1VP7A

Crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
68
structure length
68
Chain Sequence
ARPLPQDFETALAELESLVSAMENGTLPLEQSLSAYRRGVELARVCQDRLAQAEQQVKVLEGDLLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords exodeoxyribonuclease VII small subunit
publication title Crystal structure of Exodeoxyribonuclease VII small subunit E.C.3.1.11.6 (NP_881400.1) from Bordetella pertussis at 2.40 A resolution
rcsb
source organism Bordetella pertussis tohama i
total genus 26
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.11.6: Exodeoxyribonuclease VII.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02609 Exonuc_VII_S Exonuclease VII small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1040 Mainly Alpha Orthogonal Bundle Helix Hairpins Exonuclease VII, small subunit 1vp7A00
1VP7A
chains in the Genus database with same CATH superfamily
1DK1A 1L8DA 1HR0B 5KUKA 1KQSU 1BL8A 1JMKC 1B06A 3QNEA 3BFRA 2V1DA 5JVDB 2GSMB 4IL6Z 3JD0A 4H0LB 4CC5A 4I50A 2Y69C 1Q8IA 3ZHVA 1Q6HA 3LSSA 2QM7A 4YY3O 1XMOB 1VQ6V 1K92A 3WB0A 3STZC 3K5MA 4DR7O 3K9AA 1NR1A 1XHXA 3DC6A 1Q7YW 5J2UA 4R6ZA 3D3QA 3K03A 3UT5A 2KQXA 3SR2C 1NH2B 3JSLA 2QWQB 5KA6A 1YIJV 4J7JA 4E2LA 1PNLA 2X0LA 3G6EV 3ZMZA 3JAKA 4RO2A 2ZM6B 1N4CA 5B1OA 4UCOA 3HKBB 4JTCB 1Q3EA 1M9NA 1KU9A 3T2MA 3VBBA 5IDJA 3JD2A 1AI5A 4NR1A 4UVCA 2KKWA 2QGNA 3I56V 5KMGA 5LYJA 3FB8C 1MABG 2E75B 2IU0A 1QNMA 3T1YO 4JYAO 2OCHA 4J41A 5FLXN 2XTAA 4G28B 2A7WA 3LDCA 4MVOA 5EYPB 3DXRA 1SETA 1YEWA 2QKSA 1VQOV 4CH6A 3ZN0A 5CB4A 1JR9A 2FYUH 1R3IC 2E74B 5LHIA 2BOCC 2Y4TA 1U96A 1NQTA 2DWDC 2E5LO 4O4LB 4F6EA 3ICXA 4MW3A 2OTJV 1OZ0A 3ZJZA 1CXZB 4F6RB 4GX0A 3IFXA 1VQNV 2XUMA 4OPAA 5LP6B 3KCYA 3ZEDA 3OEEG 3CB2A 3JAWB 5LL6Y 4NTYA 4DR1O 4B3RB 1OV9A 4ICGA 3OFNG 4BAYA 2XHBA 1FAFA 2OT5A 2L35A 2Q0AA 1PNMA 2GHYA 5CA3A 2EJRA 2CE4A 3RYIA 2UUCB 2F4VO 2HJFC 1K73W 2F93B 5CBHA 3SPJA 4R7CA 1SESA 1NBMG 4B3MO 3F7VC 2HG5C 3HKEA 1ROPA 1NZ6A 4DV3O 2A06H 4KXRA 1BZKA 1WAZA 1H38A 3KCXA 4QIWF 3OMIB 1CEZA 3BY6A 3ABLB 1IDSA 2Z0AA 1AROP 3D8CA 3A2FA 4WCEV 2YEVA 4CC6A 3OTOB 2GDSA 3L9DA 1VARA 1TUBA 3UKMA 3CRMA 4JTAB 4Z2WA 1JOYA 4JI6O 1F7YA 3B40A 3OEHG 1FXHA 4LFBB 1X59A 2YUAA 2A9HA 1L0LH 3CPWU 4FLTA 4JI4O 4RQEA 4K8XA 4GX1A 4LF4B 4J9ZB 4X20A 3LNMB 2QWRB 3BA9A 1QCEA 4O4JA 1G1XB 2YIAA 1NT2B 3JALA 4LF7B 1G4YB 2IJKA 3QO5A 2WLMA 5JCOA 3CXCU 4NXNO 4DR6O 2ZR2A 4JAVA 3OD4A 3CCEV 1NVPD 5IYZA 3ASNC 1HDJA 4CH4A 4YHHB 3CJHA 4JI8O 1EZJA 2Q9LA 4FMTA 1N34O 1H8EG 1AVMA 3E86A 1XBLA 2CK3G 4AILC 4LFAO 1V9PA 1AI7A 2XT9A 3L75H 1ENVA 5B1NA 2UXXA 3CCSV 4I55A 4JI0B 2WLIA 3SJBC 1TUEB 1FFXA 4LNUB 2WA4A 4FJCC 3LDDA 5JVDA 3ABKC 1K8AW 2YS8A 2BSKA 2XNDG 1M4UA 2UUAO 3RYFA 1US6A 3AG4B 1MZEA 1B04A 3ETDA 3TGUH 4D7TA 2IH3C 3ZS8C 3APQA 4Z1VA 1BT8A 2AW9A 3W7WA 3ABMC 5CMUA 1BMFG 3TXSA 3ZRXA 3CEIA 1V55C 3QF7A 2YXHA 1K4CC 1G6UA 2IH1C 3LSUA 1M57C 4WFHA 1N32O 4HBNA 2FTKA 1IX9A 3AK2A 1QQCA 4RWUA 1Y76B 3RN4A 4XDKA 1NS1A 1M56C 5ITZA 2ADQB 3E83A 3K79A 4P9PA 4JGSA 4IYIA 3HKBA 4NYKA 2VQFO 1IXBA 1QLEB 1HR0O 1N36B 2JGUA 5AG2A 1Z2GA 3AG3C 1TVKB 4JI5B 1S0VA 5LHGA 1YZBA 1S77D 5JCOC 4ASUG 1Y74A 3KG2A 4DV2B 2RMKB 5GONB 2RCVA 3DSQA 4JYAB 1MSWD 2P7TC 4GX2A 4JZGA 2WWWA 5BY1A 2ZE7A 1SC5B 1FKAO 2UXCO 1XMOO 2ZE8A 3P32A 1ZX3A 4WFBV 1XI1A 4LC1A 4LF6B 4MVRA 1NVPB 1GM9A 3RGBA 4F6RA 1MNGA 3TETA 3SGIA 4DK1A 4PELA 4I0XB 4I9WA 1Q81W 3CCQV 3JAWA 4JYCA 4TUYB 1SQFA 4F4LA 1VQKV 2P22C 2ZM6O 3CRRA 3U10A 3H1HH 2ITCC 3SPGA 2EZPA 1F23A 5LXTB 2RQ6A 1OCCB 4ZI7B 4MS2A 4NTXA 3OTFA 5IJ9B 2NR5A 4JTDB 2WLNA 4QPJA 4B3TB 3BVOA 1UFIA 3N2GB 3RW0A 4K8ZA 5B5EZ 2UXDO 1SERA 1HWYA 1UJWB 1Y6XA 4LWSB 1AR1B 1VQ7V 3ML0A 2W0FC 1F4NA 3H1LH 1E79G 5L3FA 1GM8A 3T4DA 5KLVH 1WB8A 3HKCA 4MVZA 2WLKA 3SPCA 3ZBHA 1JX9A 5IWAB 3G80A 1G8MA 1I0HA 