2A7WA

Crystal structure of phosphoribosyl-atp pyrophosphatase from chromobacterium violaceum (atcc 12472). nesg target cvr7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
91
structure length
91
Chain Sequence
DVLKNIADTLEARREAAPQSSYVASLFHKGEDAILKKVAEEAAETLMASKDKDKLHLVREVADLWFHTMVLLTYHGLRPEDVVMELHRREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosyl-ATP pyrophosphatase
publication title Crystal Structure of Phosphoribosyl-ATP Pyrophosphatase from Chromobacterium violaceum. NESG Target CVR7.
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
total genus 29
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.1.31: Phosphoribosyl-ATP diphosphatase.
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2a7wA00
2GTAA 1YVWA 2YXHA 2Q4PA 2P06A 5IE9A 3CRCA 2OIEA 2Q9LA 1VMGA 2A7WA 4QGPA 3C90A 1YXBA 2A3QA 2Q73A 2OIGA 3CRAA 2Q5ZA 1Y6XA
chains in the Genus database with same CATH superfamily
4FLUA 5JH7B 2YIBA 4DV1B 4DUYB 1VF7A 3HKCB 5EYPB 2ZM6O 3SJQC 2JEUA 3APOA 5CBHA 3ASNC 5C93A 4FFBA 4UVBA 1QNMA 1FPOA 1NBMG 4R50A 5BZBA 2F93B 1NI8A 1TA8A 3CRQA 3SR2C 2XAHA 3FD9A 1WAZA 3JD2A 3BFRA 3H1KH 2YXLA 1W0JG 5LMNB 1M93A 4AILC 3FAVA 2X6CA 2FL4A 4H37A 5H6QA 1HNZB 2Q0OC 3I55V 3AK2A 5KA5A 1KP3A 3MD0A 3J81N 3QG5A 3MDSA 5B3SC 3ABLC 4X8AA 4JI3B 4D7SA 1QR8A 5A9GA 1OCZB 1SETA 2PZSA 2P4KA 1DF4A 4DV7O 2YDEA 4JI0B 1AR4A 3DSQA 4JI2B 3EXAA 3OTOB 4I9QA 1ENVA 1BL8A 4X66B 4X88A 2N74A 3H1JH 4LF4O 2R72A 3GWOA 1NU1H 5GONB 3UO3A 1XNQB 4XDJA 2HHHO 4GUNA 4NTWA 5CB4A 1FJGO 1ROPA 2EIJC 1F51A 4J41A 4ZIBA 2Y0PA 4I50A 4I9WA 1PNMA 2HP8A 1YJ9V 1FS0G 2IW5A 3ASOB 2NLJC 3B2EE 4J11A 3KCXA 1NT2B 4PA6A 4GKJB 4CH5A 5IE9A 1EM1A 4K8XA 1VMGA 1JJ2U 5LGTA 2LFSA 4BAYA 4O2AB 1NKDA 1N36B 2WPDG 1DLBA 4MS2A 4TV9B 5EC1C 1N0NA 2BOBC 2F4VB 3CXCU 4KHPB 5KAFZ 4TT3G 2EZPA 3ZMUA 5KAIZ 2R9IA 4DR6O 1KC8W 4YIPA 1O9HA 1V54C 2IU0A 4G2KA 5KA6A 3IC7A 2P90A 1MZFA 1XUQA 3RW0A 3W7TA 4DV2O 2NN4A 2WSSG 3CD6V 1L0NH 2WLIB 2XNDG 3JSLA 5JVDB 4LF5O 1AVMA 1E1RG 1WNSA 1V55B 4UUJC 1WB8A 4ZI7B 2UXNA 5D5QA 1Q5OA 2IJKA 2B1GA 1HDJA 1OHHG 3TCUA 4YY3O 3QF7A 4HYOA 4YHHO 2PTMA 4U3JB 3ZN1A 4Z2WA 1CPYA 3BHPA 2KQXA 3CXHF 4J9YB 2ZINA 5DECA 1Q90D 1N4CA 4DV1O 3UQ8A 3SYQA 2X6BA 5L3FA 2CH7A 4ICGA 4YJ3A 3U0ZA 3N2KB 4G27B 1Z5VA 1VQPV 4L87A 3MHSC 3SPHA 4QE9A 1EN5A 3TK1A 4LFBO 1W59A 4WFAV 1XOUA 3ZJZA 1MSWD 3JD4A 4WFEA 4KFMA 4CS2A 4DV5B 4U7OA 3P32A 1WA8B 4JV5O 3IFXA 1IXBA 3RYHB 2B9ZA 3DC5A 3HB3B 4JI7O 5L3GA 4FVMA 2P67A 3KG2A 2QKAA 1G1XB 1UFIA 1YJNV 2XASA 2QA4V 4IL6Z 1NZ6A 1XQ8A 4AHCA 2ZE8A 3VBBA 1YJWV 2NR5A 3ETGA 4FZ0A 4JI3O 1J5EO 3I5DA 5B1BC 3STZC 2YI8A 3JAMN 3UKMA 2Y48A 3CMAV 3CRCA 3VQWA 1H8HG 1R6NA 1QLEC 1GRJA 1R1BA 3EHBB 4JI0O 3JARA 4PDRA 4WCEV 3ZRSA 4DW0A 3E22A 4JI2O 4RWUA 4LH7A 2DYSB 4H33A 4WFGA 4I55A 3BCCH 1WP8A 4RO2A 1VQOV 3IC9A 2N04A 3FKSG 3H9VA 4GX5A 4LF9B 1JJOA 4QPJA 1AI6A 2H8PC 4TUYA 4H0LB 4LWSB 5GTIZ 3E8GA 1F7YA 4F6EA 1NVPD 1Y74B 4JI1O 4AQYB 5LMUB 1QU7A 2UXCB 2P7TC 4FLXA 2HFEC 3WFVA 5JJNB 4ABMA 1MSDA 4DR3B 2KB1A 2CTRA 5BR8O 1B3QA 3D8CA 1SF9A 2LFRA 4K0KO 3N2GB 1MABG 4KHPO 2WLKA 1R3LC 4FM0A 5IY5C 1SQXH 3VQXA 5IJ0A 1I5XA 1JA8A 5L3CA 1Q3EA 3H1LH 5LGUA 3KKYA 5FLXN 4YXWG 4OPAA 4JAVA 3K9AA 2EZOA 2YIAA 1L0LH 3FB5C 3JSNA 5HFMA 1IX9A 2ADPA 3QTCA 1XEQA 2W0FC 4OX9O 3IGAC 4TSFG 4LF8B 2IM9A 1NH2D 2Q7GA 5CA3A 4JYYA 4ZHQB 2XAJA 1BS3A 4WFBV 3K0DA 2BTQB 1HNXB 4DYLA 2JGUA 1O9GA 2Q8VA 4DUZB 3E89A 2YUAA 3CE2A 1NTZH 5J2UB 5LOVA 3CPWU 2F95B 5LHGA 2MK3A 3ABKC 1U97A 1JPXA 3ZRWB 1M57C 2HLDG 4JZGA 1MNGA 3EVKA 5LXTB 2MW2B 3ZRXA 2E5LB 3HKEB 1P7BA 4DV5O 5KMGB 1U96A 1OZ0A 1P4RA 1OCOC 2JEXA 2F66C 4QNHB 3KZIZ 5FNVB 4CZZA 4FK5C 4DRXA 3ETQA 1GO3F 3OMAB 1IVSA 1BE3H 3HKBA 2PI5A 1QVFU 3JAWA 2EINC 4DV3B 2AHYA 2QWRB 4GKKB 2E76B 2PGGA 1CEZA 4JI5B 2HJDA 5K1PA 2Q67A 2YEVA 3W7UA 1N33O 2M7WA 2JDIG 2RCVA 4HAMA 5BMVB 