5BZBA

Navms voltage-gated sodium channel pore and c-terminal domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 34
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5bzbA00
4J9ZB 4KFMA 4JTDB 4LP8A 3UKMA 4MVMA 3RVZA 4OXSA 5EBMC 3AG3C 3IFXA 4H37A 3RW0A 5CBHA 2WLHA 4X88A 3OGCC 4F4LA 3JYCA 2A9HA 3K0DA 3RBZA 4GX0A 3TCUA 4MVRA 1KKDA 2X6AA 1V54C 1XL4A 3R65A 4PDMA 4WFFA 3T4ZA 2EIJC 1XL6A 1LNQA 2AHYA 2EIMC 3FB5C 3ASNC 4J9YB 4R50A 4R8CA 4PDVA 4R7CA 3SPHA 2KB1A 4I9WA 4MVOA 2BOBC 5EBWC 4P30A 2P7TC 3X2QC 2ITDC 4PDLA 3SPIA 5BZBA 3AG2C 3WG7C 3SYPA 2WLLA 3F7VC 2HJFC 4MTGA 1ORQC 3RVYA 3SYCA 1R3IC 2WLIA 4JTAB 3ABMC 1S5HC 3ZJZA 3F7YC 2HVJC 1K4CC 4MW3A 3ZRSA 4GX1A 5CBGA 5CBFA 4RAIA 3LUTB 3ABKC 3OR6C 3K0GA 3K04A 2JK5C 1JVMA 3E89A 5E1AC 2IH3C 4MVUA 3AG4C 3EFFK 5B3SC 4QNHB 4H33A 4PA4A 1R3KC 3GB7C 3UM7A 4PA7A 1V55C 4XDKA 1QLEC 5IY5C 3E8GA 3K06A 4HZ3A 2Y69C 2YEVA 2WLLB 4RO2A 4LBEC 5KUMA 1G4YB 4QE7A 4QE9A 2A79B 2EILC 4MW8A 3STLC 4PA3A 2WLJA 4RUEA 3FB8C 4PA9A 1R3JC 4HYOA 4XDJA 1K4DC 4MTOA 3E8BA 2Q67A 2EINC 3SYQA 4EKWA 3SPJA 2DWEC 3OR7C 4UUJC 2DYSC 1OCCC 2HFEC 1OCZC 4WFGA 4X89A 5B1AC 3ASOC 3SPCA 2BOCC 2IH1C 2QTOA 4LCUC 3T1CA 3LDCA 3VOUA 2Q69A 1R3LC 2X6CA 5KUKA 2AHZA 3E83A 2K1EA 4MVSA 5EBLC 3F5WC 4GX2A 4XDLA 2H8PC 3KG2A 3E8HA 4MVZA 4MS2A 2ZD9A 5J9PC 4X8AA 2WLMA 3BEHA 3OUFA 4WFHA 3TETA 1OCOC 2WLIB 3LDEA 1M57C 3AG1C 2DYRC 4WFEA 3SPGA 2Q68A 2ZXWC 4PDRA 3SJQC 4G28B 4RUFA 3E8FA 4PA6A 2X6BA 4CBCA 4R6ZA 1BL8A 1J95A 5EC2C 3T2MA 2WLKA 3K03A 2HG5C 3LDDA 3SYOA 3E86A 3FB6C 2W0FC 4G27B 2EIKC 1OCRC 4DXWA 4ZBMA 2R9RB 2QKSA 3ABLC 4P9PA 3PJSK 3OUSA 4GX5A 2ITCC 4TWKA 2A0LA 2DWDC 2OCCC 2Q6AA 1M56C 4MTFA 4P2ZA 5EC1C 2HVKC 3HPLC 4JTCB 4BW5A 2WLNA 1ZWIC 3K08A 3LNMB 4MVQA 3IGAC 5EK0A 5B1BC 3STZC 2NLJC 1P7BA 3FB7C 4P9OA 2ATKC 3SYAA 4MSWC 3T4DA
chains in the Genus database with same CATH superfamily
1YSCA 2ZDIA 3L9DA 3RVZA 2LFRA 4PHZA 4CS3A 1BE3H 4BIOA 1YTFD 2WAMA 4QPKA 4RWUA 3BHPA 2BE3A 5K1XA 1IZ3A 4H13B 1WPXA 2ADQB 3RT3C 1SZXA 1SC5B 2WSSG 4YJ2A 4IYHA 2ZT9B 4QPJA 4ZKIA 2UXCB 4J10A 1Q8IA 4I7ZB 2HJDA 1XNRO 4JI6B 4YIPA 2IH3C 5EZYB 3BFRA 1SQVH 2IM9A 1L0NH 4FFBB 2JGUA 3BA9A 1AI7A 1YZBA 2H3OA 5KUMA 3JSLA 1AJQA 5C8YA 4QE9A 1NTKH 2CGNA 3CXHF 1H8EG 5IYDO 3L75H 3CRQA 2A06H 4EKWA 3VQXA 2EIMB 2HFEC 4Q6GA 4X89A 2A7WA 1KU9A 2V7QG 2OTJV 1WB7A 4GX2A 4MVZA 1SQBH 3TK1A 3BEHA 4DUYO 4O4IA 1M9NA 1EM1A 3H1LH 4CS4A 4DUZB 1RM1B 1BQZA 4J11A 4JI0B 5L3BA 1NVPB 1BMFG 1BL8A 5JCOC 4NXMO 3SDLA 5C8YB 2EIKC 1RP3B 1AR1B 4LH6A 1O9HA 1AR5A 4O4LB 3ZHUA 3ABKB 1WLEA 2WWWA 3IGAC 4YJ3A 1WA8B 5ITZA 3CYOA 1YJWV 3SYAA 2VS0A 2VQEO 3ETGA 1M57B 4GKKO 2CH7A 2JEXA 3WB1A 3CMEV 1N32O 2CTWA 5CBHA 4CC5A 4B08A 1V54B 3RN4A 1K5SA 4B7EA 4DUYB 3ASOB 1BZKA 1VF5B 1OCCB 4J9YB 2ZIOA 3CWBH 3X2QC 1QLNA 1RSOA 2EILB 1YI2V 1HR0O 3OTFA 3RVYA 4LF9O 3THOA 5ITZB 3F7YC 5JQGA 1VQLV 1XUQA 1AJPA 4PJ0Z 1IURA 1A32A 4XDKA 4J7JA 5C93A 3I55V 4HZ3A 1JJ2U 4GCZA 3W7UA 2Q7EA 3K3WA 5H6QA 2YICA 5JCOA 1R3JC 2QM8A 2PF4E 4YY3B 3G67A 2Q4PA 3M99B 4JI1B 5L3FA 1TUBB 3VOUA 4I55A 5KUKA 4NXNB 4UV9A 2LW7A 2GTSA 3HKDA 4YHHO 3BABA 2BTOA 1YDXA 1AR4A 4X1YA 2YIBA 4WFEA 2Q7GA 4RUFA 3JAWA 1FXVA 5DM6V 4X20B 2LO1A 3U11A 3SYOA 5CA1A 2ETNA 4FM0A 1AILA 1KYOF 1ZL8A 3CCVV 3CRMA 3CMAV 4YHHB 1H2MA 3OUSA 2UXDO 2DWDC 2Q6AA 5HFMA 5BR8O 4B3RO 2XAHA 4DV1B 4DO2A 3STZC 2NLJC 2Q9LA 3HKBB 2YC0A 1EZJA 4DV3O 3DSQA 2JRIA 1R6TA 2XAFA 3AG2B 3KCXA 4JYCA 3JASA 4UFZA 3UKMA 1IBKB 3FKSG 1EBOA 2PUSA 1FD9A 1HDJA 3CEIA 1YITV 2RJZA 3JYCA 2X7RB 1EN6A 2QE7G 1KKDA 1TVKA 5CA1B 2F4VB 1D5AA 4WF9V 4I9QA 1QR9A 3D36A 3SYCA 2KSDA 4FMTA 3ABMC 4DV2B 4DK1A 1V55B 3JD1A 4NR1A 1I5YA 1OCRB 1NI8A 1XREA 4AHCA 5FNVA 4DR3O 1FFTB 2QKCA 1Y4MA 1TVKB 1EN4A 4LFAO 1MMMA 1MOFA 1Q90D 4TV9A 4XDJA 4MTOA 1S72V 1MNGA 2YS8A 3OR7C 2WA3A 1TGOA 1OCZC 2QWPB 4DV0B 4LC1A 4NVPA 4CS2A 1N36O 3M8AA 4JYAB 4NXNO 1R6KA 4IGGA 2HR3A 1K5QA 4XDLA 4JI1O 3A0RA 1S0VA 4X8AA 4AQYB 3FAVA 4YY3O 5B5EZ 4Z2WA 4OX9B 5LMNO 2W0XA 3G6BA 2XAJA 2GV9A 2HHHO 4CBCA 4UVCA 5FNVB 1MA1A 1F7YA 3K03A 2XAGA 1I7FA 3ABMB 1DTOA 4W4KA 2L35A 2OWOA 1M56C 1ZX3A 4JTCB 4BW5A 3ZIAG 1B6QA 3LNMB 3B8NA 4DR5B 5KHGA 2Y4UA 2RMKB 4LFBB 3I56V 1DLBA 2UUBO 1F51A 2LW1A 3CRAA 1Q7YW 1HR0B 2YI9A 4H37A 3H9VA 4FLVA 5KA5A 2AXTZ 5BXZA 1Q3EA 3CSXA 3QTCA 4H0LB 4R50A 2ZNJA 3P32A 3K79A 5H9CA 1MSWD 2UUAO 3MDSA 4G2KA 3SPIA 4F6RB 5BZBA 3WG7C 2UXCO 3ETQA 3IJ4A 2QJ1A 1FXHA 4UCSA 1K4CC 3CCJV 1Y74A 3HKCA 5IYZA 3OR6C 1N8RW 1JX9A 5LMUO 3OAAG 1NU1H 4DR1B 3ABUA 1GN2A 2Y69C 4J7KA 2DOSA 1AJNA 5LYJA 2VQFB 4O4IB 2DYRB 4PA9A 3H1HH 4B3SB 4DUZO 1OV9A 2DYSC 3EXAA 3K57A 3ZRWB 3T1CA 3LDCA 2DW4A 4DRXA 1WAZA 3E83A 1PD3A 1MSDA 3ETEA 1H2SB 5IJ9A 1YF2A 1U96A 4WFHA 3TETA 4OPHA 1IBLO 4LF8O 1H2LA 1Q5OA 4BAYA 3CCRV 2P06A 2QWRB 1P49A 1SETA 1QHTA 4CH4A 5L3EA 4G27B 2P4VA 4DXWA 2GUZA 2R72A 3CCMV 1SQXH 1YJ9V 4NTYA 1Z5VA 3G80A 4GKJO 4DRXB 4JI8O 4ZOLA 4I4TB 1KD1W 2DMXA 1VQ9V 1OCOB 1OCZB 1SKVA 4HBNA 1YHQV 3ZHQA 3RBZA 2Y0PA 4R8CA 3O65A 2KB1A 4YJ2B 4PDLA 4OPAA 1YXBA 3B2EE 3RWRD 3CCSV 1NKDA 3KZIZ 2FYUH 3K9AA 2RDCA 2OCHA 1NT2B 5CBFA 4X66B 1J5EB 1VP7A 5IDJA 2YXYA 4JI2B 4X64O 1SESA 4I55B 1IX9A 3ASNB 1PNLA 1JQ0A 1RPOA 4GUNA 4LF7B 4UCTA 2Q67A 3SYQA 4PD4F 2CTQA 4X20A 2EIJB 2V4DA 5LXTB 4LCUC 3BPZA 4DR7O 2R70A 3M7MX 5HFLA 1BGYH 1QU7A 2BTQB 1BHAA 3AG1C 4HAMA 4PDRA 2GHYA 3SJQC 3N2GA 1NTZH 3ZHTA 1GKFA 3DGEA 4UB6Z 2OCCB 3B40A 1EZVH 2EULA 4DK0A 1IBMO 2LP7A 1ZWIC 4DV7B 1THZA 5GW7A 5LXTA 4EEQA 1AP6A 2EJRA 1XQ8A 4L87A 1FXKB 4DR2O 5A2QN 4HNAA 2NR5A 5CN0A 4BWAA 5IWAB 2Q0AA 4JF3A 1TAEA 3CS5A 2B1GA 2DYSB 5KHKA 1HNWO 4RQEA 2OTLV 2G38A 3T1YO 1Q43A 2BOBC 1PL0A 2IJKA 5D5PA 1HNZB 1F4MA 4TOIA 3D3QA 5JH7B 3CRCA 1X59A 4QIWF 2WLIA 