4GKKO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4gkkO00
2UUBO 4DV6O 1J5EO 1HNWO 4JI0O 2UXCO 1XEQA 4LFAO 4GKJO 5FLXN 1IBKO 3O65A 4JI8O 5BR8O 1DK1A 5A2QN 4JI3O 4DUYO 5IT9N 2UUAO 2UXBO 4JI7O 4DR7O 3R66A 4DV2O 4OX9O 4YHHO 5LMNO 3SDLA 2ZM6O 1XMQO 3JAMN 2VQEO 1N36O 4NXMO 1I94O 3T1HO 4KHPO 3J81N 2FKXA 4DUZO 2JRIA 2AGAA 4DV5O 1F7YA 1HNZO 5BY1A 2HHHO 4LFCO 5BXZA 4LF6O 4B3SO 2UXDO 4JI5O 1AILA 2UUCO 1N32O 1N34O 1X59A 3J7AU 4X66O 1G1XB 1XNRO 5H5NA 4JI1O 1IBLO 2Z0AA 1FKAO 1FYJA 4JI2O 1A32A 4JYAO 4B3RO 4DR1O 2ZKOA 4GKKO 4DV3O 3OTOO 4AQYO 2VQFO 1R1BA 2DOSA 1D2DA 1NS1A 4OPHA 4LF4O 1FJGO 4NXNO 2LW7A 4LF5O 1KUQA 2E5LO 4DR5O 4X62O 5LMUO 5IWAO 1IBMO 2UU9O 4DV1O 4DR2O 4LF7O 4DR3O 4JV5O 3J80N 4DV7O 4YY3O 2DJVA 4OPAA 4X65O 4B3TO 3RT3C 4DR6O 4B3MO 2N74A 5LL6Y 2F4VO 4JI6O 1R6TA 1YZBA 1HNXO 4DV0O 4DV4O 4LFBO 4JI4O 1XMOO 3M8AA 4X64O 1HR0O 4LF8O 1N33O 3T1YO 3F5TA 4DR4O 1XNQO 4K0KO 4LF9O 1AB3A 4A5UB
chains in the Genus database with same CATH superfamily
3KCXA 2Q0AA 1JJOA 2WPDG 2LO1A 4JI0O 2JS3A 5KX5B 2ZE7A 1V9PA 4UCSA 3CXHF 1SS3A 2R9AA 2WWWA 1QR9A 2GTAA 3DC6A 4GLXA 3VBBA 1IVSA 3C3TA 5B1AB 3T4DA 1YJ9V 2JVDA 2HVKC 2IH3C 4MTFA 1Y76B 2KKWA 5H6QA 1JJ2U 1RM1B 2CE4A 4WBNA 2JRIA 2ZE5A 5LP6A 3W7UA 4JGSA 1NU1H 2JEUA 3A0BZ 5DN6G 1Q6UA 2PY5A 4I55A 4AI8A 2IJKA 3J7AU 5IYZA 1KKCA 2IJJA 2YC0A 3ZMSA 1A32A 5JJJB 3ABLC 3CSXA 4DV3O 4JV5B 4I4TA 1QVGU 1O9HA 1CXZB 1VP7A 3LSUA 3RFRA 1YTFB 2E5LO 1WLEA 1IBMO 1I0HA 2LJ2A 5E1AC 4YHHB 3JD2A 3JSNA 1SQQH 4PA7A 4FLTA 4CS2A 1IX9A 2OT5A 2AHYA 4X1IB 1RFYA 4FFKA 4RO2A 1U96A 1J95A 1R3LC 2W6IG 1QQCA 1YXBA 5IYCO 3QNEA 4YIPA 5K1PA 1V54C 3LSSA 1G8MA 4J7JA 5LMNB 4PDMA 5EBWC 4WBNB 2FTKA 5LP6B 2EIMC 2GBOA 2EIKC 3VQXA 3JASA 1EZVH 5B1BB 1F23A 4UCUA 4K3AA 1N8RW 4PHZA 1XL6A 4FZ1A 4I55B 2HHHB 2XAHA 4AILC 5IYZB 3HR0A 3I55V 5FPRA 2V4DA 4TV8A 3ZHQA 4NXMO 1QCEA 1N34B 2AGAA 1NZ6A 2PI4A 4NVPA 4I4TB 1YJNV 1PM9A 1IBLB 1I08A 4H44B 3H1IH 4LP8A 1W59A 5H6RA 1S76D 5HFMA 1OV9A 2EIJC 3TK1A 1W0JG 4P30A 3TXSA 1SKVA 5KHJA 3W7XA 1QBZA 1T5EA 4NR1A 1KD1W 2LW1A 4B3RO 1WB7A 1R1BA 2YS8A 1BQZA 2Q7HA 3CE2A 1P49A 4YXWG 4X65B 4G2KA 5JH7A 1FJGO 4JI8B 4WFGA 1EN6A 1XL4A 1YEWA 3OTFA 4B7EA 1F4MA 1ZL8A 3FB7C 5B3SB 1NR7A 4DR4B 3JYCA 4K0KB 3JASB 3U0ZA 4RWUA 4UV9A 4CS4A 4NB5A 2VWKA 1L1FA 3ABKC 2A7WA 4MVMA 1VQOV 4JI3B 3OGIB 2UXBB 1Q81W 4TV8B 3A0RA 4FLUA 4LF9O 1AB3A 3APOA 3CCRV 4HYOA 5IJ9B 2Y4UA 3BAAA 4FIPC 3OT7A 4OXSA 3O65A 1RSOA 3FKSG 3U11A 2NNUA 1OCCC 3HKEB 4DV2O 2EILC 5KHHA 4XBFA 3ABMB 5CMUA 1H2SB 1WP7A 5LOVA 1OCRC 4O2AA 1ENVA 4LH6A 4UFZA 1XBLA 2ADPA 3SYPA 2YIDA 1MZFA 1GM8A 3ZRVA 1K4DC 1R3JC 4RQFA 4RUFA 2IW5A 3RBZA 5EC1C 2N04A 4DR1B 2MK3A 5JH7B 3DC5A 1X59A 3ASNC 2CTWA 2F95B 3CWBH 2D3OW 3DGEA 4H37A 3OEEG 3AG3C 5CA3A 3E22A 2ZINA 5JVDA 2XHBA 1P4RA 4GX5A 1H2MA 2B5UA 1EM1A 3UT5A 1VQ4V 3KKYA 3HKCA 4KXRA 4JV5O 4BIZA 1PNLA 4JI4B 2QJ1A 1XMOB 3ZN0A 4BIUA 1MSDA 2DJVA 5E79Z 3JATB 3SPCA 3OD4A 3ZEDA 1RSOB 1GH6A 3CPWU 4B3MO 5B1AC 3CRAA 2ARHA 2ETNA 4H13B 4YJ3A 3QVNA 3W7TA 3E8BA 4QE9A 1R6NA 5C93A 3SYQA 5LOVB 4O2AB 2OIGA 5CBGA 3M7MX 1BE3H 4CH3A 2BTQA 1K5QA 3JCZA 2JK5C 3HKDB 1Q8IA 2W0FC 4FM0A 4F6EA 5EC2C 1D5NA 1HNZB 1BT8A 1YHQV 5LMNO 1F51A 2ZIMA 1H8HG 3ZBHA 2VS0A 2UXDB 2UUCB 3UM7A 4DV1B 4XDJA 2YI8A 3SR2C 2HHHO 5JVDB 1AP5A 3K0DA 4CH4A 1N34O 3UT5B 3X2QB 3HKCB 2XNDG 1SRYA 1IBLO 3L73H 1XHXA 3IC7A 3JD0A 3ICXA 1BGYH 5IWAB 2UU9B 4LF7B 3T4ZA 2IM9A 2EJRA 3L71H 5J2TA 1Y67A 3CCQV 1DGSA 4DV7B 2ZNIA 4QE7A 3EHBB 2EBOA 4YJ3B 4NXNO 1KUQA 1KC8W 4DR6B 4DR5O 2F4VB 5LP6C 4DR7B 3LDEA 3D36A 2OTJV 4X64B 4PA9A 1HR0B 2V1DA 5B1BC 2QKSA 4X65O 3BA8A 1LUWA 3CB2A 4DV6B 2N74A 3AK1A 1ZSPA 1Q86W 2Q69A 4R6ZA 5KHIA 2RJZA 3T1YO 1Z5VA 4DUYB 4B3SB 5FL7G 2WA3A 4DR4O 3OE7G 4PJ0Z 4K0KO 2EINB 2ZR2A 3DXRA 3VQWA 4PD4F 3K58A 1XNRB 3JCUZ 4HNAB 3F7VC 1AVMA 1M9NA 1E79G 4JI3O 2Y4TA 4DUZB 2UXBO 2NLJC 1K33A 5KMGA 1S5LZ 4D7SA 2AZ0A 5B66Z 5EYPA 4LF6B 2Q73A 1JFFA 3I5DA 2X6CA 1JCHA 1VQPV 1AP6A 4O4JA 3KG2A 2F1MA 1K7DA 4X66B 4EKWA 5J2TB 1SF9A 1RPRA 3RGBA 4HAMA 2B1IA 2X6AA 2XAGA 2WLLA 5GONA 5LHGA 1YI2V 5BMVA 2Q4PA 1QLEB 5B3SC 1F4NA 1VF6A 3AG1B 1BQ0A 1GO3F 2EULA 2ITDC 3AG7A 4JTCB 3DSQA 4DR1O 3D3QA 3VQYA 1MNGA 3IFXA 3L74H 2YXLA 2EZPA 1TVKA 5LA6A 4Q20A 1BZKA 5DEDA 