5BZBA

Navms voltage-gated sodium channel pore and c-terminal domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
total genus 34
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5bzbA00
5EC2C 3SPHA 3JYCA 3ZJZA 3ABKC 4RO2A 4RAIA 2A0LA 4LP8A 2A9HA 1BL8A 4PA7A 2WLNA 5EBLC 4CBCA 3SPJA 2WLJA 2JK5C 1ZWIC 4PDRA 3SYAA 5CBHA 2BOCC 2NLJC 2BOBC 4PA4A 3E8HA 3UKMA 5B1AC 4MVRA 3AG1C 4MVQA 4WFEA 4P9OA 5EK0A 1OCRC 2QTOA 4MVZA 1V55C 1XL4A 2X6AA 3LDDA 3E86A 4QNHB 5KUKA 4MTOA 3E8FA 2R9RB 4MTGA 3GB7C 4MW8A 3FB5C 2X6CA 4JTDB 4MS2A 3STZC 2ZXWC 3T4ZA 4LCUC 4OXSA 3T1CA 3ZRSA 2HVJC 3ASOC 2KB1A 3OR6C 4R6ZA 1LNQA 2ZD9A 4JTAB 4GX5A 2WLHA 3R65A 1J95A 3E89A 4BW5A 1R3IC 2X6BA 4PDVA 4MVSA 1G4YB 4UUJC 4HYOA 4X89A 4TWKA 1OCOC 3F7VC 2Q6AA 4RUEA 4JTCB 2YEVA 2P7TC 2IH1C 2Q67A 3HPLC 2DYRC 4G28B 3T4DA 4P2ZA 4QE7A 3SPGA 1S5HC 4HZ3A 1QLEC 4R8CA 1R3JC 1M57C 4PDLA 4WFHA 3RW0A 3EFFK 4ZBMA 4GX0A 4H33A 3SJQC 2EIMC 3AG4C 4QE9A 1P7BA 4PDMA 2AHYA 3LNMB 1ORQC 3UM7A 3X2QC 2DYSC 3OR7C 3LDCA 2OCCC 4MVUA 3SYPA 5CBGA 4R7CA 3AG2C 2K1EA 2EIJC 3RVZA 2WLLB 3BEHA 4GX2A 2QKSA 2EINC 2HVKC 3K06A 3OUFA 4G27B 4PA6A 2DWEC 2ITCC 4H37A 4XDLA 3SPIA 3SYQA 3RVYA 3FB7C 4PA9A 3IGAC 4X8AA 4J9YB 4LBEC 2H8PC 3SPCA 3STLC 3LDEA 4XDJA 1KKDA 1OCZC 1R3LC 1K4DC 2ATKC 2W0FC 3K0GA 3SYOA 2EIKC 3F5WC 3T2MA 2ITDC 2WLKA 2A79B 3K08A 2Q69A 3ABMC 5B1BC 3K03A 4RUFA 1V54C 3FB8C 2WLMA 4WFFA 4R50A 5E1AC 3F7YC 4MW3A 5KUMA 5IY5C 2DWDC 3FB6C 5BZBA 3K0DA 1OCCC 2WLLA 2HJFC 4J9ZB 3ABLC 3E8GA 5EBMC 3IFXA 1R3KC 3ASNC 2WLIB 4MVMA 4P30A 2HG5C 2Q68A 1JVMA 3OUSA 5CBFA 3OGCC 4EKWA 1K4CC 3RBZA 4KFMA 3E8BA 5EC1C 4MVOA 3VOUA 3TETA 2Y69C 4X88A 3AG3C 4MTFA 4GX1A 2EILC 4DXWA 4I9WA 4MSWC 1XL6A 3PJSK 2AHZA 3KG2A 4P9PA 2IH3C 3K04A 4WFGA 4F4LA 4PA3A 5B3SC 5J9PC 3TCUA 3E83A 1M56C 3LUTB 2HFEC 4XDKA 3SYCA 5EBWC 3WG7C 2WLIA
chains in the Genus database with same CATH superfamily
3O9OA 2OYQA 2XUMA 3NR7A 2WLNA 3A8TA 4DR1B 3A0HZ 2GDSA 4WFEA 1FXKB 5AG2A 3FB5C 5KUKA 3N2GB 1N32O 1IBLO 3CXHF 4BIOA 4DW0A 1AJNA 1DK1A 3ZMVA 3ZMZA 3A0BZ 1P4RA 4DV3B 3QTCA 3KCXA 1G4YB 1BHBA 4AQYB 2FTKA 4X1KB 3JAKA 4NB5A 4DV7B 4J80A 4G28B 5CA1B 1Y66A 3RW0A 4FFBA 5JVDA 4NXMO 1VQ4V 4QE9A 2Y69B 2ZE6A 4JI5O 2MW2B 3ZHUA 3K9AA 3P32A 1OV9A 3HR0A 3LSSA 2EIJC 1KU9A 5IYBO 1AVMA 1KMIZ 3CCMV 1KP2A 1EZJA 3BABA 4XDJA 1R3LC 3WB2A 4FLUA 4JYAB 4B7EA 1S77D 2WLKA 4PHZA 3ABMC 4DV4B 5E1AC 4GKJB 5L3CA 3VQVA 4LFAO 4TUYB 1K92A 2UXXA 3TK1A 3T1YO 3IAYA 5ITZA 3TXSA 4UVBA 3CCEV 4JI6B 4IL6Z 4X88A 4I9WA 3U0ZA 1FXHA 3CRCA 1F4MA 3OFNG 2EULA 1I5XA 1HNZO 2UUBO 3OTOB 4JAAA 1TUBA 2P06A 5L3FA 2QM7A 3RYHB 1XHZA 5B1AC 3A2FA 4MVRA 3E86A 4AHCA 3JD4A 1ROPA 5D5QA 4OXSA 4LF8O 4LF9B 3FYIB 3CCVV 2Q0AA 4TWKA 3F7VC 1TVKB 2LO1A 1N0JA 1OCCB 1SA0B 1W0JG 4DR3O 1SQXH 5J2TA 4EEQA 3HPLC 3K57A 2ETNA 3T4DA 4QE7A 3IC9A 2IJHA 1U96A 4YIPA 4H33A 4PDMA 4AILC 2PF4E 1Y74A 1WJZA 1ORQC 2LP7A 3RWRD 5L3BA 4DV1O 4UCUA 2QSAA 4GUNA 1KKDA 1PM9A 2AXTZ 4IHJA 4UV9A 2ITDC 1JQ0A 2JJ2G 1RSOA 2CDYA 2WLMA 4BWAA 2M7WA 1WPBA 1YZBA 3OUSA 3F5TA 3ICXA 1COWG 1UFIA 1TGOA 3RBZA 2EIJB 3BA9A 1SF9A 2Q5ZA 2EILC 1SQFA 4DYLA 4DR6O 1M9NA 3UCSC 3ZHSA 2YI9A 3ABMB 1HP8A 4KUMA 4NKGB 2QKCA 4LH6A 2V1DA 4RO2A 1GN2A 1R6NA 2A0LA 1EN6A 1KECA 1BL8A 2EJRA 4PA7A 2WLJA 1ZWIC 1BGYH 3ZBHA 4W4KA 1VQMV 1AJPA 1XL4A 3RGBA 4QNHB 2P90A 5KHHA 3ZS8C 2BTQA 4DK1A 1OCZB 3STZC 4LFBB 3OW2U 1X59A 2A06H 2QWOB 4RQFA 3CJHA 1G8MA 2KB1A 3OEHG 4DRXA 1EN4A 2Q7HA 4NYKA 4O4JA 2IM9A 4LC1A 4CS3A 1U97A 3NXSA 2VS0A 4B3RB 1OJHA 2E75B 2EIMC 4H44B 4CC6A 1GTOA 1H2NA 4OPHA 1NVPD 1XOUA 3CEIA 2UXCO 1BCCH 3AEIA 2YI8A 2PTMA 1YIJV 1WB7A 2CGOA 4JAUA 1VQ5V 5B1NA 1L1FA 2Q0OC 4XBFA 1H38A 4K35A 1JX9A 4CC5A 4UVCA 5ITZB 2XNDG 3UQ8A 1Z5WA 2CTRA 1L0NH 2YS8A 1XMOO 1FFTB 1ZTEA 2HEPA 3AG1B 1VIBA 5TISZ 3H1IH 1JOYA 4FFKA 3ABLC 1V9PA 3P3PA 3CHXA 2ADPA 4UXNA 1D5NA 1WNSA 1IXMA 1QR8A 3IJ4A 4YHHB 3FD9A 4O4IB 2YDEA 4YJ3A 3GWKC 2E3CA 3AG3C 3I5DA 4AI8A 1PL4A 3WU2Z 4FLVA 4GZRB 5GTHZ 3G80A 2XASA 1FXVA 3APOA 1K9MW 5CB4A 4DV2O 1G6UA 2GTAA 3C3SA 4JI3B 5JJEB 5LP6B 1RM1C 3X2QB 5KX5A 2JK5C 4DV6O 3JAWA 1AR4A 4X64B 3LNNA 4MVZA 5J2TB 1SKVA 3CWBH 1K5QA 4TSFG 3E8FA 4DR2B 2R9RB 3RT3C 1XNRB 2YC0A 2W0XA 1TA8A 4CS2A 1XILA 3W7TA 3ETEA 1B04A 2ZKOA 1GK9A 5IY5B 4I0XB 4O2AB 1M93A 2IBZH 2RN9A 1VQ9V 1GO3F 1Z5VA 2Q67A 