1GTOA 1WB8A 3OTOB 1KP3A 2ZM6B 3L73H 3EHBB 2YUAA 4J42A 2YXHA 4LR3A 5KMGA 3OW2U 1GN3A 3AG4C 4FZ1A 4JI4B 1N0NA 3K06A 4FJCC 1SQQH 4QE7A 3RYHA 4LF6B 3FD9A 3FB8C 4HYOA 3TXSA 3QNEA 2JGDB 4U3FH 3CJHB 1VF6A 4DV6O 2D2CB 3ML0A 2RCVA 3H1KH 4JI3B 1W0JG 3JAKB 1BS3A 1CEZA 4NTXA 2JIZG 3LDEA 5KMGB 1GRJA 3LNNA 1W2BU 2ZXWC 3CCLV 4ZHQB 1BT8A 2KKWA 1WN7A 1QQCA 3N2KB 1ZL8B 1CP9A 1H2GA 4FM1A 3ZMSA 5KLVH 2QR4A 2IW5A 4RQFA 4E4EA 1P7GA 3SR2C 1DF5A 2F23A 2VWKA 2YDEA 4PV1B 3APQA 4KHPO 2XT9A 4AI8A 2RNBA 1KBHA 1FYJA 3FFQA 4GZRB 2FB5A 4JTDB 3HR0A 4MVMA 5FPOA 4TSFG 1V9PA 4FM2A 3ZN1A 1IXMA 1E79G 1GM7A 2YEVB 3K5OA 4DV7O 3UQ8A 3RGBA 2PI4A 5B1AB 1XHZA 1VQ4V 3JD3A 5IYBO 3CPWU 1GAXA 2E5LB 2W6IG 1F23A 3CC2V 4ZI7A 4JV5B 2R9IA 3A2FA 5CA0B 1ORQC 5H6RA 3CHXA 5IY5B 1S5HC 5LYJB 2HVJC 4U3JA 3ZRSA 3I5DA 1PL4A 5CB4A 3CCQV 2JDIG 3EVKA 2ZNIA 1E1QG 3K0GA 1FJGB 4K35A 5E1AC 2XTAA 3ZRWA 4H33A 3GB7C 4PA7A 1V55C 2WPDG 3WB0A 4DR7B 2YEVA 4RO2A 2WLLB 3JSNA 1U97A 2OT5A 1NJIW 2IJIA 2IU0A 4DR6O 1ENVA 4LF8B 3SPCA 2QTOA 2RN9A 2K1EA 4AILC 1VIBA 1JOYA 4UVAA 3C3TA 2B1IA 4UCVA 1ROPA 4JI2O 4PI0A 3UO3A 2DYRC 4E2LA 2ZKOA 2WLKA 3RYFB 3FB6C 1VARA 3A0BZ 3CRRA 4NKGB 1LUWA 4D7SA 2VQEB 1URFA 4JPRA 2A0LA 3ZRVA 2HVKC 3ZCCA 3CC4V 2N74A 3IAYA 3K9SA 3OE7G 2Z5UA 1GN6A 1JPXA 5FL7G 3CC7V 1JFFB 1HNXB 4NXMB 3E2EA 1VQPV 3AK2A 5LHGA 1PPJH 4N23A 3OGCC 4GX0A 3RYFA 1NBMG 3D8CA 1FJGO 1SRYA 3S3WA 4PI2A 5KHIA 3KCYA 3AG4B 3BRCA 2H94A 2ARHA 1TUEB 4JYYA 1R3IC 5GTHZ 1Y74B 5LGTA 2QWOB 5AG2A 2E5LO 4O4LA 1K33A 5CBGA 5D5QA 4DR5O 1WA8A 5J2TB 1JVMA 3P3NA 3EFFK 4K8ZA 1R3KC 4IIJB 3HKEB 4O2BB 3WFVA 2CH7B 4LBEC 4MW8A 3CCEV 3VQWA 2AGAA 4JAUA 1XNRB 2Z3YA 5LMNB 4L8JA 1DF4A 2UXXA 2YI8A 3SPJA 2EINB 1FXKC 2CGOA 3O9OA 2BCCH 5J2UB 1WNSA 2A3QA 1WJZA 1BQ0A 4K3AA 2Y69B 5EBLC 1RSOB 1N36B 2IJJA 2NNUA 3OUFA 1RPRA 1K97A 3E35A 5J2TA 4N21A 2P6JA 4G28B 1M4UA 3E8FA 4JI5B 1VQ8V 2XUMA 2OYQA 4WCEV 1FFXA 2W0FC 1OCRC 2GUZB 2UUAB 4P2ZA 5JWPA 4DV6B 2EIKB 3RFRA 2WLNA 3K08A 3DXRB 1BHBA 4X1KB 3OMAB 1GM8A 4I4TA 5EIBD 4DV2O 4CZZA 3T4DA 4NYKA 3Q4HA 2QKAA 1SQGA 4O4HA 1TUBA 1K3EA 4LF5O 2Y0IA 5JH7A 4X62O 3QO7A 1XI1A 2LFSA 1GMGA 1M5IA 1P84F 1PP9H 4MVRA 4PELA 5LA6A 1PNKA 4MT8A 3LSSA 2WA4A 3ASNC 2Q0OC 4PDVA 3ZHSA 5DEDA 4P30A 1I94O 1M56B 2GDSA 3AG2C 1L8DA 3H1JH 1XNQO 1K9MW 5LP6A 3NXSA 2YIBD 4EB6A 1H8HG 1ZLZA 1I5XA 4O4HB 2JGDA 3K5NA 2F1MA 1YTFB 3GVMA 2GTAA 4GT1A 4DR4B 5JJNB 4C7UA 5IY5C 4J7ZA 4DV5B 1OJHA 2CTRA 3W7TA 2RQ6A 1YEWA 4Q20A 2HKOA 3KKYA 2YSUB 4KXRA 4X9QA 4UUJC 4CH3A 4DV5O 4LH7A 5B1AC 4TQFA 2BOCC 5JVDA 4DR3B 4FPPA 1H2NA 2QTSA 1TA8A 3ZX6A 2UXBO 3CCUV 1IBMB 3B77A 1GN4A 3OMNB 3VQYA 2BTQA 1KMIZ 1R73A 2BSKA 4FZ0A 3SGIA 3TXQA 4JZGA 4X65B 4PA6A 2X6BA 3FYIB 3T2MA 1XHXA 3JARB 2Y4TA 1BSMA 1XMOO 1XMOB 5EK0A 1P7BA 3GWOA 3FB7C 1NQTA 1KQSU 1CXZB 1N34O 4JI7B 2FTKA 4LWSA 4LF5B 3H01A 3RYIB 1XILA 2EJ7A 3X2QB 4TUYA 4DW1A 2LGQA 5BY1A 4B3MO 2UU9O 4OXSA 3IFXA 1Q6UA 2EZPA 4X65O 1SA0B 4DV3B 1AI5A 4TV8B 2B5UA 2M6YA 3CE2A 4QGPA 3ZMZA 4R7CA 3A8TA 3DC5A 4I9WA 5EBWC 5GONA 4CH6A 5IE9A 1MABG 2WLLA 4LF4B 5IJ0B 1MZEA 1MZFA 5BMVB 3T1HB 4RAIA 3LUTB 3AK3A 3ABKC 3CXCU 1D5NA 5KAIZ 4EFBA 4TUYB 4MVUA 2P22C 2F66C 3B09A 2QGNA 2QEXV 3S3XA 1S5LZ 2WLJA 3ZRXA 1W59A 2FKXA 4JI8B 3AG3B 5GONB 1AB3A 1XEQA 4BIUA 2CTPA 2IH1C 1I94B 1R3LC 1S5JA 1GO3F 2IBZH 2X6CA 1NTMH 3VQVA 4F6RA 3BA8A 1XMQB 4CC6A 5J9PC 1VQKV 3UCSC 5IYZB 5EC2C 4LF9B 2C2AA 1IBLB 1S77D 4JAAA 3WB2A 3UO2A 3J7AU 2PZSA 2R9RB 2V1DA 4TWKA 2OCCC 2DE0X 1K92A 1Y76B 1NVPD 2E3CA 5H2FZ 2F95B 3UT5A 4JI6O 3NR7A 3OEHG 1PKXA 1S3JA 4KFMA 3W7WA 4UCRA 5A9GA 4JI5O 3SJCC 1EFRG 1SS3A 4UV8A 5LMUB 2EIJC 4DYLA 1Y66A 1QLEB 1K7DA 3SPHA 3FX7A 1S76D 2Q7HA 1UPGA 3HKEA 4O2BA 3H1IH 5IT9N 2E74B 5LHIA 4JI0O 1BCCH 1FPOA 4GX1A 3UT5B 1AP5A 4O4JA 1KB9F 2DQ3A 1W0KG 4ABMA 1RM1C 3ETDA 1Y67A 4ZOLB 2Q8VA 4O2AB 1G4YB 2A79B 2DN9A 3C3SA 2UUBB 1NZ6A 1N4CA 4FK5C 4JAVA 1ZUQA 1N34B 2QM4A 4LFBO 4KL1A 2N05A 2YIDA 1JA8A 1FKAO 1FFXB 5E79Z 3OFNG 1XMQO 5EYPB 4FLZA 2CDYA 5LBQA 4JYBA 2PI5A 2AZ2A 4FLWA 4LNUA 1KP2A 1OCOC 4K8XA 3JD0A 2JEUA 2HHHB 4OX9O 3MD0A 4O2AA 1J95A 1VMGA 2JJ2G 4GYCB 4X1IB 3JATA 2F93B 3CD6V 3ZMUA 4AQYO 1VQNV 3QO8A 4MTFA 4JYAO 4FFKA 1Q86W 5JQGB 3ZHVA 4UXNA 4J41A 3T1HO 4P9OA 1HP8A 1Q6IA 2LQTA 1JCHA 4JASA 4LFAB 3G6EV 3JD4A 4LF4O 1OHHG 2JS3A 2DQ0A 3W7SA 3APOA 4X88A 2ZE6A 4BIZA 3AK1A 3K0DA 1DK1A 2PY5A 2R9AA 4X1IA 3FB5C 3OGIB 3JALB 2Q5ZA 4NB5A 1I08A 2QM7A 3ZMTA 1JJOA 1QNMA 3HKDB 3ZN0A 1QBZA 2UU9B 4B3MB 2ZCEA 4WFAV 2HJFC 3TGUH 4JTAB 4X1YB 3F5TA 3PN1A 1I0HA 2P67A 4JI7O 4TT3G 1M90W 2W6JG 2FMLA 1O9GA 3K04A 3E22B 1K8AW 1B3QA 3JCZA 4IIJA 4JI3O 3UM7A 4IHJA 1FXKA 1JR9A 4HNAB 3STLC 2BSKB 3QO5A 3AG1B 1K4DC 5CMUA 2EBOA 4FLYA 2FL4A 5J2UA 4B3RB 5BR8B 2QA4V 4XBFA 4JI4O 4OGQB 2JJ1G 3L70H 4MTXA 5H5NA 3LSUA 3ICXA 1R1BA 1YVWA 2WLIB 5B3SB 1COWG 3QG5A 3SPGA 2Q68A 3DTUB 4WBNB 4U7NA 4R6ZA 4IHJB 5KHJA 1X4TA 3C90A 3RYIA 2HG5C 2UUCB 2ODMA 3K59A 1KC8W 3MHSC 5K1PA 5FLXN 4GX5A 1NR1A 2HP8A 3DXRA 1YJNV 4FLXA 4MVQA 4TV8A 1AI4A 3K5MA 4QJFB 5IWAO 3OMIB 2PYJA 1XNQB 4DR2B 3CJHA 5EBMC 1N33O 3GWKC 1VQ5V 5L3CA 1XDCA 2XOKG 2VRZA 4ZIBA 3LSQA 4WFFA 4KP4A 4BR6A 2XAQA 1YCIA 4KUMA 1FS0G 2ADPA 2HLDG 5DECA 5LP6B 3BCCH 3VBBA 1EN5A 2VWJA 3B8MA 2F43G 2ZQMA 5EZYA 1N32B 4K0KB 1Y6XA 1QLEC 1IVSA 4WFBV 1H2KA 2AZ0A 4GKKB 4UB8Z 3SJAC 4D6TH 4FVMA 5B1OA 1VQ6V 2K9PA 3QVNA 2QWQB 3ZHRA 3BY6A 1SERA 1Z5WA 5FPRA 3CB2A 3T1YB 5LHHA 1ZAUA 3F5WC 4ZI7B 3E8HA 2D3OW 3AG7A 5CA0A 2WLMA 1Y76A 4CH5A 1Z2GA 2Y48A 1OZ0A 4U3JB 2OIEA 1AI6A 4GLXA 4A5UB 1ZTEA 4DV4O 1VQMV 5B66Z 1NR7A 2CK3G 4TQDA 1B04A 4B3TO 3CP1A 3R66A 5EC1C 3HPLC 4BW9A 2E76B 5B1BC 1VQOV 3G71V 3OT7A 4YJ3B 2ATKC 4DR6B 4MSWC 3WG7B 3MHHC 2HEPA 3AG3C 3ZBHA 4H44B 4F4LA 2A9HA 