1VP7A

Crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
68
structure length
68
Chain Sequence
ARPLPQDFETALAELESLVSAMENGTLPLEQSLSAYRRGVELARVCQDRLAQAEQQVKVLEGDLLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Exodeoxyribonuclease VII small subunit E.C.3.1.11.6 (NP_881400.1) from Bordetella pertussis at 2.40 A resolution
rcsb
source organism Bordetella pertussis tohama i
molecule tags Hydrolase
molecule keywords exodeoxyribonuclease VII small subunit
total genus 26
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.11.6: Exodeoxyribonuclease VII.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02609 Exonuc_VII_S Exonuclease VII small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1040 Mainly Alpha Orthogonal Bundle Helix Hairpins Exonuclease VII, small subunit 1vp7A00
1VP7A
chains in the Genus database with same CATH superfamily
1JQ0A 2EIJB 5LHGA 2GSMB 4DR7O 2IH1C 4KHPB 3A0RA 1QNMA 2XT9A 5B1AB 4FJCC 1WP7A 4I0XB 4JI8B 3SYPA 3J81N 2ATKC 1FAFA 4DR6B 3GWKC 4DV5O 1H2KA 2ILMA 1R6NA 4A5UB 5IY5B 4AHCA 4DYLA 4UVBA 1DTOA 4LFAO 1OZ0A 2IW5A 2IU0A 1PKXA 4JPRA 1PP9H 2N05A 3RW0A 1OCOB 2JRIA 4K8XA 2ZT9B 4JI2O 2F43G 1YF2A 2CH7B 5CA0B 4B3TB 1NR1A 3CX5F 2UXBO 3ZRVA 4UVCA 1M1KW 1NQTA 2B9ZA 2IJHA 4BWAA 3UM7A 4YY3O 4RAIA 2Q0AA 2A06H 1N36B 1MZEA 4WF9V 1IBLO 5KX5B 1YTFB 2WSSG 3CXCU 5K1XA 4F6EA 4FMTA 1HNZO 1H2MA 1D2DA 5EZYA 4IHJA 1HNWB 2R72A 4H37A 3ABMB 1IBKB 5KHHA 3AK2A 1VF7A 2ZR2A 5DEDA 5KHKA 1DF5A 2E3CA 4JZ2A 3U11A 4JAVA 1THZA 1ZL8A 4PJ0Z 2YEVB 1I5YA 3K0GA 1PV0A 3BPZA 3MHSC 3THOA 3H9VA 3ZMVA 2QDOA 1WLEA 2HVKC 1IXMA 4TV9A 3K5OA 4X66B 1S76D 2FYUH 4ZI7A 1YJNV 4B3MO 3JYCA 4PA9A 3B40A 4U3JB 2Q0OC 3SYAA 2V4DA 4TSFG 4LFCO 3CCUV 2IH3C 2PYLA 5LA6A 1M56B 2V1DA 2R9IA 1XMQB 1FXVA 3CCQV 4CZZA 4YJ3B 4L87A 2HKOA 2CTQA 3L70H 4IL6Z 4JI0O 2ZXWB 4GX0A 2Y48A 2RN9A 1GM8A 3K06A 4Q20A 1VQMV 2DWDC 4QGPA 3JSLA 1J5EB 2GDSA 4D6TH 4YHHB 3DXRA 1US6A 3BAAA 5LBQA 2ZE6A 4R50A 2HVJC 3OTOB 4X64B 2KKWA 1OV9A 1QU7A 4FLYA 1FKAO 4YIOA 1Q82W 3T2MA 1ZUQA 1SERA 1NZ6A 5DM6V 1CXZB 1FFXA 5B1AC 5JH7B 1FPOA 2H8PC 2P6JA 1XOUA 2W0FC 1N34O 4YJ2B 2B1GA 2WLJA 1S0VA 2WPDG 1QLEB 4LF8B 2BCCH 1R1BA 3FB7C 1BCCH 3K79A 4YXWG 5CMUA 2YI9A 2XAHA 4JAUA 1XNRO 1VQOV 3AK3A 1S5LZ 1AB3A 3SJCC 4Q6GA 3IAYA 1EZVH 4X65O 3I56V 2QKCA 1H2GA 1H2SB 4X9QA 5D5PA 2WLIA 1GAXA 2NNUA 4MSWC 1B06A 4DXWA 1RP3B 2Z5UA 1OCZC 3K03A 3K9AA 5ITZB 4DR2O 3APOA 4FK5C 4LWSB 1PM9A 2UUCO 5LGUA 3ZHVA 2Q68A 3FB8C 5KA6A 1P7GA 2OIEA 2WLLA 3AG4C 4YHHO 3OT7A 1MSWD 2A79B 3OTOO 2MK3A 1SETA 2HR3A 4G2KA 5BXZA 2E74B 2P67A 5CBFA 1VP7A 2OWOA 4HNAB 3CCRV 5JCOA 1SZXA 1GM9A 5JVDA 4DW1A 3BEHA 1ZX3A 2QM8A 1BZKA 3NXSA 4QNHB 2F93B 4UCRA 4GKKB 1KMIZ 2ZR3A 4O4LB 1GN3A 3CWBH 3STZC 1QVFU 2Z0AA 1U97A 4H44B 1KD1W 3HKEB 1TVKA 1QR8A 1E79G 2YIAA 1BHAA 1Q81W 1YIJV 3A2FA 4GLXA 2CDYA 3ETGA 3K59A 3A0HZ 2F95B 1TVKB 1WP8A 1COWG 3W7SA 4DR3B 1YJ9V 4O4LA 3KKYA 4PDVA 3LDEA 3ZIAG 5FPRA 2F4VO 3ABUA 4RQEA 4LBEC 2UXCO 4LC1A 1VF6C 3KZIZ 3IGAC 4DV2B 3HPLC 4TWKA 1RPRA 4WFEA 2JIZG 5LOVB 2DYRC 3GVMA 2AHYA 1Y6XA 1ZAUA 1NT2B 3EFFK 2V7QG 4CC6A 5FLXN 4MVMA 4ZOLB 1X59A 5B1OA 2UXBB 4MVSA 4DV3O 3MAQA 3SJAC 4UCTA 4H0LB 5HFMA 3PJSK 1N32B 3RVZA 3L71H 4X1IB 1F4MA 4LFBB 4ZBMA 1JCHA 4P30A 5LMNB 4KUMA 1VQKV 4QPKA 2L35A 2W0XA 3CC7V 4LNUB 4Z2WA 2EULA 4O4IA 5GW7A 1KYOF 5ITZA 2JVDA 1ENVA 2HG5C 1FS0G 4GT1A 2WLIB 4DV4B 1JPXA 1GN2A 3JAMN 3C3SA 2EINB 3NR7A 2Y0IA 4TQDA 2HJFC 3K04A 4ZHQB 4JYCA 5IE9A 2E5LO 2Y69B 2QWNB 3AG4B 4JI5B 1D5NA 4DV1O 2XTAA 4DR1O 2UU9O 3E35A 3WB1A 2KB1A 2GUZA 3ZBHA 4JYAB 4X66O 3IJ4A 3KCXA 3SPGA 2UXCB 3RVYA 3LDCA 3ETEA 3L74H 4D7TA 1JA8A 2EZPA 4I5SA 5JH7A 1FFXB 5GONB 2QSAA 3JD0A 1NH2D 3CRRA 1ZLZA 5IYBO 4X62B 3CMAV 4F6RA 4LF5O 1LUWA 1W2BU 1EBOA 2JJ2G 4DK0A 2E75B 4I50A 3AG2B 