3C90A

The 1.25 a resolution structure of phosphoribosyl-atp pyrophosphohydrolase from mycobacterium tuberculosis, crystal form ii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
87
structure length
87
Chain Sequence
VKTFEDLFAELGDRARTRPADSTTVAALDGGVHALGKKLLEEAGEVWLAAEHESNDALAEEISQLLYWTQVLMISRGLSLDDVYRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosyl-ATP pyrophosphatase
publication title The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 34
structure length 87
sequence length 87
chains with identical sequence B, C, X
ec nomenclature ec 3.6.1.31: Phosphoribosyl-ATP diphosphatase.
pdb deposition date 2008-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 3c90A00
1VMGA 2P06A 2OIEA 1YXBA 2A3QA 2A7WA 4QGPA 5IE9A 1Y6XA 2Q4PA 2Q9LA 3C90A 1YVWA 2Q5ZA 3CRAA 2GTAA 2Q73A 2OIGA 2YXHA 3CRCA
chains in the Genus database with same CATH superfamily
2EILB 1NVPB 1WB7A 4I7ZB 1Q7YW 3FFQA 1AI7A 2W6JG 3UT5B 5BMVB 2OTLV 2YI8A 2DE0X 5KA5A 4JI4O 4AQYO 4TUYA 2HVJC 2OCCC 2N05A 4X64B 4PA4A 5L3DA 1YJNV 2AXTZ 3FYIB 3KKYA 1EZVH 4EFEA 3CCUV 1XI1A 4LFAO 4JI2B 2ZE8A 4DR2O 2ZT9B 1P49A 3C90A 5CBFA 5BXZA 1T5EA 1WNSA 4DV5B 4JI3B 2LGWA 4PA3A 4XDKA 1VQNV 3ZEDA 3JAWA 1US6A 3RYIB 3JCUZ 1F51A 3S3XA 2BSKB 2ITCC 4UCVA 1YSCA 2DYRB 1QU7A 5JQGB 1MZFA 4J10A 4RUFA 1R3JC 3K5NA 4PI2A 1YEWA 4DR1B 4N23A 3LSUA 2UUBO 1JFFB 1Z5WA 2KG7B 1KQSU 4ZIBA 5EC2C 4BIUA 2HHHO 1WLEA 4ZHQA 3ZHSA 1K97A 3VBBA 5EIBD 1MOFA 5L3BA 1QLEC 3ZHUA 3HR0A 1XNQO 3FX7A 2XOKG 3LSQA 3F5WC 1N36O 3E8GA 3CCRV 2OIEA 1NZ6A 2F1MA 2E5LB 3K0GA 4JYCA 4I9WA 2CH7A 2X7RB 2JS5A 3JD0A 1PD3A 1TVKB 3UKMA 3UT5A 5BMVA 4I5SA 4NTYA 5A2QN 4MSWC 2ZIMA 5B1NA 3AG3B 4YHHO 2H8PC 4C7UA 1GTOA 4WFGA 2ETNA 3APOA 2ADQB 4DV3O 2JK5C 4ZKIA 5E79Z 1FPOA 5K1PA 2XASA 3RW0A 3OR6C 2Q8VA 1LUVA 2L6LA 4X62O 3E35A 3ETDA 3RYIA 1LNQA 3IC9A 1GMGA 2BSKA 2CTQA 3LDCA 5JQGA 4DV0O 1I94B 5E1AC 1WPXA 5J2UB 4MVOA 4E4EA 1HWYA 5LYJA 2FYUH 2HG5C 3HKEB 3E8FA 4XDJA 1N34B 5IJ0B 1SA0A 4FM2A 1JFFA 2KG7A 2ODMA 3T1YB 1R6TA 1TAEA 4PV1B 2QKCA 3CWBH 2CGOA 2UU9O 1NT2B 4EB6B 2OTJV 2ZCEA 3AG1B 3OTOO 1IBMO 4B7EA 1PKXA 2Y69C 2JGUA 3PN1A 4IL6Z 4RAIA 1NQTA 3BRCA 3HKBB 4GZRB 1CEZA 3JCZA 4JI8B 1HNWO 4R8CA 1QBZA 2EIKC 3ZN1A 5LMNB 3NXSA 4PDLA 3QTCA 4QE7A 4TQFA 5D5PA 1NJIW 2VS0A 2PF4E 4LF4B 3X2QB 1TVKA 1G8MA 4UVAA 1KMIZ 4DK0A 1MSWD 3B8NA 4BR6A 2IH1C 1TUEB 3DXRB 1XL6A 3QO5A 3CRQA 2WSSG 3RYFB 1DTOA 1IXMA 3UM7A 2QGNA 1PL4A 2A9HA 2RN9A 3ETQA 2YIBA 3WB0A 4DR3O 4DR6O 3QG5A 1K73W 1YIJV 2ATKC 4P9PA 3TK1A 2NN4A 2EBOA 5B5EZ 2HP8A 4FLXA 3SYPA 4ICGA 5KMGB 3CB2A 4R50A 1SQGA 4LC1A 1N32B 4DV4O 4MVRA 5BY1A 1P7BA 2QKAA 3CSXA 1URFA 4JI0B 3OT7A 1PL0A 1F4MA 3ZHQA 2Q9LA 2GUZB 2JIZG 4DUZB 1JCHA 3ABLB 3JARA 2GSMB 2ZQMA 1RSOB 5IYZB 1Q81W 2IJKA 5J2UA 5KHJA 3LSSA 3N2GB 3HKEA 4DK1A 4NXNB 1OCZB 4PHZA 3CCSV 2QWRB 5IJ0A 4DV6B 5EK0A 4DW0A 5EZYB 2VQFB 3BY6A 1LR1A 4X65B 1MSDA 1SQFA 4J41A 1NH2D 1SRYA 4EB6A 4MVUA 2CAZC 2QSAA 1IBKO 4DR4B 3HKCB 1D5NA 1R1BA 2PI5A 2Q68A 5LMUO 4JZ2A 4X1KB 4UV9A 2H94A 3APQA 4JAVA 1FFXB 3HKBA 2W0FC 1WP8A 4O4LA 3IFXA 3CC4V 2IW5A 4OX9O 2EINB 3T1CA 1J5EB 4B08A 5JH7B 4FLUA 5H2FZ 1WA8B 3BVOA 1VQ9V 3CCLV 2CK3G 2IU0A 1FD9A 4CH4A 4ZI7A 1M9NA 3RYFA 1FJGO 4HNAB 4D6TH 3DC5A 3ZIAG 4F4LA 4J42A 4FVMA 3KCYA 1UFIA 5F2VO 1R3KC 3WU2Z 1S72V 4JYAO 4NB5A 1XMOO 4XBFA 3N2KB 4AHCA 1YTFB 3O9OA 2QWNB 4GYCB 4I4TB 4PDVA 1JX9A 5KMGA 1VQMV 3AG1C 4GKKB 4J7KA 1KBHA 1AVMA 1WAZA 2KSDA 3H01A 2PUSA 4B3SB 4K3AA 2K9PA 3JASB 3ZRSA 2GUZA 3CJHB 5L3FA 1MMMA 3CCEV 1VIBA 3CC2V 2QJ1A 3TJTA 4DR7O 1H2SB 1RSOA 5IYZA 4AILC 1AR5A 3N2GA 4Z1VA 3MHHC 2OCCB 3X2QC 2F4VB 1NR1A 2ZXWB 3OEHG 2N04A 1GO3F 2RNBA 3BEHA 4DV7B 1L0NH 3IGAC 2RDCA 4TQDA 1N33O 1THZA 3ZMVA 2UUCO 4P9OA 1KD1W 4MW3A 5EYPB 2D2CB 5EIBC 2YEVB 3HKCA 1OV9A 4WF9V 3K0DA 2LGQA 1FFXA 1AROP 1GH6A 4FJCC 4LFCB 3OD4A 4IHJB 3WG7B 