3EXAA 3F7YC 4H37A 3C3SA 1PL0A 2WLHA 3H1KH 5GW7A 3EVKA 2ETNA 4PDRA 3L70H 4PJ0Z 4B3RO 2CH7A 1QVGU 1VQ5V 1EN6A 4RAIA 4TV8B 5HFMA 1HNXB 1HNWO 1ZL8B 2JEXA 1D2DA 3JASA 1YJNV 4O2BA 3S3XA 2UUCO 4TQFA 2M6YA 1OCOB 4PA9A 1I7FA 1WLEA 3D36A 1OCZC 1I5YA 2JVDA 1CPYA 2JGDB 4MTOA 1SQVH 3LDEA 1NH2D 3UQ8A 2JDIG 5E1AC 4LFAB 1JVMA 3MAQA 3OR7C 2Q0OC 4HAMA 2R72A 1JFFB 4CZZA 1PL4A 2ZCEA 4YIPA 3H1IH 4DV0B 2RN9A 5LOVA 3AG2B 4I4TB 4K35A 5J2TA 4XBFA 3A0RA 2QDOA 1BQ0A 5DM6V 1K97A 1Q6UA 2A3QA 5EC1C 5FPRA 2ZNJA 5B3SB 3VQXA 3I5DA 4DRXA 4BW9A 4WFAV 1SS3A 5CA0A 3E8HA 3GWOA 1LUWA 4LF4O 2CGNA 2ITDC 3FD9A 4J10A 2AHYA 1QR8A 4LF7O 2JS3A 1M5IA 2HKOA 3ETEA 4FIPC 3RVYA 4Q6GA 3U0ZA 1URFA 4EB6B 4FFBB 2BTQA 4YHHO 5EZYB 4AQYB 2DYRC 2UU9B 5BMVB 1MG1A 2QA4V 2H94A 3SPIA 3UO3A 2LGWA 2XAHA 4TV9B 2EZOA 1SZTA 4D6TH 2OTLV 1KUQA 4JI0O 4DUZO 2IBZH 4W4KA 3IJ4A 3TCUA 2XASA 3B4SA 3RYCA 3N2KB 2ZT9B 1TVKA 4OPHA 2DJVA 4BIUA 4LH6A 4GYCB 1H2LA 1IBKB 3P3NA 4X1KB 1XILA 2QWOB 3E22A 4FLVA 2X6CA 1VMGA 1THZA 5HFLA 2EIJC 4TQDA 2CTPA 2GTAA 5IYCO 5LBQA 1M1KW 1SQPH 3D36C 2UXCB 5LGUA 2A0LA 3G6BA 5KAIZ 3OT7A 1K4DC 1SA0B 1NI8A 4DR3O 2OIGA 1YITV 3CYOA 2K1EA 3ETQA 2QSAA 1IZ3A 4TSFG 3MDSA 1E1RG 3GWKC 3K04A 1SQXH 3AK3A 3OGCC 1PNKA 4MVQA 2GBOA 1AJQA 3FAVB 4MTGA 2L6LA 4FM1A 4OXSA 4GCZA 5JJEB 3NR7A 1AI6A 4CBCA 4P9OA 2B9ZA 3CS5A 1E1QG 2ZDIA 2WLLA 3AG4C 2LW7A 4BWAA 2NNUA 3OW2U 4JI1B 2F23A 4X1YB 1K5QA 2F66C 5CN0A 3CD6V 2EIMB 2UXNA 4DO2A 1N36O 3D3IA 4O4HA 4PDVA 5KHGA 4GKKB 4FM0A 1EN4A 4HZ3A 3VQYA 4JI5O 2JS5A 4FLYA 3PJSK 1L1FA 4DV2O 2UXDB 2ODMA 4BIOA 4X66O 1FYJA 1BQZA 3E8FA 4LWSA 2GUZB 3C3TA 2YIDA 1YJWV 4W4LA 4U3JA 1ZUQA 2YI8A 4LF6O 5CA1B 1FJGB 2Y0IA 1SQBH 1PM9A 1B3QA 5BR8O 3G67A 3RBZA 4ZHQA 3H9VA 1QLEC 3VQVA 3ZHUA 3SYPA 1YF2A 1KKDA 4LF5O 2E3CA 1NTMH 1R3JC 2NLJC 2QR4A 1JPXA 1XL6A 1H8HG 2EINC 2P67A 1CP9A 4L87A 2OIEA 1XOUA 4JI2B 4AI8A 3RYHB 4TV8A 1N33B 2XOKG 3CXHF 1HNWB 4LF9B 3FX7A 4JASA 4RUFA 5BXZA 4CS4A 3AEIA 1QVFU 3JATB 4PA3A 3QVNA 4YJ3B 3ETGA 3CMEV 4B3TO 2BOBC 3K57A 1MZFA 3IC9A 5IJ0A 3O9OA 4K0KO 1AR4A 2OCCB 3JAMN 4JPRA 2DWEC 1JFFA 3HB3B 2ZE6A 1I94B 1I5XA 3WFVA 4Z1MG 2ZDIC 1IBMB 3RVZA 4MVUA 1MA1A 2AGAA 5IWAO 2PYLA 1MOFA 4DR4B 4HNAB 3A0BZ 3RWRD 1OCCC 1QR9A 1S3JA 3OUFA 2ZKOA 3R65A 1VQLV 4X89A 4DV1B 3C90A 4X64B 1OCRC 4JI3B 2VQEB 3S3WA 4UCRA 2Y48A 3WU2Z 2OWOA 4XDJA 2DE0X 2YXLA 3CRQA 4OGQB 4LH7A 1HNXO 1R1BA 1FXVA 2YDEA 1AP6A 2HLDG 1OHHG 3CC2V 4FLUA 5BMVA 1DLBA 2R9IA 4LCUC 3PN1A 1WP8A 4Q20A 2DOSA 3K58A 4UV8A 4TV9A 1YHQV 1JCHA 1S5HC 2ZINA 4J80A 4TWKA 1ZAUA 3HKDA 4DUZB 1AP5A 4DV0O 3N2KA 3FYEB 5B1BB 1EFRG 4MTFA 1EM1A 2EIKB 1V54B 2XAGA 4LF8B 4X1KA 3F5WC 1X4TA 2RJZA 2DW4A 2G38A 3IGAC 4X1IB 1PV0A 2B1GA 3DTUB 2P5OA 1OCOC 4LP8A 5JH7B 4CS3A 1RSOB 4WBNB 4J9YB 4MW8A 3CCUV 2JIZG 2W6JG 2LP7A 3FFQA 4DR3B 1GN4A 3K06A 4LBEC 1SQGA 2AHZA 3Q4HB 4PA7A 2M7WA 1WP7A 1SQQH 4J7ZA 3VOUA 1AR5A 2OYQA 4AQYO 2UU9O 1S5LZ 1K5SA 2UUBO 2LGQA 4B08A 4IGGA 3L74H 1PP9H 5B3SC 1BSMA 2ZR3A 4QE9A 2HR3A 5EK0A 3ZMUA 4XDLA 2HJDA 4YXWG 4A5UB 4DR2O 3ASOC 1YVWA 2Z3YA 5H6RA 2KG7B 3E8BA 1BE3H 2IJHA 4JV5B 5FNVB 1IBKO 2BCCH 4KHPB 3SPHA 2HEPA 3U11A 1FS0G 1VQ4V 5H6QA 4X66B 2YICA 5EYPA 2GUZA 4GLXA 2Q7GA 3MHSC 4R50A 3CX5F 2PGGA 1O9HA 3W7XA 1F4MA 1UPGA 2PF4E 4UB6Z 5D5PA 1K3EA 3T4ZA 4UB8Z 2DQ3A 4O4LA 1K9MW 5BR8B 4I50B 2H8PC 5B1AB 2YC0A 3JCUZ 4UVBA 1P84F 2LFSA 4U7NA 4ZOLB 4D7SA 5K1XA 5LP6A 4LF5B 3OM3B 1IBLB 2B5UA 4ABMA 1ORQC 2JJ1G 4CH3A 1KB9F 4UCVA 3F5TA 2CTQA 3RYHA 2A79B 3K0DA 3E8GA 2XAJA 1W59A 5J2UB 4JI1O 1AJNA 1XDCA 3UT5B 5B66Z 4GKKO 3CCMV 2PZSA 3M7MX 4DV6B 3ZIAG 3JAKB 3ABUA 3ZHTA 1P7GA 5CBFA 2B1IA 3M99B 4K0KB 3ZHQA 1FFTB 1Q86W 3K08A 1IVSA 3OAAG 1NTKH 1TA8A 1H2KA 5KMGB 4UV9A 1FJGO 1H2SB 1Q6IA 4KL1A 4FZ0A 3X2QB 2EBOA 2Y0PA 2Q7EA 3A8TA 1JJ2U 3SDLA 3DXRB 4GX5A 1GK9A 3AG1B 3NXSA 