1K73W 2EZOA 2JS3A 1E1RG 4MTXA 1S5HC 4IHJB 2QKAA 2NNUA 1N36O 1Q6HA 1RSOB 1N33B 1GM9A 2UXDO 4MVUA 1IBKO 3E22A 1W59A 5LYJA 5LOVB 4WFBV 4FLZA 3BFRA 1GN4A 4D7SA 3DXRA 3F5WC 5IYCO 4LF7B 5L3EA 5KHGA 1QHTA 5FPRA 1EFRG 2EZPA 1IX9A 5IE9A 2D2CB 1KBHA 3BVOA 2O57A 2VQEO 2WA3A 1BE3H 1SQVH 2WLLA 2UUCB 2EIMB 3U10A 2LGQA 1JFFB 1FAFA 1ZAUA 3H1JH 4LF4O 3E2EA 1WLEA 3VOUA 3CRRA 3AK3A 1CPYA 2FL4A 4DXWA 1E1QG 4MSWC 4X65O 4K8XA 1MMMA 1YHQV 3KCYA 5EYPA 2BTQB 2AZ2A 2H94A 3OAAG 4CBCA 4DRXB 4UCOA 5F2VO 5KHJA 4O4JB 1BMFG 3UKMA 4LNUA 4TV9A 5LGTA 4X1IA 3OE7G 5GW7A 3LDDA 3CCRV 1JMKC 4CH3A 4JI1B 4JI2B 3ZMSA 1YCIA 1PKXA 2ZXWC 3ZRSA 4DR1O 5H5NA 3DSQA 4R6ZA 4GT1A 4J7KA 2IJIA 4U7NA 5LXTA 1P49A 2PZSA 1SC5B 2GBOA 4HYOA 1Q43A 1M5IA 2UXBO 2KG7A 1IXBA 4D6TH 2VQFO 1HNWO 2P7TC 1R6KA 2IH1C 4I50A 5JQGA 5GTIZ 3ABTA 1R3JC 2YSUB 1HW7A 2YICA 4R8CA 4BIZA 5IDJA 1KC8W 3AG4C 5FNVA 5B5EZ 1P7BA 4FLYA 4FLXA 4AQYO 1S72V 1YVWA 3OM3B 5LMUB 2ZCEA 5A2QN 3DTUB 2DWEC 2HHHB 2H8PC 1G1XB 1L8DA 1FJGB 3RYCA 2ATKC 1YJWV 4YJ3B 2ZE7A 4L8JA 2V4DA 4LH7A 3VQWA 4UCVA 2HJFC 2VWKA 1H2KA 4P30A 3DC6A 1NQTA 3VBBA 1NZ6A 4DV4O 2W6JG 2JVDA 4IGGA 3D8CA 3JAWB 2F95B 5LMNO 2F66C 5J9PC 5EC2C 1XMQO 3QF7A 4I7ZB 1BT8A 2YXYA 2YUAA 2WPDG 1RFYA 3H1KH 3QNEA 2PI4A 1XHXA 4NR1A 5EIBD 4KXRA 3BHPA 4YY3O 3H1LH 5B1OA 4EB6A 2ZM6B 4LFCB 4MW8A 2JIZG 1SRYA 3T4ZA 3T1CA 1PPJH 3ASOC 2ZNJA 1VARA 1F4NA 4HNAA 4KHPB 2ZR3A 1OHHG 4BW5A 2PYLA 2GSMB 2IU0A 4PDVA 3CRMA 1OCOC 1F7YA 3E22B 5LYJB 3ZRXA 3PN1A 4JTCB 4F6EA 4YJ2A 3ASNB 3E35A 1S5JA 3TJTA 1SQQH 3DXRB 4GX0A 3SJQC 5IYDO 2QEXV 4UB6Z 3OR7C 3ZHTA 3CMAV 1IBMO 1F51A 2WLLB 4GX2A 3K06A 2Y0IA 4PA6A 1Q6IA 1AILA 3SPIA 3WB0A 3J81N 3Q4HA 1KYOF 4B3MB 1Z2GA 3QVNA 3TGUH 1AI5A 5DN6G 3CC2V 5H9CA 4LF5O 1I08A 5IWAB 1IVSA 4UCTA 5L3DA 4HAMA 3ETDA 2LFRA 4JYBA 2P4VA 4C7UA 2QTSA 3AG4B 2RDCA 5EYPB 2QWRB 2CH7A 2HP8A 2E5LO 3W7SA 1XI1A 2YIAA 4MVOA 2QGNA 1TAEA 5CA0A 4TV9B 1XL6A 5C93A 4JYYA 1O9GA 4F4LA 4K0KB 3TCUA 2E74B 3E83A 5CN0A 2EX3A 3I55V 3HKCA 3JASA 3J7AU 5LHIA 3ML0A 5KA6A 2CE4A 3ABKC 4ZI7A 5LXTB 1R1BA 2UUAB 2BOBC 2XAFA 4J41A 4JYCA 2KG7B 2QTOA 4JPRA 4I50B 4NTWA 3BA8A 3ABUA 4PD4F 1Q5OA 3W7XA 4UCSA 4ZOLA 4JV5O 2QJ1A 4J10A 3QG5A 1V54B 1VQOV 4JI8B 5KLVH 1N8RW 4N21A 3T1HB 4DV0B 2CTWA 1KD1W 3CCSV 1SERA 1YF2A 1BQ0A 4ABMA 3RYCB 1B06A 2C2AA 3JATA 2AHYA 5L3GA 3M8AA 4FK5C 2HJDA 1GM8A 2A3QA 3LSQA 4B08A 1A32A 3HKEA 3K59A 4H37A 1OZ0A 1N34B 4LBEC 3LDEA 4JAVA 1K4DC 1PL0A 2OTLV 1XUQA 2RCVA 3H1HH 1SETA 2Q69A 1K33A 4MW3A 4JI0B 1Y4MA 3AK1A 2JGDA 4FLTA 1WP7A 4LF6B 1S76D 4LR3A 1IBLB 2FYUH 3JD1A 2FKXA 3SJAC 2OCHA 2HR3A 1HDJA 1DLBA 4GX1A 1ZLZA 2RMKB 3OGIB 3KG2A 4UB8Z 4P9PA 3ZIAG 4WBNA 4PI0A 4IYHA 3P30A 3FAVA 3ZRWB 1VF5B 3CCLV 4JTDB 5FLXN 4JI4B 3MHSC 4RQEA 4FM1A 2DMXA 3JYCA 2JGUA 1RP3B 4NXMB 1S5LZ 3CX5F 4HNAB 2N74A 2BOCC 1I7FA 1OCRC 2L35A 2PUSA 4YJ2B 1R6TA 2UU9B 2X6CA 3R66A 4K3AA 4X64O 2H3OA 1BHAA 1LNQA 4JI7O 4JTAB 1S0VA 2ZIOA 2QM8A 3E89A 3K58A 4IYIA 5C8YA 4IIJA 1XNRO 5JH7A 2DE0X 2JS5A 3ABKB 2Z5UA 5BR8O 4LFAB 1YJNV 3Q4HB 5J2UA 4LWSA 1WP8A 1DF5A 1M57C 3JAKB 1WAZA 2B1GA 3T1YB 1H2MA 3G67A 4H13B 4FFBB 1NS1A 5JVDB 1BSMA 1WB8A 3H01A 1GAXA 2EINC 5H6RA 2HLDG 3QO7A 1I0HA 2OT5A 2CH7B 3L72H 1PNKA 4X62B 1BZKA 1NTMH 1N33O 4UCRA 4G2KA 5LBQA 1GN3A 3K08A 4B3TO 2Y4UA 4HBNA 4RUFA 5B1AB 2IJKA 5CA0B 4JASA 3KZIZ 2ZE5A 5BZBA 2B5UA 5LGNA 2JJ1G 1FS0G 3HKBA 3HKCB 3JASB 4LF7O 1HNXB 1GN6A 4Q20A 1FD9A 3RYIA 4ZI7B 4LF8B 4NVPA 2WSSG 4GCZA 2UUCO 2YXHA 2OWOA 4I5SA 3SGIA 2IH3C 2FB5A 5GONA 5B3SC 1XDCA 4DR3B 4DR7B 4DV5O 2HKOA 2ZT9B 5EBWC 3SPHA 1VQ6V 3ZJZA 3ZCCA 1Q8IA 5CA3A 3SJCC 1MNGA 1UJWB 1XNQB 1FKAO 2WA4A 1TUBB 3E8HA 1RPOA 3QO5A 4P9OA 4B7KA 4DV1B 1E79G 1VF7A 5H6QA 1QCEA 4FZ1A 1MSDA 4LCUC 5IYZA 3ZRVA 5DECA 1BQZA 4DUZB 1N4CA 4X89A 2Q7GA 1JPXA 3HKEB 3OT7A 4IT5A 3L71H 4WFHA 1QLEC 3MD0A 5BY1A 3LNMB 5HFLA 2EILB 2IJJA 1Y74B 5LA6A 1Q3EA 2JGDB 2IU3A 3VQXA 2ITCC 2F43G 3RVYA 1K5SA 5LMUO 3CC4V 1QQCA 4X66B 4E2LA 3ZX6A 2HHHO 2Q8VA 1M57B 1FJGO 4WBNB 3FAVB 4DUYO 4PJ0Z 4D7TA 1B6QA 3CCUV 5CBFA 2P22C 4OX9B 2LJ2A 3E8BA 1US6A 4GKKO 2Z0AA 4PV1B 2F4VO 4UV8A 1SQPH 4J7JA 2AHZA 1B3QA 4WFGA 1J5EO 3L74H 3WFVA 4TT3G 1KQSU 3JD3A 4TQFA 5C8YB 4CS4A 4IIJB 5JH7B 2QE7G 5K1PA 3A0RA 3B77A 3S3XA 2ZINA 2P4KA 3HKDA 3OMIB 5J2UB 2MK3A 2HVJC 1UPGA 4O2BA 3L9DA 1WPXA 1PNMA 