1RSOB

Hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
GLLAAERAVSQVLDSLEEIHALTDSSEKDLDFLHSVFQDQHLHTLLDLYDKINTKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Neuropeptide/membrane protein
molecule keywords Presynaptic protein SAP97
publication title The tetrameric L27 domain complex as an organization platform for supramolecular assemblies
pubmed doi rcsb
source organism Rattus norvegicus
total genus 18
structure length 56
sequence length 56
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1rsoB00
1Y74A 1ZL8B 3B40A 1ZL8A 1VF6C 1VF6A 1RSOB 1Y76B 1Y76A 1Y74B
chains in the Genus database with same CATH superfamily
2PYLA 4PA3A 5FNVA 4FLWA 3ZMUA 3JARB 1QLEC 2BTQB 2HJDA 1S77D 2B1IA 2X6BA 4I55B 4J10A 1IBMB 1E1QG 2DE0X 4R7CA 5KMGA 1QVGU 1K33A 2V1DA 4LF8O 5L3BA 4PDMA 2EULA 4DV7B 2EIJC 1G8MA 2P6JA 3H01A 1NR7A 2JS3A 2WSSG 5LP6C 4KXRA 4BAYA 4AI8A 1HNZB 2E76B 3CPWU 4FLVA 2ZIMA 2MK3A 4KP4A 2YSUB 3B09A 4WFHA 4J42A 2QSAA 2ZKOA 3AK1A 3CC4V 4O2BB 3AG4B 4FIPC 4U3JA 4QE9A 3RYIA 4NR1A 1R3IC 4L8JA 2BE3A 4IIJB 4XDJA 2ZNIA 1BQZA 3CHXA 1Z5VA 2W0FC 3UT5A 5IJ9A 2LW7A 3N27A 5IYDO 1OV9A 3UCSC 3JASB 2KSDA 5EK0A 2JGUA 2XASA 4B3TB 3SJBC 5LYJA 1P49A 2CDYA 4JI8B 1AP6A 2R72A 4JZGA 3LDCA 4RUEA 1QBZA 4DR6B 4XDKA 4AQYB 3OGIB 3CRAA 5KUKA 4OPAA 1RSOB 2IH1C 4LF7B 1LUVA 1QR8A 4JI0O 2UUCO 3D3QA 4O4IB 4HAMA 4JV5O 3AG3B 2BTOA 3U10A 2UXXA 4DV3O 2QM4A 2B9ZA 2LQTA 1N0NA 3EHBB 1QLEB 2UXBB 5F2VO 5KA6A 4LFBO 1QLNA 5CB4B 1AB3A 1Q6UA 1N33O 2ZXWB 3WB1A 4X20B 4LC1A 1KB9F 3FB5C 2FYUH 3E8FA 1GK9A 1VIBA 2EINC 5LP6B 2ZE7A 4KHPB 3JALA 1AR4A 2Q73A 5LMUO 2VRZA 2Q9LA 3HKDA 4QNHB 1Y76B 3BCCH 1YJWV 2AGAA 4DR7B 4PA4A 2ZM6O 4P2ZA 4PI2A 3BPZA 1GMGA 1YHQV 3WG7C 4LNUA 2YXYA 1F4NA 4Z2WA 4I7ZB 2HHHO 3K06A 4JI5O 2GSMB 4UCVA 4C7UA 4CC5A 5IJ0B 3H1HH 2PF4E 1IBLO 3HR0A 4CS4A 2XAHA 3SJAC 4FLZA 1WN7A 4IL6Z 3SPIA 3H1IH 3FB7C 3WB0A 1DK1A 1OZ0A 1NU1H 4FFBB 4JTDB 3TETA 1Q43A 2QWQB 5IYZA 3GWKC 1GKFA 5IWAO 2Y48A 4CH5A 2UXDB 2EILC 2HFEC 5CA0B 2JS5A 4JI3B 3ABMB 4ZHQA 1BGYH 1XREA 4CS2A 4RQFA 5LHIA 2YI8A 2OT5A 5CBFA 3J81N 3J80N 2ODMA 4K0KB 3AG1C 1ZL8B 4DV1O 4JYCA 4JGSA 4O4JB 2PTMA 3F5WC 4X62O 2JK5C 1XL6A 1HR0O 1IXMA 1SZTA 4RWUA 2JGDA 1JJ2U 3K0DA 4MVRA 4UXNA 5D5PA 1AI7A 3CSXA 1PNMA 2EINB 3JATA 2ZT9B 1HNWO 1T5EA 3CX5F 4GCZA 1XEQA 2ZINA 1VQ8V 1L8DA 2QEXV 2A06H 4I50A 5IE9A 3WG7B 2F43G 2Q69A 4DR2B 1KYOF 3E8GA 1Q6IA 1H2LA 3F5TA 4LWSB 3ZIAG 2QM7A 1RM1B 1V54C 1JCHA 3T4DA 3FX7A 1SZXA 3K5NA 5JJEB 2KG7A 3JD3A 1BHBA 1JOYA 2K9PA 4JI7O 5CA3A 1FXHA 3LNMB 4CZZA 5KHIA 1M5IA 1CXZB 3ZHTA 3OE7G 3SYCA 2EILB 2D3OW 1MZFA 1OJHA 3OT7A 3RYHA 4GKKB 2YEVB 3K5LA 2ZNJA 3DSQA 5EZYA 5JQGA 1JX9A 4ZOLB 1P7BA 4MVMA 3FFQA 5KHKA 1TVKA 1JJOA 2GV9A 3DGEA 1KBHA 4NTXA 4PA7A 3QO8A 1LUWA 1M93A 2DWEC 2XUMA 2H8PC 3ABKB 1JR9A 2CAZC 4DXWA 2AHZA 3K58A 3KCXA 4BR6A 4JI1O 4U3JB 4FLTA 5B1AC 4DR5O 3DXRB 4R50A 4OX9B 1NH2D 3SPCA 2VQFB 5LL6Y 5IJ9B 4CH3A 4MTFA 4GX5A 5LYJB 1I7FA 1Q81W 4OPHA 4UB6Z 3RVZA 4TQDA 1FAFA 2JIZG 4LF4B 1GN6A 4X88A 3L71H 2BCCH 1SQPH 4RO2A 4FK5C 4ABMA 5KLVH 4D7SA 1LNQA 5DM6V 3LSQA 3AG7A 2IU3A 4J41A 2YIBA 1VQKV 4TV9A 2Q7EA 1YTFD 5KAFZ 1XMQO 2BSKA 1BL8A 1NTMH 3LDDA 2HJFC 1CEZA 4DV2O 1TA8A 4TT3G 3CCJV 3ZRWB 4O2BA 1NBMG 1YF2A 1BHAA 3I56V 1YSCA 4DV4O 3R65A 1R3JC 2ETNA 4KFMA 1VQNV 1YZBA 4JTAB 3C90A 4LF6O 3JALB 2QJ1A 2UXCO 5LHGA 3HKDB 4TUYA 1JPXA 4MTGA 3T1HO 5IY5B 1FS0G 3TXQA 1RSOA 2VQEO 4EEQA 4H44B 2Y0IA 1EN5A 4Z1MG 3CCUV 1OCOC 2QWPB 4O4IA 1M90W 1NI8A 2W6JG 2PYJA 4BIZA 5LBQA 1HWYA 2MW2B 1VF6C 3U0ZA 1J95A 5EBMC 3M99B 1Q82W 3T1YB 5CB4A 3HKCA 3OR6C 1XMOB 2HG5C 1HNXO 4DR3B 4X20A 1AR1B 3MHHC 2OCCB 4DR1O 4DV6O 2N74A 4MVSA 5DECA 3BFRA 4FLXA 1K8AW 1XNRB 1NJIW 2E5LB 1G1XB 2UUBO 3ZJZA 3IC9A 1HDJA 4EFEA 4X1YB 2F4VO 2WA3A 2ZIOA 1N34O 1VQ7V 3CP1A 