1EN4A 4QPKA 2VRZA 1B04A 3L71H 4LH7A 4BWAA 5JH7A 4NTXA 1WPBA 1WA8A 4K8XA 3ABLC 1BGYH 5LA6A 2Q69A 1EM1A 3BA9A 2HFEC 4JI6O 1ZUQA 5LHGA 1XNRO 3SDLA 4NXMB 3SJAC 2Q67A 3CCMV 1NS1A 4GLXA 2IU3A 1NH2B 4HNAA 5LHHA 2XNDG 4PELA 2ZM6B 3GWKC 1H2MA 1VQLV 3B09A 3FB6C 2YUAA 1SQQH 5GONA 1QLEB 2IH3C 3B4SA 3G6EV 1YCIA 4JGSA 2KQXA 3H1KH 2F95B 4KXRA 4B3TO 1XMQB 2IJJA 3L74H 2P5OA 2PZSA 4W4KA 4AQYB 5EBWC 1FFTB 1W2BU 2HR3A 4DO2A 2X6CA 3ASOC 3CJHA 2ZKOA 2WLHA 2BOBC 4GX5A 3RYHB 2EINC 4DR2B 4D7SA 1Q3EA 2YC0A 4Z2WA 2E74B 2AHYA 1J95A 2DWDC 1QVGU 3P32A 1DK1A 3LDDA 2P90A 4MVQA 2FL4A 5EBMC 3JD3A 2D3OW 2ZNIA 3L70H 4IIJB 1XHXA 4OXSA 5IY5B 2VWJA 1Y76A 4H33A 3ZHRA 1ZSPA 4FIPC 5JVDB 3OUFA 3K59A 3ETGA 5EYPA 4B3RO 1Z2GA 2YEVA 3ASNB 3M7MX 1Q6UA 4LF8O 3VQWA 5LGUA 3JALA 1GKFA 2X6AA 3ZMUA 5BR8O 4J7ZA 2FMLA 4CC6A 2UUBB 1CPYA 4LFBO 4IHJA 1VEWA 2V4DA 2HHHB 3W7WA 2H3OA 4UB8Z 1BHAA 2ZIOA 3M8AA 3RWRD 4X1IB 5K1XA 5CB4B 2P4VA 5LHIA 1YJWV 5A9GA 3B8MA 1M5IA 3RVYA 2XTAA 4Q20A 2ZXWC 4O4HB 2WA3A 3G6BA 3STLC 1WN7A 2LP7A 2Y69B 2A3QA 2B1GA 3U11A 2XHBA 4I50B 1M4UA 1VQPV 3SPJA 1F23A 4JI7O 2Z5UA 3CD6V 3TXQA 2EIKB 1KP2A 3A8TA 4QNHB 1AR4A 4YHHB 1GM9A 2HJDA 4B7KA 4FLYA 1X4TA 4FZ0A 1H2GA 4I0XB 1R73A 1U97A 4J9YB 3WG7C 3BABA 4LF5O 2OT5A 4TOIA 1Y6XA 3RYHA 4WFAV 4DV3B 3K3WA 2LJ2A 1SERA 1YZBA 1V54B 2O57A 3LDEA 4FFBB 3HPLC 2R70A 4IIJA 4U3FH 4X62B 4IYIA 4MTXA 1Y74A 5JVDA 5KLVH 1VQ8V 1VQKV 4O2AB 2HKOA 4X89A 3CPWU 1N8RW 4JI5B 3B2EE 5TISZ 1ROPA 2WAMA 2Q7HA 2QDOA 2X0LA 1U96A 4MVMA 4UB6Z 2UXBO 2OWOA 3RBZA 4GCZA 4LH6A 5GW7A 2ARHA 5KUKA 3QF7A 4JTAB 4XDLA 3CC7V 4UCSA 4LNUB 3E22B 3OTOB 4X1IA 3AG7A 3U10A 4X64O 3OTFA 5CB4A 1IURA 1GN6A 1M93A 2R9AA 3ZRXA 2Y4TA 1PM9A 1JVMA 4O4HA 5JJJB 3P3PA 1HNWB 2QR4A 1X59A 4FFKA 4MVSA 1VF6C 5KX5B 2Q7EA 1AJQA 3CRCA 4JI3O 5IY5C 2EX3A 4B3MB 2LFSA 1S3JA 3BFRA 3BAAA 4IGGA 3ASNC 3I56V 2ZDIC 2EZOA 2IJIA 3IJ4A 2XAJA 4DYLA 5LP6B 1KKDA 3OE7G 4FLTA 2JRIA 2IJHA 4I0XA 3T2MA 3RYCB 4KUMA 1BE3H 4DR3B 4DR6B 4NYKA 4MTFA 4DR1O 4HBNA 1K9MW 2ZNJA 4WFHA 2GBOA 5B1AC 1SQBH 5DEDA 4GUNA 2CTWA 3FD9A 2V1DA 1NR7A 3W7XA 3CCVV 3JAKB 4FFBA 4DV4B 1PP9H 1Q6HA 4G2KA 3OR7C 1ZL8B 1L0LH 3W7TA 1H38A 5L3GA 5IT9N 2EJRA 3TETA 4O2AA 4U7OA 3SYOA 4FZ1A 1W0KG 4DV1O 2QEXV 5FLXN 5FPOA 4CZZA 4R7CA 4RQFA 5IE9A 4NKGB 4K0KO 1QR8A 3A0RA 1IDSA 4JF3A 2G38A 1D5AA 5L3EA 4X1YB 1Q43A 3E89A 3E22A 3F5TA 3SJQC 2VQEB 4DV2O 3AEIA 3CRMA 1IBKB 1VF7A 2XT9A 5LMUB 2EIMB 2A79B 1NBMG 1V54C 1FAFA 3EHBB 2NLJC 3CCQV 4JPRA 5KX5A 4OX9B 1RP3B 5B1BC 3ABTA 3KG2A 3T1HO 1YI2V 1SQXH 5C8YB 2LFRA 1GN2A 5CA1B 3CXCU 5CBHA 4DXWA 4X9QA 4FM1A 5LP6A 1BZKA 3SYAA 3AK3A 1VQOV 1XUQA 4KL1A 4MTOA 3HKDB 5LGTA 5B1OA 1I7FA 3SJCC 2Q7GA 4UVBA 2EJ7A 2Q0OC 2IM9A 5LXTB 3ZHTA 3CMAV 4HYOA 4JTDB 5GTHZ 1XMOB 2JS3A 4RO2A 4QE9A 1JQ0A 4PDRA 1G4YB 5LGNA 2F93B 4YY3O 3JAKA 3SGIA 4YJ2B 2AHZA 4NVPA 4LF6O 1Z5VA 1B6QA 4NR1A 1ZL8A 2LW1A 5CMUA 1FXHA 1N0JA 3P30A 2UXCO 4PDMA 4UXNA 4QIWF 1NKDA 3ABMC 2ZD9A 4IT5A 5DM6V 2ZR2A 1HNZO 4D7TA 5IYBO 4JI1B 3ASOB 4OGQB 1K3EA 1K33A 4MT8A 1RFYA 1XILA 3J81N 3UQ8A 4PA7A 4LF4O 3ZS8C 2B1IA 4MW8A 2GTAA 1P84F 4KP4A 4DUYO 4ZOLB 3TCUA 4TT3G 4KHPO 2XAGA 5LP6C 2F23A 4X1YA 3K79A 5LOVB 1M57B 2E3CA 1L8DA 1MZEA 1R3IC 4H44B 1RPRA 3E8BA 2KB1A 3CMEV 4JYBA 1VP7A 3DXRA 1ORQC 2FKXA 3JD4A 1EFRG 1YJ9V 4TSFG 2N74A 2UXNA 2WLKA 1EN6A 1HNXO 5B66Z 1ENVA 4UCUA 2WWWA 1H2KA 3Q4HB 1Y66A 4FPPA 1K8AW 3G4SV 2L35A 3ZHVA 5C8YA 4JV5O 4GX1A 5IWAO 1FYJA 4JI6B 4J11A 1HDJA 2JGDB 4DUZO 4E2LA 5CA1A 4J9ZB 5DN6G 2Z3YA 2RJZA 3W7SA 3BHPA 3SPIA 1EBOA 1OJHA 2BTQB 1BL8A 3K57A 4G27B 1SF9A 4X88A 3W7UA 2JEUA 2M7WA 1ZX3A 4X65O 2M6YA 5IDJA 4PJ0Z 3K9AA 1HR0O 2C2AA 2ILMA 1OHHG 5EZYA 2P7TC 3ZCCA 4KFMA 4B3TB 4Z1MG 1YF2A 2QM8A 4YJ2A 1K5QA 1QQCA 2DWEC 2BTOA 2YSUB 2EIMC 1PNKA 1NTZH 1GN4A 4DR4O 2ZE6A 4YJ3B 2P22C 1Y4MA 3K58A 1VMGA 2DMXA 4FK5C 5L3CA 3KCXA 4JYYA 2YI9A 4X1KA 1R3LC 