1H38A 1KP3A 2EIKC 2IJJA 1G8MA 3UKMA 5LHGA 4X88A 1NQTA 1EZJA 1K5SA 3SYAA 3UM7A 3ASNC 3F7VC 3RBZA 4QE9A 1N8RW 4P2ZA 2BOBC 2JK5C 2Y69B 3EHBB 3T2MA 2IH3C 3SPGA 3IFXA 1QR9A 3AG2B 5B1BB 1K3EA 4PDLA 3OEHG 1L1FA 1OCZB 1M56B 4X8AA 2ATKC 2A79B 3ASOC 3K08A 3MD0A 2X6CA 5EC1C 2QM7A 5CBHA 3W7SA 2WLLB 2ITCC 2ZD9A 3RVZA 2ZXWB 1LNQA 4TSFG 4JTCB 5IY5C 1GM9A 1PNMA 2ZQMA 1NBMG 2EIKB 3QO8A 2X7RB 1OHHG 4LC1A 1EBOA 1J95A 2QE7G 3WG7B 3TCUA 3ABKC 3ASNB 1QBZA 3K04A 3K0DA 4MW3A 4Z1MG 3HPLC 3ZMSA 2MK3A 2DWEC 3DTUB 2JIZG 1YI2V 3AEIA 2WPDG 1OZ0A 5IYCO 4TWKA 3AG4B 3E8HA 4PELA 2DQ3A 3ASOB 4UUJC 4P9PA 1VQ7V 2P6JA 4WFAV 2HFEC 4MTOA 1V55B 4KUMA 1R3JC 4H33A 1VQ8V 3KG2A 2OT5A 5IY5B 3CCMV 5DM6V 2GSMB 1SETA 3P30A 2DYSC 3ABMC 3CMAV 4J9ZB 2XAHA 2IU0A 1K4CC 2QKSA 5KUMA 3ABKB 2IJHA 5LGUA 2Q68A 2IU3A 1JQ0A 1GK9A 4MVSA 1M57C 3ZMVA 2PI4A 1QLEC 3OE7G 3FKSG 1JOYA 4MS2A 2DQ0A 3E8FA 1Q86W 2P90A 3SPCA 1JCHA 1YJ9V 1MG1A 2R9IA 3P32A 4ZKIA 2AHZA 2BOCC 1FXKB 2KB1A 2V1DA 4WFHA 3SPJA 2EIMC 1FXVA 2WLJA 4PA7A 5KA6A 1MOFA 2EZOA 3B77A 2DYSB 3ABMB 1QVFU 1YHQV 1COWG 5EK0A 3M99B 2HKOA 1NVPB 2Q6AA 5EC2C 4J9YB 1M57B 2B1GA 3BEHA 3B8MA 4GX0A 2DYRC 1I5YA 1W0JG 4ZBMA 2UXNA 2ZDIC 1H2GA 1VQKV 2Z5UA 3ZMZA 1M90W 5B1OA 1PD3A 3STZC 4HAMA 4HZ3A 3AG3C 4UXNA 5CA3A 1VQNV 1SESA 1OCOC 2LFRA 2ZR3A 4KFMA 1QR8A 4JYBA 2M7WA 3W7UA 2FTKA 3OAAG 3PJSK 3CC4V 4WFGA 1YSCA 2HVJC 1VQ6V 1JPXA 2V7QG 1Q81W 4GX5A 3ETGA 3QNEA 1VQLV 2WLLA 1GKFA 1NR1A 2JJ2G 5C93A 1CEZA 2A9HA 2ITDC 4MVZA 3IC7A 2IW5A 4G27B 4P9OA 5BZBA 4MVRA 3R65A 5HFLA 4QJFB 2X0LA 1AJQA 4MVUA 1FFTB 1B6QA 4WCEV 2XAFA 3WG7C 4BIZA 1ROPA 4H37A 3AG3B 2C2AA 3CC2V 1OCOB 1S5HC 5DN6G 3K79A 3TETA 3CCQV 4MVMA 4JF3A 1M1KW 1PNKA 1NJIW 1DF5A 3AG4C 2WAMA 3SYCA 4I5SA 3T4DA 2W6IG 4RQEA 3MHHC 4JYCA 1V55C 3OEEG 3CPWU 1R3IC 1IXMA 2YSUB 1PL0A 4BW5A 4JTDB 2DWDC 5LBQA 3CCUV 2R9RB 1M9NA 4JTAB 4QPKA 1R6NA 1GM7A 2EZPA 1DLBA 2WLNA 4N21A 1S0VA 1YTFB 3SYPA 4PA4A 1E79G 2XAGA 4FPPA 4GCZA 3X2QC 2OTLV 1P4RA 5EBWC 1AI4A 2Y48A 4DXWA 3ZRXA 1NH2B 5GW7A 1Q82W 3LUTB 3HB3B 1FXKA 3JD3A 4WFFA 3TK1A 2IH1C 2Z3YA 4CBCA 1VQMV 1FXKC 3E89A 2DW4A 5E1AC 3OUSA 5L3EA 3ABLC 5L3DA 1S76D 5IYDO 5CBGA 1VQ5V 3LDEA 3BY6A 1VQOV 4WFEA 1S77D 4RQFA 4UV8A 2PI5A 4MT8A 4G2KA 1BHBA 4BIUA 1OCCC 4FK5C 1I5XA 3X2QB 2AHYA 2LP7A 4HYOA 2XAQA 3OMIB 3OM3B 2WLIB 3T4ZA 1F23A 2JEXA 4DO2A 1NR7A 1KQSU 3ETEA 4MVOA 3OR7C 3H01A 2X6BA 5B1AC 1FXHA 4UV9A 4E2LA 4JPRA 3JD0A 3ABLB 3RW0A 1YJWV 2NLJC 2WLKA 3ZMUA 1DTOA 1K33A 2JDIG 1JX9A 4R7CA 3W7WA 4PDMA 2P67A 3JD1A 1AI5A 1JVMA 2F43G 3OW2U 1K9MW 1KKDA 1OCCB 1GMGA 1RPOA 2XAJA 3SJQC 4FJCC 4PA3A 2ZDIA 4XDKA 2EIJB 3E35A 2D3OW 1NVPD 2K1EA 3CXCU 4F4LA 3E8BA 5H6QA 3ML0A 5J9PC 2W6JG 2B1IA 5B1AB 2H8PC 5L3CA 1VQPV 5H9CA 2W0FC 1VQ9V 1K7DA 2CK3G 4MTFA 3T1CA 1VQ4V 3JCZA 2OCCC 2HLDG 4LP8A 1K73W 1G4YB 3QO5A 1V54C 2Q69A 1PKXA 5L3BA 1QLNA 5B1NA 4WFBV 3E83A 1ZWIC 3B8NA 1K8AW 1GM8A 4P30A 1E1RG 3E8GA 2IJIA 4XDJA 3ABTA 5CN0A 2WWWA 1WPXA 4MTGA 3STLC 4CZZA 4GX1A 4UVCA 3OUFA 5EBLC 3SPHA 1MSWD 4JASA 3GWOA 3ABUA 3ZRVA 2EJRA 3FB5C 2XASA 2OCCB 5IDJA 5FL7G 4R8CA 1H8HG 2XOKG 1QVGU 1YITV 3SYQA 1V54B 1WLEA 3CP1A 4G28B 5LGTA 1R6KA 1R3KC 2EBOA 1P7BA 4WF9V 4OXSA 1TUEB 1AJPA 3RVYA 2WLHA 4TT3G 3CMEV 1OCRB 1PNLA 1R3LC 2QM8A 3FYEB 3JYCA 2HVKC 2JEUA 1Q7YW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RUF A;  3LDD A;  5CBG A;  3ZJZ A;  4QE7 A;  5KUK A;  3LDE A;  1K4D C;  2YEV A;  4PA6 A;  4WFE A;  5EK0 A;  3AG2 C;  5B1B C;  4EKW A;  4QNH B;  5EBM C;  1OCZ C;  1M56 C;  1BL8 A;  4MW8 A;  4LCU C;  2Q6A A;  5EC2 C;  1OCC C;  3EFF K;  4J9Y B;  4PDR A;  3E86 A;  3K0G A;  2AHY A;  2WLI A;  3BEH A;  4HYO A;  4GX0 A;  2DYR C;  2ZXW C;  2WLI B;  4RO2 A;  2X6A A;  3SYO A;  3T4Z A;  4ZBM A;  2EIK C;  4MVO A;  3F7Y C;  4X89 A;  3OR7 C;  3UKM A;  3STZ C;  2X6B A;  