3TCUA 1UJWB 3QF7A 4ASUG 2X6AA 4FLTA 3T4ZA 4PDMA 4O4JB 1K73W 2ZR2A 3HB3B 3J81N 1G8MA 2GSMB 4YXWG 5KA6A 5IJ0A 1RFYA 2LGWA 5KAFZ 1HNXO 2KG7B 2EX3A 3IC9A 5B1BB 2P4KA 1G1XB 4LF7O 2E75B 1VEWA 3ZMVA 1JMKC 3AEIA 2P90A 2OIGA 2ILMA 1P4RA 4X64B 5EYPA 1JFFA 1WPBA 2KQXA 4B3TB 3DC6A 2EILC 5CA3A 2B9ZA 4PA3A 4X66O 4DV4B 4B7KA 4KHPB 3BAAA 2EINC 1GK9A 2MW2B 2Q73A 1OCCC 4WFGA 1LUVA 3ASOC 1XBLA 2MK3A 3JATB 2KG7A 2Q69A 2PYLA 4FFBA 1QVGU 1R6NA 1CPYA 3OEEG 4Z1VA 3RYCB 1SZTA 3KG2A 3L74H 2ZD9A 1DGSA 4UCOA 2AW9A 1M57C 1SQPH 4NTWA 5B1NA 3BVOA 3ABLB 3MAQA 3JAWB 1GM9A 3LDDA 4DW0A 5LL6Y 1M1KW 4K0KO 4P9PA 5IYCO 3PJSK 1QCEA 2ITCC 2ZIMA 4UCUA 3G4SV 2ZE8A 1B06A 4I50A 5LP6C 3WU2Z 1Q82W 3RYCA 4IL6Z 2EZOA 4LP8A 4JV5O 4IT5A 3JASB 2WLHA 1K34A 3U0ZA 4EFEA 1XL4A 2XASA 3D3IA 1XL6A 1LNQA 2AHYA 2EIMC 3E22A 2N04A 3OTOO 3P30A 2JVDA 1PM9A 4MVOA 2P7TC 2ITDC 3SYPA 4YIOA 1N0JA 3ZEDA 3F7VC 1WP7A 4MTGA 4I50B 1NS1A 2ZR3A 3L71H 4LFCB 2VQFO 1HNWB 3CX5F 1D2DA 3N2GB 1QVFU 4X1KA 2JK5C 3E89A 1HW7A 1IDSA 2L6LA 4PA4A 4DR1O 3Q4HB 5GTIZ 3E8GA 1L0LH 1LR1A 4DV0O 2UUCO 2CAZC 1H38A 4RUEA 2ZE7A 5L3GA 4IYIA 5EIBC 5DN6G 2ZE5A 3E8BA 4TV9B 1FAFA 1QR8A 5LA6B 4J80A 2P5OA 1KKCA 3JAMN 3IC7A 1YIJV 2AHZA 2YIAA 3W7XA 4LNUB 2H8PC 1PV0A 4MS2A 2JS5A 1UFIA 2CE4A 3JD2A 1G6UA 5KX5A 4F6EA 3ABTA 3U10A 3FAVB 3JCUZ 1T5EA 4EB6B 4Z1MG 5F2VO 4JGSA 4LF6O 1AVMA 2NN4A 2QKSA 3ABLC 3SJBC 5KHHA 2GBOA 3TJTA 5LGUA 4I5SA 3OM3B 2LJ2A 1NH2D 2ZM6O 3OD4A 4FIPC 4I0XB 1N33B 1KUQA 1KECA 4J9ZB 2PTMA 5LOVB 3FYEB 2QDOA 5JVDB 5TISZ 1HNZO 1SF9A 2DJVA 3RYHB 3RW0A 5KX5B 2UXNA 2Z0AA 2ZDIC 1F4NA 3A0HZ 2IU3A 1V54C 3JALA 3R65A 3HKBA 1VF6C 1SQFA 1VF7A 1HWYA 1J5EO 4FLUA 4LFCO 2CUGA 1ZSPA 2IJHA 2UXBB 4U7OA 3K5LA 1MG1A 3JAKA 1E1RG 2QWNB 3D36C 3N27A 1L1FA 3JARA 3ZS8C 3ZJZA 4MW3A 2QSAA 4I0XA 4JZ2A 4ZHQA 3P3PA 3HKCB 2ZXWB 5LOVA 1NH2B 3N2KA 1XOUA 5B3SC 4QNHB 4DR4O 4LWSB 1US6A 2ZINA 3L72H 5JJEB 1SA0A 4GKJB 2DWEC 1AROP 2O57A 4ICGA 4W4LA 1WP8A 1Q81W 4MVSA 2F4VO 4UVBA 3J80N 1VQ7V 5IJ9B 4WBNA 5BMVA 2XNDG 4X62B 1GH6A 2M7WA 2PGGA 1IBKO 1IXBA 3E86A 3K58A 4ZBMA 1M93A 2X0LA 5CB4B 1Q6HA 5JJJB 4D7TA 4DV1O 5L3DA 2XHBA 1PNMA 2UXDB 4B3SO 2YXLA 5LGNA 3B4SA
chains in the Genus database with same CATH topology
1YSCA 3OMIB 1VQ9V 2ZDIA 1OCOB 1OCZB 3RVZA 2LFRA 5EBMC 1K3EA 1YHQV 1VQ5V 5L3CA 1YTFD 3QO7A 2LFSA 1GMGA 2XOKG 2WAMA 3RBZA 4QPKA 4MVRA 4PELA 1PNKA 3LSQA 3LSSA 4MT8A 4WFFA 4KP4A 4R8CA 3ASNC 4PDVA 2XAQA 1WPXA 2KB1A 4KUMA 1FS0G 4P30A 1M56B 4PDLA 2WSSG 3AG2C 2HLDG 3CCSV 4QPJA 4ZKIA 1NKDA 3K9AA 1K9MW 3VBBA 5CBFA 3NXSA 5IDJA 1H8HG 1I5XA 2IH3C 3B8MA 1YTFB 2F43G 2ZQMA 4GT1A 1SESA 1AI7A 3ASNB 1QLEC 5IY5C 5KUMA 4WFBV 1AJQA 4QE9A 1PNLA 1JQ0A 3W7TA 1H8EG 1RPOA 5IYDO 4Q20A 5B1OA 2HKOA 2Q67A 1VQ6V 3SYQA 2YSUB 4EKWA 4UUJC 2EIMB 2HFEC 4X89A 2EIJB 5B1AC 2BOCC 4LCUC 3BY6A 4FPPA 1SERA 3CCUV 3B77A 5HFLA 2V7QG 5LHHA 3OMNB 2OTJV 3F5WC 4GX2A 4MVZA 3E8HA 2D3OW 1R73A 3TK1A 2WLMA 3BEHA 1M9NA 1BHAA 3AG1C 2Y48A 1OZ0A 4HAMA 1AI6A 4PDRA 2GHYA 1RM1B 3SJQC 4PA6A 5L3BA 2X6BA 1NVPB 1BMFG 1BL8A 3FYIB 1GKFA 3T2MA 1VQMV 1NR7A 2CK3G 3DGEA 2EIKC 1AR1B 2OCCB 3CP1A 5EC1C 3HPLC 3ABKB 2LP7A 1ZWIC 1WLEA 2WWWA 3IGAC 5EK0A 5B1BC 1VQOV 3G71V 1THZA 1P7BA 5GW7A 3CYOA 1YJWV 3GWOA 3FB7C 2ATKC 1NQTA 3SYAA 1KQSU 2EJRA 2FTKA 4MSWC 3WG7B 3H01A 3ETGA 3MHHC 1M57B 4L87A 3X2QB 1FXKB 2JEXA 4OXSA 3AG3C 3IFXA 3CMEV 2EZPA 5CN0A 5CBHA 1V54B 1AI5A 1K5SA 2A9HA 4JF3A 4F4LA 3TCUA 1UJWB 4ASUG 2B5UA 2X6AA 3T4ZA 4PDMA 3ASOB 2B1GA 1OCCB 2DYSB 4J9YB 3ZMZA 2ZR2A 4R7CA 1K73W 3HB3B 1G8MA 2GSMB 4YXWG 5KA6A 4RQEA 2OTLV 4I9WA 2BOBC 5EBWC 3X2QC 1QLNA 1PL0A 1MABG 2IJKA 2EILB 1YI2V 2WLLA 1F4MA 3RVYA 4QIWF 2WLIA 1GTOA 5B1BB 3F7YC 1KP3A 4RAIA 3LUTB 3ABKC 3ZMVA 1VQLV 3CXCU 3AEIA 3EHBB 2P90A 3OW2U 4MVUA 3AG4C 1AJPA 1P4RA 4XDKA 5C93A 3I55V 3K06A 4HZ3A 4FJCC 1JJ2U 2QEXV 4GCZA 4QE7A 3W7UA 2EILC 5CA3A 3K3WA 4PA3A 2WLJA 3ZRXA 5H6QA 3FB8C 1R3JC 4HYOA 2QM8A 2EINC 3AG3B 1GK9A 3QNEA 1OCCC 4WFGA 3ASOC 2IH1C 4BIUA 2MK3A 3M99B 5L3FA 3ML0A 3VOUA 2Q69A 1R3LC 1GO3F 2X6CA 5KUKA 1QVGU 1R6NA 1CPYA 3OEEG 4UV9A 1SZTA 1W0JG 3KG2A 2ZD9A 1CEZA 5J9PC 1VQKV 2JIZG 3LDEA 1M57C 4WFEA 1W2BU 5B1NA 2ZXWC 3ABLB 4RUFA 1FXVA 3CCLV 5DM6V 5EC2C 2C2AA 1GM9A 3LDDA 1S77D 1CP9A 3SYOA 1M1KW 3CCVV 1H2GA 3CMAV 2R9RB 2V1DA 4P9PA 5IYCO 3PJSK 3OUSA 1QCEA 2ITCC 4TWKA 2DWDC 2OCCC 3ZMSA 2Q6AA 2IW5A 1K92A 5HFMA 4RQFA 2XAHA 3G4SV 1NVPD 4DO2A 3STZC 2NLJC 1DF5A 1EZJA 1Q82W 2XAFA 3AG2B 3OEHG 1PKXA 1S3JA 2EZOA 4KFMA 4JTDB 4JYCA 4LP8A 4MVMA 3UKMA 3FKSG 3W7WA 4TSFG 1EBOA 3ZN1A 1YITV 1IXMA 1E79G 1K34A 2WLHA 1GM7A 2YEVB 3JYCA 2X7RB 1EFRG 2QE7G 1KKDA 4UV8A 1XL4A 2XASA 3D3IA 2PI4A 2EIJC 5B1AB 1XL6A 1Y66A 1LNQA 2AHYA 2EIMC 1QLEB 1K7DA 1VQ4V 3JD3A 5IYBO 3CPWU 3P30A 3SPHA 4WF9V 4MVOA 2W6IG 1S76D 1F23A 2P7TC 3CC2V 2ITDC 1QR9A 3SYPA 3F7VC 2R9IA 3D36A 4MTGA 3SYCA 1ORQC 5H6RA 4FMTA 5IY5B 3ABMC 5LHIA 1S5HC 2HVJC 1V55B 2ZR3A 3ZRSA 4GX1A 3CCQV 2JDIG 1QVFU 1E1QG 3JD1A 3K0GA 2DQ3A 1W0KG 1RM1C 2JK5C 3E89A 5E1AC 1I5YA 3ETDA 3ZRWA 1OCRB 4H33A 4PA4A 3GB7C 4PA7A 1V55C 2WPDG 3E8GA 2YEVA 4RO2A 2WLLB 1FFTB 1G4YB 2OT5A 2A79B 1Y4MA 1NJIW 1H38A 2IJIA 4RUEA 5L3GA 1MOFA 4FK5C 4JAVA 2IU0A 5DN6G 4XDJA 4MTOA 3E8BA 1S72V 1ENVA 1QR8A 3OR7C 1OCZC 3SPCA 2QTOA 4LC1A 3OFNG 3IC7A 1YIJV 2AHZA 1R6KA 2K1EA 3W7XA 2HR3A 1JOYA 1K5QA 4UVAA 2H8PC 4XDLA 4JYBA 5LBQA 2B1IA 4MS2A 2PI5A 1ROPA 3A0RA 1S0VA 4X8AA 1KP2A 1OCOC 3JD2A 2DYRC 3JD0A 3ABTA 2JEUA 4E2LA 2XAJA 4Z1MG 4CBCA 4UVCA 3MD0A 1J95A 2JJ2G 2WLKA 4JGSA 3K03A 2XAGA 3CD6V 3ZMUA 3ABMB 3FB6C 1VQNV 1DTOA 3QO8A 2QKSA 3ABLC 4JPRA 2A0LA 1M56C 4MTFA 3ZRVA 2HVKC 4JTCB 3ZCCA 4BW5A 3ZIAG 5LGUA 1Q86W 3CC4V 4I5SA 1B6QA 3OM3B 3LNMB 3B8NA 3OE7G 4UXNA 2Z5UA 1NH2D 4FIPC 