2WLHA 5B3SB 1RPRA 1YEWA 1ZSPA 3C3TA 3CJHB 1FYJA 2ZM6O 4LFCO 1VF6C 2Q6AA 3ABLB 2XAHA 1P7GA 1VQ8V 2ZE8A 2DYRC 1PNLA 2YIDA 1Q82W 1XQ8A 4HZ3A 4QPJA 3W7UA 1JR9A 2CAZC 3AG3B 1M4UA 3JCUZ 4R7CA 2F1MA 4XDLA 5LL6Y 1FXKC 3HKBB 2CTPA 3D3QA 5KMGA 3SPCA 2GTSA 3B4SA 4DV2B 3RYIB 1RM1B 4UVAA 3SJBC 3CS5A 4DV3O 4NXNB 4PI2A 4WFFA 1KP3A 4DV6B 3F7YC 4B3MO 4TUYA 2R72A 3EHBB 5BXZA 5GONB 1KB9F 3J80N 1MA1A 1K97A 4DV7O 1QBZA 2B1IA 3JSLA 1R3KC 4MVMA 4DR5B 1JA8A 1MOFA 5B66Z 4KFMA 3EXAA 2Y69C 2QR4A 4Q6GA 3ZN1A 1IDSA 2QWPB 1H2SB 2PGGA 1MSWD 2EJ7A 2F23A 2Z3YA 3L73H 1NU1H 2XTAA 3SYCA 4DR4B 5KHIA 5IYZB 1QLNA 4JYAO 1HWYA 1MABG 5CB4B 2DOSA 3K9SA 1IURA 4GKJO 2UXDB 4QIWF 5KX5B 4GLXA 1AP6A 2UUAO 5FL7G 4JI6O 2XAGA 5A9GA 3JAMN 3CE2A 1R3IC 2GUZA 2Y48A 3CC7V 1NTZH 2N05A 1TUEB 5LA6B 4U7OA 3K5NA 3OTOO 4U3JA 5DM6V 4FZ0A 1W0KG 1NT2B 2DN9A 4BIUA 4OGQB 3OMAB 3B8NA 4DV0O 1NTKH 3LDCA 2LGWA 1CXZB 2A7WA 4X65B 2CGNA 2QKSA 3K5MA 3GWOA 3OUFA 3SYQA 3N2KA 5EZYA 1BS3A 4PA9A 4O4HA 1Q90D 3ZHVA 1SQGA 1MZFA 2KKWA 4LF9O 3T2MA 3B09A 4B3SB 2VWJA 5BMVA 3HB3B 1N34O 2ZNIA 1OCCC 5JJJB 1DTOA 2P5OA 5EBMC 2ZXWB 4JZGA 1M1KW 3RN4A 1O9HA 3GVMA 4Z1MG 4EKWA 3DC5A 4JI0O 3OMNB 5EC1C 3JARA 3OTFA 4NTXA 5FPOA 1MG1A 4LF6O 2UXBB 4U3FH 2YIBA 2V7QG 2VQFB 3HKDB 1HNWB 2QA4V 2HFEC 4FLWA 4CH6A 4O2BB 5JCOA 3OD4A 3EVKA 3RYFA 1VQLV 5CBHA 3KKYA 1MZEA 2ZDIA 4ICGA 5LHHA 4JI4O 3CMEV 2GV9A 4LNUB 3FYEB 3SR2C 4X1IB 5IJ0A 2PY5A 1EBOA 3JALA 3L75H 4F6RA 1Y76A 4GX5A 2DW4A 2UU9O 3ZEDA 2P6JA 1I94B 3CPWU 4EFBA 2YEVA 5H2FZ 2XHBA 3AG7A 1K34A 2XT9A 5KMGB 2X0LA 4P2ZA 3B8MA 3FX7A 5JQGB 4EFEA 4ZBMA 2ZR2A 3D36A 3UM7A 4QJFB 2DYSC 3OEEG 1KKCA 4ASUG 5FNVB 1AB3A 2OCCC 3LSUA 5CBGA 5JCOC 5LMNB 1CEZA 4CH4A 1HR0B 4G27B 3P3NA 2ZDIC 4LFBO 3FKSG 1XMQB 1OCZC 3K0GA 4FM2A 2JEUA 3FB6C 3L70H 4YXWG 4X62O 4X1YA 4YY3B 2ADQB 5CMUA 1AP5A 1H2GA 3JSNA 4B3RO 4O4IA 3ASOB 1PP9H 1PD3A 3BRCA 2AZ0A 5KAIZ 4UFZA 2BSKA 1NBMG 2X7RB 4DW1A 3B40A 3CCJV 2XOKG 1GMGA 1I5YA 5IJ9A 1OCOB 3H9VA 4N23A 2Y0PA 4I9QA 1L0LH 1HNXO 3CD6V 3K5LA 3D36C 2ZQMA 1M56C 1KUQA 4XDKA 5LP6A 2WLIA 1DF4A 2DQ0A 2BTOA 2A9HA 5EBLC 5IT9N 3SPJA 1N32B 2GUZB 3UT5A 4JF3A 1SS3A 4DR7O 3G6EV 3AG1C 4MVQA 1IBMB 2N04A 4YIOA 1M90W 2JDIG 3ETGA 4TV8A 4QPKA 3GB7C 1EZVH 4U3JB 1XNQO 2R9AA 4EB6B 2XAQA 2YIBD 4YHHO 2XAJA 2DQ3A 4LF5B 4I0XA 2M6YA 3R65A 4O2AA 4JGSA 2CUGA 2LW1A 4MVSA 4ZHQA 2QDOA 2BE3A 3JD0A 2BCCH 2AGAA 4JI5B 3N2KB 5EZYB 1VQ7V 4DUZO 4O4HB 1YTFD 3SPGA 4BR6A 2E5LB 3EFFK 4JI3O 1ZL8A 5JWPA 4KL1A 5DEDA 1LUWA 5LP6C 1SQBH 3X2QC 2CK3G 4FPPA 5BMVB 5LOVA 3M7MX 1VQNV 3ETQA 2YXLA 1YI2V 1NJIW 5E79Z 1JCHA 4E4EA 2ODMA 3BEHA 4DR2O 3VQYA 4J11A 4X8AA 1NH2D 2W0FC 3CB2A 3CXCU 2OTJV 3JARB 5B1BC 3CRAA 5IY5C 1JFFA 1JJ2U 3IFXA 2F93B 4X66O 2DYSB 2CTQA 3UO3A 5HFMA 4TOIA 2OCCB 4RWUA 2LW7A 1WA8A 4JV5B 3TETA 3RYFB 1T5EA 1HNZB 2UUBB 1Y67A 1THZA 4BW9A 1YTFB 2OIEA 3PJSK 4OPAA 4OX9O 4Z1VA 3UO2A 3WG7C 5IJ0B 2E76B 3JALB 4F6RB 1Y76B 3THOA 5LHGA 5KA5A 4PDRA 3SYAA 3BY6A 3ZN0A 1NH2B 1W2BU 1V55C 2YEVB 3SDLA 3CCQV 1VQPV 4O4LA 4BAYA 4WCEV 5K1XA 2GHYA 3K79A 3OR6C 3CP1A 1LUVA 1M56B 1NR1A 4ZOLB 4RUEA 3ZHRA 1WN7A 1GRJA 5D5PA 3G4SV 1EM1A 1YDXA 4FMTA 3IC7A 2FMLA 2RJZA 3B2EE 4L87A 1XBLA 1D5AA 3JATB 3SYPA 4ZIBA 1K7DA 3I56V 4X1YB 2HVKC 4JI1O 1GKFA 4JI2O 3K5OA 4J9YB 1Y6XA 2BSKB 3SYOA 1XREA 4GYCB 1XEQA 3D3IA 1FFXA 4H0LB 5IJ9B 2NR5A 1OCRB 4KP4A 2DWDC 2L6LA 1NVPB 5KHKA 1SESA 2QM4A 2K9PA 2WLIB 4NXNO 4DR6B 2UXNA 1DGSA 4I4TA 4JI7B 1H2LA 2WAMA 1GM7A 3UT5B 3DGEA 3ZMUA 3RFRA 4DR5O 3BCCH 4TV8B 5BR8B 1FPOA 3LUTB 4X20A 1YXBA 3U11A 5B1BB 2RQ6A 1LR1A 3N27A 1AJQA 4RAIA 3CSXA 4DK0A 4ZHQB 1VF6A 3BAAA 4PA4A 5EK0A 4DR4O 4I55A 2EINB 4DO2A 4K8ZA 2X6AA 4TQDA 2QWQB 2Q4PA 4MS2A 1ZL8B 4A5UB 1NR7A 2X6BA 4B3TB 3WG7B 4FM0A 1VEWA 1ENVA 1FXKA 2UXCB 1CP9A 2Y4TA 3MHHC 3N2GA 5LGUA 4PDLA 1IZ3A 4LWSB 1V55B 3FFQA 2LQTA 1AI6A 5KAFZ 4PELA 1JJOA 4CH5A 3AG2C 1XMOB 3QO8A 3RVZA 4R50A 4X1KA 2R9IA 5CA1A 4DV5B 1VP7A 1WA8B 2RNBA 3CRQA 2EIKC 4KHPO 1AI7A 2KQXA 1YJ9V 1N0NA 3APQA 3ZMTA 5KUMA 4WFAV 1Q81W 2ARHA 1NKDA 3K0DA 5JJNB 4J9ZB 2JEXA 3E8GA 3G71V 2JRIA 4J7ZA 3ASNC 2B9ZA 2HG5C 2PI5A 2Q68A 1JVMA 3MAQA 4B3SO 3OGCC 1AI4A 1X4TA 1K4CC 2QWNB 3AK2A 4MTFA 3WB1A 1ZUQA 2DJVA 4PA3A 1F23A 3JD2A 1K3EA 1QLEB 4O4LB 3M99B 4JZ2A 1QNMA 1SZTA 1YITV 2ZIMA 4LP8A 5EIBC 2IW5A 3ZHQA 5IWAO 1AR5A 