1K4DC

Potassium channel kcsa-fab complex in low concentration of k+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemistry of ion coordination and hydration revealed by a K+ channel-Fab complex at 2.0 A resolution.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2001-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k4dC00
2IH3C 3AG3C 1XL4A 2W0FC 3UM7A 2ITDC 2HFEC 1JVMA 2WLIA 3LDDA 3LDEA 5B3SC 4BW5A 3F5WC 3EFFK 4RAIA 5E1AC 2ZD9A 1ZWIC 2QKSA 2Q69A 4PA4A 4WFFA 3FB8C 2R9RB 4PDVA 4QNHB 3HPLC 5BZBA 3OGCC 5EK0A 4MW8A 4X8AA 4MVRA 2BOCC 3OUFA 4G27B 3K0GA 2IH1C 4P9OA 3KG2A 4I9WA 4MS2A 2NLJC 2WLKA 3AG1C 4PDRA 4HZ3A 4X88A 4XDLA 4PA6A 3OR7C 2KB1A 4DXWA 4MVMA 2WLIB 4JTCB 3K06A 3SPGA 4PA7A 3ABLC 4HYOA 5KUMA 4PA3A 2DWEC 4R7CA 1OCZC 1XL6A 4OXSA 1OCCC 4XDKA 3RVZA 3SYQA 4RUFA 3E83A 3SJQC 3IFXA 5CBGA 3LNMB 2HJFC 3K0DA 2ATKC 1K4DC 2ZXWC 2OCCC 4MW3A 3ABKC 5EBLC 1S5HC 4MVQA 4LP8A 5CBFA 5J9PC 3WG7C 3E8BA 3IGAC 4PDLA 2X6AA 4JTDB 3T4DA 3E8GA 4MVSA 2HVKC 2WLHA 2AHZA 1V55C 2DWDC 2Y69C 3AG2C 2QTOA 2A0LA 3E8HA 3FB6C 4MVOA 2HG5C 4LBEC 4QE7A 4XDJA 4CBCA 2ITCC 3K04A 3SPIA 3SYOA 2X6CA 4WFGA 2EIJC 3LDCA 3STZC 3RBZA 3VOUA 4P30A 4ZBMA 3F7VC 3SPCA 5B1AC 2WLJA 3STLC 3RVYA 4F4LA 2AHYA 2WLLA 1M57C 2P7TC 3SPJA 3SYPA 4MTGA 5EC2C 3SYCA 2H8PC 4MTOA 3AG4C 3PJSK 4G28B 4H33A 2BOBC 2X6BA 2WLMA 3GB7C 4GX5A 4H37A 3RW0A 3ZRSA 4WFHA 5EC1C 3JYCA 2WLNA 4UUJC 3F7YC 4GX2A 1G4YB 4JTAB 3R65A 5KUKA 1P7BA 1J95A 2DYRC 4RUEA 5EBWC 2DYSC 1K4CC 4PA9A 2WLLB 3UKMA 3ZJZA 3K08A 3FB5C 3T4ZA 4GX1A 2K1EA 4R50A 1R3KC 5EBMC 1QLEC 4X89A 5B1BC 4TWKA 1KKDA 1OCRC 4EKWA 3K03A 4MVZA 4WFEA 2HVJC 3E8FA 1BL8A 3T1CA 3TCUA 2EILC 2EINC 3TETA 3E86A 4GX0A 2Q68A 4KFMA 2A79B 4MSWC 4PDMA 3X2QC 4MVUA 2JK5C 2EIMC 2Q6AA 4J9ZB 4QE9A 1LNQA 1V54C 3ASNC 1M56C 1OCOC 1R3JC 3E89A 4P2ZA 4RO2A 3ASOC 2YEVA 4P9PA 5IY5C 3FB7C 1R3IC 2A9HA 4MTFA 1ORQC 2Q67A 3LUTB 4J9YB 2EIKC 4R6ZA 3BEHA 3T2MA 3OUSA 3OR6C 3SYAA 3SPHA 3ABMC 5CBHA 4LCUC 1R3LC 4R8CA
chains in the Genus database with same CATH superfamily
1WP8A 2IH3C 1XL4A 1VQNV 2R9AA 1JPXA 2Y4UA 1FJGB 3IC9A 3L73H 3S3WA 4DR2O 3CEIA 1QR9A 4O4LA 1ZX3A 2P6JA 2QWPB 2IJHA 3R66A 1MSWD 3ZRWA 2JEUA 4KUMA 2JJ2G 3CPWU 1H8EG 4JV5B 4ZI7B 1FD9A 4I4TB 2HP8A 4CH5A 4PA7A 4G2KA 5LOVB 4KL1A 4WBNB 3DC6A 1KD1W 4JGSA 3RGBA 4O4IA 3IGAC 4UB6Z 3CMEV 2PUSA 3CE2A 3QF7A 4DV6B 1D5AA 3ABKB 2HVKC 1V55C 3FB6C 4H0LB 5JJJB 3OGIB 3ZHSA 5LA6A 2OYQA 4B3SB 4E4EA 2A06H 3N27A 5CA1A 3NR7A 4I7ZB 5HFMA 3SYPA 5JQGB 3IC7A 5LHGA 4JYAO 3SYCA 1K5SA 1M5IA 3JSLA 3PJSK 1XNRO 2HEPA 4PELA 2ILMA 1G6UA 1SQQH 4UVBA 3M99B 1UPGA 4JI4B 2UXCB 1FFTB 5LMNO 4X1IA 3P3PA 5DEDA 3UKMA 4O2BA 1DLBA 2LFRA 3RN4A 2YI8A 1HW7A 3ZHUA 4D7SA 3T1CA 1OCOB 4DR2B 1MOFA 1XMOB 4JZGA 2VWKA 1TA8A 3JALB 2OIEA 2V7QG 1OHHG 1DK1A 2A9HA 4MTFA 4LF5B 1SS3A 5BR8O 1Y76B 3ZIAG 4KP4A 3H1JH 4QJFB 1Y67A 4IGGA 5L3BA 3JASA 2GUZB 3LSQA 3SGIA 1PPJH 1MABG 1MSDA 4AI8A 4JI6O 5BZBA 1OV9A 3N2GA 1PD3A 5FLXN 4PHZA 4GT1A 4DR7B 2NR5A 2BOCC 1YDXA 4G27B 3CP1A 4DV0O 3K0GA 4X64O 4IIJA 3UO2A 5KAIZ 4DRXB 2Q7GA 4O4JB 2OCHA 4B3SO 2HKOA 4DUYO 1VQ6V 3ABTA 1H2GA 1TVKA 3SJCC 1F4MA 2A3QA 3QTCA 3WG7C 3QO8A 3AG7A 2KKWA 2X6AA 2JJ1G 2HHHO 1QNMA 4MVOA 1H2SB 2XT9A 4FZ1A 2IJIA 4FPPA 4K0KO 2ITCC 3K04A 4B7KA 3TXSA 1NH2B 2N05A 3SPCA 3F7VC 4DV5B 1PNKA 1YVWA 4X1IB 1L0NH 3X2QB 4ZHQB 4MTOA 3RYFA 4LFBO 4F6RA 2VQEO 3P3NA 3UT5A 4JI0B 1RPRA 2E5LB 1GN6A 2AW9A 4JI1O 3DTUB 3ETGA 5JH7B 3G80A 3ZJZA 3K08A 2VWJA 4BWAA 3CJHA 2QWNB 1FAFA 1KKDA 2ETNA 2F95B 3ASNB 3GWOA 1VEWA 4K8XA 4DR7O 4BIOA 1N33B 1L1FA 4RQFA 3RYHB 1QR8A 3LUTB 1N4CA 2QKAA 4LC1A 1SERA 4OX9B 2RDCA 4TV9B 2GTAA 2Q9LA 3B77A 4WFFA 3RYIA 1N32B 2MW2B 2RJZA 1QCEA 2NN4A 3U0ZA 2XAJA 4CS4A 1GN4A 4DV7O 1KC8W 3ZS8C 4LFAO 1K5QA 4FVMA 1HNXO 1DF5A 4UCRA 4LF8O 1YF2A 3SYQA 4DR1O 5L3FA 1YEWA 1SQGA 5LP6C 1Q8IA 4PDLA 2JVDA 4WF9V 2ZE5A 2WLHA 3E8HA 3BA8A 1CPYA 3DGEA 1N32O 1XNQO 5B1AC 1IURA 2GHYA 2ADQB 4O4HB 3FX7A 3G67A 2EIMB 4CH4A 2P7TC 1Z5VA 1IXBA 3M7MX 2E75B 3FAVA 4Z2WA 4JI1B 2WAMA 1U96A 1IZ3A 3J80N 2Y69B 3AEIA 3F7YC 4GX2A 4JTAB 5LP6A 2GTSA 5DECA 4TQDA 4ZKIA 2PI4A 2HR3A 1HNZO 3AK1A 1QVFU 4LF9B 4MSWC 1Q5OA 1QLNA 4AQYO 1SRYA 3RWRD 3CRCA 4FZ0A 3KCYA 3K5OA 2EZPA 4I0XB 1S77D 1PL4A 1K34A 1KP2A 2ZT9B 1Y4MA 5IYZB 2L35A 3CSXA 3OMAB 5H6QA 5LXTA 3CWBH 1G1XB 4RAIA 2Y0IA 3AG3B 2R9RB 4YJ3A 1ZSPA 1I5XA 3W7WA 2RNBA 3FYIB 4PJ0Z 3OAAG 3TJTA 2PZSA 2XASA 2CE4A 3E35A 1GAXA 3BA9A 2OCCB 2L6LA 3LSUA 2YIBD 1W0KG 4I4TA 1K7DA 1OCCC 4C7UA 5JH7A 2UUBB 4LF7O 3G71V 1WA8B 4DV5O 5CA0A 2ATKC 1K4DC 2ZXWC 2LGWA 1GN3A 2LW7A 1AI6A 3RYFB 5FNVA 3ZHQA 1E79G 3OTFA 5IYBO 2HHHB 4QE7A 4W4KA 1JJ2U 2E5LO 2H3OA 3VOUA 2R9IA 3CCJV 4DV6O 3H1KH 2Q7EA 3WG7B 1Z2GA 1M57C 2YC0A 2DYSB 1XHZA 4LF4O 3QVNA 2UXCO 1OCCB 4H44B 1KECA 4JI5O 3JATB 1N34O 5EC1C 1F23A 2IU0A 3C3TA 4D6TH 2DYRC 1K4CC 2JRIA 1AVMA 4NTYA 4QPJA 4GX1A 1H2NA 3W7TA 3ASOB 1H38A 2EINC 4RQEA 4KFMA 3VQVA 1G8MA 4OGQB 4LFCB 1NTMH 4JI0O 4LH7A 2UUAB 3L74H 1Z5WA 3ASNC 1Q6HA 3N2GB 2ZE8A 4J9YB 3JD2A 3SYAA 3SPHA 4TUYB 1R3LC 4IT5A 1N36B 3ZCCA 1Q86W 1PM9A 1FXKA 2UXXA 2CAZC 2RMKB 3BRCA 3IJ4A 4DV1B 3JAKA 4GKJB 4JI2B 3OEHG 2RCVA 3FFQA 2IH1C 2FYUH 4UXNA 4DR4O 1KUQA 4UCSA 3W7XA 1YCIA 2O57A 3CRAA 2ZIOA 1XNQB 4J10A 1RFYA 5GONB 1VQ5V 1VP7A 2AZ0A 1VQ7V 4GZRB 4K0KB 2OIGA 1PKXA 4MVQA 3OT7A 4U7NA 5J9PC 4GKKO 2R70A 1N0JA 2F1MA 5B1AB 3ZBHA 4N23A 1H2KA 1MZFA 3WFVA 1M90W 1Q7YW 1Q81W 1JMKC 1VF5B 1DF4A 1IBMB 3APOA 4UCUA 1SC5B 4X66O 2ZM6O 1AILA 4G28B 2BOBC 3ICXA 1J5EO 2KG7B 4DR3O 1YJ9V 2DN9A 3ETEA 3HKDB 4HBNA 5JJNB 4L87A 1BE3H 2E76B 3FKSG 3MHHC 2VQEB 3OD4A 1VQ9V 2K1EA 1Y74A 2MK3A 5B1BC 1S5LZ 3K03A 2CTWA 1VQOV 1BL8A 3JARA 3CCMV 1VQKV 2P90A 2WWWA 1V9PA 1V54C 3E89A 3MDSA 5AG2A 