4GKKO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4gkkO00
5IT9N 4X62O 4X66O 1R6TA 3OTOO 4DV2O 3SDLA 4DV7O 4YY3O 3J7AU 1IBLO 4GKJO 1R1BA 4JI7O 3J80N 1AILA 4DV1O 2FKXA 1FKAO 1FJGO 1F7YA 5LL6Y 1X59A 4K0KO 4B3TO 4X64O 4JI1O 1HNZO 3RT3C 4DV0O 1XEQA 1N34O 4B3RO 2ZM6O 2UXDO 3T1HO 4B3MO 5BY1A 4B3SO 3JAMN 5IWAO 4LF4O 4DR6O 2DJVA 1N33O 2UUAO 5LMUO 5A2QN 4X65O 4OPHA 1YZBA 2LW7A 4JI3O 4YHHO 2F4VO 1N36O 4GKKO 4DUZO 1DK1A 4JI2O 3F5TA 3O65A 1XMOO 2UU9O 1N32O 4OX9O 4LFCO 1AB3A 4DUYO 2JRIA 4OPAA 1A32A 1HR0O 3T1YO 4KHPO 4DV5O 3J81N 2UUBO 1HNXO 4JI6O 1KUQA 1IBMO 5LMNO 2DOSA 4DR7O 1XNQO 2E5LO 4JI0O 5FLXN 5BXZA 2UXCO 4NXMO 1I94O 3R66A 1NS1A 4LF6O 4JV5O 4LF8O 4DV6O 4JI4O 5H5NA 1XNRO 5BR8O 2VQEO 4DR2O 4NXNO 1G1XB 4DR3O 4DR4O 2UUCO 2ZKOA 1D2DA 2UXBO 1FYJA 2AGAA 4DR1O 4JI8O 2N74A 4AQYO 4LF5O 4LFBO 1HNWO 4DR5O 4LF7O 1XMQO 2HHHO 4JI5O 4LF9O 3M8AA 4LFAO 4DV3O 1IBKO 4JYAO 2VQFO 2Z0AA 1J5EO 4DV4O 4A5UB
chains in the Genus database with same CATH superfamily
1Q43A 3K79A 2DMXA 2JS3A 4XBFA 3EFFK 2QKSA 1OJHA 1JMKC 5H9CA 3J80N 3SYAA 1RP3B 2CAZC 3ZHSA 1EN5A 2R72A 3L72H 1F7YA 1Q81W 1NZ6A 3FAVB 4PHZA 4R8CA 2X6BA 4DV3B 1OCZB 1NR1A 2BE3A 2P90A 4MVOA 2PZSA 4O4HB 5CBFA 5BY1A 1FXVA 1JCHA 1AR4A 2HKOA 4ZBMA 4F6RB 1XHXA 3FB6C 1N33O 4ZI7B 3UCSC 1N33B 4O4LB 4F4LA 1H2GA 1TUBA 4B08A 4DRXA 3WG7C 1H2SB 1SA0A 4QE7A 5LHIA 2QE7G 2OCCC 2JRIA 4KL1A 3AG1C 1NBMG 5IYZB 4UCUA 1JR9A 1XNQO 4DR7O 2BSKA 5IWAB 4HZ3A 4IHJA 3L73H 3WB1A 2KG7A 4LF6O 4JV5O 5AG2A 2BTOA 2Y69C 5KMGB 4K8ZA 3QVNA 2F4VB 3N2GB 1R3LC 1DF4A 2GTSA 2D2CB 3UKMA 4IT5A 1AP6A 3CX5F 5F2VO 3F7YC 2A0LA 3KG2A 2K9PA 5GW7A 4PA9A 2YXYA 2GBOA 4RQEA 4DR5O 3H1IH 1JPXA 2V1DA 5EC2C 4LF9O 3A2FA 5B1OA 1NQTA 4DK1A 2ZNIA 1O9GA 5JH7B 2JK5C 4I5SA 1H8HG 4EKWA 5BR8B 4DR2B 2V4DA 3JCUZ 1GN3A 4UFZA 1W0KG 4QPJA 4CZZA 2OCHA 4DV7O 4JYCA 4GX5A 2P4VA 4ZOLB 4DV1O 2QR4A 5CA3A 4DV1B 1WA8B 1W0JG 3RYCB 3BPZA 1MZFA 4I0XB 1SS3A 3SPIA 2ZR3A 3MDSA 4B3RO 2A79B 4X88A 4BR6A 4B3RB 4X20A 1URFA 2HR3A 1AROP 1YTFB 1VQOV 3BABA 3SJCC 4YY3B 2YEVA 1G8MA 3DTUB 1K4DC 1FXKA 4GZRB 1Q5OA 3RYIB 3CRMA 2JJ1G 3E8GA 4NTXA 4LWSB 2YIDA 2QTOA 1IXMA 1WPBA 3WG7B 5LP6C 2ZDIC 4R50A 2RDCA 3GWKC 2OCCB 1I5XA 1F4MA 3VBBA 1M4UA 2PI5A 1MA1A 2BOCC 1ZL8B 1PNKA 1I94O 1OV9A 1AR5A 4I50B 4EB6B 3KKYA 3CCRV 5LA6A 1VQ5V 1Z5VA 3H9VA 4JI4O 2JJ2G 2Q5ZA 1YI2V 1G1XB 5IYDO 1AVMA 2UUCO 5LGNA 3VQVA 2QWPB 4R7CA 1SZXA 3TCUA 3K5NA 1SQQH 5EYPA 4CH6A 1GAXA 2ODMA 1XDCA 4BW9A 2RNBA 3K58A 4LF7O 2HHHO 2LGWA 4LF7B 2WLHA 2ZIMA 2HHHB 1VEWA 3SJQC 4JYAO 2YS8A 2LW1A 4JYAB 5IJ9B 1J5EO 2ZCEA 3OEHG 4A5UB 4QE9A 3E8BA 1J5EB 4R6ZA 3RYFB 3K59A 4X62O 4FPPA 3OAAG 4CBCA 2OTLV 1YTFD 1MZEA 2A7WA 1MMMA 2ZIOA 1MG1A 1VF6C 3E83A 2P06A 3CC4V 1VQNV 4U3JB 2WWWA 3IAYA 3AG7A 2QGNA 1KMIZ 4WFBV 1RPOA 1DTOA 2EINC 2PI4A 1FS0G 3W7XA 3JD4A 4I7ZB 4FZ1A 1WP7A 5B66Z 3OUSA 2FMLA 3SR2C 2QWOB 1Z2GA 3RFRA 1VF5B 2KQXA 3LSQA 2M6YA 4UVAA 1MOFA 2YXHA 3CJHA 1WN7A 1AJQA 3FKSG 3KCYA 3NXSA 3EXAA 5FL7G 2IJHA 5CMUA 2GDSA 2JVDA 3JAKA 1K4CC 1WP8A 3F5TA 2EBOA 2Q67A 3UO2A 2YI9A 4OX9O 2ARHA 2Y0PA 5JJNB 4FFKA 2X6CA 3FFQA 1EM1A 1QNMA 1M90W 2CTRA 4B3MB 3AK2A 3HKBB 3OGIB 5LP6B 3C90A 4FM1A 4MTXA 5KA5A 3JD3A 4PA7A 4O4IB 4MSWC 5B1AC 4NXNO 1VF7A 4NXNB 3A8TA 2ZKOA 1D2DA 1OCOC 4KFMA 3JARB 3UO3A 1IXBA 5EK0A 5D5QA 5CBGA 4N21A 5B1NA 1TUEB 2CGNA 2FB5A 1XMQO 3BAAA 4H37A 1T5EA 2QWRB 3LNNA 2FTKA 1P7GA 2N05A 3QNEA 2Q4PA 1AI5A 1VQKV 2IJIA 3ZMZA 2IW5A 3K3WA 2QDOA 2QM8A 4FVMA 4RUEA 5CBHA 4K0KO 2PYJA 4X64O 2Q0AA 2WLKA 4RUFA 3CC7V 5JQGA 4ABMA 2YUAA 3ASNC 2EINB 3ZRSA 3ZRVA 3LDCA 5EZYB 3RGBA 2X7RB 4LF4O 1HWYA 3UQ8A 2DJVA 1B06A 4GKJB 1X4TA 4YHHO 2IJKA 3P30A 2RMKB 5CA1B 1DK1A 2Q7HA 4OPAA 1V54B 4FIPC 1YJNV 1P49A 2QSAA 1PL4A 2ZE5A 3B8MA 3K5LA 1VIBA 3U0ZA 3ICXA 5BMVA 2WLMA 4CH5A 2OWOA 5D5PA 1CXZB 4O4HA 3R66A 4XDLA 3H1JH 2E76B 3F5WC 5KA6A 3G71V 1BQ0A 4JZ2A 4BIUA 1KP3A 5IYCO 3QTCA 3I56V 5L3EA 1L1FA 4BIZA 3SYOA 1SESA 4ZI7A 1XNRO 4IIJB 5J9PC 3AK3A 4O4LA 1XNRB 4LFCB 5B1AB 4DR1O 1VQ4V 4DR1B 1HR0B 3X2QC 1SETA 1Q6HA 4J7ZA 1US6A 1V55C 1VQ8V 4Z2WA 4LFAO 3L9DA 4Z1MG 5IYZA 4X1YB 4LFAB 5L3DA 3MD0A 1AJPA 1M5IA 3RWRD 3CRRA 4DR3B 3C3TA 4UCSA 1ENVA 5KMGA 4DV2O 1HDJA 3N2GA 1I7FA 3OMAB 3ZHRA 1Q7YW 2G38A 1HNWB 1DGSA 4JI5B 1FFXB 