2A7WA

Crystal structure of phosphoribosyl-atp pyrophosphatase from chromobacterium violaceum (atcc 12472). nesg target cvr7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
91
structure length
91
Chain Sequence
DVLKNIADTLEARREAAPQSSYVASLFHKGEDAILKKVAEEAAETLMASKDKDKLHLVREVADLWFHTMVLLTYHGLRPEDVVMELHRREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphoribosyl-ATP pyrophosphatase
publication title Crystal Structure of Phosphoribosyl-ATP Pyrophosphatase from Chromobacterium violaceum. NESG Target CVR7.
rcsb
source organism Chromobacterium violaceum
total genus 29
structure length 91
sequence length 91
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.6.1.31: Phosphoribosyl-ATP diphosphatase.
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2a7wA00
1Y6XA 2YXHA 5IE9A 1VMGA 2P06A 2OIGA 2A7WA 3CRCA 2A3QA 2Q73A 2GTAA 1YXBA 2Q5ZA 2Q9LA 3C90A 2Q4PA 2OIEA 3CRAA 4QGPA 1YVWA
chains in the Genus database with same CATH superfamily
3FB7C 3ZMUA 1WN7A 1SC5B 4U7NA 2DYSC 1AI4A 4GX0A 4N23A 3W7XA 1QLNA 1PM9A 3L73H 3ZIAG 4JV5B 2HFEC 4O2BB 1NKDA 3WG7C 1MSDA 4QE9A 1FKAO 1M4UA 2YI9A 1Y66A 4MVMA 3D36A 4HZ3A 1I94O 5A2QN 1Q90D 4PHZA 5J9PC 1Q7YW 4GYCB 1VQ9V 1ZL8B 1YHQV 1CXZB 5LXTB 2FL4A 1WA8B 3BA8A 1AJNA 4Q6GA 3SYCA 1XNQB 2A79B 2X6CA 1PL0A 1Y74B 3VQYA 1I7FA 3VBBA 5B3SC 2QA4V 3CCUV 1GM7A 4LFCB 1MG1A 1SQPH 1WP8A 4ZHQA 1N8RW 2VS0A 4E2LA 1THZA 4G28B 4OPHA 3ASNB 1IXBA 2Y4TA 4G27B 3JATB 4B3MO 3CEIA 3J81N 2EIKC 2WLNA 4KXRA 4XDJA 4X1KB 5F2VO 4H0LB 2QKAA 1YJNV 2EJ7A 3K5MA 1FXKB 3FAVA 4I5SA 2ILMA 3B2EE 2LP7A 1J95A 2F4VO 4DR4B 4LF4O 3F5WC 2JS3A 2P6JA 1ZUQA 4LP8A 5B1OA 4TV9A 3H1LH 3HKEA 4UCVA 3LNNA 2KQXA 3ABKC 4JAUA 5GONA 2IJJA 4Z2WA 1DTOA 5LA6B 3ZMTA 1GRJA 4UVBA 3K06A 2ZXWC 3HKCB 2DQ0A 1B3QA 3C90A 1M9NA 1FXVA 3J80N 1MMMA 1AILA 4DV5B 4X88A 4NTYA 4MTFA 4MVSA 3QF7A 5LYJA 1EN4A 5JH7A 2EULA 1HWYA 4TSFG 2Y69C 3E8FA 2ARHA 3JD4A 4MVUA 2P4KA 3AG1C 3SR2C 5IJ0A 3H1IH 2IU3A 4FM0A 1IBKO 2EIMC 3ETEA 1ORQC 5D5PA 1V54C 4EB6B 2Y69B 3K59A 1AP5A 1GH6A 3I55V 2YXHA 4UB8Z 1YCIA 5IE9A 2A06H 1H2MA 2JK5C 2WA4A 3E35A 3OMIB 2CGNA 1AJQA 2AGAA 3SYAA 3JD2A 4JI7B 1V54B 1SQFA 5L3CA 5EC1C 3E22A 4NXMB 2QM8A 4O4LB 1YJWV 3UT5A 1FFXA 1O9HA 1IZ3A 3U10A 3OUSA 5J2UA 3ZMZA 3KZIZ 2CUGA 2QKCA 2JDIG 3EHBB 3WU2Z 2P90A 1JJ2U 5K1PA 1BZKA 2RJZA 1R6KA 3RN4A 3CPWU 1Y67A 3CJHB 3SDLA 4ZOLA 2Q7GA 3ZS8C 5KAIZ 3MD0A 2NR5A 5LHHA 3LSSA 3A2FA 3T4ZA 4LWSB 3FYEB 3BCCH 1H8EG 3E86A 3IGAC 4J7JA 1KECA 4UUJC 4FZ1A 4X1YA 1DF5A 4ZIBA 3AG2C 1W2BU 1XREA 5B1AB 1XOUA 4NYKA 1R6TA 5BMVA 2OWOA 4AHCA 5KAFZ 1NJIW 1QBZA 1GK9A 4HBNA 1VQ8V 1SQGA 3E8GA 1N0NA 3L75H 4W4KA 1HNWO 1L8DA 4I4TA 4TUYA 4YY3B 3P3NA 4DYLA 2Y0IA 4DV5O 3H1KH 2Q4PA 2XNDG 1QR9A 2QGNA 3CC2V 3SPGA 5GW7A 3BEHA 1IVSA 1DLBA 1VF5B 3H01A 4FLUA 3SJAC 5JJEB 2DOSA 4ZI7B 2D3OW 1IURA 2AZ2A 2VRZA 2UXCO 3THOA 4MTOA 1PL4A 5LMUB 4MVOA 1NH2D 5CBFA 3P30A 3ZN1A 3ZEDA 3PN1A 2CK3G 4JI1B 3OE7G 4RO2A 1E79G 4DR2B 4KL1A 1HW7A 1KC8W 2RDCA 1V55B 1P49A 1XMQO 2E5LB 1YITV 2EILB 3CCSV 4JAVA 2H3OA 4PD4F 4H33A 4P9OA 3B77A 3DXRB 3BHPA 1AI5A 2YEVB 2RMKB 4TOIA 1H2NA 2OCCB 4CZZA 1VEWA 1GM9A 5L3BA 1JJOA 2NN4A 2RNBA 5A9GA 5CA3A 4DV4B 4IYHA 4DV2B 2A3QA 4RUFA 2ATKC 1SESA 2XAGA 3DTUB 3JD1A 4O4HA 4X65O 5L3DA 1OCZC 2F95B 3J7AU 3OEHG 3ZRXA 2P5OA 4PA7A 2IH1C 5FNVB 5IT9N 1TGOA 3R65A 1JFFB 1GO3F 4QNHB 1NR1A 2W6IG 3M8AA 2YIBA 2ADPA 2B1GA 3Q4HB 4IL6Z 3E2EA 3ZRWB 5CB4B 2F23A 2CGOA 4O4IA 1BT8A 5J2TB 2OYQA 2AHYA 2KG7A 4UV9A 2M7WA 3B8NA 5LP6A 4WFHA 2YC0A 1Y4MA 4Q20A 4WFBV 2FTKA 4YY3O 1XL6A 2XAFA 5IY5C 2ZE8A 3CMEV 1SA0A 2PUSA 5LP6C 2CH7B 5GTIZ 4DV6B 4LF9B 2P7TC 3KG2A 3UO2A 1VQOV 3JALA 5CN0A 3N27A 4MSWC 4GT1A 5IY5B 3AG7A 1J5EB 2Q7EA 4PJ0Z 4YJ2B 1W0KG 4QJFB 3CP1A 1S72V 4R50A 3PJSK 3KCXA 4CBCA 3R66A 2V7QG 3B40A 2V4DA 4DR2O 1FFTB 3W7WA 1KU9A 1ROPA 1VP7A 5JJNB 3CXHF 2E5LO 1XHXA 4DV0B 