1RSOB

Hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
b'GLLAAERAVSQVLDSLEEIHALTDSSEKDLDFLHSVFQDQHLHTLLDLYDKINTKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Presynaptic protein SAP97
publication title The tetrameric L27 domain complex as an organization platform for supramolecular assemblies
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Neuropeptide/membrane protein
total genus 18
structure length 56
sequence length 56
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1rsoB00
1VF6C 1RSOB 1Y76B 1Y74B 1VF6A 1Y74A 3B40A 1Y76A 1ZL8B 1ZL8A
chains in the Genus database with same CATH superfamily
2GHYA 4DUYO 2NLJC 3CRMA 2ITDC 4MTOA 1GM7A 4J7JA 5K1XA 3OEEG 2NN4A 4JI6B 5LMUB 5CBFA 4DR4O 3AEIA 1TA8A 1SZTA 1CXZB 1K97A 4YXWG 4E2LA 4Z2WA 1KP3A 1R6NA 1AB3A 1N34B 1WNSA 1Q90D 1FFXA 2P06A 4FLUA 5LOVB 3L72H 3APOA 1A32A 1E1QG 4DV0O 3GWKC 2DE0X 3NXSA 4H33A 3D36C 1M56C 5IDJA 5CB4A 4JYYA 2ADPA 3FFQA 2PI4A 4DR2O 1OHHG 2XNDG 5KX5B 1VIBA 1HNZO 2DYRB 4B3SB 3ZRSA 1Q43A 3AG2C 1LNQA 1SQQH 3K9AA 3WB0A 3A0BZ 2EZPA 2ILMA 3L75H 5FLXN 2WLLA 5IJ9A 4F4LA 2CDYA 1JQ0A 1OCZC 1VF7A 2PF4E 3CYOA 3TGUH 4O2BA 2Q7HA 1R1BA 4Q20A 4HNAA 3BHPA 4O2AB 1FXKB 1P7GA 1BSMA 1SRYA 3MDSA 1M5IA 4LCUC 3JYCA 4DV0B 3CRQA 2HJFC 2EBOA 1Q7YW 2DW4A 4MVSA 2W6JG 4DR2B 1KKCA 1Y74A 2ZDIC 1HNZB 1I0HA 2UUAO 4JASA 2QWNB 4PA6A 2GUZA 4J7KA 2YSUB 2AZ2A 1SQVH 2EX3A 4IYIA 3RW0A 4I0XB 4DV1O 1E79G 3EFFK 4FLYA 3PJSK 1H2KA 4G27B 4PV1B 2ZR2A 3CMAV 1EFRG 1MNGA 2ZNIA 1XHXA 3SJQC 3MHHC 3QO5A 1RSOB 1Y76B 1O9GA 1GAXA 2VRZA 4Q6GA 5H6QA 1HWYA 3A2FA 2EIMB 1MMMA 5FPOA 3ZX6A 3ZN0A 4P30A 1K9MW 3FKSG 4B3TO 4WFFA 2UXNA 1IBKO 1ZUQA 4GUNA 3LSSA 2ZIMA 2JS3A 4F6EA 3IGAC 3X2QC 4BW5A 5J2UB 4DW1A 4EB6A 3ZBHA 4B7KA 2UUAB 1GRJA 3LNMB 1CP9A 1RPRA 3N2KB 2Q68A 1W0KG 2YUAA 1WAZA 4DV1B 2ZQMA 1DK1A 3H1JH 1WP8A 5KMGB 1WJZA 2GSMB 2UU9O 2QSAA 1TUBB 1BE3H 1W2BU 2P22C 3H01A 5BXZA 3SYAA 1YIJV 1N8RW 4P9OA 3L9DA 3ZMTA 4RAIA 3RBZA 1TVKA 1GM9A 3B09A 5B1BC 3C3SA 5LGUA 1XNQO 1HW7A 5EIBC 5HFLA 3AG3B 2RN9A 1FYJA 4LC1A 3CCRV 4FPPA 1YCIA 1AR5A 4LFBO 4B3TB 1IVSA 3KCYA 4YJ2B 1IBKB 4X9QA 3B4SA 3W7XA 2HFEC 4L8JA 5KHIA 2QEXV 4JI8O 3E86A 5LL6Y 1SQPH 4DYLA 1NVPD 2DWEC 5LHGA 1QU7A 4CS4A 1BQ0A 5CMUA 3ZRVA 1VQ8V 4FLWA 4QE7A 2CAZC 2X6AA 2VWJA 2DQ0A 3JATA 2UU9B 4IL6Z 2EINB 3FX7A 3FD9A 4HBNA 1M57B 4C7UA 2QM8A 4FFBB 2A3QA 1YDXA 2KG7A 4YY3O 2YIDA 4OX9O 1EZJA 5IJ0A 2E5LO 1WLEA 2QWRB 4DRXB 1XNQB 1GMGA 1XI1A 2ATKC 1FXHA 4UCVA 1QLEC 1QR9A 2GV9A 4LH7A 3P32A 1EN5A 3A0RA 2RMKB 2UUCO 1HDJA 5JCOC 3CPWU 3DTUB 4JI7O 1AR4A 1RM1B 5B1OA 3CJHB 1K4CC 4LWSA 4FLXA 1JX9A 3STLC 2LGWA 3HKCA 4JI8B 1NTMH 4HYOA 1OCCB 2HP8A 5IYBO 1H2LA 1ZSPA 2A0LA 2QM4A 1FPOA 5LOVA 2XOKG 3FYIB 3SPCA 4DV7O 1OCOB 3UO3A 1JJ2U 3HB3B 2KQXA 1PM9A 1XHZA 5E1AC 5IY5B 3ZMSA 2W0FC 3H1KH 4K35A 3K04A 4DO2A 1G6UA 1PKXA 4QJFB 5E79Z 4YY3B 1BGYH 3C3TA 4UVAA 4OX9B 1L0NH 2E5LB 4GZRB 1OCRC 2DWDC 1PNMA 2WA4A 1XDCA 1EN4A 2UUCB 5EBWC 3HKDB 4PA7A 2Q9LA 3WFVA 4LFAO 1KECA 2XTAA 1VEWA 4JI7B 4I9WA 3CCSV 2P4KA 5IE9A 1IX9A 2GDSA 3OAAG 5CB4B 2DQ3A 4YIOA 4GT1A 2XAHA 4J11A 1YJWV 1FXKA 2ITCC 3K06A 4U3JA 4UCUA 2FTKA 5BMVB 2WLLB 2F66C 2CE4A 5KUMA 3K58A 1YVWA 3FYEB 2AW9A 4BAYA 1S77D 3CHXA 4O2BB 1F51A 2QKCA 3BRCA 3CRAA 1GN6A 3ZHSA 2VS0A 1PL4A 4LFAB 1NZ6A 2ZE7A 4XDKA 1Q8IA 1RSOA 1Y76A 3GWOA 2Z5UA 1S76D 1THZA 5KA5A 3JD3A 2X0LA 3AG4C 2C2AA 4DR5O 2FKXA 1Y74B 3SPJA 4CC6A 3D8CA 5LGTA 2ZE8A 1K7DA 2VQFO 3UKMA 3HKBB 4PA9A 1IURA 3ZRWB 4P2ZA 3SDLA 4J80A 4DV5O 1VMGA 4MSWC 3RVZA 4LF7O 4OGQB 3VQYA 2JS5A 4NXNB 1AJQA 5J2UA 2XASA 5B5EZ 3BA9A 3JD4A 5AG2A 4LF9O 3ZHVA 3K5LA 1P7BA 1P4RA 3JAKB 4UFZA 2LW7A 4XDJA 2OCCC 3C90A 5B66Z 1ENVA 3ABLC 1KUQA 4JYCA 4O4HA 2MW2B 5JVDB 1TUBA 1IDSA 3P3NA 4JAVA 1AI7A 4Z1VA 2Y4UA 4I50A 4LF6O 3LNNA 5FNVB 