5BZBA

Navms voltage-gated sodium channel pore and c-terminal domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
total genus 34
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5bzbA00
3E86A 2A79B 1K4CC 4P9PA 5EC1C 1R3LC 2JK5C 4XDLA 4PA3A 3AG1C 3JYCA 3TETA 1M56C 4RAIA 3EFFK 4X88A 4JTCB 3K03A 2EILC 2DWEC 4MVZA 3R65A 2R9RB 4LCUC 3E8HA 3T4DA 4MVMA 1JVMA 3SPJA 4MVSA 4HZ3A 4JTDB 3K04A 4P30A 4LP8A 1J95A 2ITCC 5J9PC 4RO2A 4KFMA 4BW5A 2WLLB 4PA6A 3TCUA 2H8PC 3OR6C 3ABLC 2Q69A 2DYSC 4MTFA 3ASNC 1QLEC 1M57C 4R7CA 3OGCC 2HVJC 2Q6AA 3K08A 3GB7C 2EIJC 4G28B 3ABMC 5EC2C 3ABKC 3OUSA 4R6ZA 3K0GA 3E8FA 2ITDC 2KB1A 1V55C 3FB7C 3F7VC 4QE7A 2BOBC 2YEVA 2X6BA 3K0DA 4X8AA 3K06A 3SYAA 3AG4C 1KKDA 5B1BC 4R8CA 3X2QC 3BEHA 4J9YB 1BL8A 3LDDA 4XDJA 2EINC 5EBLC 3OUFA 4MW8A 3FB8C 3FB6C 4MTGA 4MSWC 2X6CA 1OCZC 4MVQA 2WLKA 4WFGA 1S5HC 4MVUA 2WLIA 3SPIA 3AG3C 4PA9A 1P7BA 5EK0A 4G27B 2WLMA 2AHZA 2ZD9A 3T4ZA 3E8BA 2WLHA 1V54C 1XL4A 4I9WA 2Q68A 4HYOA 4MTOA 2ZXWC 4J9ZB 1G4YB 3F7YC 3E89A 4GX2A 4GX0A 4RUFA 4DXWA 3SPCA 1OCOC 3OR7C 2QTOA 3SYCA 2K1EA 4P9OA 1R3KC 4R50A 4MVRA 2A0LA 3E83A 3LNMB 2W0FC 4GX5A 4PDLA 4OXSA 3PJSK 3STZC 3AG2C 1OCCC 5BZBA 4RUEA 4TWKA 5KUMA 4JTAB 4MVOA 4WFHA 3LDCA 3LUTB 4PA4A 2EIKC 2HG5C 4PDVA 5EBMC 4H37A 4PDRA 4P2ZA 3T1CA 3E8GA 3ASOC 2EIMC 3ZJZA 4LBEC 2P7TC 2OCCC 2NLJC 5B3SC 3ZRSA 4MS2A 3UM7A 3RVZA 4GX1A 2AHYA 2HVKC 4XDKA 3SYPA 2BOCC 4UUJC 4MW3A 4WFFA 2WLJA 5CBGA 2WLIB 3SYQA 2Y69C 4X89A 3SJQC 3F5WC 3SPGA 5KUKA 3RW0A 1OCRC 4EKWA 3IFXA 1ORQC 5E1AC 3SPHA 3VOUA 2DYRC 1XL6A 2A9HA 2IH3C 3RBZA 3WG7C 2QKSA 2WLLA 4WFEA 2ATKC 1R3IC 2IH1C 3T2MA 4CBCA 3KG2A 3STLC 5CBHA 1K4DC 2HFEC 1LNQA 4PDMA 2DWDC 2X6AA 3UKMA 1ZWIC 3FB5C 2Q67A 4H33A 3RVYA 5IY5C 5EBWC 3HPLC 2WLNA 4PA7A 4F4LA 2HJFC 4ZBMA 5B1AC 3IGAC 3SYOA 5CBFA 3LDEA 4QE9A 4QNHB 1R3JC
chains in the Genus database with same CATH superfamily
4AQYO 2A79B 2QDOA 4X1KB 3K9AA 3JYCA 5JVDA 4O4LA 3RYCB 2DMXA 4X62O 3RYIB 1P49A 4LCUC 2CH7B 1JVMA 1TGOA 1JFFA 5J9PC 1VF6A 1FXHA 1NQTA 3I55V 4U7OA 3L70H 3CMAV 2CTRA 2HVJC 2RJZA 1A32A 3M7MX 3B4SA 2PTMA 4HAMA 3K5MA 4O4HB 4K3AA 4R8CA 1VQ7V 2NNUA 5KX5A 3LSSA 4YIPA 1M9NA 2X6CA 3ZHVA 2O57A 1JX9A 4B3SO 4MVUA 5TISZ 4DW0A 1QVGU 2F43G 5GTIZ 4IL6Z 3E8BA 3CSXA 1MMMA 1XL4A 1GM8A 1VQOV 1SZTA 1YIJV 4MTXA 1M4UA 3CS5A 4MVRA 3E83A 1Q8IA 1MSDA 4H13B 1ZSPA 5IY5B 4KXRA 1K7DA 1N34B 4WFHA 5EBMC 4P2ZA 4X1KA 2GTAA 2VQEB 4FLUA 3ZRVA 2LJ2A 1F4NA 4GX1A 4GKJB 3RYIA 2RMKB 2P06A 2CH7A 3U10A 1K9MW 1OCRC 3SPHA 4WBNA 3RBZA 5EZYA 2EBOA 3WG7C 4CC6A 2IH1C 3STLC 2XAQA 3UKMA 1SQFA 2D2CB 4WCEV 3UO3A 2AGAA 3G80A 3ZIAG 1I08A 3BCCH 3E86A 2ZE7A 1JMKC 4ZI7B 4TOIA 3QTCA 4DV4O 3QO7A 1HR0O 2GUZA 4MVMA 4UCOA 2OIEA 1Y66A 2UUCB 4NXMB 3CMEV 3BAAA 2EZPA 3M99B 3W7SA 2WWWA 2PYLA 2HR3A 3OGCC 3GB7C 4WF9V 4I50A 4J7KA 2CUGA 1L0LH 4JI4B 4B3RO 3F7VC 2FKXA 1AB3A 4QIWF 3ZX6A 2ZM6O 3FX7A 1EBOA 4JI6B 3OTFA 1K8AW 2P67A 1S5HC 4JI5O 4DV6O 2WLHA 1VP7A 4J9ZB 4DR5B 4IIJA 2G38A 2Q73A 3T1YB 3D3QA 4Q6GA 2DOSA 4QJFB 4TWKA 4JI1O 4G2KA 5EIBD 1DF4A 2YI8A 3KZIZ 3L9DA 2OYQA 1TAEA 5JJEB 4NTXA 2Q4PA 1SF9A 1FS0G 4ZI7A 4MW3A 3SYQA 3C90A 3CXHF 3A0RA 4X89A 2ZE8A 1YJ9V 5J2UA 3N2GA 1ZAUA 4BWAA 3H1HH 4JI0O 3OW2U 1NTZH 2DYSB 2UXBO 1H2GA 1QCEA 5CBFA 3HR0A 1YJWV 2OT5A 2UXDO 4B08A 3LNNA 4PA3A 2JDIG 4GT1A 4RAIA 4X88A 1IXBA 1XILA 2LFSA 1G6UA 2WPDG 3KCXA 4MVZA 5CA3A 1YEWA 3E8HA 3HKEB 2IU0A 1F7YA 1F4MA 2RDCA 4QGPA 4PA6A 2ZR3A 3OR6C 1RFYA 1WP8A 2MK3A 5KHGA 2EIJC 3JAMN 1BMFG 1E1RG 1O9GA 1XNQO 1H8EG 5JJNB 4DR7O 1BQZA 3OMNB 4UCSA 5L3GA 2DQ3A 1UPGA 5KHJA 3D8CA 1F51A 1W0KG 1GK9A 2EINC 4O2AA 4DUYO 4MTGA 5JQGA 3N2KB 1AP6A 1RPRA 2B1IA 3G6EV 3FAVB 3K58A 5LHHA 4MTOA 1I5XA 1G4YB 3HKCB 3E89A 1Z5WA 3EVKA 3OFNG 5IJ0B 4PDLA 4GX5A 4PI0A 4O4JB 3ABLB 1PL0A 5KMGB 4ZKIA 3LSQA 5JH7A 2YC0A 4PA4A 2Z0AA 5LMUO 4UVAA 3Q4HB 1SZXA 4LBEC 4I0XB 1XI1A 1NBMG 1ROPA 4JZGA 2JGDA 2Y69C 3HKEA 4JI8O 5FPRA 1SQBH 2ADPA 4JYAB 4X65B 3A0BZ 2W6JG 1GN4A 1VQ5V 1S0VA 2HFEC 4TQFA 4FZ1A 3CCQV 2WLNA 2P22C 5B1AC 5IE9A 4JYBA 2OCHA 1K4CC 5LGNA 2LW7A 2KKWA 4FPPA 5JWPA 2CDYA 3K03A 3CCJV 1MZEA 1MSWD 3OAAG 4DV0B 1MG1A 1IBMO 2ODMA 5CA0B 4P30A 3N2KA 4H0LB 4KFMA 4GUNA 2FTKA 3FAVA 1P4RA 2IBZH 1Y4MA 1GRJA 2ZXWB 1KBHA 1H2NA 5IJ0A 1FD9A 5LP6C 3CP1A 4AI8A 1PNLA 4FLZA 5KMGA 1JR9A 1K34A 3E22B 2E76B 3MAQA 2EIKB 2OTJV 2E3CA 2EZOA 2WAMA 4B3MB 3Q4HA 4YHHB 5C8YB 4TV9A 2Y0IA 4DR3B 4GKKB 4FFBA 4LF5B 1NH2B 2OTLV 3ZBHA 3T4ZA 4CS4A 2A3QA 1GN6A 3HB3B 5KAFZ 2Q7HA 5B1OA 4LF8B 4R50A 1RSOA 1W2BU 4LFBO 3HKBB 3PJSK 4DV2B 3ZEDA 4CH6A 4DYLA 1Y76B 4L87A 1TUEB 1WJZA 2CTPA 2EJ7A 1O9HA 3G67A 2NLJC 4PHZA 1XMQO 4FLXA 3JAWA 4XDKA 3S3XA 2XUMA 3J80N 5HFLA 1M90W 4J7ZA 4IYIA 4DV3O 3A8TA 3OMIB 1VF6C 4OX9B 1ORQC 5CA0A 3CC7V 2LGQA 3T1HB 1WPBA 1CP9A 4LF4O 2ATKC 5EYPA 2BCCH 4I5SA 3CB2A 1WNSA 2PI4A 2BSKA 2ZR2A 4DV7B 1NVPB 4DR2B 4DR1B 1PPJH 2H3OA 1IBLO 1IXMA 3ETQA 1DGSA 2JK5C 3ZN0A 4X66O 1AR1B 1GN2A 3X2QB 1N0JA 1GM7A 3DC5A 3W7UA 4DR6B 5KLVH 5C8YA 3CYOA 4DO2A 1HNZB 1X59A 4YJ3B 3C3TA 3J81N 2ITCC 1RM1C 2MW2B 4YJ2A 4U3FH 2QR4A 1I5YA 1XHXA 2IJKA 1B04A 1Q43A 3W7TA 4DV5B 3CCVV 2BTOA 3K08A 1V9PA 5EC2C 3HKBA 3N27A 4R6ZA 3MDSA 2VQFO 3K0GA 3E8FA 2N74A 4LF7O 1Y76A 1S5LZ 2ZNJA 5ITZB 1VQLV 4BAYA 1CXZB 4JGSA 4FZ0A 2F93B 1BL8A 1K97A 1LR1A 4BW9A 1FJGB 4KP4A 4MSWC 2M7WA 1N0NA 2WLKA 1NZ6A 4JV5B 1NTMH 1BE3H 1K33A 1VQPV 4I9WA 4HYOA 2GSMB 4RUFA 2QTOA 1JJ2U 4B3TB 1R3KC 5H6QA 1H38A 2A0LA 2CAZC 3FFQA 1JCHA 1SQXH 2YEVB 3LDCA 5B1NA 3LUTB 1M57B 3CJHA 1GO3F 3H1IH 3SDLA 3ABKB 1Q90D 2BOCC 2Q0OC 4UUJC 4JI2O 2XTAA 3BPZA 1FXKB 4AHCA 2CGOA 1IVSA 1R3IC 3D36A 3ZRXA 4CBCA 3E2EA 1HDJA 1VQNV 4J11A 3QG5A 2ETNA 3RVYA 5IY5C 1J5EB 1THZA 2JJ1G 1RP3B 1GMGA 4TUYB 