1RSOB

Hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
GLLAAERAVSQVLDSLEEIHALTDSSEKDLDFLHSVFQDQHLHTLLDLYDKINTKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Presynaptic protein SAP97
publication title The tetrameric L27 domain complex as an organization platform for supramolecular assemblies
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Neuropeptide/membrane protein
total genus 18
structure length 56
sequence length 56
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.650 Mainly Alpha Orthogonal Bundle Helix Hairpins L27 domain 1rsoB00
1ZL8A 1Y76B 1VF6C 1Y74B 1Y74A 1RSOB 1Y76A 1VF6A 3B40A 1ZL8B
chains in the Genus database with same CATH superfamily
3Q4HB 2OTJV 3LNMB 4JYBA 4FK5C 1OV9A 2OCCC 2BSKA 2Y69C 5JJNB 1KC8W 3HKBB 4W4LA 1DF4A 1Y74B 4YHHB 3SYCA 3CB2A 1GAXA 2DYSC 3B4SA 1ZAUA 1THZA 5DECA 4QE9A 1NH2B 1B6QA 2YS8A 3G4SV 3EFFK 3GWOA 1CXZB 2UUCB 1R6NA 2R70A 2YIBD 2DMXA 3RYCA 1JVMA 2X6BA 3TGUH 3ZHQA 3C3SA 4LF4B 1FJGO 2Q0AA 4YJ2B 1QLEB 1YEWA 2IH1C 4PA6A 1O9HA 2ZQMA 3CX5F 1YJWV 3TETA 2ADPA 1JA8A 5EIBC 4X1IA 3ZRXA 2A9HA 3LDDA 4UFZA 2Y4TA 1MG1A 3FB5C 4O4JA 5FL7G 5ITZA 3CRCA 5B5EZ 2CGNA 4MTGA 4K3AA 1NU1H 5HFMA 1PPJH 1TUBB 4OXSA 2WA3A 5IYBO 5KAIZ 2HVJC 2X6AA 4MW3A 4UCTA 3Q4HA 3N2KB 4I5SA 4X88A 4GZRB 1K9MW 4DUZO 2EBOA 2CH7B 4OX9O 2CTQA 1U97A 1YTFB 4J80A 5F2VO 2NN4A 1H8EG 1M93A 3JAMN 2PTMA 1YJNV 4GX5A 3E35A 2OYQA 1HNXO 2GSMB 1O9GA 1F4NA 1ORQC 3T1HO 4DR1O 2Q7EA 3VQWA 3ABKB 3T1YB 3UKMA 5H2FZ 4DV3O 1Q43A 4TV8B 4DV6B 4UUJC 3S3XA 3STLC 3TXSA 2N04A 2DW4A 2HLDG 1GTOA 3JYCA 2UXBB 3W7TA 1QR9A 5CA0A 3HKEB 2VS0A 4P9PA 4KUMA 2VWKA 5EC1C 3UT5B 2F4VB 2X0LA 4JI0B 5H9CA 3GWKC 1VQ8V 5LGTA 1COWG 5KMGB 1JOYA 4KL1A 4JV5B 1QLEC 3A0BZ 2UXXA 3DSQA 3KKYA 2QM8A 3UQ8A 1P7BA 3SJBC 3LSQA 3VQXA 5TISZ 2EZPA 3CCJV 2YXYA 4NXMO 3KCXA 2DJVA 3ETDA 4DV5B 2NNUA 4CS3A 4F6RB 2QWPB 4UVBA 2CH7A 1P7GA 5JJEB 3K0DA 1DTOA 4JI7B 2CE4A 3CYOA 4LF8B 2QM4A 5HFLA 1HWYA 4UCOA 4YHHO 2WWWA 1VIBA 2CTPA 4JAUA 3N2GA 5FPOA 4K0KB 1MOFA 2UUCO 4TV8A 2WSSG 5LMUB 1W59A 5CA3A 2EIJC 5KX5B 4ZBMA 2ZM6B 1K73W 5KA5A 1ROPA 1WLEA 3RYHA 4DR4O 3ABKC 3HKDB 4MVRA 1AI7A 3A0HZ 4DR2B 3AK2A 3HB3B 4H13B 2XUMA 4QIWF 3JSNA 2GTAA 1NR7A 1PKXA 5KMGA 3E8HA 1YF2A 5EYPB 1OZ0A 3FD9A 4YJ3B 1KD1W 1MSWD 1JJ2U 1RFYA 2YSUB 5EC2C 1J5EB 1BT8A 1B04A 3H01A 4X65B 4CBCA 1BGYH 5K1PA 3APOA 2KG7A 1RSOB 3J80N 3E8BA 3IC9A 2AGAA 1YI2V 4FPPA 4FLXA 1QCEA 3C3TA 2KQXA 4H37A 3THOA 2XASA 3OAAG 5KUKA 5LOVA 3CRMA 5L3BA 1R73A 2JK5C 1Q6UA 2EIMB 2ZIOA 1ENVA 3BFRA 1V55B 5KA6A 3T1YO 2QWRB 1KMIZ 5H5NA 1XMOB 3S3WA 1UJWB 1SQVH 1DK1A 3QF7A 1TGOA 1OCZB 4F6EA 4IL6Z 3N27A 5KAFZ 3OD4A 2UXBO 3O9OA 4JTCB 1SF9A 1CP9A 3ZHTA 4I4TA 4ICGA 2F4VO 2ZD9A 3VBBA 4H33A 4FLWA 3B2EE 4JI0O 3GVMA 2IW5A 1AI4A 1NS1A 2UXNA 1NQTA 3ASNC 4O2BB 1DLBA 2EILB 4LFCB 1R3LC 3RFRA 2PUSA 5LHGA 2PF4E 4JV5O 4D7TA 1Q5OA 4DYLA 5D5QA 3EXAA 3FX7A 1SC5B 4JI1B 1H8HG 3JARA 3DXRA 3ZHVA 4DV5O 2HFEC 1R3KC 3B8MA 4B7EA 3A8TA 4RQEA 4TUYB 1AI6A 2XAGA 5IY5C 3MHSC 2L6LA 4JI7O 1VQMV 2W6IG 5B1AB 5DEDA 2P5OA 4LF8O 2E5LB 1EZJA 2Q9LA 3KZIZ 4JI3B 4YY3B 4LFBB 4G2KA 1XNRB 2FTKA 1M57B 3WG7B 3E86A 3JCUZ 2YIBA 4U3JB 1KKCA 3K79A 3M99B 2RDCA 1JMKC 5LMUO 4X89A 1PL4A 2IJHA 1LUWA 1N8RW 5LP6B 2ZM6O 2EIMC 1N33B 3CS5A 3CMAV 2XTAA 1V55C 5JQGA 4FLVA 2LQTA 3FB7C 4GKKB 2X7RB 5LMNB 4DR2O 3SYOA 2P67A 5LGUA 4DR6B 1BE3H 1NTMH 1OCZC 3JALB 4LH6A 2AZ0A 3K3WA 3P3NA 3CP1A 4RQFA 2YXHA 2QEXV 1PM9A 1Z5VA 1KQSU 1GMGA 1J95A 1J5EO 2HHHB 4X65O 1V54B 2B1IA 2LO1A 3CCQV 2EILC 1NI8A 1BMFG 3FB6C 2N05A 3K9AA 4X1KB 1SS3A 5EBLC 4JTDB 4AILC 3CC4V 1VQOV 3MDSA 1YXBA 4I50A 3CCVV 4PV1B 4JTAB 1K7DA 1K4DC 3DTUB 3FB8C 1M4UA 3RYFA 4CC5A 1VP7A 4MW8A 3ETEA 2GTSA 1XMOO 5B1AC 2JGDA 3OUSA 3M8AA 3RN4A 4J41A 4FZ0A 4IYIA 1ZUQA 2R9RB 1JX9A 5LP6A 3I56V 