2UUBO 4X1YB 5LMUO 3ZRXA 3JAKB 5JVDB 1GRJA 3FAVB 2QM4A 2P4VA 4U7OA 4Q6GA 1L8DA 2B1IA 3O9OA 3CCLV 4MW8A 1IDSA 4IL6Z 1M93A 3K9SA 5L3CA 2FTKA 4NTWA 4J80A 3VQYA 3U10A 5GONA 2WLIB 4FM2A 3K06A 2QWOB 4EFEA 3CC4V 4OXSA 3E83A 2ZDIA 4NR1A 4TQFA 4UCVA 1CP9A 1WLEA 3B2EE 1HDJA 1E1QG 4NVPA 3CRMA 5IY5C 2OCCC 3ETQA 4DR3B 4X62O 4NXMO 2QKCA 2P06A 3T4DA 3MD0A 2AHZA 1W59A 1MZEA 3SYOA 2M7WA 2JGDB 1NT2B 1MMMA 2P4KA 3P32A 4P30A 3DC5A 4F4LA 1Y76A 1TUBA 4DRXA 3E2EA 2PY5A 1Y74B 1M4UA 2V1DA 2ZDIC 1AR4A 1EZJA 4WFHA 3B40A 5KHGA 5IT9N 1AP5A 2YEVB 4I5SA 2KSDA 4LF9O 1D2DA 4FK5C 2DYSC 4B3TO 1NQTA 2CH7B 2ZNJA 4JZ2A 1X59A 4R50A 1HNWB 1Q43A 5CA0B 4NXNB 4EKWA 2EX3A 2QJ1A 1SQVH 4YY3B 3MHSC 1WNSA 3DXRB 3ZRVA 4U3JA 2BSKA 1EBOA 1KKCA 3ASOC 2PI5A 3H01A 3ABLB 5LHIA 4JI4O 3SR2C 5C93A 3NXSA 4LFBB 4WFAV 3CCSV 5GW7A 1N36O 4TV9A 2Q8VA 1AROP 1ZLZA 3A0RA 3JD1A 2UXDO 1TGOA 3M8AA 4JAVA 1YITV 3CC2V 3ZHRA 4FLWA 3OUFA 2LFSA 4Z1VA 2EBOA 1S0VA 2NLJC 2F66C 4PI0A 3UCSC 1KMIZ 3FYEB 3ZN0A 2JGUA 4B3RB 1YTFB 4YHHO 4TUYA 2DYRB 4PD4F 4WFEA 3HKEB 3KZIZ 3CS5A 3STZC 1F7YA 2YIBA 4ZOLA 1MG1A 1QU7A 4J42A 1VQMV 4KHPO 3A2FA 3K3WA 1SZXA 1NZ6A 3CCVV 4DK1A 5JJEB 3RW0A 4H37A 4LF8B 3HKBA 1NBMG 1Q6IA 4UUJC 4X20B 4DV4B 1BQZA 5EZYB 4RUEA 3CXCU 4YIPA 3OE7G 4FLXA 4ASUG 1HNZB 5H9CA 3CCRV 2HVJC 4JASA 3X2QC 4MVUA 1HWYA 4AQYB 3DSQA 2Y4TA 2GSMB 2EJ7A 1R3JC 3TXQA 3K59A 4B08A 2B5UA 5C8YA 1ORQC 2YXYA 3E22B 2QEXV 2W6JG 4FFBB 3QO5A 3CCQV 1BHAA 2WLIA 3ZX6A 5E1AC 2IW5A 1EN5A 1CEZA 1US6A 5TISZ 3JCZA 3A0BZ 5EK0A 3P30A 4MVRA 4AILC 2QA4V 2Q0OC 4B3MO 2WLKA 3MAQA 1JR9A 3ZRWB 1GKFA 1GH6A 1FPOA 1OCZC 1B6QA 3O65A 4GYCB 3RVZA 4RUFA 1HR0O 2RQ6A 4H13B 2ADPA 1XNRB 1NS1A 3D3QA 4YJ2B 1XMOO 1TUEB 2BTQA 4GCZA 4FLVA 3AG2C 1LR1A 2ZNIA 4XDJA 3G4SV 3UT5B 1GN2A 3D36A 3AG2B 2EINB 1R1BA 4DR5O 4F6EA 1IBKO 1DGSA 3CHXA 3B8MA 3ZN1A 1VF6C 2FL4A 3ML0A 2Q4PA 3A8TA 1BZKA 2H8PC 3BFRA 3L75H 5IY5B 4JI5B 1YIJV 3F5TA 1GM7A 1F51A 1AJQA 4NYKA 2WA4A 1G4YB 5KUKA 4B3TB 4GUNA 2WLLB 1QLEC 1Q3EA 1HNWO 4JI3O 1M56B 2EILC 4GX0A 1A32A 3N2KB 3K79A 1LUWA 5LYJB 2IBZH 3H9VA 4IHJA 5IE9A 1FJGO 1JX9A 4X64B 4P2ZA 1LUVA 3UQ8A 1Y6XA 5H6RA 4JI6B 4DUZB 1KBHA 4QPKA 1WB8A 2W0FC 1XUQA 2ITDC 4CC6A 4RWUA 5BMVA 3C3SA 5KAFZ 3HPLC 3EXAA 4B3MB 1AJNA 1BQ0A 5CMUA 2V4DA 4BAYA 5ITZB 2XAHA 2QWRB 4P9OA 5GTIZ 1K97A 4BIZA 3SPGA 3WB0A 1R6KA 1UJWB 2ARHA 4O4JA 1K9MW 3BVOA 1AI4A 4IIJB 4NB5A 3TGUH 4MW3A 1PV0A 5JVDA 3K9AA 1S5HC 1Q90D 4CH3A 4MVSA 4I9QA 3CMAV 2YI9A 4WFGA 5EYPB 2QSAA 5CB4B 4DYLA 2OWOA 3B4SA 1DTOA 5KX5A 2AHYA 2OT5A 4HNAB 4WBNA 3U11A 3VBBA 1WPXA 2VQFO 1XOUA 1FYJA 4H33A 1FXHA 4Q20A 2VRZA 3T1HB 2WA3A 2P22C 3BPZA 1FXKC 1BT8A 2YXHA 1OCRC 2D2CB 3TCUA 3E8FA 3T1YO 1PL0A 3E86A 3HKEA 2YIDA 2JK5C 4IYIA 5LGNA 4WFBV 4LF4B 1S76D 1HP8A 3OTOO 3J81N 4YY3O 4P9PA 5L3DA 5JQGA 4TV8B 1W2BU 1U97A 1VMGA 3ABMC 1ENVA 2W6IG 2FKXA 1NR1A 1RSOA 5J2UB 2LQTA 1O9GA 3GVMA 4DUYB 4DV3B 5IWAO 4LFAB 1FFXA 5FL7G 1FFXB 1AI7A 2CH7A 2VQFB 3E22A 3JD0A 1FS0G 1JFFA 5LXTB 1Q6UA 4KXRA 2ZINA 1GK9A 2DW4A 3CCUV 4LFCO 1TUBB 4O4HA 3T1YB 3L70H 3QG5A 1M1KW 3SJAC 3WB2A 2AZ2A 1YJNV 4GKJO 1RPOA 4AHCA 2Y69C 2DWDC 4RO2A 4LWSA 5KHKA 3C90A 1VARA 2XNDG 3ETDA 1WJZA 2XAFA 2CGOA 1Y66A 2ZE6A 4CS3A 2EULA 2YSUB 5D5QA 2IJJA 2ZXWB 2IM9A 3R65A 4CC5A 5EBWC 1FKAO 2ZKOA 3JCUZ 3RYCA 5KX5B 2Y48A 4U3FH 5EBMC 1OJHA 4JI7B 2RN9A 2AGAA 2CDYA 1IBMO 1GTOA 1QHTA 3JAWA 4N21A 2UUCB 4EEQA 3OM3B 5IWAB 4J9ZB 2CGNA 1LNQA 4LR3A 2JS5A 4UV9A 3D3IA 1M56C 2NNUA 3RYHA 4IYHA 1R3IC 3RT3C 3T2MA 1AB3A 2QR4A 5B66Z 4X65O 1EN6A 1SQXH 1VQPV 1CXZB 5BR8B 3UM7A 1VQLV 2ZM6B 2OTLV 4FLUA 2ZD9A 5EZYA 1B3QA 1ZWIC 2QKSA 2Q69A 5E79Z 4X8AA 4X1KA 3WU2Z 1S5JA 4PDRA 1AJPA 4LF7B 1I5YA 2EIJB 4DXWA 4UFZA 3DXRA 1YTFD 1SESA 4F6RB 4ZOLB 5KUMA 1YHQV 3JD3A 1XL6A 4NTXA 3SJQC 4UVCA 5GTHZ 4I55B 4XBFA 3K57A 3CX5F 2DQ3A 1NTKH 4DV7B 4LF6O 3JD4A 3G6BA 1HR0B 2F93B 3THOA 1R6TA 1AP6A 1WA8A 1KU9A 2GDSA 2XAQA 2BSKB 2E3CA 4U3JB 5CA3A 1H8HG 3CRRA 5L3EA 2YS8A 3Q4HA 5K1PA 1R73A 2VS0A 1H2LA 3I5DA 1NVPD 2CK3G 2WPDG 1XMQB 5LMUB 1M9NA 3SJBC 2ZE7A 4JAAA 1XI1A 2WLNA 2F4VB 3BHPA 4I55A 5KMGB 1J95A 4PA9A 3FB5C 3T4ZA 2JEXA 4O2AA 4CH6A 4MVZA 1SA0A 4K3AA 3H1LH 1M57B 2DOSA 3BABA 1VF6A 3L71H 3AK2A 1GMGA 2CTRA 4GKKB 3CD6V 3RFRA 1WPBA 2EIKC 4UCOA 1IVSA 4HNAA 5IYDO 4K8ZA 5KLVH 1NTZH 3L9DA 1JOYA 1VQ8V 5EIBD 2FMLA 2QWQB 4DR4B 1F4NA 3ABMB 3JAMN 4X1YA 5FNVB 1PP9H 4XDLA 1AI5A 4JTCB 2QGNA 3BAAA 2JGDA 1UFIA 1ZL8A 2EZOA 4DV0B 3IFXA 2LW1A 4FLTA 3ABUA 5BY1A 2IJKA 1NH2D 1VQ4V 1WN7A 4MT8A 2HJDA 1EN4A 5B1BB 5A9GA 2HG5C 2UXBB 3CXHF 3HR0A 1NVPB 5JCOA 3JASB 1URFA 2EILB 4ZBMA 4DK0A 1IX9A 4CZZA 2OTJV 1K73W 2D3OW 2LGQA 3SPJA 4L8JA 4MTGA 3T1HO 2QE7G 1N0NA 3ZRSA 1YZBA 3OFNG 3AK3A 3OEEG 5IYCO 1IXMA 3HKDA 2UXDB 5BMVB 3J7AU 1IBLO 5FPRA 1KP3A 2EJRA 1MNGA 4TOIA 1BS3A 1SZTA 1XREA 5IJ9B 2Q5ZA 4DR1B 2PF4E 4O2BB 5B3SB 2N04A 1GO3F 1QLEB 2A79B 5J2TA 2ZQMA 4UB8Z 1D5NA 2ZR2A 4UVAA 3D8CA 2ZIMA 1SETA 3RYIB 5KA5A 4HAMA 1X4TA 3OMNB 4DV2O 3BEHA 1SQFA 4EB6A 3WB1A 5LOVA 1Q82W 2B1GA 4YHHB 3KCXA 4BW5A 1XEQA 2CTPA 2UUAO 4GLXA 3OGCC 5KA6A 4NKGB 4JI2O 1H2MA 1W0JG 4JI3B 5KHJA 5F2VO 3KG2A 5J2TB 4MS2A 1RSOB 5J2UA 4HZ3A 4B7EA 1KQSU 1IBLB 2GV9A 3JAWB 2Y0PA 5IDJA 2QDOA 4XDKA 2ZR3A 1RM1C 1JA8A 4TV8A 1S72V 1JQ0A 4JI8O 3ABKC 2LJ2A 1EFRG 3LNNA 1SQBH 4JTDB 1XMQO 3E8GA 1I0HA 2X0LA 3FD9A 1EM1A 1BSMA 2A0LA 1O9HA 3SPIA 3HKBB 4DW1A 1R6NA 3L72H 5L3GA 3JSNA 2WLJA 3PN1A 2Z5UA 5LL6Y 1EZVH 1JCHA 4LF5O 1COWG 5FPOA 4JAUA 2X6BA 4GX5A 5DM6V 2LO1A 3OMIB 5CN0A 5LMNB 2ZCEA 1BCCH 4JI8B 4DR6O 5LHHA 1R3KC 1PNLA 2QM8A 4ICGA 4TWKA 5K1XA 4DR5B 4FFBA 1P4RA 4YIOA 1YI2V 2CTQA 5CA1B 4J7ZA 4FIPC 2JDIG 4JYCA 3B8NA 3CYOA 1KB9F 1YXBA 3JALA 5IJ0B 3AG1B 4EFBA 2Q67A 1QQCA 2HLDG 4O4IB 5CBHA 2KG7A 1K33A 1B06A 