3D3QA 4NVPA 3G6BA 2BSKB 4LFAB 4GT1A 2CDYA 1VIBA 3K5OA 2XUMA 4TV8B 2DW4A 4LH6A 1LNQA 4X20B 2PUSA 1AB3A 4OXSA 5CBFA 3SYAA 4FJCC 4UCUA 3PJSK 3ABMC 4EEQA 4XDKA 4BIOA 2HVKC 3CCMV 3ZMTA 1G8MA 1OV9A 4AQYO 3OM3B 5H2FZ 4RUEA 1PP9H 1YF2A 5IYZB 1PD3A 2Q73A 5LP6B 3ZX6A 4I4TB 3UT5B 2WLJA 1FKAO 3WB2A 2RQ6A 2VQFO 3SPCA 4DV4O 2M6YA 2EILB 1HNWB 1PKXA 2OWOA 1NR1A 4NTXA 5EK0A 3S3XA 1AP6A 3AG4C 3IJ4A 5KX5A 4MVMA 2EULA 2DWDC 4LF7B 2ZDIA 5F2VO 2LP7A 2JS3A 1IXMA 1YDXA 1ZL8B 3ASNB 1M90W 2V4DA 1QHTA 2Q6AA 1IURA 4P2ZA 1XMOB 5D5PA 3THOA 2UXXA 1YEWA 4O2BA 4A5UB 3ML0A 2GSMB 3E2EA 1JCHA 5J2TB 2RJZA 1Y76B 5B1OA 4MW3A 4IYIA 3C90A 3OGCC 5IJ9A 3BY6A 3R66A 2YI9A 5BXZA 3KCYA 4PDLA 1D5NA 1HNXO 3AG7A 3Q4HA 2AXTZ 5B66Z 1KD1W 1BQZA 2GBOA 5JQGA 1H38A 3F7YC 4BWAA 1K3EA 1KQSU 1AILA 2ZD9A 3RVZA 1AJPA 3JD1A 5B3SB 1Z2GA 3ABLB 1Y4MA 1DK1A 1PNLA 4OPHA 4F6RB 4O4JA 3WU2Z 2IBZH 3K5MA 4JTDB 4PD4F 2UUAO 2IJHA 4YIOA 4ZBMA 1XMQB 3M7MX 2ZE6A 4J9ZB 3B40A 1FAFA 3CJHA 1R3KC 1K97A 3ZS8C 2LQTA 3JD0A 3RVYA 2VRZA 3GVMA 4NYKA 4PA7A 3VQYA 3QVNA 3CCLV 1JMKC 1BCCH 2A06H 1YTFB 1HP8A 2EIJB 1RFYA 4JPRA 3JASB 4O4HA 2QDOA 5ITZB 1BGYH 1XNRO 3LSSA 4LFCB 2OYQA 3BA8A 1VQ7V 4GKKO 3B8MA 1XBLA 1R73A 1XILA 4PA3A 1TGOA 4BIZA 4CS4A 3IAYA 3H1HH 4JI5O 2ZDIC 5KHJA 1XL4A 2YC0A 3ETDA 2DJVA 4X62B 4KP4A 1KU9A 2OIGA 1W2BU 4JI4B 2OCCB 4DR4B 4FFBB 2Q0AA 3SPIA 1PPJH 5DN6G 2E3CA 1WB7A 2UUCB 1JR9A 2ZXWC 2W0XA 5EBMC 4AI8A 4UVCA 1I94O 1V54B 4FFKA 3FAVB 2XOKG 1S3JA 5B1AC 4DV6B 1DTOA 1R6TA 4X1KA 1M56C 1KKDA 1FXKA 2OCHA 5GONA 3QO7A 3T2MA 5LYJA 4DR1O 1WN7A 4J7ZA 2WWWA 4J80A 3HPLC 4UXNA 2OIEA 1P49A 4H44B 4X1IA 2ZQMA 1GN4A 3T4ZA 2EIKC 4B3MB 2QM7A 5E1AC 2UUBO 2XTAA 3CRAA 1HNWO 4DR2B 3ABUA 1RSOA 2ITDC 1QLNA 4H13B 1SA0A 5H5NA 1QCEA 4DO2A 4OGQB 1S72V 1VQMV 3RYCA 1BSMA 3D3IA 5CB4B 3TJTA 4X64B 2F43G 1WPBA 4CH4A 4MSWC 3A0HZ 4I50B 4U7NA 4KXRA 1ZTEA 3T1YB 4K8ZA 1QBZA 4E4EA 2YXYA 4UCRA 2JGDA 4PA9A 4FLYA 3K59A 1YXBA 3FYEB 2HG5C 4BIUA 2UXBO 2VWKA 4JGSA 3G71V 3QNEA 2D3OW 1OCZC 4GX2A 2UXDB 4JYAB 1IBMB 4JF3A 1FFXA 1F4NA 4NXMB 5B1BB 2L6LA 3LUTB 2Q9LA 2A7WA 4W4LA 1XL6A 3F5TA 1K92A 4J10A 1QLEB 2QGNA 2ZKOA 3F5WC 5IWAB 4BW9A 1I0HA 2QKCA 3CRMA 2GTSA 1FXKC 1L1FA 1FYJA 4FM2A 1K4DC 1ORQC 4DUYO 1N32B 4ZKIA 3AG1C 2Y0IA 3G4SV 1IBLB 1H2LA 2R9AA 5EC2C 3FFQA 4DV0B 4HNAA 3LSUA 4RQFA 3OEHG 2OTJV 1PM9A 4JTAB 2X7RB 1AR5A 2QTSA 2YICA 3M99B 4IHJA 1LUVA 3K08A 4LFCO 2IJJA 2Z0AA 4QE7A 2ZNJA 1JVMA 1EN4A 4FPPA 5LMNO 4TQDA 1ZWIC 4EB6A 1Y67A 1HNZO 2BE3A 4DXWA 1K9MW 2CH7B 2QM4A 4YJ3B 3SPJA 4DR4O 1S5JA 2H94A 4MTOA 1OCRC 2A79B 2UU9B 1K5QA 5JJEB 3ZHSA 1Y6XA 4NXNB 3SDLA 5IY5B 3TETA 3NR7A 2GUZA 1VARA 1SC5B 4DV6O 1BMFG 5H9CA 3T4DA 1HR0B 3GB7C 5KUKA 3RYIB 4W4KA 1V55C 5GTHZ 2JS5A 4PELA 3OTOO 4I0XA 4MVSA 4B3SB 3SYCA 5EZYA 3ZN0A 4X66O 4GZRB 1I08A 3CS5A 2YXHA 1SZTA 1T5EA 1ZUQA 2OTLV 1XNQO 1EBOA 2ZR3A 1GM9A 1WJZA 3X2QC 1Y74A 5HFLA 4MVUA 4B3MO 1EN6A 3T1HB 2VQEB 4DR2O 1A32A 2XAQA 2A9HA 3JARB 1X4TA 4GKJO 3E22B 4EKWA 2LGWA 2B5UA 2EIMC 4I55B 3TGUH 1M57B 4B3TB 3FB8C 1Z5WA 2DYRC 1H2KA 1SZXA 3S3WA 3AK3A 5LGNA 1N36O 4X64O 2KG7B 2H3OA 4HBNA 2F4VO 3ZMZA 2A3QA 1OCOB 2D2CB 1RM1C 4TUYB 5KHIA 1QVGU 1VQ9V 1P84F 2CK3G 4WBNA 3UCSC 3D36A 2CGNA 2XAFA 5DM6V 3CRRA 1VQ6V 4PA4A 4LNUA 2KKWA 2FTKA 5C8YA 1EFRG 3H1IH 3STLC 2EJ7A 2EINB 4MTXA 4NTYA 3WG7C 4CH6A 2Y69B 2UXDO 4LCUC 3WB0A 1R6KA 3OR6C 2BCCH 4GYCB 2CAZC 5EIBC 5KUMA 5DEDA 5IJ0B 1VP7A 2RNBA 1S76D 2IH3C 3LDDA 2ZIMA 3O9OA 1MOFA 2JK5C 5CA1B 2DQ0A 3ZRWA 3PN1A 2P22C 4BR6A 2XAGA 3JAKA 2BTOA 4FIPC 3G80A 1FD9A 1GTOA 3RYFA 1Q6HA 4WFHA 4N23A 2GTAA 4O4LA 4LC1A 4Z1VA 1RPOA 1K4CC 2WLLA 1Q82W 2Q7EA 2LW1A 1N0JA 2Y4TA 1NTMH 1UPGA 4UCSA 1GN2A 2QEXV 1K33A 4X9QA 1IBKB 3ABMB 2R70A 4CC5A 3AEIA 3K0GA 3JALA 1GN6A 4UVAA 4B3RB 5LOVB 4R6ZA 3BPZA 3LNNA 1IDSA 4TOIA 2CTQA 3MAQA 4UB8Z 1VEWA 1BT8A 2LJ2A 4MVZA 4Z1MG 4K35A 2QR4A 2ZE7A 1B06A 4FLVA 