5B1A C;  4HZ3 A;  4WFH A;  4X88 A;  3SPI A;  3AG3 C;  3SYA A;  2EIN C;  3UM7 A;  3ASN C;  3F7V C;  4LBE C;  4QE9 A;  3K06 A;  1OCO C;  4P2Z A;  2BOB C;  3RBZ A;  2JK5 C;  2NLJ C;  3RW0 A;  2WLK A;  1XL4 A;  2WLM A;  4KFM A;  3T2M A;  2IH3 C;  3SPG A;  3IFX A;  3PJS K;  4R7C A;  3LDC A;  4PDM A;  4WFG A;  2HVJ C;  4PDL A;  1JVM A;  4X8A A;  3FB7 C;  2ATK C;  2A79 B;  3ASO C;  4GX5 A;  3K08 A;  2X6C A;  5EC1 C;  2WLL A;  1KKD A;  5CBH A;  3SJQ C;  2WLL B;  3OR6 C;  4PA3 A;  2A9H A;  2ITC C;  2EIJ C;  2ITD C;  2ZD9 A;  4MVZ A;  1LNQ A;  4G27 B;  4JTC B;  4P9O A;  4XDK A;  2K1E A;  4MVR A;  3R65 A;  5BZB A;  5IY5 C;  4F4L A;  3AG1 C;  3E8B A;  3IGA C;  4MVU A;  5J9P C;  3VOU A;  3FB8 C;  4R6Z A;  5B3S C;  1J95 A;  2H8P C;  3WG7 C;  4H37 A;  2W0F C;  3T1C A;  3ABK C;  4MTF A;  3TCU A;  3K04 A;  3K0D A;  4MW3 A;  2OCC C;  1S5H C;  3RVZ A;  3HPL C;  4LP8 A;  3TET A;  2DWE C;  1G4Y B;  4MVM A;  1V54 C;  2Q69 A;  1ORQ C;  3AG4 C;  3SYC A;  4TWK A;  3E8H A;  3E83 A;  3T4D A;  1ZWI C;  4UUJ C;  4P30 A;  1XL6 A;  4P9P A;  3ZRS A;  1V55 C;  3E8G A;  2HFE C;  4MTO A;  1R3I C;  4XDJ A;  1R3J C;  4H33 A;  4R50 A;  3KG2 A;  4BW5 A;  4JTD B;  4MTG A;  3STL C;  2DWD C;  4GX1 A;  5CBF A;  2R9R B;  4JTA B;  3OUF A;  5EBL C;  2DYS C;  3ABM C;  2EIL C;  3SPH A;  4GX2 A;  2WLN A;  4J9Z B;  4RAI A;  4XDL A;  1K4C C;  2QKS A;  5KUM A;  3FB5 C;  2HG5 C;  2P7T C;  4PDV A;  3SYP A;  4PA7 A;  2Q68 A;  4PA4 A;  4R8C A;  4I9W A;  4MVS A;  3GB7 C;  3SPJ A;  3SYQ A;  1M57 C;  2Q67 A;  4PA9 A;  3X2Q C;  4G28 B;  1QLE C;  1R3K C;  3OGC C;  1P7B A;  5EBW C;  4OXS A;  3K03 A;  4DXW A;  3RVY A;  4MS2 A;  2WLH A;  3FB6 C;  4RUE A;  1OCR C;  2A0L A;  3E8F A;  2QTO A;  3LUT B;  4MVQ A;  3SPC A;  1R3L C;  4CBC A;  4MSW C;  4WFF A;  2IH1 C;  2HJF C;  2AHZ A;  3E89 A;  2BOC C;  2HVK C;  2KB1 A;  3F5W C;  3JYC A;  3LNM B;  3OUS A;  5E1A C;  2EIM C;  3ABL C;  2Y69 C;  2WLJ A; 
#chains in the Genus database with same CATH topology
 2IJK A;  3LDD A;  3CHX A;  1BZK A;  1H8E G;  4DV2 O;  2CTQ A;  3HKD B;  2B5U A;  1WJZ A;  1AJN A;  3ZN1 A;  2AZ0 A;  1F51 A;  1HNZ O;  2YI8 A;  4Q20 A;  3ZRW B;  1KUQ A;  3EFF K;  3K0G A;  1MAB G;  4CS3 A;  1AI6 A;  2WLI A;  4JYY A;  4YXW G;  1YTF D;  2X6A A;  2QEX V;  1YF2 A;  4FLY A;  3ZCC A;  5H2F Z;  5BR8 B;  1TVK B;  3K58 A;  3SPI A;  2RDC A;  1NTZ H;  4QPJ A;  1KC8 W;  2PY5 A;  2Q9L A;  2ZIN A;  3LDC A;  4JYA O;  3FB7 C;  1M93 A;  1XRE A;  3T1H B;  1RM1 B;  3T1Y O;  3U11 A;  2XTA A;  4LF7 O;  1NS1 A;  3CRC A;  1O9G A;  3D3I A;  1SQF A;  3VOU A;  3FB8 C;  4R6Z A;  2DJV A;  5B3S C;  2GHY A;  1VF6 C;  3ZHV A;  1RSO A;  1THZ A;  4L8J A;  1XNR O;  2WSS G;  1HR0 O;  1SQG A;  1S5J A;  1ORQ C;  2UXB B;  2JVD A;  3L75 H;  4I0X A;  2UUC O;  4FM0 A;  1N0J A;  4R50 A;  1F4M A;  5JVD B;  3AG1 B;  5H5N A;  1QQC A;  4GX2 A;  4RAI A;  4X1Y B;  2H94 A;  5HFM A;  4JI0 B;  4DUY O;  5CA1 A;  1BGY H;  4PA9 A;  3CD6 V;  4YHH B;  4ZOL B;  2AZ2 A;  5JQG B;  1XHZ A;  3ZMT A;  4I55 A;  3G71 V;  1URF A;  3VQV A;  3JAM N;  1Y74 B;  3JD4 A;  3OMA B;  1O9H A;  3LNM B;  3IGA C;  4LWS A;  2EIL B;  4JI8 O;  2YEV A;  3D36 A;  5LYJ A;  4U7N A;  3CCR V;  1HWY A;  4I9Q A;  5FNV A;  3I55 V;  1XMQ B;  2LO1 A;  3GVM A;  2BSK A;  3H1K H;  2IJJ A;  2GTS A;  4HNA A;  1NQT A;  3SYA A;  3CB2 A;  3ASN C;  2M6Y A;  4QE9 A;  1WNS A;  4P2Z A;  2BOB C;  2UXC O;  4JI3 B;  3A0B Z;  5BY1 A;  5B1B B;  4PDL A;  2R70 A;  5LMN B;  3OEH G;  3K08 A;  3MD0 A;  4DV3 O;  1YCI A;  5EC1 C;  5CBH A;  4K3A A;  4TSF G;  4DW1 A;  1GM9 A;  1Y76 A;  2EIK B;  2QE7 G;  3TCU A;  4Z1M G;  3DTU B;  2DWE C;  3A2F A;  5GTH Z;  1ZSP A;  3JAK B;  2WPD G;  3JSL A;  4TWK A;  3AG4 B;  3E8H A;  4PEL A;  3FD9 A;  1HNX O;  4B3T O;  