3LDEA 4X65B 3JARB 2Q7HA 2Z0AA 4ZIBA 2BE3A 3FB8C 4X20A 5HFLA 2KQXA 4CS2A 3CB2A 1XQ8A 1L0LH 3AG1C 4X88A 4LNUA 2KB1A 4DV4O 1SA0B 2YIAA 3ZHVA 4TSFG 4YJ3B 2W0XA 4YXWG 4FJCC 4DR6B 4JV5O 2BCCH 3ZMSA 3BCCH 1IBKB 5IJ9A 5EBLC 3IAYA 4UCTA 2UU9B 4DO2A 3A0HZ 4I0XA 5EIBC 2XOKG 3CC7V 4LH6A 4OPHA 2FB5A 4BW9A 3OTOB 4W4LA 2X6CA 4J41A 1J5EB 4EB6B 1E1RG 1PNMA 2WLLA 4DW0A 2N74A 2P67A 4X62B 3QNEA 4NXNO 3AG4C 2M6YA 1B04A 4J11A 2XTAA 5H2FZ 1I7FA 3LSSA 3K58A 2EIKB 2QM7A 3CRQA 2PGGA 1VF7A 5H5NA 4JYYA 1P7BA 1N33O 1HNXB 3VQXA 1RP3B 4I50B 5IYZA 1NJIW 2R72A 4PV1B 2K9PA 1BHBA 2Q68A 4PDMA 4JPRA 4X66B 2BTQB 2EIMC 2Q6AA 4QE9A 3ZMZA 1I94B 1AR5A 3ZMUA 5B1NA 1T5EA 1WP7A 2JS3A 4FFKA 4O4LB 1P49A 1S3JA 1YSCA 2WSSG 1TVKB 3SDLA 2GBOA 3OUSA 1P84F 5LBQA 4D7TA 5B3SC 1OCZB 1JVMA 4ABMA 1GM8A 4Z1MG 3F5WC 3EVKA 3KKYA 1QBZA 4PA4A 5LP6B 4I50A 4K35A 3HKCA 1JFFB 3OW2U 3W7UA 4OPAA 3QO7A 2GUZA 2Q0AA 4HYOA 1ROPA 4TT3G 5LGUA 2DWEC 3N2KA 4R7CA 5CB4A 1GM9A 3RYCB 5EYPA 2F23A 1XHXA 2Q73A 5KHIA 1KYOF 2HJFC 3CJHB 3K0DA 2X7RB 4LP8A 1N34B 3HKCB 3E8BA 2IU3A 1V54B 2UUCO 3RVYA 2QTOA 4CBCA 3LDCA 3RBZA 2XAGA 5BXZA 4FM1A 4NXMB 2Z3YA 3STLC 4MTXA 1V55B 2JIZG 3EHBB 1XDCA 3Q4HB 2UXBO 4X9QA 5JWPA 4KHPB 1XBLA 5ITZA 1I94O 3ZMVA 2WLMA 3GB7C 5B1OA 1AR1B 4IHJB 3I55V 3B09A 5A2QN 5LYJA 3K5NA 2YXLA 4X1KB 4DV3O 2XHBA 2DJVA 4O2AB 3G6EV 1QVGU 3TETA 5JCOC 1NU1H 2F4VO 1YJWV 2DQ0A 2F43G 3ZHTA 4DV1O 4BR6A 2YUAA 1K92A 2CUGA 4J7JA 1OCOC 1ZTEA 4OX9O 1SQPH 2YDEA 2YEVA 3FB7C 2E74B 1I08A 3UO3A 2XUMA 3ZMTA 4LCUC 4PI2A 1RM1B 4R8CA 3W7SA 5D5PA 3AG3C 1VIBA 4DV2B 4JI7O 4E2LA 2HFEC 3LDDA 4ZI7A 1K8AW 4LNUB 3EFFK 1ZL8B 4FLZA 1MA1A 4A5UB 2YICA 5KHHA 4PDVA 4QNHB 2PYJA 1K3EA 1BMFG 1TAEA 4JYBA 1JJOA 2PTMA 4I9WA 4ZHQA 1NKDA 1SF9A 3VQWA 2UU9O 4PA6A 3OR7C 5B5EZ 4MVMA 3ABLC 2H94A 2BTOA 4PA3A 1FXVA 1ZUQA 5DN6G 4WCEV 5LGTA 1THZA 2P5OA 3ZEDA 5CBGA 1XILA 3LNMB 3BY6A 5CBFA 4FLYA 2A7WA 3H1IH 4FMTA 4B3RO 2B9ZA 1P7GA 4LBEC 2AXTZ 3K5LA 2EIJC 1FXKB 1WAZA 2QTSA 1BGYH 2UXNA 3TK1A 2PYLA 4J7KA 3APQA 2ODMA 5C8YB 5EC2C 4UV8A 2C2AA 1NR7A 1OCRB 5IJ0A 3K5MA 4LF6B 3JYCA 4LWSB 4JYAB 5KMGA 1N8RW 4BIUA 1SKVA 3H1HH 3AG4B 1WB7A 1OZ0A 2DE0X 4X89A 2LP7A 4QGPA 1NI8A 1ZAUA 3CCEV 4FM0A 4JF3A 3I56V 3GWKC 5LA6B 4QIWF 2DMXA 3JATA 3S3XA 2G38A 3D36C 4R6ZA 3OR6C 4YJ2A 4DUZO 3HB3B
chains in the Genus database with same CATH topology
1Q82W 2B1GA 4QPKA 2IH3C 3ZCCA 1XL4A 2W0FC 1Q86W 2ITDC 1VQNV 1FXKA 1JPXA 4BW5A 2UXXA 3HPLC 1QR9A 3OGCC 5KA6A 1AJNA 1W0JG 2P6JA 3OEHG 5CMUA 2IJHA 1MSWD 3ZRWA 2IH1C 2JEUA 4BAYA 2XAHA 4P9OA 3KG2A 4KUMA 4UXNA 2JJ2G 1K97A 4BIZA 4MS2A 3CPWU 1H8EG 4HZ3A 3W7XA 3SPGA 1R6KA 4PA7A 4G2KA 1KQSU 1UJWB 5IDJA 1K9MW 1VQ5V 4XDKA 2ZR3A 1VQ7V 1RM1C 1AI4A 1S72V 1KD1W 1JQ0A 1PKXA 4MW3A 3ABKC 3K9AA 1S5HC 4JGSA 4MVQA 4U7NA 5J9PC 3IGAC 1EFRG 5B1AB 4JTDB 3CMEV 3E8GA 2X0LA 3ABKB 2HVKC 4MVSA 4N23A 3FB6C 1V55C 3CMAV 2A0LA 3WFVA 1M90W 3SPIA 4WFGA 1Q7YW 1R6NA 5L3GA 1Q81W 1DTOA 2WLJA 1DF4A 2AHYA 2Z5UA 2OT5A 5HFMA 3VBBA 3SYPA 1JCHA 3IC7A 5LHGA 3SYCA 1WPXA 1K5SA 1COWG 3PJSK 4G28B 4H33A 2BOBC 4JAUA 2X6BA 1FXHA 4GX5A 1YJ9V 4PELA 5DM6V 4Q20A 3ETEA 3OMIB 4UVBA 3M99B 4L87A 1FFTB 3FKSG 5CN0A 3MHHC 1FXKC 3UKMA 1DLBA 1VQ9V 2K1EA 2LFRA 1R3KC 2MK3A 5B1BC 5LHHA 1PNLA 2QM8A 4TWKA 1OCRC 3K03A 3T1CA 3TCUA 3E8FA 1OCOB 1BL8A 1P4RA 1VQOV 1PL0A 1YI2V 3E86A 4FIPC 2JDIG 3CCMV 1MOFA 4JYCA 1VQKV 3B8NA 2JK5C 3CYOA 2P90A 5LGNA 4WFBV 2WWWA 3AG1B 1S76D 1V54C 3E89A 2V7QG 4P9PA 5L3DA 1OHHG 2A9HA 4MTFA 2Q67A 1W2BU 2HLDG 3ABMC 3ZIAG 3ZRXA 4KP4A 5CBHA 1ENVA 2W6IG 4QJFB 1K33A 4U7OA 5L3BA 3LDEA 3LSQA 1NR1A 2B1IA 1MABG 3FB8C 5HFLA 5BZBA 1PD3A 3CCLV 4GT1A 4MW8A 2BOCC 5FL7G 1AI7A 4G27B 3CP1A 5L3CA 3K0GA 2FTKA 3JD0A 1FS0G 3AG1C 4X88A 2KB1A 2WLIB 3K06A 4TSFG 4YXWG 1GK9A 4FJCC 2DW4A 3CCUV 3CC4V 4OXSA 2HKOA 3E83A 2ZDIA 1VQ6V 3ABTA 1CP9A 1H2GA 1WLEA 3ZMSA 1E1QG 1M1KW 1F4MA 5EBLC 5IY5C 2OCCC 4DO2A 3WG7C 3QO8A 2XOKG 1YJNV 2X6AA 3CC7V 1RPOA 2JJ1G 3MD0A 3T4DA 2Y69C 2AHZA 2DWDC 4RO2A 4MVOA 2IJIA 4FPPA 2ITCC 3K04A 3SYOA 2X6CA 2M7WA 2XNDG 3ETDA 3P32A 1NH2B 4P30A 3SPCA 3F7VC 2XAFA 1Y66A 1E1RG 4F4LA 1PNMA 2WLLA 1PNKA 3E2EA 2P67A 2YSUB 3X2QB 3QNEA 4MTOA 3AG4C 2IJJA 2ZXWB 2V1DA 2ZDIC 3LSSA 1EZJA 2EIKB 4WFHA 2QM7A 1RPRA 3R65A 2YEVB 1P7BA 3DTUB 4I5SA 5EBWC 4FK5C 2DYSC 3ETGA 1NQTA 3ZJZA 3K08A 4R50A 2Y48A 5EBMC 1KKDA 1NJIW 4EKWA 3ASNB 1BHBA 1GTOA 2Q68A 3GWOA 4PDMA 4JPRA 4N21A 3MHSC 2EIMC 3OM3B 2Q6AA 4J9ZB 4QE9A 1LNQA 3ZMZA 3ZRVA 3ZMUA 1EBOA 4UV9A 3D3IA 1M56C 5B1NA 2NNUA 3ASOC 1YSCA 1S3JA 2PI5A 1L1FA 2WSSG 4RQFA 3H01A 3ABLB 1R3IC 1QR8A 5LHIA 3LUTB 3T2MA 3OUSA 5C93A 3NXSA 4WFAV 4LC1A 3CCSV 1SERA 5GW7A 5LBQA 1VQPV 1AROP 3UM7A 1VQLV 5B3SC 1OCZB 1JVMA 3A0RA 1GM8A 3JD1A 4Z1MG 3F5WC 2OTLV 3B77A 1QBZA 2ZD9A 1ZWIC 2QKSA 2Q69A 4PA4A 4JAVA 4WFFA 1YITV 3CC2V 4X8AA 3OUFA 2LFSA 1QCEA 2XAJA 3OW2U 2EBOA 1S0VA 2NLJC 4PDRA 1AJPA 1KC8W 3W7UA 3QO7A 1I5YA 2EIJB 4DXWA 1YTFD 1K5QA 1SESA 4HYOA 5KUMA 1DF5A 1ROPA 4TT3G 1YHQV 5LGUA 2DWEC 3JD3A 3FYEB 4R7CA 1XL6A 3ZN0A 1GM9A 3SYQA 3SJQC 4UVCA 5L3FA 4XBFA 2HJFC 3K0DA 2DQ3A 2X7RB 1YTFB 4LP8A 2DYRB 2IU3A 1V54B 3E8BA 3JD4A 4PDLA 4WF9V 3RVYA 2WLHA 3E8HA 4WFEA 2QTOA 1CPYA 4CBCA 2XAQA 3DGEA 3STZC 3LDCA 3RBZA 5CA3A 2XAGA 1H8HG 5B1AC 2Z3YA 2GHYA 3STLC 4MTXA 1MG1A 5L3EA 1V55B 2JIZG 3EHBB 1VQMV 2EIMB 3K3WA 2P7TC 1R73A 1NVPD 2CK3G 2WPDG 3CCVV 3ZMVA 2WLMA 3GB7C 5B1OA 1M9NA 2WAMA 4H37A 3RW0A 1AR1B 3I55V 1NBMG 2WLNA 4UUJC 2Y69B 3AEIA 3F7YC 4GX2A 4JTAB 1J95A 4RUEA 3CXCU 3OE7G 4PA9A 4ASUG 4ZKIA 2PI4A 3FB5C 3T4ZA 2HR3A 2JEXA 3G6EV 5H9CA 3CCRV 1QVGU 4MVZA 3TETA 2HVJC 1QVFU 4JASA 4MSWC 3X2QC 1YJWV 2DQ0A 2F43G 4MVUA 1M57B 1HWYA 1K92A 1QLNA 2GSMB 1OCOC 1R3JC 1SRYA 1GMGA 2YEVA 3FB7C 3CD6V 2B5UA 1ORQC 2EZPA 