4GKKO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4gkkO00
1AB3A 4JI8O 2JRIA 1N32O 4DV1O 2LW7A 2AGAA 2DJVA 4LF8O 4JI6O 3O65A 1IBKO 4X62O 5LL6Y 1HNXO 2UUBO 1FKAO 4DV4O 1HNZO 5BXZA 5IT9N 1D2DA 5LMNO 1IBLO 2VQFO 3M8AA 4JI5O 4DR1O 3F5TA 4DR5O 3J80N 5A2QN 4JI7O 1XNRO 4KHPO 2HHHO 1N33O 4DR3O 4JI4O 1G1XB 4YY3O 4DR4O 3JAMN 1J5EO 3RT3C 2UU9O 4NXMO 4LFAO 4AQYO 4YHHO 2ZKOA 4DV0O 4DV5O 2UXBO 4LFCO 4JI3O 3T1YO 4DR6O 4X65O 1R6TA 1N36O 4DV7O 5LMUO 1XEQA 3OTOO 1DK1A 4DUZO 4JYAO 4LF9O 1X59A 1F7YA 2UUCO 4LF7O 1FYJA 4JV5O 1FJGO 2N74A 4DV6O 5IWAO 1HNWO 4JI1O 4LFBO 5BY1A 4OX9O 4B3RO 5FLXN 5BR8O 4B3MO 1XNQO 4DV2O 4B3TO 2DOSA 1YZBA 2UXCO 4LF6O 1A32A 4JI0O 1I94O 4A5UB 2F4VO 1AILA 4NXNO 4GKJO 4LF5O 2ZM6O 2VQEO 4X66O 4B3SO 5H5NA 1NS1A 1HR0O 2UXDO 1XMQO 1IBMO 3SDLA 4JI2O 1KUQA 4OPAA 2FKXA 4DUYO 2Z0AA 1R1BA 3T1HO 3J7AU 4K0KO 4OPHA 4DV3O 4GKKO 1N34O 3R66A 3J81N 1XMOO 4DR7O 4DR2O 2UUAO 4X64O 4LF4O 2E5LO
chains in the Genus database with same CATH superfamily
4MW3A 1PM9A 3BCCH 1X4TA 4DV1O 4G2KA 4IIJB 4MVQA 1N4CA 3JATA 4DW0A 1KYOF 1F4NA 3CCQV 1LUVA 2R9AA 1E79G 4UV9A 1HNXO 4I55B 4X62O 2ZNIA 1NQTA 1WPBA 4PDMA 1NU1H 3JAWA 4UCOA 1XHZA 2W6IG 4WBNB 5JH7B 2RQ6A 2F93B 5LMNO 2ZNJA 4QJFB 1XNRO 1AI6A 5LHIA 5KX5A 4JI4O 1G1XB 1ZTEA 1W2BU 1XREA 5IJ0A 3STLC 3CYOA 5L3BA 4LFCB 4BIOA 2UXXA 1VQOV 2FB5A 4UVAA 2V4DA 3KCXA 5LMUO 2P6JA 3WG7C 3VQXA 4JYAO 3E8HA 2AZ0A 2L35A 2E75B 4TV8A 1SZTA 5C93A 4JV5O 4J9ZB 3RFRA 1W0KG 2ZE8A 2GUZB 2RDCA 5JJEB 3ETEA 2BE3A 3EHBB 5IE9A 2WLLB 3RYCA 1BZKA 4QPKA 4IT5A 4W4KA 2ZM6B 1NKDA 2HR3A 3AK1A 4GX5A 1NJIW 2GV9A 4NKGB 5FNVA 2R72A 5CBHA 3ASNB 2DQ0A 4FVMA 3OGIB 1AJQA 5DM6V 3AK3A 3B2EE 3ASOB 2DQ3A 4DV1B 4DR2O 4R8CA 4BR6A 2Q69A 4LP8A 2YI8A 4KFMA 3ZJZA 3L74H 5EZYA 5DEDA 1HNXB 2CDYA 2YDEA 4X62B 4LWSB 2Q67A 2Z5UA 5B1AC 3RBZA 2WLIB 5HFMA 3GWKC 4BAYA 1GM8A 5LMNB 2ZR2A 1Q90D 5BXZA 1BE3H 3ZRXA 4I9WA 2DWDC 3LNMB 1NT2B 2VRZA 3F5TA 4JI4B 4O4JB 5CA0B 2KKWA 1M4UA 4D7SA 4MSWC 3HKBA 4O2AA 1JX9A 4ICGA 1GKFA 4UUJC 2LJ2A 4WFHA 1HP8A 2Q0OC 2PI4A 3AG3C 4PJ0Z 2E76B 4ZBMA 1Q6HA 5KUKA 5KHJA 1OCZC 5LMUB 2KB1A 4HNAA 2ZIMA 5BZBA 4JYAB 1N36O 3OR6C 5BMVB 4J10A 1CPYA 3KKYA 4O4IB 4I0XB 3G67A 1XEQA 3CCSV 1G4YB 4JV5B 3ZCCA 2WLKA 2WWWA 3E22A 3H1HH 4WFGA 1VIBA 3BFRA 3OEEG 5BR8O 2OT5A 3ICXA 2DYSC 1JOYA 4B3TO 3ABUA 3OMIB 3FB7C 1A32A 4NTWA 1G6UA 1AR1B 1R3IC 2IJJA 3OGCC 3OE7G 1DTOA 3JASA 1S72V 4PDRA 2DW4A 4UV8A 2BTQB 1NI8A 3SDLA 2ZDIC 1AR4A 4DR2B 1R1BA 3K08A 1WPXA 1GAXA 1R73A 3ABMB 1AJPA 1FPOA 3W7XA 4JAVA 1Q8IA 4XDJA 3GWOA 1ROPA 3CRMA 4DR4B 3CPWU 1OCOB 1SQXH 3D36C 2JS3A 1E1RG 2Q8VA 1W59A 1OZ0A 5EYPA 4JI6O 3ZHSA 5JJNB 4F6RB 3G80A 3P32A 5LP6B 2KSDA 5IT9N 3FAVB 2ZIOA 4J7JA 1R6KA 3SYCA 1IXMA 1Y74A 4MW8A 2X0LA 3HKDB 3AG3B 3BRCA 2UXNA 1TVKB 2QWOB 1SF9A 3E83A 3S3WA 4XBFA 3I55V 1N36B 3FYEB 2UXBO 3SPGA 2YXLA 4IYHA 4DR6O 4X65O 5D5PA 1UFIA 4DV7O 1CP9A 2OTLV 1QNMA 2ZE6A 4K35A 2Y4UA 1RSOA 1FYJA 1TUBB 4U3FH 4YJ2A 5BR8B 1BT8A 4K8XA 4IL6Z 2HKOA 3K5MA 4B3TB 1QLEB 1N34B 3A0HZ 3W7UA 4U3JB 3DXRB 2DOSA 1F51A 2JGDA 3BVOA 4A5UB 4UFZA 3ZHVA 1M1KW 2FYUH 4O4HB 4PI2A 4RWUA 2F43G 4FFBB 1QU7A 4JTCB 1K4CC 2UXDO 4JI2O 3K0GA 3UKMA 5IY5C 2HJDA 2MK3A 1M9NA 1WAZA 3K0DA 1WB7A 4UVCA 4DR7O 4TUYB 4LF4O 3ML0A 4FLWA 3ZHUA 3CRRA 3OMAB 5LHHA 3B77A 1H2MA 4JI6B 3APOA 1ZL8A 5A9GA 2EINC 1YJ9V 3O65A 2XAJA 3UO2A 3PJSK 5JCOC 4JZ2A 3U0ZA 5LHGA 3AG2C 1SQGA 2Q0AA 3FKSG 4RUFA 4MTOA 2JDIG 2PUSA 3HKEB 4Z2WA 3T4DA 1AP5A 2ITDC 3E35A 4YJ3B 5A2QN 4JI7O 4PDLA 4X1KA 2A3QA 3Q4HB 5J9PC 2F1MA 3AG1B 4FZ0A 4O2BA 1NTKH 2UXBB 4X1YA 3UO3A 2CTRA 2JEUA 2YIBD 4DR6B 4X65B 3BPZA 5GONB 4DV7B 3CCEV 1ZSPA 4P30A 4EB6A 2OTJV 1FFXB 4IYIA 3OM3B 1ZX3A 1K73W 2QWQB 3F7VC 1I08A 2UUCO 1NTZH 1P84F 4C7UA 4P9PA 4FLXA 4ZKIA 1K33A 1VF5B 1NBMG 2RNBA 3FB5C 3D3QA 1VMGA 4LF6O 1YSCA 4JASA 2ZE7A 4UCSA 2UXDB 4JI2B 2GBOA 2H8PC 1D5AA 4I4TA 4Z1VA 1P49A 3MHSC 4DR7B 4PELA 1WP8A 4MVMA 4LF4B 4GKKO 3CJHB 1Q6UA 3E8BA 4CS4A 4FM0A 3CMEV 1H2GA 3CC4V 1NR1A 4TQDA 3EXAA 4H0LB 2N05A 5LL6Y 2EIJC 1GM9A 2Q9LA 3WB1A 2BOCC 5B1NA 3JD4A 1P7BA 1SESA 2H94A 3LDCA 4JTDB 1H2NA 1S5JA 4LCUC 4GCZA 1N33O 4DR3O 2Q6AA 3JAKA 4KL1A 1G8MA 4U7OA 1VQ5V 2KQXA 3QG5A 4LFAO 4I5SA 2WLNA 3BA9A 4DRXB 1PNKA 4RAIA 2QKCA 3ETGA 3UT5B 3JALB 2YIBA 2YIAA 2UUCB 1VARA 1DK1A 5TISZ 1AJNA 4B7KA 3H1JH 2ZR3A 2DYRB 3KCYA 4B3MO 5JVDB 4DV2O 5EIBD 5LYJB 3N2GA 2K1EA 4E2LA 1Q7YW 2PYLA 1WLEA 5CA1B 4MTXA 1SA0B 2LW1A 2JK5C 3FD9A 3RYFA 4B3SO 1QCEA 2HVJC 1OCCC 3JARB 2PTMA 3CE2A 3CMAV 2EILC 4JGSA 4GKKB 5B1OA 1H2LA 2Z0AA 2VWJA 1SQBH 4DV3O 3ZHRA 2LFSA 3HB3B 4FM2A 1E1QG 2XTAA 2XASA 2DN9A 1YTFB 2B1GA 2Y69B 3KZIZ 5ITZB 1V55B 2EIJB 4Q20A 5IYDO 2E74B 3ZBHA 4ABMA 3C3TA 3CRCA 2Y48A 4X8AA 3JATB 1Q43A 3A2FA 2ZCEA 4WCEV 2P67A 2AHYA 1WA8A 3JAWB 1N33B 4DR3B 1XL4A 1FJGB 3NXSA 1KB9F 2HHHO 4LFAB 1H8EG 4CZZA 1N0JA 1MZFA 1K5SA 4W4LA 2OWOA 4J42A 1I94B 4AILC 3SYQA 2GDSA 4J9YB 2A7WA 3BY6A 2HP8A 5IYZA 4I50B 2IU3A 5L3FA 2ZE5A 1M57C 2QJ1A 4B3MB 3CRAA 4DV2B 3SJBC 5D5QA 4OX9O 1JMKC 4LH6A 3OMNB 4TV8B 1B3QA 4NB5A 2ZXWB 1QVFU 5CMUA 1MA1A 3CEIA 4OXSA 3ZS8C 1AI7A 3RYCB 4B3SB 3THOA 4KP4A 1B6QA 4X66O 1ORQC 4UCRA 4J80A 2JS5A 4PDVA 3FFQA 5KHIA 2QWPB 3SPHA 5JH7A 5B66Z 4DV3B 1KUQA 1EN4A 1VQ6V 2RJZA 4UCUA 1VQLV 2O57A 1Q5OA 1UJWB 3N2KB 5CB4A 3H9VA 2PF4E 3DSQA 2XUMA 4CC5A 3OAAG 1RM1B 3H1IH 2JRIA 3LSQA 2AW9A 2IJKA 1Q81W 5KHHA 4GT1A 3D8CA 4JYCA 1AR5A 5EZYB 4HBNA 3ABLC 1VQ7V 3CSXA 4D6TH 2X6AA 5CA3A 2WLJA 4E4EA 2HHHB 4JI5O 5LGUA 2LP7A 1I0HA 2ZD9A 4FPPA 2YS8A 4DR4O 1XOUA 3RT3C 2GTSA 1N8RW 3W7TA 4WFFA 1OCRC 1NZ6A 2LGQA 4XDLA 1TGOA 1US6A 4DW1A 1Y76B 5J2UA 3K58A 4IGGA 2CTPA 2P22C 5B5EZ 4HNAB 3IJ4A 4FLTA 2YXHA 2IJIA 2D2CB 4OX9B 4ZOLA 1GK9A 5L3CA 1GM7A 2JJ1G 4DV6O 5E1AC 3A0RA 3CWBH 1KKCA 1KECA 3E22B 1BQZA 3FYIB 2Z3YA 5J2TA 3WG7B 4B08A 4PA7A 3K5LA 4X66B 5IYBO 5B3SC 2WLIA 2VQEO 3B8NA 3H01A 5EBMC 5H6RA 1IURA 2QR4A 2HVKC 3GVMA 2OCCC 1K9MW 1FXVA 1N34O 1Z5WA 2QTOA 1O9GA 3WFVA 4N21A 3G6BA 2LW7A 4AQYB 4LH7A 3ZMTA 1BQ0A 3LDEA 4BIUA 4X1IA 3K9AA 4JF3A 3QF7A 2ZINA 3ABLB 1K8AW 1RP3B 1B04A 4ZI7A 3I56V 5EYPB 3LNNA 4O4IA 4JI5B 4I0XA 2EIKC 1URFA 2B5UA 2F23A 4LF7B 1PNLA 4NTXA 3ZRSA 4AHCA 2CGOA 1YJNV 1BL8A 1BCCH 3GB7C 3RYIA 4YY3O 5C8YA 1Y74B 4QE7A 5B1AB 1QQCA 4CS2A 1V54C 4WFBV 4FMTA 4CS3A 5IJ9A 1JCHA 2GSMB 2IJHA 4UCVA 1V9PA 2K9PA 4GKJB 1H2KA 3AG4C 2BTQA 1F4MA 1BHAA 5K1PA 1JFFB 2ARHA 4DV6B 1Q3EA 2A0LA 4TQFA 1EM1A 3TETA 4IHJA 4F4LA 3B4SA 3JSNA 3X2QC 3SPJA 4QIWF 1D5NA 1OCZB 1RSOB 2P5OA 1RFYA 2NR5A 1J95A 2V7QG 4X20A 1GN3A 4FIPC 2F66C 5FPOA 2F4VO 3VOUA 4ASUG 2VQEB 2JGUA 3TJTA 4G27B 3SR2C 2BSKA 1L1FA 2JGDB 2YIDA 5LA6A 3SPCA 4F6RA 3VQYA 3EFFK 5LP6A 1XDCA 5H5NA 3MD0A 3JYCA 1BSMA 2VWKA 2VS0A 1RPOA 1YHQV 2DYSB 2HEPA 1LR1A 4DK1A 3G4SV 5IYCO 4OPHA 3CS5A 4K3AA 3SJQC 4AI8A 1XMOO 4PD4F 3IC7A 2JVDA 2HJFC 1DF4A 1WJZA 1N32O 4CH6A 3ZIAG 1PD3A 2P06A 3PN1A 1EZJA 1YEWA 4MVOA 1K97A 1YJWV 1VP7A 1VQNV 4JAUA 5IDJA 2EBOA 1ZL8B 1N0NA 3B09A 1IZ3A 1EZVH 2EIKB 2IH1C 2YEVA 2Q5ZA 1HDJA 3QVNA 1Y67A 4K8ZA 4L87A 3MHHC 4UB6Z 1TUBA 4RQFA 4YY3B 3DGEA 2MW2B 2E3CA 1HWYA 5KHGA 3DTUB 5K1XA 3FX7A 1RPRA 4L8JA 2UU9O 3DXRA 4X1KB 3W7WA 1ENVA 2Y4TA 1SQVH 4FFKA 1S76D 4O2BB 5L3DA 3AG4B 2XNDG 4X1YB 3OUFA 4O4HA 2CAZC 1THZA 2ADPA 1NVPB 2JJ2G 2PGGA 3L70H 1GN2A 1OV9A 2ZQMA 2X6BA 4CH3A 2YC0A 2N74A 3HKCB 1K92A 4JI1O 5H2FZ 5CBFA 4B3RO 3QO8A 3D3IA 4GX0A 4X64B 3TXQA 4CBCA 2F4VB 1YZBA 1Z2GA 4JI0O 3NR7A 3E2EA 1EN6A 4LNUA 1GH6A 2QSAA 1I5YA 2P90A 4YIPA 3MDSA 3K5NA 3CD6V 4TV9A 2ATKC 2R9RB 2XAQA 1KP3A 4GX1A 1GN4A 2CTQA 1NS1A 5JQGB 1BGYH 2QEXV 2ETNA 5LOVB 2P7TC 3HKEA 1XMOB 4DUYO 2CTWA 4TT3G 1U97A 4I4TB 1H8HG 3CHXA 3Q4HA 5JJJB 1N32B 2A06H 4JI8O 3ZMZA 1IXBA 2NNUA 1MOFA 3AK2A 5JWPA 5GONA 1BHBA 5IY5B 1NH2D 5LGTA 3OUSA 5B1BC 3AEIA 5LXTA 4B7EA 3AG7A 2QKAA 1YVWA 5EC1C 1KD1W 2ADQB 1SQPH 4R50A 3J80N 4DR5O 5KMGB 2Q7GA 2UU9B 1TUEB 2LQTA 2PZSA 2EINB 2H3OA 4PV1B 4NXMO 3CRQA 2CUGA 3AG2B 1WB8A 3JAKB 3K59A 4YHHO 4DV0O 3L72H 2PI5A 3M99B 1ZLZA 3T4ZA 2A9HA 4FLYA 4DYLA 1MSDA 5CN0A 3K9SA 3OTOO 4DUZO 4FJCC 3RYHB 4JI1B 3VQVA 1X59A 4HZ3A 1ZUQA 4WF9V 3G71V 4B3RB 1PP9H 3JD3A 1FJGO 1HNWO 4K0KB 5BY1A 3O9OA 1YTFD 4JPRA 5FLXN 3ZMUA 4JI0B 3DC5A 1QBZA 2UXCO 1QHTA 1MMMA 3TXSA 1I94O 1VF6A 3JD0A 2QTSA 1R3LC 4MVSA 3H1LH 1EN5A 2YXYA 1NR7A 4DUYB 2P4KA 1PKXA 2EIMC 4BW5A 4RQEA 2C2AA 5EIBC 2XHBA 1IBLB 3J7AU 3T1CA 1FD9A 3R66A 4JI8B 2KG7B 1GRJA 2Q7EA 1EBOA 2L6LA 4HAMA 4X88A 2D3OW 1BS3A 1MSWD 4PA9A 2DJVA 1YXBA 5E79Z 4DV5B 4LF8O 5LBQA 4KXRA 5EK0A 3CCRV 3N27A 4PI0A 3K04A 3UT5A 