4P9OA 4JASA 1JCHA 3I56V 1JPXA 5FL7G 1DLBA 3G6EV 1KECA 3CC7V 1F51A 3JD4A 4J9ZB 1Q7YW 3FYEB 3E2EA 1OHHG 1VQPV 4H37A 3RW0A 5KA5A 2UXNA 5LHGA 2ZDIC 1F4NA 2DQ0A 3W7SA 4X88A 4BIZA 4N23A 3OGCC 3K0DA 4GX0A 2IU3A 1V54C 3R65A 1NBMG 1SRYA 3FB5C 4R50A 3P32A 1HWYA 3ZMTA 2QM7A 3K79A 5H9CA 2IJHA 1MSWD 3AG4B 4G2KA 4U7OA 1MG1A 3SPIA 5BZBA 3WG7C 3ZN0A 1QBZA 2H94A 1E1RG 4WFAV 2HJFC 1TUEB 1FXHA 1R3IC 4JTAB 1L1FA 5LGTA 2P67A 3ZJZA 1K4CC 4MW3A 1K33A 3CCJV 4TT3G 5CBGA 2W6JG 1M90W 3OR6C 1N8RW 1JX9A 3K04A 2ZXWB 1JVMA 1NH2B 1K8AW 3EFFK 3JCZA 3OAAG 4QNHB 5B3SC 1R3KC 3UM7A 3ABUA 2Y69C 3WFVA 1FXKA 4LBEC 4MW8A 3STLC 1AJNA 3CCEV 3QO5A 2DYRB 3AG1B 4PA9A 1K4DC 4JAUA 5CMUA 2Z3YA 1DF4A 2EBOA 2UXXA 3SPJA 2DWEC 2EINB 2DYSC 1FXKC 1AROP 3ZRWB 3T1CA 3LDCA 2DW4A 2QA4V 3E83A 4XBFA 1PD3A 1Q81W 4MVSA 2Y69B 5EBLC 2IJJA 2JJ1G 4MTXA 3ETEA 4UVBA 2NNUA 3OUFA 4WFHA 3TETA 1VQ7V 2WLIB 1RPRA 1COWG 1K97A 3E35A 5B3SB 3SPGA 4N21A 2Q68A 2P6JA 2XNDG 3DTUB 4G28B 3E8FA 4BAYA 2M7WA 3CCRV 1VQ8V 4U7NA 4R6ZA 4WCEV 1SETA 2HG5C 5L3EA 3E86A 4G27B 2W0FC 1KC8W 1OCRC 3MHSC 4DXWA 4ZBMA 4GX5A 1NR1A 2X0LA 4P2ZA 1YJNV 2EIKB 3CCMV 2WLNA 5L3DA 3K08A 4MVQA 1YJ9V 1AI4A 1BHBA 3OMAB 1PNMA 1GM8A 4QJFB 5LGNA 4CZZA 3T4DA 1KD1W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9Z B;  4KFM A;  4JTD B;  4LP8 A;  3UKM A;  4MVM A;  3RVZ A;  4OXS A;  5EBM C;  3AG3 C;  3IFX A;  4H37 A;  3RW0 A;  5CBH A;  2WLH A;  4X88 A;  3OGC C;  4F4L A;  3JYC A;  2A9H A;  3K0D A;  3RBZ A;  4GX0 A;  3TCU A;  4MVR A;  1KKD A;  2X6A A;  1V54 C;  1XL4 A;  3R65 A;  4PDM A;  4WFF A;  3T4Z A;  2EIJ C;  1XL6 A;  1LNQ A;  2AHY A;  2EIM C;  3FB5 C;  3ASN C;  4J9Y B;  4R50 A;  4R8C A;  4PDV A;  4R7C A;  3SPH A;  2KB1 A;  4I9W A;  4MVO A;  2BOB C;  5EBW C;  4P30 A;  2P7T C;  3X2Q C;  2ITD C;  4PDL A;  3SPI A;  5BZB A;  3AG2 C;  3WG7 C;  3SYP A;  2WLL A;  3F7V C;  2HJF C;  4MTG A;  1ORQ C;  3RVY A;  3SYC A;  1R3I C;  2WLI A;  4JTA B;  3ABM C;  1S5H C;  3ZJZ A;  3F7Y C;  2HVJ C;  1K4C C;  4MW3 A;  3ZRS A;  4GX1 A;  5CBG A;  5CBF A;  4RAI A;  3LUT B;  3ABK C;  3OR6 C;  3K0G A;  3K04 A;  2JK5 C;  1JVM A;  3E89 A;  5E1A C;  2IH3 C;  4MVU A;  3AG4 C;  3EFF K;  5B3S C;  4QNH B;  4H33 A;  4PA4 A;  1R3K C;  3GB7 C;  3UM7 A;  4PA7 A;  1V55 C;  4XDK A;  1QLE C;  5IY5 C;  3E8G A;  3K06 A;  4HZ3 A;  2Y69 C;  2YEV A;  2WLL B;  4RO2 A;  4LBE C;  5KUM A;  1G4Y B;  4QE7 A;  4QE9 A;  2A79 B;  2EIL C;  4MW8 A;  3STL C;  4PA3 A;  2WLJ A;  4RUE A;  3FB8 C;  4PA9 A;  1R3J C;  4HYO A;  4XDJ A;  1K4D C;  4MTO A;  3E8B A;  2Q67 A;  2EIN C;  3SYQ A;  4EKW A;  3SPJ A;  2DWE C;  3OR7 C;  4UUJ C;  2DYS C;  1OCC C;  2HFE C;  1OCZ C;  4WFG A;  4X89 A;  5B1A C;  3ASO C;  3SPC A;  2BOC C;  2IH1 C;  2QTO A;  4LCU C;  3T1C A;  3LDC A;  3VOU A;  2Q69 A;  1R3L C;  2X6C A;  5KUK A;  2AHZ A;  3E83 A;  2K1E A;  4MVS A;  5EBL C;  3F5W C;  4GX2 A;  4XDL A;  2H8P C;  3KG2 A;  3E8H A;  4MVZ A;  4MS2 A;  2ZD9 A;  5J9P C;  4X8A A;  2WLM A;  3BEH A;  3OUF A;  4WFH A;  3TET A;  1OCO C;  2WLI B;  3LDE A;  1M57 C;  3AG1 C;  2DYR C;  4WFE A;  3SPG A;  2Q68 A;  2ZXW C;  4PDR A;  3SJQ C;  4G28 B;  4RUF A;  3E8F A;  4PA6 A;  2X6B A;  4CBC A;  4R6Z A;  1BL8 A;  1J95 A;  5EC2 C;  3T2M A;  2WLK A;  3K03 A;  2HG5 C;  3LDD A;  3SYO A;  3E86 A;  3FB6 C;  2W0F C;  4G27 B;  2EIK C;  1OCR C;  4DXW A;  4ZBM A;  2R9R B;  2QKS A;  3ABL C;  4P9P A;  3PJS K;  3OUS A;  4GX5 A;  2ITC C;  4TWK A;  2A0L A;  2DWD C;  2OCC C;  2Q6A A;  1M56 C;  4MTF A;  4P2Z A;  5EC1 C;  2HVK C;  3HPL C;  4JTC B;  4BW5 A;  2WLN A;  1ZWI C;  3K08 A;  3LNM B;  4MVQ A;  3IGA C;  5EK0 A;  5B1B C;  3STZ C;  2NLJ C;  1P7B A;  3FB7 C;  4P9O A;  2ATK C;  3SYA A;  4MSW C;  3T4D A; 
#chains in the Genus database with same CATH topology
 1YSC A;  2ZDI A;  3L9D A;  3RVZ A;  2LFR A;  4PHZ A;  4CS3 A;  1BE3 H;  4BIO A;  1YTF D;  2WAM A;  4QPK A;  4RWU A;  3BHP A;  2BE3 A;  5K1X A;  1IZ3 A;  4H13 B;  1WPX A;  2ADQ B;  3RT3 C;  1SZX A;  1SC5 B;  2WSS G;  4YJ2 A;  4IYH A;  2ZT9 B;  4QPJ A;  4ZKI A;  2UXC B;  4J10 A;  1Q8I A;  4I7Z B;  2HJD A;  1XNR O;  4JI6 B;  4YIP A;  2IH3 C;  5EZY B;  3BFR A;  1SQV H;  2IM9 A;  1L0N H;  4FFB B;  2JGU A;  3BA9 A;  1AI7 A;  1YZB A;  2H3O A;  5KUM A;  3JSL A;  1AJQ A;  5C8Y A;  4QE9 A;  1NTK H;  2CGN A;  3CXH F;  1H8E G;  5IYD O;  3L75 H;  3CRQ A;  2A06 H;  4EKW A;  3VQX A;  2EIM B;  2HFE C;  4Q6G A;  4X89 A;  2A7W A;  1KU9 A;  2V7Q G;  2OTJ V;  1WB7 A;  4GX2 A;  4MVZ A;  1SQB H;  3TK1 A;  3BEH A;  4DUY O;  4O4I A;  1M9N A;  1EM1 A;  3H1L H;  4CS4 A;  4DUZ B;  1RM1 B;  1BQZ A;  4J11 A;  4JI0 B;  5L3B A;  1NVP B;  1BMF G;  1BL8 A;  5JCO C;  4NXM O;  3SDL A;  5C8Y B;  2EIK C;  1RP3 B;  1AR1 B;  4LH6 A;  1O9H A;  1AR5 A;  4O4L B;  3ZHU A;  3ABK B;  1WLE A;  2WWW A;  3IGA C;  4YJ3 A;  1WA8 B;  5ITZ A;  3CYO A;  1YJW V;  3SYA A;  2VS0 A;  2VQE O;  3ETG A;  1M57 B;  4GKK O;  2CH7 A;  2JEX A;  3WB1 A;  3CME V;  1N32 O;  2CTW A;  5CBH A;  4CC5 A;  4B08 A;  1V54 B;  3RN4 A;  1K5S A;  4B7E A;  4DUY B;  3ASO B;  1BZK A;  1VF5 B;  1OCC B;  4J9Y B;  2ZIO A;  3CWB H;  3X2Q C;  1QLN A;  1RSO A;  2EIL B;  1YI2 V;  1HR0 O;  3OTF A;  3RVY A;  4LF9 O;  3THO A;  5ITZ B;  3F7Y C;  5JQG A;  1VQL V;  1XUQ A;  1AJP A;  4PJ0 Z;  1IUR A;  1A32 A;  4XDK A;  4J7J A;  5C93 A;  3I55 V;  4HZ3 A;  1JJ2 U;  4GCZ A;  3W7U A;  2Q7E A;  3K3W A;  5H6Q A;  2YIC A;  5JCO A;  1R3J C;  2QM8 A;  2PF4 E;  4YY3 B;  3G67 A;  2Q4P A;  3M99 B;  4JI1 B;  5L3F A;  1TUB B;  3VOU A;  4I55 A;  5KUK A;  4NXN B;  4UV9 A;  2LW7 A;  2GTS A;  3HKD A;  4YHH O;  3BAB A;  2BTO A;  1YDX A;  1AR4 A;  4X1Y A;  2YIB A;  4WFE