1VP7A

Crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
68
structure length
68
Chain Sequence
b'ARPLPQDFETALAELESLVSAMENGTLPLEQSLSAYRRGVELARVCQDRLAQAEQQVKVLEGDLLRPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords exodeoxyribonuclease VII small subunit
publication title Crystal structure of Exodeoxyribonuclease VII small subunit E.C.3.1.11.6 (NP_881400.1) from Bordetella pertussis at 2.40 A resolution
rcsb
source organism Bordetella pertussis tohama i
molecule tags Hydrolase
total genus 26
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.11.6: Exodeoxyribonuclease VII.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02609 Exonuc_VII_S Exonuclease VII small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1040 Mainly Alpha Orthogonal Bundle Helix Hairpins Exonuclease VII, small subunit 1vp7A00
1VP7A
chains in the Genus database with same CATH superfamily
2R9AA 4DUZO 2ZNJA 3QO8A 2EX3A 4MVQA 3D8CA 4D7TA 5IJ9A 4QPKA 1AI7A 4B3RO 2AHYA 4ASUG 1F7YA 1DF5A 3IJ4A 3CCJV 2M7WA 2YIBD 2Q69A 3ETEA 3K5MA 2JEXA 4U3JA 1NT2B 3G71V 1Q8IA 2OTLV 1YF2A 4PA7A 4P30A 2QDOA 1SESA 2ZCEA 1I08A 1GN6A 2RN9A 1ZUQA 1XREA 3FD9A 1QVGU 1YIJV 2EULA 4FFBA 4JAUA 5LHHA 4U7OA 3KCYA 3E2EA 5GTHZ 1BGYH 2XASA 4Z1MG 3T4ZA 1IBKB 1FAFA 2P4VA 3UO2A 1JCHA 4CS4A 4AILC 4JZGA 3N2GB 1TAEA 3U11A 1JFFB 3CSXA 3D36C 2YXLA 4EKWA 4DV0O 2PI5A 2XAFA 1Q3EA 4YJ3B 4JF3A 1KKCA 1OCOC 4JTDB 4LF6O 3K9SA 2MW2B 1Q6IA 1Q81W 5LHGA 2BSKB 1K92A 2DQ0A 2OCCC 3O65A 1R1BA 5CA0A 1NR7A 2N05A 1H2MA 2BOCC 4BW9A 3B4SA 3AG1B 2Q7HA 5EIBC 1SERA 2FTKA 1J5EB 4K8ZA 4BIUA 5FL7G 4KL1A 3CC4V 2HJDA 2RCVA 2GV9A 1M9NA 3UKMA 3DXRA 4J42A 3SPCA 3H01A 2JIZG 5LYJB 1B06A 4DR1B 3AG3C 2HEPA 4PI0A 3JAKB 1FS0G 3ABKC 1AVMA 1M57B 1NZ6A 4R50A 2C2AA 3BCCH 1D5NA 3P3NA 4X62O 4C7UA 1XQ8A 1SC5B 5LOVB 3SYOA 2CTQA 2EZPA 3AG4C 4GLXA 2E75B 1GN4A 3CWBH 2A7WA 1XNQO 1N36O 3R65A 2LFRA 5CB4B 1HWYA 1NTKH 5IY5B 2P4KA 3JD0A 2HJFC 1QNMA 2DQ3A 3CEIA 4O2AB 4I5SA 2GUZB 1UJWB 2YEVA 2WLIB 3FAVB 1SRYA 3GWKC 2JS5A 3RYFB 2IW5A 1EZVH 3GB7C 1NKDA 4LWSB 3STZC 2QGNA 2WA4A 4I4TA 2BTQB 1H38A 1PKXA 3K03A 4RO2A 1CP9A 4DW0A 3RYCB 3JALA 4UVCA 5JH7A 3G67A 4O4LA 1AJNA 2GDSA 4G28B 4O4JA 3K06A 3RYHA 4NXMO 4OXSA 5CBHA 4RUFA 3ETDA 1VQMV 4KFMA 2QWQB 3E8GA 1TA8A 2R70A 3RW0A 4EEQA 5B66Z 4IIJB 1V55C 4F4LA 1S3JA 4UCRA 2W6JG 2EIMC 1MZEA 1P49A 1QQCA 1V54B 2VQEO 3TXQA 5B1BB 3JCZA 3I56V 2JGDA 4X65B 4EB6B 3OUSA 3OD4A 4DXWA 3ASNB 2IJJA 4FFKA 4K8XA 1AI5A 3CCQV 5GW7A 1EBOA 4LP8A 5LL6Y 5LXTB 3AG2C 5JQGB 3FX7A 1VQ9V 5LP6C 4GT1A 1K8AW 5LMNO 1S0VA 4Q20A 4JYAB 4MW8A 4JI3O 1OCZB 3K5NA 4I55B 4PDVA 1Y4MA 2ATKC 3BY6A 3JARA 4MSWC 5KAFZ 2DWDC 1PNLA 5FLXN 4J10A 4DK0A 2F43G 1N34B 1HDJA 3JD2A 3G6EV 3SDLA 4IL6Z 2Y69B 4DR7B 2QE7G 4CC5A 1JJOA 5B3SB 3AK2A 4P9OA 3JASA 4U7NA 1W0JG 3E8FA 5JVDA 1ZLZA 2PYLA 1OJHA 4O4IA 3ABLB 1G8MA 5BXZA 3ZJZA 3CCVV 4FLUA 2UUCO 5B1AB 4J9YB 1WNSA 3H1LH 4DUZB 2CGOA 4OPHA 3OR6C 5IYZA 4FLXA 3B8NA 3ZIAG 1FXVA 4TOIA 1O9HA 3IC9A 4NB5A 4PHZA 3LUTB 5LGTA 4JI6O 2CTWA 4CS2A 1J95A 5KLVH 4DV1B 3ZHUA 4TV8B 5D5PA 4ZIBA 1DLBA 1YI2V 1JJ2U 4DV4O 1K7DA 3CXCU 4RAIA 2XOKG 3ZMZA 1U96A 2NNUA 2XT9A 1N32O 3QNEA 1BZKA 2E76B 1F51A 3L70H 4O2BB 4LCUC 1JPXA 5IWAO 2NR5A 2OIGA 3MHSC 4FZ0A 4B3TB 2ZDIC 4FJCC 1NJIW 1QBZA 4JZ2A 2OT5A 2R72A 4B3MB 4PJ0Z 4YJ2A 4DV0B 1VF5B 2UUAO 4QGPA 2DOSA 2QWPB 4LF6B 2EINC 2WLNA 3JD4A 4DV5B 2UXDO 3ZN1A 4W4LA 1A32A 4LFAO 4QPJA 1IURA 4TQFA 4FLVA 3HKDB 3QF7A 1R73A 2R9IA 1HNWO 2Y48A 3K79A 3AG1C 3JD3A 3E8BA 4JYBA 1AR4A 4NTYA 4X1YA 5KMGB 3VBBA 2ZIOA 5CA1A 1RPRA 3RWRD 4LF8O 3N27A 3B40A 1E1QG 1CEZA 1LR1A 4LR3A 4J11A 2YIAA 3ABUA 4X62B 1BSMA 1OZ0A 1YJ9V 2A9HA 4TUYA 3CCSV 3J80N 1WPXA 1M57C 1XNQB 5L3GA 5IJ9B 1N36B 5EBWC 1X4TA 4FIPC 1GM7A 1XHZA 2XAGA 2FYUH 3SYCA 3LSSA 