3W7WA 2D3OW 2NLJC 1Q86W 1AROP 4FVMA 1S3JA 4ZKIA 2LFSA 4MTOA 2Q9LA 4MTGA 3S3WA 2ZD9A 1J95A 1QVGU 1URFA 3RYHA 4Z2WA 4UUJC 2NN4A 1YSCA 1Q7YW 1N36B 1K8AW 4FJCC 4K0KO 4WF9V 4DUYB 4NTYA 1GH6A 1ZX3A 1H8EG 1IBKB 2AW9A 1H8HG 3C90A 1PV0A 2Q7EA 2VRZA 2G38A 1FFXB 1I94O 1SZXA 4GKKB 2F4VB 4J42A 1TVKA 3G6BA 1SA0A 2K1EA 2PYJA 2OIGA 4QGPA 3FB7C 1J5EB 3IGAC 4W4LA 3STLC 3K3WA 4X9QA 2VQEB 1EN5A 1QVFU 2EBOA 1QU7A 4I4TB 3MDSA 1HR0O 2A79B 2Q73A 4JI8O 2ILMA 1NI8A 3K03A 1V54C 3FB8C 4LF4B 3O65A 1VQKV 4MT8A 3T1HO 3JCZA 2KSDA 4X20B 1AR1B 2WWWA 2R70A 4FIPC 1R73A 3AG2B 2W6IG 3CYOA 1P84F 3BPZA 3ZRWA 4CZZA 4I55B 3TXQA 1VMGA 1D2DA 1Q6UA 3K04A 2DYRB 2EIKB 2P67A 1QR9A
chains in the Genus database with same CATH topology
3SPHA 1DF4A 1VQ6V 3ZJZA 3ZCCA 5CA3A 2H94A 2DQ0A 3OAAG 2A9HA 2WLNA 5EBLC 4CBCA 3SPJA 1UJWB 4JF3A 1BMFG 3G6EV 3E8HA 3UKMA 1RPOA 3QO5A 3AG1C 4MVQA 4WFEA 4P9OA 1M90W 1E79G 5LGTA 2JDIG 1FXKB 3OE7G 5GW7A 3LDDA 3CCRV 3ETGA 5H6QA 1QCEA 4QPKA 3ZMSA 3GB7C 3FB5C 5KUKA 1PKXA 2ZXWC 4LCUC 3ZRSA 3ZRVA 2XAQA 1AJNA 2XAJA 2DQ3A 4R6ZA 3ZMVA 4GT1A 3ZMZA 2IJIA 3R65A 4U7NA 1P4RA 4JGSA 4MVSA 1G4YB 4HYOA 4X89A 3JD0A 1BHBA 1JPXA 2FTKA 2P7TC 1R6KA 2IH1C 1VQ7V 4G28B 1Y66A 1YTFD 3SPGA 4WFHA 1QLEC 3ABTA 1R3JC 2YSUB 4R8CA 3RW0A 3EFFK 3MD0A 4BIZA 5IDJA 1KC8W 1VQ4V 3AG4C 4QE9A 1P7BA 2Y69B 1S72V 3LNMB 5HFLA 2EILB 3OM3B 3X2QC 2CK3G 3K9AA 3P32A 4FPPA 1VQNV 2IJJA 3LSSA 1YI2V 1NJIW 1JCHA 2EIJC 3BEHA 3DTUB 2IU3A 5IYBO 2DWEC 2ITCC 2F43G 3RVYA 3CCMV 1KP2A 1EZJA 4X8AA 1NH2D 2H8PC 1K5SA 4XDJA 1R3LC 2ATKC 2W0FC 3CC4V 3CXCU 1YJWV 1S77D 2WLKA 2OTJV 3ABMC 5B1BC 4E2LA 5E1AC 5IY5C 1M57B 5L3CA 1JJ2U 2HJFC 3IFXA 1K92A 2UXXA 4P30A 1B6QA 1NQTA 2DYSB 3VBBA 5CBFA 3CCUV 3TK1A 5HFMA 2OCCB 2W6JG 3E8BA 4UVBA 3CCEV 3TETA 4X88A 4UV8A 1THZA 4I9WA 1YTFB 1FXHA 3PJSK 2AHZA 4WFGA 1F4MA 5J9PC 3OFNG 1I5XA 3WG7C 5EC2C 3WFVA 4TT3G 5L3FA 1KQSU 5LHGA 5KA5A 2WPDG 3JD3A 3QNEA 2PI4A 2QM7A 4PDRA 3SYAA 3BY6A 3ZN0A 5B1AC 4MVRA 1NH2B 1W2BU 2QE7G 1V55C 3A0RA 3B77A 5B1OA 2YEVB 3E86A 3JD4A 3CCQV 3OMIB 1VQPV 4MW8A 2JIZG 1SRYA 1ROPA 3T4ZA 4OXSA 3T1CA 2MK3A 2HVJC 4BAYA 4WCEV 3ASOC 2GHYA 3K79A 1F4NA 1WPXA 3CP1A 3OR6C 1PNMA 2ZR3A 1OHHG 2WLHA 5B3SB 3FYIB 1RPRA 4BW5A 2GSMB 3CCVV 2IU0A 1M56B 4PDVA 1NR1A 4TWKA 1OCOC 3F7VC 2Q6AA 1OCCB 3ZRXA 1W0JG 4RUEA 3ABLB 2XAHA 1VQ8V 4JTCB 3ASNB 3E35A 3HPLC 2DYRC 1PNLA 3T4DA 1Q82W 4QE7A 4HZ3A 2IJHA 4QPJA 3G4SV 4GX0A 4H33A 3SJQC 3W7UA 4FMTA 4PDMA 3IC7A 5IYDO 3AG3B 1ORQC 2LP7A 2QEXV 3OR7C 5L3BA 4L87A 3CMAV 3SYPA 1K7DA 4R7CA 1F51A 2WLLB 4GX2A 3I56V 2HVKC 3K06A 4XDLA 4PA6A 1FXKC 1GKFA 3SPIA 4J9YB 3SPCA 1KKDA 1RM1B 1AI5A 3SYOA 5DN6G 4UVAA 5H9CA 4UV9A 3CC2V 2ITDC 3D3IA 1JQ0A 2JJ2G 4WFFA 1KP3A 1OCRB 2WLMA 4HAMA 3F7YC 3ETDA 5L3DA 2LFRA 4KP4A 2DWDC 4JYBA 3EHBB 1NVPB 2M7WA 1K97A 3AG4B 1QBZA 1SESA 2B1IA 1R3KC 2WLIB 4MVMA 3OUSA 3W7SA 2UXNA 1COWG 1MOFA 3RBZA 2EIJB 4KFMA 4MVOA 2WAMA 1GM7A 2Y69C 3ZN1A 2EILC 3DGEA 3ZMUA 1XL6A 5C93A 1MSWD 2Z3YA 1M9NA 4F4LA 3TCUA 3E83A 3I55V 5CN0A 3LUTB 3SYCA 3ABMB 5B1BB 4KUMA 5LHIA 3ML0A 5KA6A 1QLNA 2V1DA 3ABKC 4RO2A 1AJQA 4RAIA 1HWYA 1MABG 1R6NA 2A0LA 2EJRA 1KECA 1BL8A 4PA7A 2WLJA 1ZWIC 2BOBC 2XAFA 4PA4A 5EK0A 1VQMV 4JYCA 4DO2A 2EINB 2QTOA 4QIWF 1AJPA 1XL4A 2X6AA 4JPRA 4QNHB 2P90A 4MS2A 1OCZB 3ABUA 3STZC 3OW2U 3W7XA 5FL7G 4RQFA 1G8MA 2KB1A 3OEHG 2XAGA 1V54B 1VQOV 1NR7A 1R3IC 2X6BA 2Y48A 3CC7V 1N8RW 3WG7B 4N21A 1ENVA 4LC1A 1TUEB 1FXKA 1KD1W 4U7OA 3NXSA 3CCSV 1SERA 1CP9A 3MHHC 5DM6V 5LGUA 4PDLA 1W0KG 2C2AA 2EIMC 1V55B 2AHYA 4BIUA 5L3GA 3OMAB 1GTOA 3B8NA 4FK5C 1NVPD 1AI6A 1GM8A 3LDCA 3AEIA 4PELA 3LSQA 1YIJV 3AG2C 3QO8A 3RVZA 4JAUA 1VQ5V 2QKSA 4R50A 3GWOA 3OUFA 3SYQA 4H37A 5B1NA 1OZ0A 4PA9A 2R9IA 1L1FA 4LBEC 3LDEA 4XBFA 1H38A 4JAVA 1JX9A 1K4DC 4UVCA 1PL0A 2OTLV 2XNDG 2EIKC 3T2MA 1AI7A 1SETA 1FFTB 2Q69A 1YJ9V 3ZMTA 3AG1B 5KUMA 4WFAV 1K33A 4MW3A 3HB3B 1Q81W 1Y4MA 1JOYA 1NKDA 3K0DA 1OCCC 1DTOA 4J9ZB 3ABLC 2JEXA 3E8GA 5EBMC 3G71V 2ZXWB 1M1KW 3ASNC 4UXNA 2HG5C 2PI5A 2Q68A 1JVMA 1S76D 3OGCC 1AI4A 4Z1MG 4EKWA 1IXMA 1QR8A 1K4CC 3OMNB 3JD1A 5EC1C 2HR3A 3AG3C 4MTFA 1DLBA 4GX1A 1MG1A 3KG2A 4P9PA 3ZIAG 2V7QG 4PA3A 2XASA 1F23A 3P30A 3JD2A 1FXVA 3ZRWB 2HFEC 1K3EA 2QA4V 1K9MW 1QLEB 3CCLV 4JTDB 3MHSC 4RQEA 3JYCA 3M99B 1SZTA 1YITV 4LP8A 1RM1C 2IW5A 3X2QB 3W7WA 