4J7ZA 3UO3A 3OTOO 4B3RO 4K8XA 1VQ6V 1XBLA 4MVQA 1NVPD 4LF9O 1L0LH 3JAWA 2EZOA 1YCIA 1H2SB 5KHJA 4NXMB 1NTKH 4DW1A 1BT8A 3CC7V 1OCOB 4LH6A 1L1FA 2HVKC 1QU7A 4MT8A 5JCOC 1UJWB 3ZRVA 2XAQA 1VQ5V 4H0LB 5B5EZ 1JA8A 4LFAB 3APOA 2Q8VA 3AG2C 4E2LA 1Y4MA 5GTIZ 3MHSC 1SQXH 4B3SO 5EIBC 1IBKO 4EKWA 1G4YB 3FYEB 4O4JA 1URFA 1OCCC 5LMNB 1LR1A 4O2AB 3SJCC 2NLJC 3ZRXA 3STLC 5KHGA 4GKJB 2OCHA 4P30A 4UCSA 1W0KG 4IYIA 3OEHG 1Y67A 2IJJA 1KP2A 2DOSA 3A0BZ 3ZBHA 2XAJA 3AG4C 5EZYB 3H1KH 2WLMA 4JYYA 2P90A 5JQGB 1Y66A 5LA6A 4YXWG 4J9YB 2QWNB 4MVUA 4JZ2A 3KZIZ 3K04A 1YTFB 1N32O 5GONB 4F6RA 4LWSA 5LGUA 2ZDIC 5L3FA 1H8EG 1KC8W 3ZHQA 1K3EA 1TGOA 2JEXA 4PV1B 3TCUA 4LBEC 3CCSV 1PL0A 3VQWA 1XQ8A 3OW2U 1S5HC 1TUBA 4X64O 2RNBA 3P32A 3G4SV 3QF7A 1BMFG 3AG3C 2X6AA 4O4LA 4X65B 4NXNB 2M7WA 2HP8A 4RQEA 1K4CC 3K03A 2W0XA 4CH4A 2YEVA 3ZHSA 4DRXA 4QPJA 3ZMVA 3SPHA 2P4KA 4J7KA 3AG2B 2WLIA 2ZXWC 4ZOLA 2O57A 3ASOC 3CRRA 1VQMV 4JI2O 5KX5B 3I5DA 4TV9B 3N2GB 1I5YA 1OCCB 3ML0A 2CGNA 3ZHUA 2RN9A 3JD2A 5B1BB 2BSKB 1K92A 5H2FZ 1YDXA 3L70H 1MNGA 2WLNA 3GWOA 3DXRA 1MSDA 5JWPA 2F95B 1AJNA 1H2GA 3F7YC 2Z0AA 1PKXA 4IHJA 2YICA 3BEHA 2QWRB 4CS3A 2M6YA 2UXNA 4TUYB 1I08A 3HKBA 2GUZB 4B3MB 1M4UA 5B66Z 5ITZA 1VF7A 4LFCB 1FFTB 1WB8A 2Q5ZA 1SF9A 2XAFA 3AEIA 4I4TB 1OCRC 4HBNA 2EZPA 1FJGB 3R66A 3ABMC 1BQ0A 2UUAO 3M7MX 5K1XA 4N21A 1N36B 1ZTEA 4J9ZB 1Q5OA 3ZN0A 3MD0A 4QE7A 4PDRA 3ZRWA 3HKCB 4ASUG 3W7UA 4WCEV 1RPRA 2JEUA 2JJ2G 3ASOB 1VF5B 1O9GA 1EBOA 3RVYA 4D7TA 1IDSA 2R9AA 2K1EA 3AK3A 5BMVA 4JI6O 3SPJA 2QTSA 3QG5A 3FB6C 4J7JA 3JSLA 1EFRG 5KUMA 1AROP 3CC2V 4JYAO 2FKXA 1THZA 1SESA 3CJHA 3LUTB 3STZC 4UCOA 1K73W 3K3WA 3D36A 3FD9A 3SYAA 4XBFA 3ZX6A 3RYCA 3CCLV 2P67A 4JI4B 1AVMA 1B6QA 1RM1C 1PP9H 1MG1A 2PGGA 4LCUC 2QWOB 4TV8B 1ZWIC 3ASNC 3CRQA 2A3QA 2EBOA 5KA5A 2DYRC 3U11A 2A7WA 4CBCA 4LP8A 4R6ZA 1NT2B 3JAWB 5K1PA 3IJ4A 5TISZ 1U96A 3OUSA 4Q20A 2PI4A 1EZVH 2V7QG 1M9NA 3G6BA 3BY6A 2R9IA 1GM9A 1OCRB 1BSMA 3CE2A 3WU2Z 1XUQA 3RW0A 4W4LA 3K57A 5CN0A 4DV0B 1K97A 1H38A 1AR5A 1OHHG 1R3KC 2QKSA 3CB2A 1R6TA 2L35A 4JAAA 1EM1A 1ORQC 2DMXA 3T4ZA 3ZN1A 1XHZA 1BE3H 4U7NA 4X1YA 4X1IB 1NKDA 5J2UB 4L87A 4FFKA 2VWKA 4YHHB 2RJZA 5J2TB 2EJ7A 3DC5A 4TWKA 2KB1A 1YI2V 2P4VA 3SGIA 2DN9A 3ABKC 1JMKC 2QR4A 4DUZB 5LHHA 3CYOA 5LA6B 1NR1A 4DV5O 4B7KA 1NS1A 1R1BA 4N23A 4UCRA 4F6RB 3GVMA 1MA1A 5BZBA 2RCVA 1IVSA 1Q6HA 5LGNA 3UO2A 4X66O 1GM7A 3JCUZ 4UVBA 3P3NA 5HFMA 5JJNB 4G27B 3T2MA 4YJ2A 3ASNB 3OEEG 4LF8B 2DYRB 5HFLA 3IC7A 1TUBB 3NXSA 3QVNA 4PELA 1GRJA 2ZR3A 3ZMZA 2E74B 4YIOA 3K08A 4O2AA 4XDLA 2JRIA 1D5AA 3A8TA 4O4LB 4IGGA 2DW4A 3RGBA 4MTXA 2OIEA 1KKCA 1YEWA 4IT5A 2ADPA 4DRXB 1Q8IA 2XHBA 2WLIB 4MW8A 2BOBC 3ZHRA 1W0JG 2ZD9A 1XI1A 2Q4PA 2NN4A 2ILMA 1SQFA 5B1OA 5GONA 2PUSA 4CC6A 2LJ2A 4FM2A 3G6EV 3HKEB 1VQLV 4YY3O 2P5OA 5IY5C 2D2CB 5B3SB 2KQXA 5H6RA 5BR8O 2ITCC 4DR4O 3K5MA 4LF5O 3D36C 4FJCC 4HNAB 3SJQC 3VOUA 4JI0B 3ETQA 2UUCB 4NB5A 2VS0A 1K9MW 4KUMA 4JV5B 2WLJA 2WWWA 4DUYO 2UU9O 4DV3B 4IHJB 3HB3B 1M57C 1XOUA 1XNQO 3OUFA 3IGAC 1Q7YW 1QHTA 1O9HA 4LFBB 3E22A 2CTWA 3HKBB 1WPXA 1N33B 4WFBV 5ITZB 5KX5A 2OCCC 1EN6A 4FPPA 1B3QA 3N2GA 5LGTA 1Y74A 5C93A 1QR9A 5AG2A 5LMUB 2ITDC 4BW9A 1P7GA 1ZAUA 2DWDC 3CS5A 2ZE8A 2ZM6B 1J5EO 3JD1A 3ABUA 1DF4A 1COWG 3G71V 2HHHB 3ZS8C 3OD4A 5A2QN 4P9PA 1FXKA 4JI5B 4PJ0Z 4IYHA 4BIOA 4W4KA 1IBLB 1GAXA 2XNDG 4MVZA 1MMMA 1PM9A 5BMVB 5FL7G 4B7EA 2GTAA 2R9RB 3ZMSA 1IBMO 3SYOA 2GUZA 2EIMC 1M56C 4MVOA 3CJHB 3G67A 1ZUQA 2WLKA 2DQ0A 4DV7O 3UQ8A 3B8NA 1CPYA 1XILA 5IWAB 1RPOA 1KP3A 3RYCB 1HNZO 4I4TA 1WAZA 1AI5A 1F4MA 1SC5B 4WF9V 4PI0A 1M57B 4WFFA 1WJZA 1MSWD 3QO7A 2CGOA 4A5UB 4DV1B 3CEIA 2F23A 4FVMA 4X89A 4TSFG 4WFAV 4X62B 3JYCA 1F7YA 1HR0B 3JSNA 4B3TO 1R3LC 3PN1A 4JI8O 2IH3C 1HNWB 2QGNA 3L9DA 1E1RG 4DR6O 3S3WA 1TUEB 3CMAV 