1VP7A

Crystal structure of exodeoxyribonuclease vii small subunit (np_881400.1) from bordetella pertussis at 2.40 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
68
structure length
68
Chain Sequence
ARPLPQDFETALAELESLVSAMENGTLPLEQSLSAYRRGVELARVCQDRLAQAEQQVKVLEGDLLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Exodeoxyribonuclease VII small subunit E.C.3.1.11.6 (NP_881400.1) from Bordetella pertussis at 2.40 A resolution
rcsb
source organism Bordetella pertussis tohama i
molecule tags Hydrolase
molecule keywords exodeoxyribonuclease VII small subunit
total genus 26
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.11.6: Exodeoxyribonuclease VII.
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02609 Exonuc_VII_S Exonuclease VII small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1040 Mainly Alpha Orthogonal Bundle Helix Hairpins Exonuclease VII, small subunit 1vp7A00
1VP7A
chains in the Genus database with same CATH superfamily
1NBMG 3AG4C 4O4IA 4QE9A 1SA0A 3K79A 5BZBA 4JAUA 3ICXA 4LFAB 4O2AB 4PDMA 4CC5A 3K57A 3JSNA 3W7UA 2QE7G 3SR2C 4DV6B 1J5EB 1K34A 3THOA 3RFRA 3OT7A 1SQVH 2P67A 3CC4V 1IDSA 3H1KH 2E5LO 3TJTA 4RQFA 4GLXA 4Q20A 3G6BA 1FXKC 2HVJC 1WJZA 1CPYA 2OCCB 3UKMA 1NR1A 4CH4A 3T1HB 2EIMC 1CEZA 4J42A 4ZI7B 5BR8B 1SA0B 3AK1A 1V54B 4DR7B 5LMNO 1BQZA 5IE9A 2FL4A 2ITDC 5L3DA 3I56V 2EINC 2NNUA 1PP9H 4I4TA 3ZRWA 4H13B 5FL7G 4DR4O 2R9IA 2XNDG 3T1YO 3BFRA 4YJ2A 3OE7G 4QGPA 4OX9B 1VF7A 2G38A 4NKGB 1WP8A 1Q7YW 4X64B 4LFCB 4NTWA 1Q6IA 3CSXA 1RP3B 3NXSA 4B3MO 2EIJB 4J7ZA 4X65O 4W4KA 2Y0PA 4DV3B 1HDJA 2UXNA 3ZHSA 4PA4A 5LL6Y 2B9ZA 5JJNB 2NR5A 1I94B 1V9PA 2JJ1G 1EFRG 4MT8A 2M6YA 3OR6C 2LJ2A 4I50B 2HG5C 3JD2A 1U97A 4GCZA 4GX0A 5EIBC 4DV4B 2QWRB 5KMGA 4JZGA 2UU9B 3UM7A 3X2QC 4A5UB 2Y4UA 4JI8B 4UCOA 1VQ5V 1IBKB 3T1HO 2QKAA 5J9PC 1Y76A 1Y67A 1SQGA 1P84F 1SQXH 1PL0A 1G1XB 5KA6A 4I5SA 3ZEDA 3ZRXA 1F7YA 2UXDB 1KD1W 5L3CA 2JJ2G 1N0JA 1S5LZ 4X1KB 3IAYA 2CGNA 3BEHA 1K5SA 3H1IH 1N36O 5KMGB 2KSDA 4HYOA 4DR3O 3D3QA 3M99B 2A79B 2QWNB 4K3AA 3JD1A 2ZIOA 1BE3H 5EC2C 1QLNA 1VEWA 4H44B 1JVMA 1U96A 2UUBO 3A2FA 1X59A 2WLKA 3CRQA 1JX9A 2QKSA 1GM9A 4ZIBA 3B2EE 2RNBA 1VMGA 4J11A 2AXTZ 2LO1A 1SESA 2R9AA 3B40A 2N74A 4UVBA 1W2BU 4LH7A 3F7YC 2X6BA 1JJ2U 2JS3A 3S3WA 2YIDA 5K1XA 3IJ4A 4JI7B 1PPJH 2AGAA 1Z2GA 1AB3A 2A0LA 4MW3A 3ABKB 3RYFA 1SZXA 1EN5A 1Q5OA 3ZN1A 4X62B 5JJJB 5FPOA 2N04A 4KFMA 5KHGA 1VARA 3U0ZA 2PYLA 1AILA 3ZHTA 1AP6A 3D3IA 3JAKA 1QR8A 2UXCB 5IWAO 3CC7V 2F66C 1S72V 5IY5B 4UVAA 1K3EA 1L8DA 5A2QN 4AQYB 3E8FA 4G2KA 1OCZB 1S3JA 2ZNIA 2HFEC 2Y69B 1VF5B 4JV5B 5GONA 1YTFD 2OIGA 1OZ0A 3CD6V 3PJSK 2FYUH 2DW4A 3FFQA 5JQGA 5B1AB 1RM1C 3CCEV 4B08A 2YDEA 5CA1B 3SJCC 3EFFK 4LH6A 1DGSA 1Y74B 1Y6XA 1HP8A 4PDRA 1QHTA 2PYJA 2CH7A 4B7EA 4HNAB 1KYOF 5EK0A 1HNWB 4K0KO 4NXNO 4O4JB 3CYOA 1Y4MA 1WAZA 4I0XA 5BY1A 3K9AA 4JI5B 2A3QA 2CTRA 1MSDA 4DV0B 5B1OA 4U3JB 1GM8A 2OIEA 4KXRA 2QM7A 4I50A 3FD9A 3ABMB 2R9RB 4DV0O 2QA4V 2ZE7A 2XAGA 4OPAA 4FM1A 4X66B 4GX5A 1PNLA 2B1IA 2HKOA 4CH3A 1VQOV 1Y66A 3N2KA 4B7KA 5L3EA 2YICA 4MTOA 4DV7O 4B3TO 3RYIA 3CJHB 3B8MA 1W0JG 2CDYA 2LFSA 3K59A 3BA8A 1XREA 2VQEB 3L73H 2RMKB 1Q6UA 4FVMA 4TUYA 1BL8A 1JFFB 3CCUV 1M4UA 2Q8VA 4JI0O 1GH6A 2ZE5A 2XAHA 5LBQA 1L0NH 4P9OA 1MOFA 3CXHF 4JYAO 2Q4PA 1WLEA 3F7VC 1DK1A 4WFHA 1TA8A 1V55B 4EEQA 1HR0O 3GVMA 4MS2A 1RPOA 2JS5A 2ZNJA 3E8BA 5H6RA 1XL6A 3EHBB 1YJNV 4J7KA 3K58A 4EKWA 3HB3B 2WLLA 3JAMN 4LC1A 1N34B 1DF4A 3QG5A 4WCEV 1UJWB 5CA0B 4BIOA 3ZS8C 5B1NA 2YUAA 4MVOA 4U7NA 4TQDA 1M57C 3CCMV 1TUBB 4PDVA 3K5LA 1GK9A 2PI4A 2E74B 4FK5C 4DUYO 4DUZO 1FS0G 1JR9A 1VQ7V 2E5LB 2IJKA 4XDKA 3RBZA 4LF7B 3CRAA 5IDJA 2QWQB 4YJ3A 4JI0B 1WB7A 1ENVA 4TV9A 2RN9A 2UUBB 2GV9A 4NR1A 1IBLB 1P49A 3QO7A 2FB5A 1VQ9V 3SYPA 1BZKA 