5JH7 B;  4MTO A;  4KUM A;  3CE2 A;  1MMM A;  3CCM V;  1XOU A;  5JWP A;  1M5I A;  3P30 A;  1VF6 A;  4JI2 O;  2IU0 A;  3ABK B;  2Y0I A;  2IU3 A;  2Q7E A;  4UCO A;  5IYZ A;  2UXB O;  4JV5 B;  3ZBH A;  3G80 A;  5EIB C;  5E79 Z;  5IJ0 A;  5JJJ B;  1KBH A;  4D7T A;  1XEQ A;  1Q86 W;  3AK3 A;  3SPC A;  1YJ9 V;  5LA6 B;  1MG1 A;  2R9I A;  1H2L A;  3B4S A;  2AHZ A;  2EIM C;  3ABM B;  1GN4 A;  4H13 B;  1R6T A;  1YZB A;  4YHH O;  4DV0 B;  1AB3 A;  2HKO A;  4LF6 O;  4J9Y B;  1AIL A;  1M57 B;  1P7G A;  5KAI Z;  3GWK C;  1P84 F;  1I5Y A;  2ZDI C;  1VAR A;  3ZMZ A;  4FFK A;  1PD3 A;  4IT5 A;  4UXN A;  1SES A;  1WAZ A;  1H2K A;  2FTK A;  3CC4 V;  4WFG A;  4O4J A;  3CWB H;  1JPX A;  2YXY A;  3HKE A;  3AK1 A;  4NYK A;  4GKK O;  4I50 A;  4LF8 B;  3UO2 A;  2WLL A;  2JRI A;  1GKF A;  4X20 A;  3JAW A;  4O4L A;  2A9H A;  1BQZ A;  2ITD C;  3BAA A;  4FLZ A;  5BZB A;  1AJQ A;  1B6Q A;  3ZHU A;  4JI3 O;  1Q5O A;  2QKC A;  1Q3E A;  1OCO B;  2CTP A;  4JZ2 A;  4DV5 B;  4DR5 B;  3KKY A;  1F7Y A;  1ZX3 A;  2WA4 A;  3SYC A;  2YUA A;  3MHH C;  1IX9 A;  1L0L H;  4JYC A;  1IXM A;  2YSU B;  4BW5 A;  2D2C B;  3N2K A;  5C8Y B;  4AI8 A;  2JGD A;  1XDC A;  1M9N A;  4JTA B;  1R6N A;  1ZL8 A;  2F4V B;  1G1X B;  1Z5W A;  3SYP A;  3CRA A;  1E79 G;  1L0N H;  5JCO A;  1EZV H;  4DK1 A;  5JJN B;  4DXW A;  1IXB A;  1NH2 B;  5GW7 A;  4DR1 B;  4IIJ A;  3TK1 A;  1FXK C;  3OUS A;  1TUB B;  5ITZ B;  3LDE A;  4HBN A;  1KB9 F;  3C3T A;  4JV5 O;  4OPH A;  4UV8 A;  2YIB A;  4BIU A;  2HHH B;  5LMU B;  3X2Q B;  2XAQ A;  2Z0A A;  1NR7 A;  1I94 O;  4FLT A;  4IGG A;  3A0H Z;  4ZHQ B;  3RYC A;  4UV9 A;  3FFQ A;  4TV9 B;  4JPR A;  4X64 O;  3ABL B;  2WLK A;  2ZE5 A;  4DV0 O;  4F6R B;  3CJH A;  4DR7 B;  4PDM A;  3JD1 A;  1MZE A;  1RPO A;  2AGA A;  2ETN A;  4FJC C;  1FPO A;  2PUS A;  1T5E A;  2ZDI A;  1IBM B;  4TQF A;  4F4L A;  4CH3 A;  5H6Q A;  1M4U A;  1G6U A;  2W6J G;  5KAF Z;  2B1I A;  1I08 A;  5H9C A;  2W0F C;  1JFF A;  2Q4P A;  1VQ9 V;  1GRJ A;  1UPG A;  3LNN A;  4LP8 A;  1G4Y B;  5IT9 N;  2KKW A;  5L3B A;  1RFY A;  4O4I B;  3E83 A;  4DR2 O;  1ZWI C;  4YY3 O;  2IJI A;  5CN0 A;  3STL C;  1WPX A;  4GX1 A;  4H44 B;  5EBL C;  3ZHS A;  3ABU A;  4LF5 B;  3BPZ A;  3ZRV A;  1HP8 A;  1VF5 B;  2OCC B;  3J80 N;  2ODM A;  1H8H G;  4DV4 O;  1QVG U;  5IJ9 B;  2HP8 A;  5LGT A;  4WF9 V;  2WLH A;  4FVM A;  3UT5 A;  3CME V;  2PZS A;  3B2E E;  1R3L C;  1N32 B;  2KG7 B;  4AQY B;  4LFC B;  3OTF A;  2RQ6 A;  4RUF A;  3RWR D;  4DUZ O;  1BMF G;  1IDS A;  2YIC A;  3HR0 A;  4EKW A;  4MTX A;  1FS0 G;  3DGE A;  3JAT A;  1YJN V;  1UJW B;  4GT1 A;  3QO7 A;  4PDR A;  5IE9 A;  3E86 A;  1H2M A;  3JAL A;  1VIB A;  2Q0O C;  1EN6 A;  4RO2 A;  5J2T A;  1J5E B;  3ETD A;  3G67 A;  3F7Y C;  4X89 A;  2LJ2 A;  4X62 B;  2RN9 A;  1NH2 D;  2EIN C;  2XT9 A;  3K06 A;  1SF9 A;  5J2U B;  4WBN A;  2WLM A;  1XL4 A;  1Y4M A;  4FLX A;  3VQX A;  2LFS A;  2Q5Z A;  1S72 V;  3N2G A;  1JA8 A;  1W0K G;  3OD4 A;  1XI1 A;  1SZX A;  4O4H A;  1H2N A;  3MDS A;  2P4V A;  4UCT A;  1I0H A;  4O2A A;  2G38 A;  1MZF A;  3KCY A;  5JVD A;  5LXT A;  1BSM A;  1BCC H;  2GV9 A;  3WFV A;  4DV1 B;  5LHH A;  1BHA A;  2BE3 A;  4NXM B;  4J42 A;  4K8X A;  3SJC C;  1N34 B;  3SGI A;  1P49 A;  4CC6 A;  2XND G;  4W4L A;  5H6R A;  4EB6 A;  1Y74 A;  1QCE A;  5K1P A;  3DXR B;  4X1K A;  1XQ8 A;  3CYO A;  2HEP A;  2ZT9 B;  1GH6 A;  1FJG O;  4FLU A;  2HG5 C;  4PDV A;  3GB7 C;  1AR1 B;  5LOV A;  1SER A;  2JGU A;  3K9A A;  2FB5 A;  1S3J A;  2QTO A;  4MVQ A;  1WN7 A;  4UFZ A;  1KD1 W;  2HJF C;  5IWA B;  4LF5 O;  2JJ1 G;  3VQY A;  2EIM B;  1XL6 A;  3CRM A;  1NKD A;  1JJ2 U;  5D5Q A;  4QE7 A;  3ZJZ A;  1QHT A;  3MAQ A;  3AG2 C;  3OMN B;  5CMU A;  1L8D A;  1M56 C;  1YXB A;  4LCU C;  2ADP A;  3CCJ V;  2Q7G A;  5DEC A;  2ZXW C;  1KP3 A;  1IBK B;  3JAR A;  1SQP H;  4NXN B;  1DK1 A;  5LHG A;  1PV0 A;  3F7V C;  1N8R W;  4LFB B;  3B09 A;  2Y69 B;  3HKB A;  1TAE A;  3SPG A;  4X66 B;  1QR9 A;  3P3N A;  2DMX A;  1OCZ B;  4X8A A;  2A79 B;  4Q6G A;  2X6C A;  5JH7 A;  2QM7 A;  3O9O A;  2ITC C;  5IY5 C;  4DYL A;  2B9Z A;  4X62 O;  1CXZ B;  1NBM G;  2GUZ A;  2FKX A;  1EBO A;  2E76 B;  3K04 A;  4PI0 A;  1YVW A;  2JIZ G;  1YI2 V;  3AEI A;  2GTA A;  1OZ0 A;  2Q73 A;  3H9V A;  4JI1 B;  4JZG A;  3ASO B;  4P9P A;  2P6J A;  4LF9 O;  2HFE C;  4J41 A;  2QR4 A;  2QDO A;  4DV1 O;  1R3J C;  5EYP A;  2GSM B;  2ZE6 A;  1SA0 A;  4UCR A;  4GKJ B;  1N34 O;  1XHX A;  3BCC H;  1PM9 A;  1JQ0 A;  1GK9 A;  4U3J B;  3ZX6 A;  2NN4 A;  1XIL A;  3FKS G;  1N33 O;  1IZ3 A;  3S3W A;  4UB8 Z;  2Q8V A;  4I4T B;  3ZED A;  1FXK B;  3RYI B;  4TUY B;  1MOF A;  3B77 A;  2DYS B;  4CS2 A;  2YID A;  5EK0 A;  1ZAU A;  2OIE A;  3M99 B;  3ZS8 C;  3TJT A;  2Q6A A;  4C7U A;  5EC2 C;  1IBL O;  4W4K A;  4JI7 O;  3I5D A;  4AIL C;  1H2G A;  2YIB D;  5EIB D;  5B1O A;  1M90 W;  4HAM A;  4ZI7 A;  3Q4H A;  2ZE7 A;  3AG3 C;  1Q43 A;  2EJ7 A;  5CA3 A;  2UU9 B;  1VQN V;  2ZR3 A;  1QR8 A;  4JYB A;  5FLX N;  2YS8 A;  2VQE B;  2V7Q G;  4FFB A;  3ETG A;  1Y67 A;  1KKC A;  3BA9 A;  5KX5 A;  1NR1 A;  1CEZ A;  4JI6 B;  4NXN O;  4KL1 A;  3IC7 A;  4G27 B;  4P9O A;  1IVS A;  3R65 A;  4QJF B;  2X0L A;  1X59 A;  4MVU A;  3SJA C;  4WCE V;  4BIZ A;  4H37 A;  5F2V O;  4OGQ B;  3AK2 A;  3TET A;  3BAB A;  3CCQ V;  1KMI Z;  2VQF B;  2V4D A;  3RGB A;  2ZIO A;  4I5S A;  2UXD B;  3L9D A;  1V55 C;  3OEE G;  5BR8 O;  1R3I C;  2GBO A;  1TUB A;  2DWD C;  5LBQ A;  2F66 C;  5ITZ A;  4X65 B;  1FFX B;  4QPK A;  2EZP A;  1DLB A;  4DW0 A;  2YIA A;  4EFE A;  3APO A;  2Q7H A;  4X1I B;  4PA4 A;  1DGS A;  4FPP A;  2E75 B;  5JCO C;  2OTL V;  3T1H O;  3RYF B;  4KHP B;  3NR7 A;  3ZHQ A;  3ICX A;  2VRZ A;  4WFF A;  2IH1 C;  2Z3Y A;  3E89 A;  5E1A C;  5D5P A;  5L3E A;  2UUB B;  4F6R A;  1VQ5 V;  4B08 A;  2BTQ B;  4RQF A;  5CB4 A;  3UQ8 A;  4G2K A;  2CE4 A;  3THO A;  3APQ A;  5KLV H;  5LP6 B;  2WLI B;  4NVP A;  4BWA A;  4DO2 A;  4NKG B;  3H01 A;  1MSD A;  2X6B A;  5B1A C;  4E2L A;  1XUQ A;  3JD0 A;  4LH7 A;  1BQ0 A;  1FD9 A;  3RW0 A;  1YJW V;  4JI0 O;  1Q8I A;  1K33 A;  2JDI G;  1JX9 A;  4R7C A;  4X9Q A;  1OCC B;  1GMG A;  4J10 A;  4CC5 A;  3CS5 A;  4K0K B;  4XDK A;  2K1E A;  2JS3 A;  2JS5 A;  3DC6 A;  4OPA A;  3E8B A;  2CH7 B;  4E4E A;  5L3C A;  2OYQ A;  3JCU Z;  4JI5 B;  2CK3 G;  2CDY A;  1H2S B;  4DRX A;  1RSO B;  5KHI A;  2HLD G;  3C90 A;  4CH6 A;  1AP6 A;  2FL4 A;  2KQX A;  5B1N A;  4WFB V;  2K9P A;  3K9S A;  3HKC A;  1XMQ O;  3B8N A;  3CSX A;  4P30 A;  4I0X B;  4CZZ A;  4UVC A;  3OUF A;  4JAS A;  2PYL A;  3FB5 C;  2XAS A;  2OCH A;  5LMN O;  4GYC B;  2XOK G;  1HNW B;  1GN6 A;  1V54 B;  1WLE A;  1YDX A;  2UXD O;  5CA1 B;  2RCV A;  4O2B B;  4TT3 G;  3A8T A;  3K5N A;  5KHK A;  2QM8 A;  4I55 B;  3JYC A;  3C3S A;  1WA8 A;  4JGS A;  1XMO B;  4LWS B;  4PA6 A;  4NB5 A;  2YEV B;  5K1X A;  1KEC A;  5EZY B;  1BL8 A;  4B7E A;  1RM1 C;  3ETQ A;  5LYJ B;  2QKA A;  4FIP C;  5FNV B;  1SC5 B;  3SYO A;  4UB6 Z;  2BSK B;  4OX9 B;  4PHZ A;  5KMG A;  5LGN A;  4LBE C;  4HNA B;  2OWO A;  2ADQ B;  5KA5 A;  4DR4 B;  3RYH B;  1AI7 A;  1F4N A;  2DN9 A;  5BMV A;  3E2E A;  1GO3 F;  1K92 A;  4DV7 B;  3OR6 C;  4IHJ A;  3W7X A;  2EIJ C;  4J80 A;  4K8Z A;  1PL4 A;  3AG1 C;  4H0L B;  4ASU G;  4FLV A;  4YJ2 A;  4KP4 A;  3G6E V;  1RPR A;  4LNU A;  4JAU A;  3DSQ A;  4IL6 Z;  2NR5 A;  3MHS C;  1XNQ B;  1IUR A;  4UVB A;  1GTO A;  2LGW A;  3IJ4 A;  2HR3 A;  2A3Q A;  3OT7 A;  3E22 A;  3CC7 V;  5CBF A;  3L74 H;  4FZ1 A;  4JI5 O;  5L3F A;  2EIL C;  1Y6X A;  1KU9 A;  5B3S B;  