1K4DC

Potassium channel kcsa-fab complex in low concentration of k+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Chemistry of ion coordination and hydration revealed by a K+ channel-Fab complex at 2.0 A resolution.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k4dC00
2Q69A 3T4ZA 2DYRC 4WFHA 3RVYA 4MW8A 3K04A 2DWDC 4X88A 2A79B 5BZBA 2Q6AA 1J95A 3K06A 2WLIB 3T4DA 5IY5C 1OCRC 2EIKC 3ZJZA 5CBGA 4LP8A 4OXSA 2Q67A 5EBLC 5KUMA 2ITDC 1ZWIC 3OR6C 4I9WA 1OCZC 2X6BA 4KFMA 4LBEC 4MTGA 4G27B 3SYPA 3K03A 3JYCA 4QNHB 4QE9A 4R7CA 3PJSK 2DWEC 2WLIA 3F7VC 3LNMB 4GX2A 4P9OA 3ASOC 1V54C 3OUSA 4X89A 3T2MA 5KUKA 4P2ZA 5EC2C 3IGAC 3K0DA 3K08A 5B3SC 2HJFC 4TWKA 1S5HC 3FB6C 4MVQA 4XDKA 1XL4A 3FB5C 3UM7A 4CBCA 4P9PA 1R3IC 3X2QC 3STLC 4XDLA 3BEHA 1G4YB 1LNQA 2Q68A 4QE7A 1XL6A 2Y69C 2YEVA 1BL8A 2W0FC 2X6CA 3FB8C 4PDLA 1JVMA 4JTDB 4MSWC 4PDRA 3RVZA 2DYSC 2HFEC 3E86A 5EBWC 3R65A 3LDEA 4P30A 4WFEA 4J9ZB 5EC1C 4PDMA 4F4LA 3E89A 3SPIA 2H8PC 4G28B 3WG7C 4PA9A 1KKDA 2HG5C 2HVJC 3AG2C 4MVZA 3AG3C 4UUJC 4WFGA 3SYOA 3UKMA 4MVMA 1R3JC 2WLNA 5CBHA 3TETA 4RUFA 2ATKC 2WLLA 4WFFA 2K1EA 4RAIA 3F7YC 3E8HA 3EFFK 3SYQA 4MVOA 4PA6A 2A9HA 4JTAB 4RUEA 3KG2A 5CBFA 3GB7C 3OR7C 4MVRA 2P7TC 4H37A 4MW3A 4J9YB 2WLHA 4R50A 3OUFA 1OCCC 3T1CA 4MTFA 5J9PC 4ZBMA 2X6AA 2WLLB 3RBZA 2A0LA 1K4DC 1V55C 2EILC 5B1BC 4EKWA 4GX1A 2ZD9A 3FB7C 3HPLC 3SYCA 3ABLC 3K0GA 3SPCA 4RO2A 4BW5A 2ITCC 3LUTB 4LCUC 1QLEC 3ABKC 3E83A 2IH3C 2AHYA 4PA3A 2WLJA 3SPHA 2QKSA 2QTOA 5E1AC 5EBMC 2WLKA 5EK0A 1M57C 2ZXWC 1R3KC 3AG4C 4HYOA 4MTOA 4JTCB 3SYAA 4DXWA 3E8GA 3LDDA 4MVUA 1OCOC 4XDJA 2BOBC 2NLJC 3E8BA 2KB1A 2WLMA 1R3LC 3STZC 3SJQC 2AHZA 2EINC 3SPJA 4MS2A 1M56C 4GX5A 4MVSA 4PDVA 1P7BA 4PA4A 4R6ZA 3RW0A 3LDCA 1K4CC 2EIJC 2EIMC 3ZRSA 4GX0A 2HVKC 2IH1C 2BOCC 4H33A 3ABMC 5B1AC 3SPGA 3ASNC 4HZ3A 3OGCC 3IFXA 4X8AA 3TCUA 4PA7A 4R8CA 3F5WC 2R9RB 3E8FA 1ORQC 2JK5C 2OCCC 3AG1C 3VOUA
chains in the Genus database with same CATH superfamily
5LHHA 3ZBHA 4MW8A 4LF5B 4JI5B 4D7SA 4I50A 4TV8A 3K58A 4B3RB 3AG2B 3N2KB 2YIDA 3H1KH 3K03A 4QNHB 2F95B 2RDCA 1XMOB 2OYQA 1OV9A 2A06H 3K5OA 1AR1B 1NI8A 4QPJA 2GV9A 1AJPA 2QEXV 2EILB 3ZX6A 1Q82W 2PGGA 4JYBA 3X2QC 4CH5A 3CE2A 2Y69C 1QLEB 2ZKOA 4DUZO 2DYSC 3FYIB 3LDEA 4EEQA 2L35A 2ZR3A 1UFIA 1IBLB 2IJKA 3JD4A 1KU9A 1GKFA 3S3WA 1NJIW 3OM3B 1SQGA 1RPOA 3JASB 3E35A 4J9YB 1IBMO 3T1CA 1XNRB 1RPRA 1XOUA 3U10A 3P30A 5JCOC 2ZXWB 4LCUC 4YXWG 4UCVA 4O4IB 4NB5A 3TXQA 2PZSA 4XDJA 1S5LZ 5TISZ 1VQ7V 2QKCA 2ZT9B 4NTWA 1DTOA 2NR5A 1BZKA 2PUSA 4JI1B 5L3EA 4JI4B 3MD0A 3MAQA 4JI8B 4DRXA 1VMGA 1S3JA 4X1YB 5IYDO 1P7GA 2JJ2G 1ZX3A 2JK5C 2OCCC 4FZ1A 2AZ2A 4IHJB 1RSOB 3B2EE 4JI0O 4YJ2B 3K04A 3CRQA 1Y4MA 3I56V 1AJQA 1VF7A 1S5JA 2QDOA 5FPOA 2Y0IA 3J80N 1R6TA 2OWOA 4DR7O 4QE9A 2QM7A 2CE4A 1WNSA 4QPKA 4EB6A 3OUSA 4J7JA 4X66O 5KUKA 2FKXA 5KHIA 5B5EZ 3CJHA 2PTMA 5JJNB 5JWPA 4BAYA 5L3FA 4NXMO 5IT9N 1FXKB 3ZHVA 4N21A 3RVZA 4LFBO 2WWWA 4X20B 2QA4V 4DV5B 3JARA 3L72H 5BR8O 4DR4B 2LGQA 1HWYA 1N32O 4KXRA 2QSAA 3G4SV 1FFTB 2EIJB 2KSDA 3G80A 2DQ3A 2P7TC 1K5QA 1RM1B 2Z0AA 1TUBB 3OTFA 3HPLC 3K5LA 3CCLV 1QQCA 3VQWA 3W7XA 2AHYA 1L0LH 5DECA 4MVUA 2BOBC 2EJRA 2CTRA 4B3SB 1RP3B 1P49A 2GUZA 5KMGB 1ROPA 4DR1O 2EINC 1NZ6A 4BWAA 4MS2A 1M56C 2JVDA 4WFAV 1QNMA 2EIMC 5IJ0B 2UUCB 2N74A 4H33A 2Q73A 5IDJA 1SQXH 3DC5A 4YIOA 4LFCB 4GT1A 2PI4A 3RYHB 1K33A 5LMNO 1QBZA 4FFKA 4DV1O 2BTQA 2QR4A 1VQ5V 4LFAO 3ZRWA 3UCSC 4NR1A 3RYFA 1S0VA 3FX7A 4TT3G 4DR2O 4BIZA 4G27B 1TVKA 3JYCA 4LF7O 5LGNA 1TAEA 3FYEB 3E2EA 3W7WA 4U3FH 3EVKA 4FM1A 1VIBA 4JYCA 2YXHA 1OCCB 3FAVA 3K08A 3UM7A 4GKJB 4JPRA 4XDLA 1G4YB 4BW9A 1FD9A 4DV2O 1MSWD 5HFLA 1AJNA 3N27A 2QWQB 3RYCB 4LF9B 2WPDG 1GM8A 3GWKC 2L6LA 3ZMZA 3AG2C 3HKEB 4U3JA 3VBBA 1QCEA 1MNGA 4JI7B 2VQFB 1BT8A 1HR0O 3BFRA 1TUEB 3UO2A 2Q7EA 4I0XA 2WLHA 4ABMA 4X62O 2EILC 1BHAA 1SERA 3AG7A 1VF6C 1Q6IA 2Q8VA 1CEZA 1QLEC 1MOFA 1K8AW 3DTUB 1R3KC 4DXWA 4HYOA 2HHHO 4UVAA 1GM9A 1LUVA 1RFYA 2GTAA 1DF4A 2D3OW 4FVMA 1K7DA 2HP8A 5IE9A 3RN4A 3THOA 3W7TA 4LH6A 2CH7A 5B3SB 1K92A 3TCUA 5C93A 4NVPA 3HR0A 2CAZC 5JJJB 4FFBA 3HKDB 4X65O 4IIJB 5LYJB 5CB4B 2EIKC 4X64B 3JSLA 2LFSA 1ZL8A 2UUAB 2DE0X 4I7ZB 2LP7A 3ZHTA 3KCYA 3DSQA 4O2BA 2EZPA 5JH7A 1UPGA 3HKCB 2E76B 3FB5C 1YIJV 4P9PA 2UXDB 2M7WA 5LL6Y 1IBKB 2K9PA 2UUBB 4JI3B 2ZE7A 4G28B 1NT2B 1Q7YW 2N04A 1N34O 3WB0A 2P6JA 1R3JC 2WLNA 2YEVB 1M5IA 2RNBA 1Y76A 3AK1A 3BVOA 3JATB 3ABMB 2YSUB 1NR1A 2XAQA 1VQ6V 4KHPO 1BGYH 1MZFA 1JOYA 2UXBO 1FXKC 3LUTB 3RWRD 1MMMA 1QR9A 1IZ3A 1XNQO 4PA3A 3KKYA 3ZN0A 2JIZG 1FJGO 1FFXB 4J80A 3H1LH 4FJCC 5IYZB 4MVSA 2CK3G 2EIJC 4ZI7A 1K73W 3MDSA 5CN0A 3EXAA 4JAUA 3LSQA 1RM1C 1PD3A 2OTJV 3CCQV 2E5LO 1I0HA 1WA8A 3H1IH 2VWJA 1GK9A 3FD9A 3AG1C 4TV9A 2W6JG 1G6UA 1D2DA 4YHHO 1VEWA 5LGTA 4QGPA 3K06A 3DXRB 3CC7V 3AG3B 2ZM6O 3ABTA 3A0BZ 4I9WA 1BHBA 1B04A 1NQTA 1K5SA 4LNUB 2P22C 3U0ZA 3BY6A 4X1KB 1Q81W 3MHHC 1XHZA 1T5EA 3GWOA 2KG7B 4GKKB 1S5HC 3B77A 4UCUA 4LR3A 3BA9A 2IJIA 1BS3A 3JD0A 4NYKA 5BY1A 4UV8A 1CXZB 3E86A 3ICXA 3KZIZ 1IVSA 4B3MB 3JD3A 3CX5F 1WB7A 2VWKA 1JQ0A 2CDYA 1JX9A 4DR3B 2AXTZ 3LSSA 1SQPH 3EFFK 3SYQA 3BABA 4LF5O 3GB7C 5JQGB 4B3RO 3ASNB 2JDIG 1EM1A 1OCCC 4YJ3A 1HW7A 4O4LB 1GRJA 1SA0A 2ZD9A 1PNMA 3ZRVA 3K0GA 3SPCA 4DV6B 3RT3C 4OX9O 3ABUA 2XTAA 3CSXA 3SPHA 1OJHA 1JFFB 1GMGA 4PI0A 5EZYA 2UU9O 3E8BA 5GONB 2E74B 5DN6G 4CS3A 3OTOB 3L70H 3BAAA 3RW0A 3IAYA 1YJNV 3SR2C 1IBLO 3ZS8C 4ZOLB 3HB3B 4JI6O 4YIPA 4YY3B 4DK1A 2R70A 4UVBA 4LWSB 3RVYA 4Q20A 3OMNB 1ZLZA 2M6YA 4GLXA 4JYYA 3K9SA 4ASUG 1OCZC 3E22B 1NR7A 3CCJV 3TGUH 3GVMA 1F7YA 4K0KB 1I08A 3C3SA 2WLIA 3JAKB 4K8ZA 1EN4A 5ITZB 5JJEB 1Q6UA 4NXNB 1COWG 5B3SC 3CEIA 4B7EA 1S77D 3K9AA 2P4KA 5H6QA 