1RSOB

Hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
GLLAAERAVSQVLDSLEEIHALTDSSEKDLDFLHSVFQDQHLHTLLDLYDKINTKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The tetrameric L27 domain complex as an organization platform for supramolecular assemblies
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Neuropeptide/membrane protein
molecule keywords Presynaptic protein SAP97
total genus 18
structure length 56
sequence length 56
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1rsoB00
1Y74B 1Y76B 1Y74A 1VF6C 3B40A 1VF6A 1ZL8A 1ZL8B 1Y76A 1RSOB
chains in the Genus database with same CATH superfamily
5EIBD 3HKBA 1NI8A 3WB2A 5FNVA 4E2LA 2LGWA 3S3WA 1N34B 4I55A 4AQYO 5B1OA 3ZS8C 1WB7A 1VQ9V 3T1HB 1V54C 3AK2A 1SZTA 3SYCA 2HP8A 4NXMB 1MA1A 3OEHG 2UU9O 3ASOB 1TUBA 4YY3B 4KFMA 5JCOA 5CB4A 4J41A 2Y4UA 2Y4TA 1B6QA 2ZDIC 5JJEB 2GUZB 4B3MB 5CA0B 4JI7B 3SDLA 2HR3A 2X6AA 2ZKOA 1GM7A 1VF6A 4PA6A 1WP8A 3E89A 4G2KA 4O4JB 2JRIA 3STLC 3SJAC 4WFHA 1HR0O 4FLVA 4DR1B 2WA4A 2H3OA 3G71V 1N36B 4LF5B 4X62O 4JV5B 3VQXA 2ZNJA 5HFMA 4O2AB 3P3NA 1FFTB 3LSUA 1OZ0A 1SQBH 1GK9A 2C2AA 5JVDB 2YS8A 2AHZA 4U7OA 3T4ZA 4U3JA 1QR9A 4JI0B 4JAAA 4NB5A 3RYCB 3LDDA 3TJTA 2PF4E 1I0HA 2FKXA 1F4MA 4CH3A 2CGNA 3DTUB 3CXHF 2R9RB 3SPJA 2XOKG 1K34A 1JJ2U 3TGUH 4DR2B 3AG3C 1MSWD 2LP7A 1KQSU 1A32A 4GKJB 1D2DA 2B1IA 2KKWA 3CRMA 4LCUC 3CPWU 1NR1A 4QE7A 2F4VB 1K5QA 1S77D 3ASNB 2HJFC 4J9ZB 3K57A 3J80N 1K7DA 4U3FH 2EIKB 2ZIOA 2CTPA 4I50A 4OX9B 4MTFA 1D5NA 1S72V 3SPCA 4H13B 1NKDA 1F51A 2LO1A 4FFKA 2P06A 2Y69B 4JF3A 3A0HZ 3VQWA 3CJHB 4QNHB 1WJZA 3G6BA 1VQLV 5LBQA 3FAVA 3ETQA 4FIPC 3B8MA 2RN9A 3CSXA 5J2UA 2Q9LA 5FPRA 4YJ3A 3EHBB 1XL6A 1TGOA 3OM3B 4NVPA 4ZHQA 4PV1B 2HLDG 3UCSC 4W4LA 1K97A 1WN7A 4CBCA 4NKGB 4NXMO 2FL4A 3HKDA 4X1KB 1R3JC 2XNDG 2W0XA 4JTCB 1YJWV 2EZPA 5IJ9A 4I55B 4MTXA 2V7QG 2UXCO 2VRZA 1EZVH 4FLXA 2HFEC 1SQQH 1AP6A 3ZRSA 3CCLV 4XDLA 2QA4V 4RQFA 4JGSA 4UCSA 2Q67A 2XAQA 3K03A 3FKSG 3UT5B 2XT9A 1E1QG 4B3SO 1QCEA 3SPGA 1M56B 4FLUA 4X20A 4GCZA 4EKWA 2Z5UA 3LNNA 2B9ZA 1CP9A 2E75B 3IC7A 2KSDA 3T4DA 2GTAA 2ZE6A 2DYSC 4PDVA 1TA8A 4YIOA 2UUAO 2EJRA 2OCCC 2KB1A 1VEWA 1Q43A 2CTQA 2L35A 4AHCA 1U97A 2LJ2A 5H5NA 1S3JA 4NTXA 1KKDA 1FJGB 3C3SA 3H1JH 1US6A 1WPXA 4ZI7B 5J2UB 1BZKA 5C8YA 3MHSC 1NZ6A 2WLNA 3APOA 1VQKV 4JTDB 3CCUV 2JGDA 1VIBA 5B66Z 3HPLC 4B3RO 3D8CA 4DR7O 4I7ZB 1NTMH 1ZX3A 4LFBB 5KX5B 3BVOA 4GUNA 2OWOA 3JALA 2GUZA 1R3LC 4B7KA 1HWYA 1XQ8A 3R66A 4G28B 4GT1A 1XNRB 2EJ7A 1PNLA 3FD9A 3K9AA 1B04A 3JARA 3O65A 4WBNA 2EIMC 3ZHTA 4DUZO 4DV5B 4UVBA 2ZM6B 1AR5A 2P90A 1KP2A 1G8MA 1DGSA 4RWUA 5LA6A 4DRXA 3GWOA 4X66B 2RDCA 4DR5B 4IT5A 4BW5A 1KYOF 4F6RA 3X2QC 4DV3O 3RYIA 5EZYB 1K5SA 3RWRD 4U7NA 3KCYA 4DR3B 4MVRA 3CCQV 2R72A 1Q6IA 4LF8B 1YCIA 1EN5A 1F23A 1JOYA 2EX3A 2QE7G 3AEIA 3OMIB 1F7YA 2VWKA 1AILA 2G38A 2PY5A 3SGIA 3IFXA 2FYUH 1SS3A 1OCOC 4LF4O 1IZ3A 4I0XB 3U0ZA 2XUMA 4I4TB 5KX5A 2ZE8A 4DXWA 1JJOA 4JASA 4X1IB 2AZ2A 2CTRA 4JI2B 3THOA 3QO7A 3OR6C 5KLVH 3CRQA 3LNMB 4BR6A 4DV4O 1P7BA 2BTOA 4B3SB 4KL1A 3E35A 4WBNB 2WA3A 1YSCA 4CH4A 4YHHB 1FFXB 2LW1A 4D7TA 3CRRA 4UV8A 4DR6B 2LFSA 3OGIB 2DWDC 4ICGA 1AI6A 5LA6B 4DRXB 3RN4A 2E5LO 1AI4A 4MTGA 1JQ0A 5H2FZ 4FZ1A 5LOVB 4CS3A 1KBHA 2X7RB 4LWSB 3OT7A 2DQ0A 4YXWG 2QEXV 4LH6A 3SYAA 1FD9A 3L75H 3CMAV 3QNEA 2XAGA 2AGAA 3MDSA 2HVJC 2PI4A 1FKAO 4GKKO 4FMTA 3DC5A 1M4UA 3I56V 1O9HA 1TVKB 3O9OA 2W0FC 3QVNA 5IY5B 1AR1B 4LFBO 4B3TO 4WFAV 1OCZC 2IH3C 2VQFB 1VF6C 5JQGB 1YVWA 1KMIZ 2A0LA 5IYCO 5GTIZ 4X1KA 3BPZA 5EIBC 4HYOA 3JD0A 1SQGA 4DV6B 1Q7YW 4LF7O 2QSAA 3FB6C 2A3QA 4H0LB 2UXBO 3JCZA 1KB9F 1I5YA 1KUQA 4CC5A 1Z5WA 1TAEA 1YF2A 3ZRWA 2ZM6O 3HKCB 2F93B 4LNUB 3BA9A 3F7VC 4TSFG 2ITDC 1FFXA 4DV2B 4YJ2A 2D3OW 2E3CA 4X88A 1BCCH 3JD3A 2O57A 1SQXH 4H37A 