4GKKO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4gkkO00
2UXBO 4LF6O 3F5TA 4LF9O 4DV0O 4JI5O 2AGAA 1J5EO 1X59A 4NXNO 2F4VO 5IWAO 1YZBA 5FLXN 4A5UB 1AILA 3OTOO 1F7YA 2UXCO 4OPAA 1FKAO 5BY1A 3JAMN 4JI1O 4B3RO 4DR4O 1N36O 4OX9O 2VQFO 3T1YO 4DR3O 2JRIA 5LMUO 3M8AA 2LW7A 4B3SO 1IBKO 3R66A 1G1XB 4JV5O 1XMOO 3J7AU 5LMNO 5BXZA 4DV3O 4DUZO 2E5LO 1HNXO 1XNQO 2UUBO 4B3MO 4YHHO 1XEQA 1D2DA 5H5NA 4JI3O 4LF8O 1XMQO 4LFAO 1R1BA 1XNRO 4DUYO 2DOSA 2ZM6O 4X65O 1NS1A 3SDLA 4X64O 4DR5O 1HR0O 4NXMO 4JI7O 4DV1O 4GKKO 4DV7O 4LF7O 5IT9N 2N74A 2FKXA 4LF5O 1R6TA 1N32O 4YY3O 2UUCO 4JI4O 4JI8O 4LFCO 1IBLO 2UUAO 3O65A 1HNZO 4AQYO 1FJGO 4GKJO 2Z0AA 4LFBO 4DR6O 4JYAO 1DK1A 4DV2O 4LF4O 4DV4O 1A32A 4JI0O 4OPHA 2UXDO 3T1HO 4DR2O 5A2QN 4DV6O 1IBMO 2DJVA 2VQEO 4DR7O 1N34O 2UU9O 4DV5O 3J81N 1AB3A 3J80N 4KHPO 4B3TO 4DR1O 4X66O 5LL6Y 1I94O 2HHHO 4X62O 1N33O 1KUQA 4JI2O 2ZKOA 5BR8O 1FYJA 4K0KO 3RT3C 1HNWO 4JI6O
chains in the Genus database with same CATH superfamily
3OT7A 4GLXA 1ZL8A 1FD9A 2QDOA 4J10A 4DV5B 4I55B 2AHZA 3TXSA 1VQ5V 1JJOA 2QGNA 1FXVA 4DR1B 5KX5A 4X66B 1NTMH 2ATKC 1PM9A 3T2MA 3JALA 1PP9H 2QKAA 4UVAA 1ORQC 4I50A 3TCUA 4PDVA 4MS2A 1OCRB 5L3CA 3BABA 1Q5OA 4LNUB 4OXSA 2H3OA 2OCCC 1XNQO 4I4TA 1H2NA 2UXCB 1SESA 1QR8A 2ZCEA 4HNAB 4O2AB 5JVDB 3L9DA 4DR3B 3KCXA 4GT1A 2XUMA 3DC5A 1G6UA 4QNHB 2Y0IA 4CS4A 4JASA 3FKSG 3F7VC 4PA6A 1VF6C 4Z2WA 2ITDC 2DMXA 1QHTA 2UUBB 1K5SA 4DR6O 4JGSA 1A32A 1GK9A 4JI0O 2Q0OC 3W7WA 4JZ2A 4DR2O 2FTKA 4UFZA 3CXHF 4UCRA 1J95A 4WFBV 3HKEB 5KHIA 3AK1A 3CPWU 4DW1A 3TETA 3OMAB 4X62O 5B3SB 5H6RA 3E8GA 2ZE8A 2ZQMA 1ZX3A 1LUWA 1GM7A 2CGNA 4JI6O 1VF6A 2B1GA 3CXCU 3T1HB 2JIZG 4NTXA 1FXKB 4LWSB 4LH7A 4JPRA 4JI5O 2F4VO 3SR2C 1VQNV 2E74B 2RQ6A 3OEHG 2HR3A 1SQBH 4I55A 4MTGA 2H94A 1M9NA 3B77A 4UCSA 2IJIA 3JAMN 1Z2GA 1YJWV 3IC7A 2WPDG 1ZTEA 4X8AA 2KQXA 3D3QA 3K5LA 3ASNB 3H9VA 1GKFA 4D7TA 2OIGA 2FMLA 4X1IA 1GN6A 3NXSA 3ZBHA 5EYPA 3U11A 4QE9A 4LNUA 3ZMTA 2X6AA 3E8HA 2BSKA 4UCTA 1BHAA 4J7KA 2NR5A 3MHSC 1Q86W 5JCOC 3H01A 1NKDA 1JR9A 4HNAA 2MW2B 1WB7A 2CDYA 4PJ0Z 5JVDA 3VOUA 3QO5A 3A8TA 4DV1O 4DV7O 2F4VB 3ZX6A 2JEUA 2ZT9B 2JS3A 1SF9A 1HNZO 2LFSA 2Z0AA 2OTJV 4CC5A 4BR6A 3G80A 4FZ1A 2VRZA 1IZ3A 3L75H 2ZXWC 4J42A 1YJ9V 4LF7B 3CRAA 1COWG 3A0HZ 3L74H 3ASNC 3FB6C 3HKEA 5JCOA 3G71V 4O2BB 3KCYA 1VQLV 2UXXA 5J2UB 4YJ3B 4R6ZA 1VQ6V 2GDSA 3F5TA 2YXYA 4NB5A 1WP7A 1KB9F 4LWSA 2H8PC 5IWAO 3OMNB 2E76B 3VQWA 3EFFK 5B5EZ 4UUJC 4JI2B 3ZCCA 4FLWA 1B04A 5BR8B 3L72H 4K0KB 3LSSA 1GN4A 5JJNB 4RQFA 1XILA 5EBWC 4I5SA 1MZFA 1XMOO 1RPRA 4JYBA 1FAFA 1W59A 4DUZO 3ABTA 1LR1A 4FFBA 5KAFZ 2YEVB 1UJWB 4H37A 4IIJA 3CRRA 3H1JH 4MW8A 4JI1B 3CCUV 1WJZA 3ZN1A 4I7ZB 1QLNA 1WNSA 1Q8IA 4CH4A 2YC0A 1XHXA 4LCUC 2LGWA 3VBBA 3K5MA 1E1QG 3W7TA 1NU1H 1VQ7V 1F51A 1PPJH 4JTCB 4RUFA 2OTLV 4AQYO 1H38A 3ABLB 1NH2B 4ZHQB 4UVBA 1Y74A 2IJJA 5CN0A 3B40A 4ZOLB 1H2LA 3B8MA 3CE2A 5A2QN 4U3FH 5GONA 2RJZA 4GKKB 5J2TA 3H1KH 5E1AC 2CTWA 3CSXA 4JI8B 1M5IA 2Q68A 3L70H 4FFKA 2HHHO 2F95B 3RW0A 3E22A 1N4CA 4UV9A 2XAQA 3UO2A 1OCOC 4JYYA 2BOCC 3K5OA 5H2FZ 1LNQA 5KMGB 4MTXA 3JYCA 4YJ3A 1Y4MA 1UPGA 1OCCB 2XHBA 3C3TA 3IJ4A 2UU9B 4P9OA 1JPXA 5FLXN 4CZZA 4LP8A 4F4LA 2DYSB 1GRJA 2EIJB 1B6QA 2CH7B 3AEIA 4IYIA 5CBHA 1AI6A 1KYOF 4DR4O 4PA3A 2WLNA 1EN5A 2VQFO 3T1YO 3JASB 2GTSA 4X89A 3UT5B 1Y6XA 3M8AA 4DV0B 1UFIA 1MG1A 3X2QB 4NXNB 1QQCA 3BA8A 1SC5B 4NYKA 2V1DA 1DTOA 1NQTA 4YJ2B 2KSDA 1TA8A 4YHHO 1XEQA 1D2DA 2R9RB 2YEVA 4ZI7B 2QA4V 1ROPA 4EB6B 2CTQA 1WPXA 2ZM6O 4DR5O 1IBKB 1CEZA 1KD1W 1RM1C 4WFGA 4JV5B 3ZHQA 4H33A 1Q90D 4QIWF 3K3WA 2UUCO 4X88A 3HKBB 1YXBA 3ZHTA 2W0XA 1MSWD 2ZR2A 4MVRA 1FJGO 3MD0A 2D2CB 5EBLC 1QCEA 2ZE7A 4X1YB 4B7EA 3ZMSA 4DV2O 4ZHQA 1XNRB 2R9AA 4LC1A 2WLLB 5KAIZ 3E8BA 3T1YB 2UXDO 4MW3A 4ZOLA 2ADQB 2EIJC 3OGIB 4NTWA 2A06H 4LF5B 1S77D 1L1FA 4JI4B 3RYFB 1IBLB 2ITCC 3ABUA 3A2FA 1U97A 3OE7G 3CX5F 4D7SA 2IJKA 3X2QC 5CB4B 3E8FA 1XQ8A 4IGGA 2HEPA 2QEXV 3JAWA 3KZIZ 5KMGA 4N21A 3ETDA 2V7QG 4KFMA 1W2BU 4R7CA 3HKCA 1YITV 1JA8A 2QTOA 4CC6A 4K35A 1O9HA 2IJHA 3H1IH 3IC9A 1N33B 1MMMA 2PI5A 1IX9A 2Z5UA 2ADPA 3N2KB 2CH7A 2QR4A 2YIDA 3APQA 1CXZB 3KKYA 2LW7A 3RVYA 3JASA 4NTYA 1NI8A 5J9PC 3ZJZA 2PGGA 5IJ9B 1IXMA 4YXWG 3J7AU 2LO1A 1QVFU 4BAYA 