2A7WA

Crystal structure of phosphoribosyl-atp pyrophosphatase from chromobacterium violaceum (atcc 12472). nesg target cvr7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
91
structure length
91
Chain Sequence
DVLKNIADTLEARREAAPQSSYVASLFHKGEDAILKKVAEEAAETLMASKDKDKLHLVREVADLWFHTMVLLTYHGLRPEDVVMELHRREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosyl-ATP pyrophosphatase
publication title Crystal Structure of Phosphoribosyl-ATP Pyrophosphatase from Chromobacterium violaceum. NESG Target CVR7.
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
total genus 29
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.1.31: Phosphoribosyl-ATP diphosphatase.
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2a7wA00
2YXHA 2Q73A 1VMGA 2Q9LA 2A7WA 1YXBA 1Y6XA 2P06A 3CRCA 2A3QA 3CRAA 2Q5ZA 2Q4PA 4QGPA 3C90A 2OIEA 2OIGA 1YVWA 5IE9A 2GTAA
chains in the Genus database with same CATH superfamily
5B1OA 4EEQA 2NNUA 3W7WA 2UUBO 2DN9A 5KAIZ 2ZM6B 3PN1A 4I50A 5J2TA 4QPJA 2P4KA 1Y66A 4AI8A 1ZL8A 4A5UB 3F7YC 1L1FA 3QNEA 4DR4B 3O65A 3CSXA 4JZ2A 2WSSG 4MVZA 2DYRB 2A79B 1VQ6V 1DTOA 2F4VB 3JD3A 2RJZA 2ZIMA 5FPRA 3CCLV 4LP8A 2PY5A 2E5LB 5IDJA 1S5HC 1U96A 4DR1O 1WLEA 1OZ0A 4X88A 5KX5B 1OV9A 5E79Z 2JJ2G 2RCVA 4X8AA 1M93A 1B6QA 2OWOA 4Q6GA 3KCXA 3SPHA 4UCUA 4MVUA 1XHZA 3LSQA 2LGWA 1TGOA 3ETDA 2QR4A 3RVYA 4FPPA 1D5NA 2JVDA 2IW5A 3UO3A 2L6LA 4CH5A 4X66B 3DXRA 4R8CA 2A3QA 4LCUC 4LFCB 5EBLC 4DW1A 5JJNB 1YDXA 4PA6A 5KUMA 3E22A 1XI1A 3DC6A 2QM8A 2WLJA 2Q6AA 1VP7A 4MW8A 2K9PA 5LMNB 1FFTB 4QNHB 1QLNA 1S5LZ 3APQA 1ZWIC 1FXKB 4FM2A 2BCCH 2EINB 1URFA 3JAMN 4DK0A 4JAVA 3WB1A 3FX7A 1M56C 2E3CA 1VMGA 4YHHB 1XDCA 1YJ9V 1KQSU 1ZSPA 3UO2A 3JD2A 2DJVA 2HVKC 4KUMA 2EX3A 4UCRA 4NTYA 2OT5A 3UCSC 4UB6Z 5H9CA 2E75B 4FJCC 3T1YO 4KP4A 5KAFZ 3E86A 4NXNO 1TAEA 3A0BZ 1XMOB 4TWKA 3JCUZ 1ORQC 3MAQA 2E76B 5KHIA 2A7WA 1I94B 1FFXA 4FLYA 3G67A 4TSFG 1VARA 2PI4A 4P9OA 3LNNA 3ZHUA 4G28B 3JSNA 2DYSC 1NR7A 4GKKO 2O57A 1BT8A 2FB5A 3DTUB 5BMVA 4B3RO 4X1KA 2PF4E 4ZIBA 1R1BA 5JCOC 1OCRC 3FB5C 4UCSA 3OM3B 2YIDA 4O4IA 1NU1H 4CS2A 1OCOC 2X6AA 4YY3O 1HNZB 1F23A 1GKFA 5JVDA 4FLZA 1FFXB 1AI6A 1XBLA 1NTMH 2ZDIA 5KHKA 4AILC 4DR3B 4JAUA 3I56V 1PL4A 4NR1A 1G6UA 2ZIOA 4DR2O 3N27A 1SRYA 1L0NH 1GN6A 1TUBA 4FZ0A 5JWPA 3VOUA 5IWAO 4I9WA 1K33A 1H2GA 5IT9N 1GAXA 4X65O 1Q81W 3K58A 4EKWA 4G27B 5IJ0A 4JI4O 3H1KH 1P84F 1TUEB 1WP8A 3AG2C 1XMQO 1JJ2U 1AI7A 4JI5O 3VBBA 3SGIA 4JGSA 3RGBA 3OW2U 5K1PA 4P2ZA 2QM4A 2KG7B 1B3QA 5H2FZ 4JI8B 3QG5A 3SPGA 3K04A 1IXBA 1NI8A 1AB3A 4XDJA 3JARA 3CEIA 4DV6O 1PL0A 1IBKB 1TUBB 4LF5B 5EC1C 3OFNG 4R50A 4LF4B 4QE7A 1NVPB 5LGNA 5LXTA 2KQXA 2EJ7A 1QR9A 2OIGA 4L87A 3EVKA 3JASB 3E8GA 1QNMA 3H1IH 3T2MA 1PKXA 1AR1B 5IJ9A 4YJ3A 1RSOA 2F1MA 2N74A 1Q7YW 1H8EG 1LUVA 2UXCB 4DUYO 3CRAA 4H13B 1OCRB 3ZMUA 4JI7B 2P22C 4JI2O 3W7SA 1OCOB 5ITZA 4DV0O 5L3CA 3D3IA 3K5LA 2CUGA 1VIBA 1CPYA 1VQ8V 2IJIA 3K79A 4I55A 3OR6C 4LWSA 4X64O 1HNWO 2P06A 2GTSA 2WLHA 2YSUB 3CHXA 4XBFA 4U7OA 3JYCA 3ZRSA 2N04A 5KLVH 3G6BA 1N34B 1ZX3A 4O4LB 4DK1A 4YJ3B 4DV4B 2EZOA 1V55C 3SPJA 1YCIA 1WNSA 2YIBD 4JF3A 5LOVA 4QIWF 4CS4A 3K5NA 4FK5C 1HR0O 4EFEA 2LJ2A 1M9NA 5JQGA 4DV2B 3R66A 3JAKA 2HEPA 3AG2B 1GM8A 2MK3A 2ZD9A 4I55B 4GX0A 2HJFC 2IJHA 3C90A 3T4DA 4PA9A 3T4ZA 3L74H 1W0JG 2ETNA 2M7WA 4TV9A 1I5YA 2GDSA 4GUNA 4MTOA 2HHHB 2BOCC 2DQ3A 2OTLV 2WLNA 4DR6B 1JOYA 4K8XA 4RAIA 1Q90D 2P67A 2R9IA 1WA8B 3OGIB 4K0KB 3SR2C 1XNRB 3CC4V 2F95B 4X20A 3RBZA 1MSDA 4JASA 2GV9A 3CRMA 1XUQA 3K08A 4FMTA 2UXNA 1AR4A 2Q7HA 3P3PA 2ZM6O 2VQEB 3JALA 1JFFB 5JQGB 4UVAA 4DR4O 4HZ3A 3ABKC 4FM1A 3H1LH 1V54C 2Q0OC 2K1EA 2WLLB 3G71V 2ZE6A 1QVFU 2QM7A 2F4VO 4NB5A 4TV9B 1WP7A 2QKAA 2E5LO 2HKOA 3SJBC 1MZEA 3WB0A 2PZSA 4K3AA 1Q8IA 1RM1C 1WB7A 3TK1A 3RT3C 4GX2A 4DV5O 2R9RB 4I4TB 2HFEC 3T1CA 2D3OW 1K4DC 1MMMA 3H9VA 5LA6A 