3ZHQA 3B77A 4HZ3A 1OCOB 2CE4A 4JI3B 4ZOLB 3AG1C 3AG2B 4EFBA 4JTCB 3SR2C 2LP7A 5GTHZ 4JAAA 2R9RB 3QF7A 4I55B 3T4DA 3UT5A 3JD0A 4C7UA 1U97A 2XT9A 4JZ2A 5A2QN 1BGYH 1Q82W 1HNWB 3SJBC 4R7CA 2YXYA 4FLYA 2E75B 3CWBH 2Q6AA 1WPXA 2PYJA 3QO5A 3WB2A 1XUQA 2YEVA 2X0LA 3K9SA 2RN9A 2QGNA 1QR9A 2Z3YA 4JI6O 2F4VB 4ICGA 2ZE5A 2EX3A 1GKFA 3QO8A 1KQSU 2CTWA 1KP3A 3CCEV 2RCVA 3JSNA 2X7RB 3CE2A 4EEQA 2UUAB 3ZN1A 3CD6V 1M5IA 4TUYA 4LH6A 2AXTZ 4CS2A 1NI8A 1K5QA 4ZOLA 5CB4A 1YCIA 4DV1B 2LO1A 4Q20A 1TVKB 2YI9A 4FLTA 1PKXA 4I55A 1HW7A 3QNEA 2K9PA 4K0KB 1ZL8B 1AI6A 4HNAB 1WB7A 1QQCA 3OMAB 3APQA 1KKCA 4FVMA 3ZHRA 5DN6G 3ML0A 5L3FA 3AG7A 4DUZB 4CZZA 1QLEB 2N04A 5EBWC 3HPLC 2XAGA 3ABMB 1GAXA 2L35A 2NR5A 4CS3A 4LFCB 1BT8A 3RYCA 4AILC 1WP7A 1N32B 1V55B 3CC2V 5IWAO 2E74B 4MT8A 3P30A 5B1BB 1Z5VA 4UCTA 1AROP 1EN4A 3FKSG 4LFAB 2EJRA 3R65A 4FM2A 3K04A 2ZCEA 2BTQB 3JCUZ 2WA4A 2DYSC 1S72V 3CCRV 3JASB 4YY3B 4O4HA 5KAIZ 3RN4A 4YXWG 3KKYA 1DF5A 5DM6V 1BS3A 2RQ6A 1KKDA 3K3WA 3FB8C 3F5TA 5CA1B 1TVKA 2XAHA 4MVQA 1YJNV 3RWRD 5EK0A 4A5UB 5LGUA 1YTFD 2F23A 1XNRB 4EFEA 2UXCB 4DK1A 5H9CA 3C3SA 4OXSA 3JD3A 4E2LA 2XAJA 3UO2A 3ZMSA 3EXAA 3L75H 3S3WA 1E79G 5JCOA 4JI7B 4H37A 3GVMA 1Q81W 1I94B 2EIMC 4AQYB 3CC4V 1EZJA 1KUQA 4X62B 2QKCA 3WB0A 5KUKA 1FXVA 3WFVA 4K35A 3SJCC 2W0XA 4UCVA 1FYJA 4X65O 1GM9A 4UVCA 1K4DC 1MA1A 1JJOA 3RT3C 1VIBA 1GH6A 3JASA 3ZS8C 1P7GA 5FLXN 3OT7A 2XNDG 4FJCC 4UV9A 2EILC 2DWEC 1FFXB 4DR4O 2XOKG 5CA1A 5LA6B 3K5NA 4CH5A 2Q0AA 4B3SB 1IZ3A 3W7WA 1K5SA 1EM1A 5AG2A 1NTKH 2IJIA 1OCRB 5IYDO 2QM7A 3CCUV 3WG7B 5B66Z 1YXBA 4LF9O 4JYCA 1LUWA 2FL4A 3K0DA 3R66A 4KUMA 2B1GA 3RYHB 2FMLA 1SRYA 4B3MO 1T5EA 2OWOA 4YHHO 3DTUB 5K1XA 2YIBD 2F66C 2WLMA 4IHJB 3LSUA 2UU9O 4JF3A 2ZXWC 2PI5A 5IDJA 4K8ZA 1EN6A 2P4VA 2KG7B 4LF8O 5IYBO 1YSCA 4DV2O 4DRXB 5BZBA 1S77D 2CGNA 2EIKC 1VEWA 1KD1W 1VF5B 3FYIB 3B2EE 3B40A 1WAZA 1COWG 4TV8B 1VQ6V 2HHHB 4DV4B 1PNMA 2VRZA 4OX9O 1N36O 3KG2A 5H5NA 4I4TB 4YIOA 2IW5A 2DWDC 2LW1A 1E1QG 1N8RW 3ABTA 4DR2O 1QLNA 1JOYA 1YZBA 3VQXA 4DR1O 1PNKA 5D5QA 2BE3A 4B3RB 3AG4B 4RQEA 3NR7A 5HFMA 1B06A 2V4DA 1HNZO 1QHTA 3AG3B 3ZMUA 4LR3A 4NKGB 2YICA 4DK0A 4JI5B 2VS0A 4DV6B 2UXXA 1BSMA 2IU3A 4DV5O 4E4EA 1Q6IA 3K5LA 4J41A 4DRXA 4FM1A 1RPOA 1YF2A 2BOBC 1ZTEA 1D2DA 1R6TA 4JI1B 3X2QC 2JEUA 1IURA 3CRRA 2VWKA 5J2TB 1AJQA 1AI4A 3P3NA 3OUFA 2P6JA 3BFRA 4TV8A 1SQGA 2Q7GA 3HKCA 3D36C 1V54C 2OIGA 1KP2A 2QE7G 3JATB 2HKOA 3JD4A 4J42A 4IGGA 3OTOB 2UUBO 4O4JA 3SGIA 3SYCA 2R70A 2KSDA 1DK1A 1IBKB 4B3TO 2JEXA 2DE0X 1BQ0A 3VBBA 1XOUA 1XDCA 5LGTA 4I0XA 2QM4A 3ZMVA 4UCUA 1YDXA 2N05A 3ASOC 3MHHC 1Y6XA 1M56B 2WSSG 2HVKC 4X20B 3L74H 2PY5A 3DXRB 1SA0B 4WFFA 2XHBA 1AILA 3F5WC 1NKDA 3RW0A 4J10A 3VOUA 2EINB 1XL6A 4ZHQB 5IJ9B 2QKSA 1AJPA 1K3EA 1WA8B 5CBHA 2QWRB 2Q67A 3K59A 4XBFA 4CH3A 1J5EO 1MABG 3SYOA 3B8NA 1Z2GA 1Y74B 1I7FA 4PELA 3TETA 4JI3O 4DR7B 4O2BB 4LH7A 5L3BA 1M93A 2XASA 1U96A 4TQDA 2JJ2G 5J2TA 5KHHA 1GN3A 2IJHA 4DUYB 4I7ZB 1J95A 4EB6B 2YXLA 3L73H 4BW5A 1AR5A 1W59A 1NU1H 2H8PC 4NVPA 1AP5A 2GV9A 3D3IA 3HKDB 3AK3A 2C2AA 3JATA 4UFZA 3CRAA 4L8JA 3ASNC 2LFRA 3A2FA 3E22A 1NR7A 4QE7A 3K06A 5DECA 3AK1A 4NXNB 5B3SB 5LMUB 1N33B 2DW4A 3TXQA 3CRQA 1OCZC 3DXRA 1SA0A 4PA9A 1L0NH 3JALB 2DYRB 1WN7A 2Q68A 4ZHQA 5KHKA 4UB6Z 4GX0A 1QR8A 5LHIA 4J7JA 1Y67A 2K1EA 4P9OA 4WFAV 3IJ4A 1KC8W 1SKVA 5KUMA 3SJAC 1Y74A 4KHPB 1FKAO 2M6YA 2ZDIA 5LP6B 3CX5F 2P7TC 4O2BA 3ZRSA 1MNGA 4N23A 1AVMA 4GYCB 2RNBA 4EB6A 1IBMB 4K0KO 5A9GA 3BY6A 4WFEA 2R9IA 3HKDA 4B7KA 2LGWA 1ZWIC 1N34O 3U0ZA 5KA6A 2HJFC 3ETGA 4LC1A 4ZBMA 3H01A 5IT9N 2VQEO 4LFCO 1N32O 4NTWA 4GKJO 4RQFA 4JYYA 5BR8B 1QVFU 2ZT9B 4YJ3A 1KB9F 1SS3A 5JVDB 1H2SB 1NS1A 2ZQMA 3I56V 5JJJB 2HLDG 1NJIW 4OPAA 4NB5A 1Q7YW 5CMUA 2E5LB 2HJDA 3JALA 2HEPA 1QLEC 4X1IB 4QPKA 2QWOB 3ABMC 5ITZA 2L6LA 4UXNA 5JCOC 4W4LA 4Z1VA 1V55C 4LFBB 4X8AA 5B1BC 4J9YB 5IYZB 3FB6C 2UUCO 2GDSA 5KX5B 1XMQB 4NXMO 3VQYA 4BR6A 4DV3B 1GTOA 4GZRB 2LQTA 1XQ8A 4NR1A 4DXWA 1H2KA 3OR7C 1YITV 4LF4B 1RM1B 4JI4O 1XNRO 1DTOA 2FYUH 3CXCU 3VQVA 4LF6B 1FFTB 4PDRA 1Q3EA 5CN0A 4DW1A 1IBLB 1ZX3A 1I94O 3UM7A 5LMNB 3WB1A 4X66B 3SYPA 3GWOA 4ABMA 4FFKA 2WLJA 3CRCA 2WLIB 3J7AU 3SJQC 2Y0PA 1OHHG 1FXKA 3SPGA 3IFXA 4DR5O 2A9HA 5E79Z 4K8XA 2ZIOA 1US6A 3T1YO 1LUVA 2QEXV 2QWPB 4WBNB 5EZYB 4D7TA 5L3EA 2X6AA 1VF7A 4D6TH 4X1IA 2GTSA 4PA7A 4JPRA 5GONB 2AZ0A 2P4KA 4J80A 4QE9A 1R3JC 5K1PA 4P9PA 1R3LC 4NYKA 4N21A 2VQFB 2HP8A 3EFFK 4LF7B 3ICXA 5IYZA 4UB8Z 4FMTA 4X64B 3O65A 1PM9A 1Q6HA 1HNXB 1D5NA 1XEQA 2GUZB 4RO2A 2IJJA 5GW7A 5FL7G 3ZCCA 1OZ0A 1HP8A 2Q9LA 4MTFA 4FIPC 2A7WA 1FAFA 1XBLA 3JD2A 3CCMV 5LOVB 3OUSA 1AI7A 1SERA 3E35A 3RGBA 2ITDC 2QJ1A 1OCCB 4I50B 1OV9A 3RFRA 2B5UA 1DLBA 3BEHA 2QSAA 3LDDA 4XDJA 2OCCB 5EBLC 3ZHTA 4MW8A 3H1LH 2VWJA 3AG1B 3ABUA 2WLIA 1PD3A 4JI2B 1P7BA 1D5AA 4BIZA 2JRIA 3P3PA 1XMOB 3SYAA 4OGQB 4IIJB 5GONA 3BRCA 4JTAB 3JARB 3CHXA 3ETDA 1AR4A 5BY1A 5F2VO 1QU7A 1ZL8A 2FB5A 3L71H 2QWNB 4HNAA 1QNMA 3CPWU 3CRMA 4EKWA 2HHHO 2IH3C 1VQMV 5EIBC 1YVWA 1KECA 5J2UB 3N2GB 4PDMA 4U3JB 3W7XA 3OGIB 5LOVA 4QNHB 4B7EA 2PF4E 4LNUB 4XDLA 3PN1A 3CCLV 5H6RA 4Z1MG 1H8HG 1TUBB 4D7SA 2V7QG 2BTQA 4JYAO 2D3OW 4MVSA 1G8MA 1B6QA 3TJTA 2F95B 5KA5A 3UQ8A 3ABLC 2Q69A 4ZIBA 3OM3B 2ZIMA 4GLXA 4W4KA 1BZKA 4PI2A 3CCSV 4X1YB 3TGUH 5DEDA 3CEIA 5KHIA 3JARA 1VQ8V 3AG4C 4DV0O 4PJ0Z 1AJNA 2IM9A 3P32A 1YTFB 2H94A 2PZSA 5IYCO 2NN4A 1BHBA 2AW9A 1H2MA 3AG3C 4O2AB 5BMVB 5LHGA 1ZLZA 2ZD9A 3I5DA 1XREA 3K57A 5JQGB 1Q5OA 5L3CA 4FLVA 3JCZA 4X9QA 3OTOO 2ZNIA 3H1JH 4U3JA 2W0FC 1G1XB 1IBKO 4RUEA 2JS3A 5FNVB 2P5OA 1VQKV 4LNUA 2JS5A 5JH7B 3K5OA 5IWAB 4DR3O 4GKKO 1AI5A 1TUBA 2ARHA 4LF5O 3JSLA 4BIUA 2GHYA 5H2FZ 2JGDB 1WB8A 2UXNA 4U7NA 2R9AA 