4UV8A 3APOA 1US6A 5IY5B 4YJ2A 3SYPA 5IE9A 3ETEA 5TISZ 2LJ2A 4ZI7A 4Z1VA 3ZEDA 2ZR3A 4EB6A 5KA6A 3I55V 5B66Z 3BAAA 4MVZA 2NN4A 1YVWA 3HKBA 2WWWA 1GN2A 4WFAV 3OUSA 4GKJO 2YIAA 1XHZA 4W4LA 3FYIB 4FPPA 2WLIA 4X1YA 1Z5WA 5L3DA 2JJ1G 2WLLA 4JI7B 2NLJC 4DV5O 5EC2C 1THZA 5L3BA 3ZHSA 1OCZC 1F4MA 4J80A 4DR1O 4X66O 1TAEA 2IM9A 1VIBA 4GZRB 3RYFA 5C8YB 1Z5VA 4JYCA 4PELA 4X1KB 3WG7B 2PTMA 4K3AA 1FYJA 2L6LA 5CB4A 2YS8A 2X0LA 4FLZA 4ICGA 1AR4A 1N0JA 2QSAA 3FB5C 5IY5C 3QNEA 1VEWA 1DGSA 1YEWA 2EINB 2QJ1A 3TXQA 2UXCO 2UXNA 1KECA 3AG1C 3RN4A 3N2KA 4DR3O 2XAFA 2P67A 4LF9B 2Q67A 3CCMV 1MABG 1KBHA 2PY5A 2GV9A 1GAXA 3C3SA 2Y0PA 4FLVA 1NH2D 2UUBO 4Q6GA 2EIKC 1ZAUA 4U3JB 4FLYA 4HAMA 5LP6B 1VP7A 2EZPA 3CHXA 4MVSA 1KC8W 4B3SB 3QO7A 2FL4A 3WG7C 4JAVA 5FL7G 2JGUA 5BMVB 1H2SB 3ZHRA 5CA0B 4TV8B 4B3MB 2WSSG 4L87A 4MTFA 2LP7A 2YICA 1MZEA 3LSQA 3SJQC 5IDJA 2EINC 1XREA 2OCHA 1YF2A 4DUYB 1R3KC 3T1HO 2PI4A 3M7MX 4X65B 3OM3B 5LBQA 1Q82W 1XL6A 1JQ0A 4EFEA 3WB2A 5L3FA 2P7TC 4DK0A 4LFCB 3RYHA 5LL6Y 2HVJC 2JGDB 2AZ2A 1X4TA 2P4KA 3BPZA 1N0NA 1CPYA 3CEIA 2EULA 4DRXB 3SJBC 1IBMB 2HP8A 3CP1A 3R65A 4JAAA 4DR7B 1BCCH 5LP6C 2OYQA 2X7RB 2PYLA 2Q7HA 4K8ZA 2EX3A 2RN9A 2M6YA 2Q4PA 1QR9A 1MNGA 1T5EA 2HLDG 1QLEB 2LGQA 2IBZH 1DF4A 3BCCH 1YTFB 1OCRC 1QBZA 3T4ZA 1K4CC 2N04A 4GUNA 2YXHA 4ABMA 3P30A 2BOBC 2P22C 1J5EB 3B4SA 4MVOA 3CJHB 4H0LB 1EM1A 2ILMA 3LDCA 3JD0A 5LGNA 4PDRA 4ASUG 1YCIA 5FPRA 3ZMUA 5DM6V 4U3JA 1NT2B 1CP9A 2XTAA 5LP6A 1R1BA 4BIUA 1GM8A 3TGUH 2DWDC 4PDMA 4DYLA 2M7WA 4LF7O 2CAZC 1BMFG 2HKOA 5LHGA 5BMVA 1QNMA 3OR6C 5CA0A 1K7DA 4TV8A 3N27A 4LF8B 1M56B 2O57A 1XMQB 1Q6UA 3K79A 3CC7V 4J9ZB 3FB7C 4OPHA 1VF7A 4O2AA 1NR1A 2IH3C 4P9PA 3O9OA 3SPHA 5IYCO 1URFA 5B3SC 2P5OA 1JOYA 3FX7A 3L73H 1K97A 1V55B 3IGAC 1FXKC 3DXRB 4G2KA 2JGDA 1ENVA 4XDLA 4JI2O 4IYHA 1AVMA 5BR8O 4K0KO 5LYJB 2YIBD 4DV4B 2Q73A 4DRXA 1AR1B 1OV9A 4BW5A 3BFRA 1X59A 4P30A 2ZNIA 1K73W 5DN6G 4GX2A 3ZMVA 1TUBB 2NNUA 3G4SV 1AROP 4JI1O 2Q7GA 2XNDG 3F7YC 1R6KA 3AG2B 5GTIZ 4DO2A 3BHPA 5H9CA 4EEQA 4FM2A 1M56C 4FLUA 1FXKA 1SQGA 4KP4A 1JX9A 3OTOB 2AW9A 1ZSPA 3TJTA 3K08A 1V55C 3QO8A 3OW2U 1WAZA 3UCSC 4GKKO 1SKVA 4W4KA 1QU7A 4JTAB 4CH5A 2ZIOA 3I56V 4AILC 3JARB 1S5HC 1K5QA 4JI8O 4DV3B 3CCJV 5B1AB 1NTKH 2P4VA 3K58A 1R3IC 1R73A 2JS5A 3JATB 5DECA 1BT8A 3ZHVA 3CCQV 4RQEA 5IYDO 1SA0B 3FAVB 2HG5C 1Q6IA 1JFFB 3GWOA 1YIJV 4NXMB 1M1KW 5LGUA 1N34O 2UU9O 3K59A 5BZBA 3SPJA 3W7UA 2DYRB 3HKDB 1IDSA 4F6RB 1S5LZ 1L0NH 2IW5A 3ASOB 3B8NA 2DW4A 1AJQA 1KP3A 4UB6Z 5LYJA 3OTFA 3ZIAG 5LGTA 4FLXA 1TUEB 4DV0O 2EJRA 2VQEB 2E75B 2AGAA 4EFBA 1YJNV 3RBZA 4NXNO 4WBNB 2CTRA 4B3TB 1Q43A 2R72A 2WAMA 2BE3A 1DF5A 3LUTB 4UCVA 5KUMA 1K3EA 4O2BA 3K9AA 1BS3A 4JAUA 5J2UA 1I08A 4LF6B 1IBKO 1S76D 5H6QA 2X6BA 4JV5O 2GUZB 2ZDIC 1N34B 3JD3A 1BL8A 4KUMA 2Q8VA 4O4HB 3ZRXA 4RWUA 1R3LC 1KP2A 5LHIA 4B3RB 1GN3A 1L0LH 1SQPH 5D5QA 3ZRSA 5CA3A 2DYRC 1N36B 2EIMB 1XNRO 4JF3A 1BZKA 4AHCA 5LMUB 3DSQA 3VQVA 4LF5O 2Y69B 1NBMG 3ABLC 4JI4O 5EK0A 4TOIA 3FFQA 1IBLO 4LBEC 3JARA 3B2EE 1FFXB 3D8CA 4JI3B 4QPKA 3UM7A 5KA5A 1DK1A 2ZDIA 3JATA 3U10A 1SA0A 1JCHA 1WN7A 2XASA 2DJVA 4X9QA 2QWQB 3D36C 4J41A 1JFFA 4JTDB 3OD4A 2DE0X 1MOFA 1YTFD 3DC6A 1OCCC 5CA1B 1N33O 5KLVH 4IHJB 4LFBB 2W6JG 2A79B 5GTHZ 1RFYA 3HKDA 4F6RA 1QVGU 1NVPB 4QPJA 3JCZA 2DYSC 5JH7B 1ZUQA 2P06A 2CUGA 3SYAA 3P32A 3P3NA 1S0VA 4KHPB 4WBNA 1M93A 3K06A 5B1OA 4FZ0A 4D6TH 1Y76B 4QJFB 3RGBA 4MVUA 3ETGA 5EZYB 4N23A 2Y69C 2Q6AA 2IH1C 3D36A 4TT3G 2QKCA 1OZ0A 4B08A 2GTAA 1AP5A 1HNWB 2JJ2G 4J7ZA 1D5NA 1I7FA 1VQ8V 1SS3A 2GUZA 5BXZA 1XL4A 1SERA 2HJDA 4O4HA 2QWNB 1PD3A 1RPOA 1N8RW 2GSMB 5K1XA 1SQQH 1S72V 4TV9B 1VQKV 4WFFA 2QWPB 4FMTA 1M57B 5IYZB 3RYCB 2WLJA 4JI7O 4O4LB 3UT5A 3WB1A 2DQ3A 1G4YB 5CMUA 1K4DC 1K33A 2E5LB 3SJCC 5EBMC 4UB8Z 3CCVV 1FFXA 3BRCA 1ZL8B 3JAKB 4XBFA 3DTUB 1LUVA 4FLTA 1ZLZA 4HZ3A 1XBLA 4YY3B 3J80N 4KL1A 3CWBH 2UUAB 1PNKA 2AXTZ 1G8MA 3E2EA 4P2ZA 4I50B 3SYCA 4LF4B 1Q81W 2FYUH 4DV6B 4LF9O 4FVMA 4I0XB 3OUFA 4GX0A 3A0RA 4I4TB 3UO3A 1AI5A 3LNMB 1OHHG 3C90A 1FKAO 3AG4B 3UKMA 5F2VO 1Y76A 2YSUB 3DGEA 5EZYA 4YIOA 3D3IA 5FNVB 2B1IA 4B3SO 1WB8A 3ICXA 1GH6A 3S3XA 1GMGA 1MSDA 4B3MO 3CB2A 2VWKA 2ZE6A 4O4JB 1GTOA 2CGOA 2EJ7A 4PA9A 4DUYO 4X65O 3KG2A 5IYZA 3A0BZ 