3AK1A 2FB5A 3HKCA 5A2QN 3WG7C 1M57C 3CCUV 3BY6A 3FAVA 2CAZC 1QHTA 1HNZB 4LF5B 2IU3A 4NB5A 1FS0G 1GN3A 3JALA 2BSKB 4B7KA 4LFCO 3RVZA 5LP6C 1I0HA 3VQVA 4CZZA 3K04A 4DV4O 1E1QG 4TWKA 4FMTA 2YI9A 1G6UA 2NR5A 2QKCA 1JQ0A 1K92A 3K5OA 5J2UB 3OR7C 4DR1B 5GTHZ 4JI1O 4C7UA 2F66C 4CS2A 2HEPA 1H2SB 2Q0OC 2X6CA 4CH3A 4DV3B 4JI5B 4RO2A 2Q8VA 4DRXA 3QG5A 4O2AB 2E5LO 5K1XA 1D5NA 4MTXA 1V54C 4LCUC 2KKWA 4JI3O 4B3MB 4X1IB 4YY3O 4LFBO 1SZTA 2WLJA 1KKDA 1XNRO 1GH6A 2A7WA 1YSCA 4UVAA 3L72H 2GUZA 4O4JB 4U7NA 4OPAA 3D36C 5FPRA 5ITZB 2CDYA 4TV9A 2YC0A 3X2QB 4JYAB 4LF7B 1AR5A 4I9QA 1IBKO 1N33O 1W2BU 3ZX6A 1B3QA 1WB8A 2A79B 2AHZA 4PDMA 4BWAA 3E89A 3TJTA 1FXKA 1QLNA 4E2LA 2F43G 1UPGA 2ZXWB 5LMNO 2LJ2A 4DR6O 1FFXA 3BPZA 2XHBA 4AHCA 3I5DA 3JASA 2Q73A 3OM3B 1AB3A 4WF9V 2F1MA 5JCOC 3WB2A 1I5YA 3QVNA 4UB6Z 2H94A 2D3OW 3JCZA 5J2UA 3D3IA 2WLNA 3O65A 3ZMUA 2HHHO 4G28B 1VQ5V 3TXQA 4P30A 3W7UA 1Q6HA 3E83A 4J9YB 1NZ6A 1VQ9V 2CTWA 2EIKB 2ATKC 2EULA 4ASUG 4TT3G 1P84F 4JASA 4K35A 4OGQB 2UUBB 2ZR2A 3P30A 4JAVA 4O2AA 3UCSC 5CA0B 4HYOA 4DR4B 5LA6A 1MSDA 1EN4A 3QO8A 1RP3B 1N0NA 4L87A 3I55V 2GDSA 2ZE8A 3W7SA 2YDEA 3UO2A 1E79G 4J11A 4NKGB 3L71H 1OCCB 1Y66A 5KHIA 4CC6A 4NXNB 1RM1B 4I55B 1XREA 4GX0A 1TAEA 1HNZO 2ARHA 2JRIA 4LF5O 5IYDO 3OTOO 5LXTA 5EK0A 1P49A 3X2QC 1VF5B 4ZOLA 5BMVB 4I0XB 1XL6A 1S0VA 2YICA 1UFIA 3K5NA 2ZXWC 3K08A 3AEIA 4WBNB 4J7KA 2QDOA 3N2GB 4MS2A 2QKAA 4CH6A 1SQFA 4X64B 3ZMTA 3K06A 1KB9F 4JI5O 2JJ2G 4QPKA 1R3JC 3TCUA 2V1DA 4PA3A 1H2GA 2LFSA 3RYHB 5IYCO 5KHKA 4IGGA 4B3MO 4QE7A 4NTWA 1BCCH 2N74A 1ZX3A 3ZIAG 2EIKC 2KB1A 4DO2A 3ZCCA 1WPXA 3CRRA 2WA4A 3JD2A 3ZJZA 1S77D 3LSUA 1LNQA 2OWOA 3MHHC 4HBNA 4JYAO 4LF7O 1SA0B 3J81N 1KUQA 2YEVB 2F95B 4XBFA 3QO5A 2QKSA 1GN2A 4I55A 1VQKV 2P7TC 1SQXH 5GONA 2C2AA 2KG7B 1KBHA 1Q82W 3FYEB 1OCCC 2ADQB 4PDLA 3BHPA 5C8YA 4DV2B 4B08A 2P06A 1MA1A 1R6TA 1IBLB 1NR1A 5BMVA 5CMUA 5LOVB 4I0XA 1RM1C 5H6RA 1SERA 5LGNA 4AQYB 1AJPA 4UV9A 1N0JA 4WBNA 4AI8A 2PZSA 2V7QG 4X1YA 1M56B 4O4LA 5KUMA 3CPWU 3OW2U 2B5UA 4YIPA 2Q69A 2LFRA 5IDJA 1IDSA 1OCRB 2HKOA 1VQLV 4J42A 2UUBO 2HR3A 3B77A 1HR0B 2AXTZ 4QGPA 1R6KA 2ZDIA 4L8JA 1NVPD 4I4TB 3KG2A 4NR1A 2RNBA 1NBMG 2RMKB 4GUNA 2ITCC 4GX2A 2XT9A 1MABG 2JDIG 1R1BA 5LHIA 3U0ZA 1EZVH 4KHPO 1PP9H 2CGOA 3P32A 1CPYA 1WA8A 2BOCC 4FJCC 1GN4A 4N21A 4O4IA 4MT8A 4A5UB 1SA0A 4PA9A 2YEVA 2ZNIA 4WFAV 4DV0B 1I94B 1Q8IA 4NXNO 2E76B 4LWSA 4DUYB 3JARB 5H6QA 3DXRB 3DC6A 5JWPA 1BL8A 4JI6O 1ZL8A 3FKSG 3K03A 5CB4A 3SYPA 1PV0A 3G71V 4TQDA 2QTOA 4JZGA 1YCIA 4PDVA 3G67A 4GCZA 5KHGA 4HNAA 4ZI7A 3T1CA 5BXZA 4PI2A 2R9AA 2A3QA 5EIBD 1B06A 3CE2A 1Q7YW 4X64O 2E75B 4X66B 1OCOB 1MMMA 5IWAB 4DK0A 4JPRA 3ZEDA 3JATA 2BOBC 1FXHA 1EN6A 1NTKH 1XBLA 1M56C 5JQGB 2PGGA 4Z1MG 4Z2WA 3SDLA 1DF5A 2RQ6A 3ZHUA 2GBOA 2PYJA 1OCRC 2JEUA 4XDKA 5IYZA 2XNDG 1FD9A 4DV4B 4KP4A 2ZE7A 4WFEA 3JSLA 2EJ7A 3HPLC 1G1XB 3CC2V 2QWNB 2CK3G 2RJZA 4FFBA 4PA4A 4EB6A 1JR9A 2VQFB 3MD0A 1Q90D 2UUAB 3PN1A 1G4YB 2OIGA 4DV2O 2WLIB 2Y0IA 2WLKA 1S72V 4CS4A 5J9PC 3RT3C 1IBLO 1L8DA 5EZYA 4I50B 4HZ3A 4I9WA 1VF7A 3B09A 4AQYO 4TQFA 3U10A 4DR5B 3RYFB 1QVGU 3DGEA 2ZE5A 1TVKA 1NH2D 4WFHA 5FNVB 3CRQA 2HVKC 5IJ9A 3U11A 2JGDB 2ZNJA 5IJ0B 2ETNA 1F4MA 1ZLZA 3JAKA 3G6EV 1HR0O 1IBKB 5IT9N 5BR8B 1XDCA 3HKCB 3E22B 1SQGA 5CA1A 3H1HH 1PNLA 3FAVB 4B3SO 4DW0A 1OCOC 1I08A 1VF6A 1AJNA 4K8XA 1VQPV 4UB8Z 1AP6A 5J2TB 1JJOA 1IXMA 1AR4A 3F7YC 1KECA 2XAQA 3BAAA 3QTCA 2CUGA 4MVSA 5DN6G 1T5EA 4DW1A 3BRCA 3WFVA 5E1AC 2ZE6A 4BIOA 2BE3A 5KHHA 4GLXA 3NR7A 4DV0O 1I94O 4DUYO 3AG1B 3BEHA 3SGIA 1DGSA 1K97A 4WCEV 2HJDA 4O4HB 3PJSK 1K5QA 2Q7HA 2H8PC 1SRYA 4XDLA 2WLHA 2WLIA 1YTFD 2QM7A 1XNQB 1MZFA 1URFA 4DRXB 1M1KW 4EFEA 3K5LA 4IIJA 4R6ZA 1I7FA 1X59A 2IM9A 4EFBA 4JI4B 1K4CC 5FNVA 1S5HC 2GUZB 3ZMSA 2DE0X 4D7SA 1NJIW 2QGNA 4X66O 