5EBLC 3H01A 1XI1A 4GYCB 1LR1A 2HFEC 4R8CA 3JALA 3JARA 1NBMG 3OR7C 2PUSA 3T2MA 4Q6GA 3DXRB 1JA8A 3J80N 1OCZB 5EIBD 3OMNB 2ZDIC 1WPXA 2E76B 3RVZA 2V7QG 3ABMC 3CHXA 4YJ2A 1H2NA 1HNWB 2XAJA 3CYOA 3P32A 4MVRA 5KMGB 4DV4O 4CH6A 4WFAV 3TGUH 4JI4O 1XMOO 2QTSA 4PDLA 1CP9A 5IJ0A 3F5TA 3E8GA 2CTQA 4X20A 1JFFB 3H1KH 2DN9A 1E1QG 4O4JB 1VQ9V 1IXMA 1LNQA 3ZHUA 2YXYA 3SPHA 1SQVH 2XOKG 4GX1A 3HKBB 2WLLB 2ZNJA 5GONB 4WFHA 5BMVB 1M57B 1TA8A 4X1KA 1GKFA 1K73W 1PPJH 1K3EA 1Z5WA 3W7WA 4FK5C 3T1HO 1UPGA 2FKXA 4J9YB 4TV9A 2YXHA 3ETGA 1WP8A 1HNZO 4I5SA 1TVKB 5LA6B 1Q82W 4J9ZB 1L8DA 4UB8Z 2UXDO 3CEIA 5KUKA 2HG5C 3ZN1A 4X1IA 2UUCO 5IYBO 1VQ7V 2VQFB 5LYJA 3LNNA 2A06H 3ZHRA 3CC4V 4FVMA 3JALB 3JARB 2P67A 4DR2B 2ZXWC 4K8ZA 4YJ2B 3FYIB 4NKGB 2ZCEA 3MD0A 3R65A 1Q90D 5IJ0B 2UUAB 5IWAO 2UU9O 4LF7O 1VMGA 4X20B 1HNXB 2P4VA 3CMEV 4TUYA 4LF8B 2ZD9A 1N33B 4DV7O 4C7UA 4MTGA 1P7BA 2WSSG 4DR6O 2B9ZA 1NQTA 2F4VO 5LL6Y 1YZBA 4GX0A 4FM2A 4E4EA 5LGNA 2DYRB 4DK1A 1QR8A 2Y48A 4X64O 1HR0O 3S3XA 4GX2A 4X1KB 2WLNA 2QGNA 4WCEV 2YIBA 3JD3A 4DV6O 3E8FA 4TV9B 1SERA 4FLZA 1LUVA 1P84F 4LFAO 3WG7B 4KUMA 4DUYO 3QO7A 4UCOA 4KFMA 3X2QC 3B09A 2P7TC 4TOIA 5LYJB 1TUEB 1B6QA 1YTFD 2VQEO 1AI4A 1GN3A 4DUZO 1B04A 4TQFA 2FB5A 3BY6A 1OCOB 4LF6O 1CEZA 1ZAUA 4U3JB 1BS3A 1PV0A 1US6A 1Q6IA 1PL4A 4AQYB 1NJIW 1M90W 4X66O 2EX3A 4IIJB 2H3OA 1BMFG 4TUYB 4PI0A 2ZE8A 1DF4A 5IJ9A 1VIBA 1W0KG 4ZIBA 1YJWV 3WB2A 4QIWF 2LQTA 3SJCC 2A3QA 2PF4E 1MG1A 1NTKH 3GVMA 2EINC 1VARA 1W2BU 3JD4A 3HKEA 2ZDIA 1AROP 3CX5F 4X62O 2WLMA 2QA4V 2NR5A 4ZOLB 3IC9A 4IT5A 1MOFA 3CJHA 4LFBB 3KCYA 4D6TH 1N0JA 2LGWA 1XNQB 2EZOA 1S5HC 4I9WA 1QHTA 2LFRA 5AG2A 2WLHA 1MA1A 2DWEC 4ICGA 1COWG 1ZTEA 3M8AA 1VQMV 1TUBA 2ZE6A 4CZZA 4UXNA 3B40A 3MHHC 5B1NA 2F43G 2F23A 4N23A 2QR4A 4MVOA 3K03A 1HNWO 3BCCH 1EFRG 1N36B 4JI1B 1QLEC 1VQKV 1TAEA 3N27A 3AG1C 3F7YC 3D36C 4YIOA 4MVZA 1PNMA 2OCCC 3MHSC 3RYIB 5EIBC 1VF7A 1JVMA 2LGQA 1WAZA 5J9PC 3LSQA 2DYSB 3CRCA 1WA8B 2Q8VA 2DQ3A 3JATA 3SPGA 4BIOA 1AR4A 2QEXV 1JOYA 1PD3A 3ASOB 2IU3A 1S72V 4JI5O 1K34A 4IYHA 3K0GA 2CTPA 1BCCH 3OMAB 1OCZC 1SESA 4J7ZA 2Z5UA 4Z2WA 5LHIA 5IY5B 3QTCA 2QM4A 3CJHB 4ZKIA 3CCJV 2ZQMA 2GSMB 2JIZG 1M5IA 1GMGA 2QWOB 2DW4A 4JAVA 3HKDA 2VQFO 5IDJA 5GTHZ 1VF5B 4EFEA 1R6KA 3F5WC 2P06A 1TUBB 3AG2B 4DR2O 2GTSA 4X9QA 2HR3A 2KB1A 4DXWA 4PI2A 3FYEB 1AI6A 1M56B 1XMQB 4R7CA 4LBEC 2QWPB 3BVOA 1KKDA 1M57C 4P9PA 3U10A 1VF6C 1ROPA 4E2LA 3A2FA 1HNXO 1NTMH 3RN4A 4LF8O 2E75B 1N33O 3E89A 5KAIZ 3AK2A 4ABMA 4DRXA 2A9HA 4P9OA 4EB6A 1Q6HA 2P4KA 2E3CA 2QWNB 3SGIA 1GN2A 2HP8A 5KA5A 4CH5A 2IJHA 3C3SA 5FLXN 3FB5C 1WN7A 4X8AA 4IGGA 4GZRB 1FPOA 2ZXWB 1URFA 2Y0IA 4YHHO 1Q7YW 3HB3B 3UO3A 1ZWIC 4PA3A 1THZA 1E1RG 2QWQB 2KQXA 2RDCA 5DM6V 2OYQA 2O57A 4IHJA 1FS0G 3A8TA 5BXZA 3ZS8C 2ZIOA 4JI2B 1YVWA 1XOUA 1SZTA 3OFNG 1UJWB 4LWSA 5IYDO 1I7FA 1SA0A 2X7RB 5CA0A 4FLXA 1ZX3A 4LF5B 3LDDA 4KP4A 4FJCC 1BHAA 2PZSA 3ZHTA 3ZMZA 3W7SA 2DYRC 2XASA 3RYFA 4HNAA 3MAQA 1VQNV 4AQYO 4P2ZA 3ZMVA 3RW0A 2GDSA 4CC6A 2WLJA 1D2DA 4BW5A 3STZC 2PYJA 4B3TB 2DWDC 3SYOA 3WFVA 3H1HH 3L9DA 4DRXB 3WG7C 4Z1VA 4UVBA 3C90A 4NYKA 4EB6B 3K04A 4HZ3A 3Q4HA 3K79A 3ETDA 5JWPA 3UQ8A 5FNVA 2UUBB 4J10A 4LFBO 4LH7A 4EEQA 2Q6AA 1XNQO 5KLVH 1OCOC 3OUFA 5K1XA 4OX9B 4Z1MG 3ETEA 4H0LB 1DF5A 2RMKB 1XEQA 4IHJB 3WB0A 4FLYA 4JI8O 3CRQA 4MTXA 3BHPA 5EBMC 3SYCA 4NTYA 3QF7A 4BR6A 3R66A 1SQPH 2HJFC 1G6UA 1UFIA 2BTOA 4LWSB 5HFLA 4FLWA 1SA0B 1NKDA 4RAIA 3H9VA 5CA0B 3JAMN 1N36O 3EVKA 5KHKA 2WLIA 4JAAA 2E5LB 3QG5A 1AJQA 4QPKA 1KB9F 3SPIA 3RYFB 1GN6A 4WF9V 2UXNA 2QTOA 4O4IA 2ITCC 3CC7V 4FFBA 1BHBA 2JS5A 1XQ8A 2IJIA 4LF4B 3G80A 1U97A 1Y74A 5H5NA 2Z0AA 2MW2B 3Q4HB 4F4LA 2ZKOA 1KP2A 4H33A 4MTOA 5C8YA 5FNVB 2JJ2G 1L0LH 4YY3B 1SC5B 3LUTB 1MABG 3HKBA 2R72A 1Q3EA 2LP7A 4NTXA 4EFBA 2GUZA 3FD9A 2OCCB 4FZ0A 5L3GA 3K5NA 2DMXA 2YI9A 4NXMB 3CCMV 1NH2B 1S77D 2FYUH 3OAAG 1RP3B 4IL6Z 2DYSC 1MMMA 5BR8B 2M7WA 3K9AA 3JSLA 3ZRWB 1GN4A 1S0VA 2WLIB 4PELA 4B7KA 4X1YB 2BOCC 3ASOC 4GCZA 4JTAB 3ABUA 4MW8A 4L87A 1I94B 1DK1A 2K9PA 2CUGA 2Q9LA 4GT1A 3P3NA 1B3QA 3N2KB 5IY5C 4O4IB 1NH2D 2ILMA 4QNHB 1YDXA 2QM7A 4TWKA 1YSCA 2P5OA 4FFBB 3T1CA 2YEVA 1Y74B 1N32B 1HDJA 1K9MW 4RQEA 1JMKC 3N2GA 4JYCA 1F7YA 5C8YB 1SQBH 2JJ1G 4K35A 2PI5A 3K57A 