3AEIA 3IC7A 1LNQA 1P84F 4TT3G 1BCCH 2F1MA 1CPYA 5EC1C 4X1YA 1M56C 1FFXA 5LA6A 1HR0B 3BHPA 2W6IG 3APOA 3BABA 2R72A 3T1HO 2EIMB 2XAFA 2QA4V 1FPOA 4LP8A 2Q7EA 5C93A 5BMVA 2WLLB 3U11A 4DV7O 3ZMZA 3K79A 4CC5A 3OEEG 3OEHG 3VQWA 3ZHUA 2JVDA 2QM8A 2ADQB 2Y4TA 2YXHA 3KCYA 3RYHA 1F23A 2ZDIC 1I0HA 4Z2WA 2X6BA 5FNVA 2ZM6B 1PL4A 5B5EZ 4DR6O 2CTQA 4NXNO 2QWQB 3UCSC 1N33O 5D5PA 4IHJA 1IDSA 2B9ZA 2KQXA 2QKAA 2ZE6A 1VMGA 2EILB 3JAKB 4TV9B 1S3JA 1HWYA 2V1DA 4FFBB 2KG7A 4BIOA 4GX2A 2Z5UA 3ZHSA 4OPHA 1NH2D 2Y48A 1EFRG 2Q8VA 3IAYA 1RSOB 1JPXA 4RWUA 1KU9A 2HG5C 2YUAA 1YI2V 4KHPO 1VARA 1VQ9V 1FJGO 1ENVA 5B3SC 1B3QA 3RVZA 3A0HZ 4JV5O 4JAUA 1IX9A 1BHAA 3JAWB 4DR4B 1PV0A 2DYRC 1MZFA 4I4TA 2WLLA 1L8DA 3GWKC 4JI0B 2YIAA 2UXBB 5BXZA 3THOA 5EYPB 4H33A 2BSKB 4F4LA 3ZRWB 2EIJB 3IC9A 3LDEA 2UXDB 2YDEA 2YIBA 4LF9B 1OJHA 1NVPD 4PD4F 1Q86W 5BR8O 4UV8A 3B8MA 5LXTB 3O9OA 1UFIA 2ZINA 4JTDB 3H9VA 4F6RB 3JAKA 3BVOA 2E5LO 1SQPH 1URFA 4FLWA 4YJ2B 2UU9B 1M57C 4H44B 5FPOA 1XNQB 1W0JG 3ABKC 1KMIZ 3MHSC 4KL1A 1S76D 4I9QA 3FB7C 2AZ2A 3DGEA 4IYHA 1MOFA 2Q5ZA 3DC6A 1FXKC 3G71V 1PP9H 3OD4A 3SPIA 4UVBA 2Y69B 2EULA 3EHBB 4G27B 2P90A 3NXSA 1S5JA 1L1FA 1HNWO 1UJWB 5LYJB 1OCOC 2QTSA 1N4CA 3L72H 4WFGA 4NTYA 3STZC 3M8AA 1N36B 4UCRA 3AG2C 2PUSA 3ZRWA 5B1AB 4MVOA 4PDVA 1K92A 4LF6O 4X20A 4O4IB 3ZMTA 4CH4A 2F4VO 3CJHB 4MS2A 1K73W 2ZKOA 1YHQV 4IT5A 3MD0A 5LMNO 3B09A 5L3DA 4JI8B 1JQ0A 5LXTA 1KYOF 2ILMA 5IJ9A 2JIZG 1WA8A 2YS8A 4F6RA 2UUAO 2YIDA 3FB5C 1V54B 3IGAC 3QVNA 1EN5A 4DV1O 3AK2A 1CEZA 4LWSB 1R73A 4F6EA 3ETEA 5LBQA 1WLEA 1X4TA 1ZUQA 2A06H 2PGGA 3SPJA 1M1KW 3ASOB 3TXSA 4X64O 3G6BA 1SQQH 4JASA 1HNXO 3TCUA 3UT5B 4QPJA 4GCZA 4DUZO 4HBNA 3H1KH 5LYJA 2WA3A 1Q6UA 1JA8A 1R1BA 2Y4UA 1SQVH 3RYFB 4G28B 2UUBB 1H2LA 1R6NA 2YSUB 2KB1A 4ASUG 2DJVA 1R6KA 4O4LB 4LFAO 2DN9A 3FYEB 4O4IA 3WU2Z 1XHZA 1VQ4V 1JFFB 5LL6Y 2DQ0A 3FD9A 2AHZA 1NR1A 3G4SV 4YY3O 3F7YC 3SPCA 3BA8A 1XMOO 3LNMB 3OE7G 1OCCC 5LP6A 3ASNB 3T1CA 2GBOA 3E8GA 1SESA 3ZJZA 4LWSA 2OCCC 4TSFG 1SETA 2AHYA 5CB4B 4JAVA 3BA9A 5CBGA 2JGUA 1QBZA 4FM0A 5E1AC 1SC5B 3T2MA 2UXCO 1OCZB 3DSQA 4WFBV 4FK5C 4PV1B 3TK1A 3RYFA 4JI7O 1EZVH 3JD1A 1TA8A 2CK3G 1NT2B
chains in the Genus database with same CATH topology
2A79B 1PNKA 1IXMA 3K9AA 3ZN0A 2JK5C 4XDLA 3JYCA 3CCLV 5H6RA 1AR1B 3AG4B 4Z1MG 1H8HG 4RQEA 3X2QB 1GM7A 5HFMA 3W7UA 2V7QG 4LCUC 1JVMA 3CYOA 4MVSA 4DO2A 2D3OW 1G8MA 1B6QA 2ITCC 1RM1C 3AG3B 5J9PC 3ZMUA 5KA5A 1FXHA 1I5YA 1NQTA 3I55V 3ABLC 4U7OA 2Q69A 2IJKA 3CMAV 3OM3B 3W7TA 2UXXA 2IU3A 3CCVV 2HVJC 3K08A 5EC2C 4R6ZA 3CCSV 4HAMA 3K0GA 3E8FA 1RPOA 2BOBC 1VQLV 4BAYA 1VQ8V 3AG4C 4JGSA 3X2QC 2JEUA 4R8CA 1AJNA 1VQ7V 2NNUA 1BL8A 1K97A 3P32A 1YTFB 2H94A 1AJQA 1AI4A 3OUFA 3LSSA 4KP4A 1M9NA 2X6CA 4MSWC 5IYCO 2M7WA 1JX9A 2P6JA 1BHBA 2WLKA 4MVUA 3AG3C 1QVGU 2F43G 5LHGA 2ZD9A 1K33A 1VQPV 3E8BA 1V54C 1XL4A 4I9WA 1KP2A 4HYOA 1GM8A 2QE7G 1SZTA 2GSMB 4MTXA 5L3CA 1VQOV 1YIJV 2HKOA 3JD4A 4RUFA 3JCZA 2QTOA 3SYCA 1JJ2U 1R3KC 5H6QA 4MVRA 2A0LA 3E83A 1H38A 2W0FC 2JEXA 3VBBA 5IY5B 1K7DA 4RUEA 1JCHA 2YEVB 4WFHA 3LDCA 5B1NA 3LUTB 1M57B 3ZMVA 5LGTA 5EBMC 1VQKV 4P2ZA 3ASOC 3MHHC 1GO3F 1M56B 3ABKB 3ZRVA 2WSSG 1F4NA 4GX1A 2HVKC 1AI5A 2BOCC 4UUJC 4WFFA 3F5WC 1NKDA 1K9MW 3RW0A 1OCRC 4BIUA 2GHYA 3SPHA 3VOUA 2EINB 3RBZA 1XL6A 2EBOA 3WG7C 1FXKB 2QKSA 2UXNA 1R3IC 3D36A 2IH1C 4U7NA 1AJPA 3ZRXA 4CBCA 1K3EA 3STLC 3AEIA 3IC7A 5CBHA 1LNQA 3E2EA 1VQNV 2XAQA 3UKMA 2Q67A 3RVYA 5IY5C 4TT3G 4XBFA 4WCEV 1THZA 2JJ1G 1MABG 1GMGA 3SYOA 3B77A 3B8NA 3ZIAG 4HZ3A 1OCOB 1CPYA 3E86A 5EC1C 4PELA 3AG1C 3TETA 1M56C 3AG2B 4JTCB 5L3BA 2XASA 2LP7A 2W6IG 2JJ2G 3QO7A 2R9RB 3T4DA 4MVMA 2IJHA 2EIMB 2XAFA 2QA4V 3JD0A 4LP8A 1J95A 5C93A 1Y66A 4BW5A 2WLLB 3CMEV 3ZMZA 2EZPA 3K79A 3M99B 1Q82W 2H8PC 3OEEG 3D3IA 3OEHG 2C2AA 3W7SA 2WWWA 2QM8A 3ASNC 2LFRA 4R7CA 2HR3A 3OGCC 2Q6AA 1WPXA 3GB7C 4WF9V 1NR7A 1F23A 2ZDIC 3F7VC 3QO5A 4QE7A 2YEVA 2X6BA 2X0LA 3K06A 4QIWF 5B3SB 1EBOA 2DW4A 1QR9A 2Z3YA 1K8AW 1OCZC 2P67A 1S5HC 4PA9A 2EILB 1GKFA 3QO8A 1S3JA 1KQSU 2WLHA 2DYRB 1KP3A 2Q68A 3CCEV 1HWYA 2V1DA 4J9ZB 4GX2A 1QR8A 2X7RB 4GX0A 5LHIA 2K1EA 4P9OA 3ZN1A 2Z5UA 4WFAV 1NH2D 3CD6V 2Y48A 1EFRG 4QJFB 1KC8W 4TWKA 5KUMA 4G2KA 1JPXA 2HG5C 1YI2V 2ZDIA 1DF4A 1K5QA 1VQ9V 1ENVA 2P7TC 5B3SC 3ZRSA 3RVZA 1FS0G 4Q20A 4MW3A 4JAUA 3SYQA 1PKXA 1BHAA 3A0RA 4X89A 3QNEA 4N23A 1YJ9V 2DYRC 1AI6A 3BY6A 2WLLA 4WFEA 3OMAB 2R9IA 5DN6G 3ML0A 5L3FA 3OW2U 2DYSB 4CZZA 1QLEB 1ZWIC 4H33A 5EBWC 3HPLC 4F4LA 5KA6A 1H2GA 2HJFC 3ETGA 4LC1A 4ZBMA 2EIJB 2XAGA 1QCEA 3ABMB 3ZRWB 3H01A 5CBFA 3LDEA 1YJWV 2OT5A 1V55B 3CC2V 4PA3A 2JDIG 4GT1A 4RAIA 1NVPD 4MT8A 4X88A 4RQFA 2LFSA 3P30A 5B1BB 1Q86W 1QVFU 1AROP 2WPDG 3FKSG 4UV8A 2EJRA 3B8MA 2ZQMA 3R65A 4MVZA 5CA3A 3E8HA 3I56V 2IU0A 2HLDG 1NJIW 1F4MA 4JTDB 3K04A 1Q7YW 5CMUA 4PA6A 2ZR3A 3OR6C 2DYSC 1S72V 3CCRV 1QLEC 1M57C 2MK3A 4QPKA 2EIJC 3ABMC 1BMFG 1E1RG 1W0JG 3ABKC 4UXNA 1H8EG 3MHSC 1S76D 4YXWG 3FB7C 1V55C 3OMNB 5L3GA 4X8AA 2DQ3A 1DF5A 3DGEA 5DM6V 1KKDA 5B1BC 1F51A 1W0KG 4J9YB 1MOFA 1GK9A 2EINC 3K3WA 1FXKC 3FB6C 3FB8C 4MTGA 3G71V 2XAHA 4MVQA 1YJNV 3SPIA 4UVBA 2Y69B 5EK0A 1RPRA 3EHBB 2B1IA 4G27B 3G6EV 2P90A 3NXSA 1L1FA 1GTOA 5LHHA 4MTOA 1UJWB 1I5XA 5LGUA 1YTFD 1G4YB 3E89A 4DXWA 1OCOC 3OR7C 1YITV 3OFNG 1RM1B 4WFGA 4PDLA 3STZC 1DTOA 4GX5A 5H9CA 4OXSA 3JD3A 3CXCU 4E2LA 2XAJA 3AG2C 3ABLB 3ZMSA 1PL0A 3ZRWA 5B1AB 4ZKIA 4MVOA 3LSQA 4PA4A 1E79G 4PDVA 1FFTB 4H37A 4PDRA 1K92A 5CN0A 1Q81W 4UVAA 3ZMTA 2EIMC 3CC4V 4LBEC 4MS2A 3UM7A 1K73W 1NBMG 1YHQV 1EZJA 3MD0A 3SYPA 3GWOA 1ROPA 5L3DA 2WLJA 1JQ0A 2WLIB 2Y69C 3SJQC 3SPGA 1OHHG 1FXKA 2JIZG 5KUKA 1FXVA 3IFXA 3WFVA 2A9HA 2W6JG 2QEXV 1GM9A 1VQ5V 1S0VA 4UVCA 1K4DC 