5H9CA 4CS4A 4D7SA 1UFIA 2Q73A 4DRXB 1PL4A 2YDEA 1RSOA 3DXRB 4JASA 1FXHA 1N32O 4FLVA 1GH6A 2G38A 3OEEG 4IIJB 2JGUA 1CEZA 4AQYB 3B09A 3HKDA 1GK9A 3E89A 4X1KB 4O2BB 4K0KO 4O4JA 5LA6B 4FM1A 4NR1A 3VOUA 1J95A 4KHPO 5GTIZ 5J2TA 5C8YA 4U3JA 2PI4A 2Y0PA 3BABA 1AROP 5JQGA 1N34B 4TV9B 5HFLA 3CRCA 1SQXH 4DR6O 1AI6A 1N33B 1I7FA 3G80A 3L73H 4KP4A 4DV1B 1E1QG 3CYOA 5JJJB 5LP6B 3CJHB 2YC0A 1XMOO 1ZL8B 1URFA 1GN4A 2XOKG 5LGTA 3FFQA 1HWYA 5LP6A 4LF4O 5B3SC 1BT8A 1BS3A 2YIBD 4ZIBA 1TUEB 4J7KA 4NVPA 3ZRXA 1AR1B 1P84F 1PD3A 4GUNA 1HNWO 5CB4A 4CH3A 5EYPA 4DV6B 3ZS8C 3H1JH 4B3RB 5KMGB 5J2TB 4Z1MG 5L3BA 1ZWIC 2HFEC 3ZX6A 3E22B 4TOIA 1IDSA 2QE7G 5CA1A 4CH5A 2OTLV 1OCCB 2AXTZ 4DR5O 3E83A 4JI4B 4UB8Z 3B77A 4O2BA 5KHIA 3TK1A 2H94A 1IBKO 5FNVB 5F2VO 1L1FA 1AR5A 3HKBA 4UXNA 3S3WA 2ADQB 1NJIW 2OCCC 4DV0O 3ABLC 4DRXA 3EXAA 3LNMB 1Q6UA 2PUSA 1Q7YW 1O9GA 5A9GA 2K1EA 4IGGA 5KLVH 4I50B 2F1MA 2ZDIC 3RT3C 2VWKA 2ZM6B 4U7NA 1AI4A 3X2QB 1XQ8A 2LW7A 2P90A 4GZRB 2QA4V 2UXNA 3OGCC 5BMVA 1N4CA 2Q69A 2GUZB 1YTFD 1K7DA 1S5JA 4U3FH 2HLDG 3LUTB 1GKFA 1Y76B 1WA8A 2RNBA 4FM2A 4JYBA 3T4ZA 5L3DA 1I08A 2Y4TA 3OGIB 4FLWA 3R65A 1AI5A 2QTOA 4DV6O 1M4UA 2RJZA 4NTXA 4LFBO 4ZKIA 1Q86W 1SA0B 5LMNO 4TT3G 2OYQA 3ZHRA 1HR0O 3CRQA 2WA3A 4X1YA 4GKJB 2IBZH 1BMFG 1HNXB 2ZNJA 1JMKC 1M9NA 1SQVH 1V9PA 3A8TA 1QR9A 3QG5A 1AJNA 1VIBA 4LNUA 4KFMA 4OX9B 2OT5A 2KQXA 3DC5A 2RDCA 5EC2C 1K34A 3ETQA 2JS3A 1F7YA 4GX1A 2KG7B 5H2FZ 4JZGA 2UXXA 1ZSPA 3G6BA 3HR0A 1MMMA 2WWWA 4DK1A 3G6EV 1XHZA 4H13B 1Y74A 4ZOLA 5CBHA 2NLJC 1R3KC 3RYFA 3WG7C 4JYAO 1KU9A 1K4DC 3DGEA 5H6RA 3CHXA 1UPGA 2DYSC 4X65B 4B3SB 1FJGB 2PI5A 1L0LH 1IURA 1E1RG 1XL4A 4TQFA 1GTOA 2QKSA 1MZFA 3IC7A 4WBNA 3QNEA 1P4RA 5EBLC 2ETNA 2EZOA 5LMUO 2LQTA 1OCRB 4PV1B 2WLHA 2IM9A 2P4KA 4MVOA 4FLZA 5LYJA 3JD4A 2JS5A 3SJBC 5IT9N 4LF5B 2BTQB 3J7AU 4JI1B 4WBNB 3B4SA 3ABLB 2QR4A 2A7WA 4I55B 3OW2U 5CN0A 1UJWB 3ZHQA 3ZRWA 5B1NA 1XMQO 1XL6A 2K9PA 4TV8A 2ITDC 1G8MA 4LH7A 4LF9B 2A3QA 1V54B 3BCCH 1N33O 1NU1H 3ZHSA 4DR4B 1PNKA 1H38A 1Y67A 3C3TA 3ZRSA 3K5NA 1Y74B 3UCSC 1SQFA 1Y4MA 4CS3A 4C7UA 3JCZA 3H1HH 3TXQA 1P49A 1M90W 4UCOA 4MT8A 4DV2O 2WLLB 4WFGA 5IY5C 3BA8A 3KG2A 4J42A 1M57B 1Z5WA 3SYCA 3QTCA 3OM3B 5IWAB 1W0JG 4J11A 4E2LA 4LH6A 4DW0A 4X1YB 3AK1A 2DN9A 3ABKB 3QF7A 4O4HA 2Q67A 1S72V 1XBLA 3CCSV 4DR5B 4QE9A 1SQPH 2AHZA 1G1XB 1VMGA 3VQYA 1MOFA 1WA8B 1Y76A 3FKSG 1XILA 3F5TA 2YS8A 4DV7O 3OR7C 3AEIA 2NR5A 2F23A 1F51A 4HZ3A 2ZKOA 3JAWB 4DR7B 1GMGA 2BOCC 1XI1A 2QWOB 3ABMC 4J9ZB 5KA5A 2EX3A 1QHTA 1Q5OA 3P3NA 4JI4O 4PD4F 2XAFA 2DQ0A 3C90A 3B8NA 3F5WC 2YI8A 2DE0X 1JVMA 5AG2A 1R3IC 2Y4UA 1BQ0A 1WPXA 2EIMC 2GBOA 3OMAB 5CA3A 1K33A 2QM4A 3HKBB 4MTGA 2W6JG 4UUJC 3M8AA 4QE7A 2CTRA 4P9OA 3RN4A 5FNVA 4MW8A 5B66Z 2DMXA 1B6QA 5JJNB 4IT5A 4DR1B 2UU9B 1DGSA 5FPOA 2R70A 4YJ3A 4LF6B 4DR2B 4NKGB 1K9MW 5EIBD 1Q3EA 3H1KH 1N36O 1AJQA 4G28B 1EN5A 3E22A 2WAMA 1AJPA 2P5OA 2LFRA 5BZBA 4GKKO 5KMGA 1YXBA 2VQEB 2N74A 5EYPB 4WCEV 2GV9A 1HNXO 3JAKA 2OCCB 5CB4B 5IDJA 3CEIA 1SZTA 3CXHF 1Q90D 1QVGU 2RQ6A 1N0JA 3G67A 4DV7B 4FFBB 1W59A 1Q8IA 4FPPA 5IJ0A 1G6UA 2GHYA 4L8JA 3N27A 4PA7A 2IU3A 1SC5B 1CPYA 3J80N 3LNNA 4IYIA 4K8ZA 1HR0B 2HP8A 5IJ9B 4IHJB 1JX9A 4B3MB 1R6KA 1QQCA 3JAKB 4EFBA 3CSXA 3U0ZA 2YSUB 1NR7A 3ZCCA 2YXLA 4CH4A 3T1CA 4LF4B 4O4JB 4RUEA 4J7JA 4CH6A 1NH2B 2AW9A 3OR6C 4PDRA 2DW4A 2OCHA 1DLBA 2XHBA 3HKDB 4B7KA 1F4NA 4MVRA 4IIJA 5J9PC 3L75H 1OCZB 4H33A 1N0NA 2A9HA 4JTAB 1FJGO 1XHXA 2F66C 4J9YB 4OGQB 3SR2C 4JI7O 2IJIA 2NN4A 2H3OA 1L8DA 4F6RB 4YIPA 2ITCC 2DOSA 3RYHB 1R3JC 2BSKA 1KUQA 3WG7B 4XBFA 2ZIMA 1VQNV 4DV0B 2YXYA 5C93A 1P7BA 3CPWU 3Q4HB 3LSUA 4WFBV 5L3EA 3SPCA 2FB5A 1VQ4V 1MA1A 4JV5B 1WN7A 2FMLA 4ZHQA 4NB5A 3ZN0A 2EIKB 3K3WA 4I7ZB 4DV4O 3M99B 2HJDA 3D3IA 5KAFZ 1MABG 1RPOA 2ZNIA 4JI2B 5BY1A 