1K4DC

Potassium channel kcsa-fab complex in low concentration of k+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Chemistry of ion coordination and hydration revealed by a K+ channel-Fab complex at 2.0 A resolution.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k4dC00
4PDRA 1V54C 3T4DA 2HVKC 3IFXA 4MVRA 1OCOC 2NLJC 2WLMA 4GX1A 4MW8A 2WLJA 4BW5A 2OCCC 4TWKA 4CBCA 4GX2A 4GX0A 5B1BC 4F4LA 3LDCA 3LDDA 4MW3A 4PDLA 4MVQA 5EBWC 5CBFA 4UUJC 2EIKC 2WLLA 4OXSA 4WFFA 2H8PC 2ZXWC 3WG7C 4PDVA 3SYCA 1P7BA 2EIJC 3OR6C 3F5WC 3ABMC 4WFGA 2EILC 1ZWIC 2WLHA 1R3JC 3SYOA 2X6AA 1K4DC 3OGCC 4MSWC 3SPIA 3SYQA 4PDMA 3FB6C 3UM7A 3TETA 2W0FC 3KG2A 4J9YB 4JTAB 1R3IC 4H37A 2DWDC 3AG3C 3LDEA 3K0DA 4XDLA 2HFEC 2A9HA 3SYAA 5EC1C 3OR7C 3E83A 4R6ZA 2WLLB 1J95A 2Y69C 3RBZA 1LNQA 4R8CA 2IH1C 5B3SC 2QTOA 3AG2C 4QNHB 3E8BA 5J9PC 2YEVA 5BZBA 3GB7C 3SPHA 3EFFK 3ZRSA 1KKDA 4X89A 3STLC 2JK5C 4RAIA 4P9PA 5KUKA 3SJQC 4G28B 5KUMA 5EK0A 3BEHA 3SPJA 4J9ZB 2Q6AA 4PA3A 3AG1C 3E8GA 3E89A 4PA4A 4QE7A 3K03A 3K08A 3LNMB 1S5HC 3SYPA 3ABKC 5CBHA 2QKSA 4LP8A 3RW0A 5IY5C 3TCUA 4EKWA 3RVYA 2EINC 4PA7A 1M57C 1OCZC 2Q69A 4MTOA 3T2MA 1R3KC 2Q68A 2WLKA 4QE9A 3PJSK 3FB7C 4G27B 2AHYA 2EIMC 3E8HA 2X6BA 4LBEC 4RO2A 1XL4A 3SPCA 2A0LA 2X6CA 5EBMC 5EBLC 3HPLC 4R50A 3K04A 4ZBMA 3F7VC 4I9WA 2WLIB 2WLNA 4LCUC 4XDJA 4KFMA 4PA6A 1R3LC 3AG4C 3OUSA 3SPGA 2DWEC 4MVOA 5CBGA 2HJFC 4RUFA 2BOCC 3VOUA 2WLIA 2KB1A 2DYSC 4MVUA 2K1EA 4P30A 4WFHA 4RUEA 1ORQC 2HG5C 4R7CA 2ITDC 3E86A 3FB8C 4HYOA 2R9RB 1K4CC 2ITCC 4PA9A 4GX5A 1OCRC 2Q67A 2IH3C 2BOBC 3F7YC 3FB5C 4MVMA 2P7TC 1M56C 4MTGA 3T4ZA 4MTFA 2ZD9A 4JTDB 4MVZA 4XDKA 3K06A 3RVZA 3ZJZA 4HZ3A 4P2ZA 4DXWA 1XL6A 1G4YB 1OCCC 1QLEC 2AHZA 2DYRC 3ASOC 3E8FA 3K0GA 3LUTB 4JTCB 3X2QC 1JVMA 3ABLC 2HVJC 4H33A 3R65A 3IGAC 1BL8A 4X8AA 4P9OA 4WFEA 4MVSA 5E1AC 3OUFA 2A79B 2ATKC 4MS2A 1V55C 3ASNC 3JYCA 5B1AC 5EC2C 3T1CA 4X88A 3UKMA 3STZC
chains in the Genus database with same CATH superfamily
3WB2A 1IBMO 2HVKC 5L3CA 1TUBA 4LH7A 1XNQO 2XAGA 2B5UA 5E79Z 5H9CA 1FPOA 4ICGA 2L35A 2PY5A 3OTOO 1R3IC 4IHJB 1RSOB 1L8DA 3AEIA 3E83A 2Y69C 1AJNA 3ZBHA 4K3AA 3EXAA 2OTJV 1IXMA 4DR5B 5J2UB 1O9GA 3ZRSA 3HKCA 2B1IA 1SQVH 3A0RA 3SJQC 5JH7A 4PA3A 3ZIAG 4PD4F 2UXDO 4PA4A 2Q7HA 1ZX3A 1URFA 4YJ3B 1S3JA 4JV5O 5CBHA 2FKXA 1R1BA 1N32B 4UV9A 1RP3B 3RW0A 3AG7A 3FAVA 2F95B 1Q86W 1HDJA 3T2MA 1R3KC 1LR1A 2HJDA 3JD0A 2CH7A 4ZOLB 3WB0A 4WFAV 4LF4O 2QJ1A 4PV1B 4B7KA 1QBZA 1T5EA 3HKBA 2XHBA 1NTKH 2L6LA 3DXRB 5LMUB 4R7CA 2LP7A 3B09A 1ZL8B 1Y74A 3F7YC 1EBOA 2H94A 3VQXA 3H1IH 2ZXWB 2PZSA 1Y6XA 5EYPA 3HR0A 4TV8B 2OIEA 5ITZA 3W7SA 1JJ2U 2WPDG 3F5TA 2XAHA 4I50A 2ZNJA 2ATKC 5K1PA 3BA9A 2JGDB 1SQQH 4TV9A 5B3SB 3MAQA 4TWKA 3M8AA 4FJCC 4PI0A 1WP8A 1PNKA 2ILMA 1GN6A 2Q8VA 3C3TA 4WFFA 4BIOA 5A2QN 2N04A 4X1IB 4MSWC 2QGNA 3ABTA 3SGIA 3T1HB 1NJIW 3ETEA 1KD1W 1L0LH 1GKFA 4QIWF 4CH3A 3HKCB 3K0DA 3D8CA 4FLTA 1GTOA 2PGGA 3H1LH 1VQKV 1FD9A 4DV3B 1OJHA 4QPJA 3A8TA 1TUEB 1NBMG 5JQGB 2PF4E 2YXYA 4P9PA 4TT3G 4C7UA 2JS3A 3OEHG 2YI9A 3JALA 1PD3A 4DR4B 1YTFD 1YHQV 1IDSA 3ABKC 4D7TA 1R6NA 1NU1H 2VS0A 3JATB 2GSMB 3CS5A 3CC4V 2Q69A 4BW9A 4AHCA 4DR3O 2GTSA 4LBEC 2ZCEA 4IL6Z 1Q8IA 2M7WA 4YJ2A 3N2KA 1XILA 4FM2A 1EFRG 4JYYA 4NYKA 4JYAO 5DEDA 4BWAA 1D5NA 3OGIB 3QO7A 3B2EE 2WLIA 4DK0A 1XMOB 1SKVA 1QR9A 3D36A 1OCRC 3TGUH 5L3DA 1RM1B 1H2SB 2EILB 2Y0IA 1N4CA 3RYHA 4P9OA 4JI7O 2P4KA 4B3MB 2CGNA 4KXRA 4B3SO 3JYCA 1OHHG 1KMIZ 4LF5O 4GX1A 5H2FZ 4I9QA 3H1JH 1PNMA 1AB3A 1H8HG 2BSKA 3B8NA 3WG7C 3N2GA 5FPRA 3OMAB 2QA4V 4O4IB 1V9PA 3IAYA 1PKXA 2Z0AA 4GYCB 4H44B 4TUYB 3P30A 2JJ1G 1SC5B 5L3GA 2ZQMA 4XDLA 2PTMA 1M57B 5GONB 4DO2A 4LF6B 4TOIA 1VQ7V 4BIZA 4X9QA 1XNRB 4X89A 2JK5C 1IX9A 1VF6A 3SPJA 3RT3C 3AG1C 2AW9A 4X1YA 1BE3H 1N0NA 2QWQB 2EULA 1BGYH 5IY5C 2OCHA 1FAFA 4YJ2B 1S5LZ 2A7WA 2IW5A 2Q0AA 1WPBA 2CAZC 3JAKA 1XI1A 1W0JG 2A06H 1WAZA 4DV5O 3BFRA 2ZE6A 2WLIB 4LCUC 3ABLB 3TJTA 2O57A 4CS2A 3CCUV 4GCZA 3SPGA 1VF7A 4RWUA 2LQTA 4RUFA 3UO3A 4J42A 1WB7A 4DR1B 1DTOA 3NR7A 1ZLZA 1PL0A 5KHIA 2QSAA 1N36B 4UXNA 2F43G 3LSSA 1NVPB 3RYIA 2JGUA 1EZJA 1OCCC 3ASOC 4FFBB 1CEZA 1JVMA 4O4JB 4X8AA 3OD4A 1QU7A 4EB6A 3CCJV 2BSKB 3VQYA 1AR1B 2YIAA 2B1GA 3ABUA 2Y69B 4O2BA 1V54C 2GBOA 4MW8A 1OCOC 4OGQB 4DV2O 1HNZB 1UPGA 3G67A 4PDLA 3A2FA 1AJQA 3WB1A 4O4LA 2ZM6O 4UUJC 1PV0A 2WLLA 2H8PC 1IBKO 3CCMV 1ZWIC 4JI8B 1L1FA 1MZFA 3CCLV 4ASUG 2DWDC 1Q82W 4FIPC 1LNQA 4LF8B 3JARB 1MMMA 2IH1C 2XAJA 1SA0B 3FFQA 4X1YB 5CB4B 1K7DA 2YEVA 5C8YB 5KHHA 1AILA 4LWSA 4N23A 2Q73A 3STLC 2XASA 3NXSA 1I08A 1B06A 3E8GA 2RCVA 4LFBB 4DRXB 3OTFA 3JAKB 1M9NA 5LMNB 2ZT9B 5EZYA 2EINC 3I56V 3GWOA 2UUCB 1F4NA 2CUGA 4G27B 2EIMC 2HHHB 1AR4A 2KSDA 4KL1A 2QM4A 2A0LA 4EFEA 2ARHA 4YY3O 2VQFB 1PM9A 1GK9A 3F7VC 4LR3A 1P49A 2JVDA 4QJFB 1M5IA 1K9MW 1Q81W 1GM9A 3KCXA 2UUBO 3RWRD 4UCRA 4RUEA 5IJ0A 3G6BA 5IE9A 3U11A 3G6EV 1IBLO 5BMVA 1SQPH 2YDEA 2YICA 2QWPB 1NH2D 2ZINA 4GT1A 3QO5A 4O2BB 3W7XA 4HNAA 3JAMN 1Y67A 1VQLV 2QKCA 2QR4A 2YXHA 3J7AU 1UFIA 4X88A 2LW7A 4X65B 4PDRA 5B5EZ 2WLMA 4BW5A 5LXTB 2OT5A 2UU9B 2ZIOA 1NQTA 4GKKB 3CCRV 1VIBA 3F5WC 4FLYA 1AI6A 1JFFB 3ZRWB 5L3BA 3ABKB 2QWRB 1WLEA 3ZMUA 2A3QA 1CPYA 2HFEC 3T1YO 2UUAB 4B7EA 2ZE5A 1QLNA 1GN4A 2Y0PA 4OX9B 3GB7C 3BVOA 2GDSA 2FMLA 5CA0B 3H9VA 5KUMA 4GKJO 3BY6A 5LA6A 2IU0A 2OTLV 2LO1A 3A0BZ 4DR2O 5HFLA 2Z5UA 2P6JA 1HNXO 4NXNO 1NZ6A 2UXNA 3UT5A 3OTOB 1VQ8V 4JI2B 1US6A 2LJ2A 1OCRB 4TQFA 2EZOA 3JD2A 4CH6A 4U3JA 4Q6GA 1GN3A 4U3FH 4TSFG 1F4MA 2UXDB 4JZGA 1BMFG 1Q3EA 4F6EA 2K1EA 3SJCC 2QEXV 3OMIB 1SRYA 4PA9A 1YZBA 2Q4PA 4HNAB 3K59A 3FB5C 4MVMA 4MTGA 1LUWA 2ZD9A 1VQ6V 2B9ZA 2RDCA 3K06A 3WG7B 4DW0A 3CCSV 1KU9A 2JRIA 1SZTA 2AGAA 4X66O 4B3RO 4FPPA 