5C8YA 1H2LA 4QGPA 1RP3B 4JI1B 1TA8A 4JI0B 3K0GA 4RQEA 2XUMA 4MTGA 1HWYA 4I5SA 4FZ1A 2RDCA 3OD4A 4X66O 1V55B 3TJTA 5CN0A 3KZIZ 4LF7B 4MSWC 4LFCO 1P7GA 4WFAV 1M90W 1R73A 3H1HH 4F6EA 4LF9O 1QVGU 1R3LC 4HBNA 1SA0B 2WPDG 1M1KW 3KG2A 2DWDC 5FNVA 1SC5B 1IBMO 1SERA 4P30A 3HKDA 5LHGA 3HB3B 5LMNO 3E89A 4IIJA 4O4JA 1YJWV 3ZCCA 4NVPA 3WU2Z 2JS5A 4J11A 4TQFA 4AQYB 5IYDO 4J7KA 3T1HB 3CWBH 3D36C 3CD6V 3CCRV 2R9AA 4GYCB 4YHHO 1AP6A 4CBCA 2CDYA 3M8AA 3OUFA 1MZFA 3AK3A 1NR1A 3ABTA 4WCEV 4U3JB 4FFBA 1SZXA 5LYJB 1AVMA 3S3WA 3MDSA 1I08A 2BTQA 3ABKB 1V54B 3JD0A 4MS2A 1XMOO 2VWJA 2W6JG 2JS3A 4Z2WA 3O9OA 2GUZA 1VQMV 4PV1B 3FB8C 4BIOA 3L72H 1RM1B 2UUCO 4ZHQB 4J7JA 4TQDA 4FLTA 3LDCA 3W7XA 1Q6IA 1M5IA 4HAMA 1L8DA 1VQ9V 1E79G 4LF6B 5CBGA 1SF9A 4KHPO 1KBHA 4P9PA 1DGSA 1J5EO 2QEXV 3LDEA 5DM6V 3G4SV 3CCJV 1W59A 3TETA 2XHBA 2ZQMA 1BZKA 5K1XA 3H01A 4LH6A 2GTAA 4WBNB 4PELA 3K59A 1HNZO 2ZINA 2WLMA 4MVSA 1I5XA 2G38A 3GB7C 2AHZA 4EB6B 1A32A 3OEHG 4JV5B 1NTKH 1M57C 1GTOA 4DR3O 5KX5A 2HLDG 2YDEA 5EZYB 5CBFA 5FL7G 5H6RA 1VQLV 2LW7A 3AG1C 4B7KA 2YXLA 2QDOA 3CX5F 5CA3A 3UQ8A 3OEEG 3B77A 3PJSK 4ZI7B 1I0HA 3FD9A 5E1AC 2CTRA 3TCUA 3ZX6A 3K3WA 4DRXA 1N0NA 3OTFA 4WF9V 2L35A 4LC1A 3ZRWB 4GCZA 3L9DA 3F5TA 2Y0IA 3APOA 5KHHA 2EULA 2CAZC 2XAJA 5H6QA 3JD4A 2NR5A 1FPOA 1S76D 4E2LA 5J2UB 2KB1A 4JI8O 3CP1A 1XL4A 1BHAA 1SQBH 2QTOA 4KL1A 1AR5A 4BIZA 1EZVH 5D5QA 3G6EV 1GMGA 5EBWC 1IBKO 1S3JA 4R6ZA 4LF5O 3OGCC 3GWOA 2R72A 4LF4O 3F5WC 3FYIB 1FXKA 2HVJC 1KMIZ 3VQYA 4DRXB 3QVNA 1O9HA 4RUEA 2B5UA 4L8JA 1BGYH 1K4CC 1NH2B 1BE3H 2ITDC 3CMEV 2F23A 4IGGA 2UXCO 3LSUA 2P6JA 4NKGB 4OGQB 3K03A 5CA1A 4NXMB 2BE3A 3CJHB 3BFRA 3ZN0A 1JA8A 1FS0G 2QWPB 4YIPA 4DV1B 2XT9A 1XQ8A 2ODMA 3B09A 1IXMA 1GN2A 3C3SA 1N36O 2FYUH 1OCCC 1O9GA 2CK3G 2KKWA 3ZIAG 1AI4A 1Y74B 3AEIA 1M57B 3FB7C 1Y67A 4JYBA 3A8TA 1SQFA 2E74B 1SQPH 1MNGA 3WB2A 1N34O 3AG1B 3BHPA 2ZNJA 4DV4O 4UCVA 2XNDG 5DEDA 2ITCC 2Q5ZA 1AI5A 5CA1B 1NZ6A 3CRQA 3HR0A 1EFRG 3CCEV 4LFBB 1IURA 2QE7G 4RWUA 4JTAB 1QCEA 1Q3EA 4O2BA 2ARHA 4DV2O 5EYPB 4UFZA 2GSMB 2D2CB 1K8AW 3K5MA 2IJJA 3ABUA 3NXSA 3B40A 4E4EA 1KP2A 1R6TA 2H8PC 4RUFA 3AG7A 2HHHO 2UUAO 4DR6O 3EFFK 3X2QC 4HNAB 3NR7A 1P7BA 1XNRO 1JX9A 3DGEA 4OPHA 4WFEA 5TISZ 2PI5A 3J80N 2P4VA 1PNLA 2VQEO 4O2BB 2UXDB 3BVOA 2LP7A 2UXBB 4N21A 3CCSV 1YTFD 5L3FA 2WLIB 3CC7V 4UVBA 1ENVA 5B1BC 5BZBA 5LHIA 4UV9A 2KG7A 2BOBC 2X0LA 2PUSA 2EILC 1GM9A 3CRCA 4LBEC 4D7SA 2DW4A 4CH3A 2Q4PA 5D5PA 1ZAUA 2RNBA 1N32B 1VQNV 1XNQB 1BCCH 1OCCB 1KYOF 1DK1A 2ZXWC 4KFMA 1BS3A 4JAAA 1JVMA 2LQTA 4FIPC 4U3FH 2B1IA 1Y6XA 4JI0O 1VQKV 3LSSA 3JASA 3SPIA 4U7NA 2UUBB 1Z2GA 3E8FA 3K9AA 4LF7O 4DV3O 2M6YA 1WAZA 3MHSC 4MW3A 5JCOA 3CXCU 2XAGA 1Q86W 1PV0A 3W7UA 2DOSA 2PTMA 4PD4F 1W0KG 2WAMA 1LNQA 2VQFB 1N33B 2H94A 2IJKA 1FJGB 2QKCA 3Q4HB 4I7ZB 4J41A 3ZRXA 1QBZA 4F4LA 4X62B 3CYOA 4MVRA 4JTCB 3QTCA 3CB2A 4AQYO 3X2QB 3T1HO 4UVCA 2XASA 4O4LA 2XAHA 5C93A 2JIZG 5BXZA 1MG1A 1ROPA 3RN4A 2EBOA 4B3MO 1YI2V 3SYAA 1K73W 4RQFA 3OE7G 2DE0X 3UM7A 2JJ1G 3EXAA 3BRCA 1UJWB 3P30A 1R3KC 4XDLA 3ZHQA 4CZZA 4DYLA 1IBLB 2V7QG 5DN6G 3OMAB 3RYCA 1AJNA 1EBOA 3CS5A 3HKBB 5B1BB 3TXSA 4B3TB 3CRRA 3BA9A 3GWKC 4DUZO 4K35A 2EILB 4DR5B 2V1DA 2YUAA 4MVMA 4F6RB 1KUQA 1WA8A 4WFHA 2AGAA 3ZS8C 4MVQA 2QWQB 4DR7B 2RMKB 4UCTA 2ZXWB 2IH3C 4PI2A 1JFFA 2AW9A 1ZLZA 1N0JA 1JPXA 2YI9A 1NKDA 1Q6HA 1PPJH 3RW0A 1D5AA 2WLLA 4QE9A 5IE9A 3RYCB 1COWG 1OJHA 1EN5A 1QQCA 2W6IG 2Y0PA 2PYJA 1PM9A 5IYBO 4JV5O 3P32A 4JTDB 1K7DA 3ZHRA 4RO2A 1KD1W 4I4TA 3JATB 2A0LA 5CA0B 2JK5C 5F2VO 2Y4TA 4YJ2B 5GONB 3RVZA 4J7ZA 4IHJB 1CP9A 2B1GA 2JEUA 4UV8A 1XHXA 3E8HA 1XOUA 2CTPA 4J42A 2RN9A 3RYFB 3QO8A 2EZPA 2QWNB 5EC2C 5EIBC 1F4MA 2EIMC 2IBZH 3SYOA 4CH4A 4YY3B 2R70A 3I5DA 2CTQA 2CH7B 1SA0A 1FXHA 2ADQB 4PDMA 3ZMVA 4B3SB 1EM1A 3WG7C 4ABMA 4ASUG 4PDRA 5CMUA 1GO3F 4UXNA 1RPRA 3FB6C 5CB4B 1XILA 3ETEA 