A;  2Q7G A;  4RUF A;  3JAW A;  1FXV A;  5DM6 V;  4X20 B;  2LO1 A;  3U11 A;  3SYO A;  5CA1 A;  2ETN A;  4FM0 A;  1AIL A;  1KYO F;  1ZL8 A;  3CCV V;  3CRM A;  3CMA V;  4YHH B;  1H2M A;  3OUS A;  2UXD O;  2DWD C;  2Q6A A;  5HFM A;  5BR8 O;  4B3R O;  2XAH A;  4DV1 B;  4DO2 A;  3STZ C;  2NLJ C;  2Q9L A;  3HKB B;  2YC0 A;  1EZJ A;  4DV3 O;  3DSQ A;  2JRI A;  1R6T A;  2XAF A;  3AG2 B;  3KCX A;  4JYC A;  3JAS A;  4UFZ A;  3UKM A;  1IBK B;  3FKS G;  1EBO A;  2PUS A;  1FD9 A;  1HDJ A;  3CEI A;  1YIT V;  2RJZ A;  3JYC A;  2X7R B;  1EN6 A;  2QE7 G;  1KKD A;  1TVK A;  5CA1 B;  2F4V B;  1D5A A;  4WF9 V;  4I9Q A;  1QR9 A;  3D36 A;  3SYC A;  2KSD A;  4FMT A;  3ABM C;  4DV2 B;  4DK1 A;  1V55 B;  3JD1 A;  4NR1 A;  1I5Y A;  1OCR B;  1NI8 A;  1XRE A;  4AHC A;  5FNV A;  4DR3 O;  1FFT B;  2QKC A;  1Y4M A;  1TVK B;  1EN4 A;  4LFA O;  1MMM A;  1MOF A;  1Q90 D;  4TV9 A;  4XDJ A;  4MTO A;  1S72 V;  1MNG A;  2YS8 A;  3OR7 C;  2WA3 A;  1TGO A;  1OCZ C;  2QWP B;  4DV0 B;  4LC1 A;  4NVP A;  4CS2 A;  1N36 O;  3M8A A;  4JYA B;  4NXN O;  1R6K A;  4IGG A;  2HR3 A;  1K5Q A;  4XDL A;  4JI1 O;  3A0R A;  1S0V A;  4X8A A;  4AQY B;  3FAV A;  4YY3 O;  5B5E Z;  4Z2W A;  4OX9 B;  5LMN O;  2W0X A;  3G6B A;  2XAJ A;  2GV9 A;  2HHH O;  4CBC A;  4UVC A;  5FNV B;  1MA1 A;  1F7Y A;  3K03 A;  2XAG A;  1I7F A;  3ABM B;  1DTO A;  4W4K A;  2L35 A;  2OWO A;  1M56 C;  1ZX3 A;  4JTC B;  4BW5 A;  3ZIA G;  1B6Q A;  3LNM B;  3B8N A;  4DR5 B;  5KHG A;  2Y4U A;  2RMK B;  4LFB B;  3I56 V;  1DLB A;  2UUB O;  1F51 A;  2LW1 A;  3CRA A;  1Q7Y W;  1HR0 B;  2YI9 A;  4H37 A;  3H9V A;  4FLV A;  5KA5 A;  2AXT Z;  5BXZ A;  1Q3E A;  3CSX A;  3QTC A;  4H0L B;  4R50 A;  2ZNJ A;  3P32 A;  3K79 A;  5H9C A;  1MSW D;  2UUA O;  3MDS A;  4G2K A;  3SPI A;  4F6R B;  5BZB A;  3WG7 C;  2UXC O;  3ETQ A;  3IJ4 A;  2QJ1 A;  1FXH A;  4UCS A;  1K4C C;  3CCJ V;  1Y74 A;  3HKC A;  5IYZ A;  3OR6 C;  1N8R W;  1JX9 A;  5LMU O;  3OAA G;  1NU1 H;  4DR1 B;  3ABU A;  1GN2 A;  2Y69 C;  4J7K A;  2DOS A;  1AJN A;  5LYJ A;  2VQF B;  4O4I B;  2DYR B;  4PA9 A;  3H1H H;  4B3S B;  4DUZ O;  1OV9 A;  2DYS C;  3EXA A;  3K57 A;  3ZRW B;  3T1C A;  3LDC A;  2DW4 A;  4DRX A;  1WAZ A;  3E83 A;  1PD3 A;  1MSD A;  3ETE A;  1H2S B;  5IJ9 A;  1YF2 A;  1U96 A;  4WFH A;  3TET A;  4OPH A;  1IBL O;  4LF8 O;  1H2L A;  1Q5O A;  4BAY A;  3CCR V;  2P06 A;  2QWR B;  1P49 A;  1SET A;  1QHT A;  4CH4 A;  5L3E A;  4G27 B;  2P4V A;  4DXW A;  2GUZ A;  2R72 A;  3CCM V;  1SQX H;  1YJ9 V;  4NTY A;  1Z5V A;  3G80 A;  4GKJ O;  4DRX B;  4JI8 O;  4ZOL A;  4I4T B;  1KD1 W;  2DMX A;  1VQ9 V;  1OCO B;  1OCZ B;  1SKV A;  4HBN A;  1YHQ V;  3ZHQ A;  3RBZ A;  2Y0P A;  4R8C A;  3O65 A;  2KB1 A;  4YJ2 B;  4PDL A;  4OPA A;  1YXB A;  3B2E E;  3RWR D;  3CCS V;  1NKD A;  3KZI Z;  2FYU H;  3K9A A;  2RDC A;  2OCH A;  1NT2 B;  5CBF A;  4X66 B;  1J5E B;  1VP7 A;  5IDJ A;  2YXY A;  4JI2 B;  4X64 O;  1SES A;  4I55 B;  1IX9 A;  3ASN B;  1PNL A;  1JQ0 A;  1RPO A;  4GUN A;  4LF7 B;  4UCT A;  2Q67 A;  3SYQ A;  4PD4 F;  2CTQ A;  4X20 A;  2EIJ B;  2V4D A;  5LXT B;  4LCU C;  3BPZ A;  4DR7 O;  2R70 A;  3M7M X;  5HFL A;  1BGY H;  1QU7 A;  2BTQ B;  1BHA A;  3AG1 C;  4HAM A;  4PDR A;  2GHY A;  3SJQ C;  3N2G A;  1NTZ H;  3ZHT A;  1GKF A;  3DGE A;  4UB6 Z;  2OCC B;  3B40 A;  1EZV H;  2EUL A;  4DK0 A;  1IBM O;  2LP7 A;  1ZWI C;  4DV7 B;  1THZ A;  5GW7 A;  5LXT A;  4EEQ A;  1AP6 A;  2EJR A;  1XQ8 A;  4L87 A;  1FXK B;  4DR2 O;  5A2Q N;  4HNA A;  2NR5 A;  5CN0 A;  4BWA A;  5IWA B;  2Q0A A;  4JF3 A;  1TAE A;  3CS5 A;  2B1G A;  2DYS B;  5KHK A;  1HNW O;  4RQE A;  2OTL V;  2G38 A;  3T1Y O;  1Q43 A;  2BOB C;  1PL0 A;  2IJK A;  5D5P A;  1HNZ B;  1F4M A;  4TOI A;  3D3Q A;  5JH7 B;  3CRC A;  1X59 A;  4QIW F;  2WLI A;  1GTO A;  1WB8 A;  3OTO B;  1KP3 A;  2ZM6 B;  3L73 H;  3EHB B;  2YUA A;  4J42 A;  2YXH A;  4LR3 A;  5KMG A;  3OW2 U;  1GN3 A;  3AG4 C;  4FZ1 A;  4JI4 B;  1N0N A;  3K06 A;  4FJC C;  1SQQ H;  4QE7 A;  3RYH A;  4LF6 B;  3FD9 A;  3FB8 C;  4HYO A;  3TXS A;  3QNE A;  2JGD B;  4U3F H;  3CJH B;  1VF6 A;  4DV6 O;  2D2C B;  3ML0 A;  2RCV A;  3H1K H;  4JI3 B;  1W0J G;  3JAK B;  1BS3 A;  1CEZ A;  4NTX A;  2JIZ G;  3LDE A;  5KMG B;  1GRJ A;  3LNN A;  1W2B U;  2ZXW C;  3CCL V;  4ZHQ B;  1BT8 A;  2KKW A;  1WN7 A;  1QQC A;  3N2K B;  1ZL8 B;  1CP9 A;  1H2G A;  4FM1 A;  3ZMS A;  5KLV H;  2QR4 A;  2IW5 A;  4RQF A;  4E4E A;  1P7G A;  3SR2 C;  1DF5 A;  2F23 A;  2VWK A;  2YDE A;  4PV1 B;  3APQ A;  4KHP O;  2XT9 A;  4AI8 A;  2RNB A;  1KBH A;  1FYJ A;  3FFQ A;  4GZR B;  2FB5 A;  4JTD B;  3HR0 A;  4MVM A;  5FPO A;  4TSF G;  1V9P A;  4FM2 A;  3ZN1 A;  1IXM A;  1E79 G;  1GM7 A;  2YEV B;  3K5O A;  4DV7 O;  3UQ8 A;  3RGB A;  2PI4 A;  5B1A B;  1XHZ A;  1VQ4 V;  3JD3 A;  5IYB O;  3CPW U;  1GAX A;  2E5L B;  2W6I G;  1F23 A;  3CC2 V;  4ZI7 A;  4JV5 B;  2R9I A;  3A2F A;  5CA0 B;  1ORQ C;  5H6R A;  3CHX A;  5IY5 B;  1S5H C;  5LYJ B;  2HVJ C;  4U3J A;  3ZRS A;  3I5D A;  1PL4 A;  5CB4 A;  3CCQ V;  2JDI G;  3EVK A;  2ZNI A;  1E1Q G;  3K0G A;  1FJG B;  4K35 A;  5E1A C;  2XTA A;  3ZRW A;  4H33 A;  3GB7 C;  4PA7 A;  1V55 C;  2WPD G;  3WB0 A;  4DR7 B;  2YEV A;  4RO2 A;  2WLL B;  3JSN A;  1U97 A;  2OT5 A;  1NJI W;  2IJI A;  2IU0 A;  4DR6 O;  1ENV A;  4LF8 B;  3SPC A;  2QTO A;  2RN9 A;  2K1E A;  4AIL C;  1VIB A;  1JOY A;  4UVA A;  3C3T A;  2B1I A;  4UCV A;  1ROP A;  4JI2 O;  4PI0 A;  3UO3 A;  2DYR C;  4E2L A;  2ZKO A;  2WLK A;  3RYF B;  3FB6 C;  1VAR A;  3A0B Z;  3CRR A;  4NKG B;  1LUW A;  4D7S A;  2VQE B;  1URF A;  4JPR A;  2A0L A;  3ZRV A;  2HVK C;  3ZCC A;  3CC4 V;  2N74 A;  3IAY A;  3K9S