5B1BC 4GX0A 4LNUB 3N27A 3W7TA 1U96A 4LF9B 4PI2A 2IU3A 3KKYA 4H13B 1E1QG 1YTFB 2W6IG 2AZ2A 4DUYB 2K9PA 3D3QA 4ZHQA 2ODMA 3AG1B 2XUMA 3AG4B 4FM1A 5IY5B 3CCVV 3AG3C 4DV7O 5FPOA 4CS3A 4FFKA 2EX3A 5FNVA 3RBZA 2P22C 2BTQA 1HP8A 3L72H 2NR5A 1K5QA 5LA6B 3AG2C 1Z2GA 1ZAUA 1PNLA 4X1KB 1FJGB 5FL7G 3AK1A 2QWNB 1HR0O 5DECA 3QNEA 5C93A 4DV6O 3FYIB 4AQYB 4BIUA 3BABA 1AVMA 5JJEB 5CA1B 1KP2A 2YSUB 4DV4O 3SPCA 5EBMC 1RFYA 3HPLC 3K04A 1OCCB 3AK2A 2IJHA 3ASOB 1E79G 1NR1A 3JCUZ 2NNUA 5LBQA 1FKAO 4MVUA 1V54B 2YXLA 1ROPA 1JQ0A 1OCOB 1JR9A 1K4CC 1B6QA 1VF6C 3D3IA 2YIDA 3LSQA 3ZN1A 4WF9V 3JSNA 1VF5B 3TXSA 4DR3B 3ZJZA 1RPOA 4CH5A 3K0GA 3CMEV 1QNMA 5IJ9B 1NI8A 2ZE8A 4LFCO 3BAAA 3UO2A 4A5UB 1XMQO 1JA8A 1GH6A 4LF7O 5JCOA 1V55C 2KQXA 3UKMA 1Q6IA 3T4DA 4YHHB 4DUZO 3JASA 4GX2A 3LDDA 4EEQA 1TVKA 5J2TA 4X20A 4FLZA 5DM6V 1FFXA 1R6TA 5FNVB 3CP1A 4AILC 2HR3A 4FLVA 3G80A 1TUBB 3LDEA 2EINB 3B4SA 3CRRA 3CSXA 3I55V 4B3SB 3MHSC 4F6RA 4LF5B 3UCSC 5BXZA 4X64O 2EIMB 4QNHB 3A0HZ 5H6RA 3SPHA 5BZBA 3K3WA 2UXBO 1XBLA 1QVFU 4G28B 5A9GA 4I0XA 4J9ZB 4ZKIA 3FYEB 3RFRA 1R6KA 2X7RB 3CXCU 3WU2Z 3EVKA 1M93A 4MTOA 2CTQA 5JJJB 2GUZA 5LOVA 5JH7B 1F7YA 1BT8A 2VQEO 3ZRVA 4NB5A 2X6CA 3ETQA 1FS0G 3P3NA 5AG2A 3IJ4A 2F4VB 4KHPO 1O9HA 1N34B 4XDJA 3FAVB 3MDSA 1HW7A 4YIOA 3OUSA 3VQWA 1P84F 2RMKB 1ORQC 3DSQA 2CH7B 4DR5O 3E86A 2DQ0A 2ITCC 5GTHZ 4BAYA 3SJBC 2RJZA 3HKBB 3FD9A 4MVZA 2F1MA 2UXXA 3ZS8C 4DV5B 4DR6B 5LYJA 1BL8A 4YXWG 1S76D 4CS4A 1NTMH 1Y74B 2R70A 3ASNC 3JD4A 4MS2A 4X62B 3DGEA 4GZRB 3OFNG 3CRQA 3G71V 1QCEA 1NT2B 4MVRA 1FXKC 2XNDG 4QGPA 5EYPB 2OCCC 5KX5A 1SERA 4Q20A 5ITZB 5K1XA 2N74A 1FXHA 4I50B 4D6TH 3JD1A 3K9SA 3OR6C 1Q5OA 2R9IA 3BHPA 1WNSA 4PHZA 2X6AA 4F6RB 3OE7G 1GM7A 4TV9B 2V7QG 4U7OA 3E35A 1KECA 3ZN0A 2JDIG 2ZDIC 3FKSG 2DMXA 2YUAA 3ETDA 1YSCA 4JAVA 4JI3O 1VQNV 1YJNV 3DC6A 4FMTA 2OIGA 5HFMA 2HLDG 2ZM6B 1M4UA 1AROP 4JI5B 3JD3A 3L75H 4KUMA 4MTXA 3R66A 3ZMZA 3ICXA 1CXZB 3GWKC 1N33O 2V1DA 3RYFA 4RO2A 3JALB 1NH2B 1S72V 1NR7A 4IT5A 2Z3YA 1VMGA 3AG4C 1JCHA 4JI1O 2E75B 1KQSU 2P5OA 3VOUA 1NKDA 2XTAA 4CC6A 3FB8C 2WSSG 1K3EA 3MD0A 3N2KB 5B1BB 3PN1A 1P4RA 5B1OA 4WBNA 3CWBH 3Q4HA 2CTWA 4NTWA 1VQPV 4RQFA 2EJ7A 4I7ZB 5BR8O 3AG3B 1YITV 5EC2C 1H2MA 3CC7V 3CRMA 1Q90D 4J7ZA 4JI4O 3AG2B 1G6UA 4F4LA 2W6JG 3S3XA 1U97A 5B1NA 3RYHB 2JJ2G 2MK3A 2QE7G 5EIBD 2YS8A 5IWAB 1IBLB 4O4HA 3SPIA 1XMOO 1G1XB 4DR7B 3IC7A 4EFBA 3CPWU 3G4SV 2A9HA 1JOYA 3RGBA 4I55A 2IJIA 2CTPA 3N2GB 4CZZA 5KA5A 1Y76A 5F2VO 2P4VA 3DTUB 4RQEA 5KAFZ 1WA8A 2EJRA 1SQGA 4NTYA 4B3MO 2Q5ZA 3K03A 2EBOA 3DC5A 4O2AA 3HKEA 1FFTB 3RN4A 1YEWA 1OCZC 2CK3G 1H8EG 3T1YB 1XUQA 2G38A 2EIKB 5B66Z 5IYZA 5EBLC 1K8AW 1MG1A 4W4LA 2LFSA 3GVMA 2FL4A 4JI0O 4NKGB 4GKJB 1Q43A 2GTAA 1R3LC 4DR2B 1V55B 4NXNB 2RQ6A 4WBNB 4NVPA 1LUVA 3T4ZA 5GW7A 3RVZA 1Q6HA 1FXKA 1QLEC 3E8FA 1GMGA 3X2QC 2HVJC 2Y4UA 3ZX6A 4UB8Z 1H2NA 3ZMTA 1JPXA 3RYIB 2PI4A 5EIBC 1DGSA 2ZDIA 3K79A 3JAWA 5CMUA 1PP9H 3ABMC 4EB6B 1J5EO 4ABMA 4PDMA 3FB6C 1VQMV 1YCIA 1Y76B 4DR1O 4H37A 1MSWD 3CJHA 4O4LB 1S0VA 4UVCA 2WLLB 4WCEV 1YJ9V 3U0ZA 1W2BU 2DE0X 2M6YA 4R8CA 4JI6B 1AI4A 4J7JA 1K97A 4X66B 1WB8A 2AXTZ 1IVSA 3LSUA 1ZUQA 5LP6A 4B3RB 1I94O 1JMKC 1YJWV 5JCOC 1M90W 1DK1A 1AJPA 2ZE7A 2BE3A 3ETGA 2Q7GA 3L70H 1YF2A 2QKSA 3APOA 3CMAV 1FXVA 4J41A 2YEVB 4LWSB 2F23A 4PA7A 4FZ1A 2Q68A 4LFAO 3P32A 1IBMB 3CCQV 1N0JA 2KG7A 3K5LA 4N21A 3ZHQA 1SQFA 4NXMO 2Q9LA 4JPRA 4ZBMA 3JCZA 1MSDA 5EZYB 1XNQB 1KBHA 4JZ2A 1Z5VA 5KLVH 1X4TA 1B3QA 1HR0B 3ASNB 4LF8O 1A32A 4DYLA 1KYOF 1FXKB 2RN9A 1AI5A 2OCCB 3CX5F 1M56C 2D2CB 1P7GA 3OAAG 4JTDB 4LFBO 4P2ZA 3KCYA 5H6QA 2DYRC 3LUTB 4WFBV 1PL4A 5IJ0B 3IGAC 4LC1A 4JV5B 2JEUA 3JAWB 2HHHO 5BMVB 4JF3A 2VQFO 1BHAA 5EBWC 1RSOA 4DV0O 4NTXA 2LFRA 2EIJC 4WFGA 2HP8A 2N05A 2YIBA 2LGWA 5J2UA 3SYOA 4K8XA 1K4DC 1S77D 4LF4B 3TETA 2XAFA 3C3SA 1XMQB 2Q0OC 3SYAA 1G8MA 4YJ3A 2IJJA 4XBFA 1W59A 2ZR2A 1OV9A 2QTOA 3HKDA 4B3TO 4DUZB 4L87A 3EFFK 1KKDA 2FYUH 2E3CA 4QE7A 3SYPA 4IGGA 3ZHTA 4X65O 2ADPA 2KG7B 1EN6A 4UVAA 1XOUA 4HAMA 2XOKG 5L3EA 2UU9O 4GKKO 3H1KH 3DXRA 1XL4A 3ZHVA 3OW2U 1COWG 1ZL8A 2DQ3A 3UT5B 4HBNA 1SS3A 2V4DA 4KFMA 1GAXA 2UUAO 2WWWA 2PI5A 3BCCH 2DYSC 1NTZH 4J10A 1ENVA 4TV8A 1QVGU 4OX9O 1ZTEA 2R9RB 3P3PA 4HYOA 4JYCA 4KP4A 4U3JB 3O9OA 1EN4A 2XAQA 2JGDA 4AI8A 3QTCA 1BQZA 2VQEB 4XDKA 3CXHF 1TGOA 3UQ8A 4UCOA 5DN6G 1S5JA 1B04A 2KKWA 4NR1A 1Q7YW 4KHPB 2GHYA 2Y48A 4MVSA 4JI2O 3OUFA 2QTSA 3KZIZ 4X1IA 1VQOV 3T1CA 5KHKA 1GO3F 2ETNA 1YXBA 2NLJC 5LHGA 4UCVA 3LDCA 1OZ0A 4YIPA 2E5LO 2EIKC 2DJVA 4FK5C 3WFVA 1MOFA 3ZHSA 5JQGA 4DK1A 4J9YB 3KG2A 3HKDB 4TQDA 4JAAA 4JYAB 3K5OA 1OCZB 5EC1C 3BPZA 4K0KO 2F93B 4DV1O 4ZHQB 3JATA 3W7UA 2BTOA 4W4KA 1YIJV 1K92A 2LW1A 3O65A 4L8JA 2BTQB 2Q7EA 3K57A 3C90A 4JI7B 1GN2A 3OT7A 2P90A 3CYOA 4LF9O 3PJSK 2CE4A 1K33A 4JI3B 2UXCO 2HKOA 4DUYO 4FM0A 1SF9A 1QLEB 2WLNA 1IURA 3H01A 3X2QB 2AZ0A 2DWEC 1HNWO 3ZHRA 5LHIA 3THOA 3ZRXA 2QKAA 1FJGO 3J81N 4U7NA 1N33B 2P7TC 4H0LB 1N8RW 1G4YB 2AHZA 3ABMB 4AQYO 3QO8A 5IYCO 1YVWA 3B40A 4O4IA 4JI1B 1KC8W 5B1AC 4TUYA 2OYQA 1JJOA 3SR2C 2QDOA 4GUNA 3ZCCA 1WJZA 1BZKA 4FVMA 2E76B 3L74H 5GONA 1SESA 1P7BA 1KKCA 1SQXH 5L3FA 3OGCC 1N32O 3CRCA 3JASB 5JJNB 4JTAB 5LGNA 4UCUA 5BR8B 1TVKB 3IC9A 1QQCA 5J2TB 2ADQB 1PPJH 4X20B 1EN5A 2FB5A 1FFXB 2MW2B 4JI4B 2VWKA 1AP6A 3BEHA 4D7SA 2ZR3A 4IYHA 2OWOA 1I7FA 1S5HC 1D5AA 1QHTA 4YHHO 5LMUO 1WN7A 4EKWA 3L9DA 5LGTA 2IJKA 2PYJA 3FB7C 4I0XB 2AHYA 3E8HA 3AK3A 1M56B 3FX7A 3B8MA 4DV2B 2YC0A 2DYRB 1KB9F 2YIBD 4E4EA 1EZVH 3M99B 1BSMA 1RPRA 1IBKB 2P06A 4K35A 3VBBA 2GUZB 4Z1MG 5LOVB 5D5PA 1H2GA 4FFBA 4BR6A 4WFHA 5LP6C 3VQVA 2ITDC 3CD6V 4J80A 4O4JA 1GRJA 1FYJA 2PUSA 1Q6UA 1YDXA 2DOSA 1BS3A 3W7WA 4DXWA 3ML0A 2EIJB 2VRZA 3TXQA 