3RYCB 1SS3A 1N32B 4O2AA 1TVKA 1IDSA 2F66C 2N74A 4GX1A 3JD3A 3MAQA 2WPDG 2DW4A 4RUEA 4X20A 5KUMA 3G80A 2CE4A 3ZCCA 2NLJC 4DV2O 1AP6A 3I56V 2QWRB 4O4JA 3DSQA 1VQ6V 1B06A 2QE7G 3K5LA 2YIDA 2DMXA 1BL8A 3JAWA 1AI6A 2WLHA 2OIEA 3CRMA 4NXNB 3F7YC 2HHHB 4ABMA 2UXDB 4MTGA 3OR6C 2IJKA 4YXWG 2P22C 5IYZA 2XAQA 2P4VA 4QPKA 1K92A 2BTQA 5KUKA 1OHHG 2A0LA 5KA6A 3T1HB 3JAKA 1LUVA 5KX5A 4YIOA 5CA0A 4U7OA 5B1BB 1F4NA 4UCUA 3ZX6A 1VQKV 1N36B 1RFYA 2CDYA 3ABUA 3E83A 3ABMB 1VQ5V 5LL6Y 5C8YA 1K97A 4K0KO 4TV8B 3QTCA 1J5EO 3K79A 1Q8IA 1FPOA 4AI8A 2W0FC 1U97A 2F43G 4LF5O 2KSDA 4I50B 2RN9A 3OMAB 4F6RB 2OTLV 4JI8B 3OUFA 4XDLA 1S0VA 1NH2B 4JI3O 5ITZB 1WPXA 5BR8B 4LBEC 4WBNB 1XEQA 5IWAO 5LBQA 1EZJA 2LGQA 2PTMA 1XBLA 2Y0PA 2Q8VA 4JPRA 3OGIB 2QKSA 4JYAB 3HKDB 5KHGA 1NI8A 2Y48A 3JCUZ 4J9ZB 5EBLC 4JTCB 5IYCO 5L3GA 3FX7A 1ZL8A 1K9MW 1OCRB 4J9YB 5LXTA 1WA8A 3WB1A 4GX5A 3OTOO 3QG5A 2P67A 2ZNJA 2UU9B 1M57C 2VQEB 1Y74A 4BR6A 2A9HA 3FB6C 1AROP 3ZMVA 4LF8B 3ZHUA 3HKBA 3ETDA 1SETA 4GKKO 1E1QG 1M57B 2YI8A 1XDCA 2VWJA 3CRQA 1SQBH 2DWEC 2EX3A 3JATA 4NXNO 3RYIB 3IJ4A 3NXSA 2HHHO 3HPLC 4JASA 1ZWIC 2X6AA 1X59A 3ASNC 5EYPA 2YUAA 3ZHSA 2MW2B 3CC4V 4PI2A 4X1KA 2GUZA 2YDEA 3CCMV 1FXHA 3RYHB 1VMGA 1FXKA 2LJ2A 1R3JC 4LFAB 4J42A 1VQLV 3AEIA 1F23A 4B3SO 1FXKC 3ABLC 5LGTA 1Z2GA 2PYLA 1F7YA 2GHYA 1VQMV 1S5HC 3QO7A 4YIPA 2HVJC 1FAFA 3T1YO 2GTSA 3ABLB 1RSOB 2ZM6B 2ZE7A 4GCZA 1AVMA 4DUZO 4UXNA 1H2KA 3HKCA 4Z1VA 3TCUA 3K58A 1X4TA 4DR7B 4FM1A 4YJ3B 2X0LA 3C3SA 3HR0A 1PKXA 2DN9A 1BHAA 3M99B 4JZ2A 4OX9O 3N2GB 1P7BA 4JI5B 4MVZA 3JSLA 3TETA 3RVZA 1SQXH 1JA8A 2EBOA 1FD9A 4EB6A 2YS8A 3N2KB 3U11A 5B1NA 3A0HZ 1MSWD 5CMUA 4JV5O 3CXCU 2Q0AA 4TWKA 3D3IA 3AG3B 3CRCA 4LNUA 4X64B 2GDSA 4UCRA 4LF6B 3RT3C 1OJHA 2JS5A 2M6YA 1RPOA 1AJPA 5BXZA 1BSMA 3LDCA 4E4EA 3UKMA 3CRAA 1WB7A 1ZTEA 1D5NA 3CCQV 4H13B 3AK2A 4IYIA 1XNQO 4BIZA 1HNXB 4LF7B 4B3RB 3SPIA 4PDMA 4CH3A 4C7UA 1OZ0A 4DV7B 3W7UA 3CJHA 4LFCO 1HDJA 2ADQB 5HFMA 5D5QA 2L35A 5EZYB 4HNAB 2H8PC 2AXTZ 4PA9A 1T5EA 4BAYA 5JWPA 2BOBC 1GN2A 1RP3B 3BA9A 3ZJZA 5LHGA 2XT9A 3ETQA 2Y4UA 1EM1A 5IJ0B 4EKWA 3JASB 3TXQA 4FFBB 2HR3A 4DUYB 3IAYA 5FPOA 4IHJB 4DR3B 4FLXA 2BOCC 4GX2A 5TISZ 5IYDO 4JI2B 1MOFA 1NU1H 5KHKA 1XQ8A 5KHIA 5KMGB 4FVMA 1DF4A 3CYOA 5B1AC 1EN5A 4DR4O 1YTFD 1YEWA 3E89A 2LO1A 5H5NA 2BCCH 2IJIA 4DR7O 1R1BA 1CPYA 4XBFA 5B5EZ 2EZOA 3H1HH 3APQA 2Q6AA 2WLKA 2HVKC 1YIJV 3G67A 5JJJB 4DR1B 2QEXV 4ZI7A 1GTOA 4EEQA 1ZLZA 1Y76B 1EZVH 2PF4E 4TQFA 1AR4A 2AW9A 2WLLB 4MS2A 1CEZA 4OGQB 1H2SB 1H2LA 4ICGA 4PV1B 1P4RA 4X64O 5H6QA 2NNUA 4LF6O 1QLEB 5EIBD 1YF2A 3SPCA 4X62B 4KHPB 1XMOB 3FD9A 1V55C 2EJRA 3OGCC 2R70A 1WB8A 4MVRA 1R3KC 3TGUH 2EILC 1PNLA 4N21A 1JMKC 2XAJA 1W59A 1I08A 1SZTA 2YEVA 1ZSPA 3CB2A 1L1FA 3E8BA 1HNXO 2IH3C 3K03A 4JI7O 2PY5A 3DC5A 4DV7O 1JCHA 1PNMA 2A7WA 2IW5A 4NXMO 3LDDA 2HJDA 4H37A 5JCOC 1Z5VA 5DN6G 4TUYB 1M56B 1UFIA 2OCCC 2YICA 2ODMA 1AR1B 1XI1A 5C93A 5IJ9B 1TUBB 3G6EV 3FB8C 4GLXA 2HJFC 1AI7A 5LMNB 5HFLA 3SYPA 5L3EA 4RQFA 5FNVA 1JFFA 1N33B 1MA1A 4DUYO 4DR3O 1K5SA 3Q4HA 4K35A 1IBLB 2Q0OC 2WAMA 4JI2O 1GN6A 3GB7C 2QWQB 3IC9A 3ZRWA 5CB4A 5JQGB 4B3TB 3CCJV 2XTAA 2OT5A 4UB6Z 1F51A 4QE7A 1EBOA 1N34B 1BGYH 2FB5A 3VQWA 2KKWA 1VQ4V 1YSCA 1BHBA 1G4YB 3CCLV 2CH7A 1S76D 4BW5A 3DC6A 2GSMB 4DR1O 4D7SA 3EFFK 2UXNA 1NVPD 2Q67A 1Q43A 1IX9A 4P30A 3WFVA 5EBWC 3EVKA 2WLJA 4BW9A 4YJ2A 3RGBA 1DK1A 1M90W 2UUCB 1SKVA 1KYOF 3CE2A 4NVPA 2JEXA 2W0XA 3TXSA 4I9QA 3CSXA 1P84F 1IBMB 4FJCC 1PD3A 3WB0A 1Q6IA 4JF3A 1N4CA 4LFBB 3RYCA 3AG4B 1NTKH 3GVMA 1WP7A 4KHPO 3EXAA 5GTHZ 5LMUO 1QCEA 3K5OA 2PI5A 4KFMA 1M1KW 1HP8A 1SERA 4JI1O 2UXXA 3VQVA 2XASA 2Q73A 1KB9F 2VQFB 2CAZC 2R9AA 2ZNIA 3FB5C 2BSKB 1Q3EA 3ZHQA 1S5LZ 1S3JA 2O57A 4QIWF 3L74H 1I0HA 3B8MA 2ZIMA 3JARB 2JGDA 4GZRB 3K5NA 4YHHB 2Q69A 4FLYA 1YI2V 4DV1B 1K34A 3BAAA 4NR1A 2W6JG 2UUBB 4DRXB 3CC7V 4BIOA 