3JALA 1H38A 3CB2A 4DR5B 2BOBC 2QM4A 2N04A 2QM7A 3VQWA 2QE7G 1Q6IA 1Z5VA 3EVKA 3FB6C 5EBLC 4NXMB 5JVDA 4ZHQA 3SGIA 1J5EO 4YHHB 1AI5A 4DV0B 3QNEA 3QO5A 1R3JC 3C3SA 4QE9A 1R3KC 1SA0A 4JI3O 2OCHA 1K3EA 5AG2A 3OTOB 1SRYA 4DUZB 2XOKG 3JARA 4CH5A 3L73H 1HNWB 2QWNB 4R6ZA 1VQ8V 2LO1A 5LGNA 4LFBO 3ZN1A 5KX5B 2UXCB 2Y0IA 3ASNC 4FLUA 3UM7A 5IJ0B 1FXKA 1M90W 1YITV 3BAAA 3H1KH 4O4LA 3ASOC 3ZMSA 2Q68A 2OIGA 3ZRWA 1TA8A 4LF5O 4Z1MG 4UCTA 3M7MX 2CH7A 2YI9A 2P4VA 2EIMB 2WLMA 3VBBA 1HR0O 1IBMO 2FMLA 2RN9A 1KP2A 4H44B 3ETDA 1VQKV 3IGAC 3WU2Z 4IIJA 4BW9A 4UB8Z 1L0NH 1DGSA 3CXCU 5CB4B 3UQ8A 3CCLV 4LF8B 1K4DC 3DC6A 3R65A 4I55A 1OCCB 3OW2U 2EILB 1YCIA 1XQ8A 3E86A 3TGUH 3IAYA 3SYPA 4WBNA 1IBKO 2YSUB 5FNVB 1PPJH 2V1DA 1I7FA 4I50A 1D2DA 2CE4A 1U96A 4H37A 3CC2V 1OHHG 1J5EB 3IFXA 4P2ZA 2QM8A 3FB8C 2AHZA 4AQYO 1PL0A 4JI3B 2M7WA 4UVBA 2OYQA 3LUTB 1XHXA 1AP6A 2DWEC 5DN6G 2QGNA 4J7ZA 1XI1A 5J2UB 1XBLA 2QKSA 4LFBB 1Q82W 4XDKA 2GUZA 4LF7O 1O9HA 4MVRA 2EJ7A 1JJ2U 3N2KA 2WLLA 4ZOLB 3HKBB 3K06A 4O2AB 3P3NA 1S5LZ 2QWRB 4LF5B 4EKWA 3ABMC 4LR3A 1AILA 4NXNO 4GKJO 4KUMA 5J2TB 1HR0B 1XUQA 1M57B 1JVMA 1IBMB 4FK5C 4D7TA 2YUAA 1MNGA 4F6EA 1OCOC 2BCCH 3SJAC 1DF5A 4OPAA 1NTMH 4PA4A 1XL6A 4MT8A 1S77D 1P7GA 4BIZA 3T1HO 2EZPA 3RWRD 5LP6C 1XNRB 3CCVV 2UUAO 2RCVA 3TK1A 4TSFG 2XAFA 4LWSA 1Y6XA 1M56C 3CC7V 1T5EA 1JPXA 5L3GA 1IBKB 3A0BZ 5GTHZ 3OD4A 4QGPA 3E8GA 3JASB 1UPGA 4HYOA 1Y76A 4X1IB 1FKAO 3HPLC 3JCZA 4O4JA 5CA0A 1GMGA 2G38A 3ZHQA 1H2SB 2HG5C 5EC2C 3K03A 1K34A 4ZI7B 4MTFA 3WB0A 1KKDA 4FLVA 4DO2A 3RGBA 2B1IA 3KG2A 4DXWA 4JYBA 3SPIA 5H9CA 1SQQH 3JCUZ 5L3EA 1EFRG 3RYIB 5C8YB 4P9OA 2IM9A 3W7SA 1QLEC 5BMVA 3CCUV 2FL4A 3T1YO 5IJ9B 4GLXA 3STZC 4PA6A 2YICA 2LFRA 1MG1A 1W0JG 3OFNG 4LF9O 1F7YA 3ZEDA 2WPDG 1CXZB 4MVZA 1OCRB 4TWKA 4IHJB 1XNQO 4H13B 1S3JA 3SYOA 1Y4MA 4NXNB 2AXTZ 4RUEA 4CH4A 2XAGA 3I5DA 5HFLA 4X20B 2JEXA 3HR0A 5KLVH 4JAAA 4LC1A 1AROP 1WP7A 1YI2V 1XMQO 2BSKB 3T1HB 1PNMA 5LA6B 1R6NA 5FL7G 2FKXA 4YJ2B 2A79B 2UUAB 2IBZH 4PA3A 4EEQA 4X64O 1M56B 5B3SB 2E5LO 4R7CA 1AB3A 2R70A 1NVPD 4MTGA 3L9DA 2EX3A 5KA5A 4H33A 5EBWC 2CK3G 3AG1C 4NTYA 3ZHTA 1QR9A 2OCCB 3P3PA 2UUBO 2OIEA 1YDXA 3FAVA 2WA4A 3B8MA 1YIJV 1JFFA 4DV4O 1SQFA 1XILA 1GN6A 2YEVB 3M8AA 3OTFA 4DR1O 3HKDA 3U11A 3IC9A 1TVKA 2CGNA 3G6EV 4KHPO 2EZOA 3JAMN 3BABA 3F7YC 2IU0A 1SETA 3T1YB 3L71H 3OT7A 1GO3F 2ZKOA 4QNHB 1OJHA 3E89A 4ZIBA 2R9IA 5CBGA 3QO7A 3K3WA 3OEHG 3CCMV 4LF9B 2WLHA 3U10A 1F23A 1ZWIC 3JD1A 4NYKA 4U7NA 1FAFA 1V54B 3F5WC 3ABKC 4U3JA 4N23A 5IWAO 3ZRVA 1XNQB 4GYCB 2B9ZA 1L8DA 4BWAA 2IH3C 2XAHA 1QLNA 3TCUA 1B06A 4FFBA 3BHPA 4X9QA 2ZDIA 1IVSA 1XMQB 4EB6B 4LNUB 3X2QB 2QA4V 1VF6C 4JTAB 2PYJA 4TV9B 3APQA 1GTOA 2EULA 3QTCA 4NVPA 1VQPV 4TUYA 1FFTB 1VEWA 4WFEA 4K0KO 3D36A 2E5LB 4GZRB 2LGWA 1MABG 2Q4PA 2X6CA 1QVGU 4MVUA 4JYYA 1QR8A 2AZ2A 4J7KA 1HW7A 2AGAA 3T2MA 2HLDG 2UUBB 2ODMA 1IX9A 3JSLA 1L0LH 3CX5F 4DV4B 3ZMVA 1P4RA 1PV0A 3BEHA 3RW0A 1VF7A 4YJ3A 4DR1B 1HNZO 2F95B 1SC5B 1COWG 2M6YA 1IBLO 2VQFO 4KHPB 3UCSC 5LXTB 3HKCA 1VQ4V 1CEZA 2DMXA 2W6JG 1JQ0A 1KU9A 1SERA 1WN7A 2W0XA 4JZGA 1SZXA 1FFXA 2DYRC 4DV5O 1FS0G 4EFBA 3K5OA 3E8FA 1R6TA 1SS3A 1ZAUA 2Y0PA 3B40A 1S5HC 1IDSA 1KMIZ 2DE0X 2QDOA 3ETQA 4GX2A 5JQGA 4J11A 5DECA 3ABKB 2IW5A 5LOVA 5IWAB 1SKVA 2W0FC 1LUWA 1AVMA 2PY5A 4FZ1A 2X7RB 4FM1A 1FXHA 4GUNA 3A8TA 3SYAA 3CP1A 4G28B 3WB2A 2Q7HA 3S3XA 3ABTA 2NLJC 2FTKA 2ZT9B 4PHZA 3CCJV 3CXHF 5KUMA 1K5QA 5H6QA 2XT9A 1FXKC 1DLBA 4YIOA 2WSSG 1PL4A 2Y69C 4CC6A 1LNQA 1KQSU 1V55C 1WNSA 3CJHA 4Q6GA 4YXWG 5KMGA 4JI7B 3J81N 5KHKA 1KC8W 5KAIZ 3MAQA 5JCOA 1I5XA 3N2GB 4RO2A 4I7ZB 3ZN0A 4MS2A 3LSSA 4QPJA 1HNZB 2BTOA 2JIZG 2ITCC 3RYFB 3LDDA 2VQFB 4TOIA 1JJOA 3RYHA 3BA8A 2ILMA 1K7DA 3LSUA 1NH2B 1VQ9V 1TAEA 4OGQB 4DRXA 1MZEA 5KAFZ 5B1BB 4LF6B 1VQMV 4ZHQB 1KBHA 3OR7C 1AI4A 4X89A 1Y66A 4LFCO 3RVZA 5GTIZ 2EJRA 2ZXWC 1BMFG 3L75H 5FPRA 3RN4A 4I9QA 3ZX6A 2RMKB 2GTAA 4WFAV 1S0VA 4FLZA 1WA8B 4NR1A 5LYJA 2WAMA 2KG7A 4J41A 2NN4A 2GHYA 3RVYA 1JA8A 5CA1A 3C90A 2WA3A 1JR9A 1YF2A 4LBEC 4UXNA 3P30A 1FXKB 4EFEA 4DK0A 2HFEC 4O4LB 3SJCC 1RM1C 3K79A 5KA6A 2ZM6O 3ZRWB 3K57A 1M5IA 5F2VO 3JD2A 5IYZB 2CH7B 2Q73A 1M93A 1Q86W 5GW7A 5ITZA
chains in the Genus database with same CATH topology