4XDL A;  5L3G A;  3WB1 A;  1ZUQ A;  2P7T C;  4J7K A;  1SQX H;  3W7T A;  2YC0 A;  4I9W A;  4LF8 O;  5IYZ B;  2Q67 A;  2E74 B;  3K3W A;  1E1Q G;  4UVA A;  3ZN0 A;  3FB6 C;  5IJ0 B;  1KP2 A;  1OCR C;  2A0L A;  5LHI A;  3PN1 A;  4CH4 A;  1ARO P;  3F5W C;  4RWU A;  3VQW A;  3HKD A;  2H3O A;  2EX3 A;  1QU7 A;  4DV5 O;  1K4D C;  5IYB O;  2ZIM A;  2YXL A;  4DR5 O;  5B1B C;  1CP9 A;  4QNH B;  2OTJ V;  4YJ3 B;  3ZRW A;  4MW8 A;  2Y0P A;  1OV9 A;  2QWQ B;  1H38 A;  1TVK A;  2PTM A;  2EIK C;  2F1M A;  1G8M A;  1NT2 B;  1QNM A;  2ILM A;  4IYH A;  2F4V O;  3UM7 A;  2OIG A;  3RBZ A;  1N36 B;  3OTO B;  2Q0A A;  4UCV A;  3T2M A;  4LH6 A;  2IH3 C;  3IFX A;  3BRC A;  1L1F A;  4O4J B;  2ATK C;  4B3R B;  4DR6 B;  4TQD A;  2FML A;  4I50 B;  3WU2 Z;  1LR1 A;  2WLL B;  3W7S A;  4DR1 O;  1WP8 A;  2UUA B;  4DR3 B;  4X20 B;  3JAW B;  1PNM A;  3QO8 A;  5TIS Z;  1SQQ H;  1OHH G;  4JAA A;  3ZHR A;  4B3S B;  5AG2 A;  1Q6U A;  3ABK C;  3ASN B;  4MW3 A;  3ZMS A;  4DV2 B;  2WA3 A;  1LUW A;  4U3J A;  4NTY A;  3UO3 A;  1B06 A;  3CX5 F;  4LR3 A;  5IYC O;  5LMU O;  4DV7 O;  2HHH O;  1HNZ B;  1D5A A;  1JR9 A;  2DQ3 A;  3R66 A;  4UUJ C;  3S3X A;  1VQ7 V;  4WFA V;  1GN3 A;  1V55 B;  2OT5 A;  5A9G A;  1FAF A;  5DM6 V;  5CA0 B;  4X1Y A;  4DV6 B;  3ABM C;  3CMA V;  2XHB A;  3QVN A;  1K4C C;  1ZL8 B;  2IJH A;  4DR7 O;  2QSA A;  4B7K A;  4ZOL A;  1M57 C;  5JQG A;  3ZMV A;  2PI4 A;  1QLE C;  1JOY A;  4MS2 A;  1IBM O;  3D8C A;  4IIJ B;  3P32 A;  1WPB A;  2VS0 A;  4LF7 B;  4PI2 A;  1ZTE A;  4WFH A;  2WLJ A;  4PA7 A;  3D3Q A;  2EZO A;  1Q6I A;  1QVF U;  1COW G;  1XNR B;  1HR0 B;  1NVP B;  4A5U B;  2B1G A;  3B8M A;  2DYR C;  1W0J G;  2UUC B;  1D2D A;  1YEW A;  2Z5U A;  3M8A A;  3STZ C;  4HZ3 A;  3RYC B;  1OCO C;  3QG5 A;  4J11 A;  2YXH A;  3H1L H;  2M7W A;  3H1H H;  3PJS K;  4DUY B;  1YSC A;  2HVJ C;  1VQ6 V;  3CJH B;  1Q81 W;  1EM1 A;  3RN4 A;  2F23 A;  2ZCE A;  2JJ2 G;  5C93 A;  1N4C A;  1GAX A;  4MVZ A;  1N32 O;  2IW5 A;  4AQY O;  4D6T H;  3QTC A;  4LFC O;  4LFA B;  4AHC A;  3OTO O;  1FFT B;  2XAF A;  3WG7 C;  4X1I A;  3JAS B;  2RMK B;  1JFF B;  5DN6 G;  3JAK A;  3K79 A;  4JI8 B;  4I7Z B;  4JF3 A;  1PNK A;  3FX7 A;  3RYF A;  1NJI W;  1HDJ A;  4K35 A;  2UUA O;  4NTW A;  1W59 A;  4RQE A;  2ZKO A;  1J5E O;  2LGQ A;  2BTO A;  2RJZ A;  3L72 H;  2F93 B;  4B3S O;  2R9R B;  5B5E Z;  5GTI Z;  1GM7 A;  2BTQ A;  1AVM A;  2P4K A;  2A06 H;  2UXC B;  4QGP A;  1NZ6 A;  1N0N A;  2XAG A;  4GCZ A;  3U0Z A;  5LP6 A;  1RP3 B;  3X2Q C;  4TV8 B;  1P4R A;  5EBW C;  3ZRX A;  4DV3 B;  2DOS A;  3LUT B;  5LA6 A;  3UT5 B;  2GDS A;  3BA8 A;  5GON B;  3HB3 B;  1A32 A;  3JD3 A;  4DV6 O;  1VQM V;  4NXM O;  2DW4 A;  3ABL C;  3J81 N;  5IYD O;  5DED A;  1MA1 A;  3BY6 A;  1VQO V;  1OJH A;  2PI5 A;  4MT8 A;  1BHB A;  4DK0 A;  3JAT B;  1AR5 A;  1ZLZ A;  4FK5 C;  1I5X A;  2AHY A;  2LP7 A;  3RFR A;  2R9A A;  1HNX B;  3OM3 B;  3T4Z A;  4B3T B;  3JAL B;  1F23 A;  2QJ1 A;  4MVO A;  2CH7 A;  5J2T B;  4FM1 A;  3K5O A;  2YDE A;  4Z2W A;  1PP9 H;  2N04 A;  4U3F H;  3ZMU A;  4JI2 B;  4WBN B;  1AP5 A;  3N2G B;  2P67 A;  4JI4 B;  1AI5 A;  1JVM A;  2F43 G;  3OW2 U;  4EFB A;  4GLX A;  1K9M W;  4O4H B;  4GUN A;  2EIJ B;  4O2A B;  1NVP D;  5IWA O;  2EUL A;  1D5N A;  5LXT B;  3ML0 A;  3LSU A;  1K7D A;  1VQ4 V;  4MTF A;  2OCC C;  1VEW A;  5FPO A;  3QO5 A;  2Q69 A;  1PKX A;  1QLN A;  3K59 A;  4O2B A;  4LF6 B;  1GM8 A;  1IBK O;  3E8G A;  4XDJ A;  2PGG A;  4EB6 B;  4LFA O;  2AXT Z;  5C8Y A;  3EVK A;  1FYJ A;  3L73 H;  4F6E A;  1BE3 H;  4LFB O;  1MSW D;  3GWO A;  4X1K B;  1JMK C;  4TOI A;  4X66 O;  2P22 C;  5EZY A;  2Y4T A;  4R8C A;  1Q90 D;  2N74 A;  1BS3 A;  1YIT V;  3SYQ A;  3CEI A;  1R6K A;  4GKK B;  1P7B A;  5LOV B;  1OCR B;  2DE0 X;  3FYE