1VQKV 4A5UB 4ZKIA 2Q68A 4IYIA 3FFQA 4H33A 4BIOA 3W7TA 4R7CA 5IY5C 3CX5F 3J7AU 2EILB 1WPBA 4E4EA 5DECA 3HKEB 2ZR2A 4X9QA 1KU9A 5IJ0B 2EJ7A 4ZHQA 5H2FZ 5KHKA 3CRCA 2JEUA 2N74A 2JVDA 5L3DA 2X6BA 5JWPA 1MOFA 2VWJA 5LA6A 4NXMB 1YTFB 4JTCB 4LF9O 5EC1C 1CXZB 3EVKA 3X2QB 5JJEB 1Q43A 2RJZA 2LW7A 1R3JC 3K0DA 1FFXA 4X1KA 4DK1A 1MSWD 3FB8C 1SQGA 2VQEB 3HKBA 3SJCC 4F6RA 1SQQH 3L72H 4FM2A 4JI8O 3ZMUA 4ZBMA 1V54C 3RGBA 5B1BC 1QLEB 2CK3G 2K1EA 4IHJB 4JI5B 3GVMA 1ZSPA 2Z3YA 5CBFA 3A0HZ 3ASNC 2A06H 3WG7B 1GM8A 1Y74B 5LMNB 1LUVA 1DK1A 3SPGA 4XDJA 4JI3B 4J80A 2WA3A 3OTFA 3E8HA 4Z1VA 1AP6A 1Q7YW 4DRXB 1ZX3A 3FKSG 1KUQA 4DV3O 1OCZC 4XDLA 5C8YA 1FXKC 1Y67A 2WLLA 5A9GA 3AG7A 2P22C 2OYQA 2CTRA 2FMLA 3CJHA 3U0ZA 4JI0O 3VOUA 2B1GA 2YEVB 2N04A 3W7WA 4CH6A 1XBLA 2VRZA 3RT3C 3BVOA 1HNXB 2Y69C 2DWEC 2UUBO 2YI9A 5B3SC 3CPWU 1ZAUA 1SF9A 5JH7B 4KHPO 2Q0AA 4O4LB 5IE9A 5KAIZ 4K35A 3OFNG 2UUCB 3D36A 4DR3O 3I55V 4I9WA 1RFYA 3UT5A 5C93A 3CRAA 5JJNB 3JAWB 3SJBC 2Q0OC 4CH5A 1K3EA 4JI6B 4MVRA 1SQFA 3CHXA 3RFRA 3AK3A 1S76D 1M1KW 2DJVA 1QR8A 2PUSA 2WWWA 1MG1A 1I5XA 4NKGB 3OAAG 2WPDG 4LH7A 2PY5A 2JGDB 2D3OW 3ZX6A 4TV9B 2BE3A 3RVZA 2UXBO 1GMGA 4DR5O 1B6QA 4FM1A 1N32B 3CCMV 1XEQA 4UUJC 5FPRA 2RDCA 2K9PA 4G2KA 2IJKA 2PI4A 3B77A 2ZE5A 4PA9A 5BMVB 4YHHO 2YUAA 5AG2A 1KP3A 1Q90D 1V9PA 2HFEC 3QO7A 2WLMA 2UUAB 3CC7V 1VF6C 2NLJC 4NTXA 3ZRVA 3IFXA 1Y76A 3H1IH 3UQ8A 2ZE6A 2E3CA 3E22A 2CTPA 1JVMA 4B08A 3R66A 4LFAB 3LNNA 3OW2U 2H8PC 2HVJC 2Q67A 4X66O 1GKFA 4PD4F 4MVSA 1WP7A 3GWOA 2AW9A 5KHJA 3TXSA 2HLDG 4DW1A 3J81N 4R8CA 5JVDB 3G80A 4FLTA 1WB8A 3BFRA 2QTOA 3K5LA 1MA1A 4KUMA 1Y6XA 5FNVB 1PM9A 5KX5B 2DN9A 1VQ8V 4H0LB 4LF8B 1BQ0A 1FPOA 1SA0A 3B8MA 2XUMA 2CH7A 4UVBA 1YEWA 1R6NA 2CGNA 5GONA 5EIBD 3ZS8C 5KUKA 2YIDA 4ZOLB 1SQXH 4P2ZA 2GHYA 4J7ZA 1NU1H 4MS2A 4X64O 3APQA 4MVMA 4W4KA 5F2VO 4IT5A 4JI7O 1SQBH 4GYCB 4JI2O 2EIJB 5L3CA 1FXHA 2Y4TA 1KB9F 4I50A 1GTOA 4I0XB 1Q5OA 1G4YB 1H2KA 2RNBA 2O57A 4X1IB 1US6A 1IVSA 4LNUB 5ITZA 2DE0X 4O4HB 2EILC 5LP6A 3OMAB 2YSUB 3RVYA 4QJFB 1SETA 4DO2A 3M7MX 2DW4A 5EZYB 4LF9B 3H1HH 5LMUO 4FMTA 2ODMA 3E86A 1K33A 2HHHO 2LGQA 3E89A 3WB1A 1H8HG 1KKDA 2B5UA 3E35A 2KG7A 3Q4HB 3X2QC 4DR4O 1AB3A 3N2KA 3QG5A 3L75H 4X8AA 4WF9V 4JI8B 1TUBA 4PDLA 3NR7A 4UV8A 3W7SA 1NH2B 3IAYA 4X20B 4ABMA 3RYIA 3OM3B 2FKXA 4X1YB 3OMIB 1QLNA 1QU7A 3K9AA 4X89A 5EYPA 4JAAA 3ZRWB 2ZINA 1IBLO 5LHIA 4RQFA 3WG7C 2R9RB 1SZTA 4UCSA 4UV9A 2JJ1G 1PD3A 4J9ZB 4UCVA 4DV3B 1WN7A 1M5IA 4WBNA 3JD1A 1EN5A 4JI0B 3K57A 3DSQA 1I5YA 4DV6O 1WA8B 5J9PC 5KHGA 3QTCA 3ASOB 3H1KH 2B9ZA 2X7RB 4LF7O 2EZOA 3M8AA 1N4CA 4MTGA 2UUBB 2LGWA 5IYDO 3BPZA 3CYOA 2BOBC 2ZR3A 2Y4UA 4L87A 4KHPB 4G27B 2ZDIA 4I7ZB 2EJRA 3BEHA 5LA6B 5J2TB 4DR3B 3ZBHA 3E83A 1HNZB 1VMGA 4Z2WA 1IX9A 4UXNA 3N2GA 3K58A 1D2DA 2V4DA 5H6RA 1JFFA 1B3QA 1DGSA 4EFBA 1SQVH 4YJ3A 4GX2A 3QVNA 1YJWV 3HKBB 3OR7C 2EIKB 2BSKA 1AR1B 3UM7A 1MMMA 4EFEA 2UXBB 1N0NA 2Y0PA 4B3RB 1FYJA 2XAQA 3JATB 3OEHG 3LDCA 2QSAA 1BHAA 3AK1A 4PA4A 4DR2O 2LQTA 4DYLA 3HR0A 4UCUA 5IYBO 4LF4O 4YHHB 2V7QG 2WSSG 2HVKC 3ICXA 3JAKA 1I94O 1JX9A 2D2CB 2PYJA 2OCHA 2GSMB 4XBFA 2JRIA 5JJJB 1RM1B 2ITCC 5LOVA 1ROPA 2L6LA 3ABTA 3IC7A 2A79B 4FM0A 2XNDG 1YCIA 4PDRA 3SJAC 3CJHB 5CB4A 1GK9A 2ZNIA 5HFLA 3ZHRA 2W0XA 1XL4A 2F95B 4O2AA 5L3FA 2GUZA 1M56B 4KXRA 4ZI7B 2WLIA 3FAVA 3SPIA 1N0JA 1KP2A 3RYFA 4JI4O 3DTUB 2P90A 1NBMG 4LWSA 4UCOA 1GO3F 2IH3C 4PA3A 1LNQA 2BTQA 2W0FC 1YXBA 2GTSA 5HFMA 4RQEA 1TVKB 4FLYA 1FFTB 4J7JA 3CMEV 1ZL8A 3CE2A 1PL0A 4B7EA 1M93A 4H44B 1BQZA 3ZRXA 1H2LA 1AR5A 1F4MA 2M6YA 4LFBO 4UB8Z 2PTMA 3EFFK 2P67A 1NVPD 1HR0O 4X64B 1P7BA 3ZHTA 3MAQA 4PI2A 4P9PA 1KQSU 3CMAV 1S5LZ 4IIJA 2RQ6A 2YICA 1AJQA 4JI2B 3VQYA 3JYCA 4HYOA 3SR2C 2Q5ZA 2H3OA 3ABMB 2QEXV 2JS3A 3C3TA 1WB7A 1NTMH 1BS3A 2EIJC 4U3JB 1WJZA 3BAAA 