5LP6B 1S5JA 4JI2O 4QPJA 5HFMA 4LF5O 1KP2A 3QG5A 2VWKA 2K9PA 4NR1A 1DLBA 4B7EA 1SC5B 2VQFB 2EIJB 4JAUA 4LNUA 3QO7A 3MD0A 4YJ2A 1W0JG 4DV5B 4LF7B 1T5EA 2BE3A 2V4DA 5KHGA 2IM9A 2QR4A 2BSKA 2RQ6A 4RUEA 4LF9B 4TT3G 2YIBD 2Q5ZA 3FB6C 1I7FA 3B8MA 4Z1MG 3CCMV 1TVKB 1J95A 2WLKA 4IHJA 1XILA 1KMIZ 2ZM6O 3OR6C 3OUSA 3JAMN 3L73H 4PA3A 5EC1C 1E1RG 3ZHRA 1FS0G 4LF6B 5DM6V 4JI2B 2ZD9A 3SPHA 1EZVH 1X59A 4LF5B 2XAJA 4DRXA 2DYSB 2PI5A 3MHSC 4J42A 1N0NA 1M93A 3VQXA 3FB8C 5EBLC 3OD4A 4NXMB 1XMOO 1V55C 3AK1A 4FLVA 1GM8A 3JALA 4NTWA 1YITV 3RYCA 4TV9A 2OTJV 3ZHTA 2JEUA 1NI8A 3OUFA 4H37A 3JARA 1PL0A 2LFSA 4FIPC 3B77A 3ABKB 4U7OA 3SPGA 5IJ0B 2ZM6B 4D7TA 2GTAA 2UXCB 5TISZ 4UB6Z 2R70A 3SJAC 3E83A 1ZLZA 3OGCC 2ZR3A 1VQ6V 4QE9A 4LWSB 3N2GB 3ZMVA 1SQBH 3HKCB 4I7ZB 3D3QA 2HR3A 3HKDA 4X66O 1VQ7V 1XMOB 3K79A 4ICGA 3T1CA 2XAGA 2G38A 3WG7C 2E3CA 4X1KA 2DYRC 3LDEA 1NR1A 2IJHA 4LP8A 3AK3A 4MVMA 1S5HC 4OXSA 2YIAA 4JTAB 2WSSG 1AVMA 2RNBA 2Q7EA 3IC9A 4DR1O 1D5NA 3MAQA 1WPBA 3J80N 3T2MA 2O57A 1F7YA 3ZN1A 3BABA 5BMVA 4PDMA 1LR1A 4LBEC 4E4EA 1SQFA 4DUYB 4WFGA 1LUVA 1XEQA 2JJ2G 2ZKOA 4EEQA 5LMNO 4DR4B 1H2GA 4ZHQA 1M9NA 4H0LB 4TV8A 5D5QA 4NTYA 3ZHQA 2CTWA 1YSCA 2UXXA 3CC2V 3SGIA 4X66B 4U3JB 1QBZA 3UM7A 4I55A 2HEPA 3FAVA 1UPGA 3RGBA 1SQGA 1NH2B 2ADQB 5EK0A 3ZRXA 4ZKIA 2RDCA 3RWRD 2E75B 3OE7G 5B1AB 3SR2C 1MZEA 3JD1A 2WLIA 5IYCO 3VBBA 1Y67A 3B8NA 5JH7A 4DR1B 2V7QG 3N27A 4DUZO 3HKBA 3ZRWA 4UVCA 1OJHA 1FKAO 1GN4A 4IGGA 2L6LA 1G8MA 1P49A 2YEVA 2CGNA 2FL4A 3W7WA 2EIMC 3W7UA 4YHHO 5LMNB 3JAKA 3ZJZA 4X1YA 2D3OW 3APQA 2FMLA 3Q4HB 2QA4V 2CH7B 1QR8A 5JVDA 4JV5O 1R3IC 4K0KO 3I5DA 5KLVH 3ZEDA 3BPZA 4JAAA 3RYIB 1YHQV 5FNVA 5C93A 5LP6A 1Q6UA 2RJZA 1XMQO 1VQNV 4GX0A 5D5PA 3OGIB 4OPHA 1NBMG 3DSQA 1BT8A 3F7YC 4DUZB 1K4DC 3OTOO 5H6RA 1RPOA 2IH1C 4YJ3A 3WU2Z 3IAYA 4O4HB 1K92A 3DXRB 5B3SC 2PUSA 4PD4F 4MT8A 3AK2A 3S3WA 3TXQA 5IYZB 1AJPA 3K5NA 3RVYA 4YHHB 4I50B 1AROP 3CCVV 2FB5A 2JIZG 3AG3C 2IJKA 3JASB 4DV2O 2E76B 2EIKB 3JD2A 4ZI7A 4JV5B 5A2QN 4JI4O 4LNUB 1KU9A 4U3FH 3O9OA 4BW9A 1XMQB 3KCXA 4UXNA 2Q67A 1HP8A 1AI6A 4JYAO 3RYHB 2P5OA 5LGNA 1MABG 3TJTA 4RO2A 1NJIW 3M8AA 4NTXA 2P90A 4CS2A 2ZE5A 1N4CA 2BSKB 5FL7G 3AG1B 3R65A 3JAWA 4G2KA 3OTOB 4AI8A 2ZINA 4IHJB 1QVFU 1GKFA 1G1XB 3ASOB 4FVMA 1M57C 4DR3O 3BEHA 1VF6C 4XBFA 2W6IG 4RQEA 3NR7A 1DTOA 4J9ZB 1V54B 4DV2B 1JVMA 1MSDA 4IT5A 4FZ0A 1YZBA 2UUBO 2X7RB 5KHJA 1RM1C 3ML0A 3T1YO 4RUFA 2KKWA 4LFBB 5BR8O 3P30A 1OCCC 1GK9A 3N2GA 3JALB 1R3JC 2NNUA 4JYAB 4F6RA 4FMTA 3RYCB 2K1EA 1U96A 4TV9B 1JA8A 3F7VC 2GTSA 1OCOC 3DC5A 1VQ4V 5KUKA 1IBLO 1PNKA 3JARB 4DR7O 2YI9A 3TK1A 2KB1A 1SQXH 4JPRA 2HVKC 1RFYA 3CCEV 3CEIA 4FLZA 2QE7G 3RN4A 1H8EG 3K5OA 4J7ZA 1R73A 1BZKA 4DR3B 4J10A 4O4IB 3E8BA 3FB5C 1OZ0A 1YTFB 2LGQA 1GTOA 4X62O 4PJ0Z 1K8AW 1KYOF 3OM3B 4TUYB 1YEWA 4K3AA 3EXAA 4TQFA 5KAFZ 2DMXA 1S3JA 3IJ4A 4K8ZA 3L71H 3I56V 3F5TA 1JMKC 3T1YB 2X6CA 1XBLA 3IC7A 2IU0A 1KKDA 2IW5A 3D36A 3BAAA 4JTCB 4H13B 2PYLA 4PI2A 2YC0A 4BIUA 3RYFB 2CK3G 4X1KB 2ZXWC 2Y0IA 2Q7GA 1M90W 2QWPB 3BFRA 3CXCU 1M1KW 2BTQA 2EZOA 1TGOA 4LFCO 1QCEA 1O9HA 4FJCC 4CC5A 4CH5A 4W4KA 2LO1A 2M6YA 4DV7B 5LXTA 1PP9H 3P3PA 1K5QA 4DK1A 4YIPA 1K73W 5GW7A 4IIJA 2Y69B 3JD0A 2BOCC 2OCHA 2JVDA 4D7SA 1COWG 2XAFA 4X62B 5EZYA 4QGPA 1F4MA 2Q69A 3WB1A 4ZHQB 4TV8B 4NVPA 3OFNG 3CS5A 5CBHA 4B08A 2KSDA 4I55B 3PN1A 5JJEB 3FAVB 1DF5A 4U7NA 5EBMC 1DF4A 5JQGB 4TOIA 5L3EA 2ZDIA 2CUGA 4LFCB 4UCRA 3Q4HA 2WLIB 1JPXA 4UCOA 2CH7A 1L1FA 1Z5WA 1IZ3A 5GONA 5JH7B 3T4ZA 2PTMA 3RYIA 1HNXO 4R50A 3O65A 3E2EA 4FLTA 4B3RO 4CS3A 4ZIBA 2YEVB 1ZX3A 3LSUA 1VQPV 4X1YB 3JSLA 4DK0A 1BS3A 4TSFG 4WFEA 3DXRA 2B5UA 4DR6O 5IYZA 4K8XA 5GTHZ 1HNWO 1EN6A 1V9PA 2R9RB 1IBMO 5ITZB 3E8HA 2JK5C 4TQDA 1EBOA 1GH6A 4N21A 4DR5B 3JASA 4PDRA 2EIJC 2F43G 4JGSA 2OCCB 2XHBA 