2E74B 2ILMA 4UCUA 4ZHQA 4NYKA 5IJ0A 4KXRA 3CXHF 5IWAO 1AILA 2VRZA 4FLUA 4TV9B 4ZIBA 4WFFA 1XILA 4I7ZB 3E2EA 4X20B 1GM7A 3CCSV 1XI1A 3E22A 1F7YA 1S5LZ 1FXKB 3A2FA 1BS3A 1MZEA 4BIZA 3OTOB 5J2TA 2V4DA 1WP8A 1FFXB 3JASB 3CSXA 3ABLB 2GHYA 2EINB 3AK3A 2IJIA 3OMNB 2OIEA 3OUFA 3ZMZA 4LC1A 5LYJA 4UCRA 3WU2Z 3G6BA 3QO7A 1W0KG 4J9ZB 2Q4PA 1VQ6V 5CBGA 1ZSPA 4LF6B 2XAFA 3OMAB 4O4HA 3ZRWA 2R9IA 2VQFO 2D2CB 2UUAO 1D5AA 3H1KH 3CJHB 4RAIA 2O57A 5CBFA 3IAYA 2Z5UA 3SYAA 3P3PA 4EKWA 3AG4B 5LA6B 4DR5O 5D5PA 2XAHA 1QR8A 2UXCO 3CWBH 1SQPH 1BHBA 4NVPA 2BTQB 3LDEA 1G8MA 4GX1A 2Y48A 4B3TB 4X20A 3A0RA 3OR6C 3CC7V 2ZIMA 1YITV 1QNMA 5B66Z 5BR8O 1RPOA 1YJ9V 3E8FA 1WP7A 4U3FH 4MVMA 4X8AA 1JFFB 2NLJC 3OGIB 2K9PA 1US6A 4EEQA 1VQNV 2CTRA 5LXTB 3ASOB 1N34B 3VOUA 4FM0A 4ZOLB 3RW0A 1SQQH 2WLMA 5E79Z 3ZN1A 4QNHB 1FXKC 3JAWA 1AROP 1Q86W 3K9SA 1SZXA 3RYIA 3SPJA 4P9OA 3W7XA 4LBEC 1H2MA 3RWRD 1Y76A 4LP8A 3BA8A 3ABLC 4DK1A 2EINC 3CJHA 1XNQO 5JJJB 2IBZH 1GO3F 3SJCC 5IE9A 4JGSA 5L3GA 1JPXA 4JI8B 3H9VA 2QSAA 2EX3A 2VWJA 2F23A 1M9NA 3B8NA 3R66A 4E4EA 3D8CA 4JI4O 2ZCEA 4K8ZA 1K3EA 1WPBA 2QR4A 1QBZA 4LNUA 1YZBA 3RGBA 4KHPB 1FPOA 4QJFB 4YXWG 1S5JA 4ABMA 3K57A 3QNEA 5CN0A 2QJ1A 2BTQA 4PI0A 1FAFA 1PD3A 2A06H 3KCYA 1FFTB 3CCMV 2Y0PA 3AG4C 3CHXA 4DXWA 1EBOA 1Q3EA 1SESA 1JFFA 3K5MA 2BTOA 2FL4A 5GONB 2H3OA 5KHJA 2E3CA 2LP7A 3IFXA 4JI6B 1N4CA 3ZS8C 5C8YB 1ZTEA 2DWEC 2IH3C 2Q6AA 3H1JH 5JVDA 1RPRA 4IHJA 1AJQA 3OEHG 1XMQB 3OGCC 1D2DA 1SKVA 4MTFA 1V9PA 1H2LA 3OT7A 1YVWA 4X1YB 1U96A 4O4LB 2EZOA 3BVOA 4LF6O 3ASOC 4Q6GA 4WFBV 3HKBA 1HW7A 1XL4A 3TK1A 2QTSA 4Z1VA 1GKFA 1Y74A 5GTIZ 1IX9A 1N36B 1XOUA 2EIJB 3JD4A 4DV1B 1NKDA 3MAQA 1JCHA 3HR0A 5BY1A 2JS5A 3FFQA 1VMGA 4TOIA 1IBMB 3LSSA 2Z0AA 4JF3A 3LDCA 1IURA 2LW1A 1L0LH 3L75H 1H38A 1BSMA 2PI4A 2DYRB 4YJ2A 2LGWA 2GV9A 3BCCH 1WA8B 2QWQB 1VQ4V 4O4IB 3ABUA 4B3TO 5EBMC 4IT5A 3T2MA 3JD1A 2B1GA 4RUEA 4JAAA 2PI5A 1BQ0A 1EM1A 2WPDG 4X62B 4LWSB 1GM9A 4U7OA 1AP5A 3D3QA 3RVYA 4MTOA 1Z2GA 2Y4UA 3R65A 3AG7A 1L0NH 1ZL8B 1TUBA 5L3FA 1HNWB 2ZR3A 4KFMA 5CB4B 1N34O 1FXVA 3T4ZA 1VQ7V 2Z3YA 3F7VC 4TSFG 4IYHA 3H1IH 2P90A 2Q7GA 2UU9B 3N2KA 4MVUA 4HNAB 4ZI7B 2P6JA 3ZBHA 1OJHA 3ZHSA 1VEWA 1OHHG 3UM7A 3LNNA 4FZ1A 4HAMA 1I5XA 3EHBB 1XEQA 4J10A 4WFGA 2RCVA 4GKJB 3ABMB 3B40A 2YI8A 5B1BB 3JD0A 3JATB 2A0LA 3CEIA 3ETQA 2RN9A 2UXDB 5AG2A 4JI8O 4DR7B 4BW9A 4B3SB 2DQ0A 4UXNA 4NTXA 4UCSA 3ZRVA 2MK3A 3SJAC 1K5SA 2MW2B 3ASNB 5IYZB 1X4TA 4R7CA 4FVMA 4LF4O 1EN5A 2XOKG 3AG2B 3HKEA 1GRJA 4JZ2A 2JEXA 2ZDIC 2YIDA 3WB1A 3UT5A 4FM1A 3CCLV 3OMIB 1XUQA 1N32B 4R8CA 3F5WC 4MVQA 2DYRC 4YIOA 2IU0A 4EB6B 4FFBB 4BR6A 1CEZA 1YIJV 5IY5B 3K59A 5EZYB 4BIUA 1XMQO 4JI2B 2WLLB 1PL0A 1K33A 4XDJA 4RWUA 4B3RB 3ICXA 1HP8A 4F6RA 3IJ4A 2P4KA 1GM8A 2KSDA 1TVKB 3FYIB 1MNGA 3E8GA 1A32A 3IGAC 4MSWC 5IJ9B 3SPHA 4LH7A 1S76D 4X9QA 2BCCH 1N36O 2JGUA 3JAKB 2WAMA 3ZHRA 4DV1O 4G27B 1IBMO 4F4LA 1BZKA 5CA1B 2FKXA 2ODMA 2OT5A 3EVKA 2JIZG 3CCRV 4PD4F 4PHZA 3ABTA 4LF9B 4DV6O 4NTYA 4OPHA 3ABMC 5B1BC 3GB7C 5KX5A 3ML0A 1LUVA 5JH7B 3AG3B 1WB7A 2P22C 5L3CA 3HKDA 1E1RG 1IZ3A 2QA4V 3G80A 2W0XA 4UVCA 4LFAB 3SPGA 4JYYA 2XAJA 3ETGA 4X62O 3BA9A 1Z5WA 4GT1A 2G38A 3K58A 3NXSA 5EYPA 2JVDA 2DN9A 2M6YA 4YJ3A 3AG2C 1WNSA 4PJ0Z 5FLXN 4R50A 1HNWO 4LR3A 2OTLV 3W7WA 1Q6IA 1M5IA 2HJFC 2L35A 2WLLA 4IIJB 1WJZA 4W4KA 2Q68A 5L3DA 4FLYA 4FFKA 5LL6Y 2HP8A 2UU9O 1KYOF 1S3JA 2IJKA 4DV7B 3CMEV 1RSOA 2W0FC 4H44B 1YHQV 2UXCB 3OFNG 3T4DA 2ZT9B 3STZC 1SETA 1LR1A 4ZHQB 3BABA 4GKJO 1H2NA 3VQYA 2JS3A 4PDRA 1F51A 3H1LH 1EFRG 1QVFU 1GK9A 3OE7G 4DR3B 1VARA 3CRAA 2UXDO 1SQBH 1KP3A 4J7JA 4DR7O 2FYUH 2ZINA 4BAYA 4K0KO 2DOSA 2ZKOA 1P4RA 5B1OA 4MVZA 5JH7A 2VQEB 1HDJA 4J7ZA 1K34A 2OCHA 1WN7A 4UCVA 4FM2A 3SPCA 2Q5ZA 3IC7A 5LYJB 1QQCA 3ZMVA 2YXLA 1VF6C 4O2BA 1N32O 5EBWC 1GN6A 3LUTB 