2HFEC 5L3EA 2X6AA 3FB5C 3CCQV 1V54B 4PA7A 2WLNA 4JPRA 5B1AC 3IGAC 4QE9A 4JYBA 1R3JC 1K4CC 4P9PA 1R3LC 2XNDG 5LGNA 1CEZA 4N21A 3EFFK 1R73A 4FPPA 3ETEA 3K03A 4FJCC 4UV9A 3CCJV 2EILC 5LBQA 2DWEC 1MSWD 3OAAG 2XOKG 1WLEA 1MG1A 3SPJA 1M1KW 4FMTA 3ASOB 4P30A 4JASA 4RO2A 4KFMA 2IJJA 2FTKA 3TCUA 5GW7A 4QPJA 4GCZA 1P4RA 1K5SA 3W7WA 5FL7G 1Y4MA 3ZCCA 2IJIA 2ZXWB 1OZ0A 4MTFA 1OCRB 4FIPC 5IYDO 2QM7A 3CCUV 3WG7B 4G28B 3CP1A 3JD2A 3CCMV 3OUSA 1R6NA 1AI7A 1PNLA 3E35A 1SERA 2YSUB 2ITDC 2KB1A 1OCCB 4JYCA 4ASUG 1K34A 1R6KA 3K0DA 2EIKB 4KUMA 2B1GA 2OTJV 2B5UA 3FYEB 1DLBA 3BEHA 2EZOA 2WAMA 1SRYA 3LDDA 4XDJA 2OCCB 5EBLC 4MW8A 3DTUB 1VQ4V 3AG1B 3ABUA 2WLIA 1PD3A 2DQ0A 1P7BA 1NH2B 2WLMA 2OTLV 2AHZA 1NR1A 3T4ZA 4BIZA 3G4SV 4JF3A 2ZXWC 2PI5A 5IDJA 3F7YC 3HB3B 3SPCA 5B1OA 4R50A 3SYAA 5IYBO 1YSCA 3LNMB 3OE7G 1W2BU 3PJSK 1OCCC 5BZBA 4L87A 1TUEB 4JTAB 3ASNB 1S77D 3T1CA 2EIKC 1KD1W 3E8GA 1SESA 3ZJZA 3ETDA 3FYIB 2OCCC 2NLJC 4TSFG 1SETA 2AHYA 4XDKA 1COWG 5HFLA 4JAVA 1M90W 5CBGA 1VQ6V 1QBZA 1PNMA 3OMIB 3CPWU 4EKWA 5E1AC 1ORQC 3CC7V 2IH3C 1VQMV 1CP9A 1KECA 2ATKC 3T2MA 1OCZB 4WFBV 3KG2A 4FK5C 4I5SA 2PI4A 2ZR2A 4PDMA 1NVPB 3TK1A 2IW5A 2DWDC 1E1QG 1N8RW 3ABTA 3W7XA 3JD1A 1QLNA 2CK3G 1JOYA 4QNHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E86 A;  2A79 B;  1K4C C;  4P9P A;  5EC1 C;  1R3L C;  2JK5 C;  4XDL A;  4PA3 A;  3AG1 C;  3JYC A;  3TET A;  1M56 C;  4RAI A;  3EFF K;  4X88 A;  4JTC B;  3K03 A;  2EIL C;  2DWE C;  4MVZ A;  3R65 A;  2R9R B;  4LCU C;  3E8H A;  3T4D A;  4MVM A;  1JVM A;  3SPJ A;  4MVS A;  4HZ3 A;  4JTD B;  3K04 A;  4P30 A;  4LP8 A;  1J95 A;  2ITC C;  5J9P C;  4RO2 A;  4KFM A;  4BW5 A;  2WLL B;  4PA6 A;  3TCU A;  2H8P C;  3OR6 C;  3ABL C;  2Q69 A;  2DYS C;  4MTF A;  3ASN C;  1QLE C;  1M57 C;  4R7C A;  3OGC C;  2HVJ C;  2Q6A A;  3K08 A;  3GB7 C;  2EIJ C;  4G28 B;  3ABM C;  5EC2 C;  3ABK C;  3OUS A;  4R6Z A;  3K0G A;  3E8F A;  2ITD C;  2KB1 A;  1V55 C;  3FB7 C;  3F7V C;  4QE7 A;  2BOB C;  2YEV A;  2X6B A;  3K0D A;  4X8A A;  3K06 A;  3SYA A;  3AG4 C;  1KKD A;  5B1B C;  4R8C A;  3X2Q C;  3BEH A;  4J9Y B;  1BL8 A;  3LDD A;  4XDJ A;  2EIN C;  5EBL C;  3OUF A;  4MW8 A;  3FB8 C;  3FB6 C;  4MTG A;  4MSW C;  2X6C A;  1OCZ C;  4MVQ A;  2WLK A;  4WFG A;  1S5H C;  4MVU A;  2WLI A;  3SPI A;  3AG3 C;  4PA9 A;  1P7B A;  5EK0 A;  4G27 B;  2WLM A;  2AHZ A;  2ZD9 A;  3T4Z A;  3E8B A;  2WLH A;  1V54 C;  1XL4 A;  4I9W A;  2Q68 A;  4HYO A;  4MTO A;  2ZXW C;  4J9Z B;  1G4Y B;  3F7Y C;  3E89 A;  4GX2 A;  4GX0 A;  4RUF A;  4DXW A;  3SPC A;  1OCO C;  3OR7 C;  2QTO A;  3SYC A;  2K1E A;  4P9O A;  1R3K C;  4R50 A;  4MVR A;  2A0L A;  3E83 A;  3LNM B;  2W0F C;  4GX5 A;  4PDL A;  4OXS A;  3PJS K;  3STZ C;  3AG2 C;  1OCC C;  5BZB A;  4RUE A;  4TWK A;  5KUM A;  4JTA B;  4MVO A;  4WFH A;  3LDC A;  3LUT B;  4PA4 A;  2EIK C;  2HG5 C;  4PDV A;  5EBM C;  4H37 A;  4PDR A;  4P2Z A;  3T1C A;  3E8G A;  3ASO C;  2EIM C;  3ZJZ A;  4LBE C;  2P7T C;  2OCC C;  2NLJ C;  5B3S C;  3ZRS A;  4MS2 A;  3UM7 A;  3RVZ A;  4GX1 A;  2AHY A;  2HVK C;  4XDK A;  3SYP A;  2BOC C;  4UUJ C;  4MW3 A;  4WFF A;  2WLJ A;  5CBG A;  2WLI B;  3SYQ A;  2Y69 C;  4X89 A;  3SJQ C;  3F5W C;  3SPG A;  5KUK A;  3RW0 A;  1OCR C;  4EKW A;  3IFX A;  1ORQ C;  5E1A C;  3SPH A;  3VOU A;  2DYR C;  1XL6 A;  2A9H A;  2IH3 C;  3RBZ A;  3WG7 C;  2QKS A;  2WLL A;  4WFE A;  2ATK C;  1R3I C;  2IH1 C;  3T2M A;  4CBC A;  3KG2 A;  3STL C;  5CBH A;  1K4D C;  2HFE C;  1LNQ A;  4PDM A;  2DWD C;  2X6A A;  3UKM A;  1ZWI C;  3FB5 C;  2Q67 A;  4H33 A;  3RVY A;  5IY5 C;  5EBW C;  3HPL C;  2WLN A;  4PA7 A;  4F4L A;  2HJF C;  4ZBM A;  5B1A C;  3IGA C;  3SYO A;  5CBF A;  3LDE A;  4QE9 A;  4QNH B;  1R3J C; 
#chains in the Genus database with same CATH topology
 4AQY O;  2A79 B;  2QDO A;  4X1K B;  3K9A A;  3JYC A;  5JVD A;  4O4L A;  3RYC B;  2DMX A;  4X62 O;  3RYI B;  1P49 A;  4LCU C;  2CH7 B;  1JVM A;  1TGO A;  1JFF A;  5J9P C;  1VF6 A;  1FXH A;  1NQT A;  3I55 V;  4U7O A;  3L70 H;  3CMA V;  2CTR A;  2HVJ C;  2RJZ A;  1A32 A;  3M7M X;  3B4S A;  2PTM A;  4HAM A;  3K5M A;  4O4H B;  4K3A A;  4R8C A;  1VQ7 V;  2NNU A;  5KX5 A;  3LSS A;  4YIP A;  1M9N A;  2X6C A;  3ZHV A;  2O57 A;  1JX9 A;  4B3S O;  4MVU A;  5TIS Z;  4DW0 A;  1QVG U;  2F43 G;  5GTI Z;  4IL6 Z;  3E8B A;  3CSX A;  1MMM A;  1XL4 A;  1GM8 A;  1VQO V;  1SZT A;  1YIJ V;  4MTX A;  1M4U A;  3CS5 A;  4MVR A;  3E83 A;  1Q8I A;  1MSD A;  4H13 B;  1ZSP A;  5IY5 B;  4KXR A;  1K7D A;  1N34 B;  4WFH A;  5EBM C;  4P2Z A;  4X1K A;  2GTA A;  2VQE B;  4FLU A;  3ZRV A;  2LJ2 A;  1F4N A;  4GX1 A;  4GKJ B;  3RYI A;  2RMK B;  2P06 A;  2CH7 A;  3U10 A;  1K9M W;  1OCR C;  3SPH A;  4WBN A;  3RBZ A;  5EZY A;  2EBO A;  3WG7 C;  4CC6 A;  2IH1 C;  3STL C;  2XAQ A;  3UKM A;  1SQF A;  2D2C B;  4WCE V;  3UO3 A;  2AGA A;  3G80 A;  3ZIA G;  1I08 A;  3BCC H;  3E86 A;  2ZE7 A;  1JMK C;  4ZI7 B;  4TOI A;  3QTC A;  4DV4 O;  3QO7 A;  1HR0 O;  2GUZ A;  4MVM A;  4UCO A;  2OIE A;  1Y66 A;  2UUC B;  4NXM B;  3CME V;  3BAA A;  2EZP A;  3M99 B;  3W7S A;  2WWW A;  2PYL A;  2HR3 A;  3OGC C;  3GB7 C;  4WF9 V;  4I50 A;  4J7K A;  2CUG A;  1L0L H;  4JI4 B;  4B3R O;  3F7V C;  2FKX A;  1AB3 A;  4QIW F;  3ZX6 A;  2ZM6 O;  3FX7 A;  1EBO A;  4JI6 B;  3OTF A;  1K8A W;  2P67 A;  1S5H C;  4JI5 O;  4DV6 O;  2WLH A;  1VP7 A;  4J9Z B;  4DR5 B;  4IIJ A;  2G38 A;  2Q73 A;  3T1Y B;  3D3Q A;  4Q6G A;  2DOS A;  4QJF B;  4TWK A;  4JI1 O;  4G2K A;  5EIB D;  1DF4 A;  2YI8 A;  3KZI Z;  3L9D A;  2OYQ A;  1TAE A;  5JJE B;  4NTX A;  2Q4P A;  1SF9 A;  1FS0 G;  4ZI7 A;  4MW3 A;  3SYQ A;  3C90 A;  3CXH F;  3A0R A;  4X89 A;  