4TV9B 3ABUA 1KUQA 5DECA 3K06A 3OMIB 4F6RB 3I55V 1FKAO 3J80N 1KYOF 1Q8IA 1PV0A 1YITV 1K5SA 4O4IB 3DTUB 4GKJB 2UXDB 4X20B 3TGUH 4FMTA 4BAYA 3OEEG 5LBQA 2YS8A 4B3RB 2LW7A 4LF8B 1BHBA 3D8CA 1S5JA 2AGAA 2Q5ZA 4H37A 2OIGA 1XL4A 4GX2A 1S76D 3SPHA 3CHXA 2PI4A 3MDSA 3K03A 5H6QA 5FNVB 2RQ6A 3JSLA 3QNEA 1ZAUA 1FXKB 2R9IA 5EBLC 1M56B 4GKKO 2QTOA 3N2KA 4CBCA 1WJZA 1XREA 2WLJA 2P67A 4I4TA 3G80A 4TUYB 2QWPB 4GX0A 2JGDA 1GRJA 4TV8B 4UUJC 4JI4B 1UJWB 1OCCC 3JASA 1H2NA 3RN4A 2Z0AA 5IYDO 4J80A 2BTQA 3CP1A 2YXYA 4X66O 1IXBA 1M1KW 4LFAB 4F6EA 2GTSA 2PYJA 2LO1A 1VQ7V 2VWKA 4DV7O 2KKWA 5CA0B 2JEXA 3JAWB 1M57C 1Q86W 4JI7B 5FL7G 3FB8C 3VQVA 4WBNB 2FB5A 3JAMN 4UCTA 3T4DA 4YJ3A 4UFZA 1BQZA 3KZIZ 4DW1A 4LF5B 1IX9A 1K34A 2JJ2G 3F7YC 2YDEA 2WLMA 3AK2A 3T4ZA 1HP8A 3VQYA 2AZ0A 4ZHQB 4F6RA 2Y0PA 3E8HA 2YIBD 4LF9O 1I5XA 5B1AB 4O4IA 4X20A 5J9PC 3D3IA 3B40A 2EIJC 4MS2A 3L9DA 3MD0A 3RVZA 2ZM6O 1BQ0A 4OPHA 2AW9A 5BZBA 1XNQB 1A32A 1B3QA 1MA1A 3QO7A 3BCCH 5KAFZ 4U3JB 3K5LA 2WLNA 1N36B 1SC5B 1LUWA 5FNVA 2BCCH 1JA8A 2CH7B 1ZLZA 2WLIB 2UXBB 1D2DA 1FXKA 4BIOA 2CUGA 4LWSB 1XMQO 1JPXA 4DR5O 1L1FA 1IBLO 2QA4V 5C93A 1MG1A 1AJPA 1AP6A 3SPGA 1RM1B 4TV8A 3H1JH 4O4JB 1TA8A 3CE2A 3RGBA 3SJBC 2UUAO 3M99B 1K92A 1XHZA 3ZMSA 4CS3A 1VF5B 4YIPA 2RMKB 5J2TB 3S3WA 1V9PA 2ZE7A 3FAVB 1CXZB 3VOUA 1N0NA 3BA8A 2Q6AA 5CA0A 4NTWA 1FS0G 3CCJV 4WBNA 1GN3A 3WFVA 1VF6A 2YIAA 3L72H 5B1BB 3A0HZ 3ZBHA 5LYJB 2Q4PA 4LCUC 4O2BB 4DV0B 2QKSA 1YHQV 1KB9F 3A2FA 3B77A 4LF7O 1SA0B 1FXKC 2ZDIA 1AB3A 1M56C 1AI6A 2PGGA 1S0VA 1AR1B 3OMNB 1XDCA 1XQ8A 3C3TA 2DOSA 2R72A 2CE4A 4CH3A 2WPDG 4Q6GA 3G67A 2F66C 1V55B 4QPJA 1XBLA 1DLBA 2OCHA 3VQXA 1AI5A 4JAUA 2UU9B 2HVKC 5JWPA 2AZ2A 2P6JA 2E76B 1IBMB 5B3SB 1PNLA 1OZ0A 1S77D 4DV1B 1W0JG 4IYHA 1MABG 1OCOB 4U3JA 2DJVA 4N21A 4JI2O 2Y0IA 2ITDC 3ABMB 2WLIA 1KECA 4K0KB 2WA4A 5CA3A 2YIDA 3OMAB 4LWSA 4QJFB 4DV5O 3ML0A 1TGOA 4EEQA 5KHKA 4I50A 2QTSA 4CH5A 4DV2B 3SYCA 1MNGA 3E2EA 4H0LB 4O4JA 1RPOA 2F43G 3E86A 1F7YA 4H13B 1GK9A 3THOA 5J2TA 1QCEA 1TUBB 2IBZH 4LP8A 2XAHA 4WFEA 2E75B 3FYEB 3FAVA 3PJSK 4A5UB 4X8AA 3AG4C 4CH6A 5KHIA 1I5YA 1GM7A 3T1HB 3FKSG 3ETEA 1QNMA 3A0BZ 4TWKA 3AG2C 2OYQA 2XUMA 3JARB 5IJ9B 5GTIZ 3N27A 4UCRA 2EILC 4EKWA 2JDIG 4OPAA 2XAQA 4JI5O 2MK3A 1SQVH 4O2BA 5HFLA 1N4CA 2W6IG 4PA6A 4JASA 3JYCA 4JZGA 2E5LO 2QM4A 1Q6IA 1VQ4V 4YY3B 5JJEB 3DC6A 1RM1C 1SS3A 4LF6B 2YXHA 2UXCB 4LNUA 1YTFD 4I9QA 1NI8A 1BCCH 5H6RA 1IVSA 1HNZB 4O4LB 1WB8A 2BOCC 1H8HG 1KP3A 1YVWA 3D36A 1SKVA 2R9RB 1DGSA 2Q73A 2CTPA 3F7VC 4B3MO 5AG2A 3OW2U 4DUYB 1JJ2U 2DYRC 3NR7A 3EVKA 3I5DA 2DYSB 4KHPB 3K08A 3BPZA 4ZI7B 1DF4A 1AJNA 4FLZA 1GM8A 1EZJA 3TXSA 2X6BA 1XOUA 3ZMZA 1I94O 1FJGB 2B5UA 2WLLB 3HB3B 3CEIA 3RYCA 1QLNA 4P2ZA 2XAFA 2ZR3A 2YXLA 1N34O 1EN5A 1TUBA 1HNXB 3ZJZA 2K1EA 1V55C 3G71V 4BIZA 4JYAB 1R6KA 5CN0A 3H9VA 3T1YO 1H2LA 1P7GA 2P4KA 2A7WA 1XEQA 3CX5F 1Y67A 5B3SC 5KHGA 4JV5B 3JD2A 5IWAB 3K9SA 3P3NA 3IC7A 1COWG 1SZXA 5KAIZ 3DSQA 5IJ9A 4DRXB 1OCOC 2NNUA 3UO3A 3RT3C 1JJOA 1KC8W 2RCVA 3D36C 3OGIB 2A0LA 4DR7B 1OCRB 3C3SA 4EFBA 4K8ZA 4JI8O 1HW7A 2V7QG 1OCCB 5LMNO 1HR0B 3R66A 3J7AU 3AG3C 3GWOA 1ZTEA 4AI8A 2CTRA 1G1XB 2VQEO 1K4DC 4WCEV 1N33B 2UUCB 3QO8A 2QE7G 4MTGA 5H9CA 4CS2A 1NTKH 4LBEC 1SETA 1PNMA 2YICA 5EC1C 3K5OA 3K04A 4FM0A 1K4CC 3FB7C 1NTMH 1K7DA 1NU1H 2A06H 5HFMA 5LA6B 2QWQB 1SESA 2HLDG 4LR3A 1N32O 5CBGA 1YDXA 4GT1A 1H8EG 5D5QA 3CYOA 4G28B 4JI0O 1S5HC 4RUEA 3K5MA 3STZC 1XNRB 1BMFG 1QR9A 3E83A 4U7NA 1W59A 4YIOA 2PTMA 4WFBV 3L73H 3JATB 5GONB 3ABKB 2WLLA 3AK1A 2HJFC 3UO2A 2EIJB 3HKDA 4NXNO 1KKCA 1I08A 2PYLA 2GHYA 5LXTA 4DV6O 5LL6Y 2W0XA 5ITZB 2QWOB 2VQFO 1FXVA 4K35A 1VQ5V 1BSMA 4RQEA 2Y4UA 2PY5A 4ABMA 4UCOA 4DRXA 3IAYA 1NVPD 3RFRA 1I0HA 2EZPA 4JI1O 4X66B 4QGPA 3FB5C 5KUMA 1DF5A 2DQ0A 2DYSC 2CDYA 3CRRA 1ZWIC 4PI0A 1J5EO 1WP7A 1Y76B 3OM3B 3EXAA 4FLVA 2GDSA 3UCSC 