4QPKA 2AGAA 2R9RB 4KL1A 2XT9A 3OW2U 4UV9A 4CS3A 2ZM6B 3DC6A 1XREA 3AG4B 1JQ0A 5FPRA 3HKDA 1YI2V 2HVJC 1VQ8V 1TVKA 2AW9A 4UCOA 3CB2A 5CA0A 1KP2A 4ZOLB 1SRYA 3APQA 1VQNV 1D2DA 4JTCB 3D36C 1F4MA 1MG1A 3RBZA 4DRXB 2ITCC 1HR0O 1JOYA 4P9PA 1KB9F 4YJ2A 3G6EV 4JYCA 3HKBB 2DMXA 3JAWB 5JJJB 4X1YA 3U10A 1KMIZ 2Z5UA 3AG2C 2GDSA 3TXQA 4PHZA 1DF5A 1AI4A 4LF9O 4D7TA 1K7DA 4IIJB 3E86A 3CCSV 2YEVB 5CN0A 3CSXA 3DXRA 3OMIB 4DR5B 5AG2A 4MT8A 3K9SA 1I5YA 4LF6B 5LMUO 2GV9A 2KSDA 3ZHTA 2UXCO 2IU3A 4N21A 3SJBC 4DV7B 4P30A 1JFFA 3JCUZ 3A8TA 1NVPB 1F23A 2IH1C 4DR3O 1US6A 1VQLV 3L9DA 3JATA 4CBCA 2YSUB 4MVRA 2DWEC 1OCCC 1FJGB 2P4VA 1ZX3A 3L70H 3E8FA 4C7UA 1NR7A 2QWQB 3OAAG 3VQVA 4O4IA 2JRIA 4JZ2A 2VWJA 3ZCCA 3ZHVA 1ZSPA 1RPRA 4JAUA 4LF8O 4F4LA 3BA9A 2HEPA 2X0LA 5KX5B 3L75H 2FKXA 2NNUA 1AI7A 1PL0A 3AG3C 3K04A 4R7CA 2CTWA 3E8HA 1NH2B 1CP9A 2A0LA 1H2GA 4GX1A 3HR0A 4DUZO 2V1DA 5LA6A 1YZBA 4O2BB 2ZXWB 4UCTA 4DR6B 1B04A 5BY1A 4EFBA 4J42A 3E8BA 3DTUB 5JH7A 3L73H 5IJ9B 3OD4A 2E5LO 5B1AB 1YCIA 1YVWA 3HKCA 3LNMB 5EYPA 1M56B 3Q4HB 5JQGB 2CTPA 1ZAUA 4BW5A 3FYIB 3ZRVA 4QGPA 4DK0A 3ZMSA 2G38A 2WLMA 4B3RO 2P5OA 3JASA 3OT7A 2FMLA 4X65B 2V7QG 2WLHA 4YHHB 5LL6Y 3DGEA 1TUBB 4PV1B 2EIKB 3L72H 4B7EA 4MW8A 1FXHA 1M4UA 5LBQA 4DV3O 1XDCA 2Z3YA 1Q8IA 3ABTA 1H2MA 1JX9A 4JI6B 5KHGA 3CJHB 3R65A 5LHHA 2PY5A 1KBHA 1XHXA 2ODMA 4LFBB 4FLZA 4LBEC 4JV5B 4IGGA 1K8AW 3QO8A 1OJHA 4O4HB 4LFAO 4JI7B 2Y4UA 2L35A 1WLEA 1TAEA 3NXSA 3JD3A 3G67A 3K5NA 2PI4A 1J95A 1I7FA 2Q5ZA 4RAIA 4RQEA 4FMTA 4UFZA 2CGOA 1J5EB 4DR5O 2QSAA 2ETNA 2E75B 5EIBD 4LF6O 1GMGA 5IYDO 3OMNB 2P6JA 3C3SA 4UV8A 5IDJA 1XI1A 2ZE5A 2IJIA 5A2QN 3RN4A 1GKFA 3J80N 1FFTB 2WA4A 1HWYA 3ZHUA 4X1KB 4JI8B 4LF7O 1FXKB 3JYCA 1G6UA 1VQ5V 4O2AA 3AG1B 3OUFA 5LYJB 1G4YB 4TV9A 3OE7G 1WP7A 5CBGA 2DE0X 1GM7A 4Q6GA 4FM1A 2Q69A 4TQFA 4KUMA 1XMOO 1SQPH 4X1IB 5K1XA 3OFNG 4JI1B 1COWG 1Y66A 5KHHA 4GLXA 4JASA 4IT5A 1RSOB 1AJNA 4J7KA 2CE4A 3P30A 1FXVA 4MVOA 1SA0B 1GM8A 2OCCC 1VQKV 2FB5A 5BR8B 2WLIA 5JVDA 4K0KB 4FZ1A 4ZI7A 3RYCB 2X6AA 1OCRB 2Q4PA 4U3FH 4DK1A 4DR7B 3K58A 5EBLC 4U3JA 4ASUG 1YSCA 5IT9N 5CMUA 2LW7A 2AZ0A 4DW1A 2JGDB 2DQ3A 1YIJV 1XMQO 2F23A 1NQTA 2GHYA 3W7SA 2QWPB 4OX9B 4QIWF 2ZNIA 1N34B 3N2KA 4Q20A 3CCQV 1R3IC 2YS8A 3F7VC 3J7AU 2RN9A 3L71H 4X65O 4E2LA 1FFXB 1WA8A 1S0VA 3SJAC 3ASOC 4JYBA 3X2QB 3RYHA 1Q6IA 3K3WA 1K34A 1V9PA 3B4SA 5B1NA 3ZMVA 1KYOF 1M5IA 2XHBA 1TUEB 3CCJV 1S77D 3BRCA 2WA3A 3CCEV 4JI6O 2W6JG 2JIZG 3JCZA 4FLTA 1WPXA 2EIMB 3W7XA 4X62O 2LO1A 2DYRB 3OR7C 4JI4O 3A0BZ 1P7GA 1KECA 4HNAB 4QJFB 2Q68A 4P9OA 2UUCO 1GH6A 4IHJB 5JWPA 3BABA 4I5SA 2F1MA 3CCUV 1N8RW 1RM1B 3RYIA 2ZIOA 2ZR2A 4EB6B 2N05A 5KLVH 3SPGA 4MVQA 3B8NA 5J9PC 1PNKA 4PJ0Z 3WG7B 4X89A 1RP3B 4K3AA 1Q43A 1N33B 4CH3A 2AHZA 4LWSA 1LR1A 5FL7G 2B1IA 1SQFA 1YHQV 2QE7G 2QWOB 2GUZB 5EBWC 2DN9A 2PF4E 4TWKA 5TISZ 5IYBO 1H2NA 1BQ0A 4L8JA 4JI8O 3RGBA 1E1QG 1Q6UA 3CC2V 4I0XB 3ABKB 5L3BA 2KG7A 5EZYB 3RWRD 4EFEA 3C3TA 3N2GA 2OT5A 1MA1A 4UB6Z 1MZEA 3ZBHA 4G28B 2JVDA 3RFRA 1L8DA 3AK1A 3T1CA 3CMEV 2HJFC 5H6RA 4R8CA 3UO2A 4B7KA 3CCVV 3T1YO 1EZJA 1NTKH 1PL4A 2P06A 1AR1B 2CUGA 2VQFB 2ADQB 3LDEA 1URFA 3H01A 4DV4B 2PYLA 2EX3A 3P3PA 1SKVA 3OGIB 1SS3A 4HZ3A 2RDCA 1VF5B 4PI0A 1XHZA 4ZHQA 3K03A 3CC7V 2BTQA 3CYOA 4JYAO 1IBMO 4DR7O 2QM8A 4NXMO 1AJQA 1K73W 5CA1A 3BEHA 1Q81W 1SQGA 3CHXA 3N27A 5J2UA 4WBNB 3A2FA 5IWAO 2DYSC 1NS1A 5L3EA 1N34O 3SYOA 2EBOA 3CX5F 4LNUB 1SQQH 2FYUH 5LXTA 1N32O 5C8YB 1GK9A 1S5LZ 1IBLO 1AP5A 4JAAA 2K1EA 3HKEA 4D6TH 2K9PA 3I56V 5KMGA 3AG2B 3U11A 4DV0O 3OUSA 1KKCA 2C2AA 4WF9V 2QJ1A 2QKSA 3FX7A 1BHAA 1GN3A 3K79A 1QQCA 5FNVA 2ILMA 4B08A 3ICXA 5JCOA 3CC4V 3OTFA 1EZVH 1SERA 2VS0A 4UCVA 3JAKB 2UUAB 1D5AA 3RYFB 1QR9A 2ATKC 4PDVA 3E35A 2E74B 3B09A 3MHHC 4O4LB 3CEIA 1VQ4V 2HR3A 2WLLB 1GAXA 2UU9O 1YITV 1YTFD 4ZOLA 3ZEDA 4NXNO 1IZ3A 1OCCB 1VF6A 4IYHA 1NJIW 