2N04A 1IZ3A 2IM9A 3CCMV 3NR7A 4AQYO 4ZI7A 2YXHA 4LF7O 2IBZH 2CK3G 1VP7A 1I94O 4NVPA 3SDLA 2ZE5A 1UPGA 1WP7A 3IFXA 4J11A 2ATKC 4EFBA 1TAEA 2UXBO 2LGWA 3TK1A 4TV8A 1S5LZ 3OMAB 3N2KA 4QIWF 2DYSB 2IU0A 4JI7B 2ZCEA 2EIMB 1M56B 1NTZH 3K79A 4H37A 4E4EA 3L74H 5KAIZ 5L3GA 1X59A 1H2KA 3FKSG 4KHPO 4FZ1A 5CMUA 4D6TH 2Q0AA 2WA4A 4NTWA 4GLXA 4YJ2B 5JH7A 4DR7O 3CWBH 4BW5A 1NH2B 2P22C 1QCEA 1K5QA 3T1CA 5IYBO 4X1IA 1RFYA 5J2UA 4MSWC 2EJRA 5J2TA 4J80A 3CMEV 1YITV 1VQ9V 5B1BC 2F1MA 2JVDA 1EN4A 2ZQMA 1ZX3A 1B06A 1Q86W 3BRCA 4JI1B 5IYCO 1K5SA 1NQTA 5H9CA 2NNUA 4DR5B 4ZBMA 1ROPA 3ABLC 1FXKC 2OTLV 5JVDA 3SPGA 4JAVA 3QTCA 1OCZB 1HP8A 1HW7A 4UV8A 2UXDO 3OAAG 1DTOA 2LW1A 5L3EA 4JI3O 2Y0PA 4GX0A 2G38A 2RQ6A 5IDJA 3BVOA 4K0KO 3TXSA 4ICGA 5EYPA 1FD9A 1FYJA 3CCVV 1DF5A 4JTCB 1XMQB 3MDSA 1L0NH 3OFNG 1S72V 3E83A 1SS3A 5CA1A 4H33A 1K34A 4DK0A 4RAIA 2Y69B 2Q6AA 4DV2B 3E22B 3SYQA 2Q67A 3I55V 4HZ3A 4RUFA 1K7DA 4UCUA 1ZLZA 3QO5A 1KECA 1PL4A 2Q68A 1WB7A 4G28B 1KKDA 2GBOA 3OMNB 4DR2O 1N0JA 4DV4B 1GH6A 3X2QC 5E79Z 3GB7C 2JJ1G 3QNEA 4WFGA 1M1KW 3OGCC 1GN2A 3B77A 4LF6B 1Y74B 4MW3A 2PZSA 2UXCB 5L3DA 3K5OA 3HKEA 2WPDG 3T1HB 1X4TA 3E8HA 2FB5A 3S3XA 2HKOA 5CBHA 2LP7A 4K3AA 2VQEB 4H13B 4X1KA 3ABLB 4HNAA 1FXKB 1PNLA 2E75B 4WFEA 3JCZA 2QKAA 4UFZA 5LXTB 2CH7B 3RWRD 2LFSA 3CXCU 3WB2A 4GKKO 5H5NA 3BAAA 2PY5A 3E89A 4I5SA 1WNSA 3VQXA 1HNXB 2QE7G 3TGUH 3ZCCA 2WLHA 2AZ2A 4DR1B 5IT9N 4DV6B 3APQA 3E86A 1NVPB 2UUBB 1V55B 3JAKA 3UM7A 2XAGA 2F4VB 4YJ3B 1GN4A 1S76D 4OX9O 2XOKG 1N34B 1H2MA 2YIAA 5C8YA 1I94B 2PI5A 1KUQA 3W7TA 1JQ0A 2P06A 2ZE6A 5DEDA 2VQFO 3X2QB 5J9PC 4DYLA 3K0GA 1SQBH 1K4DC 3OTOB 3ZEDA 4B3RB 3LDEA 1PD3A 4LF4O 3FAVB 1SA0A 2CTQA 4LF9B 1F23A 3B8MA 3P30A 3DTUB 4ZI7B 2WAMA 2VWJA 2EIJB 5E1AC 4ZKIA 4CH6A 5CBGA 2LO1A 1AILA 1FKAO 4I9WA 1PV0A 2N05A 2P7TC 2R70A 3LNNA 3N2KB 4X8AA 4KL1A 4QPKA 5D5QA 2ZR2A 3VQYA 4B3SB 2YDEA 2H94A 1IBKB 1QQCA 4BWAA 1GM8A 1V9PA 1XHXA 3UKMA 4Z1VA 2CTPA 3AK2A 3E2EA 5LOVA 4EB6A 1DGSA 1VQOV 4FLYA 1Y6XA 1BZKA 2ARHA 4OXSA 2W6IG 3C3SA 4K8ZA 2OYQA 5JH7B 4GX1A 5FPOA 1SETA 1N32B 1AI4A 3C3TA 2A79B 4F4LA 3F7VC 4I0XA 4AILC 1MOFA 3E8BA 1A32A 3B4SA 2YS8A 5L3CA 1Q3EA 3ETGA 5B3SC 1EZJA 3BA8A 3KKYA 3T1YO 2WLLA 3A2FA 3ETDA 3W7XA 4FLUA 1XMOO 5JVDB 4X64B 2OTJV 3KCYA 3RYFA 4BIUA 4DR3O 2Y4UA 3FB8C 3RFRA 2AHYA 1N4CA 4UVCA 1QNMA 2YXLA 4G2KA 1JFFA 2Z3YA 3ABTA 1U97A 3HPLC 2AZ0A 1R73A 5EBWC 1XNRO 2LFRA 1R6NA 2E5LO 3VBBA 4FM0A 4UB8Z 3W7WA 1FFXA 1H8HG 4JI2B 3SYPA 5H6QA 1FPOA 1DLBA 1D5NA 4FZ0A 3H1JH 2YC0A 5EYPB 1GN3A 3MAQA 3RN4A 2GHYA 4O4HB 5CA1B 4HYOA 4JF3A 1VARA 1VF6A 1WA8A 4K35A 3K9SA 1S0VA 2GTSA 2E3CA 2QTOA 2JDIG 3A0HZ 3CRMA 4FM1A 2H3OA 3CRCA 1NZ6A 4NXMO 5FNVB 1Z2GA 1VMGA 2B5UA 1CP9A 2FMLA 1YXBA 4WBNA 4GX2A 2OWOA 4LFAO 1G6UA 5BXZA 4PA6A 1VQPV 3CXHF 1KU9A 5KMGB 2Y4TA 3Q4HA 3BA9A 3AG1B 4X1KB 3SR2C 1IURA 1F51A 3CCQV 4TQFA 3RT3C 5LMNO 1D2DA 3O65A 3ZHVA 4GKJO 4PDVA 2UUAB 1AP5A 2IW5A 4PDLA 4JYBA 5BY1A 2IJHA 4I9QA 3CCEV 3RYIB 4GYCB 1IX9A 3B2EE 1US6A 4MTOA 3W7SA 1SQVH 2A9HA 5B1NA 4UV9A 3UT5B 4AHCA 1YVWA 2CTRA 1XDCA 2KKWA 4ZIBA 3PJSK 2GDSA 3L75H 1FXVA 1QVFU 1MABG 3JARA 4JI6B 2BTQA 4Q6GA 5JCOA 3OM3B 2OIGA 1B04A 2LGQA 3TJTA 3FYIB 4I55A 4U3FH 1KQSU 1V54B 2X7RB 1AI6A 4JYAB 5A9GA 3JAKB 2Z5UA 4NKGB 5C8YB 2ADQB 2B1GA 4GUNA 1KD1W 4X65O 5LXTA 4NXNO 2CH7A 1E79G 1W2BU 1KMIZ 4R8CA 2BOCC 1WPBA 1SA0B 1Q90D 5EC2C 1XL4A 2DYSC 3ZMTA 2AW9A 3L73H 1W59A 1PPJH 4IIJA 4UVAA 4B08A 4P9OA 1YIJV 3H9VA 3A0RA 3JASA 2CUGA 1AJPA 3EXAA 1ENVA 3K9AA 4NYKA 3DC6A 2ZDIA 2XT9A 1VQ4V 4LNUB 5FLXN 5B1AB 4PHZA 1UFIA 4YJ3A 3EFFK 3OTFA 3JD0A 5EIBD 2YIBD 5LOVB 4EB6B 3G80A 2L6LA 1YJNV 1SERA 4QGPA 3L72H 4YIPA 2CE4A 5KHHA 2QDOA 3ZRSA 3FAVA 3WFVA 4B3MO 2Q7GA 4TOIA 3JAMN 4DV5B 1MZEA 5IYZB 3H1LH 4LFCO 3RBZA 3THOA 1OCZC 4UCTA 4I0XB 1SRYA 5LP6A 