2JEUA 4JI1O 2BCCH 1JCHA 4UFZA 4JI4O 1BL8A 1US6A 1JVMA 4MSWC 4NTXA 3VQXA 5CA1B 4WFEA 4LH7A 1G1XB 4J9ZB 3SJBC 4LF4O 3E89A 5J2UA 4UUJC 2F66C 4DK0A 4DUYB 3E8HA 4J42A 4W4KA 4UV9A 2ETNA 4RUEA 2Y0PA 1AP5A 2YIBD 3T1HO 3EHBB 3APQA 3K59A 2YC0A 3B8NA 4QJFB 2IM9A 2B1IA 4ZBMA 2OIGA 1DF5A 4O4IA 2RJZA 4TQFA 1AR5A 2W6IG 3P3PA 1U97A 2BSKB 3SYCA 4DV0B 2F93B 4WCEV 4X1IB 3I5DA 5L3BA 2QKSA 3SYAA 4FMTA 3CS5A 3JSNA 4UCSA 1HNWB 1P4RA 1JMKC 1ZTEA 3TJTA 5LA6B 4BIUA 1DK1A 4PD4F 4X1YA 3OT7A 4DR4O 1L0NH 4PELA 1H2GA 2ARHA 3CCUV 3ABMC 1IDSA 1RSOA 2GSMB 4YJ2A 1QVFU 3ZHSA 4B3TO 4I50B 2DQ0A 2Q7GA 3F5WC 3TK1A 3JAWB 3B8MA 2QKAA 2EIKB 1I7FA 1K3EA 1H2KA 2IBZH 4DV3O 2A79B 1FAFA 1KQSU 2VQEB 4FZ0A 3WG7B 3L73H 5CBGA 2Y48A 5L3CA 1SQQH 2DOSA 1ZWIC 3ZRXA 3CXCU 4KFMA 4MTGA 3SYPA 3K5NA 1FXKA 4UCOA 4J11A 4B08A 4JGSA 4PJ0Z 4X20A 2IW5A 2JS3A 4IL6Z 4XDKA 2XAJA 5BMVA 4OGQB 3J7AU 4GUNA 1VQMV 1NH2D 3CWBH 2UUCO 2CGOA 2LJ2A 2Q9LA 1MSDA 3L74H 3CB2A 1DLBA 3AG3C 4UCRA 4G2KA 1TUBA 3TETA 1P84F 1VQ4V 1FKAO 4LF8O 1YSCA 5KA5A 5GTIZ 3QVNA 1I5XA 1SZXA 1FPOA 2ZNJA 1VQKV 3RFRA 2P67A 3M99B 3ZMUA 4DUZB 2OCHA 2EULA 4BW5A 4Q6GA 5KMGA 1AI5A 2IH3C 3H9VA 1JJ2U 4JASA 4FLZA 5KAIZ 4MTOA 5IJ0A 4GKJO 5B66Z 4DRXB 2NN4A 4DV7O 4ZHQB 4WF9V 2KB1A 4JAVA 4DO2A 4LF6O 4W4LA 1O9GA 2QWRB 3CCMV 1VARA 4PA4A 3JAMN 3RYHA 2RMKB 3ZRSA 4LF9O 1GTOA 2Q5ZA 3AG1B 3ASNC 2PYJA 2EBOA 5EIBD 1KYOF 1N4CA 2VQFO 1SF9A 2D2CB 5CA0B 2JS5A 1XBLA 5C8YB 2F43G 4FLXA 3ZJZA 2XHBA 2CTQA 3D8CA 5EYPB 3OR6C 3CJHB 1F23A 5KA6A 2WAMA 2V1DA 4KUMA 1WAZA 3RYCA 2OTLV 2YI8A 4DR6O 1V55B 3K79A 5FPRA 1SETA 3D36A 3STLC 3CPWU 4HNAB 4QE7A 2IU0A 3HKEA 2GBOA 1S76D 4O4HB 5KHGA 3ZHUA 3K5MA 3T1YO 2X7RB 1S72V 5F2VO 4MVZA 4O2AB 4TUYB 4X66B 5FNVB 1N33O 4DV4O 3KG2A 5CBFA 3W7UA 1H2LA 4MVRA 5LMUO 4MTFA 1WPXA 2WLLB 2X6AA 1Q43A 4LFBB 5LOVB 4L87A 2FL4A 5BR8B 2ITCC 1N32B 1AI4A 5E1AC 2DN9A 2N05A 2GTSA 3LDDA 5L3DA 3VQYA 2HLDG 3OE7G 2UXDO 2B9ZA 3AK2A 3STZC 3H1JH 2XAFA 5LP6B 4GX5A 1IBKO 1XMQO 4R6ZA 2Q0OC 1YCIA 4GX0A 4NKGB 2WA3A 4JI3O 5L3GA 2UUBO 2PYLA 2BOCC 5KHJA 2BTQB 4HZ3A 3HKDA 5LGUA 4IIJA 3ZRWB 5LYJA 5CB4A 4FLWA 3RYFB 3E8FA 3JD2A 1TVKB 2LGWA 3T4ZA 3APOA 1ENVA 1OCZB 1X59A 4FLVA 3ZCCA 4OXSA 4H44B 3DC6A 1W2BU 3HKCA 2JGUA 1OZ0A 2QJ1A 4FIPC 3CC2V 1BMFG 1YXBA 4P2ZA 2F4VO 1M93A 3ETGA 3FFQA 3DGEA 5LMNB 3G67A 4MVQA 4JYAO 4DV1B 3ABLB 3U11A 1F4MA 2YEVA 5JVDB 3IC9A 1QHTA 4DR2B 4FM0A 3Q4HA 4PDMA 1BE3H 3WG7C 4AI8A 3JATA 4PA9A 1OCOB 2Y4TA 5K1XA 4LF7B 4I0XB 1PM9A 2A3QA 5FL7G 5JCOA 1I94B 4FK5C 5KHKA 2ATKC 4UCTA 3SJAC 4BR6A 3K57A 1H2SB 3MHSC 4OPAA 5B1AB 1AROP 4UB8Z 4I4TB 4R50A 1Q3EA 1FFXA 3FB7C 2O57A 1FS0G 5B1NA 1EZVH 3CCVV 1YZBA 2YXLA 5IYZA 3JALB 2EZOA 3CRCA 1YJWV 4GKKO 1SZTA 4JTCB 2IU3A 3G71V 1EN6A 2XNDG 1KP2A 1HR0B 3NR7A 5J2TB 2XOKG 3ASOB 1B3QA 2IH1C 4B3MO 1K97A 4X8AA 4PA7A 3CHXA 3L71H 1ZL8B 1W59A 3DXRA 4JI2B 5BXZA 1ORQC 1YJ9V 2HHHB 4I9QA 4U7NA 3RYIB 1J5EB 3ZEDA 5LXTB 4O2BB 4X1KA 3JCUZ 2ZINA 2UXCO 2ITDC 4LBEC 4DV6O 4O4JB 1E1QG 3N2GB 4F6RB 2ADQB 3UT5A 2JGDA 4I55A 1GN3A 4DR5O 4L8JA 3OTOO 1GAXA 3HKBA 3CYOA 3O65A 1XUQA 1PL0A 1N36O 1KKCA 4PDRA 4B7KA 3AEIA 4P30A 1XILA 5H9CA 2CUGA 1XDCA 1BCCH 5JQGA 5CBHA 3UKMA 4D7TA 2ZIOA 2ZQMA 2YI9A 5KX5B 1MA1A 4O4LA 4GCZA 2Z5UA 1KECA 4PA6A 2A9HA 2WSSG 2YS8A 2CTWA 4H37A 1EFRG 3M7MX 5IJ9A 1JFFA 3LNNA 2A0LA 1K4DC 1V55C 1HNXO 1QU7A 5GONA 1WP7A 1N8RW 2PF4E 4NXNO 1SQBH 2ZCEA 5KLVH 4WBNB 4ZOLA 3BA8A 2UXXA 4JI5O 4Z2WA 2WLMA 1R3LC 1VF5B 1KC8W 1WPBA 2R72A 4TV9B 4KHPB 2QWNB 1WJZA 4HBNA 2UXBB 1XMOO 4C7UA 3A8TA 3JD1A 4ICGA 2FB5A 1I5YA 4E4EA 2PI5A 2P06A 2C2AA 5BZBA 4LC1A 1GN6A 3P32A 3JAKA 5A9GA 5ITZA 1SKVA 4LP8A 5IWAB 2HR3A 4DV0O 1YI2V 1EN5A 2JEXA 1V9PA 3WFVA 5LP6C 3PJSK 2E5LB 2PY5A 4GX2A 2XASA 4JV5B 1Y66A 2W0XA 1HNWO 5EC2C 3K0DA 3WU2Z 1VQOV 5B1BB 3N2KA 4BIOA 2IJHA 1AVMA 3BEHA 4DW1A 1XNRO 3ABKB 1JPXA 4PDLA 4D6TH 1M1KW 2A7WA 2ZM6B 5E79Z 2QGNA 3SDLA 3AG4B 3SPIA 2LO1A 4HAMA 3B09A 4RQFA 3L9DA 4CC5A 1B6QA 4YJ3B 1Y74B 3CCEV 1VF6A 4WFFA 3L75H 1HNZB 1K34A 3I55V 5LBQA 4MVOA 5B1OA 4X1IA 1R1BA 3QF7A 1YTFD 5J9PC 2B1GA 4J10A 4EKWA 4OPHA 4JI8O 5EZYB 1M90W 2LW7A 3ABLC 2DYRB 3JASA 5LA6A 1O9HA 2QWOB 3W7SA 5EK0A 1OCRB 3QG5A 1PPJH 2RCVA 1OCOC 1AR4A 4UXNA 4Z1MG 5GW7A 4RQEA 4ZKIA 3JAWA 1YDXA 1P7BA 2FYUH 1K4CC 2OIEA 5H5NA 5B1AC 1HP8A 3OGCC 1EBOA 4OX9B 4FM2A 2R9RB 2E3CA 1YF2A 3JCZA 1QR8A 4WFHA 3UQ8A 4CH4A 2UU9B 1J95A 2WLIB 3T4DA 1KMIZ 1PNKA 1X4TA 1NH2B 4DV5O 2NNUA 2X6BA 4IHJA 1D5AA 1SRYA 2YUAA 4K3AA 3A0HZ 3FKSG 3ZHRA 4TV8B 1VQLV 3ASOC 4QIWF 4JI6B 5CA3A 2AZ0A 1H2MA 1R73A 1GN4A 2HJFC 4N23A 1UJWB 3FB6C 3G6EV 5J2UB 1R3IC 1ZAUA 2QE7G 4AILC 3OGIB 4IT5A 4AQYB 3FB8C 4JTDB 1XREA 1M57B 5EC1C 4F4LA 1Q8IA 4JAAA 3NXSA 4RAIA 4AHCA 4JTAB 1XEQA 4B3SO 1MZEA 4A5UB 4CZZA 5IYBO 4ZHQA 1NKDA 4LF4B 3SJCC 1XQ8A 4LFCO 2CGNA 2ZDIC 2F23A 1NU1H 2WLKA 3E8GA 5K1PA 3T1HB 1Y6XA 4JZ2A 3F5TA 4PDVA 3QO8A 2JRIA 3LDCA 3CRRA 5CA0A 1V54B 5C8YA 2FTKA 2ZE5A 1AI6A 4KP4A 4CS2A 3ZMVA 2BE3A 2ZNIA 1OHHG 3WB1A 1FYJA 4GYCB 5HFMA 5EYPA 3VOUA 2P4VA 3CC4V 1URFA 3H1HH 4X88A 1W0KG 1M9NA 2Q6AA 1CPYA 5EBLC 1IBMB 5KAFZ 1Z5VA 3LSUA 1BQZA 1KUQA 5BMVB 4J41A 1TGOA 4B3TB 1Q90D 4HNAA 3F7VC 3LNMB 3IC7A 4JI7O 4O4HA 1BQ0A 2HKOA 1WP8A 4TQDA 4TWKA 1XL4A 4CBCA 4U7OA 4DV3B 5KHHA 1MG1A 1VQ9V 1AI7A 3OAAG 4O2AA 4TUYA 4GZRB 4EB6B 3M8AA 4K35A 3CMAV 2DMXA 1N0JA 5FNVA 2OT5A 3CD6V 3R65A 2ZIMA 1KKDA 2HG5C 4IYHA 1KBHA 5DEDA 2ODMA 1U96A 4RUFA 2WLLA 5LOVA 3JARB 1NTKH 2R9IA 4JI0B 3A0RA 1ZUQA 2EJ7A 3QO7A 5B1BC 3P3NA 2AGAA 4GX1A 4J7ZA 3BHPA 1NTZH 4DR7B 1E79G 3ABKC 3E83A 5LP6A 1QVGU 2XAHA 5EBMC 3D3IA 4RWUA 3CCRV 3AG4C 4LF8B 2Y4UA 1FXVA 2XAGA 4X64O 1ZSPA 4TOIA 3BCCH 5IYCO 4NXMB 2UUAO 3BPZA 1NTMH 4CS4A 1WLEA 1I94O 2GUZB 2B5UA 2HEPA 2KKWA 4E2LA 1PV0A 