1VQLV 2JK5C 2D3OW 5CBHA 2BOCC 2NLJC 1Q86W 1AROP 2ZDIA 1S3JA 4ZKIA 5LHHA 1OCRC 3CMEV 4MVZA 2LFSA 1K5QA 4TSFG 4MTOA 3E8FA 2R9RB 4MTGA 3FYEB 2X6CA 1EBOA 1BHAA 1LNQA 2ZD9A 4JTAB 4GX5A 3W7TA 1S0VA 1J95A 2QM8A 3E89A 3ETEA 1QVGU 2DW4A 1GK9A 4UUJC 5IY5B 1YSCA 1Q7YW 1K8AW 2P6JA 3ABKB 1VQ9V 3CPWU 4FJCC 1GO3F 2Z5UA 2YEVA 4WF9V 2Q67A 1YJNV 1K34A 1K73W 1H8EG 2EZOA 2X0LA 1E1RG 4MTXA 4P2ZA 1S5HC 1DF5A 3B8MA 1M57C 2B1GA 1H8HG 4ZBMA 2NNUA 2ZR2A 3D36A 3UM7A 4QJFB 2DYSC 3OEEG 4ASUG 1GM9A 2OCCC 4MVUA 5CBGA 1CEZA 2K1EA 3H01A 2EINC 4G27B 5H6RA 2HLDG 4WFBV 3QO7A 3FB7C 2OT5A 2ZDIC 3IGAC 3STLC 3K3WA 3FKSG 1PNKA 1OCZC 1QVFU 3K0GA 4G2KA 2EBOA 5LBQA 3F5WC 5IYCO 5L3EA 2A79B 3K08A 2JEUA 1EFRG 3K03A 4RUFA 2IJKA 5B1AB 2EZPA 4JASA 1V54C 3FB8C 1VQKV 4MT8A 3FB6C 3JCZA 5BZBA 2B5UA 4YXWG 5LGNA 2JJ1G 2WLLA 2EIMB 1FS0G 5CMUA 1AR1B 1H2GA 2WWWA 3ASOB 4Q20A 4FIPC 1PD3A 1R73A 1NBMG 2X7RB 3E2EA 3AG2B 2WSSG 3CCJV 1WLEA 2XOKG 1GMGA 3VOUA 1I5YA 4GCZA 2W6IG 1OCOB 1CPYA 3CYOA 4N23A 4DXWA 1E1QG 4I5SA 4MSWC 3ZRWA 4CZZA 3CD6V 2IH3C 3K04A 5B3SC 2DYRB 2EIKB 1YHQV 2P67A 2ZQMA 1M56C 1QR9A 4XDKA 2HKOA 5EBWC 2WLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EC2 C;  3SPH A;  3JYC A;  3ZJZ A;  3ABK C;  4RO2 A;  4RAI A;  2A0L A;  4LP8 A;  2A9H A;  1BL8 A;  4PA7 A;  2WLN A;  5EBL C;  4CBC A;  3SPJ A;  2WLJ A;  2JK5 C;  1ZWI C;  4PDR A;  3SYA A;  5CBH A;  2BOC C;  2NLJ C;  2BOB C;  4PA4 A;  3E8H A;  3UKM A;  5B1A C;  4MVR A;  3AG1 C;  4MVQ A;  4WFE A;  4P9O A;  5EK0 A;  1OCR C;  2QTO A;  4MVZ A;  1V55 C;  1XL4 A;  2X6A A;  3LDD A;  3E86 A;  4QNH B;  5KUK A;  4MTO A;  3E8F A;  2R9R B;  4MTG A;  3GB7 C;  4MW8 A;  3FB5 C;  2X6C A;  4JTD B;  4MS2 A;  3STZ C;  2ZXW C;  3T4Z A;  4LCU C;  4OXS A;  3T1C A;  3ZRS A;  2HVJ C;  3ASO C;  2KB1 A;  3OR6 C;  4R6Z A;  1LNQ A;  2ZD9 A;  4JTA B;  4GX5 A;  2WLH A;  3R65 A;  1J95 A;  3E89 A;  4BW5 A;  1R3I C;  2X6B A;  4PDV A;  4MVS A;  1G4Y B;  4UUJ C;  4HYO A;  4X89 A;  4TWK A;  1OCO C;  3F7V C;  2Q6A A;  4RUE A;  4JTC B;  2YEV A;  2P7T C;  2IH1 C;  2Q67 A;  3HPL C;  2DYR C;  4G28 B;  3T4D A;  4P2Z A;  4QE7 A;  3SPG A;  1S5H C;  4HZ3 A;  1QLE C;  4R8C A;  1R3J C;  1M57 C;  4PDL A;  4WFH A;  3RW0 A;  3EFF K;  4ZBM A;  4GX0 A;  4H33 A;  3SJQ C;  2EIM C;  3AG4 C;  4QE9 A;  1P7B A;  4PDM A;  2AHY A;  3LNM B;  1ORQ C;  3UM7 A;  3X2Q C;  2DYS C;  3OR7 C;  3LDC A;  2OCC C;  4MVU A;  3SYP A;  5CBG A;  4R7C A;  3AG2 C;  2K1E A;  2EIJ C;  3RVZ A;  2WLL B;  3BEH A;  4GX2 A;  2QKS A;  2EIN C;  2HVK C;  3K06 A;  3OUF A;  4G27 B;  4PA6 A;  2DWE C;  2ITC C;  4H37 A;  4XDL A;  3SPI A;  3SYQ A;  3RVY A;  3FB7 C;  4PA9 A;  3IGA C;  4X8A A;  4J9Y B;  4LBE C;  2H8P C;  3SPC A;  3STL C;  3LDE A;  4XDJ A;  1KKD A;  1OCZ C;  1R3L C;  1K4D C;  2ATK C;  2W0F C;  3K0G A;  3SYO A;  2EIK C;  3F5W C;  3T2M A;  2ITD C;  2WLK A;  2A79 B;  3K08 A;  2Q69 A;  3ABM C;  5B1B C;  3K03 A;  4RUF A;  1V54 C;  3FB8 C;  2WLM A;  4WFF A;  4R50 A;  5E1A C;  3F7Y C;  4MW3 A;  5KUM A;  5IY5 C;  2DWD C;  3FB6 C;  5BZB A;  3K0D A;  1OCC C;  2WLL A;  2HJF C;  4J9Z B;  3ABL C;  3E8G A;  5EBM C;  3IFX A;  1R3K C;  3ASN C;  2WLI B;  4MVM A;  4P30 A;  2HG5 C;  2Q68 A;  1JVM A;  3OUS A;  5CBF A;  3OGC C;  4EKW A;  1K4C C;  3RBZ A;  4KFM A;  3E8B A;  5EC1 C;  4MVO A;  3VOU A;  3TET A;  2Y69 C;  4X88 A;  3AG3 C;  4MTF A;  4GX1 A;  2EIL C;  4DXW A;  4I9W A;  4MSW C;  1XL6 A;  3PJS K;  2AHZ A;  3KG2 A;  4P9P A;  2IH3 C;  3K04 A;  4WFG A;  4F4L A;  4PA3 A;  5B3S C;  5J9P C;  3TCU A;  3E83 A;  1M56 C;  3LUT B;  2HFE C;  4XDK A;  3SYC A;  5EBW C;  3WG7 C;  2WLI A; 
#chains in the Genus database with same CATH topology