3AG3B 1L8DA 1B04A 3LSUA 3WB2A 4FLZA 5GTIZ 3JSNA 1YHQV 5LXTA 4JYCA 5LMUB 4WFFA 5JQGA 5A2QN 4FFBB 5K1XA 1EN4A 3AG4B 3G6BA 4K0KO 2HHHB 2JDIG 5JCOC 1XHXA 4JTAB 4I55A 1FXKA 3K0GA 4GX1A 1JOYA 4DR4B 2VQFO 4WFGA 1YDXA 4FPPA 2IJHA 4MTFA 1P7GA 3A8TA 4B3SO 3OGIB 5DEDA 1HP8A 1S77D 2ZM6O 2KSDA 2F23A 4K3AA 2V1DA 1VQ4V 3AEIA 3LDDA 5CA0B 1F23A 3OTOO 1IDSA 2F66C 1AP5A 4MVOA 2WLJA 1COWG 1OCRB 2X0LA 3APOA 4NXNO 3A0RA 1YITV 3SJQC 2UXCO 4N21A 1SA0B 4JAVA 1UPGA 5J2UA 4WFEA 4FK5C 5GONB 1IBMO 1SS3A 1IBLB 1VF7A 4MVUA 3DXRB 3O9OA 4LFCO 2ARHA 4FVMA 5B1OA 1R6TA 2YXHA 3DC5A 2XAHA 1BHBA 3CD6V 3QO5A 3W7UA 5KHHA 2P7TC 4BW5A 4OPAA 5IDJA 1IXBA 3K59A 3D3IA 4TV8A 1NQTA 4LF7B 3HB3B 4LC1A 3FB6C 3RBZA 1H2GA 4RWUA 4J41A 2PGGA 1G6UA 5CN0A 2L35A 5B5EZ 1TUEB 1VF6A 2CDYA 3S3XA 4I4TB 2VWKA 3OE7G 3OT7A 3A2FA 1P4RA 2HKOA 1RSOA 4DR6O 2FB5A 2QWRB 4JYAO 2NN4A 4NR1A 2CAZC 1KC8W 3JALB 1AILA 1NR1A 2ZE8A 2IBZH 2KG7B 2KB1A 4O4JB 3RYHB 1TGOA 1OV9A 2UU9O 3ABLC 2ZT9B 4GCZA 4TSFG 5LBQA 4JASA 5B1AC 3HKDA 1L0LH 1S5HC 2EIKC 3WU2Z 5EC2C 3FYIB 2DYRB 4DR2B 4UCTA 3JAMN 4HNAA 4DV4B 1UFIA 2Z0AA 2A0LA 3CXHF 4LF4B 3CP1A 4JI1O 5KUMA 3HKCA 2CE4A 4GX5A 2ADPA 5KMGA 1I94B 2E5LO 1EFRG 2OTJV 2WAMA 1BMFG 2ADQB 1KECA 2VS0A 1YZBA 5IWAB 1OCCB 3MDSA 3BHPA 2HR3A 4CC6A 4WBNB 3BABA 2MK3A 1O9GA 1GRJA 1JR9A 4YY3O 3DGEA 5B1NA 2F4VO 1K9MW 1VQPV 4DV1O 1RM1C 3JARB 2UXDB 3CB2A 2BCCH 4JI4B 3T1HO 2ZXWB 1PNKA 3KKYA 1Q6UA 3HKEA 1WAZA 3SYAA 1M56C 3SPJA 1ORQC 5IJ0A 1HNWB 3JASB 1VQ5V 1Y66A 1JQ0A 2EINB 3VQXA 2PF4E 4B3TO 4LFBB 4QIWF 4B3MO 4O4IB 1Q82W 1HR0B 2QKSA 1AI6A 3U10A 4DV5O 4GZRB 1KMIZ 2IH1C 3L74H 2WLKA 5IYZB 1G1XB 1FJGO 1BE3H 4YIOA 1NVPB 2A3QA 2LFSA 4DV2O 3KCXA 2B1IA 4AQYO 2ZD9A 1MZFA 1YJNV 5EBMC 1BCCH 4MTXA 4IHJA 1W0KG 3ABMC 3OGCC 5EK0A 1T5EA 4D6TH 2Y0IA 3ML0A 3ZMSA 1S5JA 2JK5C 5DN6G 3CC2V 4WFBV 3P3PA 1Y74A 4K0KB 4D7SA 1K5QA 4N23A 1EM1A 1JA8A 4BWAA 2OWOA 5KA6A 4UVAA 4DRXA 4L8JA 2VQFB 4CBCA 4AHCA 1W2BU 1QCEA 1GN3A 4YJ2B 4KP4A 3JSLA 5LGNA 4B3SB 4J7KA 5E1AC 2Q8VA 4MVZA 3VQWA 3A0BZ 2XHBA 2ZM6B 5H5NA 1WP8A 2Q6AA 2YS8A 1S72V 3T1YO 1KBHA 3OTOB 3WFVA 1VQLV 4LF5O 1YTFD 2IJIA 4NXNB 1Z5WA 4F6EA 2UXCB 2JGUA 1BT8A 5TISZ 4RUEA 2EBOA 2ZKOA 1Q6HA 1ZL8B 1IBMB 2DYSB 2F1MA 2Q9LA 1GH6A 1OCRC 2LJ2A 1XMQO 1AJPA 4H37A 1M90W 4LFCB 4BAYA 4QE7A 3ZN0A 1H8EG 5CA1B 1QLEC 3JAWA 3CRMA 5BZBA 1XI1A 1QVFU 5CA3A 3KZIZ 2E74B 1XMOO 2AGAA 1HW7A 4GKKO 5BR8O 4OX9O 4TUYB 5FPOA 1BL8A 3TK1A 2KQXA 3HPLC 2UXNA 4TV9A 1XNRO 3ZMTA 1VARA 5LGUA 2LW1A 1FD9A 4TWKA 2ILMA 1Z2GA 3SYPA 3M99B 4MT8A 4JI5O 4GKJO 2P06A 3MHHC 2IM9A 1D5AA 3FYEB 1IZ3A 2JJ2G 3CRRA 5KA5A 4QE9A 1OHHG 4HBNA 5BMVA 1P84F 1SQPH 4DR6B 2ZIMA 4ZHQB 2YDEA 3SPHA 1FXKB 3LSQA 2ETNA 3BA9A 2AZ0A 3FB7C 2QTSA 4JV5O 4YIPA 3LNMB 4JGSA 2Q4PA 4IGGA 2UU9B 3MD0A 1RP3B 1R3KC 3CCLV 3LDEA 3G4SV 1FFXB 4X1KB 1N8RW 3F7VC 2Q7EA 4DV7O 1N33O 2Q73A 1VQ7V 4F6RB 1R6KA 3CCRV 4GX0A 2AXTZ 1XUQA 4E2LA 3TJTA 1HNXO 1AROP 3C3SA 4JI1B 2DYRC 4DR5B 5FNVA 3S3WA 5J2UB 1L1FA 1GAXA 1VP7A 2DMXA 5KX5A 2E5LB 4NYKA 1QHTA 3F7YC 3STLC 2OIEA 4DUYO 5D5QA 2QM4A 3ZHSA 1L0NH 3ZEDA 1R3LC 1THZA 4ZOLA 1FKAO 3CCEV 5LYJA 3NXSA 4YY3B 1H2NA 3K5OA 2F4VB 1OCCC 4OGQB 1NI8A 1VQ6V 3ZHVA 4AI8A 1E79G 2Q7GA 4B7KA 5CMUA 3T4DA 3TGUH 3JCUZ 4NTWA 3EXAA 5C8YB 3P32A 3F5WC 2BTOA 3ETQA 3OMNB 4X66B 3T1HB 1ENVA 2WLLB 4I0XA 3THOA 2LP7A 4X1IA 3L71H 5EBLC 2IU3A 5H9CA 3L73H 4LNUA 2WLHA 4O4HA 2YI8A 2ZXWC 3H1JH 3K08A 1SKVA 5JCOA 4MTOA 5EZYA 1RSOB 2YXYA 1E1RG 1KD1W 1Z5VA 4ICGA 2UXXA 4NVPA 5CBGA 1MSDA 4R6ZA 4Q6GA 3P30A 5BY1A 3RYCA 2XTAA 3D3QA 3UT5B 3ZCCA 1IBKO 1FJGB 1XOUA 1OCOB 3Q4HA 3RN4A 2QA4V 4LH6A 1XL6A 3WB0A 2OCCB 2ZE7A 3PJSK 3UCSC 4DV2B 1SZXA 2W6IG 5L3BA 4HAMA 4AQYB 3ETGA 1VQOV 1W59A 4HNAB 1GM9A 4JI7B 1AI4A 1DTOA 4X20A 1PP9H 1NS1A 3KG2A 3ZRSA 3HKCB 2G38A 3TETA 4GUNA 2AZ2A 4EB6A 2QWOB 