B;  1TA8 A;  2HVK C;  4GZR B;  3CXH F;  1S5L Z;  1W2B U;  2QWR B;  3O65 A;  4BR6 A;  4BW9 A;  1Y66 A;  3RYH A;  5KUK A;  2QA4 V;  4U7O A;  1TGO A;  5EBM C;  1SQV H;  4JAV A;  1K97 A;  4UCU A;  4FMT A;  4JI1 O;  1EFR G;  2YI9 A;  3FAV B;  3M7M X;  1SZT A;  3JD2 A;  4ZHQ A;  1VMG A;  4QIW F;  4TV9 A;  3JAR B;  3CCV V;  1U97 A;  1K5Q A;  3NXS A;  4GKJ O;  4Z1V A;  3LSQ A;  2XUM A;  3CRQ A;  3RT3 C;  3K5M A;  3HKB B;  4N23 A;  5KHG A;  1YIJ V;  3B40 A;  2UXX A;  3ZIA G;  4J7Z A;  1CPY A;  3BVO A;  1SS3 A;  3WB0 A;  3LSS A;  4YIP A;  2ZM6 B;  1B3Q A;  3DC5 A;  3CCL V;  1K34 A;  3WB2 A;  2ZR2 A;  2GUZ B;  1SRY A;  2EIN B;  2F95 B;  1DF4 A;  2NNU A;  4JI4 O;  2A7W A;  3I56 V;  4O4I A;  3ZRS A;  3N27 A;  1VF7 A;  4FLW A;  1U96 A;  3KZI Z;  4CH5 A;  3OFN G;  5EYP B;  1I94 B;  3VBB A;  3SDL A;  2UU9 O;  1R73 A;  2P5O A;  4NTX A;  4X64 B;  1SA0 B;  1WB7 A;  4YJ3 A;  1FKA O;  4L87 A;  2CTW A;  4EEQ A;  2VQE O;  5IJ9 A;  2FYU H;  3CCS V;  2ZNJ A;  1ENV A;  1UFI A;  3OGC C;  3CCE V;  1QLE B;  3K03 A;  4JI6 O;  4RUE A;  4XBF A;  2KG7 A;  4MSW C;  4ZIB A;  3G4S V;  2Y69 C;  1NTM H;  2CAZ C;  5KHH A;  2VQF O;  2LW1 A;  1OCZ C;  1KYO F;  3A0R A;  3IC9 A;  4BAY A;  1V9P A;  3FYI B;  4DR2 B;  2QTS A;  2O57 A;  4IYI A;  4FZ0 A;  2DYR B;  4YY3 B;  4X65 O;  3UKM A;  4X88 A;  1EZJ A;  1K5S A;  5J2U A;  2ZNI A;  2QGN A;  4ZI7 B;  3Q4H B;  2JK5 C;  3EHB B;  2QM4 A;  1HW7 A;  1GN2 A;  3AG2 B;  1K3E A;  1M56 B;  4DV4 B;  3ASO C;  4KHP O;  4B3M B;  3UCS C;  4FFB B;  3J7A U;  3BHP A;  5KX5 B;  2ZD9 A;  3RVZ A;  2ZXW B;  1LNQ A;  4JTC B;  5CA0 A;  4YIO A;  2PYJ A;  2ZQM A;  1Z5V A;  4PD4 F;  2X7R B;  2UUB O;  4LC1 A;  4BIO A;  1J95 A;  3WG7 B;  1QBZ A;  3K0D A;  4DUZ B;  3HPL C;  2MK3 A;  3SJB C;  2ARH A;  2N05 A;  4J7J A;  2ZM6 O;  2VWJ A;  4H33 A;  3DXR A;  1VQ8 V;  3KG2 A;  3K5L A;  5IY5 B;  1NTK H;  4PJ0 Z;  1SET A;  2DYS C;  1Y76 B;  4J9Z B;  2XAH A;  5KUM A;  2QKS A;  5LGU A;  2Q68 A;  5A2Q N;  4MVS A;  3OE7 G;  3QF7 A;  3IAY A;  4K0K O;  2DQ0 A;  3E8F A;  2P90 A;  1JCH A;  1Q6H A;  4ZKI A;  2BOC C;  2KB1 A;  2V1D A;  3SPJ A;  2P06 A;  1FXV A;  5KA6 A;  1YHQ V;  3CRR A;  5CB4 B;  4FM2 A;  2QWP B;  3KCX A;  3BEH A;  4GX0 A;  4ZBM A;  5JJE B;  2UXN A;  1VQK V;  1X4T A;  3P3P A;  3JAS A;  1SKV A;  1I7F A;  2LFR A;  1PPJ H;  3AG7 A;  4KFM A;  3TGU H;  3W7U A;  1FJG B;  3ZHT A;  3OAA G;  4LF4 B;  1HNW O;  2QWN B;  4GX5 A;  2CGN A;  3SR2 C;  1WP7 A;  2MW2 B;  3QNE A;  1VQL V;  1US6 A;  2RNB A;  4PV1 B;  2E5L B;  4MVR A;  5HFL A;  1ROP A;  1XMO O;  3AG3 B;  2CTR A;  2C2A A;  3CC2 V;  1S5H C;  2ZE8 A;  4DRX B;  4MVM A;  1M1K W;  4TV8 A;  4B3M O;  3H1I H;  1DF5 A;  3AG4 C;  2WAM A;  3T4D A;  2W6I G;  3F5T A;  3HKE B;  3HKC B;  5GON A;  3CPW U;  1PL0 A;  4OX9 O;  4O4L B;  4JTD B;  1R1B A;  3CCU V;  2WLN A;  1EN5 A;  4N21 A;  1S0V A;  2L35 A;  4DR4 O;  1YTF B;  1XBL A;  5LP6 C;  1AI4 A;  2QWO B;  1Z2G A;  2L6L A;  2Y48 A;  1NU1 H;  2IM9 A;  1Q82 W;  2LW7 A;  3TXQ A;  4I4T A;  2BCC H;  1B04 A;  1FXK A;  4CBC A;  3RYI A;  4ICG A;  4TUY A;  5BXZ A;  2CGO A;  5L3D A;  3N2K B;  1S76 D;  1WA8 B;  2JGD B;  5CBG A;  4WFE A;  1S77 D;  2HJD A;  2KSD A;  1WB8 A;  4KXR A;  4UCS A;  1XNQ O;  1OCC C;  1AR4 A;  4JYA B;  3L70 H;  4HYO A;  1JJO A;  3OMI B;  4LF9 B;  3TXS A;  2JEX A;  1KQS U;  3ETE A;  3OR7 C;  1LUV A;  5FPR A;  3T1Y B;  3OGI B;  3EXA A;  1FXH A;  1NI8 A;  5KMG B;  2NLJ C;  4CS4 A;  1DTO A;  2E3C A;  3JSN A;  2R72 A;  4NR1 A;  3W7W A;  3K57 A;  5BMV B;  1SQB H;  1KKD A;  2XAJ A;  3SJQ C;  4ABM A;  1N33 B;  4PA3 A;  3E35 A;  4IHJ B;  5KHJ A;  2D3O W;  3CXC U;  3U10 A;  5J9P C;  5B1A B;  2H8P C;  1VQP V;  3T1C A;  3JCZ A;  4YJ2 B;  4LF4 O;  1EN4 A;  1K73 W;  1V54 C;  4LNU B;  2IBZ H;  2LQT A;  1IBL B;  1K8A W;  5B66 Z;  2CUG A;  1E1R G;  2E5L O;  3G6B A;  3ABT A;  3L71 H;  4JI7 B;  3H1J H;  4D7S A;  2WWW A;  4MTG A;  1FFX A;  1N36 O;  3E22 B;  3SPH A;  2EJR A;  2W0X A;  5IDJ A;  5FL7 G;  2VWK A;  3FAV A;  3D36 C;  5LL6 Y;  4DR6 O;  4B3R O;  2PF4 E;  3CP1 A;  4G28 B;  1R3K C;  2EBO A;  1VP7 A;  1TUE B;  4OXS A;  1AJP A;  2AW9 A;  3RVY A;  4DR3 O;  3BFR A;  2Y4U A;  1MNG A;  1PNL A;  1BT8 A;  2JEU A;  1Q7Y W; 
