1RSOB

Hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
GLLAAERAVSQVLDSLEEIHALTDSSEKDLDFLHSVFQDQHLHTLLDLYDKINTKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The tetrameric L27 domain complex as an organization platform for supramolecular assemblies
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Neuropeptide/membrane protein
molecule keywords Presynaptic protein SAP97
total genus 18
structure length 56
sequence length 56
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1rsoB00
3B40A 1VF6C 1VF6A 1ZL8A 1Y74B 1ZL8B 1Y74A 1Y76B 1Y76A 1RSOB
chains in the Genus database with same CATH superfamily
4WFGA 2JJ1G 2KG7B 4DW1A 4CH6A 4X1KB 3AG3C 2WWWA 5JCOC 4UCTA 5IT9N 4X62O 4X89A 4AI8A 1VQ7V 2QTOA 4DV1O 1QU7A 1NBMG 2QKCA 5BR8B 1Z5VA 2ZNIA 3GB7C 4O2BB 4B3SO 1R6KA 1ZSPA 3M8AA 3CYOA 4UVBA 5KHKA 2ZD9A 4X64O 5HFMA 3ZRVA 1R1BA 5EZYB 2JK5C 3CMEV 2CTRA 2ZE8A 1OCCB 1VQ9V 5KUKA 3AEIA 3AK2A 3SPHA 3IAYA 5K1XA 3WU2Z 1PL4A 1NKDA 1GM8A 2UXDB 1YSCA 4TV9A 4AILC 5IYCO 4YJ3A 3FB8C 1JJOA 3KCXA 4YJ2A 1KECA 2P6JA 2OCCC 3AG1B 4JI2B 3X2QC 5FPRA 2JEXA 2E5LO 3K9AA 4JV5B 4UCSA 2ZR2A 2CK3G 5L3DA 4U7NA 1G4YB 1YHQV 3ABTA 5GTHZ 3RFRA 4CH3A 2PTMA 3OMNB 1V54C 2VS0A 2XAHA 2UUAB 3JARB 4JI1O 2Z5UA 3B2EE 4UFZA 1QBZA 4DV0B 1YIJV 1SA0B 4DR6B 1XNQB 2NLJC 1VMGA 2UXBB 4TOIA 2A9HA 4UVCA 1XILA 1AJQA 1GKFA 2P4VA 4MTXA 3IFXA 3DC5A 3IGAC 1B6QA 2ZR3A 3A8TA 3UO2A 1CXZB 4B7EA 4JTDB 3B8MA 2ILMA 2ADQB 1AP6A 3CHXA 3JSNA 1TGOA 3ZHUA 1AI6A 3AG1C 4LP8A 2O57A 1EZJA 3TETA 4LF9O 1IZ3A 1M57C 3T1YB 5C8YA 1K4DC 4I9QA 3FB5C 4DR1B 3R66A 5KX5B 2Q67A 5LYJA 2HEPA 2BOCC 4ZI7B 2DQ0A 1R6NA 5LMUB 1T5EA 4X8AA 3KZIZ 3QTCA 4WFEA 1OJHA 1H2SB 3SJCC 3JAMN 2UUCB 4A5UB 4EFBA 3JYCA 5AG2A 4HNAA 3JASB 4WFBV 1NZ6A 4JF3A 5J2TB 3E8HA 2HKOA 2JVDA 4LFAO 3MHSC 4I50B 3CMAV 2E74B 4DR3O 2BTOA 3I5DA 1UJWB 2BSKA 3Q4HA 4MVUA 5JJEB 2BOBC 2Q4PA 2QM8A 1WB7A 3JCUZ 2B5UA 4H37A 2ODMA 3PN1A 4OPAA 1AJNA 1P7GA 4P2ZA 4FMTA 1FPOA 4NTXA 4B3MB 4QJFB 4TV8A 1WPXA 2QKSA 1S5LZ 4LF7B 1H38A 2KQXA 3ZHSA 1THZA 5CBGA 4UVAA 1GM7A 3LUTB 5KA5A 2Y0PA 4TWKA 2Y4TA 5H6QA 4DV2B 5E79Z 4DR5O 1W2BU 1J95A 4O4HB 1KQSU 1AR5A 2JGUA 4JGSA 3JD4A 1H2KA 3LDDA 2OYQA 4QPJA 3A0HZ 4NXMB 1BQZA 1SQXH 4MSWC 4DUZO 2UUAO 3RYFA 2N04A 1Y6XA 1BHAA 2KG7A 3ZIAG 1GN2A 1PL0A 5B1NA 1HNXO 2X7RB 3OFNG 3BEHA 2PUSA 1VQMV 1N36B 2ZIMA 1Y66A 1O9GA 5LP6A 1YVWA 4R7CA 3G80A 3O9OA 5CBHA 3UO3A 2ZDIA 4TUYB 4UXNA 1SF9A 5IY5C 5BY1A 4PA3A 4JI8B 3ZS8C 5B1BC 1NH2D 1H8HG 4U7OA 1K97A 1YJ9V 4OGQB 2ZNJA 5J2UA 1WNSA 4G2KA 4LF4B 2EILB 2AZ0A 1RPRA 4KUMA 3LDCA 4FZ1A 2DMXA 1FJGB 2F43G 5EIBC 1QR8A 1E1RG 5L3BA 4NXMO 1AR4A 3ASNC 5KHGA 1F4NA 4FLTA 1G6UA 1Q86W 1SQQH 1JMKC 4BIOA 1RM1B 1M1KW 2N05A 2ZE7A 2YUAA 2E75B 3U11A 4DV4O 4J7ZA 2GUZA 5IJ9B 2JS3A 4G28B 4E2LA 1AP5A 1PP9H 5DN6G 4WFFA 1TVKA 2YEVB 4IL6Z 1SQPH 4KP4A 1URFA 3ML0A 3FAVA 2ZINA 3P32A 2G38A 1TUBA 1KBHA 3HB3B 2ZKOA 2RNBA 3FB7C 2OCCB 5J2UB 2YIBD 4QE9A 2UU9B 3G6EV 4MVOA 3CC2V 1FJGO 1FXKC 2UUCO 1N0NA 4BWAA 4LNUA 4FM0A 1COWG 1XDCA 1VEWA 3CC7V 3HKCA 1Q43A 5E1AC 5IE9A 5LMUO 1BGYH 1K33A 4JYBA 3JATA 1NVPD 3F5WC 4EB6A 1XL4A 4JI4O 2HHHO 5FNVB 1XMQO 2QDOA 4YXWG 3CCMV 1RSOB 4DR5B 4MVQA 4JYYA 2F95B 5LOVB 1K9MW 3E22B 2ADPA 4PDMA 3LSUA 1ZL8B 1LUWA 3CEIA 4I4TB 1IVSA 2K1EA 3L74H 4B7KA 2AXTZ 2QJ1A 1K8AW 5EBWC 2Y0IA 1K73W 2WLHA 2A7WA 4O4IA 1FXVA 5EC1C 5LMNB 2UUBO 5IJ0B 4LF7O 2M6YA 4TSFG 1IBMB 5CMUA 1N8RW 1GN4A 4DV2O 4DUYO 3H1LH 2ZT9B 1SQFA 1P7BA 1XREA 3QO7A 1UFIA 2XNDG 3T2MA 4D7TA 2YI8A 3SYQA 4EFEA 1MSWD 4PJ0Z 3G67A 2V7QG 4O2AB 2JDIG 4W4LA 3BHPA 1KB9F 2P7TC 1V55C 2R72A 5LP6C 4B3TO 4J10A 4I7ZB 2CTPA 2OTJV 1AB3A 1VQ6V 2RQ6A 4NKGB 3FYEB 2PGGA 4QPKA 3QF7A 1TUEB 3J7AU 2EJ7A 3SYPA 1SERA 4TV9B 1I5XA 5L3GA 2F4VB 3MDSA 1V55B 1I94O 3OW2U 2P90A 5C93A 1US6A 2LFSA 