 3O9O A;  2OYQ A;  2XUM A;  3NR7 A;  2WLN A;  3A8T A;  4DR1 B;  3A0H Z;  2GDS A;  4WFE A;  1FXK B;  5AG2 A;  3FB5 C;  5KUK A;  3N2G B;  1N32 O;  1IBL O;  3CXH F;  4BIO A;  4DW0 A;  1AJN A;  1DK1 A;  3ZMV A;  3ZMZ A;  3A0B Z;  1P4R A;  4DV3 B;  3QTC A;  3KCX A;  1G4Y B;  1BHB A;  4AQY B;  2FTK A;  4X1K B;  3JAK A;  4NB5 A;  4DV7 B;  4J80 A;  4G28 B;  5CA1 B;  1Y66 A;  3RW0 A;  4FFB A;  5JVD A;  4NXM O;  1VQ4 V;  4QE9 A;  2Y69 B;  2ZE6 A;  4JI5 O;  2MW2 B;  3ZHU A;  3K9A A;  3P32 A;  1OV9 A;  3HR0 A;  3LSS A;  2EIJ C;  1KU9 A;  5IYB O;  1AVM A;  1KMI Z;  3CCM V;  1KP2 A;  1EZJ A;  3BAB A;  4XDJ A;  1R3L C;  3WB2 A;  4FLU A;  4JYA B;  4B7E A;  1S77 D;  2WLK A;  4PHZ A;  3ABM C;  4DV4 B;  5E1A C;  4GKJ B;  5L3C A;  3VQV A;  4LFA O;  4TUY B;  1K92 A;  2UXX A;  3TK1 A;  3T1Y O;  3IAY A;  5ITZ A;  3TXS A;  4UVB A;  3CCE V;  4JI6 B;  4IL6 Z;  4X88 A;  4I9W A;  3U0Z A;  1FXH A;  3CRC A;  1F4M A;  3OFN G;  2EUL A;  1I5X A;  1HNZ O;  2UUB O;  3OTO B;  4JAA A;  1TUB A;  2P06 A;  5L3F A;  2QM7 A;  3RYH B;  1XHZ A;  5B1A C;  3A2F A;  4MVR A;  3E86 A;  4AHC A;  3JD4 A;  1ROP A;  5D5Q A;  4OXS A;  4LF8 O;  4LF9 B;  3FYI B;  3CCV V;  2Q0A A;  4TWK A;  3F7V C;  1TVK B;  2LO1 A;  1N0J A;  1OCC B;  1SA0 B;  1W0J G;  4DR3 O;  1SQX H;  5J2T A;  4EEQ A;  3HPL C;  3K57 A;  2ETN A;  3T4D A;  4QE7 A;  3IC9 A;  2IJH A;  1U96 A;  4YIP A;  4H33 A;  4PDM A;  4AIL C;  2PF4 E;  1Y74 A;  1WJZ A;  1ORQ C;  2LP7 A;  3RWR D;  5L3B A;  4DV1 O;  4UCU A;  2QSA A;  4GUN A;  1KKD A;  1PM9 A;  2AXT Z;  4IHJ A;  4UV9 A;  2ITD C;  1JQ0 A;  2JJ2 G;  1RSO A;  2CDY A;  2WLM A;  4BWA A;  2M7W A;  1WPB A;  1YZB A;  3OUS A;  3F5T A;  3ICX A;  1COW G;  1UFI A;  1TGO A;  3RBZ A;  2EIJ B;  3BA9 A;  1SF9 A;  2Q5Z A;  2EIL C;  1SQF A;  4DYL A;  4DR6 O;  1M9N A;  3UCS C;  3ZHS A;  2YI9 A;  3ABM B;  1HP8 A;  4KUM A;  4NKG B;  2QKC A;  4LH6 A;  2V1D A;  4RO2 A;  1GN2 A;  1R6N A;  2A0L A;  1EN6 A;  1KEC A;  1BL8 A;  2EJR A;  4PA7 A;  2WLJ A;  1ZWI C;  1BGY H;  3ZBH A;  4W4K A;  1VQM V;  1AJP A;  1XL4 A;  3RGB A;  4QNH B;  2P90 A;  5KHH A;  3ZS8 C;  2BTQ A;  4DK1 A;  1OCZ B;  3STZ C;  4LFB B;  3OW2 U;  1X59 A;  2A06 H;  2QWO B;  4RQF A;  3CJH A;  1G8M A;  2KB1 A;  3OEH G;  4DRX A;  1EN4 A;  2Q7H A;  4NYK A;  4O4J A;  2IM9 A;  4LC1 A;  4CS3 A;  1U97 A;  3NXS A;  2VS0 A;  4B3R B;  1OJH A;  2E75 B;  2EIM C;  4H44 B;  4CC6 A;  1GTO A;  1H2N A;  4OPH A;  1NVP D;  1XOU A;  3CEI A;  2UXC O;  1BCC H;  3AEI A;  2YI8 A;  2PTM A;  1YIJ V;  1WB7 A;  2CGO A;  4JAU A;  1VQ5 V;  5B1N A;  1L1F A;  2Q0O C;  4XBF A;  1H38 A;  4K35 A;  1JX9 A;  4CC5 A;  4UVC A;  5ITZ B;  2XND G;  3UQ8 A;  1Z5W A;  2CTR A;  1L0N H;  2YS8 A;  1XMO O;  1FFT B;  1ZTE A;  2HEP A;  3AG1 B;  1VIB A;  5TIS Z;  3H1I H;  1JOY A;  4FFK A;  3ABL C;  1V9P A;  3P3P A;  3CHX A;  2ADP A;  4UXN A;  1D5N A;  1WNS A;  1IXM A;  1QR8 A;  3IJ4 A;  4YHH B;  3FD9 A;  4O4I B;  2YDE A;  4YJ3 A;  3GWK C;  2E3C A;  3AG3 C;  3I5D A;  4AI8 A;  1PL4 A;  3WU2 Z;  4FLV A;  4GZR B;  5GTH Z;  3G80 A;  2XAS A;  1FXV A;  3APO A;  1K9M W;  5CB4 A;  4DV2 O;  1G6U A;  2GTA A;  3C3S A;  4JI3 B;  5JJE B;  5LP6 B;  1RM1 C;  3X2Q B;  5KX5 A;  2JK5 C;  4DV6 O;  3JAW A;  1AR4 A;  4X64 B;  3LNN A;  4MVZ A;  5J2T B;  1SKV A;  3CWB H;  1K5Q A;  4TSF G;  3E8F A;  4DR2 B;  2R9R B;  3RT3 C;  1XNR B;  2YC0 A;  2W0X A;  1TA8 A;  4CS2 A;  1XIL A;  3W7T A;  3ETE A;  1B04 A;  2ZKO A;  1GK9 A;  5IY5 B;  4I0X B;  4O2A B;  1M93 A;  2IBZ H;  2RN9 A;  1VQ9 V;  1GO3 F;  1Z5V A;  2Q67 A;  1K73 W;  2EZO A;  2JS3 A;  1E1R G;  4MTX A;  1S5H C;  4IHJ B;  2QKA A;  2NNU A;  1N36 O;  1Q6H A;  1RSO B;  1N33 B;  1GM9 A;  2UXD O;  4MVU A;  1IBK O;  3E22 A;  1W59 A;  5LYJ A;  5LOV B;  4WFB V;  4FLZ A;  3BFR A;  1GN4 A;  4D7S A;  3DXR A;  3F5W C;  5IYC O;  4LF7 B;  5L3E A;  5KHG A;  1QHT A;  5FPR A;  1EFR G;  2EZP A;  1IX9 A;  5IE9 A;  2D2C B;  1KBH A;  3BVO A;  2O57 A;  2VQE O;  2WA3 A;  1BE3 H;  1SQV H;  2WLL A;  2UUC B;  2EIM B;  3U10 A;  2LGQ A;  1JFF B;  1FAF A;  1ZAU A;  3H1J H;  4LF4 O;  3E2E A;  1WLE A;  3VOU A;  3CRR A;  3AK3 A;  1CPY A;  2FL4 A;  4DXW A;  1E1Q G;  4MSW C;  4X65 O;  4K8X A;  1MMM A;  1YHQ V;  3KCY A;  5EYP A;  2BTQ B;  2AZ2 A;  2H94 A;  3OAA G;  4CBC A;  4DRX B;  4UCO A;  5F2V O;  5KHJ A;  4O4J B;  1BMF G;  3UKM A;  4LNU A;  4TV9 A;  5LGT A;  4X1I A;  3OE7 G;  5GW7 A;  3LDD A;  3CCR V;  1JMK C;  4CH3 A;  4JI1 B;  4JI2 B;  3ZMS A;  1YCI A;  1PKX A;  2ZXW C;  3ZRS A;  4DR1 O;  5H5N A;  3DSQ A;  4R6Z A;  4GT1 A;  4J7K A;  2IJI A;  4U7N A;  5LXT A;  1P49 A;  2PZS A;  1SC5 B;  2GBO A;  4HYO A;  1Q43 A;  1M5I A;  2UXB O;  2KG7 A;  1IXB A;  4D6T H;  2VQF O;  1HNW O;  2P7T C;  1R6K A;  2IH1 C;  4I50 A;  5JQG A;  5GTI Z;  3ABT A;  1R3J C;  2YSU B;  1HW7 A;  2YIC A;  4R8C A;  4BIZ A;  5IDJ A;  1KC8 W;  3AG4 C;  5FNV A;  5B5E Z;  1P7B A;  4FLY A;  4FLX A;  4AQY O;  1S72 V;  1YVW A;  3OM3 B;  5LMU B;  2ZCE A;  5A2Q N;  3DTU B;  2DWE C;  2HHH B;  2H8P C;  1G1X B;  1L8D A;  1FJG B;  3RYC A;  2ATK C;  1YJW V;  4YJ3 B;  2ZE7 A;  4L8J A;  2V4D A;  4LH7 A;  3VQW A;  4UCV A;  2HJF C;  2VWK A;  1H2K A;  4P30 A;  3DC6 A;  1NQT A;  3VBB A;  1NZ6 A;  4DV4 O;  2W6J G;  2JVD A;  4IGG A;  3D8C A;  3JAW B;  2F95 B;  5LMN O;  2F66 C;  5J9P C;  5EC2 C;  1XMQ O;  3QF7 A;  4I7Z B;  1BT8 A;  2YXY A;  2YUA A;  2WPD G;  1RFY A;  3H1K H;  3QNE A;  2PI4 A;  1XHX A;  4NR1 A;  5EIB D;  4KXR A;  3BHP A;  4YY3 O;  3H1L H;  5B1O A;  4EB6 A;  2ZM6 B;  4LFC B;  4MW8 A;  2JIZ G;  1SRY A;  3T4Z A;  3T1C A;  1PPJ H;  3ASO C;  2ZNJ A;  1VAR A;  1F4N A;  4HNA A;  4KHP B;  2ZR3 A;  1OHH G;  4BW5 A;  2PYL A;  2GSM B;  2IU0 A;  4PDV A;  3CRM A;  1OCO C;  1F7Y A;  3E22 B;  5LYJ B;  3ZRX A;  3PN1 A;  4JTC B;  4F6E A;  4YJ2 A;  3ASN B;  3E35 A;  1S5J A;  3TJT A;  1SQQ H;  3DXR B;  4GX0 A;  3SJQ C;  5IYD O;  2QEX V;  4UB6 Z;  3OR7 C;  3ZHT A;  3CMA V;  1IBM O;  1F51 A;  2WLL B;  4GX2 A;  3K06 A;  2Y0I A;  4PA6 A;  1Q6I A;  1AIL A;  3SPI A;  3WB0 A;  3J81 N;  3Q4H A;  1KYO F;  4B3M B;  1Z2G A;  3QVN A;  3TGU H;  1AI5 A;  5DN6 G;  3CC2 V;  5H9C A;  4LF5 O;  1I08 A;  5IWA B;  1IVS A;  4UCT A;  5L3D A;  4HAM A;  3ETD A;  2LFR A;  4JYB A;  2P4V A;  4C7U A;  2QTS A;  3AG4 B;  2RDC A;  5EYP B;  2QWR B;  2CH7 A;  2HP8 A;  2E5L O;  3W7S A;  1XI1 A;  2YIA A;  4MVO A;  2QGN A;  1TAE A;  5CA0 A;  4TV9 B;  1XL6 A;  5C93 A;  4JYY A;  1O9G A;  4F4L A;  4K0K B;  3TCU A;  2E74 B;  3E83 A;  5CN0 A;  2EX3 A;  3I55 V;  3HKC A;  3JAS A;  3J7A U;  5LHI A;  3ML0 A;  5KA6 A;  2CE4 A;  3ABK C;  4ZI7 A;  5LXT B;  1R1B A;  2UUA B;  2BOB C;  2XAF A;  4J41 A;  4JYC A;  2KG7 B;  2QTO A;  4JPR A;  4I50 B;  4NTW A;  3BA8 A;  3ABU A;  4PD4 F;  1Q5O A;  3W7X A;  4UCS A;  4ZOL A;  4JV5 O;  2QJ1 A;  4J10 A;  3QG5 A;  1V54 B;  1VQO V;  4JI8 B;  5KLV H;  1N8R W;  4N21 A;  3T1H B;  4DV0 B;  2CTW A;  1KD1 W;  3CCS V;  1SER A;  1YF2 A;  1BQ0 A;  4ABM A;  3RYC B;  1B06 A;  2C2A A;  3JAT A;  2AHY A;  5L3G A;  3M8A A;  4FK5 C;  2HJD A;  1GM8 A;  2A3Q A;  3LSQ A;  4B08 A;  1A32 A;  3HKE A;  3K59 A;  4H37 A;  1OZ0 A;  1N34 B;  4LBE C;  3LDE A;  4JAV A;  1K4D C;  1PL0 A;  2OTL V;  1XUQ A;  2RCV A;  3H1H H;  1SET A;  2Q69 A;  1K33 A;  4MW3 A;  4JI0 B;  1Y4M A;  3AK1 A;  2JGD A;  4FLT A;  1WP7 A;  4LF6 B;  1S76 D;  4LR3 A;  1IBL B;  2FYU H;  3JD1 A;  2FKX A;  3SJA C;  2OCH A;  2HR3 A;  1HDJ A;  1DLB A;  4GX1 A;  1ZLZ A;  2RMK B;  3OGI B;  3KG2 A;  4UB8 Z;  4P9P A;  3ZIA G;  4WBN A;  4PI0 A;  4IYH A;  3P30 A;  3FAV A;  3ZRW B;  1VF5 B;  3CCL V;  4JTD B;  5FLX N;  4JI4 B;  3MHS C;  4RQE A;  4FM1 A;  2DMX A;  3JYC A;  2JGU A;  1RP3 B;  4NXM B;  1S5L Z;  3CX5 F;  4HNA B;  2N74 A;  2BOC C;  1I7F A;  1OCR C;  2L35 A;  2PUS A;  4YJ2 B;  1R6T A;  2UU9 B;  2X6C A;  3R66 A;  4K3A A;  4X64 O;  2H3O A;  1BHA A;  1LNQ A;  4JI7 O;  4JTA B;  1S0V A;  2ZIO A;  2QM8 A;  3E89 A;  3K58 A;  4IYI A;  5C8Y A;  4IIJ A;  1XNR O;  5JH7 A;  2DE0 X;  2JS5 A;  3ABK B;  2Z5U A;  5BR8 O;  4LFA B;  1YJN V;  3Q4H B;  5J2U A;  4LWS A;  1WP8 A;  1DF5 A;  1M57 C;  3JAK B;  1WAZ A;  2B1G A;  3T1Y B;  1H2M A;  3G67 A;  4H13 B;  4FFB B;  1NS1 A;  5JVD B;  1BSM A;  1WB8 A;  3H01 A;  1GAX A;  2EIN C;  5H6R A;  2HLD G;  3QO7 A;  1I0H A;  2OT5 A;  2CH7 B;  3L72 H;  1PNK A;  4X62 B;  1BZK A;  1NTM H;  1N33 O;  4UCR A;  4G2K A;  5LBQ A;  1GN3 A;  3K08 A;  4B3T O;  2Y4U A;  4HBN A;  4RUF A;  5B1A B;  2IJK A;  5CA0 B;  4JAS A;  3KZI Z;  2ZE5 A;  5BZB A;  2B5U A;  5LGN A;  2JJ1 G;  1FS0 G;  3HKB A;  3HKC B;  3JAS B;  4LF7 O;  1HNX B;  1GN6 A;  4Q20 A;  1FD9 A;  3RYI A;  4ZI7 B;  4LF8 B;  4NVP A;  2WSS G;  4GCZ A;  2UUC O;  2YXH A;  2OWO A;  4I5S A;  3SGI A;  2IH3 C;  2FB5 A;  5GON A;  5B3S C;  1XDC A;  4DR3 B;  4DR7 B;  4DV5 O;  2HKO A;  2ZT9 B;  5EBW C;  3SPH A;  1VQ6 V;  3ZJZ A;  3ZCC A;  1Q8I A;  5CA3 A;  3SJC C;  1MNG A;  1UJW B;  1XNQ B;  1FKA O;  2WA4 A;  1TUB B;  3E8H A;  1RPO A;  3QO5 A;  4P9O A;  4B7K A;  4DV1 B;  1E79 G;  1VF7 A;  5H6Q A;  1QCE A;  4FZ1 A;  1MSD A;  4LCU C;  5IYZ A;  3ZRV A;  5DEC A;  