3KKYA 1Z5WA 3AK1A 4DV4O 3K57A 2DWDC 2F93B 4AQYB 2UXBB 3O9OA 1IBLO 1HR0B 5DEDA 4B3TO 1BE3H 2Z3YA 1SZXA 3S3WA 4JTDB 1MABG 1SQQH 1PV0A 4X8AA 2CTPA 2GBOA 2E75B 1XILA 4FLZA 3MHHC 1F4MA 1LUWA 4JI0B 2ZINA 1PP9H 4LH7A 3BY6A 2DJVA 2EINC 5CBHA 5JVDA 1Q81W 1YTFB 3ZRVA 3D8CA 4DW1A 4X9QA 2XUMA 3CWBH 2X6BA 3SPHA 1WJZA 5B1BC 1Q82W 3OMNB 3TK1A 4TV8A 1GN4A 2EINB 3ABMC 1NS1A 4UV8A 2UUCO 4J7KA 4F6RA 2KB1A 3L70H 4WF9V 1L0NH 5FLXN 4DV6O 4UVCA 4JI4B 4LF9O 4B7EA 4JYYA 5LOVB 2WWWA 2Q7HA 3A0BZ 4U3JB 5EIBC 2HEPA 4WBNA 1U96A 3ML0A 4LFBO 4X1IB 4JYCA 4DR6B 2QM7A 3CCEV 1OCCB 2ETNA 3JAMN 3HKDA 4JI6B 3ZBHA 1K4DC 1HNZB 1YDXA 3F7VC 4OXSA 4CC6A 1RM1C 1TA8A 3QVNA 1WLEA 4PA4A 5AG2A 1KKCA 4MVQA 3X2QB 4PDVA 2EZPA 1QVGU 1DGSA 4O2BA 2Q5ZA 4DV0O 4I0XB 3ZHVA 1GMGA 1AR5A 1RM1B 4UCSA 4RAIA 1OCRC 4LF4B 1N32O 5CA1B 2QSAA 2DYRC 1Q5OA 3AK3A 1R3LC 2D2CB 5H9CA 1KKDA 4IIJB 1S5JA 1NTZH 2V1DA 3H9VA 4I7ZB 2DYRB 2YXYA 2Q9LA 1JR9A 3CS5A 3CCRV 2ZR2A 2UUAB 2IM9A 4OPAA 3U0ZA 5DM6V 4PI0A 2MK3A 1HR0O 4FLWA 2WLIB 3RYHA 2HKOA 1WAZA 4I55B 2Z5UA 3T2MA 3RYFB 4ZKIA 1CP9A 4JI0O 2CTWA 3W7TA 2WLMA 4A5UB 2QR4A 4X89A 5H2FZ 2DYSB 2UXDO 1AB3A 3OR7C 4CS4A 1IBKB 3LSUA 4CS3A 3WG7B 4CS2A 2L6LA 2ZIOA 2AHZA 1KQSU 2WSSG 5L3FA 3F5TA 1RSOA 1ZX3A 4PDLA 4RWUA 4FLVA 4W4LA 3D36C 3T1HO 4J7ZA 2QWPB 4PDRA 5DECA 1NVPB 4UCTA 4J80A 1N36O 2QTOA 1R6NA 4JI4O 4X66B 4YJ3A 3B4SA 4LCUC 3HKBB 3BPZA 2DQ3A 5B3SB 4PA6A 4DR6O 3ZMSA 1BQZA 4L87A 3N2GA 5LA6A 2GTAA 4JI6O 2HG5C 1HNZO 3BRCA 4JI8O 5EYPB 4NTXA 3K0GA 2ZT9B 2GUZB 4ZHQB 3N2KA 4IT5A 1YJ9V 1H38A 3SJBC 2LFSA 2R9IA 5EBMC 5BR8O 3QO5A 1TUEB 2EIKB 1NZ6A 4GKJB 4JYAO 4DW0A 2F1MA 4NTWA 3AG3C 3BVOA 2PI4A 2C2AA 3JYCA 2OCHA 2ZDIA 2YIAA 4RQEA 1SF9A 1UPGA 3WB2A 3FAVB 3IFXA 2UUAO 2UU9O 4DK0A 2VQEO 2ZDIC 4F6EA 2YIBD 4TQDA 3T4DA 1BQ0A 4O4LA 1VQPV 3ABKB 4LF8O 5EZYA 1K3EA 4D7TA 1HNWB 4HNAA 3SGIA 3H1JH 2LW7A 4TV9B 1GM8A 3HKEB 1VARA 2ZXWB 2ZCEA 4LR3A 1BS3A 4MT8A 4UCOA 4P2ZA 3HB3B 2XAHA 4DR5B 4B7KA 5GONB 3ZHRA 1QNMA 3STLC 4GUNA 3JASA 2UXCB 1WPBA 4FFBA 3QO8A 4IHJA 3B09A 4LH6A 4TT3G 1KP2A 4EFBA 4HYOA 4NKGB 4DK1A 2ZE6A 4HAMA 2HLDG 1QVFU 3NR7A 3K9SA 3AG1B 1US6A 3M7MX 5LYJB 3A8TA 5KMGA 2ZD9A 5JH7B 4LFAO 4JTAB 4LWSA 2EIJC 4WFEA 1YZBA 2EIMB 4LNUB 1XMQB 4J11A 3OD4A 4FLTA 2IJHA 1QQCA 4X66O 4JZGA 3ASOC 2EIJB 3K04A 3FKSG 2Q68A 2ZR3A 3MDSA 4JYBA 2ZM6O 1M93A 5LGUA 5IYBO 1NTMH 1Y76A 2JGUA 3STZC 3ASOB 1NBMG 3E22B 1JOYA 2BE3A 3UT5B 2GV9A 1FFXB 1QU7A 2WLLA 3JD0A 3CRRA 4FMTA 3G6BA 1FJGB 5J2UB 5EC2C 1BCCH 4BIUA 1Y6XA 5E79Z 4X65B 3A0RA 3LSQA 4GKJO 3UM7A 1XL4A 3G71V 4JI5O 2OIGA 3K3WA 3VOUA 2E74B 4CC5A 1Q6HA 2ITDC 2LGWA 2R9RB 1XNRB 3FYIB 4ZOLB 1QLEC 1K8AW 2QWOB 1BMFG 1WNSA 3ABTA 3TJTA 3UQ8A 2RQ6A 1ENVA 5E1AC 3K08A 3LNMB 4JGSA 3QNEA 3SYQA 2CTRA 3LUTB 4DV3B 2PGGA 4ASUG 3SPJA 3AG2B 3L72H 4QPJA 5BY1A 4UVAA 4PA3A 4WFGA 2JJ2G 5KLVH 3RVYA 1G8MA 3SJCC 4X1YB 2N04A 5IJ9A 5KHJA 1TUBA 4U3FH 3DXRA 3GWKC 5BMVB 1TAEA 4DR5O 1KD1W 1M56C 5JCOA 3SJQC 4LF7O 4JAAA 4B3RO 2ZKOA 1LNQA 5B66Z 5LGNA 2RCVA 4FK5C 3P3PA 2JEUA 4I4TB 1KP3A 5JQGA 3ICXA 2YXLA 2H94A 3ZHTA 3L71H 4FPPA 4QGPA 1OV9A 1OCOC 1MZFA 3CMAV 5CBGA 4J10A 4D6TH 2LQTA 1R73A 3T1CA 3KCYA 2FMLA 1MNGA 4IGGA 1OCOB 2QTSA 4WFFA 3BABA 2R72A 5J2TA 2LW1A 5KA5A 1NQTA 1EFRG 1K7DA 1A32A 2PYJA 1UJWB 2IU0A 1NT2B 2E76B 4B08A 3GWOA 3OFNG 3OEEG 5FL7G 3I5DA 1FJGO 1G1XB 1W0JG 1KUQA 1I5XA 3SYOA 4LC1A 2Z0AA 1K73W 1M5IA 2YSUB 2LFRA 3CX5F 1GKFA 1KBHA 2E3CA 2IBZH 3S3XA 4CH5A 1XNRO 1GAXA 1K5QA 4R8CA 1OCZB 1PPJH 1N0JA 3AG4C 2JRIA 1JX9A 4FFKA 4UFZA 4O4HB 2CTQA 4DV3O 1E1RG 1QR8A 3RFRA 2BSKA 4CH6A 4X62O 1XMOO 1K33A 3JARA 2JIZG 2JVDA 2B5UA 1FS0G 1SQVH 5IDJA 2QWNB 1YXBA 4CH4A 4DRXA 4O4IB 2X7RB 2KG7B 4H44B 4K0KB 5LP6B 4WFAV 2FKXA 3C3TA 4LF5B 2B9ZA 3FFQA 1I5YA 2XOKG 3APOA 1R3IC 1COWG 3VQXA 3UO3A 1SA0B 5KHHA 4AILC 3RWRD 1NR7A 4BWAA 1JQ0A 4JI3B 4MW3A 3JALB 3OAAG 1H8HG 5LMNO 2BTOA 3OM3B 