2EIKC 2QEXV 2W6JG 5IYDO 3ZMTA 4LCUC 1K34A 1KP2A 1RM1B 3QO5A 1S77D 1Y4MA 3CCQV 4R8CA 3W7SA 3AG3C 4E2LA 2WLIA 2HFEC 3LDDA 1BHAA 1JOYA 5H6QA 3OMAB 1K8AW 3EFFK 4RAIA 5E1AC 1VQ8V 2IW5A 3AG3B 1CEZA 2R9RB 1I5XA 4PDVA 4QNHB 1K3EA 3JCZA 1F4NA 5EK0A 3ABMB 3W7WA 1BMFG 3P30A 4MVRA 2QA4V 3FYIB 4JYBA 3OAAG 4I9WA 1NKDA 2XASA 2WLKA 1AI5A 4XDLA 3ZRWB 3E35A 4PA6A 3OR7C 1GKFA 2OCCB 4MVMA 4JTCB 3ABLC 2H94A 4PA3A 1W0KG 1FXVA 1OCZC 1K7DA 1B6QA 1OCCC 5DN6G 3RVZA 4WCEV 4RUFA 3G71V 5LGTA 2EZOA 1THZA 3IFXA 5CBGA 3ABUA 3LNMB 3BY6A 2IJKA 2ATKC 1K4DC 2ZXWC 5CBFA 1NH2D 1AI6A 1VQ4V 1TUEB 4FMTA 4GCZA 4MT8A 3AG2C 1E79G 5B1BB 5IYBO 4XDJA 2HG5C 4LBEC 4QE7A 3G4SV 1JJ2U 1NVPB 2EIJC 1FXKB 3VOUA 3D36A 3AG2B 2EILB 2EINB 2R9IA 3CCJV 4ZBMA 2UXNA 3WG7B 4CZZA 3TK1A 1K73W 2OTJV 3B8MA 3ZN1A 2D3OW 1M57C 3ML0A 3SPJA 2DYSB 4MTGA 5EC2C 4UV8A 2H8PC 2C2AA 5IY5B 2QE7G 1OCCB 1NR7A 1KECA 3ZRSA 1OCRB 1YIJV 1GM7A 5EC1C 3JYCA 1F51A 1F23A 1AJQA 3OFNG 2IU0A 1N8RW 3OEEG 4BIUA 5IYCO 1G4YB 1IXMA 5KUKA 2DYRC 1KP3A 1K4CC 2EJRA 2WLLB 3AG4B 1OZ0A 4QPJA 4GX1A 1SZTA 1QLEC 4X89A 2LP7A 3W7TA 3ASOB 5B3SB 3CCEV 1H38A 1M56B 1GO3F 2EILC 2EINC 1QLEB 4JF3A 4GX0A 4RQEA 4KFMA 2A79B 1G8MA 3K79A 3I56V 2ZQMA 4QIWF 2ZR2A 3ASNC 1JX9A 4UVAA 4P2ZA 1SETA 5KA5A 4HAMA 4R6ZA 3OMNB 4J9YB 3JD2A 3BEHA 3OR6C 3SYAA 3SPHA 5H6RA 1R3LC 3HB3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IH3 C;  3AG3 C;  1XL4 A;  2W0F C;  3UM7 A;  2ITD C;  2HFE C;  1JVM A;  2WLI A;  3LDD A;  3LDE A;  5B3S C;  4BW5 A;  3F5W C;  3EFF K;  4RAI A;  5E1A C;  2ZD9 A;  1ZWI C;  2QKS A;  2Q69 A;  4PA4 A;  4WFF A;  3FB8 C;  2R9R B;  4PDV A;  4QNH B;  3HPL C;  5BZB A;  3OGC C;  5EK0 A;  4MW8 A;  4X8A A;  4MVR A;  2BOC C;  3OUF A;  4G27 B;  3K0G A;  2IH1 C;  4P9O A;  3KG2 A;  4I9W A;  4MS2 A;  2NLJ C;  2WLK A;  3AG1 C;  4PDR A;  4HZ3 A;  4X88 A;  4XDL A;  4PA6 A;  3OR7 C;  2KB1 A;  4DXW A;  4MVM A;  2WLI B;  4JTC B;  3K06 A;  3SPG A;  4PA7 A;  3ABL C;  4HYO A;  5KUM A;  4PA3 A;  2DWE C;  4R7C A;  1OCZ C;  1XL6 A;  4OXS A;  1OCC C;  4XDK A;  3RVZ A;  3SYQ A;  4RUF A;  3E83 A;  3SJQ C;  3IFX A;  5CBG A;  3LNM B;  2HJF C;  3K0D A;  2ATK C;  1K4D C;  2ZXW C;  2OCC C;  4MW3 A;  3ABK C;  5EBL C;  1S5H C;  4MVQ A;  4LP8 A;  5CBF A;  5J9P C;  3WG7 C;  3E8B A;  3IGA C;  4PDL A;  2X6A A;  4JTD B;  3T4D A;  3E8G A;  4MVS A;  2HVK C;  2WLH A;  2AHZ A;  1V55 C;  2DWD C;  2Y69 C;  3AG2 C;  2QTO A;  2A0L A;  3E8H A;  3FB6 C;  4MVO A;  2HG5 C;  4LBE C;  4QE7 A;  4XDJ A;  4CBC A;  2ITC C;  3K04 A;  3SPI A;  3SYO A;  2X6C A;  4WFG A;  2EIJ C;  3LDC A;  3STZ C;  3RBZ A;  3VOU A;  4P30 A;  4ZBM A;  3F7V C;  3SPC A;  5B1A C;  2WLJ A;  3STL C;  3RVY A;  4F4L A;  2AHY A;  2WLL A;  1M57 C;  2P7T C;  3SPJ A;  3SYP A;  4MTG A;  5EC2 C;  3SYC A;  2H8P C;  4MTO A;  3AG4 C;  3PJS K;  4G28 B;  4H33 A;  2BOB C;  2X6B A;  2WLM A;  3GB7 C;  4GX5 A;  4H37 A;  3RW0 A;  3ZRS A;  4WFH A;  5EC1 C;  3JYC A;  2WLN A;  4UUJ C;  3F7Y C;  4GX2 A;  1G4Y B;  4JTA B;  3R65 A;  5KUK A;  1P7B A;  1J95 A;  2DYR C;  4RUE A;  5EBW C;  2DYS C;  1K4C C;  4PA9 A;  2WLL B;  3UKM A;  3ZJZ A;  3K08 A;  3FB5 C;  3T4Z A;  4GX1 A;  2K1E A;  4R50 A;  1R3K C;  5EBM C;  1QLE C;  4X89 A;  5B1B C;  4TWK A;  1KKD A;  1OCR C;  4EKW A;  3K03 A;  4MVZ A;  4WFE A;  2HVJ C;  3E8F A;  1BL8 A;  3T1C A;  3TCU A;  2EIL C;  2EIN C;  3TET A;  3E86 A;  4GX0 A;  2Q68 A;  4KFM A;  2A79 B;  4MSW C;  4PDM A;  3X2Q C;  4MVU A;  2JK5 C;  2EIM C;  2Q6A A;  4J9Z B;  4QE9 A;  1LNQ A;  1V54 C;  3ASN C;  1M56 C;  1OCO C;  1R3J C;  3E89 A;  4P2Z A;  4RO2 A;  3ASO C;  2YEV A;  4P9P A;  5IY5 C;  3FB7 C;  1R3I C;  2A9H A;  4MTF A;  1ORQ C;  2Q67 A;  3LUT B;  4J9Y B;  2EIK C;  4R6Z A;  3BEH A;  3T2M A;  3OUS A;  3OR6 C;  3SYA A;  3SPH A;  3ABM C;  5CBH A;  4LCU C;  1R3L C;  4R8C A; 
#chains in the Genus database with same CATH topology
 1WP8 A;  2IH3 C;  1XL4 A;  1VQN V;  2R9A A;  1JPX A;  2Y4U A;  1FJG B;  3IC9 A;  3L73 H;  3S3W A;  4DR2 O;  3CEI A;  1QR9 A;  4O4L A;  1ZX3 A;  2P6J A;  2QWP B;  2IJH A;  3R66 A;  1MSW D;  3ZRW A;  2JEU A;  4KUM A;  2JJ2 G;  3CPW U;  1H8E G;  4JV5 B;  4ZI7 B;  1FD9 A;  4I4T B;  2HP8 A;  4CH5 A;  4PA7 A;  4G2K A;  5LOV B;  4KL1 A;  4WBN B;  3DC6 A;  1KD1 W;  4JGS A;  3RGB A;  4O4I A;  3IGA C;  4UB6 Z;  3CME V;  2PUS A;  3CE2 A;  3QF7 A;  4DV6 B;  1D5A A;  3ABK B;  2HVK C;  1V55 C;  3FB6 C;  4H0L B;  5JJJ B;  3OGI B;  3ZHS A;  5LA6 A;  2OYQ A;  4B3S B;  4E4E A;  2A06 H;  3N27 A;  5CA1 A;  3NR7 A;  4I7Z B;  5HFM A;  3SYP A;  5JQG B;  3IC7 A;  5LHG A;  4JYA O;  3SYC A;  1K5S A;  1M5I A;  3JSL A;  3PJS K;  1XNR O;  2HEP A;  4PEL A;  2ILM A;  1G6U A;  1SQQ H;  4UVB A;  3M99 B;  1UPG A;  4JI4 B;  2UXC B;  1FFT B;  5LMN O;  4X1I A;  3P3P A;  5DED A;  3UKM A;  4O2B A;  1DLB A;  2LFR A;  3RN4 A;  2YI8 A;  1HW7 A;  3ZHU A;  4D7S A;  3T1C A;  1OCO B;  4DR2 B;  1MOF A;  1XMO B;  4JZG A;  2VWK A;  1TA8 A;  3JAL B;  2OIE A;  2V7Q G;  1OHH G;  1DK1 A;  2A9H A;  4MTF A;  4LF5 B;  1SS3 A;  5BR8 O;  1Y76 B;  3ZIA G;  4KP4 A;  3H1J H;  4QJF B;  1Y67 A;  4IGG A;  5L3B A;  3JAS A;  2GUZ B;  3LSQ A;  3SGI A;  1PPJ H;  1MAB G;  1MSD A;  4AI8 A;  4JI6 O;  5BZB A;  1OV9 A;  3N2G A;  1PD3 A;  5FLX N;  4PHZ A;  4GT1 A;  4DR7 B;  2NR5 A;  2BOC C;  1YDX A;  4G27 B;  3CP1 A;  4DV0 O;  3K0G A;  4X64 O;  4IIJ A;  3UO2 A;  5KAI Z;  4DRX B;  2Q7G A;  4O4J B;  2OCH A;  4B3S O;  2HKO A;  4DUY O;  1VQ6 V;  3ABT A;  1H2G A;  1TVK A;  3SJC C;  1F4M A;  2A3Q A;  3QTC A;  3WG7 C;  3QO8 A;  3AG7 A;  2KKW A;  2X6A A;  2JJ1 G;  2HHH O;  1QNM A;  4MVO A;  1H2S B;  2XT9 A;  4FZ1 A;  2IJI A;  4FPP A;  4K0K O;  2ITC C;  3K04 A;  