1J5EO 3T1CA 1XDCA 1GN2A 4UFZA 5E79Z 3ZRWA 3ABKB 4JPRA 4PDMA 1EN6A 4PELA 1U97A 1VIBA 4JYYA 3DC6A 4IYHA 4DR1O 1PV0A 5DM6V 1IXMA 2ITDC 1VEWA 1K34A 1Y76B 1K73W 3E22B 1Q86W 3PN1A 2QKAA 2QM7A 1RPOA 3T1YB 1WA8A 5KHIA 3FB5C 3H9VA 3CRQA 4LF5B 2QJ1A 3L9DA 3EHBB 1YVWA 4HZ3A 4MW3A 1I0HA 1YSCA 1XMQB 5J2TA 1F4NA 1URFA 1I7FA 3F5TA 4PA6A 2PZSA 4BR6A 4YXWG 2DYSC 3B09A 2YC0A 4WFAV 3OEEG 3SYQA 1K5SA 2CH7B 2XAJA 1XMOB 5H6QA 1H2SB 3ZHQA 4GKKB 5BR8B 4OX9B 1NH2D 2HP8A 2QR4A 5K1PA 4LBEC 1V55B 1R3IC 1XNRB 1JMKC 2CUGA 2EIMB 2Z5UA 5L3EA 2P5OA 3W7XA 3JATA 3OUFA 1XILA 4DV6B 3BRCA 3IGAC 4GKJB 1M4UA 1WLEA 4I50B 4CZZA 2H94A 4X65O 5IT9N 3CS5A 3C90A 2QWNB 2X6CA 3AG2B 5ITZB 1LUWA 3ASOC 5LP6B 2YIBA 3UO3A 1PL4A 1ZTEA 3T2MA 2IU0A 2GBOA 1K4CC 4O2BA 4JV5B 4TT3G 2LO1A 1EZJA 4CH4A 1CPYA 3ZMVA 4PV1B 4XDKA 1PPJH 1KYOF 2QM8A 4DV7B 3BA8A 1N33B 4H13B 1VQNV 1MNGA 4BIZA 2P6JA 3N2KB 3CCUV 4ZI7A 2ZQMA 2HG5C 3SGIA 4I9QA 4X88A 1TUBB 4CH3A 2GTAA 4WFHA 1K4DC 1N34O 5IYCO 2KKWA 2QKCA 4WCEV 2X6AA 4DR7O 1TVKA 1ZWIC 3RYIB 3VQVA 3I5DA 4TQDA 1X59A 1MABG 3B2EE 4DUYB 4CS3A 1DF4A 1HNZO 2AHZA 4U3FH 2F93B 4UB6Z 4FZ1A 3K04A 5EYPB 1NTZH 2FL4A 1QR9A 1K97A 4FLWA 4QNHB 3K3WA 3TCUA 2RMKB 1PNMA
chains in the Genus database with same CATH topology
1VP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VP7 A; 
#chains in the Genus database with same CATH topology
 2R9A A;  4DUZ O;  2ZNJ A;  3QO8 A;  2EX3 A;  4MVQ A;  3D8C A;  4D7T A;  5IJ9 A;  4QPK A;  1AI7 A;  4B3R O;  2AHY A;  4ASU G;  1F7Y A;  1DF5 A;  3IJ4 A;  3CCJ V;  2M7W A;  2YIB D;  2Q69 A;  3ETE A;  3K5M A;  2JEX A;  4U3J A;  1NT2 B;  3G71 V;  1Q8I A;  2OTL V;  1YF2 A;  4PA7 A;  4P30 A;  2QDO A;  1SES A;  2ZCE A;  1I08 A;  1GN6 A;  2RN9 A;  1ZUQ A;  1XRE A;  3FD9 A;  1QVG U;  1YIJ V;  2EUL A;  4FFB A;  4JAU A;  5LHH A;  4U7O A;  3KCY A;  3E2E A;  5GTH Z;  1BGY H;  2XAS A;  4Z1M G;  3T4Z A;  1IBK B;  1FAF A;  2P4V A;  3UO2 A;  1JCH A;  4CS4 A;  4AIL C;  4JZG A;  3N2G B;  1TAE A;  3U11 A;  1JFF B;  3CSX A;  3D36 C;  2YXL A;  4EKW A;  4DV0 O;  2PI5 A;  2XAF A;  1Q3E A;  4YJ3 B;  4JF3 A;  1KKC A;  1OCO C;  4JTD B;  4LF6 O;  3K9S A;  2MW2 B;  1Q6I A;  1Q81 W;  5LHG A;  2BSK B;  1K92 A;  2DQ0 A;  2OCC C;  3O65 A;  1R1B A;  5CA0 A;  1NR7 A;  2N05 A;  1H2M A;  2BOC C;  4BW9 A;  3B4S A;  3AG1 B;  2Q7H A;  5EIB C;  1SER A;  2FTK A;  1J5E B;  4K8Z A;  4BIU A;  5FL7 G;  4KL1 A;  3CC4 V;  2HJD A;  2RCV A;  2GV9 A;  1M9N A;  3UKM A;  3DXR A;  4J42 A;  3SPC A;  3H01 A;  2JIZ G;  5LYJ B;  1B06 A;  4DR1 B;  3AG3 C;  2HEP A;  4PI0 A;  3JAK B;  1FS0 G;  3ABK C;  1AVM A;  1M57 B;  1NZ6 A;  4R50 A;  2C2A A;  3BCC H;  1D5N A;  3P3N A;  4X62 O;  4C7U A;  1XQ8 A;  1SC5 B;  5LOV B;  3SYO A;  2CTQ A;  2EZP A;  3AG4 C;  4GLX A;  2E75 B;  1GN4 A;  3CWB H;  2A7W A;  1XNQ O;  1N36 O;  3R65 A;  2LFR A;  5CB4 B;  1HWY A;  1NTK H;  5IY5 B;  2P4K A;  3JD0 A;  2HJF C;  1QNM A;  2DQ3 A;  3CEI A;  4O2A B;  4I5S A;  2GUZ B;  1UJW B;  2YEV A;  2WLI B;  3FAV B;  1SRY A;  3GWK C;  2JS5 A;  3RYF B;  2IW5 A;  1EZV H;  3GB7 C;  1NKD A;  4LWS B;  3STZ C;  2QGN A;  2WA4 A;  4I4T A;  2BTQ B;  1H38 A;  1PKX A;  3K03 A;  4RO2 A;  1CP9 A;  4DW0 A;  3RYC B;  3JAL A;  4UVC A;  5JH7 A;  3G67 A;  4O4L A;  1AJN A;  2GDS A;  4G28 B;  4O4J A;  3K06 A;  3RYH A;  4NXM O;  4OXS A;  5CBH A;  4RUF A;  3ETD A;  1VQM V;  4KFM A;  2QWQ B;  3E8G A;  1TA8 A;  2R70 A;  3RW0 A;  4EEQ A;  5B66 Z;  4IIJ B;  1V55 C;  4F4L A;  1S3J A;  4UCR A;  2W6J G;  2EIM C;  1MZE A;  1P49 A;  1QQC A;  1V54 B;  2VQE O;  3TXQ A;  5B1B B;  3JCZ A;  3I56 V;  2JGD A;  4X65 B;  4EB6 B;  3OUS A;  3OD4 A;  4DXW A;  3ASN B;  2IJJ A;  4FFK A;  4K8X A;  1AI5 A;  3CCQ V;  5GW7 A;  1EBO A;  4LP8 A;  5LL6 Y;  5LXT B;  3AG2 C;  5JQG B;  3FX7 