4LP8A 3JALB 5BMVA 1S5HC 4LR3A 3E83A 2BSKA 3A0RA 3K06A 1XNRB 2YIBD 1X59A 2RMKB 2Y69C 3EFFK 3FB7C 4TV8A 1SQVH 3L74H 5B5EZ 3BVOA 3K57A 3SGIA 3ZHQA 4X20A 4B3SO 3M8AA 1B6QA 4NB5A 4GCZA 4IIJA 2ZT9B 3K5LA 3WB1A 1LUWA 2BOCC 2Q7HA 3HKDB 1W0KG 2WAMA 3CWBH 3SYPA 1CXZB 3AG3B 1TVKB 5CA0B 3T1HO 5E79Z 5IYZA 2VQEO 1KUQA 1SESA 1M1KW 5LP6A 2QTOA 4I4TA 3UT5A 1Q7YW 1AROP 4YJ2B 3VOUA 4I7ZB 2LGQA 3CP1A 1I94B 1K5SA 4B3TO 2ARHA 4X1YB 2YIDA 2ZCEA 4CC6A 3BAAA 4MTGA 3O65A 5FPOA 4DR1B 1BZKA 2W6IG 3W7WA 2WLNA 2PYJA 1ZL8A 4LF4B 1BHBA 3DXRB 2HHHB 3OEEG 4NKGB 1Q86W 5LHIA 4J7JA 2JJ2G 5JCOC 3SJCC 4XDLA 1UJWB 5J2TA 1Y76A 2UUBB 5L3DA 1AI5A 1JFFB 4GX0A 3ETEA 3LDCA 3JATB 1MMMA 2EJRA 3RT3C 1DGSA 1E79G 1HW7A 1VF6C 4MTFA 4PI2A 2JJ1G 3LSQA 3ZHRA 5IYCO 4F6RA 1PV0A 1SQBH 1ZLZA 4O4IB 2DOSA 4RUFA 2AZ2A 2HKOA 4XBFA 3B77A 2QWNB 3QO5A 5KHKA 3FB6C 4DV2B 1R3JC 2UXBB 4NR1A 4WFFA 4LF5B 3GWKC 1IBKO 3CCRV 1H2SB 4PDMA 1H8EG 3P3NA 5LP6C 1THZA 3UM7A 4FLWA 5LA6B 3ZIAG 1TUBA 4YY3B 5ITZA 3TXSA 1M9NA 2EILC 2O57A 4O4JB 5GW7A
chains in the Genus database with same CATH topology
2GTAA 1YVWA 2YXHA 2Q4PA 2P06A 5IE9A 3CRCA 2OIEA 2Q9LA 1VMGA 2A7WA 4QGPA 3C90A 1YXBA 2A3QA 2Q73A 2OIGA 3CRAA 2Q5ZA 1Y6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTA A;  1YVW A;  2YXH A;  2Q4P A;  2P06 A;  5IE9 A;  3CRC A;  2OIE A;  2Q9L A;  1VMG A;  2A7W A;  4QGP A;  3C90 A;  1YXB A;  2A3Q A;  2Q73 A;  2OIG A;  3CRA A;  2Q5Z A;  1Y6X A; 
#chains in the Genus database with same CATH topology
 4FLU A;  5JH7 B;  2YIB A;  4DV1 B;  4DUY B;  1VF7 A;  3HKC B;  5EYP B;  2ZM6 O;  3SJQ C;  2JEU A;  3APO A;  5CBH A;  3ASN C;  5C93 A;  4FFB A;  4UVB A;  1QNM A;  1FPO A;  1NBM G;  4R50 A;  5BZB A;  2F93 B;  1NI8 A;  1TA8 A;  3CRQ A;  3SR2 C;  2XAH A;  3FD9 A;  1WAZ A;  3JD2 A;  3BFR A;  3H1K H;  2YXL A;  1W0J G;  5LMN B;  1M93 A;  4AIL C;  3FAV A;  2X6C A;  2FL4 A;  4H37 A;  5H6Q A;  1HNZ B;  2Q0O C;  3I55 V;  3AK2 A;  5KA5 A;  1KP3 A;  3MD0 A;  3J81 N;  3QG5 A;  3MDS A;  5B3S C;  3ABL C;  4X8A A;  4JI3 B;  4D7S A;  1QR8 A;  5A9G A;  1OCZ B;  1SET A;  2PZS A;  2P4K A;  1DF4 A;  4DV7 O;  2YDE A;  4JI0 B;  1AR4 A;  3DSQ A;  4JI2 B;  3EXA A;  3OTO B;  4I9Q A;  1ENV A;  1BL8 A;  4X66 B;  4X88 A;  2N74 A;  3H1J H;  4LF4 O;  2R72 A;  3GWO A;  1NU1 H;  5GON B;  3UO3 A;  1XNQ B;  4XDJ A;  2HHH O;  4GUN A;  4NTW A;  5CB4 A;  1FJG O;  1ROP A;  2EIJ C;  1F51 A;  4J41 A;  4ZIB A;  2Y0P A;  4I50 A;  4I9W A;  1PNM A;  2HP8 A;  1YJ9 V;  1FS0 G;  2IW5 A;  3ASO B;  2NLJ C;  3B2E E;  4J11 A;  3KCX A;  1NT2 B;  4PA6 A;  4GKJ B;  4CH5 A;  5IE9 A;  1EM1 A;  4K8X A;  1VMG A;  1JJ2 U;  5LGT A;  2LFS A;  4BAY A;  4O2A B;  1NKD A;  1N36 B;  2WPD G;  1DLB A;  4MS2 A;  4TV9 B;  5EC1 C;  1N0N A;  2BOB C;  2F4V B;  3CXC U;  4KHP B;  5KAF Z;  4TT3 G;  2EZP A;  3ZMU A;  5KAI Z;  2R9I A;  4DR6 O;  1KC8 W;  4YIP A;  1O9H A;  1V54 C;  2IU0 A;  4G2K A;  5KA6 A;  3IC7 A;  2P90 A;  1MZF A;  1XUQ A;  3RW0 A;  3W7T A;  4DV2 O;  2NN4 A;  2WSS G;  3CD6 V;  1L0N H;  2WLI B;  2XND G;  3JSL A;  5JVD B;  4LF5 O;  1AVM A;  1E1R G;  1WNS A;  1V55 B;  4UUJ C;  1WB8 A;  4ZI7 B;  2UXN A;  5D5Q A;  1Q5O A;  2IJK A;  2B1G A;  1HDJ A;  1OHH G;  3TCU A;  4YY3 O;  3QF7 A;  4HYO A;  4YHH O;  2PTM A;  4U3J B;  3ZN1 A;  4Z2W A;  1CPY A;  3BHP A;  2KQX A;  3CXH F;  4J9Y B;  2ZIN A;  5DEC A;  1Q90 D;  1N4C A;  4DV1 O;  3UQ8 A;  3SYQ A;  2X6B A;  5L3F A;  2CH7 A;  4ICG A;  4YJ3 A;  3U0Z A;  3N2K B;  4G27 B;  1Z5V A;  1VQP V;  4L87 A;  3MHS C;  3SPH A;  4QE9 A;  1EN5 A;  3TK1 A;  4LFB O;  1W59 A;  4WFA V;  1XOU A;  3ZJZ A;  1MSW D;  3JD4 A;  4WFE A;  4KFM A;  4CS2 A;  4DV5 B;  4U7O A;  3P32 A;  1WA8 B;  4JV5 O;  3IFX A;  1IXB A;  3RYH B;  2B9Z A;  3DC5 A;  3HB3 B;  4JI7 O;  5L3G A;  4FVM A;  2P67 A;  3KG2 A;  2QKA A;  1G1X B;  1UFI A;  1YJN