3J7AU 1FJGO 4ZHQB 2EIKC 3KG2A 4X66B 1N36O 1Y76A 1IXBA 3P3PA 2FL4A 4JASA 2YI9A 1BS3A 4DW0A 2WLLB 1S3JA 1GTOA 3RYFB 2QM8A 5IJ0A 3K59A 4LH7A 2YUAA 2JGDB 2HVJC 4NTYA 3OMIB 3IAYA 1JFFB 2DJVA 3JATB 1H2NA 2X0LA 2DQ3A 2Y69C 5EC1C 3JD4A 3OR7C 1ZSPA 3D3IA 2HLDG 4LR3A 2F66C 4PA9A 1GO3F 1BCCH 1SKVA 2Q7HA 2QA4V 4FFBA 1I5XA 4OGQB 3CD6V 2RMKB 1FFXB 3EVKA 4I50B 2IJIA 3O9OA 5GTHZ 3M8AA 5JJJB 3CCRV 3B40A 4U7OA 1AJQA 5GW7A 2AXTZ 1SQQH 4GZRB 5CA0A 2RDCA 4JI4O 2Q0OC 2EX3A 5FPRA 4GT1A 4YY3B 4F6EA 2KG7B 1WA8B 1JVMA 3ETEA 5BR8B 3BHPA 4DR4B 4LF5B 2NR5A 1ZL8A 4MS2A 2HR3A 1P84F 3E35A 2XTAA 1PNKA 2F93B 1SQGA 2V4DA 3D8CA 4DUYB 2UU9B 4FMTA 1P4RA 5EBLC 4QJFB 1XNQB 4WBNB 3RYHB 4DV0O 3ICXA 2EIKB 2X6CA 4JAUA 4X9QA 3VQVA 3LSSA 3Q4HB 1TVKB 1I0HA 2HEPA 4DK1A 2FTKA 1N8RW 4YHHO 1WLEA 3LSUA 1RP3B 2YIDA 1YJ9V 1R6KA 4UUJC 1WP8A 4O4HA 1S5JA 2C2AA 4PD4F 4DUZO 1J5EB 1V55C 1Z5WA 4DO2A 2A0LA 4JPRA 2IJKA 1VEWA 3BABA 2QKCA 5DN6G
chains in the Genus database with same CATH topology
1Y74A 1ZL8B 3B40A 1ZL8A 1VF6C 1VF6A 1RSOB 1Y76B 1Y76A 1Y74B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y74 A;  1ZL8 B;  3B40 A;  1ZL8 A;  1VF6 C;  1VF6 A;  1RSO B;  1Y76 B;  1Y76 A;  1Y74 B; 
#chains in the Genus database with same CATH topology
 2PYL A;  4PA3 A;  5FNV A;  4FLW A;  3ZMU A;  3JAR B;  1QLE C;  2BTQ B;  2HJD A;  1S77 D;  2B1I A;  2X6B A;  4I55 B;  4J10 A;  1IBM B;  1E1Q G;  2DE0 X;  4R7C A;  5KMG A;  1QVG U;  1K33 A;  2V1D A;  4LF8 O;  5L3B A;  4PDM A;  2EUL A;  4DV7 B;  2EIJ C;  1G8M A;  2P6J A;  3H01 A;  1NR7 A;  2JS3 A;  2WSS G;  5LP6 C;  4KXR A;  4BAY A;  4AI8 A;  1HNZ B;  2E76 B;  3CPW U;  4FLV A;  2ZIM A;  2MK3 A;  4KP4 A;  2YSU B;  3B09 A;  4WFH A;  4J42 A;  2QSA A;  2ZKO A;  3AK1 A;  3CC4 V;  4O2B B;  3AG4 B;  4FIP C;  4U3J A;  4QE9 A;  3RYI A;  4NR1 A;  1R3I C;  4L8J A;  2BE3 A;  4IIJ B;  4XDJ A;  2ZNI A;  1BQZ A;  3CHX A;  1Z5V A;  2W0F C;  3UT5 A;  5IJ9 A;  2LW7 A;  3N27 A;  5IYD O;  1OV9 A;  3UCS C;  3JAS B;  2KSD A;  5EK0 A;  2JGU A;  2XAS A;  4B3T B;  3SJB C;  5LYJ A;  1P49 A;  2CDY A;  4JI8 B;  1AP6 A;  2R72 A;  4JZG A;  3LDC A;  4RUE A;  1QBZ A;  4DR6 B;  4XDK A;  4AQY B;  3OGI B;  3CRA A;  5KUK A;  4OPA A;  1RSO B;  2IH1 C;  4LF7 B;  1LUV A;  1QR8 A;  4JI0 O;  2UUC O;  3D3Q A;  4O4I B;  4HAM A;  4JV5 O;  3AG3 B;  2BTO A;  3U10 A;  2UXX A;  4DV3 O;  2QM4 A;  2B9Z A;  2LQT A;  1N0N A;  3EHB B;  1QLE B;  2UXB B;  5F2V O;  5KA6 A;  4LFB O;  1QLN A;  5CB4 B;  1AB3 A;  1Q6U A;  1N33 O;  2ZXW B;  3WB1 A;  4X20 B;  4LC1 A;  1KB9 F;  3FB5 C;  2FYU H;  3E8F A;  1GK9 A;  1VIB A;  2EIN C;  5LP6 B;  2ZE7 A;  4KHP B;  3JAL A;  1AR4 A;  2Q73 A;  5LMU O;  2VRZ A;  2Q9L A;  3HKD A;  4QNH B;  1Y76 B;  3BCC H;  1YJW V;  2AGA A;  4DR7 B;  4PA4 A;  2ZM6 O;  4P2Z A;  4PI2 A;  3BPZ A;  1GMG A;  1YHQ V;  3WG7 C;  4LNU A;  2YXY A;  1F4N A;  4Z2W A;  4I7Z B;  2HHH O;  3K06 A;  4JI5 O;  2GSM B;  4UCV A;  4C7U A;  4CC5 A;  5IJ0 B;  3H1H H;  2PF4 E;  1IBL O;  3HR0 A;  4CS4 A;  2XAH A;  3SJA C;  4FLZ A;  1WN7 A;  4IL6 Z;  3SPI A;  3H1I H;  3FB7 C;  3WB0 A;  1DK1 A;  1OZ0 A;  1NU1 H;  4FFB B;  4JTD B;  3TET A;  1Q43 A;  2QWQ B;  5IYZ A;  3GWK C;  1GKF A;  5IWA O;  2Y48 A;  4CH5 A;  2UXD B;  2EIL C;  2HFE C;  5CA0 B;  2JS5 A;  4JI3 B;  3ABM B;  4ZHQ A;  1BGY H;  1XRE A;  4CS2 A;  4RQF A;  5LHI A;  2YI8 A;  2OT5 A;  5CBF A;  3J81 N;  3J80 N;  2ODM A;  4K0K B;  3AG1 C;  1ZL8 B;  4DV1 O;  4JYC A;  4JGS A;  4O4J B;  2PTM A;  3F5W C;  4X62 O;  2JK5 C;  1XL6 A;  1HR0 O;  1IXM A;  1SZT A;  4RWU A;  2JGD A;  1JJ2 U;  3K0D A;  4MVR A;  4UXN A;  5D5P A;  1AI7 A;  3CSX A;  1PNM A;  2EIN B;  3JAT A;  2ZT9 B;  1HNW O;  1T5E A;  3CX5 F;  4GCZ A;  1XEQ A;  2ZIN A;  1VQ8 V;  1L8D A;  2QEX V;  2A06 H;  