3OTFA 1YDXA 3SPIA 3ZRWB 2M7WA 3L73H 1BHAA 3AG3C 5L3EA 2DWDC 1Q81W 2F93B 1K8AW 5KLVH 2YIAA 1L1FA 2AW9A 5B3SB 4JI2O 4PELA 1PNMA 2QE7G 2B9ZA 4FLZA 4JYCA 2R72A 1AVMA 4B3RO 1Y4MA 1WAZA 1TA8A 5C93A 3K0GA 4RUFA 4TUYA 2PY5A 1FJGB 1IVSA 2EJRA 3SR2C 5CBHA 2DQ3A 3SJQC 3OEEG 1NVPB 3ZN0A 2LW7A 3JD3A 1F23A 3L74H 2FMLA 1BQZA 2Q67A 3APQA 3C90A 5A9GA 4U3JA 3DC5A 1R3IC 2AZ2A 1XQ8A 4LF9O 1NTZH 2OCCB 1M90W 2Y69B 1PNKA 4BW5A 3CXCU 5LHHA 4PA7A 2YUAA 3ZRSA 1TUEB 1W0JG 1Y6XA 1XHZA 1XHXA 4P2ZA 3JAWB 2DYSB 4CH5A 2P4VA 4UV8A 2PYLA 4LFAO 3RBZA 3UO3A 1KU9A 4DUZB 3RYIB 4MVOA 4OX9B 1QU7A 4FIPC 1KP2A 2IJJA 1Y76B 3CD6V 1AI5A 1HNXB 4CH4A 1Y67A 4FLTA 3T1HB 3M7MX 3J7AU 2QWOB 3AG1C 3CCEV 5LBQA 1IXBA 4QPJA 4DV7O 4X1KA 4LNUB 3L9DA 3D36A 3RYCB 4H0LB 4N23A 3L70H 3F5TA 5B3SC 1AR1B 1FKAO 2W6JG 4D6TH 1ZWIC 4DR3O 4Q20A 2AHYA 3SYQA 5B1NA 5GW7A 2JJ1G 5DM6V 4GYCB 2HG5C 2LGQA 2K1EA 5JVDB 5JCOA 2VQEO 4IHJB 5BZBA 4ZKIA 4NXMB 2ITDC 3WB0A 1FYJA 1H2KA 1NT2B 4GKKO
chains in the Genus database with same CATH topology
1ZL8A 1Y76B 1VF6C 1Y74B 1Y74A 1RSOB 1Y76A 1VF6A 3B40A 1ZL8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZL8 A;  1Y76 B;  1VF6 C;  1Y74 B;  1Y74 A;  1RSO B;  1Y76 A;  1VF6 A;  3B40 A;  1ZL8 B; 
#chains in the Genus database with same CATH topology
 3Q4H B;  2OTJ V;  3LNM B;  4JYB A;  4FK5 C;  1OV9 A;  2OCC C;  2BSK A;  2Y69 C;  5JJN B;  1KC8 W;  3HKB B;  4W4L A;  1DF4 A;  1Y74 B;  4YHH B;  3SYC A;  3CB2 A;  1GAX A;  2DYS C;  3B4S A;  1ZAU A;  1THZ A;  5DEC A;  4QE9 A;  1NH2 B;  1B6Q A;  2YS8 A;  3G4S V;  3EFF K;  3GWO A;  1CXZ B;  2UUC B;  1R6N A;  2R70 A;  2YIB D;  2DMX A;  3RYC A;  1JVM A;  2X6B A;  3TGU H;  3ZHQ A;  3C3S A;  4LF4 B;  1FJG O;  2Q0A A;  4YJ2 B;  1QLE B;  1YEW A;  2IH1 C;  4PA6 A;  1O9H A;  2ZQM A;  3CX5 F;  1YJW V;  3TET A;  2ADP A;  1JA8 A;  5EIB C;  4X1I A;  3ZRX A;  2A9H A;  3LDD A;  4UFZ A;  2Y4T A;  1MG1 A;  3FB5 C;  4O4J A;  5FL7 G;  5ITZ A;  3CRC A;  5B5E Z;  2CGN A;  4MTG A;  4K3A A;  1NU1 H;  5HFM A;  1PPJ H;  1TUB B;  4OXS A;  2WA3 A;  5IYB O;  5KAI Z;  2HVJ C;  2X6A A;  4MW3 A;  4UCT A;  3Q4H A;  3N2K B;  4I5S A;  4X88 A;  4GZR B;  1K9M W;  4DUZ O;  2EBO A;  2CH7 B;  4OX9 O;  2CTQ A;  1U97 A;  1YTF B;  4J80 A;  5F2V O;  2NN4 A;  1H8E G;  1M93 A;  3JAM N;  2PTM A;  1YJN V;  4GX5 A;  3E35 A;  2OYQ A;  1HNX O;  2GSM B;  1O9G A;  1F4N A;  1ORQ C;  3T1H O;  4DR1 O;  2Q7E A;  3VQW A;  3ABK B;  3T1Y B;  3UKM A;  5H2F Z;  4DV3 O;  1Q43 A;  4TV8 B;  4DV6 B;  4UUJ C;  3S3X A;  3STL C;  3TXS A;  2N04 A;  2DW4 A;  2HLD G;  1GTO A;  3JYC A;  2UXB B;  3W7T A;  1QR9 A;  5CA0 A;  3HKE B;  2VS0 A;  4P9P A;  4KUM A;  2VWK A;  5EC1 C;  3UT5 B;  2F4V B;  2X0L A;  4JI0 B;  5H9C A;  3GWK C;  1VQ8 V;  5LGT A;  1COW G;  5KMG B;  1JOY A;  4KL1 A;  4JV5 B;  1QLE C;  3A0B Z;  2UXX A;  3DSQ A;  3KKY A;  2QM8 A;  3UQ8 A;  1P7B A;  3SJB C;  3LSQ A;  3VQX A;  5TIS Z;  2EZP A;  3CCJ V;  2YXY A;  4NXM O;  3KCX A;  2DJV A;  3ETD A;  4DV5 B;  2NNU A;  4CS3 A;  4F6R B;  2QWP B;  4UVB A;  2CH7 A;  1P7G A;  5JJE B;  3K0D A;  1DTO A;  4JI7 B;  2CE4 A;  3CYO A;  4LF8 B;  2QM4 A;  5HFL A;  1HWY A;  4UCO A;  4YHH O;  2WWW A;  1VIB A;  2CTP A;  4JAU A;  3N2G A;  5FPO A;  4K0K B;  1MOF A;  2UUC O;  4TV8 A;  2WSS G;  5LMU B;  1W59 A;  5CA3 A;  2EIJ C;  5KX5 B;  4ZBM A;  2ZM6 B;  1K73 W;  5KA5 A;  1ROP A;  1WLE A;  3RYH A;  4DR4 O;  3ABK C;  3HKD B;  4MVR A;  1AI7 A;  3A0H Z;  4DR2 B;  3AK2 A;  3HB3 B;  4H13 B;  2XUM A;  4QIW F;  3JSN A;  2GTA A;  1NR7 A;  1PKX A;  5KMG A;  3E8H A;  1YF2 A;  5EYP B;  1OZ0 A;  3FD9 A;  4YJ3 B;  1KD1 W;  1MSW D;  1JJ2 U;  1RFY A;  2YSU B;  5EC2 C;  1J5E B;  1BT8 A;  1B04 A;  3H01 A;  4X65 B;  4CBC A;  1BGY H;  5K1P A;  3APO A;  2KG7 A;  1RSO B;  3J80 N;  3E8B A;  3IC9 A;  2AGA A;  1YI2 V;  4FPP A;  4FLX A;  1QCE A;  3C3T A;  2KQX A;  4H37 A;  3THO A;  2XAS A;  3OAA G;  5KUK A;  5LOV A;  3CRM A;  5L3B A;  1R73 A;  2JK5 C;  1Q6U A;  2EIM B;  2ZIO A;  1ENV A;  3BFR A;  1V55 B;  5KA6 A;  3T1Y O;  2QWR B;  1KMI Z;  5H5N A;  1XMO B;  3S3W A;  1UJW B;  1SQV H;  1DK1 A;  3QF7 A;  1TGO A;  1OCZ B;  4F6E A;  4IL6 Z;  3N27 A;  5KAF Z;  3OD4 A;  2UXB O;  3O9O A;  4JTC B;  1SF9 A;  1CP9 A;  3ZHT A;  4I4T A;  4ICG A;  2F4V O;  2ZD9 A;  3VBB A;  4H33 A;  4FLW A;  3B2E E;  4JI0 O;  3GVM A;  2IW5 A;  1AI4 A;  1NS1 A;  2UXN A;  1NQT A;  3ASN C;  4O2B B;  1DLB A;  2EIL B;  4LFC B;  1R3L C;  3RFR A;  2PUS A;  5LHG A;  2PF4 E;  4JV5 O;  4D7T A;  1Q5O A;  4DYL A;  5D5Q A;  3EXA A;  3FX7 A;  1SC5 B;  4JI1 B;  1H8H G;  3JAR A;  3DXR A;  3ZHV A;  4DV5 O;  2HFE C;  1R3K C;  3B8M A;  4B7E A;  3A8T A;  4RQE A;  4TUY B;  1AI6 A;  2XAG A;  5IY5 C;  3MHS C;  2L6L A;  4JI7 O;  1VQM V;  2W6I G;  5B1A B;  5DED A;  2P5O A;  4LF8 O;  2E5L B;  1EZJ A;  2Q9L A;  3KZI Z;  4JI3 B;  4YY3 B;  4LFB B;  4G2K A;  1XNR B;  2FTK A;  1M57 B;  3WG7 B;  3E86 A;  3JCU Z;  2YIB A;  4U3J B;  1KKC A;  3K79 A;  3M99 B;  2RDC A;  1JMK C;  5LMU O;  4X89 A;  1PL4 A;  2IJH A;  1LUW A;  1N8R W;  5LP6 B;  2ZM6 O;  2EIM C;  1N33 B;  3CS5 A;  3CMA V;  2XTA A;  1V55 C;  5JQG A;  4FLV A;  2LQT A;  3FB7 C;  4GKK B;  2X7R B;  5LMN B;  4DR2 O;  3SYO A;  2P67 A;  5LGU A;  4DR6 B;  1BE3 H;  1NTM H;  1OCZ C;  3JAL B;  4LH6 A;  2AZ0 A;  3K3W A;  3P3N A;  3CP1 A;  4RQF A;  2YXH A;  2QEX V;  1PM9 A;  1Z5V A;  1KQS U;  1GMG A;  1J95 A;  1J5E O;  2HHH B;  4X65 O;  1V54 B;  2B1I A;  2LO1 A;  3CCQ V;  2EIL C;  1NI8 A;  1BMF G;  3FB6 C;  2N05 A;  3K9A A;  4X1K B;  1SS3 A;  5EBL C;  4JTD B;  4AIL C;  3CC4 V;  1VQO V;  3MDS A;  1YXB A;  4I50 A;  3CCV V;  4PV1 B;  4JTA B;  1K7D A;  1K4D C;  3DTU B;  3FB8 C;  1M4U A;  3RYF A;  4CC5 A;  1VP7 A;  4MW8 A;  3ETE A;  2GTS A;  1XMO O;  5B1A C;  2JGD A;  3OUS A;  3M8A A;  3RN4 A;  4J41 A;  4FZ0 A;  4IYI A;  1ZUQ A;  2R9R B;  1JX9 A;  5LP6 A;  3I56 V;  3AK1 A;  2FB5 A;  3HKC A;  5A2Q N;  3WG7 C;  1M57 C;  3CCU V;  3BY6 A;  3FAV A;  2CAZ C;  1QHT A;  1HNZ B;  4LF5 B;  2IU3 A;  4NB5 A;  1FS0 G;  1GN3 A;  3JAL A;  2BSK B;  4B7K A;  4LFC O;  3RVZ A;  5LP6 C;  1I0H A;  3VQV A;  4CZZ A;  3K04 A;  4DV4 O;  1E1Q G;  4TWK A;  4FMT A;  2YI9 A;  1G6U A;  2NR5 A;  2QKC A;  1JQ0 A;  1K92 A;  3K5O A;  5J2U B;  3OR7 C;  4DR1 B;  5GTH Z;  4JI1 O;  4C7U A;  2F66 C;  4CS2 A;  2HEP A;  1H2S B;  2Q0O C;  2X6C A;  4CH3 A;  4DV3 B;  4JI5 B;  4RO2 A;  2Q8V A;  4DRX A;  3QG5 A;  4O2A B;  2E5L O;  5K1X A;  1D5N A;  4MTX A;  1V54 C;  4LCU C;  2KKW A;  4JI3 O;  4B3M B;  4X1I B;  4YY3 O;  4LFB O;  1SZT A;  2WLJ A;  1KKD A;  1XNR O;  1GH6 A;  2A7W A;  1YSC A;  4UVA A;  3L72 H;  2GUZ A;  4O4J B;  4U7N A;  4OPA A;  3D36 C;  5FPR A;  5ITZ B;  2CDY A;  4TV9 A;  2YC0 A;  3X2Q B;  4JYA B;  4LF7 B;  1AR5 A;  4I9Q A;  1IBK O;  1N33 O;  1W2B U;  3ZX6 A;  1B3Q A;  1WB8 A;  2A79 B;  2AHZ A;  4PDM A;  4BWA A;  3E89 A;  3TJT A;  1FXK A;  1QLN A;  4E2L A;  2F43 G;  1UPG A;  2ZXW B;  5LMN O;  2LJ2 A;  4DR6 O;  1FFX A;  3BPZ A;  2XHB A;  4AHC A;  3I5D A;  3JAS A;  2Q73 A;  3OM3 B;  1AB3 A;  4WF9 V;  2F1M A;  5JCO C;  3WB2 A;  1I5Y A;  3QVN A;  4UB6 Z;  2H94 A;  2D3O W;  3JCZ A;  5J2U A;  3D3I A;  2WLN A;  3O65 A;  3ZMU A;  2HHH O;  4G28 B;  1VQ5 V;  3TXQ A;  4P30 A;  3W7U A;  1Q6H A;  3E83 A;  4J9Y B;  1NZ6 A;  1VQ9 V;  2CTW A;  2EIK B;  2ATK C;  2EUL A;  4ASU G;  4TT3 G;  1P84 F;  4JAS A;  4K35 A;  4OGQ B;  2UUB B;  2ZR2 A;  3P30 A;  4JAV A;  4O2A A;  3UCS C;  5CA0 B;  4HYO A;  4DR4 B;  5LA6 A;  1MSD A;  1EN4 A;  3QO8 A;  1RP3 B;  1N0N A;  4L87 A;  3I55 