4B7K A;  3TXS A;  1NH2 B;  2N05 A;  3SPC A;  3F7V C;  4DV5 B;  1PNK A;  1YVW A;  4X1I B;  1L0N H;  3X2Q B;  4ZHQ B;  4MTO A;  3RYF A;  4LFB O;  4F6R A;  2VQE O;  3P3N A;  3UT5 A;  4JI0 B;  1RPR A;  2E5L B;  1GN6 A;  2AW9 A;  4JI1 O;  3DTU B;  3ETG A;  5JH7 B;  3G80 A;  3ZJZ A;  3K08 A;  2VWJ A;  4BWA A;  3CJH A;  2QWN B;  1FAF A;  1KKD A;  2ETN A;  2F95 B;  3ASN B;  3GWO A;  1VEW A;  4K8X A;  4DR7 O;  4BIO A;  1N33 B;  1L1F A;  4RQF A;  3RYH B;  1QR8 A;  3LUT B;  1N4C A;  2QKA A;  4LC1 A;  1SER A;  4OX9 B;  2RDC A;  4TV9 B;  2GTA A;  2Q9L A;  3B77 A;  4WFF A;  3RYI A;  1N32 B;  2MW2 B;  2RJZ A;  1QCE A;  2NN4 A;  3U0Z A;  2XAJ A;  4CS4 A;  1GN4 A;  4DV7 O;  1KC8 W;  3ZS8 C;  4LFA O;  1K5Q A;  4FVM A;  1HNX O;  1DF5 A;  4UCR A;  4LF8 O;  1YF2 A;  3SYQ A;  4DR1 O;  5L3F A;  1YEW A;  1SQG A;  5LP6 C;  1Q8I A;  4PDL A;  2JVD A;  4WF9 V;  2ZE5 A;  2WLH A;  3E8H A;  3BA8 A;  1CPY A;  3DGE A;  1N32 O;  1XNQ O;  5B1A C;  1IUR A;  2GHY A;  2ADQ B;  4O4H B;  3FX7 A;  3G67 A;  2EIM B;  4CH4 A;  2P7T C;  1Z5V A;  1IXB A;  3M7M X;  2E75 B;  3FAV A;  4Z2W A;  4JI1 B;  2WAM A;  1U96 A;  1IZ3 A;  3J80 N;  2Y69 B;  3AEI A;  3F7Y C;  4GX2 A;  4JTA B;  5LP6 A;  2GTS A;  5DEC A;  4TQD A;  4ZKI A;  2PI4 A;  2HR3 A;  1HNZ O;  3AK1 A;  1QVF U;  4LF9 B;  4MSW C;  1Q5O A;  1QLN A;  4AQY O;  1SRY A;  3RWR D;  3CRC A;  4FZ0 A;  3KCY A;  3K5O A;  2EZP A;  4I0X B;  1S77 D;  1PL4 A;  1K34 A;  1KP2 A;  2ZT9 B;  1Y4M A;  5IYZ B;  2L35 A;  3CSX A;  3OMA B;  5H6Q A;  5LXT A;  3CWB H;  1G1X B;  4RAI A;  2Y0I A;  3AG3 B;  2R9R B;  4YJ3 A;  1ZSP A;  1I5X A;  3W7W A;  2RNB A;  3FYI B;  4PJ0 Z;  3OAA G;  3TJT A;  2PZS A;  2XAS A;  2CE4 A;  3E35 A;  1GAX A;  3BA9 A;  2OCC B;  2L6L A;  3LSU A;  2YIB D;  1W0K G;  4I4T A;  1K7D A;  1OCC C;  4C7U A;  5JH7 A;  2UUB B;  4LF7 O;  3G71 V;  1WA8 B;  4DV5 O;  5CA0 A;  2ATK C;  1K4D C;  2ZXW C;  2LGW A;  1GN3 A;  2LW7 A;  1AI6 A;  3RYF B;  5FNV A;  3ZHQ A;  1E79 G;  3OTF A;  5IYB O;  2HHH B;  4QE7 A;  4W4K A;  1JJ2 U;  2E5L O;  2H3O A;  3VOU A;  2R9I A;  3CCJ V;  4DV6 O;  3H1K H;  2Q7E A;  3WG7 B;  1Z2G A;  1M57 C;  2YC0 A;  2DYS B;  1XHZ A;  4LF4 O;  3QVN A;  2UXC O;  1OCC B;  4H44 B;  1KEC A;  4JI5 O;  3JAT B;  1N34 O;  5EC1 C;  1F23 A;  2IU0 A;  3C3T A;  4D6T H;  2DYR C;  1K4C C;  2JRI A;  1AVM A;  4NTY A;  4QPJ A;  4GX1 A;  1H2N A;  3W7T A;  3ASO B;  1H38 A;  2EIN C;  4RQE A;  4KFM A;  3VQV A;  1G8M A;  4OGQ B;  4LFC B;  1NTM H;  4JI0 O;  4LH7 A;  2UUA B;  3L74 H;  1Z5W A;  3ASN C;  1Q6H A;  3N2G B;  2ZE8 A;  4J9Y B;  3JD2 A;  3SYA A;  3SPH A;  4TUY B;  1R3L C;  4IT5 A;  1N36 B;  3ZCC A;  1Q86 W;  1PM9 A;  1FXK A;  2UXX A;  2CAZ C;  2RMK B;  3BRC A;  3IJ4 A;  4DV1 B;  3JAK A;  4GKJ B;  4JI2 B;  3OEH G;  2RCV A;  3FFQ A;  2IH1 C;  2FYU H;  4UXN A;  4DR4 O;  1KUQ A;  4UCS A;  3W7X A;  1YCI A;  2O57 A;  3CRA A;  2ZIO A;  1XNQ B;  4J10 A;  1RFY A;  5GON B;  1VQ5 V;  1VP7 A;  2AZ0 A;  1VQ7 V;  4GZR B;  4K0K B;  2OIG A;  1PKX A;  4MVQ A;  3OT7 A;  4U7N A;  5J9P C;  4GKK O;  2R70 A;  1N0J A;  2F1M A;  5B1A B;  3ZBH A;  4N23 A;  1H2K A;  1MZF A;  3WFV A;  1M90 W;  1Q7Y W;  1Q81 W;  1JMK C;  1VF5 B;  1DF4 A;  1IBM B;  3APO A;  4UCU A;  1SC5 B;  4X66 O;  2ZM6 O;  1AIL A;  4G28 B;  2BOB C;  3ICX A;  1J5E O;  2KG7 B;  4DR3 O;  1YJ9 V;  2DN9 A;  3ETE A;  3HKD B;  4HBN A;  5JJN B;  4L87 A;  1BE3 H;  2E76 B;  3FKS G;  3MHH C;  2VQE B;  3OD4 A;  1VQ9 V;  2K1E A;  1Y74 A;  2MK3 A;  5B1B C;  1S5L Z;  3K03 A;  2CTW A;  1VQO V;  1BL8 A;  3JAR A;  3CCM V;  1VQK V;  2P90 A;  2WWW A;  1V9P A;  1V54 C;  3E89 A;  3MDS A;  5AG2 A;  2UUB O;  4X1Y B;  5LMU O;  3ZRX A;  3JAK B;  5JVD B;  1GRJ A;  3FAV B;  2QM4 A;  2P4V A;  4U7O A;  4Q6G A;  1L8D A;  2B1I A;  3O9O A;  3CCL V;  4MW8 A;  1IDS A;  4IL6 Z;  1M93 A;  3K9S A;  5L3C A;  2FTK A;  4NTW A;  4J80 A;  3VQY A;  3U10 A;  5GON A;  2WLI B;  4FM2 A;  3K06 A;  2QWO B;  4EFE A;  3CC4 V;  4OXS A;  3E83 A;  2ZDI A;  4NR1 A;  4TQF A;  4UCV A;  1CP9 A;  1WLE A;  3B2E E;  1HDJ A;  1E1Q G;  4NVP A;  3CRM A;  5IY5 C;  2OCC C;  3ETQ A;  4DR3 B;  4X62 O;  4NXM O;  2QKC A;  2P06 A;  3T4D A;  3MD0 A;  2AHZ A;  1W59 A;  1MZE A;  3SYO A;  2M7W A;  2JGD B;  1NT2 B;  1MMM A;  2P4K A;  3P32 A;  4P30 A;  3DC5 A;  4F4L A;  1Y76 A;  1TUB A;  4DRX A;  3E2E A;  2PY5 A;  1Y74 B;  1M4U A;  2V1D A;  2ZDI C;  1AR4 A;  1EZJ A;  4WFH A;  3B40 A;  5KHG A;  5IT9 N;  1AP5 A;  2YEV B;  4I5S A;  2KSD A;  4LF9 O;  1D2D A;  4FK5 C;  2DYS C;  4B3T O;  1NQT A;  2CH7 B;  2ZNJ A;  4JZ2 A;  1X59 A;  4R50 A;  1HNW B;  1Q43 A;  5CA0 B;  4NXN B;  4EKW A;  2EX3 A;  2QJ1 A;  1SQV H;  4YY3 B;  3MHS C;  1WNS A;  3DXR B;  3ZRV A;  4U3J A;  2BSK A;  1EBO A;  1KKC A;  3ASO C;  2PI5 A;  3H01 A;  3ABL B;  5LHI A;  4JI4 O;  3SR2 C;  5C93 A;  3NXS A;  4LFB B;  4WFA V;  3CCS V;  5GW7 A;  1N36 O;  4TV9 A;  2Q8V A;  1ARO P;  1ZLZ A;  3A0R A;  3JD1 A;  2UXD O;  1TGO A;  3M8A A;  4JAV A;  1YIT V;  3CC2 V;  3ZHR A;  4FLW A;  3OUF A;  2LFS A;  4Z1V A;  2EBO A;  1S0V A;  2NLJ C;  2F66 C;  4PI0 A;  3UCS C;  1KMI Z;  3FYE B;  3ZN0 A;  2JGU A;  4B3R B;  1YTF B;  4YHH O;  4TUY A;  2DYR B;  4PD4 F;  4WFE A;  3HKE B;  3KZI Z;  3CS5 A;  3STZ C;  1F7Y A;  2YIB A;  4ZOL A;  1MG1 A;  1QU7 A;  4J42 A;  1VQM V;  4KHP O;  3A2F A;  3K3W A;  1SZX A;  1NZ6 A;  3CCV V;  4DK1 A;  5JJE B;  3RW0 A;  4H37 A;  4LF8 B;  3HKB A;  1NBM G;  1Q6I A;  4UUJ C;  4X20 B;  4DV4 B;  1BQZ A;  5EZY B;  4RUE A;  3CXC U;  4YIP A;  3OE7 G;  4FLX A;  4ASU G;  1HNZ B;  5H9C A;  3CCR V;  2HVJ C;  4JAS A;  3X2Q C;  4MVU A;  1HWY A;  4AQY B;  3DSQ A;  2Y4T A;  2GSM B;  2EJ7 A;  