4X8AA 4NYKA 4LFBO 5E79Z 4FJCC 1CXZB 4MTGA 3ZMTA 1K7DA 5GTHZ 1S5HC 1M57B 4UVCA 2XASA 3DGEA 5DN6G 3ZMUA 4UCRA 2JK5C 2WLJA 2WLIB 3L70H 4RUFA 2P7TC 3OTOB 2YEVA 1N8RW 4IHJA 4MVZA 4I0XB 2X6CA 2YXHA 2YC0A 5FNVA 2XAFA 4PDLA 3ZX6A 2HEPA 4LF9O 1B04A 2KQXA 3C90A 1SETA 3UO2A 1Z5WA 4FLXA 1XMOO 3BAAA 4I4TB 2UXBB 1S76D 3LSSA 4P30A 3MAQA 1XEQA 5EBLC 2E76B 4R7CA 1NKDA 4TUYB 4XDJA 4JTAB 3CXCU 1N33O 4DK1A 2CGOA 4LF6B 5IT9N 2ZQMA 1XBLA 5IJ0A 2HP8A 1US6A 2QJ1A 3APQA 4FLYA 1Q82W 2ADQB 2IM9A 2ZE8A 3HKDB 3APOA 3ZJZA 1GMGA 1KECA 3K3WA 1H38A 3A8TA 2IJJA 2M7WA 1MZEA 1Y74A 4AQYO 4LF8O 1XNQB 4NB5A 5KHIA 1VQMV 4O4JA 5B1BB 3IGAC 3CJHA 2KB1A 1ZLZA 1AR1B 5IYBO 3G80A 1TGOA 1EN6A 1OCOB 4DV7B 1K92A 2YXLA 2WPDG 2N05A 3T2MA 3ZCCA 1VQNV 2UXDO 4O4IB 5CBFA 1YI2V 4OGQB 3E86A 3JARB 4LF5O 1NTKH 3BABA 1QVFU 1B3QA 1JJOA 1R73A 2BSKB 3RW0A 5EYPB 1OCRC 4FLZA 4JTDB 4RO2A 1NTMH 3MDSA 1VQ6V 1XILA 2YIBD 4L8JA 4J41A 2EINB 1FXKB 3BY6A 1IBKO 5CA0A 5H9CA 4UCTA 3M8AA 3OMIB 4CH6A 2JEUA 2CE4A 5A9GA 1NVPD 4X1KA 2GBOA 1R3JC 4I9WA 1HNZO 1ORQC 3OTFA 2D2CB 3FB5C 4I7ZB 4LFAO 4K0KB 3ETGA 5FPRA 3LSUA 4IL6Z 1F51A 2ZM6B 3HKBA 3JALB 4HAMA 2JGUA 1S77D 4UV9A 5B3SB 4YHHB 3KCXA 2WLHA 1RPRA 4DXWA 1Q43A 5LXTB 4BWAA 5CA3A 1K97A 4XDLA 2YI8A 5CN0A 4YY3O 3OEHG 1FXVA 2NN4A 5B5EZ 2EIMB 4PJ0Z 4KHPB 2GUZA 4JI6B 4IYIA 3H1HH 4Q6GA 4JI8O 2UXCO 3ASNC 3K03A 3AG2C 5CBHA 1LR1A 1FXHA 2GTAA 4EFEA 3D8CA 2CK3G 2RDCA 4TV8B 4JI4B 1THZA 1YJ9V 1PNMA 4B3SO 5LMNB 5EZYA 3T1CA 3CPWU 1QLEB 4GX2A 2QM8A 4UB6Z 4N21A 2ODMA 5LHHA 4JI7O 4W4LA 3SPJA 4MVQA 1SS3A 1T5EA 3HKCA 4GYCB 3RYHB 3AG3B 5ITZB 3ABLB 4P2ZA 1NI8A 1P4RA 1AI5A 5LGNA 5H5NA 5K1PA 5IYCO 1VQKV 2JEXA 4DR1O 4FLTA 4LR3A 3WG7C 3TCUA 3KZIZ 4P9PA 1VQLV 1XDCA 3JARA 2UXBO 2X7RB 3A0BZ 4JI1B 3CWBH 2Q68A 2IU3A 4DR3B 3OW2U 5IJ0B 1VIBA 2WWWA 4UCVA 4MSWC 3DC6A 2OCHA 2X0LA 1O9GA 1DTOA 1AVMA 2YEVB 3ZN0A 1SF9A 5ITZA 3BHPA 4N23A 4IYHA 2DOSA 3L74H 4FLVA 5DEDA 4JI3O 4YIOA 1XNRB 1TVKB 4K8ZA 2H8PC 3M7MX 3H01A 1XHXA 2A9HA 2GTSA 2FKXA 4JAVA 5EIBD 3CRRA 2UU9O 1BCCH 4MW8A 1KBHA 1I5XA 3Q4HB 2OYQA 4L87A 5IYDO 2RCVA 4I9QA 3ZRSA 4DV5O 2Z0AA 3K08A 2WSSG 4ZKIA 1HNWO 3JAWA 3E22A 1KMIZ 4O4LB 4ZOLB 1LUVA 1SC5B 3WB2A 1HNZB 3AK2A 2PI5A 5LA6B 4D6TH 5LP6A 4WFEA 5LYJB 1URFA 2H94A 5KAIZ 1H2MA 3ABUA 1L1FA 2IW5A 1KB9F 3VQVA 2D3OW 4JAAA 4BIUA 4DR2O 2OTLV 3RWRD 1MABG 3T1YB 2H3OA 1FFXA 4DR4B 1N34O 1NT2B 3JASA 3QNEA 1M1KW 4KP4A 4X20B 3DXRB 4O2BA 4B3SB 1KKCA 4ABMA 5AG2A 1IBMB 4R8CA 2JDIG 4Z2WA 2BOCC 1I08A 3HPLC 3CX5F 4OPHA 1FAFA 5CB4A 4X9QA 1VQPV 1JFFA 3W7XA 4NXMO 2CH7B 3TK1A 1BS3A 1SKVA 4F6RA 5JVDA 3NR7A 4GZRB 1NH2D 3SPIA 2Q0AA 4DW1A 4B3MB 1QR9A 3E22B 4ZOLA 4YY3B 4JYAB 4LFCO 4TQFA 4AI8A 4GKJB 1XMQB 3P30A 3DXRA 4PELA 3UCSC 3W7SA 1AR4A 1CP9A 1N33B 4RWUA 4PD4F 2P6JA 2Q69A 2VS0A 4O4HB 3TETA 5LMUO 2QTSA 2VQEO 3PN1A 1MA1A 5LHIA 4I55A 1SQPH 5J2TB 4WFFA 3DTUB 2GDSA 2ARHA 2F4VB 2CAZC 1AI7A 3SJQC 1R6TA 1G4YB 3OM3B 3T4ZA 1F23A 3FYIB 2WA4A 3U10A 3D36C 1MNGA 3OUSA 1I5YA 4JI6O 3G4SV 1QU7A 3UT5A 4UCSA 3AG2B 3I5DA 1AJPA 2ZR2A 2EJRA 2DJVA 4JF3A 4BAYA 1VQ4V 2EIKC 3CCSV 3OAAG 3AK3A 4IT5A 4DV1O 5J2UB 5JCOC 1SQFA 1GM7A 4TV9B 1Q3EA 5JQGB 1TVKA 2DYRC 3CCJV 4H37A 2LGQA 2BTQA 1FD9A 2F95B 3LDCA 3B77A 3RYHA 4RQEA 2W0FC 3FKSG 1N32O 1IURA 3HR0A 2F1MA 4Z1VA 1BQ0A 1MG1A 2DWEC 3EVKA 3BRCA 5L3GA 2YI9A 2OT5A 3L9DA 1FFXB 2R70A 2YIAA 3IFXA 2IU0A 1LUWA 4PI2A 3STZC 3JALA 4CC6A 3MHSC 4EB6B 1GN2A 2LP7A 4DW0A 4E4EA 2QKCA 4LP8A 1K8AW 1OCCB 1AJQA 3LDDA 2A06H 3J7AU 3FX7A 2YSUB 2PF4E 4FM2A 2BTOA 1FXKA 2OWOA 4JYYA 3N2KB 1WA8A 3AEIA 3ASOB 4K35A 3G67A 3ASOC 1NH2B 3J81N 3E35A 5KX5A 3ZMSA 4YIPA 1HNXB 4JI4O 4X88A 2WA3A 1WNSA 1Q6HA 1R3KC 1IXBA 2LQTA 4E2LA 2P4VA 5B1AC 3RYCA 1RM1B 2P5OA 1WA8B 5EC1C 1SRYA 3O65A 4IGGA 3C3SA 3HKEA 5KHKA 1NJIW 1NZ6A 3LUTB 1TUEB 2QR4A 2Q7EA 1P7GA 3OFNG 1XNQO 