3T1HO 5KA6A 1AI7A 3R65A 4JI0B 1IXBA 5LHHA 2WA4A 5IT9N 2A79B 2QM8A 3CC2V 3SDLA 1THZA 3STZC 4DV3O 1KP3A 2WLJA 4CBCA 5H5NA 1VEWA 1XREA 1I5XA 1HWYA 5LYJB 2F4VO 5CBFA 3CRAA 4OXSA 1N34O 2VWJA 3JARA 4DR4O 4JGSA 1SA0A 5CB4A 1K73W 1R73A 3J80N 4YY3B 4J7KA 5C8YA 5JWPA 1R3JC 4G2KA 1SETA 4FLUA 2BCCH 3UM7A 2W0XA 2DW4A 5KX5B 1TAEA 2WA3A 5KMGA 2UUBB 1J95A 4DRXA 1Z5WA 1VQ4V 3H1HH 2IBZH 1BQ0A 4DR6O 2X0LA 2R72A 2C2AA 3K9AA 4X62O 1J5EB 4LP8A 1E1RG 1I0HA 2DYSB 3TCUA 5CA3A 4LH6A 2PYLA 1Y66A 2X6BA 5FLXN 1ZSPA 1M1KW 1MA1A 3S3WA 4R50A 2QM7A 3M7MX 1I94B 3ZEDA 1IZ3A 4DW1A 1AP5A 1DLBA 3OMNB 3RYFB 3EHBB 4J11A 2DN9A 2D3OW 2Q67A 2WAMA 2ZIMA 3E22A 4OPAA 4LFAB 1EM1A 1DF4A 4HZ3A 4JI5O 3L71H 5LL6Y 3QG5A 4NXMB 3APQA 5LXTA 4H33A 4WFEA 3L73H 5E1AC 2XT9A 3QF7A 1JFFA 1HNXB 3ZRWA 1XHZA 4LF6O 4I4TA 2IM9A 2EZPA 3IFXA 1MZEA 3Q4HB 1GM8A 1XNRO 1WPXA 1H2KA 1X59A 1XDCA 1F23A 4MVQA 2ZXWC 5IDJA 3SYCA 4JYBA 5KMGB 2R9AA 5GTIZ 3SYQA 3RYCA 5CA0A 4PJ0Z 4UVBA 4K8ZA 2CTRA 5LGUA 1Y4MA 4IYIA 4R6ZA 2JIZG 1CP9A 3K5MA 1L0NH 5B3SC 1SQBH 3CCEV 4O4HB 1AR5A 3CB2A 4DV0B 5EK0A 4QPKA 3E89A 4I55B 1SZXA 1F51A 3RVYA 4Z1VA 1WA8B 1MNGA 1N36O 1XEQA 3TK1A 4UCTA 2JEXA 5IWAO 4B3TB 3MHHC 1XHXA 3K5NA 4O2AB 3HKEB 4I9WA 3QVNA 4DR7O 5IYBO 1VQ9V 2RNBA 1VARA 4Z2WA 4MVOA 4UV8A 5CBGA 5B1AB 3E22B 2KB1A 1WP7A 5IYZB 1HNZO 5KHJA 3OEEG 4GX5A 4DV7B 3OM3B 2JS5A 2IH3C 1KUQA 5JVDA 3E2EA 1XL6A 4LNUA 4I4TB 1H2LA 4JI8O 5D5QA 2GV9A 5TISZ 4ZI7A 3ZMSA 4ZIBA 5CN0A 1QR8A 4DV6B 3CE2A 3ZHUA 4IIJA 4MW3A 2HEPA 3RYCB 2YI8A 1RM1C 3LNNA 2ZNIA 4PDVA 4UCSA 4DV4B 2EILC 4X1KA 2WLHA 3ZMVA 1NVPD 1BCCH 5LMNO 1BHBA 2W0FC 2Y4TA 4FZ0A 2UUCO 4I5SA 1W0KG 3SJAC 4CC5A 3OR7C 2P67A 4UB6Z 3E8BA 5J9PC 2CGOA 4GLXA 4IHJA 3BRCA 1I5YA 5KHGA 4RAIA 2FTKA 5KUKA 4JAUA 5CA1A 2E5LB 5BY1A 3CJHB 2Q6AA 3K08A 3LNMB 1UJWB 1H38A 4LFCB 2ZKOA 1K34A 3JSLA 1MABG 5LP6B 4FLWA 4LF7B 1M57C 4OPHA 5IYDO 2WLKA 4QE9A 3HB3B 3K58A 1TA8A 4K0KB 4DV1B 2QWOB 3U10A 1K5SA 2F66C 1DF5A 3I5DA 4PA6A 2E74B 1NS1A 1YI2V 1VP7A 4ZOLA 4MT8A 2HJFC 3BA8A 4B08A 5IJ9A 2BOCC 4JI6O 2LGQA 4P30A 5JVDB 2H3OA 1VQ5V 2HG5C 3CHXA 2CDYA 1JX9A 4UFZA 5KAIZ 2BOBC 1D2DA 3B77A 4MTFA 2UXCB 2NN4A 4X64B 4ZI7B 4PELA 4FLXA 4JASA 2UXBB 4CH4A 4JTCB 3ABLC 1XQ8A 3D36C 4IIJB 3CEIA 1HNWB 4E2LA
chains in the Genus database with same CATH topology
4PDRA 2HVKC 2WLMA 5L3CA 3ZCCA 4BW5A 3AG2B 4F4LA 2OT5A 2W6JG 1NQTA 5B1NA 2JJ2G 2XAGA 2MK3A 1SESA 2QE7G 3CCRV 2B5UA 1P7BA 3F5WC 1AI6A 5L3FA 3ZRWB 5H9CA 5L3BA 3OGCC 3SPIA 3ABKB 1WLEA 4JTAB 3IC7A 1R3IC 3ZMUA 5LGNA 3CPWU 1CPYA 2HFEC 2A9HA 3AEIA 3G4SV 1JOYA 3E83A 2Y69C 1AJNA 2IJIA 2OTJV 4CZZA 1IXMA 5KA5A 1QLNA 3GB7C 3ZRSA 3DTUB 4RQEA 2B1IA 3A0RA 3SJQC 2EJRA 5KUMA 3BEHA 3BY6A 4PA3A 3ZIAG 2IU0A 2OTLV 4PA4A 2ZR3A 3K03A 2EBOA 1S5HC 5HFLA 2Z5UA 2P6JA 1S3JA 5CBHA 2UXNA 4UV9A 1FFTB 3RW0A 4EKWA 1VQ8V 5LGTA 1OCZC 2CK3G 2IJKA 1Q86W 3T2MA 1R3KC 1H8EG 1OCRB 3FB7C 2AHYA 3E8HA 2EIKB 3JD0A 1M56B 3B8MA 5EBLC 1K8AW 1MG1A 2EZOA 3JD2A 2LFSA 4WFAV 2DYRB 3M99B 1RPRA 1QBZA 4TSFG 1R3LC 1F4MA 3VBBA 4Z1MG 1V55B 1BMFG 1H2GA 2K1EA 4WFHA 4R7CA 2ITDC 3CD6V 2QEXV 3OMIB 2LP7A 1SRYA 4PA9A 3F7YC 1EBOA 3W7WA 2H94A 3FB5C 4MVMA 4MTGA 5GW7A 3T4ZA 2ZD9A 3RVZA 1VQ6V 3K06A 2ZXWB 4DXWA 3WG7B 3CCSV 1FXKA 3ML0A 2EIJB 1QLEC 3E8FA 1GMGA 3X2QC 5KA6A 2HVJC 1AI7A 3R65A 3W7SA 1JJ2U 2WPDG 5LHHA 2XAHA 2A79B 2ATKC 2QM8A 3CC2V 1SZTA 1THZA 3STZC 3ZMTA 1JPXA 1KP3A 2WLJA 5B3SB 2PI4A 4TWKA 4FPPA 4FJCC 4GX0A 5B1BC 4CBCA 1I5XA 2ZDIA 1HWYA 3K79A 1PNKA 5CBFA 3W7TA 4OXSA 2IU3A 4WFFA 1E1QG 5CMUA 1YTFB 2W6IG 4JGSA 1K73W 3ABMC 3AG1B 1R73A 1R3JC 4G2KA 1SETA 3AG4B 4MSWC 3ABTA 3FB6C 4PDMA 3UM7A 1VQMV 1NJIW 3ETEA 1KD1W 4H37A 1GKFA 4QIWF 5IY5B 2DW4A 3AG3C 3CCVV 1MSWD 3K0DA 1S0VA 4UVCA 3RBZA 2WLLB 1J95A 4WCEV 1GTOA 1YJ9V 1W2BU 1VQKV 4R8CA 1K5QA 4QPJA 1VQ4V 1AI4A 1K97A 3AG2C 1PNLA 1TUEB 1NBMG 1YJWV 4P9PA 4TT3G 1M90W 2X0LA 1AJPA 5FL7G 3OEHG 2C2AA 1PD3A 3K9AA 1YTFD 1YHQV 3ETGA 3QNEA 3ABKC 5C93A 3FYIB 1R6NA 2QKSA 4LP8A 4BIUA 3CMAV 1FXVA 1E1RG 2DYSB 2YEVB 3TCUA 5CA3A 2GSMB 4PA7A 3CC4V 2Q69A 2Q68A 1Y66A 3P32A 1KP2A 2X6BA 4LBEC 2YSUB 3CCQV 1M1KW 3SPCA 4N21A 5EBMC 3HPLC 4R50A 2M7WA 2QM7A 3K04A 1OCCB 4JPRA 4ZBMA 2IJHA 3ASOB 1E79G 3JCZA 1EFRG 1NR1A 2NNUA 1DLBA 3OMNB 3ASNB 3EHBB 5LBQA 3QO7A 2WLIA 4MVUA 1V54B 1ROPA 1FXKB 1JQ0A 1AI5A 1K4CC 1OCOB 1QR9A 1B6QA 2OCCB 3D36A 3D3IA 1OCRC 2Q67A 2WAMA 3LSQA 3ZN1A 4WF9V 2D3OW 5L3DA 1M56C 1DF4A 1RM1B 3OAAG 4JTDB 3ZJZA 4HZ3A 4P2ZA 1RPOA 5H6QA 2DYRC 3K0GA 3LUTB 3CMEV 2EILB 4WFBV 4H33A 3IGAC 4P9OA 4WFEA 5E1AC 4LC1A 1V55C 3JYCA 1OHHG 3ZRWA 3UKMA 2JEUA 3T4DA 2EZPA 3IFXA 1GM8A 4GX1A 4JF3A 1WPXA 4GX2A 1BHAA 3LDDA 5EBWC 1F23A 1PNMA 4MVQA 1H8HG 3B8NA 2LFRA 2ZXWC 3WG7C 5IDJA 3SYCA 2EIJC 4JYBA 3OMAB 5DM6V 4WFGA 2QA4V 1PKXA 3SYOA 3P30A 1K4DC 3CP1A 3SYQA 1S77D 2JJ1G 3TETA 5L3GA 2HR3A 4UVBA 2XAFA 2ZQMA 3LDEA 4XDLA 2EINB 5LGUA 3SYAA 1Y4MA 1M57B 4R6ZA 1G8MA 2JIZG 1CP9A 3I55V 3MHSC 2IJJA 4XBFA 4DO2A 2ZR2A 5B3SC 1VQ7V 2QTOA 2EIMB 4BIZA 4QNHB 3CCEV 4L87A 5H6RA 3SPHA 5BZBA 3EFFK 3K3WA 1KKDA 4X89A 2JK5C 1QVFU 4G28B 3SPJA 5EK0A 4QPKA 4J9ZB 4ZKIA 3AG1C 3E89A 4QE7A 3FYEB 3SYPA 1R6KA 2X7RB 3CXCU 1F51A 5IY5C 3RVYA 4UVAA 4MTOA 4HAMA 2IW5A 2XOKG 5L3EA 3TK1A 2JEXA 3ZRVA 1XL4A 1W0JG 2X6CA 3MHHC 1FS0G 3OW2U 4I9WA 2WLIB 1COWG 2DQ3A 4LCUC 3ABLB 5IYBO 4XDJA 1VQ9V 4KFMA 3CCUV 4GCZA 3OUSA 3SPGA 4MVOA 4UV8A 5CBGA 2WWWA 5B1AB 4RUFA 2PI5A 2KB1A 2DYSC 1ENVA 1ORQC 3E86A 1DTOA 2DQ0A 2R9RB 4HYOA 1QVGU 2ITCC 1PL0A 3OEEG 4JYCA 4GX5A 4KP4A 3OM3B 2IH3C 4BAYA 2XAQA 3E2EA 4UXNA 2F43G 4MVZA 3LSSA 4XDKA 1NVPB 1XL6A 1EZJA 1OCCC 3ASOC 2UXXA 5DN6G 1CEZA 1JVMA 1Q7YW 1BL8A 4YXWG 2GHYA 2Y48A 4X8AA 1S76D 4MVSA 3OUFA 3ZMSA 4MS2A 3ASNC 3JD4A 3CCJV 1VQOV 3T1CA 