5IWAB 4FM2A 3RBZA 2XHBA 1N33O 5FPRA 1GN3A 2P06A 1URFA 3W7SA 2K1EA 1Q6UA 4NB5A 4KP4A 2WA3A 3OTOB 1VF7A 3MHSC 4Z1MG 4DXWA 1N34O 3IC7A 1P7GA 2QDOA 1JVMA 1PNKA 2JGDB 2HP8A 2N05A 2ITCC 5BZBA 4O2AB 1FYJA 1H2GA 1TVKB 3L9DA 2ZQMA 1B6QA 1I94B 1LR1A 1VQ7V 5LOVA 4G2KA 4MW8A 4U3JA 3CD6V 4GKKB 1L0LH 4F4LA 1D5AA 1VIBA 1ZAUA 1D2DA 4X20B 4X1IA 5H6RA 3P32A 3CCVV 3JSNA 3E8HA 3G4SV 1KMIZ 4I50A 5LHIA 2FYUH 4R7CA 2QJ1A 3DGEA 1SRYA 1OCCC 4O4JB 1IBMO 5ITZA 4ZBMA 1IXMA 1EN6A 4I0XA 4K3AA 4I9WA 3JAWB 1VF6A 3CHXA 3LDEA 3X2QC 5CA1A 4B3SB 1RPRA 1YVWA 4B3MB 1QHTA 5EK0A 1G6UA 4PELA 2ZE5A 5JVDB 1VF6C 3D3QA 4IIJA 3OTFA 2VQFO 1V9PA 3OT7A 1K4CC 2DE0X 5IYZB 4R6ZA 2G38A 2B1IA 3JCZA 1Q86W 3T1YB 2VWKA 4J41A 1VQNV 2BTQB 4DUZB 4FZ0A 3JAKB 5KX5B 4XDKA 3UCSC 3ZRSA 2F4VB 2QM4A 2JJ1G 3K9AA 5CA0B 4YHHO 1MZEA 1O9GA 1S77D 2WLIA 4WCEV 4DV1O 2K9PA 3BFRA 1XUQA 4L8JA 3RW0A 5K1XA 2OTJV 4FIPC 4P9PA 3ETGA 4I55A 3OW2U 4MTXA 4DO2A 3ZN0A 4K8XA 3RYFA 2UUBO 1XHZA 3K0DA 4EFEA 4KUMA 2AZ0A 5C8YB 3RYIA 4OX9B 2PZSA 4K8ZA 3O65A 1B04A 4AQYO 1JPXA 2UXBO
chains in the Genus database with same CATH topology
1Y6XA 2YXHA 5IE9A 1VMGA 2P06A 2OIGA 2A7WA 3CRCA 2A3QA 2Q73A 2GTAA 1YXBA 2Q5ZA 2Q9LA 3C90A 2Q4PA 2OIEA 3CRAA 4QGPA 1YVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y6X A;  2YXH A;  5IE9 A;  1VMG A;  2P06 A;  2OIG A;  2A7W A;  3CRC A;  2A3Q A;  2Q73 A;  2GTA A;  1YXB A;  2Q5Z A;  2Q9L A;  3C90 A;  2Q4P A;  2OIE A;  3CRA A;  4QGP A;  1YVW A; 
#chains in the Genus database with same CATH topology
 3FB7 C;  3ZMU A;  1WN7 A;  1SC5 B;  4U7N A;  2DYS C;  1AI4 A;  4GX0 A;  4N23 A;  3W7X A;  1QLN A;  1PM9 A;  3L73 H;  3ZIA G;  4JV5 B;  2HFE C;  4O2B B;  1NKD A;  3WG7 C;  1MSD A;  4QE9 A;  1FKA O;  1M4U A;  2YI9 A;  1Y66 A;  4MVM A;  3D36 A;  4HZ3 A;  1I94 O;  5A2Q N;  1Q90 D;  4PHZ A;  5J9P C;  1Q7Y W;  4GYC B;  1VQ9 V;  1ZL8 B;  1YHQ V;  1CXZ B;  5LXT B;  2FL4 A;  1WA8 B;  3BA8 A;  1AJN A;  4Q6G A;  3SYC A;  1XNQ B;  2A79 B;  2X6C A;  1PL0 A;  1Y74 B;  3VQY A;  1I7F A;  3VBB A;  5B3S C;  2QA4 V;  3CCU V;  1GM7 A;  4LFC B;  1MG1 A;  1SQP H;  1WP8 A;  4ZHQ A;  1N8R W;  2VS0 A;  4E2L A;  1THZ A;  4G28 B;  4OPH A;  3ASN B;  1IXB A;  2Y4T A;  4G27 B;  3JAT B;  4B3M O;  3CEI A;  3J81 N;  2EIK C;  2WLN A;  4KXR A;  4XDJ A;  4X1K B;  5F2V O;  4H0L B;  2QKA A;  1YJN V;  2EJ7 A;  3K5M A;  1FXK B;  3FAV A;  4I5S A;  2ILM A;  3B2E E;  2LP7 A;  1J95 A;  2F4V O;  4DR4 B;  4LF4 O;  3F5W C;  2JS3 A;  2P6J A;  1ZUQ A;  4LP8 A;  5B1O A;  4TV9 A;  3H1L H;  3HKE A;  4UCV A;  3LNN A;  2KQX A;  3ABK C;  4JAU A;  5GON A;  2IJJ A;  4Z2W A;  1DTO A;  5LA6 B;  3ZMT A;  1GRJ A;  4UVB A;  3K06 A;  2ZXW C;  3HKC B;  2DQ0 A;  1B3Q A;  3C90 A;  1M9N A;  1FXV A;  3J80 N;  1MMM A;  1AIL A;  4DV5 B;  4X88 A;  4NTY A;  4MTF A;  4MVS A;  3QF7 A;  5LYJ A;  1EN4 A;  5JH7 A;  2EUL A;  1HWY A;  4TSF G;  2Y69 C;  3E8F A;  2ARH A;  3JD4 A;  4MVU A;  2P4K A;  3AG1 C;  3SR2 C;  5IJ0 A;  3H1I H;  2IU3 A;  4FM0 A;  1IBK O;  2EIM C;  3ETE A;  1ORQ C;  5D5P A;  1V54 C;  4EB6 B;  2Y69 B;  3K59 A;  1AP5 A;  1GH6 A;  3I55 V;  2YXH A;  4UB8 Z;  1YCI A;  5IE9 A;  2A06 H;  1H2M A;  2JK5 C;  2WA4 A;  3E35 A;  3OMI B;  2CGN A;  1AJQ A;  2AGA A;  3SYA A;  3JD2 A;  4JI7 B;  1V54 B;  1SQF A;  5L3C A;  5EC1 C;  3E22 A;  4NXM B;  2QM8 A;  4O4L B;  1YJW V;  3UT5 A;  1FFX A;  1O9H A;  1IZ3 A;  3U10 A;  3OUS A;  5J2U A;  3ZMZ A;  3KZI Z;  2CUG A;  2QKC A;  2JDI G;  3EHB B;  3WU2 Z;  2P90 A;  1JJ2 U;  5K1P A;  1BZK A;  2RJZ A;  1R6K A;  3RN4 A;  3CPW U;  1Y67 A;  3CJH B;  3SDL A;  4ZOL A;  2Q7G A;  3ZS8 C;  5KAI Z;  3MD0 A;  2NR5 A;  5LHH A;  3LSS A;  3A2F A;  3T4Z A;  4LWS B;  3FYE B;  3BCC H;  1H8E G;  3E86 A;  3IGA C;  4J7J A;  1KEC A;  4UUJ C;  4FZ1 A;  4X1Y A;  1DF5 A;  4ZIB A;  3AG2 C;  1W2B U;  1XRE A;  5B1A B;  