4TV8B 3JATB 2VWJA 1Y76B 2V7QG 1TVKB 4IYIA 2L35A 3HKDB 4BW5A 4DV4B 2PYLA 1S3JA 5JH7A 2RN9A 4LC1A 2ATKC 3BRCA 3ASNB 4FLZA 2CK3G 4I4TB 1VARA 3LNMB 1BQZA 1ORQC 4RQFA 3HKCB 2R9AA 3JD1A 1FJGB 2GUZB 4PA6A 3LDEA 3BY6A 2QKAA 1S5JA 1KKDA 3RYCA 1BZKA 1K33A 3JSNA 1SQVH 2UXDB 4I0XA 1WJZA 1XREA 3CRAA 4E2LA 1QLEC 3CRQA 4J7JA 2UXCO 3AG4C 4LH7A 3RN4A 4YJ2B 4AHCA 2GV9A 1CP9A 2QJ1A 2EIKC 2CTWA 3T1CA 2GHYA 5LHHA 3K0DA 1N36B 4FLUA 3OGCC 2HEPA 4WFEA 3RYIA 2Y48A 4PD4F 3N2KB 1BE3H 4LWSA 1YITV 4KHPB 4TT3G 2MW2B 4C7UA 3CCQV 5K1XA 4Q20A 4AILC 1IBKO 3OT7A 1Y74B 5KAFZ 1IBKB 2LFSA 2WLIB 4JAVA 1S0VA 3APQA 3CB2A 1KBHA 1P7BA 1ZL8A 5IJ0B 4O2BA 3VQWA 4I50A 2YIBA 2VRZA 3H01A 1XL4A 3OR6C 4X66O 3OEEG 3D3QA 1RSOA 1BHBA 3SDLA 1IBLO 1R1BA 2NNUA 1IBLB 2LGQA 4WBNB 1K5SA 3ABLC 3GB7C 3IJ4A 5KHJA 1Q90D 1JJ2U 1L0LH 3QG5A 4JYYA 3RVYA 4IGGA 3B77A 2VQFB 4W4KA 3E8FA 4WFFA 1SERA 5CB4B 4D7TA 3AK1A 2F23A 1AI6A 1Y66A 4J10A 2ITDC 1OCRC 4JGSA 2UUAO 1LR1A 1LUWA 2Z5UA 4JI3O 4FLXA 4JF3A 4H44B 3QF7A 1R3KC 1L0NH 3K04A 2UU9O 3ETQA 4U3JA 2UU9B 4ZKIA 1A32A 4K3AA 3T1YO 3T2MA 2ADPA 1ZWIC 1I0HA 4JI6O 4JI6B 3CCMV 1TA8A 4GX0A 4NXMO 2EX3A 4MVMA 1FXHA 2LO1A 2M7WA 1QLEB 3K06A 4FFBB 3AG4B 4G2KA 3TK1A 1R3IC 5KAIZ 2VQEO 1JQ0A 3QO8A 3B40A 1YIJV 2EIKB 2YIAA 5IE9A 4LR3A 1NTZH 5IY5C 4DR7B 1XNQB 4LNUB 2HJFC 3M8AA 2XUMA 2BOBC 5CA0B 2ITCC 1K9MW 4LF6B 2PGGA 4JV5B 1OCCC 3HKBA 5KX5B 1IZ3A 5LP6A 3E2EA 4YIPA 2ZDIA 2RJZA 2JGDB 4L8JA 3G67A 5L3GA 4J80A 1S5LZ 4O4IA 4H13B 5L3CA 1O9HA 2O57A 1UPGA 5JVDB 1ZUQA 1H8EG 4HBNA 5TISZ 3OMNB 4FMTA 3KZIZ 4DR5B 2QKCA 1R3JC 3JARA 2EJ7A 4LF9B 4B3TO 5JWPA 4Q6GA 1ZX3A 2CE4A 2XTAA 3ASOB 4HAMA 1N34O 2P5OA 3S3XA 1D5NA 3T1HO 3M99B 2XASA 1GH6A 4E4EA 1QBZA 1JOYA 4DV7B 4TQFA 2P67A 1JA8A 2XNDG 2DN9A 1OCRB 4X8AA 5KLVH 2OIGA 4P9PA 4JI2O 1AB3A 1IX9A 1N4CA 4UCTA 4U3FH 3MHSC 2AHZA 3AEIA 3I55V 4FZ0A 3ZHQA 1YXBA 2QA4V 1NS1A 2EIMC 2EZOA 2R9RB 5EZYA 4GLXA 1N8RW 4L87A 4IL6Z 1YF2A 3CMEV 4WCEV 3OR7C 1LNQA 3MHHC 2Q0OC 2XAHA 3ETGA 4FM0A 4LF5O 3F7VC 2B1GA 3HR0A 3TETA 5CA1A 1WAZA 4LF5B 5LGTA 3A0HZ 2XAFA 3ZN1A 5H6RA 2AHYA 3E35A 4H0LB 3AG1B 5IYBO 1JJOA 1H2KA 5GONB 1I94B 4CS2A 4EFEA 1R6KA 5IY5B 2PTMA 3STZC 3TGUH 3RW0A 1YJ9V 2W0XA 5IT9N 2CTQA 4JI4B 1VQ6V 2Y69B 4TV9A 2UUCB 1R6TA 1F51A 3BA8A 4OXSA 2WPDG 4IIJA 2FKXA 1PKXA 1W59A 2DQ0A 5ITZB 2PUSA 2W6JG 3Q4HB 1X59A 3WB0A 3D36A 4JI1O 3UM7A 2Q8VA 2X0LA 2DW4A 4JI1B 2DQ3A 2IU3A 4O4JB 4X89A 4X1YA 3W7UA 4DR6O 4X62B 2HVKC 4I55B 5LMUO 4JYBA 3ML0A 3H1KH 5LMUB 1PM9A 2UXXA 3QO7A 1VQLV 2F66C 1FPOA 5KHHA 1NTKH 5JCOA 1XMOO 1GTOA 3K0GA 1WB8A 1YHQV 1N32O 5LBQA 1N32B 3JD2A 3JALA 2IBZH 1YJWV 1FFXA 3H1HH 4J9ZB 3JATA 3JSLA 4XDJA 1Y76A 2XAGA 3W7TA 5LMNO 1VQ9V 1TVKA 1FD9A 4ASUG 4KXRA 1ZSPA 3HKDA 5LXTB 2WLJA 4TQDA 4G28B 1KYOF 2XT9A 1Q6UA 2F95B 4NB5A 4I4TA 3ABMC 2X6AA 4MVZA 4OX9B 2CGOA 4WFAV 3HKCA 4PELA 2GUZA 3SGIA 3VOUA 1S76D 1ZTEA 4UV8A 1E1QG 4QNHB 3K5MA 3GVMA 1E1RG 2A3QA 2BSKB 3TXSA 4IYHA 2KG7B 2Y4TA 4MVUA 3CS5A 4YJ2A 1P84F 2HG5C 2NN4A 3LSUA 2ZR2A 4PDMA 1BHAA 2P6JA 3T4ZA 3M7MX 1ZLZA 1FKAO 4FLTA 3IFXA 1XMQB 2XOKG 3N2KA 4PDVA 4I9WA 2E3CA 1M1KW 1CPYA 1JVMA 2WLIA 3UT5B 1M93A 2B5UA 5IJ0A 3K9AA 4J7KA 1F4NA 3D3IA 1OHHG 4UCOA 1EZJA 4UB6Z 4J9YB 4K0KB 4FLYA 5IDJA 2B1IA 1VP7A 4X64B 3ZIAG 1S5HC 3HKEB 1OZ0A 1EN4A 4MTFA 3K9SA 1ZAUA 4JZGA 2OIEA 2OTJV 4DV5O 3DC5A 4JI0O 2LP7A 4LF4B 1K97A 2R70A 4DK0A 3ZMSA 2IM9A 1B6QA 4X20B 4DYLA 4NVPA 2MK3A 3AG2C 1EN6A 1K73W 4YHHB 1J95A 3E86A 2WLNA 4RWUA 3CCVV 1H2NA 3OW2U 4DR4O 1EFRG 4TUYB 4RO2A 4DR4B 2ZXWC 3OMIB 4JI8O 5KUMA 2KKWA 3ABMB 3FAVA 4CC6A 2ILMA 2EILC 4HNAB 3ABKC 1K3EA 3OM3B 2EIJC 5DM6V 4F6RA 1XHZA 3W7WA 5LA6B 3FX7A 4FFBA 1S72V 4CC5A 1K34A 1KC8W 2BTQB 1DLBA 3J7AU 3LSSA 1PP9H 1K8AW 1FAFA 1OCOB 3ETEA 5J2UB 1NTMH 3ETDA 2P22C 1XI1A 1RM1C 1SQBH 3CHXA 3RT3C 1XEQA 4GX2A 4DV0O 3U11A 2ZM6O 2ZM6B 2WLLB 4YJ3B 4PA4A 1E79G 5CA0A 3U10A 5KX5A 4PV1B 4DV2B 2QWNB 2JGDA 3ABTA 3D8CA 4GKKO 3C3SA 2DE0X 4GKKB 5LOVB 3HB3B 5JVDA 2QM4A 1WNSA 1H38A 2BCCH 2IU0A 2EULA 5LGUA 5EBLC 2QEXV 3WFVA 1KUQA 1MSDA 3CRCA 4GYCB 5GTIZ 2Q7EA 4AI8A 4LF8O 2QTSA 4DV6O 5FNVB 3ZHTA 2QWQB 3AG2B 4ZOLA 1Q8IA 3SJAC 2UXBO 1Q3EA 5FPRA 1PPJH 1WA8A 3ZN0A 2UXBB 4AQYO 4LFBO 4AQYB 3CE2A 3RVZA 4LFBB 2JIZG 2ZXWB 3T4DA 1QVFU 1OCZC 2Q68A 