4LF8O 1NTZH 3ZCCA 2EILB 4B3MO 1S0VA 4YJ3B 3G6EV 2JGDB 1F4NA 4B3RB 3RYHA 2A7WA 1JCHA 3F5WC 4MVZA 1I94O 5J2TB 1J5EO 4XDLA 4UUJC 1PNLA 2IJIA 2CTRA 3QVNA 2YXHA 5LHHA 1I5XA 1KBHA 2QKAA 1Y66A 2F4VO 3W7TA 3LSQA 5A9GA 1I5YA 3BCCH 2EJRA 3A8TA 2WWWA 5DECA 2VQEO 2BCCH 2QKSA 4ZI7B 1NR7A 4DR6B 3B40A 1UJWB 1FJGO 1ZTEA 3T1HO 5DN6G 4PHZA 1HNWB 1B3QA 3KG2A 3ASNC 1IBMB 3CRCA 4BR6A 4PDVA 4MS2A 2OYQA 3ETEA 1XUQA 1NVPB 4GX1A 4LF8B 3JAWB 2V1DA 4MTXA 4NB5A 3HR0A 4W4LA 5LMUO 4B3MB 1ZWIC 4MW3A 2ZCEA 3E8GA 3ZS8C 4CH3A 3QNEA 1AR1B 1I94B 2WA3A 1R3KC 1J5EB 4O4LB 5DEDA 5J9PC 1D2DA 3ABMC 2H3OA 3U11A 2F4VB 4KHPO 3EVKA 4X88A 4UCTA 2H94A 1XL6A 2F93B 1FAFA 2A06H 3E35A 5JCOA 3HPLC 3J7AU 1NS1A 4O4IA 1FJGB 3T1HB 1F23A 2GBOA 4KXRA 1YF2A 1VARA 3J81N 2JGUA 4JI1O 3G71V 3HKEA 4F6RB 4B3SO 1H2NA 4TUYA 1DGSA 2Y48A 1WA8A 5EYPA 4EKWA 4X64O 2HKOA 5CA3A 3JSNA 1VQLV 1YTFD 4FM2A 3E89A 4O4JA 2WLNA 1FXVA 3E22A 3RYFA 2YXLA 3ABUA 1D5AA 2XAQA 3KZIZ 3ZMZA 3SPIA 2AZ0A 2EJ7A 4WFAV 4KL1A 4FM1A 4KHPB 1VP7A 5BY1A 3K3WA 4KUMA 4PELA 2L35A 4X8AA 1LUWA 3G80A 4JYBA 4MVRA 1R3LC 1L8DA 3OT7A 3GVMA 4X65O 3VQVA 4AILC 1K3EA 3WG7B 4UB8Z 4JI1B 2Q6AA 2PGGA 4R7CA 5CA1A 2OWOA 1M56B 1Q6IA 3SYPA 1Q6HA 3SYCA 1FXKC 3OMNB 1B6QA 2BTQB 2EULA 2OTLV 4X64B 4GKKO 2F23A 1OV9A 1SETA 3CP1A 4RQFA 3AG2B 5LXTB 1U97A 1S5LZ 2BOBC 5B1AC 3OW2U 1JJOA 3K9SA 1Q5OA 1M4UA 3CXHF 4D6TH 2QGNA 1JFFB 2JDIG 5CA0A 5JQGA 4IIJB 4UV8A 3OMIB 1OCZB 4MVQA 4JF3A 3I55V 4BIZA 5BZBA 2PZSA 2QTOA 4N23A 5EZYB 1PPJH 1YXBA 4GX5A 4CH4A 4JZ2A 4KFMA 4PDLA 3S3XA 1L0LH 3SYOA 4DV3O 1NTKH 5IWAO 4X65B 1QLNA 2LQTA 2Q0AA 5LA6B 5L3FA 4GLXA 5EC2C 3M99B 2LJ2A 1CPYA 3B2EE 2Y4TA 2HG5C 1AP5A 2H8PC 1R6KA 4AHCA 4GKKB 1K33A 5H9CA 4FK5C 2LFRA 3G6BA 5GONB 3CX5F 3BVOA 4HZ3A 5KA6A 3SYQA 5ITZA 1SKVA 1NQTA 5C8YA 1IXMA 1BHBA 2Z3YA 2ETNA 4QPKA 4FFKA 1Q81W 4X1IB 1MZFA 3K03A 1BHAA 5LBQA 1NU1H 1SA0B 1EM1A 1GN3A 4EFBA 2Q8VA 1FD9A 3RT3C 4MTGA 2N05A 2JGDA 4DV3B 5IWAB 1Z2GA 2QWOB 3TETA 5J2TA 3CCQV 1ZAUA 4X20A 1JR9A 4JZGA 5LYJA 2ZT9B 3H9VA 1S72V 2JEXA 3ETDA 4JI5O 3T4DA 3X2QB 2EIKC 2LP7A 3D3IA 1WPXA 4OPAA 1TUEB 1CEZA 4WCEV 3BA8A 5CBGA 2BTOA 1H2SB 4K0KB 3UT5A 4TWKA 3H1HH 2YICA 2XUMA 4MW8A 1ZL8B 4GX2A 1NKDA 5B3SB 3K5MA 4ZOLA 1HR0O 3H1IH 3JCZA 1ROPA 5LHIA 3AG1C 3IFXA 2YS8A 1UFIA 2DOSA 4PA4A 3ASOC 5B1BB 2EINC 4DW0A 2A79B 4GKJO 1VF5B 3VOUA 1XL4A 3UO2A 3WB2A 2AXTZ 3CRRA 1IXBA 1N32O 3UQ8A 4O4LA 3G67A 2WAMA 1V54C 1KC8W 4DV6O 3LUTB 4JI5B 1VQOV 4WBNA 3CC7V 1Y4MA 1K34A 4EFEA 1N33O 1ORQC 5GTIZ 2M7WA 2OIEA 4GYCB 2QTSA 4JI4B 2XT9A 2IBZH 2Y0PA 2A9HA 1BMFG 1VQKV 2HJDA 1MSWD 1KB9F 3ZMUA 1HR0B 4ASUG 3CC4V 1VQ9V 4GCZA 4NKGB 4QIWF 3QTCA 4ABMA 4UVBA 4RWUA 4JI3O 2WLJA 2OIGA 1YI2V 1Z5VA 5IY5C 1QNMA 2B9ZA 3BY6A 2JRIA 4GKJB 1QLEB 3K59A 5B1NA 4AQYO 1Y6XA 1BCCH 2QM7A 1N32B 2DJVA 4I4TB 3CE2A 2IU3A 4DV6B 1AILA 3ZIAG 5KHHA 1US6A 4NYKA 3HKEB 1N0JA 1SZXA 1W59A 1N33B 2AHYA 1WA8B 2UUBB 5EYPB 1TAEA 2R9AA 3CCLV 4G28B 5BR8B 3CCJV 2Z0AA 4O4JB 5KX5A 1WP7A 2CTQA 3M7MX 3E22B 4QNHB 4JI3B 1JOYA 3U0ZA 2YI8A 1IBLB 1FFXB 1SS3A 4DR7B 4LR3A 2FYUH 1OCRB 2IH3C 4JTDB 2Y69C 2P6JA 4AQYB 3L74H 3QO8A 1JFFA 1N36O 3STZC 2X6BA 2HHHO 3CCUV 2OT5A 4R6ZA 3DC6A 3W7SA 2N04A 2ZXWB 5CA1B 1MOFA 4O2AA 1MA1A 4R8CA 5K1PA 2P67A 2ZNJA 4CZZA 3OTFA 2P4VA 3CSXA 1NH2D 1WB8A 1WB7A 4LF4O 4J41A 1KD1W 1AP6A 4X89A 3UCSC 2RCVA 2QJ1A 4FM0A 4NXNO 1SERA 5IJ9B 5LA6A 4MVUA 1QHTA 2B1IA 3LDDA 1B04A 1AI5A 5IYDO 2HVJC 5CA0B 1P84F 2WLMA 4I0XA 1X4TA 2R72A 4I5SA 1SESA 4HNAB 4KP4A 2W0XA 3LDCA 4LH6A 1VQMV 2UXDO 1RP3B 3FB7C 4I9QA 4CH6A 4HAMA 1AI4A 2UXBO 3TXSA 3K0GA 1N36B 3SJCC 2AHZA 5JJNB 5CN0A 2HHHB 5H2FZ 1QVGU 3AG4B 3OMAB 5L3DA 4X1IA 2AGAA 2NR5A 2GUZB 3CWBH 3ABTA 4DV4O 4MVOA 1QQCA 4LF4B 1SA0A 2WPDG 1K5SA 2QWQB 3DGEA 2ZE6A 2YDEA 3OEHG 4UV9A 5LP6C 1VQ5V 1WN7A 3ETQA 1B06A 3U10A 