1S5JA 3AG2C 1AILA 1KMIZ 4HBNA 3OTOB 4O4HB 3JAKA 2K1EA 3TETA 1DTOA 1M56C 2YIAA 4UB6Z 4CBCA 2GUZB 4JPRA 1ZUQA 4UCRA 4JI2O 2FL4A 5LMUB 3LNMB 3BRCA 1L0NH 4LF9B 1MSWD 2LFSA 1O9GA 4UV8A 5D5QA 1QVFU 2HLDG 2YICA 1KU9A 5ITZA 4LF5O 2YSUB 4DV1O 3OMIB 5B5EZ 4UCVA 1M1KW 4XDKA 4DV2B 3AEIA 3RWRD 3AG4B 3I56V 4JYBA 3ZRSA 4B3TO 1KBHA 1H8EG 4G27B 4J42A 3CC2V 1J5EB 1P7GA 3AK3A 4LNUA 3ZHVA 4U3JA 1OZ0A 2UXCB 3UCSC 1OHHG 5JJEB 4FM1A 3OM3B 1IBKB 3ZCCA 3CS5A 3CXCU 3E8HA 4MT8A 3G6BA 1NR1A 1VQ8V 4IIJA 4JI7B 4O4LA 2VRZA 2YEVB 3CCVV 3G4SV 2KSDA 2UUBO 3N2GB 1AI7A 4UVCA 5JJNB 2ZM6B 5LGUA 1YF2A 1AR5A 1AJNA 5A2QN 3JAWA 4D7TA 1H2KA 2ZT9B 4DR7O 1OJHA 1GM7A 1Q5OA 5KUMA 4OX9O 3JAKB 3MDSA 5KAFZ 4LFCB 4CS3A 3FB8C 4ZOLA 4RUEA 3SYAA 2QSAA 3ABTA 5A9GA 2OIEA 4LCUC 4J7KA 2DQ0A 2OWOA 3SJAC 2JDIG 3G67A 4UCTA 2R9IA 5D5PA 1Y66A 1HW7A 4B3SO 4JYAB 1BSMA 4G28B 3G6EV 5ITZB 4B3MB 1CPYA 2WA4A 1FXKA 1G1XB 1XNRO 2N05A 2AXTZ 4QPJA 3O9OA 3GWKC 5CBFA 1FKAO 1FYJA 4J80A 4W4LA 1M4UA 2UXXA 5CA1A 4DR3B 1QNMA 5GTIZ 1AR1B 4MS2A 3RYHA 2ATKC 2IBZH 4LNUB 3CMAV 4LF4O 4ASUG 4WFEA 3H1JH 3RYIA 4N21A 3E2EA 1MZEA 1N0NA 4O4LB 1IXBA 4JZGA 4QGPA 1V55B 5CN0A 3OEHG 5LXTA 4YY3O 1WA8A 3OUSA 1S3JA 4UUJC 1KP3A 3JAWB 3VQVA 4WFBV 1HP8A 2CH7A 4GKJB 3B4SA 2QDOA 5B1OA 3KZIZ 2F66C 4MVSA 4DW0A 2BCCH 4A5UB 2G38A 1FAFA 2KG7A 2H94A 3BFRA 3P3PA 4PA6A 1GAXA 3ZJZA 4F6RA 4K8XA 5BR8O 4KHPB 3ZMTA 4L8JA 4I7ZB 4DV5B 2CDYA 1M93A 2ADQB 4NTWA 3SDLA 1Q43A 1FXKB 1YCIA 4JYYA 4TQDA 1FXVA 1KQSU 2XAQA 4NXNB 5IE9A 4I50A 2AHZA 3PJSK 1I94O 3J81N 4DR5B 3G71V 2YIBD 3ZRXA 1FFXA 2IU0A 5CA1B 2QKAA 1ORQC 1GM9A 3RYHB 1IURA 1R73A 3TCUA 2Y0PA 3EXAA 1EZJA 1Y6XA 1X4TA 1N32O 1SETA 1PL0A 4LR3A 2QKCA 2PGGA 5JCOA 5EZYA 3K59A 3PN1A 3T1YB 5LXTB 4KL1A 5KA6A 3OTOO 4R50A 4UVAA 5TISZ 3GB7C 3E35A 1NS1A 2L6LA 4DO2A 2CH7B 2LW7A 4JZ2A 1XILA 5LMUO 4JI6B 4U7NA 1SQXH 3OR6C 4DV0B 2YDEA 2BE3A 2KG7B 2W0XA 2XTAA 4F6RB 2QE7G 4ZHQA 5L3FA 3CD6V 4U3FH 5LGTA 3CCSV 1KECA 2QWRB 4LC1A 2Q67A 4MVQA 2ZR3A 1Z2GA 4I50B 5CB4A 3A0HZ 5H2FZ 3FAVA 5J2UA 1J5EO 2Y69C 1FFXB 2UXCO 4B08A 1IBKO 1G4YB 4AHCA 3QO8A 5BZBA 2VWJA 1NTZH 3BEHA 2UUAO 1SQGA 4JI7O 5GW7A 1K92A 3CRMA 2C2AA 2P22C 2ZM6O 1XREA 2R9RB 5EZYB 1WB8A 1ZL8B 3E83A 4J11A 1GK9A 1VEWA 3TXQA 4BAYA 3DTUB 1KYOF 5H9CA 2HVJC 5F2VO 2W6JG 4BW9A 4LFCO 3IAYA 1EN5A 4I0XA 2EJ7A 4GKKB 1JR9A 4PA4A 1IZ3A 2RNBA 3AG4C 2A79B 1Y4MA 4DV4B 4X88A 2R70A 2Q7EA 4JYAO 4DW1A 3UO2A 3ETQA 1IDSA 3SPJA 2FMLA 1ZLZA 4ZHQB 3JD1A 3QO5A 3BABA 2DOSA 3IGAC 4OPHA 1D5AA 4WFFA 1RM1C 3OGCC 3ZHSA 2A0LA 1K97A 4DR3O 4GUNA 5CB4B 1SZXA 4W4KA 4BWAA 3FAVB 5J2UB 1AI5A 3EFFK 5CBHA 1EN4A 3T1HB 2F93B 1I5XA 3K5LA 3CP1A 2CGNA 1BL8A 3SJBC 4JI0B 4JAUA 3L72H 3ABLB 3K5OA 2BSKA 4ZI7A 1TGOA 2GHYA 1NT2B 1HWYA 2ODMA 3P30A 2BOBC 5KHGA 1VQ5V 4FLVA 4GKJO 4JF3A 1FXHA 3E22B 3THOA 1JX9A 5IT9N 3B8MA 4I0XB 2JGDA 4OGQB 4TSFG 3ZX6A 4TT3G 2YUAA 2E74B 1NI8A 2HEPA 1K4CC 2D2CB 3K06A 1NVPB 3E86A 4KHPO 3K3WA 3WB1A 4DV5O 3NXSA 2QM8A 4JTDB 2XAFA 1YITV 3D8CA 1N4CA 3B8NA 1V54B 1FD9A 2X6BA 4JASA 2RCVA 4DK0A 4DV3B 2EIMB 1WJZA 1V55C 2EIKB 2P90A 5L3DA 3FB6C 2RN9A 4X89A 3ZRWA 4I9QA 1WNSA 4JI1O 3CCEV 3SJQC 3L75H 3UKMA 1NVPD 4X1YA 1IBMB 2BTQB 3GWOA 3VOUA 1QU7A 1I5YA 1YIJV 2XT9A 2DE0X 2P6JA 3N2KA 3ZIAG 4LFAB 4QJFB 3K9SA 2BSKB 4ZI7B 3D3IA 3CCUV 1GRJA 1XHZA 3LDCA 3RYCA 2WAMA 4OPAA 1R3IC 4CC5A 1H2GA 2EIJB 3HPLC 2VQEB 1QLNA 1WPBA 3RT3C 2CAZC 1FXKC 1R6TA 2AW9A 4JI6O 4PDRA 5JQGA 1XDCA 2JGDB 1AJPA 1PP9H 4DV0O 2Q0OC 5LHHA 2WLKA 5L3EA 4O4HA 3BPZA 2OCHA 1XUQA 3K08A 3OW2U 3M99B 3FFQA 3CCLV 5DECA 5LBQA 2HKOA 4MVUA 3NR7A 1PNKA 2M6YA 1SQFA 4O2BA 4MSWC 1DLBA 4IYIA 1H2LA 4J41A 2RQ6A 1GTOA 3TJTA 4FPPA 1XMQO 1VQ6V 3B2EE 3APQA 1PKXA 3ABKB 1H38A 4X62B 2GV9A 1R3KC 2Z3YA 4PDVA 5KX5A 5BY1A 3IJ4A 4MW3A 4B3RB 2PYLA 2OTLV 2JGUA 2X0LA 4PV1B 3STLC 1OCCB 2L35A 4U7OA 5FPOA 2CTRA 3BA9A 1FJGB 2NN4A 1Y76A 1RPOA 3RYCB 2EILB 2AZ2A 4GKKO 1OCRB 5L3BA 2H8PC 5JQGB 3S3WA 1FFTB 2Y69B 3RVYA 4FMTA 4DYLA 2CGOA 5EYPB 2Q5ZA 3CRRA 2JEXA 1JQ0A 3H1LH 1EBOA 4ZBMA 3B77A 2CK3G 3ASNB 2B1GA 4O2BB 1B06A 1JPXA 5L3CA 3K5MA 1VQLV 3L70H 5JCOC 3ZMUA 3ML0A 3FX7A 5EK0A 1K5SA 3WU2Z 2HJDA 3AG3B 2IH1C 4XDLA 2PTMA 1K8AW 4JI5B 2Q7GA 2XUMA 2Q68A
chains in the Genus database with same CATH topology