5KMGB 5IYZB 4K8ZA 1HP8A 2DMXA 5KHGA 4LNUB 5IWAB 3BA8A 1T5EA 4U3JA 3MHHC 4X65B 3U0ZA 5LYJA 1EN6A 1V9PA 1XMQB 3B8NA 4BW9A 2YS8A 4BIUA 1US6A 4QJFB 4JI6B 4CH6A 2JDIG 4DV1O 4GX5A 1NT2B 2HJDA 1N8RW 4D6TH 2WA3A 3FAVB 1DF5A 1GN4A 1G8MA 2A06H 4ZHQA 5CBHA 1HNXB 1K3EA 3D3QA 4X89A 5EBMC 5A2QN 2Q68A 3IJ4A 5LP6C 2ZE5A 1R6NA 4TUYA 2ZR2A 3OTOB 3RYIB 3OMIB 5FPOA 2EJRA 1VQ5V 2HP8A 4LFBO 4WBNA 4UCOA 4B7EA 1SQXH 1X59A 4LH7A 4J9ZB 2JGDB 5B5EZ 4BR6A 3I55V 1YITV 4WFFA 1RFYA 3TGUH 4EB6A 1I94O 3K9SA 3L75H 4HYOA 1YEWA 5B1AC 2EIMB 3K06A 4YXWG 1RPOA 3B4SA 2F43G 5EZYA 4W4KA 4X1IA 3HKCB 3H1JH 5IYCO 3E8BA 3VQVA 3WG7B 4TUYB 4JYAB 3JAWA 1HNWB 1FD9A 2AXTZ 1QU7A 5B1NA 1LUWA 1W2BU 4O2AB 2ATKC 2OTJV 1OCZC 4NTWA 4ZI7A 1KU9A 1UFIA 1PP9H 1H2SB 1I7FA 3CCUV 3D36A 2UXBO 3ZRWA 4GLXA 1B04A 5KA5A 4CC6A 3U11A 4NYKA 2ILMA 3N2GA 2AZ2A 3A0HZ 1VF6C 1HR0B 1H8HG 2Y4UA 1YVWA 3ABMB 1VQ7V 3DC5A 5J2UA 4X1IB 3FFQA 2BSKB 3F7VC 2X6BA 1MOFA 2YXHA 1VQ4V 3UT5B 1EN4A 4GT1A 4OX9B 1N32O 3JAWB 3ZHSA 1HDJA 4B08A 3HKEB 1S0VA 1BMFG 1SZTA 1P4RA 1VQOV 3J7AU 2OCCC 3RYHB 1QLEC 2IU0A 2QA4V 1TVKA 4JI3B 2IH1C 1KKDA 5LP6B 2WWWA 4FLUA 4OPAA 3G80A 3N2GB 1VQPV 5AG2A 3ETGA 3K57A 2PYLA 4W4LA 1JR9A 3CJHA 2UXXA 4BAYA 5LL6Y 1IDSA 1Y76B 2W0FC 3LDDA 2VQFO 1GN3A 4JYCA 1N33O 2NLJC 2FL4A 3ASOB 1FJGO 1Q43A 2DWEC 1SS3A 1VF6A 3N2KB 4X62O 5B1AB 1Y74A 4DV5B 4DXWA 4TV8B 1S72V 1NTZH 4LFAB 1TVKB 3OR7C 1Q5OA 2YEVA 2IM9A 3THOA 3QO7A 2AZ0A 1WPXA 4LR3A 4JZGA 1BQ0A 2EIKC 3CXHF 3FKSG 4I50B 5J2TB 1SESA 1OCZB 1ZL8B 5LBQA 1CXZB 4H0LB 2QSAA 4JI7O 2XOKG 1NVPD 1WJZA 3RFRA 4FLWA 2YXYA 3D8CA 3K5OA 2EIJC 5EYPA 2UU9B 2QWOB 1PD3A 1IBLO 5LGUA 4ZOLA 1Q82W 4LF9B 4MTXA 1H2NA 4Z1VA 5B3SC 1AP5A 3K0DA 4B3TO 2P7TC 4GKJB 4O4HA 5BY1A 1X4TA 1HW7A 1IBMB 4HNAA 2YEVB 2Q67A 4DR5O 1FYJA 2ZNIA 1K92A 3C3TA 3E2EA 4DR7O 1ZTEA 5IY5C 2F66C 2QJ1A 2C2AA 3CCVV 1KP3A 1H38A 2DQ0A 2LFSA 2OCCB 3ZMZA 4X9QA 1KECA 1QLEB 3DXRB 1AJQA 2H3OA 2WLIA 2XTAA 1FAFA 1KC8W 2ZDIC 1G1XB 3R65A 4H37A 5LMUB 4ZOLB 3GVMA 1U97A 1D2DA 2P90A 3CCMV 1K9MW 2YICA 1BQZA 3E22B 4O4HB 2Z3YA 2VRZA 1BSMA 4G2KA 4K0KO 3SJQC 4LF8B 1WPBA 2P5OA 3VQXA 2UUCB 5BR8B 1E1RG 5GTHZ 2FMLA 2ZR3A 1KB9F 4TT3G 1PNKA 3ML0A 2Y69C 2MW2B 4KHPB 2CTWA 4GZRB 1J5EB 1VF5B 2EIKB 1GRJA 4WFBV 2Q9LA 2Q69A 1K34A 3TXQA 4DO2A 1YJNV 1B06A 3KKYA 5EK0A 3VQWA 3IC7A 3AK2A 2CGOA 2Q7GA 4QPKA 1YIJV 2EIJB 5JJJB 1K5QA 4B3SO 1YF2A 3Q4HA 3ZBHA 4UUJC 2Z0AA 4DV7B 3ZMTA 5B3SB 3FYEB 1J95A 3BABA 4WFGA 1NJIW 4JI1O 2ZE7A 3IFXA 3CC2V 3SYCA 3EHBB 5BMVB 3U10A 3E35A 1AILA 5IY5B 4X1KB 3L73H 1WN7A 2CE4A 1N4CA 5L3DA 3OMNB 4O4IB 4D7TA 3B8MA 3P3NA 5L3GA 1M56B 5JVDB 4I9QA 1JMKC 4JI6O 3ICXA 4DR1B 3HKBA 4KXRA 2N05A 4PA7A 3SYPA 4PJ0Z 1SQQH 1H2MA 1F4NA 2B9ZA 2WLKA 2CGNA 4IL6Z 1SQVH 4F6RA 2PGGA 1FKAO 1HNXO 1UPGA 2ZT9B 3AG3C 1QHTA 1SQGA 3SYQA 3OTOO 4FFKA 1IVSA 5IJ0B 3IC9A 1MABG 3ETQA 2DYSB 3OUSA 2Y69B 2A9HA 2WA4A 2VS0A 5A9GA 5JH7A 2GBOA 2OCHA 1GH6A 4NTXA 3STLC 2QTSA 1QR8A 4CC5A 2F93B 3RWRD 1VF7A 3JARB 2Q0AA 3CMAV 3B2EE 4H33A 3L71H 3JD1A 4TOIA 3JATA 1GK9A 1N36B 2V4DA 1BHBA 1Z5VA 5CA0A 4OXSA 4LF6O 4N23A 1DLBA 4PA3A 4JYAO 5LXTB 3W7TA 4PHZA 1JJOA 4J10A 3E83A 1P49A 2GHYA 3IGAC 4YJ2A 5GONA 1R3IC 4IHJA 4JYYA 1F51A 5IJ9B 1RSOB 1K5SA 5EIBD 5JH7B 2XAQA 1SKVA 2LO1A 4I0XA 5B66Z 3RYFA 4PDLA 1K97A 4IYIA 3SPCA 3T1YB 1SETA 5ITZB 2Q7EA 4NXNB 3J81N 2CH7A 3ZN1A 4LWSB 3ZMSA 4OX9O 4AHCA 3LNMB 2LW1A 1YTFB 1M4UA 3BCCH 2LGQA 3STZC 2UUAB 2X6CA 5HFLA 4ZBMA 5DECA 5CB4A 5HFMA 5GTIZ 4GKKB 5J9PC 5KMGA 3M7MX 1YZBA 5LGTA 5IYZA 4FLXA 4FVMA 3AG3B 4I0XB 4JI3O 4B3RB 1NQTA 5H5NA 5GW7A 4LNUA 1XREA 3UKMA 3ZHTA 4C7UA 2OIEA 5LOVB 3DSQA 1G4YB 3BEHA 4CS3A 3SJCC 2OYQA 2YI8A 3CCQV 1BL8A 1JCHA 1Q6UA 3JAKB 1R3JC 1IX9A 4IT5A 2IU3A 3ABLC 4FLVA 4DW0A 2XAFA 1MA1A 1F7YA 3BAAA 1XL6A 4GX1A 3WFVA 1THZA 4H44B 3FAVA 4DR2B 4YIOA 4J80A 2HG5C 1JQ0A 2BTOA 3ZEDA 1OHHG 3L70H 4MVOA 3S3XA 4LFAO 