5FL7G 2EJRA 3I55V 5L3FA 2ZINA 1YJWV 4JI6O 3BFRA 5IWAO 1Z5VA 1IX9A 2P7TC 3WU2Z 3SDLA 1NI8A 4EFEA 1SQQH 2LP7A 2Z3YA 3SYOA 3CRMA 5LHHA 3KCYA 3K0DA 3JALB 2P22C 3JATB 3N2GA 2L6LA 3K5LA 2ARHA 3OMIB 3TJTA 1RFYA 1KBHA 2EIJC 4J10A 4X62O 5JCOC 2ADPA 4RWUA 2YIDA 4GX2A 5B3SB 3A0BZ 5LOVA 3I5DA 1VQLV 2GTAA 1H2NA 3ETDA 2RCVA 3OUFA 2N04A 3RGBA 4X20A 3UT5A 4I55A 5DN6G 2UUAO 1NVPD 3ASNB 2UXDB 1KKCA 4J41A 3E2EA 2C2AA 1XEQA 2BTQA 4FLXA 1OCOC 4EEQA 4RQFA 1KB9F 1M57C 2ZE5A 2ZE7A 1K3EA 4K0KB 2EILC 1NKDA 1OCCC 5D5QA 3F7VC 1YEWA 3FB5C 3FAVA 3W7WA 4B3SO 4UVAA 4MTFA 3HKEA 2ZQMA 2R9RB 4J80A 1WJZA 3GB7C 3TGUH 4PA3A 5B5EZ 3LSQA 4P9PA 1K97A 2QEXV 2LJ2A 3OMNB 2O57A 2QTSA 4RO2A 3BVOA 2YIBA 1ORQC 2FTKA 5KUKA 3EVKA 1X4TA 5JVDB 3ZMSA 3K57A 4FLTA 1AVMA 4HNAA 3E8GA 1XNQO 3RYFB 2X6CA 4E4EA 3X2QC 1I0HA 1JJ2U 4UCSA 3E8BA 5IYDO 2Q6AA 3D36A 2KG7A 4MVZA 1JFFB 3T1YO 1AILA 3RYIA 3ZHTA 2EIMB 4GCZA 4N21A 2MW2B 4OPHA 4JGSA 3UO3A 3B8MA 1I5XA 4DV5B 2EIKC 4LWSA 3K58A 4JI1O 1MSDA 4ABMA 4PI0A 1PPJH 3WB0A 1M56C 2WLKA 4U7OA 1I94O 1EN6A 3JASA 5IYZB 1FXKB 2GTSA 1IBMB 4XDJA 2X6BA 3H01A 1SRYA 3BY6A 2WLNA 4MW3A 4DR4O 2JEUA 4JI5O 1OJHA 4NXMO 3LSSA 3E8HA 3L72H 4DO2A 2CGNA 1PNMA 4HAMA 3UQ8A 3PN1A 3RBZA 3FYEB 5B1BB 2X6AA 3APQA 4JF3A 1YHQV 1JFFA 3VQWA 1YVWA 2JJ1G 4JTDB 2IJJA 3SPIA 3P3PA 4WFHA 1VQPV 5KUMA 2ZD9A 5BR8B 1K92A 2EBOA 3L9DA 2VQFB 2WLMA 5E1AC 3QO7A 1BHBA 1OHHG 3HB3B 1R3LC 5H5NA 3FD9A 2CE4A 1LR1A 1QLEC 4XDLA 3RFRA 3MHHC 3ML0A 1AP5A 1CP9A 1WAZA 2PTMA 3P32A 2LW1A 1S77D 2JEXA 1QLNA 4LP8A 2EILB 4XDKA 1VEWA 1K8AW 2W6IG 3K9SA 4GYCB 4PA6A 4MTOA 4JI3B 1EFRG 3SJQC 4PA4A 3WB2A 3FAVB 4ICGA 1WNSA 3OD4A 5CA1B 2BOBC 1BQZA 3R66A 1ZTEA 1WB7A 4TUYA 3STLC 2AZ2A 4ZI7B 3WFVA 1XREA 4CBCA 4NXMB 4DR3O 4FFKA 3AG3C 3GWOA 4QIWF 5A2QN 4X20B 4JV5O 2YEVA 3SYQA 3QO5A 1AP6A 5L3CA 2B5UA 2M7WA 3W7UA 3CJHA 5BR8O 1KC8W 3BRCA 3ABTA 5LGNA 1T5EA 4JAAA 3FX7A 4HYOA 4JI0B 4FIPC 4DV3B 1VF5B 5JQGB 2PGGA 5C8YB 4EB6A 2AGAA 5KX5A 4I4TA 2B1IA 2UXDO 3W7XA 1K4CC 1EZJA 3VBBA 4PDLA 2CK3G 4X1KA 5EC1C 4JYYA 1BGYH 2QM7A 4NYKA 4JI3O 2HHHB 1N8RW 2JGDA 1RM1B 2YXHA 2XNDG 1RSOB 1EM1A 1SS3A 2XUMA 5DECA 1AR4A 4BR6A 3P30A 2XASA 4LF9O 2LGQA 1PL0A 1IZ3A 1F23A 4B3TO 4DUYO 5J2UB 4UFZA 4FLUA 2LFSA 2QWPB 3Q4HA 4R8CA 2DYRB 1R73A 5GONA 5LXTB 1MG1A 3SPHA 2BSKB 5LXTA 2Q8VA 2JDIG 1IVSA 2XAQA 3RYHA 1YDXA 4NTWA 3U10A 1K73W 3JARA 4GX5A 4PELA 1QBZA 5J2UA 2VWJA 3H1IH 3N2KA 2UUBO 2RMKB 2PYJA 1FYJA 4I9WA 1LNQA 4FZ0A 5K1PA 1KP2A 1K5QA 1S3JA 1DK1A 2JGDB 2VRZA 4Z1VA 1JOYA 4DUZO 4OPAA 1VQ6V 2OTJV 3D3QA 2Q7HA 3MD0A 5EK0A 2DWEC 3JD1A 1V55C 3CS5A 2QKAA 2QJ1A 1XNQB 4FZ1A 3E8FA 4OX9O 5JJEB 2EINC 4N23A 4O4IB 1D5AA 2PF4E 4I4TB 1IBMO 4CC5A 2HHHO 4AILC 1TA8A 4EB6B 1NTZH 4X1IA 1HW7A 4B7EA 3M7MX 3IC9A 4LF7B 1HP8A 1YI2V 1VARA 5IJ9A 2F4VB 1KP3A 2CTPA 1V54C 3HKCA 3D8CA 4LCUC 2WA4A 3K08A 1XMOB 1SF9A 1O9HA 1J5EO 1TGOA 4LR3A 3OEHG 1TUBB 5IJ0B 1SESA 4K3AA 2IJKA 3AG2C 4FFBA 1U96A 4X64O 2PZSA 4J7ZA 3ZHUA 1SQBH 1EN4A 1YCIA 2OIGA 4B08A 2XAGA 4R7CA 2EJ7A 1WB8A 1Z2GA 1KQSU 1VQ9V 4TUYB 4LF6O 2CGOA 2FKXA 3K5MA 1M93A 3ZMUA 1A32A 2UUBB 3VQVA 2CUGA 4B3RO 4X88A 3CC2V 3ZMTA 1VQ8V 2LGWA 1FXKC 3ABKC 4DUZB 4MVUA 2VQEO 2P06A 1XUQA 5EBMC 4MVQA 1RM1C 4PHZA 2Q7EA 3RYCA 2A0LA 3T4DA 4ASUG 3ZJZA 4LFAB 1TAEA 4FM0A 5TISZ 4BAYA 1KKDA 4MTXA 1VQ7V 2YICA 1GM7A 5B1BC 1NS1A 2D2CB 1JJOA 4LF8O 2X7RB 4BIOA 5KHGA 3CCMV 1YZBA 4LF7O 1Q6IA 3E86A 5LP6C 2AZ0A 4O2AA 2CAZC 1B3QA 4BW5A 4X89A 3ASOB 2UUCB 3CC4V 1GRJA 5KAIZ 3CB2A 4UB6Z 4UV8A 3SGIA 3VQXA 3QO8A 2ZM6O 4AI8A 2R9AA 3UKMA 3JAWA 1KECA 2QGNA 5JWPA 3OAAG 3DSQA 2Q9LA 2Q7GA 3TXSA 3G71V 4O4HB 3JCUZ 4W4LA 1V55B 2E76B 1IBLB 2Q4PA 1FFTB 1L0NH 3H1LH 1FXKA 3T1YB 1IXBA 2ZXWC 5IYZA 3JASB 2X0LA 1H8EG 1NTMH 4OXSA 3W7TA 4PI2A 4GKJO 3OFNG 4NXNO 4CS2A 4JI7B 1BL8A 3AG7A 3DC6A 3JD3A 