1XOU A;  4NYK A;  1R6T A;  5BMV A;  2OWO A;  4AHC A;  5KAF Z;  1NJI W;  1QBZ A;  1GK9 A;  4HBN A;  1VQ8 V;  1SQG A;  3E8G A;  1N0N A;  3L75 H;  4W4K A;  1HNW O;  1L8D A;  4I4T A;  4TUY A;  4YY3 B;  3P3N A;  4DYL A;  2Y0I A;  4DV5 O;  3H1K H;  2Q4P A;  2XND G;  1QR9 A;  2QGN A;  3CC2 V;  3SPG A;  5GW7 A;  3BEH A;  1IVS A;  1DLB A;  1VF5 B;  3H01 A;  4FLU A;  3SJA C;  5JJE B;  2DOS A;  4ZI7 B;  2D3O W;  1IUR A;  2AZ2 A;  2VRZ A;  2UXC O;  3THO A;  4MTO A;  1PL4 A;  5LMU B;  4MVO A;  1NH2 D;  5CBF A;  3P30 A;  3ZN1 A;  3ZED A;  3PN1 A;  2CK3 G;  4JI1 B;  3OE7 G;  4RO2 A;  1E79 G;  4DR2 B;  4KL1 A;  1HW7 A;  1KC8 W;  2RDC A;  1V55 B;  1P49 A;  1XMQ O;  2E5L B;  1YIT V;  2EIL B;  3CCS V;  4JAV A;  2H3O A;  4PD4 F;  4H33 A;  4P9O A;  3B77 A;  3DXR B;  3BHP A;  1AI5 A;  2YEV B;  2RMK B;  4TOI A;  1H2N A;  2OCC B;  4CZZ A;  1VEW A;  1GM9 A;  5L3B A;  1JJO A;  2NN4 A;  2RNB A;  5A9G A;  5CA3 A;  4DV4 B;  4IYH A;  4DV2 B;  2A3Q A;  4RUF A;  2ATK C;  1SES A;  2XAG A;  3DTU B;  3JD1 A;  4O4H A;  4X65 O;  5L3D A;  1OCZ C;  2F95 B;  3J7A U;  3OEH G;  3ZRX A;  2P5O A;  4PA7 A;  2IH1 C;  5FNV B;  5IT9 N;  1TGO A;  3R65 A;  1JFF B;  1GO3 F;  4QNH B;  1NR1 A;  2W6I G;  3M8A A;  2YIB A;  2ADP A;  2B1G A;  3Q4H B;  4IL6 Z;  3E2E A;  3ZRW B;  5CB4 B;  2F23 A;  2CGO A;  4O4I A;  1BT8 A;  5J2T B;  2OYQ A;  2AHY A;  2KG7 A;  4UV9 A;  2M7W A;  3B8N A;  5LP6 A;  4WFH A;  2YC0 A;  1Y4M A;  4Q20 A;  4WFB V;  2FTK A;  4YY3 O;  1XL6 A;  2XAF A;  5IY5 C;  2ZE8 A;  3CME V;  1SA0 A;  2PUS A;  5LP6 C;  2CH7 B;  5GTI Z;  4DV6 B;  4LF9 B;  2P7T C;  3KG2 A;  3UO2 A;  1VQO V;  3JAL A;  5CN0 A;  3N27 A;  4MSW C;  4GT1 A;  5IY5 B;  3AG7 A;  1J5E B;  2Q7E A;  4PJ0 Z;  4YJ2 B;  1W0K G;  4QJF B;  3CP1 A;  1S72 V;  4R50 A;  3PJS K;  3KCX A;  4CBC A;  3R66 A;  2V7Q G;  3B40 A;  2V4D A;  4DR2 O;  1FFT B;  3W7W A;  1KU9 A;  1ROP A;  1VP7 A;  5JJN B;  3CXH F;  2E5L O;  1XHX A;  4DV0 B;  3RYC B;  1SS3 A;  1N32 B;  4O2A A;  1TVK A;  1IDS A;  2F66 C;  2N74 A;  4GX1 A;  3JD3 A;  3MAQ A;  2WPD G;  2DW4 A;  4RUE A;  4X20 A;  5KUM A;  3G80 A;  2CE4 A;  3ZCC A;  2NLJ C;  4DV2 O;  1AP6 A;  3I56 V;  2QWR B;  4O4J A;  3DSQ A;  1VQ6 V;  1B06 A;  2QE7 G;  3K5L A;  2YID A;  2DMX A;  1BL8 A;  3JAW A;  1AI6 A;  2WLH A;  2OIE A;  3CRM A;  4NXN B;  3F7Y C;  2HHH B;  4ABM A;  2UXD B;  4MTG A;  3OR6 C;  2IJK A;  4YXW G;  2P22 C;  5IYZ A;  2XAQ A;  2P4V A;  4QPK A;  1K92 A;  2BTQ A;  5KUK A;  1OHH G;  2A0L A;  5KA6 A;  3T1H B;  3JAK A;  1LUV A;  5KX5 A;  4YIO A;  5CA0 A;  4U7O A;  5B1B B;  1F4N A;  4UCU A;  3ZX6 A;  1VQK V;  1N36 B;  1RFY A;  2CDY A;  3ABU A;  3E83 A;  3ABM B;  1VQ5 V;  5LL6 Y;  5C8Y A;  1K97 A;  4K0K O;  4TV8 B;  3QTC A;  1J5E O;  3K79 A;  1Q8I A;  1FPO A;  4AI8 A;  2W0F C;  1U97 A;  2F43 G;  4LF5 O;  2KSD A;  4I50 B;  2RN9 A;  3OMA B;  4F6R B;  2OTL V;  4JI8 B;  3OUF A;  4XDL A;  1S0V A;  1NH2 B;  4JI3 O;  5ITZ B;  1WPX A;  5BR8 B;  4LBE C;  4WBN B;  1XEQ A;  5IWA O;  5LBQ A;  1EZJ A;  2LGQ A;  2PTM A;  1XBL A;  2Y0P A;  2Q8V A;  4JPR A;  3OGI B;  2QKS A;  4JYA B;  3HKD B;  5KHG A;  1NI8 A;  2Y48 A;  3JCU Z;  4J9Z B;  5EBL C;  4JTC B;  5IYC O;  5L3G A;  3FX7 A;  1ZL8 A;  1K9M W;  1OCR B;  4J9Y B;  5LXT A;  1WA8 A;  3WB1 A;  4GX5 A;  3OTO O;  3QG5 A;  2P67 A;  2ZNJ A;  2UU9 B;  1M57 C;  2VQE B;  1Y74 A;  4BR6 A;  2A9H A;  3FB6 C;  1ARO P;  3ZMV A;  4LF8 B;  3ZHU A;  3HKB A;  3ETD A;  1SET A;  4GKK O;  1E1Q G;  1M57 B;  2YI8 A;  1XDC A;  2VWJ A;  3CRQ A;  1SQB H;  2DWE C;  2EX3 A;  3JAT A;  4NXN O;  3RYI B;  3IJ4 A;  3NXS A;  2HHH O;  3HPL C;  4JAS A;  1ZWI C;  2X6A A;  1X59 A;  3ASN C;  5EYP A;  2YUA A;  3ZHS A;  2MW2 B;  3CC4 V;  4PI2 A;  4X1K A;  2GUZ A;  2YDE A;  3CCM V;  1FXH A;  3RYH B;  1VMG A;  1FXK A;  2LJ2 A;  1R3J C;  4LFA B;  4J42 