3Q4HB 2KG7B 4NR1A 4XDJA 2YDEA 5LMNB 2YIBA 4LFCO 4BWAA 5IJ9A 2OT5A 1HNXB 2QWRB 1R6NA 1SQFA 3EVKA 2QM4A 4LFAB 2LQTA 1M4UA 2F23A 1O9GA 1KQSU 3MAQA 1NZ6A 1IBMO 2OIEA 3JAKA 3AG4C 4DR7O 4B7KA 3FD9A 5IYBO 2IU3A 4L8JA 3JD1A 1N32B 5LOVB 3ZHUA 4PI2A 2RNBA 2K9PA 2Z3YA 1FFTB 2D3OW 2ZNJA 2DWEC 3JD2A 2F43G 2VS0A 3EXAA 3S3WA 1WLEA 5EIBC 3RT3C 3CMAV 4JYAB 2XOKG 5K1PA 3U0ZA 1VF5B 5KHKA 1WA8B 4X1IB 2B5UA 4PA4A 5EYPB 1J5EO 1BGYH 4QE7A 4H44B 3ZN0A 3VQYA 4I0XA 3BY6A 3SPCA 2BSKB 2ODMA 3CCSV 1F7YA 1I94B 2KKWA 4J7JA 1IURA 1XI1A 2Q69A 5C8YA 4UVCA 4X1KA 4J9YB 4OX9O 2K1EA 2C2AA 3P3PA 3E89A 4TQDA 1G1XB 1NR7A 2WLHA 1SQVH 5FNVA 1I5XA 4AI8A 4X20B 1HW7A 2VWJA 4MTOA 1H2GA 2FB5A 2WA3A 3K5NA 1BE3H 5H5NA 4GCZA 4LF8O 1FS0G 3AG3B 1XMQO 1BQ0A 2GBOA 4O4JA 2XAHA 2EILB 4PDLA 2ZINA 4X64O 1IVSA 2A0LA 1VQ4V 4JZGA 4I9QA 1MA1A 1JJ2U 2WLMA 3Q4HA 5GW7A 2KG7A 1XNQB 5KHHA 5AG2A 2BTQB 1WPBA 4WF9V 1NVPD 4ZKIA 1JVMA 2W0FC 3H1HH 3CRCA 4DV4O 3OAAG 4OX9B 2HFEC 1V54B 3SYQA 3L71H 1YI2V 1P7GA 5LOVA 3K0DA 4QGPA 3CCLV 1AR5A 4MVQA 2WA4A 5LXTB 2ZXWB 2CK3G 1VQOV 3ABMB 2B9ZA 4DR6B 2EZOA 4EKWA 4LR3A 2A3QA 4JI0B 4DR2B 2QM7A 4IT5A 1QLEC 4X64B 3AG3C 1WA8A 3BVOA 4FFBB 1BHBA 3CCRV 2AZ0A 3ABKB 2CTPA 2EILC 1KKDA 3BEHA 4IIJB 3OTOO 1OJHA 2QTSA 3SPGA 4HYOA 3CS5A 4X62B 2E3CA 2A7WA 3RFRA 4BIOA 2DN9A 3CC4V 4TSFG 4G28B 1GM9A 3ZRVA 4JI6B 3K57A 2OWOA 4CS3A 3LSUA 2LFRA 1B3QA 4JI5B 3AG7A 4MT8A 1U96A 4XDKA 4H13B 2GHYA 4DV3O 3G6BA 2BCCH 5CBFA 3PN1A 4X20A 1V54C 1PL4A 1IXBA 1Y74B 3CC2V 5B1BB 1JMKC 1Q3EA 3G67A 1RSOB 3SYOA 5IJ0B 1EN6A 1P4RA 4NVPA 2YI8A 1KKCA 5GONB 3ML0A 4E4EA 5J2TB 2DOSA 2QWOB 3SDLA 4NXMO 4PV1B 3ABMC 5IT9N 2F66C 2Y4TA 3E22B 1D5AA 2CE4A 3CJHA 2JDIG 1SETA 2X6CA 3O65A 4G27B 3ETQA 5JJEB 3ABKC 2BTQA 3OEEG 3LDDA 4IL6Z 2YI9A 3M99B 4F6EA 4LH6A 2VQEO 4CBCA 4DV1B 4DV7B 3J81N 1HDJA 4B3TO 4I9WA 1AP6A 3TK1A 3THOA 1HNZB 5LXTA 3ZMZA 1PKXA 5DEDA 4O4IB 3T4DA 1YSCA 3CD6V 1NTZH 4E2LA 4LF6O 1DLBA 1P84F 3T1CA 1H2MA 3EHBB 5EIBD 5B1BC 5L3EA 4R50A 1OCOB 2R70A 5C93A 1SRYA 1S5JA 2G38A 5FPOA 3SPIA 4Z1MG 1Q7YW 3AG2C 4KXRA 2ARHA 4A5UB 1AILA 3IFXA 2ZD9A 1NJIW 5KHGA 5JJJB 4B3RO 3GB7C 3DXRA 1N36O 2PZSA 1E79G 5KHJA 5LMUO 2HVKC 5LA6B 2PYJA 3FB8C 1XDCA 1P49A 5IWAB 1FPOA 3BA9A 5D5PA 1H8HG 4JI3O 1TUBA 3F5WC 3HR0A 5IJ0A 1RSOA 2BTOA 2YXLA 4MSWC 2Q9LA 3OR7C 1VQMV 5B1AC 3OGCC 2XT9A 1NS1A 3RYIB 3CYOA 1HR0O 2HJFC 4FM1A 3JD4A 4PD4F 2R9IA 3WB0A 2FKXA 1XMOB 1L8DA 5KUKA 2L35A 4WFEA 4DUZB 4K8XA 3QVNA 4BIZA 5B1NA 1RM1B 3E83A 4LFBO 2P6JA 4RO2A 3JAWB 2YUAA 1EZJA 4MVMA 3MDSA 1K8AW 3STLC 1SQXH 3HKCB 2KB1A 5JWPA 2ZIMA 1AB3A 4KHPO 3ASOC 1H8EG 3K04A 3N2GB 5HFMA 5ITZB 4YIPA 2MK3A 1RP3B 4AQYB 3K0GA 1H2KA 4J11A 4R8CA 4RAIA 1HNWO 2RDCA 2V4DA 4O4IA 3RWRD 2UXBO 2EBOA 4C7UA 4TWKA 1SZXA 3FAVA 3AK2A 1HR0B 2W6IG 1PV0A 3QF7A 3SGIA 2JK5C 4PI0A 1KU9A 2Y48A 4ZIBA 2PF4E 2HHHB 4Q20A 3OMIB 5BY1A 1F23A 4FM0A 4WFHA 2Q0AA 2P90A 2WLKA 2RCVA 2XAJA 1PNMA 2QKSA 2Q5ZA 3R66A 1Y66A 1I5YA 1Y67A 1YDXA 4CH6A 1KMIZ 2QE7G 5LA6A 3QG5A 1YHQV 1W0KG 2E5LO 2EIMC 2F1MA 2JVDA 3CCEV 2IU0A 5JQGB 1TVKB 2XAGA 2WLIB 3UQ8A 4DR4B 2LW1A 3ZS8C 2QM8A 1AJPA 2VQFB 3WU2Z 2ETNA 3JSLA 2UXBB 2RMKB 4RUEA 2N74A 3IAYA 4U7NA 1R6TA 3RYIA 4YY3O 3RVZA 2UUAO 3CRQA 3LDEA 3K9SA 3H1LH 4YHHB 4LF4O 2PUSA 4DV6O 2ZM6B 1TGOA 4DR5B 4TUYB 3W7XA 1PNLA 2JEXA 2UUCB 2A9HA 1I0HA 3ZRWB 1M90W 3N2GA 5ITZA 3JCUZ 1KUQA 1PL0A 1FJGB 1VARA 3CMEV 5LHHA 1OCZB 1VQPV 3B09A 2F93B 4OGQB 2AHYA 1W0JG 4CS2A 3I5DA 4DV2B 2ZKOA 3HPLC 2UXDB 4BW9A 5KX5B 1R3JC 1YZBA 1K34A 4ZBMA 3STZC 3WFVA 1VMGA 1BQZA 4HBNA 1S3JA 3JSNA 4OPAA 4FJCC 4UCUA 3JALB 1K9MW 1VQ9V 1SZTA 3G6EV 4UXNA 5CA1A 1EBOA 3NR7A 4IHJA 2JRIA 4U7OA 3AG1B 1HWYA 2Y4UA 1EFRG 4WCEV 1V9PA 5LMNO 4DXWA 1B06A 5JH7A 1ZWIC 4PHZA 1M57C 3W7SA 2N05A 1HNXO 4TQFA 1HP8A 1FXHA 4LFAO 5A9GA 1K92A 4DW0A 1F4NA 3HB3B 5JQGA 1TVKA 2EIKB 1GO3F 3K03A 4DK1A 1N32O 3RYHB 3E86A 2Q7EA 3MHHC 3LNNA 1P7BA 3E35A 1Q6HA 4NKGB 1AJNA 4FK5C 5EC1C 3OFNG 1AI7A 4GX5A 4JYAO 3PJSK 3SJAC 4TV9A 5L3GA 2OCCB 3FYEB 5HFLA 3GVMA 4GYCB 5CBGA 3RYCA 4TUYA 4UCOA 1EZVH 3GWKC 5E79Z 1BSMA 4O4LA 4PA7A 3QTCA 2ZE5A 3AK3A 1I94O 4GX1A 3CRMA 3ZRWA 1WP8A 2DQ0A 1EN4A 1XOUA 4CH3A 4GKJB 1AI4A 1XUQA 1E1RG 4FIPC 3VQXA
chains in the Genus database with same CATH topology