4I50 A;  5IE9 A;  3WG7 B;  2F43 G;  2Q69 A;  4DR2 B;  1KYO F;  3E8G A;  1Q6I A;  1H2L A;  3F5T A;  4LWS B;  3ZIA G;  2QM7 A;  1RM1 B;  1V54 C;  1JCH A;  3T4D A;  3FX7 A;  1SZX A;  3K5N A;  5JJE B;  2KG7 A;  3JD3 A;  1BHB A;  1JOY A;  2K9P A;  4JI7 O;  5CA3 A;  1FXH A;  3LNM B;  4CZZ A;  5KHI A;  1M5I A;  1CXZ B;  3ZHT A;  3OE7 G;  3SYC A;  2EIL B;  2D3O W;  1MZF A;  1OJH A;  3OT7 A;  3RYH A;  4GKK B;  2YEV B;  3K5L A;  2ZNJ A;  3DSQ A;  5EZY A;  5JQG A;  1JX9 A;  4ZOL B;  1P7B A;  4MVM A;  3FFQ A;  5KHK A;  1TVK A;  1JJO A;  2GV9 A;  3DGE A;  1KBH A;  4NTX A;  4PA7 A;  3QO8 A;  1LUW A;  1M93 A;  2DWE C;  2XUM A;  2H8P C;  3ABK B;  1JR9 A;  2CAZ C;  4DXW A;  2AHZ A;  3K58 A;  3KCX A;  4BR6 A;  4JI1 O;  4U3J B;  4FLT A;  5B1A C;  4DR5 O;  3DXR B;  4R50 A;  4OX9 B;  1NH2 D;  3SPC A;  2VQF B;  5LL6 Y;  5IJ9 B;  4CH3 A;  4MTF A;  4GX5 A;  5LYJ B;  1I7F A;  1Q81 W;  4OPH A;  4UB6 Z;  3RVZ A;  4TQD A;  1FAF A;  2JIZ G;  4LF4 B;  1GN6 A;  4X88 A;  3L71 H;  2BCC H;  1SQP H;  4RO2 A;  4FK5 C;  4ABM A;  5KLV H;  4D7S A;  1LNQ A;  5DM6 V;  3LSQ A;  3AG7 A;  2IU3 A;  4J41 A;  2YIB A;  1VQK V;  4TV9 A;  2Q7E A;  1YTF D;  5KAF Z;  1XMQ O;  2BSK A;  1BL8 A;  1NTM H;  3LDD A;  2HJF C;  1CEZ A;  4DV2 O;  1TA8 A;  4TT3 G;  3CCJ V;  3ZRW B;  4O2B A;  1NBM G;  1YF2 A;  1BHA A;  3I56 V;  1YSC A;  4DV4 O;  3R65 A;  1R3J C;  2ETN A;  4KFM A;  1VQN V;  1YZB A;  4JTA B;  3C90 A;  4LF6 O;  3JAL B;  2QJ1 A;  2UXC O;  5LHG A;  3HKD B;  4TUY A;  1JPX A;  4MTG A;  3T1H O;  5IY5 B;  1FS0 G;  3TXQ A;  1RSO A;  2VQE O;  4EEQ A;  4H44 B;  2Y0I A;  1EN5 A;  4Z1M G;  3CCU V;  1OCO C;  2QWP B;  4O4I A;  1M90 W;  1NI8 A;  2W6J G;  2PYJ A;  4BIZ A;  5LBQ A;  1HWY A;  2MW2 B;  1VF6 C;  3U0Z A;  1J95 A;  5EBM C;  3M99 B;  1Q82 W;  3T1Y B;  5CB4 A;  3HKC A;  3OR6 C;  1XMO B;  2HG5 C;  1HNX O;  4DR3 B;  4X20 A;  1AR1 B;  3MHH C;  2OCC B;  4DR1 O;  4DV6 O;  2N74 A;  4MVS A;  5DEC A;  3BFR A;  4FLX A;  1K8A W;  1XNR B;  1NJI W;  2E5L B;  1G1X B;  2UUB O;  3ZJZ A;  3IC9 A;  1HDJ A;  4EFE A;  4X1Y B;  2F4V O;  2WA3 A;  2ZIO A;  1N34 O;  1VQ7 V;  3CP1 A;  4J7Z A;  3UO3 A;  3OTO O;  4B3R O;  4K8X A;  1VQ6 V;  1XBL A;  4MVQ A;  1NVP D;  4LF9 O;  1L0L H;  3JAW A;  2EZO A;  1YCI A;  1H2S B;  5KHJ A;  4NXM B;  1NTK H;  4DW1 A;  1BT8 A;  3CC7 V;  1OCO B;  4LH6 A;  1L1F A;  2HVK C;  1QU7 A;  4MT8 A;  5JCO C;  1UJW B;  3ZRV A;  2XAQ A;  1VQ5 V;  4H0L B;  5B5E Z;  1JA8 A;  4LFA B;  3APO A;  2Q8V A;  3AG2 C;  4E2L A;  1Y4M A;  5GTI Z;  3MHS C;  1SQX H;  4B3S O;  5EIB C;  1IBK O;  4EKW A;  1G4Y B;  3FYE B;  4O4J A;  1URF A;  1OCC C;  5LMN B;  1LR1 A;  4O2A B;  3SJC C;  2NLJ C;  3ZRX A;  3STL C;  5KHG A;  4GKJ B;  2OCH A;  4P30 A;  4UCS A;  1W0K G;  4IYI A;  3OEH G;  1Y67 A;  2IJJ A;  1KP2 A;  2DOS A;  3A0B Z;  3ZBH A;  2XAJ A;  3AG4 C;  5EZY B;  3H1K H;  2WLM A;  4JYY A;  2P90 A;  5JQG B;  1Y66 A;  5LA6 A;  4YXW G;  4J9Y B;  2QWN B;  4MVU A;  4JZ2 A;  3KZI Z;  3K04 A;  1YTF B;  1N32 O;  5GON B;  4F6R A;  4LWS A;  5LGU A;  2ZDI C;  5L3F A;  1H8E G;  1KC8 W;  3ZHQ A;  1K3E A;  1TGO A;  2JEX A;  4PV1 B;  3TCU A;  4LBE C;  3CCS V;  1PL0 A;  3VQW A;  1XQ8 A;  3OW2 U;  1S5H C;  1TUB A;  4X64 O;  2RNB A;  3P32 A;  3G4S V;  3QF7 A;  1BMF G;  3AG3 C;  2X6A A;  4O4L A;  4X65 B;  4NXN B;  2M7W A;  2HP8 A;  4RQE A;  1K4C C;  3K03 A;  2W0X A;  4CH4 A;  2YEV A;  3ZHS A;  4DRX A;  4QPJ A;  3ZMV A;  3SPH A;  2P4K A;  4J7K A;  3AG2 B;  2WLI A;  2ZXW C;  4ZOL A;  2O57 A;  3ASO C;  3CRR A;  1VQM V;  4JI2 O;  5KX5 B;  3I5D A;  4TV9 B;  3N2G B;  1I5Y A;  1OCC B;  3ML0 A;  2CGN A;  3ZHU A;  2RN9 A;  3JD2 A;  5B1B B;  2BSK B;  1K92 A;  5H2F Z;  1YDX A;  3L70 H;  1MNG A;  2WLN A;  3GWO A;  3DXR A;  1MSD