5CN0A 1QR8A 3DGEA 1GO3F 1AR1B 3ABUA 2B1GA 2Y69B 3OFNG 1V54C 1QCEA 3G71V 4MVRA 4MW8A 1FXKC 1OCOC 2NLJC 2XNDG 2OCCC 5LHGA 3LDCA 1OZ0A 4PDLA 4MW3A 1AJQA 1SERA 4Q20A 4UUJC 2EIKC 2WLLA 1RM1C 1FXHA 2H8PC 4FK5C 3WFVA 3CCMV 4PDVA 1MOFA 3JD1A 3OR6C 2EILC 2R9IA 1ZWIC 2WLHA 3ZMVA 1NVPD 2X6AA 1BHBA 3OE7G 1GM7A 2W0FC 3KG2A 4J9YB 1L1FA 2V7QG 3CCLV 4U7OA 3E35A 1KECA 3ZN0A 4ASUG 2DWDC 2JDIG 2ZDIC 4I5SA 1W0KG 3FKSG 1Q82W 3ETDA 1OCZB 3OR7C 5EC1C 1YSCA 4JAVA 2P67A 4FIPC 1LNQA 2IH1C 2XAJA 1VQNV 3E8BA 1K7DA 5J9PC 2YEVA 3W7UA 1YJNV 4N23A 4FMTA 1I5YA 3STLC 5HFMA 4RAIA 2FTKA 2HLDG 2XASA 3NXSA 5KUKA 4JAUA 1YIJV 1K92A 2Q6AA 3E8GA 3K08A 1AROP 3LNMB 3JD3A 1UJWB 1H38A 4KUMA 4MTXA 1K34A 1M9NA 3ZMZA 1MABG 2EINC 1M57C 3I56V 3GWOA 1F4NA 2P90A 3CYOA 5IYDO 2WLKA 4QE9A 3PJSK 2V1DA 3HB3B 4G27B 1K33A 2EIMC 2HKOA 4RO2A 1NH2B 2A0LA 1S72V 1NR7A 1K5SA 1GK9A 1QLEB 3F7VC 2Z3YA 2WLNA 3H01A 3X2QB 1DF5A 4QJFB 4PA6A 1K9MW 3AG4C 1Q81W 1GM9A 1JCHA 1YI2V 2DWEC 1KQSU 4MT8A 2HJFC 5LHIA 2BOCC 3VOUA 1NKDA 4P30A 1VQ5V 4RUEA 3ZRXA 2HG5C 3FB8C 2WSSG 1K3EA 3MD0A 1JX9A 5B1BB 4U7NA 1P4RA 2BOBC 5B1OA 3B77A 2P7TC 4MTFA 3G6EV 1N8RW 4PELA 1G4YB 4JASA 2AHZA 3ABMB 1VQPV 1NH2D 4RQFA 4JTCB 4GT1A 3QO5A 3W7XA 3ABLC 1VQLV 3QO8A 5IYCO 3AG3B 1YITV 1KC8W 5B1AC 5EC2C 4X88A 3CC7V 4E2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDR A;  1V54 C;  3T4D A;  2HVK C;  3IFX A;  4MVR A;  1OCO C;  2NLJ C;  2WLM A;  4GX1 A;  4MW8 A;  2WLJ A;  4BW5 A;  2OCC C;  4TWK A;  4CBC A;  4GX2 A;  4GX0 A;  5B1B C;  4F4L A;  3LDC A;  3LDD A;  4MW3 A;  4PDL A;  4MVQ A;  5EBW C;  5CBF A;  4UUJ C;  2EIK C;  2WLL A;  4OXS A;  4WFF A;  2H8P C;  2ZXW C;  3WG7 C;  4PDV A;  3SYC A;  1P7B A;  2EIJ C;  3OR6 C;  3F5W C;  3ABM C;  4WFG A;  2EIL C;  1ZWI C;  2WLH A;  1R3J C;  3SYO A;  2X6A A;  1K4D C;  3OGC C;  4MSW C;  3SPI A;  3SYQ A;  4PDM A;  3FB6 C;  3UM7 A;  3TET A;  2W0F C;  3KG2 A;  4J9Y B;  4JTA B;  1R3I C;  4H37 A;  2DWD C;  3AG3 C;  3LDE A;  3K0D A;  4XDL A;  2HFE C;  2A9H A;  3SYA A;  5EC1 C;  3OR7 C;  3E83 A;  4R6Z A;  2WLL B;  1J95 A;  2Y69 C;  3RBZ A;  1LNQ A;  4R8C A;  2IH1 C;  5B3S C;  2QTO A;  3AG2 C;  4QNH B;  3E8B A;  5J9P C;  2YEV A;  5BZB A;  3GB7 C;  3SPH A;  3EFF K;  3ZRS A;  1KKD A;  4X89 A;  3STL C;  2JK5 C;  4RAI A;  4P9P A;  5KUK A;  3SJQ C;  4G28 B;  5KUM A;  5EK0 A;  3BEH A;  3SPJ A;  4J9Z B;  2Q6A A;  4PA3 A;  3AG1 C;  3E8G A;  3E89 A;  4PA4 A;  4QE7 A;  3K03 A;  3K08 A;  3LNM B;  1S5H C;  3SYP A;  3ABK C;  5CBH A;  2QKS A;  4LP8 A;  3RW0 A;  5IY5 C;  3TCU A;  4EKW A;  3RVY A;  2EIN C;  4PA7 A;  1M57 C;  1OCZ C;  2Q69 A;  4MTO A;  3T2M A;  1R3K C;  2Q68 A;  2WLK A;  4QE9 A;  3PJS K;  3FB7 C;  4G27 B;  2AHY A;  2EIM C;  3E8H A;  2X6B A;  4LBE C;  4RO2 A;  1XL4 A;  3SPC A;  2A0L A;  2X6C A;  5EBM C;  5EBL C;  3HPL C;  4R50 A;  3K04 A;  4ZBM A;  3F7V C;  4I9W A;  2WLI B;  2WLN A;  4LCU C;  4XDJ A;  4KFM A;  4PA6 A;  1R3L C;  3AG4 C;  3OUS A;  3SPG A;  2DWE C;  4MVO A;  5CBG A;  2HJF C;  4RUF A;  2BOC C;  3VOU A;  2WLI A;  2KB1 A;  2DYS C;  4MVU A;  2K1E A;  4P30 A;  4WFH A;  4RUE A;  1ORQ C;  2HG5 C;  4R7C A;  2ITD C;  3E86 A;  3FB8 C;  4HYO A;  2R9R B;  1K4C C;  2ITC C;  4PA9 A;  4GX5 A;  1OCR C;  2Q67 A;  2IH3 C;  2BOB C;  3F7Y C;  3FB5 C;  4MVM A;  2P7T C;  1M56 C;  4MTG A;  3T4Z A;  4MTF A;  2ZD9 A;  4JTD B;  4MVZ A;  4XDK A;  3K06 A;  3RVZ A;  3ZJZ A;  4HZ3 A;  4P2Z A;  4DXW A;  1XL6 A;  1G4Y B;  1OCC C;  1QLE C;  2AHZ A;  2DYR C;  3ASO C;  3E8F A;  3K0G A;  3LUT B;  4JTC B;  3X2Q C;  1JVM A;  3ABL C;  2HVJ C;  4H33 A;  3R65 A;  3IGA C;  1BL8 A;  4X8A A;  4P9O A;  4WFE A;  4MVS A;  5E1A C;  3OUF A;  2A79 B;  2ATK C;  4MS2 A;  1V55 C;  3ASN C;  3JYC A;  5B1A C;  5EC2 C;  3T1C A;  4X88 A;  3UKM A;  3STZ C; 
#chains in the Genus database with same CATH topology
 3WB2 A;  1IBM O;  2HVK C;  5L3C A;  1TUB A;  4LH7 A;  1XNQ O;  2XAG A;  2B5U A;  5E79 Z;  5H9C A;  1FPO A;  4ICG A;  2L35 A;  2PY5 A;  3OTO O;  1R3I C;  4IHJ B;  1RSO B;  1L8D A;  3AEI A;  3E83 A;  2Y69 C;  1AJN A;  3ZBH A;  4K3A A;  3EXA A;  2OTJ V;  1IXM A;  4DR5 B;  5J2U B;  1O9G A;  3ZRS A;  3HKC A;  2B1I A;  1SQV H;  3A0R A;  3SJQ C;  5JH7 A;  4PA3 A;  3ZIA G;  4PD4 F;  2UXD O;  4PA4 A;  2Q7H A;  1ZX3 A;  1URF A;  4YJ3 B;  1S3J A;  4JV5 O;  5CBH A;  2FKX A;  1R1B A;  1N32 B;  4UV9 A;  1RP3 B;  3RW0 A;  3AG7 A;  3FAV A;  2F95 B;  1Q86 W;  1HDJ A;  3T2M A;  1R3K C;  1LR1 A;  2HJD A;  3JD0 A;  2CH7 A;  4ZOL B;  3WB0 A;  4WFA V;  4LF4 O;  2QJ1 A;  4PV1 B;  4B7K A;  1QBZ A;  1T5E A;  3HKB A;  2XHB A;  1NTK H;  2L6L A;  3DXR B;  5LMU B;  4R7C A;  2LP7 A;  3B09 A;  1ZL8 B;  1Y74 A;  3F7Y C;  1EBO A;  2H94 A;  3VQX A;  3H1I H;  2ZXW B;  2PZS A;  1Y6X A;  5EYP A;  3HR0 A;  4TV8 B;  2OIE A;  5ITZ A;  3W7S A;  1JJ2 U;  2WPD G;  3F5T A;  2XAH A;  4I50 A;  2ZNJ A;  2ATK C;  5K1P A;  3BA9 A;  2JGD B;  1SQQ H;  4TV9 A;  5B3S B;  3MAQ A;  4TWK A;  3M8A A;  4FJC C;  4PI0 A;  1WP8 A;  1PNK A;  2ILM A;  1GN6 A;  2Q8V A;  3C3T A;  4WFF A;  4BIO A;  5A2Q N;  2N04 A;  4X1I B;  4MSW C;  2QGN A;  3ABT A;  3SGI A;  3T1H B;  1NJI W;  3ETE A;  1KD1 W;  1L0L H;  1GKF A;  4QIW F;  4CH3 A;  3HKC B;  3K0D A;  3D8C A;  4FLT A;  1GTO A;  2PGG A;  3H1L H;  1VQK V;  1FD9 A;  4DV3 B;  1OJH A;  4QPJ A;  3A8T A;  1TUE B;  1NBM G;  5JQG B;  2PF4 E;  2YXY A;  4P9P A;  4TT3 G;  4C7U A;  2JS3 A;  3OEH G;  2YI9 A;  3JAL A;  1PD3 A;  4DR4 B;  1YTF D;  1YHQ V;  1IDS A;  3ABK C;  4D7T A;  1R6N A;  1NU1 H;  2VS0 A;  3JAT B;  2GSM B;  3CS5 A;  3CC4 V;  2Q69 A;  4BW9 A;  4AHC A;  4DR3 O;  2GTS A;  4LBE C;  2ZCE A;  4IL6 Z;  1Q8I A;  2M7W A;  4YJ2 A;  