3CRAA 2QTOA 4DW0A 2NN4A 5EC2C 2ATKC 4RQEA 4DV1B 2CH7B 4X64B 1OCOB 1AB3A 1SQVH 1K4DC 1NJIW 2VQEO 3OEEG 1PNKA 3RYFB 1JX9A 1WP7A 4DK0A 3FFQA 3L74H 2A79B 1AJPA 1CXZB 5JH7A 1GRJA 1N8RW 5KA6A 1H8HG 1Z5VA 4QPKA 2DMXA 1FAFA 4X89A 2A7WA 2VS0A 3JAKA 1SF9A 3K59A 5B1AB 3AG4C 2PI5A 2WLKA 3B2EE 1M57C 1PNMA 4DR4B 1VARA 3K79A 1NH2B 3ABKC 2ADPA 3SJQC 1X59A 4ZIBA 5JWPA 3BRCA 3FB8C 4PJ0Z 4C7UA 5C93A 1IBLO 3FYEB 2QGNA 2WLIA 3JARB 1AJNA 2X0LA 1FXKB 2F43G 1YIJV 2JGDB 4EB6A 1MSDA 3NR7A 3C90A 4L8JA 1L8DA 1FYJA 2WLHA 4I9WA 5LHHA 1N34O 3K58A 2ZR2A 3ZMZA 4RO2A 3H9VA 2YXHA 1KC8W 5E1AC 2IW5A 1K73W 1DF4A 4DW1A 4JAVA 3SYOA 2ODMA 3JATA 1PPJH 1QLEB 3W7WA 3K5NA 5KMGA 4KP4A 1G1XB 4B3TB 1R6NA 4LF9O 1FXVA 1LUWA 1DTOA 2L6LA 3AK1A 2YXYA 1VF7A 4IHJB 5DM6V 4DV6O 4LF7B 3VOUA 1S76D 2OCCB 1XNRO 1WNSA 3OTOO 5GTHZ 2EINC 3B09A 3JAWA 2PYLA 2Q73A 4E4EA 1HP8A 2YIBA 4P9PA 3ABLB 1KECA 4DK1A 3K9SA 2ZNIA 3ZHQA 3RYHA 1PL4A 4IIJA 4JZ2A 1ROPA 1VF5B 3CX5F 4J10A 2JVDA 4DV3B 1EN6A 1P84F 3GVMA 1YXBA 4TWKA 5KHIA 3W7TA 1FPOA 3MHHC 2ZT9B 4CS4A 1B3QA 3IJ4A 4JI0O 4UCUA 3RYCA 4K8ZA 1V9PA 3K06A 3DXRA 4HBNA 4N21A 5IYBO 2H94A 4R6ZA 4MW3A 4FK5C 4LF4B 1WB8A 3ABMC 4DR2O 1UPGA 4DV7B 4FM1A 4LF6O 2CUGA 1ZUQA 2QWQB 4XDKA 2ZINA 5IDJA 3HR0A 2B1GA 3E22A 1VQPV 1QVGU 2IJHA 2P7TC 1H2LA 2CGOA 1VMGA 2LQTA 1BSMA 3JYCA 4JYBA 4BIOA 1XMQO 2AXTZ 4I0XA 2YUAA 4JTAB 1CPYA 1IBLB 1EFRG 3K5MA 3B4SA 1IDSA 2W6JG 2NLJC 4P9OA 1XBLA 4MVSA 1NS1A 3RGBA 3IGAC 2UXXA 5KUKA 1S5LZ 1SQFA 2PTMA 2WLJA 1DLBA 3ETDA 2QR4A 3HKCA 4IIJB 2EIJB 3UQ8A 1WA8B 2FTKA 4UCOA 4JI4B 5L3BA 3N2GA 4K0KB 1FXKA 5LGUA 4BAYA 2XAJA 5DN6G 1JFFB 4QJFB 2GV9A 1GM9A 1Y6XA 4J42A 3H1HH 4TQDA 2ITCC 1P4RA 3B40A 5H6RA 1QR8A 2RCVA 2WLLB 1SERA 2BCCH 4CZZA 4LP8A 1FXHA 1OCCB 2QTSA 1VQ6V 3VQYA 1XL4A 3SYPA 5FPOA 4NXNO 1FS0G 2DE0X 3ZHVA 4TT3G 5KA5A 1YEWA 3D36C 1BS3A 3TXSA 4WFFA 4UVCA 1IXBA 2UXBB 2R9AA 4R50A 4CH6A 3PJSK 1O9GA 5K1PA 3ZEDA 3ABTA 3BCCH 3L72H 1J95A 1HNXB 3CC2V 1AR4A 4O2AA 1G6UA 3KKYA 2PZSA 3UO2A 4LFAO 5B1BC 3N2KA 4X62B 4EB6B 4O4LA 4PDMA 1Y74A 1H8EG 2EILB 2OYQA 4H33A 3ABMB 2AW9A 5IYZA 1W59A 2LGQA 2JS5A 2LW7A 1KD1W 3ZRWB 1FJGO 5BZBA 1S5HC 2RQ6A 3EVKA 1S0VA 4O4LB 2R70A 4D7SA 2YIBD 1H2KA 4JZGA 2E76B 2KQXA 1SETA 1RPRA 5EYPA 1MNGA 1L1FA 3D3IA 2YI8A 1Y76B 1K4CC 2F66C 4X9QA 4TV8B 2YC0A 3F5WC 1JR9A 4I5SA 3DXRB 3K04A 4HZ3A 3CCJV 2EULA 2QKCA 3WB0A 4D6TH 1W0KG 2V1DA 5L3GA 3Q4HB 4JYAO 1M90W 1WAZA 5B5EZ 1H2GA 3RFRA 4PI0A 2Y69C 2DYRC 5IWAB 2OT5A 3RVZA 3E22B 1Q90D 4TQFA 2RMKB 1GN2A 4X1YB 2IH1C 1BQ0A 3S3XA 5KAFZ 3ZIAG 3JD4A 1ENVA 1RPOA 4JI1O 4KXRA 4LFCO 1XOUA 2K1EA 1CEZA 3K08A 1URFA 3C3TA 3SJCC 2ZQMA 1HDJA 4JI4O 4EEQA 3H1IH 1ZL8A 4K35A 1JPXA 3CD6V 1IX9A 1THZA 4KHPO 5CMUA 3JAWB 3F5TA 3JCUZ 5BMVA 4JI6O 1QU7A 3LDCA 3EXAA 4JI2O 5BR8O 2ILMA 4LF9B 4Q6GA 4AI8A 1GM8A 4I50B 3HKEB 3W7SA 2Q0OC 2CK3G 1GN4A 3IC9A 3ZHRA 3KCXA 4DV0O 1GO3F 2Q8VA 4JI8B 1BL8A 4FFBB 5LGTA 1Q82W 3OTOB 1VQ7V 5J2TB 4UVAA 4CC6A 1HNWB 2DYSB 4O2BB 5IJ0A 4JPRA 3ZJZA 1XMOB 3M8AA 4BIUA 3KG2A 2JDIG 4J80A 4LFAB 1GN3A 3GWKC 3CS5A 3ZBHA 5GONA 4WF9V 1PD3A 3ZHSA 1EM1A 3CRCA 2UUAB 1PP9H 3J81N 3AG1C 1PM9A 2Y0PA 3R65A 3ZMSA 5IT9N 1OJHA 4LR3A 2Q7HA 4X1IA 5E79Z 1OCRC 3N2KB 2YICA 4MW8A 3B77A 4DUYO 1N33B 5ITZB 3CCEV 2PUSA 4GX1A 3FX7A 4GX2A 4UUJC 4B08A 3VBBA 5KHHA 3CE2A 4Z1VA 2A9HA 4IGGA 2QJ1A 2F23A 2UUCB 4R8CA 3G67A 1MZEA 1OHHG 1AI5A 1QQCA 1X4TA 3WU2Z 4LNUA 3ZCCA 1W0JG 4DUZB 1ORQC 3T2MA 5EZYA 2EIJC 3OFNG 3K0GA 1V55B 1SA0A 5FL7G 3RVYA 3T1CA 1EN4A 2YIAA 3GB7C 4JI1B 2QKSA 4UV9A 1QLNA 4J7KA 3ZHUA 3RT3C 2DN9A 5DECA 4DV1O 1N0NA 2CTWA 4ZBMA 1PV0A 1Z2GA 2LFRA 4TV9B 3CMEV 1MZFA 1NR7A 5EBLC 2N04A 2GBOA 2HHHB 1Q6UA 1VQ8V 3ICXA 5BY1A 2WWWA 1BT8A 2Q4PA 1XREA 3T1HO 2NR5A 3ZX6A 1YTFB 1YZBA 1B06A 1RM1C 3J7AU 2Y48A 3UKMA 2QWPB 4JI6B 1HNZO 4R7CA 1N0JA 4J7JA 5B3SC 4GZRB 5BR8B 3LSQA 3TETA 5LMNB 4U3JB 3LUTB 2ZD9A 5EYPB 1OCZB 1RP3B 1SQPH 4K8XA 2JEXA 3DC6A 5IE9A 2XAFA 5D5PA 4DV4B 5H9CA 5A2QN 4DV0B 2PGGA 3SYQA 2QKAA 1RSOB 1XUQA 1GTOA 2IJIA 3VQVA 3AG3B 3AK3A 3X2QB 2WLMA 3FYIB 1COWG 4FJCC 1NQTA 5AG2A 1XMOO 1QVFU 3I5DA 4RAIA 5LOVA 1N36O 2P4KA 1SA0B 3K5LA 5DEDA 2P67A 1LR1A 4FFBA 4FM0A 1P49A 5J2TA 2BTQA 4QE9A 2XHBA 2JK5C 3EFFK 3OUSA 3E83A 5LXTA 1LNQA 4MVUA 4I4TA 4HAMA 1BHBA 2OTJV 5LL6Y 2QDOA 3FB5C 2F95B 3SJBC 3CWBH 2DQ3A 4GKKB 4UFZA 4NYKA 1N33O 3AG2B 4G27B 1XNQB 5BMVB 3QO5A 2IM9A 3E8HA 1ZAUA 2P22C 2YIDA 1R6TA 2VQFO 1GMGA 2IJJA 1NBMG 5B1BB 1Y66A 5CBFA 5IYDO 2UUCO 1UJWB 4QPJA 4ZKIA 4PA9A 2DYRB 2H8PC 2Q7GA 3QF7A 4NTWA 1XILA 1XI1A 3HKEA 4JYAB 4OX9O 2WPDG 4EFBA 1I7FA 3D36A 3I55V 3BY6A 1ZTEA 4WFEA 3UT5A 1M5IA 3CJHA 4O4HA 4TUYA 5LYJB 2Z0AA 3ETEA 4DYLA 5KMGB 3W7XA 2HG5C 3K0DA 5BXZA 4MVZA 2XTAA 5CBGA 4O4HB 4TUYB 2HHHO 2UUBO 1J5EB 1GKFA 4BW9A 1IBMO 4AQYB 4ASUG 4J7ZA 2OIGA 3CCRV 4MVMA 5L3FA 5B1AC 1VQ4V 5EK0A 2ZIMA 3LDEA 1IBKB 2IBZH 1NH2D 2A06H 4TOIA 4YY3O 5LMNO 4DV7O 4NTYA 1BE3H 4UB8Z 1KKCA 5GONB 4LH7A 2B5UA 4JI7O 5KHKA 1I94O 1Q5OA 2JGUA 4FLYA 2QWRB 5IYZB 4YIPA 2XASA 3AG7A 5D5QA 4ZOLB 3M7MX 1M9NA 3BAAA 3KZIZ 5J9PC 1H2MA 1QHTA 3JD2A 4MVOA 1SZXA 3BABA 1Y4MA 3A0BZ 3JD1A 2YDEA 3TXQA 1JVMA 3TCUA 3AG1B 2GTSA 2HVKC 1VQMV 2ZXWC 4F4LA 2EIMB 3HB3B 1TUBB 3P32A 1BHAA 4X65O 1OCRB 2YI9A 5KAIZ 5CA0A 3CCSV 3OW2U 3D3QA 4B7EA 4PA3A 4BIZA 3SR2C 2CAZC 2YXLA 3DGEA 2FMLA 3H1LH 3STZC 4MVQA 1XNQO 3CP1A 2UXDB 3ML0A 1TUEB 4B3RB 5LMUB 2ADQB 1AVMA 4JAUA 4YJ3B 1K8AW 3OR7C 4JYYA 1MABG 4UCVA 4IHJA 1AROP 4GKJO 1DF5A 2Z3YA 2QWOB 2JJ1G 2XAHA 1PKXA 5KHGA 2N05A 2KG7B 3CC4V 5LP6C 3U11A 3RYHB 4PD4F 5KUMA 1M56C 1HNXO 1Q8IA 1I5XA 2MW2B 1H2SB 4OPHA 2EIKC 2OTLV 1AJQA 4FLTA 2BSKA 2Q7EA 3RYIB 4WFBV 3N27A 3JATB 3MAQA 1ZWIC 4DR3O 1GH6A 3E86A 2W6IG 2WLLA 1N32B 2EZOA 1ZSPA 1E1RG 4MT8A 3ABUA 2BOBC 3OMAB 1IVSA 5JCOC 2YEVB 4WCEV 1IBKO 2VWJA 2PYJA 1NT2B 1P7GA 2QM7A 4FPPA 1NTZH 3SPHA 4GLXA 5F2VO 3SPIA 1HNZB 4K3AA 2N74A 4Q20A 1KP3A 4TV8A 1OCCC 4UCTA 3BHPA 2QWNB 2UXCB 3JSLA 2WSSG 4QGPA 3LSSA 4JI5B 3T1YB 3QO8A 1I94B 4FLWA 1TVKA 3BFRA 5LXTB 4ABMA 3PN1A 1OV9A 1VQOV 1Q81W 4DR6O 3ZMTA 3JALB 3U10A 1XHXA 1MOFA 5HFLA 4AILC 4NR1A 2WAMA 4PELA 5LHIA 3A0RA 4PA4A 1SESA 1E79G 5A9GA 4PI2A 5EBMC 2UXNA 1XEQA 3RBZA 4X65B 2R9IA 3A8TA 1YJ9V 4I9QA 3CYOA 2MK3A 3W7UA 1L0LH 2V4DA 5B3SB 4LBEC 2AZ0A 4W4KA 3ZN1A 1SKVA 3E8FA 4HNAA 3OAAG 3N2GB 4K0KO 5FLXN 3BEHA 4GYCB 5LP6A 2IU0A 4KHPB 4FZ0A 1NVPD 2DW4A 1RFYA 2UXDO 2BTQB 2FB5A 4GX0A 1GN6A 5LMUO 3RYFA 4DR7B 5LHGA 5LP6B 4OXSA 2X6BA 1R1BA 5FNVB 1WLEA 3CB2A 1H2NA 3E8GA 3MD0A 4ZHQB 2ZE7A 2ZCEA 5JQGA 1EZJA 2M7WA 4PDLA 4NXNB 1BQZA 2YSUB 4JI8O 1AI7A 3CXCU 1Q86W 1LUVA 1IURA 1M57B 1HNWO 3P3PA 5EBWC 3JSNA 1R3IC 4ZOLA 1M93A 2K9PA 5JVDA 2QM4A 4DV2O 1Q3EA 4FM2A 3ABKB 2P6JA 4DR1O 2P4VA 5C8YB 4LF5O 2M6YA 1BMFG 5CA1B 4X66O 5L3DA 2KG7A 3BA8A 5LGNA 5EC1C 4DR5O 2ZR3A 1MMMA 1Y74B 4RUEA 4A5UB 5GW7A 3ASNC 4P30A 3G6EV 4FVMA 1R73A 4X64O 2ETNA 1Y67A 1JCHA 4JYCA 4PDRA 5CN0A 3ZMUA 4O4IB 1RM1B 4LF8O 2Q6AA 2UUBB 4DUYB 1J5EO 2IJKA 1NU1H 4XBFA 1IBMB 2JS3A 1YDXA 4N23A 3L71H 4OPAA 5KHJA 3JAKB 3OD4A 4CS2A 1K92A 3ZRVA 1IXMA 3WB1A 1Y76A 2IU3A 5JJJB 5JJNB 2RNBA 4DR4O 1VQNV 2F4VO 1WPBA 3T1YO 4JI5O 1G4YB 2GHYA 3E2EA 2Q5ZA 1SRYA 5K1XA 4JI3B 1KU9A 1VP7A 3OGCC 4X1YA 4YHHO 3FB7C 3OTFA 3OE7G 3L70H 3RW0A 1ZLZA 3OUFA 5IWAO 4KUMA 4MSWC 2E5LB 2JIZG 2Q0AA 2BOCC 1QNMA 3K3WA 2AHYA 1GAXA 4F6EA 3ZN0A 4BWAA 4UB6Z 1ZL8B 4LFCB 1FXKC 3H01A 1L0NH 4DO2A 4OGQB 5CBHA 2RJZA 1PL0A 3WFVA 3JASB 4YJ2B 2EILC 3L73H 1SC5B 1K33A 3QTCA 2YEVA 3UM7A 1R6KA 3M99B 2DJVA 4IYHA 1YI2V 1JFFA 4F6RB 4Z2WA 2NNUA 2UU9B 1NTKH 3B8NA 2CH7A 5L3CA 4LC1A 3A2FA 2E74B 4P2ZA 1VQ5V 2OCHA 3Q4HA 3CCMV 3CC7V 3AG4B 3E8BA 