1R3J C;  3TXQ A;  3K59 A;  4B08 A;  2B5U A;  5C8Y A;  1ORQ C;  2YXY A;  3E22 B;  2QEX V;  2W6J G;  4FFB B;  3QO5 A;  3CCQ V;  1BHA A;  2WLI A;  3ZX6 A;  5E1A C;  2IW5 A;  1EN5 A;  1CEZ A;  1US6 A;  5TIS Z;  3JCZ A;  3A0B Z;  5EK0 A;  3P30 A;  4MVR A;  4AIL C;  2QA4 V;  2Q0O C;  4B3M O;  2WLK A;  3MAQ A;  1JR9 A;  3ZRW B;  1GKF A;  1GH6 A;  1FPO A;  1OCZ C;  1B6Q A;  3O65 A;  4GYC B;  3RVZ A;  4RUF A;  1HR0 O;  2RQ6 A;  4H13 B;  2ADP A;  1XNR B;  1NS1 A;  3D3Q A;  4YJ2 B;  1XMO O;  1TUE B;  2BTQ A;  4GCZ A;  4FLV A;  3AG2 C;  1LR1 A;  2ZNI A;  4XDJ A;  3G4S V;  3UT5 B;  1GN2 A;  3D36 A;  3AG2 B;  2EIN B;  1R1B A;  4DR5 O;  4F6E A;  1IBK O;  1DGS A;  3CHX A;  3B8M A;  3ZN1 A;  1VF6 C;  2FL4 A;  3ML0 A;  2Q4P A;  3A8T A;  1BZK A;  2H8P C;  3BFR A;  3L75 H;  5IY5 B;  4JI5 B;  1YIJ V;  3F5T A;  1GM7 A;  1F51 A;  1AJQ A;  4NYK A;  2WA4 A;  1G4Y B;  5KUK A;  4B3T B;  4GUN A;  2WLL B;  1QLE C;  1Q3E A;  1HNW O;  4JI3 O;  1M56 B;  2EIL C;  4GX0 A;  1A32 A;  3N2K B;  3K79 A;  1LUW A;  5LYJ B;  2IBZ H;  3H9V A;  4IHJ A;  5IE9 A;  1FJG O;  1JX9 A;  4X64 B;  4P2Z A;  1LUV A;  3UQ8 A;  1Y6X A;  5H6R A;  4JI6 B;  4DUZ B;  1KBH A;  4QPK A;  1WB8 A;  2W0F C;  1XUQ A;  2ITD C;  4CC6 A;  4RWU A;  5BMV A;  3C3S A;  5KAF Z;  3HPL C;  3EXA A;  4B3M B;  1AJN A;  1BQ0 A;  5CMU A;  2V4D A;  4BAY A;  5ITZ B;  2XAH A;  2QWR B;  4P9O A;  5GTI Z;  1K97 A;  4BIZ A;  3SPG A;  3WB0 A;  1R6K A;  1UJW B;  2ARH A;  4O4J A;  1K9M W;  3BVO A;  1AI4 A;  4IIJ B;  4NB5 A;  3TGU H;  4MW3 A;  1PV0 A;  5JVD A;  3K9A A;  1S5H C;  1Q90 D;  4CH3 A;  4MVS A;  4I9Q A;  3CMA V;  2YI9 A;  4WFG A;  5EYP B;  2QSA A;  5CB4 B;  4DYL A;  2OWO A;  3B4S A;  1DTO A;  5KX5 A;  2AHY A;  2OT5 A;  4HNA B;  4WBN A;  3U11 A;  3VBB A;  1WPX A;  2VQF O;  1XOU A;  1FYJ A;  4H33 A;  1FXH A;  4Q20 A;  2VRZ A;  3T1H B;  2WA3 A;  2P22 C;  3BPZ A;  1FXK C;  1BT8 A;  2YXH A;  1OCR C;  2D2C B;  3TCU A;  3E8F A;  3T1Y O;  1PL0 A;  3E86 A;  3HKE A;  2YID A;  2JK5 C;  4IYI A;  5LGN A;  4WFB V;  4LF4 B;  1S76 D;  1HP8 A;  3OTO O;  3J81 N;  4YY3 O;  4P9P A;  5L3D A;  5JQG A;  4TV8 B;  1W2B U;  1U97 A;  1VMG A;  3ABM C;  1ENV A;  2W6I G;  2FKX A;  1NR1 A;  1RSO A;  5J2U B;  2LQT A;  1O9G A;  3GVM A;  4DUY B;  4DV3 B;  5IWA O;  4LFA B;  1FFX A;  5FL7 G;  1FFX B;  1AI7 A;  2CH7 A;  2VQF B;  3E22 A;  3JD0 A;  1FS0 G;  1JFF A;  5LXT B;  1Q6U A;  4KXR A;  2ZIN A;  1GK9 A;  2DW4 A;  3CCU V;  4LFC O;  1TUB B;  4O4H A;  3T1Y B;  3L70 H;  3QG5 A;  1M1K W;  3SJA C;  3WB2 A;  2AZ2 A;  1YJN V;  4GKJ O;  1RPO A;  4AHC A;  2Y69 C;  2DWD C;  4RO2 A;  4LWS A;  5KHK A;  3C90 A;  1VAR A;  2XND G;  3ETD A;  1WJZ A;  2XAF A;  2CGO A;  1Y66 A;  2ZE6 A;  4CS3 A;  2EUL A;  2YSU B;  5D5Q A;  2IJJ A;  2ZXW B;  2IM9 A;  3R65 A;  4CC5 A;  5EBW C;  1FKA O;  2ZKO A;  3JCU Z;  3RYC A;  5KX5 B;  2Y48 A;  4U3F H;  5EBM C;  1OJH A;  4JI7 B;  2RN9 A;  2AGA A;  2CDY A;  1IBM O;  1GTO A;  1QHT A;  3JAW A;  4N21 A;  2UUC B;  4EEQ A;  3OM3 B;  5IWA B;  4J9Z B;  2CGN A;  1LNQ A;  4LR3 A;  2JS5 A;  4UV9 A;  3D3I A;  1M56 C;  2NNU A;  3RYH A;  4IYH A;  1R3I C;  3RT3 C;  3T2M A;  1AB3 A;  2QR4 A;  5B66 Z;  4X65 O;  1EN6 A;  1SQX H;  1VQP V;  1CXZ B;  5BR8 B;  3UM7 A;  1VQL V;  2ZM6 B;  2OTL V;  4FLU A;  2ZD9 A;  5EZY A;  1B3Q A;  1ZWI C;  2QKS A;  2Q69 A;  5E79 Z;  4X8A A;  4X1K A;  3WU2 Z;  1S5J A;  4PDR A;  1AJP A;  4LF7 B;  1I5Y A;  2EIJ B;  4DXW A;  4UFZ A;  3DXR A;  1YTF D;  1SES A;  4F6R B;  4ZOL B;  5KUM A;  1YHQ V;  3JD3 A;  1XL6 A;  4NTX A;  3SJQ C;  4UVC A;  5GTH Z;  4I55 B;  4XBF A;  3K57 A;  3CX5 F;  2DQ3 A;  1NTK H;  4DV7 B;  4LF6 O;  3JD4 A;  3G6B A;  1HR0 B;  2F93 B;  3THO A;  1R6T A;  1AP6 A;  1WA8 A;  1KU9 A;  2GDS A;  2XAQ A;  2BSK B;  2E3C A;  4U3J B;  5CA3 A;  1H8H G;  3CRR A;  5L3E A;  2YS8 A;  3Q4H A;  5K1P A;  1R73 A;  2VS0 A;  1H2L A;  3I5D A;  1NVP D;  2CK3 G;  2WPD G;  1XMQ B;  5LMU B;  1M9N A;  3SJB C;  2ZE7 A;  4JAA A;  1XI1 A;  2WLN A;  2F4V B;  3BHP A;  4I55 A;  5KMG B;  1J95 A;  4PA9 A;  3FB5 C;  3T4Z A;  2JEX A;  4O2A A;  4CH6 A;  4MVZ A;  1SA0 A;  4K3A A;  3H1L H;  1M57 B;  2DOS A;  3BAB A;  1VF6 A;  3L71 H;  3AK2 A;  1GMG A;  2CTR A;  4GKK B;  3CD6 V;  3RFR A;  1WPB A;  2EIK C;  4UCO A;  1IVS A;  4HNA A;  5IYD O;  4K8Z A;  5KLV H;  1NTZ H;  3L9D A;  1JOY A;  1VQ8 V;  5EIB D;  2FML A;  2QWQ B;  4DR4 B;  1F4N A;  3ABM B;  3JAM N;  4X1Y A;  5FNV B;  1PP9 H;  4XDL A;  1AI5 A;  4JTC B;  2QGN A;  3BAA A;  2JGD A;  1UFI A;  1ZL8 A;  2EZO A;  4DV0 B;  3IFX A;  2LW1 A;  4FLT A;  3ABU A;  5BY1 A;  2IJK A;  1NH2 D;  1VQ4 V;  1WN7 A;  4MT8 A;  2HJD A;  1EN4 A;  5B1B B;  5A9G A;  2HG5 C;  2UXB B;  3CXH F;  3HR0 A;  1NVP B;  5JCO A;  3JAS B;  1URF A;  2EIL B;  4ZBM A;  4DK0 A;  1IX9 A;  4CZZ A;  2OTJ V;  1K73 W;  2D3O W;  2LGQ A;  3SPJ A;  4L8J A;  4MTG A;  3T1H O;  2QE7 G;  1N0N A;  3ZRS A;  1YZB A;  3OFN G;  3AK3 A;  3OEE G;  5IYC O;  1IXM A;  3HKD A;  2UXD B;  5BMV B;  3J7A U;  1IBL O;  5FPR A;  1KP3 A;  2EJR A;  1MNG A;  4TOI A;  1BS3 A;  1SZT A;  1XRE A;  5IJ9 B;  2Q5Z A;  4DR1 B;  2PF4 E;  4O2B B;  5B3S B;  2N04 A;  1GO3 F;  1QLE B;  2A79 B;  5J2T A;  2ZQM A;  4UB8 Z;  1D5N A;  2ZR2 A;  4UVA A;  3D8C A;  2ZIM A;  1SET A;  3RYI B;  5KA5 A;  4HAM A;  1X4T A;  3OMN B;  4DV2 O;  3BEH A;  1SQF A;  4EB6 A;  3WB1 A;  5LOV A;  1Q82 W;  2B1G A;  4YHH B;  3KCX A;  4BW5 A;  1XEQ A;  2CTP A;  2UUA O;  4GLX A;  3OGC C;  5KA6 A;  4NKG B;  4JI2 O;  1H2M A;  1W0J G;  4JI3 B;  5KHJ A;  5F2V O;  3KG2 A;  5J2T B;  4MS2 A;  1RSO B;  5J2U A;  4HZ3 A;  4B7E A;  1KQS U;  1IBL B;  2GV9 A;  3JAW B;  2Y0P A;  5IDJ A;  