3CS5A 1B6QA 3AG1C 3CMEV 4R6ZA 1IX9A 5JJEB 3UO3A 2W6JG 1PNKA 2Q5ZA 4O4LA 4IIJA 2RQ6A 3K5OA 3SPHA 1YSCA 3K0GA 1YVWA 2MW2B 3X2QB 3B8NA 1LNQA 4K8XA 4ASUG 2DYSC 2HHHO 4YHHO 3JATB 1F4MA 2V1DA 1KKDA 2BSKA 1IXMA 2Q6AA 3E83A 1UPGA 1R1BA 4DV5B 2EIKB 4IIJB 2EILC 1OCOC 4ZHQB 2ZXWC 3N2GB 4D7TA 3B09A 2RJZA 4CBCA 1A32A 4UUJC 3OD4A 3F5WC 3ABTA 3JATA 3MD0A 4FM0A 3MHHC 1Y76B 2HVKC 3LNMB 4KHPO 1BHAA 1YHQV 1FYJA 2X6AA 4PA6A 1AP5A 3HKCB 2QWPB 2DYSB 3ZMVA 3RYFB 3CC2V 4LFBB 3K5NA 2F43G 3AG1B 2W6IG 4KUMA 2PUSA 2AHZA 5KUKA 2ETNA 1H2NA 1BT8A 1SQQH 2CTQA 4EFBA 4DR6O 4TSFG 5LMUB 1YXBA 2KKWA 1EBOA 4DR1B 3GWOA 3SYQA 3QO5A 4AHCA 3F5TA 5C8YA 3ZRWB 3RVYA 1H2KA 4U3JA 5LXTA 1I0HA 4LCUC 2DMXA 2QWOB 4QPKA 1YTFB 5IWAB 4GKJO 4X64O 2XHBA 1YDXA 4DUZB 1ROPA 3CEIA 4YJ3B 4DR5O 1YITV 4LF6O 4DO2A 4OX9O 4DV2O 1H2GA 1WPBA 4WBNA 5KLVH 3CHXA 5FNVB 3P3NA 4GUNA 3L75H 4DR7O 2ZT9B 1AROP 1O9HA 3HKBB 1GRJA 3DC5A 1D2DA 5KAFZ 4H33A 4FFKA 1HR0B 4UCUA 4BW5A 4FLWA 4MTFA 2ZIMA 2VRZA 4TOIA 4HZ3A 3OTOO 1S5JA 5B1BC 4LWSB 1Z5VA 4DR2B 2WLNA 5D5QA 4GKKO 1EZVH 5LYJA 1K4CC 2B5UA 4MTXA 2UUCB 2EBOA 3N27A 1YIJV 3CCQV 1K9MW 1PKXA 3P32A 5FLXN 1GN3A 3ZHRA 4AILC 2HJFC 4FLUA 2XT9A 4B3TB 2HHHB 1JQ0A 1AI4A 4EB6A 2K9PA 1M90W 3B4SA 2AZ0A 1UFIA 2WLLB 3VQYA 1JPXA 1ZTEA 1XMOB 2QDOA 5IJ9A 2XUMA 1X4TA 2Z3YA 2FMLA 2ZD9A 1V55C 1VF6A 3LSQA 5LP6B 4JI2B 3JAWB 3ETEA 4BW9A 1PL4A 5JH7B 4X89A 1FJGO 1GO3F 4F4LA 3CRMA 3FYEB 1S0VA 4H0LB 4YXWG 2EX3A 4PHZA 5LA6A 1XNRO 2PTMA 4QE7A 1ZUQA 4XBFA 1I94O 3A0HZ 3RT3C 1G6UA 4YJ2B 3G71V 1K73W 1QLEC 2EZOA 5DECA 5IJ9B 1BGYH 1TAEA 1XQ8A 4J9YB 4WBNB 2FTKA 3RYCB 2ZDIC 5JCOA 4RAIA 5BMVA 4ZBMA 2EIJC 3GB7C 3SPGA 1E1QG 2EILB 2F23A 1GN6A 1B06A 4ICGA 4JASA 2ZINA 4FPPA 4CS4A 1QVGU 3JASB 1YCIA 4X1YB 1KP3A 3KCYA 4X1IB 2LW1A 3ETDA 3D36A 4DUYB 4Z1MG 5BMVB 1N36B 2VWKA 5EBWC 1KQSU 4CZZA 3RGBA 4FZ1A 4X1YA 3KG2A 3SYOA 2HJDA 2QTOA 4X62O 1OCZC 4I55B 5J2TA 4TV8A 3R65A 5D5PA 4RUEA 2ADPA 4LNUA 4UFZA 1AR5A 4QPJA 3S3XA 2BOBC 5GTIZ 1XOUA 2Q7GA 3ZHQA 5H6QA 1R6KA 5TISZ 3KKYA 4J80A 4JYCA 2L35A 3LNNA 3CRCA 3WU2Z 3SPCA 1TUBA 5E1AC 2L6LA 3UT5B 1H8HG 3JCZA 1DLBA 5CA1A 4NVPA 2MK3A 2UUAB 4TWKA 1FKAO 4MVMA 2QM4A 2F4VO 3SYAA 2VQFO 2KG7A 1GKFA 1WPXA 5C93A 3QO8A 2QGNA 4HBNA 3DSQA 3W7TA 2Q0OC 3OEEG 4ZI7A 2CUGA 3L72H 2UXXA 2ZM6O 4DV2B 2CTWA 2O57A 2UUCO 1YF2A 1ZL8A 3QVNA 2VQFB 5KHJA 1P7BA 4DK0A 5GONB 3R66A 4X66O 4FIPC 4DRXB 4JV5O 3AG7A 4GKKB 1SERA 3UQ8A 2ZR3A 2IH3C 3ZIAG 2JRIA 3BCCH 3E8GA 3IC7A 3Q4HA 4LF7O 4J10A 5CMUA 2QEXV 4DR6B 1VP7A 3K0DA 2V7QG 5L3BA 3ML0A 1M56C 2HR3A 1M56B 3JAKB 3WB1A 4C7UA 4O2AA 4DV4O 1M9NA 3TXQA 4JI5O 5BXZA 2DN9A 4DYLA 1PD3A 1GAXA 3G6EV 3SJBC 3U11A 1K5QA 4PV1B 3SYCA 4LF5B 1EN4A 4LWSA 2Q7HA 1ZL8B 1JMKC 4HNAA 3VOUA 3LDEA 2AW9A 2AZ2A 2ZCEA 1R3IC 3TGUH 4PA3A 5EZYB 3SJAC 1YJWV 1K33A 4X65B 1KUQA 4J9ZB 1QBZA 2W0XA 3JSLA 3CCRV 4JYBA 3RN4A 4QNHB 2GHYA 3H1JH 3HKDA 3TXSA 4WFAV 4CS2A 3K04A 2PGGA 1PM9A 2CTPA 3BA9A 2Y69C 3ASNB 3H1LH 1N32B 3FAVA 3T4DA 3QTCA 1OCCC 4UV8A 4LNUB 2XTAA 2E3CA 3CE2A 1HW7A 1Q86W 3W7WA 1BSMA 5BR8O 4DV1B 3FAVB 1IZ3A 2DQ0A 3JCUZ 3K5MA 1VQ8V 2OTJV 3H9VA 2P22C 1G8MA 2GSMB 2AHYA 5KHHA 5JWPA 2LW7A 1AJNA 1NR7A 4LBEC 5H2FZ 2XAQA 3CMAV 1M93A 4WFBV 2Y0IA 1OHHG 1XUQA 4NTXA 4JI2O 2XAJA 1IVSA 1AI6A 1GTOA 4FFBA 1H8EG 4MVUA 4PA9A 1F4NA 1Q90D 4FZ0A 1EM1A 2Y4TA 2OCCC 4NXNB 1BMFG 3N2GA 3BVOA 4F6EA 2V4DA 3ZRVA 2ZE6A 1FFTB 1HWYA 3OR7C 5IY5C 2DWDC 4WFGA 1R6NA 4MVSA 5B3SC 4FFBB 3VBBA 3OMAB 3ZHVA 2EZPA 1OV9A 1ZWIC 1J95A 4DR5B 4ZHQA 3O9OA 2BTQB 4LF4B 1BHBA 1OCRB 2HLDG 1H2LA 1IBLO 3IC9A 3E2EA 2IH1C 3GWKC 2C2AA 4G28B 3ABKC 2ATKC 5KA5A 4CH5A 1N0NA 2Q9LA 2BE3A 3CB2A 2XOKG 2P06A 2B1GA 2GUZB 3OMNB 3L71H 3BPZA 5C8YB 3ABLC 1D5NA 3AG3C 1R3LC 4B3RO 3ETQA 1W59A 5LGUA 1QCEA 1IBMO 1W0KG 4B3RB 2JGDB 2ZKOA 5LP6C 5EYPA 3FB8C 5DM6V 1KP2A 3C3TA 