#chains in the Genus database with same CATH homology
 4RUF A;  1W2B U;  2IJK A;  3LDD A;  4JGS A;  5KUK A;  1BMF G;  1H8E G;  1Y66 A;  4PA6 A;  2QA4 V;  2B5U A;  4U7O A;  4EKW A;  4MTX A;  1FS0 G;  2YEV B;  1AJN A;  5EBM C;  3DGE A;  1KEC A;  3ZN1 A;  1BL8 A;  1F51 A;  4JAV A;  1YJN V;  1UJW B;  1K97 A;  4FMT A;  4Q20 A;  4GT1 A;  1EFR G;  3ZRW B;  3QO7 A;  3EFF K;  1RM1 C;  4PDR A;  3E86 A;  3K0G A;  1MAB G;  1AI6 A;  2WLI A;  4YXW G;  1YTF D;  4FIP C;  4RO2 A;  2X6A A;  1SZT A;  3SYO A;  2QEX V;  3JD2 A;  3ZCC A;  3ETD A;  3F7Y C;  4X89 A;  4QIW F;  3SPI A;  5LGN A;  1NH2 D;  3CCV V;  2EIN C;  4LBE C;  1K5Q A;  3K06 A;  3NXS A;  4QPJ A;  1KC8 W;  2WLM A;  1XL4 A;  1Y4M A;  3LSQ A;  2LFS A;  4N23 A;  1S72 V;  1YIJ V;  5KA5 A;  1W0K G;  2UXX A;  1AI7 A;  3LDC A;  1F4N A;  3E2E A;  1GO3 F;  3FB7 C;  3ZIA G;  1CPY A;  1K92 A;  1RM1 B;  3OR6 C;  3LSS A;  3W7X A;  2EIJ C;  3D3I A;  3AG1 C;  1K34 A;  3WFV A;  3CCL V;  5LHH A;  1BHA A;  2ZR2 A;  3VOU A;  3FB8 C;  4R6Z A;  5B3S C;  2GHY A;  4ASU G;  1SRY A;  1THZ A;  2EIN B;  4KP4 A;  3G6E V;  1RPR A;  1DF4 A;  2NNU A;  2WSS G;  3I56 V;  4JAU A;  1ORQ C;  3MHS C;  2XND G;  4UVB A;  1GTO A;  5H6R A;  3ZRS A;  1QCE A;  4R50 A;  1F4M A;  2HR3 A;  3OFN G;  3CC7 V;  3VBB A;  5CBF A;  3AG1 B;  5L3F A;  1R73 A;  2EIL C;  3CYO A;  4GX2 A;  4RAI A;  5B3S B;  4XDL A;  5L3G A;  2HG5 C;  2H94 A;  2P7T C;  4PDV A;  5HFM A;  4L87 A;  3W7T A;  4I9W A;  3GB7 C;  1AR1 B;  3CCS V;  4PA9 A;  2Q67 A;  3K3W A;  1ENV A;  1SER A;  3CD6 V;  1E1Q G;  3OGC C;  4UVA A;  3CCE V;  1QLE B;  3K03 A;  3K9A A;  3ZN0 A;  1S3J A;  3FB6 C;  4RUE A;  1KP2 A;  1OCR C;  2A0L A;  2QTO A;  3ZMT A;  4MVQ A;  5LHI A;  4XBF A;  1KD1 W;  3G71 V;  1ARO P;  4MSW C;  2HJF C;  3JD4 A;  3F5W C;  3OMA B;  3LNM B;  3G4S V;  2JJ1 G;  3IGA C;  2EIM B;  2Y69 C;  1XL6 A;  1NKD A;  2EIL B;  3ZJZ A;  4QE7 A;  1JJ2 U;  1K4D C;  2YEV A;  5IYB O;  5B1B C;  1CP9 A;  3AG2 C;  3OMN B;  4QNH B;  2OTJ V;  1OCZ C;  1M56 C;  5CMU A;  3ZRW A;  3D36 A;  4MW8 A;  3A0R A;  4LCU C;  4U7N A;  4BAY A;  3CCR V;  3CCJ V;  1HWY A;  3FYI B;  3I55 V;  2ZXW C;  2DYR B;  1H38 A;  1KP3 A;  2EIK C;  2IJJ A;  1G8M A;  3UKM A;  5LHG A;  4X88 A;  1NQT A;  1EZJ A;  1K5S A;  3SYA A;  3UM7 A;  3ASN C;  3F7V C;  3RBZ A;  4QE9 A;  1N8R W;  4P2Z A;  2BOB C;  2JK5 C;  2Y69 B;  3EHB B;  3T2M A;  2IH3 C;  3SPG A;  3IFX A;  1QR9 A;  3AG2 B;  5B1B B;  1K3E A;  4PDL A;  3OEH G;  1L1F A;  1OCZ B;  1M56 B;  4X8A A;  2ATK C;  2A79 B;  3ASO C;  3K08 A;  3MD0 A;  2X6C A;  5EC1 C;  2QM7 A;  5CBH A;  3W7S A;  2WLL B;  2ITC C;  2ZD9 A;  3RVZ A;  2ZXW B;  1LNQ A;  4TSF G;  4JTC B;  5IY5 C;  1GM9 A;  1PNM A;  2ZQM A;  1NBM G;  2EIK B;  3QO8 A;  2X7R B;  1OHH G;  4LC1 A;  1EBO A;  1J95 A;  2QE7 G;  3WG7 B;  3TCU A;  3ABK C;  3ASN B;  1QBZ A;  3K04 A;  3K0D A;  4MW3 A;  4Z1M G;  3HPL C;  3ZMS A;  2MK3 A;  2DWE C;  3DTU B;  2JIZ G;  1YI2 V;  3AEI A;  2WPD G;  1OZ0 A;  5IYC O;  4TWK A;  3AG4 B;  3E8H A;  4PEL A;  2DQ3 A;  3ASO B;  4UUJ C;  4P9P A;  1VQ7 V;  2P6J A;  4WFA V;  2HFE C;  4MTO A;  1V55 B;  4KUM A;  1R3J C;  4H33 A;  1VQ8 V;  3KG2 A;  2OT5 A;  5IY5 B;  3CCM V;  5DM6 V;  2GSM B;  1SET A;  3P30 A;  2DYS C;  3ABM C;  3CMA V;  4J9Z B;  2XAH A;  2IU0 A;  1K4C C;  2QKS