4L87A 3N2KA 5C8YB 3JCUZ 4IYHA 3E8FA 2QDOA 3AG7A 5JJJB 1Q82W 5KMGA 2EILC 3CB2A 3EHBB 2CTPA 1MG1A 2UXDB 3ABLB 3ICXA 2MK3A 1ZL8A 3ZHUA 2UXBB 2JJ1G 1HNXB 1AJNA 4J9YB 1XREA 3CMEV 2F1MA 5F2VO 2PYJA 4EB6B 4X20B 4P9PA 1PV0A 5LYJB 2YIBA 2DN9A 4NXMO 4DV4B 1BQZA 3VQWA 1H2MA 2E74B 3ETGA 2YXYA 1GN2A 4ZBMA 1BL8A 4H44B 1G4YB 4JI0O 3TCUA 3QF7A 3UT5B 1PD3A 5L3CA 1H8HG 1I08A 1XNRO 4ZOLB 2DYSC 3GB7C 2ARHA 5EIBD 1XQ8A 1KQSU 5KHKA 5IT9N 2ODMA 1R6TA 2B1GA 1XOUA 3L70H 2PY5A 2F95B 4BWAA 2UXCO 2Q4PA 3K0DA 3K08A 3K57A 2D2CB 2P7TC 5JWPA 4JI6O 1YJNV 1VF6A 2HLDG 4FFBA 1Q86W 1NT2B 3ASNB 2Q0OC 5L3BA 2LW1A 1Q3EA 3ABKC 1N34O 2WLHA 3THOA 4A5UB 4UCSA 4DXWA 4WBNB 4WFBV 1H38A 3CJHA 5FPRA 5L3GA 4BIOA 2VQEB 3JATB 3OR7C 4FZ1A 4JI0B 4WF9V 2N74A 2ZIOA 5H5NA 1FFTB 1V55B 2R9IA 3R66A 3KKYA 4PI0A 5KAIZ 1YJ9V 4I4TA 3SJBC 1URFA 3A0HZ 1XNRB 3H1LH 4WFHA 2IJJA 2KG7B 1GO3F 3G4SV 3CD6V 1SF9A 4CBCA 2CGOA 3ABMB 4MTFA 3RFRA 2Q73A
chains in the Genus database with same CATH topology
1VF6C 1RSOB 1Y76B 1Y74B 1VF6A 1Y74A 3B40A 1Y76A 1ZL8B 1ZL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF6 C;  1RSO B;  1Y76 B;  1Y74 B;  1VF6 A;  1Y74 A;  3B40 A;  1Y76 A;  1ZL8 B;  1ZL8 A; 
#chains in the Genus database with same CATH topology
 2GHY A;  4DUY O;  2NLJ C;  3CRM A;  2ITD C;  4MTO A;  1GM7 A;  4J7J A;  5K1X A;  3OEE G;  2NN4 A;  4JI6 B;  5LMU B;  5CBF A;  4DR4 O;  3AEI A;  1TA8 A;  1SZT A;  1CXZ B;  1K97 A;  4YXW G;  4E2L A;  4Z2W A;  1KP3 A;  1R6N A;  1AB3 A;  1N34 B;  1WNS A;  1Q90 D;  1FFX A;  2P06 A;  4FLU A;  5LOV B;  3L72 H;  3APO A;  1A32 A;  1E1Q G;  4DV0 O;  3GWK C;  2DE0 X;  3NXS A;  4H33 A;  3D36 C;  1M56 C;  5IDJ A;  5CB4 A;  4JYY A;  2ADP A;  3FFQ A;  2PI4 A;  4DR2 O;  1OHH G;  2XND G;  5KX5 B;  1VIB A;  1HNZ O;  2DYR B;  4B3S B;  3ZRS A;  1Q43 A;  3AG2 C;  1LNQ A;  1SQQ H;  3K9A A;  3WB0 A;  3A0B Z;  2EZP A;  2ILM A;  3L75 H;  5FLX N;  2WLL A;  5IJ9 A;  4F4L A;  2CDY A;  1JQ0 A;  1OCZ C;  1VF7 A;  2PF4 E;  3CYO A;  3TGU H;  4O2B A;  2Q7H A;  1R1B A;  4Q20 A;  4HNA A;  3BHP A;  4O2A B;  1FXK B;  1P7G A;  1BSM A;  1SRY A;  3MDS A;  1M5I A;  4LCU C;  3JYC A;  4DV0 B;  3CRQ A;  2HJF C;  2EBO A;  1Q7Y W;  2DW4 A;  4MVS A;  2W6J G;  4DR2 B;  1KKC A;  1Y74 A;  2ZDI C;  1HNZ B;  1I0H A;  2UUA O;  4JAS A;  2QWN B;  4PA6 A;  2GUZ A;  4J7K A;  2YSU B;  2AZ2 A;  1SQV H;  2EX3 A;  4IYI A;  3RW0 A;  4I0X B;  4DV1 O;  1E79 G;  3EFF K;  4FLY A;  3PJS K;  1H2K A;  4G27 B;  4PV1 B;  2ZR2 A;  3CMA V;  1EFR G;  1MNG A;  2ZNI A;  1XHX A;  3SJQ C;  3MHH C;  3QO5 A;  1RSO B;  1Y76 B;  1O9G A;  1GAX A;  2VRZ A;  4Q6G A;  5H6Q A;  1HWY A;  3A2F A;  2EIM B;  1MMM A;  5FPO A;  3ZX6 A;  3ZN0 A;  4P30 A;  1K9M W;  3FKS G;  4B3T O;  4WFF A;  2UXN A;  1IBK O;  1ZUQ A;  4GUN A;  3LSS A;  2ZIM A;  2JS3 A;  4F6E A;  3IGA C;  3X2Q C;  4BW5 A;  5J2U B;  4DW1 A;  4EB6 A;  3ZBH A;  4B7K A;  2UUA B;  1GRJ A;  3LNM B;  1CP9 A;  1RPR A;  3N2K B;  2Q68 A;  1W0K G;  2YUA A;  1WAZ A;  4DV1 B;  2ZQM A;  1DK1 A;  3H1J H;  1WP8 A;  5KMG B;  1WJZ A;  2GSM B;  2UU9 O;  2QSA A;  1TUB B;  1BE3 H;  1W2B U;  2P22 C;  3H01 A;  5BXZ A;  3SYA A;  1YIJ V;  1N8R W;  4P9O A;  3L9D A;  3ZMT A;  4RAI A;  3RBZ A;  1TVK A;  1GM9 A;  3B09 A;  5B1B C;  3C3S A;  5LGU A;  1XNQ O;  1HW7 A;  5EIB C;  5HFL A;  3AG3 B;  2RN9 A;  1FYJ A;  4LC1 A;  3CCR V;  4FPP A;  1YCI A;  1AR5 A;  4LFB O;  4B3T B;  1IVS A;  3KCY A;  4YJ2 B;  1IBK B;  4X9Q A;  3B4S A;  3W7X A;  2HFE C;  4L8J A;  5KHI A;  2QEX V;  4JI8 O;  3E86 A;  5LL6 Y;  1SQP H;  4DYL A;  1NVP D;  2DWE C;  5LHG A;  1QU7 A;  4CS4 A;  1BQ0 A;  5CMU A;  3ZRV A;  1VQ8 V;  4FLW A;  4QE7 A;  2CAZ C;  2X6A A;  2VWJ A;  2DQ0 A;  3JAT A;  2UU9 B;  4IL6 Z;  2EIN B;  3FX7 A;  3FD9 A;  4HBN