2QDO A;  4XDK A;  2ZR3 A;  1RM1 C;  1JA8 A;  4TV8 A;  1S72 V;  1JQ0 A;  4JI8 O;  3ABK C;  2LJ2 A;  1EFR G;  3LNN A;  1SQB H;  4JTD B;  1XMQ O;  3E8G A;  1I0H A;  2X0L A;  3FD9 A;  1EM1 A;  1BSM A;  2A0L A;  1O9H A;  3SPI A;  3HKB B;  4DW1 A;  1R6N A;  3L72 H;  5L3G A;  3JSN A;  2WLJ A;  3PN1 A;  2Z5U A;  5LL6 Y;  1EZV H;  1JCH A;  4LF5 O;  1COW G;  5FPO A;  4JAU A;  2X6B A;  4GX5 A;  5DM6 V;  2LO1 A;  3OMI B;  5CN0 A;  5LMN B;  2ZCE A;  1BCC H;  4JI8 B;  4DR6 O;  5LHH A;  1R3K C;  1PNL A;  2QM8 A;  4ICG A;  4TWK A;  5K1X A;  4DR5 B;  4FFB A;  1P4R A;  4YIO A;  1YI2 V;  2CTQ A;  5CA1 B;  4J7Z A;  4FIP C;  2JDI G;  4JYC A;  3B8N A;  3CYO A;  1KB9 F;  1YXB A;  3JAL A;  5IJ0 B;  3AG1 B;  4EFB A;  2Q67 A;  1QQC A;  2HLD G;  4O4I B;  5CBH A;  2KG7 A;  1K33 A;  1B06 A;  3LDE A;  4X65 B;  3JAR B;  2Q7H A;  2Z0A A;  4ZIB A;  2BE3 A;  3FB8 C;  4X20 A;  5HFL A;  2KQX A;  4CS2 A;  3CB2 A;  1XQ8 A;  1L0L H;  3AG1 C;  4X88 A;  4LNU A;  2KB1 A;  4DV4 O;  1SA0 B;  2YIA A;  3ZHV A;  4TSF G;  4YJ3 B;  2W0X A;  4YXW G;  4FJC C;  4DR6 B;  4JV5 O;  2BCC H;  3ZMS A;  3BCC H;  1IBK B;  5IJ9 A;  5EBL C;  3IAY A;  4UCT A;  2UU9 B;  4DO2 A;  3A0H Z;  4I0X A;  5EIB C;  2XOK G;  3CC7 V;  4LH6 A;  4OPH A;  2FB5 A;  4BW9 A;  3OTO B;  4W4L A;  2X6C A;  4J41 A;  1J5E B;  4EB6 B;  1E1R G;  1PNM A;  2WLL A;  4DW0 A;  2N74 A;  2P67 A;  4X62 B;  3QNE A;  4NXN O;  3AG4 C;  2M6Y A;  1B04 A;  4J11 A;  2XTA A;  5H2F Z;  1I7F A;  3LSS A;  3K58 A;  2EIK B;  2QM7 A;  3CRQ A;  2PGG A;  1VF7 A;  5H5N A;  4JYY A;  1P7B A;  1N33 O;  1HNX B;  3VQX A;  1RP3 B;  4I50 B;  5IYZ A;  1NJI W;  2R72 A;  4PV1 B;  2K9P A;  1BHB A;  2Q68 A;  4PDM A;  4JPR A;  4X66 B;  2BTQ B;  2EIM C;  2Q6A A;  4QE9 A;  3ZMZ A;  1I94 B;  1AR5 A;  3ZMU A;  5B1N A;  1T5E A;  1WP7 A;  2JS3 A;  4FFK A;  4O4L B;  1P49 A;  1S3J A;  1YSC A;  2WSS G;  1TVK B;  3SDL A;  2GBO A;  3OUS A;  1P84 F;  5LBQ A;  4D7T A;  5B3S C;  1OCZ B;  1JVM A;  4ABM A;  1GM8 A;  4Z1M G;  3F5W C;  3EVK A;  3KKY A;  1QBZ A;  4PA4 A;  5LP6 B;  4I50 A;  4K35 A;  3HKC A;  1JFF B;  3OW2 U;  3W7U A;  4OPA A;  3QO7 A;  2GUZ A;  2Q0A A;  4HYO A;  1ROP A;  4TT3 G;  5LGU A;  2DWE C;  3N2K A;  4R7C A;  5CB4 A;  1GM9 A;  3RYC B;  5EYP A;  2F23 A;  1XHX A;  2Q73 A;  5KHI A;  1KYO F;  2HJF C;  3CJH B;  3K0D A;  2X7R B;  4LP8 A;  1N34 B;  3HKC B;  3E8B A;  2IU3 A;  1V54 B;  2UUC O;  3RVY A;  2QTO A;  4CBC A;  3LDC A;  3RBZ A;  2XAG A;  5BXZ A;  4FM1 A;  4NXM B;  2Z3Y A;  3STL C;  4MTX A;  1V55 B;  2JIZ G;  3EHB B;  1XDC A;  3Q4H B;  2UXB O;  4X9Q A;  5JWP A;  4KHP B;  1XBL A;  5ITZ A;  1I94 O;  3ZMV A;  2WLM A;  3GB7 C;  5B1O A;  1AR1 B;  4IHJ B;  3I55 V;  3B09 A;  5A2Q N;  5LYJ A;  3K5N A;  2YXL A;  4X1K B;  4DV3 O;  2XHB A;  2DJV A;  4O2A B;  3G6E V;  1QVG U;  3TET A;  5JCO C;  1NU1 H;  2F4V O;  1YJW V;  2DQ0 A;  2F43 G;  3ZHT A;  4DV1 O;  4BR6 A;  2YUA A;  1K92 A;  2CUG A;  4J7J A;  1OCO C;  1ZTE A;  4OX9 O;  1SQP H;  2YDE A;  2YEV A;  3FB7 C;  2E74 B;  1I08 A;  3UO3 A;  2XUM A;  3ZMT A;  4LCU C;  4PI2 A;  1RM1 B;  4R8C A;  3W7S A;  5D5P A;  3AG3 C;  1VIB A;  4DV2 B;  4JI7 O;  4E2L A;  2HFE C;  3LDD A;  4ZI7 A;  1K8A W;  4LNU B;  3EFF K;  1ZL8 B;  4FLZ A;  1MA1 A;  4A5U B;  2YIC A;  5KHH A;  4PDV A;  4QNH B;  2PYJ A;  1K3E A;  1BMF G;  1TAE A;  4JYB A;  1JJO A;  2PTM A;  4I9W A;  4ZHQ A;  1NKD A;  1SF9 A;  3VQW A;  2UU9 O;  4PA6 A;  3OR7 C;  5B5E Z;  4MVM A;  3ABL C;  2H94 A;  2BTO A;  4PA3 A;  1FXV A;  1ZUQ A;  5DN6 G;  4WCE V;  5LGT A;  1THZ A;  2P5O A;  3ZED A;  5CBG A;  1XIL A;  3LNM B;  3BY6 A;  5CBF A;  4FLY A;  2A7W A;  3H1I H;  4FMT A;  4B3R O;  2B9Z A;  1P7G A;  4LBE C;  2AXT Z;  3K5L A;  2EIJ C;  1FXK B;  1WAZ A;  2QTS A;  1BGY H;  2UXN A;  3TK1 A;  2PYL A;  4J7K A;  3APQ A;  2ODM A;  5C8Y B;  5EC2 C;  4UV8 A;  2C2A A;  1NR7 A;  1OCR B;  5IJ0 A;  3K5M A;  4LF6 B;  3JYC A;  4LWS B;  4JYA B;  5KMG A;  1N8R W;  4BIU A;  1SKV A;  3H1H H;  3AG4 B;  1WB7 A;  1OZ0 A;  2DE0 X;  4X89 A;  2LP7 A;  4QGP A;  1NI8 A;  1ZAU A;  3CCE V;  4FM0 A;  4JF3 A;  3I56 V;  3GWK C;  5LA6 B;  4QIW F;  2DMX A;  3JAT A;  3S3X A;  2G38 A;  3D36 C;  4R6Z A;  3OR6 C;  4YJ2 A;  4DUZ O;  3HB3 B; 
#chains in the Genus database with same CATH homology
 1Q82 W;  2B1G A;  4QPK A;  2IH3 C;  3ZCC A;  1XL4 A;  2W0F C;  1Q86 W;  2ITD C;  1VQN V;  1FXK A;  1JPX A;  4BW5 A;  2UXX A;  3HPL C;  1QR9 A;  3OGC C;  5KA6 A;  1AJN A;  1W0J G;  2P6J A;  3OEH G;  5CMU A;  2IJH A;  1MSW D;  3ZRW A;  2IH1 C;  2JEU A;  4BAY A;  2XAH A;  4P9O A;  3KG2 A;  4KUM A;  4UXN A;  2JJ2 G;  1K97 A;  4BIZ A;  4MS2 A;  3CPW U;  1H8E G;  4HZ3 A;  3W7X A;  3SPG A;  1R6K A;  4PA7 A;  4G2K A;  1KQS U;  1UJW B;  5IDJ A;  1K9M W;  1VQ5 V;  4XDK A;  2ZR3 A;  1VQ7 V;  1RM1 C;  1AI4 A;  1S72 V;  1KD1 W;  1JQ0 A;  1PKX A;  4MW3 A;  3ABK C;  3K9A A;  1S5H C;  4JGS A;  4MVQ A;  4U7N A;  5J9P C;  3IGA C;  1EFR G;  5B1A B;  4JTD B;  3CME V;  3E8G A;  2X0L A;  3ABK B;  2HVK C;  4MVS A;  4N23 A;  3FB6 C;  1V55 C;  3CMA V;  2A0L A;  3WFV A;  1M90 W;  3SPI A;  4WFG A;  1Q7Y W;  1R6N A;  5L3G A;  1Q81 W;  1DTO A;  2WLJ A;  1DF4 A;  2AHY A;  2Z5U A;  2OT5 A;  5HFM A;  3VBB A;  3SYP A;  1JCH A;  3IC7 A;  5LHG A;  3SYC A;  1WPX A;  1K5S A;  1COW G;  3PJS K;  4G28 B;  4H33 A;  2BOB C;  4JAU A;  2X6B A;  1FXH A;  4GX5 A;  1YJ9 V;  4PEL A;  5DM6 V;  4Q20 A;  3ETE A;  3OMI B;  4UVB A;  3M99 B;  4L87 A;  1FFT B;  3FKS G;  5CN0 A;  3MHH C;  1FXK C;  3UKM A;  1DLB A;  1VQ9 V;  2K1E A;  2LFR A;  1R3K C;  2MK3 A;  5B1B C;  5LHH A;  1PNL A;  2QM8 A;  4TWK A;  1OCR C;  3K03 A;  3T1C A;  3TCU A;  3E8F