1K4DC 1E79G 4UB8Z 5CB4B 4BR6A 1PV0A 2DQ3A 2ZDIA 3JD3A 1KC8W 1NU1H 3JD0A 1MMMA 1COWG 4LF4O 1EZJA 3QF7A 1L0LH 1YZBA 5LOVB 4MVRA 5KUMA 1WN7A 2WLMA 1MSWD 2QSAA 3WB0A 1VF6C 2YXYA 2KG7B 1SZTA 5CBGA 4DRXA 2VWJA 5IYZA 1NQTA 1YEWA 2E75B 2IBZH 2NLJC 3CCLV 1RSOB 5EBMC 4R50A 2EULA 2ITCC 4QIWF 5JH7A 1QQCA 3HKEB 2P4KA 2F93B 1FPOA 3FB6C 4KL1A 1XMQO 1NVPB 1ZSPA 2DE0X 1NS1A 4JZ2A 2UUAO 3JYCA 4OXSA 4JI3B 1KU9A 5HFLA 2PY5A 3JD4A 1JOYA 1ZX3A 1RFYA 2Q73A 2K1EA 4UXNA 4JGSA 1M5IA 5IYZB 4NXMB 5KX5B 5J2UA 2ILMA 3ZHUA 2P90A 1QNMA 1DF5A 5HFMA 1HNXO 1XI1A 4U3FH 4U7OA 4JI1O 1WB8A 2YIBA 5LOVA 4GX1A 3K9SA 1GN4A 3E89A 2YS8A 2BCCH 2JIZG 4LF8B 1ZAUA 1MZFA 4DV3O 1Q81W 3RYIB 4JTCB 3CP1A 3K06A 3FB7C 1Q8IA 5JVDB 4F6RB 3P3PA 1JA8A 1H2SB 1NTZH 1OJHA 4WF9V 3OGCC 3OGIB 3VQXA 4GT1A 1N4CA 4G27B 3CCVV 2DYRB 4FMTA 1I7FA 2JGDA 2IJIA 4X20A 1D5AA 4O4HA 4CS3A 3I55V 4D7SA 4BIZA 3ZBHA 5LGTA 2IJHA 3WG7B 1SQBH 3EXAA 4O2BB 4TT3G 1XHZA 3ZMZA 2PZSA 2WAMA 2JVDA 4JPRA 3WFVA 4LF9B 3J80N 2ZXWB 1V54C 3SGIA 3SDLA 3E8HA 2Y48A 5GW7A 2A7WA 2Z5UA 4J7JA 4X1IA 1FJGB 4NTYA 2Q67A 3AG4B 3OUFA 4PA7A 1JCHA 2LFRA 4PI0A 3STLC 3A0RA 2WLIA 3RVZA 5LHGA 1E1RG 2LGWA 4DV6O 1J5EO 3ABMC 4IHJB 1RSOA 3VQWA 5B66Z 4QJFB 1XL4A 1WP7A 2R72A 5L3FA 2EJ7A 5F2VO
chains in the Genus database with same CATH topology
1VP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VP7 A; 
#chains in the Genus database with same CATH topology
 1NBM G;  3AG4 C;  4O4I A;  4QE9 A;  1SA0 A;  3K79 A;  5BZB A;  4JAU A;  3ICX A;  4LFA B;  4O2A B;  4PDM A;  4CC5 A;  3K57 A;  3JSN A;  3W7U A;  2QE7 G;  3SR2 C;  4DV6 B;  1J5E B;  1K34 A;  3THO A;  3RFR A;  3OT7 A;  1SQV H;  2P67 A;  3CC4 V;  1IDS A;  3H1K H;  2E5L O;  3TJT A;  4RQF A;  4GLX A;  4Q20 A;  3G6B A;  1FXK C;  2HVJ C;  1WJZ A;  1CPY A;  2OCC B;  3UKM A;  1NR1 A;  4CH4 A;  3T1H B;  2EIM C;  1CEZ A;  4J42 A;  4ZI7 B;  5BR8 B;  1SA0 B;  3AK1 A;  1V54 B;  4DR7 B;  5LMN O;  1BQZ A;  5IE9 A;  2FL4 A;  2ITD C;  5L3D A;  3I56 V;  2EIN C;  2NNU A;  1PP9 H;  4I4T A;  3ZRW A;  4H13 B;  5FL7 G;  4DR4 O;  2R9I A;  2XND G;  3T1Y O;  3BFR A;  4YJ2 A;  3OE7 G;  4QGP A;  4OX9 B;  1VF7 A;  2G38 A;  4NKG B;  1WP8 A;  1Q7Y W;  4X64 B;  4LFC B;  4NTW A;  1Q6I A;  3CSX A;  1RP3 B;  3NXS A;  4B3M O;  2EIJ B;  4J7Z A;  4X65 O;  4W4K A;  2Y0P A;  4DV3 B;  1HDJ A;  2UXN A;  3ZHS A;  4PA4 A;  5LL6 Y;  2B9Z A;  5JJN B;  2NR5 A;  1I94 B;  1V9P A;  2JJ1 G;  1EFR G;  4MT8 A;  2M6Y A;  3OR6 C;  2LJ2 A;  4I50 B;  2HG5 C;  3JD2 A;  1U97 A;  4GCZ A;  4GX0 A;  5EIB C;  4DV4 B;  2QWR B;  5KMG A;  4JZG A;  2UU9 B;  3UM7 A;  3X2Q C;  4A5U B;  2Y4U A;  4JI8 B;  4UCO A;  1VQ5 V;  1IBK B;  3T1H O;  2QKA A;  5J9P C;  1Y76 A;  1Y67 A;  1SQG A;  1P84 F;  1SQX H;  1PL0 A;  1G1X B;  5KA6 A;  4I5S A;  3ZED A;  3ZRX A;  1F7Y A;  2UXD B;  1KD1 W;  5L3C A;  2JJ2 G;  1N0J A;  1S5L Z;  4X1K B;  3IAY A;  2CGN A;  3BEH A;  1K5S A;  3H1I H;  1N36 O;  5KMG B;  2KSD A;  4HYO A;  4DR3 O;  3D3Q A;  3M99 B;  2A79 B;  2QWN B;  4K3A A;  3JD1 A;  2ZIO A;  1BE3 H;  5EC2 C;  1QLN A;  1VEW A;  4H44 B;  1JVM A;  1U96 A;  2UUB O;  3A2F A;  1X59 A;  2WLK A;  3CRQ A;  1JX9 A;  2QKS A;  1GM9 A;  4ZIB A;  3B2E E;  2RNB A;  1VMG A;  4J11 A;  2AXT Z;  2LO1 A;  1SES A;  2R9A A;  3B40 A;  2N74 A;  4UVB A;  1W2B U;  4LH7 A;  3F7Y C;  2X6B A;  1JJ2 U;  2JS3 A;  3S3W A;  2YID A;  5K1X A;  3IJ4 A;  4JI7 B;  1PPJ H;  2AGA A;  1Z2G A;  1AB3 A;  2A0L A;  4MW3 A;  3ABK B;  3RYF A;  1SZX A;  1EN5 A;  1Q5O A;  3ZN1 A;  4X62 B;  5JJJ B;  5FPO A;  2N04 A;  4KFM A;  5KHG A;  1VAR A;  3U0Z A;  2PYL A;  1AIL A;  3ZHT A;  1AP6 A;  3D3I A;  3JAK A;  1QR8 A;  2UXC B;  5IWA O;  3CC7 V;  2F66 C;  1S72 V;  5IY5 B;  4UVA A;  1K3E A;  1L8D A;  5A2Q N;  4AQY B;  3E8F A;  4G2K A;  1OCZ B;  