4W4KA 3RYIB 1PNLA 3MDSA 3QVNA 4YJ2A 2Y69C 4I9QA 3AG1B 1SQGA 5EBWC 2M6YA 4PDMA 2PY5A 3AG3B 3T1HO 5L3GA 1S5HC 4UCVA 3OTFA 3O65A 1HDJA 1YSCA 1H2LA 4BIZA 4DUYB 4JI6B 4HBNA 3CCLV 1R6TA 2LO1A 3JD2A 3ZEDA 2ODMA 4O2AB 3ZN1A 4QJFB 1I94B 3ZMZA 2ZIOA 4TV8B 3ICXA 1FD9A 2ZDIA 4RUFA 3BA9A 3ZRWB 3ASNC 2ZE8A 3DTUB 4LFCB 4R6ZA 3S3XA 1G4YB 1NBMG 1H8HG 2VQFO 2P4VA 3RYCB 1NTKH 1SKVA 1WPBA 4UV9A 4QPJA 5IYCO 1NVPB 1GN6A 5LMUB 1VQ5V 1M5IA 5LYJB 4G27B 2CTWA 3CCJV 1YITV 4X8AA 2QWRB 2Q5ZA 2XAJA 4BW9A 2UUAB 4UCUA 1K5SA 1XDCA 3CCVV 3SPJA 3CMEV 1B04A 3OE7G 1XNRB 4KL1A 5GTHZ 5KHJA 4NXNB 4KXRA 4K35A 2DJVA 5CBGA 3UT5B 4BIUA 4F4LA 4JTCB 3CP1A 1TUBA 2BE3A 2FL4A 2JK5C 2BTOA 3RWRD 3EHBB 3T1HB 1DF4A 4JI8O 3BHPA 1LUVA 3ASOC 3HKCB 1AI7A 3CCEV 2DYSB 3CRAA 1BE3H 3IFXA 5EZYB 1VF6A 1Q6HA 1Q43A 3JATA 3N2GB 4WFAV 3FYIB 1ROPA 1QCEA 3JALA 5H6QA 2YUAA 3TETA 4P2ZA 3LDDA 5LHIA 3CE2A 4MS2A 5LL6Y 2HEPA 1OCRC 4IYHA 2E5LB 4WFFA 5E79Z 4EKWA 1W0KG 5EIBC 2D3OW 1Y66A 1BSMA 2ZCEA 4YY3B 2CH7A 5CA0A 1JR9A 3OUSA 3TCUA 1SA0A 1MNGA 1HNZB 3JSNA 3FB6C 3N2KB 3O9OA 3G4SV 4AQYO 4FVMA 2VS0A 1GO3F 3AG1C 2KSDA 3D36C 3F7YC 3JARB 2QWQB 3CD6V 2DQ3A 4NTYA 5BMVB 3B2EE 4I0XA 3UO2A
chains in the Genus database with same CATH topology
1VP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VP7 A; 
#chains in the Genus database with same CATH topology
 1JQ0 A;  2EIJ B;  5LHG A;  2GSM B;  4DR7 O;  2IH1 C;  4KHP B;  3A0R A;  1QNM A;  2XT9 A;  5B1A B;  4FJC C;  1WP7 A;  4I0X B;  4JI8 B;  3SYP A;  3J81 N;  2ATK C;  1FAF A;  4DR6 B;  3GWK C;  4DV5 O;  1H2K A;  2ILM A;  1R6N A;  4A5U B;  5IY5 B;  4AHC A;  4DYL A;  4UVB A;  1DTO A;  4LFA O;  1OZ0 A;  2IW5 A;  2IU0 A;  1PKX A;  4JPR A;  1PP9 H;  2N05 A;  3RW0 A;  1OCO B;  2JRI A;  4K8X A;  2ZT9 B;  4JI2 O;  2F43 G;  1YF2 A;  2CH7 B;  5CA0 B;  4B3T B;  1NR1 A;  3CX5 F;  2UXB O;  3ZRV A;  4UVC A;  1M1K W;  1NQT A;  2B9Z A;  2IJH A;  4BWA A;  3UM7 A;  4YY3 O;  4RAI A;  2Q0A A;  2A06 H;  1N36 B;  1MZE A;  4WF9 V;  1IBL O;  5KX5 B;  1YTF B;  2WSS G;  3CXC U;  5K1X A;  4F6E A;  4FMT A;  1HNZ O;  1H2M A;  1D2D A;  5EZY A;  4IHJ A;  1HNW B;  2R72 A;  4H37 A;  3ABM B;  1IBK B;  5KHH A;  3AK2 A;  1VF7 A;  2ZR2 A;  5DED A;  5KHK A;  1DF5 A;  2E3C A;  4JZ2 A;  3U11 A;  4JAV A;  1THZ A;  1ZL8 A;  4PJ0 Z;  2YEV B;  1I5Y A;  3K0G A;  1PV0 A;  3BPZ A;  3MHS C;  3THO A;  3H9V A;  3ZMV A;  2QDO A;  1WLE A;  2HVK C;  1IXM A;  4TV9 A;  3K5O A;  4X66 B;  1S76 D;  2FYU H;  4ZI7 A;  1YJN V;  4B3M O;  3JYC A;  4PA9 A;  3B40 A;  4U3J B;  2Q0O C;  3SYA A;  2V4D A;  4TSF G;  4LFC O;  3CCU V;  2IH3 C;  2PYL A;  5LA6 A;  1M56 B;  2V1D A;  2R9I A;  1XMQ B;  1FXV A;  3CCQ V;  4CZZ A;  4YJ3 B;  4L87 A;  2HKO A;  2CTQ A;  3L70 H;  4IL6 Z;  4JI0 O;  2ZXW B;  4GX0 A;  2Y48 A;  2RN9 A;  1GM8 A;  3K06 A;  4Q20 A;  1VQM V;  2DWD C;  4QGP A;  3JSL A;  1J5E B;  2GDS A;  4D6T H;  4YHH B;  3DXR A;  1US6 A;  3BAA A;  5LBQ A;  2ZE6 A;  4R50 A;  2HVJ C;  3OTO B;  4X64 B;  2KKW A;  1OV9 A;  1QU7 A;  4FLY A;  1FKA O;  4YIO A;  1Q82 W;  3T2M A;  1ZUQ A;  1SER A;  1NZ6 A;  5DM6 V;  1CXZ B;  1FFX A;  5B1A C;  5JH7 B;  1FPO A;  2H8P C;  2P6J A;  1XOU A;  2W0F C;  1N34 O;  4YJ2 B;  2B1G A;  2WLJ A;  1S0V A;  2WPD G;  1QLE B;  4LF8 B;  2BCC H;  1R1B A;  3FB7 C;  1BCC H;  3K79 A;  4YXW G;  5CMU A;  2YI9 A;  2XAH A;  4JAU A;  1XNR O;  1VQO V;  3AK3 A;  1S5L Z;  1AB3 A;  3SJC C;  4Q6G A;  3IAY A;  1EZV H;  4X65 O;  3I56 V;  2QKC A;  1H2G A;  1H2S B;  4X9Q A;  5D5P A;  2WLI A;  1GAX A;  2NNU A;  4MSW C;  1B06 A;  4DXW A;  1RP3 B;  2Z5U A;  1OCZ C;  3K03 A;  3K9A A;  5ITZ B;  4DR2 O;  3APO A;  4FK5 C;  4LWS B;  1PM9 A;  2UUC O;  5LGU A;  3ZHV A;  2Q68 A;  3FB8 C;  5KA6 A;  1P7G A;  2OIE A;  2WLL A;  3AG4 C;  4YHH O;  