3N2K A;  1XIL A;  4FM2 A;  1EFR G;  4JYY A;  4NYK A;  4JYA O;  5DED A;  4BWA A;  1D5N A;  3OGI B;  3QO7 A;  3B2E E;  2WLI A;  4DK0 A;  1XMO B;  1SKV A;  1QR9 A;  3D36 A;  1OCR C;  3TGU H;  5L3D A;  1RM1 B;  1H2S B;  2EIL B;  2Y0I A;  1N4C A;  3RYH A;  4P9O A;  4JI7 O;  2P4K A;  4B3M B;  2CGN A;  4KXR A;  4B3S O;  3JYC A;  1OHH G;  1KMI Z;  4LF5 O;  4GX1 A;  5H2F Z;  4I9Q A;  3H1J H;  1PNM A;  1AB3 A;  1H8H G;  2BSK A;  3B8N A;  3WG7 C;  3N2G A;  5FPR A;  3OMA B;  2QA4 V;  4O4I B;  1V9P A;  3IAY A;  1PKX A;  2Z0A A;  4GYC B;  4H44 B;  4TUY B;  3P30 A;  2JJ1 G;  1SC5 B;  5L3G A;  2ZQM A;  4XDL A;  2PTM A;  1M57 B;  5GON B;  4DO2 A;  4LF6 B;  4TOI A;  1VQ7 V;  4BIZ A;  4X9Q A;  1XNR B;  4X89 A;  2JK5 C;  1IX9 A;  1VF6 A;  3SPJ A;  3RT3 C;  3AG1 C;  2AW9 A;  4X1Y A;  1BE3 H;  1N0N A;  2QWQ B;  2EUL A;  1BGY H;  5IY5 C;  2OCH A;  1FAF A;  4YJ2 B;  1S5L Z;  2A7W A;  2IW5 A;  2Q0A A;  1WPB A;  2CAZ C;  3JAK A;  1XI1 A;  1W0J G;  2A06 H;  1WAZ A;  4DV5 O;  3BFR A;  2ZE6 A;  2WLI B;  4LCU C;  3ABL B;  3TJT A;  2O57 A;  4CS2 A;  3CCU V;  4GCZ A;  3SPG A;  1VF7 A;  4RWU A;  2LQT A;  4RUF A;  3UO3 A;  4J42 A;  1WB7 A;  4DR1 B;  1DTO A;  3NR7 A;  1ZLZ A;  1PL0 A;  5KHI A;  2QSA A;  1N36 B;  4UXN A;  2F43 G;  3LSS A;  1NVP B;  3RYI A;  2JGU A;  1EZJ A;  1OCC C;  3ASO C;  4FFB B;  1CEZ A;  1JVM A;  4O4J B;  4X8A A;  3OD4 A;  1QU7 A;  4EB6 A;  3CCJ V;  2BSK B;  3VQY A;  1AR1 B;  2YIA A;  2B1G A;  3ABU A;  2Y69 B;  4O2B A;  1V54 C;  2GBO A;  4MW8 A;  1OCO C;  4OGQ B;  4DV2 O;  1HNZ B;  1UPG A;  3G67 A;  4PDL A;  3A2F A;  1AJQ A;  3WB1 A;  4O4L A;  2ZM6 O;  4UUJ C;  1PV0 A;  2WLL A;  2H8P C;  1IBK O;  3CCM V;  1ZWI C;  4JI8 B;  1L1F A;  1MZF A;  3CCL V;  4ASU G;  2DWD C;  1Q82 W;  4FIP C;  1LNQ A;  4LF8 B;  3JAR B;  1MMM A;  2IH1 C;  2XAJ A;  1SA0 B;  3FFQ A;  4X1Y B;  5CB4 B;  1K7D A;  2YEV A;  5C8Y B;  5KHH A;  1AIL A;  4LWS A;  4N23 A;  2Q73 A;  3STL C;  2XAS A;  3NXS A;  1I08 A;  1B06 A;  3E8G A;  2RCV A;  4LFB B;  4DRX B;  3OTF A;  3JAK B;  1M9N A;  5LMN B;  2ZT9 B;  5EZY A;  2EIN C;  3I56 V;  3GWO A;  2UUC B;  1F4N A;  2CUG A;  4G27 B;  2EIM C;  2HHH B;  1AR4 A;  2KSD A;  4KL1 A;  2QM4 A;  2A0L A;  4EFE A;  2ARH A;  4YY3 O;  2VQF B;  1PM9 A;  1GK9 A;  3F7V C;  4LR3 A;  1P49 A;  2JVD A;  4QJF B;  1M5I A;  1K9M W;  1Q81 W;  1GM9 A;  3KCX A;  2UUB O;  3RWR D;  4UCR A;  4RUE A;  5IJ0 A;  3G6B A;  5IE9 A;  3U11 A;  3G6E V;  1IBL O;  5BMV A;  1SQP H;  2YDE A;  2YIC A;  2QWP B;  1NH2 D;  2ZIN A;  4GT1 A;  3QO5 A;  4O2B B;  3W7X A;  4HNA A;  3JAM N;  1Y67 A;  1VQL V;  2QKC A;  2QR4 A;  2YXH A;  3J7A U;  1UFI A;  4X88 A;  2LW7 A;  4X65 B;  4PDR A;  5B5E Z;  2WLM A;  4BW5 A;  5LXT B;  2OT5 A;  2UU9 B;  2ZIO A;  1NQT A;  4GKK B;  3CCR V;  1VIB A;  3F5W C;  4FLY A;  1AI6 A;  1JFF B;  3ZRW B;  5L3B A;  3ABK B;  2QWR B;  1WLE A;  3ZMU A;  2A3Q A;  1CPY A;  2HFE C;  3T1Y O;  2UUA B;  4B7E A;  2ZE5 A;  1QLN A;  1GN4 A;  2Y0P A;  4OX9 B;  3GB7 C;  3BVO A;  2GDS A;  2FML A;  5CA0 B;  3H9V A;  5KUM A;  4GKJ O;  3BY6 A;  5LA6 A;  2IU0 A;  2OTL V;  2LO1 A;  3A0B Z;  4DR2 O;  5HFL A;  2Z5U A;  2P6J A;  1HNX O;  4NXN O;  1NZ6 A;  2UXN A;  3UT5 A;  3OTO B;  1VQ8 V;  4JI2 B;  1US6 A;  2LJ2 A;  1OCR B;  4TQF A;  2EZO A;  3JD2 A;  4CH6 A;  4U3J A;  4Q6G A;  1GN3 A;  4U3F H;  4TSF G;  1F4M A;  2UXD B;  4JZG A;  1BMF G;  1Q3E A;  4F6E A;  2K1E A;  3SJC C;  2QEX V;  3OMI B;  1SRY A;  4PA9 A;  1YZB A;  2Q4P A;  4HNA B;  3K59 A;  3FB5 C;  4MVM A;  4MTG A;  1LUW A;  2ZD9 A;  1VQ6 V;  2B9Z A;  2RDC A;  3K06 A;  3WG7 B;  4DW0 A;  3CCS V;  1KU9 A;  2JRI A;  1SZT A;  2AGA A;  4X66 O;  4B3R O;  4FPP A;  5B1B C;  4GX0 A;  4LNU B;  3N27 A;  3W7T A;  1U96 A;  4LF9 B;  4PI2 A;  2IU3 A;  3KKY A;  4H13 B;  1E1Q G;  1YTF B;  2W6I G;  2AZ2 A;  4DUY B;  2K9P A;  3D3Q A;  4ZHQ A;  2ODM A;  3AG1 B;  2XUM A;  3AG4 B;  4FM1 A;  5IY5 B;  3CCV V;  3AG3 C;  4DV7 O;  5FPO A;  4CS3 A;  4FFK A;  2EX3 A;  5FNV A;  3RBZ A;  2P22 C;  2BTQ A;  1HP8 A;  3L72 H;  2NR5 A;  1K5Q A;  5LA6 B;  3AG2 C;  1Z2G A;  1ZAU A;  1PNL A;  4X1K B;  1FJG B;  5FL7 G;  3AK1 A;  2QWN B;  1HR0 O;  5DEC A;  3QNE A;  5C93 A;  4DV6 O;  3FYI B;  4AQY B;  4BIU A;  3BAB A;  1AVM A;  5JJE B;  5CA1 B;  1KP2 A;  2YSU B;  4DV4 O;  3SPC A;  5EBM C;  1RFY A;  3HPL C;  3K04 A;  1OCC B;  3AK2 A;  2IJH A;  3ASO B;  1E79 G;  1NR1 A;  3JCU Z;  2NNU A;  5LBQ A;  1FKA O;  4MVU A;  1V54 B;  2YXL A;  1ROP A;  1JQ0 A;  1OCO B;  1JR9 A;  1K4C C;  1B6Q A;  1VF6 C;  3D3I A;  2YID A;  3LSQ A;  3ZN1 A;  4WF9 V;  3JSN A;  1VF5 B;  3TXS A;  4DR3 B;  3ZJZ A;  1RPO A;  4CH5 A;  3K0G A;  3CME V;  1QNM A;  5IJ9 B;  1NI8 A;  2ZE8 A;  4LFC O;  3BAA A;  3UO2 A;  4A5U B;  1XMQ O;  1JA8 A;  1GH6 A;  4LF7 O;  5JCO A;  1V55 C;  2KQX A;  3UKM A;  1Q6I A;  3T4D A;  4YHH B;  4DUZ O;  3JAS A;  4GX2 A;  3LDD A;  4EEQ A;  1TVK A;  5J2T A;  4X20 A;  4FLZ A;  5DM6 V;  1FFX A;  1R6T A;  5FNV B;  3CP1 A;  4AIL C;  2HR3 A;  4FLV A;  3G80 A;  1TUB B;  3LDE A;  2EIN B;  3B4S A;  3CRR A;  3CSX A;  3I55 V;  4B3S B;  3MHS C;  4F6R A;  4LF5 B;  3UCS C;  5BXZ A;  4X64 O;  2EIM B;  4QNH B;  3A0H Z;  5H6R A;  3SPH A;  5BZB A;  3K3W A;  2UXB O;  1XBL A;  1QVF U;  4G28 B;  5A9G A;  4I0X A;  4J9Z B;  4ZKI A;  3FYE B;  3RFR A;  1R6K A;  2X7R B;  3CXC U;  3WU2 Z;  3EVK A;  1M93 A;  4MTO A;  2CTQ A;  5JJJ B;  2GUZ A;  5LOV A;  5JH7 B;  1F7Y A;  1BT8 A;  2VQE O;  3ZRV A;  4NB5 A;  2X6C A;  3ETQ A;  1FS0 G;  3P3N A;  5AG2 A;  3IJ4 A;  2F4V B;  4KHP O;  1O9H A;  1N34 B;  4XDJ A;  3FAV B;  3MDS A;  1HW7 A;  4YIO A;  3OUS A;  3VQW A;  1P84 F;  2RMK B;  