1S3J A;  2ZNI A;  2HFE C;  2Y69 B;  1VF5 B;  4JV5 B;  5GON A;  1YTF D;  2OIG A;  1OZ0 A;  3CD6 V;  3PJS K;  2FYU H;  2DW4 A;  3FFQ A;  5JQG A;  5B1A B;  1RM1 C;  3CCE V;  4B08 A;  2YDE A;  5CA1 B;  3SJC C;  3EFF K;  4LH6 A;  1DGS A;  1Y74 B;  1Y6X A;  1HP8 A;  4PDR A;  1QHT A;  2PYJ A;  2CH7 A;  4B7E A;  4HNA B;  1KYO F;  5EK0 A;  1HNW B;  4K0K O;  4NXN O;  4O4J B;  3CYO A;  1Y4M A;  1WAZ A;  4I0X A;  5BY1 A;  3K9A A;  4JI5 B;  2A3Q A;  2CTR A;  1MSD A;  4DV0 B;  5B1O A;  4U3J B;  1GM8 A;  2OIE A;  4KXR A;  2QM7 A;  4I50 A;  3FD9 A;  3ABM B;  2R9R B;  4DV0 O;  2QA4 V;  2ZE7 A;  2XAG A;  4OPA A;  4FM1 A;  4X66 B;  4GX5 A;  1PNL A;  2B1I A;  2HKO A;  4CH3 A;  1VQO V;  1Y66 A;  3N2K A;  4B7K A;  5L3E A;  2YIC A;  4MTO A;  4DV7 O;  4B3T O;  3RYI A;  3CJH B;  3B8M A;  1W0J G;  2CDY A;  2LFS A;  3K59 A;  3BA8 A;  1XRE A;  2VQE B;  3L73 H;  2RMK B;  1Q6U A;  4FVM A;  4TUY A;  1BL8 A;  1JFF B;  3CCU V;  1M4U A;  2Q8V A;  4JI0 O;  1GH6 A;  2ZE5 A;  2XAH A;  5LBQ A;  1L0N H;  4P9O A;  1MOF A;  3CXH F;  4JYA O;  2Q4P A;  1WLE A;  3F7V C;  1DK1 A;  4WFH A;  1TA8 A;  1V55 B;  4EEQ A;  1HR0 O;  3GVM A;  4MS2 A;  1RPO A;  2JS5 A;  2ZNJ A;  3E8B A;  5H6R A;  1XL6 A;  3EHB B;  1YJN V;  4J7K A;  3K58 A;  4EKW A;  3HB3 B;  2WLL A;  3JAM N;  4LC1 A;  1N34 B;  1DF4 A;  3QG5 A;  4WCE V;  1UJW B;  5CA0 B;  4BIO A;  3ZS8 C;  5B1N A;  2YUA A;  4MVO A;  4U7N A;  4TQD A;  1M57 C;  3CCM V;  1TUB B;  4PDV A;  3K5L A;  1GK9 A;  2PI4 A;  2E74 B;  4FK5 C;  4DUY O;  4DUZ O;  1FS0 G;  1JR9 A;  1VQ7 V;  2E5L B;  2IJK A;  4XDK A;  3RBZ A;  4LF7 B;  3CRA A;  5IDJ A;  2QWQ B;  4YJ3 A;  4JI0 B;  1WB7 A;  1ENV A;  4TV9 A;  2RN9 A;  2UUB B;  2GV9 A;  4NR1 A;  1IBL B;  1P49 A;  3QO7 A;  2FB5 A;  1VQ9 V;  3SYP A;  1BZK A;  4X8A A;  4NYK A;  4LFB O;  5E79 Z;  4FJC C;  1CXZ B;  4MTG A;  3ZMT A;  1K7D A;  5GTH Z;  1S5H C;  1M57 B;  4UVC A;  2XAS A;  3DGE A;  5DN6 G;  3ZMU A;  4UCR A;  2JK5 C;  2WLJ A;  2WLI B;  3L70 H;  4RUF A;  2P7T C;  3OTO B;  2YEV A;  1N8R W;  4IHJ A;  4MVZ A;  4I0X B;  2X6C A;  2YXH A;  2YC0 A;  5FNV A;  2XAF A;  4PDL A;  3ZX6 A;  2HEP A;  4LF9 O;  1B04 A;  2KQX A;  3C90 A;  1SET A;  3UO2 A;  1Z5W A;  4FLX A;  1XMO O;  3BAA A;  4I4T B;  2UXB B;  1S76 D;  3LSS A;  4P30 A;  3MAQ A;  1XEQ A;  5EBL C;  2E76 B;  4R7C A;  1NKD A;  4TUY B;  4XDJ A;  4JTA B;  3CXC U;  1N33 O;  4DK1 A;  2CGO A;  4LF6 B;  5IT9 N;  2ZQM A;  1XBL A;  5IJ0 A;  2HP8 A;  1US6 A;  2QJ1 A;  3APQ A;  4FLY A;  1Q82 W;  2ADQ B;  2IM9 A;  2ZE8 A;  3HKD B;  3APO A;  3ZJZ A;  1GMG A;  1KEC A;  3K3W A;  1H38 A;  3A8T A;  2IJJ A;  2M7W A;  1MZE A;  1Y74 A;  4AQY O;  4LF8 O;  1XNQ B;  4NB5 A;  5KHI A;  1VQM V;  4O4J A;  5B1B B;  3IGA C;  3CJH A;  2KB1 A;  1ZLZ A;  1AR1 B;  5IYB O;  3G80 A;  1TGO A;  1EN6 A;  1OCO B;  4DV7 B;  1K92 A;  2YXL A;  2WPD G;  2N05 A;  3T2M A;  3ZCC A;  1VQN V;  2UXD O;  4O4I B;  5CBF A;  1YI2 V;  4OGQ B;  3E86 A;  3JAR B;  4LF5 O;  1NTK H;  3BAB A;  1QVF U;  1B3Q A;  1JJO A;  1R73 A;  2BSK B;  3RW0 A;  5EYP B;  1OCR C;  4FLZ A;  4JTD B;  4RO2 A;  1NTM H;  3MDS A;  1VQ6 V;  1XIL A;  2YIB D;  4L8J A;  4J41 A;  2EIN B;  1FXK B;  3BY6 A;  1IBK O;  5CA0 A;  5H9C A;  4UCT A;  3M8A A;  3OMI B;  4CH6 A;  2JEU A;  2CE4 A;  5A9G A;  1NVP D;  4X1K A;  2GBO A;  1R3J C;  4I9W A;  1HNZ O;  1ORQ C;  3OTF A;  2D2C B;  3FB5 C;  4I7Z B;  4LFA O;  4K0K B;  3ETG A;  5FPR A;  3LSU A;  4IL6 Z;  1F51 A;  2ZM6 B;  3HKB A;  3JAL B;  4HAM A;  2JGU A;  1S77 D;  4UV9 A;  5B3S B;  4YHH B;  3KCX A;  2WLH A;  1RPR A;  4DXW A;  1Q43 A;  5LXT B;  4BWA A;  5CA3 A;  1K97 A;  4XDL A;  2YI8 A;  5CN0 A;  4YY3 O;  3OEH G;  1FXV A;  2NN4 A;  5B5E Z;  2EIM B;  4PJ0 Z;  4KHP B;  2GUZ A;  4JI6 B;  4IYI A;  3H1H H;  4Q6G