2UXBO 4LF6O 3F5TA 4LF9O 4DV0O 4JI5O 2AGAA 1J5EO 1X59A 4NXNO 2F4VO 5IWAO 1YZBA 5FLXN 4A5UB 1AILA 3OTOO 1F7YA 2UXCO 4OPAA 1FKAO 5BY1A 3JAMN 4JI1O 4B3RO 4DR4O 1N36O 4OX9O 2VQFO 3T1YO 4DR3O 2JRIA 5LMUO 3M8AA 2LW7A 4B3SO 1IBKO 3R66A 1G1XB 4JV5O 1XMOO 3J7AU 5LMNO 5BXZA 4DV3O 4DUZO 2E5LO 1HNXO 1XNQO 2UUBO 4B3MO 4YHHO 1XEQA 1D2DA 5H5NA 4JI3O 4LF8O 1XMQO 4LFAO 1R1BA 1XNRO 4DUYO 2DOSA 2ZM6O 4X65O 1NS1A 3SDLA 4X64O 4DR5O 1HR0O 4NXMO 4JI7O 4DV1O 4GKKO 4DV7O 4LF7O 5IT9N 2N74A 2FKXA 4LF5O 1R6TA 1N32O 4YY3O 2UUCO 4JI4O 4JI8O 4LFCO 1IBLO 2UUAO 3O65A 1HNZO 4AQYO 1FJGO 4GKJO 2Z0AA 4LFBO 4DR6O 4JYAO 1DK1A 4DV2O 4LF4O 4DV4O 1A32A 4JI0O 4OPHA 2UXDO 3T1HO 4DR2O 5A2QN 4DV6O 1IBMO 2DJVA 2VQEO 4DR7O 1N34O 2UU9O 4DV5O 3J81N 1AB3A 3J80N 4KHPO 4B3TO 4DR1O 4X66O 5LL6Y 1I94O 2HHHO 4X62O 1N33O 1KUQA 4JI2O 2ZKOA 5BR8O 1FYJA 4K0KO 3RT3C 1HNWO 4JI6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB O;  4LF6 O;  3F5T A;  4LF9 O;  4DV0 O;  4JI5 O;  2AGA A;  1J5E O;  1X59 A;  4NXN O;  2F4V O;  5IWA O;  1YZB A;  5FLX N;  4A5U B;  1AIL A;  3OTO O;  1F7Y A;  2UXC O;  4OPA A;  1FKA O;  5BY1 A;  3JAM N;  4JI1 O;  4B3R O;  4DR4 O;  1N36 O;  4OX9 O;  2VQF O;  3T1Y O;  4DR3 O;  2JRI A;  5LMU O;  3M8A A;  2LW7 A;  4B3S O;  1IBK O;  3R66 A;  1G1X B;  4JV5 O;  1XMO O;  3J7A U;  5LMN O;  5BXZ A;  4DV3 O;  4DUZ O;  2E5L O;  1HNX O;  1XNQ O;  2UUB O;  4B3M O;  4YHH O;  1XEQ A;  1D2D A;  5H5N A;  4JI3 O;  4LF8 O;  1XMQ O;  4LFA O;  1R1B A;  1XNR O;  4DUY O;  2DOS A;  2ZM6 O;  4X65 O;  1NS1 A;  3SDL A;  4X64 O;  4DR5 O;  1HR0 O;  4NXM O;  4JI7 O;  4DV1 O;  4GKK O;  4DV7 O;  4LF7 O;  5IT9 N;  2N74 A;  2FKX A;  4LF5 O;  1R6T A;  1N32 O;  4YY3 O;  2UUC O;  4JI4 O;  4JI8 O;  4LFC O;  1IBL O;  2UUA O;  3O65 A;  1HNZ O;  4AQY O;  1FJG O;  4GKJ O;  2Z0A A;  4LFB O;  4DR6 O;  4JYA O;  1DK1 A;  4DV2 O;  4LF4 O;  4DV4 O;  1A32 A;  4JI0 O;  4OPH A;  2UXD O;  3T1H O;  4DR2 O;  5A2Q N;  4DV6 O;  1IBM O;  2DJV A;  2VQE O;  4DR7 O;  1N34 O;  2UU9 O;  4DV5 O;  3J81 N;  1AB3 A;  3J80 N;  4KHP O;  4B3T O;  4DR1 O;  4X66 O;  5LL6 Y;  1I94 O;  2HHH O;  4X62 O;  1N33 O;  1KUQ A;  4JI2 O;  2ZKO A;  5BR8 O;  1FYJ A;  4K0K O;  3RT3 C;  1HNW O;  4JI6 O; 
#chains in the Genus database with same CATH topology
 3OT7 A;  4GLX A;  1ZL8 A;  1FD9 A;  2QDO A;  4J10 A;  4DV5 B;  4I55 B;  2AHZ A;  3TXS A;  1VQ5 V;  1JJO A;  2QGN A;  1FXV A;  4DR1 B;  5KX5 A;  4X66 B;  1NTM H;  2ATK C;  1PM9 A;  3T2M A;  3JAL A;  1PP9 H;  2QKA A;  4UVA A;  1ORQ C;  4I50 A;  3TCU A;  4PDV A;  4MS2 A;  1OCR B;  5L3C A;  3BAB A;  1Q5O A;  4LNU B;  4OXS A;  2H3O A;  2OCC C;  1XNQ O;  4I4T A;  1H2N A;  2UXC B;  1SES A;  1QR8 A;  2ZCE A;  4HNA B;  4O2A B;  5JVD B;  3L9D A;  4DR3 B;  3KCX A;  4GT1 A;  2XUM A;  3DC5 A;  1G6U A;  4QNH B;  2Y0I A;  4CS4 A;  4JAS A;  3FKS G;  3F7V C;  4PA6 A;  1VF6 C;  4Z2W A;  2ITD C;  2DMX A;  1QHT A;  2UUB B;  1K5S A;  4DR6 O;  4JGS A;  1A32 A;  1GK9 A;  4JI0 O;  2Q0O C;  3W7W A;  4JZ2 A;  4DR2 O;  2FTK A;  4UFZ A;  3CXH F;  4UCR A;  1J95 A;  4WFB V;  3HKE B;  5KHI A;  3AK1 A;  3CPW U;  4DW1 A;  3TET A;  3OMA B;  4X62 O;  5B3S B;  5H6R A;  3E8G A;  2ZE8 A;  2ZQM A;  1ZX3 A;  1LUW A;  1GM7 A;  2CGN A;  4JI6 O;  1VF6 A;  2B1G A;  3CXC U;  3T1H B;  2JIZ G;  4NTX A;  1FXK B;  4LWS B;  4LH7 A;  4JPR A;  4JI5 O;  2F4V O;  3SR2 C;  1VQN V;  2E74 B;  2RQ6 A;  3OEH G;  2HR3 A;  1SQB H;  4I55 A;  4MTG A;  2H94 A;  1M9N A;  3B77 A;  4UCS A;  2IJI A;  3JAM N;  1Z2G A;  1YJW V;  3IC7 A;  2WPD G;  1ZTE A;  4X8A A;  2KQX A;  3D3Q A;  3K5L A;  3ASN B;  3H9V A;  1GKF A;  4D7T A;  2OIG A;  2FML A;  4X1I A;  1GN6 A;  3NXS A;  3ZBH A;  5EYP A;  3U11 A;  4QE9 A;  4LNU A;  3ZMT A;  2X6A A;  3E8H A;  2BSK A;  4UCT A;  1BHA A;  4J7K A;  2NR5 A;  3MHS C;  1Q86 W;  5JCO C;  3H01 A;  1NKD A;  1JR9 A;  4HNA A;  2MW2 B;  1WB7 A;  2CDY A;  4PJ0 Z;  5JVD A;  3VOU A;  3QO5 A;  3A8T A;  4DV1 O;  4DV7 O;  2F4V B;  3ZX6 A;  2JEU A;  2ZT9 B;  2JS3 A;  1SF9 A;  1HNZ O;  2LFS A;  2Z0A A;  2OTJ V;  4CC5 A;  4BR6 A;  3G80 A;  4FZ1 A;  2VRZ A;  1IZ3 A;  3L75 H;  2ZXW C;  4J42 A;  1YJ9 V;  4LF7 B;  3CRA A;  1COW G;  3A0H Z;  3L74 H;  3ASN C;  3FB6 C;  3HKE