2ZE8 A;  1YJ9 V;  5J2U A;  3N2G A;  1ZAU A;  4BWA A;  3H1H H;  4JI0 O;  3OW2 U;  1NTZ H;  2DYS B;  2UXB O;  1H2G A;  1QCE A;  5CBF A;  3HR0 A;  1YJW V;  2OT5 A;  2UXD O;  4B08 A;  3LNN A;  4PA3 A;  2JDI G;  4GT1 A;  4RAI A;  4X88 A;  1IXB A;  1XIL A;  2LFS A;  1G6U A;  2WPD G;  3KCX A;  4MVZ A;  5CA3 A;  1YEW A;  3E8H A;  3HKE B;  2IU0 A;  1F7Y A;  1F4M A;  2RDC A;  4QGP A;  4PA6 A;  2ZR3 A;  3OR6 C;  1RFY A;  1WP8 A;  2MK3 A;  5KHG A;  2EIJ C;  3JAM N;  1BMF G;  1E1R G;  1O9G A;  1XNQ O;  1H8E G;  5JJN B;  4DR7 O;  1BQZ A;  3OMN B;  4UCS A;  5L3G A;  2DQ3 A;  1UPG A;  5KHJ A;  3D8C A;  1F51 A;  1W0K G;  1GK9 A;  2EIN C;  4O2A A;  4DUY O;  4MTG A;  5JQG A;  3N2K B;  1AP6 A;  1RPR A;  2B1I A;  3G6E V;  3FAV B;  3K58 A;  5LHH A;  4MTO A;  1I5X A;  1G4Y B;  3HKC B;  3E89 A;  1Z5W A;  3EVK A;  3OFN G;  5IJ0 B;  4PDL A;  4GX5 A;  4PI0 A;  4O4J B;  3ABL B;  1PL0 A;  5KMG B;  4ZKI A;  3LSQ A;  5JH7 A;  2YC0 A;  4PA4 A;  2Z0A A;  5LMU O;  4UVA A;  3Q4H B;  1SZX A;  4LBE C;  4I0X B;  1XI1 A;  1NBM G;  1ROP A;  4JZG A;  2JGD A;  2Y69 C;  3HKE A;  4JI8 O;  5FPR A;  1SQB H;  2ADP A;  4JYA B;  4X65 B;  3A0B Z;  2W6J G;  1GN4 A;  1VQ5 V;  1S0V A;  2HFE C;  4TQF A;  4FZ1 A;  3CCQ V;  2WLN A;  2P22 C;  5B1A C;  5IE9 A;  4JYB A;  2OCH A;  1K4C C;  5LGN A;  2LW7 A;  2KKW A;  4FPP A;  5JWP A;  2CDY A;  3K03 A;  3CCJ V;  1MZE A;  1MSW D;  3OAA G;  4DV0 B;  1MG1 A;  1IBM O;  2ODM A;  5CA0 B;  4P30 A;  3N2K A;  4H0L B;  4KFM A;  4GUN A;  2FTK A;  3FAV A;  1P4R A;  2IBZ H;  1Y4M A;  1GRJ A;  2ZXW B;  1KBH A;  1H2N A;  5IJ0 A;  1FD9 A;  5LP6 C;  3CP1 A;  4AI8 A;  1PNL A;  4FLZ A;  5KMG A;  1JR9 A;  1K34 A;  3E22 B;  2E76 B;  3MAQ A;  2EIK B;  2OTJ V;  2E3C A;  2EZO A;  2WAM A;  4B3M B;  3Q4H A;  4YHH B;  5C8Y B;  4TV9 A;  2Y0I A;  4DR3 B;  4GKK B;  4FFB A;  4LF5 B;  1NH2 B;  2OTL V;  3ZBH A;  3T4Z A;  4CS4 A;  2A3Q A;  1GN6 A;  3HB3 B;  5KAF Z;  2Q7H A;  5B1O A;  4LF8 B;  4R50 A;  1RSO A;  1W2B U;  4LFB O;  3HKB B;  3PJS K;  4DV2 B;  3ZED A;  4CH6 A;  4DYL A;  1Y76 B;  4L87 A;  1TUE B;  1WJZ A;  2CTP A;  2EJ7 A;  1O9H A;  3G67 A;  2NLJ C;  4PHZ A;  1XMQ O;  4FLX A;  3JAW A;  4XDK A;  3S3X A;  2XUM A;  3J80 N;  5HFL A;  1M90 W;  4J7Z A;  4IYI A;  4DV3 O;  3A8T A;  3OMI B;  1VF6 C;  4OX9 B;  1ORQ C;  5CA0 A;  3CC7 V;  2LGQ A;  3T1H B;  1WPB A;  1CP9 A;  4LF4 O;  2ATK C;  5EYP A;  2BCC H;  4I5S A;  3CB2 A;  1WNS A;  2PI4 A;  2BSK A;  2ZR2 A;  4DV7 B;  1NVP B;  4DR2 B;  4DR1 B;  1PPJ H;  2H3O A;  1IBL O;  1IXM A;  3ETQ A;  1DGS A;  2JK5 C;  3ZN0 A;  4X66 O;  1AR1 B;  1GN2 A;  3X2Q B;  1N0J A;  1GM7 A;  3DC5 A;  3W7U A;  4DR6 B;  5KLV H;  5C8Y A;  3CYO A;  4DO2 A;  1HNZ B;  1X59 A;  4YJ3 B;  3C3T A;  3J81 N;  2ITC C;  1RM1 C;  2MW2 B;  4YJ2 A;  4U3F H;  2QR4 A;  1I5Y A;  1XHX A;  2IJK A;  1B04 A;  1Q43 A;  3W7T A;  4DV5 B;  3CCV V;  2BTO A;  3K08 A;  1V9P A;  5EC2 C;  3HKB A;  3N27 A;  4R6Z A;  3MDS A;  2VQF O;  3K0G A;  3E8F A;  2N74 A;  4LF7 O;  1Y76 A;  1S5L Z;  2ZNJ A;  5ITZ B;  1VQL V;  4BAY A;  1CXZ B;  4JGS A;  4FZ0 A;  2F93 B;  1BL8 A;  1K97 A;  1LR1 A;  4BW9 A;  1FJG B;  4KP4 A;  4MSW C;  2M7W A;  1N0N A;  2WLK A;  1NZ6 A;  4JV5 B;  1NTM H;  1BE3 H;  1K33 A;  1VQP V;  4I9W A;  4HYO A;  2GSM B;  4RUF A;  2QTO A;  1JJ2 U;  4B3T B;  1R3K C;  5H6Q A;  1H38 A;  2A0L A;  2CAZ C;  3FFQ A;  1JCH A;  1SQX H;  2YEV B;  3LDC A;  5B1N A;  3LUT B;  1M57 B;  3CJH A;  1GO3 F;  3H1I H;  3SDL A;  3ABK B;  1Q90 D;  2BOC C;  2Q0O C;  4UUJ C;  4JI2 O;  2XTA A;  3BPZ A;  1FXK B;  4AHC A;  2CGO A;  1IVS A;  1R3I C;  3D36 A;  3ZRX A;  4CBC A;  3E2E A;  1HDJ A;  1VQN V;  4J11 A;  3QG5 A;  2ETN A;  3RVY A;  5IY5 C;  1J5E B;  1THZ A;  2JJ1 G;  1RP3 B;  1GMG A;  4TUY B;  3ZHQ A;  3B77 A;  4HZ3 A;  1OCO B;  2CE4 A;  4JI3 B;  4ZOL B;  3AG1 C;  3AG2 B;  4EFB A;  4JTC B;  3SR2 C;  2LP7 A;  5GTH Z;  4JAA A;  2R9R B;  3QF7 A;  4I55 B;  3T4D A;  3UT5 A;  3JD0 A;  4C7U A;  1U97 A;  2XT9 A;  4JZ2 A;  5A2Q N;  1BGY H;  1Q82 W;  1HNW B;  3SJB C;  4R7C A;  2YXY A;  4FLY A;  2E75 B;  3CWB H;  2Q6A A;  1WPX A;  2PYJ A;  3QO5 A;  3WB2 A;  1XUQ A;  2YEV A;  2X0L A;  3K9S A;  2RN9 A;  2QGN A;  1QR9 A;  2Z3Y A;  4JI6 O;  2F4V B;  4ICG A;  2ZE5 A;  2EX3 A;  1GKF A;  3QO8 A;  1KQS U;  2CTW A;  1KP3 A;  3CCE V;  2RCV A;  3JSN A;  2X7R B;  3CE2 A;  4EEQ A;  2UUA B;  3ZN1 A;  3CD6 V;  1M5I A;  4TUY A;  4LH6 A;  2AXT Z;  4CS2 A;  1NI8 A;  1K5Q A;  4ZOL A;  5CB4 A;  1YCI A;  4DV1 B;  2LO1 A;  4Q20 A;  1TVK B;  2YI9 A;  4FLT A;  1PKX A;  4I55 A;  1HW7 A;  3QNE A;  2K9P A;  4K0K B;  1ZL8 B;  1AI6 A;  4HNA B;  1WB7 A;  1QQC A;  3OMA B;  3APQ A;  1KKC A;  4FVM A;  3ZHR A;  5DN6 G;  3ML0 A;  5L3F A;  3AG7 A;  4DUZ B;  4CZZ A;  1QLE B;  2N04 A;  5EBW C;  3HPL C;  2XAG A;  3ABM B;  1GAX A;  2L35 A;  2NR5 A;  4CS3 A;  4LFC B;  1BT8 A;  3RYC A;  4AIL C;  1WP7 A;  1N32 B;  1V55 B;  3CC2 V;  5IWA O;  2E74 B;  4MT8 A;  3P30 A;  5B1B B;  1Z5V A;  4UCT A;  1ARO P;  1EN4 A;  3FKS G;  4LFA B;  2EJR A;  3R65 A;  4FM2 A;  3K04 A;  2ZCE A;  2BTQ B;  3JCU Z;  2WA4 A;  2DYS C;  1S72 V;  3CCR V;  3JAS B;  4YY3 B;  4O4H A;  5KAI Z;  3RN4 A;  4YXW G;  3KKY A;  1DF5 A;  5DM6 V;  1BS3 A;  2RQ6 A;  1KKD A;  3K3W A;  3FB8 C;  3F5T A;  5CA1 B;  1TVK A;  2XAH A;  4MVQ A;  1YJN V;  3RWR D;  5EK0 A;  4A5U B;  5LGU A;  1YTF D;  2F23 A;  1XNR B;  4EFE A;  2UXC B;  4DK1 A;  5H9C A;  3C3S A;  4OXS A;  3JD3 A;  4E2L A;  2XAJ A;  3UO2 A;  3ZMS A;  3EXA A;  3L75 H;  3S3W A;  1E79 G;  5JCO A;  4JI7 B;  4H37 A;  3GVM A;  1Q81 W;  1I94 B;  2EIM C;  4AQY B;  3CC4 V;  1EZJ A;  1KUQ A;  4X62 B;  