3OT7 A;  1MSW D;  2A79 B;  3OTO O;  2MK3 A;  1SET A;  2HR3 A;  4G2K A;  5BXZ A;  2E74 B;  2P67 A;  5CBF A;  1VP7 A;  2OWO A;  4HNA B;  3CCR V;  5JCO A;  1SZX A;  1GM9 A;  5JVD A;  4DW1 A;  3BEH A;  1ZX3 A;  2QM8 A;  1BZK A;  3NXS A;  4QNH B;  2F93 B;  4UCR A;  4GKK B;  1KMI Z;  2ZR3 A;  4O4L B;  1GN3 A;  3CWB H;  3STZ C;  1QVF U;  2Z0A A;  1U97 A;  4H44 B;  1KD1 W;  3HKE B;  1TVK A;  1QR8 A;  1E79 G;  2YIA A;  1BHA A;  1Q81 W;  1YIJ V;  3A2F A;  4GLX A;  2CDY A;  3ETG A;  3K59 A;  3A0H Z;  2F95 B;  1TVK B;  1WP8 A;  1COW G;  3W7S A;  4DR3 B;  1YJ9 V;  4O4L A;  3KKY A;  4PDV A;  3LDE A;  3ZIA G;  5FPR A;  2F4V O;  3ABU A;  4RQE A;  4LBE C;  2UXC O;  4LC1 A;  1VF6 C;  3KZI Z;  3IGA C;  4DV2 B;  3HPL C;  4TWK A;  1RPR A;  4WFE A;  2JIZ G;  5LOV B;  2DYR C;  3GVM A;  2AHY A;  1Y6X A;  1ZAU A;  1NT2 B;  3EFF K;  2V7Q G;  4CC6 A;  5FLX N;  4MVM A;  4ZOL B;  1X59 A;  5B1O A;  2UXB B;  4MVS A;  4DV3 O;  3MAQ A;  3SJA C;  4UCT A;  4H0L B;  5HFM A;  3PJS K;  1N32 B;  3RVZ A;  3L71 H;  4X1I B;  1F4M A;  4LFB B;  4ZBM A;  1JCH A;  4P30 A;  5LMN B;  4KUM A;  1VQK V;  4QPK A;  2L35 A;  2W0X A;  3CC7 V;  4LNU B;  4Z2W A;  2EUL A;  4O4I A;  5GW7 A;  1KYO F;  5ITZ A;  2JVD A;  1ENV A;  2HG5 C;  1FS0 G;  4GT1 A;  2WLI B;  4DV4 B;  1JPX A;  1GN2 A;  3JAM N;  3C3S A;  2EIN B;  3NR7 A;  2Y0I A;  4TQD A;  2HJF C;  3K04 A;  4ZHQ B;  4JYC A;  5IE9 A;  2E5L O;  2Y69 B;  2QWN B;  3AG4 B;  4JI5 B;  1D5N A;  4DV1 O;  2XTA A;  4DR1 O;  2UU9 O;  3E35 A;  3WB1 A;  2KB1 A;  2GUZ A;  3ZBH A;  4JYA B;  4X66 O;  3IJ4 A;  3KCX A;  3SPG A;  2UXC B;  3RVY A;  3LDC A;  3ETE A;  3L74 H;  4D7T A;  1JA8 A;  2EZP A;  4I5S A;  5JH7 A;  1FFX B;  5GON B;  2QSA A;  3JD0 A;  1NH2 D;  3CRR A;  1ZLZ A;  5IYB O;  4X62 B;  3CMA V;  4F6R A;  4LF5 O;  1LUW A;  1W2B U;  1EBO A;  2JJ2 G;  4DK0 A;  2E75 B;  4I50 A;  3AG2 B;  5H9C A;  4CS4 A;  4D7S A;  1UFI A;  2Q73 A;  4DRX B;  1PL4 A;  2YDE A;  1RSO A;  3DXR B;  4JAS A;  1FXH A;  1N32 O;  4FLV A;  1GH6 A;  2G38 A;  3OEE G;  4IIJ B;  2JGU A;  1CEZ A;  4AQY B;  3B09 A;  3HKD A;  1GK9 A;  3E89 A;  4X1K B;  4O2B B;  4K0K O;  4O4J A;  5LA6 B;  4FM1 A;  4NR1 A;  3VOU A;  1J95 A;  4KHP O;  5GTI Z;  5J2T A;  5C8Y A;  4U3J A;  2PI4 A;  2Y0P A;  3BAB A;  1ARO P;  5JQG A;  1N34 B;  4TV9 B;  5HFL A;  3CRC A;  1SQX H;  4DR6 O;  1AI6 A;  1N33 B;  1I7F A;  3G80 A;  3L73 H;  4KP4 A;  4DV1 B;  1E1Q G;  3CYO A;  5JJJ B;  5LP6 B;  3CJH B;  2YC0 A;  1XMO O;  1ZL8 B;  1URF A;  1GN4 A;  2XOK G;  5LGT A;  3FFQ A;  1HWY A;  5LP6 A;  4LF4 O;  5B3S C;  1BT8 A;  1BS3 A;  2YIB D;  4ZIB A;  1TUE B;  4J7K A;  4NVP A;  3ZRX A;  1AR1 B;  1P84 F;  1PD3 A;  4GUN A;  1HNW O;  5CB4 A;  4CH3 A;  5EYP A;  4DV6 B;  3ZS8 C;  3H1J H;  4B3R B;  5KMG B;  5J2T B;  4Z1M G;  5L3B A;  1ZWI C;  2HFE C;  3ZX6 A;  3E22 B;  4TOI A;  1IDS A;  2QE7 G;  5CA1 A;  4CH5 A;  2OTL V;  1OCC B;  2AXT Z;  4DR5 O;  3E83 A;  4JI4 B;  4UB8 Z;  3B77 A;  4O2B A;  5KHI A;  3TK1 A;  2H94 A;  1IBK O;  5FNV B;  5F2V O;  1L1F A;  1AR5 A;  3HKB A;  4UXN A;  3S3W A;  2ADQ B;  1NJI W;  2OCC C;  4DV0 O;  3ABL C;  4DRX A;  3EXA A;  3LNM B;  1Q6U A;  2PUS A;  1Q7Y W;  1O9G A;  5A9G A;  2K1E A;  4IGG A;  5KLV H;  4I50 B;  2F1M A;  2ZDI C;  3RT3 C;  2VWK A;  2ZM6 B;  4U7N A;  1AI4 A;  3X2Q B;  1XQ8 A;  2LW7 A;  2P90 A;  4GZR B;  2QA4 V;  2UXN A;  3OGC C;  5BMV A;  1N4C A;  2Q69 A;  2GUZ B;  1YTF D;  1K7D A;  1S5J A;  4U3F H;  2HLD G;  3LUT B;  1GKF A;  1Y76 B;  1WA8 A;  2RNB A;  4FM2 A;  4JYB A;  3T4Z A;  5L3D A;  1I08 A;  2Y4T A;  3OGI B;  4FLW A;  3R65 A;  1AI5 A;  2QTO A;  4DV6 O;  1M4U A;  2RJZ A;  4NTX A;  4LFB O;  4ZKI A;  1Q86 W;  1SA0 B;  5LMN O;  4TT3 G;  2OYQ A;  3ZHR A;  1HR0 O;  3CRQ A;  2WA3 A;  