2UUBO 4DV6O 1J5EO 1HNWO 4JI0O 2UXCO 1XEQA 4LFAO 4GKJO 5FLXN 1IBKO 3O65A 4JI8O 5BR8O 1DK1A 5A2QN 4JI3O 4DUYO 5IT9N 2UUAO 2UXBO 4JI7O 4DR7O 3R66A 4DV2O 4OX9O 4YHHO 5LMNO 3SDLA 2ZM6O 1XMQO 3JAMN 2VQEO 1N36O 4NXMO 1I94O 3T1HO 4KHPO 3J81N 2FKXA 4DUZO 2JRIA 2AGAA 4DV5O 1F7YA 1HNZO 5BY1A 2HHHO 4LFCO 5BXZA 4LF6O 4B3SO 2UXDO 4JI5O 1AILA 2UUCO 1N32O 1N34O 1X59A 3J7AU 4X66O 1G1XB 1XNRO 5H5NA 4JI1O 1IBLO 2Z0AA 1FKAO 1FYJA 4JI2O 1A32A 4JYAO 4B3RO 4DR1O 2ZKOA 4GKKO 4DV3O 3OTOO 4AQYO 2VQFO 1R1BA 2DOSA 1D2DA 1NS1A 4OPHA 4LF4O 1FJGO 4NXNO 2LW7A 4LF5O 1KUQA 2E5LO 4DR5O 4X62O 5LMUO 5IWAO 1IBMO 2UU9O 4DV1O 4DR2O 4LF7O 4DR3O 4JV5O 3J80N 4DV7O 4YY3O 2DJVA 4OPAA 4X65O 4B3TO 3RT3C 4DR6O 4B3MO 2N74A 5LL6Y 2F4VO 4JI6O 1R6TA 1YZBA 1HNXO 4DV0O 4DV4O 4LFBO 4JI4O 1XMOO 3M8AA 4X64O 1HR0O 4LF8O 1N33O 3T1YO 3F5TA 4DR4O 1XNQO 4K0KO 4LF9O 1AB3A 4A5UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB O;  4DV6 O;  1J5E O;  1HNW O;  4JI0 O;  2UXC O;  1XEQ A;  4LFA O;  4GKJ O;  5FLX N;  1IBK O;  3O65 A;  4JI8 O;  5BR8 O;  1DK1 A;  5A2Q N;  4JI3 O;  4DUY O;  5IT9 N;  2UUA O;  2UXB O;  4JI7 O;  4DR7 O;  3R66 A;  4DV2 O;  4OX9 O;  4YHH O;  5LMN O;  3SDL A;  2ZM6 O;  1XMQ O;  3JAM N;  2VQE O;  1N36 O;  4NXM O;  1I94 O;  3T1H O;  4KHP O;  3J81 N;  2FKX A;  4DUZ O;  2JRI A;  2AGA A;  4DV5 O;  1F7Y A;  1HNZ O;  5BY1 A;  2HHH O;  4LFC O;  5BXZ A;  4LF6 O;  4B3S O;  2UXD O;  4JI5 O;  1AIL A;  2UUC O;  1N32 O;  1N34 O;  1X59 A;  3J7A U;  4X66 O;  1G1X B;  1XNR O;  5H5N A;  4JI1 O;  1IBL O;  2Z0A A;  1FKA O;  1FYJ A;  4JI2 O;  1A32 A;  4JYA O;  4B3R O;  4DR1 O;  2ZKO A;  4GKK O;  4DV3 O;  3OTO O;  4AQY O;  2VQF O;  1R1B A;  2DOS A;  1D2D A;  1NS1 A;  4OPH A;  4LF4 O;  1FJG O;  4NXN O;  2LW7 A;  4LF5 O;  1KUQ A;  2E5L O;  4DR5 O;  4X62 O;  5LMU O;  5IWA O;  1IBM O;  2UU9 O;  4DV1 O;  4DR2 O;  4LF7 O;  4DR3 O;  4JV5 O;  3J80 N;  4DV7 O;  4YY3 O;  2DJV A;  4OPA A;  4X65 O;  4B3T O;  3RT3 C;  4DR6 O;  4B3M O;  2N74 A;  5LL6 Y;  2F4V O;  4JI6 O;  1R6T A;  1YZB A;  1HNX O;  4DV0 O;  4DV4 O;  4LFB O;  4JI4 O;  1XMO O;  3M8A A;  4X64 O;  1HR0 O;  4LF8 O;  1N33 O;  3T1Y O;  3F5T A;  4DR4 O;  1XNQ O;  4K0K O;  4LF9 O;  1AB3 A;  4A5U B; 
#chains in the Genus database with same CATH topology
 3KCX A;  2Q0A A;  1JJO A;  2WPD G;  2LO1 A;  4JI0 O;  2JS3 A;  5KX5 B;  2ZE7 A;  1V9P A;  4UCS A;  3CXH F;  1SS3 A;  2R9A A;  2WWW A;  1QR9 A;  2GTA A;  3DC6 A;  4GLX A;  3VBB A;  1IVS A;  3C3T A;  5B1A B;  3T4D A;  1YJ9 V;  2JVD A;  2HVK C;  2IH3 C;  4MTF A;  1Y76 B;  2KKW A;  5H6Q A;  1JJ2 U;  1RM1 B;  2CE4 A;  4WBN A;  2JRI A;  2ZE5 A;  5LP6 A;  3W7U A;  4JGS A;  1NU1 H;  2JEU A;  3A0B Z;  5DN6 G;  1Q6U A;  2PY5 A;  4I55 A;  4AI8 A;  2IJK A;  3J7A U;  5IYZ A;  1KKC A;  2IJJ A;  2YC0 A;  3ZMS A;  1A32 A;  5JJJ B;  3ABL C;  3CSX A;  4DV3 O;  4JV5 B;  4I4T A;  1QVG U;  1O9H A;  1CXZ B;  1VP7 A;  3LSU A;  3RFR A;  1YTF B;  2E5L O;  1WLE A;  1IBM O;  1I0H A;  2LJ2 A;  5E1A C;  4YHH B;  3JD2 A;  3JSN A;  1SQQ H;  4PA7 A;  4FLT A;  4CS2 A;  1IX9 A;  2OT5 A;  2AHY A;  4X1I B;  1RFY A;  4FFK A;  4RO2 A;  1U96 A;  1J95 A;  1R3L C;  2W6I G;  1QQC A;  1YXB A;  5IYC O;  3QNE A;  4YIP A;  5K1P A;  1V54 C;  3LSS A;  1G8M A;  4J7J A;  5LMN B;  4PDM A;  5EBW C;  4WBN B;  2FTK A;  5LP6 B;  2EIM C;  2GBO A;  2EIK C;  3VQX A;  3JAS A;  1EZV H;  5B1B B;  1F23 A;  4UCU A;  4K3A A;  1N8R W;  4PHZ A;  1XL6 A;  4FZ1 A;  4I55 B;  2HHH B;  2XAH A;  4AIL C;  5IYZ B;  3HR0 A;  3I55 V;  5FPR A;  2V4D A;  4TV8 A;  3ZHQ A;  4NXM O;  1QCE A;  1N34 B;  2AGA A;  1NZ6 A;  2PI4 A;  4NVP A;  4I4T B;  1YJN V;  1PM9 A;  1IBL B;  1I08 A;  4H44 B;  3H1I H;  4LP8 A;  1W59 A;  5H6R A;  1S76 D;  5HFM A;  1OV9 A;  2EIJ C;  3TK1 A;  1W0J G;  4P30 A;  3TXS A;  1SKV A;  5KHJ A;  3W7X A;  1QBZ A;  1T5E A;  4NR1 A;  1KD1 W;  2LW1 A;  4B3R O;  1WB7 A;  1R1B A;  2YS8 A;  1BQZ A;  2Q7H A;  3CE2 A;  1P49 A;  4YXW G;  4X65 B;  4G2K A;  5JH7 A;  1FJG O;  4JI8 B;  4WFG A;  1EN6 A;  1XL4 A;  1YEW A;  3OTF A;  4B7E A;  1F4M A;  1ZL8 A;  3FB7 C;  5B3S B;  1NR7 A;  4DR4 B;  3JYC A;  4K0K B;  3JAS B;  3U0Z A;  4RWU A;  4UV9 A;  4CS4 A;  4NB5 A;  2VWK A;  1L1F A;  3ABK