3RFRA 5F2VO 1AJPA 4LFCO 2YIBD 3TJTA 4JI2O 1N33O 2P4VA 4UFZA 5LMNB 4QE7A 1S72V 4LF9O 4NKGB 4EEQA 3KKYA 4H13B 3A0HZ 3N27A 3QO7A 1Q90D 1R6KA 4FPPA 5KHJA 1N0JA 1JJOA 4WF9V 4DXWA 2N74A 2HFEC 3ZRVA 2LO1A 2AZ2A 1DF4A 4N23A 4R8CA 1GTOA 4JF3A 3BEHA 4NB5A 2YSUB 1EBOA 1Q82W 1XQ8A 5LP6C 1SF9A 3T1CA 3RYIB 1WN7A 4DV7B 2XAQA 4PA4A 1I94O 3QTCA 1NR7A 4GKJB 1RP3B 4PDMA 2DN9A 1IBMO 5C8YB 4LNUA 3KZIZ 3HKEB 2DQ0A 5BZBA 3ABMB 3LNNA 4X65B 2K9PA 3ZX6A 2W6IG 4DR4O 4YJ2B 4X1IA 4RUEA 5DN6G 4U7OA 2VWKA 2DYSB 3ZRWB 2LJ2A 2YEVB 5GTHZ 4DUYB 1RSOA 3W7SA 4WBNA 1K33A 4DV1O 1M57B 4X64O 1PKXA 4JI3O 2VQEO 4PD4F 3R66A 2UXBB 4AHCA 3CRCA 3ABLC 3JD1A 2OCCC 3EFFK 2R9RB 4NVPA 3ABTA 4B7EA 3W7UA 3G4SV 3BHPA 4DYLA 1Y76A 4X20B 1R6NA 2F43G 2UUBB 3CCVV 3AG3B 3SYAA 1TGOA 2PTMA 1DTOA 1XNQO 2F95B 4KFMA 4DK0A 3UM7A 1YXBA 4NTWA 3JARB 2CDYA 3BPZA 2EJ7A 1AB3A 4DR2B 4B3SB 1GMGA 5IYZB 3HPLC 3JCZA 4I9QA 2X6BA 4YIOA 2KG7A 3ZCCA 1LR1A 2IU3A 1VF6A 4LF8O 1I08A 1Y66A 4CS2A 1ZSPA 4O2AB 5GONA 3WG7B 2D3OW 4N21A 4KP4A 4I55B 4IIJB 3JYCA 1FFXB 2XAFA 2IM9A 3BCCH 2P90A 4TT3G 1XHZA 2CTWA 2JJ2G 4JYBA 3SJCC 2BSKB 1A32A 3RYFB 3FB5C 4C7UA 4DW0A 5KUMA 3ZMTA 4I0XA 3SYCA 3L72H 4ZOLA 5B1BC 4EFEA 3IAYA 4MT8A 1ZWIC 1R73A 1V54C 2EIKC 2CAZC 5IY5B 1WNSA 4TUYA 1XMQB 2QEXV 2ZD9A 3FYIB 2JK5C 2WAMA 4RQFA 3E2EA 4L8JA 5LA6B 3K9SA 1R3KC 2CUGA 4BW5A 5LXTA 3ZN1A 4ZI7A 2Q68A 2PI4A 1GKFA 5IJ9A 4DV4O 4JV5O 4JAAA 3FKSG 3DC5A 5ITZB 4JAUA 2QM8A 4DW1A 3B77A 4QJFB 4E4EA 4KHPO 3JSNA 3LSQA 2H3OA 3N2GA 5E79Z 4BIZA 1KYOF 3CC4V 1H2MA 4OX9O 1GN6A 2KSDA 3WB1A 3ZMVA 2O57A 2Q8VA 3K0GA 3B8MA 4UCUA 4PV1B 2GTSA 4EFBA 1Y74B 2ZXWB 4PI0A 5LMUB 2PYJA 5KX5B 1RPOA 4FZ1A 1Y4MA 1MMMA 4PA6A 3SJAC 2MW2B 3UO2A 4X62B 1IBLO 3J81N 1XREA 1VF6C 4LFCB 1GRJA 1EZVH 1OCZB 1RM1B 2VRZA 4J42A 1K7DA 4MSWC 2EILB 1ZL8A 4H44B 1QHTA 2HP8A 2Y4UA 4UCSA 5DECA 2IW5A 5KHKA 1EN5A 5L3EA 2FB5A 4DV6O 5EBMC 1U97A 2JGDA 2IJJA 3M8AA 1NU1H 3BA8A 1J5EB 1XL4A 5B1AC 1IXMA 1WPXA 2YI9A 1HNZB 2Z5UA 2P06A 3BABA 3AK1A 3T1HB 2P4KA 1GN2A 1XNRB 4LR3A 1XUQA 5C8YA 1KECA 4I4TA 2IJIA 2N04A 4GZRB 4X9QA 2V4DA 2QWNB 4PHZA 3B2EE 2GV9A 4I5SA 5C93A 5TISZ 4YJ2A 5EC2C 1FXKB 1O9GA 5KA5A 1M90W 4P30A 3QG5A 3ZRWA 2R9AA 1TAEA 4GUNA 4O4IB 5JWPA 3CCLV 5IE9A 3SJQC 1T5EA 1GN3A 2DYRB 4IT5A 4IHJB 1RFYA 2QM4A 1NJIW 3HKCB 3QO8A 2Q69A 5LMNO 1GO3F 3E89A 3UCSC 2WA3A 4ZKIA 1LUVA 1FD9A 4B7KA 4EB6A 4FFBA 1N0NA 1NKDA 3CSXA 1VIBA 5EZYA 2Q6AA 3RT3C 1MSDA 4UVAA 3BAAA 2ZQMA 2CH7B 5KAFZ 1NTZH 4U3FH 2KB1A 3X2QC 2HHHB 1Z5VA 4QNHB 1XNQB 4DV5B 3J7AU 2QKCA 3JARA 1P49A 3CHXA 4JI7B 3JASB 3K59A 4O2BB 2Q67A 2FKXA 3CC7V 3AG1C 4DV7O 1KC8W 2EIJB 2Y69B 4MVSA 4GKJO 1JQ0A 4DR5B 1VP7A 5L3DA 1WA8B 3VQWA 2ATKC 3JD4A 4UUJC 5A9GA 1VQPV 4X65O 2D2CB 3GVMA 4O2AA 2MK3A 3I55V 4NXMB 5KHHA 2ZE5A 4ZIBA 3G71V 4IIJA 1M93A 1S76D 2YIBA 1YJ9V 4DUYO 2VWJA 3CWBH 5LOVB 2QE7G 5DEDA 5J2TB 1SA0A 1D5AA 3TK1A 2UXBO 1PPJH 2FL4A 3TXQA 4JZ2A 1N8RW 2EULA 5K1PA 3W7TA 1YI2V 4QPKA 2ZIMA 4PI2A 5H5NA 4DRXB 4WFEA 4YY3B 3FAVA 4WFFA 3AG2C 2RNBA 3STLC 5CA0B 2N05A 3OGIB 4UXNA 1HW7A 4DR7B 4J11A 1BHAA 5LA6A 2DYSC 1QU7A 1W2BU 5JJJB 4X1YA 4B3SO 2WPDG 1K34A 2BTQB 2R70A 5IT9N 3OMAB 3SYOA 5IYBO 1YTFD 1HP8A 3DGEA 2BE3A 4DV4B 1P4RA 1ZTEA 1WPBA 2LQTA 1YCIA 5FL7G 1Z5WA 4OX9B 5JQGB 1L0NH 2Q5ZA 3APOA 3RYCB 3MHHC 2AZ0A 2HVJC 5CA1A 2EINB 3B09A 3E22B 4WFGA 3T1YB 2QTSA 3CP1A 1WB7A 2LFRA 2AXTZ 3SYQA 1GH6A 5KX5A 3K3WA 5LGNA 3OR6C 2HVKC 2PI5A 1XMQO 2RDCA 1YSCA 1H2NA 1PD3A 3L73H 3WG7C 1ZLZA 5LHHA 3H1JH 1J95A 2E5LB 2LW1A 1W0KG 1DGSA 1KD1W 4QGPA 1H2GA 3O65A 1VQMV 2ZNIA 2PY5A 3ZMSA 2DMXA 4G27B 3JATA 1W0JG 4YJ3A 4X8AA 3K5OA 4FFKA 4H33A 4KUMA 4DR1B 2E76B 2V7QG 1JA8A 3ZRSA 2WLLB 5GTIZ 4I7ZB 2ILMA 1BHBA 3ZHRA 4ZBMA 3AG7A 2P6JA 1R3LC 2F4VB 4O4HB 2F1MA 1DF5A 5IY5C 2QKAA 5LYJB 4B3MB 5EBWC 4P2ZA 1BCCH 1OCRB 