V;  2GDS A;  2ZE8 A;  3W7S A;  2YDE A;  3UO2 A;  1E79 G;  4J11 A;  4NKG B;  3L71 H;  1OCC B;  1Y66 A;  5KHI A;  4CC6 A;  4NXN B;  1RM1 B;  4I55 B;  1XRE A;  4GX0 A;  1TAE A;  1HNZ O;  2ARH A;  2JRI A;  4LF5 O;  5IYD O;  3OTO O;  5LXT A;  5EK0 A;  1P49 A;  3X2Q C;  1VF5 B;  4ZOL A;  5BMV B;  4I0X B;  1XL6 A;  1S0V A;  2YIC A;  1UFI A;  3K5N A;  2ZXW C;  3K08 A;  3AEI A;  4WBN B;  4J7K A;  2QDO A;  3N2G B;  4MS2 A;  2QKA A;  4CH6 A;  1SQF A;  4X64 B;  3ZMT A;  3K06 A;  1KB9 F;  4JI5 O;  2JJ2 G;  4QPK A;  1R3J C;  3TCU A;  2V1D A;  4PA3 A;  1H2G A;  2LFS A;  3RYH B;  5IYC O;  5KHK A;  4IGG A;  4B3M O;  4QE7 A;  4NTW A;  1BCC H;  2N74 A;  1ZX3 A;  3ZIA G;  2EIK C;  2KB1 A;  4DO2 A;  3ZCC A;  1WPX A;  3CRR A;  2WA4 A;  3JD2 A;  3ZJZ A;  1S77 D;  3LSU A;  1LNQ A;  2OWO A;  3MHH C;  4HBN A;  4JYA O;  4LF7 O;  1SA0 B;  3J81 N;  1KUQ A;  2YEV B;  2F95 B;  4XBF A;  3QO5 A;  2QKS A;  1GN2 A;  4I55 A;  1VQK V;  2P7T C;  1SQX H;  5GON A;  2C2A A;  2KG7 B;  1KBH A;  1Q82 W;  3FYE B;  1OCC C;  2ADQ B;  4PDL A;  3BHP A;  5C8Y A;  4DV2 B;  4B08 A;  2P06 A;  1MA1 A;  1R6T A;  1IBL B;  1NR1 A;  5BMV A;  5CMU A;  5LOV B;  4I0X A;  1RM1 C;  5H6R A;  1SER A;  5LGN A;  4AQY B;  1AJP A;  4UV9 A;  1N0J A;  4WBN A;  4AI8 A;  2PZS A;  2V7Q G;  4X1Y A;  1M56 B;  4O4L A;  5KUM A;  3CPW U;  3OW2 U;  2B5U A;  4YIP A;  2Q69 A;  2LFR A;  5IDJ A;  1IDS A;  1OCR B;  2HKO A;  1VQL V;  4J42 A;  2UUB O;  2HR3 A;  3B77 A;  1HR0 B;  2AXT Z;  4QGP A;  1R6K A;  2ZDI A;  4L8J A;  1NVP D;  4I4T B;  3KG2 A;  4NR1 A;  2RNB A;  1NBM G;  2RMK B;  4GUN A;  2ITC C;  4GX2 A;  2XT9 A;  1MAB G;  2JDI G;  1R1B A;  5LHI A;  3U0Z A;  1EZV H;  4KHP O;  1PP9 H;  2CGO A;  3P32 A;  1CPY A;  1WA8 A;  2BOC C;  4FJC C;  1GN4 A;  4N21 A;  4O4I A;  4MT8 A;  4A5U B;  1SA0 A;  4PA9 A;  2YEV A;  2ZNI A;  4WFA V;  4DV0 B;  1I94 B;  1Q8I A;  4NXN O;  2E76 B;  4LWS A;  4DUY B;  3JAR B;  5H6Q A;  3DXR B;  3DC6 A;  5JWP A;  1BL8 A;  4JI6 O;  1ZL8 A;  3FKS G;  3K03 A;  5CB4 A;  3SYP A;  1PV0 A;  3G71 V;  4TQD A;  2QTO A;  4JZG A;  1YCI A;  4PDV A;  3G67 A;  4GCZ A;  5KHG A;  4HNA A;  4ZI7 A;  3T1C A;  5BXZ A;  4PI2 A;  2R9A A;  2A3Q A;  5EIB D;  1B06 A;  3CE2 A;  1Q7Y W;  4X64 O;  2E75 B;  4X66 B;  1OCO B;  1MMM A;  5IWA B;  4DK0 A;  4JPR A;  3ZED A;  3JAT A;  2BOB C;  1FXH A;  1EN6 A;  1NTK H;  1XBL A;  1M56 C;  5JQG B;  2PGG A;  4Z1M G;  4Z2W A;  3SDL A;  1DF5 A;  2RQ6 A;  3ZHU A;  2GBO A;  2PYJ A;  1OCR C;  2JEU A;  4XDK A;  5IYZ A;  2XND G;  1FD9 A;  4DV4 B;  4KP4 A;  2ZE7 A;  4WFE A;  3JSL A;  2EJ7 A;  3HPL C;  1G1X B;  3CC2 V;  2QWN B;  2CK3 G;  2RJZ A;  4FFB A;  4PA4 A;  4EB6 A;  1JR9 A;  2VQF B;  3MD0 A;  1Q90 D;  2UUA B;  3PN1 A;  1G4Y B;  2OIG A;  4DV2 O;  2WLI B;  2Y0I A;  2WLK A;  1S72 V;  4CS4 A;  5J9P C;  3RT3 C;  1IBL O;  1L8D A;  5EZY A;  4I50 B;  4HZ3 A;  4I9W A;  1VF7 A;  3B09 A;  4AQY O;  4TQF A;  3U10 A;  4DR5 B;  3RYF B;  1QVG U;  3DGE A;  2ZE5 A;  1TVK A;  1NH2 D;  4WFH A;  5FNV B;  3CRQ A;  2HVK C;  5IJ9 A;  3U11 A;  2JGD B;  2ZNJ A;  5IJ0 B;  2ETN A;  1F4M A;  1ZLZ A;  3JAK A;  3G6E V;  1HR0 O;  1IBK B;  5IT9 N;  5BR8 B;  1XDC A;  3HKC B;  3E22 B;  1SQG A;  5CA1 A;  3H1H H;  1PNL A;  3FAV B;  4B3S O;  4DW0 A;  1OCO C;  1I08 A;  1VF6 A;  1AJN A;  4K8X A;  1VQP V;  4UB8 Z;  1AP6 A;  5J2T B;  1JJO A;  1IXM A;  1AR4 A;  3F7Y C;  1KEC A;  2XAQ A;  3BAA A;  3QTC A;  2CUG A;  4MVS A;  5DN6 G;  1T5E A;  4DW1 A;  3BRC A;  3WFV A;  5E1A C;  2ZE6 A;  4BIO A;  2BE3 A;  5KHH A;  4GLX A;  3NR7 A;  4DV0 O;  1I94 O;  4DUY O;  3AG1 B;  3BEH A;  3SGI A;  1DGS A;  1K97 A;  4WCE V;  2HJD A;  4O4H B;  3PJS K;  1K5Q A;  2Q7H A;  2H8P C;  1SRY A;  4XDL A;  2WLH A;  2WLI A;  1YTF D;  2QM7 A;  1XNQ B;  