2Q73A 4EFBA 4X20B 3AG4C 2YIAA 4X1YA 4XDKA 4BW5A 3CE2A 3RYIA 3JALB 5JJEB 4J9YB 3ABMC 1VEWA 4NXMO 2FKXA 3A0RA 4JI4B 2NN4A 1R6KA 3ASNC 2ADPA 1L0LH 2LFRA 4JI5B 2JGDA 4MTFA 2UU9O 3HPLC 4DV3B 2JEXA 1H2KA 1YXBA 3M99B 1KKCA 1Y4MA 3MD0A 1NH2D 4DV6B 1CEZA 1PNMA 2YIBA 4GKJO 4ICGA 1YHQV 3SDLA 3HKCA 1YSCA 1WB8A 1Z5WA 4X1YB 4PA4A 1XEQA 2AHYA 4Q20A 5LA6B 5C8YB 4O2AA 3QF7A 3QO5A 4ZKIA 3ZHVA 2YC0A 2QWRB 2DYRC 1ZUQA 4B3MB 3ASOC 4DUYB 3BY6A 5LMUO 2ZCEA 5L3BA 4PDVA 4JI2B 4DV0B 1S77D 1LR1A 1NS1A 5L3EA 4Z1MG 1AJPA 1NBMG 5FNVB 3ABLB 2BSKA 1IZ3A 3UT5A 3HKDB 4X64B 2FTKA 1MSWD 4IIJB 4O4JB 5KHJA 4LF8O 3HKEA 3IAYA 5KUKA 4DUZB 2Q8VA 2W0XA 5BR8O 2HR3A 2UXDO 2QKSA 3RYHA 2ZKOA 3OAAG 3JSLA 2Y48A 4IYHA 4JPRA 3A2FA 3AG4B 5LP6A 2Z5UA 2JGUA 4FFBB 3ZJZA 4FM0A 1S5JA 2RQ6A 4R7CA 2JRIA 3ASNB 1AROP 2BTQB 4UB8Z 4MT8A 1GM7A 3JCZA 3AK1A 2KSDA 2X7RB 1Y76A 3KCYA 4BWAA 3BPZA 5LHHA 1XNQO 2GUZB 5FLXN 3OT7A 1FXKC 3LUTB 1DF4A 2EINC 2QGNA 3N2KA 5KA6A 2VWKA 4DV7O 3SJAC 4TV8A 2ZE8A 3CPWU 1EZJA 1FXVA 3ZRVA 1E1QG 4PI0A
chains in the Genus database with same CATH topology
2YXHA 2Q73A 1VMGA 2Q9LA 2A7WA 1YXBA 1Y6XA 2P06A 3CRCA 2A3QA 3CRAA 2Q5ZA 2Q4PA 4QGPA 3C90A 2OIEA 2OIGA 1YVWA 5IE9A 2GTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YXH A;  2Q73 A;  1VMG A;  2Q9L A;  2A7W A;  1YXB A;  1Y6X A;  2P06 A;  3CRC A;  2A3Q A;  3CRA A;  2Q5Z A;  2Q4P A;  4QGP A;  3C90 A;  2OIE A;  2OIG A;  1YVW A;  5IE9 A;  2GTA A; 
#chains in the Genus database with same CATH topology
 5B1O A;  4EEQ A;  2NNU A;  3W7W A;  2UUB O;  2DN9 A;  5KAI Z;  2ZM6 B;  3PN1 A;  4I50 A;  5J2T A;  4QPJ A;  2P4K A;  1Y66 A;  4AI8 A;  1ZL8 A;  4A5U B;  3F7Y C;  1L1F A;  3QNE A;  4DR4 B;  3O65 A;  3CSX A;  4JZ2 A;  2WSS G;  4MVZ A;  2DYR B;  2A79 B;  1VQ6 V;  1DTO A;  2F4V B;  3JD3 A;  2RJZ A;  2ZIM A;  5FPR A;  3CCL V;  4LP8 A;  2PY5 A;  2E5L B;  5IDJ A;  1S5H C;  1U96 A;  4DR1 O;  1WLE A;  1OZ0 A;  4X88 A;  5KX5 B;  1OV9 A;  5E79 Z;  2JJ2 G;  2RCV A;  4X8A A;  1M93 A;  1B6Q A;  2OWO A;  4Q6G A;  3KCX A;  3SPH A;  4UCU A;  4MVU A;  1XHZ A;  3LSQ A;  2LGW A;  1TGO A;  3ETD A;  2QR4 A;  3RVY A;  4FPP A;  1D5N A;  2JVD A;  2IW5 A;  3UO3 A;  2L6L A;  4CH5 A;  4X66 B;  3DXR A;  4R8C A;  2A3Q A;  4LCU C;  4LFC B;  5EBL C;  4DW1 A;  5JJN B;  1YDX A;  4PA6 A;  5KUM A;  3E22 A;  1XI1 A;  3DC6 A;  2QM8 A;  2WLJ A;  2Q6A A;  1VP7 A;  4MW8 A;  2K9P A;  5LMN B;  1FFT B;  4QNH B;  1QLN A;  1S5L Z;  3APQ A;  1ZWI C;  1FXK B;  4FM2 A;  2BCC H;  2EIN B;  1URF A;  3JAM N;  4DK0 A;  4JAV A;  3WB1 A;  3FX7 A;  1M56 C;  2E3C A;  1VMG A;  4YHH B;  1XDC A;  1YJ9 V;  1KQS U;  1ZSP A;  3UO2 A;  3JD2 A;  2DJV A;  2HVK C;  4KUM A;  2EX3 A;  4UCR A;  4NTY A;  2OT5 A;  3UCS C;  4UB6 Z;  5H9C A;  2E75 B;  4FJC C;  3T1Y O;  4KP4 A;  5KAF Z;  3E86 A;  4NXN O;  1TAE A;  3A0B Z;  1XMO B;  4TWK A;  3JCU Z;  1ORQ C;  3MAQ A;  2E76 B;  5KHI A;  2A7W A;  1I94 B;  1FFX A;  4FLY A;  3G67 A;  4TSF G;  1VAR A;  2PI4 A;  4P9O A;  3LNN A;  3ZHU A;  4G28 B;  3JSN A;  2DYS C;  1NR7 A;  4GKK O;  2O57 A;  1BT8 A;  2FB5 A;  3DTU B;  5BMV A;  4B3R O;  4X1K A;  2PF4 E;  4ZIB A;  1R1B A;  5JCO C;  1OCR C;  3FB5 C;  4UCS A;  3OM3 B;  2YID A;  4O4I A;  1NU1 H;  4CS2 A;  1OCO C;  2X6A A;  4YY3 O;  1HNZ B;  1F23 A;  1GKF A;  5JVD A;  4FLZ A;  1FFX B;  1AI6 A;  1XBL A;  1NTM H;  2ZDI A;  5KHK A;  4AIL C;  4DR3 B;  4JAU A;  3I56 V;  1PL4 A;  4NR1 A;  1G6U A;  2ZIO A;  4DR2 O;  3N27 A;  1SRY A;  1L0N H;  1GN6 A;  1TUB A;  4FZ0 A;  5JWP A;  3VOU A;  5IWA O;  4I9W A;  1K33 A;  1H2G A;  5IT9 N;  1GAX A;  4X65 O;  1Q81 W;  3K58 A;  4EKW A;  4G27 B;  5IJ0 A;  4JI4 O;  3H1K H;  1P84 F;  1TUE B;  1WP8 A;  3AG2 C;  1XMQ O;  1JJ2 U;  1AI7 A;  4JI5 O;  3VBB A;  3SGI A;  4JGS A;  3RGB A;  3OW2 U;  5K1P A;  4P2Z A;  2QM4 A;  2KG7 B;  1B3Q A;  5H2F