1ORQ C;  3DSQ A;  2CH7 B;  4DR5 O;  3E86 A;  2DQ0 A;  2ITC C;  5GTH Z;  4BAY A;  3SJB C;  2RJZ A;  3HKB B;  3FD9 A;  4MVZ A;  2F1M A;  2UXX A;  3ZS8 C;  4DV5 B;  4DR6 B;  5LYJ A;  1BL8 A;  4YXW G;  1S76 D;  4CS4 A;  1NTM H;  1Y74 B;  2R70 A;  3ASN C;  3JD4 A;  4MS2 A;  4X62 B;  3DGE A;  4GZR B;  3OFN G;  3CRQ A;  3G71 V;  1QCE A;  1NT2 B;  4MVR A;  1FXK C;  2XND G;  4QGP A;  5EYP B;  2OCC C;  5KX5 A;  1SER A;  4Q20 A;  5ITZ B;  5K1X A;  2N74 A;  1FXH A;  4I50 B;  4D6T H;  3JD1 A;  3K9S A;  3OR6 C;  1Q5O A;  2R9I A;  3BHP A;  1WNS A;  4PHZ A;  2X6A A;  4F6R B;  3OE7 G;  1GM7 A;  4TV9 B;  2V7Q G;  4U7O A;  3E35 A;  1KEC A;  3ZN0 A;  2JDI G;  2ZDI C;  3FKS G;  2DMX A;  2YUA A;  3ETD A;  1YSC A;  4JAV A;  4JI3 O;  1VQN V;  1YJN V;  3DC6 A;  4FMT A;  2OIG A;  5HFM A;  2HLD G;  2ZM6 B;  1M4U A;  1ARO P;  4JI5 B;  3JD3 A;  3L75 H;  4KUM A;  4MTX A;  3R66 A;  3ZMZ A;  3ICX A;  1CXZ B;  3GWK C;  1N33 O;  2V1D A;  3RYF A;  4RO2 A;  3JAL B;  1NH2 B;  1S72 V;  1NR7 A;  4IT5 A;  2Z3Y A;  1VMG A;  3AG4 C;  1JCH A;  4JI1 O;  2E75 B;  1KQS U;  2P5O A;  3VOU A;  1NKD A;  2XTA A;  4CC6 A;  3FB8 C;  2WSS G;  1K3E A;  3MD0 A;  3N2K B;  5B1B B;  3PN1 A;  1P4R A;  5B1O A;  4WBN A;  3CWB H;  3Q4H A;  2CTW A;  4NTW A;  1VQP V;  4RQF A;  2EJ7 A;  4I7Z B;  5BR8 O;  3AG3 B;  1YIT V;  5EC2 C;  1H2M A;  3CC7 V;  3CRM A;  1Q90 D;  4J7Z A;  4JI4 O;  3AG2 B;  1G6U A;  4F4L A;  2W6J G;  3S3X A;  1U97 A;  5B1N A;  3RYH B;  2JJ2 G;  2MK3 A;  2QE7 G;  5EIB D;  2YS8 A;  5IWA B;  1IBL B;  4O4H A;  3SPI A;  1XMO O;  1G1X B;  4DR7 B;  3IC7 A;  4EFB A;  3CPW U;  3G4S V;  2A9H A;  1JOY A;  3RGB A;  4I55 A;  2IJI A;  2CTP A;  3N2G B;  4CZZ A;  5KA5 A;  1Y76 A;  5F2V O;  2P4V A;  3DTU B;  4RQE A;  5KAF Z;  1WA8 A;  2EJR A;  1SQG A;  4NTY A;  4B3M O;  2Q5Z A;  3K03 A;  2EBO A;  3DC5 A;  4O2A A;  3HKE A;  1FFT B;  3RN4 A;  1YEW A;  1OCZ C;  2CK3 G;  1H8E G;  3T1Y B;  1XUQ A;  2G38 A;  2EIK B;  5B66 Z;  5IYZ A;  5EBL C;  1K8A W;  1MG1 A;  4W4L A;  2LFS A;  3GVM A;  2FL4 A;  4JI0 O;  4NKG B;  4GKJ B;  1Q43 A;  2GTA A;  1R3L C;  4DR2 B;  1V55 B;  4NXN B;  2RQ6 A;  4WBN B;  4NVP A;  1LUV A;  3T4Z A;  5GW7 A;  3RVZ A;  1Q6H A;  1FXK A;  1QLE C;  3E8F A;  1GMG A;  3X2Q C;  2HVJ C;  2Y4U A;  3ZX6 A;  4UB8 Z;  1H2N A;  3ZMT A;  1JPX A;  3RYI B;  2PI4 A;  5EIB C;  1DGS A;  2ZDI A;  3K79 A;  3JAW A;  5CMU A;  1PP9 H;  3ABM C;  4EB6 B;  1J5E O;  4ABM A;  4PDM A;  3FB6 C;  1VQM V;  1YCI A;  1Y76 B;  4DR1 O;  4H37 A;  1MSW D;  3CJH A;  4O4L B;  1S0V A;  4UVC A;  2WLL B;  4WCE V;  1YJ9 V;  3U0Z A;  1W2B U;  2DE0 X;  2M6Y A;  4R8C A;  4JI6 B;  1AI4 A;  4J7J A;  1K97 A;  4X66 B;  1WB8 A;  2AXT Z;  1IVS A;  3LSU A;  1ZUQ A;  5LP6 A;  4B3R B;  1I94 O;  1JMK C;  1YJW V;  5JCO C;  1M90 W;  1DK1 A;  1AJP A;  2ZE7 A;  2BE3 A;  3ETG A;  2Q7G A;  3L70 H;  1YF2 A;  2QKS A;  3APO A;  3CMA V;  1FXV A;  4J41 A;  2YEV B;  4LWS B;  2F23 A;  4PA7 A;  4FZ1 A;  2Q68 A;  4LFA O;  3P32 A;  1IBM B;  3CCQ V;  1N0J A;  2KG7 A;  3K5L A;  4N21 A;  3ZHQ A;  1SQF A;  4NXM O;  2Q9L A;  4JPR A;  4ZBM A;  3JCZ A;  1MSD A;  5EZY B;  1XNQ B;  1KBH A;  4JZ2 A;  1Z5V A;  5KLV H;  1X4T A;  1B3Q A;  1HR0 B;  3ASN B;  4LF8 O;  1A32 A;  4DYL A;  1KYO F;  1FXK B;  2RN9 A;  1AI5 A;  2OCC B;  3CX5 F;  1M56 C;  2D2C B;  1P7G A;  3OAA G;  4JTD B;  4LFB O;  4P2Z A;  3KCY A;  5H6Q A;  2DYR C;  3LUT B;  4WFB V;  1PL4 A;  5IJ0 B;  3IGA C;  4LC1 A;  4JV5 B;  2JEU A;  3JAW B;  2HHH O;  5BMV B;  4JF3 A;  2VQF O;  1BHA A;  5EBW C;  1RSO A;  4DV0 O;  4NTX A;  2LFR A;  2EIJ C;  4WFG A;  2HP8 A;  2N05 A;  2YIB A;  2LGW A;  5J2U A;  3SYO A;  4K8X A;  1K4D C;  1S77 D;  4LF4 B;  3TET A;  2XAF A;  3C3S A;  1XMQ B;  2Q0O C;  3SYA A;  1G8M A;  4YJ3 A;  2IJJ A;  4XBF A;  1W59 A;  2ZR2 A;  1OV9 A;  2QTO A;  3HKD A;  4B3T O;  4DUZ B;  4L87 A;  3EFF K;  1KKD A;  2FYU H;  2E3C A;  4QE7 A;  3SYP A;  4IGG A;  3ZHT A;  4X65 O;  2ADP A;  2KG7 B;  1EN6 A;  4UVA A;  1XOU A;  4HAM A;  2XOK G;  5L3E A;  2UU9 O;  4GKK O;  3H1K H;  3DXR A;  1XL4 A;  3ZHV A;  3OW2 U;  1COW G;  1ZL8 A;  2DQ3 A;  3UT5 B;  4HBN A;  1SS3 A;  2V4D A;  4KFM A;  1GAX A;  2UUA O;  2WWW A;  2PI5 A;  3BCC H;  2DYS C;  1NTZ H;  4J10 A;  1ENV A;  4TV8 A;  1QVG U;  4OX9 O;  1ZTE A;  2R9R B;  3P3P A;  4HYO A;  4JYC A;  4KP4 A;  4U3J B;  3O9O A;  1EN4 A;  2XAQ A;  2JGD A;  4AI8 A;  3QTC A;  1BQZ A;  2VQE B;  4XDK A;  3CXH F;  1TGO A;  3UQ8 A;  4UCO A;  5DN6 G;  1S5J A;  1B04 A;  2KKW A;  4NR1 A;  1Q7Y W;  4KHP B;  2GHY A;  2Y48 A;  4MVS A;  4JI2 O;  3OUF A;  2QTS A;  3KZI Z;  4X1I A;  1VQO V;  3T1C A;  5KHK A;  1GO3 F;  2ETN A;  1YXB A;  2NLJ C;  5LHG A;  4UCV A;  3LDC A;  1OZ0 A;  4YIP A;  2E5L O;  2EIK C;  2DJV A;  4FK5 C;  3WFV A;  1MOF A;  3ZHS A;  5JQG A;  4DK1 A;  4J9Y B;  3KG2 A;  3HKD B;  4TQD A;  4JAA A;  4JYA B;  3K5O A;  1OCZ B;  5EC1 C;  3BPZ A;  4K0K O;  2F93 B;  4DV1 O;  4ZHQ B;  3JAT A;  3W7U A;  2BTO A;  4W4K A;  1YIJ V;  1K92 A;  2LW1 A;  3O65 A;  4L8J A;  2BTQ B;  2Q7E A;  3K57 A;  3C90 A;  4JI7 B;  1GN2 A;  3OT7 A;  2P90 A;  3CYO A;  4LF9 O;  3PJS K;  2CE4 A;  1K33 A;  4JI3 B;  2UXC O;  2HKO A;  4DUY O;  4FM0 A;  1SF9 A;  1QLE B;  2WLN A;  1IUR A;  3H01 A;  3X2Q B;  2AZ0 A;  2DWE C;  1HNW O;  3ZHR A;  5LHI A;  3THO A;  3ZRX A;  2QKA A;  1FJG O;  3J81 N;  4U7N A;  1N33 B;  2P7T C;  4H0L B;  1N8R W;  1G4Y B;  2AHZ A;  3ABM B;  4AQY O;  3QO8 A;  5IYC O;  1YVW A;  3B40 A;  4O4I A;  4JI1 B;  1KC8 W;  5B1A C;  4TUY A;  2OYQ A;  1JJO A;  3SR2 C;  2QDO A;  4GUN A;  3ZCC A;  1WJZ A;  1BZK A;  4FVM A;  2E76 B;  3L74 H;  5GON A;  1SES A;  1P7B A;  1KKC