A;  5JCO A;  3G71 V;  4O2B B;  3KCY A;  1VQL V;  2UXX A;  5J2U B;  4YJ3 B;  4R6Z A;  1VQ6 V;  2GDS A;  3F5T A;  2YXY A;  4NB5 A;  1WP7 A;  1KB9 F;  4LWS A;  2H8P C;  5IWA O;  3OMN B;  2E76 B;  3VQW A;  3EFF K;  5B5E Z;  4UUJ C;  4JI2 B;  3ZCC A;  4FLW A;  1B04 A;  5BR8 B;  3L72 H;  4K0K B;  3LSS A;  1GN4 A;  5JJN B;  4RQF A;  1XIL A;  5EBW C;  4I5S A;  1MZF A;  1XMO O;  1RPR A;  4JYB A;  1FAF A;  1W59 A;  4DUZ O;  3ABT A;  1LR1 A;  4FFB A;  5KAF Z;  2YEV B;  1UJW B;  4H37 A;  4IIJ A;  3CRR A;  3H1J H;  4MW8 A;  4JI1 B;  3CCU V;  1WJZ A;  3ZN1 A;  4I7Z B;  1QLN A;  1WNS A;  1Q8I A;  4CH4 A;  2YC0 A;  1XHX A;  4LCU C;  2LGW A;  3VBB A;  3K5M A;  1E1Q G;  3W7T A;  1NU1 H;  1VQ7 V;  1F51 A;  1PPJ H;  4JTC B;  4RUF A;  2OTL V;  4AQY O;  1H38 A;  3ABL B;  1NH2 B;  4ZHQ B;  4UVB A;  1Y74 A;  2IJJ A;  5CN0 A;  3B40 A;  4ZOL B;  1H2L A;  3B8M A;  3CE2 A;  5A2Q N;  4U3F H;  5GON A;  2RJZ A;  4GKK B;  5J2T A;  3H1K H;  5E1A C;  2CTW A;  3CSX A;  4JI8 B;  1M5I A;  2Q68 A;  3L70 H;  4FFK A;  2HHH O;  2F95 B;  3RW0 A;  3E22 A;  1N4C A;  4UV9 A;  2XAQ A;  3UO2 A;  1OCO C;  4JYY A;  2BOC C;  3K5O A;  5H2F Z;  1LNQ A;  5KMG B;  4MTX A;  3JYC A;  4YJ3 A;  1Y4M A;  1UPG A;  1OCC B;  2XHB A;  3C3T A;  3IJ4 A;  2UU9 B;  4P9O A;  1JPX A;  5FLX N;  4CZZ A;  4LP8 A;  4F4L A;  2DYS B;  1GRJ A;  2EIJ B;  1B6Q A;  2CH7 B;  3AEI A;  4IYI A;  5CBH A;  1AI6 A;  1KYO F;  4DR4 O;  4PA3 A;  2WLN A;  1EN5 A;  2VQF O;  3T1Y O;  3JAS B;  2GTS A;  4X89 A;  3UT5 B;  1Y6X A;  3M8A A;  4DV0 B;  1UFI A;  1MG1 A;  3X2Q B;  4NXN B;  1QQC A;  3BA8 A;  1SC5 B;  4NYK A;  2V1D A;  1DTO A;  1NQT A;  4YJ2 B;  2KSD A;  1TA8 A;  4YHH O;  1XEQ A;  1D2D A;  2R9R B;  2YEV A;  4ZI7 B;  2QA4 V;  1ROP A;  4EB6 B;  2CTQ A;  1WPX A;  2ZM6 O;  4DR5 O;  1IBK B;  1CEZ A;  1KD1 W;  1RM1 C;  4WFG A;  4JV5 B;  3ZHQ A;  4H33 A;  1Q90 D;  4QIW F;  3K3W A;  2UUC O;  4X88 A;  3HKB B;  1YXB A;  3ZHT A;  2W0X A;  1MSW D;  2ZR2 A;  4MVR A;  1FJG O;  3MD0 A;  2D2C B;  5EBL C;  1QCE A;  2ZE7 A;  4X1Y B;  4B7E A;  3ZMS A;  4DV2 O;  4ZHQ A;  1XNR B;  2R9A A;  4LC1 A;  2WLL B;  5KAI Z;  3E8B A;  3T1Y B;  2UXD O;  4MW3 A;  4ZOL A;  2ADQ B;  2EIJ C;  3OGI B;  4NTW A;  2A06 H;  4LF5 B;  1S77 D;  1L1F A;  4JI4 B;  3RYF B;  1IBL B;  2ITC C;  3ABU A;  3A2F A;  1U97 A;  3OE7 G;  3CX5 F;  4D7S A;  2IJK A;  3X2Q C;  5CB4 B;  3E8F A;  1XQ8 A;  4IGG A;  2HEP A;  2QEX V;  3JAW A;  3KZI Z;  5KMG A;  4N21 A;  3ETD A;  2V7Q G;  4KFM A;  1W2B U;  4R7C A;  3HKC A;  1YIT V;  1JA8 A;  2QTO A;  4CC6 A;  4K35 A;  1O9H A;  2IJH A;  3H1I H;  3IC9 A;  1N33 B;  1MMM A;  2PI5 A;  1IX9 A;  2Z5U A;  2ADP A;  3N2K B;  2CH7 A;  2QR4 A;  2YID A;  3APQ A;  1CXZ B;  3KKY A;  2LW7 A;  3RVY A;  3JAS A;  4NTY A;  1NI8 A;  5J9P C;  3ZJZ A;  2PGG A;  5IJ9 B;  1IXM A;  4YXW G;  3J7A U;  2LO1 A;  1QVF U;  4BAY A;  4UV8 A;  3APO A;  1US6 A;  5IY5 B;  4YJ2 A;  3SYP A;  5IE9 A;  3ETE A;  5TIS Z;  2LJ2 A;  4ZI7 A;  4Z1V A;  3ZED A;  2ZR3 A;  4EB6 A;  5KA6 A;  3I55 V;  5B66 Z;  3BAA A;  4MVZ A;  2NN4 A;  1YVW A;  3HKB A;  2WWW A;  1GN2 A;  4WFA V;  3OUS A;  4GKJ O;  2YIA A;  1XHZ A;  4W4L A;  3FYI B;  4FPP A;  2WLI A;  4X1Y A;  1Z5W A;  5L3D A;  2JJ1 G;  2WLL A;  4JI7 B;  2NLJ C;  4DV5 O;  5EC2 C;  1THZ A;  5L3B A;  3ZHS A;  1OCZ C;  1F4M A;  4J80 A;  4DR1 O;  4X66 O;  1TAE A;  2IM9 A;  1VIB A;  4GZR B;  3RYF A;  5C8Y B;  1Z5V A;  4JYC A;  4PEL A;  4X1K B;  3WG7 B;  2PTM A;  4K3A A;  1FYJ A;  2L6L A;  5CB4 A;  2YS8 A;  2X0L A;  4FLZ A;  4ICG A;  1AR4 A;  1N0J A;  2QSA A;  3FB5 C;  5IY5 C;  3QNE A;  1VEW A;  1DGS A;  1YEW A;  2EIN B;  2QJ1 A;  3TXQ A;  2UXC O;  2UXN A;  1KEC A;  3AG1 C;  3RN4 A;  3N2K A;  4DR3 O;  2XAF A;  2P67 A;  4LF9 B;  2Q67 A;  3CCM V;  1MAB G;  1KBH A;  2PY5 A;  2GV9 A;  1GAX A;  3C3S A;  2Y0P A;  4FLV A;  1NH2 D;  2UUB O;  4Q6G A;  2EIK C;  1ZAU A;  4U3J B;  4FLY A;  4HAM A;  5LP6 B;  1VP7 A;  2EZP A;  3CHX A;  4MVS A;  1KC8 W;  4B3S B;  3QO7 A;  2FL4 A;  3WG7 C;  4JAV A;  5FL7 G;  2JGU A;  5BMV B;  1H2S B;  3ZHR A;  5CA0 B;  4TV8 B;  4B3M B;  2WSS G;  4L87 A;  4MTF A;  2LP7 A;  2YIC A;  1MZE A;  3LSQ A;  3SJQ C;  5IDJ A;  2EIN C;  1XRE