3CP1A 2G38A 2DYRC 4K8XA 2DWDC 4DV7B 2ZE6A 5IY5C 1OCRC 2BTOA 4LF6B 1Q6HA 2Q67A 1JA8A 4X9QA 3ZN1A 1JR9A 2IJJA 1EZJA 4P9OA 2P5OA 1R6NA 5JVDA 3O9OA 3OEHG 3IGAC 3CCSV 3IJ4A 3H01A 2Q68A 4FPPA 2H94A 2WA4A 4DR1B 3BRCA 4FLTA 5AG2A 3FAVB 1KB9F 2HFEC 2JJ1G 1H8HG 2H8PC 3CRAA 2H3OA 4WFBV 4WFGA 4JI2O 4I4TA 4MT8A 3ZHQA 4FLYA 4ZIBA 3KCXA 2MK3A 2XUMA 4J7KA 1J5EO 3OR7C 2VS0A 4DR6B 1GO3F 2ILMA 2FMLA 3JALA 4U3JB 3QTCA 3RBZA 2YICA 4LFAB 3C3TA 1G8MA 4EFEA 3OFNG 3T1YB 5J2TA 2E75B 2AW9A 1H38A 1VQ8V 1M57C 2ZXWC 1YHQV 1XHXA 1N33B 3ML0A 2NLJC 2QTSA 4DV4B 1YVWA 1D5NA 3C90A 1Y67A 3SJQC 2YDEA 1Q86W 3WB2A 3QNEA 5LMUB 1NBMG 4DV2B 3ETQA 2V7QG 3IFXA 3RYIA 4DYLA 3B4SA 5LXTA 3X2QB 3OEEG 4TSFG 2Y69B 3TXSA 3G6BA 2Q0AA 2QWPB 2DJVA 2DYSB 4O4JA 5EIBC 2CH7B 1BSMA 1AB3A 4EFBA 1VP7A 1GH6A 3N2GA 1M4UA 3ZIAG 4F6RA 1Z5WA 2EX3A 2Q7HA 1XMQB 2YIAA 4DW0A 4FFBB 4X62B 1E1RG 2VRZA 4H0LB 4R7CA 1IXBA 4DR3O 2DWEC 3B40A 3RGBA 1V54C 4X89A 2ZDIA 1KP3A 3Q4HB 3R66A 4JZGA 3OMIB 3AK3A 3ZMSA 1R6KA 1IX9A 1IXMA 3ETDA 4I5SA 1LNQA 4LNUA 1SC5B 2QM4A 1W0JG 5JH7B 2W0FC 2X6CA 5KX5A 3ZMTA 3D3QA 2CTPA 5H6RA 1LR1A 5EBWC 1PL4A 2KG7A 1L1FA 4H13B 3K3WA 5LHIA 2KQXA 4JF3A 5LHGA 1AP6A 2ADPA 2F4VB 2LFRA 4JYAB 3S3XA 3UO3A 5IWAO 1Z2GA 3OUFA 4X65B 4CH3A 5FLXN 2X0LA 1Y76B 1H2NA 1TA8A 4WBNA 2OCCB 3OD4A 1DGSA 3PN1A 4RO2A 4JV5O 1THZA 2WLJA 4YY3O 2DW4A 4Z1VA 5GTHZ 1IURA 2Z3YA 1WB8A 1Q5OA 2RN9A 4IGGA 2V4DA 2AHZA 3SPJA 3CRMA 4F6EA 4PV1B 5D5QA 1NVPB 2UXNA 3SPGA 1GM7A 4K0KO 3J81N 4PHZA 3OW2U 1HNZO 2XT9A 1N34B 4ZI7B 4PI2A 1PKXA 3OMAB 4CC6A 1B06A 2Q69A 1GN2A 1WA8B 1XI1A 3UT5B 2JGDB 1KD1W 5KUMA 4I55B 3ETEA 1HDJA 4LWSA 2YIBA 3HKBB 1AILA 4DUYO 1XNQB 1CP9A 3VQVA 3T2MA 1K9MW 2QM8A 1FJGB 3E22A 1SS3A 4UVCA 1XL6A 1Y74A 1YTFB 1FXHA 1NS1A 2UXCB 1NVPD 1YITV 2ZR2A 4FLUA 3CXHF 2HVJC 3SYOA 5IJ9B 2ZE8A 4MVMA 1WN7A 1SQFA 2EINB 2GDSA 2K1EA 3F7YC 1M56B 3D36C 2RQ6A 5CA1A 1LUWA 2EIMB 4DR5B 4YHHB 2Q4PA 1VQPV 1N0NA 4MW3A 3QO5A 2P90A 4CH6A 5DM6V 1N36B 2R9AA 1QLNA 4KL1A 4NTYA 3A2FA 1VQNV 2QTOA 4UB6Z 5D5PA 2F1MA 2HJDA 1SA0B 1MABG 5H2FZ 2BSKA 2GHYA 2VQEO 3SGIA 4AQYO 1JJOA 5A2QN 2HVKC 4MTXA 2MW2B 1HNXB 1L8DA 3CMEV 2YXYA 4XBFA 4IYIA 1F4NA 1SQVH 1PP9H 1YEWA 2LQTA 4R8CA 1PNLA 1F51A 1H8EG 2LW1A 1A32A 5CMUA 5IY5B 1SESA
chains in the Genus database with same CATH topology
3T4ZA 5LHHA 5LGTA 1ENVA 4MW8A 4X88A 1W0KG 1M9NA 2Q6AA 1OCZB 3K06A 1CPYA 3ZCCA 3CC7V 3AG2B 3AG3B 4OXSA 5EBLC 3ABTA 1BHBA 4I9WA 1W2BU 3K03A 1NQTA 4QNHB 1K5SA 1OZ0A 3BY6A 3F7VC 3LNMB 3IC7A 4FIPC 1Q81W 3CC2V 3MHHC 1BMFG 1AR1B 4P2ZA 2HKOA 3ETGA 4QPJA 3GWOA 1AJPA 3DGEA 4TWKA 1S5HC 2EILB 2QEXV 3B77A 4MVQA 1XL4A 1Q82W 4CBCA 4U7OA 4JYBA 3X2QC 1MG1A 1VQ9V 2IJIA 1AI7A 3OAAG 3ABLB 1F4MA 2Y69C 2YEVA 1QLEB 3JD0A 3CMAV 4UV8A 2DYSC 3FYIB 3E86A 2OT5A 3CD6V 3R65A 3LDEA 2ZR3A 4PDMA 3WG7C 2IJKA 4PA9A 1OCOB 1KKDA 2HG5C 3JD3A 3JD4A 1JQ0A 5FL7G 1JX9A 4FK5C 1GKFA 3LSSA 4RUFA 2ATKC 2WLLA 3EFFK 3SYQA 1NJIW 3OM3B 3GB7C 3MHSC 1RPOA 5B1AB 2R9IA 3A0RA 3E35A 1AROP 4J9YB 3ASNB 2JDIG 4R50A 1OCCC 3T1CA 3QO7A 5B1BC 1RPRA 4GX1A 2ZD9A 1PNMA 3FB7C 3P30A 1FS0G 3ZRVA 5B1NA 2ZXWB 3K0GA 3SPCA 3CCVV 1E79G 4LCUC 4YXWG 3ABKC 3E83A 3ABUA 3SPHA 2EZOA 2XAHA 5EBMC 3D3IA 1QVGU 1YJWV 3CCRV 1GMGA 1SZTA 3AG4C 4JTCB 2IU3A 3G71V 4XDJA 2XNDG 1KP2A 1FXVA 1VQ7V 3E8BA 2XAGA 2XOKG 5DN6G 1DTOA 5IYCO 3RW0A 5L3EA 1YJNV 3ASOB 3MD0A 1WLEA 2IH1C 1K97A 4X8AA 3HB3B 1S3JA 4PA7A 2B5UA 5IYDO 4E2LA 2JJ2G 1ORQC 2JK5C 2OCCC 3CP1A 1YJ9V 4UVBA 2DYRC 4U7NA 3RVYA 4Q20A 3K04A 2DWDC 3OMNB 5IY5C 1OCRC 1Y4MA 3I56V 1AJQA 2Q67A 2ITDC 4ASUG 1OCZC 1NR7A 4LBEC 3CCJV 1E1QG 3ZN1A 4QE9A 2IJJA 2QM7A 1EZJA 2WLIA 4QPKA 4P9OA 3OUSA 1R6NA 3OEHG 5KUKA 1COWG 3IGAC 5B3SC 3CCSV 1S77D 3K9AA 4BAYA 5L3FA 5H6QA 2JEUA 3H01A 2Q68A 4FPPA 1FXKB 3CYOA 2H94A 1JCHA 4N21A 1PL0A 1BL8A 3RVZA 1JVMA 4MSWC 4PDRA 2WWWA 3AEIA 2HFEC 4WFEA 2QA4V 4P30A 2JJ1G 4J9ZB 5H9CA 3E89A 1H8HG 1HWYA 2H8PC 4UUJC 5CBHA 3UKMA 4WFBV 4WFGA 4MT8A 2ZQMA 4GCZA 3E8HA 2Z5UA 4UV9A 2MK3A 1KECA 3G4SV 1FFTB 4PA6A 2A9HA 4RUEA 2EIJB 2WSSG 3OR7C 1GO3F 2DQ3A 2P7TC 1K5QA 3EHBB 4H37A 1RM1B 1EFRG 3B8NA 4QJFB 2B1IA 4ZBMA 3RBZA 1DF5A 2A0LA 1K4DC 1V55C 2W6IG 1G8MA 3HPLC 3SYCA 3CCLV 3OFNG 4WCEV 3W7XA 2AHYA 5L3BA 1N8RW 2QKSA 1H38A 3SYAA 1M57C 2ZXWC 4FMTA 1YHQV 1VQ8V 4MVUA 3ML0A 2BOBC 2NLJC 1P4RA 2EJRA 2UXXA 2WLMA 1ROPA 1R3LC 3SJQC 4BIUA 2EINC 1Q86W 4MS2A 1M56C 1KC8W 3QNEA 1NBMG 4WFAV 2EIMC 4PELA 1H2GA 3CCUV 4H33A 3ABMC 2GSMB 1QVFU 2V7QG 3IFXA 5IDJA 2DQ0A 3F5WC 3TK1A 3X2QB 3JD1A 3B8MA 4GT1A 2PI4A 3OEEG 4TSFG 1I5YA 2PI5A 2Y69B 2EIKB 1K33A 1QBZA 2DYSB 1K3EA 2C2AA 5BZBA 2A79B 4LC1A 1KQSU 1VQ5V 3P32A 3ZIAG 3WG7B 3ZRWA 5CBGA 2Y48A 5L3CA 4LP8A 1S0VA 2HR3A 1ZWIC 4TT3G 3ZRXA 3CXCU 4KFMA 1YI2V 4MTGA 4BIZA 4G27B 3SYPA 2JEXA 1E1RG 3JYCA 3WFVA 5LGNA 3FYEB 4R7CA 3PJSK 3E2EA 3W7WA 2DWEC 1FXKA 4GX2A 2XASA 1V54C 1Y66A 4JYCA 4X89A 1OCCB 2ZDIA 3K0DA 4JGSA 3K08A 5EC2C 1VQOV 1KP3A 2IW5A 3OMIB 5B1BB 2IJHA 1R6KA 4XDKA 3UM7A 3ZMSA 1IXMA 2XAJA 4JPRA 4XDLA 3BEHA 1G4YB 3ETDA 1LNQA 4I5SA 1NH2D 1VQMV 1W0JG 3ABKB 1MSWD 2W0FC 2X6CA 1JPXA 4PDLA 3ZMTA 1M1KW 5H6RA 5HFLA 5EBWC 1AJNA 3AG4B 1L1FA 2WPDG 1GM8A 3SPIA 3ZMZA 3K3WA 5LHIA 1DLBA 3AG2C 3AG3C 4HAMA 4RQFA 4G2KA 1B6QA 3TETA 3CCEV 1VQ4V 3VBBA 4JF3A 4WFFA 1QCEA 1YSCA 5LHGA 5KA5A 1K34A 3I55V 5LBQA 4MVOA 5B1OA 1TUEB 2LFRA 1I5XA 1VQKV 2P67A 2WLHA 1YTFD 3OUFA 3M99B 5J9PC 2B1GA 2X0LA 2EILC 4EKWA 3ZMUA 1BHAA 1SERA 2OCCB 1M90W 3ABLC 4RO2A 4BW5A 1CEZA 1QLEC 1AI5A 2DYRB 2IH3C 1MOFA 1THZA 1JJ2U 2WLJA 4JASA 2DW4A 3W7SA 5EK0A 1K8AW 3DTUB 1OCRB 1R3KC 4HYOA 4MTOA 4DXWA 2Z3YA 1OCOC 4UVAA 1GM9A 4WF9V 4UXNA 2KB1A 4Z1MG 5GW7A 1DF4A 4JAVA 4DO2A 4RQEA 2D3OW 2AHZA 3SPJA 4ZKIA 3CCMV 1K7DA 1P7BA 4PA4A 1K4CC 3ZRSA 