A;  1SQX H;  5L3F A;  3OGC C;  1N32 O;  3CRC A;  3JAS B;  5JJN B;  4JTA B;  5LGN A;  4UCU A;  5BR8 B;  1TVK B;  3IC9 A;  1QQC A;  5J2T B;  2ADQ B;  1PPJ H;  4X20 B;  1EN5 A;  2FB5 A;  1FFX B;  2MW2 B;  4JI4 B;  2VWK A;  1AP6 A;  3BEH A;  4D7S A;  2ZR3 A;  4IYH A;  2OWO A;  1I7F A;  1S5H C;  1D5A A;  1QHT A;  4YHH O;  5LMU O;  1WN7 A;  4EKW A;  3L9D A;  5LGT A;  2IJK A;  2PYJ A;  3FB7 C;  4I0X B;  2AHY A;  3E8H A;  3AK3 A;  1M56 B;  3FX7 A;  3B8M A;  4DV2 B;  2YC0 A;  2DYR B;  1KB9 F;  2YIB D;  4E4E A;  1EZV H;  3M99 B;  1BSM A;  1RPR A;  1IBK B;  2P06 A;  4K35 A;  3VBB A;  2GUZ B;  4Z1M G;  5LOV B;  5D5P A;  1H2G A;  4FFB A;  4BR6 A;  4WFH A;  5LP6 C;  3VQV A;  2ITD C;  3CD6 V;  4J80 A;  4O4J A;  1GRJ A;  1FYJ A;  2PUS A;  1Q6U A;  1YDX A;  2DOS A;  1BS3 A;  3W7W A;  4DXW A;  3ML0 A;  2EIJ B;  2VRZ A;  3TXQ A;  3T1H O;  5KA6 A;  1AI7 A;  3R65 A;  4JI0 B;  1IXB A;  5LHH A;  2WA4 A;  5IT9 N;  2A79 B;  2QM8 A;  3CC2 V;  3SDL A;  1THZ A;  3STZ C;  4DV3 O;  1KP3 A;  2WLJ A;  4CBC A;  5H5N A;  1VEW A;  1XRE A;  1I5X A;  1HWY A;  5LYJ B;  2F4V O;  5CBF A;  3CRA A;  4OXS A;  1N34 O;  2VWJ A;  3JAR A;  4DR4 O;  4JGS A;  1SA0 A;  5CB4 A;  1K73 W;  1R73 A;  3J80 N;  4YY3 B;  4J7K A;  5C8Y A;  5JWP A;  1R3J C;  4G2K A;  1SET A;  4FLU A;  2BCC H;  3UM7 A;  2W0X A;  2DW4 A;  5KX5 B;  1TAE A;  2WA3 A;  5KMG A;  2UUB B;  1J95 A;  4DRX A;  1Z5W A;  1VQ4 V;  3H1H H;  2IBZ H;  1BQ0 A;  4DR6 O;  2X0L A;  2R72 A;  2C2A A;  3K9A A;  4X62 O;  1J5E B;  4LP8 A;  1E1R G;  1I0H A;  2DYS B;  3TCU A;  5CA3 A;  4LH6 A;  2PYL A;  1Y66 A;  2X6B A;  5FLX N;  1ZSP A;  1M1K W;  1MA1 A;  3S3W A;  4R50 A;  2QM7 A;  3M7M X;  1I94 B;  3ZED A;  1IZ3 A;  4DW1 A;  1AP5 A;  1DLB A;  3OMN B;  3RYF B;  3EHB B;  4J11 A;  2DN9 A;  2D3O W;  2Q67 A;  2WAM A;  2ZIM A;  3E22 A;  4OPA A;  4LFA B;  1EM1 A;  1DF4 A;  4HZ3 A;  4JI5 O;  3L71 H;  5LL6 Y;  3QG5 A;  4NXM B;  3APQ A;  5LXT A;  4H33 A;  4WFE A;  3L73 H;  5E1A C;  2XT9 A;  3QF7 A;  1JFF A;  1HNX B;  3ZRW A;  1XHZ A;  4LF6 O;  4I4T A;  2IM9 A;  2EZP A;  3IFX A;  1MZE A;  3Q4H B;  1GM8 A;  1XNR O;  1WPX A;  1H2K A;  1X59 A;  1XDC A;  1F23 A;  4MVQ A;  2ZXW C;  5IDJ A;  3SYC A;  4JYB A;  5KMG B;  2R9A A;  5GTI Z;  3SYQ A;  3RYC A;  5CA0 A;  4PJ0 Z;  4UVB A;  4K8Z A;  2CTR A;  5LGU A;  1Y4M A;  4IYI A;  4R6Z A;  2JIZ G;  1CP9 A;  3K5M A;  1L0N H;  5B3S C;  1SQB H;  3CCE V;  4O4H B;  1AR5 A;  3CB2 A;  4DV0 B;  5EK0 A;  4QPK A;  3E89 A;  4I55 B;  1SZX A;  1F51 A;  3RVY A;  4Z1V A;  1WA8 B;  1MNG A;  1N36 O;  1XEQ A;  3TK1 A;  4UCT A;  2JEX A;  5IWA O;  4B3T B;  3MHH C;  1XHX A;  3K5N A;  4O2A B;  3HKE B;  4I9W A;  3QVN A;  4DR7 O;  5IYB O;  1VQ9 V;  2RNB A;  1VAR A;  4Z2W A;  4MVO A;  4UV8 A;  5CBG A;  5B1A B;  3E22 B;  2KB1 A;  1WP7 A;  5IYZ B;  1HNZ O;  5KHJ A;  3OEE G;  4GX5 A;  4DV7 B;  3OM3 B;  2JS5 A;  2IH3 C;  1KUQ A;  5JVD A;  3E2E A;  1XL6 A;  4LNU A;  4I4T B;  1H2L A;  4JI8 O;  5D5Q A;  2GV9 A;  5TIS Z;  4ZI7 A;  3ZMS A;  4ZIB A;  5CN0 A;  1QR8 A;  4DV6 B;  3CE2 A;  3ZHU A;  4IIJ A;  4MW3 A;  2HEP A;  3RYC B;  2YI8 A;  1RM1 C;  3LNN A;  2ZNI A;  4PDV A;  4UCS A;  4DV4 B;  2EIL C;  4X1K A;  2WLH A;  3ZMV A;  1NVP D;  1BCC H;  5LMN O;  1BHB A;  2W0F C;  2Y4T A;  4FZ0 A;  2UUC O;  4I5S A;  1W0K G;  3SJA C;  4CC5 A;  3OR7 C;  2P67 A;  4UB6 Z;  3E8B A;  5J9P C;  2CGO A;  4GLX A;  4IHJ A;  3BRC A;  1I5Y A;  5KHG A;  4RAI A;  2FTK A;  5KUK A;  4JAU A;  5CA1 A;  2E5L B;  5BY1 A;  3CJH B;  2Q6A A;  3K08 A;  3LNM B;  1UJW B;  1H38 A;  4LFC B;  2ZKO A;  1K34 A;  3JSL A;  1MAB G;  5LP6 B;  4FLW A;  4LF7 B;  1M57 C;  4OPH A;  5IYD O;  2WLK A;  4QE9 A;  3HB3 B;  3K58 A;  1TA8 A;  4K0K B;  4DV1 B;  2QWO B;  3U10 A;  1K5S A;  2F66 C;  1DF5 A;  3I5D A;  4PA6 A;  2E74 B;  1NS1 A;  1YI2 V;  1VP7 A;  4ZOL A;  4MT8 A;  2HJF C;  3BA8 A;  4B08 A;  5IJ9 A;  2BOC C;  4JI6 O;  2LGQ A;  4P30 A;  5JVD B;  2H3O A;  1VQ5 V;  2HG5 C;  3CHX A;  2CDY A;  1JX9 A;  4UFZ A;  5KAI Z;  2BOB C;  1D2D A;  3B77 A;  4MTF A;  2UXC B;  2NN4 A;  4X64 B;  4ZI7 B;  4PEL A;  4FLX A;  4JAS A;  2UXB B;  4CH4 A;  4JTC B;  3ABL C;  1XQ8 A;  3D36 C;  4IIJ B;  3CEI A;  1HNW B;  4E2L A; 
#chains in the Genus database with same CATH homology
 4PDR A;  2HVK C;  2WLM A;  5L3C A;  3ZCC A;  4BW5 A;  3AG2 B;  4F4L A;  2OT5 A;  2W6J G;  1NQT A;  5B1N A;  2JJ2 G;  2XAG A;  2MK3 A;  1SES A;  2QE7 G;  3CCR V;  2B5U A;  1P7B A;  3F5W C;  1AI6 A;  5L3F A;  3ZRW B;  5H9C A;  5L3B A;  3OGC C;  3SPI A;  3ABK B;  1WLE A;  4JTA B;  3IC7 A;  1R3I C;  3ZMU A;  5LGN A;  3CPW U;  1CPY A;  2HFE C;  2A9H A;  3AEI A;  3G4S V;  1JOY A;  3E83 A;  2Y69 C;  1AJN A;  2IJI A;  2OTJ V;  4CZZ A;  1IXM A;  5KA5 A;  1QLN A;  3GB7 C;  3ZRS A;  3DTU B;  4RQE A;  2B1I A;  3A0R A;  3SJQ C;  2EJR A;  5KUM A;  3BEH A;  3BY6 A;  4PA3 A;  3ZIA G;  2IU0 A;  2OTL V;  4PA4 A;  2ZR3 A;  3K03 A;  2EBO A;  1S5H C;  5HFL A;  2Z5U A;  2P6J A;  1S3J A;  5CBH A;  2UXN A;  4UV9 A;  1FFT B;  3RW0 A;  4EKW A;  1VQ8 V;  5LGT A;  1OCZ C;  2CK3 G;  2IJK A;  1Q86 W;  3T2M A;  1R3K C;  1H8E G;  1OCR B;  3FB7 C;  2AHY A;  3E8H A;  2EIK B;  3JD0 A;  1M56 B;  3B8M A;  5EBL C;  1K8A W;  1MG1 A;  2EZO A;  3JD2 A;  2LFS A;  4WFA V;  2DYR B;  3M99 B;  1RPR A;  1QBZ A;  4TSF G;  1R3L C;  1F4M A;  3VBB A;  4Z1M G;  1V55 B;  1BMF G;  1H2G A;  2K1E A;  4WFH A;  4R7C A;  2ITD C;  3CD6 V;  2QEX V;  3OMI B;  2LP7 A;  1SRY A;  4PA9 A;  3F7Y C;  1EBO A;  3W7W A;  2H94 A;  3FB5 C;  4MVM A;  4MTG A;  5GW7 A;  3T4Z A;  2ZD9 A;  3RVZ A;  1VQ6 V;  3K06 A;  2ZXW B;  4DXW A;  3WG7 B;  3CCS V;  1FXK A;  3ML0 A;  2EIJ B;  1QLE C;  3E8F A;  1GMG A;  3X2Q C;  5KA6 A;  2HVJ C;  1AI7 A;  3R65 A;  3W7S A;  1JJ2 U;  2WPD G;  5LHH A;  2XAH A;  2A79 B;  2ATK C;  2QM8 A;  3CC2 V;  1SZT A;  1THZ A;  3STZ C;  3ZMT A;  1JPX A;  1KP3 A;  2WLJ A;  5B3S B;  2PI4 A;  4TWK A;  4FPP A;  4FJC C;  4GX0 A;  5B1B C;  4CBC A;  1I5X A;  2ZDI A;  1HWY A;  3K79 A;  1PNK A;  5CBF A;  3W7T A;  4OXS A;  2IU3 A;  4WFF A;  1E1Q G;  5CMU A;  1YTF B;  2W6I G;  4JGS A;  1K73 W;  3ABM C;  3AG1 B;  1R73 A;  1R3J C;  4G2K A;  1SET A;  3AG4 B;  4MSW C;  3ABT A;  3FB6 C;  4PDM A;  3UM7 A;  1VQM V;  1NJI W;  3ETE A;  1KD1 W;  4H37 A;  1GKF A;  4QIW F;  5IY5 B;  2DW4 A;  3AG3 C;  3CCV V;  1MSW D;  3K0D A;  1S0V A;  4UVC A;  3RBZ A;  2WLL B;  1J95 A;  4WCE V;  1GTO A;  1YJ9 V;  1W2B U;  1VQK V;  4R8C A;  1K5Q A;  4QPJ A;  1VQ4 V;  1AI4 A;  1K97 A;  3AG2 C;  1PNL A;  1TUE B;  1NBM G;  1YJW V;  4P9P A;  4TT3 G;  1M90 W;  2X0L A;  1AJP A;  5FL7 G;  3OEH G;  2C2A A;  1PD3 A;  3K9A A;  1YTF D;  1YHQ V;  3ETG A;  3QNE A;  3ABK C;  5C93 A;  3FYI B;  1R6N A;  2QKS A;  4LP8 A;  4BIU A;  3CMA V;  1FXV A;  1E1R G;  2DYS B;  2YEV B;  3TCU A;  5CA3 A;  2GSM B;  4PA7 A;  3CC4 V;  2Q69 A;  2Q68 A;  1Y66 A;  3P32 A;  1KP2 A;  2X6B A;  4LBE C;  2YSU B;  3CCQ V;  1M1K W;  3SPC A;  4N21 A;  5EBM C;  3HPL C;  4R50 A;  2M7W A;  2QM7 A;  3K04 A;  1OCC B;  4JPR A;  4ZBM A;  2IJH A;  3ASO B;  1E79 G;  3JCZ A;  1EFR G;  1NR1 A;  2NNU A;  1DLB A;  3OMN B;  3ASN B;  3EHB B;  5LBQ A;  3QO7 A;  2WLI A;  4MVU A;  1V54 B;  1ROP A;  1FXK B;  1JQ0 A;  1AI5 A;  1K4C C;  1OCO B;  1QR9 A;  1B6Q A;  2OCC B;  3D36 A;  3D3I A;  1OCR C;  2Q67 A;  2WAM A;  3LSQ A;  3ZN1 A;  4WF9 V;  2D3O W;  5L3D A;  1M56 C;  1DF4 A;  1RM1 B;  3OAA G;  4JTD B;  3ZJZ A;  4HZ3 A;  4P2Z A;  1RPO A;  5H6Q A;  2DYR C;  3K0G A;  3LUT B;  3CME V;  2EIL B;  4WFB V;  4H33 A;  3IGA C;  4P9O A;  4WFE A;  5E1A C;  4LC1 A;  1V55 C;  3JYC A;  1OHH G;  3ZRW A;  3UKM A;  2JEU A;  3T4D A;  2EZP A;  3IFX A;  1GM8 A;  4GX1 A;  4JF3 A;  1WPX A;  4GX2 A;  1BHA A;  3LDD A;  5EBW C;  1F23 A;  1PNM A;  4MVQ A;  1H8H G;  3B8N A;  2LFR A;  2ZXW C;  3WG7 C;  5IDJ A;  3SYC A;  2EIJ C;  4JYB A;  3OMA B;  5DM6 V;  4WFG A;  2QA4 V;  1PKX A;  3SYO A;  3P30 A;  1K4D C;  3CP1 A;  3SYQ A;  1S77 D;  2JJ1 G;  3TET A;  5L3G A;  2HR3 A;  4UVB A;  2XAF A;  2ZQM A;  3LDE A;  4XDL A;  2EIN B;  5LGU A;  3SYA A;  1Y4M A;  1M57 B;  4R6Z A;  1G8M A;  2JIZ G;  1CP9 A;  3I55 V;  3MHS C;  2IJJ A;  4XBF A;  4DO2 A;  2ZR2 A;  5B3S C;  1VQ7 V;  2QTO A;  2EIM B;  4BIZ A;  4QNH B;  3CCE V;  4L87 A;  5H6R A;  3SPH A;  5BZB A;  3EFF K;  3K3W A;  1KKD A;  4X89 A;  2JK5 C;  1QVF U;  4G28 B;  3SPJ A;  5EK0 A;  4QPK A;  4J9Z B;  4ZKI A;  3AG1 C;  3E89 A;  4QE7 A;  3FYE B;  3SYP A;  1R6K A;  2X7R B;  3CXC U;  1F51 A;  5IY5 C;  3RVY A;  4UVA A;  4MTO A;  4HAM A;  2IW5 A;  2XOK G;  5L3E A;  3TK1 A;  2JEX A;  3ZRV A;  1XL4 A;  1W0J G;  2X6C A;  3MHH C;  1FS0 G;  3OW2 U;  4I9W A;  2WLI B;  1COW G;  2DQ3 A;  4LCU C;  3ABL B;  5IYB O;  4XDJ A;  1VQ9 V;  4KFM A;  3CCU V;  4GCZ A;  3OUS A;  3SPG A;  4MVO A;  4UV8 A;  5CBG A;  2WWW A;  5B1A B;  4RUF A;  2PI5 A;  2KB1 A;  2DYS C;  1ENV A;  1ORQ C;  3E86 A;  1DTO A;  2DQ0 A;  2R9R B;  4HYO A;  1QVG U;  2ITC C;  1PL0 A;  3OEE G;  4JYC A;  4GX5 A;  4KP4 A;  3OM3 B;  2IH3 C;  4BAY A;  2XAQ A;  3E2E A;  4UXN A;  2F43 G;  4MVZ A;  3LSS A;  4XDK A;  1NVP B;  1XL6 A;  1EZJ A;  1OCC C;  3ASO C;  2UXX A;  5DN6 G;  1CEZ A;  1JVM A;  1Q7Y W;  1BL8 A;  4YXW G;  2GHY A;  2Y48 A;  4X8A A;  1S76 D;  4MVS A;  3OUF A;  3ZMS A;  4MS2 A;  3ASN C;  3JD4 A;  3CCJ V;  1VQO V;  3T1C A;  5CN0 A;  1QR8 A;  3DGE A;  1GO3 F;  1AR1 B;  3ABU A;  2B1G A;  2Y69 B;  3OFN G;  1V54 C;  1QCE A;  3G71 V;  4MVR A;  4MW8 A;  1FXK C;  1OCO C;  2NLJ C;  2XND G;  2OCC C;  5LHG A;  3LDC A;  1OZ0 A;  4PDL A;  4MW3 A;  1AJQ A;  1SER A;  4Q20 A;  4UUJ C;  2EIK C;  2WLL A;  1RM1 C;  1FXH A;  2H8P C;  4FK5 C;  3WFV A;  3CCM V;  4PDV A;  1MOF A;  3JD1 A;  3OR6 C;  2EIL C;  2R9I A;  1ZWI C;  2WLH A;  3ZMV A;  1NVP D;  2X6A A;  1BHB A;  3OE7 G;  1GM7 A;  2W0F C;  3KG2 A;  4J9Y B;  1L1F A;  2V7Q G;  3CCL V;  4U7O A;  3E35 A;  1KEC A;  3ZN0 A;  4ASU G;  2DWD C;  2JDI G;  2ZDI C;  4I5S A;  1W0K G;  3FKS G;  1Q82 W;  3ETD A;  1OCZ B;  3OR7 C;  5EC1 C;  1YSC A;  4JAV A;  2P67 A;  4FIP C;  1LNQ A;  2IH1 C;  2XAJ A;  1VQN V;  3E8B A;  1K7D A;  5J9P C;  2YEV A;  3W7U A;  1YJN V;  4N23 A;  4FMT A;  1I5Y A;  3STL C;  5HFM A;  4RAI A;  2FTK A;  2HLD G;  2XAS A;  3NXS A;  5KUK A;  4JAU A;  1YIJ V;  1K92 A;  2Q6A A;  3E8G A;  3K08 A;  1ARO P;  3LNM B;  3JD3 A;  1UJW B;  1H38 A;  4KUM A;  4MTX A;  1K34 A;  1M9N A;  3ZMZ A;  1MAB G;  2EIN C;  1M57 C;  3I56 V;  3GWO A;  1F4N A;  2P90 A;  3CYO A;  5IYD O;  2WLK A;  4QE9 A;  3PJS K;  2V1D A;  3HB3 B;  4G27 B;  1K33 A;  2EIM C;  2HKO A;  4RO2 A;  1NH2 B;  2A0L A;  1S72 V;  1NR7 A;  1K5S A;  1GK9 A;  1QLE B;  3F7V C;  2Z3Y A;  2WLN A;  3H01 A;  3X2Q B;  1DF5 A;  4QJF B;  4PA6 A;  1K9M W;  3AG4 C;  1Q81 W;  1GM9 A;  1JCH A;  1YI2 V;  2DWE C;  1KQS U;  4MT8 A;  2HJF C;  5LHI A;  2BOC C;  3VOU A;  1NKD A;  4P30 A;  1VQ5 V;  4RUE A;  3ZRX A;  2HG5 C;  3FB8 C;  2WSS G;  1K3E A;  3MD0 A;  1JX9 A;  5B1B B;  4U7N A;  1P4R A;  2BOB C;  5B1O A;  3B77 A;  2P7T C;  4MTF A;  3G6E V;  1N8R W;  4PEL A;  1G4Y B;  4JAS A;  2AHZ A;  3ABM B;  1VQP V;  1NH2 D;  4RQF A;  4JTC B;  4GT1 A;  3QO5 A;  3W7X A;  3ABL C;  1VQL V;  3QO8 A;  5IYC O;  3AG3 B;  1YIT V;  1KC8 W;  5B1A C;  5EC2 C;  4X88 A;  3CC7 V;  4E2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...