V;  2XAS A;  2QA4 V;  4IL6 Z;  1NZ6 A;  1XQ8 A;  4AHC A;  2ZE8 A;  3VBB A;  1YJW V;  2NR5 A;  3ETG A;  4FZ0 A;  4JI3 O;  1J5E O;  3I5D A;  5B1B C;  3STZ C;  2YI8 A;  3JAM N;  3UKM A;  2Y48 A;  3CMA V;  3CRC A;  3VQW A;  1H8H G;  1R6N A;  1QLE C;  1GRJ A;  1R1B A;  3EHB B;  4JI0 O;  3JAR A;  4PDR A;  4WCE V;  3ZRS A;  4DW0 A;  3E22 A;  4JI2 O;  4RWU A;  4LH7 A;  2DYS B;  4H33 A;  4WFG A;  4I55 A;  3BCC H;  1WP8 A;  4RO2 A;  1VQO V;  3IC9 A;  2N04 A;  3FKS G;  3H9V A;  4GX5 A;  4LF9 B;  1JJO A;  4QPJ A;  1AI6 A;  2H8P C;  4TUY A;  4H0L B;  4LWS B;  5GTI Z;  3E8G A;  1F7Y A;  4F6E A;  1NVP D;  1Y74 B;  4JI1 O;  4AQY B;  5LMU B;  1QU7 A;  2UXC B;  2P7T C;  4FLX A;  2HFE C;  3WFV A;  5JJN B;  4ABM A;  1MSD A;  4DR3 B;  2KB1 A;  2CTR A;  5BR8 O;  1B3Q A;  3D8C A;  1SF9 A;  2LFR A;  4K0K O;  3N2G B;  1MAB G;  4KHP O;  2WLK A;  1R3L C;  4FM0 A;  5IY5 C;  1SQX H;  3VQX A;  5IJ0 A;  1I5X A;  1JA8 A;  5L3C A;  1Q3E A;  3H1L H;  5LGU A;  3KKY A;  5FLX N;  4YXW G;  4OPA A;  4JAV A;  3K9A A;  2EZO A;  2YIA A;  1L0L H;  3FB5 C;  3JSN A;  5HFM A;  1IX9 A;  2ADP A;  3QTC A;  1XEQ A;  2W0F C;  4OX9 O;  3IGA C;  4TSF G;  4LF8 B;  2IM9 A;  1NH2 D;  2Q7G A;  5CA3 A;  4JYY A;  4ZHQ B;  2XAJ A;  1BS3 A;  4WFB V;  3K0D A;  2BTQ B;  1HNX B;  4DYL A;  2JGU A;  1O9G A;  2Q8V A;  4DUZ B;  3E89 A;  2YUA A;  3CE2 A;  1NTZ H;  5J2U B;  5LOV A;  3CPW U;  2F95 B;  5LHG A;  2MK3 A;  3ABK C;  1U97 A;  1JPX A;  3ZRW B;  1M57 C;  2HLD G;  4JZG A;  1MNG A;  3EVK A;  5LXT B;  2MW2 B;  3ZRX A;  2E5L B;  3HKE B;  1P7B A;  4DV5 O;  5KMG B;  1U96 A;  1OZ0 A;  1P4R A;  1OCO C;  2JEX A;  2F66 C;  4QNH B;  3KZI Z;  5FNV B;  4CZZ A;  4FK5 C;  4DRX A;  3ETQ A;  1GO3 F;  3OMA B;  1IVS A;  1BE3 H;  3HKB A;  2PI5 A;  1QVF U;  3JAW A;  2EIN C;  4DV3 B;  2AHY A;  2QWR B;  4GKK B;  2E76 B;  2PGG A;  1CEZ A;  4JI5 B;  2HJD A;  5K1P A;  2Q67 A;  2YEV A;  3W7U A;  1N33 O;  2M7W A;  2JDI G;  2RCV A;  4HAM A;  5BMV B;  3D3Q A;  4NVP A;  3G6B A;  2BSK B;  4LFA B;  4GT1 A;  2CDY A;  1VIB A;  3K5O A;  2XUM A;  4TV8 B;  2DW4 A;  4LH6 A;  1LNQ A;  4X20 B;  2PUS A;  1AB3 A;  4OXS A;  5CBF A;  3SYA A;  4FJC C;  4UCU A;  3PJS K;  3ABM C;  4EEQ A;  4XDK A;  4BIO A;  2HVK C;  3CCM V;  3ZMT A;  1G8M A;  1OV9 A;  4AQY O;  3OM3 B;  5H2F Z;  4RUE A;  1PP9 H;  1YF2 A;  5IYZ B;  1PD3 A;  2Q73 A;  5LP6 B;  3ZX6 A;  4I4T B;  3UT5 B;  2WLJ A;  1FKA O;  3WB2 A;  2RQ6 A;  2VQF O;  3SPC A;  4DV4 O;  2M6Y A;  2EIL B;  1HNW B;  1PKX A;  2OWO A;  1NR1 A;  4NTX A;  5EK0 A;  3S3X A;  1AP6 A;  3AG4 C;  3IJ4 A;  5KX5 A;  4MVM A;  2EUL A;  2DWD C;  4LF7 B;  2ZDI A;  5F2V O;  2LP7 A;  2JS3 A;  1IXM A;  1YDX A;  1ZL8 B;  3ASN B;  1M90 W;  2V4D A;  1QHT A;  2Q6A A;  1IUR A;  4P2Z A;  1XMO B;  5D5P A;  3THO A;  2UXX A;  1YEW A;  4O2B A;  4A5U B;  3ML0 A;  2GSM B;  3E2E A;  1JCH A;  5J2T B;  2RJZ A;  1Y76 B;  5B1O A;  4MW3 A;  4IYI A;  3C90 A;  3OGC C;  5IJ9 A;  3BY6 A;  3R66 A;  2YI9 A;  5BXZ A;  3KCY A;  4PDL A;  1D5N A;  1HNX O;  3AG7 A;  3Q4H A;  2AXT Z;  5B66 Z;  1KD1 W;  1BQZ A;  2GBO A;  5JQG A;  1H38 A;  3F7Y C;  4BWA A;  1K3E A;  1KQS U;  1AIL A;  2ZD9 A;  3RVZ A;  1AJP A;  3JD1 A;  5B3S B;  1Z2G A;  3ABL B;  1Y4M A;  1DK1 A;  1PNL A;  4OPH A;  4F6R B;  4O4J A;  3WU2 Z;  2IBZ H;  3K5M A;  4JTD B;  4PD4 F;  2UUA O;  2IJH A;  4YIO A;  4ZBM A;  1XMQ B;  3M7M X;  2ZE6 A;  4J9Z B;  3B40 A;  1FAF A;  3CJH A;  1R3K C;  1K97 A;  3ZS8 C;  2LQT A;  3JD0 A;  3RVY A;  2VRZ A;  3GVM A;  4NYK A;  4PA7 A;  3VQY A;  3QVN A;  3CCL V;  1JMK C;  1BCC H;  2A06 H;  1YTF B;  1HP8 A;  2EIJ B;  1RFY A;  4JPR A;  3JAS B;  4O4H A;  2QDO A;  5ITZ B;  1BGY H;  1XNR O;  3LSS A;  4LFC B;  2OYQ A;  3BA8 A;  1VQ7 V;  4GKK O;  3B8M A;  1XBL A;  1R73 A;  1XIL A;  4PA3 A;  1TGO A;  4BIZ A;  4CS4 A;  