Z;  4JI8 B;  3QG5 A;  3SPG A;  3K04 A;  1IXB A;  1NI8 A;  1AB3 A;  4XDJ A;  3JAR A;  3CEI A;  4DV6 O;  1PL0 A;  1IBK B;  1TUB B;  4LF5 B;  5EC1 C;  3OFN G;  4R50 A;  4LF4 B;  4QE7 A;  1NVP B;  5LGN A;  5LXT A;  2KQX A;  2EJ7 A;  1QR9 A;  2OIG A;  4L87 A;  3EVK A;  3JAS B;  3E8G A;  1QNM A;  3H1I H;  3T2M A;  1PKX A;  1AR1 B;  5IJ9 A;  4YJ3 A;  1RSO A;  2F1M A;  2N74 A;  1Q7Y W;  1H8E G;  1LUV A;  2UXC B;  4DUY O;  3CRA A;  4H13 B;  1OCR B;  3ZMU A;  4JI7 B;  2P22 C;  4JI2 O;  3W7S A;  1OCO B;  5ITZ A;  4DV0 O;  5L3C A;  3D3I A;  3K5L A;  2CUG A;  1VIB A;  1CPY A;  1VQ8 V;  2IJI A;  3K79 A;  4I55 A;  3OR6 C;  4LWS A;  4X64 O;  1HNW O;  2P06 A;  2GTS A;  2WLH A;  2YSU B;  3CHX A;  4XBF A;  4U7O A;  3JYC A;  3ZRS A;  2N04 A;  5KLV H;  3G6B A;  1N34 B;  1ZX3 A;  4O4L B;  4DK1 A;  4YJ3 B;  4DV4 B;  2EZO A;  1V55 C;  3SPJ A;  1YCI A;  1WNS A;  2YIB D;  4JF3 A;  5LOV A;  4QIW F;  4CS4 A;  3K5N A;  4FK5 C;  1HR0 O;  4EFE A;  2LJ2 A;  1M9N A;  5JQG A;  4DV2 B;  3R66 A;  3JAK A;  2HEP A;  3AG2 B;  1GM8 A;  2MK3 A;  2ZD9 A;  4I55 B;  4GX0 A;  2HJF C;  2IJH A;  3C90 A;  3T4D A;  4PA9 A;  3T4Z A;  3L74 H;  1W0J G;  2ETN A;  2M7W A;  4TV9 A;  1I5Y A;  2GDS A;  4GUN A;  4MTO A;  2HHH B;  2BOC C;  2DQ3 A;  2OTL V;  2WLN A;  4DR6 B;  1JOY A;  4K8X A;  4RAI A;  1Q90 D;  2P67 A;  2R9I A;  1WA8 B;  3OGI B;  4K0K B;  3SR2 C;  1XNR B;  3CC4 V;  2F95 B;  4X20 A;  3RBZ A;  1MSD A;  4JAS A;  2GV9 A;  3CRM A;  1XUQ A;  3K08 A;  4FMT A;  2UXN A;  1AR4 A;  2Q7H A;  3P3P A;  2ZM6 O;  2VQE B;  3JAL A;  1JFF B;  5JQG B;  4UVA A;  4DR4 O;  4HZ3 A;  3ABK C;  4FM1 A;  3H1L H;  1V54 C;  2Q0O C;  2K1E A;  2WLL B;  3G71 V;  2ZE6 A;  1QVF U;  2QM7 A;  2F4V O;  4NB5 A;  4TV9 B;  1WP7 A;  2QKA A;  2E5L O;  2HKO A;  3SJB C;  1MZE A;  3WB0 A;  2PZS A;  4K3A A;  1Q8I A;  1RM1 C;  1WB7 A;  3TK1 A;  3RT3 C;  4GX2 A;  4DV5 O;  2R9R B;  4I4T B;  2HFE C;  3T1C A;  2D3O W;  1K4D C;  1MMM A;  3H9V A;  5LA6 A;  5C8Y A;  1H2L A;  4QGP A;  1RP3 B;  4JI1 B;  1TA8 A;  4JI0 B;  3K0G A;  4RQE A;  2XUM A;  4MTG A;  1HWY A;  4I5S A;  4FZ1 A;  2RDC A;  3OD4 A;  4X66 O;  1V55 B;  3TJT A;  5CN0 A;  3KZI Z;  4LF7 B;  4MSW C;  4LFC O;  1P7G A;  4WFA V;  1M90 W;  1R73 A;  3H1H H;  4F6E A;  4LF9 O;  1QVG U;  1R3L C;  4HBN A;  1SA0 B;  2WPD G;  1M1K W;  3KG2 A;  2DWD C;  5FNV A;  1SC5 B;  1IBM O;  1SER A;  4P30 A;  3HKD A;  5LHG A;  3HB3 B;  5LMN O;  3E89 A;  4IIJ A;  4O4J A;  1YJW V;  3ZCC A;  4NVP A;  3WU2 Z;  2JS5 A;  4J11 A;  4TQF A;  4AQY B;  5IYD O;  4J7K A;  3T1H B;  3CWB H;  3D36 C;  3CD6 V;  3CCR V;  2R9A A;  4GYC B;  4YHH O;  1AP6 A;  4CBC A;  2CDY A;  3M8A A;  3OUF A;  1MZF A;  3AK3 A;  1NR1 A;  3ABT A;  4WCE V;  4U3J B;  4FFB A;  1SZX A;  5LYJ B;  1AVM A;  3S3W A;  3MDS A;  1I08 A;  2BTQ A;  3ABK B;  1V54 B;  3JD0 A;  4MS2 A;  1XMO O;  2VWJ A;  2W6J G;  2JS3 A;  4Z2W A;  3O9O A;  2GUZ A;  1VQM V;  4PV1 B;  3FB8 C;  4BIO A;  3L72 H;  1RM1 B;  2UUC O;  4ZHQ B;  4J7J A;  4TQD A;  4FLT A;  3LDC A;  3W7X A;  1Q6I A;  1M5I A;  4HAM A;  1L8D A;  1VQ9 V;  1E79 G;  4LF6 B;  5CBG A;  1SF9 A;  4KHP O;  1KBH A;  4P9P A;  1DGS A;  1J5E O;  2QEX V;  3LDE A;  5DM6 V;  3G4S V;  3CCJ V;  1W59 A;  3TET A;  2XHB A;  2ZQM A;  1BZK A;  5K1X A;  3H01 A;  4LH6 A;  2GTA A;  4WBN B;  4PEL A;  3K59 A;  1HNZ O;  2ZIN A;  2WLM A;  4MVS A;  1I5X A;  2G38 A;  3GB7 C;  2AHZ A;  4EB6 B;  1A32 A;  3OEH G;  4JV5 B;  1NTK H;  1M57 C;  1GTO A;  4DR3 O;  5KX5 A;  2HLD G;  2YDE A;  5EZY B;  5CBF A;  5FL7 G;  5H6R A;  1VQL V;  2LW7 A;  3AG1 C;  4B7K A;  2YXL A;  2QDO A;  3CX5 F;  5CA3 A;  3UQ8 A;  3OEE G;  3B77 A;  3PJS K;  4ZI7 B;  1I0H A;  3FD9 A;  5E1A C;  2CTR A;  3TCU A;  3ZX6 A;  3K3W A;  4DRX A;  1N0N A;  3OTF A;  4WF9 V;  2L35 A;  4LC1 A;  3ZRW B;  4GCZ A;  3L9D A;  