A;  4JI8 O;  2UXC O;  3ASN C;  3K03 A;  3AG2 C;  5CBH A;  1LR1 A;  1FXH A;  2GTA A;  4EFE A;  3D8C A;  2CK3 G;  2RDC A;  4TV8 B;  4JI4 B;  1THZ A;  1YJ9 V;  1PNM A;  4B3S O;  5LMN B;  5EZY A;  3T1C A;  3CPW U;  1QLE B;  4GX2 A;  2QM8 A;  4UB6 Z;  4N21 A;  2ODM A;  5LHH A;  4JI7 O;  4W4L A;  3SPJ A;  4MVQ A;  1SS3 A;  1T5E A;  3HKC A;  4GYC B;  3RYH B;  3AG3 B;  5ITZ B;  3ABL B;  4P2Z A;  1NI8 A;  1P4R A;  1AI5 A;  5LGN A;  5H5N A;  5K1P A;  5IYC O;  1VQK V;  2JEX A;  4DR1 O;  4FLT A;  4LR3 A;  3WG7 C;  3TCU A;  3KZI Z;  4P9P A;  1VQL V;  1XDC A;  3JAR A;  2UXB O;  2X7R B;  3A0B Z;  4JI1 B;  3CWB H;  2Q68 A;  2IU3 A;  4DR3 B;  3OW2 U;  5IJ0 B;  1VIB A;  2WWW A;  4UCV A;  4MSW C;  3DC6 A;  2OCH A;  2X0L A;  1O9G A;  1DTO A;  1AVM A;  2YEV B;  3ZN0 A;  1SF9 A;  5ITZ A;  3BHP A;  4N23 A;  4IYH A;  2DOS A;  3L74 H;  4FLV A;  5DED A;  4JI3 O;  4YIO A;  1XNR B;  1TVK B;  4K8Z A;  2H8P C;  3M7M X;  3H01 A;  1XHX A;  2A9H A;  2GTS A;  2FKX A;  4JAV A;  5EIB D;  3CRR A;  2UU9 O;  1BCC H;  4MW8 A;  1KBH A;  1I5X A;  3Q4H B;  2OYQ A;  4L87 A;  5IYD O;  2RCV A;  4I9Q A;  3ZRS A;  4DV5 O;  2Z0A A;  3K08 A;  2WSS G;  4ZKI A;  1HNW O;  3JAW A;  3E22 A;  1KMI Z;  4O4L B;  4ZOL B;  1LUV A;  1SC5 B;  3WB2 A;  1HNZ B;  3AK2 A;  2PI5 A;  5LA6 B;  4D6T H;  5LP6 A;  4WFE A;  5LYJ B;  1URF A;  2H94 A;  5KAI Z;  1H2M A;  3ABU A;  1L1F A;  2IW5 A;  1KB9 F;  3VQV A;  2D3O W;  4JAA A;  4BIU A;  4DR2 O;  2OTL V;  3RWR D;  1MAB G;  3T1Y B;  2H3O A;  1FFX A;  4DR4 B;  1N34 O;  1NT2 B;  3JAS A;  3QNE A;  1M1K W;  4KP4 A;  4X20 B;  3DXR B;  4O2B A;  4B3S B;  1KKC A;  4ABM A;  5AG2 A;  1IBM B;  4R8C A;  2JDI G;  4Z2W A;  2BOC C;  1I08 A;  3HPL C;  3CX5 F;  4OPH A;  1FAF A;  5CB4 A;  4X9Q A;  1VQP V;  1JFF A;  3W7X A;  4NXM O;  2CH7 B;  3TK1 A;  1BS3 A;  1SKV A;  4F6R A;  5JVD A;  3NR7 A;  4GZR B;  1NH2 D;  3SPI A;  2Q0A A;  4DW1 A;  4B3M B;  1QR9 A;  3E22 B;  4ZOL A;  4YY3 B;  4JYA B;  4LFC O;  4TQF A;  4AI8 A;  4GKJ B;  1XMQ B;  3P30 A;  3DXR A;  4PEL A;  3UCS C;  3W7S A;  1AR4 A;  1CP9 A;  1N33 B;  4RWU A;  4PD4 F;  2P6J A;  2Q69 A;  2VS0 A;  4O4H B;  3TET A;  5LMU O;  2QTS A;  2VQE O;  3PN1 A;  1MA1 A;  5LHI A;  4I55 A;  1SQP H;  5J2T B;  4WFF A;  3DTU B;  2GDS A;  2ARH A;  2F4V B;  2CAZ C;  1AI7 A;  3SJQ C;  1R6T A;  1G4Y B;  3OM3 B;  3T4Z A;  1F23 A;  3FYI B;  2WA4 A;  3U10 A;  3D36 C;  1MNG A;  3OUS A;  1I5Y A;  4JI6 O;  3G4S V;  1QU7 A;  3UT5 A;  4UCS A;  3AG2 B;  3I5D A;  1AJP A;  2ZR2 A;  2EJR A;  2DJV A;  4JF3 A;  4BAY A;  1VQ4 V;  2EIK C;  3CCS V;  3OAA G;  3AK3 A;  4IT5 A;  4DV1 O;  5J2U B;  5JCO C;  1SQF A;  1GM7 A;  4TV9 B;  1Q3E A;  5JQG B;  1TVK A;  2DYR C;  3CCJ V;  4H37 A;  2LGQ A;  2BTQ A;  1FD9 A;  2F95 B;  3LDC A;  3B77 A;  3RYH A;  4RQE A;  2W0F C;  3FKS G;  1N32 O;  1IUR A;  3HR0 A;  2F1M A;  4Z1V A;  1BQ0 A;  1MG1 A;  2DWE C;  3EVK A;  3BRC A;  5L3G A;  2YI9 A;  2OT5 A;  3L9D A;  1FFX B;  2R70 A;  2YIA A;  3IFX A;  2IU0 A;  1LUW A;  4PI2 A;  3STZ C;  3JAL A;  4CC6 A;  3MHS C;  4EB6 B;  1GN2 A;  2LP7 A;  4DW0 A;  4E4E A;  2QKC A;  4LP8 A;  1K8A W;  1OCC B;  1AJQ A;  3LDD A;  2A06 H;  3J7A U;  3FX7 A;  2YSU B;  2PF4 E;  4FM2 A;  2BTO A;  1FXK A;  2OWO A;  4JYY A;  3N2K B;  1WA8 A;  3AEI A;  3ASO B;  4K35 A;  3G67 A;  3ASO C;  1NH2 B;  3J81 N;  3E35 A;  5KX5 A;  3ZMS A;  4YIP A;  1HNX B;  4JI4 O;  4X88 A;  2WA3 A;  1WNS A;  1Q6H A;  1R3K C;  1IXB A;  2LQT A;  4E2L A;  2P4V A;  5B1A C;  3RYC A;  1RM1 B;  2P5O A;  1WA8 B;  5EC1 C;  1SRY A;  3O65 A;  4IGG A;  3C3S A;  3HKE A;  5KHK A;  1NJI W;  1NZ6 A;  3LUT B;  1TUE B;  2QR4 A;  2Q7E A;  1P7G A;  3OFN G;  1XNQ O;  3CS5 A;  1B6Q A;  3AG1 C;  3CME V;  4R6Z A;  1IX9 A;  5JJE B;  3UO3 A;  2W6J G;  1PNK A;  