A;  2OCH A;  1YF2 A;  4DUY B;  1R3K C;  3T1H O;  2PI4 A;  3M7M X;  4X65 B;  3OM3 B;  5LBQ A;  1Q82 W;  1XL6 A;  1JQ0 A;  4EFE A;  3WB2 A;  5L3F A;  2P7T C;  4DK0 A;  4LFC B;  3RYH A;  5LL6 Y;  2HVJ C;  2JGD B;  2AZ2 A;  1X4T A;  2P4K A;  3BPZ A;  1N0N A;  1CPY A;  3CEI A;  2EUL A;  4DRX B;  3SJB C;  1IBM B;  2HP8 A;  3CP1 A;  3R65 A;  4JAA A;  4DR7 B;  1BCC H;  5LP6 C;  2OYQ A;  2X7R B;  2PYL A;  2Q7H A;  4K8Z A;  2EX3 A;  2RN9 A;  2M6Y A;  2Q4P A;  1QR9 A;  1MNG A;  1T5E A;  2HLD G;  1QLE B;  2LGQ A;  2IBZ H;  1DF4 A;  3BCC H;  1YTF B;  1OCR C;  1QBZ A;  3T4Z A;  1K4C C;  2N04 A;  4GUN A;  2YXH A;  4ABM A;  3P30 A;  2BOB C;  2P22 C;  1J5E B;  3B4S A;  4MVO A;  3CJH B;  4H0L B;  1EM1 A;  2ILM A;  3LDC A;  3JD0 A;  5LGN A;  4PDR A;  4ASU G;  1YCI A;  5FPR A;  3ZMU A;  5DM6 V;  4U3J A;  1NT2 B;  1CP9 A;  2XTA A;  5LP6 A;  1R1B A;  4BIU A;  1GM8 A;  3TGU H;  2DWD C;  4PDM A;  4DYL A;  2M7W A;  4LF7 O;  2CAZ C;  1BMF G;  2HKO A;  5LHG A;  5BMV A;  1QNM A;  3OR6 C;  5CA0 A;  1K7D A;  4TV8 A;  3N27 A;  4LF8 B;  1M56 B;  2O57 A;  1XMQ B;  1Q6U A;  3K79 A;  3CC7 V;  4J9Z B;  3FB7 C;  4OPH A;  1VF7 A;  4O2A A;  1NR1 A;  2IH3 C;  4P9P A;  3O9O A;  3SPH A;  5IYC O;  1URF A;  5B3S C;  2P5O A;  1JOY A;  3FX7 A;  3L73 H;  1K97 A;  1V55 B;  3IGA C;  1FXK C;  3DXR B;  4G2K A;  2JGD A;  1ENV A;  4XDL A;  4JI2 O;  4IYH A;  1AVM A;  5BR8 O;  4K0K O;  5LYJ B;  2YIB D;  4DV4 B;  2Q73 A;  4DRX A;  1AR1 B;  1OV9 A;  4BW5 A;  3BFR A;  1X59 A;  4P30 A;  2ZNI A;  1K73 W;  5DN6 G;  4GX2 A;  3ZMV A;  1TUB B;  2NNU A;  3G4S V;  1ARO P;  4JI1 O;  2Q7G A;  2XND G;  3F7Y C;  1R6K A;  3AG2 B;  5GTI Z;  4DO2 A;  3BHP A;  5H9C A;  4EEQ A;  4FM2 A;  1M56 C;  4FLU A;  1FXK A;  1SQG A;  4KP4 A;  1JX9 A;  3OTO B;  2AW9 A;  1ZSP A;  3TJT A;  3K08 A;  1V55 C;  3QO8 A;  3OW2 U;  1WAZ A;  3UCS C;  4GKK O;  1SKV A;  4W4K A;  1QU7 A;  4JTA B;  4CH5 A;  2ZIO A;  3I56 V;  4AIL C;  3JAR B;  1S5H C;  1K5Q A;  4JI8 O;  4DV3 B;  3CCJ V;  5B1A B;  1NTK H;  2P4V A;  3K58 A;  1R3I C;  1R73 A;  2JS5 A;  3JAT B;  5DEC A;  1BT8 A;  3ZHV A;  3CCQ V;  4RQE A;  5IYD O;  1SA0 B;  3FAV B;  2HG5 C;  1Q6I A;  1JFF B;  3GWO A;  1YIJ V;  4NXM B;  1M1K W;  5LGU A;  1N34 O;  2UU9 O;  3K59 A;  5BZB A;  3SPJ A;  3W7U A;  2DYR B;  3HKD B;  1IDS A;  4F6R B;  1S5L Z;  1L0N H;  2IW5 A;  3ASO B;  3B8N A;  2DW4 A;  1AJQ A;  1KP3 A;  4UB6 Z;  5LYJ A;  3OTF A;  3ZIA G;  5LGT A;  4FLX A;  1TUE B;  4DV0 O;  2EJR A;  2VQE B;  2E75 B;  2AGA A;  4EFB A;  1YJN V;  3RBZ A;  4NXN O;  4WBN B;  2CTR A;  4B3T B;  1Q43 A;  2R72 A;  2WAM A;  2BE3 A;  1DF5 A;  3LUT B;  4UCV A;  5KUM A;  1K3E A;  4O2B A;  3K9A A;  1BS3 A;  4JAU A;  5J2U A;  1I08 A;  4LF6 B;  1IBK O;  1S76 D;  5H6Q A;  2X6B A;  4JV5 O;  2GUZ B;  2ZDI C;  1N34 B;  3JD3 A;  1BL8 A;  4KUM A;  2Q8V A;  4O4H B;  3ZRX A;  4RWU A;  1R3L C;  1KP2 A;  5LHI A;  4B3R B;  1GN3 A;  1L0L H;  1SQP H;  5D5Q A;  3ZRS A;  5CA3 A;  2DYR C;  1N36 B;  2EIM B;  1XNR O;  4JF3 A;  1BZK A;  4AHC A;  5LMU B;  3DSQ A;  3VQV A;  4LF5 O;  2Y69 B;  1NBM G;  3ABL C;  4JI4 O;  5EK0 A;  4TOI A;  3FFQ A;  1IBL O;  4LBE C;  3JAR A;  3B2E E;  1FFX B;  3D8C A;  4JI3 B;  4QPK A;  3UM7 A;  5KA5 A;  1DK1 A;  2ZDI A;  3JAT A;  3U10 A;  1SA0 A;  1JCH A;  1WN7 A;  2XAS A;  2DJV A;  4X9Q A;  2QWQ B;  3D36 C;  4J41 A;  1JFF A;  4JTD B;  3OD4 A;  2DE0 X;  1MOF A;  1YTF D;  3DC6 A;  1OCC C;  5CA1 B;  1N33 O;  5KLV H;  4IHJ B;  4LFB B;  2W6J G;  2A79 B;  5GTH Z;  1RFY A;  3HKD A;  4F6R A;  1QVG U;  1NVP B;  4QPJ A;  3JCZ A;  2DYS C;  5JH7 B;  1ZUQ A;  2P06 A;  2CUG A;  3SYA A;  3P32 A;  3P3N A;  1S0V A;  4KHP B;  4WBN A;  1M93 A;  3K06 A;  5B1O A;  4FZ0 A;  4D6T H;  1Y76 B;  4QJF B;  3RGB A;  4MVU A;  3ETG A;  5EZY B;  4N23 A;  2Y69 C;  2Q6A A;  2IH1 C;  3D36 A;  4TT3 G;  2QKC A;  1OZ0 A;  4B08 A;  2GTA A;  1AP5 A;  1HNW B;  2JJ2 G;  4J7Z A;  1D5N A;  1I7F A;  1VQ8 V;  1SS3 A;  2GUZ A;  5BXZ A;  1XL4 A;  1SER A;  2HJD A;  4O4H A;  2QWN B;  1PD3 A;  1RPO A;  1N8R W;  2GSM B;  5K1X A;  1SQQ H;  1S72 V;  4TV9 B;  1VQK V;  4WFF A;  2QWP B;  4FMT A;  1M57 B;  5IYZ B;  3RYC B;  2WLJ A;  4JI7 O;  4O4L B;  3UT5 A;  