2UXCB 3RYHB 1SQPH 2Q73A 3IGAC 3E8HA 5A9GA 3WU2Z 3CCUV 4FK5C 1VMGA 3ABKB 3ZRWB 1F23A 3THOA 3BCCH 3VQYA 5DEDA 2EIJB 1KB9F 3G6EV 3ABUA 2DYSC 1H2MA 2EJRA 2CH7B 4JI7O 2Q7GA 2PY5A 4BWAA 1TAEA 1EZVH 1BT8A 2CUGA 1HW7A 2PF4E 3X2QB 1GK9A 2WAMA 1SKVA 2DWDC 1V55B 1L8DA 3SPCA 3FB8C 1Y4MA 5GONA 4EB6A 3FB5C 3DSQA 3JAMN 5BZBA 4X66B 5KUKA 2Q6AA 1VQ7V 2KSDA 3JD0A 2LW7A 3L74H 3SJBC 5K1PA 4WFGA 2VWKA 4DUZO 4JAUA 2XAQA 3CYOA 1RPRA 4D6TH 1K7DA 2NLJC 4DUYO 4J41A 2AXTZ 3Q4HA 1NH2B 1NKDA 3G6BA 3CPWU 3DXRB 5FLXN 2E75B 5IJ9A 3B2EE 2ZNJA 1IVSA 2UUAB 3RYFA 4O4JA 4JI3B 3APOA 3B09A 3G4SV 3ZS8C 1KD1W 4I55A 2EZPA 4KP4A 5L3BA 4NTYA 4LCUC 1NVPB 2N74A 3ZCCA 3T1YB 5J2TB 1PL0A 1XL6A 3JASB 5HFMA 1HP8A 4NXMB 2LQTA 4DV3O 3N27A 1IURA 4PJ0Z 5BMVB 4XDKA 4TSFG 1QLNA 3E22B 2ETNA 3SPJA 5LXTA 4FM2A 4HYOA 2VQEB 1YEWA 2R9IA 4UB8Z 3ZEDA 3ZX6A 1QCEA 1LUVA 3ZMTA 1BGYH 4CH4A 1QU7A 3CP1A 1AILA 4TOIA 1PD3A 2YC0A 1Q82W 2DYSB 1N0JA 4X1KB 2HP8A 4MTOA 1VQPV 4X1IB 3CWBH 5DN6G 4GT1A 4QJFB 1GN6A 1NH2D 5IWAO 1XUQA 3SPGA 2ZD9A 3IC7A 4JTDB 1Y6XA 1BCCH 2FL4A 1WPXA 2F4VO 1Q86W 1SRYA 1NU1H 3O65A 1U96A 4U7NA 3ABLB 1GM9A 4B3TB 4YXWG 1JX9A 2D3OW 1JFFB 1KU9A 2Y0IA 3K08A 1N34B 1AI4A 4UCVA 3GWOA 1NVPD 3T1HB 1HNXO 4ZHQB 1HNXB 1Z5WA 4MT8A 4NYKA 2HVJC 3HPLC 1M9NA 3ZJZA 1BMFG 3CCLV 3CMAV 3ZBHA 1GRJA 1N0NA 2Q69A 3UT5A 3OD4A 4DO2A 4JI2B 2ZINA 5BR8O 4DR2O 3O9OA 4UVBA 1KQSU 4JPRA 2AZ2A 1VF6A 3K03A 2B9ZA 4H33A 1NJIW 4JASA 1MABG 4DW0A 3HKEA 5LYJB 2YI8A 1K92A 4EEQA 5C93A 5DECA 5KHKA 3JAWB 2L6LA 1FYJA 4CS3A 1Q6IA 2IJJA 3K57A 2UXNA 2HJDA 4J11A 2F43G 2JEXA 1WB7A 3P3PA 4YY3O 5C8YB 3BEHA 2OYQA 4TUYA 1IDSA 3L70H 4MS2A 2HLDG 2CDYA 2F93B 4O2AB 4MVSA 4HNAA 4LBEC 4UUJC 1OCCB 3SYPA 4QIWF 4UCRA 4BAYA 2OT5A 1SQXH 3FYIB 4O2BB 3B4SA 5A2QN 2P7TC 2ADQB 2AZ0A 5EBMC 5B1BC 1RSOB 4W4LA 2AW9A 2BTQA 4NKGB 1PNLA 5J2UA 1D5AA 2XAJA 3STLC 1QR8A 4Z1VA 5B5EZ 1KP2A 3BFRA 5JJEB 2UUBO 1IBMO 2CTPA 1Y67A 2UUBB 3FB7C 1IBMB 4DR6B 4KUMA 1YCIA 1I08A 4MTGA 2WLLA 4YJ3A 5L3FA 4GCZA 1S77D 3VQXA 5H5NA 1QHTA 1XMOB 3IC9A 3OTFA 2YDEA 4MVRA 3SYCA 4P9OA 3W7SA 2XHBA 4TV8A 1UJWB 5LOVA 5LHGA 1GM7A 1GM8A 5LMNB 1I5YA 3L75H 3CCSV 3A0RA 3FYEB 4PI0A 1FXKC 3ZRXA 4UVCA 3H1LH 2EIMB 3P3NA 2DYRC 1GN4A 5HFLA 1TUBB 4DRXB 1SA0B 5FNVA 1PNMA 1M57C 2YIBD 2VS0A 2IH1C 1V54C 2ZE8A 3BVOA 3EHBB 3CCJV 1GN2A 3PN1A 4CH3A 4IHJB 5EIBC 4P30A 2KB1A 3RYHA 4B3MO 3DGEA 1NT2B 1PV0A 3E89A 4EFBA 4DXWA 3R65A 2IH3C 2Q9LA 3B8NA 1XBLA 3ZRWA 1BSMA 5H2FZ 5H6QA 1MNGA 1SC5B 3AG3C 1M56C 3CSXA 4DW1A 2ZQMA 2CH7A 2GSMB 4GUNA 3D36C 1TGOA 4LP8A 5B1BB 3CD6V 4J42A 2JDIG 1YVWA 5KHGA 3CC2V 1QR9A 4UXNA 1Y74A 2YICA 1YSCA 4QPKA 2YSUB 1QQCA 1SQGA 3FD9A 2FYUH 3S3WA 3JYCA 1VQMV 5JCOC 4ICGA 4WBNA 1CEZA 4WF9V 4YIOA 2NR5A 3L71H 4DV5B 1NR7A 2H3OA 4JI0B 1G6UA 1GKFA 5CB4A 2H8PC 3KCXA 3DXRA 2YEVB 4MW3A 4B7KA 2ZT9B 1FXKB 3P32A 4NTWA 5B3SC 2Z3YA 1AR1B 2P4KA 4NR1A 4JI8B 4JTAB 2K1EA 4GKJO 5EBWC 4FLWA 2DYRB 1SF9A 3OUFA 2C2AA 2WA3A 5CN0A 3SYQA 4CS4A 3SPHA 1P4RA 1M57B 2LJ2A 3A0BZ 1B04A 5J2TA 2ZE6A 3PJSK 3I5DA 3JASA 4PDRA 1AP5A 3G80A 4MW8A 1RFYA 3LUTB 4B3SO 4B3SB 1MSWD 3EVKA 2F1MA 3WB2A 3JCZA 3E22A 4TV9B 2JEUA 1QVGU 2A06H 1SQFA 2GTAA 1G4YB 1XOUA 1YDXA 5EYPB 1BL8A 5E79Z 4LFCO 4F6EA 3AG3B 1W2BU 1M56B 1XQ8A 4DV0B 1HR0O 4LNUA 2ZE7A 4X1KA 3J81N 1AJNA 3QO5A 2DOSA 4D7SA 4LH6A 5BXZA 2W0FC 4P2ZA 1GO3F 4X1IA 4JTCB 2RQ6A 4UV9A 4N23A 4TWKA 2A9HA 1V9PA 2YXLA 2Y4UA 3RBZA 4B7EA 4DR3O 3TXQA 1K5QA 5FPOA 1ROPA 1HNWO 5JJJB 4G27B 4U7OA 4JI5O 3JALB 1NI8A 4FJCC 1JFFA 2E74B 4PDLA 3ZMUA 2HFEC 2JS5A 4LF8B 4ZHQA 1B3QA 4DV4O 4DV6B 2WA4A 3TJTA 2N04A 1EBOA 3CJHB 3BA9A 5KHIA 5EC1C 3OTOO 3JAKB 3OTOB 1KECA 5EIBD 5B3SB 1COWG 5E1AC 1FJGO 5LL6Y 3OFNG 1GMGA 3DC6A 1HNZO 3CXCU 2EILB 4FLVA 3BHPA 1HNZB 5LYJA 4K35A 2UXDO 1U97A 3JAWA 3ZHVA 1WLEA 3CCEV 4GX1A 4X9QA 2W6IG 4X65O 4OPHA 1YZBA 4JI7B 4X65B 4QGPA 5GTHZ 3K5OA 1N36O 1AI7A 2RCVA 1FFTB 1XILA 1SZTA 2DWEC 5C8YA 3ZHUA 3ZMVA 1RM1B 4KHPO 3NR7A 2E5LO 1BS3A 1R6NA 2E5LB 4O2AA 3LDDA 1UFIA 1H2LA 4I9QA 1R73A 4RAIA 1THZA 4DUZB 1DF5A 1KKCA 4K8XA 4MVQA 4DUYB 2AGAA 5ITZA 4JAAA 2JGUA 4OGQB 2QM7A 5JQGB 3MAQA 2H94A 4WFHA 3CEIA 3OE7G 3ASOC 4BIOA 3CXHF 2VQFO 2LFRA 2WSSG 4PI2A 4ZIBA 2Z0AA 4PA3A
chains in the Genus database with same CATH topology