1AB3A 4JI8O 2JRIA 1N32O 4DV1O 2LW7A 2AGAA 2DJVA 4LF8O 4JI6O 3O65A 1IBKO 4X62O 5LL6Y 1HNXO 2UUBO 1FKAO 4DV4O 1HNZO 5BXZA 5IT9N 1D2DA 5LMNO 1IBLO 2VQFO 3M8AA 4JI5O 4DR1O 3F5TA 4DR5O 3J80N 5A2QN 4JI7O 1XNRO 4KHPO 2HHHO 1N33O 4DR3O 4JI4O 1G1XB 4YY3O 4DR4O 3JAMN 1J5EO 3RT3C 2UU9O 4NXMO 4LFAO 4AQYO 4YHHO 2ZKOA 4DV0O 4DV5O 2UXBO 4LFCO 4JI3O 3T1YO 4DR6O 4X65O 1R6TA 1N36O 4DV7O 5LMUO 1XEQA 3OTOO 1DK1A 4DUZO 4JYAO 4LF9O 1X59A 1F7YA 2UUCO 4LF7O 1FYJA 4JV5O 1FJGO 2N74A 4DV6O 5IWAO 1HNWO 4JI1O 4LFBO 5BY1A 4OX9O 4B3RO 5FLXN 5BR8O 4B3MO 1XNQO 4DV2O 4B3TO 2DOSA 1YZBA 2UXCO 4LF6O 1A32A 4JI0O 1I94O 4A5UB 2F4VO 1AILA 4NXNO 4GKJO 4LF5O 2ZM6O 2VQEO 4X66O 4B3SO 5H5NA 1NS1A 1HR0O 2UXDO 1XMQO 1IBMO 3SDLA 4JI2O 1KUQA 4OPAA 2FKXA 4DUYO 2Z0AA 1R1BA 3T1HO 3J7AU 4K0KO 4OPHA 4DV3O 4GKKO 1N34O 3R66A 3J81N 1XMOO 4DR7O 4DR2O 2UUAO 4X64O 4LF4O 2E5LO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AB3 A;  4JI8 O;  2JRI A;  1N32 O;  4DV1 O;  2LW7 A;  2AGA A;  2DJV A;  4LF8 O;  4JI6 O;  3O65 A;  1IBK O;  4X62 O;  5LL6 Y;  1HNX O;  2UUB O;  1FKA O;  4DV4 O;  1HNZ O;  5BXZ A;  5IT9 N;  1D2D A;  5LMN O;  1IBL O;  2VQF O;  3M8A A;  4JI5 O;  4DR1 O;  3F5T A;  4DR5 O;  3J80 N;  5A2Q N;  4JI7 O;  1XNR O;  4KHP O;  2HHH O;  1N33 O;  4DR3 O;  4JI4 O;  1G1X B;  4YY3 O;  4DR4 O;  3JAM N;  1J5E O;  3RT3 C;  2UU9 O;  4NXM O;  4LFA O;  4AQY O;  4YHH O;  2ZKO A;  4DV0 O;  4DV5 O;  2UXB O;  4LFC O;  4JI3 O;  3T1Y O;  4DR6 O;  4X65 O;  1R6T A;  1N36 O;  4DV7 O;  5LMU O;  1XEQ A;  3OTO O;  1DK1 A;  4DUZ O;  4JYA O;  4LF9 O;  1X59 A;  1F7Y A;  2UUC O;  4LF7 O;  1FYJ A;  4JV5 O;  1FJG O;  2N74 A;  4DV6 O;  5IWA O;  1HNW O;  4JI1 O;  4LFB O;  5BY1 A;  4OX9 O;  4B3R O;  5FLX N;  5BR8 O;  4B3M O;  1XNQ O;  4DV2 O;  4B3T O;  2DOS A;  1YZB A;  2UXC O;  4LF6 O;  1A32 A;  4JI0 O;  1I94 O;  4A5U B;  2F4V O;  1AIL A;  4NXN O;  4GKJ O;  4LF5 O;  2ZM6 O;  2VQE O;  4X66 O;  4B3S O;  5H5N A;  1NS1 A;  1HR0 O;  2UXD O;  1XMQ O;  1IBM O;  3SDL A;  4JI2 O;  1KUQ A;  4OPA A;  2FKX A;  4DUY O;  2Z0A A;  1R1B A;  3T1H O;  3J7A U;  4K0K O;  4OPH A;  4DV3 O;  4GKK O;  1N34 O;  3R66 A;  3J81 N;  1XMO O;  4DR7 O;  4DR2 O;  2UUA O;  4X64 O;  4LF4 O;  2E5L O; 
#chains in the Genus database with same CATH topology
 4MW3 A;  1PM9 A;  3BCC H;  1X4T A;  4DV1 O;  4G2K A;  4IIJ B;  4MVQ A;  1N4C A;  3JAT A;  4DW0 A;  1KYO F;  1F4N A;  3CCQ V;  1LUV A;  2R9A A;  1E79 G;  4UV9 A;  1HNX O;  4I55 B;  4X62 O;  2ZNI A;  1NQT A;  1WPB A;  4PDM A;  1NU1 H;  3JAW A;  4UCO A;  1XHZ A;  2W6I G;  4WBN B;  5JH7 B;  2RQ6 A;  2F93 B;  5LMN O;  2ZNJ A;  4QJF B;  1XNR O;  1AI6 A;  5LHI A;  5KX5 A;  4JI4 O;  1G1X B;  1ZTE A;  1W2B U;  1XRE A;  5IJ0 A;  3STL C;  3CYO A;  5L3B A;  4LFC B;  4BIO A;  2UXX A;  1VQO V;  2FB5 A;  4UVA A;  2V4D A;  3KCX A;  5LMU O;  2P6J A;  3WG7 C;  3VQX A;  4JYA O;  3E8H A;  2AZ0 A;  2L35 A;  2E75 B;  4TV8 A;  1SZT A;  5C93 A;  4JV5 O;  4J9Z B;  3RFR A;  1W0K G;  2ZE8 A;  2GUZ B;  2RDC A;  5JJE B;  3ETE A;  2BE3 A;  3EHB B;  5IE9 A;  2WLL B;  3RYC A;  1BZK A;  4QPK A;  4IT5 A;  4W4K A;  2ZM6 B;  1NKD A;  2HR3 A;  3AK1 A;  4GX5 A;  1NJI W;  2GV9 A;  4NKG B;  5FNV A;  2R72 A;  5CBH A;  3ASN B;  2DQ0 A;  4FVM A;  3OGI B;  1AJQ A;  5DM6 V;  3AK3 A;  3B2E E;  3ASO B;  2DQ3 A;  4DV1 B;  4DR2 O;  4R8C A;  4BR6 A;  2Q69 A;  4LP8 A;  2YI8 A;  4KFM A;  3ZJZ A;  3L74 H;  5EZY A;  5DED A;  1HNX B;  2CDY A;  2YDE A;  4X62 B;  4LWS B;  2Q67 A;  2Z5U A;  5B1A C;  3RBZ A;  2WLI B;  5HFM A;  3GWK C;  4BAY A;  1GM8 A;  5LMN B;  2ZR2 A;  1Q90 D;  5BXZ A;  1BE3 H;  3ZRX A;  4I9W A;  2DWD C;  3LNM B;  1NT2 B;  2VRZ A;  3F5T A;  4JI4 B;  4O4J B;  5CA0 B;  2KKW A;  1M4U A;  4D7S A;  4MSW C;  3HKB A;  4O2A A;  1JX9 A;  4ICG A;  1GKF A;  4UUJ C;  2LJ2 A;  4WFH A;  1HP8 A;  2Q0O C;  2PI4 A;  3AG3 C;  4PJ0 Z;  2E76 B;  4ZBM A;  1Q6H A;  5KUK A;  5KHJ A;  1OCZ C;  5LMU B;  2KB1 A;  4HNA A;  2ZIM A;  5BZB A;  4JYA B;  1N36 O;  3OR6 C;  5BMV B;  4J10 A;  1CPY A;  3KKY A;  4O4I B;  4I0X B;  3G67 A;  1XEQ A;  3CCS V;  1G4Y B;  4JV5 B;  3ZCC A;  2WLK A;  2WWW A;  3E22 A;  3H1H H;  4WFG A;  1VIB A;  3BFR A;  3OEE G;  5BR8 O;  2OT5 A;  3ICX A;  2DYS C;  1JOY A;  4B3T O;  3ABU A;  3OMI B;  3FB7 C;  1A32 A;  4NTW A;  1G6U A;  1AR1 B;  1R3I C;  2IJJ A;  3OGC C;  3OE7 G;  1DTO A;  3JAS A;  1S72 V;  4PDR A;  2DW4 A;  4UV8 A;  2BTQ B;  1NI8 A;  3SDL A;  2ZDI C;  1AR4 A;  4DR2 B;  1R1B A;  3K08 A;  1WPX A;  1GAX A;  1R73 A;  3ABM B;  1AJP A;  1FPO A;  3W7X A;  4JAV A;  1Q8I A;  4XDJ A;  3GWO A;  1ROP A;  3CRM A;  4DR4 B;  3CPW U;  1OCO B;  1SQX H;  3D36 C;  2JS3 A;  1E1R G;  2Q8V A;  1W59 A;  1OZ0 A;  5EYP A;  4JI6 O;  3ZHS A;  5JJN B;  4F6R B;  3G80 A;  3P32 A;  5LP6 B;  2KSD A;  5IT9 N;  3FAV B;  2ZIO A;  4J7J A;  1R6K A;  3SYC A;  1IXM A;  1Y74 A;  4MW8 A;  2X0L A;  3HKD B;  3AG3 B;  3BRC A;  2UXN A;  1TVK B;  2QWO B;  1SF9 A;  3E83 A;  3S3W A;  4XBF A;  3I55 V;  1N36 B;  3FYE B;  2UXB O;  3SPG A;  2YXL A;  4IYH A;  4DR6 O;  4X65 O;  5D5P A;  1UFI A;  4DV7 O;  1CP9 A;  2OTL V;  1QNM A;  2ZE6 A;  4K35 A;  2Y4U A;  1RSO A;  1FYJ A;  1TUB B;  4U3F H;  4YJ2 A;  5BR8 B;  1BT8 A;  4K8X A;  4IL6 Z;  2HKO A;  3K5M A;  4B3T B;  1QLE B;  1N34 B;  3A0H Z;  3W7U A;  4U3J B;  3DXR B;  2DOS A;  1F51 A;  2JGD A;  3BVO A;  4A5U B;  4UFZ A;  3ZHV A;  1M1K W;  2FYU H;  4O4H B;  4PI2 A;  4RWU A;  2F43 G;  4FFB B;  1QU7 A;  4JTC B;  1K4C C;  2UXD O;  4JI2 O;  3K0G A;  3UKM A;  5IY5 C;  2HJD A;  2MK3 A;  1M9N A;  1WAZ A;  3K0D A;  1WB7 A;  4UVC A;  4DR7 O;  4TUY B;  4LF4 O;  3ML0 A;  4FLW A;  3ZHU A;  3CRR A;  3OMA B;  5LHH A;  3B77 A;  1H2M A;  4JI6 B;  3APO A;  1ZL8 A;  5A9G A;  2EIN C;  1YJ9 V;  3O65 A;  2XAJ A;  3UO2 A;  3PJS K;  5JCO C;  4JZ2 A;  3U0Z A;  5LHG A;  3AG2 C;  1SQG A;  2Q0A A;  3FKS G;  4RUF A;  4MTO A;  2JDI G;  2PUS A;  3HKE B;  4Z2W A;  3T4D A;  1AP5 A;  2ITD C;  3E35 A;  4YJ3 B;  5A2Q N;  4JI7 O;  4PDL A;  4X1K A;  2A3Q A;  3Q4H B;  5J9P C;  2F1M A;  3AG1 B;  4FZ0 A;  4O2B A;  1NTK H;  2UXB B;  4X1Y A;  3UO3 A;  2CTR A;  2JEU A;  2YIB D;  4DR6 B;  4X65 B;  3BPZ A;  5GON B;  4DV7 B;  3CCE V;  1ZSP A;  4P30 A;  4EB6 A;  2OTJ V;  1FFX B;  4IYI A;  3OM3 B;  1ZX3 A;  1K73 W;  2QWQ B;  3F7V C;  1I08 A;  2UUC O;  1NTZ H;  1P84 F;  4C7U A;  4P9P A;  4FLX A;  4ZKI A;  1K33 A;  1VF5 B;  1NBM G;  2RNB A;  3FB5 C;  3D3Q A;  1VMG A;  4LF6 O;  1YSC A;  4JAS A;  2ZE7 A;  4UCS A;  2UXD B;  4JI2 B;  2GBO A;  2H8P C;  1D5A A;  4I4T A;  4Z1V A;  1P49 A;  3MHS C;  4DR7 B;  4PEL A;  1WP8 A;  4MVM A;  4LF4 B;  4GKK O;  3CJH B;  1Q6U A;  3E8B A;  4CS4 A;  4FM0 A;  3CME V;  1H2G A;  3CC4 V;  1NR1 A;  4TQD A;  3EXA A;  4H0L B;  2N05 A;  5LL6 Y;  2EIJ C;  1GM9 A;  2Q9L A;  3WB1 A;  2BOC C;  5B1N A;  3JD4 A;  1P7B A;  1SES A;  2H94 A;  3LDC A;  4JTD B;  1H2N A;  1S5J A;  4LCU C;  4GCZ A;  1N33 O;  4DR3 O;  2Q6A A;  3JAK A;  4KL1 A;  1G8M A;  4U7O A;  1VQ5 V;  2KQX A;  3QG5 A;  4LFA O;  4I5S A;  2WLN A;  3BA9 A;  4DRX B;  1PNK A;  4RAI A;  2QKC A;  3ETG A;  3UT5 B;  3JAL B;  2YIB A;  2YIA A;  2UUC B;  1VAR A;  1DK1 A;  5TIS Z;  1AJN A;  4B7K A;  3H1J H;  2ZR3 A;  2DYR B;  3KCY A;  4B3M O;  5JVD B;  4DV2 O;  5EIB D;  5LYJ B;  3N2G A;  2K1E A;  4E2L A;  1Q7Y W;  2PYL A;  1WLE A;  5CA1 B;  4MTX A;  1SA0 B;  2LW1 A;  2JK5 C;  3FD9 A;  3RYF A;  4B3S O;  1QCE A;  2HVJ C;  1OCC C;  3JAR B;  2PTM A;  3CE2 A;  3CMA V;  2EIL C;  4JGS A;  4GKK B;  5B1O A;  1H2L A;  2Z0A A;  2VWJ A;  1SQB H;  4DV3 O;  3ZHR A;  2LFS A;  3HB3 B;  4FM2 A;  1E1Q G;  2XTA A;  2XAS A;  2DN9 A;  1YTF B;  2B1G A;  2Y69 B;  3KZI Z;  5ITZ B;  1V55 B;  2EIJ B;  4Q20 A;  5IYD O;  2E74 B;  3ZBH A;  4ABM A;  3C3T A;  3CRC A;  2Y48 A;  4X8A A;  3JAT B;  1Q43 A;  3A2F A;  2ZCE A;  4WCE V;  2P67 A;  2AHY A;  1WA8 A;  3JAW B;  1N33 B;  4DR3 B;  1XL4 A;  1FJG B;  3NXS A;  1KB9 F;  2HHH O;  4LFA B;  1H8E G;  4CZZ A;  1N0J A;  1MZF A;  1K5S A;  4W4L A;  2OWO A;  4J42 A;  1I94 B;  4AIL C;  3SYQ A;  2GDS A;  4J9Y B;  2A7W A;  3BY6 A;  2HP8 A;  5IYZ A;  4I50 B;  2IU3 A;  5L3F A;  2ZE5 A;  1M57 C;  2QJ1 A;  4B3M B;  3CRA A;  4DV2 B;  3SJB C;  5D5Q A;  4OX9 O;  1JMK C;  4LH6 A;  3OMN B;  4TV8 B;  1B3Q A;  4NB5 A;  2ZXW B;  1QVF U;  5CMU A;  1MA1 A;  3CEI A;  4OXS A;  3ZS8 C;  1AI7 A;  3RYC B;  4B3S B;  3THO A;  4KP4 A;  1B6Q A;  4X66 O;  1ORQ C;  4UCR A;  4J80 A;  2JS5 