3W7TA 1GTOA 1NVPB 2UXNA 5B1AC 3SPGA 1GM7A 3AG1B 3ASNC 5B3SB 3OW2U 3OGCC 1K92A 1EBOA 2EBOA 3TCUA 5C93A 2R9RB 1PKXA 3OMAB 2Q69A 3JCZA 1QR8A 4WFHA 2F43G 1J95A 2WLIB 3T4DA 2EIKC 3ZJZA 1PNKA 1NH2B 2LFSA 1KD1W 5KUMA 3OR6C 2NNUA 2X6BA 3ETEA 1F23A 5KA6A 2LP7A 1SRYA 3FKSG 2WAMA 1VQLV 2V1DA 2EZPA 3ASOC 4KUMA 1CP9A 4QIWF 5CA3A 3T2MA 1R73A 1K9MW 2QM8A 2HJFC 4N23A 1UJWB 3FB6C 2OTLV 1V55B 3K79A 3FB5C 1YIJV 3G6EV 4P9PA 1R3IC 1SETA 3D36A 3STLC 4UVCA 3CPWU 2QE7G 2M7WA 4QE7A 2IU0A 1XL6A 1YTFB 3FB8C 1S76D 4JTDB 1FXHA 1NVPD 1YITV 2ZR2A 1M57B 5EC1C 4F4LA 2X7RB 4G28B 1S72V 1Q7YW 2HVJC 4MVZA 3SYOA 2P6JA 4MVMA 1R3JC 2WLNA 2YEVB 3NXSA 2EINB 2K1EA 4RAIA 3F7YC 1M56B 4JTAB 2EIMB 3KG2A 5CBFA 3W7UA 1VQPV 4MVRA 3ABMB 4MW3A 2YSUB 3QO5A 2P90A 4MTFA 1NR1A 1WPXA 2WLLB 2X6AA 2XAQA 1VQ6V 5DM6V 2OTJV 1JOYA 4CZZA 1QLNA 5IYBO 4L87A 1FXKC 1NKDA 2ITCC 3LUTB 1QR9A 1AI4A 4PA3A 2ZDIC 1VQNV 2QTOA 5E1AC 3ZN0A 2WLKA 2JIZG 3E8GA 3LDDA 5L3DA 1MABG 2HLDG 3OE7G 3VOUA 2GHYA 4FJCC 3STZC 2XAFA 4MVSA 4GX5A 4PDVA 3QO8A 4R6ZA 2CK3G 3LDCA 2EIJC 4GX0A 2HVKC 1K73W 5L3GA 4MTXA 1V54B 5CN0A 2BOCC 4JAUA 3LSQA 1RM1C 1PD3A 2FTKA 3CMEV 1AI6A 4KP4A 4HZ3A 1F4NA 4XBFA 5LGUA 3CCQV 3ZMVA 3ZRWB 4R8CA 1GK9A 1OHHG 1F51A 1PNLA 1H8EG 3E8FA 5CMUA 5HFMA 3AG1C 5IY5B 2W6JG 3CC4V 3JD2A 1SESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q69 A;  3T4Z A;  2DYR C;  4WFH A;  3RVY A;  4MW8 A;  3K04 A;  2DWD C;  4X88 A;  2A79 B;  5BZB A;  2Q6A A;  1J95 A;  3K06 A;  2WLI B;  3T4D A;  5IY5 C;  1OCR C;  2EIK C;  3ZJZ A;  5CBG A;  4LP8 A;  4OXS A;  2Q67 A;  5EBL C;  5KUM A;  2ITD C;  1ZWI C;  3OR6 C;  4I9W A;  1OCZ C;  2X6B A;  4KFM A;  4LBE C;  4MTG A;  4G27 B;  3SYP A;  3K03 A;  3JYC A;  4QNH B;  4QE9 A;  4R7C A;  3PJS K;  2DWE C;  2WLI A;  3F7V C;  3LNM B;  4GX2 A;  4P9O A;  3ASO C;  1V54 C;  3OUS A;  4X89 A;  3T2M A;  5KUK A;  4P2Z A;  5EC2 C;  3IGA C;  3K0D A;  3K08 A;  5B3S C;  2HJF C;  4TWK A;  1S5H C;  3FB6 C;  4MVQ A;  4XDK A;  1XL4 A;  3FB5 C;  3UM7 A;  4CBC A;  4P9P A;  1R3I C;  3X2Q C;  3STL C;  4XDL A;  3BEH A;  1G4Y B;  1LNQ A;  2Q68 A;  4QE7 A;  1XL6 A;  2Y69 C;  2YEV A;  1BL8 A;  2W0F C;  2X6C A;  3FB8 C;  4PDL A;  1JVM A;  4JTD B;  4MSW C;  4PDR A;  3RVZ A;  2DYS C;  2HFE C;  3E86 A;  5EBW C;  3R65 A;  3LDE A;  4P30 A;  4WFE A;  4J9Z B;  5EC1 C;  4PDM A;  4F4L A;  3E89 A;  3SPI A;  2H8P C;  4G28 B;  3WG7 C;  4PA9 A;  1KKD A;  2HG5 C;  2HVJ C;  3AG2 C;  4MVZ A;  3AG3 C;  4UUJ C;  4WFG A;  3SYO A;  3UKM A;  4MVM A;  1R3J C;  2WLN A;  5CBH A;  3TET A;  4RUF A;  2ATK C;  2WLL A;  4WFF A;  2K1E A;  4RAI A;  3F7Y C;  3E8H A;  3EFF K;  3SYQ A;  4MVO A;  4PA6 A;  2A9H A;  4JTA B;  4RUE A;  3KG2 A;  5CBF A;  3GB7 C;  3OR7 C;  4MVR A;  2P7T C;  4H37 A;  4MW3 A;  4J9Y B;  2WLH A;  4R50 A;  3OUF A;  1OCC C;  3T1C A;  4MTF A;  5J9P C;  4ZBM A;  2X6A A;  2WLL B;  3RBZ A;  2A0L A;  1K4D C;  1V55 C;  2EIL C;  5B1B C;  4EKW A;  4GX1 A;  2ZD9 A;  3FB7 C;  3HPL C;  3SYC A;  3ABL C;  3K0G A;  3SPC A;  4RO2 A;  4BW5 A;  2ITC C;  3LUT B;  4LCU C;  1QLE C;  3ABK C;  3E83 A;  2IH3 C;  2AHY A;  4PA3 A;  2WLJ A;  3SPH A;  2QKS A;  2QTO A;  5E1A C;  5EBM C;  2WLK A;  5EK0 A;  1M57 C;  2ZXW C;  1R3K C;  3AG4 C;  4HYO A;  4MTO A;  4JTC B;  3SYA A;  4DXW A;  3E8G A;  3LDD A;  4MVU A;  1OCO C;  4XDJ A;  2BOB C;  2NLJ C;  3E8B A;  2KB1 A;  2WLM A;  1R3L C;  3STZ C;  3SJQ C;  2AHZ A;  2EIN C;  3SPJ A;  4MS2 A;  1M56 C;  4GX5 A;  4MVS A;  4PDV A;  1P7B A;  4PA4 A;  4R6Z A;  3RW0 A;  3LDC A;  1K4C C;  2EIJ C;  2EIM C;  3ZRS A;  4GX0 A;  2HVK C;  2IH1 C;  2BOC C;  4H33 A;  3ABM C;  5B1A C;  3SPG A;  3ASN C;  4HZ3 A;  3OGC C;  3IFX A;  4X8A A;  3TCU A;  4PA7 A;  4R8C A;  3F5W C;  2R9R B;  3E8F A;  1ORQ C;  2JK5 C;  2OCC C;  3AG1 C;  3VOU A; 
#chains in the Genus database with same CATH topology
 5LHH A;  3ZBH A;  4MW8 A;  4LF5 B;  4JI5 B;  4D7S A;  4I50 A;  4TV8 A;  3K58 A;  4B3R B;  3AG2 B;  3N2K B;  2YID A;  3H1K H;  3K03 A;  4QNH B;  2F95 B;  2RDC A;  1XMO B;  2OYQ A;  1OV9 A;  2A06 H;  3K5O A;  1AR1 B;  1NI8 A;  4QPJ A;  2GV9 A;  1AJP A;  2QEX V;  2EIL B;  3ZX6 A;  1Q82 W;  2PGG A;  4JYB A;  3X2Q C;  4CH5 A;  3CE2 A;  2Y69 C;  1QLE B;  2ZKO A;  4DUZ O;  2DYS C;  3FYI B;  3LDE A;  4EEQ A;  2L35 A;  2ZR3 A;  1UFI A;  1IBL B;  2IJK A;  3JD4 A;  1KU9 A;  1GKF A;  3S3W A;  1NJI W;  3OM3 B;  1SQG A;  1RPO A;  3JAS B;  3E35 A;  4J9Y B;  1IBM O;  3T1C A;  1XNR B;  1RPR A;  1XOU A;  3U10 A;  3P30 A;  5JCO C;  2ZXW B;  4LCU C;  4YXW G;  4UCV A;  4O4I B;  4NB5 A;  3TXQ A;  2PZS A;  4XDJ A;  1S5L Z;  5TIS Z;  1VQ7 V;  2QKC A;  2ZT9 B;  4NTW A;  1DTO A;  2NR5 A;  1BZK A;  2PUS A;  4JI1 B;  5L3E A;  4JI4 B;  3MD0 A;  3MAQ A;  4JI8 B;  4DRX A;  1VMG A;  1S3J A;  4X1Y B;  5IYD O;  1P7G A;  2JJ2 G;  1ZX3 A;  2JK5 C;  2OCC C;  4FZ1 A;  2AZ2 A;  4IHJ B;  1RSO B;  3B2E E;  4JI0 O;  4YJ2 B;  3K04 A;  3CRQ A;  1Y4M A;  3I56 V;  1AJQ A;  1VF7 A;  1S5J A;  2QDO A;  5FPO A;  2Y0I A;  3J80 N;  1R6T A;  2OWO A;  4DR7 O;  4QE9 A;  2QM7 A;  2CE4 A;  1WNS A;  4QPK A;  4EB6 A;  3OUS A;  4J7J A;  4X66 O;  5KUK A;  2FKX A;  5KHI A;  5B5E Z;  3CJH A;  2PTM A;  5JJN B;  5JWP A;  4BAY A;  5L3F A;  4NXM O;  5IT9 N;  1FXK B;  3ZHV A;  4N21 A;  3RVZ A;  4LFB O;  2WWW A;  4X20 B;  2QA4 V;  4DV5 B;  3JAR A;  3L72 H;  5BR8 O;  4DR4 B;  2LGQ A;  1HWY A;  1N32 O;  4KXR A;  2QSA A;  3G4S V;  1FFT B;  2EIJ B;  2KSD A;  3G80 A;  2DQ3 A;  2P7T C;  1K5Q A;  1RM1 B;  2Z0A A;  1TUB B;  3OTF A;  3HPL C;  3K5L A;  3CCL V;  1QQC A;  3VQW A;  3W7X A;  2AHY A;  1L0L H;  5DEC A;  4MVU A;  2BOB C;  2EJR A;  2CTR A;  4B3S B;  1RP3 B;  1P49 A;  2GUZ A;  