4DV3B 1GM7A 4FLWA 3JD3A 1KP3A 5LMUO 5LGTA 2QTOA 1FXKA 3ZHSA 2EIMC 2Q4PA 4HNAA 1VEWA 5L3CA 2Q7HA 4O4IA 4U3JB 3P30A 4X62O 2WSSG 2QWPB 1QLNA 3CRAA 2YXYA 3ASNB 3B8NA 5D5QA 4IYHA 5CB4B 3K5NA 1BGYH 1WJZA 4GT1A 4PDLA 4IHJA 3LUTB 2ADPA 1IURA 4UCTA 5FPOA 4JI6B 2W0XA 4ZHQB 1YTFB 4FLZA 4HYOA 5J9PC 1KP2A 5L3GA 3J80N 3OE7G 4JI4B 5CBGA 1P7BA 2ZXWC 2C2AA 1Q43A 4CH5A 5KHIA 1J5EO 5H9CA 2WLJA 4FVMA 1AI4A 3ABKB 3MD0A 3BRCA 1HNZO 4K3AA 5A2QN 4NXNB 4DR6B 3T1HO 1Y67A 4MTXA 1VF5B 3CE2A 2BTOA 1KKCA 1XNRO 3K5LA 5H2FZ 4JYYA 1RM1C 4JI8B 1WA8A 5L3BA 4X88A 1N34B 1AILA 1VQ8V 4FLXA 3CCJV 5IJ0B 2EILC 5EIBC 1F51A 1KMIZ 2VS0A 1YDXA 1S5JA 3H01A 5JJNB 1XEQA 3L71H 1RPRA 3WB2A 3CMAV 3HR0A 1V55B 1GAXA 2X7RB 3P3PA 5JH7A 1SKVA 3OTOO 4G2KA 3FB6C 1COWG 3GB7C 4FM2A 2NN4A 2JRIA 1TUBB 1SZXA 1VQ9V 1M56B 1VF7A 2PUSA 2UUAB 3EHBB 1FPOA 3Q4HA 3FB7C 4LFBO 1SRYA 2ARHA 1B6QA 2X6AA 3ASOB 3IC7A 1BS3A 4J7KA 1R6TA 2CGOA 2QJ1A 2ZIOA 4O4JB 3OUSA 4BR6A 5EBLC 2FMLA 2HHHO 1FXKC 3JALB 1QBZA 2CTRA 4DV5O 4JI7O 4EKWA 2Q73A 1KBHA 2EX3A 1LNQA 1OJHA 1Q5OA 1N32B 2JEUA 4DR5O 3CJHB 5EIBD 3CCRV 4TOIA 4FK5C 5FNVA 3E35A 1D5NA 3THOA 4NXMO 5IYDO 3HKDB 4MVMA 5JQGA 2VQFB 2WLIB 3OMNB
chains in the Genus database with same CATH topology
1VP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VP7 A; 
#chains in the Genus database with same CATH topology
 1DK1 A;  1L8D A;  1HR0 B;  5KUK A;  1KQS U;  1BL8 A;  1JMK C;  1B06 A;  3QNE A;  3BFR A;  2V1D A;  5JVD B;  2GSM B;  4IL6 Z;  3JD0 A;  4H0L B;  4CC5 A;  4I50 A;  2Y69 C;  1Q8I A;  3ZHV A;  1Q6H A;  3LSS A;  2QM7 A;  4YY3 O;  1XMO B;  1VQ6 V;  1K92 A;  3WB0 A;  3STZ C;  3K5M A;  4DR7 O;  3K9A A;  1NR1 A;  1XHX A;  3DC6 A;  1Q7Y W;  5J2U A;  4R6Z A;  3D3Q A;  3K03 A;  3UT5 A;  2KQX A;  3SR2 C;  1NH2 B;  3JSL A;  2QWQ B;  5KA6 A;  1YIJ V;  4J7J A;  4E2L A;  1PNL A;  2X0L A;  3G6E V;  3ZMZ A;  3JAK A;  4RO2 A;  2ZM6 B;  1N4C A;  5B1O A;  4UCO A;  3HKB B;  4JTC B;  1Q3E A;  1M9N A;  1KU9 A;  3T2M A;  3VBB A;  5IDJ A;  3JD2 A;  1AI5 A;  4NR1 A;  4UVC A;  2KKW A;  2QGN A;  3I56 V;  5KMG A;  5LYJ A;  3FB8 C;  1MAB G;  2E75 B;  2IU0 A;  1QNM A;  3T1Y O;  4JYA O;  2OCH A;  4J41 A;  5FLX N;  2XTA A;  4G28 B;  2A7W A;  3LDC A;  4MVO A;  5EYP B;  3DXR A;  1SET A;  1YEW A;  2QKS A;  1VQO V;  4CH6 A;  3ZN0 A;  5CB4 A;  1JR9 A;  2FYU H;  1R3I C;  2E74 B;  5LHI A;  2BOC C;  2Y4T A;  1U96 A;  1NQT A;  2DWD C;  2E5L O;  4O4L B;  4F6E A;  3ICX A;  4MW3 A;  2OTJ V;  1OZ0 A;  3ZJZ A;  1CXZ B;  4F6R B;  4GX0 A;  3IFX A;  1VQN V;  2XUM A;  4OPA A;  5LP6 B;  3KCY A;  3ZED A;  3OEE G;  3CB2 A;  3JAW B;  5LL6 Y;  4NTY A;  4DR1 O;  4B3R B;  1OV9 A;  4ICG A;  3OFN G;  4BAY A;  2XHB A;  1FAF A;  2OT5 A;  2L35 A;  2Q0A A;  1PNM A;  2GHY A;  5CA3 A;  2EJR A;  2CE4 A;  3RYI A;  2UUC B;  2F4V O;  2HJF C;  1K73 W;  2F93 B;  5CBH A;  3SPJ A;  4R7C A;  1SES A;  1NBM G;  4B3M O;  3F7V C;  2HG5 C;  3HKE A;  1ROP A;  1NZ6 A;  4DV3 O;  2A06 H;  4KXR A;  1BZK A;  1WAZ A;  1H38 A;  3KCX A;  4QIW F;  3OMI B;  1CEZ A;  3BY6 A;  3ABL B;  1IDS A;  2Z0A A;  1ARO P;  3D8C A;  3A2F A;  4WCE V;  2YEV A;  4CC6 A;  3OTO B;  2GDS A;  3L9D A;  1VAR A;  1TUB A;  3UKM A;  3CRM A;  4JTA B;  4Z2W A;  1JOY A;  4JI6 O;  1F7Y A;  3B40 A;  3OEH G;  1FXH A;  4LFB B;  1X59 A;  2YUA A;  2A9H A;  1L0L H;  3CPW U;  4FLT A;  4JI4 O;  4RQE A;  4K8X A;  4GX1 A;  4LF4 B;  4J9Z B;  4X20 A;  3LNM B;  2QWR B;  3BA9 A;  1QCE A;  4O4J A;  1G1X B;  2YIA A;  1NT2 B;  3JAL A;  4LF7 B;  1G4Y B;  2IJK A;  3QO5 A;  2WLM A;  5JCO A;  3CXC U;  4NXN O;  4DR6 O;  2ZR2 A;  4JAV A;  3OD4 A;  3CCE V;  1NVP D;  5IYZ A;  3ASN C;  1HDJ A;  4CH4 A;  4YHH B;  3CJH A;  4JI8 O;  1EZJ A;  2Q9L A;  4FMT A;  1N34 O;  1H8E G;  1AVM A;  3E86 A;  1XBL A;  