4X1Y A;  4GKJ B;  2IBZ H;  1BMF G;  1HNX B;  2ZNJ A;  1JMK C;  1M9N A;  1SQV H;  1V9P A;  3A8T A;  1QR9 A;  3QG5 A;  1AJN A;  1VIB A;  4LNU A;  4KFM A;  4OX9 B;  2OT5 A;  2KQX A;  3DC5 A;  2RDC A;  5EC2 C;  1K34 A;  3ETQ A;  2JS3 A;  1F7Y A;  4GX1 A;  2KG7 B;  5H2F Z;  4JZG A;  2UXX A;  1ZSP A;  3G6B A;  3HR0 A;  1MMM A;  2WWW A;  4DK1 A;  3G6E V;  1XHZ A;  4H13 B;  1Y74 A;  4ZOL A;  5CBH A;  2NLJ C;  1R3K C;  3RYF A;  3WG7 C;  4JYA O;  1KU9 A;  1K4D C;  3DGE A;  5H6R A;  3CHX A;  1UPG A;  2DYS C;  4X65 B;  4B3S B;  1FJG B;  2PI5 A;  1L0L H;  1IUR A;  1E1R G;  1XL4 A;  4TQF A;  1GTO A;  2QKS A;  1MZF A;  3IC7 A;  4WBN A;  3QNE A;  1P4R A;  5EBL C;  2ETN A;  2EZO A;  5LMU O;  2LQT A;  1OCR B;  4PV1 B;  2WLH A;  2IM9 A;  2P4K A;  4MVO A;  4FLZ A;  5LYJ A;  3JD4 A;  2JS5 A;  3SJB C;  5IT9 N;  4LF5 B;  2BTQ B;  3J7A U;  4JI1 B;  4WBN B;  3B4S A;  3ABL B;  2QR4 A;  2A7W A;  4I55 B;  3OW2 U;  5CN0 A;  1UJW B;  3ZHQ A;  3ZRW A;  5B1N A;  1XMQ O;  1XL6 A;  2K9P A;  4TV8 A;  2ITD C;  1G8M A;  4LH7 A;  4LF9 B;  2A3Q A;  1V54 B;  3BCC H;  1N33 O;  1NU1 H;  3ZHS A;  4DR4 B;  1PNK A;  1H38 A;  1Y67 A;  3C3T A;  3ZRS A;  3K5N A;  1Y74 B;  3UCS C;  1SQF A;  1Y4M A;  4CS3 A;  4C7U A;  3JCZ A;  3H1H H;  3TXQ A;  1P49 A;  1M90 W;  4UCO A;  4MT8 A;  4DV2 O;  2WLL B;  4WFG A;  5IY5 C;  3BA8 A;  3KG2 A;  4J42 A;  1M57 B;  1Z5W A;  3SYC A;  3QTC A;  3OM3 B;  5IWA B;  1W0J G;  4J11 A;  4E2L A;  4LH6 A;  4DW0 A;  4X1Y B;  3AK1 A;  2DN9 A;  3ABK B;  3QF7 A;  4O4H A;  2Q67 A;  1S72 V;  1XBL A;  3CCS V;  4DR5 B;  4QE9 A;  1SQP H;  2AHZ A;  1G1X B;  1VMG A;  3VQY A;  1MOF A;  1WA8 B;  1Y76 A;  3FKS G;  1XIL A;  3F5T A;  2YS8 A;  4DV7 O;  3OR7 C;  3AEI A;  2NR5 A;  2F23 A;  1F51 A;  4HZ3 A;  2ZKO A;  3JAW B;  4DR7 B;  1GMG A;  2BOC C;  1XI1 A;  2QWO B;  3ABM C;  4J9Z B;  5KA5 A;  2EX3 A;  1QHT A;  1Q5O A;  3P3N A;  4JI4 O;  4PD4 F;  2XAF A;  2DQ0 A;  3C90 A;  3B8N A;  3F5W C;  2YI8 A;  2DE0 X;  1JVM A;  5AG2 A;  1R3I C;  2Y4U A;  1BQ0 A;  1WPX A;  2EIM C;  2GBO A;  3OMA B;  5CA3 A;  1K33 A;  2QM4 A;  3HKB B;  4MTG A;  2W6J G;  4UUJ C;  3M8A A;  4QE7 A;  2CTR A;  4P9O A;  3RN4 A;  5FNV A;  4MW8 A;  5B66 Z;  2DMX A;  1B6Q A;  5JJN B;  4IT5 A;  4DR1 B;  2UU9 B;  1DGS A;  5FPO A;  2R70 A;  4YJ3 A;  4LF6 B;  4DR2 B;  4NKG B;  1K9M W;  5EIB D;  1Q3E A;  3H1K H;  1N36 O;  1AJQ A;  4G28 B;  1EN5 A;  3E22 A;  2WAM A;  1AJP A;  2P5O A;  2LFR A;  5BZB A;  4GKK O;  5KMG A;  1YXB A;  2VQE B;  2N74 A;  5EYP B;  4WCE V;  2GV9 A;  1HNX O;  3JAK A;  2OCC B;  5CB4 B;  5IDJ A;  3CEI A;  1SZT A;  3CXH F;  1Q90 D;  1QVG U;  2RQ6 A;  1N0J A;  3G67 A;  4DV7 B;  4FFB B;  1W59 A;  1Q8I A;  4FPP A;  5IJ0 A;  1G6U A;  2GHY A;  4L8J A;  3N27 A;  4PA7 A;  2IU3 A;  1SC5 B;  1CPY A;  3J80 N;  3LNN A;  4IYI A;  4K8Z A;  1HR0 B;  2HP8 A;  5IJ9 B;  4IHJ B;  1JX9 A;  4B3M B;  1R6K A;  1QQC A;  3JAK B;  4EFB A;  3CSX A;  3U0Z A;  2YSU B;  1NR7 A;  3ZCC A;  2YXL A;  4CH4 A;  3T1C A;  4LF4 B;  4O4J B;  4RUE A;  4J7J A;  4CH6 A;  1NH2 B;  2AW9 A;  3OR6 C;  4PDR A;  2DW4 A;  2OCH A;  1DLB A;  2XHB A;  3HKD B;  4B7K A;  1F4N A;  4MVR A;  4IIJ A;  5J9P C;  3L75 H;  1OCZ B;  4H33 A;  1N0N A;  2A9H A;  4JTA B;  1FJG O;  1XHX A;  2F66 C;  4J9Y B;  4OGQ B;  3SR2 C;  4JI7 O;  2IJI A;  2NN4 A;  2H3O A;  1L8D A;  4F6R B;  4YIP A;  2ITC C;  2DOS A;  3RYH B;  1R3J C;  2BSK A;  1KUQ A;  3WG7 B;  4XBF A;  2ZIM A;  1VQN V;  4DV0 B;  2YXY A;  5C93 A;  1P7B A;  3CPW U;  3Q4H B;  3LSU A;  4WFB V;  5L3E A;  3SPC A;  2FB5 A;  1VQ4 V;  1MA1 A;  4JV5 B;  1WN7 A;  2FML A;  4ZHQ A;  4NB5 A;  3ZN0 A;  2EIK B;  3K3W A;  4I7Z B;  4DV4 O;  3M99 B;  2HJD A;  3D3I A;  5KAF Z;  1MAB G;  1RPO A;  2ZNI A;  4JI2 B;  5BY1 A;  