2QKC A;  3WB0 A;  5KUK A;  1FXV A;  3WFV A;  4K35 A;  3SJC C;  2W0X A;  4UCV A;  1FYJ A;  4X65 O;  1GM9 A;  4UVC A;  1K4D C;  1MA1 A;  1JJO A;  3RT3 C;  1VIB A;  1GH6 A;  3JAS A;  3ZS8 C;  1P7G A;  5FLX N;  3OT7 A;  2XND G;  4FJC C;  4UV9 A;  2EIL C;  2DWE C;  1FFX B;  4DR4 O;  2XOK G;  5CA1 A;  5LA6 B;  3K5N A;  4CH5 A;  2Q0A A;  4B3S B;  1IZ3 A;  3W7W A;  1K5S A;  1EM1 A;  5AG2 A;  1NTK H;  2IJI A;  1OCR B;  5IYD O;  2QM7 A;  3CCU V;  3WG7 B;  5B66 Z;  1YXB A;  4LF9 O;  4JYC A;  1LUW A;  2FL4 A;  3K0D A;  3R66 A;  4KUM A;  2B1G A;  3RYH B;  2FML A;  1SRY A;  4B3M O;  1T5E A;  2OWO A;  4YHH O;  3DTU B;  5K1X A;  2YIB D;  2F66 C;  2WLM A;  4IHJ B;  3LSU A;  2UU9 O;  4JF3 A;  2ZXW C;  2PI5 A;  5IDJ A;  4K8Z A;  1EN6 A;  2P4V A;  2KG7 B;  4LF8 O;  5IYB O;  1YSC A;  4DV2 O;  4DRX B;  5BZB A;  1S77 D;  2CGN A;  2EIK C;  1VEW A;  1KD1 W;  1VF5 B;  3FYI B;  3B2E E;  3B40 A;  1WAZ A;  1COW G;  4TV8 B;  1VQ6 V;  2HHH B;  4DV4 B;  1PNM A;  2VRZ A;  4OX9 O;  1N36 O;  3KG2 A;  5H5N A;  4I4T B;  4YIO A;  2IW5 A;  2DWD C;  2LW1 A;  1E1Q G;  1N8R W;  3ABT A;  4DR2 O;  1QLN A;  1JOY A;  1YZB A;  3VQX A;  4DR1 O;  1PNK A;  5D5Q A;  2BE3 A;  4B3R B;  3AG4 B;  4RQE A;  3NR7 A;  5HFM A;  1B06 A;  2V4D A;  1HNZ O;  1QHT A;  3AG3 B;  3ZMU A;  4LR3 A;  4NKG B;  2YIC A;  4DK0 A;  4JI5 B;  2VS0 A;  4DV6 B;  2UXX A;  1BSM A;  2IU3 A;  4DV5 O;  4E4E A;  1Q6I A;  3K5L A;  4J41 A;  4DRX A;  4FM1 A;  1RPO A;  1YF2 A;  2BOB C;  1ZTE A;  1D2D A;  1R6T A;  4JI1 B;  3X2Q C;  2JEU A;  1IUR A;  3CRR A;  2VWK A;  5J2T B;  1AJQ A;  1AI4 A;  3P3N A;  3OUF A;  2P6J A;  3BFR A;  4TV8 A;  1SQG A;  2Q7G A;  3HKC A;  3D36 C;  1V54 C;  2OIG A;  1KP2 A;  2QE7 G;  3JAT B;  2HKO A;  3JD4 A;  4J42 A;  4IGG A;  3OTO B;  2UUB O;  4O4J A;  3SGI A;  3SYC A;  2R70 A;  2KSD A;  1DK1 A;  1IBK B;  4B3T O;  2JEX A;  2DE0 X;  1BQ0 A;  3VBB A;  1XOU A;  1XDC A;  5LGT A;  4I0X A;  2QM4 A;  3ZMV A;  4UCU A;  1YDX A;  2N05 A;  3ASO C;  3MHH C;  1Y6X A;  1M56 B;  2WSS G;  2HVK C;  4X20 B;  3L74 H;  2PY5 A;  3DXR B;  1SA0 B;  4WFF A;  2XHB A;  1AIL A;  3F5W C;  1NKD A;  3RW0 A;  4J10 A;  3VOU A;  2EIN B;  1XL6 A;  4ZHQ B;  5IJ9 B;  2QKS A;  1AJP A;  1K3E A;  1WA8 B;  5CBH A;  2QWR B;  2Q67 A;  3K59 A;  4XBF A;  4CH3 A;  1J5E O;  1MAB G;  3SYO A;  3B8N A;  1Z2G A;  1Y74 B;  1I7F A;  4PEL A;  3TET A;  4JI3 O;  4DR7 B;  4O2B B;  4LH7 A;  5L3B A;  1M93 A;  2XAS A;  1U96 A;  4TQD A;  2JJ2 G;  5J2T A;  5KHH A;  1GN3 A;  2IJH A;  4DUY B;  4I7Z B;  1J95 A;  4EB6 B;  2YXL A;  3L73 H;  4BW5 A;  1AR5 A;  1W59 A;  1NU1 H;  2H8P C;  4NVP A;  1AP5 A;  2GV9 A;  3D3I A;  3HKD B;  3AK3 A;  2C2A A;  3JAT A;  4UFZ A;  3CRA A;  4L8J A;  3ASN C;  2LFR A;  3A2F A;  3E22 A;  1NR7 A;  4QE7 A;  3K06 A;  5DEC A;  3AK1 A;  4NXN B;  5B3S B;  5LMU B;  1N33 B;  2DW4 A;  3TXQ A;  3CRQ A;  1OCZ C;  3DXR A;  1SA0 A;  4PA9 A;  1L0N H;  3JAL B;  2DYR B;  1WN7 A;  2Q68 A;  4ZHQ A;  5KHK A;  4UB6 Z;  4GX0 A;  1QR8 A;  5LHI A;  4J7J A;  1Y67 A;  2K1E A;  4P9O A;  4WFA V;  3IJ4 A;  1KC8 W;  1SKV A;  5KUM A;  3SJA C;  1Y74 A;  4KHP B;  1FKA O;  2M6Y A;  2ZDI A;  5LP6 B;  3CX5 F;  2P7T C;  4O2B A;  3ZRS A;  1MNG A;  4N23 A;  1AVM A;  4GYC B;  2RNB A;  4EB6 A;  1IBM B;  4K0K O;  5A9G A;  3BY6 A;  4WFE A;  2R9I A;  3HKD A;  4B7K A;  2LGW A;  1ZWI C;  1N34 O;  3U0Z A;  5KA6 A;  2HJF C;  3ETG A;  4LC1 A;  4ZBM A;  3H01 A;  5IT9 N;  2VQE O;  4LFC O;  1N32 O;  4NTW A;  4GKJ O;  4RQF A;  4JYY A;  5BR8 B;  1QVF U;  2ZT9 B;  4YJ3 A;  1KB9 F;  1SS3 A;  5JVD B;  1H2S B;  1NS1 A;  2ZQM A;  3I56 V;  5JJJ B;  2HLD G;  1NJI W;  4OPA A;  4NB5 A;  1Q7Y W;  5CMU A;  2E5L B;  2HJD A;  3JAL A;  2HEP A;  1QLE C;  4X1I B;  4QPK A;  2QWO B;  3ABM C;  5ITZ A;  2L6L A;  4UXN A;  5JCO C;  4W4L A;  4Z1V A;  1V55 C;  4LFB B;  4X8A A;  5B1B C;  4J9Y B;  5IYZ B;  3FB6 C;  2UUC O;  2GDS A;  5KX5 B;  1XMQ B;  4NXM O;  3VQY A;  4BR6 A;  4DV3 B;  1GTO A;  4GZR B;  2LQT A;  1XQ8 A;  4NR1 A;  4DXW A;  1H2K A;  3OR7 C;  1YIT V;  4LF4 B;  1RM1 B;  4JI4 O;  1XNR O;  1DTO A;  2FYU H;  3CXC U;  3VQV A;  4LF6 B;  1FFT B;  4PDR A;  1Q3E A;  5CN0 A;  4DW1 A;  1IBL B;  1ZX3 A;  1I94 O;  3UM7 A;  5LMN B;  3WB1 A;  4X66 B;  3SYP A;  3GWO A;  4ABM A;  4FFK A;  2WLJ A;  3CRC A;  2WLI B;  3J7A U;  3SJQ C;  2Y0P A;  1OHH G;  1FXK A;  3SPG A;  3IFX A;  4DR5 O;  2A9H A;  5E79 Z;  4K8X A;  2ZIO A;  1US6 A;  3T1Y O;  1LUV A;  2QEX V;  2QWP B;  4WBN B;  5EZY B;  4D7T A;  5L3E A;  2X6A A;  1VF7 A;  4D6T H;  4X1I A;  2GTS A;  4PA7 A;  4JPR A;  5GON B;  2AZ0 A;  2P4K A;  4J80 A;  4QE9 A;  1R3J C;  5K1P A;  4P9P A;  1R3L C;  4NYK A;  4N21 A;  2VQF B;  2HP8 A;  3EFF K;  4LF7 B;  3ICX A;  5IYZ A;  4UB8 Z;  4FMT A;  4X64 B;  3O65 A;  1PM9 A;  1Q6H A;  1HNX B;  1D5N A;  1XEQ A;  2GUZ B;  4RO2 A;  2IJJ A;  5GW7 A;  5FL7 G;  3ZCC A;  1OZ0 A;  1HP8 A;  2Q9L A;  4MTF A;  4FIP C;  2A7W A;  1FAF A;  1XBL A;  3JD2 A;  3CCM V;  5LOV B;  3OUS A;  1AI7 A;  1SER A;  3E35 A;  3RGB A;  2ITD C;  2QJ1 A;  1OCC B;  4I50 B;  1OV9 A;  3RFR A;  2B5U A;  1DLB A;  3BEH A;  2QSA A;  3LDD A;  4XDJ A;  2OCC B;  5EBL C;  3ZHT A;  4MW8 A;  3H1L H;  2VWJ A;  3AG1 B;  3ABU A;  2WLI A;  1PD3 A;  4JI2 B;  1P7B A;  1D5A A;  4BIZ A;  2JRI A;  3P3P A;  1XMO B;  3SYA A;  4OGQ B;  4IIJ B;  5GON A;  3BRC A;  4JTA B;  3JAR B;  3CHX A;  3ETD A;  1AR4 A;  5BY1 A;  5F2V O;  1QU7 A;  1ZL8 A;  2FB5 A;  3L71 H;  2QWN B;  4HNA A;  1QNM A;  3CPW U;  3CRM A;  4EKW A;  2HHH O;  2IH3 C;  1VQM V;  5EIB C;  1YVW A;  1KEC A;  5J2U B;  3N2G B;  4PDM A;  4U3J B;  3W7X A;  3OGI B;  5LOV A;  4QNH B;  