5KMG B;  1ROP A;  4DR1 O;  2EIN C;  1NZ6 A;  4BWA A;  4MS2 A;  1M56 C;  2JVD A;  4WFA V;  1QNM A;  2EIM C;  5IJ0 B;  2UUC B;  2N74 A;  4H33 A;  2Q73 A;  5IDJ A;  1SQX H;  3DC5 A;  4YIO A;  4LFC B;  4GT1 A;  2PI4 A;  3RYH B;  1K33 A;  5LMN O;  1QBZ A;  4FFK A;  4DV1 O;  2BTQ A;  2QR4 A;  1VQ5 V;  4LFA O;  3ZRW A;  3UCS C;  4NR1 A;  3RYF A;  1S0V A;  3FX7 A;  4TT3 G;  4DR2 O;  4BIZ A;  4G27 B;  1TVK A;  3JYC A;  4LF7 O;  5LGN A;  1TAE A;  3FYE B;  3E2E A;  3W7W A;  4U3F H;  3EVK A;  4FM1 A;  1VIB A;  4JYC A;  2YXH A;  1OCC B;  3FAV A;  3K08 A;  3UM7 A;  4GKJ B;  4JPR A;  4XDL A;  1G4Y B;  4BW9 A;  1FD9 A;  4DV2 O;  1MSW D;  5HFL A;  1AJN A;  3N27 A;  2QWQ B;  3RYC B;  4LF9 B;  2WPD G;  1GM8 A;  3GWK C;  2L6L A;  3ZMZ A;  3AG2 C;  3HKE B;  4U3J A;  3VBB A;  1QCE A;  1MNG A;  4JI7 B;  2VQF B;  1BT8 A;  1HR0 O;  3BFR A;  1TUE B;  3UO2 A;  2Q7E A;  4I0X A;  2WLH A;  4ABM A;  4X62 O;  2EIL C;  1BHA A;  1SER A;  3AG7 A;  1VF6 C;  1Q6I A;  2Q8V A;  1CEZ A;  1QLE C;  1MOF A;  1K8A W;  3DTU B;  1R3K C;  4DXW A;  4HYO A;  2HHH O;  4UVA A;  1GM9 A;  1LUV A;  1RFY A;  2GTA A;  1DF4 A;  2D3O W;  4FVM A;  1K7D A;  2HP8 A;  5IE9 A;  3RN4 A;  3THO A;  3W7T A;  4LH6 A;  2CH7 A;  5B3S B;  1K92 A;  3TCU A;  5C93 A;  4NVP A;  3HR0 A;  2CAZ C;  5JJJ B;  4FFB A;  3HKD B;  4X65 O;  4IIJ B;  5LYJ B;  5CB4 B;  2EIK C;  4X64 B;  3JSL A;  2LFS A;  1ZL8 A;  2UUA B;  2DE0 X;  4I7Z B;  2LP7 A;  3ZHT A;  3KCY A;  3DSQ A;  4O2B A;  2EZP A;  5JH7 A;  1UPG A;  3HKC B;  2E76 B;  3FB5 C;  1YIJ V;  4P9P A;  2UXD B;  2M7W A;  5LL6 Y;  1IBK B;  2K9P A;  2UUB B;  4JI3 B;  2ZE7 A;  4G28 B;  1NT2 B;  1Q7Y W;  2N04 A;  1N34 O;  3WB0 A;  2P6J A;  1R3J C;  2WLN A;  2YEV B;  1M5I A;  2RNB A;  1Y76 A;  3AK1 A;  3BVO A;  3JAT B;  3ABM B;  2YSU B;  1NR1 A;  2XAQ A;  1VQ6 V;  4KHP O;  1BGY H;  1MZF A;  1JOY A;  2UXB O;  1FXK C;  3LUT B;  3RWR D;  1MMM A;  1QR9 A;  1IZ3 A;  1XNQ O;  4PA3 A;  3KKY A;  3ZN0 A;  2JIZ G;  1FJG O;  1FFX B;  4J80 A;  3H1L H;  4FJC C;  5IYZ B;  4MVS A;  2CK3 G;  2EIJ C;  4ZI7 A;  1K73 W;  3MDS A;  5CN0 A;  3EXA A;  4JAU A;  3LSQ A;  1RM1 C;  1PD3 A;  2OTJ V;  3CCQ V;  2E5L O;  1I0H A;  1WA8 A;  3H1I H;  2VWJ A;  1GK9 A;  3FD9 A;  3AG1 C;  4TV9 A;  2W6J G;  1G6U A;  1D2D A;  4YHH O;  1VEW A;  5LGT A;  4QGP A;  3K06 A;  3DXR B;  3CC7 V;  3AG3 B;  2ZM6 O;  3ABT A;  3A0B Z;  4I9W A;  1BHB A;  1B04 A;  1NQT A;  1K5S A;  4LNU B;  2P22 C;  3U0Z A;  3BY6 A;  4X1K B;  1Q81 W;  3MHH C;  1XHZ A;  1T5E A;  3GWO A;  2KG7 B;  4GKK B;  1S5H C;  3B77 A;  4UCU A;  4LR3 A;  3BA9 A;  2IJI A;  1BS3 A;  3JD0 A;  4NYK A;  5BY1 A;  4UV8 A;  1CXZ B;  3E86 A;  3ICX A;  3KZI Z;  1IVS A;  4B3M B;  3JD3 A;  3CX5 F;  1WB7 A;  2VWK A;  1JQ0 A;  2CDY A;  1JX9 A;  4DR3 B;  2AXT Z;  3LSS A;  1SQP H;  3EFF K;  3SYQ A;  3BAB A;  4LF5 O;  3GB7 C;  5JQG B;  4B3R O;  3ASN B;  2JDI G;  1EM1 A;  1OCC C;  4YJ3 A;  1HW7 A;  4O4L B;  1GRJ A;  1SA0 A;  2ZD9 A;  1PNM A;  3ZRV A;  3K0G A;  3SPC A;  4DV6 B;  3RT3 C;  4OX9 O;  3ABU A;  2XTA A;  3CSX A;  3SPH A;  1OJH A;  1JFF B;  1GMG A;  4PI0 A;  5EZY A;  2UU9 O;  3E8B A;  5GON B;  2E74 B;  5DN6 G;  4CS3 A;  3OTO B;  3L70 H;  3BAA A;  3RW0 A;  3IAY A;  1YJN V;  3SR2 C;  1IBL O;  3ZS8 C;  4ZOL B;  3HB3 B;  4JI6 O;  4YIP A;  4YY3 B;  4DK1 A;  2R70 A;  4UVB A;  4LWS B;  3RVY A;  4Q20 A;  3OMN B;  1ZLZ A;  2M6Y A;  4GLX A;  4JYY A;  3K9S A;  4ASU G;  1OCZ C;  3E22 B;  1NR7 A;  3CCJ V;  3TGU H;  3GVM A;  1F7Y A;  4K0K B;  1I08 A;  3C3S A;  2WLI A;  3JAK B;  4K8Z A;  1EN4 A;  5ITZ B;  5JJE B;  1Q6U A;  4NXN B;  1COW G;  5B3S C;  3CEI A;  4B7E A;  1S77 D;  3K9A A;  2P4K A;  5H6Q A;  2JEU A;  4JI1 O;  2BCC H;  1JCH A;  4UFZ A;  4JI4 O;  1BL8 A;  1US6 A;  1JVM A;  4MSW C;  4NTX A;  3VQX A;  5CA1 B;  4WFE A;  4LH7 A;  1G1X B;  4J9Z B;  3SJB C;  4LF4 O;  3E89 A;  5J2U A;  4UUJ C;  2F66 C;  4DK0 A;  4DUY B;  3E8H A;  4J42 A;  4W4K A;  4UV9 A;  2ETN A;  4RUE A;  2Y0P A;  1AP5 A;  2YIB D;  3T1H O;  3EHB B;  3APQ A;  3K59 A;  2YC0 A;  3B8N A;  4QJF B;  2IM9 A;  2B1I A;  4ZBM A;  2OIG A;  1DF5 A;  4O4I A;  2RJZ A;  4TQF A;  1AR5 A;  2W6I G;  3P3P A;  1U97 A;  2BSK B;  3SYC A;  4DV0 B;  2F93 B;  4WCE V;  4X1I B;  3I5D A;  5L3B A;  2QKS A;  3SYA A;  4FMT A;  3CS5 A;  3JSN A;  4UCS A;  1HNW B;  1P4R A;  1JMK C;  1ZTE A;  3TJT A;  5LA6 B;  4BIU A;  1DK1 A;  4PD4 F;  4X1Y A;  3OT7 A;  4DR4 O;  1L0N H;  4PEL A;  1H2G A;  2ARH A;  3CCU V;  3ABM C;  1IDS A;  1RSO A;  2GSM B;  4YJ2 A;  1QVF U;  3ZHS A;  4B3T O;  4I50 B;  2DQ0 A;  2Q7G A;  3F5W C;  3TK1 A;  3JAW B;  3B8M A;  2QKA A;  2EIK B;  1I7F A;  1K3E A;  1H2K A;  2IBZ H;  4DV3 O;  2A79 B;  1FAF A;  1KQS U;  2VQE B;  4FZ0 A;  3WG7 B;  3L73 H;  5CBG A;  2Y48 A;  5L3C A;  1SQQ H;  2DOS A;  1ZWI C;  3ZRX A;  3CXC U;  4KFM A;  4MTG A;  3SYP A;  3K5N A;  1FXK A;  4UCO A;  4J11 A;  4B08 A;  4JGS A;  4PJ0 Z;  4X20 A;  2IW5 A;  2JS3 A;  4IL6 Z;  4XDK A;  2XAJ A;  5BMV A;  4OGQ B;  3J7A U;  4GUN A;  1VQM V;  1NH2 D;  3CWB H;  2UUC O;  2CGO A;  2LJ2 A;  2Q9L A;  1MSD A;  3L74 H;  3CB2 A;  1DLB A;  3AG3 C;  4UCR A;  4G2K A;  1TUB A;  3TET A;  1P84 F;  1VQ4 V;  1FKA O;  4LF8 O;  1YSC A;  5KA5 A;  5GTI Z;  3QVN A;  1I5X A;  1SZX A;  1FPO A;  2ZNJ A;  1VQK V;  3RFR A;  2P67 A;  3M99 B;  3ZMU A;  4DUZ B;  2OCH A;  2EUL A;  4BW5 A;  4Q6G A;  5KMG A;  1AI5 A;  2IH3 C;  3H9V A;  1JJ2 U;  4JAS A;  4FLZ A;  5KAI Z;  4MTO A;  5IJ0 A;  4GKJ O;  5B66 Z;  4DRX B;  2NN4 A;  4DV7 O;  4ZHQ B;  4WF9 V;  2KB1 A;  4JAV A;  4DO2 A;  4LF6 O;  4W4L A;  1O9G A;  2QWR B;  3CCM V;  1VAR A;  4PA4 A;  3JAM N;  3RYH A;  