5IT9N 4X62O 4X66O 1R6TA 3OTOO 4DV2O 3SDLA 4DV7O 4YY3O 3J7AU 1IBLO 4GKJO 1R1BA 4JI7O 3J80N 1AILA 4DV1O 2FKXA 1FKAO 1FJGO 1F7YA 5LL6Y 1X59A 4K0KO 4B3TO 4X64O 4JI1O 1HNZO 3RT3C 4DV0O 1XEQA 1N34O 4B3RO 2ZM6O 2UXDO 3T1HO 4B3MO 5BY1A 4B3SO 3JAMN 5IWAO 4LF4O 4DR6O 2DJVA 1N33O 2UUAO 5LMUO 5A2QN 4X65O 4OPHA 1YZBA 2LW7A 4JI3O 4YHHO 2F4VO 1N36O 4GKKO 4DUZO 1DK1A 4JI2O 3F5TA 3O65A 1XMOO 2UU9O 1N32O 4OX9O 4LFCO 1AB3A 4DUYO 2JRIA 4OPAA 1A32A 1HR0O 3T1YO 4KHPO 4DV5O 3J81N 2UUBO 1HNXO 4JI6O 1KUQA 1IBMO 5LMNO 2DOSA 4DR7O 1XNQO 2E5LO 4JI0O 5FLXN 5BXZA 2UXCO 4NXMO 1I94O 3R66A 1NS1A 4LF6O 4JV5O 4LF8O 4DV6O 4JI4O 5H5NA 1XNRO 5BR8O 2VQEO 4DR2O 4NXNO 1G1XB 4DR3O 4DR4O 2UUCO 2ZKOA 1D2DA 2UXBO 1FYJA 2AGAA 4DR1O 4JI8O 2N74A 4AQYO 4LF5O 4LFBO 1HNWO 4DR5O 4LF7O 1XMQO 2HHHO 4JI5O 4LF9O 3M8AA 4LFAO 4DV3O 1IBKO 4JYAO 2VQFO 2Z0AA 1J5EO 4DV4O 4A5UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 N;  4X62 O;  4X66 O;  1R6T A;  3OTO O;  4DV2 O;  3SDL A;  4DV7 O;  4YY3 O;  3J7A U;  1IBL O;  4GKJ O;  1R1B A;  4JI7 O;  3J80 N;  1AIL A;  4DV1 O;  2FKX A;  1FKA O;  1FJG O;  1F7Y A;  5LL6 Y;  1X59 A;  4K0K O;  4B3T O;  4X64 O;  4JI1 O;  1HNZ O;  3RT3 C;  4DV0 O;  1XEQ A;  1N34 O;  4B3R O;  2ZM6 O;  2UXD O;  3T1H O;  4B3M O;  5BY1 A;  4B3S O;  3JAM N;  5IWA O;  4LF4 O;  4DR6 O;  2DJV A;  1N33 O;  2UUA O;  5LMU O;  5A2Q N;  4X65 O;  4OPH A;  1YZB A;  2LW7 A;  4JI3 O;  4YHH O;  2F4V O;  1N36 O;  4GKK O;  4DUZ O;  1DK1 A;  4JI2 O;  3F5T A;  3O65 A;  1XMO O;  2UU9 O;  1N32 O;  4OX9 O;  4LFC O;  1AB3 A;  4DUY O;  2JRI A;  4OPA A;  1A32 A;  1HR0 O;  3T1Y O;  4KHP O;  4DV5 O;  3J81 N;  2UUB O;  1HNX O;  4JI6 O;  1KUQ A;  1IBM O;  5LMN O;  2DOS A;  4DR7 O;  1XNQ O;  2E5L O;  4JI0 O;  5FLX N;  5BXZ A;  2UXC O;  4NXM O;  1I94 O;  3R66 A;  1NS1 A;  4LF6 O;  4JV5 O;  4LF8 O;  4DV6 O;  4JI4 O;  5H5N A;  1XNR O;  5BR8 O;  2VQE O;  4DR2 O;  4NXN O;  1G1X B;  4DR3 O;  4DR4 O;  2UUC O;  2ZKO A;  1D2D A;  2UXB O;  1FYJ A;  2AGA A;  4DR1 O;  4JI8 O;  2N74 A;  4AQY O;  4LF5 O;  4LFB O;  1HNW O;  4DR5 O;  4LF7 O;  1XMQ O;  2HHH O;  4JI5 O;  4LF9 O;  3M8A A;  4LFA O;  4DV3 O;  1IBK O;  4JYA O;  2VQF O;  2Z0A A;  1J5E O;  4DV4 O;  4A5U B; 
#chains in the Genus database with same CATH topology
 1Q43 A;  3K79 A;  2DMX A;  2JS3 A;  4XBF A;  3EFF K;  2QKS A;  1OJH A;  1JMK C;  5H9C A;  3J80 N;  3SYA A;  1RP3 B;  2CAZ C;  3ZHS A;  1EN5 A;  2R72 A;  3L72 H;  1F7Y A;  1Q81 W;  1NZ6 A;  3FAV B;  4PHZ A;  4R8C A;  2X6B A;  4DV3 B;  1OCZ B;  1NR1 A;  2BE3 A;  2P90 A;  4MVO A;  2PZS A;  4O4H B;  5CBF A;  5BY1 A;  1FXV A;  1JCH A;  1AR4 A;  2HKO A;  4ZBM A;  4F6R B;  1XHX A;  3FB6 C;  1N33 O;  4ZI7 B;  3UCS C;  1N33 B;  4O4L B;  4F4L A;  1H2G A;  1TUB A;  4B08 A;  4DRX A;  3WG7 C;  1H2S B;  1SA0 A;  4QE7 A;  5LHI A;  2QE7 G;  2OCC C;  2JRI A;  4KL1 A;  3AG1 C;  1NBM G;  5IYZ B;  4UCU A;  1JR9 A;  1XNQ O;  4DR7 O;  2BSK A;  5IWA B;  4HZ3 A;  4IHJ A;  3L73 H;  3WB1 A;  2KG7 A;  4LF6 O;  4JV5 O;  5AG2 A;  2BTO A;  2Y69 C;  5KMG B;  4K8Z A;  3QVN A;  2F4V B;  3N2G B;  1R3L C;  1DF4 A;  2GTS A;  2D2C B;  3UKM A;  4IT5 A;  1AP6 A;  3CX5 F;  5F2V O;  3F7Y C;  2A0L A;  3KG2 A;  2K9P A;  5GW7 A;  4PA9 A;  2YXY A;  2GBO A;  4RQE A;  4DR5 O;  3H1I H;  1JPX A;  2V1D A;  5EC2 C;  4LF9 O;  3A2F A;  5B1O A;  1NQT A;  4DK1 A;  2ZNI A;  1O9G A;  5JH7 B;  2JK5 C;  4I5S A;  1H8H G;  4EKW A;  5BR8 B;  4DR2 B;  2V4D A;  3JCU Z;  1GN3 A;  4UFZ A;  1W0K G;  4QPJ A;  4CZZ A;  2OCH A;  4DV7 O;  4JYC A;  4GX5 A;  2P4V A;  4ZOL B;  4DV1 O;  2QR4 A;  5CA3 A;  4DV1 B;  1WA8 B;  1W0J G;  3RYC B;  3BPZ A;  1MZF A;  4I0X B;  1SS3 A;  3SPI A;  2ZR3 A;  3MDS A;  4B3R O;  2A79 B;  4X88 A;  4BR6 A;  4B3R B;  4X20 A;  1URF A;  2HR3 A;  1ARO P;  1YTF B;  1VQO V;  3BAB A;  3SJC C;  4YY3 B;  2YEV A;  1G8M A;  3DTU B;  1K4D C;  1FXK A;  4GZR B;  1Q5O A;  3RYI B;  3CRM A;  2JJ1 G;  3E8G A;  4NTX A;  4LWS B;  2YID A;  2QTO A;  1IXM A;  1WPB A;  3WG7 B;  5LP6 C;  2ZDI C;  4R50 A;  2RDC A;  3GWK C;  2OCC B;  1I5X A;  1F4M A;  3VBB A;  1M4U A;  2PI5 A;  1MA1 A;  2BOC C;  1ZL8 B;  1PNK A;  1I94 O;  1OV9 A;  1AR5 A;  4I50 B;  4EB6 B;  3KKY A;  3CCR V;  5LA6 A;  