5FL7 G;  2EJR A;  3I55 V;  5L3F A;  2ZIN A;  1YJW V;  4JI6 O;  3BFR A;  5IWA O;  1Z5V A;  1IX9 A;  2P7T C;  3WU2 Z;  3SDL A;  1NI8 A;  4EFE A;  1SQQ H;  2LP7 A;  2Z3Y A;  3SYO A;  3CRM A;  5LHH A;  3KCY A;  3K0D A;  3JAL B;  2P22 C;  3JAT B;  3N2G A;  2L6L A;  3K5L A;  2ARH A;  3OMI B;  3TJT A;  1RFY A;  1KBH A;  2EIJ C;  4J10 A;  4X62 O;  5JCO C;  2ADP A;  4RWU A;  2YID A;  4GX2 A;  5B3S B;  3A0B Z;  5LOV A;  3I5D A;  1VQL V;  2GTA A;  1H2N A;  3ETD A;  2RCV A;  3OUF A;  2N04 A;  3RGB A;  4X20 A;  3UT5 A;  4I55 A;  5DN6 G;  2UUA O;  1NVP D;  3ASN B;  2UXD B;  1KKC A;  4J41 A;  3E2E A;  2C2A A;  1XEQ A;  2BTQ A;  4FLX A;  1OCO C;  4EEQ A;  4RQF A;  1KB9 F;  1M57 C;  2ZE5 A;  2ZE7 A;  1K3E A;  4K0K B;  2EIL C;  1NKD A;  1OCC C;  5D5Q A;  3F7V C;  1YEW A;  3FB5 C;  3FAV A;  3W7W A;  4B3S O;  4UVA A;  4MTF A;  3HKE A;  2ZQM A;  2R9R B;  4J80 A;  1WJZ A;  3GB7 C;  3TGU H;  4PA3 A;  5B5E Z;  3LSQ A;  4P9P A;  1K97 A;  2QEX V;  2LJ2 A;  3OMN B;  2O57 A;  2QTS A;  4RO2 A;  3BVO A;  2YIB A;  1ORQ C;  2FTK A;  5KUK A;  3EVK A;  1X4T A;  5JVD B;  3ZMS A;  3K57 A;  4FLT A;  1AVM A;  4HNA A;  3E8G A;  1XNQ O;  3RYF B;  2X6C A;  4E4E A;  3X2Q C;  1I0H A;  1JJ2 U;  4UCS A;  3E8B A;  5IYD O;  2Q6A A;  3D36 A;  2KG7 A;  4MVZ A;  1JFF B;  3T1Y O;  1AIL A;  3RYI A;  3ZHT A;  2EIM B;  4GCZ A;  4N21 A;  2MW2 B;  4OPH A;  4JGS A;  3UO3 A;  3B8M A;  1I5X A;  4DV5 B;  2EIK C;  4LWS A;  3K58 A;  4JI1 O;  1MSD A;  4ABM A;  4PI0 A;  1PPJ H;  3WB0 A;  1M56 C;  2WLK A;  4U7O A;  1I94 O;  1EN6 A;  3JAS A;  5IYZ B;  1FXK B;  2GTS A;  1IBM B;  4XDJ A;  2X6B A;  3H01 A;  1SRY A;  3BY6 A;  2WLN A;  4MW3 A;  4DR4 O;  2JEU A;  4JI5 O;  1OJH A;  4NXM O;  3LSS A;  3E8H A;  3L72 H;  4DO2 A;  2CGN A;  1PNM A;  4HAM A;  3UQ8 A;  3PN1 A;  3RBZ A;  3FYE B;  5B1B B;  2X6A A;  3APQ A;  4JF3 A;  1YHQ V;  1JFF A;  3VQW A;  1YVW A;  2JJ1 G;  4JTD B;  2IJJ A;  3SPI A;  3P3P A;  4WFH A;  1VQP V;  5KUM A;  2ZD9 A;  5BR8 B;  1K92 A;  2EBO A;  3L9D A;  2VQF B;  2WLM A;  5E1A C;  3QO7 A;  1BHB A;  1OHH G;  3HB3 B;  1R3L C;  5H5N A;  3FD9 A;  2CE4 A;  1LR1 A;  1QLE C;  4XDL A;  3RFR A;  3MHH C;  3ML0 A;  1AP5 A;  1CP9 A;  1WAZ A;  2PTM A;  3P32 A;  2LW1 A;  1S77 D;  2JEX A;  1QLN A;  4LP8 A;  2EIL B;  4XDK A;  1VEW A;  1K8A W;  2W6I G;  3K9S A;  4GYC B;  4PA6 A;  4MTO A;  4JI3 B;  1EFR G;  3SJQ C;  4PA4 A;  3WB2 A;  3FAV B;  4ICG A;  1WNS A;  3OD4 A;  5CA1 B;  2BOB C;  1BQZ A;  3R66 A;  1ZTE A;  1WB7 A;  4TUY A;  3STL C;  2AZ2 A;  4ZI7 B;  3WFV A;  1XRE A;  4CBC A;  4NXM B;  4DR3 O;  4FFK A;  3AG3 C;  3GWO A;  4QIW F;  5A2Q N;  4X20 B;  4JV5 O;  2YEV A;  3SYQ A;  3QO5 A;  1AP6 A;  5L3C A;  2B5U A;  2M7W A;  3W7U A;  3CJH A;  5BR8 O;  1KC8 W;  3BRC A;  3ABT A;  5LGN A;  1T5E A;  4JAA A;  3FX7 A;  4HYO A;  4JI0 B;  4FIP C;  4DV3 B;  1VF5 B;  5JQG B;  2PGG A;  5C8Y B;  4EB6 A;  2AGA A;  5KX5 A;  4I4T A;  2B1I A;  2UXD O;  3W7X A;  1K4C C;  1EZJ A;  3VBB A;  4PDL A;  2CK3 G;  4X1K A;  5EC1 C;  4JYY A;  1BGY H;  2QM7 A;  4NYK A;  4JI3 O;  2HHH B;  1N8R W;  2JGD A;  1RM1 B;  2YXH A;  2XND G;  1RSO B;  1EM1 A;  1SS3 A;  2XUM A;  5DEC A;  1AR4 A;  4BR6 A;  3P30 A;  2XAS A;  4LF9 O;  2LGQ A;  1PL0 A;  1IZ3 A;  1F23 A;  4B3T O;  4DUY O;  5J2U B;  4UFZ A;  4FLU A;  2LFS A;  2QWP B;  3Q4H A;  4R8C A;  2DYR B;  1R73 A;  5GON A;  5LXT B;  1MG1 A;  3SPH A;  2BSK B;  5LXT A;  2Q8V A;  2JDI G;  1IVS A;  2XAQ A;  3RYH A;  1YDX A;  4NTW A;  3U10 A;  1K73 W;  3JAR A;  4GX5 A;  4PEL A;  1QBZ A;  5J2U A;  2VWJ A;  3H1I H;  3N2K A;  2UUB O;  2RMK B;  2PYJ A;  1FYJ A;  4I9W A;  1LNQ A;  4FZ0 A;  5K1P A;  1KP2 A;  1K5Q A;  1S3J A;  1DK1 A;  2JGD B;  2VRZ A;  4Z1V A;  1JOY A;  4DUZ O;  4OPA A;  1VQ6 V;  