3B09A 2WLNA 2GTAA 1FFTB 1X59A 2C2AA 1BL8A 2NR5A 3SGIA 4DV5B 2W6JG 2DYSC 4LH6A 3S3WA 2E76B 3VQVA 1VQNV 5B1AB 3SR2C 3ABMC 2VQFO 3CRRA 1BE3H 1KC8W 4AQYO 4FM1A 5LA6B 1OCOC 2EJRA 1KP2A 3APOA 2P22C 3K5MA 2ZQMA 3AG7A 3CRQA 5D5PA 2RN9A 1PNLA 4GX1A 4JI8O 3P3NA 4JI5O 5EYPA 2B1IA 4O2AA 5CN0A 2DWEC 1E1QG 5H9CA 2AHZA 1SA0A 1DF5A 2H3OA 3CJHB 5LP6B 2LW7A 5A9GA 4ZBMA 4FIPC 5EK0A 2UXXA 3SPIA 1U96A 5GW7A 3VQYA 1WP7A 5GTIZ 3GWOA 3KCYA 4P9PA 4PDLA 1V9PA 3T4DA 3BA9A 3T4ZA 5JCOA 3BRCA 1R6TA 3U0ZA 4FLZA 1N32O 1EN6A 2XTAA 4E4EA 1AI5A 1FS0G 1NI8A 1YTFD 5B66Z 3IC7A 2ZCEA 4GX2A 3W7SA 1HW7A 2NNUA 4GKJO 3CCRV 2CTWA 1I5YA 2Q0OC 2EIJC 3BAAA 1XOUA 3OEEG 1M56C 1R3IC 1Z5WA 1BQ0A 5EYPB 3QO8A 3ZHQA 4J9YB 1HNXB 1BS3A 5IJ9A 1OZ0A 1PKXA 4JI4B 1WJZA 4K3AA 1YI2V 5KHJA 1H8EG 4WBNA 2R9IA 3SYAA 4BW5A 1PD3A 2Q0AA 3LSQA 1Q6IA 4MTGA 4TUYA 2W0FC 4GKKO 4JYCA 1XEQA 2AHYA 4X1YA 3K04A 1Q81W 1IBKO 1M57B 4IIJA 4DV6O 2DWDC 4B3SB 5JJJB 1N32B 4WF9V 4X64B 5KHIA 5LMNO 1YTFB 4YJ3B 4H13B 2PY5A 3VBBA 5CA0B 4YIOA 4YJ2B 4ASUG 4NXNB 1OCZB 3SPGA 1Y76A 3PJSK 5B1AC 1VQOV 4F6RB 3I56V 1Q5OA 4LF8O 5EC2C 2R9RB 2IH3C 4K0KB 5FL7G 1QHTA 1YXBA 4J42A 2RMKB 2W6IG 3SYOA 3N2KA 4YY3B 1HNWO 1MOFA 2LP7A 4GLXA 1PNMA 2DW4A 2XASA 3K59A 3SDLA 3T1HO 3ZMZA 2EIKC 2FTKA 2P06A 3JARA 1K5SA 4KFMA 2AZ2A 1MZFA 3WFVA 3H1JH 2XOKG 3FYIB 3OGCC 2HLDG 2F4VO 3ZX6A 2Q6AA 4KXRA 1D5AA 3ZRSA 3E8BA 4BIUA 2WLIA 2EIKB 3KG2A 4IT5A 3CCUV 2RCVA 1AR1B 2RJZA 1JA8A 2UXBO 3N2GB 1WA8B 2PYJA 3AG2B 2CH7B 5KMGA 4PI0A 1OCRC 2QGNA 4TQFA 2KKWA 1XBLA 4F6RA 4X20B 1VQLV 4LF8B 2ZIOA 4XDLA 4K0KO 3ZHVA 1FD9A 3SJQC 4JAUA 2JIZG 3ZMVA 4O4JA 4JI5B 2DOSA 2QSAA 4LFCB 3N2KB 4DK1A 4MS2A 2QE7G 5LYJB 4P30A 4W4KA 1PNKA 4LWSA 3CCEV 1DLBA 4YIPA 4UCOA 3GVMA 3MAQA 1G1XB 3QNEA 3ZRWA 1Q7YW 1ZUQA 4KHPB 3QG5A 4JI3O 4U3FH 4N21A 3ZJZA 1MABG 3LSSA 1NT2B 3IC9A 2F93B 1L1FA 3CCQV 1EZVH 2Q69A 3UCSC 1GO3F 1WP8A 4BIZA 4JI0B 2EINC 4PDRA 3P3PA 5CA1A 3E86A 2X0LA 3DGEA 3H01A 2JJ2G 3CCSV 5JQGA 5LA6A 4CH4A 2BSKB 2GHYA 1FAFA 1MSDA 3HKEA 3H1HH 1QVFU 3AG2C 4LFBB 3D8CA 1H2MA 3STLC 4WCEV 4UUJC 4RQEA 4GKJB 1IBKB 3HKDA 2X6BA 4OX9B 4GX5A 3JALA 3W7UA 1RM1C 1KD1W 3AK1A 3K57A 4O4LB 1H2GA 3B77A 3RT3C 1M4UA 3STZC 1YJNV 1H2LA 2QR4A 2Q8VA 2WAMA 3JSLA 3SJAC 4HAMA 2EULA 1W59A 4DYLA 1SZXA 1IX9A 4MTFA 2WLJA 2WLKA 1HNWB 3RGBA 1QLEB 5JH7B 3RYCB 3HKBB 5GONA 1PPJH 3OTOB 2B9ZA 2QWPB 4IYIA 4TQDA 3EHBB 4AQYB 1VQKV 1FYJA 4R8CA 3RWRD 2F23A 4BR6A 1NTKH 1JVMA 3K06A 2CAZC 2MW2B 3BY6A 4O2BA 1SQVH 2V1DA 2HG5C 1ROPA 4HYOA 3ZMTA 4DR6O 4AHCA 3F7VC 3ETQA 1EM1A 4DV5O 3ZRXA 5FLXN 1IURA 4ZHQB 1N36O 4N23A 1P49A 2Q68A 1YF2A 2XAFA 5LHIA 2W0XA 3A2FA 4X1YB 3UM7A 5CBFA 1F23A 1KKCA 1ZAUA 3BPZA 3RYHA 1N33O 4YHHO 1DF4A 2LW1A 1BCCH 3W7TA 2A0LA 2BTQB 3C3SA 4MVMA 4JAVA 3EXAA 1W0JG 2ZDIC 1EN5A 4FJCC 1M56B 4PA9A 4YY3O 3AG4B 4JZGA 1K92A 3ZHRA 1VF6C 4H44B 3RN4A 1NTMH 4DR7B 2CGOA 2FYUH 3RVYA 2HJDA 2ATKC 4IYHA 1YEWA 4LF9B 2R9AA 4ZOLB 2R70A 3T1YO 5H5NA 3CCLV 4X66O 4X9QA 1SQGA 1XUQA 2DYSB 3SYCA 1RPOA 3ETDA 4FLUA 2IW5A 5KLVH 4DRXB 2N74A 1Z2GA 1S5JA 4KL1A 1BMFG 3SJBC 2QWOB 1GAXA 1E79G 1NR1A 5LBQA 5LHHA 4TT3G 5B1BB 1S3JA 1SKVA 3K5NA 1ZX3A 1L0NH 3ZCCA 3EFFK 1M90W 4HBNA 2YIDA 3RYHB 1XI1A 1NQTA 3L73H 4R6ZA 4LF6O 3Q4HB 4JASA 4PA4A 5J9PC 2GTSA 2WA3A 2XAQA 1HWYA 2YI9A 3W7XA 2HP8A 5KAIZ 5IYZA 4LFCO 4H0LB 4DXWA 5BMVB 2YXLA 1CPYA 2Z0AA 3CCVV 5C8YB 3NR7A 1JFFA 4CC6A 3VQXA 5BXZA 4GZRB 4B3MO 4X65B 1B3QA 1BHBA 4GKKB 4J80A 4RUFA 1N0JA 4B3RO 2FMLA 1GRJA 3T1CA 2XAGA 3E22A 4I5SA 4DV1B 4FLXA 1XMQB 1FFXA 1Q90D 2Y48A 5JWPA 3OM3B 4F4LA 1WLEA 3X2QB 4DV3B 3JAKB 1XL6A 2IJHA 4C7UA 3FAVB 4NTWA 1LNQA 1AVMA 4HNAB 3CB2A 1KP3A 3ASOC 1KU9A 3K5OA 1H2NA 3B40A 5LGUA 4DW0A 3K9SA 3ICXA 3ZMSA 1J5EB 5B3SC 3JCZA 4UB8Z 5IYZB 1M5IA 5BMVA 2WSSG 3CXHF 3HKCB 3JD0A 3RW0A 1I7FA 1NVPB 4DO2A 