1MZF A;  1URF A;  4DRX B;  1M1K W;  4EFE A;  3K5L A;  4IIJ A;  4R6Z A;  1I7F A;  1X59 A;  2IM9 A;  4EFB A;  4JI4 B;  1K4C C;  5FNV A;  1S5H C;  2GUZ B;  3ZMS A;  2DE0 X;  4D7S A;  1NJI W;  2QGN A;  4X66 O;  2E74 B;  2ILM A;  4UCU A;  4ZHQ A;  4NYK A;  5IJ0 A;  4KXR A;  3CXH F;  5IWA O;  1AIL A;  2VRZ A;  4FLU A;  4TV9 B;  4ZIB A;  4WFF A;  1XIL A;  4I7Z B;  3E2E A;  4X20 B;  1GM7 A;  3CCS V;  1XI1 A;  3E22 A;  1F7Y A;  1S5L Z;  1FXK B;  3A2F A;  1BS3 A;  1MZE A;  4BIZ A;  3OTO B;  5J2T A;  2V4D A;  1WP8 A;  1FFX B;  3JAS B;  3CSX A;  3ABL B;  2GHY A;  2EIN B;  3AK3 A;  2IJI A;  3OMN B;  2OIE A;  3OUF A;  3ZMZ A;  4LC1 A;  5LYJ A;  4UCR A;  3WU2 Z;  3G6B A;  3QO7 A;  1W0K G;  4J9Z B;  2Q4P A;  1VQ6 V;  5CBG A;  1ZSP A;  4LF6 B;  2XAF A;  3OMA B;  4O4H A;  3ZRW A;  2R9I A;  2VQF O;  2D2C B;  2UUA O;  1D5A A;  3H1K H;  3CJH B;  4RAI A;  2O57 A;  5CBF A;  3IAY A;  2Z5U A;  3SYA A;  3P3P A;  4EKW A;  3AG4 B;  5LA6 B;  4DR5 O;  5D5P A;  2XAH A;  1QR8 A;  2UXC O;  3CWB H;  1SQP H;  1BHB A;  4NVP A;  2BTQ B;  3LDE A;  1G8M A;  4GX1 A;  2Y48 A;  4B3T B;  4X20 A;  3A0R A;  3OR6 C;  3CC7 V;  2ZIM A;  1YIT V;  1QNM A;  5B66 Z;  5BR8 O;  1RPO A;  1YJ9 V;  3E8F A;  1WP7 A;  4U3F H;  4MVM A;  4X8A A;  1JFF B;  2NLJ C;  3OGI B;  2K9P A;  1US6 A;  4EEQ A;  1VQN V;  2CTR A;  5LXT B;  3ASO B;  1N34 B;  3VOU A;  4FM0 A;  4ZOL B;  3RW0 A;  1SQQ H;  2WLM A;  5E79 Z;  3ZN1 A;  4QNH B;  1FXK C;  3JAW A;  1ARO P;  1Q86 W;  3K9S A;  1SZX A;  3RYI A;  3SPJ A;  4P9O A;  3W7X A;  4LBE C;  1H2M A;  3RWR D;  1Y76 A;  4LP8 A;  3BA8 A;  3ABL C;  4DK1 A;  2EIN C;  3CJH A;  1XNQ O;  5JJJ B;  2IBZ H;  1GO3 F;  3SJC C;  5IE9 A;  4JGS A;  5L3G A;  1JPX A;  4JI8 B;  3H9V A;  2QSA A;  2EX3 A;  2VWJ A;  2F23 A;  1M9N A;  3B8N A;  3R66 A;  4E4E A;  3D8C A;  4JI4 O;  2ZCE A;  4K8Z A;  1K3E A;  1WPB A;  2QR4 A;  1QBZ A;  4LNU A;  1YZB A;  3RGB A;  4KHP B;  1FPO A;  4QJF B;  4YXW G;  1S5J A;  4ABM A;  3K57 A;  3QNE A;  5CN0 A;  2QJ1 A;  2BTQ A;  4PI0 A;  1FAF A;  1PD3 A;  2A06 H;  3KCY A;  1FFT B;  3CCM V;  2Y0P A;  3AG4 C;  3CHX A;  4DXW A;  1EBO A;  1Q3E A;  1SES A;  1JFF A;  3K5M A;  2BTO A;  2FL4 A;  5GON B;  2H3O A;  5KHJ A;  2E3C A;  2LP7 A;  3IFX A;  4JI6 B;  1N4C A;  3ZS8 C;  5C8Y B;  1ZTE A;  2DWE C;  2IH3 C;  2Q6A A;  3H1J H;  5JVD A;  1RPR A;  4IHJ A;  1AJQ A;  3OEH G;  1XMQ B;  3OGC C;  1D2D A;  1SKV A;  4MTF A;  1V9P A;  1H2L A;  3OT7 A;  1YVW A;  4X1Y B;  1U96 A;  4O4L B;  2EZO A;  3BVO A;  4LF6 O;  3ASO C;  4Q6G A;  4WFB V;  3HKB A;  1HW7 A;  1XL4 A;  3TK1 A;  2QTS A;  4Z1V A;  1GKF A;  1Y74 A;  5GTI Z;  1IX9 A;  1N36 B;  1XOU A;  2EIJ B;  3JD4 A;  4DV1 B;  1NKD A;  3MAQ A;  1JCH A;  3HR0 A;  5BY1 A;  2JS5 A;  3FFQ A;  1VMG A;  4TOI A;  1IBM B;  3LSS A;  2Z0A A;  4JF3 A;  3LDC A;  1IUR A;  2LW1 A;  1L0L H;  3L75 H;  1H38 A;  1BSM A;  2PI4 A;  2DYR B;  4YJ2 A;  2LGW A;  2GV9 A;  3BCC H;  1WA8 B;  2QWQ B;  1VQ4 V;  4O4I B;  3ABU A;  4B3T O;  5EBM C;  4IT5 A;  3T2M A;  3JD1 A;  2B1G A;  4RUE A;  4JAA A;  2PI5 A;  1BQ0 A;  1EM1 A;  2WPD G;  4X62 B;  4LWS B;  1GM9 A;  4U7O A;  1AP5 A;  3D3Q A;  3RVY A;  4MTO A;  1Z2G A;  2Y4U A;  3R65 A;  3AG7 A;  1L0N H;  1ZL8 B;  1TUB A;  5L3F A;  1HNW B;  2ZR3 A;  4KFM A;  5CB4 B;  1N34 O;  1FXV A;  3T4Z A;  1VQ7 V;  2Z3Y A;  3F7V C;  4TSF G;  4IYH A;  3H1I H;  2P90 A;  2Q7G A;  2UU9 B;  3N2K A;  4MVU A;  4HNA B;  4ZI7 B;  2P6J A;  3ZBH A;  1OJH A;  3ZHS A;  1VEW A;  1OHH G;  3UM7 A;  3LNN A;  4FZ1 A;  4HAM A;  1I5X A;  3EHB B;  1XEQ A;  4J10 A;  4WFG A;  2RCV A;  4GKJ B;  3ABM B;  3B40 A;  2YI8 A;  5B1B B;  3JD0 A;  3JAT B;  2A0L A;  3CEI A;  3ETQ A;  2RN9 A;  2UXD B;  5AG2 A;  4JI8 O;  4DR7 B;  4BW9 A;  4B3S B;  2DQ0 A;  4UXN