3WB1 A;  2DQ3 A;  1G4Y B;  5CMU A;  1K4D C;  1K33 A;  2E5L B;  3SJC C;  5EBM C;  4UB8 Z;  3CCV V;  1FFX A;  3BRC A;  1ZL8 B;  3JAK B;  4XBF A;  3DTU B;  1LUV A;  4FLT A;  1ZLZ A;  4HZ3 A;  1XBL A;  4YY3 B;  3J80 N;  4KL1 A;  3CWB H;  2UUA B;  1PNK A;  2AXT Z;  1G8M A;  3E2E A;  4P2Z A;  4I50 B;  3SYC A;  4LF4 B;  1Q81 W;  2FYU H;  4DV6 B;  4LF9 O;  4FVM A;  4I0X B;  3OUF A;  4GX0 A;  3A0R A;  4I4T B;  3UO3 A;  1AI5 A;  3LNM B;  1OHH G;  3C90 A;  1FKA O;  3AG4 B;  3UKM A;  5F2V O;  1Y76 A;  2YSU B;  3DGE A;  5EZY A;  4YIO A;  3D3I A;  5FNV B;  2B1I A;  4B3S O;  1WB8 A;  3ICX A;  1GH6 A;  3S3X A;  1GMG A;  1MSD A;  4B3M O;  3CB2 A;  2VWK A;  2ZE6 A;  4O4J B;  1GTO A;  2CGO A;  2EJ7 A;  4PA9 A;  4DUY O;  4X65 O;  3KG2 A;  5IYZ A;  3A0B Z;  3Q4H B;  2KG7 B;  4NR1 A;  4XDJ A;  2YDE A;  5LMN B;  2YIB A;  4LFC O;  4BWA A;  5IJ9 A;  2OT5 A;  1HNX B;  2QWR B;  1R6N A;  1SQF A;  3EVK A;  2QM4 A;  4LFA B;  2LQT A;  1M4U A;  2F23 A;  1O9G A;  1KQS U;  3MAQ A;  1NZ6 A;  1IBM O;  2OIE A;  3JAK A;  3AG4 C;  4DR7 O;  4B7K A;  3FD9 A;  5IYB O;  2IU3 A;  4L8J A;  3JD1 A;  1N32 B;  5LOV B;  3ZHU A;  4PI2 A;  2RNB A;  2K9P A;  2Z3Y A;  1FFT B;  2D3O W;  2ZNJ A;  2DWE C;  3JD2 A;  2F43 G;  2VS0 A;  3EXA A;  3S3W A;  1WLE A;  5EIB C;  3RT3 C;  3CMA V;  4JYA B;  2XOK G;  5K1P A;  3U0Z A;  1VF5 B;  5KHK A;  1WA8 B;  4X1I B;  2B5U A;  4PA4 A;  5EYP B;  1J5E O;  1BGY H;  4QE7 A;  4H44 B;  3ZN0 A;  3VQY A;  4I0X A;  3BY6 A;  3SPC A;  2BSK B;  2ODM A;  3CCS V;  1F7Y A;  1I94 B;  2KKW A;  4J7J A;  1IUR A;  1XI1 A;  2Q69 A;  5C8Y A;  4UVC A;  4X1K A;  4J9Y B;  4OX9 O;  2K1E A;  2C2A A;  3P3P A;  3E89 A;  4TQD A;  1G1X B;  1NR7 A;  2WLH A;  1SQV H;  5FNV A;  1I5X A;  4AI8 A;  4X20 B;  1HW7 A;  2VWJ A;  4MTO A;  1H2G A;  2FB5 A;  2WA3 A;  3K5N A;  1BE3 H;  5H5N A;  4GCZ A;  4LF8 O;  1FS0 G;  3AG3 B;  1XMQ O;  1BQ0 A;  2GBO A;  4O4J A;  2XAH A;  2EIL B;  4PDL A;  2ZIN A;  4X64 O;  1IVS A;  2A0L A;  1VQ4 V;  4JZG A;  4I9Q A;  1MA1 A;  1JJ2 U;  2WLM A;  3Q4H A;  5GW7 A;  2KG7 A;  1XNQ B;  5KHH A;  5AG2 A;  2BTQ B;  1WPB A;  4WF9 V;  1NVP D;  4ZKI A;  1JVM A;  2W0F C;  3H1H H;  3CRC A;  4DV4 O;  3OAA G;  4OX9 B;  2HFE C;  1V54 B;  3SYQ A;  3L71 H;  1YI2 V;  1P7G A;  5LOV A;  3K0D A;  4QGP A;  3CCL V;  1AR5 A;  4MVQ A;  2WA4 A;  5LXT B;  2ZXW B;  2CK3 G;  1VQO V;  3ABM B;  2B9Z A;  4DR6 B;  2EZO A;  4EKW A;  4LR3 A;  2A3Q A;  4JI0 B;  4DR2 B;  2QM7 A;  4IT5 A;  1QLE C;  4X64 B;  3AG3 C;  1WA8 A;  3BVO A;  4FFB B;  1BHB A;  3CCR V;  2AZ0 A;  3ABK B;  2CTP A;  2EIL C;  1KKD A;  3BEH A;  4IIJ B;  3OTO O;  1OJH A;  2QTS A;  3SPG A;  4HYO A;  3CS5 A;  4X62 B;  2E3C A;  2A7W A;  3RFR A;  4BIO A;  2DN9 A;  3CC4 V;  4TSF G;  4G28 B;  1GM9 A;  3ZRV A;  4JI6 B;  3K57 A;  2OWO A;  4CS3 A;  3LSU A;  2LFR A;  1B3Q A;  4JI5 B;  3AG7 A;  4MT8 A;  1U96 A;  4XDK A;  4H13 B;  2GHY A;  4DV3 O;  3G6B A;  2BCC H;  5CBF A;  3PN1 A;  4X20 A;  1V54 C;  1PL4 A;  1IXB A;  1Y74 B;  3CC2 V;  5B1B B;  1JMK C;  1Q3E A;  3G67 A;  1RSO B;  3SYO A;  5IJ0 B;  1EN6 A;  1P4R A;  4NVP A;  2YI8 A;  1KKC A;  5GON B;  3ML0 A;  4E4E A;  5J2T B;  2DOS A;  2QWO B;  3SDL A;  4NXM O;  4PV1 B;  3ABM C;  5IT9 N;  2F66 C;  2Y4T A;  3E22 B;  1D5A A;  2CE4 A;  3CJH A;  2JDI G;  1SET A;  2X6C A;  3O65 A;  4G27 B;  3ETQ A;  5JJE B;  3ABK C;  2BTQ A;  3OEE G;  3LDD A;  4IL6 Z;  2YI9 A;  3M99 B;  4F6E A;  4LH6 A;  2VQE O;  4CBC A;  4DV1 B;  4DV7 B;  3J81 N;  1HDJ A;  4B3T O;  4I9W A;  1AP6 A;  3TK1 A;  3THO A;  1HNZ B;  5LXT A;  3ZMZ A;  1PKX A;  5DED A;  4O4I B;  3T4D A;  1YSC A;  3CD6 V;  1NTZ H;  4E2L A;  4LF6 O;  1DLB A;  1P84 F;  3T1C A;  1H2M A;  3EHB B;  5EIB D;  5B1B C;  5L3E A;  4R50 A;  1OCO B;  2R70 A;  5C93 A;  1SRY A;  1S5J A;  2G38 A;  5FPO A;  3SPI A;  4Z1M G;  1Q7Y W;  3AG2 C;  4KXR A;  2ARH A;  4A5U B;  1AIL A;  3IFX A;  2ZD9 A;  1NJI W;  5KHG A;  5JJJ B;  4B3R O;  3GB7 C;  3DXR A;  1N36 O;  2PZS A;  1E79 G;  5KHJ A;  5LMU O;  2HVK C;  5LA6 B;  2PYJ A;  3FB8 C;  1XDC A;  1P49 A;  5IWA B;  1FPO A;  3BA9 A;  5D5P A;  1H8H G;  4JI3 O;  1TUB A;  3F5W C;  3HR0 A;  5IJ0 A;  1RSO A;  2BTO A;  2YXL A;  4MSW C;  2Q9L A;  