3O65A 5FPOA 3N27A 1LUVA 2MK3A 4EB6B 3CXCU 1BT8A 1EBOA 2WLLB 3M99B 2VWJA 1BZKA 3AG3B 2VQEB 3OAAG 3OTFA 4YHHB 5A2QN 2CTQA 3C3TA 2YICA 4PD4F 3P30A 4I9WA 3D3IA 4ICGA 3U10A 1PV0A 4JTAB 4IGGA 1HNZB 3OD4A 4GUNA 4U3JA 1OCCC 1GN6A 3OTOO 3RYIA 3M7MX 1K7DA 4O4HA 4DV3O 2EIJB 3D3QA 3JAKA 4CS4A 3OEHG 1TA8A 4NB5A 1MG1A 1QCEA 2XAJA 3UQ8A 1XNQO 3MHHC 2A79B 2LGWA 4PA6A 2QWNB 2FKXA 3L72H 4L87A 2OCHA 2UU9O 5H2FZ 4ZKIA 4RQFA 5J2TA 1VIBA 2Q7EA 4QE7A 1Y67A 2AGAA 2ITDC 4I50A 2GUZB 5B1OA 3OGIB 4K35A 3LNNA 1YITV 3WG7C 2BE3A 2V4DA 1YZBA 2ETNA 4I0XA 1AILA 1G8MA 5IYDO 1V54B 4JAAA 5B3SB 1N33B 2XUMA 3EVKA 1PM9A 2WLMA 2H94A 4NYKA 3OMIB 3ASNB 3FB6C 3JD2A 1MA1A 4GCZA 1HNZO 1O9HA 1GMGA 1QQCA 3CRAA 3SPCA 1TAEA 4JPRA 4ZI7A 1N34B 1VQPV 4GX0A 4PHZA 4EEQA 4LH7A 3DTUB 4CBCA 3ABLC 2CE4A 4X65O 2QWQB 2QM7A 4X1IB 2P4KA 4MVZA 4X20A 2EIMB 4RWUA 4B3RB 1GK9A 1N4CA 4H33A 5JH7A 3RYCA 2B1GA 3R65A 1KUQA 5JVDA 4ZOLA 2YIAA 4WFHA 5LOVA 4DR3B 4JI7B 4FZ0A 1GN3A 1HR0O 2OIEA 4DV7O 1JOYA 3L75H 3MD0A 1SESA 4UCVA 1TVKB 2GDSA 2WPDG 2YEVA 3GWKC 2PYLA 2FL4A 2YC0A 1FXKB 1VP7A 1SS3A 3ZEDA 1XMOB 3K0DA 1ZLZA 1DGSA 2YS8A 4LBEC 4PDVA 1QVGU 5LGTA 1NTZH 1BSMA 1IBMO 4RUEA 1SQBH 1A32A 2JGDB 4LC1A 4DUYB 4LF5O 4JTCB 1NJIW 5KA6A 3H9VA 4UCRA 3WB1A 2VQEO 3K5LA 2YXHA 1WAZA 4X1IA 3FD9A 5LXTA 4LR3A 2OIGA 3HR0A 3A0RA 1AJPA 1ZTEA 1K34A 5FNVA 3CC4V 4DR7O 4CC5A 4BW9A 1JFFB 2YDEA 2IM9A 2EILC 5EBLC 5LHGA 1VQ4V 2X6AA 3QO5A 2Y4UA 4MT8A 3ZBHA 4NXNO 2ZM6O 5B5EZ 2EBOA 4UV8A 1U97A 5IWAO 1XMOO 1I08A 4IHJB 5ITZA 1K5QA 2KSDA 2L35A 3OR7C 4NTYA 1R3LC 4GT1A 1OV9A 1IXBA 1L0LH 1K3EA 3TGUH 4FFKA 2QA4V 4QIWF 2VQFB 3OT7A 4QGPA 4FLWA 1S72V 2IH1C 2CUGA 1SC5B 3ZMUA 4X66B 3FX7A 1ORQC 4RAIA 1YJWV 1XQ8A 1L8DA 2IU3A 2HR3A 2DE0X 2OWOA 1JCHA 3KKYA 4Q20A 5IDJA 2P67A 3F7YC 4FK5C 4Z1MG 5LL6Y 3JATB 3ETGA 4DR4B 4LCUC 2PZSA 1AI7A 1HP8A 5KX5A 3JD1A 1JQ0A 2K9PA 3ABKB 2DQ3A 3TXSA 4X1KA 3AG4C 4DV4B 2GV9A 3TXQA 3ABMB 2KB1A 1XHZA 4IHJA 4LF6B 4P9OA 3E89A 1ENVA 1Q6HA 3ZHTA 1B06A 1RFYA 2OT5A 2GSMB 4NVPA 1P4RA 1TUBB 3S3XA 4XDKA 4JYAO 3F5TA 1QR9A 5EBMC 2BCCH 1N34O 4ZIBA 3L70H 4CZZA 3BVOA 1Q8IA 1QLNA 1VQ5V 5EIBD 4JI3B 3ZN1A 3VOUA 1M93A 1GTOA 1NU1H 1WB8A 3WG7B 1CEZA 1EN4A 2CH7A 5KMGB 1EFRG 1JJ2U 3CRCA 3HKEB 4WBNB 1IBLB 1Q82W 2QTSA 2AW9A 3BFRA 4Z2WA 4JI7O 1AI4A 4J7JA 1XNRB 3JALB 1VF7A 3THOA 4LFBO 4X62B 2LQTA 3K08A 4JI6B 1Y74B 3ABKC 2CDYA 1D5NA 4DV6B 3B8NA 3ETEA 1J5EO 1W0KG 2ZE5A 3E35A 3RYIB 3QVNA 4DUZB 3K79A 1UPGA 2QM4A 1R73A 4MW8A 4BAYA 2IU0A 3J80N 3CPWU 1HR0B 3CS5A 3UT5A 1S77D 4J11A 2DYRC 4J9ZB 2UXNA 2EINB 5IJ0A 1OCRB 2JS5A 2DJVA 3K0GA 3RBZA 2YIBA 4PV1B 3IJ4A 3VQWA 5CA1B 3HKBA 2A3QA 1FKAO 1Q6UA 1SRYA 3OR6C 4ABMA 5KUMA 5KAFZ 2F66C 3FKSG 5F2VO 1DK1A 1K4CC 4MVRA 4FLVA 2HVKC 3CE2A 2LGQA 4B3TB 2ZXWB 1JPXA 2ZM6B 3DC6A 1VF6A 3K58A 2OTLV 3D36A 1NS1A 2IJKA 1ZWIC 4R50A 2JGDA 1X4TA 3WB0A 3TCUA 4OPHA 2M7WA 1I94B 2ZXWC 3N2GA 3E2EA 5CA0A 4K8XA 3CWBH 3K3WA 2CGNA 5D5QA 2BTQA 2IBZH 3G71V 3ABUA 3DXRB 1QNMA 1NR7A 1QLEC 5LXTB 5IWAB 5L3CA 4X88A 4Z1VA 4FLYA 1VF5B 1F4MA 1KMIZ 3SPJA 3JD3A 1Q3EA 4Q6GA 3A0BZ 1LR1A 1KKDA 2PI5A 2F1MA 4JV5O 3E8FA 4O4JB 4DR2O 3TJTA 4FPPA 4J7KA 3ASOB 4CS2A 4F6EA 1ZL8A 4I4TA 4DV7B 4LWSB 5DECA 3CCJV 1IDSA 1RP3B 4HZ3A 3LDEA 1FXKA 4KHPO 2ITCC 3OUSA 5EZYA 1P84F 3H1IH 1I0HA 3CJHA 2UXCO 2QEXV 2VRZA 5K1PA 4JI0O 2JEUA 3NXSA 2VWKA 4DR4O 4WFAV 2EZOA 5BR8O 2IJJA 2HHHB 2Q7GA 4PI2A 1S5HC 2ARHA 4FM2A 1S76D 1XNRO 3UKMA 4JYAB 4FFBA 3I55V 2FB5A 4UCUA 1CP9A 5DEDA 2D3OW 2Y69B 4OX9O 4LFAB 1RSOA 2PI4A 1OCOB 2PF4E 5IY5B 5CB4A 2UUBB 4LF5B 1D2DA 4OXSA 2E3CA 3W7WA 4JI2O 2P5OA 1F7YA 2NN4A 1R3KC 4K8ZA 1VQ8V 2E5LB 2JRIA 3JASA 4FVMA 4MTOA 2Q73A 2HFEC 2Q5ZA 5JVDB 1IXMA 2QWRB 1MMMA 3HPLC 1JX9A 4DV0O 1B04A 3K03A 1DTOA 2YXYA 4I55A 4D7SA 4FFBB 1F51A 1OHHG 3C90A 1KYOF 5BZBA 2UXDO 3APQA 