A;  4NTX A;  4UCS A;  3ZRV A;  2MK3 A;  3SJA C;  1K5S A;  2MW2 B;  3ASN B;  5IYZ B;  1X4T A;  4R7C A;  4FVM A;  4LF4 O;  1EN5 A;  2XOK G;  3AG2 B;  3HKE A;  1GRJ A;  4JZ2 A;  2JEX A;  2ZDI C;  2YID A;  3WB1 A;  3UT5 A;  4FM1 A;  3CCL V;  3OMI B;  1XUQ A;  1N32 B;  4R8C A;  3F5W C;  4MVQ A;  2DYR C;  4YIO A;  2IU0 A;  4EB6 B;  4FFB B;  4BR6 A;  1CEZ A;  1YIJ V;  5IY5 B;  3K59 A;  5EZY B;  4BIU A;  1XMQ O;  4JI2 B;  2WLL B;  1PL0 A;  1K33 A;  4XDJ A;  4RWU A;  4B3R B;  3ICX A;  1HP8 A;  4F6R A;  3IJ4 A;  2P4K A;  1GM8 A;  2KSD A;  1TVK B;  3FYI B;  1MNG A;  3E8G A;  1A32 A;  3IGA C;  4MSW C;  5IJ9 B;  3SPH A;  4LH7 A;  1S76 D;  4X9Q A;  2BCC H;  1N36 O;  2JGU A;  3JAK B;  2WAM A;  3ZHR A;  4DV1 O;  4G27 B;  1IBM O;  4F4L A;  1BZK A;  5CA1 B;  2FKX A;  2ODM A;  2OT5 A;  3EVK A;  2JIZ G;  3CCR V;  4PD4 F;  4PHZ A;  3ABT A;  4LF9 B;  4DV6 O;  4NTY A;  4OPH A;  3ABM C;  5B1B C;  3GB7 C;  5KX5 A;  3ML0 A;  1LUV A;  5JH7 B;  3AG3 B;  1WB7 A;  2P22 C;  5L3C A;  3HKD A;  1E1R G;  1IZ3 A;  2QA4 V;  3G80 A;  2W0X A;  4UVC A;  4LFA B;  3SPG A;  4JYY A;  2XAJ A;  3ETG A;  4X62 O;  3BA9 A;  1Z5W A;  4GT1 A;  2G38 A;  3K58 A;  3NXS A;  5EYP A;  2JVD A;  2DN9 A;  2M6Y A;  4YJ3 A;  3AG2 C;  1WNS A;  4PJ0 Z;  5FLX N;  4R50 A;  1HNW O;  4LR3 A;  2OTL V;  3W7W A;  1Q6I A;  1M5I A;  2HJF C;  2L35 A;  2WLL A;  4IIJ B;  1WJZ A;  4W4K A;  2Q68 A;  5L3D A;  4FLY A;  4FFK A;  5LL6 Y;  2HP8 A;  2UU9 O;  1KYO F;  1S3J A;  2IJK A;  4DV7 B;  3CME V;  1RSO A;  2W0F C;  4H44 B;  1YHQ V;  2UXC B;  3OFN G;  3T4D A;  2ZT9 B;  3STZ C;  1SET A;  1LR1 A;  4ZHQ B;  3BAB A;  4GKJ O;  1H2N A;  3VQY A;  2JS3 A;  4PDR A;  1F51 A;  3H1L H;  1EFR G;  1QVF U;  1GK9 A;  3OE7 G;  4DR3 B;  1VAR A;  3CRA A;  2UXD O;  1SQB H;  1KP3 A;  4J7J A;  4DR7 O;  2FYU H;  2ZIN A;  4BAY A;  4K0K O;  2DOS A;  2ZKO A;  1P4R A;  5B1O A;  4MVZ A;  5JH7 A;  2VQE B;  1HDJ A;  4J7Z A;  1K34 A;  2OCH A;  1WN7 A;  4UCV A;  4FM2 A;  3SPC A;  2Q5Z A;  3IC7 A;  5LYJ B;  1QQC A;  3ZMV A;  2YXL A;  1VF6 C;  4O2B A;  1N32 O;  5EBW C;  1GN6 A;  3LUT B;  3OTF A;  1YDX A;  3SPI A;  3ZRW B;  2M7W A;  3L73 H;  1BHA A;  3AG3 C;  5L3E A;  2DWD C;  1Q81 W;  2F93 B;  1K8A W;  5KLV H;  2YIA A;  1L1F A;  2AW9 A;  5B3S B;  4JI2 O;  4PEL A;  1PNM A;  2QE7 G;  2B9Z A;  4FLZ A;  4JYC A;  2R72 A;  1AVM A;  4B3R O;  1Y4M A;  1WAZ A;  1TA8 A;  5C93 A;  3K0G A;  4RUF A;  4TUY A;  2PY5 A;  1FJG B;  1IVS A;  2EJR A;  3SR2 C;  5CBH A;  2DQ3 A;  3SJQ C;  3OEE G;  1NVP B;  3ZN0 A;  2LW7 A;  3JD3 A;  1F23 A;  3L74 H;  2FML A;  1BQZ A;  2Q67 A;  3APQ A;  3C90 A;  5A9G A;  4U3J A;  3DC5 A;  1R3I C;  2AZ2 A;  1XQ8 A;  4LF9 O;  1NTZ H;  2OCC B;  1M90 W;  2Y69 B;  1PNK A;  4BW5 A;  3CXC U;  5LHH A;  4PA7 A;  2YUA A;  3ZRS A;  1TUE B;  1W0J G;  1Y6X A;  1XHZ A;  1XHX A;  4P2Z A;  3JAW B;  2DYS B;  4CH5 A;  2P4V A;  4UV8 A;  2PYL A;  4LFA O;  3RBZ A;  3UO3 A;  1KU9 A;  4DUZ B;  3RYI B;  4MVO A;  4OX9 B;  1QU7 A;  4FIP C;  1KP2 A;  2IJJ A;  1Y76 B;  3CD6 V;  1AI5 A;  1HNX B;  4CH4 A;  1Y67 A;  4FLT A;  3T1H B;  3M7M X;  3J7A U;  2QWO B;  3AG1 C;  3CCE V;  5LBQ A;  1IXB A;  4QPJ A;  4DV7 O;  4X1K A;  4LNU B;  3L9D A;  3D36 A;  3RYC B;  4H0L B;  4N23 A;  3L70 H;  3F5T A;  5B3S C;  1AR1 B;  1FKA O;  2W6J G;  4D6T H;  1ZWI C;  4DR3 O;  4Q20 A;  2AHY A;  3SYQ A;  5B1N A;  5GW7 A;  2JJ1 G;  5DM6 V;  4GYC B;  2HG5 C;  2LGQ A;  2K1E A;  5JVD B;  5JCO A;  2VQE O;  4IHJ B;  5BZB A;  4ZKI A;  4NXM B;  2ITD C;  3WB0 A;  1FYJ A;  1H2K A;  1NT2 B;  4GKK O; 
#chains in the Genus database with same CATH homology
 1ZL8 A;  1Y76 B;  1VF6 C;  1Y74 B;  1Y74 A;  1RSO B;  1Y76 A;  1VF6 A;  3B40 A;  1ZL8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...