4B7E A;  2PF4 E;  4LNU B;  4XDL A;  3PN1 A;  3CCL V;  5H6R A;  4Z1M G;  1H8H G;  1TUB B;  4D7S A;  2V7Q G;  2BTQ A;  4JYA O;  2D3O W;  4MVS A;  1G8M A;  1B6Q A;  3TJT A;  2F95 B;  5KA5 A;  3UQ8 A;  3ABL C;  2Q69 A;  4ZIB A;  3OM3 B;  2ZIM A;  4GLX A;  4W4K A;  1BZK A;  4PI2 A;  3CCS V;  4X1Y B;  3TGU H;  5DED A;  3CEI A;  5KHI A;  3JAR A;  1VQ8 V;  3AG4 C;  4DV0 O;  4PJ0 Z;  1AJN A;  2IM9 A;  3P32 A;  1YTF B;  2H94 A;  2PZS A;  5IYC O;  2NN4 A;  1BHB A;  2AW9 A;  1H2M A;  3AG3 C;  4O2A B;  5BMV B;  5LHG A;  1ZLZ A;  2ZD9 A;  3I5D A;  1XRE A;  3K57 A;  5JQG B;  1Q5O A;  5L3C A;  4FLV A;  3JCZ A;  4X9Q A;  3OTO O;  2ZNI A;  3H1J H;  4U3J A;  2W0F C;  1G1X B;  1IBK O;  4RUE A;  2JS3 A;  5FNV B;  2P5O A;  1VQK V;  4LNU A;  2JS5 A;  5JH7 B;  3K5O A;  5IWA B;  4DR3 O;  4GKK O;  1AI5 A;  1TUB A;  2ARH A;  4LF5 O;  3JSL A;  4BIU A;  2GHY A;  5H2F Z;  2JGD B;  1WB8 A;  2UXN A;  4U7N A;  2R9A A;  3AEI A;  3IC7 A;  1LNQ A;  1P84 F;  4TT3 G;  1BCC H;  2F1M A;  1CPY A;  5EC1 C;  4X1Y A;  1M56 C;  1FFX A;  5LA6 A;  1HR0 B;  3BHP A;  2W6I G;  3APO A;  3BAB A;  2R72 A;  3T1H O;  2EIM B;  2XAF A;  2QA4 V;  1FPO A;  4LP8 A;  2Q7E A;  5C93 A;  5BMV A;  2WLL B;  3U11 A;  4DV7 O;  3ZMZ A;  3K79 A;  4CC5 A;  3OEE G;  3OEH G;  3VQW A;  3ZHU A;  2JVD A;  2QM8 A;  2ADQ B;  2Y4T A;  2YXH A;  3KCY A;  3RYH A;  1F23 A;  2ZDI C;  1I0H A;  4Z2W A;  2X6B A;  5FNV A;  2ZM6 B;  1PL4 A;  5B5E Z;  4DR6 O;  2CTQ A;  4NXN O;  2QWQ B;  3UCS C;  1N33 O;  5D5P A;  4IHJ A;  1IDS A;  2B9Z A;  2KQX A;  2QKA A;  2ZE6 A;  1VMG A;  2EIL B;  3JAK B;  4TV9 B;  1S3J A;  1HWY A;  2V1D A;  4FFB B;  2KG7 A;  4BIO A;  4GX2 A;  2Z5U A;  3ZHS A;  4OPH A;  1NH2 D;  2Y48 A;  1EFR G;  2Q8V A;  3IAY A;  1RSO B;  1JPX A;  4RWU A;  1KU9 A;  2HG5 C;  2YUA A;  1YI2 V;  4KHP O;  1VAR A;  1VQ9 V;  1FJG O;  1ENV A;  5B3S C;  1B3Q A;  3RVZ A;  3A0H Z;  4JV5 O;  4JAU A;  1IX9 A;  1BHA A;  3JAW B;  4DR4 B;  1PV0 A;  2DYR C;  1MZF A;  4I4T A;  2WLL A;  1L8D A;  3GWK C;  4JI0 B;  2YIA A;  2UXB B;  5BXZ A;  3THO A;  5EYP B;  4H33 A;  2BSK B;  4F4L A;  3ZRW B;  2EIJ B;  3IC9 A;  3LDE A;  2UXD B;  2YDE A;  2YIB A;  4LF9 B;  1OJH A;  1NVP D;  4PD4 F;  1Q86 W;  5BR8 O;  4UV8 A;  3B8M A;  5LXT B;  3O9O A;  1UFI A;  2ZIN A;  4JTD B;  3H9V A;  4F6R B;  3JAK A;  3BVO A;  2E5L O;  1SQP H;  1URF A;  4FLW A;  4YJ2 B;  2UU9 B;  1M57 C;  4H44 B;  5FPO A;  1XNQ B;  1W0J G;  3ABK C;  1KMI Z;  3MHS C;  4KL1 A;  1S76 D;  4I9Q A;  3FB7 C;  2AZ2 A;  3DGE A;  4IYH A;  1MOF A;  2Q5Z A;  3DC6 A;  1FXK C;  3G71 V;  1PP9 H;  3OD4 A;  3SPI A;  4UVB A;  2Y69 B;  2EUL A;  3EHB B;  4G27 B;  2P90 A;  3NXS A;  1S5J A;  1L1F A;  1HNW O;  1UJW B;  5LYJ B;  1OCO C;  2QTS A;  1N4C A;  3L72 H;  4WFG A;  4NTY A;  3STZ C;  3M8A A;  1N36 B;  4UCR A;  3AG2 C;  2PUS A;  3ZRW A;  5B1A B;  4MVO A;  4PDV A;  1K92 A;  4LF6 O;  4X20 A;  4O4I B;  3ZMT A;  4CH4 A;  2F4V O;  3CJH B;  4MS2 A;  1K73 W;  2ZKO A;  1YHQ V;  4IT5 A;  3MD0 A;  5LMN O;  3B09 A;  5L3D A;  4JI8 B;  1JQ0 A;  5LXT A;  1KYO F;  2ILM A;  5IJ9 A;  2JIZ G;  1WA8 A;  2YS8 A;  4F6R A;  2UUA O;  2YID A;  3FB5 C;  1V54 B;  3IGA C;  3QVN A;  1EN5 A;  4DV1 O;  3AK2 A;  1CEZ A;  4LWS B;  1R73 A;  4F6E A;  3ETE A;  5LBQ A;  1WLE A;  1X4T A;  1ZUQ A;  2A06 H;  2PGG A;  3SPJ A;  1M1K W;  3ASO B;  3TXS A;  4X64 O;  3G6B A;  1SQQ H;  4JAS A;  1HNX O;  3TCU A;  3UT5 B;  4QPJ A;  4GCZ A;  4DUZ O;  4HBN A;  3H1K H;  5LYJ A;  2WA3 A;  1Q6U A;  1JA8 A;  1R1B A;  2Y4U A;  1SQV H;  3RYF B;  4G28 B;  2UUB B;  1H2L A;  1R6N A;  2YSU B;  2KB1 A;  4ASU G;  2DJV A;  1R6K A;  4O4L B;  4LFA O;  2DN9 A;  3FYE B;  4O4I A;  3WU2 Z;  1XHZ A;  1VQ4 V;  1JFF B;  5LL6 Y;  2DQ0 A;  3FD9 A;  2AHZ A;  1NR1 A;  3G4S V;  4YY3 O;  3F7Y C;  3SPC A;  3BA8 A;  1XMO O;  3LNM B;  3OE7 G;  1OCC C;  5LP6 A;  3ASN B;  3T1C A;  2GBO A;  3E8G A;  1SES A;  3ZJZ A;  4LWS A;  2OCC C;  4TSF G;  1SET A;  2AHY A;  5CB4 B;  4JAV A;  3BA9 A;  5CBG A;  2JGU A;  1QBZ A;  4FM0 A;  5E1A C;  1SC5 B;  3T2M A;  2UXC O;  1OCZ B;  3DSQ A;  4WFB V;  4FK5 C;  4PV1 B;  3TK1 A;  3RYF A;  4JI7 O;  1EZV H;  3JD1 A;  1TA8 A;  2CK3 G;  1NT2 B; 
#chains in the Genus database with same CATH homology
 2A79 B;  1PNK A;  1IXM A;  3K9A A;  3ZN0 A;  2JK5 C;  4XDL A;  3JYC A;  3CCL V;  5H6R A;  1AR1 B;  3AG4 B;  4Z1M G;  1H8H G;  4RQE A;  3X2Q B;  1GM7 A;  5HFM A;  3W7U A;  2V7Q G;  4LCU C;  1JVM A;  3CYO A;  4MVS A;  4DO2 A;  2D3O W;  1G8M A;  1B6Q A;  2ITC C;  1RM1 C;  3AG3 B;  5J9P C;  3ZMU A;  5KA5 A;  1FXH A;  1I5Y A;  1NQT A;  3I55 V;  3ABL C;  4U7O A;  2Q69 A;  2IJK A;  3CMA V;  3OM3 B;  3W7T A;  2UXX A;  2IU3 A;  3CCV V;  2HVJ C;  3K08 A;  5EC2 C;  4R6Z A;  3CCS V;  4HAM A;  3K0G A;  3E8F A;  1RPO A;  2BOB C;  1VQL V;  4BAY A;  1VQ8 V;  3AG4 C;  4JGS A;  3X2Q C;  2JEU A;  4R8C A;  1AJN A;  1VQ7 V;  2NNU A;  1BL8 A;  1K97 A;  3P32 A;  1YTF B;  2H94 A;  1AJQ A;  1AI4 A;  3OUF A;  3LSS A;  4KP4 A;  1M9N A;  2X6C A;  4MSW C;  5IYC O;  2M7W A;  1JX9 A;  2P6J A;  1BHB A;  2WLK A;  4MVU A;  3AG3 C;  1QVG U;  2F43 G;  5LHG A;  2ZD9 A;  1K33 A;  1VQP V;  3E8B A;  1V54 C;  1XL4 A;  4I9W A;  1KP2 A;  4HYO A;  1GM8 A;  2QE7 G;  1SZT A;  2GSM B;  4MTX A;  5L3C A;  1VQO V;  1YIJ V;  2HKO A;  3JD4 A;  4RUF A;  3JCZ A;  2QTO A;  3SYC A;  1JJ2 U;  1R3K C;  5H6Q A;  4MVR A;  2A0L A;  3E83 A;  1H38 A;  2W0F C;  2JEX A;  3VBB A;  5IY5 B;  1K7D A;  4RUE A;  1JCH A;  2YEV B;  4WFH A;  3LDC A;  5B1N A;  3LUT B;  1M57 B;  3ZMV A;  5LGT A;  5EBM C;  1VQK V;  4P2Z A;  3ASO C;  3MHH C;  1GO3 F;  1M56 B;  3ABK B;  3ZRV A;  2WSS