2ZXWB 4B3MO 3NXSA 4QIWF 3UO3A 1I08A 4H44B 3ZMVA 5IY5C 3ASOC 1XHZA 3TK1A 5LYJA 3CEIA 1H38A 4LWSA 4UCRA 1V54B 2OIEA 4PA7A 1HW7A 3ZRXA 4CH5A 2F1MA 4J9YB 2CE4A 2BE3A 4O2BA 5IJ0B 1YJNV 1YITV 2Q68A 1BGYH 2P5OA 1HR0B 4EFEA 1AP5A 2CDYA 3WG7B 3FAVB 4ZI7A 4WFGA 1JA8A 1NVPB 2GDSA 1T5EA 3ABLC 3QG5A 4JV5O 1YTFD 1D5AA 3P30A 3K5OA 1N4CA 4Z1MG 1S5JA 1XDCA 2D2CB 2ZE5A 2Y0IA 1W2BU 5TISZ 4X8AA 2QM8A 4FLZA 3IAYA 5B1NA 3AG2C 2X6CA 1M1KW 3HKDB 3DSQA 1R3KC 1N32O 5L3EA 2VQEB 2GSMB 3G4SV 3JASA 1QBZA 2DWEC 2ZDIA 1DK1A 2HEPA 3L9DA 1WA8A 3WG7C 2BSKB 4HNAB 5ITZA 4UXNA 1U96A 4PHZA 1RSOA 4MS2A 3JAMN 2Q69A 3OMNB 5IJ9B 4GX5A 5CA3A 4O4IA 3G80A 5CB4B 4LF6B 4MTOA 2JEUA 2HJDA 1EBOA 4IYIA 3H1KH 4J11A 1JMKC 4X20B 3APQA 2ARHA 1QLEC 4L87A 1XMQB 4JI3O 3F7YC 1F4NA 3CHXA 2DOSA 2HKOA 1Q6HA 4DV5O 1V55C 4RUFA 3ETGA 3CCVV 1K3EA 2EBOA 3HKBB 4IL6Z 1MG1A 4O4JA 5JH7B 1K9MW 2WLIB 1UFIA 5CA1A 5H6QA 2JJ2G 4XDJA 4TV9A 2EINB 1YHQV
chains in the Genus database with same CATH topology
1Y74B 1Y76B 1Y74A 1VF6C 3B40A 1VF6A 1ZL8A 1ZL8B 1Y76A 1RSOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y74 B;  1Y76 B;  1Y74 A;  1VF6 C;  3B40 A;  1VF6 A;  1ZL8 A;  1ZL8 B;  1Y76 A;  1RSO B; 
#chains in the Genus database with same CATH topology
 5EIB D;  3HKB A;  1NI8 A;  3WB2 A;  5FNV A;  4E2L A;  2LGW A;  3S3W A;  1N34 B;  4I55 A;  4AQY O;  5B1O A;  3ZS8 C;  1WB7 A;  1VQ9 V;  3T1H B;  1V54 C;  3AK2 A;  1SZT A;  3SYC A;  2HP8 A;  4NXM B;  1MA1 A;  3OEH G;  2UU9 O;  3ASO B;  1TUB A;  4YY3 B;  4KFM A;  5JCO A;  5CB4 A;  4J41 A;  2Y4U A;  2Y4T A;  1B6Q A;  2ZDI C;  5JJE B;  2GUZ B;  4B3M B;  5CA0 B;  4JI7 B;  3SDL A;  2HR3 A;  2X6A A;  2ZKO A;  1GM7 A;  1VF6 A;  4PA6 A;  1WP8 A;  3E89 A;  4G2K A;  4O4J B;  2JRI A;  3STL C;  3SJA C;  4WFH A;  1HR0 O;  4FLV A;  4DR1 B;  2WA4 A;  2H3O A;  3G71 V;  1N36 B;  4LF5 B;  4X62 O;  4JV5 B;  3VQX A;  2ZNJ A;  5HFM A;  4O2A B;  3P3N A;  1FFT B;  3LSU A;  1OZ0 A;  1SQB H;  1GK9 A;  2C2A A;  5JVD B;  2YS8 A;  2AHZ A;  4U7O A;  3T4Z A;  4U3J A;  1QR9 A;  4JI0 B;  4JAA A;  4NB5 A;  3RYC B;  3LDD A;  3TJT A;  2PF4 E;  1I0H A;  2FKX A;  1F4M A;  4CH3 A;  2CGN A;  3DTU B;  3CXH F;  2R9R B;  3SPJ A;  2XOK G;  1K34 A;  1JJ2 U;  3TGU H;  4DR2 B;  3AG3 C;  1MSW D;  2LP7 A;  1KQS U;  1A32 A;  4GKJ B;  1D2D A;  2B1I A;  2KKW A;  3CRM A;  4LCU C;  3CPW U;  1NR1 A;  4QE7 A;  2F4V B;  1K5Q A;  1S77 D;  3ASN B;  2HJF C;  4J9Z B;  3K57 A;  3J80 N;  1K7D A;  4U3F H;  2EIK B;  2ZIO A;  2CTP A;  4I50 A;  4OX9 B;  4MTF A;  1D5N A;  1S72 V;  3SPC A;  4H13 B;  1NKD A;  1F51 A;  2LO1 A;  4FFK A;  2P06 A;  2Y69 B;  4JF3 A;  3A0H Z;  3VQW A;  3CJH B;  4QNH B;  1WJZ A;  3G6B A;  1VQL V;  5LBQ A;  3FAV A;  3ETQ A;  4FIP C;  3B8M A;  2RN9 A;  3CSX A;  5J2U A;  2Q9L A;  5FPR A;  4YJ3 A;  3EHB B;  1XL6 A;  1TGO A;  3OM3 B;  4NVP A;  4ZHQ A;  4PV1 B;  2HLD G;  3UCS C;  4W4L A;  1K97 A;  1WN7 A;  4CBC A;  4NKG B;  4NXM O;  2FL4 A;  3HKD A;  4X1K B;  1R3J C;  2XND G;  2W0X A;  4JTC B;  1YJW V;  2EZP A;  5IJ9 A;  4I55 B;  4MTX A;  2V7Q G;  2UXC O;  2VRZ A;  1EZV H;  4FLX A;  2HFE C;  1SQQ H;  1AP6 A;  3ZRS A;  3CCL V;  4XDL A;  2QA4 V;  4RQF A;  4JGS A;  4UCS A;  2Q67 A;  2XAQ A;  3K03 A;  3FKS G;  3UT5 B;  2XT9 A;  1E1Q G;  4B3S O;  1QCE A;  3SPG A;  1M56 B;  4FLU A;  4X20 A;  4GCZ A;  4EKW A;  2Z5U A;  3LNN A;  2B9Z A;  1CP9 A;  2E75 B;  3IC7 A;  2KSD A;  3T4D A;  2GTA A;  2ZE6 A;  2DYS C;  4PDV A;  1TA8 A;  4YIO A;  2UUA O;  2EJR A;  2OCC C;  2KB1 A;  1VEW A;  1Q43 A;  2CTQ A;  2L35 A;  4AHC A;  1U97 A;  2LJ2 A;  5H5N A;  1S3J A;  4NTX A;  1KKD A;  1FJG B;  3C3S A;  3H1J H;  1US6 A;  1WPX A;  4ZI7 B;  5J2U B;  1BZK A;  5C8Y A;  3MHS C;  1NZ6 A;  2WLN A;  3APO A;  1VQK V;  4JTD B;  3CCU