1VQ5 V;  1Z5V A;  3H9V A;  4JI4 O;  2JJ2 G;  2Q5Z A;  1YI2 V;  1G1X B;  5IYD O;  1AVM A;  2UUC O;  5LGN A;  3VQV A;  2QWP B;  4R7C A;  1SZX A;  3TCU A;  3K5N A;  1SQQ H;  5EYP A;  4CH6 A;  1GAX A;  2ODM A;  1XDC A;  4BW9 A;  2RNB A;  3K58 A;  4LF7 O;  2HHH O;  2LGW A;  4LF7 B;  2WLH A;  2ZIM A;  2HHH B;  1VEW A;  3SJQ C;  4JYA O;  2YS8 A;  2LW1 A;  4JYA B;  5IJ9 B;  1J5E O;  2ZCE A;  3OEH G;  4A5U B;  4QE9 A;  3E8B A;  1J5E B;  4R6Z A;  3RYF B;  3K59 A;  4X62 O;  4FPP A;  3OAA G;  4CBC A;  2OTL V;  1YTF D;  1MZE A;  2A7W A;  1MMM A;  2ZIO A;  1MG1 A;  1VF6 C;  3E83 A;  2P06 A;  3CC4 V;  1VQN V;  4U3J B;  2WWW A;  3IAY A;  3AG7 A;  2QGN A;  1KMI Z;  4WFB V;  1RPO A;  1DTO A;  2EIN C;  2PI4 A;  1FS0 G;  3W7X A;  3JD4 A;  4I7Z B;  4FZ1 A;  1WP7 A;  5B66 Z;  3OUS A;  2FML A;  3SR2 C;  2QWO B;  1Z2G A;  3RFR A;  1VF5 B;  2KQX A;  3LSQ A;  2M6Y A;  4UVA A;  1MOF A;  2YXH A;  3CJH A;  1WN7 A;  1AJQ A;  3FKS G;  3KCY A;  3NXS A;  3EXA A;  5FL7 G;  2IJH A;  5CMU A;  2GDS A;  2JVD A;  3JAK A;  1K4C C;  1WP8 A;  3F5T A;  2EBO A;  2Q67 A;  3UO2 A;  2YI9 A;  4OX9 O;  2ARH A;  2Y0P A;  5JJN B;  4FFK A;  2X6C A;  3FFQ A;  1EM1 A;  1QNM A;  1M90 W;  2CTR A;  4B3M B;  3AK2 A;  3HKB B;  3OGI B;  5LP6 B;  3C90 A;  4FM1 A;  4MTX A;  5KA5 A;  3JD3 A;  4PA7 A;  4O4I B;  4MSW C;  5B1A C;  4NXN O;  1VF7 A;  4NXN B;  3A8T A;  2ZKO A;  1D2D A;  1OCO C;  4KFM A;  3JAR B;  3UO3 A;  1IXB A;  5EK0 A;  5D5Q A;  5CBG A;  4N21 A;  5B1N A;  1TUE B;  2CGN A;  2FB5 A;  1XMQ O;  3BAA A;  4H37 A;  1T5E A;  2QWR B;  3LNN A;  2FTK A;  1P7G A;  2N05 A;  3QNE A;  2Q4P A;  1AI5 A;  1VQK V;  2IJI A;  3ZMZ A;  2IW5 A;  3K3W A;  2QDO A;  2QM8 A;  4FVM A;  4RUE A;  5CBH A;  4K0K O;  2PYJ A;  4X64 O;  2Q0A A;  2WLK A;  4RUF A;  3CC7 V;  5JQG A;  4ABM A;  2YUA A;  3ASN C;  2EIN B;  3ZRS A;  3ZRV A;  3LDC A;  5EZY B;  3RGB A;  2X7R B;  4LF4 O;  1HWY A;  3UQ8 A;  2DJV A;  1B06 A;  4GKJ B;  1X4T A;  4YHH O;  2IJK A;  3P30 A;  2RMK B;  5CA1 B;  1DK1 A;  2Q7H A;  4OPA A;  1V54 B;  4FIP C;  1YJN V;  1P49 A;  2QSA A;  1PL4 A;  2ZE5 A;  3B8M A;  3K5L A;  1VIB A;  3U0Z A;  3ICX A;  5BMV A;  2WLM A;  4CH5 A;  2OWO A;  5D5P A;  1CXZ B;  4O4H A;  3R66 A;  4XDL A;  3H1J H;  2E76 B;  3F5W C;  5KA6 A;  3G71 V;  1BQ0 A;  4JZ2 A;  4BIU A;  1KP3 A;  5IYC O;  3QTC A;  3I56 V;  5L3E A;  1L1F A;  4BIZ A;  3SYO A;  1SES A;  4ZI7 A;  1XNR O;  4IIJ B;  5J9P C;  3AK3 A;  4O4L A;  1XNR B;  4LFC B;  5B1A B;  4DR1 O;  1VQ4 V;  4DR1 B;  1HR0 B;  3X2Q C;  1SET A;  1Q6H A;  4J7Z A;  1US6 A;  1V55 C;  1VQ8 V;  4Z2W A;  4LFA O;  3L9D A;  4Z1M G;  5IYZ A;  4X1Y B;  4LFA B;  5L3D A;  3MD0 A;  1AJP A;  1M5I A;  3RWR D;  3CRR A;  4DR3 B;  3C3T A;  4UCS A;  1ENV A;  5KMG A;  4DV2 O;  1HDJ A;  3N2G A;  1I7F A;  3OMA B;  3ZHR A;  1Q7Y W;  2G38 A;  1HNW B;  1DGS A;  4JI5 B;  1FFX B;  4TV8 B;  3JAT B;  2VWJ A;  1Y76 B;  2V7Q G;  1TVK B;  4IYI A;  2L35 A;  3HKD B;  4BW5 A;  4DV4 B;  2PYL A;  1S3J A;  5JH7 A;  2RN9 A;  4LC1 A;  2ATK C;  3BRC A;  3ASN B;  4FLZ A;  2CK3 G;  4I4T B;  1VAR A;  3LNM B;  1BQZ A;  1ORQ C;  4RQF A;  3HKC B;  2R9A A;  3JD1 A;  1FJG B;  2GUZ B;  4PA6 A;  3LDE A;  3BY6 A;  2QKA A;  1S5J A;  1KKD A;  3RYC A;  1BZK A;  1K33 A;  3JSN A;  1SQV H;  2UXD B;  4I0X A;  1WJZ A;  1XRE A;  3CRA A;  4E2L A;  1QLE C;  3CRQ A;  4J7J A;  2UXC O;  3AG4 C;  4LH7 A;  3RN4 A;  4YJ2 B;  4AHC A;  2GV9 A;  1CP9 A;  2QJ1 A;  2EIK C;  2CTW A;  3T1C A;  2GHY A;  5LHH A;  3K0D A;  1N36 B;  4FLU A;  3OGC C;  2HEP A;  4WFE A;  3RYI A;  2Y48 A;  4PD4 F;  3N2K B;  1BE3 H;  4LWS A;  1YIT V;  4KHP B;  4TT3 G;  2MW2 B;  4C7U A;  3CCQ V;  5K1X A;  4Q20 A;  4AIL C;  1IBK O;  3OT7 A;  1Y74 B;  5KAF Z;  1IBK B;  2LFS A;  2WLI B;  4JAV A;  1S0V A;  3APQ A;  3CB2 A;  1KBH A;  1P7B A;  1ZL8 A;  5IJ0 B;  4O2B A;  3VQW A;  4I50 A;  2YIB A;  2VRZ A;  3H01 A;  1XL4 A;  3OR6 C;  4X66 O;  3OEE G;  3D3Q A;  1RSO A;  1BHB A;  3SDL A;  1IBL O;  1R1B A;  2NNU A;  1IBL B;  2LGQ A;  4WBN B;  1K5S A;  3ABL C;  3GB7 C;  3IJ4 A;  5KHJ A;  1Q90 D;  1JJ2 U;  1L0L H;  3QG5 A;  4JYY A;  3RVY A;  4IGG A;  3B77 A;  2VQF B;  4W4K A;  3E8F A;  4WFF A;  1SER A;  5CB4 