A;  1M57 B;  4C7U A;  2QM8 A;  4FFB B;  2A3Q A;  1YDX A;  2KG7 A;  4YY3 O;  2YID A;  4OX9 O;  1EZJ A;  5IJ0 A;  2E5L O;  1WLE A;  2QWR B;  4DRX B;  1XNQ B;  1GMG A;  1XI1 A;  2ATK C;  1FXH A;  4UCV A;  1QLE C;  1QR9 A;  2GV9 A;  4LH7 A;  3P32 A;  1EN5 A;  3A0R A;  2RMK B;  2UUC O;  1HDJ A;  5JCO C;  3CPW U;  3DTU B;  4JI7 O;  1AR4 A;  1RM1 B;  5B1O A;  3CJH B;  1K4C C;  4LWS A;  4FLX A;  1JX9 A;  3STL C;  2LGW A;  3HKC A;  4JI8 B;  1NTM H;  4HYO A;  1OCC B;  2HP8 A;  5IYB O;  1H2L A;  1ZSP A;  2A0L A;  2QM4 A;  1FPO A;  5LOV A;  2XOK G;  3FYI B;  3SPC A;  4DV7 O;  1OCO B;  3UO3 A;  1JJ2 U;  3HB3 B;  2KQX A;  1PM9 A;  1XHZ A;  5E1A C;  5IY5 B;  3ZMS A;  2W0F C;  3H1K H;  4K35 A;  3K04 A;  4DO2 A;  1G6U A;  1PKX A;  4QJF B;  5E79 Z;  4YY3 B;  1BGY H;  3C3T A;  4UVA A;  4OX9 B;  1L0N H;  2E5L B;  4GZR B;  1OCR C;  2DWD C;  1PNM A;  2WA4 A;  1XDC A;  1EN4 A;  2UUC B;  5EBW C;  3HKD B;  4PA7 A;  2Q9L A;  3WFV A;  4LFA O;  1KEC A;  2XTA A;  1VEW A;  4JI7 B;  4I9W A;  3CCS V;  2P4K A;  5IE9 A;  1IX9 A;  2GDS A;  3OAA G;  5CB4 B;  2DQ3 A;  4YIO A;  4GT1 A;  2XAH A;  4J11 A;  1YJW V;  1FXK A;  2ITC C;  3K06 A;  4U3J A;  4UCU A;  2FTK A;  5BMV B;  2WLL B;  2F66 C;  2CE4 A;  5KUM A;  3K58 A;  1YVW A;  3FYE B;  2AW9 A;  4BAY A;  1S77 D;  3CHX A;  4O2B B;  1F51 A;  2QKC A;  3BRC A;  3CRA A;  1GN6 A;  3ZHS A;  2VS0 A;  1PL4 A;  4LFA B;  1NZ6 A;  2ZE7 A;  4XDK A;  1Q8I A;  1RSO A;  1Y76 A;  3GWO A;  2Z5U A;  1S76 D;  1THZ A;  5KA5 A;  3JD3 A;  2X0L A;  3AG4 C;  2C2A A;  4DR5 O;  2FKX A;  1Y74 B;  3SPJ A;  4CC6 A;  3D8C A;  5LGT A;  2ZE8 A;  1K7D A;  2VQF O;  3UKM A;  3HKB B;  4PA9 A;  1IUR A;  3ZRW B;  4P2Z A;  3SDL A;  4J80 A;  4DV5 O;  1VMG A;  4MSW C;  3RVZ A;  4LF7 O;  4OGQ B;  3VQY A;  2JS5 A;  4NXN B;  1AJQ A;  5J2U A;  2XAS A;  5B5E Z;  3BA9 A;  3JD4 A;  5AG2 A;  4LF9 O;  3ZHV A;  3K5L A;  1P7B A;  1P4R A;  3JAK B;  4UFZ A;  2LW7 A;  4XDJ A;  2OCC C;  3C90 A;  5B66 Z;  1ENV A;  3ABL C;  1KUQ A;  4JYC A;  4O4H A;  2MW2 B;  5JVD B;  1TUB A;  1IDS A;  3P3N A;  4JAV A;  1AI7 A;  4Z1V A;  2Y4U A;  4I50 A;  4LF6 O;  3LNN A;  5FNV B;  5LP6 B;  1S5J A;  4JI2 O;  4QPJ A;  5HFM A;  4LF5 O;  1KP2 A;  3QG5 A;  2VWK A;  2K9P A;  4NR1 A;  1DLB A;  4B7E A;  1SC5 B;  2VQF B;  2EIJ B;  4JAU A;  4LNU A;  3QO7 A;  3MD0 A;  4YJ2 A;  1W0J G;  4DV5 B;  4LF7 B;  1T5E A;  2BE3 A;  2V4D A;  5KHG A;  2IM9 A;  2QR4 A;  2BSK A;  2RQ6 A;  4RUE A;  4LF9 B;  4TT3 G;  2YIB D;  2Q5Z A;  3FB6 C;  1I7F A;  3B8M A;  4Z1M G;  3CCM V;  1TVK B;  1J95 A;  2WLK A;  4IHJ A;  1XIL A;  1KMI Z;  2ZM6 O;  3OR6 C;  3OUS A;  3JAM N;  3L73 H;  4PA3 A;  5EC1 C;  1E1R G;  3ZHR A;  1FS0 G;  4LF6 B;  5DM6 V;  4JI2 B;  2ZD9 A;  3SPH A;  1EZV H;  1X59 A;  4LF5 B;  2XAJ A;  4DRX A;  2DYS B;  2PI5 A;  3MHS C;  4J42 A;  1N0N A;  1M93 A;  3VQX A;  3FB8 C;  5EBL C;  3OD4 A;  4NXM B;  1XMO O;  1V55 C;  3AK1 A;  4FLV A;  1GM8 A;  3JAL A;  4NTW A;  1YIT V;  3RYC A;  4TV9 A;  2OTJ V;  3ZHT A;  2JEU A;  1NI8 A;  3OUF A;  4H37 A;  3JAR A;  1PL0 A;  2LFS A;  4FIP C;  3B77 A;  3ABK B;  4U7O A;  3SPG A;  5IJ0 B;  2ZM6 B;  4D7T A;  2GTA A;  2UXC B;  5TIS Z;  4UB6 Z;  2R70 A;  3SJA C;  3E83 A;  1ZLZ A;  3OGC C;  2ZR3 A;  1VQ6 V;  4QE9 A;  4LWS B;  3N2G B;  3ZMV A;  1SQB H;  3HKC B;  4I7Z B;  3D3Q A;  2HR3 A;  3HKD A;  4X66 O;  1VQ7 V;  1XMO B;  3K79 A;  4ICG A;  3T1C A;  2XAG A;  2G38 A;  3WG7 C;  2E3C A;  4X1K A;  2DYR C;  3LDE A;  1NR1 A;  2IJH A;  4LP8 A;  3AK3 A;  4MVM A;  1S5H C;  4OXS A;  2YIA A;  4JTA B;  2WSS G;  1AVM A;  2RNB A;  2Q7E A;  3IC9 A;  4DR1 O;  1D5N A;  3MAQ A;  1WPB A;  3J80 N;  3T2M A;  2O57 A;  1F7Y A;  3ZN1 A;  3BAB A;  5BMV A;  4PDM A;  1LR1 A;  4LBE C;  4E4E A;  1SQF A;  