2RMK B;  3ZRS A;  4LF9 O;  1GTO A;  2Q5Z A;  3AG1 B;  3ASN C;  2PYJ A;  2EBO A;  5EIB D;  1KYO F;  1N4C A;  2VQF O;  1SF9 A;  2D2C B;  5CA0 B;  2JS5 A;  1XBL A;  5C8Y B;  2F43 G;  4FLX A;  3ZJZ A;  2XHB A;  2CTQ A;  3D8C A;  5EYP B;  3OR6 C;  3CJH B;  1F23 A;  5KA6 A;  2WAM A;  2V1D A;  4KUM A;  1WAZ A;  3RYC A;  2OTL V;  2YI8 A;  4DR6 O;  1V55 B;  3K79 A;  5FPR A;  1SET A;  3D36 A;  3STL C;  3CPW U;  4HNA B;  4QE7 A;  2IU0 A;  3HKE A;  2GBO A;  1S76 D;  4O4H B;  5KHG A;  3ZHU A;  3K5M A;  3T1Y O;  2X7R B;  1S72 V;  5F2V O;  4MVZ A;  4O2A B;  4TUY B;  4X66 B;  5FNV B;  1N33 O;  4DV4 O;  3KG2 A;  5CBF A;  3W7U A;  1H2L A;  4MVR A;  5LMU O;  4MTF A;  1WPX A;  2WLL B;  2X6A A;  1Q43 A;  4LFB B;  5LOV B;  4L87 A;  2FL4 A;  5BR8 B;  2ITC C;  1N32 B;  1AI4 A;  5E1A C;  2DN9 A;  2N05 A;  2GTS A;  3LDD A;  5L3D A;  3VQY A;  2HLD G;  3OE7 G;  2UXD O;  2B9Z A;  3AK2 A;  3STZ C;  3H1J H;  2XAF A;  5LP6 B;  4GX5 A;  1IBK O;  1XMQ O;  4R6Z A;  2Q0O C;  1YCI A;  4GX0 A;  4NKG B;  2WA3 A;  4JI3 O;  5L3G A;  2UUB O;  2PYL A;  2BOC C;  5KHJ A;  2BTQ B;  4HZ3 A;  3HKD A;  5LGU A;  4IIJ A;  3ZRW B;  5LYJ A;  5CB4 A;  4FLW A;  3RYF B;  3E8F A;  3JD2 A;  1TVK B;  2LGW A;  3T4Z A;  3APO A;  1ENV A;  1OCZ B;  1X59 A;  4FLV A;  3ZCC A;  4OXS A;  4H44 B;  3DC6 A;  1W2B U;  3HKC A;  2JGU A;  1OZ0 A;  2QJ1 A;  4FIP C;  3CC2 V;  1BMF G;  1YXB A;  4P2Z A;  2F4V O;  1M93 A;  3ETG A;  3FFQ A;  3DGE A;  5LMN B;  3G67 A;  4MVQ A;  4JYA O;  4DV1 B;  3ABL B;  3U11 A;  1F4M A;  2YEV A;  5JVD B;  3IC9 A;  1QHT A;  4DR2 B;  4FM0 A;  3Q4H A;  4PDM A;  1BE3 H;  3WG7 C;  4AI8 A;  3JAT A;  4PA9 A;  1OCO B;  2Y4T A;  5K1X A;  4LF7 B;  4I0X B;  1PM9 A;  2A3Q A;  5FL7 G;  5JCO A;  1I94 B;  4FK5 C;  5KHK A;  2ATK C;  4UCT A;  3SJA C;  4BR6 A;  3K57 A;  1H2S B;  3MHS C;  4OPA A;  5B1A B;  1ARO P;  4UB8 Z;  4I4T B;  4R50 A;  1Q3E A;  1FFX A;  3FB7 C;  2O57 A;  1FS0 G;  5B1N A;  1EZV H;  3CCV V;  1YZB A;  2YXL A;  5IYZ A;  3JAL B;  2EZO A;  3CRC A;  1YJW V;  4GKK O;  1SZT A;  4JTC B;  2IU3 A;  3G71 V;  1EN6 A;  2XND G;  1KP2 A;  1HR0 B;  3NR7 A;  5J2T B;  2XOK G;  3ASO B;  1B3Q A;  2IH1 C;  4B3M O;  1K97 A;  4X8A A;  4PA7 A;  3CHX A;  3L71 H;  1ZL8 B;  1W59 A;  3DXR A;  4JI2 B;  5BXZ A;  1ORQ C;  1YJ9 V;  2HHH B;  4I9Q A;  4U7N A;  3RYI B;  1J5E B;  3ZED A;  5LXT B;  4O2B B;  4X1K A;  3JCU Z;  2ZIN A;  2UXC O;  2ITD C;  4LBE C;  4DV6 O;  4O4J B;  1E1Q G;  3N2G B;  4F6R B;  2ADQ B;  3UT5 A;  2JGD A;  4I55 A;  1GN3 A;  4DR5 O;  4L8J A;  3OTO O;  1GAX A;  3HKB A;  3CYO A;  3O65 A;  1XUQ A;  1PL0 A;  1N36 O;  1KKC A;  4PDR A;  4B7K A;  3AEI A;  4P30 A;  1XIL A;  5H9C A;  2CUG A;  1XDC A;  1BCC H;  5JQG A;  5CBH A;  3UKM A;  4D7T A;  2ZIO A;  2ZQM A;  2YI9 A;  5KX5 B;  1MA1 A;  4O4L A;  4GCZ A;  2Z5U A;  1KEC A;  4PA6 A;  2A9H A;  2WSS G;  2YS8 A;  2CTW A;  4H37 A;  1EFR G;  3M7M X;  5IJ9 A;  1JFF A;  3LNN A;  2A0L A;  1K4D C;  1V55 C;  1HNX O;  1QU7 A;  5GON A;  1WP7 A;  1N8R W;  2PF4 E;  4NXN O;  1SQB H;  2ZCE A;  5KLV H;  4WBN B;  4ZOL A;  3BA8 A;  2UXX A;  4JI5 O;  4Z2W A;  2WLM A;  1R3L C;  1VF5 B;  1KC8 W;  1WPB A;  2R72 A;  4TV9 B;  4KHP B;  2QWN B;  1WJZ A;  4HBN A;  2UXB B;  1XMO O;  4C7U A;  3A8T A;  3JD1 A;  4ICG A;  2FB5 A;  1I5Y A;  4E4E A;  2PI5 A;  2P06 A;  2C2A A;  5BZB A;  4LC1 A;  1GN6 A;  3P32 A;  3JAK A;  5A9G A;  5ITZ A;  1SKV A;  4LP8 A;  5IWA B;  2HR3 A;  4DV0 O;  1YI2 V;  1EN5 A;  2JEX A;  1V9P A;  3WFV A;  5LP6 C;  3PJS K;  2E5L B;  2PY5 A;  4GX2 A;  2XAS A;  4JV5 B;  1Y66 A;  2W0X A;  1HNW O;  5EC2 C;  3K0D A;  3WU2 Z;  1VQO V;  5B1B B;  3N2K A;  4BIO A;  2IJH A;  1AVM A;  3BEH A;  4DW1 A;  1XNR O;  3ABK B;  1JPX A;  4PDL A;  4D6T H;  1M1K W;  2A7W A;  2ZM6 B;  5E79 Z;  2QGN A;  3SDL A;  3AG4 B;  3SPI A;  2LO1 A;  4HAM A;  3B09 A;  4RQF A;  3L9D A;  4CC5 A;  1B6Q A;  4YJ3 B;  1Y74 B;  3CCE V;  1VF6 A;  4WFF A;  3L75 H;  1HNZ B;  1K34 A;  3I55 V;  5LBQ A;  4MVO A;  5B1O A;  4X1I A;  1R1B A;  3QF7 A;  1YTF D;  5J9P C;  2B1G A;  4J10 A;  4EKW A;  4OPH A;  4JI8 O;  5EZY B;  1M90 W;  2LW7 A;  3ABL C;  2DYR B;  3JAS A;  5LA6 A;  1O9H A;  2QWO B;  3W7S A;  5EK0 A;  1OCR B;  3QG5 A;  1PPJ H;  2RCV A;  1OCO C;  1AR4 A;  4UXN A;  4Z1M G;  5GW7 A;  4RQE A;  4ZKI A;  3JAW A;  1YDX A;  1P7B A;  2FYU H;  1K4C C;  2OIE A;  5H5N A;  5B1A C;  1HP8 A;  3OGC C;  1EBO A;  4OX9 B;  4FM2 A;  2R9R B;  2E3C A;  1YF2 A;  3JCZ A;  1QR8 A;  4WFH A;  3UQ8 A;  4CH4 A;  2UU9 B;  1J95 A;  2WLI B;  3T4D A;  1KMI Z;  1PNK A;  1X4T A;  1NH2 B;  4DV5 O;  2NNU A;  2X6B A;  4IHJ A;  1D5A A;  1SRY A;  2YUA A;  4K3A A;  3A0H Z;  3FKS G;  3ZHR A;  4TV8 B;  1VQL V;  3ASO C;  4QIW F;  4JI6 B;  5CA3 A;  2AZ0 A;  1H2M A;  1R73 A;  1GN4 A;  2HJF C;  4N23 A;  1UJW B;  3FB6 C;  3G6E V;  5J2U B;  1R3I C;  1ZAU A;  2QE7 G;  4AIL C;  3OGI B;  4IT5 A;  4AQY B;  3FB8 C;  4JTD B;  1XRE A;  1M57 B;  5EC1 C;  4F4L A;  1Q8I A;  4JAA A;  3NXS A;  4RAI A;  4AHC A;  4JTA B;  1XEQ A;  4B3S O;  1MZE A;  4A5U B;  4CZZ A;  5IYB O;  4ZHQ A;  1NKD A;  4LF4 B;  3SJC C;  1XQ8 A;  4LFC O;  2CGN A;  2ZDI C;  2F23 A;  1NU1 H;  2WLK A;  3E8G A;  5K1P A;  3T1H B;  1Y6X A;  4JZ2 A;  3F5T A;  4PDV A;  3QO8 A;  2JRI A;  3LDC A;  3CRR A;  5CA0 A;  1V54 B;  5C8Y A;  2FTK A;  2ZE5 A;  1AI6 A;  4KP4 A;  4CS2 A;  3ZMV A;  2BE3 A;  2ZNI A;  1OHH G;  3WB1 A;  1FYJ A;  4GYC B;  5HFM A;  5EYP A;  3VOU A;  2P4V A;  3CC4 V;  1URF A;  3H1H H;  4X88 A;  1W0K G;  1M9N A;  2Q6A A;  1CPY A;  5EBL C;  1IBM B;  5KAF Z;  1Z5V A;  3LSU A;  1BQZ A;  1KUQ A;  5BMV B;  4J41 A;  1TGO A;  4B3T B;  1Q90 D;  4HNA A;  3F7V