C;  2A7W A;  4MVM A;  1VQO V;  4JI3 B;  3OGI B;  2UXB B;  1Q81 W;  4TV8 B;  3A0R A;  4FLU A;  4LF9 O;  1AB3 A;  3APO A;  3CCR V;  4HYO A;  5IJ9 B;  2Y4U A;  3BAA A;  4FIP C;  3OT7 A;  4OXS A;  3O65 A;  1RSO A;  3FKS G;  3U11 A;  2NNU A;  1OCC C;  3HKE B;  4DV2 O;  2EIL C;  5KHH A;  4XBF A;  3ABM B;  5CMU A;  1H2S B;  1WP7 A;  5LOV A;  1OCR C;  4O2A A;  1ENV A;  4LH6 A;  4UFZ A;  1XBL A;  2ADP A;  3SYP A;  2YID A;  1MZF A;  1GM8 A;  3ZRV A;  1K4D C;  1R3J C;  4RQF A;  4RUF A;  2IW5 A;  3RBZ A;  5EC1 C;  2N04 A;  4DR1 B;  2MK3 A;  5JH7 B;  3DC5 A;  1X59 A;  3ASN C;  2CTW A;  2F95 B;  3CWB H;  2D3O W;  3DGE A;  4H37 A;  3OEE G;  3AG3 C;  5CA3 A;  3E22 A;  2ZIN A;  5JVD A;  2XHB A;  1P4R A;  4GX5 A;  1H2M A;  2B5U A;  1EM1 A;  3UT5 A;  1VQ4 V;  3KKY A;  3HKC A;  4KXR A;  4JV5 O;  4BIZ A;  1PNL A;  4JI4 B;  2QJ1 A;  1XMO B;  3ZN0 A;  4BIU A;  1MSD A;  2DJV A;  5E79 Z;  3JAT B;  3SPC A;  3OD4 A;  3ZED A;  1RSO B;  1GH6 A;  3CPW U;  4B3M O;  5B1A C;  3CRA A;  2ARH A;  2ETN A;  4H13 B;  4YJ3 A;  3QVN A;  3W7T A;  3E8B A;  4QE9 A;  1R6N A;  5C93 A;  3SYQ A;  5LOV B;  4O2A B;  2OIG A;  5CBG A;  3M7M X;  1BE3 H;  4CH3 A;  2BTQ A;  1K5Q A;  3JCZ A;  2JK5 C;  3HKD B;  1Q8I A;  2W0F C;  4FM0 A;  4F6E A;  5EC2 C;  1D5N A;  1HNZ B;  1BT8 A;  1YHQ V;  5LMN O;  1F51 A;  2ZIM A;  1H8H G;  3ZBH A;  2VS0 A;  2UXD B;  2UUC B;  3UM7 A;  4DV1 B;  4XDJ A;  2YI8 A;  3SR2 C;  2HHH O;  5JVD B;  1AP5 A;  3K0D A;  4CH4 A;  1N34 O;  3UT5 B;  3X2Q B;  3HKC B;  2XND G;  1SRY A;  1IBL O;  3L73 H;  1XHX A;  3IC7 A;  3JD0 A;  3ICX A;  1BGY H;  5IWA B;  2UU9 B;  4LF7 B;  3T4Z A;  2IM9 A;  2EJR A;  3L71 H;  5J2T A;  1Y67 A;  3CCQ V;  1DGS A;  4DV7 B;  2ZNI A;  4QE7 A;  3EHB B;  2EBO A;  4YJ3 B;  4NXN O;  1KUQ A;  1KC8 W;  4DR6 B;  4DR5 O;  2F4V B;  5LP6 C;  4DR7 B;  3LDE A;  3D36 A;  2OTJ V;  4X64 B;  4PA9 A;  1HR0 B;  2V1D A;  5B1B C;  2QKS A;  4X65 O;  3BA8 A;  1LUW A;  3CB2 A;  4DV6 B;  2N74 A;  3AK1 A;  1ZSP A;  1Q86 W;  2Q69 A;  4R6Z A;  5KHI A;  2RJZ A;  3T1Y O;  1Z5V A;  4DUY B;  4B3S B;  5FL7 G;  2WA3 A;  4DR4 O;  3OE7 G;  4PJ0 Z;  4K0K O;  2EIN B;  2ZR2 A;  3DXR A;  3VQW A;  4PD4 F;  3K58 A;  1XNR B;  3JCU Z;  4HNA B;  3F7V C;  1AVM A;  1M9N A;  1E79 G;  4JI3 O;  2Y4T A;  4DUZ B;  2UXB O;  2NLJ C;  1K33 A;  5KMG A;  1S5L Z;  4D7S A;  2AZ0 A;  5B66 Z;  5EYP A;  4LF6 B;  2Q73 A;  1JFF A;  3I5D A;  2X6C A;  1JCH A;  1VQP V;  1AP6 A;  4O4J A;  3KG2 A;  2F1M A;  1K7D A;  4X66 B;  4EKW A;  5J2T B;  1SF9 A;  1RPR A;  3RGB A;  4HAM A;  2B1I A;  2X6A A;  2XAG A;  2WLL A;  5GON A;  5LHG A;  1YI2 V;  5BMV A;  2Q4P A;  1QLE B;  5B3S C;  1F4N A;  1VF6 A;  3AG1 B;  1BQ0 A;  1GO3 F;  2EUL A;  2ITD C;  3AG7 A;  4JTC B;  3DSQ A;  4DR1 O;  3D3Q A;  3VQY A;  1MNG A;  3IFX A;  3L74 H;  2YXL A;  2EZP A;  1TVK A;  5LA6 A;  4Q20 A;  1BZK A;  5DED A;  5EBL C;  3H01 A;  1XI1 A;  4GYC B;  1LR1 A;  2HFE C;  4R8C A;  3JAL A;  3JAR A;  1NBM G;  3OR7 C;  2PUS A;  3T2M A;  4Q6G A;  3DXR B;  1JA8 A;  3J80 N;  1OCZ B;  5EIB D;  3OMN B;  2ZDI C;  1WPX A;  2E76 B;  3RVZ A;  2V7Q G;  3ABM C;  3CHX A;  4YJ2 A;  1H2N A;  1HNW B;  2XAJ A;  3CYO A;  3P32 A;  4MVR A;  5KMG B;  4DV4 O;  4CH6 A;  4WFA V;  3TGU H;  4JI4 O;  1XMO O;  2QTS A;  4PDL A;  1CP9 A;  5IJ0 A;  3F5T A;  3E8G A;  2CTQ A;  4X20 A;  1JFF B;  3H1K H;  2DN9 A;  1E1Q G;  4O4J B;  1VQ9 V;  1IXM A;  1LNQ A;  3ZHU A;  2YXY A;  3SPH A;  1SQV H;  2XOK G;  4GX1 A;  3HKB B;  2WLL B;  2ZNJ A;  5GON B;  4WFH A;  5BMV B;  1M57 B;  1TA8 A;  4X1K A;  1GKF A;  1K73 W;  1PPJ H;  1K3E A;  1Z5W A;  3W7W A;  4FK5 C;  3T1H O;  1UPG A;  2FKX A;  4J9Y B;  4TV9 A;  2YXH A;  3ETG A;  1WP8 A;  1HNZ O;  4I5S A;  1TVK B;  5LA6 B;  1Q82 W;  4J9Z B;  1L8D A;  4UB8 Z;  2UXD O;  3CEI A;  5KUK A;  2HG5 C;  3ZN1 A;  4X1I A;  2UUC O;  5IYB O;  1VQ7 V;  2VQF B;  5LYJ A;  3LNN A;  2A06 H;  3ZHR A;  3CC4 V;  4FVM A;  3JAL B;  3JAR B;  2P67 A;  4DR2 B;  2ZXW C;  4K8Z A;  4YJ2 B;  3FYI B;  4NKG B;  2ZCE A;  3MD0 A;  3R65 A;  1Q90 D;  5IJ0 B;  2UUA B;  5IWA O;  2UU9 O;  4LF7 O;  1VMG A;  4X20 B;  1HNX B;  2P4V A;  3CME V;  4TUY A;  4LF8 B;  2ZD9 A;  1N33 B;  4DV7 O;  4C7U A;  4MTG