4DUY B;  4WFG A;  1LUV A;  1XEQ A;  2JJ2 G;  2ZKO A;  4EEQ A;  5LMN O;  4DR4 B;  1H2G A;  4ZHQ A;  1M9N A;  4H0L B;  4TV8 A;  5D5Q A;  4NTY A;  3ZHQ A;  2CTW A;  1YSC A;  2UXX A;  3CC2 V;  3SGI A;  4X66 B;  4U3J B;  1QBZ A;  3UM7 A;  4I55 A;  2HEP A;  3FAV A;  1UPG A;  3RGB A;  1SQG A;  1NH2 B;  2ADQ B;  5EK0 A;  3ZRX A;  4ZKI A;  2RDC A;  3RWR D;  2E75 B;  3OE7 G;  5B1A B;  3SR2 C;  1MZE A;  3JD1 A;  2WLI A;  5IYC O;  3VBB A;  1Y67 A;  3B8N A;  5JH7 A;  4DR1 B;  2V7Q G;  3N27 A;  4DUZ O;  3HKB A;  3ZRW A;  4UVC A;  1OJH A;  1FKA O;  1GN4 A;  4IGG A;  2L6L A;  1G8M A;  1P49 A;  2YEV A;  2CGN A;  2FL4 A;  3W7W A;  2EIM C;  3W7U A;  4YHH O;  5LMN B;  3JAK A;  3ZJZ A;  4X1Y A;  2D3O W;  3APQ A;  2FML A;  3Q4H B;  2QA4 V;  2CH7 B;  1QR8 A;  5JVD A;  4JV5 O;  1R3I C;  4K0K O;  3I5D A;  5KLV H;  3ZED A;  3BPZ A;  4JAA A;  3RYI B;  1YHQ V;  5FNV A;  5C93 A;  5LP6 A;  1Q6U A;  2RJZ A;  1XMQ O;  1VQN V;  4GX0 A;  5D5P A;  3OGI B;  4OPH A;  1NBM G;  3DSQ A;  1BT8 A;  3F7Y C;  4DUZ B;  1K4D C;  3OTO O;  5H6R A;  1RPO A;  2IH1 C;  4YJ3 A;  3WU2 Z;  3IAY A;  4O4H B;  1K92 A;  3DXR B;  5B3S C;  2PUS A;  4PD4 F;  4MT8 A;  3AK2 A;  3S3W A;  3TXQ A;  5IYZ B;  1AJP A;  3K5N A;  3RVY A;  4YHH B;  4I50 B;  1ARO P;  3CCV V;  2FB5 A;  2JIZ G;  3AG3 C;  2IJK A;  3JAS B;  4DV2 O;  2E76 B;  2EIK B;  3JD2 A;  4ZI7 A;  4JV5 B;  5A2Q N;  4JI4 O;  4LNU B;  1KU9 A;  4U3F H;  3O9O A;  4BW9 A;  1XMQ B;  3KCX A;  4UXN A;  2Q67 A;  1HP8 A;  1AI6 A;  4JYA O;  3RYH B;  2P5O A;  5LGN A;  1MAB G;  3TJT A;  4RO2 A;  1NJI W;  3M8A A;  4NTX A;  2P90 A;  4CS2 A;  2ZE5 A;  1N4C A;  2BSK B;  5FL7 G;  3AG1 B;  3R65 A;  3JAW A;  4G2K A;  3OTO B;  4AI8 A;  2ZIN A;  4IHJ B;  1QVF U;  1GKF A;  1G1X B;  3ASO B;  4FVM A;  1M57 C;  4DR3 O;  3BEH A;  1VF6 C;  4XBF A;  2W6I G;  4RQE A;  3NR7 A;  1DTO A;  4J9Z B;  1V54 B;  4DV2 B;  1JVM A;  1MSD A;  4IT5 A;  4FZ0 A;  1YZB A;  2UUB O;  2X7R B;  5KHJ A;  1RM1 C;  3ML0 A;  3T1Y O;  4RUF A;  2KKW A;  4LFB B;  5BR8 O;  3P30 A;  1OCC C;  1GK9 A;  3N2G A;  3JAL B;  1R3J C;  2NNU A;  4JYA B;  4F6R A;  4FMT A;  3RYC B;  2K1E A;  1U96 A;  4TV9 B;  1JA8 A;  3F7V C;  2GTS A;  1OCO C;  3DC5 A;  1VQ4 V;  5KUK A;  1IBL O;  1PNK A;  3JAR B;  4DR7 O;  2YI9 A;  3TK1 A;  2KB1 A;  1SQX H;  4JPR A;  2HVK C;  1RFY A;  3CCE V;  3CEI A;  4FLZ A;  2QE7 G;  3RN4 A;  1H8E G;  3K5O A;  4J7Z A;  1R73 A;  1BZK A;  4DR3 B;  4J10 A;  4O4I B;  3E8B A;  3FB5 C;  1OZ0 A;  1YTF B;  2LGQ A;  1GTO A;  4X62 O;  4PJ0 Z;  1K8A W;  1KYO F;  3OM3 B;  4TUY B;  1YEW A;  4K3A A;  3EXA A;  4TQF A;  5KAF Z;  2DMX A;  1S3J A;  3IJ4 A;  4K8Z A;  3L71 H;  3I56 V;  3F5T A;  1JMK C;  3T1Y B;  2X6C A;  1XBL A;  3IC7 A;  2IU0 A;  1KKD A;  2IW5 A;  3D36 A;  3BAA A;  4JTC B;  4H13 B;  2PYL A;  4PI2 A;  2YC0 A;  4BIU A;  3RYF B;  2CK3 G;  4X1K B;  2ZXW C;  2Y0I A;  2Q7G A;  1M90 W;  2QWP B;  3BFR A;  3CXC U;  1M1K W;  2BTQ A;  2EZO A;  1TGO A;  4LFC O;  1QCE A;  1O9H A;  4FJC C;  4CC5 A;  4CH5 A;  4W4K A;  2LO1 A;  2M6Y A;  4DV7 B;  5LXT A;  1PP9 H;  3P3P A;  1K5Q A;  4DK1 A;  4YIP A;  1K73 W;  5GW7 A;  4IIJ A;  2Y69 B;  3JD0 A;  2BOC C;  2OCH A;  2JVD A;  4D7S A;  1COW G;  2XAF A;  4X62 B;  5EZY A;  4QGP A;  1F4M A;  2Q69 A;  3WB1 A;  4ZHQ B;  4TV8 B;  4NVP A;  3OFN G;  3CS5 A;  5CBH A;  4B08 A;  2KSD A;  4I55 B;  3PN1 A;  5JJE B;  3FAV B;  1DF5 A;  4U7N A;  5EBM C;  1DF4 A;  5JQG B;  4TOI A;  5L3E A;  2ZDI A;  2CUG A;  4LFC B;  4UCR A;  3Q4H A;  2WLI B;  1JPX A;  4UCO A;  2CH7 A;  1L1F A;  1Z5W A;  1IZ3 A;  5GON A;  5JH7 B;  3T4Z A;  2PTM A;  3RYI A;  1HNX O;  4R50 A;  3O65 A;  3E2E A;  4FLT A;  4B3R O;  4CS3 A;  4ZIB A;  2YEV B;  1ZX3 A;  3LSU A;  1VQP V;  4X1Y B;  3JSL A;  4DK0 