1SETA 2Y69C 3OMAB 4XDJA 5IYBO 4MW3A 3ABLB 2WLLA 5CB4B 4PELA 4TV8B 4XBFA 3D36C 2EIMC 5LGNA 3TK1A 2H8PC 2L6LA 5CA3A 3BCCH 4U3JB 2IJIA 1FXHA 3T1HB 1FFXB 1HDJA 3OUFA 1NH2B 4NR1A 2Z3YA 2LO1A 2ZE6A 4DK0A 3CX5F 1XHXA 2Q9LA 3FFQA 2QKAA 4L8JA 4JZ2A 3G6BA 3UT5B 2RDCA 3BABA 3JAWA 1YDXA 3H1KH 5GONB 4CS3A 1GM9A 2Q7HA 4JI1B 1R3JC 1WPBA 3CD6V 2WLIB 4LF4O 4PA7A 1YCIA 4MVSA 3E8GA 4I55B 5KHHA 2GBOA 4LNUB 5JQGB 2UXCB 4DR1O 4GYCB 1OCZC 1WA8A 5DM6V 4DRXA 1JR9A 4QNHB 2XHBA 5ITZB 5TISZ 5HFLA 2WA4A 3G4SV 1IBLO 2DN9A 4I0XB 2XT9A 4DR2B 4D6TH 3B4SA 3HKDB 3CSXA 1MZEA 4G27B 4ZHQA 3LNMB 1VARA 3J81N 2LJ2A 3WB2A 3CP1A 3E83A 2DYRB 1Y74A 1MNGA 3L71H 4CH5A 4UB6Z 4UV9A 4JI6O 2HJFC 4O4LA 4IIJB 2EZPA 3DSQA 3OE7G 2D2CB 2LFRA 3RVZA 1M9NA 4B08A 2X6CA 2EX3A 2A06H 3CRMA 1SZTA 2YSUB 1WN7A 1GH6A 1Y4MA 3ZRWB 3BA8A 5JJNB 5L3FA 5H6RA 1AROP 1S0VA 1Y76B 3JAWB 4O4IB 4RO2A 2HVJC 3DXRA 4EKWA 4J41A 3AK3A 3ZN0A 3RYFB 3L9DA 5L3EA
chains in the Genus database with same CATH topology
3B40A 1VF6C 1VF6A 1ZL8A 1Y74B 1ZL8B 1Y74A 1Y76B 1Y76A 1RSOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B40 A;  1VF6 C;  1VF6 A;  1ZL8 A;  1Y74 B;  1ZL8 B;  1Y74 A;  1Y76 B;  1Y76 A;  1RSO B; 
#chains in the Genus database with same CATH topology
 4WFG A;  2JJ1 G;  2KG7 B;  4DW1 A;  4CH6 A;  4X1K B;  3AG3 C;  2WWW A;  5JCO C;  4UCT A;  5IT9 N;  4X62 O;  4X89 A;  4AI8 A;  1VQ7 V;  2QTO A;  4DV1 O;  1QU7 A;  1NBM G;  2QKC A;  5BR8 B;  1Z5V A;  2ZNI A;  3GB7 C;  4O2B B;  4B3S O;  1R6K A;  1ZSP A;  3M8A A;  3CYO A;  4UVB A;  5KHK A;  2ZD9 A;  4X64 O;  5HFM A;  3ZRV A;  1R1B A;  5EZY B;  2JK5 C;  3CME V;  2CTR A;  2ZE8 A;  1OCC B;  1VQ9 V;  5KUK A;  3AEI A;  3AK2 A;  3SPH A;  3IAY A;  5K1X A;  3WU2 Z;  1PL4 A;  1NKD A;  1GM8 A;  2UXD B;  1YSC A;  4TV9 A;  4AIL C;  5IYC O;  4YJ3 A;  3FB8 C;  1JJO A;  3KCX A;  4YJ2 A;  1KEC A;  2P6J A;  2OCC C;  3AG1 B;  4JI2 B;  3X2Q C;  5FPR A;  2JEX A;  2E5L O;  3K9A A;  4JV5 B;  4UCS A;  2ZR2 A;  2CK3 G;  5L3D A;  4U7N A;  1G4Y B;  1YHQ V;  3ABT A;  5GTH Z;  3RFR A;  4CH3 A;  2PTM A;  3OMN B;  1V54 C;  2VS0 A;  2XAH A;  2UUA B;  3JAR B;  4JI1 O;  2Z5U A;  3B2E E;  4UFZ A;  1QBZ A;  4DV0 B;  1YIJ V;  1SA0 B;  4DR6 B;  1XNQ B;  2NLJ C;  1VMG A;  2UXB B;  4TOI A;  2A9H A;  4UVC A;  1XIL A;  1AJQ A;  1GKF A;  2P4V A;  4MTX A;  3IFX A;  3DC5 A;  3IGA C;  1B6Q A;  2ZR3 A;  3A8T A;  3UO2 A;  1CXZ B;  4B7E A;  4JTD B;  3B8M A;  2ILM A;  2ADQ B;  1AP6 A;  3CHX A;  3JSN A;  1TGO A;  3ZHU A;  1AI6 A;  3AG1 C;  4LP8 A;  2O57 A;  1EZJ A;  3TET A;  4LF9 O;  1IZ3 A;  1M57 C;  3T1Y B;  5C8Y A;  1K4D C;  4I9Q A;  3FB5 C;  4DR1 B;  3R66 A;  5KX5 B;  2Q67 A;  5LYJ A;  2HEP A;  2BOC C;  4ZI7 B;  2DQ0 A;  1R6N A;  5LMU B;  1T5E A;  4X8A A;  3KZI Z;  3QTC A;  4WFE A;  1OJH A;  1H2S B;  3SJC C;  3JAM N;  2UUC B;  4A5U B;  4EFB A;  3JYC A;  5AG2 A;  4HNA A;  3JAS B;  4WFB V;  1NZ6 A;  4JF3 A;  5J2T B;  3E8H A;  2HKO A;  2JVD A;  4LFA O;  3MHS C;  4I50 B;  3CMA V;  2E74 B;  4DR3 O;  2BTO A;  3I5D A;  1UJW B;  2BSK A;  3Q4H A;  4MVU A;  5JJE B;  2BOB C;  2Q4P A;  2QM8 A;  1WB7 A;  3JCU Z;  2B5U A;  4H37 A;  2ODM A;  3PN1 A;  4OPA A;  1AJN A;  1P7G A;  4P2Z A;  4FMT A;  1FPO A;  4NTX A;  4B3M B;  4QJF B;  4TV8 A;  1WPX A;  2QKS A;  1S5L Z;  4LF7 B;  1H38 A;  2KQX A;  3ZHS A;  1THZ A;  5CBG A;  4UVA A;  1GM7 A;  3LUT B;  5KA5 A;  2Y0P A;  4TWK A;  2Y4T A;  5H6Q A;  4DV2 B;  5E79 Z;  4DR5 O;  1W2B U;  1J95 A;  4O4H B;  1KQS U;  1AR5 A;  2JGU A;  4JGS A;  3JD4 A;  1H2K A;  3LDD A;  2OYQ A;  4QPJ A;  3A0H Z;  4NXM B;  1BQZ A;  1SQX H;  4MSW C;  4DUZ O;  2UUA O;  3RYF A;  2N04 A;  1Y6X A;  1BHA A;  2KG7 A;  3ZIA G;  1GN2 A;  1PL0 A;  5B1N A;  1HNX O;  2X7R B;  3OFN G;  3BEH A;  2PUS A;  1VQM