A;  4PDV A;  3FFQ A;  5KHI A;  2QWP B;  3SPH A;  5JH7 A;  5B66 Z;  4DV3 B;  1KUQ A;  1EN4 A;  1VQ6 V;  2RJZ A;  4UCU A;  1VQL V;  2O57 A;  1Q5O A;  1UJW B;  3N2K B;  5CB4 A;  3H9V A;  2PF4 E;  3DSQ A;  2XUM A;  4CC5 A;  3OAA G;  1RM1 B;  3H1I H;  2JRI A;  3LSQ A;  2AW9 A;  2IJK A;  1Q81 W;  5KHH A;  4GT1 A;  3D8C A;  4JYC A;  1AR5 A;  5EZY B;  4HBN A;  3ABL C;  1VQ7 V;  3CSX A;  4D6T H;  2X6A A;  5CA3 A;  2WLJ A;  4E4E A;  2HHH B;  4JI5 O;  5LGU A;  2LP7 A;  1I0H A;  2ZD9 A;  4FPP A;  2YS8 A;  4DR4 O;  1XOU A;  3RT3 C;  2GTS A;  1N8R W;  3W7T A;  4WFF A;  1OCR C;  1NZ6 A;  2LGQ A;  4XDL A;  1TGO A;  1US6 A;  4DW1 A;  1Y76 B;  5J2U A;  3K58 A;  4IGG A;  2CTP A;  2P22 C;  5B5E Z;  4HNA B;  3IJ4 A;  4FLT A;  2YXH A;  2IJI A;  2D2C B;  4OX9 B;  4ZOL A;  1GK9 A;  5L3C A;  1GM7 A;  2JJ1 G;  4DV6 O;  5E1A C;  3A0R A;  3CWB H;  1KKC A;  1KEC A;  3E22 B;  1BQZ A;  3FYI B;  2Z3Y A;  5J2T A;  3WG7 B;  4B08 A;  4PA7 A;  3K5L A;  4X66 B;  5IYB O;  5B3S C;  2WLI A;  2VQE O;  3B8N A;  3H01 A;  5EBM C;  5H6R A;  1IUR A;  2QR4 A;  2HVK C;  3GVM A;  2OCC C;  1K9M W;  1FXV A;  1N34 O;  1Z5W A;  2QTO A;  1O9G A;  3WFV A;  4N21 A;  3G6B A;  2LW7 A;  4AQY B;  4LH7 A;  3ZMT A;  1BQ0 A;  3LDE A;  4BIU A;  4X1I A;  3K9A A;  4JF3 A;  3QF7 A;  2ZIN A;  3ABL B;  1K8A W;  1RP3 B;  1B04 A;  4ZI7 A;  3I56 V;  5EYP B;  3LNN A;  4O4I A;  4JI5 B;  4I0X A;  2EIK C;  1URF A;  2B5U A;  2F23 A;  4LF7 B;  1PNL A;  4NTX A;  3ZRS A;  4AHC A;  2CGO A;  1YJN V;  1BL8 A;  1BCC H;  3GB7 C;  3RYI A;  4YY3 O;  5C8Y A;  1Y74 B;  4QE7 A;  5B1A B;  1QQC A;  4CS2 A;  1V54 C;  4WFB V;  4FMT A;  4CS3 A;  5IJ9 A;  1JCH A;  2GSM B;  2IJH A;  4UCV A;  1V9P A;  2K9P A;  4GKJ B;  1H2K A;  3AG4 C;  2BTQ A;  1F4M A;  1BHA A;  5K1P A;  1JFF B;  2ARH A;  4DV6 B;  1Q3E A;  2A0L A;  4TQF A;  1EM1 A;  3TET A;  4IHJ A;  4F4L A;  3B4S A;  3JSN A;  3X2Q C;  3SPJ A;  4QIW F;  1D5N A;  1OCZ B;  1RSO B;  2P5O A;  1RFY A;  2NR5 A;  1J95 A;  2V7Q G;  4X20 A;  1GN3 A;  4FIP C;  2F66 C;  5FPO A;  2F4V O;  3VOU A;  4ASU G;  2VQE B;  2JGU A;  3TJT A;  4G27 B;  3SR2 C;  2BSK A;  1L1F A;  2JGD B;  2YID A;  5LA6 A;  3SPC A;  4F6R A;  3VQY A;  3EFF K;  5LP6 A;  1XDC A;  5H5N A;  3MD0 A;  3JYC A;  1BSM A;  2VWK A;  2VS0 A;  1RPO A;  1YHQ V;  2DYS B;  2HEP A;  1LR1 A;  4DK1 A;  3G4S V;  5IYC O;  4OPH A;  3CS5 A;  4K3A A;  3SJQ C;  4AI8 A;  1XMO O;  4PD4 F;  3IC7 A;  2JVD A;  2HJF C;  1DF4 A;  1WJZ A;  1N32 O;  4CH6 A;  3ZIA G;  1PD3 A;  2P06 A;  3PN1 A;  1EZJ A;  1YEW A;  4MVO A;  1K97 A;  1YJW V;  1VP7 A;  1VQN V;  4JAU A;  5IDJ A;  2EBO A;  1ZL8 B;  1N0N A;  3B09 A;  1IZ3 A;  1EZV H;  2EIK B;  2IH1 C;  2YEV A;  2Q5Z A;  1HDJ A;  3QVN A;  1Y67 A;  4K8Z A;  4L87 A;  3MHH C;  4UB6 Z;  1TUB A;  4RQF A;  4YY3 B;  3DGE A;  2MW2 B;  2E3C A;  1HWY A;  5KHG A;  3DTU B;  5K1X A;  3FX7 A;  1RPR A;  4L8J A;  2UU9 O;  3DXR A;  4X1K B;  3W7W A;  1ENV A;  2Y4T A;  1SQV H;  4FFK A;  1S76 D;  4O2B B;  5L3D A;  3AG4 B;  2XND G;  4X1Y B;  3OUF A;  4O4H A;  2CAZ C;  1THZ A;  2ADP A;  1NVP B;  2JJ2 G;  2PGG A;  3L70 H;  1GN2 A;  1OV9 A;  2ZQM A;  2X6B A;  4CH3 A;  2YC0 A;  2N74 A;  3HKC B;  1K92 A;  4JI1 O;  5H2F Z;  5CBF A;  4B3R O;  3QO8 A;  3D3I A;  4GX0 A;  4X64 B;  3TXQ A;  4CBC A;  2F4V B;  1YZB A;  1Z2G A;  4JI0 O;  3NR7 A;  3E2E A;  1EN6 A;  4LNU A;  1GH6 A;  2QSA A;  1I5Y A;  2P90 A;  4YIP A;  3MDS A;  3K5N A;  3CD6 V;  4TV9 A;  2ATK C;  2R9R B;  2XAQ A;  1KP3 A;  4GX1 A;  1GN4 A;  2CTQ A;  1NS1 A;  5JQG B;  1BGY H;  2QEX V;  2ETN A;  5LOV B;  2P7T C;  3HKE A;  1XMO B;  4DUY O;  2CTW A;  4TT3 G;  1U97 A;  4I4T B;  1H8H G;  3CHX A;  3Q4H A;  5JJJ B;  1N32 B;  2A06 H;  4JI8 O;  3ZMZ A;  1IXB A;  2NNU A;  1MOF A;  3AK2 A;  5JWP A;  5GON A;  1BHB A;  5IY5 B;  1NH2 D;  5LGT A;  3OUS A;  5B1B C;  3AEI A;  5LXT A;  4B7E A;  3AG7 A;  2QKA A;  1YVW A;  5EC1 C;  1KD1 W;  2ADQ B;  1SQP H;  4R50 A;  3J80 N;  4DR5 O;  5KMG B;  2Q7G A;  2UU9 B;  1TUE B;  2LQT A;  2PZS A;  2EIN B;  2H3O A;  4PV1 B;  4NXM O;  3CRQ A;  2CUG A;  3AG2 B;  1WB8 A;  3JAK B;  3K59 A;  4YHH O;  4DV0 O;  3L72 H;  2PI5 A;  3M99 B;  1ZLZ A;  3T4Z A;  2A9H A;  4FLY A;  4DYL