A;  1OCO B;  1BL8 A;  1P4R A;  1VQO V;  1PL0 A;  1YI2 V;  3E86 A;  4FIP C;  2JDI G;  3CCM V;  1MOF A;  4JYC A;  1VQK V;  3B8N A;  2JK5 C;  3CYO A;  2P90 A;  5LGN A;  4WFB V;  2WWW A;  3AG1 B;  1S76 D;  1V54 C;  3E89 A;  2V7Q G;  4P9P A;  5L3D A;  1OHH G;  2A9H A;  4MTF A;  2Q67 A;  1W2B U;  2HLD G;  3ABM C;  3ZIA G;  3ZRX A;  4KP4 A;  5CBH A;  1ENV A;  2W6I G;  4QJF B;  1K33 A;  4U7O A;  5L3B A;  3LDE A;  3LSQ A;  1NR1 A;  2B1I A;  1MAB G;  3FB8 C;  5HFL A;  5BZB A;  1PD3 A;  3CCL V;  4GT1 A;  4MW8 A;  2BOC C;  5FL7 G;  1AI7 A;  4G27 B;  3CP1 A;  5L3C A;  3K0G A;  2FTK A;  3JD0 A;  1FS0 G;  3AG1 C;  4X88 A;  2KB1 A;  2WLI B;  3K06 A;  4TSF G;  4YXW G;  1GK9 A;  4FJC C;  2DW4 A;  3CCU V;  3CC4 V;  4OXS A;  2HKO A;  3E83 A;  2ZDI A;  1VQ6 V;  3ABT A;  1CP9 A;  1H2G A;  1WLE A;  3ZMS A;  1E1Q G;  1M1K W;  1F4M A;  5EBL C;  5IY5 C;  2OCC C;  4DO2 A;  3WG7 C;  3QO8 A;  2XOK G;  1YJN V;  2X6A A;  3CC7 V;  1RPO A;  2JJ1 G;  3MD0 A;  3T4D A;  2Y69 C;  2AHZ A;  2DWD C;  4RO2 A;  4MVO A;  2IJI A;  4FPP A;  2ITC C;  3K04 A;  3SYO A;  2X6C A;  2M7W A;  2XND G;  3ETD A;  3P32 A;  1NH2 B;  4P30 A;  3SPC A;  3F7V C;  2XAF A;  1Y66 A;  1E1R G;  4F4L A;  1PNM A;  2WLL A;  1PNK A;  3E2E A;  2P67 A;  2YSU B;  3X2Q B;  3QNE A;  4MTO A;  3AG4 C;  2IJJ A;  2ZXW B;  2V1D A;  2ZDI C;  3LSS A;  1EZJ A;  2EIK B;  4WFH A;  2QM7 A;  1RPR A;  3R65 A;  2YEV B;  1P7B A;  3DTU B;  4I5S A;  5EBW C;  4FK5 C;  2DYS C;  3ETG A;  1NQT A;  3ZJZ A;  3K08 A;  4R50 A;  2Y48 A;  5EBM C;  1KKD A;  1NJI W;  4EKW A;  3ASN B;  1BHB A;  1GTO A;  2Q68 A;  3GWO A;  4PDM A;  4JPR A;  4N21 A;  3MHS C;  2EIM C;  3OM3 B;  2Q6A A;  4J9Z B;  4QE9 A;  1LNQ A;  3ZMZ A;  3ZRV A;  3ZMU A;  1EBO A;  4UV9 A;  3D3I A;  1M56 C;  5B1N A;  2NNU A;  3ASO C;  1YSC A;  1S3J A;  2PI5 A;  1L1F A;  2WSS G;  4RQF A;  3H01 A;  3ABL B;  1R3I C;  1QR8 A;  5LHI A;  3LUT B;  3T2M A;  3OUS A;  5C93 A;  3NXS A;  4WFA V;  4LC1 A;  3CCS V;  1SER A;  5GW7 A;  5LBQ A;  1VQP V;  1ARO P;  3UM7 A;  1VQL V;  5B3S C;  1OCZ B;  1JVM A;  3A0R A;  1GM8 A;  3JD1 A;  4Z1M G;  3F5W C;  2OTL V;  3B77 A;  1QBZ A;  2ZD9 A;  1ZWI C;  2QKS A;  2Q69 A;  4PA4 A;  4JAV A;  4WFF A;  1YIT V;  3CC2 V;  4X8A A;  3OUF A;  2LFS A;  1QCE A;  2XAJ A;  3OW2 U;  2EBO A;  1S0V A;  2NLJ C;  4PDR A;  1AJP A;  1KC8 W;  3W7U A;  3QO7 A;  1I5Y A;  2EIJ B;  4DXW A;  1YTF D;  1K5Q A;  1SES A;  4HYO A;  5KUM A;  1DF5 A;  1ROP A;  4TT3 G;  1YHQ V;  5LGU A;  2DWE C;  3JD3 A;  3FYE B;  4R7C A;  1XL6 A;  3ZN0 A;  1GM9 A;  3SYQ A;  3SJQ C;  4UVC A;  5L3F A;  4XBF A;  2HJF C;  3K0D A;  2DQ3 A;  2X7R B;  1YTF B;  4LP8 A;  2DYR B;  2IU3 A;  1V54 B;  3E8B A;  3JD4 A;  4PDL A;  4WF9 V;  3RVY A;  2WLH A;  3E8H A;  4WFE A;  2QTO A;  1CPY A;  4CBC A;  2XAQ A;  3DGE A;  3STZ C;  3LDC A;  3RBZ A;  5CA3 A;  2XAG A;  1H8H G;  5B1A C;  2Z3Y A;  2GHY A;  3STL C;  4MTX A;  1MG1 A;  5L3E A;  1V55 B;  2JIZ G;  3EHB B;  1VQM V;  2EIM B;  3K3W A;  2P7T C;  1R73 A;  1NVP D;  2CK3 G;  2WPD G;  3CCV V;  3ZMV A;  2WLM A;  3GB7 C;  5B1O A;  1M9N A;  2WAM A;  4H37 A;  3RW0 A;  1AR1 B;  3I55 V;  1NBM G;  2WLN A;  4UUJ C;  2Y69 B;  3AEI A;  3F7Y C;  4GX2 A;  4JTA B;  1J95 A;  4RUE A;  3CXC U;  3OE7 G;  4PA9 A;  4ASU G;  4ZKI A;  2PI4 A;  3FB5 C;  3T4Z A;  2HR3 A;  2JEX A;  3G6E V;  5H9C A;  3CCR V;  1QVG U;  4MVZ A;  3TET A;  2HVJ C;  1QVF U;  4JAS A;  4MSW C;  3X2Q C;  1YJW V;  2DQ0 A;  2F43 G;  4MVU A;  1M57 B;  1HWY A;  1K92 A;  1QLN A;  2GSM B;  1OCO C;  1R3J C;  1SRY A;  1GMG A;  2YEV A;  3FB7 C;  3CD6 V;  2B5U A;  1ORQ C;  2EZP A;  2EIK C;  2QEX V;  2W6J G;  5IYD O;  3ZMT A;  4LCU C;  1K34 A;  1KP2 A;  1RM1 B;  3QO5 A;  1S77 D;  1Y4M A;  3CCQ V;  4R8C A;  3W7S A;  3AG3 C;  4E2L A;  2WLI A;  2HFE C;  3LDD A;  1BHA A;  1JOY A;  5H6Q A;  3OMA B;  1K8A W;  3EFF K;  4RAI A;  5E1A C;  1VQ8 V;  2IW5 A;  3AG3 B;  1CEZ A;  2R9R B;  1I5X A;  4PDV A;  4QNH B;  1K3E A;  3JCZ A;  1F4N A;  5EK0 A;  3ABM B;  3W7W A;  1BMF G;  3P30 A;  4MVR A;  2QA4 V;  3FYI B;  4JYB A;  3OAA G;  4I9W A;  1NKD A;  2XAS A;  2WLK A;  1AI5 A;  4XDL A;  3ZRW B;  3E35 A;  4PA6 A;  3OR7 C;  1GKF A;  2OCC B;  4MVM A;  4JTC B;  3ABL C;  2H94 A;  4PA3 A;  1W0K G;  1FXV A;  1OCZ C;  1K7D A;  1B6Q A;  1OCC C;  5DN6 G;  3RVZ A;  4WCE V;  4RUF A;  3G71 V;  5LGT A;  2EZO A;  1THZ A;  3IFX A;  5CBG A;  3ABU A;  3LNM B;  3BY6 A;  2IJK A;  2ATK C;  1K4D C;  2ZXW C;  5CBF A;  1NH2 D;  1AI6 A;  1VQ4 V;  1TUE B;  4FMT A;  4GCZ A;  4MT8 A;  3AG2 C;  1E79 G;  5B1B B;  5IYB O;  4XDJ A;  2HG5 C;  4LBE C;  4QE7 A;  3G4S V;  1JJ2 U;  1NVP B;  2EIJ C;  1FXK B;  3VOU A;  3D36 A;  3AG2 B;  2EIL B;  2EIN B;  2R9I A;  3CCJ V;  4ZBM A;  2UXN A;  3WG7 B;  4CZZ A;  3TK1 A;  1K73 W;  2OTJ V;  3B8M A;  3ZN1 A;  2D3O W;  1M57 C;  3ML0 A;  3SPJ A;  2DYS B;  4MTG A;  5EC2 C;  4UV8 A;  2H8P C;  2C2A A;  5IY5 B;  2QE7 G;  1OCC B;  1NR7 A;  1KEC A;  3ZRS A;  1OCR B;  1YIJ V;  1GM7 A;  5EC1 C;  3JYC A;  1F51 A;  1F23 A;  1AJQ A;  3OFN G;  2IU0 A;  1N8R W;  3OEE G;  4BIU A;  5IYC O;  1G4Y B;  1IXM A;  5KUK A;  2DYR C;  1KP3 A;  1K4C C;  2EJR A;  2WLL B;  3AG4 B;  1OZ0 A;  4QPJ A;  4GX1 A;  1SZT A;  1QLE C;  4X89 A;  2LP7 A;  3W7T A;  3ASO B;  5B3S B;  3CCE V;  1H38 A;  1M56 B;  1GO3 F;  2EIL C;  2EIN C;  1QLE B;  4JF3 A;  4GX0 A;  4RQE A;  4KFM A;  2A79 B;  1G8M A;  3K79 A;  3I56 V;  2ZQM A;  4QIW F;  2ZR2 A;  3ASN C;  1JX9 A;  4UVA A;  4P2Z A;  1SET A;  5KA5 A;  4HAM A;  4R6Z A;  3OMN B;  4J9Y B;  3JD2 A;  3BEH A;  3OR6 C;  3SYA A;  3SPH A;  5H6R A;  1R3L C;  3HB3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...