V;  1N36 B;  2ZIM A;  1Y66 A;  1O9G A;  5LP6 A;  1YVW A;  4R7C A;  3G80 A;  3O9O A;  5CBH A;  3UO3 A;  2ZDI A;  4TUY B;  4UXN A;  1SF9 A;  5IY5 C;  5BY1 A;  4PA3 A;  4JI8 B;  3ZS8 C;  5B1B C;  1NH2 D;  1H8H G;  4U7O A;  1K97 A;  1YJ9 V;  4OGQ B;  2ZNJ A;  5J2U A;  1WNS A;  4G2K A;  4LF4 B;  2EIL B;  2AZ0 A;  1RPR A;  4KUM A;  3LDC A;  4FZ1 A;  2DMX A;  1FJG B;  2F43 G;  5EIB C;  1QR8 A;  1E1R G;  5L3B A;  4NXM O;  1AR4 A;  3ASN C;  5KHG A;  1F4N A;  4FLT A;  1G6U A;  1Q86 W;  1SQQ H;  1JMK C;  4BIO A;  1RM1 B;  1M1K W;  2N05 A;  2ZE7 A;  2YUA A;  2E75 B;  3U11 A;  4DV4 O;  4J7Z A;  2GUZ A;  5IJ9 B;  2JS3 A;  4G28 B;  4E2L A;  1AP5 A;  1PP9 H;  5DN6 G;  4WFF A;  1TVK A;  2YEV B;  4IL6 Z;  1SQP H;  4KP4 A;  1URF A;  3ML0 A;  3FAV A;  2ZIN A;  3P32 A;  2G38 A;  1TUB A;  1KBH A;  3HB3 B;  2ZKO A;  2RNB A;  3FB7 C;  2OCC B;  5J2U B;  2YIB D;  4QE9 A;  2UU9 B;  3G6E V;  4MVO A;  3CC2 V;  1FJG O;  1FXK C;  2UUC O;  1N0N A;  4BWA A;  4LNU A;  4FM0 A;  1COW G;  1XDC A;  1VEW A;  3CC7 V;  3HKC A;  1Q43 A;  5E1A C;  5IE9 A;  5LMU O;  1BGY H;  1K33 A;  4JYB A;  3JAT A;  1NVP D;  3F5W C;  4EB6 A;  1XL4 A;  4JI4 O;  2HHH O;  5FNV B;  1XMQ O;  2QDO A;  4YXW G;  3CCM V;  1RSO B;  4DR5 B;  4MVQ A;  4JYY A;  2F95 B;  5LOV B;  1K9M W;  3E22 B;  2ADP A;  4PDM A;  3LSU A;  1ZL8 B;  1LUW A;  3CEI A;  4I4T B;  1IVS A;  2K1E A;  3L74 H;  4B7K A;  2AXT Z;  2QJ1 A;  1K8A W;  5EBW C;  2Y0I A;  1K73 W;  2WLH A;  2A7W A;  4O4I A;  1FXV A;  5EC1 C;  5LMN B;  2UUB O;  5IJ0 B;  4LF7 O;  2M6Y A;  4TSF G;  1IBM B;  5CMU A;  1N8R W;  1GN4 A;  4DV2 O;  4DUY O;  3H1L H;  2ZT9 B;  1SQF A;  1P7B A;  1XRE A;  3QO7 A;  1UFI A;  2XND G;  3T2M A;  4D7T A;  2YI8 A;  3SYQ A;  4EFE A;  1MSW D;  4PJ0 Z;  3G67 A;  2V7Q G;  4O2A B;  2JDI G;  4W4L A;  3BHP A;  1KB9 F;  2P7T C;  1V55 C;  2R72 A;  5LP6 C;  4B3T O;  4J10 A;  4I7Z B;  2CTP A;  2OTJ V;  1AB3 A;  1VQ6 V;  2RQ6 A;  4NKG B;  3FYE B;  2PGG A;  4QPK A;  3QF7 A;  1TUE B;  3J7A U;  2EJ7 A;  3SYP A;  1SER A;  4TV9 B;  1I5X A;  5L3G A;  2F4V B;  3MDS A;  1V55 B;  1I94 O;  3OW2 U;  2P90 A;  5C93 A;  1US6 A;  2LFS A;  3B09 A;  2WLN A;  2GTA A;  1FFT B;  1X59 A;  2C2A A;  1BL8 A;  2NR5 A;  3SGI A;  4DV5 B;  2W6J G;  2DYS C;  4LH6 A;  3S3W A;  2E76 B;  3VQV A;  1VQN V;  5B1A B;  3SR2 C;  3ABM C;  2VQF O;  3CRR A;  1BE3 H;  1KC8 W;  4AQY O;  4FM1 A;  5LA6 B;  1OCO C;  2EJR A;  1KP2 A;  3APO A;  2P22 C;  3K5M A;  2ZQM A;  3AG7 A;  3CRQ A;  5D5P A;  2RN9 A;  1PNL A;  4GX1 A;  4JI8 O;  3P3N A;  4JI5 O;  5EYP A;  2B1I A;  4O2A A;  5CN0 A;  2DWE C;  1E1Q G;  5H9C A;  2AHZ A;  1SA0 A;  1DF5 A;  2H3O A;  3CJH B;  5LP6 B;  2LW7 A;  5A9G A;  4ZBM A;  4FIP C;  5EK0 A;  2UXX A;  3SPI A;  1U96 A;  5GW7 A;  3VQY A;  1WP7 A;  5GTI Z;  3GWO A;  3KCY A;  4P9P A;  4PDL A;  1V9P A;  3T4D A;  3BA9 A;  3T4Z A;  5JCO A;  3BRC A;  1R6T A;  3U0Z A;  4FLZ A;  1N32 O;  1EN6 A;  2XTA A;  4E4E A;  1AI5 A;  1FS0 G;  1NI8 A;  1YTF D;  5B66 Z;  3IC7 A;  2ZCE A;  4GX2 A;  3W7S A;  1HW7 A;  2NNU A;  4GKJ O;  3CCR V;  2CTW A;  1I5Y A;  2Q0O C;  2EIJ C;  3BAA A;  1XOU A;  3OEE G;  1M56 C;  1R3I C;  1Z5W A;  1BQ0 A;  5EYP B;  3QO8 A;  3ZHQ A;  4J9Y B;  1HNX B;  1BS3 A;  5IJ9 A;  1OZ0 A;  1PKX A;  4JI4 B;  1WJZ A;  4K3A A;  1YI2 V;  5KHJ A;  1H8E G;  4WBN A;  2R9I A;  3SYA A;  4BW5 A;  1PD3 A;  2Q0A A;  3LSQ A;  1Q6I A;  4MTG A;  4TUY A;  2W0F C;  4GKK O;  4JYC A;  1XEQ A;  2AHY A;  4X1Y A;  3K04 A;  1Q81 W;  1IBK O;  1M57 B;  4IIJ A;  4DV6 O;  2DWD C;  4B3S B;  5JJJ B;  1N32 B;  4WF9 V;  4X64 B;  5KHI A;  5LMN O;  1YTF B;  4YJ3 B;  4H13 B;  2PY5 A;  3VBB A;  5CA0 B;  4YIO A;  4YJ2 B;  4ASU G;  4NXN B;  1OCZ B;  3SPG A;  1Y76 A;  3PJS K;  5B1A C;  1VQO V;  