A;  5JWP A;  2F95 B;  1AJN A;  1H2G A;  3F7Y C;  2Z0A A;  1PKX A;  4IHJ A;  2YIC A;  3BEH A;  2QWR B;  4CS3 A;  2M6Y A;  2UXN A;  4TUY B;  1I08 A;  3HKB A;  2GUZ B;  4B3M B;  1M4U A;  5B66 Z;  5ITZ A;  1VF7 A;  4LFC B;  1FFT B;  1WB8 A;  2Q5Z A;  1SF9 A;  2XAF A;  3AEI A;  4I4T B;  1OCR C;  4HBN A;  2EZP A;  1FJG B;  3R66 A;  3ABM C;  1BQ0 A;  2UUA O;  3M7M X;  5K1X A;  4N21 A;  1N36 B;  1ZTE A;  4J9Z B;  1Q5O A;  3ZN0 A;  3MD0 A;  4QE7 A;  4PDR A;  3ZRW A;  3HKC B;  4ASU G;  3W7U A;  4WCE V;  1RPR A;  2JEU A;  2JJ2 G;  3ASO B;  1VF5 B;  1O9G A;  1EBO A;  3RVY A;  4D7T A;  1IDS A;  2R9A A;  2K1E A;  3AK3 A;  5BMV A;  4JI6 O;  3SPJ A;  2QTS A;  3QG5 A;  3FB6 C;  4J7J A;  3JSL A;  1EFR G;  5KUM A;  1ARO P;  3CC2 V;  4JYA O;  2FKX A;  1THZ A;  1SES A;  3CJH A;  3LUT B;  3STZ C;  4UCO A;  1K73 W;  3K3W A;  3D36 A;  3FD9 A;  3SYA A;  4XBF A;  3ZX6 A;  3RYC A;  3CCL V;  2P67 A;  4JI4 B;  1AVM A;  1B6Q A;  1RM1 C;  1PP9 H;  1MG1 A;  2PGG A;  4LCU C;  2QWO B;  4TV8 B;  1ZWI C;  3ASN C;  3CRQ A;  2A3Q A;  2EBO A;  5KA5 A;  2DYR C;  3U11 A;  2A7W A;  4CBC A;  4LP8 A;  4R6Z A;  1NT2 B;  3JAW B;  5K1P A;  3IJ4 A;  5TIS Z;  1U96 A;  3OUS A;  4Q20 A;  2PI4 A;  1EZV H;  2V7Q G;  1M9N A;  3G6B A;  3BY6 A;  2R9I A;  1GM9 A;  1OCR B;  1BSM A;  3CE2 A;  3WU2 Z;  1XUQ A;  3RW0 A;  4W4L A;  3K57 A;  5CN0 A;  4DV0 B;  1K97 A;  1H38 A;  1AR5 A;  1OHH G;  1R3K C;  2QKS A;  3CB2 A;  1R6T A;  2L35 A;  4JAA A;  1EM1 A;  1ORQ C;  2DMX A;  3T4Z A;  3ZN1 A;  1XHZ A;  1BE3 H;  4U7N A;  4X1Y A;  4X1I B;  1NKD A;  5J2U B;  4L87 A;  4FFK A;  2VWK A;  4YHH B;  2RJZ A;  5J2T B;  2EJ7 A;  3DC5 A;  4TWK A;  2KB1 A;  1YI2 V;  2P4V A;  3SGI A;  2DN9 A;  3ABK C;  1JMK C;  2QR4 A;  4DUZ B;  5LHH A;  3CYO A;  5LA6 B;  1NR1 A;  4DV5 O;  4B7K A;  1NS1 A;  1R1B A;  4N23 A;  4UCR A;  4F6R B;  3GVM A;  1MA1 A;  5BZB A;  2RCV A;  1IVS A;  1Q6H A;  5LGN A;  3UO2 A;  4X66 O;  1GM7 A;  3JCU Z;  4UVB A;  3P3N A;  5HFM A;  5JJN B;  4G27 B;  3T2M A;  4YJ2 A;  3ASN B;  3OEE G;  4LF8 B;  2DYR B;  5HFL A;  3IC7 A;  1TUB B;  3NXS A;  3QVN A;  4PEL A;  1GRJ A;  2ZR3 A;  3ZMZ A;  2E74 B;  4YIO A;  3K08 A;  4O2A A;  4XDL A;  2JRI A;  1D5A A;  3A8T A;  4O4L B;  4IGG A;  2DW4 A;  3RGB A;  4MTX A;  2OIE A;  1KKC A;  1YEW A;  4IT5 A;  2ADP A;  4DRX B;  1Q8I A;  2XHB A;  2WLI B;  4MW8 A;  2BOB C;  3ZHR A;  1W0J G;  2ZD9 A;  1XI1 A;  2Q4P A;  2NN4 A;  2ILM A;  1SQF A;  5B1O A;  5GON A;  2PUS A;  4CC6 A;  2LJ2 A;  4FM2 A;  3G6E V;  3HKE B;  1VQL V;  4YY3 O;  2P5O A;  5IY5 C;  2D2C B;  5B3S B;  2KQX A;  5H6R A;  5BR8 O;  2ITC C;  4DR4 O;  3K5M A;  4LF5 O;  3D36 C;  4FJC C;  4HNA B;  3SJQ C;  3VOU A;  4JI0 B;  3ETQ A;  2UUC B;  4NB5 A;  2VS0 A;  1K9M W;  4KUM A;  4JV5 B;  2WLJ A;  2WWW A;  4DUY O;  2UU9 O;  4DV3 B;  4IHJ B;  3HB3 B;  1M57 C;  1XOU A;  1XNQ O;  3OUF A;  3IGA C;  1Q7Y W;  1QHT A;  1O9H A;  4LFB B;  3E22 A;  2CTW A;  3HKB B;  1WPX A;  1N33 B;  4WFB V;  5ITZ B;  5KX5 A;  2OCC C;  1EN6 A;  4FPP A;  1B3Q A;  3N2G A;  5LGT A;  1Y74 A;  5C93 A;  1QR9 A;  5AG2 A;  5LMU B;  2ITD C;  4BW9 A;  1P7G A;  1ZAU A;  2DWD C;  3CS5 A;  2ZE8 A;  2ZM6 B;  1J5E O;  3JD1 A;  3ABU A;  1DF4 A;  1COW G;  3G71 V;  2HHH B;  3ZS8 C;  3OD4 A;  5A2Q N;  4P9P A;  1FXK A;  4JI5 B;  4PJ0 Z;  4IYH A;  4BIO A;  4W4K A;  1IBL B;  1GAX A;  2XND G;  4MVZ A;  1MMM A;  1PM9 A;  5BMV B;  5FL7 G;  4B7E A;  2GTA A;  2R9R B;  3ZMS A;  1IBM O;  3SYO A;  2GUZ A;  2EIM C;  1M56 C;  4MVO A;  3CJH B;  3G67 A;  1ZUQ A;  2WLK A;  2DQ0 A;  4DV7 O;  3UQ8 A;  3B8N A;  1CPY A;  1XIL A;  5IWA B;  1RPO A;  1KP3 A;  3RYC B;  1HNZ O;  4I4T A;  1WAZ A;  1AI5 A;  1F4M A;  1SC5 B;  4WF9 V;  4PI0 A;  1M57 B;  4WFF A;  1WJZ A;  1MSW D;  3QO7 