B;  4D7T A;  3AK1 A;  2F23 A;  1AI6 A;  1Y66 A;  4J10 A;  2ITD C;  1OCR C;  4JGS A;  2UUA O;  1LR1 A;  1LUW A;  2Z5U A;  4JI3 O;  4FLX A;  4JF3 A;  4H44 B;  3QF7 A;  1R3K C;  1L0N H;  3K04 A;  2UU9 O;  3ETQ A;  4U3J A;  2UU9 B;  4ZKI A;  1A32 A;  4K3A A;  3T1Y O;  3T2M A;  2ADP A;  1ZWI C;  1I0H A;  4JI6 O;  4JI6 B;  3CCM V;  1TA8 A;  4GX0 A;  4NXM O;  2EX3 A;  4MVM A;  1FXH A;  2LO1 A;  2M7W A;  1QLE B;  3K06 A;  4FFB B;  3AG4 B;  4G2K A;  3TK1 A;  1R3I C;  5KAI Z;  2VQE O;  1JQ0 A;  3QO8 A;  3B40 A;  1YIJ V;  2EIK B;  2YIA A;  5IE9 A;  4LR3 A;  1NTZ H;  5IY5 C;  4DR7 B;  1XNQ B;  4LNU B;  2HJF C;  3M8A A;  2XUM A;  2BOB C;  5CA0 B;  2ITC C;  1K9M W;  4LF6 B;  2PGG A;  4JV5 B;  1OCC C;  3HKB A;  5KX5 B;  1IZ3 A;  5LP6 A;  3E2E A;  4YIP A;  2ZDI A;  2RJZ A;  2JGD B;  4L8J A;  3G67 A;  5L3G A;  4J80 A;  1S5L Z;  4O4I A;  4H13 B;  5L3C A;  1O9H A;  2O57 A;  1UPG A;  5JVD B;  1ZUQ A;  1H8E G;  4HBN A;  5TIS Z;  3OMN B;  4FMT A;  3KZI Z;  4DR5 B;  2QKC A;  1R3J C;  3JAR A;  2EJ7 A;  4LF9 B;  4B3T O;  5JWP A;  4Q6G A;  1ZX3 A;  2CE4 A;  2XTA A;  3ASO B;  4HAM A;  1N34 O;  2P5O A;  3S3X A;  1D5N A;  3T1H O;  3M99 B;  2XAS A;  1GH6 A;  4E4E A;  1QBZ A;  1JOY A;  4DV7 B;  4TQF A;  2P67 A;  1JA8 A;  2XND G;  2DN9 A;  1OCR B;  4X8A A;  5KLV H;  2OIG A;  4P9P A;  4JI2 O;  1AB3 A;  1IX9 A;  1N4C A;  4UCT A;  4U3F H;  3MHS C;  2AHZ A;  3AEI A;  3I55 V;  4FZ0 A;  3ZHQ A;  1YXB A;  2QA4 V;  1NS1 A;  2EIM C;  2EZO A;  2R9R B;  5EZY A;  4GLX A;  1N8R W;  4L87 A;  4IL6 Z;  1YF2 A;  3CME V;  4WCE V;  3OR7 C;  1LNQ A;  3MHH C;  2Q0O C;  2XAH A;  3ETG A;  4FM0 A;  4LF5 O;  3F7V C;  2B1G A;  3HR0 A;  3TET A;  5CA1 A;  1WAZ A;  4LF5 B;  5LGT A;  3A0H Z;  2XAF A;  3ZN1 A;  5H6R A;  2AHY A;  3E35 A;  4H0L B;  3AG1 B;  5IYB O;  1JJO A;  1H2K A;  5GON B;  1I94 B;  4CS2 A;  4EFE A;  1R6K A;  5IY5 B;  2PTM A;  3STZ C;  3TGU H;  3RW0 A;  1YJ9 V;  2W0X A;  5IT9 N;  2CTQ A;  4JI4 B;  1VQ6 V;  2Y69 B;  4TV9 A;  2UUC B;  1R6T A;  1F51 A;  3BA8 A;  4OXS A;  2WPD G;  4IIJ A;  2FKX A;  1PKX A;  1W59 A;  2DQ0 A;  5ITZ B;  2PUS A;  2W6J G;  3Q4H B;  1X59 A;  3WB0 A;  3D36 A;  4JI1 O;  3UM7 A;  2Q8V A;  2X0L A;  2DW4 A;  4JI1 B;  2DQ3 A;  2IU3 A;  4O4J B;  4X89 A;  4X1Y A;  3W7U A;  4DR6 O;  4X62 B;  2HVK C;  4I55 B;  5LMU O;  4JYB A;  3ML0 A;  3H1K H;  5LMU B;  1PM9 A;  2UXX A;  3QO7 A;  1VQL V;  2F66 C;  1FPO A;  5KHH A;  1NTK H;  5JCO A;  1XMO O;  1GTO A;  3K0G A;  1WB8 A;  1YHQ V;  1N32 O;  5LBQ A;  1N32 B;  3JD2 A;  3JAL A;  2IBZ H;  1YJW V;  1FFX A;  3H1H H;  4J9Z B;  3JAT A;  3JSL A;  4XDJ A;  1Y76 A;  2XAG A;  3W7T A;  5LMN O;  1VQ9 V;  1TVK A;  1FD9 A;  4ASU G;  4KXR A;  1ZSP A;  3HKD A;  5LXT B;  2WLJ A;  4TQD A;  4G28 B;  1KYO F;  2XT9 A;  1Q6U A;  2F95 B;  4NB5 A;  4I4T A;  3ABM C;  2X6A A;  4MVZ A;  4OX9 B;  2CGO A;  4WFA V;  3HKC A;  4PEL A;  2GUZ A;  3SGI A;  3VOU A;  1S76 D;  1ZTE A;  4UV8 A;  1E1Q G;  4QNH B;  3K5M A;  3GVM A;  1E1R G;  2A3Q A;  2BSK B;  3TXS A;  4IYH A;  2KG7 B;  2Y4T A;  4MVU A;  3CS5 A;  4YJ2 A;  1P84 F;  2HG5 C;  2NN4 A;  3LSU A;  2ZR2 A;  4PDM A;  1BHA A;  2P6J A;  3T4Z A;  3M7M X;  1ZLZ A;  1FKA O;  4FLT A;  3IFX A;  1XMQ B;  2XOK G;  3N2K A;  4PDV A;  4I9W A;  2E3C A;  1M1K W;  1CPY A;  1JVM A;  2WLI A;  3UT5 B;  1M93 A;  2B5U A;  5IJ0 A;  3K9A A;  4J7K A;  1F4N A;  3D3I A;  1OHH G;  4UCO A;  1EZJ A;  4UB6 Z;  4J9Y B;  4K0K B;  4FLY A;  5IDJ A;  2B1I A;  1VP7 A;  4X64 B;  3ZIA G;  1S5H C;  3HKE B;  1OZ0 A;  1EN4 A;  4MTF A;  3K9S A;  1ZAU A;  4JZG A;  2OIE A;  2OTJ V;  4DV5 O;  3DC5 A;  4JI0 O;  2LP7 A;  4LF4 B;  1K97 A;  2R70 A;  4DK0 A;  3ZMS A;  2IM9 A;  1B6Q A;  4X20 B;  4DYL A;  4NVP A;  2MK3 A;  3AG2 C;  1EN6 A;  1K73 W;  4YHH B;  1J95 A;  3E86 A;  2WLN A;  4RWU A;  3CCV V;  1H2N A;  3OW2 U;  4DR4 O;  1EFR G;  4TUY B;  4RO2 A;  4DR4 B;  2ZXW C;  3OMI B;  4JI8 O;  5KUM A;  2KKW A;  3ABM B;  3FAV A;  4CC6 A;  2ILM A;  2EIL C;  4HNA B;  3ABK C;  1K3E A;  3OM3 B;  2EIJ C;  5DM6 V;  4F6R A;  1XHZ A;  3W7W A;  5LA6 B;  3FX7 A;  4FFB A;  1S72 V;  4CC5 A;  1K34 A;  1KC8 W;  2BTQ B;  1DLB A;  3J7A U;  3LSS A;  1PP9 H;  1K8A W;  1FAF A;  1OCO