4F6R B;  3I56 V;  1Q5O A;  4LF8 O;  5EC2 C;  2R9R B;  2IH3 C;  4K0K B;  5FL7 G;  1QHT A;  1YXB A;  4J42 A;  2RMK B;  2W6I G;  3SYO A;  3N2K A;  4YY3 B;  1HNW O;  1MOF A;  2LP7 A;  4GLX A;  1PNM A;  2DW4 A;  2XAS A;  3K59 A;  3SDL A;  3T1H O;  3ZMZ A;  2EIK C;  2FTK A;  2P06 A;  3JAR A;  1K5S A;  4KFM A;  2AZ2 A;  1MZF A;  3WFV A;  3H1J H;  2XOK G;  3FYI B;  3OGC C;  2HLD G;  2F4V O;  3ZX6 A;  2Q6A A;  4KXR A;  1D5A A;  3ZRS A;  3E8B A;  4BIU A;  2WLI A;  2EIK B;  3KG2 A;  4IT5 A;  3CCU V;  2RCV A;  1AR1 B;  2RJZ A;  1JA8 A;  2UXB O;  3N2G B;  1WA8 B;  2PYJ A;  3AG2 B;  2CH7 B;  5KMG A;  4PI0 A;  1OCR C;  2QGN A;  4TQF A;  2KKW A;  1XBL A;  4F6R A;  4X20 B;  1VQL V;  4LF8 B;  2ZIO A;  4XDL A;  4K0K O;  3ZHV A;  1FD9 A;  3SJQ C;  4JAU A;  2JIZ G;  3ZMV A;  4O4J A;  4JI5 B;  2DOS A;  2QSA A;  4LFC B;  3N2K B;  4DK1 A;  4MS2 A;  2QE7 G;  5LYJ B;  4P30 A;  4W4K A;  1PNK A;  4LWS A;  3CCE V;  1DLB A;  4YIP A;  4UCO A;  3GVM A;  3MAQ A;  1G1X B;  3QNE A;  3ZRW A;  1Q7Y W;  1ZUQ A;  4KHP B;  3QG5 A;  4JI3 O;  4U3F H;  4N21 A;  3ZJZ A;  1MAB G;  3LSS A;  1NT2 B;  3IC9 A;  2F93 B;  1L1F A;  3CCQ V;  1EZV H;  2Q69 A;  3UCS C;  1GO3 F;  1WP8 A;  4BIZ A;  4JI0 B;  2EIN C;  4PDR A;  3P3P A;  5CA1 A;  3E86 A;  2X0L A;  3DGE A;  3H01 A;  2JJ2 G;  3CCS V;  5JQG A;  5LA6 A;  4CH4 A;  2BSK B;  2GHY A;  1FAF A;  1MSD A;  3HKE A;  3H1H H;  1QVF U;  3AG2 C;  4LFB B;  3D8C A;  1H2M A;  3STL C;  4WCE V;  4UUJ C;  4RQE A;  4GKJ B;  1IBK B;  3HKD A;  2X6B A;  4OX9 B;  4GX5 A;  3JAL A;  3W7U A;  1RM1 C;  1KD1 W;  3AK1 A;  3K57 A;  4O4L B;  1H2G A;  3B77 A;  3RT3 C;  1M4U A;  3STZ C;  1YJN V;  1H2L A;  2QR4 A;  2Q8V A;  2WAM A;  3JSL A;  3SJA C;  4HAM A;  2EUL A;  1W59 A;  4DYL A;  1SZX A;  1IX9 A;  4MTF A;  2WLJ A;  2WLK A;  1HNW B;  3RGB A;  1QLE B;  5JH7 B;  3RYC B;  3HKB B;  5GON A;  1PPJ H;  3OTO B;  2B9Z A;  2QWP B;  4IYI A;  4TQD A;  3EHB B;  4AQY B;  1VQK V;  1FYJ A;  4R8C A;  3RWR D;  2F23 A;  4BR6 A;  1NTK H;  1JVM A;  3K06 A;  2CAZ C;  2MW2 B;  3BY6 A;  4O2B A;  1SQV H;  2V1D A;  2HG5 C;  1ROP A;  4HYO A;  3ZMT A;  4DR6 O;  4AHC A;  3F7V C;  3ETQ A;  1EM1 A;  4DV5 O;  3ZRX A;  5FLX N;  1IUR A;  4ZHQ B;  1N36 O;  4N23 A;  1P49 A;  2Q68 A;  1YF2 A;  2XAF A;  5LHI A;  2W0X A;  3A2F A;  4X1Y B;  3UM7 A;  5CBF A;  1F23 A;  1KKC A;  1ZAU A;  3BPZ A;  3RYH A;  1N33 O;  4YHH O;  1DF4 A;  2LW1 A;  1BCC H;  3W7T A;  2A0L A;  2BTQ B;  3C3S A;  4MVM A;  4JAV A;  3EXA A;  1W0J G;  2ZDI C;  1EN5 A;  4FJC C;  1M56 B;  4PA9 A;  4YY3 O;  3AG4 B;  4JZG A;  1K92 A;  3ZHR A;  1VF6 C;  4H44 B;  3RN4 A;  1NTM H;  4DR7 B;  2CGO A;  2FYU H;  3RVY A;  2HJD A;  2ATK C;  4IYH A;  1YEW A;  4LF9 B;  2R9A A;  4ZOL B;  2R70 A;  3T1Y O;  5H5N A;  3CCL V;  4X66 O;  4X9Q A;  1SQG A;  1XUQ A;  2DYS B;  3SYC A;  1RPO A;  3ETD A;  4FLU A;  2IW5 A;  5KLV H;  4DRX B;  2N74 A;  1Z2G A;  1S5J A;  4KL1 A;  1BMF G;  3SJB C;  2QWO B;  1GAX A;  1E79 G;  1NR1 A;  5LBQ A;  5LHH A;  4TT3 G;  5B1B B;  1S3J A;  1SKV A;  3K5N A;  1ZX3 A;  1L0N H;  3ZCC A;  3EFF K;  1M90 W;  4HBN A;  2YID A;  3RYH B;  1XI1 A;  1NQT A;  3L73 H;  4R6Z A;  4LF6 O;  3Q4H B;  4JAS A;  4PA4 A;  5J9P C;  2GTS A;  2WA3 A;  2XAQ A;  1HWY A;  2YI9 A;  3W7X A;  2HP8 A;  5KAI Z;  5IYZ A;  4LFC O;  4H0L B;  4DXW A;  5BMV B;  2YXL A;  1CPY A;  2Z0A A;  3CCV V;  5C8Y B;  3NR7 A;  1JFF A;  4CC6 A;  3VQX A;  5BXZ A;  4GZR B;  4B3M O;  4X65 B;  1B3Q A;  1BHB A;  4GKK B;  4J80 A;  4RUF A;  1N0J A;  4B3R O;  2FML A;  1GRJ A;  3T1C A;  2XAG A;  3E22 A;  4I5S A;  4DV1 B;  4FLX A;  1XMQ B;  1FFX A;  1Q90 D;  2Y48 A;  5JWP A;  3OM3 B;  4F4L A;  1WLE A;  3X2Q B;  4DV3 B;  3JAK B;  1XL6 A;  2IJH A;  4C7U A;  3FAV B;  4NTW A;  1LNQ A;  1AVM A;  4HNA B;  3CB2 A;  1KP3 A;  3ASO C;  1KU9 A;  3K5O A;  1H2N A;  3B40 A;  5LGU A;  4DW0 A;  3K9S A;  3ICX A;  3ZMS A;  1J5E B;  5B3S C;  3JCZ A;  4UB8 Z;  5IYZ B;  1M5I A;  5BMV A;  2WSS G;  3CXH F;  3HKC B;  3JD0 A;  3RW0 A;  1I7F A;  1NVP B;  4DO2 A;  3O65 A;  5FPO A;  3N27 A;  1LUV A;  2MK3 A;  4EB6 B;  3CXC U;  1BT8 A;  1EBO A;  2WLL B;  3M99 B;  2VWJ A;  1BZK A;  3AG3 B;  2VQE B;  3OAA G;  3OTF A;  4YHH B;  5A2Q N;  2CTQ A;  3C3T A;  2YIC A;  4PD4 F;  3P30 A;  4I9W A;  3D3I A;  4ICG A;  3U10 A;  1PV0 A;  4JTA B;  4IGG A;  1HNZ B;  3OD4 A;  4GUN A;  4U3J A;  1OCC C;  1GN6 A;  3OTO O;  3RYI A;  3M7M X;  1K7D A;  4O4H A;  4DV3 O;  2EIJ B;  3D3Q A;  3JAK A;  4CS4 A;  3OEH G;  1TA8 A;  4NB5 A;  1MG1 A;  1QCE A;  2XAJ A;  3UQ8 A;  1XNQ O;  3MHH C;  2A79 B;  2LGW A;  4PA6 A;  2QWN B;  2FKX A;  3L72 H;  4L87 A;  2OCH A;  2UU9 O;  5H2F Z;  4ZKI A;  4RQF A;  5J2T A;  1VIB A;  2Q7E A;  4QE7 A;  1Y67 A;  2AGA A;  2ITD C;  4I50 A;  2GUZ B;  5B1O A;  3OGI B;  4K35 A;  3LNN A;  1YIT V;  3WG7 C;  2BE3 A;  2V4D A;  1YZB A;  2ETN A;  4I0X A;  1AIL A;  1G8M A;  5IYD O;  1V54 B;  4JAA A;  5B3S B;  1N33 B;  2XUM A;  3EVK A;  1PM9 A;  2WLM A;  2H94 A;  4NYK A;  3OMI B;  3ASN B;  3FB6 C;  3JD2 A;  1MA1 A;  4GCZ A;  1HNZ O;  1O9H A;  1GMG A;  1QQC A;  3CRA A;  3SPC A;  1TAE A;  4JPR A;  4ZI7 A;  1N34 B;  1VQP V;  4GX0 A;  4PHZ A;  4EEQ A;  4LH7 A;  3DTU B;  4CBC A;  3ABL C;  2CE4 A;  4X65 O;  2QWQ B;  2QM7 A;  4X1I B;  2P4K A;  4MVZ A;  4X20 A;  2EIM B;  4RWU A;  4B3R B;  1GK9 A;  1N4C A;  4H33 A;  5JH7 A;  3RYC A;  2B1G A;  3R65 A;  1KUQ A;  5JVD A;  4ZOL A;  2YIA A;  4WFH A;  5LOV A;  4DR3 B;  4JI7 B;  4FZ0 A;  1GN3 A;  1HR0 O;  2OIE A;  4DV7 O;  1JOY A;  3L75 H;  3MD0 A;  1SES A;  4UCV A;  1TVK B;  2GDS A;  2WPD G;  2YEV A;  3GWK C;  2PYL A;  2FL4 A;  2YC0 A;  1FXK B;  1VP7 A;  1SS3 A;  3ZED A;  1XMO B;  3K0D A;  1ZLZ A;  1DGS A;  2YS8 A;  4LBE C;  4PDV A;  1QVG U;  5LGT A;  1NTZ H;  1BSM A;  1IBM O;  4RUE A;  1SQB H;  1A32 A;  2JGD B;  4LC1 A;  4DUY B;  4LF5 O;  4JTC B;  1NJI W;  5KA6 A;  3H9V A;  4UCR A;  3WB1 A;  2VQE O;  3K5L A;  2YXH A;  1WAZ A;  4X1I A;  3FD9 A;  5LXT A;  4LR3 A;  2OIG A;  3HR0 A;  3A0R A;  1AJP A;  1ZTE A;  1K34 A;  5FNV A;  3CC4 V;  4DR7 O;  4CC5 A;  4BW9 A;  1JFF B;  2YDE A;  2IM9 A;  2EIL C;  5EBL C;  5LHG A;  1VQ4 V;  2X6A A;  3QO5 A;  2Y4U A;  4MT8 A;  3ZBH A;  4NXN O;  2ZM6 O;  5B5E Z;  2EBO A;  4UV8 A;  1U97 A;  5IWA O;  1XMO O;  1I08 A;  4IHJ B;  5ITZ A;  1K5Q A;  2KSD A;  2L35 A;  3OR7 C;  4NTY A;  1R3L C;  4GT1 A;  1OV9 A;  1IXB A;  1L0L H;  1K3E A;  3TGU H;  4FFK A;  2QA4 V;  4QIW F;  2VQF B;  3OT7 A;  4QGP A;  4FLW A;  1S72 V;  2IH1 C;  2CUG A;  1SC5 B;  3ZMU A;  4X66 B;  3FX7 A;  1ORQ C;  4RAI A;  1YJW V;  1XQ8 A;  1L8D A;  2IU3 A;  2HR3 A;  2DE0 X;  2OWO A;  1JCH A;  3KKY A;  4Q20 A;  5IDJ A;  2P67 A;  3F7Y C;  4FK5 C;  4Z1M G;  5LL6 Y;  3JAT B;  3ETG A;  4DR4 B;  4LCU C;  2PZS A;  1AI7 A;  1HP8 A;  5KX5 A;  3JD1 A;  1JQ0 A;  2K9P A;  3ABK B;  2DQ3 A;  3TXS A;  4X1K A;  3AG4 C;  4DV4 B;  2GV9 A;  3TXQ A;  3ABM B;  2KB1 A;  1XHZ A;  4IHJ A;  4LF6 B;  4P9O A;  3E89 A;  1ENV A;  1Q6H A;  3ZHT A;  1B06 A;  1RFY A;  2OT5 A;  2GSM B;  4NVP A;  1P4R A;  1TUB B;  3S3X A;  4XDK A;  4JYA O;  3F5T A;  1QR9 A;  5EBM C;  2BCC H;  1N34 O;  4ZIB A;  3L70 H;  4CZZ A;  3BVO A;  1Q8I A;  1QLN A;  1VQ5 V;  5EIB D;  4JI3 B;  3ZN1 A;  3VOU A;  1M93 A;  1GTO A;  1NU1 H;  1WB8 A;  3WG7 B;  1CEZ A;  1EN4 A;  2CH7 A;  5KMG B;  1EFR G;  1JJ2 U;  3CRC A;  3HKE B;  4WBN B;  1IBL B;  1Q82 W;  2QTS A;  2AW9 A;  3BFR A;  4Z2W A;  4JI7 O;  1AI4 A;  4J7J A;  1XNR B;  3JAL B;  1VF7 A;  3THO A;  4LFB O;  4X62 B;  2LQT A;  