G;  1F4N A;  4GX1 A;  2HVK C;  1AI5 A;  2BOC C;  4UUJ C;  4WFF A;  3F5W C;  1NKD A;  1K9M W;  3RW0 A;  1OCR C;  4BIU A;  2GHY A;  3SPH A;  3VOU A;  2EIN B;  3RBZ A;  1XL6 A;  2EBO A;  3WG7 C;  1FXK B;  2QKS A;  2UXN A;  1R3I C;  3D36 A;  2IH1 C;  4U7N A;  1AJP A;  3ZRX A;  4CBC A;  1K3E A;  3STL C;  3AEI A;  3IC7 A;  5CBH A;  1LNQ A;  3E2E A;  1VQN V;  2XAQ A;  3UKM A;  2Q67 A;  3RVY A;  5IY5 C;  4TT3 G;  4XBF A;  4WCE V;  1THZ A;  2JJ1 G;  1MAB G;  1GMG A;  3SYO A;  3B77 A;  3B8N A;  3ZIA G;  4HZ3 A;  1OCO B;  1CPY A;  3E86 A;  5EC1 C;  4PEL A;  3AG1 C;  3TET A;  1M56 C;  3AG2 B;  4JTC B;  5L3B A;  2XAS A;  2LP7 A;  2W6I G;  2JJ2 G;  3QO7 A;  2R9R B;  3T4D A;  4MVM A;  2IJH A;  2EIM B;  2XAF A;  2QA4 V;  3JD0 A;  4LP8 A;  1J95 A;  5C93 A;  1Y66 A;  4BW5 A;  2WLL B;  3CME V;  3ZMZ A;  2EZP A;  3K79 A;  3M99 B;  1Q82 W;  2H8P C;  3OEE G;  3D3I A;  3OEH G;  2C2A A;  3W7S A;  2WWW A;  2QM8 A;  3ASN C;  2LFR A;  4R7C A;  2HR3 A;  3OGC C;  2Q6A A;  1WPX A;  3GB7 C;  4WF9 V;  1NR7 A;  1F23 A;  2ZDI C;  3F7V C;  3QO5 A;  4QE7 A;  2YEV A;  2X6B A;  2X0L A;  3K06 A;  4QIW F;  5B3S B;  1EBO A;  2DW4 A;  1QR9 A;  2Z3Y A;  1K8A W;  1OCZ C;  2P67 A;  1S5H C;  4PA9 A;  2EIL B;  1GKF A;  3QO8 A;  1S3J A;  1KQS U;  2WLH A;  2DYR B;  1KP3 A;  2Q68 A;  3CCE V;  1HWY A;  2V1D A;  4J9Z B;  4GX2 A;  1QR8 A;  2X7R B;  4GX0 A;  5LHI A;  2K1E A;  4P9O A;  3ZN1 A;  2Z5U A;  4WFA V;  1NH2 D;  3CD6 V;  2Y48 A;  1EFR G;  4QJF B;  1KC8 W;  4TWK A;  5KUM A;  4G2K A;  1JPX A;  2HG5 C;  1YI2 V;  2ZDI A;  1DF4 A;  1K5Q A;  1VQ9 V;  1ENV A;  2P7T C;  5B3S C;  3ZRS A;  3RVZ A;  1FS0 G;  4Q20 A;  4MW3 A;  4JAU A;  3SYQ A;  1PKX A;  1BHA A;  3A0R A;  4X89 A;  3QNE A;  4N23 A;  1YJ9 V;  2DYR C;  1AI6 A;  3BY6 A;  2WLL A;  4WFE A;  3OMA B;  2R9I A;  5DN6 G;  3ML0 A;  5L3F A;  3OW2 U;  2DYS B;  4CZZ A;  1QLE B;  1ZWI C;  4H33 A;  5EBW C;  3HPL C;  4F4L A;  5KA6 A;  1H2G A;  2HJF C;  3ETG A;  4LC1 A;  4ZBM A;  2EIJ B;  2XAG A;  1QCE A;  3ABM B;  3ZRW B;  3H01 A;  5CBF A;  3LDE A;  1YJW V;  2OT5 A;  1V55 B;  3CC2 V;  4PA3 A;  2JDI G;  4GT1 A;  4RAI A;  1NVP D;  4MT8 A;  4X88 A;  4RQF A;  2LFS A;  3P30 A;  5B1B B;  1Q86 W;  1QVF U;  1ARO P;  2WPD G;  3FKS G;  4UV8 A;  2EJR A;  3B8M A;  2ZQM A;  3R65 A;  4MVZ A;  5CA3 A;  3E8H A;  3I56 V;  2IU0 A;  2HLD G;  1NJI W;  1F4M A;  4JTD B;  3K04 A;  1Q7Y W;  5CMU A;  4PA6 A;  2ZR3 A;  3OR6 C;  2DYS C;  1S72 V;  3CCR V;  1QLE C;  1M57 C;  2MK3 A;  4QPK A;  2EIJ C;  3ABM C;  1BMF G;  1E1R G;  1W0J G;  3ABK C;  4UXN A;  1H8E G;  3MHS C;  1S76 D;  4YXW G;  3FB7 C;  1V55 C;  3OMN B;  5L3G A;  4X8A A;  2DQ3 A;  1DF5 A;  3DGE A;  5DM6 V;  1KKD A;  5B1B C;  1F51 A;  1W0K G;  4J9Y B;  1MOF A;  1GK9 A;  2EIN C;  3K3W A;  1FXK C;  3FB6 C;  3FB8 C;  4MTG A;  3G71 V;  2XAH A;  4MVQ A;  1YJN V;  3SPI A;  4UVB A;  2Y69 B;  5EK0 A;  1RPR A;  3EHB B;  2B1I A;  4G27 B;  3G6E V;  2P90 A;  3NXS A;  1L1F A;  1GTO A;  5LHH A;  4MTO A;  1UJW B;  1I5X A;  5LGU A;  1YTF D;  1G4Y B;  3E89 A;  4DXW A;  1OCO C;  3OR7 C;  1YIT V;  3OFN G;  1RM1 B;  4WFG A;  4PDL A;  3STZ C;  1DTO A;  4GX5 A;  5H9C A;  4OXS A;  3JD3 A;  3CXC U;  4E2L A;  2XAJ A;  3AG2 C;  3ABL B;  3ZMS A;  1PL0 A;  3ZRW A;  5B1A B;  4ZKI A;  4MVO A;  3LSQ A;  4PA4 A;  1E79 G;  4PDV A;  1FFT B;  4H37 A;  4PDR A;  1K92 A;  5CN0 A;  1Q81 W;  4UVA A;  3ZMT A;  2EIM C;  3CC4 V;  4LBE C;  4MS2 A;  3UM7 A;  1K73 W;  1NBM G;  1YHQ V;  1EZJ A;  3MD0 A;  3SYP A;  3GWO A;  1ROP A;  5L3D A;  2WLJ A;  1JQ0 A;  2WLI B;  2Y69 C;  3SJQ C;  3SPG A;  1OHH G;  1FXK A;  2JIZ G;  5KUK A;  1FXV A;  3IFX A;  3WFV A;  2A9H A;  2W6J G;  2QEX V;  1GM9 A;  1VQ5 V;  1S0V A;  4UVC A;  1K4D C;  2HFE C;  5L3E A;  2X6A A;  3FB5 C;  3CCQ V;  1V54 B;  4PA7 A;  2WLN A;  4JPR A;  5B1A C;  3IGA C;  4QE9 A;  4JYB A;  1R3J C;  1K4C C;  4P9P A;  1R3L C;  2XND G;  5LGN A;  1CEZ A;  4N21 A;  3EFF K;  1R73 A;  4FPP A;  3ETE A;  3K03 A;  4FJC C;  4UV9 A;  3CCJ V;  2EIL C;  5LBQ A;  2DWE C;  1MSW D;  3OAA G;  2XOK G;  1WLE A;  1MG1 A;  3SPJ A;  1M1K W;  4FMT A;  3ASO B;  4P30 A;  4JAS A;  4RO2 A;  4KFM A;  2IJJ A;  2FTK A;  3TCU A;  5GW7 A;  4QPJ A;  4GCZ A;  1P4R A;  1K5S A;  3W7W A;  5FL7 G;  1Y4M A;  3ZCC A;  2IJI A;  2ZXW B;  1OZ0 A;  4MTF A;  1OCR B;  4FIP C;  5IYD O;  2QM7 A;  3CCU V;  3WG7 B;  4G28 B;  3CP1 A;  3JD2 A;  3CCM V;  3OUS A;  1R6N A;  1AI7 A;  1PNL A;  3E35 A;  1SER A;  2YSU B;  2ITD C;  2KB1 A;  1OCC B;  4JYC A;  4ASU G;  1K34 A;  1R6K A;  3K0D A;  2EIK B;  4KUM A;  2B1G A;  2OTJ V;  2B5U A;  3FYE B;  1DLB A;  3BEH A;  2EZO A;  2WAM A;  1SRY A;  3LDD A;  4XDJ A;  2OCC B;  5EBL C;  4MW8 A;  3DTU B;  1VQ4 V;  3AG1 B;  3ABU A;  2WLI A;  1PD3 A;  2DQ0 A;  1P7B A;  1NH2 B;  2WLM A;  2OTL V;  2AHZ A;  1NR1 A;  3T4Z A;  4BIZ A;  3G4S V;  4JF3 A;  2ZXW C;  2PI5 A;  5IDJ A;  3F7Y C;  3HB3 B;  3SPC A;  5B1O A;  4R50 A;  3SYA A;  5IYB O;  1YSC A;  3LNM B;  3OE7 G;  1W2B U;  3PJS K;  1OCC C;  5BZB A;  4L87 A;  1TUE B;  4JTA B;  3ASN B;  1S77 D;  3T1C A;  2EIK C;  1KD1 W;  3E8G A;  1SES A;  3ZJZ A;  3ETD A;  3FYI B;  2OCC C;  2NLJ C;  4TSF G;  1SET A;  2AHY A;  4XDK A;  1COW G;  5HFL A;  4JAV A;  1M90 W;  5CBG A;  1VQ6 V;  1QBZ A;  1PNM A;  3OMI B;  3CPW U;  4EKW A;  5E1A C;  1ORQ C;  3CC7 V;  2IH3 C;  1VQM V;  1CP9 A;  1KEC A;  2ATK C;  3T2M A;  1OCZ B;  4WFB V;  3KG2 A;  4FK5 C;  4I5S A;  2PI4 A;  2ZR2 A;  4PDM A;  1NVP B;  3TK1 A;  2IW5 A;  2DWD C;  1E1Q G;  1N8R W;  3ABT A;  3W7X A;  3JD1 A;  1QLN A;  2CK3 G;  1JOY A;  4QNH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...