V;  2JGD A;  1VIB A;  5B66 Z;  3HPL C;  4B3R O;  3D8C A;  4DR7 O;  4I7Z B;  1NTM H;  1ZX3 A;  4LFB B;  5KX5 B;  3BVO A;  4GUN A;  2OWO A;  3JAL A;  2GUZ A;  1R3L C;  4B7K A;  1HWY A;  1XQ8 A;  3R66 A;  4G28 B;  4GT1 A;  1XNR B;  2EJ7 A;  1PNL A;  3FD9 A;  3K9A A;  1B04 A;  3JAR A;  3O65 A;  4WBN A;  2EIM C;  3ZHT A;  4DUZ O;  4DV5 B;  4UVB A;  2ZM6 B;  1AR5 A;  2P90 A;  1KP2 A;  1G8M A;  1DGS A;  4RWU A;  5LA6 A;  4DRX A;  3GWO A;  4X66 B;  2RDC A;  4DR5 B;  4IT5 A;  4BW5 A;  1KYO F;  4F6R A;  3X2Q C;  4DV3 O;  3RYI A;  5EZY B;  1K5S A;  3RWR D;  4U7N A;  3KCY A;  4DR3 B;  4MVR A;  3CCQ V;  2R72 A;  1Q6I A;  4LF8 B;  1YCI A;  1EN5 A;  1F23 A;  1JOY A;  2EX3 A;  2QE7 G;  3AEI A;  3OMI B;  1F7Y A;  2VWK A;  1AIL A;  2G38 A;  2PY5 A;  3SGI A;  3IFX A;  2FYU H;  1SS3 A;  1OCO C;  4LF4 O;  1IZ3 A;  4I0X B;  3U0Z A;  2XUM A;  4I4T B;  5KX5 A;  2ZE8 A;  4DXW A;  1JJO A;  4JAS A;  4X1I B;  2AZ2 A;  2CTR A;  4JI2 B;  3THO A;  3QO7 A;  3OR6 C;  5KLV H;  3CRQ A;  3LNM B;  4BR6 A;  4DV4 O;  1P7B A;  2BTO A;  4B3S B;  4KL1 A;  3E35 A;  4WBN B;  2WA3 A;  1YSC A;  4CH4 A;  4YHH B;  1FFX B;  2LW1 A;  4D7T A;  3CRR A;  4UV8 A;  4DR6 B;  2LFS A;  3OGI B;  2DWD C;  4ICG A;  1AI6 A;  5LA6 B;  4DRX B;  3RN4 A;  2E5L O;  1AI4 A;  4MTG A;  1JQ0 A;  5H2F Z;  4FZ1 A;  5LOV B;  4CS3 A;  1KBH A;  2X7R B;  4LWS B;  3OT7 A;  2DQ0 A;  4YXW G;  2QEX V;  4LH6 A;  3SYA A;  1FD9 A;  3L75 H;  3CMA V;  3QNE A;  2XAG A;  2AGA A;  3MDS A;  2HVJ C;  2PI4 A;  1FKA O;  4GKK O;  4FMT A;  3DC5 A;  1M4U A;  3I56 V;  1O9H A;  1TVK B;  3O9O A;  2W0F C;  3QVN A;  5IY5 B;  1AR1 B;  4LFB O;  4B3T O;  4WFA V;  1OCZ C;  2IH3 C;  2VQF B;  1VF6 C;  5JQG B;  1YVW A;  1KMI Z;  2A0L A;  5IYC O;  5GTI Z;  4X1K A;  3BPZ A;  5EIB C;  4HYO A;  3JD0 A;  1SQG A;  4DV6 B;  1Q7Y W;  4LF7 O;  2QSA A;  3FB6 C;  2A3Q A;  4H0L B;  2UXB O;  3JCZ A;  1KB9 F;  1I5Y A;  1KUQ A;  4CC5 A;  1Z5W A;  1TAE A;  1YF2 A;  3ZRW A;  2ZM6 O;  3HKC B;  2F93 B;  4LNU B;  3BA9 A;  3F7V C;  4TSF G;  2ITD C;  1FFX A;  4DV2 B;  4YJ2 A;  2D3O W;  2E3C A;  4X88 A;  1BCC H;  3JD3 A;  2O57 A;  1SQX H;  4H37 A;  3CRA A;  2QTO A;  4DW0 A;  2NN4 A;  5EC2 C;  2ATK C;  4RQE A;  4DV1 B;  2CH7 B;  4X64 B;  1OCO B;  1AB3 A;  1SQV H;  1K4D C;  1NJI W;  2VQE O;  3OEE G;  1PNK A;  3RYF B;  1JX9 A;  1WP7 A;  4DK0 A;  3FFQ A;  3L74 H;  2A79 B;  1AJP A;  1CXZ B;  5JH7 A;  1GRJ A;  1N8R W;  5KA6 A;  1H8H G;  1Z5V A;  4QPK A;  2DMX A;  1FAF A;  4X89 A;  2A7W A;  2VS0 A;  3JAK A;  1SF9 A;  3K59 A;  5B1A B;  3AG4 C;  2PI5 A;  2WLK A;  3B2E E;  1M57 C;  1PNM A;  4DR4 B;  1VAR A;  3K79 A;  1NH2 B;  3ABK C;  2ADP A;  3SJQ C;  1X59 A;  4ZIB A;  5JWP A;  3BRC A;  3FB8 C;  4PJ0 Z;  4C7U A;  5C93 A;  1IBL O;  3FYE B;  2QGN A;  2WLI A;  3JAR B;  1AJN A;  2X0L A;  1FXK B;  2F43 G;  1YIJ V;  2JGD B;  4EB6 A;  1MSD A;  3NR7 A;  3C90 A;  4L8J A;  1L8D A;  1FYJ A;  2WLH A;  4I9W A;  5LHH A;  1N34 O;  3K58 A;  2ZR2 A;  3ZMZ A;  4RO2 A;  3H9V A;  2YXH A;  1KC8 W;  5E1A C;  2IW5 A;  1K73 W;  1DF4 A;  4DW1 A;  4JAV A;  3SYO A;  2ODM A;  3JAT A;  1PPJ H;  1QLE B;  3W7W A;  3K5N A;  5KMG A;  4KP4 A;  1G1X B;  4B3T B;  1R6N A;  4LF9 O;  1FXV A;  1LUW A;  1DTO A;  2L6L A;  3AK1 A;  2YXY A;  1VF7 A;  4IHJ B;  5DM6 V;  4DV6 O;  4LF7 B;  3VOU A;  1S76 D;  2OCC B;  1XNR O;  1WNS A;  3OTO O;  5GTH Z;  2EIN C;  3B09 A;  3JAW A;  2PYL A;  2Q73 A;  4E4E A;  1HP8 A;  2YIB A;  4P9P A;  3ABL B;  1KEC A;  4DK1 A;  3K9S A;  2ZNI A;  3ZHQ A;  3RYH A;  1PL4 A;  4IIJ A;  4JZ2 A;  1ROP A;  1VF5 B;  3CX5 F;  4J10 A;  2JVD A;  4DV3 B;  1EN6 A;  1P84 F;  3GVM A;  1YXB A;  4TWK A;  5KHI A;  3W7T A;  1FPO A;  3MHH C;  2ZT9 B;  4CS4 A;  1B3Q A;  3IJ4 A;  4JI0 O;  4UCU A;  