3IAY A;  3H1H H;  4JI5 O;  2ZDI C;  5KHJ A;  1XL4 A;  2YC0 A;  3ETD A;  2DJV A;  4X62 B;  4KP4 A;  1KU9 A;  2OIG A;  1W2B U;  4JI4 B;  2OCC B;  4DR4 B;  4FFB B;  2Q0A A;  3SPI A;  1PPJ H;  5DN6 G;  2E3C A;  1WB7 A;  2UUC B;  1JR9 A;  2ZXW C;  2W0X A;  5EBM C;  4AI8 A;  4UVC A;  1I94 O;  1V54 B;  4FFK A;  3FAV B;  2XOK G;  1S3J A;  5B1A C;  4DV6 B;  1DTO A;  1R6T A;  4X1K A;  1M56 C;  1KKD A;  1FXK A;  2OCH A;  5GON A;  3QO7 A;  3T2M A;  5LYJ A;  4DR1 O;  1WN7 A;  4J7Z A;  2WWW A;  4J80 A;  3HPL C;  4UXN A;  2OIE A;  1P49 A;  4H44 B;  4X1I A;  2ZQM A;  1GN4 A;  3T4Z A;  2EIK C;  4B3M B;  2QM7 A;  5E1A C;  2UUB O;  2XTA A;  3CRA A;  1HNW O;  4DR2 B;  3ABU A;  1RSO A;  2ITD C;  1QLN A;  4H13 B;  1SA0 A;  5H5N A;  1QCE A;  4DO2 A;  4OGQ B;  1S72 V;  1VQM V;  3RYC A;  1BSM A;  3D3I A;  5CB4 B;  3TJT A;  4X64 B;  2F43 G;  1WPB A;  4CH4 A;  4MSW C;  3A0H Z;  4I50 B;  4U7N A;  4KXR A;  1ZTE A;  3T1Y B;  4K8Z A;  1QBZ A;  4E4E A;  2YXY A;  4UCR A;  2JGD A;  4PA9 A;  4FLY A;  3K59 A;  1YXB A;  3FYE B;  2HG5 C;  4BIU A;  2UXB O;  2VWK A;  4JGS A;  3G71 V;  3QNE A;  2D3O W;  1OCZ C;  4GX2 A;  2UXD B;  4JYA B;  1IBM B;  4JF3 A;  1FFX A;  1F4N A;  4NXM B;  5B1B B;  2L6L A;  3LUT B;  2Q9L A;  2A7W A;  4W4L A;  1XL6 A;  3F5T A;  1K92 A;  4J10 A;  1QLE B;  2QGN A;  2ZKO A;  3F5W C;  5IWA B;  4BW9 A;  1I0H A;  2QKC A;  3CRM A;  2GTS A;  1FXK C;  1L1F A;  1FYJ A;  4FM2 A;  1K4D C;  1ORQ C;  4DUY O;  1N32 B;  4ZKI A;  3AG1 C;  2Y0I A;  3G4S V;  1IBL B;  1H2L A;  2R9A A;  5EC2 C;  3FFQ A;  4DV0 B;  4HNA A;  3LSU A;  4RQF A;  3OEH G;  2OTJ V;  1PM9 A;  4JTA B;  2X7R B;  1AR5 A;  2QTS A;  2YIC A;  3M99 B;  4IHJ A;  1LUV A;  3K08 A;  4LFC O;  2IJJ A;  2Z0A A;  4QE7 A;  2ZNJ A;  1JVM A;  1EN4 A;  4FPP A;  5LMN O;  4TQD A;  1ZWI C;  4EB6 A;  1Y67 A;  1HNZ O;  2BE3 A;  4DXW A;  1K9M W;  2CH7 B;  2QM4 A;  4YJ3 B;  3SPJ A;  4DR4 O;  1S5J A;  2H94 A;  4MTO A;  1OCR C;  2A79 B;  2UU9 B;  1K5Q A;  5JJE B;  3ZHS A;  1Y6X A;  4NXN B;  3SDL A;  5IY5 B;  3TET A;  3NR7 A;  2GUZ A;  1VAR A;  1SC5 B;  4DV6 O;  1BMF G;  5H9C A;  3T4D A;  1HR0 B;  3GB7 C;  5KUK A;  3RYI B;  4W4K A;  1V55 C;  5GTH Z;  2JS5 A;  4PEL A;  3OTO O;  4I0X A;  4MVS A;  4B3S B;  3SYC A;  5EZY A;  3ZN0 A;  4X66 O;  4GZR B;  1I08 A;  3CS5 A;  2YXH A;  1SZT A;  1T5E A;  1ZUQ A;  2OTL V;  1XNQ O;  1EBO A;  2ZR3 A;  1GM9 A;  1WJZ A;  3X2Q C;  1Y74 A;  5HFL A;  4MVU A;  4B3M O;  1EN6 A;  3T1H B;  2VQE B;  4DR2 O;  1A32 A;  2XAQ A;  2A9H A;  3JAR B;  1X4T A;  4GKJ O;  3E22 B;  4EKW A;  2LGW A;  2B5U A;  2EIM C;  4I55 B;  3TGU H;  1M57 B;  4B3T B;  3FB8 C;  1Z5W A;  2DYR C;  1H2K A;  1SZX A;  3S3W A;  3AK3 A;  5LGN A;  1N36 O;  4X64 O;  2KG7 B;  2H3O A;  4HBN A;  2F4V O;  3ZMZ A;  2A3Q A;  1OCO B;  2D2C B;  1RM1 C;  4TUY B;  5KHI A;  1QVG U;  1VQ9 V;  1P84 F;  2CK3 G;  4WBN A;  3UCS C;  3D36 A;  2CGN A;  2XAF A;  5DM6 V;  3CRR A;  1VQ6 V;  4PA4 A;  4LNU A;  2KKW A;  2FTK A;  5C8Y A;  1EFR G;  3H1I H;  3STL C;  2EJ7 A;  2EIN B;  4MTX A;  4NTY A;  3WG7 C;  4CH6 A;  2Y69 B;  2UXD O;  4LCU C;  3WB0 A;  1R6K A;  3OR6 C;  2BCC H;  4GYC B;  2CAZ C;  5EIB C;  5KUM A;  5DED A;  5IJ0 B;  1VP7 A;  2RNB A;  1S76 D;  2IH3 C;  3LDD A;  2ZIM A;  3O9O A;  1MOF A;  2JK5 C;  5CA1 B;  2DQ0 A;  3ZRW A;  3PN1 A;  2P22 C;  4BR6 A;  2XAG A;  3JAK A;  2BTO A;  4FIP C;  3G80 A;  1FD9 A;  1GTO A;  3RYF A;  1Q6H A;  4WFH A;  4N23 A;  2GTA A;  4O4L A;  4LC1 A;  4Z1V A;  1RPO A;  1K4C C;  2WLL A;  1Q82 W;  2Q7E A;  2LW1 A;  1N0J A;  2Y4T A;  1NTM H;  1UPG A;  4UCS A;  1GN2 A;  2QEX V;  1K33 A;  4X9Q A;  1IBK B;  3ABM B;  2R70 A;  4CC5 A;  3AEI A;  3K0G A;  3JAL A;  1GN6 A;  4UVA A;  4B3R B;  5LOV B;  4R6Z A;  3BPZ A;  3LNN A;  1IDS A;  4TOI A;  2CTQ A;  3MAQ A;  4UB8 Z;  1VEW A;  1BT8 A;  