A;  3OE7 G;  2Z5U A;  1GN6 A;  1JPX A;  5FL7 G;  3CC7 V;  1JFF B;  1HNX B;  4NXM B;  3E2E A;  1VQP V;  3AK2 A;  5LHG A;  1PPJ H;  4N23 A;  3OGC C;  4GX0 A;  3RYF A;  1NBM G;  3D8C A;  1FJG O;  1SRY A;  3S3W A;  4PI2 A;  5KHI A;  3KCY A;  3AG4 B;  3BRC A;  2H94 A;  2ARH A;  1TUE B;  4JYY A;  1R3I C;  5GTH Z;  1Y74 B;  5LGT A;  2QWO B;  5AG2 A;  2E5L O;  4O4L A;  1K33 A;  5CBG A;  5D5Q A;  4DR5 O;  1WA8 A;  5J2T B;  1JVM A;  3P3N A;  3EFF K;  4K8Z A;  1R3K C;  4IIJ B;  3HKE B;  4O2B B;  3WFV A;  2CH7 B;  4LBE C;  4MW8 A;  3CCE V;  3VQW A;  2AGA A;  4JAU A;  1XNR B;  2Z3Y A;  5LMN B;  4L8J A;  1DF4 A;  2UXX A;  2YI8 A;  3SPJ A;  2EIN B;  1FXK C;  2CGO A;  3O9O A;  2BCC H;  5J2U B;  1WNS A;  2A3Q A;  1WJZ A;  1BQ0 A;  4K3A A;  2Y69 B;  5EBL C;  1RSO B;  1N36 B;  2IJJ A;  2NNU A;  3OUF A;  1RPR A;  1K97 A;  3E35 A;  5J2T A;  4N21 A;  2P6J A;  4G28 B;  1M4U A;  3E8F A;  4JI5 B;  1VQ8 V;  2XUM A;  2OYQ A;  4WCE V;  1FFX A;  2W0F C;  1OCR C;  2GUZ B;  2UUA B;  4P2Z A;  5JWP A;  4DV6 B;  2EIK B;  3RFR A;  2WLN A;  3K08 A;  3DXR B;  1BHB A;  4X1K B;  3OMA B;  1GM8 A;  4I4T A;  5EIB D;  4DV2 O;  4CZZ A;  3T4D A;  4NYK A;  3Q4H A;  2QKA A;  1SQG A;  4O4H A;  1TUB A;  1K3E A;  4LF5 O;  2Y0I A;  5JH7 A;  4X62 O;  3QO7 A;  1XI1 A;  2LFS A;  1GMG A;  1M5I A;  1P84 F;  1PP9 H;  4MVR A;  4PEL A;  5LA6 A;  1PNK A;  4MT8 A;  3LSS A;  2WA4 A;  3ASN C;  2Q0O C;  4PDV A;  3ZHS A;  5DED A;  4P30 A;  1I94 O;  1M56 B;  2GDS A;  3AG2 C;  1L8D A;  3H1J H;  1XNQ O;  1K9M W;  5LP6 A;  3NXS A;  2YIB D;  4EB6 A;  1H8H G;  1ZLZ A;  1I5X A;  4O4H B;  2JGD A;  3K5N A;  2F1M A;  1YTF B;  3GVM A;  2GTA A;  4GT1 A;  4DR4 B;  5JJN B;  4C7U A;  5IY5 C;  4J7Z A;  4DV5 B;  1OJH A;  2CTR A;  3W7T A;  2RQ6 A;  1YEW A;  4Q20 A;  2HKO A;  3KKY A;  2YSU B;  4KXR A;  4X9Q A;  4UUJ C;  4CH3 A;  4DV5 O;  4LH7 A;  5B1A C;  4TQF A;  2BOC C;  5JVD A;  4DR3 B;  4FPP A;  1H2N A;  2QTS A;  1TA8 A;  3ZX6 A;  2UXB O;  3CCU V;  1IBM B;  3B77 A;  1GN4 A;  3OMN B;  3VQY A;  2BTQ A;  1KMI Z;  1R73 A;  2BSK A;  4FZ0 A;  3SGI A;  3TXQ A;  4JZG A;  4X65 B;  4PA6 A;  2X6B A;  3FYI B;  3T2M A;  1XHX A;  3JAR B;  2Y4T A;  1BSM A;  1XMO O;  1XMO B;  5EK0 A;  1P7B A;  3GWO A;  3FB7 C;  1NQT A;  1KQS U;  1CXZ B;  1N34 O;  4JI7 B;  2FTK A;  4LWS A;  4LF5 B;  3H01 A;  3RYI B;  1XIL A;  2EJ7 A;  3X2Q B;  4TUY A;  4DW1 A;  2LGQ A;  5BY1 A;  4B3M O;  2UU9 O;  4OXS A;  3IFX A;  1Q6U A;  2EZP A;  4X65 O;  1SA0 B;  4DV3 B;  1AI5 A;  4TV8 B;  2B5U A;  2M6Y A;  3CE2 A;  4QGP A;  3ZMZ A;  4R7C A;  3A8T A;  3DC5 A;  4I9W A;  5EBW C;  5GON A;  4CH6 A;  5IE9 A;  1MAB G;  2WLL A;  4LF4 B;  5IJ0 B;  1MZE A;  1MZF A;  5BMV B;  3T1H B;  4RAI A;  3LUT B;  3AK3 A;  3ABK C;  3CXC U;  1D5N A;  5KAI Z;  4EFB A;  4TUY B;  4MVU A;  2P22 C;  2F66 C;  3B09 A;  2QGN A;  2QEX V;  3S3X A;  1S5L Z;  2WLJ A;  3ZRX A;  1W59 A;  2FKX A;  4JI8 B;  3AG3 B;  5GON B;  1AB3 A;  1XEQ A;  4BIU A;  2CTP A;  2IH1 C;  1I94 B;  1R3L C;  1S5J A;  1GO3 F;  2IBZ H;  2X6C A;  1NTM H;  3VQV A;  4F6R A;  3BA8 A;  1XMQ B;  4CC6 A;  5J9P C;  1VQK V;  3UCS C;  5IYZ B;  5EC2 C;  4LF9 B;  2C2A A;  1IBL B;  1S77 D;  4JAA A;  3WB2 A;  3UO2 A;  3J7A U;  2PZS A;  2R9R B;  2V1D A;  4TWK A;  2OCC C;  2DE0 X;  1K92 A;  1Y76 B;  1NVP D;  2E3C A;  5H2F Z;  2F95 B;  3UT5 A;  4JI6 O;  3NR7 A;  3OEH G;  1PKX A;  1S3J A;  4KFM A;  3W7W A;  4UCR A;  5A9G A;  4JI5 O;  3SJC C;  1EFR G;  1SS3 A;  4UV8 A;  5LMU B;  2EIJ C;  4DYL A;  1Y66 A;  1QLE B;  1K7D A;  3SPH A;  3FX7 A;  1S76 D;  2Q7H A;  1UPG A;  3HKE A;  4O2B A;  3H1I H;  5IT9 N;  2E74 B;  5LHI A;  4JI0 O;  1BCC H;  1FPO A;  4GX1 A;  3UT5 B;  1AP5 A;  4O4J A;  1KB9 F;  2DQ3 A;  1W0K G;  4ABM A;  1RM1 C;  3ETD A;  1Y67 A;  4ZOL B;  2Q8V A;  4O2A B;  1G4Y B;  2A79 B;  2DN9 A;  3C3S A;  2UUB B;  1NZ6 A;  1N4C A;  4FK5 C;  4JAV A;  1ZUQ A;  1N34 B;  2QM4 A;  4LFB O;  4KL1 A;  2N05 A;  2YID A;  1JA8 A;  1FKA O;  1FFX B;  5E79 Z;  3OFN G;  1XMQ O;  5EYP B;  4FLZ A;  2CDY A;  5LBQ A;  4JYB A;  2PI5 A;  2AZ2 A;  4FLW A;  4LNU A;  1KP2 A;  1OCO C;  4K8X A;  3JD0 A;  2JEU A;  2HHH B;  4OX9 O;  3MD0 A;  4O2A A;  1J95 A;  1VMG A;  2JJ2 G;  4GYC B;  4X1I B;  3JAT A;  2F93 B;  3CD6 V;  3ZMU A;  4AQY O;  1VQN V;  3QO8 A;  4MTF A;  4JYA O;  4FFK A;  1Q86 W;  5JQG B;  3ZHV A;  4UXN A;  4J41 A;  3T1H O;  4P9O A;  1HP8 A;  1Q6I A;  2LQT A;  1JCH A;  4JAS A;  4LFA B;  3G6E V;  3JD4 A;  4LF4 O;  1OHH G;  2JS3 A;  2DQ0 A;  3W7S A;  3APO A;  4X88 A;  2ZE6 A;  4BIZ A;  3AK1 A;  3K0D A;  1DK1 A;  2PY5 A;  2R9A A;  4X1I A;  3FB5 C;  3OGI B;  3JAL B;  2Q5Z A;  4NB5 A;  1I08 A;  2QM7 A;  3ZMT A;  1JJO A;  1QNM A;  3HKD B;  3ZN0 A;  1QBZ A;  2UU9 B;  4B3M B;  2ZCE A;  4WFA V;  2HJF C;  3TGU H;  4JTA B;  4X1Y B;  3F5T A;  3PN1 A;  1I0H A;  2P67 A;  4JI7 O;  4TT3 G;  1M90 W;  2W6J G;  2FML A;  1O9G A;  3K04 A;  3E22 B;  1K8A W;  1B3Q A;  3JCZ A;  4IIJ A;  4JI3 O;  3UM7 A;  4IHJ A;  1FXK A;  1JR9 A;  4HNA B;  3STL C;  2BSK B;  3QO5 A;  3AG1 B;  1K4D C;  5CMU A;  2EBO A;  4FLY A;  2FL4 A;  5J2U A;  4B3R B;  5BR8 B;  2QA4 V;  4XBF A;  4JI4 O;  4OGQ B;  2JJ1 G;  3L70 H;  4MTX A;  5H5N A;  3LSU A;  3ICX A;  1R1B A;  1YVW A;  2WLI B;  5B3S B;  1COW G;  3QG5 A;  3SPG A;  2Q68 A;  3DTU B;  4WBN B;  4U7N A;  4R6Z A;  4IHJ B;  5KHJ A;  1X4T A;  3C90 A;  3RYI A;  2HG5 C;  2UUC B;  2ODM A;  3K59 A;  1KC8 W;  3MHS C;  5K1P A;  5FLX N;  4GX5 A;  1NR1 A;  2HP8 A;  3DXR A;  1YJN V;  4FLX A;  4MVQ A;  4TV8 A;  1AI4 A;  3K5M A;  4QJF B;  5IWA O;  3OMI B;  2PYJ A;  1XNQ B;  4DR2 B;  3CJH A;  5EBM C;  1N33 O;  