2OTJ V;  3D3Q A;  2Q7H A;  3MD0 A;  5EK0 A;  2DWE C;  3JD1 A;  1V55 C;  3CS5 A;  2QKA A;  2QJ1 A;  1XNQ B;  4FZ1 A;  3E8F A;  4OX9 O;  5JJE B;  2EIN C;  4N23 A;  4O4I B;  1D5A A;  2PF4 E;  4I4T B;  1IBM O;  4CC5 A;  2HHH O;  4AIL C;  1TA8 A;  4EB6 B;  1NTZ H;  4X1I A;  1HW7 A;  4B7E A;  3M7M X;  3IC9 A;  4LF7 B;  1HP8 A;  1YI2 V;  1VAR A;  5IJ9 A;  2F4V B;  1KP3 A;  2CTP A;  1V54 C;  3HKC A;  3D8C A;  4LCU C;  2WA4 A;  3K08 A;  1XMO B;  1SF9 A;  1O9H A;  1J5E O;  1TGO A;  4LR3 A;  3OEH G;  1TUB B;  5IJ0 B;  1SES A;  4K3A A;  2IJK A;  3AG2 C;  4FFB A;  1U96 A;  4X64 O;  2PZS A;  4J7Z A;  3ZHU A;  1SQB H;  1EN4 A;  1YCI A;  2OIG A;  4B08 A;  2XAG A;  4R7C A;  2EJ7 A;  1WB8 A;  1Z2G A;  1KQS U;  1VQ9 V;  4TUY B;  4LF6 O;  2CGO A;  2FKX A;  3K5M A;  1M93 A;  3ZMU A;  1A32 A;  2UUB B;  3VQV A;  2CUG A;  4B3R O;  4X88 A;  3CC2 V;  3ZMT A;  1VQ8 V;  2LGW A;  1FXK C;  3ABK C;  4DUZ B;  4MVU A;  2VQE O;  2P06 A;  1XUQ A;  5EBM C;  4MVQ A;  1RM1 C;  4PHZ A;  2Q7E A;  3RYC A;  2A0L A;  3T4D A;  4ASU G;  3ZJZ A;  4LFA B;  1TAE A;  4FM0 A;  5TIS Z;  4BAY A;  1KKD A;  4MTX A;  1VQ7 V;  2YIC A;  1GM7 A;  5B1B C;  1NS1 A;  2D2C B;  1JJO A;  4LF8 O;  2X7R B;  4BIO A;  5KHG A;  3CCM V;  1YZB A;  4LF7 O;  1Q6I A;  3E86 A;  5LP6 C;  2AZ0 A;  4O2A A;  2CAZ C;  1B3Q A;  4BW5 A;  4X89 A;  3ASO B;  2UUC B;  3CC4 V;  1GRJ A;  5KAI Z;  3CB2 A;  4UB6 Z;  4UV8 A;  3SGI A;  3VQX A;  3QO8 A;  2ZM6 O;  4AI8 A;  2R9A A;  3UKM A;  3JAW A;  1KEC A;  2QGN A;  5JWP A;  3OAA G;  3DSQ A;  2Q9L A;  2Q7G A;  3TXS A;  3G71 V;  4O4H B;  3JCU Z;  4W4L A;  1V55 B;  2E76 B;  1IBL B;  2Q4P A;  1FFT B;  1L0N H;  3H1L H;  1FXK A;  3T1Y B;  1IXB A;  2ZXW C;  5IYZ A;  3JAS B;  2X0L A;  1H8E G;  1NTM H;  4OXS A;  3W7T A;  4PI2 A;  4GKJ O;  3OFN G;  4NXN O;  4CS2 A;  4JI7 B;  1BL8 A;  3AG7 A;  3DC6 A;  3JD3 A;  4W4K A;  3RYI B;  1PNL A;  3MDS A;  3QVN A;  4YJ2 A;  2Y69 C;  4I9Q A;  3AG1 B;  1SQG A;  5EBW C;  2M6Y A;  4PDM A;  2PY5 A;  3AG3 B;  3T1H O;  5L3G A;  1S5H C;  4UCV A;  3OTF A;  3O65 A;  1HDJ A;  1YSC A;  1H2L A;  4BIZ A;  4DUY B;  4JI6 B;  4HBN A;  3CCL V;  1R6T A;  2LO1 A;  3JD2 A;  3ZED A;  2ODM A;  4O2A B;  3ZN1 A;  4QJF B;  1I94 B;  3ZMZ A;  2ZIO A;  4TV8 B;  3ICX A;  1FD9 A;  2ZDI A;  4RUF A;  3BA9 A;  3ZRW B;  3ASN C;  2ZE8 A;  3DTU B;  4LFC B;  4R6Z A;  3S3X A;  1G4Y B;  1NBM G;  1H8H G;  2VQF O;  2P4V A;  3RYC B;  1NTK H;  1SKV A;  1WPB A;  4UV9 A;  4QPJ A;  5IYC O;  1NVP B;  1GN6 A;  5LMU B;  1VQ5 V;  1M5I A;  5LYJ B;  4G27 B;  2CTW A;  3CCJ V;  1YIT V;  4X8A A;  2QWR B;  2Q5Z A;  2XAJ A;  4BW9 A;  2UUA B;  4UCU A;  1K5S A;  1XDC A;  3CCV V;  3SPJ A;  3CME V;  1B04 A;  3OE7 G;  1XNR B;  4KL1 A;  5GTH Z;  5KHJ A;  4NXN B;  4KXR A;  4K35 A;  2DJV A;  5CBG A;  3UT5 B;  4BIU A;  4F4L A;  4JTC B;  3CP1 A;  1TUB A;  2BE3 A;  2FL4 A;  2JK5 C;  2BTO A;  3RWR D;  3EHB B;  3T1H B;  1DF4 A;  4JI8 O;  3BHP A;  1LUV A;  3ASO C;  3HKC B;  1AI7 A;  3CCE V;  2DYS B;  3CRA A;  1BE3 H;  3IFX A;  5EZY B;  1VF6 A;  1Q6H A;  1Q43 A;  3JAT A;  3N2G B;  4WFA V;  3FYI B;  1ROP A;  1QCE A;  3JAL A;  5H6Q A;  2YUA A;  3TET A;  4P2Z A;  3LDD A;  5LHI A;  3CE2 A;  4MS2 A;  5LL6 Y;  2HEP A;  1OCR C;  4IYH A;  2E5L B;  4WFF A;  5E79 Z;  4EKW A;  1W0K G;  5EIB C;  2D3O W;  1Y66 A;  1BSM A;  2ZCE A;  4YY3 B;  2CH7 A;  5CA0 A;  1JR9 A;  3OUS A;  3TCU A;  1SA0 A;  1MNG A;  1HNZ B;  3JSN A;  3FB6 C;  3N2K B;  3O9O A;  3G4S V;  4AQY O;  4FVM A;  2VS0 A;  1GO3 F;  3AG1 C;  2KSD A;  3D36 C;  3F7Y C;  3JAR B;  2QWQ B;  3CD6 V;  2DQ3 A;  4NTY A;  5BMV B;  3B2E E;  4I0X A;  3UO2 A; 
#chains in the Genus database with same CATH homology
 1VP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...