C;  3LNM B;  3IC7 A;  4JI7 O;  4O4H A;  1BQ0 A;  2HKO A;  1WP8 A;  4TQD A;  4TWK A;  1XL4 A;  4CBC A;  4U7O A;  4DV3 B;  5KHH A;  1MG1 A;  1VQ9 V;  1AI7 A;  3OAA G;  4O2A A;  4TUY A;  4GZR B;  4EB6 B;  3M8A A;  4K35 A;  3CMA V;  2DMX A;  1N0J A;  5FNV A;  2OT5 A;  3CD6 V;  3R65 A;  2ZIM A;  1KKD A;  2HG5 C;  4IYH A;  1KBH A;  5DED A;  2ODM A;  1U96 A;  4RUF A;  2WLL A;  5LOV A;  3JAR B;  1NTK H;  2R9I A;  4JI0 B;  3A0R A;  1ZUQ A;  2EJ7 A;  3QO7 A;  5B1B C;  3P3N A;  2AGA A;  4GX1 A;  4J7Z A;  3BHP A;  1NTZ H;  4DR7 B;  1E79 G;  3ABK C;  3E83 A;  5LP6 A;  1QVG U;  2XAH A;  5EBM C;  3D3I A;  4RWU A;  3CCR V;  3AG4 C;  4LF8 B;  2Y4U A;  1FXV A;  2XAG A;  4X64 O;  1ZSP A;  4TOI A;  3BCC H;  5IYC O;  4NXM B;  2UUA O;  3BPZ A;  1NTM H;  4CS4 A;  1WLE A;  1I94 O;  2GUZ B;  2B5U A;  2HEP A;  2KKW A;  4E2L A;  1PV0 A;  3CP1 A;  2G38 A;  2DYR C;  4K8X A;  2DWD C;  4DV7 B;  2ZE6 A;  5IY5 C;  1OCR C;  2BTO A;  4LF6 B;  1Q6H A;  2Q67 A;  1JA8 A;  4X9Q A;  3ZN1 A;  1JR9 A;  2IJJ A;  1EZJ A;  4P9O A;  2P5O A;  1R6N A;  5JVD A;  3O9O A;  3OEH G;  3IGA C;  3CCS V;  3IJ4 A;  3H01 A;  2Q68 A;  4FPP A;  2H94 A;  2WA4 A;  4DR1 B;  3BRC A;  4FLT A;  5AG2 A;  3FAV B;  1KB9 F;  2HFE C;  2JJ1 G;  1H8H G;  2H8P C;  3CRA A;  2H3O A;  4WFB V;  4WFG A;  4JI2 O;  4I4T A;  4MT8 A;  3ZHQ A;  4FLY A;  4ZIB A;  3KCX A;  2MK3 A;  2XUM A;  4J7K A;  1J5E O;  3OR7 C;  2VS0 A;  4DR6 B;  1GO3 F;  2ILM A;  2FML A;  3JAL A;  4U3J B;  3QTC A;  3RBZ A;  2YIC A;  4LFA B;  3C3T A;  1G8M A;  4EFE A;  3OFN G;  3T1Y B;  5J2T A;  2E75 B;  2AW9 A;  1H38 A;  1VQ8 V;  1M57 C;  2ZXW C;  1YHQ V;  1XHX A;  1N33 B;  3ML0 A;  2NLJ C;  2QTS A;  4DV4 B;  1YVW A;  1D5N A;  3C90 A;  1Y67 A;  3SJQ C;  2YDE A;  1Q86 W;  3WB2 A;  3QNE A;  5LMU B;  1NBM G;  4DV2 B;  3ETQ A;  2V7Q G;  3IFX A;  3RYI A;  4DYL A;  3B4S A;  5LXT A;  3X2Q B;  3OEE G;  4TSF G;  2Y69 B;  3TXS A;  3G6B A;  2Q0A A;  2QWP B;  2DJV A;  2DYS B;  4O4J A;  5EIB C;  2CH7 B;  1BSM A;  1AB3 A;  4EFB A;  1VP7 A;  1GH6 A;  3N2G A;  1M4U A;  3ZIA G;  4F6R A;  1Z5W A;  2EX3 A;  2Q7H A;  1XMQ B;  2YIA A;  4DW0 A;  4FFB B;  4X62 B;  1E1R G;  2VRZ A;  4H0L B;  4R7C A;  1IXB A;  4DR3 O;  2DWE C;  3B40 A;  3RGB A;  1V54 C;  4X89 A;  2ZDI A;  1KP3 A;  3Q4H B;  3R66 A;  4JZG A;  3OMI B;  3AK3 A;  3ZMS A;  1R6K A;  1IX9 A;  1IXM A;  3ETD A;  4I5S A;  1LNQ A;  4LNU A;  1SC5 B;  2QM4 A;  1W0J G;  5JH7 B;  2W0F C;  2X6C A;  5KX5 A;  3ZMT A;  3D3Q A;  2CTP A;  5H6R A;  1LR1 A;  5EBW C;  1PL4 A;  2KG7 A;  1L1F A;  4H13 B;  3K3W A;  5LHI A;  2KQX A;  4JF3 A;  5LHG A;  1AP6 A;  2ADP A;  2F4V B;  2LFR A;  4JYA B;  3S3X A;  3UO3 A;  5IWA O;  1Z2G A;  3OUF A;  4X65 B;  4CH3 A;  5FLX N;  2X0L A;  1Y76 B;  1H2N A;  1TA8 A;  4WBN A;  2OCC B;  3OD4 A;  1DGS A;  3PN1 A;  4RO2 A;  4JV5 O;  1THZ A;  2WLJ A;  4YY3 O;  2DW4 A;  4Z1V A;  5GTH Z;  1IUR A;  2Z3Y A;  1WB8 A;  1Q5O A;  2RN9 A;  4IGG A;  2V4D A;  2AHZ A;  3SPJ A;  3CRM A;  4F6E A;  4PV1 B;  5D5Q A;  1NVP B;  2UXN A;  3SPG A;  1GM7 A;  4K0K O;  3J81 N;  4PHZ A;  3OW2 U;  1HNZ O;  2XT9 A;  1N34 B;  4ZI7 B;  4PI2 A;  1PKX A;  3OMA B;  4CC6 A;  1B06 A;  2Q69 A;  1GN2 A;  1WA8 B;  1XI1 A;  3UT5 B;  2JGD B;  1KD1 W;  5KUM A;  4I55 B;  3ETE A;  1HDJ A;  4LWS A;  2YIB A;  3HKB B;  1AIL A;  4DUY O;  1XNQ B;  1CP9 A;  3VQV A;  3T2M A;  1K9M W;  2QM8 A;  1FJG B;  3E22 A;  1SS3 A;  4UVC A;  1XL6 A;  1Y74 A;  1YTF B;  1FXH A;  1NS1 A;  2UXC B;  1NVP D;  1YIT V;  2ZR2 A;  4FLU A;  3CXH F;  2HVJ C;  3SYO A;  5IJ9 B;  2ZE8 A;  4MVM A;  1WN7 A;  1SQF A;  2EIN B;  2GDS A;  2K1E A;  3F7Y C;  1M56 B;  3D36 C;  2RQ6 A;  5CA1 A;  1LUW A;  2EIM B;  4DR5 B;  4YHH B;  2Q4P A;  1VQP V;  1N0N A;  4MW3 A;  3QO5 A;  2P90 A;  4CH6 A;  5DM6 V;  1N36 B;  2R9A A;  1QLN A;  4KL1 A;  4NTY A;  3A2F A;  1VQN V;  2QTO A;  4UB6 Z;  5D5P A;  2F1M A;  2HJD A;  1SA0 B;  1MAB G;  5H2F Z;  2BSK A;  2GHY A;  2VQE O;  3SGI A;  4AQY O;  1JJO A;  5A2Q N;  2HVK C;  4MTX A;  2MW2 B;  1HNX B;  1L8D A;  3CME V;  2YXY A;  4XBF A;  4IYI A;  1F4N A;  1SQV H;  1PP9 H;  1YEW A;  2LQT A;  4R8C A;  1PNL A;  1F51 A;  1H8E G;  2LW1 A;  1A32 A;  5CMU A;  5IY5 B;  1SES A; 
#chains in the Genus database with same CATH homology
 3T4Z A;  5LHH A;  5LGT A;  1ENV A;  4MW8 A;  4X88 A;  1W0K G;  1M9N A;  2Q6A A;  1OCZ B;  3K06 A;  1CPY A;  3ZCC A;  3CC7 V;  3AG2 B;  3AG3 B;  4OXS A;  5EBL C;  3ABT A;  1BHB A;  4I9W A;  1W2B U;  3K03 A;  1NQT A;  4QNH B;  1K5S A;  1OZ0 A;  3BY6 A;  3F7V C;  3LNM B;  3IC7 A;  4FIP C;  1Q81 W;  3CC2 V;  3MHH C;  1BMF G;  1AR1 B;  4P2Z A;  2HKO A;  3ETG A;  4QPJ A;  3GWO A;  1AJP A;  3DGE A;  4TWK A;  1S5H C;  2EIL B;  2QEX V;  3B77 A;  4MVQ A;  1XL4 A;  1Q82 W;  4CBC A;  4U7O A;  4JYB A;  3X2Q C;  1MG1 A;  1VQ9 V;  2IJI A;  1AI7 A;  3OAA G;  3ABL B;  1F4M A;  2Y69 C;  2YEV A;  1QLE B;  3JD0 A;  3CMA V;  4UV8 A;  2DYS C;  3FYI B;  3E86 A;  2OT5 A;  3CD6 V;  3R65 A;  3LDE A;  2ZR3 A;  4PDM A;  3WG7 C;  2IJK A;  4PA9 A;  1OCO B;  1KKD A;  2HG5 C;  3JD3 A;  3JD4 A;  1JQ0 A;  5FL7 G;  1JX9 A;  4FK5 C;  1GKF A;  3LSS A;  4RUF A;  2ATK C;  2WLL A;  3EFF K;  3SYQ A;  1NJI W;  3OM3 B;  3GB7 C;  3MHS C;  1RPO A;  5B1A B;  2R9I A;  3A0R A;  3E35 A;  1ARO P;  4J9Y B;  3ASN B;  2JDI G;  4R50 A;  1OCC C;  3T1C A;  3QO7 A;  5B1B C;  1RPR A;  4GX1 A;  2ZD9 A;  1PNM A;  3FB7 C;  3P30 A;  1FS0 G;  3ZRV A;  5B1N A;  2ZXW B;  3K0G A;  3SPC A;  3CCV V;  1E79 G;  4LCU C;  4YXW G;  3ABK C;  3E83 A;  3ABU A;  3SPH A;  2EZO A;  2XAH A;  5EBM C;  3D3I A;  1QVG U;  1YJW V;  3CCR V;  1GMG A;  1SZT A;  3AG4 C;  4JTC B;  2IU3 