A;  1VQ9 V;  5LP6 C;  4GT1 A;  1K8A W;  5LMN O;  1S0V A;  4Q20 A;  4JYA B;  4MW8 A;  4JI3 O;  1OCZ B;  3K5N A;  4I55 B;  4PDV A;  1Y4M A;  2ATK C;  3BY6 A;  3JAR A;  4MSW C;  5KAF Z;  2DWD C;  1PNL A;  5FLX N;  4J10 A;  4DK0 A;  2F43 G;  1N34 B;  1HDJ A;  3JD2 A;  3G6E V;  3SDL A;  4IL6 Z;  2Y69 B;  4DR7 B;  2QE7 G;  4CC5 A;  1JJO A;  5B3S B;  3AK2 A;  4P9O A;  3JAS A;  4U7N A;  1W0J G;  3E8F A;  5JVD A;  1ZLZ A;  2PYL A;  1OJH A;  4O4I A;  3ABL B;  1G8M A;  5BXZ A;  3ZJZ A;  3CCV V;  4FLU A;  2UUC O;  5B1A B;  4J9Y B;  1WNS A;  3H1L H;  4DUZ B;  2CGO A;  4OPH A;  3OR6 C;  5IYZ A;  4FLX A;  3B8N A;  3ZIA G;  1FXV A;  4TOI A;  1O9H A;  3IC9 A;  4NB5 A;  4PHZ A;  3LUT B;  5LGT A;  4JI6 O;  2CTW A;  4CS2 A;  1J95 A;  5KLV H;  4DV1 B;  3ZHU A;  4TV8 B;  5D5P A;  4ZIB A;  1DLB A;  1YI2 V;  1JJ2 U;  4DV4 O;  1K7D A;  3CXC U;  4RAI A;  2XOK G;  3ZMZ A;  1U96 A;  2NNU A;  2XT9 A;  1N32 O;  3QNE A;  1BZK A;  2E76 B;  1F51 A;  3L70 H;  4O2B B;  4LCU C;  1JPX A;  5IWA O;  2NR5 A;  2OIG A;  3MHS C;  4FZ0 A;  4B3T B;  2ZDI C;  4FJC C;  1NJI W;  1QBZ A;  4JZ2 A;  2OT5 A;  2R72 A;  4B3M B;  4PJ0 Z;  4YJ2 A;  4DV0 B;  1VF5 B;  2UUA O;  4QGP A;  2DOS A;  2QWP B;  4LF6 B;  2EIN C;  2WLN A;  3JD4 A;  4DV5 B;  2UXD O;  3ZN1 A;  4W4L A;  1A32 A;  4LFA O;  4QPJ A;  1IUR A;  4TQF A;  4FLV A;  3HKD B;  3QF7 A;  1R73 A;  2R9I A;  1HNW O;  2Y48 A;  3K79 A;  3AG1 C;  3JD3 A;  3E8B A;  4JYB A;  1AR4 A;  4NTY A;  4X1Y A;  5KMG B;  3VBB A;  2ZIO A;  5CA1 A;  1RPR A;  3RWR D;  4LF8 O;  3N27 A;  3B40 A;  1E1Q G;  1CEZ A;  1LR1 A;  4LR3 A;  4J11 A;  2YIA A;  3ABU A;  4X62 B;  1BSM A;  1OZ0 A;  1YJ9 V;  2A9H A;  4TUY A;  3CCS V;  3J80 N;  1WPX A;  1M57 C;  1XNQ B;  5L3G A;  5IJ9 B;  1N36 B;  5EBW C;  1X4T A;  4FIP C;  1GM7 A;  1XHZ A;  2XAG A;  2FYU H;  3SYC A;  3LSS A;  1VQK V;  4A5U B;  4ZKI A;  2Q68 A;  4IYI A;  3FFQ A;  4H33 A;  4BIO A;  3W7T A;  4R7C A;  5IY5 C;  3CX5 F;  3J7A U;  2EIL B;  1WPB A;  4E4E A;  5DEC A;  3HKE B;  2ZR2 A;  4X9Q A;  1KU9 A;  5IJ0 B;  2EJ7 A;  4ZHQ A;  5H2F Z;  5KHK A;  3CRC A;  2JEU A;  2N74 A;  2JVD A;  5L3D A;  2X6B A;  5JWP A;  1MOF A;  2VWJ A;  5LA6 A;  4NXM B;  1YTF B;  4JTC B;  4LF9 O;  5EC1 C;  1CXZ B;  3EVK A;  3X2Q B;  5JJE B;  1Q43 A;  2RJZ A;  2LW7 A;  1R3J C;  3K0D A;  1FFX A;  4X1K A;  4DK1 A;  1MSW D;  3FB8 C;  1SQG A;  2VQE B;  3HKB A;  3SJC C;  4F6R A;  1SQQ H;  3L72 H;  4FM2 A;  4JI8 O;  3ZMU A;  4ZBM A;  1V54 C;  3RGB A;  5B1B C;  1QLE B;  2CK3 G;  2K1E A;  4IHJ B;  4JI5 B;  3GVM A;  1ZSP A;  2Z3Y A;  5CBF A;  3A0H Z;  3ASN C;  2A06 H;  3WG7 B;  1GM8 A;  1Y74 B;  5LMN B;  1LUV A;  1DK1 A;  3SPG A;  4XDJ A;  4JI3 B;  4J80 A;  2WA3 A;  3OTF A;  3E8H A;  4Z1V A;  1AP6 A;  1Q7Y W;  4DRX B;  1ZX3 A;  3FKS G;  1KUQ A;  4DV3 O;  1OCZ C;  4XDL A;  5C8Y A;  1FXK C;  1Y67 A;  2WLL A;  5A9G A;  3AG7 A;  2P22 C;  2OYQ A;  2CTR A;  2FML A;  3CJH A;  3U0Z A;  4JI0 O;  3VOU A;  2B1G A;  2YEV B;  2N04 A;  3W7W A;  4CH6 A;  1XBL A;  2VRZ A;  3RT3 C;  3BVO A;  1HNX B;  2Y69 C;  2DWE C;  2UUB O;  2YI9 A;  5B3S C;  3CPW U;  1ZAU A;  1SF9 A;  5JH7 B;  4KHP O;  2Q0A A;  4O4L B;  5IE9 A;  5KAI Z;  4K35 A;  3OFN G;  2UUC B;  3D36 A;  4DR3 O;  3I55 V;  4I9W A;  1RFY A;  3UT5 A;  5C93 A;  3CRA A;  5JJN B;  3JAW B;  3SJB C;  2Q0O C;  4CH5 A;  1K3E A;  4JI6 B;  4MVR A;  1SQF A;  3CHX A;  3RFR A;  3AK3 A;  1S76 D;  1M1K W;  2DJV A;  1QR8 A;  2PUS A;  2WWW A;  1MG1 A;  1I5X A;  4NKG B;  3OAA G;  2WPD G;  4LH7 A;  2PY5 A;  2JGD B;  2D3O W;  3ZX6 A;  4TV9 B;  2BE3 A;  3RVZ A;  2UXB O;  1GMG A;  4DR5 O;  1B6Q A;  4FM1 A;  1N32 B;  3CCM V;  1XEQ A;  4UUJ C;  5FPR A;  2RDC A;  2K9P A;  4G2K A;  2IJK A;  2PI4 A;  3B77 A;  2ZE5 A;  4PA9 A;  5BMV B;  