A;  1MSD A;  5CN0 A;  3K9S A;  3OTO O;  4DUZ O;  4FJC C;  3RYH B;  4JI1 B;  3VQV A;  1X59 A;  4HZ3 A;  1ZUQ A;  4WF9 V;  3G71 V;  4B3R B;  1PP9 H;  3JD3 A;  1FJG O;  1HNW O;  4K0K B;  5BY1 A;  3O9O A;  1YTF D;  4JPR A;  5FLX N;  3ZMU A;  4JI0 B;  3DC5 A;  1QBZ A;  2UXC O;  1QHT A;  1MMM A;  3TXS A;  1I94 O;  1VF6 A;  3JD0 A;  2QTS A;  1R3L C;  4MVS A;  3H1L H;  1EN5 A;  2YXY A;  1NR7 A;  4DUY B;  2P4K A;  1PKX A;  2EIM C;  4BW5 A;  4RQE A;  2C2A A;  5EIB C;  2XHB A;  1IBL B;  3J7A U;  3T1C A;  1FD9 A;  3R66 A;  4JI8 B;  2KG7 B;  1GRJ A;  2Q7E A;  1EBO A;  2L6L A;  4HAM A;  4X88 A;  2D3O W;  1BS3 A;  1MSW D;  4PA9 A;  2DJV A;  1YXB A;  5E79 Z;  4DV5 B;  4LF8 O;  5LBQ A;  4KXR A;  5EK0 A;  3CCR V;  3N27 A;  4PI0 A;  3K04 A;  3UT5 A;  3JAL A;  1H38 A;  3CB2 A;  4DR5 B;  2BOB C;  2QM4 A;  2N04 A;  2QM7 A;  3VQW A;  2QE7 G;  1Q6I A;  1Z5V A;  3EVK A;  3FB6 C;  5EBL C;  4NXM B;  5JVD A;  4ZHQ A;  3SGI A;  1J5E O;  4YHH B;  1AI5 A;  4DV0 B;  3QNE A;  3QO5 A;  1R3J C;  3C3S A;  4QE9 A;  1R3K C;  1SA0 A;  4JI3 O;  2OCH A;  1K3E A;  5AG2 A;  3OTO B;  1SRY A;  4DUZ B;  2XOK G;  3JAR A;  4CH5 A;  3L73 H;  1HNW B;  2QWN B;  4R6Z A;  1VQ8 V;  2LO1 A;  5LGN A;  4LFB O;  3ZN1 A;  5KX5 B;  2UXC B;  2Y0I A;  3ASN C;  4FLU A;  3UM7 A;  5IJ0 B;  1FXK A;  1M90 W;  1YIT V;  3BAA A;  3H1K H;  4O4L A;  3ASO C;  3ZMS A;  2Q68 A;  2OIG A;  3ZRW A;  1TA8 A;  4LF5 O;  4Z1M G;  4UCT A;  3M7M X;  2CH7 A;  2YI9 A;  2P4V A;  2EIM B;  2WLM A;  3VBB A;  1HR0 O;  1IBM O;  2FML A;  2RN9 A;  1KP2 A;  4H44 B;  3ETD A;  1VQK V;  3IGA C;  3WU2 Z;  4IIJ A;  4BW9 A;  4UB8 Z;  1L0N H;  1DGS A;  3CXC U;  5CB4 B;  3UQ8 A;  3CCL V;  4LF8 B;  1K4D C;  3DC6 A;  3R65 A;  4I55 A;  1OCC B;  3OW2 U;  2EIL B;  1YCI A;  1XQ8 A;  3E86 A;  3TGU H;  3IAY A;  3SYP A;  4WBN A;  1IBK O;  2YSU B;  5FNV B;  1PPJ H;  2V1D A;  1I7F A;  4I50 A;  1D2D A;  2CE4 A;  1U96 A;  4H37 A;  3CC2 V;  1OHH G;  1J5E B;  3IFX A;  4P2Z A;  2QM8 A;  3FB8 C;  2AHZ A;  4AQY O;  1PL0 A;  4JI3 B;  2M7W A;  4UVB A;  2OYQ A;  3LUT B;  1XHX A;  1AP6 A;  2DWE C;  5DN6 G;  2QGN A;  4J7Z A;  1XI1 A;  5J2U B;  1XBL A;  2QKS A;  4LFB B;  1Q82 W;  4XDK A;  2GUZ A;  4LF7 O;  1O9H A;  4MVR A;  2EJ7 A;  1JJ2 U;  3N2K A;  2WLL A;  4ZOL B;  3HKB B;  3K06 A;  4O2A B;  3P3N A;  1S5L Z;  2QWR B;  4LF5 B;  4EKW A;  3ABM C;  4LR3 A;  1AIL A;  4NXN O;  4GKJ O;  4KUM A;  5J2T B;  1HR0 B;  1XUQ A;  1M57 B;  1JVM A;  1IBM B;  4FK5 C;  4D7T A;  2YUA A;  1MNG A;  4F6E A;  1OCO C;  2BCC H;  3SJA C;  1DF5 A;  4OPA A;  1NTM H;  4PA4 A;  1XL6 A;  4MT8 A;  1S77 D;  1P7G A;  4BIZ A;  3T1H O;  2EZP A;  3RWR D;  5LP6 C;  1XNR B;  3CCV V;  2UUA O;  2RCV A;  3TK1 A;  4TSF G;  2XAF A;  4LWS A;  1Y6X A;  1M56 C;  3CC7 V;  1T5E A;  1JPX A;  5L3G A;  1IBK B;  3A0B Z;  5GTH Z;  3OD4 A;  4QGP A;  3E8G A;  3JAS B;  1UPG A;  4HYO A;  1Y76 A;  4X1I B;  1FKA O;  3HPL C;  3JCZ A;  4O4J A;  5CA0 A;  1GMG A;  2G38 A;  3ZHQ A;  1H2S B;  2HG5 C;  5EC2 C;  3K03 A;  1K34 A;  4ZI7 B;  4MTF A;  3WB0 A;  1KKD A;  4FLV A;  4DO2 A;  3RGB A;  2B1I A;  3KG2 A;  4DXW A;  4JYB A;  3SPI A;  5H9C A;  1SQQ H;  3JCU Z;  5L3E A;  1EFR G;  3RYI B;  5C8Y B;  4P9O A;  2IM9 A;  3W7S A;  1QLE C;  5BMV A;  3CCU V;  2FL4 A;  3T1Y O;  5IJ9 B;  4GLX A;  3STZ C;  4PA6 A;  2YIC A;  2LFR A;  1MG1 A;  1W0J G;  3OFN G;  4LF9 O;  1F7Y A;  3ZED A;  2WPD G;  1CXZ B;  4MVZ A;  1OCR B;  4TWK A;  4IHJ B;  1XNQ O;  4H13 B;  1S3J A;  3SYO A;  1Y4M A;  4NXN B;  2AXT Z;  4RUE A;  4CH4 A;  2XAG A;  3I5D A;  5HFL A;  4X20 B;  2JEX A;  3HR0 A;  5KLV H;  4JAA A;  4LC1 A;  1ARO P;  1WP7 A;  1YI2 V;  1XMQ O;  2BSK B;  3T1H B;  1PNM A;  5LA6 B;  1R6N A;  5FL7 G;  2FKX A;  4YJ2 B;  2A79 B;  2UUA B;  2IBZ H;  4PA3 A;  4EEQ A;  4X64 O;  1M56 B;  5B3S B;  2E5L O;  4R7C A;  1AB3 A;  2R70 A;  1NVP D;  4MTG A;  3L9D A;  2EX3 A;  5KA5 A;  4H33 A;  5EBW C;  2CK3 G;  3AG1 C;  4NTY A;  3ZHT A;  1QR9 A;  2OCC B;  3P3P A;  2UUB O;  2OIE A;  1YDX A;  3FAV A;  2WA4 A;  3B8M A;  1YIJ V;  1JFF A;  4DV4 O;  1SQF A;  1XIL A;  1GN6 A;  2YEV B;  3M8A A;  3OTF A;  4DR1 O;  3HKD A;  3U11 A;  3IC9 A;  1TVK A;  2CGN A;  3G6E V;  4KHP O;  