B;  3ETE A;  5J2U B;  1NTM H;  3ETD A;  2P22 C;  1XI1 A;  1RM1 C;  1SQB H;  3CHX A;  3RT3 C;  1XEQ A;  4GX2 A;  4DV0 O;  3U11 A;  2ZM6 O;  2ZM6 B;  2WLL B;  4YJ3 B;  4PA4 A;  1E79 G;  5CA0 A;  3U10 A;  5KX5 A;  4PV1 B;  4DV2 B;  2QWN B;  2JGD A;  3ABT A;  3D8C A;  4GKK O;  3C3S A;  2DE0 X;  4GKK B;  5LOV B;  3HB3 B;  5JVD A;  2QM4 A;  1WNS A;  1H38 A;  2BCC H;  2IU0 A;  2EUL A;  5LGU A;  5EBL C;  2QEX V;  3WFV A;  1KUQ A;  1MSD A;  3CRC A;  4GYC B;  5GTI Z;  2Q7E A;  4AI8 A;  4LF8 O;  2QTS A;  4DV6 O;  5FNV B;  3ZHT A;  2QWQ B;  3AG2 B;  4ZOL A;  1Q8I A;  3SJA C;  2UXB O;  1Q3E A;  5FPR A;  1PPJ H;  1WA8 A;  3ZN0 A;  2UXB B;  4AQY O;  4LFB O;  4AQY B;  3CE2 A;  3RVZ A;  4LFB B;  2JIZ G;  2ZXW B;  3T4D A;  1QVF U;  1OCZ C;  2Q68 A;  2UXC B;  3RYH B;  1SQP H;  2Q73 A;  3IGA C;  3E8H A;  5A9G A;  3WU2 Z;  3CCU V;  4FK5 C;  1VMG A;  3ABK B;  3ZRW B;  1F23 A;  3THO A;  3BCC H;  3VQY A;  5DED A;  2EIJ B;  1KB9 F;  3G6E V;  3ABU A;  2DYS C;  1H2M A;  2EJR A;  2CH7 B;  4JI7 O;  2Q7G A;  2PY5 A;  4BWA A;  1TAE A;  1EZV H;  1BT8 A;  2CUG A;  1HW7 A;  2PF4 E;  3X2Q B;  1GK9 A;  2WAM A;  1SKV A;  2DWD C;  1V55 B;  1L8D A;  3SPC A;  3FB8 C;  1Y4M A;  5GON A;  4EB6 A;  3FB5 C;  3DSQ A;  3JAM N;  5BZB A;  4X66 B;  5KUK A;  2Q6A A;  1VQ7 V;  2KSD A;  3JD0 A;  2LW7 A;  3L74 H;  3SJB C;  5K1P A;  4WFG A;  2VWK A;  4DUZ O;  4JAU A;  2XAQ A;  3CYO A;  1RPR A;  4D6T H;  1K7D A;  2NLJ C;  4DUY O;  4J41 A;  2AXT Z;  3Q4H A;  1NH2 B;  1NKD A;  3G6B A;  3CPW U;  3DXR B;  5FLX N;  2E75 B;  5IJ9 A;  3B2E E;  2ZNJ A;  1IVS A;  2UUA B;  3RYF A;  4O4J A;  4JI3 B;  3APO A;  3B09 A;  3G4S V;  3ZS8 C;  1KD1 W;  4I55 A;  2EZP A;  4KP4 A;  5L3B A;  4NTY A;  4LCU C;  1NVP B;  2N74 A;  3ZCC A;  3T1Y B;  5J2T B;  1PL0 A;  1XL6 A;  3JAS B;  5HFM A;  1HP8 A;  4NXM B;  2LQT A;  4DV3 O;  3N27 A;  1IUR A;  4PJ0 Z;  5BMV B;  4XDK A;  4TSF G;  1QLN A;  3E22 B;  2ETN A;  3SPJ A;  5LXT A;  4FM2 A;  4HYO A;  2VQE B;  1YEW A;  2R9I A;  4UB8 Z;  3ZED A;  3ZX6 A;  1QCE A;  1LUV A;  3ZMT A;  1BGY H;  4CH4 A;  1QU7 A;  3CP1 A;  1AIL A;  4TOI A;  1PD3 A;  2YC0 A;  1Q82 W;  2DYS B;  1N0J A;  4X1K B;  2HP8 A;  4MTO A;  1VQP V;  4X1I B;  3CWB H;  5DN6 G;  4GT1 A;  4QJF B;  1GN6 A;  1NH2 D;  5IWA O;  1XUQ A;  3SPG A;  2ZD9 A;  3IC7 A;  4JTD B;  1Y6X A;  1BCC H;  2FL4 A;  1WPX A;  2F4V O;  1Q86 W;  1SRY A;  1NU1 H;  3O65 A;  1U96 A;  4U7N A;  3ABL B;  1GM9 A;  4B3T B;  4YXW G;  1JX9 A;  2D3O W;  1JFF B;  1KU9 A;  2Y0I A;  3K08 A;  1N34 B;  1AI4 A;  4UCV A;  3GWO A;  1NVP D;  3T1H B;  1HNX O;  4ZHQ B;  1HNX B;  1Z5W A;  4MT8 A;  4NYK A;  2HVJ C;  3HPL C;  1M9N A;  3ZJZ A;  1BMF G;  3CCL V;  3CMA V;  3ZBH A;  1GRJ A;  1N0N A;  2Q69 A;  3UT5 A;  3OD4 A;  4DO2 A;  4JI2 B;  2ZIN A;  5BR8 O;  4DR2 O;  3O9O A;  4UVB A;  1KQS U;  4JPR A;  2AZ2 A;  1VF6 A;  3K03 A;  2B9Z A;  4H33 A;  1NJI W;  4JAS A;  1MAB G;  4DW0 A;  3HKE A;  5LYJ B;  2YI8 A;  1K92 A;  4EEQ A;  5C93 A;  5DEC A;  5KHK A;  3JAW B;  2L6L A;  1FYJ A;  4CS3 A;  1Q6I A;  2IJJ A;  3K57 A;  2UXN A;  2HJD A;  4J11 A;  2F43 G;  2JEX A;  1WB7 A;  3P3P A;  4YY3 O;  5C8Y B;  3BEH A;  2OYQ A;  4TUY A;  1IDS A;  3L70 H;  4MS2 A;  2HLD G;  2CDY A;  2F93 B;  4O2A B;  4MVS A;  4HNA A;  4LBE C;  4UUJ C;  1OCC B;  3SYP A;  4QIW F;  4UCR A;  4BAY A;  2OT5 A;  1SQX H;  3FYI B;  4O2B B;  3B4S A;  5A2Q N;  2P7T C;  2ADQ B;  2AZ0 A;  5EBM C;  5B1B C;  1RSO B;  4W4L A;  2AW9 A;  2BTQ A;  4NKG B;  1PNL A;  5J2U A;  1D5A A;  2XAJ A;  3STL C;  1QR8 A;  4Z1V A;  5B5E Z;  1KP2 A;  3BFR A;  5JJE B;  2UUB O;  1IBM O;  2CTP A;  1Y67 A;  2UUB B;  3FB7 C;  1IBM B;  4DR6 B;  4KUM A;  1YCI A;  1I08 A;  4MTG A;  2WLL A;  4YJ3 A;  5L3F A;  4GCZ A;  1S77 D;  3VQX A;  5H5N A;  1QHT A;  1XMO B;  3IC9 A;  3OTF A;  2YDE A;  4MVR A;  3SYC A;  4P9O A;  3W7S A;  2XHB A;  4TV8 A;  1UJW B;  5LOV A;  5LHG A;  1GM7 A;  1GM8 A;  5LMN B;  1I5Y A;  3L75 H;  3CCS V;  3A0R A;  3FYE B;  4PI0 A;  1FXK C;  3ZRX A;  4UVC A;  3H1L H;  2EIM B;  3P3N A;  2DYR C;  1GN4 A;  5HFL A;  1TUB B;  4DRX B;  1SA0 B;  5FNV A;  1PNM A;  1M57 C;  2YIB D;  2VS0 A;  2IH1 C;  1V54 C;  2ZE8 A;  3BVO A;  3EHB B;  