2CK3 G;  4AIL C;  4LFA O;  1V9P A;  1AI7 A;  2XT9 A;  3L75 H;  1ENV A;  5B1N A;  2UXX A;  3CCS V;  4I55 A;  4JI0 B;  2WLI A;  3SJB C;  1TUE B;  1FFX A;  4LNU B;  2WA4 A;  4FJC C;  3LDD A;  5JVD A;  3ABK C;  1K8A W;  2YS8 A;  2BSK A;  2XND G;  1M4U A;  2UUA O;  3RYF A;  1US6 A;  3AG4 B;  1MZE A;  1B04 A;  3ETD A;  3TGU H;  4D7T A;  2IH3 C;  3ZS8 C;  3APQ A;  4Z1V A;  1BT8 A;  2AW9 A;  3W7W A;  3ABM C;  5CMU A;  1BMF G;  3TXS A;  3ZRX A;  3CEI A;  1V55 C;  3QF7 A;  2YXH A;  1K4C C;  1G6U A;  2IH1 C;  3LSU A;  1M57 C;  4WFH A;  1N32 O;  4HBN A;  2FTK A;  1IX9 A;  3AK2 A;  1QQC A;  4RWU A;  1Y76 B;  3RN4 A;  4XDK A;  1NS1 A;  1M56 C;  5ITZ A;  2ADQ B;  3E83 A;  3K79 A;  4P9P A;  4JGS A;  4IYI A;  3HKB A;  4NYK A;  2VQF O;  1IXB A;  1QLE B;  1HR0 O;  1N36 B;  2JGU A;  5AG2 A;  1Z2G A;  3AG3 C;  1TVK B;  4JI5 B;  1S0V A;  5LHG A;  1YZB A;  1S77 D;  5JCO C;  4ASU G;  1Y74 A;  3KG2 A;  4DV2 B;  2RMK B;  5GON B;  2RCV A;  3DSQ A;  4JYA B;  1MSW D;  2P7T C;  4GX2 A;  4JZG A;  2WWW A;  5BY1 A;  2ZE7 A;  1SC5 B;  1FKA O;  2UXC O;  1XMO O;  2ZE8 A;  3P32 A;  1ZX3 A;  4WFB V;  1XI1 A;  4LC1 A;  4LF6 B;  4MVR A;  1NVP B;  1GM9 A;  3RGB A;  4F6R A;  1MNG A;  3TET A;  3SGI A;  4DK1 A;  4PEL A;  4I0X B;  4I9W A;  1Q81 W;  3CCQ V;  3JAW A;  4JYC A;  4TUY B;  1SQF A;  4F4L A;  1VQK V;  2P22 C;  2ZM6 O;  3CRR A;  3U10 A;  3H1H H;  2ITC C;  3SPG A;  2EZP A;  1F23 A;  5LXT B;  2RQ6 A;  1OCC B;  4ZI7 B;  4MS2 A;  4NTX A;  3OTF A;  5IJ9 B;  2NR5 A;  4JTD B;  2WLN A;  4QPJ A;  4B3T B;  3BVO A;  1UFI A;  3N2G B;  3RW0 A;  4K8Z A;  5B5E Z;  2UXD O;  1SER A;  1HWY A;  1UJW B;  1Y6X A;  4LWS B;  1AR1 B;  1VQ7 V;  3ML0 A;  2W0F C;  1F4N A;  3H1L H;  1E79 G;  5L3F A;  1GM8 A;  3T4D A;  5KLV H;  1WB8 A;  3HKC A;  4MVZ A;  2WLK A;  3SPC A;  3ZBH A;  1JX9 A;  5IWA B;  3G80 A;  1G8M A;  1I0H A;  3EXA A;  3F7Y C;  4H37 A;  3C3S A;  1PL0 A;  2WLH A;  3H1K H;  5GW7 A;  3EVK A;  2ETN A;  4PDR A;  3L70 H;  4PJ0 Z;  4B3R O;  2CH7 A;  1QVG U;  1VQ5 V;  1EN6 A;  4RAI A;  4TV8 B;  5HFM A;  1HNX B;  1HNW O;  1ZL8 B;  2JEX A;  1D2D A;  3JAS A;  1YJN V;  4O2B A;  3S3X A;  2UUC O;  4TQF A;  2M6Y A;  1OCO B;  4PA9 A;  1I7F A;  1WLE A;  3D36 A;  1OCZ C;  1I5Y A;  2JVD A;  1CPY A;  2JGD B;  4MTO A;  1SQV H;  3LDE A;  1NH2 D;  3UQ8 A;  2JDI G;  5E1A C;  4LFA B;  1JVM A;  3MAQ A;  3OR7 C;  2Q0O C;  4HAM A;  2R72 A;  1JFF B;  4CZZ A;  1PL4 A;  2ZCE A;  4YIP A;  3H1I H;  4DV0 B;  2RN9 A;  5LOV A;  3AG2 B;  4I4T B;  4K35 A;  5J2T A;  4XBF A;  3A0R A;  2QDO A;  1BQ0 A;  5DM6 V;  1K97 A;  1Q6U A;  2A3Q A;  5EC1 C;  5FPR A;  2ZNJ A;  5B3S B;  3VQX A;  3I5D A;  4DRX A;  4BW9 A;  4WFA V;  1SS3 A;  5CA0 A;  3E8H A;  3GWO A;  1LUW A;  4LF4 O;  2CGN A;  2ITD C;  3FD9 A;  4J10 A;  2AHY A;  1QR8 A;  4LF7 O;  2JS3 A;  1M5I A;  2HKO A;  3ETE A;  4FIP C;  3RVY A;  4Q6G A;  3U0Z A;  1URF A;  4EB6 B;  4FFB B;  2BTQ A;  4YHH O;  5EZY B;  4AQY B;  2DYR C;  2UU9 B;  5BMV B;  1MG1 A;  2QA4 V;  2H94 A;  3SPI A;  3UO3 A;  2LGW A;  2XAH A;  4TV9 B;  2EZO A;  1SZT A;  4D6T H;  2OTL V;  1KUQ A;  4JI0 O;  4DUZ O;  2IBZ H;  4W4K A;  3IJ4 A;  3TCU A;  2XAS A;  3B4S A;  3RYC A;  3N2K B;  2ZT9 B;  1TVK A;  4OPH A;  2DJV A;  4BIU A;  4LH6 A;  4GYC B;  1H2L A;  1IBK B;  3P3N A;  4X1K B;  1XIL A;  2QWO B;  3E22 A;  4FLV A;  2X6C A;  1VMG A;  1THZ A;  5HFL A;  2EIJ C;  4TQD A;  2CTP A;  2GTA A;  5IYC O;  5LBQ A;  1M1K W;  1SQP H;  3D36 C;  2UXC B;  5LGU A;  2A0L A;  3G6B A;  5KAI Z;  3OT7 A;  1K4D C;  1SA0 B;  1NI8 A;  4DR3 O;  2OIG A;  1YIT V;  3CYO A;  2K1E A;  3ETQ A;  2QSA A;  1IZ3 A;  4TSF G;  3MDS A;  1E1R G;  3GWK C;  3K04 A;  1SQX H;  3AK3 A;  3OGC C;  1PNK A;  4MVQ A;  2GBO A;  1AJQ A;  3FAV B;  4MTG A;  