4ZOLA 4P30A 4MVZA 3MHSC 3LUTB 2Y48A 2JVDA 4I55B 4PA9A 4R6ZA 1JMKC 3JALB 5LOVA 1B06A 4YXWG 3ZRVA 5JCOA 3D3QA 2FTKA 4PD4F 3ZRWB 4CC5A 5BR8B 4CS4A 2DN9A 4L87A 4ZBMA 4W4LA 4JTCB 3ZX6A 4LFBB 1VARA 1Q82W 1E1QG 1QHTA 5FPRA 4LF9B 1IZ3A 3ZN0A 4FLWA 2NR5A 3Q4HA 1G6UA 1PPJH 4B3SO 1P4RA 2UXXA 1OCZC 1E79G 3LNNA 3OGCC 3CRAA 1OCRC 2BE3A 4J7JA 5H5NA 1GAXA 3WB1A 3JATA 3O65A 3LNMB 4L8JA 3H1IH 2QM7A 3H1HH 4HAMA 1BS3A 2Q0AA 1O9GA 2F4VO 4UVCA 1JOYA 2DQ3A 2GV9A 4JAAA 5ITZA 4UV8A 1JR9A 2HEPA 2MW2B 1KU9A 4DR5B 1IBLB 2LQTA 2CGNA 4HZ3A 3ZMTA 1R6NA 2DW4A 5JCOC 5KHHA 3GVMA 1SZTA 2P06A 1YXBA 2ZE5A 2UUAB 3CS5A 3EFFK 1AP5A 4RWUA 1Q5OA 2ZINA 3JSNA 1AI4A 1O9HA 3R65A 3SR2C 1Q90D 1SQPH 2ADPA 3H1LH 3OFNG 1E1RG 4WFFA 4LFCO 3MAQA 1UPGA 4TV9A 1CP9A 3ICXA 1AILA 1S5LZ 2EULA 4BW5A 3SPCA 4GKJO 2UXDO 4BW9A 1Y74B 1F4NA 3CXHF 3AG4B 3JD1A 5KA6A 1QVFU 4ASUG 1VQ6V 4I55A 4NXMO 3GB7C 3ABKC 5IYCO 1BT8A 3SYQA 3DGEA 3WB2A 3OUSA 2B9ZA 3L75H 3OAAG 3AG2B 3U0ZA 4LF7B 3QVNA 1M90W 5JJNB 3ZRWA 2JJ1G
chains in the Genus database with same CATH topology
1VMGA 2P06A 2OIEA 1YXBA 2A3QA 2A7WA 4QGPA 5IE9A 1Y6XA 2Q4PA 2Q9LA 3C90A 1YVWA 2Q5ZA 3CRAA 2GTAA 2Q73A 2OIGA 2YXHA 3CRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VMG A;  2P06 A;  2OIE A;  1YXB A;  2A3Q A;  2A7W A;  4QGP A;  5IE9 A;  1Y6X A;  2Q4P A;  2Q9L A;  3C90 A;  1YVW A;  2Q5Z A;  3CRA A;  2GTA A;  2Q73 A;  2OIG A;  2YXH A;  3CRC A; 
#chains in the Genus database with same CATH topology
 2EIL B;  1NVP B;  1WB7 A;  4I7Z B;  1Q7Y W;  3FFQ A;  1AI7 A;  2W6J G;  3UT5 B;  5BMV B;  2OTL V;  2YI8 A;  2DE0 X;  5KA5 A;  4JI4 O;  4AQY O;  4TUY A;  2HVJ C;  2OCC C;  2N05 A;  4X64 B;  4PA4 A;  5L3D A;  1YJN V;  2AXT Z;  3FYI B;  3KKY A;  1EZV H;  4EFE A;  3CCU V;  1XI1 A;  4LFA O;  4JI2 B;  2ZE8 A;  4DR2 O;  2ZT9 B;  1P49 A;  3C90 A;  5CBF A;  5BXZ A;  1T5E A;  1WNS A;  4DV5 B;  4JI3 B;  2LGW A;  4PA3 A;  4XDK A;  1VQN V;  3ZED A;  3JAW A;  1US6 A;  3RYI B;  3JCU Z;  1F51 A;  3S3X A;  2BSK B;  2ITC C;  4UCV A;  1YSC A;  2DYR B;  1QU7 A;  5JQG B;  1MZF A;  4J10 A;  4RUF A;  1R3J C;  3K5N A;  4PI2 A;  1YEW A;  4DR1 B;  4N23 A;  3LSU A;  2UUB O;  1JFF B;  1Z5W A;  2KG7 B;  1KQS U;  4ZIB A;  5EC2 C;  4BIU A;  2HHH O;  1WLE A;  4ZHQ A;  3ZHS A;  1K97 A;  3VBB A;  5EIB D;  1MOF A;  5L3B A;  1QLE C;  3ZHU A;  3HR0 A;  1XNQ O;  3FX7 A;  2XOK G;  3LSQ A;  3F5W C;  1N36 O;  3E8G A;  3CCR V;  2OIE A;  1NZ6 A;  2F1M A;  2E5L B;  3K0G A;  4JYC A;  4I9W A;  2CH7 A;  2X7R B;  2JS5 A;  3JD0 A;  1PD3 A;  1TVK B;  3UKM A;  3UT5 A;  5BMV A;  4I5S A;  4NTY A;  5A2Q N;  4MSW C;  2ZIM A;  5B1N A;  3AG3 B;  4YHH O;  2H8P C;  4C7U A;  1GTO A;  4WFG A;  2ETN A;  3APO A;  2ADQ B;  4DV3 O;  2JK5 C;  4ZKI A;  5E79 Z;  1FPO A;  5K1P A;  2XAS A;  3RW0 A;  3OR6 C;  2Q8V A;  1LUV A;  2L6L A;  4X62 O;  3E35 A;  3ETD A;  3RYI A;  1LNQ A;  3IC9 A;  1GMG A;  2BSK A;  2CTQ A;  3LDC A;  5JQG A;  4DV0 O;  1I94 B;  5E1A C;  1WPX A;  5J2U B;  4MVO A;  4E4E A;  1HWY A;  5LYJ A;  2FYU H;  2HG5 C;  3HKE B;  3E8F A;  4XDJ A;  1N34 B;  5IJ0 B;  1SA0 A;  4FM2 A;  1JFF A;  2KG7 A;  2ODM A;  3T1Y B;  1R6T A;  1TAE A;  4PV1 B;  2QKC A;  3CWB H;  2CGO A;  2UU9 O;  1NT2 B;  4EB6 B;  2OTJ V;  2ZCE A;  3AG1 B;  3OTO O;  1IBM O;  4B7E A;  1PKX A;  2Y69 C;  2JGU A;  3PN1 A;  4IL6 Z;  4RAI A;  1NQT A;  3BRC A;  3HKB B;  4GZR B;  1CEZ A;  3JCZ A;  4JI8 B;  1HNW O;  4R8C A;  1QBZ A;  2EIK C;  3ZN1 A;  5LMN B;  3NXS A;  4PDL A;  3QTC A;  4QE7 A;  4TQF A;  5D5P A;  1NJI W;  2VS0 A;  2PF4 E;  4LF4 B;  3X2Q B;  1TVK A;  1G8M A;  4UVA A;  1KMI Z;  4DK0 A;  1MSW D;  3B8N A;  4BR6 A;  2IH1 C;  1TUE B;  3DXR B;  1XL6 A;  3QO5 A;  3CRQ A;  2WSS G;  3RYF B;  1DTO A;  1IXM A;  3UM7 A;  2QGN A;  1PL4 A;  2A9H A;  2RN9 A;  3ETQ A;  2YIB A;  3WB0 A;  4DR3 O;  4DR6 