A;  1BS3 A;  4TSF G;  4WFE A;  3DXR A;  2B5U A;  4DR6 O;  5IYZ A;  4K8X A;  5GTH Z;  1HNW O;  1EN6 A;  1V9P A;  2R9R B;  1IBM O;  5ITZ B;  3E8H A;  2JK5 C;  4TQD A;  1EBO A;  1GH6 A;  4N21 A;  4DR5 B;  3JAS A;  4PDR A;  2EIJ C;  2F43 G;  4JGS A;  2OCC B;  2XHB A;  4LF8 O;  1NTZ H;  3ZCC A;  2EIL B;  4B3M O;  1S0V A;  4YJ3 B;  3G6E V;  2JGD B;  1F4N A;  4B3R B;  3RYH A;  2A7W A;  1JCH A;  3F5W C;  4MVZ A;  1I94 O;  5J2T B;  1J5E O;  4XDL A;  4UUJ C;  1PNL A;  2IJI A;  2CTR A;  3QVN A;  2YXH A;  5LHH A;  1I5X A;  1KBH A;  2QKA A;  1Y66 A;  2F4V O;  3W7T A;  3LSQ A;  5A9G A;  1I5Y A;  3BCC H;  2EJR A;  3A8T A;  2WWW A;  5DEC A;  2VQE O;  2BCC H;  2QKS A;  4ZI7 B;  1NR7 A;  4DR6 B;  3B40 A;  1UJW B;  1FJG O;  1ZTE A;  3T1H O;  5DN6 G;  4PHZ A;  1HNW B;  1B3Q A;  3KG2 A;  3ASN C;  1IBM B;  3CRC A;  4BR6 A;  4PDV A;  4MS2 A;  2OYQ A;  3ETE A;  1XUQ A;  1NVP B;  4GX1 A;  4LF8 B;  3JAW B;  2V1D A;  4MTX A;  4NB5 A;  3HR0 A;  4W4L A;  5LMU O;  4B3M B;  1ZWI C;  4MW3 A;  2ZCE A;  3E8G A;  3ZS8 C;  4CH3 A;  3QNE A;  1AR1 B;  1I94 B;  2WA3 A;  1R3K C;  1J5E B;  4O4L B;  5DED A;  5J9P C;  1D2D A;  3ABM C;  2H3O A;  3U11 A;  2F4V B;  4KHP O;  3EVK A;  4X88 A;  4UCT A;  2H94 A;  1XL6 A;  2F93 B;  1FAF A;  2A06 H;  3E35 A;  5JCO A;  3HPL C;  3J7A U;  1NS1 A;  4O4I A;  1FJG B;  3T1H B;  1F23 A;  2GBO A;  4KXR A;  1YF2 A;  1VAR A;  3J81 N;  2JGU A;  4JI1 O;  3G71 V;  3HKE A;  4F6R B;  4B3S O;  1H2N A;  4TUY A;  1DGS A;  2Y48 A;  1WA8 A;  5EYP A;  4EKW A;  4X64 O;  2HKO A;  5CA3 A;  3JSN A;  1VQL V;  1YTF D;  4FM2 A;  3E89 A;  4O4J A;  2WLN A;  1FXV A;  3E22 A;  3RYF A;  2YXL A;  3ABU A;  1D5A A;  2XAQ A;  3KZI Z;  3ZMZ A;  3SPI A;  2AZ0 A;  2EJ7 A;  4WFA V;  4KL1 A;  4FM1 A;  4KHP B;  1VP7 A;  5BY1 A;  3K3W A;  4KUM A;  4PEL A;  2L35 A;  4X8A A;  1LUW A;  3G80 A;  4JYB A;  4MVR A;  1R3L C;  1L8D A;  3OT7 A;  3GVM A;  4X65 O;  3VQV A;  4AIL C;  1K3E A;  3WG7 B;  4UB8 Z;  4JI1 B;  2Q6A A;  2PGG A;  4R7C A;  5CA1 A;  2OWO A;  1M56 B;  1Q6I A;  3SYP A;  1Q6H A;  3SYC A;  1FXK C;  3OMN B;  1B6Q A;  2BTQ B;  2EUL A;  2OTL V;  4X64 B;  4GKK O;  2F23 A;  1OV9 A;  1SET A;  3CP1 A;  4RQF A;  3AG2 B;  5LXT B;  1U97 A;  1S5L Z;  2BOB C;  5B1A C;  3OW2 U;  1JJO A;  3K9S A;  1Q5O A;  1M4U A;  3CXH F;  4D6T H;  2QGN A;  1JFF B;  2JDI G;  5CA0 A;  5JQG A;  4IIJ B;  4UV8 A;  3OMI B;  1OCZ B;  4MVQ A;  4JF3 A;  3I55 V;  4BIZ A;  5BZB A;  2PZS A;  2QTO A;  4N23 A;  5EZY B;  1PPJ H;  1YXB A;  4GX5 A;  4CH4 A;  4JZ2 A;  4KFM A;  4PDL A;  3S3X A;  1L0L H;  3SYO A;  4DV3 O;  1NTK H;  5IWA O;  4X65 B;  1QLN A;  2LQT A;  2Q0A A;  5LA6 B;  5L3F A;  4GLX A;  5EC2 C;  3M99 B;  2LJ2 A;  1CPY A;  3B2E E;  2Y4T A;  2HG5 C;  1AP5 A;  2H8P C;  1R6K A;  4AHC A;  4GKK B;  1K33 A;  5H9C A;  4FK5 C;  2LFR A;  3G6B A;  5GON B;  3CX5 F;  3BVO A;  4HZ3 A;  5KA6 A;  3SYQ A;  5ITZ A;  1SKV A;  1NQT A;  5C8Y A;  1IXM A;  1BHB A;  2Z3Y A;  2ETN A;  4QPK A;  4FFK A;  1Q81 W;  4X1I B;  1MZF A;  3K03 A;  1BHA A;  5LBQ A;  1NU1 H;  1SA0 B;  1EM1 A;  1GN3 A;  4EFB A;  2Q8V A;  1FD9 A;  3RT3 C;  4MTG A;  2N05 A;  2JGD A;  4DV3 B;  5IWA B;  1Z2G A;  2QWO B;  3TET A;  5J2T A;  3CCQ V;  1ZAU A;  4X20 A;  1JR9 A;  4JZG A;  5LYJ A;  2ZT9 B;  3H9V A;  1S72 V;  2JEX A;  3ETD A;  4JI5 O;  3T4D A;  3X2Q B;  2EIK C;  2LP7 A;  3D3I A;  1WPX A;  4OPA A;  1TUE B;  1CEZ A;  4WCE V;  3BA8 A;  5CBG A;  2BTO A;  1H2S B;  4K0K B;  3UT5 A;  4TWK A;  3H1H H;  2YIC A;  2XUM A;  4MW8 A;  1ZL8 B;  4GX2 A;  1NKD A;  5B3S B;  3K5M A;  4ZOL A;  1HR0 O;  3H1I H;  3JCZ A;  1ROP A;  5LHI A;  3AG1 C;  3IFX A;  2YS8 A;  1UFI A;  2DOS A;  4PA4 A;  3ASO C;  5B1B B;  2EIN C;  4DW0 A;  2A79 B;  4GKJ O;  1VF5 B;  3VOU A;  