3RYC A;  4K8Z A;  1V9P A;  3K06 A;  3DXR A;  4HBN A;  4N21 A;  5IYB O;  2H94 A;  4R6Z A;  4MW3 A;  4FK5 C;  4LF4 B;  1WB8 A;  3ABM C;  4DR2 O;  1UPG A;  4DV7 B;  4FM1 A;  4LF6 O;  2CUG A;  1ZUQ A;  2QWQ B;  4XDK A;  2ZIN A;  5IDJ A;  3HR0 A;  2B1G A;  3E22 A;  1VQP V;  1QVG U;  2IJH A;  2P7T C;  1H2L A;  2CGO A;  1VMG A;  2LQT A;  1BSM A;  3JYC A;  4JYB A;  4BIO A;  1XMQ O;  2AXT Z;  4I0X A;  2YUA A;  4JTA B;  1CPY A;  1IBL B;  1EFR G;  3K5M A;  3B4S A;  1IDS A;  2W6J G;  2NLJ C;  4P9O A;  1XBL A;  4MVS A;  1NS1 A;  3RGB A;  3IGA C;  2UXX A;  5KUK A;  1S5L Z;  1SQF A;  2PTM A;  2WLJ A;  1DLB A;  3ETD A;  2QR4 A;  3HKC A;  4IIJ B;  2EIJ B;  3UQ8 A;  1WA8 B;  2FTK A;  4UCO A;  4JI4 B;  5L3B A;  3N2G A;  4K0K B;  1FXK A;  5LGU A;  4BAY A;  2XAJ A;  5DN6 G;  1JFF B;  4QJF B;  2GV9 A;  1GM9 A;  1Y6X A;  4J42 A;  3H1H H;  4TQD A;  2ITC C;  1P4R A;  3B40 A;  5H6R A;  1QR8 A;  2RCV A;  2WLL B;  1SER A;  2BCC H;  4CZZ A;  4LP8 A;  1FXH A;  1OCC B;  2QTS A;  1VQ6 V;  3VQY A;  1XL4 A;  3SYP A;  5FPO A;  4NXN O;  1FS0 G;  2DE0 X;  3ZHV A;  4TT3 G;  5KA5 A;  1YEW A;  3D36 C;  1BS3 A;  3TXS A;  4WFF A;  4UVC A;  1IXB A;  2UXB B;  2R9A A;  4R50 A;  4CH6 A;  3PJS K;  1O9G A;  5K1P A;  3ZED A;  3ABT A;  3BCC H;  3L72 H;  1J95 A;  1HNX B;  3CC2 V;  1AR4 A;  4O2A A;  1G6U A;  3KKY A;  2PZS A;  3UO2 A;  4LFA O;  5B1B C;  3N2K A;  4X62 B;  4EB6 B;  4O4L A;  4PDM A;  1Y74 A;  1H8E G;  2EIL B;  2OYQ A;  4H33 A;  3ABM B;  2AW9 A;  5IYZ A;  1W59 A;  2LGQ A;  2JS5 A;  2LW7 A;  1KD1 W;  3ZRW B;  1FJG O;  5BZB A;  1S5H C;  2RQ6 A;  3EVK A;  1S0V A;  4O4L B;  2R70 A;  4D7S A;  2YIB D;  1H2K A;  4JZG A;  2E76 B;  2KQX A;  1SET A;  1RPR A;  5EYP A;  1MNG A;  1L1F A;  3D3I A;  2YI8 A;  1Y76 B;  1K4C C;  2F66 C;  4X9Q A;  4TV8 B;  2YC0 A;  3F5W C;  1JR9 A;  4I5S A;  3DXR B;  3K04 A;  4HZ3 A;  3CCJ V;  2EUL A;  2QKC A;  3WB0 A;  4D6T H;  1W0K G;  2V1D A;  5L3G A;  3Q4H B;  4JYA O;  1M90 W;  1WAZ A;  5B5E Z;  1H2G A;  3RFR A;  4PI0 A;  2Y69 C;  2DYR C;  5IWA B;  2OT5 A;  3RVZ A;  3E22 B;  1Q90 D;  4TQF A;  2RMK B;  1GN2 A;  4X1Y B;  2IH1 C;  1BQ0 A;  3S3X A;  5KAF Z;  3ZIA G;  3JD4 A;  1ENV A;  1RPO A;  4JI1 O;  4KXR A;  4LFC O;  1XOU A;  2K1E A;  1CEZ A;  3K08 A;  1URF A;  3C3T A;  3SJC C;  2ZQM A;  1HDJ A;  4JI4 O;  4EEQ A;  3H1I H;  1ZL8 A;  4K35 A;  1JPX A;  3CD6 V;  1IX9 A;  1THZ A;  4KHP O;  5CMU A;  3JAW B;  3F5T A;  3JCU Z;  5BMV A;  4JI6 O;  1QU7 A;  3LDC A;  3EXA A;  4JI2 O;  5BR8 O;  2ILM A;  4LF9 B;  4Q6G A;  4AI8 A;  1GM8 A;  4I50 B;  3HKE B;  3W7S A;  2Q0O C;  2CK3 G;  1GN4 A;  3IC9 A;  3ZHR A;  3KCX A;  4DV0 O;  1GO3 F;  2Q8V A;  4JI8 B;  1BL8 A;  4FFB B;  5LGT A;  1Q82 W;  3OTO B;  1VQ7 V;  5J2T B;  4UVA A;  4CC6 A;  1HNW B;  2DYS B;  4O2B B;  5IJ0 A;  4JPR A;  3ZJZ A;  1XMO B;  3M8A A;  4BIU A;  3KG2 A;  2JDI G;  4J80 A;  4LFA B;  1GN3 A;  3GWK C;  3CS5 A;  3ZBH A;  5GON A;  4WF9 V;  1PD3 A;  3ZHS A;  1EM1 A;  3CRC A;  2UUA B;  1PP9 H;  3J81 N;  3AG1 C;  1PM9 A;  2Y0P A;  3R65 A;  3ZMS A;  5IT9 N;  1OJH A;  4LR3 A;  2Q7H A;  4X1I A;  5E79 Z;  1OCR C;  3N2K B;  2YIC A;  4MW8 A;  3B77 A;  4DUY O;  1N33 B;  5ITZ B;  3CCE V;  2PUS A;  4GX1 A;  3FX7 A;  4GX2 A;  4UUJ C;  4B08 A;  3VBB A;  5KHH A;  3CE2 A;  4Z1V A;  2A9H A;  4IGG A;  2QJ1 A;  2F23 A;  2UUC B;  4R8C A;  3G67 A;  1MZE A;  1OHH G;  1AI5 A;  1QQC A;  1X4T A;  3WU2 Z;  4LNU A;  3ZCC A;  1W0J G;  4DUZ B;  1ORQ C;  3T2M A;  5EZY A;  2EIJ C;  3OFN G;  3K0G A;  1V55 B;  1SA0 A;  5FL7 G;  3RVY A;  3T1C A;  1EN4 A;  2YIA A;  3GB7 C;  4JI1 B;  2QKS A;  4UV9 A;  1QLN A;  4J7K A;  3ZHU A;  3RT3 C;  2DN9 A;  5DEC A;  4DV1 O;  1N0N A;  2CTW A;  4ZBM A;  1PV0 A;  1Z2G A;  2LFR A;  4TV9 B;  3CME