A;  5KUM A;  3ABK B;  2IJH A;  5LGU A;  2Q68 A;  2IU3 A;  1JQ0 A;  1GK9 A;  4MVS A;  1M57 C;  3ZMV A;  2PI4 A;  1QLE C;  3OE7 G;  3FKS G;  1JOY A;  4MS2 A;  2DQ0 A;  3E8F A;  1Q86 W;  2P90 A;  3SPC A;  1JCH A;  1YJ9 V;  1MG1 A;  2R9I A;  3P32 A;  4ZKI A;  2AHZ A;  2BOC C;  1FXK B;  2KB1 A;  2V1D A;  4WFH A;  3SPJ A;  2EIM C;  1FXV A;  2WLJ A;  4PA7 A;  5KA6 A;  1MOF A;  2EZO A;  3B77 A;  2DYS B;  3ABM B;  1QVF U;  1YHQ V;  1COW G;  5EK0 A;  3M99 B;  2HKO A;  1NVP B;  2Q6A A;  5EC2 C;  4J9Y B;  1M57 B;  2B1G A;  3BEH A;  3B8M A;  4GX0 A;  2DYR C;  1I5Y A;  1W0J G;  4ZBM A;  2UXN A;  2ZDI C;  1H2G A;  1VQK V;  2Z5U A;  3ZMZ A;  1M90 W;  5B1O A;  1PD3 A;  3STZ C;  4HAM A;  4HZ3 A;  3AG3 C;  4UXN A;  5CA3 A;  1VQN V;  1SES A;  1OCO C;  2LFR A;  2ZR3 A;  4KFM A;  1QR8 A;  4JYB A;  2M7W A;  3W7U A;  2FTK A;  3OAA G;  3PJS K;  3CC4 V;  4WFG A;  1YSC A;  2HVJ C;  1VQ6 V;  1JPX A;  2V7Q G;  1Q81 W;  4GX5 A;  3ETG A;  3QNE A;  1VQL V;  2WLL A;  1GKF A;  1NR1 A;  2JJ2 G;  5C93 A;  1CEZ A;  2A9H A;  2ITD C;  4MVZ A;  3IC7 A;  2IW5 A;  4G27 B;  4P9O A;  5BZB A;  4MVR A;  3R65 A;  5HFL A;  4QJF B;  2X0L A;  1AJQ A;  4MVU A;  1FFT B;  1B6Q A;  4WCE V;  2XAF A;  3WG7 C;  4BIZ A;  1ROP A;  4H37 A;  3AG3 B;  2C2A A;  3CC2 V;  1OCO B;  1S5H C;  5DN6 G;  3K79 A;  3TET A;  3CCQ V;  4MVM A;  4JF3 A;  1M1K W;  1PNK A;  1NJI W;  1DF5 A;  3AG4 C;  2WAM A;  3SYC A;  4I5S A;  3T4D A;  2W6I G;  4RQE A;  3MHH C;  4JYC A;  1V55 C;  3OEE G;  3CPW U;  1R3I C;  1IXM A;  2YSU B;  1PL0 A;  4BW5 A;  4JTD B;  2DWD C;  5LBQ A;  3CCU V;  2R9R B;  1M9N A;  4JTA B;  4QPK A;  1R6N A;  1GM7 A;  2EZP A;  1DLB A;  2WLN A;  4N21 A;  1S0V A;  1YTF B;  3SYP A;  4PA4 A;  1E79 G;  2XAG A;  4FPP A;  4GCZ A;  3X2Q C;  2OTL V;  1P4R A;  5EBW C;  1AI4 A;  2Y48 A;  4DXW A;  3ZRX A;  1NH2 B;  5GW7 A;  1Q82 W;  3LUT B;  3HB3 B;  1FXK A;  3JD3 A;  4WFF A;  3TK1 A;  2IH1 C;  2Z3Y A;  4CBC A;  1VQM V;  1FXK C;  3E89 A;  2DW4 A;  5E1A C;  3OUS A;  5L3E A;  3ABL C;  5L3D A;  1S76 D;  5IYD O;  5CBG A;  1VQ5 V;  3LDE A;  3BY6 A;  1VQO V;  4WFE A;  1S77 D;  4RQF A;  4UV8 A;  2PI5 A;  4MT8 A;  4G2K A;  1BHB A;  4BIU A;  1OCC C;  4FK5 C;  1I5X A;  3X2Q B;  2AHY A;  2LP7 A;  4HYO A;  2XAQ A;  3OMI B;  3OM3 B;  2WLI B;  3T4Z A;  1F23 A;  2JEX A;  4DO2 A;  1NR7 A;  1KQS U;  3ETE A;  4MVO A;  3OR7 C;  3H01 A;  2X6B A;  5B1A C;  1FXH A;  4UV9 A;  4E2L A;  4JPR A;  3JD0 A;  3ABL B;  3RW0 A;  1YJW V;  2NLJ C;  2WLK A;  3ZMU A;  1DTO A;  1K33 A;  2JDI G;  1JX9 A;  4R7C A;  3W7W A;  4PDM A;  2P67 A;  3JD1 A;  1AI5 A;  1JVM A;  2F43 G;  3OW2 U;  1K9M W;  1KKD A;  1OCC B;  1GMG A;  1RPO A;  2XAJ A;  3SJQ C;  4FJC C;  4PA3 A;  2ZDI A;  4XDK A;  2EIJ B;  3E35 A;  2D3O W;  1NVP D;  2K1E A;  3CXC U;  4F4L A;  3E8B A;  5H6Q A;  3ML0 A;  5J9P C;  2W6J G;  2B1I A;  5B1A B;  2H8P C;  5L3C A;  1VQP V;  5H9C A;  2W0F C;  1VQ9 V;  1K7D A;  2CK3 G;  4MTF A;  3T1C A;  1VQ4 V;  3JCZ A;  2OCC C;  2HLD G;  4LP8 A;  1K73 W;  1G4Y B;  3QO5 A;  1V54 C;  2Q69 A;  1PKX A;  5L3B A;  1QLN A;  5B1N A;  4WFB V;  3E83 A;  1ZWI C;  3B8N A;  1K8A W;  1GM8 A;  4P30 A;  1E1R G;  3E8G A;  2IJI A;  4XDJ A;  3ABT A;  5CN0 A;  2WWW A;  1WPX A;  4MTG A;  3STL C;  4CZZ A;  4GX1 A;  4UVC A;  3OUF A;  5EBL C;  3SPH A;  1MSW D;  4JAS A;  3GWO A;  3ABU A;  3ZRV A;  2EJR A;  3FB5 C;  2XAS A;  2OCC B;  5IDJ A;  5FL7 G;  4R8C A;  1H8H G;  2XOK G;  1QVG U;  1YIT V;  3SYQ A;  1V54 B;  1WLE A;  3CP1 A;  4G28 B;  5LGT A;  1R6K A;  1R3K C;  2EBO A;  1P7B A;  4WF9 V;  4OXS A;  1TUE B;  1AJP A;  3RVY A;  2WLH A;  4TT3 G;  3CME V;  1OCR B;  1PNL A;  1R3L C;  2QM8 A;  3FYE B;  3JYC A;  2HVK C;  2JEU A;  1Q7Y W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...