3F5T A;  2Y0I A;  3APO A;  5KHH A;  2EUL A;  2CAZ C;  2XAJ A;  5H6Q A;  3JD4 A;  2NR5 A;  1FPO A;  1S76 D;  4E2L A;  5J2U B;  2KB1 A;  4JI8 O;  3CP1 A;  1XL4 A;  1BHA A;  1SQB H;  2QTO A;  4KL1 A;  1AR5 A;  4BIZ A;  1EZV H;  5D5Q A;  3G6E V;  1GMG A;  5EBW C;  1IBK O;  1S3J A;  4R6Z A;  4LF5 O;  3OGC C;  3GWO A;  2R72 A;  4LF4 O;  3F5W C;  3FYI B;  1FXK A;  2HVJ C;  1KMI Z;  3VQY A;  4DRX B;  3QVN A;  1O9H A;  4RUE A;  2B5U A;  4L8J A;  1BGY H;  1K4C C;  1NH2 B;  1BE3 H;  2ITD C;  3CME V;  2F23 A;  4IGG A;  2UXC O;  3LSU A;  2P6J A;  4NKG B;  4OGQ B;  3K03 A;  5CA1 A;  4NXM B;  2BE3 A;  3CJH B;  3BFR A;  3ZN0 A;  1JA8 A;  1FS0 G;  2QWP B;  4YIP A;  4DV1 B;  2XT9 A;  1XQ8 A;  2ODM A;  3B09 A;  1IXM A;  1GN2 A;  3C3S A;  1N36 O;  2FYU H;  1OCC C;  1O9G A;  2CK3 G;  2KKW A;  3ZIA G;  1AI4 A;  1Y74 B;  3AEI A;  1M57 B;  3FB7 C;  1Y67 A;  4JYB A;  3A8T A;  1SQF A;  2E74 B;  1SQP H;  1MNG A;  3WB2 A;  1N34 O;  3AG1 B;  3BHP A;  2ZNJ A;  4DV4 O;  4UCV A;  2XND G;  5DED A;  2ITC C;  2Q5Z A;  1AI5 A;  5CA1 B;  1NZ6 A;  3CRQ A;  3HR0 A;  1EFR G;  3CCE V;  4LFB B;  1IUR A;  2QE7 G;  4RWU A;  4JTA B;  1QCE A;  1Q3E A;  4O2B A;  2ARH A;  4DV2 O;  5EYP B;  4UFZ A;  2GSM B;  2D2C B;  1K8A W;  3K5M A;  2IJJ A;  3ABU A;  3NXS A;  3B40 A;  4E4E A;  1KP2 A;  1R6T A;  2H8P C;  4RUF A;  3AG7 A;  2HHH O;  2UUA O;  4DR6 O;  3EFF K;  3X2Q C;  4HNA B;  3NR7 A;  1P7B A;  1XNR O;  1JX9 A;  3DGE A;  4OPH A;  4WFE A;  5TIS Z;  2PI5 A;  3J80 N;  2P4V A;  1PNL A;  2VQE O;  4O2B B;  2UXD B;  3BVO A;  2LP7 A;  2UXB B;  4N21 A;  3CCS V;  1YTF D;  5L3F A;  2WLI B;  3CC7 V;  4UVB A;  1ENV A;  5B1B C;  5BZB A;  5LHI A;  4UV9 A;  2KG7 A;  2BOB C;  2X0L A;  2PUS A;  2EIL C;  1GM9 A;  3CRC A;  4LBE C;  4D7S A;  2DW4 A;  4CH3 A;  2Q4P A;  5D5P A;  1ZAU A;  2RNB A;  1N32 B;  1VQN V;  1XNQ B;  1BCC H;  1OCC B;  1KYO F;  1DK1 A;  2ZXW C;  4KFM A;  1BS3 A;  4JAA A;  1JVM A;  2LQT A;  4FIP C;  4U3F H;  2B1I A;  1Y6X A;  4JI0 O;  1VQK V;  3LSS A;  3JAS A;  3SPI A;  4U7N A;  2UUB B;  1Z2G A;  3E8F A;  3K9A A;  4LF7 O;  4DV3 O;  2M6Y A;  1WAZ A;  3MHS C;  4MW3 A;  5JCO A;  3CXC U;  2XAG A;  1Q86 W;  1PV0 A;  3W7U A;  2DOS A;  2PTM A;  4PD4 F;  1W0K G;  2WAM A;  1LNQ A;  2VQF B;  1N33 B;  2H94 A;  2IJK A;  1FJG B;  2QKC A;  3Q4H B;  4I7Z B;  4J41 A;  3ZRX A;  1QBZ A;  4F4L A;  4X62 B;  3CYO A;  4MVR A;  4JTC B;  3QTC A;  3CB2 A;  4AQY O;  3X2Q B;  3T1H O;  4UVC A;  2XAS A;  4O4L A;  2XAH A;  5C93 A;  2JIZ G;  5BXZ A;  1MG1 A;  1ROP A;  3RN4 A;  2EBO A;  4B3M O;  1YI2 V;  3SYA A;  1K73 W;  4RQF A;  3OE7 G;  2DE0 X;  3UM7 A;  2JJ1 G;  3EXA A;  3BRC A;  1UJW B;  3P30 A;  1R3K C;  4XDL A;  3ZHQ A;  4CZZ A;  4DYL A;  1IBL B;  2V7Q G;  5DN6 G;  3OMA B;  3RYC A;  1AJN A;  1EBO A;  3CS5 A;  3HKB B;  5B1B B;  3TXS A;  4B3T B;  3CRR A;  3BA9 A;  3GWK C;  4DUZ O;  4K35 A;  2EIL B;  4DR5 B;  2V1D A;  2YUA A;  4MVM A;  4F6R B;  1KUQ A;  1WA8 A;  4WFH A;  2AGA A;  3ZS8 C;  4MVQ A;  2QWQ B;  4DR7 B;  2RMK B;  4UCT A;  2ZXW B;  2IH3 C;  4PI2 A;  1JFF A;  2AW9 A;  1ZLZ A;  1N0J A;  1JPX A;  2YI9 A;  1NKD A;  1Q6H A;  1PPJ H;  3RW0 A;  1D5A A;  2WLL A;  4QE9 A;  5IE9 A;  3RYC B;  1COW G;  1OJH A;  1EN5 A;  1QQC A;  2W6I G;  2Y0P A;  2PYJ A;  1PM9 A;  5IYB O;  4JV5 O;  3P32 A;  4JTD B;  1K7D A;  3ZHR A;  4RO2 A;  1KD1 W;  4I4T A;  3JAT B;  2A0L A;  5CA0 B;  2JK5 C;  5F2V O;  2Y4T A;  4YJ2 B;  5GON B;  3RVZ A;  4J7Z A;  4IHJ B;  1CP9 A;  2B1G A;  2JEU A;  4UV8 A;  1XHX A;  3E8H A;  1XOU A;  2CTP A;  4J42 A;  2RN9 A;  3RYF B;  3QO8 A;  2EZP A;  2QWN B;  5EC2 C;  5EIB C;  1F4M A;  2EIM C;  2IBZ H;  3SYO A;  4CH4 A;  4YY3 B;  2R70 A;  3I5D A;  2CTQ A;  2CH7 B;  1SA0 A;  1FXH A;  2ADQ B;  4PDM A;  3ZMV A;  4B3S B;  1EM1 A;  3WG7 C;  4ABM A;  4ASU G;  4PDR A;  