V;  1MZF A;  1NR7 A;  5EBL C;  2N04 A;  2GBO A;  2HHH B;  1Q6U A;  1VQ8 V;  3ICX A;  5BY1 A;  2WWW A;  1BT8 A;  2Q4P A;  1XRE A;  3T1H O;  2NR5 A;  3ZX6 A;  1YTF B;  1YZB A;  1B06 A;  1RM1 C;  3J7A U;  2Y48 A;  3UKM A;  2QWP B;  4JI6 B;  1HNZ O;  4R7C A;  1N0J A;  4J7J A;  5B3S C;  4GZR B;  5BR8 B;  3LSQ A;  3TET A;  5LMN B;  4U3J B;  3LUT B;  2ZD9 A;  5EYP B;  1OCZ B;  1RP3 B;  1SQP H;  4K8X A;  2JEX A;  3DC6 A;  5IE9 A;  2XAF A;  5D5P A;  4DV4 B;  5H9C A;  5A2Q N;  4DV0 B;  2PGG A;  3SYQ A;  2QKA A;  1RSO B;  1XUQ A;  1GTO A;  2IJI A;  3VQV A;  3AG3 B;  3AK3 A;  3X2Q B;  2WLM A;  3FYI B;  1COW G;  4FJC C;  1NQT A;  5AG2 A;  1XMO O;  1QVF U;  3I5D A;  4RAI A;  5LOV A;  1N36 O;  2P4K A;  1SA0 B;  3K5L A;  5DED A;  2P67 A;  1LR1 A;  4FFB A;  4FM0 A;  1P49 A;  5J2T A;  2BTQ A;  4QE9 A;  2XHB A;  2JK5 C;  3EFF K;  3OUS A;  3E83 A;  5LXT A;  1LNQ A;  4MVU A;  4I4T A;  4HAM A;  1BHB A;  2OTJ V;  5LL6 Y;  2QDO A;  3FB5 C;  2F95 B;  3SJB C;  3CWB H;  2DQ3 A;  4GKK B;  4UFZ A;  4NYK A;  1N33 O;  3AG2 B;  4G27 B;  1XNQ B;  5BMV B;  3QO5 A;  2IM9 A;  3E8H A;  1ZAU A;  2P22 C;  2YID A;  1R6T A;  2VQF O;  1GMG A;  2IJJ A;  1NBM G;  5B1B B;  1Y66 A;  5CBF A;  5IYD O;  2UUC O;  1UJW B;  4QPJ A;  4ZKI A;  4PA9 A;  2DYR B;  2H8P C;  2Q7G A;  3QF7 A;  4NTW A;  1XIL A;  1XI1 A;  3HKE A;  4JYA B;  4OX9 O;  2WPD G;  4EFB A;  1I7F A;  3D36 A;  3I55 V;  3BY6 A;  1ZTE A;  4WFE A;  3UT5 A;  1M5I A;  3CJH A;  4O4H A;  4TUY A;  5LYJ B;  2Z0A A;  3ETE A;  4DYL A;  5KMG B;  3W7X A;  2HG5 C;  3K0D A;  5BXZ A;  4MVZ A;  2XTA A;  5CBG A;  4O4H B;  4TUY B;  2HHH O;  2UUB O;  1J5E B;  1GKF A;  4BW9 A;  1IBM O;  4AQY B;  4ASU G;  4J7Z A;  2OIG A;  3CCR V;  4MVM A;  5L3F A;  5B1A C;  1VQ4 V;  5EK0 A;  2ZIM A;  3LDE A;  1IBK B;  2IBZ H;  1NH2 D;  2A06 H;  4TOI A;  4YY3 O;  5LMN O;  4DV7 O;  4NTY A;  1BE3 H;  4UB8 Z;  1KKC A;  5GON B;  4LH7 A;  2B5U A;  4JI7 O;  5KHK A;  1I94 O;  1Q5O A;  2JGU A;  4FLY A;  2QWR B;  5IYZ B;  4YIP A;  2XAS A;  3AG7 A;  5D5Q A;  4ZOL B;  3M7M X;  1M9N A;  3BAA A;  3KZI Z;  5J9P C;  1H2M A;  1QHT A;  3JD2 A;  4MVO A;  1SZX A;  3BAB A;  1Y4M A;  3A0B Z;  3JD1 A;  2YDE A;  3TXQ A;  1JVM A;  3TCU A;  3AG1 B;  2GTS A;  2HVK C;  1VQM V;  2ZXW C;  4F4L A;  2EIM B;  3HB3 B;  1TUB B;  3P32 A;  1BHA A;  4X65 O;  1OCR B;  2YI9 A;  5KAI Z;  5CA0 A;  3CCS V;  3OW2 U;  3D3Q A;  4B7E A;  4PA3 A;  4BIZ A;  3SR2 C;  2CAZ C;  2YXL A;  3DGE A;  2FML A;  3H1L H;  3STZ C;  4MVQ A;  1XNQ O;  3CP1 A;  2UXD B;  3ML0 A;  1TUE B;  4B3R B;  5LMU B;  2ADQ B;  1AVM A;  4JAU A;  4YJ3 B;  1K8A W;  3OR7 C;  4JYY A;  1MAB G;  4UCV A;  4IHJ A;  1ARO P;  4GKJ O;  1DF5 A;  2Z3Y A;  2QWO B;  2JJ1 G;  2XAH A;  1PKX A;  5KHG A;  2N05 A;  2KG7 B;  3CC4 V;  5LP6 C;  3U11 A;  3RYH B;  4PD4 F;  5KUM A;  1M56 C;  1HNX O;  1Q8I A;  1I5X A;  2MW2 B;  1H2S B;  4OPH A;  2EIK C;  2OTL V;  1AJQ A;  4FLT A;  2BSK A;  2Q7E A;  3RYI B;  4WFB V;  3N27 A;  3JAT B;  3MAQ A;  1ZWI C;  4DR3 O;  1GH6 A;  3E86 A;  2W6I G;  2WLL A;  1N32 B;  2EZO A;  1ZSP A;  1E1R G;  4MT8 A;  3ABU A;  2BOB C;  3OMA B;  1IVS A;  5JCO C;  2YEV B;  4WCE V;  1IBK O;  2VWJ A;  2PYJ A;  1NT2 B;  1P7G A;  2QM7 A;  4FPP A;  1NTZ H;  3SPH A;  4GLX A;  5F2V O;  3SPI A;  1HNZ B;  4K3A A;  2N74 A;  4Q20 A;  1KP3 A;  4TV8 A;  1OCC C;  4UCT A;  3BHP A;  2QWN B;  2UXC B;  3JSL A;  2WSS G;  4QGP A;  3LSS A;  4JI5 B;  3T1Y B;  3QO8 A;  1I94 B;  4FLW A;  1TVK A;  3BFR A;  5LXT B;  4ABM A;  3PN1 A;  1OV9 A;  1VQO V;  1Q81 W;  4DR6 O;  3ZMT A;  3JAL B;  3U10 A;  1XHX A;  1MOF A;  5HFL A;  4AIL C;  4NR1 A;  2WAM A;  4PEL A;  5LHI A;  3A0R A;  4PA4 A;  1SES A;  1E79 G;  5A9G A;  4PI2 A;  5EBM C;  2UXN A;  1XEQ A;  3RBZ A;  