O;  3QG5 A;  1K73 W;  1YIJ V;  2ATK C;  4P9P A;  3TK1 A;  2NN4 A;  2EBO A;  5B5E Z;  2HP8 A;  4FLX A;  3SYP A;  4ICG A;  5KMG B;  3CB2 A;  4R50 A;  1SQG A;  4LC1 A;  1N32 B;  4DV4 O;  4MVR A;  5BY1 A;  1P7B A;  2QKA A;  3CSX A;  1URF A;  4JI0 B;  3OT7 A;  1PL0 A;  1F4M A;  3ZHQ A;  2Q9L A;  2GUZ B;  2JIZ G;  4DUZ B;  1JCH A;  3ABL B;  3JAR A;  2GSM B;  2ZQM A;  1RSO B;  5IYZ B;  1Q81 W;  2IJK A;  5J2U A;  5KHJ A;  3LSS A;  3N2G B;  3HKE A;  4DK1 A;  4NXN B;  1OCZ B;  4PHZ A;  3CCS V;  2QWR B;  5IJ0 A;  4DV6 B;  5EK0 A;  4DW0 A;  5EZY B;  2VQF B;  3BY6 A;  1LR1 A;  4X65 B;  1MSD A;  1SQF A;  4J41 A;  1NH2 D;  1SRY A;  4EB6 A;  4MVU A;  2CAZ C;  2QSA A;  1IBK O;  4DR4 B;  3HKC B;  1D5N A;  1R1B A;  2PI5 A;  2Q68 A;  5LMU O;  4JZ2 A;  4X1K B;  4UV9 A;  2H94 A;  3APQ A;  4JAV A;  1FFX B;  3HKB A;  2W0F C;  1WP8 A;  4O4L A;  3IFX A;  3CC4 V;  2IW5 A;  4OX9 O;  2EIN B;  3T1C A;  1J5E B;  4B08 A;  5JH7 B;  4FLU A;  5H2F Z;  1WA8 B;  3BVO A;  1VQ9 V;  3CCL V;  2CK3 G;  2IU0 A;  1FD9 A;  4CH4 A;  4ZI7 A;  1M9N A;  3RYF A;  1FJG O;  4HNA B;  4D6T H;  3DC5 A;  3ZIA G;  4F4L A;  4J42 A;  4FVM A;  3KCY A;  1UFI A;  5F2V O;  1R3K C;  3WU2 Z;  1S72 V;  4JYA O;  4NB5 A;  1XMO O;  4XBF A;  3N2K B;  4AHC A;  1YTF B;  3O9O A;  2QWN B;  4GYC B;  4I4T B;  4PDV A;  1JX9 A;  5KMG A;  1VQM V;  3AG1 C;  4GKK B;  4J7K A;  1KBH A;  1AVM A;  1WAZ A;  2KSD A;  3H01 A;  2PUS A;  4B3S B;  4K3A A;  2K9P A;  3JAS B;  3ZRS A;  2GUZ A;  3CJH B;  5L3F A;  1MMM A;  3CCE V;  1VIB A;  3CC2 V;  2QJ1 A;  3TJT A;  4DR7 O;  1H2S B;  1RSO A;  5IYZ A;  4AIL C;  1AR5 A;  3N2G A;  4Z1V A;  3MHH C;  2OCC B;  3X2Q C;  2F4V B;  1NR1 A;  2ZXW B;  3OEH G;  2N04 A;  1GO3 F;  2RNB A;  3BEH A;  4DV7 B;  1L0N H;  3IGA C;  2RDC A;  4TQD A;  1N33 O;  1THZ A;  3ZMV A;  2UUC O;  4P9O A;  1KD1 W;  4MW3 A;  5EYP B;  2D2C B;  5EIB C;  2YEV B;  3HKC A;  1OV9 A;  4WF9 V;  3K0D A;  2LGQ A;  1FFX A;  1ARO P;  1GH6 A;  4FJC C;  4LFC B;  3OD4 A;  4IHJ B;  3WG7 B;  1EN4 A;  4QPK A;  2VRZ A;  1B04 A;  3L71 H;  4LH7 A;  4BWA A;  5JH7 A;  4NTX A;  1WPB A;  1WA8 A;  4K8X A;  3ABL C;  1BGY H;  5LA6 A;  2Q69 A;  1EM1 A;  3BA9 A;  2HFE C;  4JI6 O;  1ZUQ A;  5LHG A;  1XNR O;  3SDL A;  4NXM B;  3SJA C;  2Q67 A;  3CCM V;  1NS1 A;  4GLX A;  2IU3 A;  1NH2 B;  4HNA A;  5LHH A;  2XND G;  4PEL A;  2ZM6 B;  3GWK C;  1H2M A;  1VQL V;  3B09 A;  3FB6 C;  2YUA A;  1SQQ H;  5GON A;  1QLE B;  2IH3 C;  3B4S A;  3G6E V;  1YCI A;  4JGS A;  2KQX A;  3H1K H;  2F95 B;  4KXR A;  4B3T O;  1XMQ B;  2IJJ A;  3L74 H;  2P5O A;  2PZS A;  4W4K A;  4AQY B;  5EBW C;  1FFT B;  1W2B U;  2HR3 A;  4DO2 A;  2X6C A;  3ASO C;  3CJH A;  2ZKO A;  2WLH A;  2BOB C;  4GX5 A;  3RYH B;  2EIN C;  4DR2 B;  4D7S A;  1Q3E A;  2YC0 A;  4Z2W A;  2E74 B;  2AHY A;  1J95 A;  2DWD C;  1QVG U;  3P32 A;  1DK1 A;  3LDD A;  2P90 A;  4MVQ A;  2FL4 A;  5EBM C;  3JD3 A;  2D3O W;  2ZNI A;  3L70 H;  4IIJ B;  1XHX A;  4OXS A;  5IY5 B;  2VWJ A;  1Y76 A;  4H33 A;  3ZHR A;  1ZSP A;  4FIP C;  5JVD B;  3OUF A;  3K59 A;  3ETG A;  5EYP A;  4B3R O;  1Z2G A;  2YEV A;  3ASN B;  3M7M X;  1Q6U A;  4LF8 O;  3VQW A;  5LGU A;  3JAL A;  1GKF A;  2X6A A;  3ZMU A;  5BR8 O;  4J7Z A;  2FML A;  4CC6 A;  2UUB B;  1CPY A;  4LFB O;  4IHJ A;  1VEW A;  2V4D A;  2HHH B;  3W7W A;  2H3O A;  4UB8 Z;  1BHA A;  2ZIO A;  3M8A A;  3RWR D;  4X1I B;  5K1X A;  5CB4 B;  2P4V A;  5LHI A;  1YJW V;  5A9G A;  3B8M A;  1M5I A;  3RVY A;  2XTA A;  4Q20 A;  2ZXW C;  4O4H B;  2WA3 A;  3G6B A;  3STL C;  1WN7 A;  2LP7 A;  2Y69 B;  2A3Q A;  2B1G A;  3U11 A;  2XHB A;  4I50 B;  1M4U A;  1VQP V;  3SPJ A;  1F23 A;  4JI7 O;  2Z5U A;  3CD6 V;  3TXQ A;  2EIK B;  1KP2 A;  3A8T A;  4QNH B;  1AR4 A;  4YHH B;  1GM9 A;  2HJD A;  4B7K A;  4FLY A;  1X4T A;  4FZ0 A;  1H2G A;  4I0X B;  