A;  1VQL V;  3AEI A;  1F23 A;  4B3S O;  1FXK C;  3ABL C;  5LGT A;  1Z2G A;  2PYL A;  1F7Y A;  2GHY A;  1VQM V;  1S5H C;  3QO7 A;  4YIP A;  2HVJ C;  1FAF A;  3T1Y O;  2GTS A;  3ABL B;  1RSO B;  2ZM6 B;  2ZE7 A;  4GCZ A;  1AVM A;  4DUZ O;  4UXN A;  1H2K A;  3HKC A;  4Z1V A;  3TCU A;  3K58 A;  1X4T A;  4DR7 B;  4FM1 A;  4YJ3 B;  2X0L A;  3C3S A;  3HR0 A;  1PKX A;  2DN9 A;  1BHA A;  3M99 B;  4JZ2 A;  4OX9 O;  3N2G B;  1P7B A;  4JI5 B;  4MVZ A;  3JSL A;  3TET A;  3RVZ A;  1SQX H;  1JA8 A;  2EBO A;  1FD9 A;  4EB6 A;  2YS8 A;  3N2K B;  3U11 A;  5B1N A;  3A0H Z;  1MSW D;  5CMU A;  4JV5 O;  3CXC U;  2Q0A A;  4TWK A;  3D3I A;  3AG3 B;  3CRC A;  4LNU A;  4X64 B;  2GDS A;  4UCR A;  4LF6 B;  3RT3 C;  1OJH A;  2JS5 A;  2M6Y A;  1RPO A;  1AJP A;  5BXZ A;  1BSM A;  3LDC A;  4E4E A;  3UKM A;  3CRA A;  1WB7 A;  1ZTE A;  1D5N A;  3CCQ V;  4H13 B;  3AK2 A;  4IYI A;  1XNQ O;  4BIZ A;  1HNX B;  4LF7 B;  4B3R B;  3SPI A;  4PDM A;  4CH3 A;  4C7U A;  1OZ0 A;  4DV7 B;  3W7U A;  3CJH A;  4LFC O;  1HDJ A;  2ADQ B;  5HFM A;  5D5Q A;  2L35 A;  5EZY B;  4HNA B;  2H8P C;  2AXT Z;  4PA9 A;  1T5E A;  4BAY A;  5JWP A;  2BOB C;  1GN2 A;  1RP3 B;  3BA9 A;  3ZJZ A;  5LHG A;  2XT9 A;  3ETQ A;  2Y4U A;  1EM1 A;  5IJ0 B;  4EKW A;  3JAS B;  3TXQ A;  4FFB B;  2HR3 A;  4DUY B;  3IAY A;  5FPO A;  4IHJ B;  4DR3 B;  4FLX A;  2BOC C;  4GX2 A;  5TIS Z;  5IYD O;  4JI2 B;  1MOF A;  1NU1 H;  5KHK A;  1XQ8 A;  5KHI A;  5KMG B;  4FVM A;  1DF4 A;  3CYO A;  5B1A C;  1EN5 A;  4DR4 O;  1YTF D;  1YEW A;  3E89 A;  2LO1 A;  5H5N A;  2BCC H;  2IJI A;  4DR7 O;  1R1B A;  1CPY A;  4XBF A;  5B5E Z;  2EZO A;  3H1H H;  3APQ A;  2Q6A A;  2WLK A;  2HVK C;  1YIJ V;  3G67 A;  5JJJ B;  4DR1 B;  2QEX V;  4ZI7 A;  1GTO A;  4EEQ A;  1ZLZ A;  1Y76 B;  1EZV H;  2PF4 E;  4TQF A;  1AR4 A;  2AW9 A;  2WLL B;  4MS2 A;  1CEZ A;  4OGQ B;  1H2S B;  1H2L A;  4ICG A;  4PV1 B;  1P4R A;  4X64 O;  5H6Q A;  2NNU A;  4LF6 O;  1QLE B;  5EIB D;  1YF2 A;  3SPC A;  4X62 B;  4KHP B;  1XMO B;  3FD9 A;  1V55 C;  2EJR A;  3OGC C;  2R70 A;  1WB8 A;  4MVR A;  1R3K C;  3TGU H;  2EIL C;  1PNL A;  4N21 A;  1JMK C;  2XAJ A;  1W59 A;  1I08 A;  1SZT A;  2YEV A;  1ZSP A;  3CB2 A;  1L1F A;  3E8B A;  1HNX O;  2IH3 C;  3K03 A;  4JI7 O;  2PY5 A;  3DC5 A;  4DV7 O;  1JCH A;  1PNM A;  2A7W A;  2IW5 A;  4NXM O;  3LDD A;  2HJD A;  4H37 A;  5JCO C;  1Z5V A;  5DN6 G;  4TUY B;  1M56 B;  1UFI A;  2OCC C;  2YIC A;  2ODM A;  1AR1 B;  1XI1 A;  5C93 A;  5IJ9 B;  1TUB B;  3G6E V;  3FB8 C;  4GLX A;  2HJF C;  1AI7 A;  5LMN B;  5HFL A;  3SYP A;  5L3E A;  4RQF A;  5FNV A;  1JFF A;  1N33 B;  1MA1 A;  4DUY O;  4DR3 O;  1K5S A;  3Q4H A;  4K35 A;  1IBL B;  2Q0O C;  2WAM A;  4JI2 O;  1GN6 A;  3GB7 C;  2QWQ B;  3IC9 A;  3ZRW A;  5CB4 A;  5JQG B;  4B3T B;  3CCJ V;  2XTA A;  2OT5 A;  4UB6 Z;  1F51 A;  4QE7 A;  1EBO A;  1N34 B;  1BGY H;  2FB5 A;  3VQW A;  2KKW A;  1VQ4 V;  1YSC A;  1BHB A;  1G4Y B;  3CCL V;  2CH7 A;  1S76 D;  4BW5 A;  3DC6 A;  2GSM B;  4DR1 O;  4D7S A;  3EFF K;  2UXN A;  1NVP D;  2Q67 A;  1Q43 A;  1IX9 A;  4P30 A;  3WFV A;  5EBW C;  3EVK A;  2WLJ A;  4BW9 A;  4YJ2 A;  3RGB A;  1DK1 A;  1M90 W;  2UUC B;  1SKV A;  1KYO F;  3CE2 A;  4NVP A;  2JEX A;  2W0X A;  3TXS A;  4I9Q A;  3CSX A;  1P84 F;  1IBM B;  4FJC C;  1PD3 A;  3WB0 A;  1Q6I A;  4JF3 A;  1N4C A;  4LFB B;  3RYC A;  3AG4 B;  1NTK H;  3GVM A;  1WP7 A;  4KHP O;  3EXA A;  5GTH Z;  5LMU O;  1QCE A;  3K5O A;  2PI5 A;  4KFM A;  1M1K W;  1HP8 A;  1SER A;  4JI1 O;  2UXX A;  3VQV A;  2XAS A;  2Q73 A;  1KB9 F;  2VQF B;  2CAZ C;  2R9A A;  2ZNI A;  3FB5 C;  2BSK B;  1Q3E A;  3ZHQ A;  1S5L Z;  1S3J A;  2O57 A;  4QIW F;  3L74 H;  1I0H A;  3B8M A;  2ZIM A;  3JAR B;  2JGD A;  4GZR B;  3K5N A;  4YHH B;  2Q69 A;  4FLY A;  1YI2 V;  4DV1 B;  1K34 A;  3BAA A;  4NR1 A;  2W6J G;  