A;  1P7B A;  2WSS G;  4DR6 O;  2B9Z A;  1NQT A;  2F4V O;  5LL6 Y;  1YZB A;  4GX0 A;  4FM2 A;  4E4E A;  5LGN A;  2DYR B;  4DK1 A;  1QR8 A;  2Y48 A;  4X64 O;  1HR0 O;  3S3X A;  4GX2 A;  4X1K B;  2WLN A;  2QGN A;  4WCE V;  2YIB A;  3JD3 A;  4DV6 O;  3E8F A;  4TV9 B;  1SER A;  4FLZ A;  1LUV A;  1P84 F;  4LFA O;  3WG7 B;  4KUM A;  4DUY O;  3QO7 A;  4UCO A;  4KFM A;  3X2Q C;  3B09 A;  2P7T C;  4TOI A;  5LYJ B;  1TUE B;  1B6Q A;  1YTF D;  2VQE O;  1AI4 A;  1GN3 A;  4DUZ O;  1B04 A;  4TQF A;  2FB5 A;  3BY6 A;  1OCO B;  4LF6 O;  1CEZ A;  1ZAU A;  4U3J B;  1BS3 A;  1PV0 A;  1US6 A;  1Q6I A;  1PL4 A;  4AQY B;  1NJI W;  1M90 W;  4X66 O;  2EX3 A;  4IIJ B;  2H3O A;  1BMF G;  4TUY B;  4PI0 A;  2ZE8 A;  1DF4 A;  5IJ9 A;  1VIB A;  1W0K G;  4ZIB A;  1YJW V;  3WB2 A;  4QIW F;  2LQT A;  3SJC C;  2A3Q A;  2PF4 E;  1MG1 A;  1NTK H;  3GVM A;  2EIN C;  1VAR A;  1W2B U;  3JD4 A;  3HKE A;  2ZDI A;  1ARO P;  3CX5 F;  4X62 O;  2WLM A;  2QA4 V;  2NR5 A;  4ZOL B;  3IC9 A;  4IT5 A;  1MOF A;  3CJH A;  4LFB B;  3KCY A;  4D6T H;  1N0J A;  2LGW A;  1XNQ B;  2EZO A;  1S5H C;  4I9W A;  1QHT A;  2LFR A;  5AG2 A;  2WLH A;  1MA1 A;  2DWE C;  4ICG A;  1COW G;  1ZTE A;  3M8A A;  1VQM V;  1TUB A;  2ZE6 A;  4CZZ A;  4UXN A;  3B40 A;  3MHH C;  5B1N A;  2F43 G;  2F23 A;  4N23 A;  2QR4 A;  4MVO A;  3K03 A;  1HNW O;  3BCC H;  1EFR G;  1N36 B;  4JI1 B;  1QLE C;  1VQK V;  1TAE A;  3N27 A;  3AG1 C;  3F7Y C;  3D36 C;  4YIO A;  4MVZ A;  1PNM A;  2OCC C;  3MHS C;  3RYI B;  5EIB C;  1VF7 A;  1JVM A;  2LGQ A;  1WAZ A;  5J9P C;  3LSQ A;  2DYS B;  3CRC A;  1WA8 B;  2Q8V A;  2DQ3 A;  3JAT A;  3SPG A;  4BIO A;  1AR4 A;  2QEX V;  1JOY A;  1PD3 A;  3ASO B;  2IU3 A;  1S72 V;  4JI5 O;  1K34 A;  4IYH A;  3K0G A;  2CTP A;  1BCC H;  3OMA B;  1OCZ C;  1SES A;  4J7Z A;  2Z5U A;  4Z2W A;  5LHI A;  5IY5 B;  3QTC A;  2QM4 A;  3CJH B;  4ZKI A;  3CCJ V;  2ZQM A;  2GSM B;  2JIZ G;  1M5I A;  1GMG A;  2QWO B;  2DW4 A;  4JAV A;  3HKD A;  2VQF O;  5IDJ A;  5GTH Z;  1VF5 B;  4EFE A;  1R6K A;  3F5W C;  2P06 A;  1TUB B;  3AG2 B;  4DR2 O;  2GTS A;  4X9Q A;  2HR3 A;  2KB1 A;  4DXW A;  4PI2 A;  3FYE B;  1AI6 A;  1M56 B;  1XMQ B;  4R7C A;  4LBE C;  2QWP B;  3BVO A;  1KKD A;  1M57 C;  4P9P A;  3U10 A;  1VF6 C;  1ROP A;  4E2L A;  3A2F A;  1HNX O;  1NTM H;  3RN4 A;  4LF8 O;  2E75 B;  1N33 O;  3E89 A;  5KAI Z;  3AK2 A;  4ABM A;  4DRX A;  2A9H A;  4P9O A;  4EB6 A;  1Q6H A;  2P4K A;  2E3C A;  2QWN B;  3SGI A;  1GN2 A;  2HP8 A;  5KA5 A;  4CH5 A;  2IJH A;  3C3S A;  5FLX N;  3FB5 C;  1WN7 A;  4X8A A;  4IGG A;  4GZR B;  1FPO A;  2ZXW B;  1URF A;  2Y0I A;  4YHH O;  1Q7Y W;  3HB3 B;  3UO3 A;  1ZWI C;  4PA3 A;  1THZ A;  1E1R G;  2QWQ B;  2KQX A;  2RDC A;  5DM6 V;  2OYQ A;  2O57 A;  4IHJ A;  1FS0 G;  3A8T A;  5BXZ A;  3ZS8 C;  2ZIO A;  4JI2 B;  1YVW A;  1XOU A;  1SZT A;  3OFN G;  1UJW B;  4LWS A;  5IYD O;  1I7F A;  1SA0 A;  2X7R B;  5CA0 A;  4FLX A;  1ZX3 A;  4LF5 B;  3LDD A;  4KP4 A;  4FJC C;  1BHA A;  2PZS A;  3ZHT A;  3ZMZ A;  3W7S A;  2DYR C;  2XAS A;  3RYF A;  4HNA A;  3MAQ A;  1VQN V;  4AQY O;  4P2Z A;  3ZMV A;  3RW0 A;  2GDS A;  4CC6 A;  2WLJ A;  1D2D A;  4BW5 A;  3STZ C;  2PYJ A;  4B3T B;  2DWD C;  3SYO A;  3WFV A;  3H1H H;  3L9D A;  4DRX B;  3WG7 C;  4Z1V A;  4UVB A;  3C90 A;  4NYK A;  4EB6 B;  3K04 A;  4HZ3 A;  3Q4H A;  3K79 A;  3ETD A;  5JWP A;  3UQ8 A;  5FNV A;  2UUB B;  4J10 A;  4LFB O;  4LH7 A;  4EEQ A;  2Q6A A;  1XNQ O;  5KLV H;  1OCO C;  3OUF A;  5K1X A;  4OX9 B;  4Z1M G;  3ETE A;  4H0L B;  1DF5 A;  2RMK B;  1XEQ A;  4IHJ B;  3WB0 A;  4FLY A;  4JI8 O;  3CRQ A;  4MTX A;  3BHP A;  5EBM C;  3SYC A;  4NTY A;  3QF7 A;  4BR6 A;  3R66 A;  1SQP H;  2HJF C;  1G6U A;  1UFI A;  2BTO A;  4LWS B;  5HFL A;  4FLW A;  1SA0 B;  1NKD A;  4RAI A;  3H9V A;  5CA0 B;  3JAM N;  1N36 O;  3EVK A;  5KHK A;  2WLI A;  4JAA A;  2E5L B;  3QG5 A;  1AJQ A;  4QPK A;  1KB9 F;  3SPI A;  3RYF B;  1GN6 A;  4WF9 V;  2UXN A;  2QTO A;  4O4I A;  2ITC C;  3CC7 V;  4FFB A;  1BHB A;  2JS5 A;  1XQ8 A;  2IJI A;  4LF4 B;  3G80 A;  1U97 A;  1Y74 A;  5H5N A;  2Z0A A;  2MW2 B;  3Q4H B;  4F4L A;  2ZKO A;  1KP2 A;  4H33 A;  4MTO A;  5C8Y A;  5FNV B;  2JJ2 G;  1L0L H;  