2EZO A;  3JAM N;  3BAB A;  3F7Y C;  2IU0 A;  1SET A;  3T1Y B;  3L71 H;  3OT7 A;  1GO3 F;  2ZKO A;  4QNH B;  1OJH A;  3E89 A;  4ZIB A;  2R9I A;  5CBG A;  3QO7 A;  3K3W A;  3OEH G;  3CCM V;  4LF9 B;  2WLH A;  3U10 A;  1F23 A;  1ZWI C;  3JD1 A;  4NYK A;  4U7N A;  1FAF A;  1V54 B;  3F5W C;  3ABK C;  4U3J A;  4N23 A;  5IWA O;  3ZRV A;  1XNQ B;  4GYC B;  2B9Z A;  1L8D A;  4BWA A;  2IH3 C;  2XAH A;  1QLN A;  3TCU A;  1B06 A;  4FFB A;  3BHP A;  4X9Q A;  2ZDI A;  1IVS A;  1XMQ B;  4EB6 B;  4LNU B;  3X2Q B;  2QA4 V;  1VF6 C;  4JTA B;  2PYJ A;  4TV9 B;  3APQ A;  1GTO A;  2EUL A;  3QTC A;  4NVP A;  1VQP V;  4TUY A;  1FFT B;  1VEW A;  4WFE A;  4K0K O;  3D36 A;  2E5L B;  4GZR B;  2LGW A;  1MAB G;  2Q4P A;  2X6C A;  1QVG U;  4MVU A;  4JYY A;  1QR8 A;  2AZ2 A;  4J7K A;  1HW7 A;  2AGA A;  3T2M A;  2HLD G;  2UUB B;  2ODM A;  1IX9 A;  3JSL A;  1L0L H;  3CX5 F;  4DV4 B;  3ZMV A;  1P4R A;  1PV0 A;  3BEH A;  3RW0 A;  1VF7 A;  4YJ3 A;  4DR1 B;  1HNZ O;  2F95 B;  1SC5 B;  1COW G;  2M6Y A;  1IBL O;  2VQF O;  4KHP B;  3UCS C;  5LXT B;  3HKC A;  1VQ4 V;  1CEZ A;  2DMX A;  2W6J G;  1JQ0 A;  1KU9 A;  1SER A;  1WN7 A;  2W0X A;  4JZG A;  1SZX A;  1FFX A;  2DYR C;  4DV5 O;  1FS0 G;  4EFB A;  3K5O A;  3E8F A;  1R6T A;  1SS3 A;  1ZAU A;  2Y0P A;  3B40 A;  1S5H C;  1IDS A;  1KMI Z;  2DE0 X;  2QDO A;  3ETQ A;  4GX2 A;  5JQG A;  4J11 A;  5DEC A;  3ABK B;  2IW5 A;  5LOV A;  5IWA B;  1SKV A;  2W0F C;  1LUW A;  1AVM A;  2PY5 A;  4FZ1 A;  2X7R B;  4FM1 A;  1FXH A;  4GUN A;  3A8T A;  3SYA A;  3CP1 A;  4G28 B;  3WB2 A;  2Q7H A;  3S3X A;  3ABT A;  2NLJ C;  2FTK A;  2ZT9 B;  4PHZ A;  3CCJ V;  3CXH F;  5KUM A;  1K5Q A;  5H6Q A;  2XT9 A;  1FXK C;  1DLB A;  4YIO A;  2WSS G;  1PL4 A;  2Y69 C;  4CC6 A;  1LNQ A;  1KQS U;  1V55 C;  1WNS A;  3CJH A;  4Q6G A;  4YXW G;  5KMG A;  4JI7 B;  3J81 N;  5KHK A;  1KC8 W;  5KAI Z;  3MAQ A;  5JCO A;  1I5X A;  3N2G B;  4RO2 A;  4I7Z B;  3ZN0 A;  4MS2 A;  3LSS A;  4QPJ A;  1HNZ B;  2BTO A;  2JIZ G;  2ITC C;  3RYF B;  3LDD A;  2VQF B;  4TOI A;  1JJO A;  3RYH A;  3BA8 A;  2ILM A;  1K7D A;  3LSU A;  1NH2 B;  1VQ9 V;  1TAE A;  4OGQ B;  4DRX A;  1MZE A;  5KAF Z;  5B1B B;  4LF6 B;  1VQM V;  4ZHQ B;  1KBH A;  3OR7 C;  1AI4 A;  4X89 A;  1Y66 A;  4LFC O;  3RVZ A;  5GTI Z;  2EJR A;  2ZXW C;  1BMF G;  3L75 H;  5FPR A;  3RN4 A;  4I9Q A;  3ZX6 A;  2RMK B;  2GTA A;  4WFA V;  1S0V A;  4FLZ A;  1WA8 B;  4NR1 A;  5LYJ A;  2WAM A;  2KG7 A;  4J41 A;  2NN4 A;  2GHY A;  3RVY A;  1JA8 A;  5CA1 A;  3C90 A;  2WA3 A;  1JR9 A;  1YF2 A;  4LBE C;  4UXN A;  3P30 A;  1FXK B;  4EFE A;  4DK0 A;  2HFE C;  4O4L B;  3SJC C;  1RM1 C;  3K79 A;  5KA6 A;  2ZM6 O;  3ZRW B;  3K57 A;  1M5I A;  5F2V O;  3JD2 A;  5IYZ B;  2CH7 B;  2Q73 A;  1M93 A;  1Q86 W;  5GW7 A;  5ITZ A; 
#chains in the Genus database with same CATH homology
 1AB3 A;  4JI8 O;  2JRI A;  1N32 O;  4DV1 O;  2LW7 A;  2AGA A;  2DJV A;  4LF8 O;  4JI6 O;  3O65 A;  1IBK O;  4X62 O;  5LL6 Y;  1HNX O;  2UUB O;  1FKA O;  4DV4 O;  1HNZ O;  5BXZ A;  5IT9 N;  1D2D A;  5LMN O;  1IBL O;  2VQF O;  3M8A A;  4JI5 O;  4DR1 O;  3F5T A;  4DR5 O;  3J80 N;  5A2Q N;  4JI7 O;  1XNR O;  4KHP O;  2HHH O;  1N33 O;  4DR3 O;  4JI4 O;  1G1X B;  4YY3 O;  4DR4 O;  3JAM N;  1J5E O;  3RT3 C;  2UU9 O;  4NXM O;  4LFA O;  4AQY O;  4YHH O;  2ZKO A;  4DV0 O;  4DV5 O;  2UXB O;  4LFC O;  4JI3 O;  3T1Y O;  4DR6 O;  4X65 O;  1R6T A;  1N36 O;  4DV7 O;  5LMU O;  1XEQ A;  3OTO O;  1DK1 A;  4DUZ O;  4JYA O;  4LF9 O;  1X59 A;  1F7Y A;  2UUC O;  4LF7 O;  1FYJ A;  4JV5 O;  1FJG O;  2N74 A;  4DV6 O;  5IWA O;  1HNW O;  4JI1 O;  4LFB O;  5BY1 A;  4OX9 O;  4B3R O;  5FLX N;  5BR8 O;  4B3M O;  1XNQ O;  4DV2 O;  4B3T O;  2DOS A;  1YZB A;  2UXC O;  4LF6 O;  1A32 A;  4JI0 O;  1I94 O;  4A5U B;  2F4V O;  1AIL A;  4NXN O;  4GKJ O;  4LF5 O;  2ZM6 O;  2VQE O;  4X66 O;  4B3S O;  5H5N A;  1NS1 A;  1HR0 O;  2UXD O;  1XMQ O;  1IBM O;  3SDL A;  4JI2 O;  1KUQ A;  4OPA A;  2FKX A;  4DUY O;  2Z0A A;  1R1B A;  3T1H O;  3J7A U;  4K0K O;  4OPH A;  4DV3 O;  4GKK O;  1N34 O;  3R66 A;  3J81 N;  1XMO O;  4DR7 O;  4DR2 O;  2UUA O;  4X64 O;  4LF4 O;  2E5L O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...