2LJ2 A;  4MVZ A;  4Z1M G;  4K35 A;  2QR4 A;  2ZE7 A;  1B06 A;  4FLV A;  4QPK A;  2AGA A;  2R9R B;  4KL1 A;  2XT9 A;  3OW2 U;  4UV9 A;  4CS3 A;  2ZM6 B;  3DC6 A;  1XRE A;  3AG4 B;  1JQ0 A;  5FPR A;  3HKD A;  1YI2 V;  2HVJ C;  1VQ8 V;  1TVK A;  2AW9 A;  4UCO A;  3CB2 A;  5CA0 A;  1KP2 A;  4ZOL B;  1SRY A;  3APQ A;  1VQN V;  1D2D A;  4JTC B;  3D36 C;  1F4M A;  1MG1 A;  3RBZ A;  4DRX B;  2ITC C;  1HR0 O;  1JOY A;  4P9P A;  1KB9 F;  4YJ2 A;  3G6E V;  4JYC A;  3HKB B;  2DMX A;  3JAW B;  5JJJ B;  4X1Y A;  3U10 A;  1KMI Z;  2Z5U A;  3AG2 C;  2GDS A;  3TXQ A;  4PHZ A;  1DF5 A;  1AI4 A;  4LF9 O;  4D7T A;  1K7D A;  4IIJ B;  3E86 A;  3CCS V;  2YEV B;  5CN0 A;  3CSX A;  3DXR A;  3OMI B;  4DR5 B;  5AG2 A;  4MT8 A;  3K9S A;  1I5Y A;  4LF6 B;  5LMU O;  2GV9 A;  2KSD A;  3ZHT A;  2UXC O;  2IU3 A;  4N21 A;  3SJB C;  4DV7 B;  4P30 A;  1JFF A;  3JCU Z;  3A8T A;  1NVP B;  1F23 A;  2IH1 C;  4DR3 O;  1US6 A;  1VQL V;  3L9D A;  3JAT A;  4CBC A;  2YSU B;  4MVR A;  2DWE C;  1OCC C;  1FJG B;  2P4V A;  1ZX3 A;  3L70 H;  3E8F A;  4C7U A;  1NR7 A;  2QWQ B;  3OAA G;  3VQV A;  4O4I A;  2JRI A;  4JZ2 A;  2VWJ A;  3ZCC A;  3ZHV A;  1ZSP A;  1RPR A;  4JAU A;  4LF8 O;  4F4L A;  3BA9 A;  2HEP A;  2X0L A;  5KX5 B;  3L75 H;  2FKX A;  2NNU A;  1AI7 A;  1PL0 A;  3AG3 C;  3K04 A;  4R7C A;  2CTW A;  3E8H A;  1NH2 B;  1CP9 A;  2A0L A;  1H2G A;  4GX1 A;  3HR0 A;  4DUZ O;  2V1D A;  5LA6 A;  1YZB A;  4O2B B;  2ZXW B;  4UCT A;  4DR6 B;  1B04 A;  5BY1 A;  4EFB A;  4J42 A;  3E8B A;  3DTU B;  5JH7 A;  3L73 H;  5IJ9 B;  3OD4 A;  2E5L O;  5B1A B;  1YCI A;  1YVW A;  3HKC A;  3LNM B;  5EYP A;  1M56 B;  3Q4H B;  5JQG B;  2CTP A;  1ZAU A;  4BW5 A;  3FYI B;  3ZRV A;  4QGP A;  4DK0 A;  3ZMS A;  2G38 A;  2WLM A;  4B3R O;  2P5O A;  3JAS A;  3OT7 A;  2FML A;  4X65 B;  2V7Q G;  2WLH A;  4YHH B;  5LL6 Y;  3DGE A;  1TUB B;  4PV1 B;  2EIK B;  3L72 H;  4B7E A;  4MW8 A;  1FXH A;  1M4U A;  5LBQ A;  4DV3 O;  1XDC A;  2Z3Y A;  1Q8I A;  3ABT A;  1H2M A;  1JX9 A;  4JI6 B;  5KHG A;  3CJH B;  3R65 A;  5LHH A;  2PY5 A;  1KBH A;  1XHX A;  2ODM A;  4LFB B;  4FLZ A;  4LBE C;  4JV5 B;  4IGG A;  1K8A W;  3QO8 A;  1OJH A;  4O4H B;  4LFA O;  4JI7 B;  2Y4U A;  2L35 A;  1WLE A;  1TAE A;  3NXS A;  3JD3 A;  3G67 A;  3K5N A;  2PI4 A;  1J95 A;  1I7F A;  2Q5Z A;  4RAI A;  4RQE A;  4FMT A;  4UFZ A;  2CGO A;  1J5E B;  4DR5 O;  2QSA A;  2ETN A;  2E75 B;  5EIB D;  4LF6 O;  1GMG A;  5IYD O;  3OMN B;  2P6J A;  3C3S A;  4UV8 A;  5IDJ A;  1XI1 A;  2ZE5 A;  2IJI A;  5A2Q N;  3RN4 A;  1GKF A;  3J80 N;  1FFT B;  2WA4 A;  1HWY A;  3ZHU A;  4X1K B;  4JI8 B;  4LF7 O;  1FXK B;  3JYC A;  1G6U A;  1VQ5 V;  4O2A A;  3AG1 B;  3OUF A;  5LYJ B;  1G4Y B;  4TV9 A;  3OE7 G;  1WP7 A;  5CBG A;  2DE0 X;  1GM7 A;  4Q6G A;  4FM1 A;  2Q69 A;  4TQF A;  4KUM A;  1XMO O;  1SQP H;  4X1I B;  5K1X A;  3OFN G;  4JI1 B;  1COW G;  1Y66 A;  5KHH A;  4GLX A;  4JAS A;  4IT5 A;  1RSO B;  1AJN A;  4J7K A;  2CE4 A;  3P30 A;  1FXV A;  4MVO A;  1SA0 B;  1GM8 A;  2OCC C;  1VQK V;  2FB5 A;  5BR8 B;  2WLI A;  5JVD A;  4K0K B;  4FZ1 A;  4ZI7 A;  3RYC B;  2X6A A;  1OCR B;  2Q4P A;  4U3F H;  4DK1 A;  4DR7 B;  3K58 A;  5EBL C;  4U3J A;  4ASU G;  1YSC A;  5IT9 N;  5CMU A;  2LW7 A;  2AZ0 A;  4DW1 A;  2JGD B;  2DQ3 A;  1YIJ V;  1XMQ O;  2F23 A;  1NQT A;  2GHY A;  3W7S A;  2QWP B;  4OX9 B;  4QIW F;  2ZNI A;  1N34 B;  3N2K A;  4Q20 A;  3CCQ V;  1R3I C;  2YS8 A;  3F7V C;  3J7A U;  2RN9 A;  3L71 H;  4X65 O;  4E2L A;  1FFX B;  1WA8 A;  1S0V A;  3SJA C;  3ASO C;  4JYB A;  3X2Q B;  3RYH A;  1Q6I A;  3K3W A;  1K34 A;  1V9P A;  3B4S A;  5B1N A;  3ZMV A;  1KYO F;  1M5I A;  2XHB A;  1TUE B;  3CCJ V;  1S77 D;  3BRC A;  2WA3 A;  3CCE V;  4JI6 O;  2W6J G;  2JIZ G;  3JCZ A;  4FLT A;  1WPX A;  2EIM B;  3W7X A;  4X62 O;  2LO1 A;  2DYR B;  3OR7 C;  