1R73 A;  1U97 A;  4J9Y B;  3WG7 C;  3BAB A;  4LF5 O;  2OT5 A;  4TOI A;  1Y6X A;  3RYH A;  4WFA V;  4DV3 B;  3K3W A;  2LJ2 A;  1SER A;  1YZB A;  1V54 B;  2O57 A;  3LDE A;  4FFB B;  3HPL C;  2R70 A;  4IIJ A;  4U3F H;  4X62 B;  4IYI A;  4MTX A;  1Y74 A;  5JVD A;  5KLV H;  1VQ8 V;  1VQK V;  4O2A B;  2HKO A;  4X89 A;  3CPW U;  1N8R W;  4JI5 B;  3B2E E;  5TIS Z;  1ROP A;  2WAM A;  2Q7H A;  2QDO A;  2X0L A;  1U96 A;  4MVM A;  4UB6 Z;  2UXB O;  2OWO A;  3RBZ A;  4GCZ A;  4LH6 A;  5GW7 A;  2ARH A;  5KUK A;  3QF7 A;  4JTA B;  4XDL A;  3CC7 V;  4UCS A;  4LNU B;  3E22 B;  3OTO B;  4X1I A;  3AG7 A;  3U10 A;  4X64 O;  3OTF A;  5CB4 A;  1IUR A;  1GN6 A;  1M93 A;  2R9A A;  3ZRX A;  2Y4T A;  1PM9 A;  1JVM A;  4O4H A;  5JJJ B;  3P3P A;  1HNW B;  2QR4 A;  1X59 A;  4FFK A;  4MVS A;  1VF6 C;  5KX5 B;  2Q7E A;  1AJQ A;  3CRC A;  4JI3 O;  5IY5 C;  2EX3 A;  4B3M B;  2LFS A;  1S3J A;  3BFR A;  3BAA A;  4IGG A;  3ASN C;  3I56 V;  2ZDI C;  2EZO A;  2IJI A;  3IJ4 A;  2XAJ A;  4DYL A;  5LP6 B;  1KKD A;  3OE7 G;  4FLT A;  2JRI A;  2IJH A;  4I0X A;  3T2M A;  3RYC B;  4KUM A;  1BE3 H;  4DR3 B;  4DR6 B;  4NYK A;  4MTF A;  4DR1 O;  4HBN A;  1K9M W;  2ZNJ A;  4WFH A;  2GBO A;  5B1A C;  1SQB H;  5DED A;  4GUN A;  2CTW A;  3FD9 A;  2V1D A;  1NR7 A;  3W7X A;  3CCV V;  3JAK B;  4FFB A;  4DV4 B;  1PP9 H;  1Q6H A;  4G2K A;  3OR7 C;  1ZL8 B;  1L0L H;  3W7T A;  1H38 A;  5L3G A;  5IT9 N;  2EJR A;  3TET A;  4O2A A;  4U7O A;  3SYO A;  4FZ1 A;  1W0K G;  4DV1 O;  2QEX V;  5FLX N;  5FPO A;  4CZZ A;  4R7C A;  4RQF A;  5IE9 A;  4NKG B;  4K0K O;  1QR8 A;  3A0R A;  1IDS A;  4JF3 A;  2G38 A;  1D5A A;  5L3E A;  4X1Y B;  1Q43 A;  3E89 A;  3E22 A;  3F5T A;  3SJQ C;  2VQE B;  4DV2 O;  3AEI A;  3CRM A;  1IBK B;  1VF7 A;  2XT9 A;  5LMU B;  2EIM B;  2A79 B;  1NBM G;  1V54 C;  1FAF A;  3EHB B;  2NLJ C;  3CCQ V;  4JPR A;  5KX5 A;  4OX9 B;  1RP3 B;  5B1B C;  3ABT A;  3KG2 A;  3T1H O;  1YI2 V;  1SQX H;  5C8Y B;  2LFR A;  1GN2 A;  5CA1 B;  3CXC U;  5CBH A;  4DXW A;  4X9Q A;  4FM1 A;  5LP6 A;  1BZK A;  3SYA A;  3AK3 A;  1VQO V;  1XUQ A;  4KL1 A;  4MTO A;  3HKD B;  5LGT A;  5B1O A;  1I7F A;  3SJC C;  2Q7G A;  4UVB A;  2EJ7 A;  2Q0O C;  2IM9 A;  5LXT B;  3ZHT A;  3CMA V;  4HYO A;  4JTD B;  5GTH Z;  1XMO B;  2JS3 A;  4RO2 A;  4QE9 A;  1JQ0 A;  4PDR A;  1G4Y B;  5LGN A;  2F93 B;  4YY3 O;  3JAK A;  3SGI A;  4YJ2 B;  2AHZ A;  4NVP A;  4LF6 O;  1Z5V A;  1B6Q A;  4NR1 A;  1ZL8 A;  2LW1 A;  5CMU A;  1FXH A;  1N0J A;  3P30 A;  2UXC O;  4PDM A;  4UXN A;  4QIW F;  1NKD A;  3ABM C;  2ZD9 A;  4IT5 A;  5DM6 V;  2ZR2 A;  1HNZ O;  4D7T A;  5IYB O;  4JI1 B;  3ASO B;  4OGQ B;  1K3E A;  1K33 A;  4MT8 A;  1RFY A;  1XIL A;  3J81 N;  3UQ8 A;  4PA7 A;  4LF4 O;  3ZS8 C;  2B1I A;  4MW8 A;  2GTA A;  1P84 F;  4KP4 A;  4DUY O;  4ZOL B;  3TCU A;  4TT3 G;  4KHP O;  2XAG A;  5LP6 C;  2F23 A;  4X1Y A;  3K79 A;  5LOV B;  1M57 B;  2E3C A;  1L8D A;  1MZE A;  1R3I C;  4H44 B;  1RPR A;  3E8B A;  2KB1 A;  3CME V;  4JYB A;  1VP7 A;  3DXR A;  1ORQ C;  2FKX A;  3JD4 A;  1EFR G;  1YJ9 V;  4TSF G;  2N74 A;  2UXN A;  2WLK A;  1EN6 A;  1HNX O;  5B66 Z;  1ENV A;  4UCU A;  2WWW A;  1H2K A;  3Q4H B;  1Y66 A;  4FPP A;  1K8A W;  3G4S V;  2L35 A;  3ZHV A;  5C8Y A;  4JV5 O;  4GX1 A;  5IWA O;  1FYJ A;  4JI6 B;  4J11 A;  1HDJ A;  2JGD B;  4DUZ O;  4E2L A;  5CA1 A;  4J9Z B;  5DN6 G;  2Z3Y A;  2RJZ A;  3W7S A;  3BHP A;  3SPI A;  1EBO A;  1OJH A;  2BTQ B;  1BL8 A;  3K57 A;  4G27 B;  1SF9 A;  4X88 A;  3W7U A;  2JEU A;  2M7W A;  1ZX3 A;  4X65 O;  2M6Y A;  5IDJ A;  4PJ0 Z;  3K9A A;  1HR0 O;  2C2A A;  2ILM A;  1OHH G;  5EZY A;  2P7T C;  3ZCC A;  4KFM A;  4B3T B;  4Z1M G;  1YF2 A;  2QM8 A;  4YJ2 A;  1K5Q A;  1QQC A;  2DWE C;  2BTO A;  2YSU B;  2EIM C;  1PNK A;  1NTZ H;  1GN4 A;  4DR4 O;  2ZE6 A;  4YJ3 B;  