4YHH O;  2YUA A;  5AG2 A;  1KP3 A;  1Q90 D;  1V9P A;  2HFE C;  3QO7 A;  2WLM A;  2UUA B;  3CC7 V;  1VF6 C;  2NLJ C;  4NTX A;  3ZRV A;  3IFX A;  1Y76 A;  3H1I H;  3UQ8 A;  2ZE6 A;  2E3C A;  3E22 A;  2CTP A;  1JVM A;  4B08 A;  3R66 A;  4LFA B;  3LNN A;  3OW2 U;  2H8P C;  2HVJ C;  2Q67 A;  4X66 O;  1GKF A;  4PD4 F;  4MVS A;  1WP7 A;  3GWO A;  2AW9 A;  5KHJ A;  3TXS A;  2HLD G;  4DW1 A;  3J81 N;  4R8C A;  5JVD B;  3G80 A;  4FLT A;  1WB8 A;  3BFR A;  2QTO A;  3K5L A;  1MA1 A;  4KUM A;  1Y6X A;  5FNV B;  1PM9 A;  5KX5 B;  2DN9 A;  1VQ8 V;  4H0L B;  4LF8 B;  1BQ0 A;  1FPO A;  1SA0 A;  3B8M A;  2XUM A;  2CH7 A;  4UVB A;  1YEW A;  1R6N A;  2CGN A;  5GON A;  5EIB D;  3ZS8 C;  5KUK A;  2YID A;  4ZOL B;  1SQX H;  4P2Z A;  2GHY A;  4J7Z A;  1NU1 H;  4MS2 A;  4X64 O;  3APQ A;  4MVM A;  4W4K A;  5F2V O;  4IT5 A;  4JI7 O;  1SQB H;  4GYC B;  4JI2 O;  2EIJ B;  5L3C A;  1FXH A;  2Y4T A;  1KB9 F;  4I50 A;  1GTO A;  4I0X B;  1Q5O A;  1G4Y B;  1H2K A;  2RNB A;  2O57 A;  4X1I B;  1US6 A;  1IVS A;  4LNU B;  5ITZ A;  2DE0 X;  4O4H B;  2EIL C;  5LP6 A;  3OMA B;  2YSU B;  3RVY A;  4QJF B;  1SET A;  4DO2 A;  3M7M X;  2DW4 A;  5EZY B;  4LF9 B;  3H1H H;  5LMU O;  4FMT A;  2ODM A;  3E86 A;  1K33 A;  2HHH O;  2LGQ A;  3E89 A;  3WB1 A;  1H8H G;  1KKD A;  2B5U A;  3E35 A;  2KG7 A;  3Q4H B;  3X2Q C;  4DR4 O;  1AB3 A;  3N2K A;  3QG5 A;  3L75 H;  4X8A A;  4WF9 V;  4JI8 B;  1TUB A;  4PDL A;  3NR7 A;  4UV8 A;  3W7S A;  1NH2 B;  3IAY A;  4X20 B;  4ABM A;  3RYI A;  3OM3 B;  2FKX A;  4X1Y B;  3OMI B;  1QLN A;  1QU7 A;  3K9A A;  4X89 A;  5EYP A;  4JAA A;  3ZRW B;  2ZIN A;  1IBL O;  5LHI A;  4RQF A;  3WG7 C;  2R9R B;  1SZT A;  4UCS A;  4UV9 A;  2JJ1 G;  1PD3 A;  4J9Z B;  4UCV A;  4DV3 B;  1WN7 A;  1M5I A;  4WBN A;  3JD1 A;  1EN5 A;  4JI0 B;  3K57 A;  3DSQ A;  1I5Y A;  4DV6 O;  1WA8 B;  5J9P C;  5KHG A;  3QTC A;  3ASO B;  3H1K H;  2B9Z A;  2X7R B;  4LF7 O;  2EZO A;  3M8A A;  1N4C A;  4MTG A;  2UUB B;  2LGW A;  5IYD O;  3BPZ A;  3CYO A;  2BOB C;  2ZR3 A;  2Y4U A;  4L87 A;  4KHP B;  4G27 B;  2ZDI A;  4I7Z B;  2EJR A;  3BEH A;  5LA6 B;  5J2T B;  4DR3 B;  3ZBH A;  3E83 A;  1HNZ B;  1VMG A;  4Z2W A;  1IX9 A;  4UXN A;  3N2G A;  3K58 A;  1D2D A;  2V4D A;  5H6R A;  1JFF A;  1B3Q A;  1DGS A;  4EFB A;  1SQV H;  4YJ3 A;  4GX2 A;  3QVN A;  1YJW V;  3HKB B;  3OR7 C;  2EIK B;  2BSK A;  1AR1 B;  3UM7 A;  1MMM A;  4EFE A;  2UXB B;  1N0N A;  2Y0P A;  4B3R B;  1FYJ A;  2XAQ A;  3JAT B;  3OEH G;  3LDC A;  2QSA A;  1BHA A;  3AK1 A;  4PA4 A;  4DR2 O;  2LQT A;  4DYL A;  3HR0 A;  4UCU A;  5IYB O;  4LF4 O;  4YHH B;  2V7Q G;  2WSS G;  2HVK C;  3ICX A;  3JAK A;  1I94 O;  1JX9 A;  2D2C B;  2PYJ A;  2OCH A;  2GSM B;  4XBF A;  2JRI A;  5JJJ B;  1RM1 B;  2ITC C;  5LOV A;  1ROP A;  2L6L A;  3ABT A;  3IC7 A;  2A79 B;  4FM0 A;  2XND G;  1YCI A;  4PDR A;  3SJA C;  3CJH B;  5CB4 A;  1GK9 A;  2ZNI A;  5HFL A;  3ZHR A;  2W0X A;  1XL4 A;  2F95 B;  4O2A A;  5L3F A;  2GUZ A;  1M56 B;  4KXR A;  4ZI7 B;  2WLI A;  3FAV A;  3SPI A;  1N0J A;  1KP2 A;  3RYF A;  4JI4 O;  3DTU B;  2P90 A;  1NBM G;  4LWS A;  4UCO A;  1GO3 F;  2IH3 C;  4PA3 A;  1LNQ A;  2BTQ A;  2W0F C;  1YXB A;  2GTS A;  5HFM A;  4RQE A;  1TVK B;  4FLY A;  1FFT B;  4J7J A;  3CME V;  1ZL8 A;  3CE2 A;  1PL0 A;  4B7E A;  1M93 A;  4H44 B;  1BQZ A;  3ZRX A;  1H2L A;  1AR5 A;  1F4M A;  2M6Y A;  4LFB O;  4UB8 Z;  2PTM A;  3EFF K;  2P67 A;  1NVP D;  1HR0 O;  4X64 B;  1P7B A;  3ZHT A;  3MAQ A;  4PI2 A;  4P9P A;  1KQS U;  3CMA V;  1S5L Z;  4IIJ A;  2RQ6 A;  2YIC A;  1AJQ A;  4JI2 B;  3VQY A;  3JYC A;  4HYO A;  3SR2 C;  2Q5Z A;  2H3O A;  3ABM B;  2QEX V;  2JS3 A;  3C3T A;  1WB7 A;  1NTM H;  1BS3 A;  2EIJ C;  4U3J B;  1WJZ A;  3BAA A;  3AG3 B;  1L8D A;  1B04 A;  