2L6L A;  4FM1 A;  4OXS A;  4GCZ A;  5JJE B;  3NR7 A;  1AI6 A;  4CBC A;  4P9O A;  2B9Z A;  3CS5 A;  1E1Q G;  2ZDI A;  2WLL A;  3AG4 C;  2LW7 A;  4BWA A;  2NNU A;  3OW2 U;  4JI1 B;  2F23 A;  4X1Y B;  1K5Q A;  2F66 C;  5CN0 A;  3CD6 V;  2EIM B;  2UXN A;  4DO2 A;  1N36 O;  3D3I A;  4O4H A;  4PDV A;  5KHG A;  4GKK B;  4FM0 A;  1EN4 A;  4HZ3 A;  3VQY A;  4JI5 O;  2JS5 A;  4FLY A;  3PJS K;  1L1F A;  4DV2 O;  2UXD B;  2ODM A;  4BIO A;  4X66 O;  1FYJ A;  1BQZ A;  3E8F A;  4LWS A;  2GUZ B;  3C3T A;  2YID A;  1YJW V;  4W4L A;  4U3J A;  1ZUQ A;  2YI8 A;  4LF6 O;  5CA1 B;  1FJG B;  2Y0I A;  1SQB H;  1PM9 A;  1B3Q A;  5BR8 O;  3G67 A;  3RBZ A;  4ZHQ A;  3H9V A;  1QLE C;  3VQV A;  3ZHU A;  3SYP A;  1YF2 A;  1KKD A;  4LF5 O;  2E3C A;  1NTM H;  1R3J C;  2NLJ C;  2QR4 A;  1JPX A;  1XL6 A;  1H8H G;  2EIN C;  2P67 A;  1CP9 A;  4L87 A;  2OIE A;  1XOU A;  4JI2 B;  4AI8 A;  3RYH B;  4TV8 A;  1N33 B;  2XOK G;  3CXH F;  1HNW B;  4LF9 B;  3FX7 A;  4JAS A;  4RUF A;  5BXZ A;  4CS4 A;  3AEI A;  1QVF U;  3JAT B;  4PA3 A;  3QVN A;  4YJ3 B;  3ETG A;  3CME V;  4B3T O;  2BOB C;  3K57 A;  1MZF A;  3IC9 A;  5IJ0 A;  3O9O A;  4K0K O;  1AR4 A;  2OCC B;  3JAM N;  4JPR A;  2DWE C;  1JFF A;  3HB3 B;  2ZE6 A;  1I94 B;  1I5X A;  3WFV A;  4Z1M G;  2ZDI C;  1IBM B;  3RVZ A;  4MVU A;  1MA1 A;  2AGA A;  5IWA O;  2PYL A;  1MOF A;  4DR4 B;  4HNA B;  3A0B Z;  3RWR D;  1OCC C;  1QR9 A;  1S3J A;  3OUF A;  2ZKO A;  3R65 A;  1VQL V;  4X89 A;  4DV1 B;  3C90 A;  4X64 B;  1OCR C;  4JI3 B;  2VQE B;  3S3W A;  4UCR A;  2Y48 A;  3WU2 Z;  2OWO A;  4XDJ A;  2DE0 X;  2YXL A;  3CRQ A;  4OGQ B;  4LH7 A;  1HNX O;  1R1B A;  1FXV A;  2YDE A;  1AP6 A;  2HLD G;  1OHH G;  3CC2 V;  4FLU A;  5BMV A;  1DLB A;  2R9I A;  4LCU C;  3PN1 A;  1WP8 A;  4Q20 A;  2DOS A;  3K58 A;  4UV8 A;  4TV9 A;  1YHQ V;  1JCH A;  1S5H C;  2ZIN A;  4J80 A;  4TWK A;  1ZAU A;  3HKD A;  4DUZ B;  1AP5 A;  4DV0 O;  3N2K A;  3FYE B;  5B1B B;  1EFR G;  4MTF A;  1EM1 A;  2EIK B;  1V54 B;  2XAG A;  4LF8 B;  4X1K A;  3F5W C;  1X4T A;  2RJZ A;  2DW4 A;  2G38 A;  3IGA C;  4X1I B;  1PV0 A;  2B1G A;  3DTU B;  2P5O A;  1OCO C;  4LP8 A;  5JH7 B;  4CS3 A;  1RSO B;  4WBN B;  4J9Y B;  4MW8 A;  3CCU V;  2JIZ G;  2W6J G;  2LP7 A;  3FFQ A;  4DR3 B;  1GN4 A;  3K06 A;  4LBE C;  1SQG A;  2AHZ A;  3Q4H B;  4PA7 A;  2M7W A;  1WP7 A;  1SQQ H;  4J7Z A;  3VOU A;  1AR5 A;  2OYQ A;  4AQY O;  2UU9 O;  1S5L Z;  1K5S A;  2UUB O;  2LGQ A;  4B08 A;  4IGG A;  3L74 H;  1PP9 H;  5B3S C;  1BSM A;  2ZR3 A;  4QE9 A;  2HR3 A;  5EK0 A;  3ZMU A;  4XDL A;  2HJD A;  4YXW G;  4A5U B;  4DR2 O;  3ASO C;  1YVW A;  2Z3Y A;  5H6R A;  2KG7 B;  3E8B A;  1BE3 H;  2IJH A;  4JV5 B;  5FNV B;  1IBK O;  2BCC H;  4KHP B;  3SPH A;  2HEP A;  3U11 A;  1FS0 G;  1VQ4 V;  5H6Q A;  4X66 B;  2YIC A;  5EYP A;  2GUZ A;  4GLX A;  2Q7G A;  3MHS C;  4R50 A;  3CX5 F;  2PGG A;  1O9H A;  3W7X A;  1F4M A;  1UPG A;  2PF4 E;  4UB6 Z;  5D5P A;  1K3E A;  3T4Z A;  4UB8 Z;  2DQ3 A;  4O4L A;  1K9M W;  5BR8 B;  4I50 B;  2H8P C;  5B1A B;  2YC0 A;  3JCU Z;  4UVB A;  1P84 F;  2LFS A;  4U7N A;  4ZOL B;  4D7S A;  5K1X A;  5LP6 A;  4LF5 B;  3OM3 B;  1IBL B;  2B5U A;  4ABM A;  1ORQ C;  2JJ1 G;  4CH3 A;  1KB9 F;  4UCV A;  3F5T A;  2CTQ A;  3RYH A;  2A79 B;  3K0D A;  3E8G A;  2XAJ A;  1W59 A;  5J2U B;  4JI1 O;  1AJN A;  1XDC A;  3UT5 B;  5B66 Z;  4GKK O;  3CCM V;  2PZS A;  3M7M X;  4DV6 B;  3ZIA G;  3JAK B;  3ABU A;  3ZHT A;  1P7G A;  5CBF A;  2B1I A;  3M99 B;  4K0K B;  3ZHQ A;  1FFT B;  1Q86 W;  3K08 A;  1IVS A;  3OAA G;  1NTK H;  1TA8 A;  1H2K A;  5KMG B;  4UV9 A;  1FJG O;  1H2S B;  1Q6I A;  4KL1 A;  4FZ0 A;  3X2Q B;  2EBO A;  2Y0P A;  2Q7E A;  3A8T A;  1JJ2 U;  3SDL A;  3DXR B;  4GX5 A;  1GK9 A;  3AG1 B;  3NXS A;  