3CCJ V;  1GN2 A;  3PN1 A;  4CH3 A;  4IHJ B;  5EIB C;  4P30 A;  2KB1 A;  3RYH A;  4B3M O;  3DGE A;  1NT2 B;  1PV0 A;  3E89 A;  4EFB A;  4DXW A;  3R65 A;  2IH3 C;  2Q9L A;  3B8N A;  1XBL A;  3ZRW A;  1BSM A;  5H2F Z;  5H6Q A;  1MNG A;  1SC5 B;  3AG3 C;  1M56 C;  3CSX A;  4DW1 A;  2ZQM A;  2CH7 A;  2GSM B;  4GUN A;  3D36 C;  1TGO A;  4LP8 A;  5B1B B;  3CD6 V;  4J42 A;  2JDI G;  1YVW A;  5KHG A;  3CC2 V;  1QR9 A;  4UXN A;  1Y74 A;  2YIC A;  1YSC A;  4QPK A;  2YSU B;  1QQC A;  1SQG A;  3FD9 A;  2FYU H;  3S3W A;  3JYC A;  1VQM V;  5JCO C;  4ICG A;  4WBN A;  1CEZ A;  4WF9 V;  4YIO A;  2NR5 A;  3L71 H;  4DV5 B;  1NR7 A;  2H3O A;  4JI0 B;  1G6U A;  1GKF A;  5CB4 A;  2H8P C;  3KCX A;  3DXR A;  2YEV B;  4MW3 A;  4B7K A;  2ZT9 B;  1FXK B;  3P32 A;  4NTW A;  5B3S C;  2Z3Y A;  1AR1 B;  2P4K A;  4NR1 A;  4JI8 B;  4JTA B;  2K1E A;  4GKJ O;  5EBW C;  4FLW A;  2DYR B;  1SF9 A;  3OUF A;  2C2A A;  2WA3 A;  5CN0 A;  3SYQ A;  4CS4 A;  3SPH A;  1P4R A;  1M57 B;  2LJ2 A;  3A0B Z;  1B04 A;  5J2T A;  2ZE6 A;  3PJS K;  3I5D A;  3JAS A;  4PDR A;  1AP5 A;  3G80 A;  4MW8 A;  1RFY A;  3LUT B;  4B3S O;  4B3S B;  1MSW D;  3EVK A;  2F1M A;  3WB2 A;  3JCZ A;  3E22 A;  4TV9 B;  2JEU A;  1QVG U;  2A06 H;  1SQF A;  2GTA A;  1G4Y B;  1XOU A;  1YDX A;  5EYP B;  1BL8 A;  5E79 Z;  4LFC O;  4F6E A;  3AG3 B;  1W2B U;  1M56 B;  1XQ8 A;  4DV0 B;  1HR0 O;  4LNU A;  2ZE7 A;  4X1K A;  3J81 N;  1AJN A;  3QO5 A;  2DOS A;  4D7S A;  4LH6 A;  5BXZ A;  2W0F C;  4P2Z A;  1GO3 F;  4X1I A;  4JTC B;  2RQ6 A;  4UV9 A;  4N23 A;  4TWK A;  2A9H A;  1V9P A;  2YXL A;  2Y4U A;  3RBZ A;  4B7E A;  4DR3 O;  3TXQ A;  1K5Q A;  5FPO A;  1ROP A;  1HNW O;  5JJJ B;  4G27 B;  4U7O A;  4JI5 O;  3JAL B;  1NI8 A;  4FJC C;  1JFF A;  2E74 B;  4PDL A;  3ZMU A;  2HFE C;  2JS5 A;  4LF8 B;  4ZHQ A;  1B3Q A;  4DV4 O;  4DV6 B;  2WA4 A;  3TJT A;  2N04 A;  1EBO A;  3CJH B;  3BA9 A;  5KHI A;  5EC1 C;  3OTO O;  3JAK B;  3OTO B;  1KEC A;  5EIB D;  5B3S B;  1COW G;  5E1A C;  1FJG O;  5LL6 Y;  3OFN G;  1GMG A;  3DC6 A;  1HNZ O;  3CXC U;  2EIL B;  4FLV A;  3BHP A;  1HNZ B;  5LYJ A;  4K35 A;  2UXD O;  1U97 A;  3JAW A;  3ZHV A;  1WLE A;  3CCE V;  4GX1 A;  4X9Q A;  2W6I G;  4X65 O;  4OPH A;  1YZB A;  4JI7 B;  4X65 B;  4QGP A;  5GTH Z;  3K5O A;  1N36 O;  1AI7 A;  2RCV A;  1FFT B;  1XIL A;  1SZT A;  2DWE C;  5C8Y A;  3ZHU A;  3ZMV A;  1RM1 B;  4KHP O;  3NR7 A;  2E5L O;  1BS3 A;  1R6N A;  2E5L B;  4O2A A;  3LDD A;  1UFI A;  1H2L A;  4I9Q A;  1R73 A;  4RAI A;  1THZ A;  4DUZ B;  1DF5 A;  1KKC A;  4K8X A;  4MVQ A;  4DUY B;  2AGA A;  5ITZ A;  4JAA A;  2JGU A;  4OGQ B;  2QM7 A;  5JQG B;  3MAQ A;  2H94 A;  4WFH A;  3CEI A;  3OE7 G;  3ASO C;  4BIO A;  3CXH F;  2VQF O;  2LFR A;  2WSS G;  4PI2 A;  4ZIB A;  2Z0A A;  4PA3 A; 
#chains in the Genus database with same CATH homology
 5IT9 N;  4X62 O;  4X66 O;  1R6T A;  3OTO O;  4DV2 O;  3SDL A;  4DV7 O;  4YY3 O;  3J7A U;  1IBL O;  4GKJ O;  1R1B A;  4JI7 O;  3J80 N;  1AIL A;  4DV1 O;  2FKX A;  1FKA O;  1FJG O;  1F7Y A;  5LL6 Y;  1X59 A;  4K0K O;  4B3T O;  4X64 O;  4JI1 O;  1HNZ O;  3RT3 C;  4DV0 O;  1XEQ A;  1N34 O;  4B3R O;  2ZM6 O;  2UXD O;  3T1H O;  4B3M O;  5BY1 A;  4B3S O;  3JAM N;  5IWA O;  4LF4 O;  4DR6 O;  2DJV A;  1N33 O;  2UUA O;  5LMU O;  5A2Q N;  4X65 O;  4OPH A;  1YZB A;  2LW7 A;  4JI3 O;  4YHH O;  2F4V O;  1N36 O;  4GKK O;  4DUZ O;  1DK1 A;  4JI2 O;  3F5T A;  3O65 A;  1XMO O;  2UU9 O;  1N32 O;  4OX9 O;  4LFC O;  1AB3 A;  4DUY O;  2JRI A;  4OPA A;  1A32 A;  1HR0 O;  3T1Y O;  4KHP O;  4DV5 O;  3J81 N;  2UUB O;  1HNX O;  4JI6 O;  1KUQ A;  1IBM O;  5LMN O;  2DOS A;  4DR7 O;  1XNQ O;  2E5L O;  4JI0 O;  5FLX N;  5BXZ A;  2UXC O;  4NXM O;  1I94 O;  3R66 A;  1NS1 A;  4LF6 O;  4JV5 O;  4LF8 O;  4DV6 O;  4JI4 O;  5H5N A;  1XNR O;  5BR8 O;  2VQE O;  4DR2 O;  4NXN O;  1G1X B;  4DR3 O;  4DR4 O;  2UUC O;  2ZKO A;  1D2D A;  2UXB O;  1FYJ A;  2AGA A;  4DR1 O;  4JI8 O;  2N74 A;  4AQY O;  4LF5 O;  4LFB O;  1HNW O;  4DR5 O;  4LF7 O;  1XMQ O;  2HHH O;  4JI5 O;  4LF9 O;  3M8A A;  4LFA O;  4DV3 O;  1IBK O;  4JYA O;  2VQF O;  2Z0A A;  1J5E O;  4DV4 O;  4A5U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...