3LSU A;  3WB2 A;  4FLZ A;  5GTI Z;  3JSN A;  1YHQ V;  5LXT A;  4JYC A;  5LMU B;  4WFF A;  5JQG A;  5A2Q N;  4FFB B;  5K1X A;  1EN4 A;  3AG4 B;  3G6B A;  4K0K O;  2HHH B;  2JDI G;  5JCO C;  1XHX A;  4JTA B;  4I55 A;  1FXK A;  3K0G A;  4GX1 A;  1JOY A;  4DR4 B;  2VQF O;  4WFG A;  1YDX A;  4FPP A;  2IJH A;  4MTF A;  1P7G A;  3A8T A;  4B3S O;  3OGI B;  5DED A;  1HP8 A;  1S77 D;  2ZM6 O;  2KSD A;  2F23 A;  4K3A A;  2V1D A;  1VQ4 V;  3AEI A;  3LDD A;  5CA0 B;  1F23 A;  3OTO O;  1IDS A;  2F66 C;  1AP5 A;  4MVO A;  2WLJ A;  1COW G;  1OCR B;  2X0L A;  3APO A;  4NXN O;  3A0R A;  1YIT V;  3SJQ C;  2UXC O;  4N21 A;  1SA0 B;  4JAV A;  1UPG A;  5J2U A;  4WFE A;  4FK5 C;  5GON B;  1IBM O;  1SS3 A;  1IBL B;  1VF7 A;  4MVU A;  3DXR B;  3O9O A;  4LFC O;  2ARH A;  4FVM A;  5B1O A;  1R6T A;  2YXH A;  3DC5 A;  2XAH A;  1BHB A;  3CD6 V;  3QO5 A;  3W7U A;  5KHH A;  2P7T C;  4BW5 A;  4OPA A;  5IDJ A;  1IXB A;  3K59 A;  3D3I A;  4TV8 A;  1NQT A;  4LF7 B;  3HB3 B;  4LC1 A;  3FB6 C;  3RBZ A;  1H2G A;  4RWU A;  4J41 A;  2PGG A;  1G6U A;  5CN0 A;  2L35 A;  5B5E Z;  1TUE B;  1VF6 A;  2CDY A;  3S3X A;  4I4T B;  2VWK A;  3OE7 G;  3OT7 A;  3A2F A;  1P4R A;  2HKO A;  1RSO A;  4DR6 O;  2FB5 A;  2QWR B;  4JYA O;  2NN4 A;  4NR1 A;  2CAZ C;  1KC8 W;  3JAL B;  1AIL A;  1NR1 A;  2ZE8 A;  2IBZ H;  2KG7 B;  2KB1 A;  4O4J B;  3RYH B;  1TGO A;  1OV9 A;  2UU9 O;  3ABL C;  2ZT9 B;  4GCZ A;  4TSF G;  5LBQ A;  4JAS A;  5B1A C;  3HKD A;  1L0L H;  1S5H C;  2EIK C;  3WU2 Z;  5EC2 C;  3FYI B;  2DYR B;  4DR2 B;  4UCT A;  3JAM N;  4HNA A;  4DV4 B;  1UFI A;  2Z0A A;  2A0L A;  3CXH F;  4LF4 B;  3CP1 A;  4JI1 O;  5KUM A;  3HKC A;  2CE4 A;  4GX5 A;  2ADP A;  5KMG A;  1I94 B;  2E5L O;  1EFR G;  2OTJ V;  2WAM A;  1BMF G;  2ADQ B;  1KEC A;  2VS0 A;  1YZB A;  5IWA B;  1OCC B;  3MDS A;  3BHP A;  2HR3 A;  4CC6 A;  4WBN B;  3BAB A;  2MK3 A;  1O9G A;  1GRJ A;  1JR9 A;  4YY3 O;  3DGE A;  5B1N A;  2F4V O;  1K9M W;  1VQP V;  4DV1 O;  1RM1 C;  3JAR B;  2UXD B;  3CB2 A;  2BCC H;  4JI4 B;  3T1H O;  2ZXW B;  1PNK A;  3KKY A;  1Q6U A;  3HKE A;  1WAZ A;  3SYA A;  1M56 C;  3SPJ A;  1ORQ C;  5IJ0 A;  1HNW B;  3JAS B;  1VQ5 V;  1Y66 A;  1JQ0 A;  2EIN B;  3VQX A;  2PF4 E;  4B3T O;  4LFB B;  4QIW F;  4B3M O;  4O4I B;  1Q82 W;  1HR0 B;  2QKS A;  1AI6 A;  3U10 A;  4DV5 O;  4GZR B;  1KMI Z;  2IH1 C;  3L74 H;  2WLK A;  5IYZ B;  1G1X B;  1FJG O;  1BE3 H;  4YIO A;  1NVP B;  2A3Q A;  2LFS A;  4DV2 O;  3KCX A;  2B1I A;  4AQY O;  2ZD9 A;  1MZF A;  1YJN V;  5EBM C;  1BCC H;  4MTX A;  4IHJ A;  1W0K G;  3ABM C;  3OGC C;  5EK0 A;  1T5E A;  4D6T H;  2Y0I A;  3ML0 A;  3ZMS A;  1S5J A;  2JK5 C;  5DN6 G;  3CC2 V;  4WFB V;  3P3P A;  1Y74 A;  4K0K B;  4D7S A;  1K5Q A;  4N23 A;  1EM1 A;  1JA8 A;  4BWA A;  2OWO A;  5KA6 A;  4UVA A;  4DRX A;  4L8J A;  2VQF B;  4CBC A;  4AHC A;  1W2B U;  1QCE A;  1GN3 A;  4YJ2 B;  4KP4 A;  3JSL A;  5LGN A;  4B3S B;  4J7K A;  5E1A C;  2Q8V A;  4MVZ A;  3VQW A;  3A0B Z;  2XHB A;  2ZM6 B;  5H5N A;  1WP8 A;  2Q6A A;  2YS8 A;  1S72 V;  3T1Y O;  1KBH A;  3OTO B;  3WFV A;  1VQL V;  4LF5 O;  1YTF D;  2IJI A;  4NXN B;  1Z5W A;  4F6E A;  2UXC B;  2JGU A;  1BT8 A;  5TIS Z;  4RUE A;  2EBO A;  2ZKO A;  1Q6H A;  1ZL8 B;  1IBM B;  2DYS B;  2F1M A;  2Q9L A;  1GH6 A;  1OCR C;  2LJ2 A;  1XMQ O;  1AJP A;  4H37 A;  1M90 W;  4LFC B;  4BAY A;  4QE7 A;  3ZN0 A;  1H8E G;  5CA1 B;  1QLE C;  3JAW A;  3CRM A;  5BZB A;  1XI1 A;  1QVF U;  5CA3 A;  3KZI Z;  2E74 B;  1XMO O;  2AGA A;  1HW7 A;  4GKK O;  5BR8 O;  4OX9 O;  4TUY B;  5FPO A;  1BL8 A;  3TK1 A;  2KQX A;  3HPL C;  2UXN A;  4TV9 A;  1XNR O;  3ZMT A;  1VAR A;  5LGU A;  2LW1 A;  1FD9 A;  4TWK A;  2ILM A;  1Z2G A;  3SYP A;  3M99 B;  4MT8 A;  4JI5 O;  4GKJ O;  2P06 A;  3MHH