4JI4 O;  3A0B Z;  1P7G A;  1KEC A;  4HNA B;  4QJF B;  2Q68 A;  4P9O A;  2UUC O;  1GH6 A;  4IHJ B;  5JWP A;  3BAB A;  4I5S A;  2F1M A;  3CCU V;  1N8R W;  1RM1 B;  3RYI A;  2ZIO A;  2ZR2 A;  4EB6 B;  2N05 A;  5KLV H;  3SPG A;  4MVQ A;  3B8N A;  5J9P C;  1PNK A;  4PJ0 Z;  3WG7 B;  4X89 A;  1RP3 B;  4K3A A;  1Q43 A;  1N33 B;  4CH3 A;  2AHZ A;  4LWS A;  1LR1 A;  5FL7 G;  2B1I A;  1SQF A;  1YHQ V;  2QE7 G;  2QWO B;  2GUZ B;  5EBW C;  2DN9 A;  2PF4 E;  4TWK A;  5TIS Z;  5IYB O;  1H2N A;  1BQ0 A;  4L8J A;  4JI8 O;  3RGB A;  1E1Q G;  1Q6U A;  3CC2 V;  4I0X B;  3ABK B;  5L3B A;  2KG7 A;  5EZY B;  3RWR D;  4EFE A;  3C3T A;  3N2G A;  2OT5 A;  1MA1 A;  4UB6 Z;  1MZE A;  3ZBH A;  4G28 B;  2JVD A;  3RFR A;  1L8D A;  3AK1 A;  3T1C A;  3CME V;  2HJF C;  5H6R A;  4R8C A;  3UO2 A;  4B7K A;  3CCV V;  3T1Y O;  1EZJ A;  1NTK H;  1PL4 A;  2P06 A;  1AR1 B;  2CUG A;  2VQF B;  2ADQ B;  3LDE A;  1URF A;  3H01 A;  4DV4 B;  2PYL A;  2EX3 A;  3P3P A;  1SKV A;  3OGI B;  1SS3 A;  4HZ3 A;  2RDC A;  1VF5 B;  4PI0 A;  1XHZ A;  4ZHQ A;  3K03 A;  3CC7 V;  2BTQ A;  3CYO A;  4JYA O;  1IBM O;  4DR7 O;  2QM8 A;  4NXM O;  1AJQ A;  1K73 W;  5CA1 A;  3BEH A;  1Q81 W;  1SQG A;  3CHX A;  3N27 A;  5J2U A;  4WBN B;  3A2F A;  5IWA O;  2DYS C;  1NS1 A;  5L3E A;  1N34 O;  3SYO A;  2EBO A;  3CX5 F;  4LNU B;  1SQQ H;  2FYU H;  5LXT A;  1N32 O;  5C8Y B;  1GK9 A;  1S5L Z;  1IBL O;  1AP5 A;  4JAA A;  2K1E A;  3HKE A;  4D6T H;  2K9P A;  3I56 V;  5KMG A;  3AG2 B;  3U11 A;  4DV0 O;  3OUS A;  1KKC A;  2C2A A;  4WF9 V;  2QJ1 A;  2QKS A;  3FX7 A;  1BHA A;  1GN3 A;  3K79 A;  1QQC A;  5FNV A;  2ILM A;  4B08 A;  3ICX A;  5JCO A;  3CC4 V;  3OTF A;  1EZV H;  1SER A;  2VS0 A;  4UCV A;  3JAK B;  2UUA B;  1D5A A;  3RYF B;  1QR9 A;  2ATK C;  4PDV A;  3E35 A;  2E74 B;  3B09 A;  3MHH C;  4O4L B;  3CEI A;  1VQ4 V;  2HR3 A;  2WLL B;  1GAX A;  2UU9 O;  1YIT V;  1YTF D;  4ZOL A;  3ZED A;  4NXN O;  1IZ3 A;  1OCC B;  1VF6 A;  4IYH A;  1NJI W;  4LP8 A;  3JAL B;  5BMV A;  1S5H C;  4LR3 A;  3E83 A;  2BSK A;  3A0R A;  3K06 A;  1XNR B;  2YIB D;  1X59 A;  2RMK B;  2Y69 C;  3EFF K;  3FB7 C;  4TV8 A;  1SQV H;  3L74 H;  5B5E Z;  3BVO A;  3K57 A;  3SGI A;  3ZHQ A;  4X20 A;  4B3S O;  3M8A A;  1B6Q A;  4NB5 A;  4GCZ A;  4IIJ A;  2ZT9 B;  3K5L A;  3WB1 A;  1LUW A;  2BOC C;  2Q7H A;  3HKD B;  1W0K G;  2WAM A;  3CWB H;  3SYP A;  1CXZ B;  3AG3 B;  1TVK B;  5CA0 B;  3T1H O;  5E79 Z;  5IYZ A;  2VQE O;  1KUQ A;  1SES A;  1M1K W;  5LP6 A;  2QTO A;  4I4T A;  3UT5 A;  1Q7Y W;  1ARO P;  4YJ2 B;  3VOU A;  4I7Z B;  2LGQ A;  3CP1 A;  1I94 B;  1K5S A;  4B3T O;  2ARH A;  4X1Y B;  2YID A;  2ZCE A;  4CC6 A;  3BAA A;  4MTG A;  3O65 A;  5FPO A;  4DR1 B;  1BZK A;  2W6I G;  3W7W A;  2WLN A;  2PYJ A;  1ZL8 A;  4LF4 B;  1BHB A;  3DXR B;  2HHH B;  3OEE G;  4NKG B;  1Q86 W;  5LHI A;  4J7J A;  2JJ2 G;  5JCO C;  3SJC C;  4XDL A;  1UJW B;  5J2T A;  1Y76 A;  2UUB B;  5L3D A;  1AI5 A;  1JFF B;  4GX0 A;  3ETE A;  3LDC A;  3JAT B;  1MMM A;  2EJR A;  3RT3 C;  1DGS A;  1E79 G;  1HW7 A;  1VF6 C;  4MTF A;  4PI2 A;  2JJ1 G;  3LSQ A;  3ZHR A;  5IYC O;  4F6R A;  1PV0 A;  1SQB H;  1ZLZ A;  4O4I B;  2DOS A;  4RUF A;  2AZ2 A;  2HKO A;  4XBF A;  3B77 A;  2QWN B;  3QO5 A;  5KHK A;  3FB6 C;  4DV2 B;  1R3J C;  2UXB B;  4NR1 A;  4WFF A;  4LF5 B;  3GWK C;  1IBK O;  3CCR V;  1H2S B;  4PDM A;  1H8E G;  3P3N A;  5LP6 C;  1THZ A;  3UM7 A;  4FLW A;  5LA6 B;  3ZIA G;  1TUB A;  4YY3 B;  5ITZ A;  3TXS A;  1M9N A;  2EIL C;  2O57 A;  4O4J B;  5GW7 A; 
#chains in the Genus database with same CATH homology
 2GTA A;  1YVW A;  2YXH A;  2Q4P A;  2P06 A;  5IE9 A;  3CRC A;  2OIE A;  2Q9L A;  1VMG A;  2A7W A;  4QGP A;  3C90 A;  1YXB A;  2A3Q A;  2Q73 A;  2OIG A;  3CRA A;  2Q5Z A;  1Y6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...