A;  2CGO A;  4A5U B;  4DV1 B;  3CEI A;  2F23 A;  4FVM A;  4X89 A;  4TSF G;  4WFA V;  4X62 B;  3JYC A;  1F7Y A;  1HR0 B;  3JSN A;  4B3T O;  1R3L C;  3PN1 A;  4JI8 O;  2IH3 C;  1HNW B;  2QGN A;  3L9D A;  1E1R G;  4DR6 O;  3S3W A;  1TUE B;  3CMA V;  2N04 A;  1IZ3 A;  2IM9 A;  3CCM V;  3NR7 A;  4AQY O;  4ZI7 A;  2YXH A;  4LF7 O;  2IBZ H;  2CK3 G;  1VP7 A;  1I94 O;  4NVP A;  3SDL A;  2ZE5 A;  1UPG A;  1WP7 A;  3IFX A;  4J11 A;  2ATK C;  4EFB A;  1TAE A;  2UXB O;  2LGW A;  3TK1 A;  4TV8 A;  1S5L Z;  3OMA B;  3N2K A;  4QIW F;  2DYS B;  2IU0 A;  4JI7 B;  2ZCE A;  2EIM B;  1M56 B;  1NTZ H;  3K79 A;  4H37 A;  4E4E A;  3L74 H;  5KAI Z;  5L3G A;  1X59 A;  1H2K A;  3FKS G;  4KHP O;  4FZ1 A;  5CMU A;  4D6T H;  2Q0A A;  2WA4 A;  4NTW A;  4GLX A;  4YJ2 B;  5JH7 A;  4DR7 O;  3CWB H;  4BW5 A;  1NH2 B;  2P22 C;  1QCE A;  1K5Q A;  3T1C A;  5IYB O;  4X1I A;  1RFY A;  5J2U A;  4MSW C;  2EJR A;  5J2T A;  4J80 A;  3CME V;  1YIT V;  1VQ9 V;  5B1B C;  2F1M A;  2JVD A;  1EN4 A;  2ZQM A;  1ZX3 A;  1B06 A;  1Q86 W;  3BRC A;  4JI1 B;  5IYC O;  1K5S A;  1NQT A;  5H9C A;  2NNU A;  4DR5 B;  4ZBM A;  1ROP A;  3ABL C;  1FXK C;  2OTL V;  5JVD A;  3SPG A;  4JAV A;  3QTC A;  1OCZ B;  1HP8 A;  1HW7 A;  4UV8 A;  2UXD O;  3OAA G;  1DTO A;  2LW1 A;  5L3E A;  4JI3 O;  2Y0P A;  4GX0 A;  2G38 A;  2RQ6 A;  5IDJ A;  3BVO A;  4K0K O;  3TXS A;  4ICG A;  5EYP A;  1FD9 A;  1FYJ A;  3CCV V;  1DF5 A;  4JTC B;  1XMQ B;  3MDS A;  1L0N H;  3OFN G;  1S72 V;  3E83 A;  1SS3 A;  5CA1 A;  4H33 A;  1K34 A;  4DK0 A;  4RAI A;  2Y69 B;  2Q6A A;  4DV2 B;  3E22 B;  3SYQ A;  2Q67 A;  3I55 V;  4HZ3 A;  4RUF A;  1K7D A;  4UCU A;  1ZLZ A;  3QO5 A;  1KEC A;  1PL4 A;  2Q68 A;  1WB7 A;  4G28 B;  1KKD A;  2GBO A;  3OMN B;  4DR2 O;  1N0J A;  4DV4 B;  1GH6 A;  3X2Q C;  5E79 Z;  3GB7 C;  2JJ1 G;  3QNE A;  4WFG A;  1M1K W;  3OGC C;  1GN2 A;  3B77 A;  4LF6 B;  1Y74 B;  4MW3 A;  2PZS A;  2UXC B;  5L3D A;  3K5O A;  3HKE A;  2WPD G;  3T1H B;  1X4T A;  3E8H A;  2FB5 A;  3S3X A;  2HKO A;  5CBH A;  2LP7 A;  4K3A A;  2VQE B;  4H13 B;  4X1K A;  3ABL B;  4HNA A;  1FXK B;  1PNL A;  2E75 B;  4WFE A;  3JCZ A;  2QKA A;  4UFZ A;  5LXT B;  2CH7 B;  3RWR D;  2LFS A;  3CXC U;  3WB2 A;  4GKK O;  5H5N A;  3BAA A;  2PY5 A;  3E89 A;  4I5S A;  1WNS A;  3VQX A;  1HNX B;  2QE7 G;  3TGU H;  3ZCC A;  2WLH A;  2AZ2 A;  4DR1 B;  5IT9 N;  4DV6 B;  3APQ A;  3E86 A;  1NVP B;  2UUB B;  1V55 B;  3JAK A;  3UM7 A;  2XAG A;  2F4V B;  4YJ3 B;  1GN4 A;  1S76 D;  4OX9 O;  2XOK G;  1N34 B;  1H2M A;  2YIA A;  5C8Y A;  1I94 B;  2PI5 A;  1KUQ A;  3W7T A;  1JQ0 A;  2P06 A;  2ZE6 A;  5DED A;  2VQF O;  3X2Q B;  5J9P C;  4DYL A;  3K0G A;  1SQB H;  1K4D C;  3OTO B;  3ZED A;  4B3R B;  3LDE A;  1PD3 A;  4LF4 O;  3FAV B;  1SA0 A;  2CTQ A;  4LF9 B;  1F23 A;  3B8M A;  3P30 A;  3DTU B;  4ZI7 B;  2WAM A;  2VWJ A;  2EIJ B;  5E1A C;  4ZKI A;  4CH6 A;  5CBG A;  2LO1 A;  1AIL A;  1FKA O;  4I9W A;  1PV0 A;  2N05 A;  2P7T C;  2R70 A;  3LNN A;  3N2K B;  4X8A A;  4KL1 A;  4QPK A;  5D5Q A;  2ZR2 A;  3VQY A;  4B3S B;  2YDE A;  2H94 A;  1IBK B;  1QQC A;  4BWA A;  1GM8 A;  1V9P A;  1XHX A;  3UKM A;  4Z1V A;  2CTP A;  3AK2 A;  3E2E A;  5LOV A;  4EB6 A;  1DGS A;  1VQO V;  4FLY A;  1Y6X A;  1BZK A;  2ARH A;  4OXS A;  2W6I G;  3C3S A;  4K8Z A;  2OYQ A;  5JH7 B;  4GX1 A;  5FPO A;  1SET A;  1N32 B;  1AI4 A;  3C3T A;  2A79 B;  4F4L A;  3F7V C;  4I0X A;  4AIL C;  1MOF A;  3E8B A;  1A32 A;  3B4S A;  2YS8 A;  5L3C A;  1Q3E A;  3ETG A;  5B3S C;  1EZJ A;  3BA8 A;  3KKY A;  3T1Y O;  2WLL A;  3A2F A;  3ETD A;  3W7X A;  4FLU A;  1XMO O;  5JVD B;  4X64 B;  2OTJ V;  3KCY A;  3RYF A;  4BIU A;  4DR3 O;  2Y4U A;  3FB8 C;  3RFR A;  2AHY A;  1N4C A;  4UVC A;  1QNM A;  2YXL A;  4G2K A;  