2UUB B;  4DRX B;  3CC7 V;  4BIO A;  3KKY A;  1Z5W A;  3AK1 A;  4DV4 O;  3K57 A;  2DWD C;  2F93 B;  4AQY B;  2UXB B;  3O9O A;  1IBL O;  1HR0 B;  5DED A;  4B3T O;  1BE3 H;  2Z3Y A;  1SZX A;  3S3W A;  4JTD B;  1MAB G;  1SQQ H;  1PV0 A;  4X8A A;  2CTP A;  2GBO A;  2E75 B;  1XIL A;  4FLZ A;  3MHH C;  1F4M A;  1LUW A;  4JI0 B;  2ZIN A;  1PP9 H;  4LH7 A;  3BY6 A;  2DJV A;  2EIN C;  5CBH A;  5JVD A;  1Q81 W;  1YTF B;  3ZRV A;  3D8C A;  4DW1 A;  4X9Q A;  2XUM A;  3CWB H;  2X6B A;  3SPH A;  1WJZ A;  5B1B C;  1Q82 W;  3OMN B;  3TK1 A;  4TV8 A;  1GN4 A;  2EIN B;  3ABM C;  1NS1 A;  4UV8 A;  2UUC O;  4J7K A;  4F6R A;  2KB1 A;  3L70 H;  4WF9 V;  1L0N H;  5FLX N;  4DV6 O;  4UVC A;  4JI4 B;  4LF9 O;  4B7E A;  4JYY A;  5LOV B;  2WWW A;  2Q7H A;  3A0B Z;  4U3J B;  5EIB C;  2HEP A;  4WBN A;  1U96 A;  3ML0 A;  4LFB O;  4X1I B;  4JYC A;  4DR6 B;  2QM7 A;  3CCE V;  1OCC B;  2ETN A;  3JAM N;  3HKD A;  4JI6 B;  3ZBH A;  1K4D C;  1HNZ B;  1YDX A;  3F7V C;  4OXS A;  4CC6 A;  1RM1 C;  1TA8 A;  3QVN A;  1WLE A;  4PA4 A;  5AG2 A;  1KKC A;  4MVQ A;  3X2Q B;  4PDV A;  2EZP A;  1QVG U;  1DGS A;  4O2B A;  2Q5Z A;  4DV0 O;  4I0X B;  3ZHV A;  1GMG A;  1AR5 A;  1RM1 B;  4UCS A;  4RAI A;  1OCR C;  4LF4 B;  1N32 O;  5CA1 B;  2QSA A;  2DYR C;  1Q5O A;  3AK3 A;  1R3L C;  2D2C B;  5H9C A;  1KKD A;  4IIJ B;  1S5J A;  1NTZ H;  2V1D A;  3H9V A;  4I7Z B;  2DYR B;  2YXY A;  2Q9L A;  1JR9 A;  3CS5 A;  3CCR V;  2ZR2 A;  2UUA B;  2IM9 A;  4OPA A;  3U0Z A;  5DM6 V;  4PI0 A;  2MK3 A;  1HR0 O;  4FLW A;  2WLI B;  3RYH A;  2HKO A;  1WAZ A;  4I55 B;  2Z5U A;  3T2M A;  3RYF B;  4ZKI A;  1CP9 A;  4JI0 O;  2CTW A;  3W7T A;  2WLM A;  4A5U B;  2QR4 A;  4X89 A;  5H2F Z;  2DYS B;  2UXD O;  1AB3 A;  3OR7 C;  4CS4 A;  1IBK B;  3LSU A;  4CS3 A;  3WG7 B;  4CS2 A;  2L6L A;  2ZIO A;  2AHZ A;  1KQS U;  2WSS G;  5L3F A;  3F5T A;  1RSO A;  1ZX3 A;  4PDL A;  4RWU A;  4FLV A;  4W4L A;  3D36 C;  3T1H O;  4J7Z A;  2QWP B;  4PDR A;  5DEC A;  1NVP B;  4UCT A;  4J80 A;  1N36 O;  2QTO A;  1R6N A;  4JI4 O;  4X66 B;  4YJ3 A;  3B4S A;  4LCU C;  3HKB B;  3BPZ A;  2DQ3 A;  5B3S B;  4PA6 A;  4DR6 O;  3ZMS A;  1BQZ A;  4L87 A;  3N2G A;  5LA6 A;  2GTA A;  4JI6 O;  2HG5 C;  1HNZ O;  3BRC A;  4JI8 O;  5EYP B;  4NTX A;  3K0G A;  2ZT9 B;  2GUZ B;  4ZHQ B;  3N2K A;  4IT5 A;  1YJ9 V;  1H38 A;  3SJB C;  2LFS A;  2R9I A;  5EBM C;  5BR8 O;  3QO5 A;  1TUE B;  2EIK B;  1NZ6 A;  4GKJ B;  4JYA O;  4DW0 A;  2F1M A;  4NTW A;  3AG3 C;  3BVO A;  2PI4 A;  2C2A A;  3JYC A;  2OCH A;  2ZDI A;  2YIA A;  4RQE A;  1SF9 A;  1UPG A;  3WB2 A;  3FAV B;  3IFX A;  2UUA O;  2UU9 O;  4DK0 A;  2VQE O;  2ZDI C;  4F6E A;  2YIB D;  4TQD A;  3T4D A;  1BQ0 A;  4O4L A;  1VQP V;  3ABK B;  4LF8 O;  5EZY A;  1K3E A;  4D7T A;  1HNW B;  4HNA A;  3SGI A;  3H1J H;  2LW7 A;  4TV9 B;  1GM8 A;  3HKE B;  1VAR A;  2ZXW B;  2ZCE A;  4LR3 A;  1BS3 A;  4MT8 A;  4UCO A;  4P2Z A;  3HB3 B;  2XAH A;  4DR5 B;  4B7K A;  5GON B;  3ZHR A;  1QNM A;  3STL C;  4GUN A;  3JAS A;  2UXC B;  1WPB A;  4FFB A;  3QO8 A;  4IHJ A;  3B09 A;  4LH6 A;  4TT3 G;  1KP2 A;  4EFB A;  4HYO A;  4NKG B;  4DK1 A;  2ZE6 A;  4HAM A;  2HLD G;  1QVF U;  3NR7 A;  3K9S A;  3AG1 B;  1US6 A;  3M7M X;  5LYJ B;  3A8T A;  5KMG A;  2ZD9 A;  5JH7 B;  4LFA O;  4JTA B;  4LWS A;  2EIJ C;  4WFE A;  1YZB A;  2EIM B;  4LNU B;  1XMQ B;  4J11 A;  3OD4 A;  4FLT A;  2IJH A;  1QQC A;  4X66 O;  4JZG A;  3ASO C;  2EIJ B;  3K04 A;  3FKS G;  2Q68 A;  2ZR3 A;  3MDS A;  4JYB A;  2ZM6 O;  1M93 A;  5LGU A;  5IYB O;  1NTM H;  1Y76 A;  2JGU A;  3STZ C;  3ASO B;  1NBM G;  3E22 B;  1JOY A;  2BE3 A;  3UT5 B;  2GV9 A;  1FFX B;  1QU7 A;  2WLL A;  3JD0 A;  3CRR A;  4FMT A;  3G6B A;  1FJG B;  5J2U B;  5EC2 C;  1BCC H;  4BIU A;  1Y6X A;  5E79 Z;  4X65 B;  3A0R A;  3LSQ A;  4GKJ O;  3UM7 A;  1XL4 A;  