3RFR A;  5F2V O;  1AJP A;  4LFC O;  2YIB D;  3TJT A;  4JI2 O;  1N33 O;  2P4V A;  4UFZ A;  5LMN B;  4QE7 A;  1S72 V;  4LF9 O;  4NKG B;  4EEQ A;  3KKY A;  4H13 B;  3A0H Z;  3N27 A;  3QO7 A;  1Q90 D;  1R6K A;  4FPP A;  5KHJ A;  1N0J A;  1JJO A;  4WF9 V;  4DXW A;  2N74 A;  2HFE C;  3ZRV A;  2LO1 A;  2AZ2 A;  1DF4 A;  4N23 A;  4R8C A;  1GTO A;  4JF3 A;  3BEH A;  4NB5 A;  2YSU B;  1EBO A;  1Q82 W;  1XQ8 A;  5LP6 C;  1SF9 A;  3T1C A;  3RYI B;  1WN7 A;  4DV7 B;  2XAQ A;  4PA4 A;  1I94 O;  3QTC A;  1NR7 A;  4GKJ B;  1RP3 B;  4PDM A;  2DN9 A;  1IBM O;  5C8Y B;  4LNU A;  3KZI Z;  3HKE B;  2DQ0 A;  5BZB A;  3ABM B;  3LNN A;  4X65 B;  2K9P A;  3ZX6 A;  2W6I G;  4DR4 O;  4YJ2 B;  4X1I A;  4RUE A;  5DN6 G;  4U7O A;  2VWK A;  2DYS B;  3ZRW B;  2LJ2 A;  2YEV B;  5GTH Z;  4DUY B;  1RSO A;  3W7S A;  4WBN A;  1K33 A;  4DV1 O;  1M57 B;  4X64 O;  1PKX A;  4JI3 O;  2VQE O;  4PD4 F;  3R66 A;  2UXB B;  4AHC A;  3CRC A;  3ABL C;  3JD1 A;  2OCC C;  3EFF K;  2R9R B;  4NVP A;  3ABT A;  4B7E A;  3W7U A;  3G4S V;  3BHP A;  4DYL A;  1Y76 A;  4X20 B;  1R6N A;  2F43 G;  2UUB B;  3CCV V;  3AG3 B;  3SYA A;  1TGO A;  2PTM A;  1DTO A;  1XNQ O;  2F95 B;  4KFM A;  4DK0 A;  3UM7 A;  1YXB A;  4NTW A;  3JAR B;  2CDY A;  3BPZ A;  2EJ7 A;  1AB3 A;  4DR2 B;  4B3S B;  1GMG A;  5IYZ B;  3HPL C;  3JCZ A;  4I9Q A;  2X6B A;  4YIO A;  2KG7 A;  3ZCC A;  1LR1 A;  2IU3 A;  1VF6 A;  4LF8 O;  1I08 A;  1Y66 A;  4CS2 A;  1ZSP A;  4O2A B;  5GON A;  3WG7 B;  2D3O W;  4N21 A;  4KP4 A;  4I55 B;  4IIJ B;  3JYC A;  1FFX B;  2XAF A;  2IM9 A;  3BCC H;  2P90 A;  4TT3 G;  1XHZ A;  2CTW A;  2JJ2 G;  4JYB A;  3SJC C;  2BSK B;  1A32 A;  3RYF B;  3FB5 C;  4C7U A;  4DW0 A;  5KUM A;  3ZMT A;  4I0X A;  3SYC A;  3L72 H;  4ZOL A;  5B1B C;  4EFE A;  3IAY A;  4MT8 A;  1ZWI C;  1R73 A;  1V54 C;  2EIK C;  2CAZ C;  5IY5 B;  1WNS A;  4TUY A;  1XMQ B;  2QEX V;  2ZD9 A;  3FYI B;  2JK5 C;  2WAM A;  4RQF A;  3E2E A;  4L8J A;  5LA6 B;  3K9S A;  1R3K C;  2CUG A;  4BW5 A;  5LXT A;  3ZN1 A;  4ZI7 A;  2Q68 A;  2PI4 A;  1GKF A;  5IJ9 A;  4DV4 O;  4JV5 O;  4JAA A;  3FKS G;  3DC5 A;  5ITZ B;  4JAU A;  2QM8 A;  4DW1 A;  3B77 A;  4QJF B;  4E4E A;  4KHP O;  3JSN A;  3LSQ A;  2H3O A;  3N2G A;  5E79 Z;  4BIZ A;  1KYO F;  3CC4 V;  1H2M A;  4OX9 O;  1GN6 A;  2KSD A;  3WB1 A;  3ZMV A;  2O57 A;  2Q8V A;  3K0G A;  3B8M A;  4UCU A;  4PV1 B;  2GTS A;  4EFB A;  1Y74 B;  2ZXW B;  4PI0 A;  5LMU B;  2PYJ A;  5KX5 B;  1RPO A;  4FZ1 A;  1Y4M A;  1MMM A;  4PA6 A;  3SJA C;  2MW2 B;  3UO2 A;  4X62 B;  1IBL O;  3J81 N;  1XRE A;  1VF6 C;  4LFC B;  1GRJ A;  1EZV H;  1OCZ B;  1RM1 B;  2VRZ A;  4J42 A;  1K7D A;  4MSW C;  2EIL B;  1ZL8 A;  4H44 B;  1QHT A;  2HP8 A;  2Y4U A;  4UCS A;  5DEC A;  2IW5 A;  5KHK A;  1EN5 A;  5L3E A;  2FB5 A;  4DV6 O;  5EBM C;  1U97 A;  2JGD A;  2IJJ A;  3M8A A;  1NU1 H;  3BA8 A;  1J5E B;  1XL4 A;  5B1A C;  1IXM A;  1WPX A;  2YI9 A;  1HNZ B;  2Z5U A;  2P06 A;  3BAB A;  3AK1 A;  3T1H B;  2P4K A;  1GN2 A;  1XNR B;  4LR3 A;  1XUQ A;  5C8Y A;  1KEC A;  4I4T A;  2IJI A;  2N04 A;  4GZR B;  4X9Q A;  2V4D A;  2QWN B;  4PHZ A;  3B2E E;  2GV9 A;  4I5S A;  5C93 A;  5TIS Z;  4YJ2 A;  5EC2 C;  1FXK B;  1O9G A;  5KA5 A;  1M90 W;  4P30 A;  3QG5 A;  3ZRW A;  2R9A A;  1TAE A;  4GUN A;  4O4I B;  5JWP A;  3CCL V;  5IE9 A;  3SJQ C;  1T5E A;  1GN3 A;  2DYR B;  4IT5 A;  4IHJ B;  1RFY A;  2QM4 A;  1NJI W;  3HKC B;  3QO8 A;  2Q69 A;  5LMN O;  1GO3 F;  3E89 A;  3UCS C;  2WA3 A;  4ZKI A;  1LUV A;  1FD9 A;  4B7K A;  4EB6 A;  4FFB A;  1N0N A;  1NKD A;  3CSX A;  1VIB A;  5EZY A;  2Q6A A;  3RT3 C;  1MSD A;  4UVA A;  3BAA A;  2ZQM A;  2CH7 B;  5KAF Z;  1NTZ H;  4U3F H;  2KB1 A;  3X2Q C;  2HHH B;  1Z5V A;  4QNH B;  1XNQ B;  4DV5 B;  3J7A U;  2QKC