1XL4 A;  3UO2 A;  3WB2 A;  2AXT Z;  3CRR A;  1IXB A;  1N32 O;  3UQ8 A;  4O4L A;  3G67 A;  2WAM A;  1V54 C;  1KC8 W;  4DV6 O;  3LUT B;  4JI5 B;  1VQO V;  4WBN A;  3CC7 V;  1Y4M A;  1K34 A;  4EFE A;  1N33 O;  1ORQ C;  5GTI Z;  2M7W A;  2OIE A;  4GYC B;  2QTS A;  4JI4 B;  2XT9 A;  2IBZ H;  2Y0P A;  2A9H A;  1BMF G;  1VQK V;  2HJD A;  1MSW D;  1KB9 F;  3ZMU A;  1HR0 B;  4ASU G;  3CC4 V;  1VQ9 V;  4GCZ A;  4NKG B;  4QIW F;  3QTC A;  4ABM A;  4UVB A;  4RWU A;  4JI3 O;  2WLJ A;  2OIG A;  1YI2 V;  1Z5V A;  5IY5 C;  1QNM A;  2B9Z A;  3BY6 A;  2JRI A;  4GKJ B;  1QLE B;  3K59 A;  5B1N A;  4AQY O;  1Y6X A;  1BCC H;  2QM7 A;  1N32 B;  2DJV A;  4I4T B;  3CE2 A;  2IU3 A;  4DV6 B;  1AIL A;  3ZIA G;  5KHH A;  1US6 A;  4NYK A;  3HKE B;  1N0J A;  1SZX A;  1W59 A;  1N33 B;  2AHY A;  1WA8 B;  2UUB B;  5EYP B;  1TAE A;  2R9A A;  3CCL V;  4G28 B;  5BR8 B;  3CCJ V;  2Z0A A;  4O4J B;  5KX5 A;  1WP7 A;  2CTQ A;  3M7M X;  3E22 B;  4QNH B;  4JI3 B;  1JOY A;  3U0Z A;  2YI8 A;  1IBL B;  1FFX B;  1SS3 A;  4DR7 B;  4LR3 A;  2FYU H;  1OCR B;  2IH3 C;  4JTD B;  2Y69 C;  2P6J A;  4AQY B;  3L74 H;  3QO8 A;  1JFF A;  1N36 O;  3STZ C;  2X6B A;  2HHH O;  3CCU V;  2OT5 A;  4R6Z A;  3DC6 A;  3W7S A;  2N04 A;  2ZXW B;  5CA1 B;  1MOF A;  4O2A A;  1MA1 A;  4R8C A;  5K1P A;  2P67 A;  2ZNJ A;  4CZZ A;  3OTF A;  2P4V A;  3CSX A;  1NH2 D;  1WB8 A;  1WB7 A;  4LF4 O;  4J41 A;  1KD1 W;  1AP6 A;  4X89 A;  3UCS C;  2RCV A;  2QJ1 A;  4FM0 A;  4NXN O;  1SER A;  5IJ9 B;  5LA6 A;  4MVU A;  1QHT A;  2B1I A;  3LDD A;  1B04 A;  1AI5 A;  5IYD O;  2HVJ C;  5CA0 B;  1P84 F;  2WLM A;  4I0X A;  1X4T A;  2R72 A;  4I5S A;  1SES A;  4HNA B;  4KP4 A;  2W0X A;  3LDC A;  4LH6 A;  1VQM V;  2UXD O;  1RP3 B;  3FB7 C;  4I9Q A;  4CH6 A;  4HAM A;  1AI4 A;  2UXB O;  3TXS A;  3K0G A;  1N36 B;  3SJC C;  2AHZ A;  5JJN B;  5CN0 A;  2HHH B;  5H2F Z;  1QVG U;  3AG4 B;  3OMA B;  5L3D A;  4X1I A;  2AGA A;  2NR5 A;  2GUZ B;  3CWB H;  3ABT A;  4DV4 O;  4MVO A;  1QQC A;  4LF4 B;  1SA0 A;  2WPD G;  1K5S A;  2QWQ B;  3DGE A;  2ZE6 A;  2YDE A;  3OEH G;  4UV9 A;  5LP6 C;  1VQ5 V;  1WN7 A;  3ETQ A;  1B06 A;  3U10 A;  4L87 A;  3N2K A;  5C8Y B;  3JCU Z;  4IYH A;  3E8F A;  2QDO A;  3AG7 A;  5JJJ B;  1Q82 W;  5KMG A;  2EIL C;  3CB2 A;  3EHB B;  2CTP A;  1MG1 A;  2UXD B;  3ABL B;  3ICX A;  2MK3 A;  1ZL8 A;  3ZHU A;  2UXB B;  2JJ1 G;  1HNX B;  1AJN A;  4J9Y B;  1XRE A;  3CME V;  2F1M A;  5F2V O;  2PYJ A;  4EB6 B;  4X20 B;  4P9P A;  1PV0 A;  5LYJ B;  2YIB A;  2DN9 A;  4NXM O;  4DV4 B;  1BQZ A;  3VQW A;  1H2M A;  2E74 B;  3ETG A;  2YXY A;  1GN2 A;  4ZBM A;  1BL8 A;  4H44 B;  1G4Y B;  4JI0 O;  3TCU A;  3QF7 A;  3UT5 B;  1PD3 A;  5L3C A;  1H8H G;  1I08 A;  1XNR O;  4ZOL B;  2DYS C;  3GB7 C;  2ARH A;  5EIB D;  1XQ8 A;  1KQS U;  5KHK A;  5IT9 N;  2ODM A;  1R6T A;  2B1G A;  1XOU A;  3L70 H;  2PY5 A;  2F95 B;  4BWA A;  2UXC O;  2Q4P A;  3K0D A;  3K08 A;  3K57 A;  2D2C B;  2P7T C;  5JWP A;  4JI6 O;  1YJN V;  1VF6 A;  2HLD G;  4FFB A;  1Q86 W;  1NT2 B;  3ASN B;  2Q0O C;  5L3B A;  2LW1 A;  1Q3E A;  3ABK C;  1N34 O;  2WLH A;  3THO A;  4A5U B;  4UCS A;  4DXW A;  4WBN B;  4WFB V;  1H38 A;  3CJH A;  5FPR A;  5L3G A;  4BIO A;  2VQE B;  3JAT B;  3OR7 C;  4FZ1 A;  4JI0 B;  4WF9 V;  2N74 A;  2ZIO A;  5H5N A;  1FFT B;  1V55 B;  2R9I A;  3R66 A;  3KKY A;  4PI0 A;  5KAI Z;  1YJ9 V;  4I4T A;  3SJB C;  1URF A;  3A0H Z;  1XNR B;  3H1L H;  4WFH A;  2IJJ A;  2KG7 B;  1GO3 F;  3G4S V;  3CD6 V;  1SF9 A;  4CBC A;  2CGO A;  3ABM B;  4MTF A;  3RFR A;  2Q73 A; 
#chains in the Genus database with same CATH homology
 1VF6 C;  1RSO B;  1Y76 B;  1Y74 B;  1VF6 A;  1Y74 A;  3B40 A;  1Y76 A;  1ZL8 B;  1ZL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...