A;  3G71 V;  4XDJ A;  2XND G;  1KP2 A;  1FXV A;  1VQ7 V;  3E8B A;  2XAG A;  2XOK G;  5DN6 G;  1DTO A;  5IYC O;  3RW0 A;  5L3E A;  1YJN V;  3ASO B;  3MD0 A;  1WLE A;  2IH1 C;  1K97 A;  4X8A A;  3HB3 B;  1S3J A;  4PA7 A;  2B5U A;  5IYD O;  4E2L A;  2JJ2 G;  1ORQ C;  2JK5 C;  2OCC C;  3CP1 A;  1YJ9 V;  4UVB A;  2DYR C;  4U7N A;  3RVY A;  4Q20 A;  3K04 A;  2DWD C;  3OMN B;  5IY5 C;  1OCR C;  1Y4M A;  3I56 V;  1AJQ A;  2Q67 A;  2ITD C;  4ASU G;  1OCZ C;  1NR7 A;  4LBE C;  3CCJ V;  1E1Q G;  3ZN1 A;  4QE9 A;  2IJJ A;  2QM7 A;  1EZJ A;  2WLI A;  4QPK A;  4P9O A;  3OUS A;  1R6N A;  3OEH G;  5KUK A;  1COW G;  3IGA C;  5B3S C;  3CCS V;  1S77 D;  3K9A A;  4BAY A;  5L3F A;  5H6Q A;  2JEU A;  3H01 A;  2Q68 A;  4FPP A;  1FXK B;  3CYO A;  2H94 A;  1JCH A;  4N21 A;  1PL0 A;  1BL8 A;  3RVZ A;  1JVM A;  4MSW C;  4PDR A;  2WWW A;  3AEI A;  2HFE C;  4WFE A;  2QA4 V;  4P30 A;  2JJ1 G;  4J9Z B;  5H9C A;  3E89 A;  1H8H G;  1HWY A;  2H8P C;  4UUJ C;  5CBH A;  3UKM A;  4WFB V;  4WFG A;  4MT8 A;  2ZQM A;  4GCZ A;  3E8H A;  2Z5U A;  4UV9 A;  2MK3 A;  1KEC A;  3G4S V;  1FFT B;  4PA6 A;  2A9H A;  4RUE A;  2EIJ B;  2WSS G;  3OR7 C;  1GO3 F;  2DQ3 A;  2P7T C;  1K5Q A;  3EHB B;  4H37 A;  1RM1 B;  1EFR G;  3B8N A;  4QJF B;  2B1I A;  4ZBM A;  3RBZ A;  1DF5 A;  2A0L A;  1K4D C;  1V55 C;  2W6I G;  1G8M A;  3HPL C;  3SYC A;  3CCL V;  3OFN G;  4WCE V;  3W7X A;  2AHY A;  5L3B A;  1N8R W;  2QKS A;  1H38 A;  3SYA A;  1M57 C;  2ZXW C;  4FMT A;  1YHQ V;  1VQ8 V;  4MVU A;  3ML0 A;  2BOB C;  2NLJ C;  1P4R A;  2EJR A;  2UXX A;  2WLM A;  1ROP A;  1R3L C;  3SJQ C;  4BIU A;  2EIN C;  1Q86 W;  4MS2 A;  1M56 C;  1KC8 W;  3QNE A;  1NBM G;  4WFA V;  2EIM C;  4PEL A;  1H2G A;  3CCU V;  4H33 A;  3ABM C;  2GSM B;  1QVF U;  2V7Q G;  3IFX A;  5IDJ A;  2DQ0 A;  3F5W C;  3TK1 A;  3X2Q B;  3JD1 A;  3B8M A;  4GT1 A;  2PI4 A;  3OEE G;  4TSF G;  1I5Y A;  2PI5 A;  2Y69 B;  2EIK B;  1K33 A;  1QBZ A;  2DYS B;  1K3E A;  2C2A A;  5BZB A;  2A79 B;  4LC1 A;  1KQS U;  1VQ5 V;  3P32 A;  3ZIA G;  3WG7 B;  3ZRW A;  5CBG A;  2Y48 A;  5L3C A;  4LP8 A;  1S0V A;  2HR3 A;  1ZWI C;  4TT3 G;  3ZRX A;  3CXC U;  4KFM A;  1YI2 V;  4MTG A;  4BIZ A;  4G27 B;  3SYP A;  2JEX A;  1E1R G;  3JYC A;  3WFV A;  5LGN A;  3FYE B;  4R7C A;  3PJS K;  3E2E A;  3W7W A;  2DWE C;  1FXK A;  4GX2 A;  2XAS A;  1V54 C;  1Y66 A;  4JYC A;  4X89 A;  1OCC B;  2ZDI A;  3K0D A;  4JGS A;  3K08 A;  5EC2 C;  1VQO V;  1KP3 A;  2IW5 A;  3OMI B;  5B1B B;  2IJH A;  1R6K A;  4XDK A;  3UM7 A;  3ZMS A;  1IXM A;  2XAJ A;  4JPR A;  4XDL A;  3BEH A;  1G4Y B;  3ETD A;  1LNQ A;  4I5S A;  1NH2 D;  1VQM V;  1W0J G;  3ABK B;  1MSW D;  2W0F C;  2X6C A;  1JPX A;  4PDL A;  3ZMT A;  1M1K W;  5H6R A;  5HFL A;  5EBW C;  1AJN A;  3AG4 B;  1L1F A;  2WPD G;  1GM8 A;  3SPI A;  3ZMZ A;  3K3W A;  5LHI A;  1DLB A;  3AG2 C;  3AG3 C;  4HAM A;  4RQF A;  4G2K A;  1B6Q A;  3TET A;  3CCE V;  1VQ4 V;  3VBB A;  4JF3 A;  4WFF A;  1QCE A;  1YSC A;  5LHG A;  5KA5 A;  1K34 A;  3I55 V;  5LBQ A;  4MVO A;  5B1O A;  1TUE B;  2LFR A;  1I5X A;  1VQK V;  2P67 A;  2WLH A;  1YTF D;  3OUF A;  3M99 B;  5J9P C;  2B1G A;  2X0L A;  2EIL C;  4EKW A;  3ZMU A;  1BHA A;  1SER A;  2OCC B;  1M90 W;  3ABL C;  4RO2 A;  4BW5 A;  1CEZ A;  1QLE C;  1AI5 A;  2DYR B;  2IH3 C;  1MOF A;  1THZ A;  1JJ2 U;  2WLJ A;  4JAS A;  2DW4 A;  3W7S A;  5EK0 A;  1K8A W;  3DTU B;  1OCR B;  1R3K C;  4HYO A;  4MTO A;  4DXW A;  2Z3Y A;  1OCO C;  4UVA A;  1GM9 A;  4WF9 V;  4UXN A;  2KB1 A;  4Z1M G;  5GW7 A;  1DF4 A;  4JAV A;  4DO2 A;  4RQE A;  2D3O W;  2AHZ A;  3SPJ A;  4ZKI A;  3CCM V;  1K7D A;  1P7B A;  4PA4 A;  1K4C C;  3ZRS A;  3W7T A;  1GTO A;  1NVP B;  2UXN A;  5B1A C;  3SPG A;  1GM7 A;  3AG1 B;  3ASN C;  5B3S B;  3OW2 U;  3OGC C;  1K92 A;  1EBO A;  2EBO A;  3TCU A;  5C93 A;  2R9R B;  1PKX A;  3OMA B;  2Q69 A;  3JCZ A;  1QR8 A;  4WFH A;  2F43 G;  1J95 A;  2WLI B;  3T4D A;  2EIK C;  3ZJZ A;  1PNK A;  1NH2 B;  2LFS A;  1KD1 W;  5KUM A;  3OR6 C;  2NNU A;  2X6B A;  3ETE A;  1F23 A;  5KA6 A;  2LP7 A;  1SRY A;  3FKS G;  2WAM A;  1VQL V;  2V1D A;  2EZP A;  3ASO C;  4KUM A;  1CP9 A;  4QIW F;  5CA3 A;  3T2M A;  1R73 A;  1K9M W;  2QM8 A;  2HJF C;  4N23 A;  1UJW B;  3FB6 C;  2OTL V;  1V55 B;  3K79 A;  3FB5 C;  1YIJ V;  3G6E V;  4P9P A;  1R3I C;  1SET A;  3D36 A;  3STL C;  4UVC A;  3CPW U;  2QE7 G;  2M7W A;  4QE7 A;  2IU0 A;  1XL6 A;  1YTF B;  3FB8 C;  1S76 D;  4JTD B;  1FXH A;  1NVP D;  1YIT V;  2ZR2 A;  1M57 B;  5EC1 C;  4F4L A;  2X7R B;  4G28 B;  1S72 V;  1Q7Y W;  2HVJ C;  4MVZ A;  3SYO A;  2P6J A;  4MVM A;  1R3J C;  2WLN A;  2YEV B;  3NXS A;  2EIN B;  2K1E A;  4RAI A;  3F7Y C;  1M56 B;  4JTA B;  2EIM B;  3KG2 A;  5CBF A;  3W7U A;  1VQP V;  4MVR A;  3ABM B;  4MW3 A;  2YSU B;  3QO5 A;  2P90 A;  4MTF A;  1NR1 A;  1WPX A;  2WLL B;  2X6A A;  2XAQ A;  1VQ6 V;  5DM6 V;  2OTJ V;  1JOY A;  4CZZ A;  1QLN A;  5IYB O;  4L87 A;  1FXK C;  1NKD A;  2ITC C;  3LUT B;  1QR9 A;  1AI4 A;  4PA3 A;  2ZDI C;  1VQN V;  2QTO A;  5E1A C;  3ZN0 A;  2WLK A;  2JIZ G;  3E8G A;  3LDD A;  5L3D A;  1MAB G;  2HLD G;  3OE7 G;  3VOU A;  2GHY A;  4FJC C;  3STZ C;  2XAF A;  4MVS A;  4GX5 A;  4PDV A;  3QO8 A;  4R6Z A;  2CK3 G;  3LDC A;  2EIJ C;  4GX0 A;  2HVK C;  1K73 W;  5L3G A;  4MTX A;  1V54 B;  5CN0 A;  2BOC C;  4JAU A;  3LSQ A;  1RM1 C;  1PD3 A;  2FTK A;  3CME V;  1AI6 A;  4KP4 A;  4HZ3 A;  1F4N A;  4XBF A;  5LGU A;  3CCQ V;  3ZMV A;  3ZRW B;  4R8C A;  1GK9 A;  1OHH G;  1F51 A;  1PNL A;  1H8E G;  3E8F A;  5CMU A;  5HFM A;  3AG1 C;  5IY5 B;  2W6J G;  3CC4 V;  3JD2 A;  1SES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...