2P22 C;  1Y4M A;  3K58 A;  1VMG A;  2DMX A;  4FK5 C;  5L3C A;  3KCX A;  4JYY A;  2YI9 A;  4X1K A;  1R3L C;  4TV9 B;  3ABU A;  1KUQ A;  5DEC A;  3K06 A;  3OMI B;  4F6R B;  3I55 V;  1FKA O;  3J80 N;  1KYO F;  1Q8I A;  1PV0 A;  1YIT V;  1K5S A;  4O4I B;  3DTU B;  4GKJ B;  2UXD B;  4X20 B;  3TGU H;  4FMT A;  4BAY A;  3OEE G;  5LBQ A;  2YS8 A;  4B3R B;  2LW7 A;  4LF8 B;  1BHB A;  3D8C A;  1S5J A;  2AGA A;  2Q5Z A;  4H37 A;  2OIG A;  1XL4 A;  4GX2 A;  1S76 D;  3SPH A;  3CHX A;  2PI4 A;  3MDS A;  3K03 A;  5H6Q A;  5FNV B;  2RQ6 A;  3JSL A;  3QNE A;  1ZAU A;  1FXK B;  2R9I A;  5EBL C;  1M56 B;  4GKK O;  2QTO A;  3N2K A;  4CBC A;  1WJZ A;  1XRE A;  2WLJ A;  2P67 A;  4I4T A;  3G80 A;  4TUY B;  2QWP B;  4GX0 A;  2JGD A;  1GRJ A;  4TV8 B;  4UUJ C;  4JI4 B;  1UJW B;  1OCC C;  3JAS A;  1H2N A;  3RN4 A;  2Z0A A;  5IYD O;  4J80 A;  2BTQ A;  3CP1 A;  2YXY A;  4X66 O;  1IXB A;  1M1K W;  4LFA B;  4F6E A;  2GTS A;  2PYJ A;  2LO1 A;  1VQ7 V;  2VWK A;  4DV7 O;  2KKW A;  5CA0 B;  2JEX A;  3JAW B;  1M57 C;  1Q86 W;  4JI7 B;  5FL7 G;  3FB8 C;  3VQV A;  4WBN B;  2FB5 A;  3JAM N;  4UCT A;  3T4D A;  4YJ3 A;  4UFZ A;  1BQZ A;  3KZI Z;  4DW1 A;  4LF5 B;  1IX9 A;  1K34 A;  2JJ2 G;  3F7Y C;  2YDE A;  2WLM A;  3AK2 A;  3T4Z A;  1HP8 A;  3VQY A;  2AZ0 A;  4ZHQ B;  4F6R A;  2Y0P A;  3E8H A;  2YIB D;  4LF9 O;  1I5X A;  5B1A B;  4O4I A;  4X20 A;  5J9P C;  3D3I A;  3B40 A;  2EIJ C;  4MS2 A;  3L9D A;  3MD0 A;  3RVZ A;  2ZM6 O;  1BQ0 A;  4OPH A;  2AW9 A;  5BZB A;  1XNQ B;  1A32 A;  1B3Q A;  1MA1 A;  3QO7 A;  3BCC H;  5KAF Z;  4U3J B;  3K5L A;  2WLN A;  1N36 B;  1SC5 B;  1LUW A;  5FNV A;  2BCC H;  1JA8 A;  2CH7 B;  1ZLZ A;  2WLI B;  2UXB B;  1D2D A;  1FXK A;  4BIO A;  2CUG A;  4LWS B;  1XMQ O;  1JPX A;  4DR5 O;  1L1F A;  1IBL O;  2QA4 V;  5C93 A;  1MG1 A;  1AJP A;  1AP6 A;  3SPG A;  1RM1 B;  4TV8 A;  3H1J H;  4O4J B;  1TA8 A;  3CE2 A;  3RGB A;  3SJB C;  2UUA O;  3M99 B;  1K92 A;  1XHZ A;  3ZMS A;  4CS3 A;  1VF5 B;  4YIP A;  2RMK B;  5J2T B;  3S3W A;  1V9P A;  2ZE7 A;  3FAV B;  1CXZ B;  3VOU A;  1N0N A;  3BA8 A;  2Q6A A;  5CA0 A;  4NTW A;  1FS0 G;  3CCJ V;  4WBN A;  1GN3 A;  3WFV A;  1VF6 A;  2YIA A;  3L72 H;  5B1B B;  3A0H Z;  3ZBH A;  5LYJ B;  2Q4P A;  4LCU C;  4O2B B;  4DV0 B;  2QKS A;  1YHQ V;  1KB9 F;  3A2F A;  3B77 A;  4LF7 O;  1SA0 B;  1FXK C;  2ZDI A;  1AB3 A;  1M56 C;  1AI6 A;  2PGG A;  1S0V A;  1AR1 B;  3OMN B;  1XDC A;  1XQ8 A;  3C3T A;  2DOS A;  2R72 A;  2CE4 A;  4CH3 A;  2WPD G;  4Q6G A;  3G67 A;  2F66 C;  1V55 B;  4QPJ A;  1XBL A;  1DLB A;  2OCH A;  3VQX A;  1AI5 A;  4JAU A;  2UU9 B;  2HVK C;  5JWP A;  2AZ2 A;  2P6J A;  2E76 B;  1IBM B;  5B3S B;  1PNL A;  1OZ0 A;  1S77 D;  4DV1 B;  1W0J G;  4IYH A;  1MAB G;  1OCO B;  4U3J A;  2DJV A;  4N21 A;  4JI2 O;  2Y0I A;  2ITD C;  3ABM B;  2WLI A;  1KEC A;  4K0K B;  2WA4 A;  5CA3 A;  2YID A;  3OMA B;  4LWS A;  4QJF B;  4DV5 O;  3ML0 A;  1TGO A;  4EEQ A;  5KHK A;  4I50 A;  2QTS A;  4CH5 A;  4DV2 B;  3SYC A;  1MNG A;  3E2E A;  4H0L B;  4O4J A;  1RPO A;  2F43 G;  3E86 A;  1F7Y A;  4H13 B;  1GK9 A;  3THO A;  5J2T A;  1QCE A;  1TUB B;  2IBZ H;  4LP8 A;  2XAH A;  4WFE A;  2E75 B;  3FYE B;  3FAV A;  3PJS K;  4A5U B;  4X8A A;  3AG4 C;  4CH6 A;  5KHI A;  1I5Y A;  1GM7 A;  3T1H B;  3FKS G;  3ETE A;  1QNM A;  3A0B Z;  4TWK A;  3AG2 C;  2OYQ A;  2XUM A;  3JAR B;  5IJ9 B;  5GTI Z;  3N27 A;  4UCR A;  2EIL C;  4EKW A;  2JDI G;  4OPA A;  2XAQ A;  4JI5 O;  2MK3 A;  1SQV H;  4O2B A;  5HFL A;  1N4C A;  2W6I G;  4PA6 A;  4JAS A;  3JYC A;  4JZG A;  2E5L O;  2QM4 A;  1Q6I A;  1VQ4 V;  4YY3 B;  5JJE B;  3DC6 A;  1RM1 C;  1SS3 A;  4LF6 B;  2YXH A;  2UXC B;  4LNU A;  1YTF D;  4I9Q A;  1NI8 A;  1BCC H;  5H6R A;  1IVS A;  1HNZ B;  4O4L B;  1WB8 A;  2BOC C;  1H8H G;  1KP3 A;  1YVW A;  3D36 A;  1SKV