2Q5Z A;  4O4L A;  4IIJ A;  2RQ6 A;  3K5O A;  3SPH A;  1YSC A;  3K0G A;  1YVW A;  2MW2 B;  3X2Q B;  3B8N A;  1LNQ A;  4K8X A;  4ASU G;  2DYS C;  2HHH O;  4YHH O;  3JAT B;  1F4M A;  2V1D A;  1KKD A;  2BSK A;  1IXM A;  2Q6A A;  3E83 A;  1UPG A;  1R1B A;  4DV5 B;  2EIK B;  4IIJ B;  2EIL C;  1OCO C;  4ZHQ B;  2ZXW C;  3N2G B;  4D7T A;  3B09 A;  2RJZ A;  4CBC A;  1A32 A;  4UUJ C;  3OD4 A;  3F5W C;  3ABT A;  3JAT A;  3MD0 A;  4FM0 A;  3MHH C;  1Y76 B;  2HVK C;  3LNM B;  4KHP O;  1BHA A;  1YHQ V;  1FYJ A;  2X6A A;  4PA6 A;  1AP5 A;  3HKC B;  2QWP B;  2DYS B;  3ZMV A;  3RYF B;  3CC2 V;  4LFB B;  3K5N A;  2F43 G;  3AG1 B;  2W6I G;  4KUM A;  2PUS A;  2AHZ A;  5KUK A;  2ETN A;  1H2N A;  1BT8 A;  1SQQ H;  2CTQ A;  4EFB A;  4DR6 O;  4TSF G;  5LMU B;  1YXB A;  2KKW A;  1EBO A;  4DR1 B;  3GWO A;  3SYQ A;  3QO5 A;  4AHC A;  3F5T A;  5C8Y A;  3ZRW B;  3RVY A;  1H2K A;  4U3J A;  5LXT A;  1I0H A;  4LCU C;  2DMX A;  2QWO B;  4QPK A;  1YTF B;  5IWA B;  4GKJ O;  4X64 O;  2XHB A;  1YDX A;  4DUZ B;  1ROP A;  3CEI A;  4YJ3 B;  4DR5 O;  1YIT V;  4LF6 O;  4DO2 A;  4OX9 O;  4DV2 O;  1H2G A;  1WPB A;  4WBN A;  5KLV H;  3CHX A;  5FNV B;  3P3N A;  4GUN A;  3L75 H;  4DR7 O;  2ZT9 B;  1ARO P;  1O9H A;  3HKB B;  1GRJ A;  3DC5 A;  1D2D A;  5KAF Z;  4H33 A;  4FFK A;  1HR0 B;  4UCU A;  4BW5 A;  4FLW A;  4MTF A;  2ZIM A;  2VRZ A;  4TOI A;  4HZ3 A;  3OTO O;  1S5J A;  5B1B C;  4LWS B;  1Z5V A;  4DR2 B;  2WLN A;  5D5Q A;  4GKK O;  1EZV H;  5LYJ A;  1K4C C;  2B5U A;  4MTX A;  2UUC B;  2EBO A;  3N27 A;  1YIJ V;  3CCQ V;  1K9M W;  1PKX A;  3P32 A;  5FLX N;  1GN3 A;  3ZHR A;  4AIL C;  2HJF C;  4FLU A;  2XT9 A;  4B3T B;  2HHH B;  1JQ0 A;  1AI4 A;  4EB6 A;  2K9P A;  1M90 W;  3B4S A;  2AZ0 A;  1UFI A;  2WLL B;  3VQY A;  1JPX A;  1ZTE A;  1XMO B;  2QDO A;  5IJ9 A;  2XUM A;  1X4T A;  2Z3Y A;  2FML A;  2ZD9 A;  1V55 C;  1VF6 A;  3LSQ A;  5LP6 B;  4JI2 B;  3JAW B;  3ETE A;  4BW9 A;  1PL4 A;  5JH7 B;  4X89 A;  1FJG O;  1GO3 F;  4F4L A;  3CRM A;  3FYE B;  1S0V A;  4H0L B;  4YXW G;  2EX3 A;  4PHZ A;  5LA6 A;  1XNR O;  2PTM A;  4QE7 A;  1ZUQ A;  4XBF A;  1I94 O;  3A0H Z;  3RT3 C;  1G6U A;  4YJ2 B;  3G71 V;  1K73 W;  1QLE C;  2EZO A;  5DEC A;  5IJ9 B;  1BGY H;  1TAE A;  1XQ8 A;  4J9Y B;  4WBN B;  2FTK A;  3RYC B;  2ZDI C;  5JCO A;  4RAI A;  5BMV A;  4ZBM A;  2EIJ C;  3GB7 C;  3SPG A;  1E1Q G;  2EIL B;  2F23 A;  1GN6 A;  1B06 A;  4ICG A;  4JAS A;  2ZIN A;  4FPP A;  4CS4 A;  1QVG U;  3JAS B;  1YCI A;  4X1Y B;  1KP3 A;  3KCY A;  4X1I B;  2LW1 A;  3ETD A;  3D36 A;  4DUY B;  4Z1M G;  5BMV B;  1N36 B;  2VWK A;  5EBW C;  1KQS U;  4CZZ A;  3RGB A;  4FZ1 A;  4X1Y A;  3KG2 A;  3SYO A;  2HJD A;  2QTO A;  4X62 O;  1OCZ C;  4I55 B;  5J2T A;  4TV8 A;  3R65 A;  5D5P A;  4RUE A;  2ADP A;  4LNU A;  4UFZ A;  1AR5 A;  4QPJ A;  3S3X A;  2BOB C;  5GTI Z;  1XOU A;  2Q7G A;  3ZHQ A;  5H6Q A;  1R6K A;  5TIS Z;  3KKY A;  4J80 A;  4JYC A;  2L35 A;  3LNN A;  3CRC A;  3WU2 Z;  3SPC A;  1TUB A;  5E1A C;  2L6L A;  3UT5 B;  1H8H G;  3JCZ A;  1DLB A;  5CA1 A;  4NVP A;  2MK3 A;  2UUA B;  4TWK A;  1FKA O;  4MVM A;  2QM4 A;  2F4V O;  3SYA A;  2VQF O;  2KG7 A;  1GKF A;  1WPX A;  5C93 A;  3QO8 A;  2QGN A;  4HBN A;  3DSQ A;  3W7T A;  2Q0O C;  3OEE G;  4ZI7 A;  2CUG A;  3L72 H;  2UXX A;  2ZM6 O;  4DV2 B;  2CTW A;  2O57 A;  2UUC O;  1YF2 A;  1ZL8 A;  3QVN A;  2VQF B;  5KHJ A;  1P7B A;  4DK0 A;  5GON B;  3R66 A;  4X66 O;  4FIP C;  4DRX B;  4JV5 O;  3AG7 A;  4GKK B;  1SER A;  3UQ8 A;  2ZR3 A;  2IH3 C;  3ZIA G;  2JRI A;  3BCC H;  3E8G A;  3IC7 A;  3Q4H A;  4LF7 O;  4J10 A;  5CMU A;  2QEX V;  4DR6 B;  1VP7 A;  3K0D A;  2V7Q G;  5L3B A;  3ML0 A;  1M56 C;  2HR3 A;  1M56 B;  3JAK B;  3WB1 A;  4C7U A;  4O2A A;  4DV4 O;  1M9N A;  3TXQ A;  4JI5 