4X65 B;  2R9I A;  3A8T A;  1YJ9 V;  4I9Q A;  3CYO A;  2MK3 A;  3W7U A;  1L0L H;  2V4D A;  5B3S B;  4LBE C;  2AZ0 A;  4W4K A;  3ZN1 A;  1SKV A;  3E8F A;  4HNA A;  3OAA G;  3N2G B;  4K0K O;  5FLX N;  3BEH A;  4GYC B;  5LP6 A;  2IU0 A;  4KHP B;  4FZ0 A;  1NVP D;  2DW4 A;  1RFY A;  2UXD O;  2BTQ B;  2FB5 A;  4GX0 A;  1GN6 A;  5LMU O;  3RYF A;  4DR7 B;  5LHG A;  5LP6 B;  4OXS A;  2X6B A;  1R1B A;  5FNV B;  1WLE A;  3CB2 A;  1H2N A;  3E8G A;  3MD0 A;  4ZHQ B;  2ZE7 A;  2ZCE A;  5JQG A;  1EZJ A;  2M7W A;  4PDL A;  4NXN B;  1BQZ A;  2YSU B;  4JI8 O;  1AI7 A;  3CXC U;  1Q86 W;  1LUV A;  1IUR A;  1M57 B;  1HNW O;  3P3P A;  5EBW C;  3JSN A;  1R3I C;  4ZOL A;  1M93 A;  2K9P A;  5JVD A;  2QM4 A;  4DV2 O;  1Q3E A;  4FM2 A;  3ABK B;  2P6J A;  4DR1 O;  2P4V A;  5C8Y B;  4LF5 O;  2M6Y A;  1BMF G;  5CA1 B;  4X66 O;  5L3D A;  2KG7 A;  3BA8 A;  5LGN A;  5EC1 C;  4DR5 O;  2ZR3 A;  1MMM A;  1Y74 B;  4RUE A;  4A5U B;  5GW7 A;  3ASN C;  4P30 A;  3G6E V;  4FVM A;  1R73 A;  4X64 O;  2ETN A;  1Y67 A;  1JCH A;  4JYC A;  4PDR A;  5CN0 A;  3ZMU A;  4O4I B;  1RM1 B;  4LF8 O;  2Q6A A;  2UUB B;  4DUY B;  1J5E O;  2IJK A;  1NU1 H;  4XBF A;  1IBM B;  2JS3 A;  1YDX A;  4N23 A;  3L71 H;  4OPA A;  5KHJ A;  3JAK B;  3OD4 A;  4CS2 A;  1K92 A;  3ZRV A;  1IXM A;  3WB1 A;  1Y76 A;  2IU3 A;  5JJJ B;  5JJN B;  2RNB A;  4DR4 O;  1VQN V;  2F4V O;  1WPB A;  3T1Y O;  4JI5 O;  1G4Y B;  2GHY A;  3E2E A;  2Q5Z A;  1SRY A;  5K1X A;  4JI3 B;  1KU9 A;  1VP7 A;  3OGC C;  4X1Y A;  4YHH O;  3FB7 C;  3OTF A;  3OE7 G;  3L70 H;  3RW0 A;  1ZLZ A;  3OUF A;  5IWA O;  4KUM A;  4MSW C;  2E5L B;  2JIZ G;  2Q0A A;  2BOC C;  1QNM A;  3K3W A;  2AHY A;  1GAX A;  4F6E A;  3ZN0 A;  4BWA A;  4UB6 Z;  1ZL8 B;  4LFC B;  1FXK C;  3H01 A;  1L0N H;  4DO2 A;  4OGQ B;  5CBH A;  2RJZ A;  1PL0 A;  3WFV A;  3JAS B;  4YJ2 B;  2EIL C;  3L73 H;  1SC5 B;  1K33 A;  3QTC A;  2YEV A;  3UM7 A;  1R6K A;  3M99 B;  2DJV A;  4IYH A;  1YI2 V;  1JFF A;  4F6R B;  4Z2W A;  2NNU A;  2UU9 B;  1NTK H;  3B8N A;  2CH7 A;  5L3C A;  4LC1 A;  3A2F A;  2E74 B;  4P2Z A;  1VQ5 V;  2OCH A;  3Q4H A;  3CCM V;  3CC7 V;  3AG4 B;  3E8B A;  2ZXW B;  4B3M O;  3NXS A;  4QIW F;  3UO3 A;  1I08 A;  4H44 B;  3ZMV A;  5IY5 C;  3ASO C;  1XHZ A;  3TK1 A;  5LYJ A;  3CEI A;  1H38 A;  4LWS A;  4UCR A;  1V54 B;  2OIE A;  4PA7 A;  1HW7 A;  3ZRX A;  4CH5 A;  2F1M A;  4J9Y B;  2CE4 A;  2BE3 A;  4O2B A;  5IJ0 B;  1YJN V;  1YIT V;  2Q68 A;  1BGY H;  2P5O A;  1HR0 B;  4EFE A;  1AP5 A;  2CDY A;  3WG7 B;  3FAV B;  4ZI7 A;  4WFG A;  1JA8 A;  1NVP B;  2GDS A;  1T5E A;  3ABL C;  3QG5 A;  4JV5 O;  1YTF D;  1D5A A;  3P30 A;  3K5O A;  1N4C A;  4Z1M G;  1S5J A;  1XDC A;  2D2C B;  2ZE5 A;  2Y0I A;  1W2B U;  5TIS Z;  4X8A A;  2QM8 A;  4FLZ A;  3IAY A;  5B1N A;  3AG2 C;  2X6C A;  1M1K W;  3HKD B;  3DSQ A;  1R3K C;  1N32 O;  5L3E A;  2VQE B;  2GSM B;  3G4S V;  3JAS A;  1QBZ A;  2DWE C;  2ZDI A;  1DK1 A;  2HEP A;  3L9D A;  1WA8 A;  3WG7 C;  2BSK B;  4HNA B;  5ITZ A;  4UXN A;  1U96 A;  4PHZ A;  1RSO A;  4MS2 A;  3JAM N;  2Q69 A;  3OMN B;  5IJ9 B;  4GX5 A;  5CA3 A;  4O4I A;  3G80 A;  5CB4 B;  4LF6 B;  4MTO A;  2JEU A;  2HJD A;  1EBO A;  4IYI A;  3H1K H;  4J11 A;  1JMK C;  4X20 B;  3APQ A;  2ARH A;  1QLE C;  4L87 A;  1XMQ B;  4JI3 O;  3F7Y C;  1F4N A;  3CHX A;  2DOS A;  2HKO A;  1Q6H A;  4DV5 O;  1V55 C;  4RUF A;  3ETG A;  3CCV V;  1K3E A;  2EBO A;  3HKB B;  4IL6 Z;  1MG1 A;  4O4J A;  5JH7 B;  1K9M W;  2WLI B;  1UFI A;  5CA1 A;  5H6Q A;  2JJ2 G;  4XDJ A;  4TV9 A;  2EIN B;  1YHQ V; 
#chains in the Genus database with same CATH homology
 1Y74 B;  1Y76 B;  1Y74 A;  1VF6 C;  3B40 A;  1VF6 A;  1ZL8 A;  1ZL8 B;  1Y76 A;  1RSO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...