3G71 V;  4JI5 O;  2OIG A;  3K3W A;  3VOU A;  2E74 B;  4CC5 A;  1Q6H A;  2ITD C;  2LGW A;  2R9R B;  1XNR B;  3FYI B;  4ZOL B;  1QLE C;  1K8A W;  2QWO B;  1BMF G;  1WNS A;  3ABT A;  3TJT A;  3UQ8 A;  2RQ6 A;  1ENV A;  5E1A C;  3K08 A;  3LNM B;  4JGS A;  3QNE A;  3SYQ A;  2CTR A;  3LUT B;  4DV3 B;  2PGG A;  4ASU G;  3SPJ A;  3AG2 B;  3L72 H;  4QPJ A;  5BY1 A;  4UVA A;  4PA3 A;  4WFG A;  2JJ2 G;  5KLV H;  3RVY A;  1G8M A;  3SJC C;  4X1Y B;  2N04 A;  5IJ9 A;  5KHJ A;  1TUB A;  4U3F H;  3DXR A;  3GWK C;  5BMV B;  1TAE A;  4DR5 O;  1KD1 W;  1M56 C;  5JCO A;  3SJQ C;  4LF7 O;  4JAA A;  4B3R O;  2ZKO A;  1LNQ A;  5B66 Z;  5LGN A;  2RCV A;  4FK5 C;  3P3P A;  2JEU A;  4I4T B;  1KP3 A;  5JQG A;  3ICX A;  2YXL A;  2H94 A;  3ZHT A;  3L71 H;  4FPP A;  4QGP A;  1OV9 A;  1OCO C;  1MZF A;  3CMA V;  5CBG A;  4J10 A;  4D6T H;  2LQT A;  1R73 A;  3T1C A;  3KCY A;  2FML A;  1MNG A;  4IGG A;  1OCO B;  2QTS A;  4WFF A;  3BAB A;  2R72 A;  5J2T A;  2LW1 A;  5KA5 A;  1NQT A;  1EFR G;  1K7D A;  1A32 A;  2PYJ A;  1UJW B;  2IU0 A;  1NT2 B;  2E76 B;  4B08 A;  3GWO A;  3OFN G;  3OEE G;  5FL7 G;  3I5D A;  1FJG O;  1G1X B;  1W0J G;  1KUQ A;  1I5X A;  3SYO A;  4LC1 A;  2Z0A A;  1K73 W;  1M5I A;  2YSU B;  2LFR A;  3CX5 F;  1GKF A;  1KBH A;  2E3C A;  2IBZ H;  3S3X A;  4CH5 A;  1XNR O;  1GAX A;  1K5Q A;  4R8C A;  1OCZ B;  1PPJ H;  1N0J A;  3AG4 C;  2JRI A;  1JX9 A;  4FFK A;  4UFZ A;  4O4H B;  2CTQ A;  4DV3 O;  1E1R G;  1QR8 A;  3RFR A;  2BSK A;  4CH6 A;  4X62 O;  1XMO O;  1K33 A;  3JAR A;  2JIZ G;  2JVD A;  2B5U A;  1FS0 G;  1SQV H;  5IDJ A;  2QWN B;  1YXB A;  4CH4 A;  4DRX A;  4O4I B;  2X7R B;  2KG7 B;  4H44 B;  4K0K B;  5LP6 B;  4WFA V;  2FKX A;  3C3T A;  4LF5 B;  2B9Z A;  3FFQ A;  1I5Y A;  2XOK G;  3APO A;  1R3I C;  1COW G;  3VQX A;  3UO3 A;  1SA0 B;  5KHH A;  4AIL C;  3RWR D;  1NR7 A;  4BWA A;  1JQ0 A;  4JI3 B;  4MW3 A;  3JAL B;  3OAA G;  1H8H G;  5LMN O;  2BTO A;  3OM3 B;  5IWA B;  4FM2 A;  3RBZ A;  2XHB A;  1N33 O;  5FPR A;  1GN3 A;  2P06 A;  1URF A;  3W7S A;  2K1E A;  1Q6U A;  4NB5 A;  4KP4 A;  2WA3 A;  3OTO B;  1VF7 A;  3MHS C;  4Z1M G;  4DXW A;  1N34 O;  3IC7 A;  1P7G A;  2QDO A;  1JVM A;  1PNK A;  2JGD B;  2HP8 A;  2N05 A;  2ITC C;  5BZB A;  4O2A B;  1FYJ A;  1H2G A;  1TVK B;  3L9D A;  2ZQM A;  1B6Q A;  1I94 B;  1LR1 A;  1VQ7 V;  5LOV A;  4G2K A;  4MW8 A;  4U3J A;  3CD6 V;  4GKK B;  1L0L H;  4F4L A;  1D5A A;  1VIB A;  1ZAU A;  1D2D A;  4X20 B;  4X1I A;  5H6R A;  3P32 A;  3CCV V;  3JSN A;  3E8H A;  3G4S V;  1KMI Z;  4I50 A;  5LHI A;  2FYU H;  4R7C A;  2QJ1 A;  3DGE A;  1SRY A;  1OCC C;  4O4J B;  1IBM O;  5ITZ A;  4ZBM A;  1IXM A;  1EN6 A;  4I0X A;  4K3A A;  4I9W A;  3JAW B;  1VF6 A;  3CHX A;  3LDE A;  3X2Q C;  5CA1 A;  4B3S B;  1RPR A;  1YVW A;  4B3M B;  1QHT A;  5EK0 A;  1G6U A;  4PEL A;  2ZE5 A;  5JVD B;  1VF6 C;  3D3Q A;  4IIJ A;  3OTF A;  2VQF O;  1V9P A;  3OT7 A;  1K4C C;  2DE0 X;  5IYZ B;  4R6Z A;  2G38 A;  2B1I A;  3JCZ A;  1Q86 W;  3T1Y B;  2VWK A;  4J41 A;  1VQN V;  2BTQ B;  4DUZ B;  4FZ0 A;  3JAK B;  5KX5 B;  4XDK A;  3UCS C;  3ZRS A;  2F4V B;  2QM4 A;  2JJ1 G;  3K9A A;  5CA0 B;  4YHH O;  1MZE A;  1O9G A;  1S77 D;  2WLI A;  4WCE V;  4DV1 O;  2K9P A;  3BFR A;  1XUQ A;  4L8J A;  3RW0 A;  5K1X A;  2OTJ V;  4FIP C;  4P9P A;  3ETG A;  4I55 A;  3OW2 U;  4MTX A;  4DO2 A;  3ZN0 A;  4K8X A;  3RYF A;  2UUB O;  1XHZ A;  3K0D A;  4EFE A;  4KUM A;  2AZ0 A;  5C8Y B;  3RYI A;  4OX9 B;  2PZS A;  4K8Z A;  3O65 A;  1B04 A;  4AQY O;  1JPX A;  2UXB O; 
#chains in the Genus database with same CATH homology
 1Y6X A;  2YXH A;  5IE9 A;  1VMG A;  2P06 A;  2OIG A;  2A7W A;  3CRC A;  2A3Q A;  2Q73 A;  2GTA A;  1YXB A;  2Q5Z A;  2Q9L A;  3C90 A;  2Q4P A;  2OIE A;  3CRA A;  4QGP A;  1YVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...