C;  2IM9 A;  1D5A A;  3FYE B;  1IZ3 A;  2JJ2 G;  3CRR A;  5KA5 A;  4QE9 A;  1OHH G;  4HBN A;  5BMV A;  1P84 F;  1SQP H;  4DR6 B;  2ZIM A;  4ZHQ B;  2YDE A;  3SPH A;  1FXK B;  3LSQ A;  2ETN A;  3BA9 A;  2AZ0 A;  3FB7 C;  2QTS A;  4JV5 O;  4YIP A;  3LNM B;  4JGS A;  2Q4P A;  4IGG A;  2UU9 B;  3MD0 A;  1RP3 B;  1R3K C;  3CCL V;  3LDE A;  3G4S V;  1FFX B;  4X1K B;  1N8R W;  3F7V C;  2Q7E A;  4DV7 O;  1N33 O;  2Q73 A;  1VQ7 V;  4F6R B;  1R6K A;  3CCR V;  4GX0 A;  2AXT Z;  1XUQ A;  4E2L A;  3TJT A;  1HNX O;  1ARO P;  3C3S A;  4JI1 B;  2DYR C;  4DR5 B;  5FNV A;  3S3W A;  5J2U B;  1L1F A;  1GAX A;  1VP7 A;  2DMX A;  5KX5 A;  2E5L B;  4NYK A;  1QHT A;  3F7Y C;  3STL C;  2OIE A;  4DUY O;  5D5Q A;  2QM4 A;  3ZHS A;  1L0N H;  3ZED A;  1R3L C;  1THZ A;  4ZOL A;  1FKA O;  3CCE V;  5LYJ A;  3NXS A;  4YY3 B;  1H2N A;  3K5O A;  2F4V B;  1OCC C;  4OGQ B;  1NI8 A;  1VQ6 V;  3ZHV A;  4AI8 A;  1E79 G;  2Q7G A;  4B7K A;  5CMU A;  3T4D A;  3TGU H;  3JCU Z;  4NTW A;  3EXA A;  5C8Y B;  3P32 A;  3F5W C;  2BTO A;  3ETQ A;  3OMN B;  4X66 B;  3T1H B;  1ENV A;  2WLL B;  4I0X A;  3THO A;  2LP7 A;  4X1I A;  3L71 H;  5EBL C;  2IU3 A;  5H9C A;  3L73 H;  4LNU A;  2WLH A;  4O4H A;  2YI8 A;  2ZXW C;  3H1J H;  3K08 A;  1SKV A;  5JCO A;  4MTO A;  5EZY A;  1RSO B;  2YXY A;  1E1R G;  1KD1 W;  1Z5V A;  4ICG A;  2UXX A;  4NVP A;  5CBG A;  1MSD A;  4R6Z A;  4Q6G A;  3P30 A;  5BY1 A;  3RYC A;  2XTA A;  3D3Q A;  3UT5 B;  3ZCC A;  1IBK O;  1FJG B;  1XOU A;  1OCO B;  3Q4H A;  3RN4 A;  2QA4 V;  4LH6 A;  1XL6 A;  3WB0 A;  2OCC B;  2ZE7 A;  3PJS K;  3UCS C;  4DV2 B;  1SZX A;  2W6I G;  5L3B A;  4HAM A;  4AQY B;  3ETG A;  1VQO V;  1W59 A;  4HNA B;  1GM9 A;  4JI7 B;  1AI4 A;  1DTO A;  4X20 A;  1PP9 H;  1NS1 A;  3KG2 A;  3ZRS A;  3HKC B;  2G38 A;  3TET A;  4GUN A;  2AZ2 A;  4EB6 A;  2QWO B;  1J5E O;  3T1C A;  1XDC A;  1GN2 A;  4UFZ A;  5E79 Z;  3ZRW A;  3ABK B;  4JPR A;  4PDM A;  1EN6 A;  4PEL A;  1U97 A;  1VIB A;  4JYY A;  3DC6 A;  4IYH A;  4DR1 O;  1PV0 A;  5DM6 V;  1IXM A;  2ITD C;  1VEW A;  1K34 A;  1Y76 B;  1K73 W;  3E22 B;  1Q86 W;  3PN1 A;  2QKA A;  2QM7 A;  1RPO A;  3T1Y B;  1WA8 A;  5KHI A;  3FB5 C;  3H9V A;  3CRQ A;  4LF5 B;  2QJ1 A;  3L9D A;  3EHB B;  1YVW A;  4HZ3 A;  4MW3 A;  1I0H A;  1YSC A;  1XMQ B;  5J2T A;  1F4N A;  1URF A;  1I7F A;  3F5T A;  4PA6 A;  2PZS A;  4BR6 A;  4YXW G;  2DYS C;  3B09 A;  2YC0 A;  4WFA V;  3OEE G;  3SYQ A;  1K5S A;  2CH7 B;  2XAJ A;  1XMO B;  5H6Q A;  1H2S B;  3ZHQ A;  4GKK B;  5BR8 B;  4OX9 B;  1NH2 D;  2HP8 A;  2QR4 A;  5K1P A;  4LBE C;  1V55 B;  1R3I C;  1XNR B;  1JMK C;  2CUG A;  2EIM B;  2Z5U A;  5L3E A;  2P5O A;  3W7X A;  3JAT A;  3OUF A;  1XIL A;  4DV6 B;  3BRC A;  3IGA C;  4GKJ B;  1M4U A;  1WLE A;  4I50 B;  4CZZ A;  2H94 A;  4X65 O;  5IT9 N;  3CS5 A;  3C90 A;  2QWN B;  2X6C A;  3AG2 B;  5ITZ B;  1LUW A;  3ASO C;  5LP6 B;  2YIB A;  3UO3 A;  1PL4 A;  1ZTE A;  3T2M A;  2IU0 A;  2GBO A;  1K4C C;  4O2B A;  4JV5 B;  4TT3 G;  2LO1 A;  1EZJ A;  4CH4 A;  1CPY A;  3ZMV A;  4PV1 B;  4XDK A;  1PPJ H;  1KYO F;  2QM8 A;  4DV7 B;  3BA8 A;  1N33 B;  4H13 B;  1VQN V;  1MNG A;  4BIZ A;  2P6J A;  3N2K B;  3CCU V;  4ZI7 A;  2ZQM A;  2HG5 C;  3SGI A;  4I9Q A;  4X88 A;  1TUB B;  4CH3 A;  2GTA A;  4WFH A;  1K4D C;  1N34 O;  5IYC O;  2KKW A;  2QKC A;  4WCE V;  2X6A A;  4DR7 O;  1TVK A;  1ZWI C;  3RYI B;  3VQV A;  3I5D A;  4TQD A;  1X59 A;  1MAB G;  3B2E E;  4DUY B;  4CS3 A;  1DF4 A;  1HNZ O;  2AHZ A;  4U3F H;  2F93 B;  4UB6 Z;  4FZ1 A;  3K04 A;  5EYP B;  1NTZ H;  2FL4 A;  1QR9 A;  1K97 A;  4FLW A;  4QNH B;  3K3W A;  3TCU A;  2RMK B;  1PNM A; 
#chains in the Genus database with same CATH homology
 1VP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...