A;  3JAR A;  1P49 A;  3CHX A;  4JI7 B;  3JAS B;  3K59 A;  4O2B B;  2Q67 A;  2FKX A;  3CC7 V;  3AG1 C;  4DV7 O;  1KC8 W;  2EIJ B;  2Y69 B;  4MVS A;  4GKJ O;  1JQ0 A;  4DR5 B;  1VP7 A;  5L3D A;  1WA8 B;  3VQW A;  2ATK C;  3JD4 A;  4UUJ C;  5A9G A;  1VQP V;  4X65 O;  2D2C B;  3GVM A;  4O2A A;  2MK3 A;  3I55 V;  4NXM B;  5KHH A;  2ZE5 A;  4ZIB A;  3G71 V;  4IIJ A;  1M93 A;  1S76 D;  2YIB A;  1YJ9 V;  4DUY O;  2VWJ A;  3CWB H;  5LOV B;  2QE7 G;  5DED A;  5J2T B;  1SA0 A;  1D5A A;  3TK1 A;  2UXB O;  1PPJ H;  2FL4 A;  3TXQ A;  4JZ2 A;  1N8R W;  2EUL A;  5K1P A;  3W7T A;  1YI2 V;  4QPK A;  2ZIM A;  4PI2 A;  5H5N A;  4DRX B;  4WFE A;  4YY3 B;  3FAV A;  4WFF A;  3AG2 C;  2RNB A;  3STL C;  5CA0 B;  2N05 A;  3OGI B;  4UXN A;  1HW7 A;  4DR7 B;  4J11 A;  1BHA A;  5LA6 A;  2DYS C;  1QU7 A;  1W2B U;  5JJJ B;  4X1Y A;  4B3S O;  2WPD G;  1K34 A;  2BTQ B;  2R70 A;  5IT9 N;  3OMA B;  3SYO A;  5IYB O;  1YTF D;  1HP8 A;  3DGE A;  2BE3 A;  4DV4 B;  1P4R A;  1ZTE A;  1WPB A;  2LQT A;  1YCI A;  5FL7 G;  1Z5W A;  4OX9 B;  5JQG B;  1L0N H;  2Q5Z A;  3APO A;  3RYC B;  3MHH C;  2AZ0 A;  2HVJ C;  5CA1 A;  2EIN B;  3B09 A;  3E22 B;  4WFG A;  3T1Y B;  2QTS A;  3CP1 A;  1WB7 A;  2LFR A;  2AXT Z;  3SYQ A;  1GH6 A;  5KX5 A;  3K3W A;  5LGN A;  3OR6 C;  2HVK C;  2PI5 A;  1XMQ O;  2RDC A;  1YSC A;  1H2N A;  1PD3 A;  3L73 H;  3WG7 C;  1ZLZ A;  5LHH A;  3H1J H;  1J95 A;  2E5L B;  2LW1 A;  1W0K G;  1DGS A;  1KD1 W;  4QGP A;  1H2G A;  3O65 A;  1VQM V;  2ZNI A;  2PY5 A;  3ZMS A;  2DMX A;  4G27 B;  3JAT A;  1W0J G;  4YJ3 A;  4X8A A;  3K5O A;  4FFK A;  4H33 A;  4KUM A;  4DR1 B;  2E76 B;  2V7Q G;  1JA8 A;  3ZRS A;  2WLL B;  5GTI Z;  4I7Z B;  2ILM A;  1BHB A;  3ZHR A;  4ZBM A;  3AG7 A;  2P6J A;  1R3L C;  2F4V B;  4O4H B;  2F1M A;  1DF5 A;  5IY5 C;  2QKA A;  5LYJ B;  4B3M B;  5EBW C;  4P2Z A;  1BCC H;  1OCR B;  4DV3 B;  1GM7 A;  4FLW A;  3JD3 A;  1KP3 A;  5LMU O;  5LGT A;  2QTO A;  1FXK A;  3ZHS A;  2EIM C;  2Q4P A;  4HNA A;  1VEW A;  5L3C A;  2Q7H A;  4O4I A;  4U3J B;  3P30 A;  4X62 O;  2WSS G;  2QWP B;  1QLN A;  3CRA A;  2YXY A;  3ASN B;  3B8N A;  5D5Q A;  4IYH A;  5CB4 B;  3K5N A;  1BGY H;  1WJZ A;  4GT1 A;  4PDL A;  4IHJ A;  3LUT B;  2ADP A;  1IUR A;  4UCT A;  5FPO A;  4JI6 B;  2W0X A;  4ZHQ B;  1YTF B;  4FLZ A;  4HYO A;  5J9P C;  1KP2 A;  5L3G A;  3J80 N;  3OE7 G;  4JI4 B;  5CBG A;  1P7B A;  2ZXW C;  2C2A A;  1Q43 A;  4CH5 A;  5KHI A;  1J5E O;  5H9C A;  2WLJ A;  4FVM A;  1AI4 A;  3ABK B;  3MD0 A;  3BRC A;  1HNZ O;  4K3A A;  5A2Q N;  4NXN B;  4DR6 B;  3T1H O;  1Y67 A;  4MTX A;  1VF5 B;  3CE2 A;  2BTO A;  1KKC A;  1XNR O;  3K5L A;  5H2F Z;  4JYY A;  1RM1 C;  4JI8 B;  1WA8 A;  5L3B A;  4X88 A;  1N34 B;  1AIL A;  1VQ8 V;  4FLX A;  3CCJ V;  5IJ0 B;  2EIL C;  5EIB C;  1F51 A;  1KMI Z;  2VS0 A;  1YDX A;  1S5J A;  3H01 A;  5JJN B;  1XEQ A;  3L71 H;  1RPR A;  3WB2 A;  3CMA V;  3HR0 A;  1V55 B;  1GAX A;  2X7R B;  3P3P A;  5JH7 A;  1SKV A;  3OTO O;  4G2K A;  3FB6 C;  1COW G;  3GB7 C;  4FM2 A;  2NN4 A;  2JRI A;  1TUB B;  1SZX A;  1VQ9 V;  1M56 B;  1VF7 A;  2PUS A;  2UUA B;  3EHB B;  1FPO A;  3Q4H A;  3FB7 C;  4LFB O;  1SRY A;  2ARH A;  1B6Q A;  2X6A A;  3ASO B;  3IC7 A;  1BS3 A;  4J7K A;  1R6T A;  2CGO A;  2QJ1 A;  2ZIO A;  4O4J B;  3OUS A;  4BR6 A;  5EBL C;  2FML A;  2HHH O;  1FXK C;  3JAL B;  1QBZ A;  2CTR A;  4DV5 O;  4JI7 O;  4EKW A;  2Q73 A;  1KBH A;  2EX3 A;  1LNQ A;  1OJH A;  1Q5O A;  1N32 B;  2JEU A;  4DR5 O;  3CJH B;  5EIB D;  3CCR V;  4TOI A;  4FK5 C;  5FNV A;  3E35 A;  1D5N A;  3THO A;  4NXM O;  5IYD O;  3HKD B;  4MVM A;  5JQG A;  2VQF B;  2WLI B;  3OMN B; 
#chains in the Genus database with same CATH homology
 1VP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...