3GWK C;  1VQ5 V;  5L3C A;  1XDC A;  2XOK G;  2VRZ A;  4ZIB A;  3LSQ A;  4WFF A;  4KP4 A;  4BR6 A;  2XAQ A;  1YCI A;  4KUM A;  1FS0 G;  2ADP A;  2HLD G;  5DEC A;  5LP6 B;  3BCC H;  3VBB A;  1EN5 A;  2VWJ A;  3B8M A;  2F43 G;  2ZQM A;  5EZY A;  1N32 B;  4K0K B;  1Y6X A;  1QLE C;  1IVS A;  4WFB V;  1H2K A;  2AZ0 A;  4GKK B;  4UB8 Z;  3SJA C;  4D6T H;  4FVM A;  5B1O A;  1VQ6 V;  2K9P A;  3QVN A;  2QWQ B;  3ZHR A;  3BY6 A;  1SER A;  1Z5W A;  5FPR A;  3CB2 A;  3T1Y B;  5LHH A;  1ZAU A;  3F5W C;  4ZI7 B;  3E8H A;  2D3O W;  3AG7 A;  5CA0 A;  2WLM A;  1Y76 A;  4CH5 A;  1Z2G A;  2Y48 A;  1OZ0 A;  4U3J B;  2OIE A;  1AI6 A;  4GLX A;  4A5U B;  1ZTE A;  4DV4 O;  1VQM V;  5B66 Z;  1NR7 A;  2CK3 G;  4TQD A;  1B04 A;  4B3T O;  3CP1 A;  3R66 A;  5EC1 C;  3HPL C;  4BW9 A;  2E76 B;  5B1B C;  1VQO V;  3G71 V;  3OT7 A;  4YJ3 B;  2ATK C;  4DR6 B;  4MSW C;  3WG7 B;  3MHH C;  2HEP A;  3AG3 C;  3ZBH A;  4H44 B;  4F4L A;  2A9H A;  3TCU A;  1UJW B;  3QF7 A;  4ASU G;  2X6A A;  4FLT A;  3T4Z A;  4PDM A;  4O4J B;  1K73 W;  2ZR2 A;  3HB3 B;  3J81 N;  1G8M A;  2GSM B;  4YXW G;  5KA6 A;  5IJ0 A;  1RFY A;  2LGW A;  5KAF Z;  1HNX O;  2KG7 B;  2EX3 A;  3IC9 A;  5B1B B;  2P4K A;  1G1X B;  4LF7 O;  2E75 B;  1VEW A;  3ZMV A;  1JMK C;  3AEI A;  2P90 A;  2OIG A;  2ILM A;  1P4R A;  4X64 B;  5EYP A;  1JFF A;  1WPB A;  2KQX A;  4B3T B;  3DC6 A;  2EIL C;  5CA3 A;  2B9Z A;  4PA3 A;  4X66 O;  4DV4 B;  4B7K A;  4KHP B;  3BAA A;  2EIN C;  1GK9 A;  2MW2 B;  2Q73 A;  1OCC C;  4WFG A;  1LUV A;  3ASO C;  1XBL A;  2MK3 A;  3JAT B;  2KG7 A;  2Q69 A;  2PYL A;  4FFB A;  1QVG U;  1R6N A;  1CPY A;  3OEE G;  4Z1V A;  3RYC B;  1SZT A;  3KG2 A;  3L74 H;  2ZD9 A;  1DGS A;  4UCO A;  2AW9 A;  1M57 C;  1SQP H;  4NTW A;  5B1N A;  3BVO A;  3ABL B;  3MAQ A;  3JAW B;  1GM9 A;  3LDD A;  4DW0 A;  5LL6 Y;  1M1K W;  4K0K O;  4P9P A;  5IYC O;  3PJS K;  1QCE A;  2ITC C;  2ZIM A;  4UCU A;  3G4S V;  2ZE8 A;  1B06 A;  4I50 A;  5LP6 C;  3WU2 Z;  1Q82 W;  3RYC A;  4IL6 Z;  2EZO A;  4LP8 A;  4JV5 O;  4IT5 A;  3JAS B;  2WLH A;  1K34 A;  3U0Z A;  4EFE A;  1XL4 A;  2XAS A;  3D3I A;  1XL6 A;  1LNQ A;  2AHY A;  2EIM C;  3E22 A;  2N04 A;  3OTO O;  3P30 A;  2JVD A;  1PM9 A;  4MVO A;  2P7T C;  2ITD C;  3SYP A;  4YIO A;  1N0J A;  3ZED A;  3F7V C;  1WP7 A;  4MTG A;  4I50 B;  1NS1 A;  2ZR3 A;  3L71 H;  4LFC B;  2VQF O;  1HNW B;  3CX5 F;  1D2D A;  3N2G B;  1QVF U;  4X1K A;  2JK5 C;  3E89 A;  1HW7 A;  1IDS A;  2L6L A;  4PA4 A;  4DR1 O;  3Q4H B;  5GTI Z;  3E8G A;  1L0L H;  1LR1 A;  4DV0 O;  2UUC O;  2CAZ C;  1H38 A;  4RUE A;  2ZE7 A;  5L3G A;  4IYI A;  5EIB C;  5DN6 G;  2ZE5 A;  3E8B A;  4TV9 B;  1FAF A;  1QR8 A;  5LA6 B;  4J80 A;  2P5O A;  1KKC A;  3JAM N;  3IC7 A;  1YIJ V;  2AHZ A;  2YIA A;  3W7X A;  4LNU B;  2H8P C;  1PV0 A;  4MS2 A;  2JS5 A;  1UFI A;  2CE4 A;  3JD2 A;  1G6U A;  5KX5 A;  4F6E A;  3ABT A;  3U10 A;  3FAV B;  3JCU Z;  1T5E A;  4EB6 B;  4Z1M G;  5F2V O;  4JGS A;  4LF6 O;  1AVM A;  2NN4 A;  2QKS A;  3ABL C;  3SJB C;  5KHH A;  2GBO A;  3TJT A;  5LGU A;  4I5S A;  3OM3 B;  2LJ2 A;  1NH2 D;  2ZM6 O;  3OD4 A;  4FIP C;  4I0X B;  1N33 B;  1KUQ A;  1KEC A;  4J9Z B;  2PTM A;  5LOV B;  3FYE B;  2QDO A;  5JVD B;  5TIS Z;  1HNZ O;  1SF9 A;  2DJV A;  3RYH B;  3RW0 A;  5KX5 B;  2UXN A;  2Z0A A;  2ZDI C;  1F4N A;  3A0H Z;  2IU3 A;  1V54 C;  3JAL A;  3R65 A;  3HKB A;  1VF6 C;  1SQF A;  1VF7 A;  1HWY A;  1J5E O;  4FLU A;  4LFC O;  2CUG A;  1ZSP A;  2IJH A;  2UXB B;  4U7O A;  3K5L A;  1MG1 A;  3JAK A;  1E1R G;  2QWN B;  3D36 C;  3N27 A;  1L1F A;  3JAR A;  3ZS8 C;  3ZJZ A;  4MW3 A;  2QSA A;  4I0X A;  4JZ2 A;  4ZHQ A;  3P3P A;  3HKC B;  2ZXW B;  5LOV A;  1NH2 B;  3N2K A;  1XOU A;  5B3S C;  4QNH B;  4DR4 O;  4LWS B;  1US6 A;  2ZIN A;  3L72 H;  5JJE B;  1SA0 A;  4GKJ B;  2DWE C;  1ARO P;  2O57 A;  4ICG A;  4W4L A;  1WP8 A;  1Q81 W;  4MVS A;  2F4V O;  4UVB A;  3J80 N;  1VQ7 V;  5IJ9 B;  4WBN A;  5BMV A;  2XND G;  4X62 B;  1GH6 A;  2M7W A;  2PGG A;  1IBK O;  1IXB A;  3E86 A;  3K58 A;  4ZBM A;  1M93 A;  2X0L A;  5CB4 B;  1Q6H A;  5JJJ B;  4D7T A;  4DV1 O;  5L3D A;  2XHB A;  1PNM A;  2UXD B;  4B3S O;  2YXL A;  5LGN A;  3B4S A; 
#chains in the Genus database with same CATH homology
 1YSC A;  3OMI B;  1VQ9 V;  2ZDI A;  1OCO B;  1OCZ B;  3RVZ A;  2LFR A;  5EBM C;  1K3E A;  1YHQ V;  1VQ5 V;  5L3C A;  1YTF D;  3QO7 A;  2LFS A;  1GMG A;  2XOK G;  2WAM A;  3RBZ A;  4QPK A;  4MVR A;  4PEL A;  1PNK A;  3LSQ A;  3LSS A;  4MT8 A;  4WFF A;  4KP4 A;  4R8C A;  3ASN C;  4PDV A;  2XAQ A;  1WPX A;  2KB1 A;  4KUM A;  1FS0 G;  4P30 A;  1M56 B;  4PDL A;  2WSS G;  3AG2 C;  2HLD G;  3CCS V;  4QPJ A;  4ZKI A;  1NKD A;  3K9A A;  1K9M W;  3VBB A;  5CBF A;  3NXS A;  5IDJ A;  1H8H G;  1I5X A;  2IH3 C;  3B8M A;  1YTF B;  2F43 G;  2ZQM A;  4GT1 A;  1SES A;  1AI7 A;  3ASN B;  1QLE C;  5IY5 C;  5KUM A;  4WFB V;  1AJQ A;  4QE9 A;  1PNL A;  1JQ0 A;  3W7T A;  1H8E G;  1RPO A;  5IYD O;  4Q20 A;  5B1O A;  2HKO A;  2Q67 A;  1VQ6 V;  3SYQ A;  2YSU B;  4EKW A;  4UUJ C;  2EIM B;  2HFE C;  4X89 A;  2EIJ B;  5B1A C;  2BOC C;  4LCU C;  3BY6 A;  4FPP A;  1SER A;  3CCU V;  3B77 A;  5HFL A;  2V7Q G;  5LHH A;  3OMN B;  2OTJ V;  3F5W C;  4GX2 A;  4MVZ A;  3E8H A;  2D3O W;  1R73 A;  3TK1 A;  2WLM A;  3BEH A;  1M9N A;  1BHA A;  3AG1 C;  2Y48 A;  1OZ0 A;  4HAM A;  1AI6 A;  4PDR A;  2GHY A;  1RM1 B;  3SJQ C;  4PA6 A;  5L3B A;  2X6B A;  1NVP B;  1BMF G;  1BL8 A;  3FYI B;  1GKF A;  3T2M A;  1VQM V;  1NR7 A;  2CK3 G;  3DGE A;  2EIK C;  1AR1 B;  2OCC B;  3CP1 A;  5EC1 C;  3HPL C;  3ABK B;  2LP7 A;  1ZWI C;  1WLE A;  2WWW A;  3IGA C;  5EK0 A;  