1JFF A;  2Z3Y A;  3ABT A;  1U97 A;  3HPL C;  2AZ0 A;  1R73 A;  5EBW C;  1XNR O;  2LFR A;  1R6N A;  2E5L O;  3VBB A;  4FM0 A;  4UB8 Z;  3W7W A;  1FFX A;  1H8H G;  4JI2 B;  3SYP A;  5H6Q A;  1FPO A;  1DLB A;  1D5N A;  4FZ0 A;  3H1J H;  2YC0 A;  5EYP B;  1GN3 A;  3MAQ A;  3RN4 A;  2GHY A;  4O4H B;  5CA1 B;  4HYO A;  4JF3 A;  1VAR A;  1VF6 A;  1WA8 A;  4K35 A;  3K9S A;  1S0V A;  2GTS A;  2E3C A;  2QTO A;  2JDI G;  3A0H Z;  3CRM A;  4FM1 A;  2H3O A;  3CRC A;  1NZ6 A;  4NXM O;  5FNV B;  1Z2G A;  1VMG A;  2B5U A;  1CP9 A;  2FML A;  1YXB A;  4WBN A;  4GX2 A;  2OWO A;  4LFA O;  1G6U A;  5BXZ A;  4PA6 A;  1VQP V;  3CXH F;  1KU9 A;  5KMG B;  2Y4T A;  3Q4H A;  3BA9 A;  3AG1 B;  4X1K B;  3SR2 C;  1IUR A;  1F51 A;  3CCQ V;  4TQF A;  3RT3 C;  5LMN O;  1D2D A;  3O65 A;  3ZHV A;  4GKJ O;  4PDV A;  2UUA B;  1AP5 A;  2IW5 A;  4PDL A;  4JYB A;  5BY1 A;  2IJH A;  4I9Q A;  3CCE V;  3RYI B;  4GYC B;  1IX9 A;  3B2E E;  1US6 A;  4MTO A;  3W7S A;  1SQV H;  2A9H A;  5B1N A;  4UV9 A;  3UT5 B;  4AHC A;  1YVW A;  2CTR A;  1XDC A;  2KKW A;  4ZIB A;  3PJS K;  2GDS A;  3L75 H;  1FXV A;  1QVF U;  1MAB G;  3JAR A;  4JI6 B;  2BTQ A;  4Q6G A;  5JCO A;  3OM3 B;  2OIG A;  1B04 A;  2LGQ A;  3TJT A;  3FYI B;  4I55 A;  4U3F H;  1KQS U;  1V54 B;  2X7R B;  1AI6 A;  4JYA B;  5A9G A;  3JAK B;  2Z5U A;  4NKG B;  5C8Y B;  2ADQ B;  2B1G A;  4GUN A;  1KD1 W;  4X65 O;  5LXT A;  4NXN O;  2CH7 A;  1E79 G;  1W2B U;  1KMI Z;  4R8C A;  2BOC C;  1WPB A;  1SA0 B;  1Q90 D;  5EC2 C;  1XL4 A;  2DYS C;  3ZMT A;  2AW9 A;  3L73 H;  1W59 A;  1PPJ H;  4IIJ A;  4UVA A;  4B08 A;  4P9O A;  1YIJ V;  3H9V A;  3A0R A;  3JAS A;  2CUG A;  1AJP A;  3EXA A;  1ENV A;  3K9A A;  4NYK A;  3DC6 A;  2ZDI A;  2XT9 A;  1VQ4 V;  4LNU B;  5FLX N;  5B1A B;  4PHZ A;  1UFI A;  4YJ3 A;  3EFF K;  3OTF A;  3JD0 A;  5EIB D;  2YIB D;  5LOV B;  4EB6 B;  3G80 A;  2L6L A;  1YJN V;  1SER A;  4QGP A;  3L72 H;  4YIP A;  2CE4 A;  5KHH A;  2QDO A;  3ZRS A;  3FAV A;  3WFV A;  4B3M O;  2Q7G A;  4TOI A;  3JAM N;  4DV5 B;  1MZE A;  5IYZ B;  3H1L H;  4LFC O;  3RBZ A;  3THO A;  1OCZ C;  4UCT A;  4I0X B;  1SRY A;  5LP6 A;  3J7A U;  1FJG O;  4ZHQ B;  2EIK C;  3KG2 A;  4X66 B;  1N36 O;  1Y76 A;  1IXB A;  3P3P A;  2FL4 A;  4JAS A;  2YI9 A;  1BS3 A;  4DW0 A;  2WLL B;  1S3J A;  1GTO A;  3RYF B;  2QM8 A;  5IJ0 A;  3K59 A;  4LH7 A;  2YUA A;  2JGD B;  2HVJ C;  4NTY A;  3OMI B;  3IAY A;  1JFF B;  2DJV A;  3JAT B;  1H2N A;  2X0L A;  2DQ3 A;  2Y69 C;  5EC1 C;  3JD4 A;  3OR7 C;  1ZSP A;  3D3I A;  2HLD G;  4LR3 A;  2F66 C;  4PA9 A;  1GO3 F;  1BCC H;  1SKV A;  2Q7H A;  2QA4 V;  4FFB A;  1I5X A;  4OGQ B;  3CD6 V;  2RMK B;  1FFX B;  3EVK A;  4I50 B;  2IJI A;  3O9O A;  5GTH Z;  3M8A A;  5JJJ B;  3CCR V;  3B40 A;  4U7O A;  1AJQ A;  5GW7 A;  2AXT Z;  1SQQ H;  4GZR B;  5CA0 A;  2RDC A;  4JI4 O;  2Q0O C;  2EX3 A;  5FPR A;  4GT1 A;  4YY3 B;  4F6E A;  2KG7 B;  1WA8 B;  1JVM A;  3ETE A;  5BR8 B;  3BHP A;  4DR4 B;  4LF5 B;  2NR5 A;  1ZL8 A;  4MS2 A;  2HR3 A;  1P84 F;  3E35 A;  2XTA A;  1PNK A;  2F93 B;  1SQG A;  2V4D A;  3D8C A;  4DUY B;  2UU9 B;  4FMT A;  1P4R A;  5EBL C;  4QJF B;  1XNQ B;  4WBN B;  3RYH B;  4DV0 O;  3ICX A;  2EIK B;  2X6C A;  4JAU A;  4X9Q A;  3VQV A;  3LSS A;  3Q4H B;  1TVK B;  1I0H A;  2HEP A;  4DK1 A;  2FTK A;  1N8R W;  4YHH O;  1WLE A;  3LSU A;  1RP3 B;  2YID A;  1YJ9 V;  1R6K A;  4UUJ C;  1WP8 A;  4O4H A;  1S5J A;  2C2A A;  4PD4 F;  4DUZ O;  1J5E B;  1V55 C;  1Z5W A;  4DO2 A;  2A0L A;  4JPR A;  2IJK A;  1VEW A;  3BAB A;  2QKC A;  5DN6 G; 
#chains in the Genus database with same CATH homology
 1Y74 A;  1ZL8 B;  3B40 A;  1ZL8 A;  1VF6 C;  1VF6 A;  1RSO B;  1Y76 B;  1Y76 A;  1Y74 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...