3OR7 C;  1VQM V;  5B1A C;  3OGC C;  2XT9 A;  1NS1 A;  3RYI B;  3CYO A;  1HR0 O;  2HJF C;  4FM1 A;  3JD4 A;  4PD4 F;  2R9I A;  3WB0 A;  2FKX A;  1XMO B;  1L8D A;  5KUK A;  2L35 A;  4WFE A;  4DUZ B;  4K8X A;  3QVN A;  4BIZ A;  5B1N A;  1RM1 B;  3E83 A;  4LFB O;  2P6J A;  4RO2 A;  3JAW B;  2YUA A;  1EZJ A;  4MVM A;  3MDS A;  1K8A W;  3STL C;  1SQX H;  3HKC B;  2KB1 A;  5JWP A;  2ZIM A;  1AB3 A;  4KHP O;  3ASO C;  1H8E G;  3K04 A;  3N2G B;  5HFM A;  5ITZ B;  4YIP A;  2MK3 A;  1RP3 B;  4AQY B;  3K0G A;  1H2K A;  4J11 A;  4R8C A;  4RAI A;  1HNW O;  2RDC A;  2V4D A;  4O4I A;  3RWR D;  2UXB O;  2EBO A;  4C7U A;  4TWK A;  1SZX A;  3FAV A;  3AK2 A;  1HR0 B;  2W6I G;  1PV0 A;  3QF7 A;  3SGI A;  2JK5 C;  4PI0 A;  1KU9 A;  2Y48 A;  4ZIB A;  2PF4 E;  2HHH B;  4Q20 A;  3OMI B;  5BY1 A;  1F23 A;  4FM0 A;  4WFH A;  2Q0A A;  2P90 A;  2WLK A;  2RCV A;  2XAJ A;  1PNM A;  2QKS A;  2Q5Z A;  3R66 A;  1Y66 A;  1I5Y A;  1Y67 A;  1YDX A;  4CH6 A;  1KMI Z;  2QE7 G;  5LA6 A;  3QG5 A;  1YHQ V;  1W0K G;  2E5L O;  2EIM C;  2F1M A;  2JVD A;  3CCE V;  2IU0 A;  5JQG B;  1TVK B;  2XAG A;  2WLI B;  3UQ8 A;  4DR4 B;  2LW1 A;  3ZS8 C;  2QM8 A;  1AJP A;  2VQF B;  3WU2 Z;  2ETN A;  3JSL A;  2UXB B;  2RMK B;  4RUE A;  2N74 A;  3IAY A;  4U7N A;  1R6T A;  3RYI A;  4YY3 O;  3RVZ A;  2UUA O;  3CRQ A;  3LDE A;  3K9S A;  3H1L H;  4YHH B;  4LF4 O;  2PUS A;  4DV6 O;  2ZM6 B;  1TGO A;  4DR5 B;  4TUY B;  3W7X A;  1PNL A;  2JEX A;  2UUC B;  2A9H A;  1I0H A;  3ZRW B;  1M90 W;  3N2G A;  5ITZ A;  3JCU Z;  1KUQ A;  1PL0 A;  1FJG B;  1VAR A;  3CME V;  5LHH A;  1OCZ B;  1VQP V;  3B09 A;  2F93 B;  4OGQ B;  2AHY A;  1W0J G;  4CS2 A;  3I5D A;  4DV2 B;  2ZKO A;  3HPL C;  2UXD B;  4BW9 A;  5KX5 B;  1R3J C;  1YZB A;  1K34 A;  4ZBM A;  3STZ C;  3WFV A;  1VMG A;  1BQZ A;  4HBN A;  1S3J A;  3JSN A;  4OPA A;  4FJC C;  4UCU A;  3JAL B;  1K9M W;  1VQ9 V;  1SZT A;  3G6E V;  4UXN A;  5CA1 A;  1EBO A;  3NR7 A;  4IHJ A;  2JRI A;  4U7O A;  3AG1 B;  1HWY A;  2Y4U A;  1EFR G;  4WCE V;  1V9P A;  5LMN O;  4DXW A;  1B06 A;  5JH7 A;  1ZWI C;  4PHZ A;  1M57 C;  3W7S A;  2N05 A;  1HNX O;  4TQF A;  1HP8 A;  1FXH A;  4LFA O;  5A9G A;  1K92 A;  4DW0 A;  1F4N A;  3HB3 B;  5JQG A;  1TVK A;  2EIK B;  1GO3 F;  3K03 A;  4DK1 A;  1N32 O;  3RYH B;  3E86 A;  2Q7E A;  3MHH C;  3LNN A;  1P7B A;  3E35 A;  1Q6H A;  4NKG B;  1AJN A;  4FK5 C;  5EC1 C;  3OFN G;  1AI7 A;  4GX5 A;  4JYA O;  3PJS K;  3SJA C;  4TV9 A;  5L3G A;  2OCC B;  3FYE B;  5HFL A;  3GVM A;  4GYC B;  5CBG A;  3RYC A;  4TUY A;  4UCO A;  1EZV H;  3GWK C;  5E79 Z;  1BSM A;  4O4L A;  4PA7 A;  3QTC A;  2ZE5 A;  3AK3 A;  1I94 O;  4GX1 A;  3CRM A;  3ZRW A;  1WP8 A;  2DQ0 A;  1EN4 A;  1XOU A;  4CH3 A;  4GKJ B;  1AI4 A;  1XUQ A;  1E1R G;  4FIP C;  3VQX A; 
#chains in the Genus database with same CATH homology
 2UXB O;  4LF6 O;  3F5T A;  4LF9 O;  4DV0 O;  4JI5 O;  2AGA A;  1J5E O;  1X59 A;  4NXN O;  2F4V O;  5IWA O;  1YZB A;  5FLX N;  4A5U B;  1AIL A;  3OTO O;  1F7Y A;  2UXC O;  4OPA A;  1FKA O;  5BY1 A;  3JAM N;  4JI1 O;  4B3R O;  4DR4 O;  1N36 O;  4OX9 O;  2VQF O;  3T1Y O;  4DR3 O;  2JRI A;  5LMU O;  3M8A A;  2LW7 A;  4B3S O;  1IBK O;  3R66 A;  1G1X B;  4JV5 O;  1XMO O;  3J7A U;  5LMN O;  5BXZ A;  4DV3 O;  4DUZ O;  2E5L O;  1HNX O;  1XNQ O;  2UUB O;  4B3M O;  4YHH O;  1XEQ A;  1D2D A;  5H5N A;  4JI3 O;  4LF8 O;  1XMQ O;  4LFA O;  1R1B A;  1XNR O;  4DUY O;  2DOS A;  2ZM6 O;  4X65 O;  1NS1 A;  3SDL A;  4X64 O;  4DR5 O;  1HR0 O;  4NXM O;  4JI7 O;  4DV1 O;  4GKK O;  4DV7 O;  4LF7 O;  5IT9 N;  2N74 A;  2FKX A;  4LF5 O;  1R6T A;  1N32 O;  4YY3 O;  2UUC O;  4JI4 O;  4JI8 O;  4LFC O;  1IBL O;  2UUA O;  3O65 A;  1HNZ O;  4AQY O;  1FJG O;  4GKJ O;  2Z0A A;  4LFB O;  4DR6 O;  4JYA O;  1DK1 A;  4DV2 O;  4LF4 O;  4DV4 O;  1A32 A;  4JI0 O;  4OPH A;  2UXD O;  3T1H O;  4DR2 O;  5A2Q N;  4DV6 O;  1IBM O;  2DJV A;  2VQE O;  4DR7 O;  1N34 O;  2UU9 O;  4DV5 O;  3J81 N;  1AB3 A;  3J80 N;  4KHP O;  4B3T O;  4DR1 O;  4X66 O;  5LL6 Y;  1I94 O;  2HHH O;  4X62 O;  1N33 O;  1KUQ A;  4JI2 O;  2ZKO A;  5BR8 O;  1FYJ A;  4K0K O;  3RT3 C;  1HNW O;  4JI6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...