5B1B C;  1VQO V;  3G71 V;  1THZ A;  1P7B A;  5GW7 A;  3CYO A;  1YJW V;  3GWO A;  3FB7 C;  2ATK C;  1NQT A;  3SYA A;  1KQS U;  2EJR A;  2FTK A;  4MSW C;  3WG7 B;  3H01 A;  3ETG A;  3MHH C;  1M57 B;  4L87 A;  3X2Q B;  1FXK B;  2JEX A;  4OXS A;  3AG3 C;  3IFX A;  3CME V;  2EZP A;  5CN0 A;  5CBH A;  1V54 B;  1AI5 A;  1K5S A;  2A9H A;  4JF3 A;  4F4L A;  3TCU A;  1UJW B;  4ASU G;  2B5U A;  2X6A A;  3T4Z A;  4PDM A;  3ASO B;  2B1G A;  1OCC B;  2DYS B;  4J9Y B;  3ZMZ A;  2ZR2 A;  4R7C A;  1K73 W;  3HB3 B;  1G8M A;  2GSM B;  4YXW G;  5KA6 A;  4RQE A;  2OTL V;  4I9W A;  2BOB C;  5EBW C;  3X2Q C;  1QLN A;  1PL0 A;  1MAB G;  2IJK A;  2EIL B;  1YI2 V;  2WLL A;  1F4M A;  3RVY A;  4QIW F;  2WLI A;  1GTO A;  5B1B B;  3F7Y C;  1KP3 A;  4RAI A;  3LUT B;  3ABK C;  3ZMV A;  1VQL V;  3CXC U;  3AEI A;  3EHB B;  2P90 A;  3OW2 U;  4MVU A;  3AG4 C;  1AJP A;  1P4R A;  4XDK A;  5C93 A;  3I55 V;  3K06 A;  4HZ3 A;  4FJC C;  1JJ2 U;  2QEX V;  4GCZ A;  4QE7 A;  3W7U A;  2EIL C;  5CA3 A;  3K3W A;  4PA3 A;  2WLJ A;  3ZRX A;  5H6Q A;  3FB8 C;  1R3J C;  4HYO A;  2QM8 A;  2EIN C;  3AG3 B;  1GK9 A;  3QNE A;  1OCC C;  4WFG A;  3ASO C;  2IH1 C;  4BIU A;  2MK3 A;  3M99 B;  5L3F A;  3ML0 A;  3VOU A;  2Q69 A;  1R3L C;  1GO3 F;  2X6C A;  5KUK A;  1QVG U;  1R6N A;  1CPY A;  3OEE G;  4UV9 A;  1SZT A;  1W0J G;  3KG2 A;  2ZD9 A;  1CEZ A;  5J9P C;  1VQK V;  2JIZ G;  3LDE A;  1M57 C;  4WFE A;  1W2B U;  5B1N A;  2ZXW C;  3ABL B;  4RUF A;  1FXV A;  3CCL V;  5DM6 V;  5EC2 C;  2C2A A;  1GM9 A;  3LDD A;  1S77 D;  1CP9 A;  3SYO A;  1M1K W;  3CCV V;  1H2G A;  3CMA V;  2R9R B;  2V1D A;  4P9P A;  5IYC O;  3PJS K;  3OUS A;  1QCE A;  2ITC C;  4TWK A;  2DWD C;  2OCC C;  3ZMS A;  2Q6A A;  2IW5 A;  1K92 A;  5HFM A;  4RQF A;  2XAH A;  3G4S V;  1NVP D;  4DO2 A;  3STZ C;  2NLJ C;  1DF5 A;  1EZJ A;  1Q82 W;  2XAF A;  3AG2 B;  3OEH G;  1PKX A;  1S3J A;  2EZO A;  4KFM A;  4JTD B;  4JYC A;  4LP8 A;  4MVM A;  3UKM A;  3FKS G;  3W7W A;  4TSF G;  1EBO A;  3ZN1 A;  1YIT V;  1IXM A;  1E79 G;  1K34 A;  2WLH A;  1GM7 A;  2YEV B;  3JYC A;  2X7R B;  1EFR G;  2QE7 G;  1KKD A;  4UV8 A;  1XL4 A;  2XAS A;  3D3I A;  2PI4 A;  2EIJ C;  5B1A B;  1XL6 A;  1Y66 A;  1LNQ A;  2AHY A;  2EIM C;  1QLE B;  1K7D A;  1VQ4 V;  3JD3 A;  5IYB O;  3CPW U;  3P30 A;  3SPH A;  4WF9 V;  4MVO A;  2W6I G;  1S76 D;  1F23 A;  2P7T C;  3CC2 V;  2ITD C;  1QR9 A;  3SYP A;  3F7V C;  2R9I A;  3D36 A;  4MTG A;  3SYC A;  1ORQ C;  5H6R A;  4FMT A;  5IY5 B;  3ABM C;  5LHI A;  1S5H C;  2HVJ C;  1V55 B;  2ZR3 A;  3ZRS A;  4GX1 A;  3CCQ V;  2JDI G;  1QVF U;  1E1Q G;  3JD1 A;  3K0G A;  2DQ3 A;  1W0K G;  1RM1 C;  2JK5 C;  3E89 A;  5E1A C;  1I5Y A;  3ETD A;  3ZRW A;  1OCR B;  4H33 A;  4PA4 A;  3GB7 C;  4PA7 A;  1V55 C;  2WPD G;  3E8G A;  2YEV A;  4RO2 A;  2WLL B;  1FFT B;  1G4Y B;  2OT5 A;  2A79 B;  1Y4M A;  1NJI W;  1H38 A;  2IJI A;  4RUE A;  5L3G A;  1MOF A;  4FK5 C;  4JAV A;  2IU0 A;  5DN6 G;  4XDJ A;  4MTO A;  3E8B A;  1S72 V;  1ENV A;  1QR8 A;  3OR7 C;  1OCZ C;  3SPC A;  2QTO A;  4LC1 A;  3OFN G;  3IC7 A;  1YIJ V;  2AHZ A;  1R6K A;  2K1E A;  3W7X A;  2HR3 A;  1JOY A;  1K5Q A;  4UVA A;  2H8P C;  4XDL A;  4JYB A;  5LBQ A;  2B1I A;  4MS2 A;  2PI5 A;  1ROP A;  3A0R A;  1S0V A;  4X8A A;  1KP2 A;  1OCO C;  3JD2 A;  2DYR C;  3JD0 A;  3ABT A;  2JEU A;  4E2L A;  2XAJ A;  4Z1M G;  4CBC A;  4UVC A;  3MD0 A;  1J95 A;  2JJ2 G;  2WLK A;  4JGS A;  3K03 A;  2XAG A;  3CD6 V;  3ZMU A;  3ABM B;  3FB6 C;  1VQN V;  1DTO A;  3QO8 A;  2QKS A;  3ABL C;  4JPR A;  2A0L A;  1M56 C;  4MTF A;  3ZRV A;  2HVK C;  4JTC B;  3ZCC A;  4BW5 A;  3ZIA G;  5LGU A;  1Q86 W;  3CC4 V;  4I5S A;  1B6Q A;  3OM3 B;  3LNM B;  3B8N A;  3OE7 G;  4UXN A;  2Z5U A;  1NH2 D;  4FIP C;  4P9O A;  4JAS A;  1JCH A;  3I56 V;  1JPX A;  5FL7 G;  1DLB A;  3G6E V;  1KEC A;  3CC7 V;  1F51 A;  3JD4 A;  4J9Z B;  1Q7Y W;  3FYE B;  3E2E A;  1OHH G;  1VQP V;  4H37 A;  3RW0 A;  5KA5 A;  2UXN A;  5LHG A;  2ZDI C;  1F4N A;  2DQ0 A;  3W7S A;  4X88 A;  4BIZ A;  4N23 A;  3OGC C;  3K0D A;  4GX0 A;  2IU3 A;  1V54 C;  3R65 A;  1NBM G;  1SRY A;  3FB5 C;  4R50 A;  3P32 A;  1HWY A;  3ZMT A;  2QM7 A;  3K79 A;  5H9C A;  2IJH A;  1MSW D;  3AG4 B;  4G2K A;  4U7O A;  1MG1 A;  3SPI A;  5BZB A;  3WG7 C;  3ZN0 A;  1QBZ A;  2H94 A;  1E1R G;  4WFA V;  2HJF C;  1TUE B;  1FXH A;  1R3I C;  4JTA B;  1L1F A;  5LGT A;  2P67 A;  3ZJZ A;  1K4C C;  4MW3 A;  1K33 A;  3CCJ V;  4TT3 G;  5CBG A;  2W6J G;  1M90 W;  3OR6 C;  1N8R W;  1JX9 A;  3K04 A;  2ZXW B;  1JVM A;  1NH2 B;  1K8A W;  3EFF K;  3JCZ A;  3OAA G;  4QNH B;  5B3S C;  1R3K C;  3UM7 A;  3ABU A;  2Y69 C;  3WFV A;  1FXK A;  4LBE C;  4MW8 A;  3STL C;  1AJN A;  3CCE V;  3QO5 A;  2DYR B;  3AG1 B;  4PA9 A;  1K4D C;  4JAU A;  5CMU A;  2Z3Y A;  1DF4 A;  2EBO A;  2UXX A;  3SPJ A;  2DWE C;  2EIN B;  2DYS C;  1FXK C;  1ARO P;  3ZRW B;  3T1C A;  3LDC A;  2DW4 A;  2QA4 V;  3E83 A;  4XBF A;  1PD3 A;  1Q81 W;  4MVS A;  2Y69 B;  5EBL C;  2IJJ A;  2JJ1 G;  4MTX A;  3ETE A;  4UVB A;  2NNU A;  3OUF A;  4WFH A;  3TET A;  1VQ7 V;  2WLI B;  1RPR A;  1COW G;  1K97 A;  3E35 A;  5B3S B;  3SPG A;  4N21 A;  2Q68 A;  2P6J A;  2XND G;  3DTU B;  4G28 B;  3E8F A;  4BAY A;  2M7W A;  3CCR V;  1VQ8 V;  4U7N A;  4R6Z A;  4WCE V;  1SET A;  2HG5 C;  5L3E A;  3E86 A;  4G27 B;  2W0F C;  1KC8 W;  1OCR C;  3MHS C;  4DXW A;  4ZBM A;  4GX5 A;  1NR1 A;  2X0L A;  4P2Z A;  1YJN V;  2EIK B;  3CCM V;  2WLN A;  5L3D A;  3K08 A;  4MVQ A;  1YJ9 V;  1AI4 A;  1BHB A;  3OMA B;  1PNM A;  1GM8 A;  4QJF B;  5LGN A;  4CZZ A;  3T4D A;  1KD1 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...