4YY3 B;  1SC5 B;  3LUT B;  1MAB G;  3HKB A;  2R72 A;  1Q3E A;  2LP7 A;  4NTX A;  4EFB A;  2GUZ A;  3FD9 A;  2OCC B;  4FZ0 A;  5L3G A;  3K5N A;  2DMX A;  2YI9 A;  4NXM B;  3CCM V;  1NH2 B;  1S77 D;  2FYU H;  3OAA G;  1RP3 B;  4IL6 Z;  2DYS C;  1MMM A;  5BR8 B;  2M7W A;  3K9A A;  3JSL A;  3ZRW B;  1GN4 A;  1S0V A;  2WLI B;  4PEL A;  4B7K A;  4X1Y B;  2BOC C;  3ASO C;  4GCZ A;  4JTA B;  3ABU A;  4MW8 A;  4L87 A;  1I94 B;  1DK1 A;  2K9P A;  2CUG A;  2Q9L A;  4GT1 A;  3P3N A;  1B3Q A;  3N2K B;  5IY5 C;  4O4I B;  1NH2 D;  2ILM A;  4QNH B;  1YDX A;  2QM7 A;  4TWK A;  1YSC A;  2P5O A;  4FFB B;  3T1C A;  2YEV A;  1Y74 B;  1N32 B;  1HDJ A;  1K9M W;  4RQE A;  1JMK C;  3N2G A;  4JYC A;  1F7Y A;  5C8Y B;  1SQB H;  2JJ1 G;  4K35 A;  2PI5 A;  3K57 A;  1S5J A;  3AG2 C;  1AIL A;  1KMI Z;  4HBN A;  3OTO B;  4O4H B;  3JAK A;  2K1E A;  3TET A;  1DTO A;  1M56 C;  2YIA A;  4UB6 Z;  4CBC A;  2GUZ B;  4JPR A;  1ZUQ A;  4UCR A;  4JI2 O;  2FL4 A;  5LMU B;  3LNM B;  3BRC A;  1L0N H;  4LF9 B;  1MSW D;  2LFS A;  1O9G A;  4UV8 A;  5D5Q A;  1QVF U;  2HLD G;  2YIC A;  1KU9 A;  5ITZ A;  4LF5 O;  2YSU B;  4DV1 O;  3OMI B;  5B5E Z;  4UCV A;  1M1K W;  4XDK A;  4DV2 B;  3AEI A;  3RWR D;  3AG4 B;  3I56 V;  4JYB A;  3ZRS A;  4B3T O;  1KBH A;  1H8E G;  4G27 B;  4J42 A;  3CC2 V;  1J5E B;  1P7G A;  3AK3 A;  4LNU A;  3ZHV A;  4U3J A;  1OZ0 A;  2UXC B;  3UCS C;  1OHH G;  5JJE B;  4FM1 A;  3OM3 B;  1IBK B;  3ZCC A;  3CS5 A;  3CXC U;  3E8H A;  4MT8 A;  3G6B A;  1NR1 A;  1VQ8 V;  4IIJ A;  4JI7 B;  4O4L A;  2VRZ A;  2YEV B;  3CCV V;  3G4S V;  2KSD A;  2UUB O;  3N2G B;  1AI7 A;  4UVC A;  5JJN B;  2ZM6 B;  5LGU A;  1YF2 A;  1AR5 A;  1AJN A;  5A2Q N;  3JAW A;  4D7T A;  1H2K A;  2ZT9 B;  4DR7 O;  1OJH A;  1GM7 A;  1Q5O A;  5KUM A;  4OX9 O;  3JAK B;  3MDS A;  5KAF Z;  4LFC B;  4CS3 A;  3FB8 C;  4ZOL A;  4RUE A;  3SYA A;  2QSA A;  3ABT A;  5A9G A;  2OIE A;  4LCU C;  4J7K A;  2DQ0 A;  2OWO A;  3SJA C;  2JDI G;  3G67 A;  4UCT A;  2R9I A;  5D5P A;  1Y66 A;  1HW7 A;  4B3S O;  4JYA B;  1BSM A;  4G28 B;  3G6E V;  5ITZ B;  4B3M B;  1CPY A;  2WA4 A;  1FXK A;  1G1X B;  1XNR O;  2N05 A;  2AXT Z;  4QPJ A;  3O9O A;  3GWK C;  5CBF A;  1FKA O;  1FYJ A;  4J80 A;  4W4L A;  1M4U A;  2UXX A;  5CA1 A;  4DR3 B;  1QNM A;  5GTI Z;  1AR1 B;  4MS2 A;  3RYH A;  2ATK C;  2IBZ H;  4LNU B;  3CMA V;  4LF4 O;  4ASU G;  4WFE A;  3H1J H;  3RYI A;  4N21 A;  3E2E A;  1MZE A;  1N0N A;  4O4L B;  1IXB A;  4JZG A;  4QGP A;  1V55 B;  5CN0 A;  3OEH G;  5LXT A;  4YY3 O;  1WA8 A;  3OUS A;  1S3J A;  4UUJ C;  1KP3 A;  3JAW B;  3VQV A;  4WFB V;  1HP8 A;  2CH7 A;  4GKJ B;  3B4S A;  2QDO A;  5B1O A;  3KZI Z;  2F66 C;  4MVS A;  4DW0 A;  2BCC H;  4A5U B;  2G38 A;  1FAF A;  2KG7 A;  2H94 A;  3BFR A;  3P3P A;  4PA6 A;  1GAX A;  3ZJZ A;  4F6R A;  4K8X A;  5BR8 O;  4KHP B;  3ZMT A;  4L8J A;  4I7Z B;  4DV5 B;  2CDY A;  1M93 A;  2ADQ B;  4NTW A;  3SDL A;  1Q43 A;  1FXK B;  1YCI A;  4JYY A;  4TQD A;  1FXV A;  1KQS U;  2XAQ A;  4NXN B;  5IE9 A;  4I50 A;  2AHZ A;  3PJS K;  1I94 O;  3J81 N;  4DR5 B;  3G71 V;  2YIB D;  3ZRX A;  1FFX A;  2IU0 A;  5CA1 B;  2QKA A;  1ORQ C;  1GM9 A;  3RYH B;  1IUR A;  1R73 A;  3TCU A;  2Y0P A;  3EXA A;  1EZJ A;  1Y6X A;  1X4T A;  1N32 O;  1SET A;  1PL0 A;  4LR3 A;  2QKC A;  2PGG A;  5JCO A;  5EZY A;  3K59 A;  3PN1 A;  3T1Y B;  5LXT B;  4KL1 A;  5KA6 A;  3OTO O;  4R50 A;  4UVA A;  5TIS Z;  3GB7 C;  3E35 A;  1NS1 A;  2L6L A;  4DO2 A;  2CH7 B;  2LW7 A;  4JZ2 A;  1XIL A;  5LMU O;  4JI6 B;  4U7N A;  1SQX H;  3OR6 C;  4DV0 B;  2YDE A;  2BE3 A;  2KG7 B;  2W0X A;  2XTA A;  4F6R B;  2QE7 G;  4ZHQ A;  5L3F A;  3CD6 V;  4U3F H;  5LGT A;  3CCS V;  1KEC A;  2QWR B;  4LC1 A;  2Q67 A;  4MVQ A;  2ZR3 A;  1Z2G A;  4I50 B;  5CB4 A;  3A0H Z;  5H2F Z;  3FAV A;  5J2U A;  1J5E O;  2Y69 C;  1FFX B;  2UXC O;  4B08 A;  1IBK O;  1G4Y B;  4AHC A;  3QO8 A;  5BZB A;  2VWJ A;  1NTZ H;  3BEH A;  2UUA O;  1SQG A;  4JI7 O;  5GW7 A;  1K92 A;  3CRM A;  2C2A A;  2P22 C;  2ZM6 O;  1XRE A;  2R9R B;  5EZY B;  1WB8 A;  1ZL8 B;  3E83 A;  4J11 A;  1GK9 A;  1VEW A;  3TXQ A;  4BAY A;  3DTU B;  1KYO F;  5H9C A;  2HVJ C;  5F2V O;  2W6J G;  4BW9 A;  4LFC O;  3IAY A;  