A;  2R9R B;  1DGS A;  2Q73 A;  2CTP A;  3F7V C;  4B3M O;  5AG2 A;  3OW2 U;  4DUY B;  1JJ2 U;  2DYR C;  3NR7 A;  3EVK A;  3I5D A;  2DYS B;  4KHP B;  3K08 A;  3BPZ A;  4ZI7 B;  1DF4 A;  1AJN A;  4FLZ A;  1GM8 A;  1EZJ A;  3TXS A;  2X6B A;  1XOU A;  3ZMZ A;  1I94 O;  1FJG B;  2B5U A;  2WLL B;  3HB3 B;  3CEI A;  3RYC A;  1QLN A;  4P2Z A;  2XAF A;  2ZR3 A;  2YXL A;  1N34 O;  1EN5 A;  1TUB A;  1HNX B;  3ZJZ A;  2K1E A;  1V55 C;  3G71 V;  4BIZ A;  4JYA B;  1R6K A;  5CN0 A;  3H9V A;  3T1Y O;  1H2L A;  1P7G A;  2P4K A;  2A7W A;  1XEQ A;  3CX5 F;  1Y67 A;  5B3S C;  5KHG A;  4JV5 B;  3JD2 A;  5IWA B;  3K9S A;  3P3N A;  3IC7 A;  1COW G;  1SZX A;  5KAI Z;  3DSQ A;  5IJ9 A;  4DRX B;  1OCO C;  2NNU A;  3UO3 A;  3RT3 C;  1JJO A;  1KC8 W;  2RCV A;  3D36 C;  3OGI B;  2A0L A;  4DR7 B;  1OCR B;  3C3S A;  4EFB A;  4K8Z A;  4JI8 O;  1HW7 A;  2V7Q G;  1OCC B;  5LMN O;  1HR0 B;  3R66 A;  3J7A U;  3AG3 C;  3GWO A;  1ZTE A;  4AI8 A;  2CTR A;  1G1X B;  2VQE O;  1K4D C;  4WCE V;  1N33 B;  2UUC B;  3QO8 A;  2QE7 G;  4MTG A;  5H9C A;  4CS2 A;  1NTK H;  4LBE C;  1SET A;  1PNM A;  2YIC A;  5EC1 C;  3K5O A;  3K04 A;  4FM0 A;  1K4C C;  3FB7 C;  1NTM H;  1K7D A;  1NU1 H;  2A06 H;  5HFM A;  5LA6 B;  2QWQ B;  1SES A;  2HLD G;  4LR3 A;  1N32 O;  5CBG A;  1YDX A;  4GT1 A;  1H8E G;  5D5Q A;  3CYO A;  4G28 B;  4JI0 O;  1S5H C;  4RUE A;  3K5M A;  3STZ C;  1XNR B;  1BMF G;  1QR9 A;  3E83 A;  4U7N A;  1W59 A;  4YIO A;  2PTM A;  4WFB V;  3L73 H;  3JAT B;  5GON B;  3ABK B;  2WLL A;  3AK1 A;  2HJF C;  3UO2 A;  2EIJ B;  3HKD A;  4NXN O;  1KKC A;  1I08 A;  2PYL A;  2GHY A;  5LXT A;  4DV6 O;  5LL6 Y;  2W0X A;  5ITZ B;  2QWO B;  2VQF O;  1FXV A;  4K35 A;  1VQ5 V;  1BSM A;  4RQE A;  2Y4U A;  2PY5 A;  4ABM A;  4UCO A;  4DRX A;  3IAY A;  1NVP D;  3RFR A;  1I0H A;  2EZP A;  4JI1 O;  4X66 B;  4QGP A;  3FB5 C;  5KUM A;  1DF5 A;  2DQ0 A;  2DYS C;  2CDY A;  3CRR A;  1ZWI C;  4PI0 A;  1J5E O;  1WP7 A;  1Y76 B;  3OM3 B;  3EXA A;  4FLV A;  2GDS A;  3UCS C;  4ZOL A;  4P30 A;  4MVZ A;  3MHS C;  3LUT B;  2Y48 A;  2JVD A;  4I55 B;  4PA9 A;  4R6Z A;  1JMK C;  3JAL B;  5LOV A;  1B06 A;  4YXW G;  3ZRV A;  5JCO A;  3D3Q A;  2FTK A;  4PD4 F;  3ZRW B;  4CC5 A;  5BR8 B;  4CS4 A;  2DN9 A;  4L87 A;  4ZBM A;  4W4L A;  4JTC B;  3ZX6 A;  4LFB B;  1VAR A;  1Q82 W;  1E1Q G;  1QHT A;  5FPR A;  4LF9 B;  1IZ3 A;  3ZN0 A;  4FLW A;  2NR5 A;  3Q4H A;  1G6U A;  1PPJ H;  4B3S O;  1P4R A;  2UXX A;  1OCZ C;  1E79 G;  3LNN A;  3OGC C;  3CRA A;  1OCR C;  2BE3 A;  4J7J A;  5H5N A;  1GAX A;  3WB1 A;  3JAT A;  3O65 A;  3LNM B;  4L8J A;  3H1I H;  2QM7 A;  3H1H H;  4HAM A;  1BS3 A;  2Q0A A;  1O9G A;  2F4V O;  4UVC A;  1JOY A;  2DQ3 A;  2GV9 A;  4JAA A;  5ITZ A;  4UV8 A;  1JR9 A;  2HEP A;  2MW2 B;  1KU9 A;  4DR5 B;  1IBL B;  2LQT A;  2CGN A;  4HZ3 A;  3ZMT A;  1R6N A;  2DW4 A;  5JCO C;  5KHH A;  3GVM A;  1SZT A;  2P06 A;  1YXB A;  2ZE5 A;  2UUA B;  3CS5 A;  3EFF K;  1AP5 A;  4RWU A;  1Q5O A;  2ZIN A;  3JSN A;  1AI4 A;  1O9H A;  3R65 A;  3SR2 C;  1Q90 D;  1SQP H;  2ADP A;  3H1L H;  3OFN G;  1E1R G;  4WFF A;  4LFC O;  3MAQ A;  1UPG A;  4TV9 A;  1CP9 A;  3ICX A;  1AIL A;  1S5L Z;  2EUL A;  4BW5 A;  3SPC A;  4GKJ O;  2UXD O;  4BW9 A;  1Y74 B;  1F4N A;  3CXH F;  3AG4 B;  3JD1 A;  5KA6 A;  1QVF U;  4ASU G;  1VQ6 V;  4I55 A;  4NXM O;  3GB7 C;  3ABK C;  5IYC O;  1BT8 A;  3SYQ A;  3DGE A;  3WB2 A;  3OUS A;  2B9Z A;  3L75 H;  3OAA G;  3AG2 B;  3U0Z A;  4LF7 B;  3QVN A;  1M90 W;  5JJN B;  3ZRW A;  2JJ1 G; 
#chains in the Genus database with same CATH homology
 1VMG A;  2P06 A;  2OIE A;  1YXB A;  2A3Q A;  2A7W A;  4QGP A;  5IE9 A;  1Y6X A;  2Q4P A;  2Q9L A;  3C90 A;  1YVW A;  2Q5Z A;  3CRA A;  2GTA A;  2Q73 A;  2OIG A;  2YXH A;  3CRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...