5CMU A;  1GO3 F;  4UXN A;  1RPR A;  3FB6 C;  5CB4 B;  1XIL A;  3ETE A;  5KMG B;  5IYZ B;  4K8Z A;  1HP8 A;  2DMX A;  5KHG A;  4LNU B;  5IWA B;  3BA8 A;  1T5E A;  4U3J A;  3MHH C;  4X65 B;  3U0Z A;  5LYJ A;  1EN6 A;  1V9P A;  1XMQ B;  3B8N A;  4BW9 A;  2YS8 A;  4BIU A;  1US6 A;  4QJF B;  4JI6 B;  4CH6 A;  2JDI G;  4DV1 O;  4GX5 A;  1NT2 B;  2HJD A;  1N8R W;  4D6T H;  2WA3 A;  3FAV B;  1DF5 A;  1GN4 A;  1G8M A;  2A06 H;  4ZHQ A;  5CBH A;  1HNX B;  1K3E A;  3D3Q A;  4X89 A;  5EBM C;  5A2Q N;  2Q68 A;  3IJ4 A;  5LP6 C;  2ZE5 A;  1R6N A;  4TUY A;  2ZR2 A;  3OTO B;  3RYI B;  3OMI B;  5FPO A;  2EJR A;  1VQ5 V;  2HP8 A;  4LFB O;  4WBN A;  4UCO A;  4B7E A;  1SQX H;  1X59 A;  4LH7 A;  4J9Z B;  2JGD B;  5B5E Z;  4BR6 A;  3I55 V;  1YIT V;  4WFF A;  1RFY A;  3TGU H;  4EB6 A;  1I94 O;  3K9S A;  3L75 H;  4HYO A;  1YEW A;  5B1A C;  2EIM B;  3K06 A;  4YXW G;  1RPO A;  3B4S A;  2F43 G;  5EZY A;  4W4K A;  4X1I A;  3HKC B;  3H1J H;  5IYC O;  3E8B A;  3VQV A;  3WG7 B;  4TUY B;  4JYA B;  3JAW A;  1HNW B;  1FD9 A;  2AXT Z;  1QU7 A;  5B1N A;  1LUW A;  1W2B U;  4O2A B;  2ATK C;  2OTJ V;  1OCZ C;  4NTW A;  4ZI7 A;  1KU9 A;  1UFI A;  1PP9 H;  1H2S B;  1I7F A;  3CCU V;  3D36 A;  2UXB O;  3ZRW A;  4GLX A;  1B04 A;  5KA5 A;  4CC6 A;  3U11 A;  4NYK A;  2ILM A;  3N2G A;  2AZ2 A;  3A0H Z;  1VF6 C;  1HR0 B;  1H8H G;  2Y4U A;  1YVW A;  3ABM B;  1VQ7 V;  3DC5 A;  5J2U A;  4X1I B;  3FFQ A;  2BSK B;  3F7V C;  2X6B A;  1MOF A;  2YXH A;  1VQ4 V;  3UT5 B;  1EN4 A;  4GT1 A;  4OX9 B;  1N32 O;  3JAW B;  3ZHS A;  1HDJ A;  4B08 A;  3HKE B;  1S0V A;  1BMF G;  1SZT A;  1P4R A;  1VQO V;  3J7A U;  2OCC C;  3RYH B;  1QLE C;  2IU0 A;  2QA4 V;  1TVK A;  4JI3 B;  2IH1 C;  1KKD A;  5LP6 B;  2WWW A;  4FLU A;  4OPA A;  3G80 A;  3N2G B;  1VQP V;  5AG2 A;  3ETG A;  3K57 A;  2PYL A;  4W4L A;  1JR9 A;  3CJH A;  2UXX A;  4BAY A;  5LL6 Y;  1IDS A;  1Y76 B;  2W0F C;  3LDD A;  2VQF O;  1GN3 A;  4JYC A;  1N33 O;  2NLJ C;  2FL4 A;  3ASO B;  1FJG O;  1Q43 A;  2DWE C;  1SS3 A;  1VF6 A;  3N2K B;  4X62 O;  5B1A B;  1Y74 A;  4DV5 B;  4DXW A;  4TV8 B;  1S72 V;  1NTZ H;  4LFA B;  1TVK B;  3OR7 C;  1Q5O A;  2YEV A;  2IM9 A;  3THO A;  3QO7 A;  2AZ0 A;  1WPX A;  4LR3 A;  4JZG A;  1BQ0 A;  2EIK C;  3CXH F;  3FKS G;  4I50 B;  5J2T B;  1SES A;  1OCZ B;  1ZL8 B;  5LBQ A;  1CXZ B;  4H0L B;  2QSA A;  4JI7 O;  2XOK G;  1NVP D;  1WJZ A;  3RFR A;  4FLW A;  2YXY A;  3D8C A;  3K5O A;  2EIJ C;  5EYP A;  2UU9 B;  2QWO B;  1PD3 A;  1IBL O;  5LGU A;  4ZOL A;  1Q82 W;  4LF9 B;  4MTX A;  1H2N A;  4Z1V A;  5B3S C;  1AP5 A;  3K0D A;  4B3T O;  2P7T C;  4GKJ B;  4O4H A;  5BY1 A;  1X4T A;  1HW7 A;  1IBM B;  4HNA A;  2YEV B;  2Q67 A;  4DR5 O;  1FYJ A;  2ZNI A;  1K92 A;  3C3T A;  3E2E A;  4DR7 O;  1ZTE A;  5IY5 C;  2F66 C;  2QJ1 A;  2C2A A;  3CCV V;  1KP3 A;  1H38 A;  2DQ0 A;  2LFS A;  2OCC B;  3ZMZ A;  4X9Q A;  1KEC A;  1QLE B;  3DXR B;  1AJQ A;  2H3O A;  2WLI A;  2XTA A;  1FAF A;  1KC8 W;  2ZDI C;  1G1X B;  3R65 A;  4H37 A;  5LMU B;  4ZOL B;  3GVM A;  1U97 A;  1D2D A;  2P90 A;  3CCM V;  1K9M W;  2YIC A;  1BQZ A;  3E22 B;  4O4H B;  2Z3Y A;  2VRZ A;  1BSM A;  4G2K A;  4K0K O;  3SJQ C;  4LF8 B;  1WPB A;  2P5O A;  3VQX A;  2UUC B;  5BR8 B;  1E1R G;  5GTH Z;  2FML A;  2ZR3 A;  1KB9 F;  4TT3 G;  1PNK A;  3ML0 A;  2Y69 C;  2MW2 B;  4KHP B;  2CTW A;  4GZR B;  1J5E B;  1VF5 B;  2EIK B;  1GRJ A;  4WFB V;  2Q9L A;  2Q69 A;  1K34 A;  3TXQ A;  4DO2 A;  1YJN V;  1B06 A;  3KKY A;  5EK0 A;  3VQW A;  3IC7 A;  3AK2 A;  2CGO A;  2Q7G A;  4QPK A;  1YIJ V;  2EIJ B;  5JJJ B;  1K5Q A;  4B3S O;  1YF2 A;  3Q4H A;  3ZBH A;  4UUJ C;  2Z0A A;  4DV7 B;  3ZMT A;  5B3S B;  3FYE B;  1J95 A;  3BAB A;  4WFG A;  1NJI W;  4JI1 O;  2ZE7 A;  3IFX A;  3CC2 V;  3SYC A;  3EHB B;  5BMV B;  3U10 A;  3E35 A;  1AIL A;  5IY5 B;  