1EN5 A;  4I0X A;  2EJ7 A;  4GKK B;  1JR9 A;  4PA4 A;  1IZ3 A;  2RNB A;  3AG4 C;  2A79 B;  1Y4M A;  4DV4 B;  4X88 A;  2R70 A;  2Q7E A;  4JYA O;  4DW1 A;  3UO2 A;  3ETQ A;  1IDS A;  3SPJ A;  2FML A;  1ZLZ A;  4ZHQ B;  3JD1 A;  3QO5 A;  3BAB A;  2DOS A;  3IGA C;  4OPH A;  1D5A A;  4WFF A;  1RM1 C;  3OGC C;  3ZHS A;  2A0L A;  1K97 A;  4DR3 O;  4GUN A;  5CB4 B;  1SZX A;  4W4K A;  4BWA A;  3FAV B;  5J2U B;  1AI5 A;  3EFF K;  5CBH A;  1EN4 A;  3T1H B;  2F93 B;  1I5X A;  3K5L A;  3CP1 A;  2CGN A;  1BL8 A;  3SJB C;  4JI0 B;  4JAU A;  3L72 H;  3ABL B;  3K5O A;  2BSK A;  4ZI7 A;  1TGO A;  2GHY A;  1NT2 B;  1HWY A;  2ODM A;  3P30 A;  2BOB C;  5KHG A;  1VQ5 V;  4FLV A;  4GKJ O;  4JF3 A;  1FXH A;  3E22 B;  3THO A;  1JX9 A;  5IT9 N;  3B8M A;  4I0X B;  2JGD A;  4OGQ B;  4TSF G;  3ZX6 A;  4TT3 G;  2YUA A;  2E74 B;  1NI8 A;  2HEP A;  1K4C C;  2D2C B;  3K06 A;  1NVP B;  3E86 A;  4KHP O;  3K3W A;  3WB1 A;  4DV5 O;  3NXS A;  2QM8 A;  4JTD B;  2XAF A;  1YIT V;  3D8C A;  1N4C A;  3B8N A;  1V54 B;  1FD9 A;  2X6B A;  4JAS A;  2RCV A;  4DK0 A;  4DV3 B;  2EIM B;  1WJZ A;  1V55 C;  2EIK B;  2P90 A;  5L3D A;  3FB6 C;  2RN9 A;  4X89 A;  3ZRW A;  4I9Q A;  1WNS A;  4JI1 O;  3CCE V;  3SJQ C;  3L75 H;  3UKM A;  1NVP D;  4X1Y A;  1IBM B;  2BTQ B;  3GWO A;  3VOU A;  1QU7 A;  1I5Y A;  1YIJ V;  2XT9 A;  2DE0 X;  2P6J A;  3N2K A;  3ZIA G;  4LFA B;  4QJF B;  3K9S A;  2BSK B;  4ZI7 B;  3D3I A;  3CCU V;  1GRJ A;  1XHZ A;  3LDC A;  3RYC A;  2WAM A;  4OPA A;  1R3I C;  4CC5 A;  1H2G A;  2EIJ B;  3HPL C;  2VQE B;  1QLN A;  1WPB A;  3RT3 C;  2CAZ C;  1FXK C;  1R6T A;  2AW9 A;  4JI6 O;  4PDR A;  5JQG A;  1XDC A;  2JGD B;  1AJP A;  1PP9 H;  4DV0 O;  2Q0O C;  5LHH A;  2WLK A;  5L3E A;  4O4H A;  3BPZ A;  2OCH A;  1XUQ A;  3K08 A;  3OW2 U;  3M99 B;  3FFQ A;  3CCL V;  5DEC A;  5LBQ A;  2HKO A;  4MVU A;  3NR7 A;  1PNK A;  2M6Y A;  1SQF A;  4O2B A;  4MSW C;  1DLB A;  4IYI A;  1H2L A;  4J41 A;  2RQ6 A;  1GTO A;  3TJT A;  4FPP A;  1XMQ O;  1VQ6 V;  3B2E E;  3APQ A;  1PKX A;  3ABK B;  1H38 A;  4X62 B;  2GV9 A;  1R3K C;  2Z3Y A;  4PDV A;  5KX5 A;  5BY1 A;  3IJ4 A;  4MW3 A;  4B3R B;  2PYL A;  2OTL V;  2JGU A;  2X0L A;  4PV1 B;  3STL C;  1OCC B;  2L35 A;  4U7O A;  5FPO A;  2CTR A;  3BA9 A;  1FJG B;  2NN4 A;  1Y76 A;  1RPO A;  3RYC B;  2EIL B;  2AZ2 A;  4GKK O;  1OCR B;  5L3B A;  2H8P C;  5JQG B;  3S3W A;  1FFT B;  2Y69 B;  3RVY A;  4FMT A;  4DYL A;  2CGO A;  5EYP B;  2Q5Z A;  3CRR A;  2JEX A;  1JQ0 A;  3H1L H;  1EBO A;  4ZBM A;  3B77 A;  2CK3 G;  3ASN B;  2B1G A;  4O2B B;  1B06 A;  1JPX A;  5L3C A;  3K5M A;  1VQL V;  3L70 H;  5JCO C;  3ZMU A;  3ML0 A;  3FX7 A;  5EK0 A;  1K5S A;  3WU2 Z;  2HJD A;  3AG3 B;  2IH1 C;  4XDL A;  2PTM A;  1K8A W;  4JI5 B;  2Q7G A;  2XUM A;  2Q68 A; 
#chains in the Genus database with same CATH homology
 2UUB O;  4DV6 O;  1J5E O;  1HNW O;  4JI0 O;  2UXC O;  1XEQ A;  4LFA O;  4GKJ O;  5FLX N;  1IBK O;  3O65 A;  4JI8 O;  5BR8 O;  1DK1 A;  5A2Q N;  4JI3 O;  4DUY O;  5IT9 N;  2UUA O;  2UXB O;  4JI7 O;  4DR7 O;  3R66 A;  4DV2 O;  4OX9 O;  4YHH O;  5LMN O;  3SDL A;  2ZM6 O;  1XMQ O;  3JAM N;  2VQE O;  1N36 O;  4NXM O;  1I94 O;  3T1H O;  4KHP O;  3J81 N;  2FKX A;  4DUZ O;  2JRI A;  2AGA A;  4DV5 O;  1F7Y A;  1HNZ O;  5BY1 A;  2HHH O;  4LFC O;  5BXZ A;  4LF6 O;  4B3S O;  2UXD O;  4JI5 O;  1AIL A;  2UUC O;  1N32 O;  1N34 O;  1X59 A;  3J7A U;  4X66 O;  1G1X B;  1XNR O;  5H5N A;  4JI1 O;  1IBL O;  2Z0A A;  1FKA O;  1FYJ A;  4JI2 O;  1A32 A;  4JYA O;  4B3R O;  4DR1 O;  2ZKO A;  4GKK O;  4DV3 O;  3OTO O;  4AQY O;  2VQF O;  1R1B A;  2DOS A;  1D2D A;  1NS1 A;  4OPH A;  4LF4 O;  1FJG O;  4NXN O;  2LW7 A;  4LF5 O;  1KUQ A;  2E5L O;  4DR5 O;  4X62 O;  5LMU O;  5IWA O;  1IBM O;  2UU9 O;  4DV1 O;  4DR2 O;  4LF7 O;  4DR3 O;  4JV5 O;  3J80 N;  4DV7 O;  4YY3 O;  2DJV A;  4OPA A;  4X65 O;  4B3T O;  3RT3 C;  4DR6 O;  4B3M O;  2N74 A;  5LL6 Y;  2F4V O;  4JI6 O;  1R6T A;  1YZB A;  1HNX O;  4DV0 O;  4DV4 O;  4LFB O;  4JI4 O;  1XMO O;  3M8A A;  4X64 O;  1HR0 O;  4LF8 O;  1N33 O;  3T1Y O;  3F5T A;  4DR4 O;  1XNQ O;  4K0K O;  4LF9 O;  1AB3 A;  4A5U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...