3K08 A;  4JI6 B;  1Y74 B;  3ABK C;  2CDY A;  1D5N A;  4DV6 B;  3B8N A;  3ETE A;  1J5E O;  1W0K G;  2ZE5 A;  3E35 A;  3RYI B;  3QVN A;  4DUZ B;  3K79 A;  1UPG A;  2QM4 A;  1R73 A;  4MW8 A;  4BAY A;  2IU0 A;  3J80 N;  3CPW U;  1HR0 B;  3CS5 A;  3UT5 A;  1S77 D;  4J11 A;  2DYR C;  4J9Z B;  2UXN A;  2EIN B;  5IJ0 A;  1OCR B;  2JS5 A;  2DJV A;  3K0G A;  3RBZ A;  2YIB A;  4PV1 B;  3IJ4 A;  3VQW A;  5CA1 B;  3HKB A;  2A3Q A;  1FKA O;  1Q6U A;  1SRY A;  3OR6 C;  4ABM A;  5KUM A;  5KAF Z;  2F66 C;  3FKS G;  5F2V O;  1DK1 A;  1K4C C;  4MVR A;  4FLV A;  2HVK C;  3CE2 A;  2LGQ A;  4B3T B;  2ZXW B;  1JPX A;  2ZM6 B;  3DC6 A;  1VF6 A;  3K58 A;  2OTL V;  3D36 A;  1NS1 A;  2IJK A;  1ZWI C;  4R50 A;  2JGD A;  1X4T A;  3WB0 A;  3TCU A;  4OPH A;  2M7W A;  1I94 B;  2ZXW C;  3N2G A;  3E2E A;  5CA0 A;  4K8X A;  3CWB H;  3K3W A;  2CGN A;  5D5Q A;  2BTQ A;  2IBZ H;  3G71 V;  3ABU A;  3DXR B;  1QNM A;  1NR7 A;  1QLE C;  5LXT B;  5IWA B;  5L3C A;  4X88 A;  4Z1V A;  4FLY A;  1VF5 B;  1F4M A;  1KMI Z;  3SPJ A;  3JD3 A;  1Q3E A;  4Q6G A;  3A0B Z;  1LR1 A;  1KKD A;  2PI5 A;  2F1M A;  4JV5 O;  3E8F A;  4O4J B;  4DR2 O;  3TJT A;  4FPP A;  4J7K A;  3ASO B;  4CS2 A;  4F6E A;  1ZL8 A;  4I4T A;  4DV7 B;  4LWS B;  5DEC A;  3CCJ V;  1IDS A;  1RP3 B;  4HZ3 A;  3LDE A;  1FXK A;  4KHP O;  2ITC C;  3OUS A;  5EZY A;  1P84 F;  3H1I H;  1I0H A;  3CJH A;  2UXC O;  2QEX V;  2VRZ A;  5K1P A;  4JI0 O;  2JEU A;  3NXS A;  2VWK A;  4DR4 O;  4WFA V;  2EZO A;  5BR8 O;  2IJJ A;  2HHH B;  2Q7G A;  4PI2 A;  1S5H C;  2ARH A;  4FM2 A;  1S76 D;  1XNR O;  3UKM A;  4JYA B;  4FFB A;  3I55 V;  2FB5 A;  4UCU A;  1CP9 A;  5DED A;  2D3O W;  2Y69 B;  4OX9 O;  4LFA B;  1RSO A;  2PI4 A;  1OCO B;  2PF4 E;  5IY5 B;  5CB4 A;  2UUB B;  4LF5 B;  1D2D A;  4OXS A;  2E3C A;  3W7W A;  4JI2 O;  2P5O A;  1F7Y A;  2NN4 A;  1R3K C;  4K8Z A;  1VQ8 V;  2E5L B;  2JRI A;  3JAS A;  4FVM A;  4MTO A;  2Q73 A;  2HFE C;  2Q5Z A;  5JVD B;  1IXM A;  2QWR B;  1MMM A;  3HPL C;  1JX9 A;  4DV0 O;  1B04 A;  3K03 A;  1DTO A;  2YXY A;  4I55 A;  4D7S A;  4FFB B;  1F51 A;  1OHH G;  3C90 A;  1KYO F;  5BZB A;  2UXD O;  3APQ A;  1SET A;  2Y69 C;  3OMA B;  4XDJ A;  5IYB O;  4MW3 A;  3ABL B;  2WLL A;  5CB4 B;  4PEL A;  4TV8 B;  4XBF A;  3D36 C;  2EIM C;  5LGN A;  3TK1 A;  2H8P C;  2L6L A;  5CA3 A;  3BCC H;  4U3J B;  2IJI A;  1FXH A;  3T1H B;  1FFX B;  1HDJ A;  3OUF A;  1NH2 B;  4NR1 A;  2Z3Y A;  2LO1 A;  2ZE6 A;  4DK0 A;  3CX5 F;  1XHX A;  2Q9L A;  3FFQ A;  2QKA A;  4L8J A;  4JZ2 A;  3G6B A;  3UT5 B;  2RDC A;  3BAB A;  3JAW A;  1YDX A;  3H1K H;  5GON B;  4CS3 A;  1GM9 A;  2Q7H A;  4JI1 B;  1R3J C;  1WPB A;  3CD6 V;  2WLI B;  4LF4 O;  4PA7 A;  1YCI A;  4MVS A;  3E8G A;  4I55 B;  5KHH A;  2GBO A;  4LNU B;  5JQG B;  2UXC B;  4DR1 O;  4GYC B;  1OCZ C;  1WA8 A;  5DM6 V;  4DRX A;  1JR9 A;  4QNH B;  2XHB A;  5ITZ B;  5TIS Z;  5HFL A;  2WA4 A;  3G4S V;  1IBL O;  2DN9 A;  4I0X B;  2XT9 A;  4DR2 B;  4D6T H;  3B4S A;  3HKD B;  3CSX A;  1MZE A;  4G27 B;  4ZHQ A;  3LNM B;  1VAR A;  3J81 N;  2LJ2 A;  3WB2 A;  3CP1 A;  3E83 A;  2DYR B;  1Y74 A;  1MNG A;  3L71 H;  4CH5 A;  4UB6 Z;  4UV9 A;  4JI6 O;  2HJF C;  4O4L A;  4IIJ B;  2EZP A;  3DSQ A;  3OE7 G;  2D2C B;  2LFR A;  3RVZ A;  1M9N A;  4B08 A;  2X6C A;  2EX3 A;  2A06 H;  3CRM A;  1SZT A;  2YSU B;  1WN7 A;  1GH6 A;  1Y4M A;  3ZRW B;  3BA8 A;  5JJN B;  5L3F A;  5H6R A;  1ARO P;  1S0V A;  1Y76 B;  3JAW B;  4O4I B;  4RO2 A;  2HVJ C;  3DXR A;  4EKW A;  4J41 A;  3AK3 A;  3ZN0 A;  3RYF B;  3L9D A;  5L3E A; 
#chains in the Genus database with same CATH homology
 3B40 A;  1VF6 C;  1VF6 A;  1ZL8 A;  1Y74 B;  1ZL8 B;  1Y74 A;  1Y76 B;  1Y76 A;  1RSO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...