4X1K B;  3L73 H;  1WN7 A;  2CE4 A;  1N4C A;  5L3D A;  3OMN B;  4O4I B;  4D7T A;  3B8M A;  3P3N A;  5L3G A;  1M56 B;  5JVD B;  4I9Q A;  1JMK C;  4JI6 O;  3ICX A;  4DR1 B;  3HKB A;  4KXR A;  2N05 A;  4PA7 A;  3SYP A;  4PJ0 Z;  1SQQ H;  1H2M A;  1F4N A;  2B9Z A;  2WLK A;  2CGN A;  4IL6 Z;  1SQV H;  4F6R A;  2PGG A;  1FKA O;  1HNX O;  1UPG A;  2ZT9 B;  3AG3 C;  1QHT A;  1SQG A;  3SYQ A;  3OTO O;  4FFK A;  1IVS A;  5IJ0 B;  3IC9 A;  1MAB G;  3ETQ A;  2DYS B;  3OUS A;  2Y69 B;  2A9H A;  2WA4 A;  2VS0 A;  5A9G A;  5JH7 A;  2GBO A;  2OCH A;  1GH6 A;  4NTX A;  3STL C;  2QTS A;  1QR8 A;  4CC5 A;  2F93 B;  3RWR D;  1VF7 A;  3JAR B;  2Q0A A;  3CMA V;  3B2E E;  4H33 A;  3L71 H;  3JD1 A;  4TOI A;  3JAT A;  1GK9 A;  1N36 B;  2V4D A;  1BHB A;  1Z5V A;  5CA0 A;  4OXS A;  4LF6 O;  4N23 A;  1DLB A;  4PA3 A;  4JYA O;  5LXT B;  3W7T A;  4PHZ A;  1JJO A;  4J10 A;  3E83 A;  1P49 A;  2GHY A;  3IGA C;  4YJ2 A;  5GON A;  1R3I C;  4IHJ A;  4JYY A;  1F51 A;  5IJ9 B;  1RSO B;  1K5S A;  5EIB D;  5JH7 B;  2XAQ A;  1SKV A;  2LO1 A;  4I0X A;  5B66 Z;  3RYF A;  4PDL A;  1K97 A;  4IYI A;  3SPC A;  3T1Y B;  1SET A;  5ITZ B;  2Q7E A;  4NXN B;  3J81 N;  2CH7 A;  3ZN1 A;  4LWS B;  3ZMS A;  4OX9 O;  4AHC A;  3LNM B;  2LW1 A;  1YTF B;  1M4U A;  3BCC H;  2LGQ A;  3STZ C;  2UUA B;  2X6C A;  5HFL A;  4ZBM A;  5DEC A;  5CB4 A;  5HFM A;  5GTI Z;  4GKK B;  5J9P C;  5KMG A;  3M7M X;  1YZB A;  5LGT A;  5IYZ A;  4FLX A;  4FVM A;  3AG3 B;  4I0X B;  4JI3 O;  4B3R B;  1NQT A;  5H5N A;  5GW7 A;  4LNU A;  1XRE A;  3UKM A;  3ZHT A;  4C7U A;  2OIE A;  5LOV B;  3DSQ A;  1G4Y B;  3BEH A;  4CS3 A;  3SJC C;  2OYQ A;  2YI8 A;  3CCQ V;  1BL8 A;  1JCH A;  1Q6U A;  3JAK B;  1R3J C;  1IX9 A;  4IT5 A;  2IU3 A;  3ABL C;  4FLV A;  4DW0 A;  2XAF A;  1MA1 A;  1F7Y A;  3BAA A;  1XL6 A;  4GX1 A;  3WFV A;  1THZ A;  4H44 B;  3FAV A;  4DR2 B;  4YIO A;  4J80 A;  2HG5 C;  1JQ0 A;  2BTO A;  3ZED A;  1OHH G;  3L70 H;  4MVO A;  3S3X A;  4LFA O;  2Q73 A;  4EFB A;  4X20 B;  3AG4 C;  2YIA A;  4X1Y A;  4XDK A;  4BW5 A;  3CE2 A;  3RYI A;  3JAL B;  5JJE B;  4J9Y B;  3ABM C;  1VEW A;  4NXM O;  2FKX A;  3A0R A;  4JI4 B;  2NN4 A;  1R6K A;  3ASN C;  2ADP A;  1L0L H;  2LFR A;  4JI5 B;  2JGD A;  4MTF A;  2UU9 O;  3HPL C;  4DV3 B;  2JEX A;  1H2K A;  1YXB A;  3M99 B;  1KKC A;  1Y4M A;  3MD0 A;  1NH2 D;  4DV6 B;  1CEZ A;  1PNM A;  2YIB A;  4GKJ O;  4ICG A;  1YHQ V;  3SDL A;  3HKC A;  1YSC A;  1WB8 A;  1Z5W A;  4X1Y B;  4PA4 A;  1XEQ A;  2AHY A;  4Q20 A;  5LA6 B;  5C8Y B;  4O2A A;  3QF7 A;  3QO5 A;  4ZKI A;  3ZHV A;  2YC0 A;  2QWR B;  2DYR C;  1ZUQ A;  4B3M B;  3ASO C;  4DUY B;  3BY6 A;  5LMU O;  2ZCE A;  5L3B A;  4PDV A;  4JI2 B;  4DV0 B;  1S77 D;  1LR1 A;  1NS1 A;  5L3E A;  4Z1M G;  1AJP A;  1NBM G;  5FNV B;  3ABL B;  2BSK A;  1IZ3 A;  3UT5 A;  3HKD B;  4X64 B;  2FTK A;  1MSW D;  4IIJ B;  4O4J B;  5KHJ A;  4LF8 O;  3HKE A;  3IAY A;  5KUK A;  4DUZ B;  2Q8V A;  2W0X A;  5BR8 O;  2HR3 A;  2UXD O;  2QKS A;  3RYH A;  2ZKO A;  3OAA G;  3JSL A;  2Y48 A;  4IYH A;  4JPR A;  3A2F A;  3AG4 B;  5LP6 A;  2Z5U A;  2JGU A;  4FFB B;  3ZJZ A;  4FM0 A;  1S5J A;  2RQ6 A;  4R7C A;  2JRI A;  3ASN B;  1ARO P;  2BTQ B;  4UB8 Z;  4MT8 A;  1GM7 A;  3JCZ A;  3AK1 A;  2KSD A;  2X7R B;  1Y76 A;  3KCY A;  4BWA A;  3BPZ A;  5LHH A;  1XNQ O;  2GUZ B;  5FLX N;  3OT7 A;  1FXK C;  3LUT B;  1DF4 A;  2EIN C;  2QGN A;  3N2K A;  5KA6 A;  2VWK A;  4DV7 O;  3SJA C;  4TV8 A;  2ZE8 A;  3CPW U;  1EZJ A;  1FXV A;  3ZRV A;  1E1Q G;  4PI0 A; 
#chains in the Genus database with same CATH homology
 2YXH A;  2Q73 A;  1VMG A;  2Q9L A;  2A7W A;  1YXB A;  1Y6X A;  2P06 A;  3CRC A;  2A3Q A;  3CRA A;  2Q5Z A;  2Q4P A;  4QGP A;  3C90 A;  2OIE A;  2OIG A;  1YVW A;  5IE9 A;  2GTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...