O;  5BXZ A;  2DN9 A;  4DYL A;  1PD3 A;  1GAX A;  3G6E V;  3SJB C;  3U11 A;  1K5Q A;  4PV1 B;  3SYC A;  4LF5 B;  1EN4 A;  4LWS A;  2Q7H A;  1ZL8 B;  1JMK C;  4HNA A;  3VOU A;  3LDE A;  2AW9 A;  2AZ2 A;  2ZCE A;  1R3I C;  3TGU H;  4PA3 A;  5EZY B;  3SJA C;  1YJW V;  1K33 A;  4X65 B;  1KUQ A;  4J9Z B;  1QBZ A;  2W0X A;  3JSL A;  3CCR V;  4JYB A;  3RN4 A;  4QNH B;  2GHY A;  3H1J H;  3HKD A;  3TXS A;  4WFA V;  4CS2 A;  3K04 A;  2PGG A;  1PM9 A;  2CTP A;  3BA9 A;  2Y69 C;  3ASN B;  3H1L H;  1N32 B;  3FAV A;  3T4D A;  3QTC A;  1OCC C;  4UV8 A;  4LNU B;  2XTA A;  2E3C A;  3CE2 A;  1HW7 A;  1Q86 W;  3W7W A;  1BSM A;  5BR8 O;  4DV1 B;  3FAV B;  1IZ3 A;  2DQ0 A;  3JCU Z;  3K5M A;  1VQ8 V;  2OTJ V;  3H9V A;  2P22 C;  1G8M A;  2GSM B;  2AHY A;  5KHH A;  5JWP A;  2LW7 A;  1AJN A;  1NR7 A;  4LBE C;  5H2F Z;  2XAQ A;  3CMA V;  1M93 A;  4WFB V;  2Y0I A;  1OHH G;  1XUQ A;  4NTX A;  4JI2 O;  2XAJ A;  1IVS A;  1AI6 A;  1GTO A;  4FFB A;  1H8E G;  4MVU A;  4PA9 A;  1F4N A;  1Q90 D;  4FZ0 A;  1EM1 A;  2Y4T A;  2OCC C;  4NXN B;  1BMF G;  3N2G A;  3BVO A;  4F6E A;  2V4D A;  3ZRV A;  2ZE6 A;  1FFT B;  1HWY A;  3OR7 C;  5IY5 C;  2DWD C;  4WFG A;  1R6N A;  4MVS A;  5B3S C;  4FFB B;  3VBB A;  3OMA B;  3ZHV A;  2EZP A;  1OV9 A;  1ZWI C;  1J95 A;  4DR5 B;  4ZHQ A;  3O9O A;  2BTQ B;  4LF4 B;  1BHB A;  1OCR B;  2HLD G;  1H2L A;  1IBL O;  3IC9 A;  3E2E A;  2IH1 C;  3GWK C;  2C2A A;  4G28 B;  3ABK C;  2ATK C;  5KA5 A;  4CH5 A;  1N0N A;  2Q9L A;  2BE3 A;  3CB2 A;  2XOK G;  2P06 A;  2B1G A;  2GUZ B;  3OMN B;  3L71 H;  3BPZ A;  5C8Y B;  3ABL C;  1D5N A;  3AG3 C;  1R3L C;  4B3R O;  3ETQ A;  1W59 A;  5LGU A;  1QCE A;  1IBM O;  1W0K G;  4B3R B;  2JGD B;  2ZKO A;  5LP6 C;  5EYP A;  3FB8 C;  5DM6 V;  1KP2 A;  3C3T A;  1K4D C;  1E79 G;  4UB8 Z;  5CB4 B;  4BR6 A;  1PV0 A;  2DQ3 A;  2ZDI A;  3JD3 A;  1KC8 W;  1NU1 H;  3JD0 A;  1MMM A;  1COW G;  4LF4 O;  1EZJ A;  3QF7 A;  1L0L H;  1YZB A;  5LOV B;  4MVR A;  5KUM A;  1WN7 A;  2WLM A;  1MSW D;  2QSA A;  3WB0 A;  1VF6 C;  2YXY A;  2KG7 B;  1SZT A;  5CBG A;  4DRX A;  2VWJ A;  5IYZ A;  1NQT A;  1YEW A;  2E75 B;  2IBZ H;  2NLJ C;  3CCL V;  1RSO B;  5EBM C;  4R50 A;  2EUL A;  2ITC C;  4QIW F;  5JH7 A;  1QQC A;  3HKE B;  2P4K A;  2F93 B;  1FPO A;  3FB6 C;  4KL1 A;  1XMQ O;  1NVP B;  1ZSP A;  2DE0 X;  1NS1 A;  4JZ2 A;  2UUA O;  3JYC A;  4OXS A;  4JI3 B;  1KU9 A;  5HFL A;  2PY5 A;  3JD4 A;  1JOY A;  1ZX3 A;  1RFY A;  2Q73 A;  2K1E A;  4UXN A;  4JGS A;  1M5I A;  5IYZ B;  4NXM B;  5KX5 B;  5J2U A;  2ILM A;  3ZHU A;  2P90 A;  1QNM A;  1DF5 A;  5HFM A;  1HNX O;  1XI1 A;  4U3F H;  4U7O A;  4JI1 O;  1WB8 A;  2YIB A;  5LOV A;  4GX1 A;  3K9S A;  1GN4 A;  3E89 A;  2YS8 A;  2BCC H;  2JIZ G;  4LF8 B;  1ZAU A;  1MZF A;  4DV3 O;  1Q81 W;  3RYI B;  4JTC B;  3CP1 A;  3K06 A;  3FB7 C;  1Q8I A;  5JVD B;  4F6R B;  3P3P A;  1JA8 A;  1H2S B;  1NTZ H;  1OJH A;  4WF9 V;  3OGC C;  3OGI B;  3VQX A;  4GT1 A;  1N4C A;  4G27 B;  3CCV V;  2DYR B;  4FMT A;  1I7F A;  2JGD A;  2IJI A;  4X20 A;  1D5A A;  4O4H A;  4CS3 A;  3I55 V;  4D7S A;  4BIZ A;  3ZBH A;  5LGT A;  2IJH A;  3WG7 B;  1SQB H;  3EXA A;  4O2B B;  4TT3 G;  1XHZ A;  3ZMZ A;  2PZS A;  2WAM A;  2JVD A;  4JPR A;  3WFV A;  4LF9 B;  3J80 N;  2ZXW B;  1V54 C;  3SGI A;  3SDL A;  3E8H A;  2Y48 A;  5GW7 A;  2A7W A;  2Z5U A;  4J7J A;  4X1I A;  1FJG B;  4NTY A;  2Q67 A;  3AG4 B;  3OUF A;  4PA7 A;  1JCH A;  2LFR A;  4PI0 A;  3STL C;  3A0R A;  2WLI A;  3RVZ A;  5LHG A;  1E1R G;  2LGW A;  4DV6 O;  1J5E O;  3ABM C;  4IHJ B;  1RSO A;  3VQW A;  5B66 Z;  4QJF B;  1XL4 A;  1WP7 A;  2R72 A;  5L3F A;  2EJ7 A;  5F2V O; 
#chains in the Genus database with same CATH homology
 1VP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...