1BQZ A;  4DUZ B;  1N4C A;  4X89 A;  2Q7G A;  1JPX A;  3HKE B;  3OT7 A;  4IT5 A;  3L71 H;  4WFH A;  1QLE C;  3MD0 A;  5BY1 A;  3LNM B;  5HFL A;  2EIL B;  2IJJ A;  1Y74 B;  5LA6 A;  1Q3E A;  2JGD B;  2IU3 A;  3VQX A;  2ITC C;  2F43 G;  3RVY A;  1K5S A;  5LMU O;  3CC4 V;  1QQC A;  4X66 B;  4E2L A;  3ZX6 A;  2HHH O;  2Q8V A;  1M57 B;  1FJG O;  4WBN B;  3FAV B;  4DUY O;  4PJ0 Z;  4D7T A;  1B6Q A;  3CCU V;  5CBF A;  2P22 C;  4OX9 B;  2LJ2 A;  3E8B A;  1US6 A;  4GKK O;  2Z0A A;  4PV1 B;  2F4V O;  4UV8 A;  1SQP H;  4J7J A;  2AHZ A;  1B3Q A;  4WFG A;  1J5E O;  3L74 H;  3WFV A;  4TT3 G;  1KQS U;  3JD3 A;  4TQF A;  5C8Y B;  4CS4 A;  4IIJ B;  5JH7 B;  2QE7 G;  5K1P A;  3A0R A;  3B77 A;  3S3X A;  2ZIN A;  2P4K A;  3HKD A;  3OMI B;  5J2U B;  2MK3 A;  2HVJ C;  1UPG A;  4O2B A;  3L9D A;  1WPX A;  1PNM A;  2WLH A;  5B3S B;  1RPR A;  1YEW A;  1ZSP A;  3C3T A;  3CJH B;  1FYJ A;  2ZM6 O;  4LFC O;  1VF6 C;  2Q6A A;  3ABL B;  2XAH A;  1P7G A;  1VQ8 V;  2ZE8 A;  2DYR C;  1PNL A;  2YID A;  1Q82 W;  1XQ8 A;  4HZ3 A;  4QPJ A;  3W7U A;  1JR9 A;  2CAZ C;  3AG3 B;  1M4U A;  3JCU Z;  4R7C A;  2F1M A;  4XDL A;  5LL6 Y;  1FXK C;  3HKB B;  2CTP A;  3D3Q A;  5KMG A;  3SPC A;  2GTS A;  3B4S A;  4DV2 B;  3RYI B;  1RM1 B;  4UVA A;  3SJB C;  3CS5 A;  4DV3 O;  4NXN B;  4PI2 A;  4WFF A;  1KP3 A;  4DV6 B;  3F7Y C;  4B3M O;  4TUY A;  2R72 A;  3EHB B;  5BXZ A;  5GON B;  1KB9 F;  3J80 N;  1MA1 A;  1K97 A;  4DV7 O;  1QBZ A;  2B1I A;  3JSL A;  1R3K C;  4MVM A;  4DR5 B;  1JA8 A;  1MOF A;  5B66 Z;  4KFM A;  3EXA A;  2Y69 C;  2QR4 A;  4Q6G A;  3ZN1 A;  1IDS A;  2QWP B;  1H2S B;  2PGG A;  1MSW D;  2EJ7 A;  2F23 A;  2Z3Y A;  3L73 H;  1NU1 H;  2XTA A;  3SYC A;  4DR4 B;  5KHI A;  5IYZ B;  1QLN A;  4JYA O;  1HWY A;  1MAB G;  5CB4 B;  2DOS A;  3K9S A;  1IUR A;  4GKJ O;  2UXD B;  4QIW F;  5KX5 B;  4GLX A;  1AP6 A;  2UUA O;  5FL7 G;  4JI6 O;  2XAG A;  5A9G A;  3JAM N;  3CE2 A;  1R3I C;  2GUZ A;  2Y48 A;  3CC7 V;  1NTZ H;  2N05 A;  1TUE B;  5LA6 B;  4U7O A;  3K5N A;  3OTO O;  4U3J A;  5DM6 V;  4FZ0 A;  1W0K G;  1NT2 B;  2DN9 A;  4BIU A;  4OGQ B;  3OMA B;  3B8N A;  4DV0 O;  1NTK H;  3LDC A;  2LGW A;  1CXZ B;  2A7W A;  4X65 B;  2CGN A;  2QKS A;  3K5M A;  3GWO A;  3OUF A;  3SYQ A;  3N2K A;  5EZY A;  1BS3 A;  4PA9 A;  4O4H A;  1Q90 D;  3ZHV A;  1SQG A;  1MZF A;  2KKW A;  4LF9 O;  3T2M A;  3B09 A;  4B3S B;  2VWJ A;  5BMV A;  3HB3 B;  1N34 O;  2ZNI A;  1OCC C;  5JJJ B;  1DTO A;  2P5O A;  5EBM C;  2ZXW B;  4JZG A;  1M1K W;  3RN4 A;  1O9H A;  3GVM A;  4Z1M G;  4EKW A;  3DC5 A;  4JI0 O;  3OMN B;  5EC1 C;  3JAR A;  3OTF A;  4NTX A;  5FPO A;  1MG1 A;  4LF6 O;  2UXB B;  4U3F H;  2YIB A;  2V7Q G;  2VQF B;  3HKD B;  1HNW B;  2QA4 V;  2HFE C;  4FLW A;  4CH6 A;  4O2B B;  5JCO A;  3OD4 A;  3EVK A;  3RYF A;  1VQL V;  5CBH A;  3KKY A;  1MZE A;  2ZDI A;  4ICG A;  5LHH A;  4JI4 O;  3CME V;  2GV9 A;  4LNU B;  3FYE B;  3SR2 C;  4X1I B;  5IJ0 A;  2PY5 A;  1EBO A;  3JAL A;  3L75 H;  4F6R A;  1Y76 A;  4GX5 A;  2DW4 A;  2UU9 O;  3ZED A;  2P6J A;  1I94 B;  3CPW U;  4EFB A;  2YEV A;  5H2F Z;  2XHB A;  3AG7 A;  1K34 A;  2XT9 A;  5KMG B;  2X0L A;  4P2Z A;  3B8M A;  3FX7 A;  5JQG B;  4EFE A;  4ZBM A;  2ZR2 A;  3D36 A;  3UM7 A;  4QJF B;  2DYS C;  3OEE G;  1KKC A;  4ASU G;  5FNV B;  1AB3 A;  2OCC C;  3LSU A;  5CBG A;  5JCO C;  5LMN B;  1CEZ A;  4CH4 A;  1HR0 B;  4G27 B;  3P3N A;  2ZDI C;  4LFB O;  3FKS G;  1XMQ B;  1OCZ C;  3K0G A;  4FM2 A;  2JEU A;  3FB6 C;  3L70 H;  4YXW G;  4X62 O;  4X1Y A;  4YY3 B;  2ADQ B;  5CMU A;  1AP5 A;  1H2G A;  3JSN A;  4B3R O;  4O4I A;  3ASO B;  1PP9 H;  1PD3 A;  3BRC A;  2AZ0 A;  5KAI Z;  4UFZ A;  2BSK A;  1NBM G;  2X7R B;  4DW1 A;  3B40 A;  3CCJ V;  2XOK G;  1GMG A;  1I5Y A;  5IJ9 A;  1OCO B;  3H9V A;  4N23 A;  2Y0P A;  4I9Q A;  1L0L H;  1HNX O;  3CD6 V;  3K5L A;  3D36 C;  2ZQM A;  1M56 C;  1KUQ A;  4XDK A;  5LP6 A;  2WLI A;  1DF4 A;  2DQ0 A;  2BTO A;  2A9H A;  5EBL C;  5IT9 N;  3SPJ A;  1N32 B;  2GUZ B;  3UT5 A;  4JF3 A;  1SS3 A;  4DR7 O;  3G6E V;  3AG1 C;  4MVQ A;  1IBM B;  2N04 A;  4YIO A;  1M90 W;  2JDI G;  3ETG A;  4TV8 A;  4QPK A;  3GB7 C;  1EZV H;  4U3J B;  1XNQ O;  2R9A A;  4EB6 B;  2XAQ A;  2YIB D;  4YHH O;  2XAJ A;  2DQ3 A;  4LF5 B;  4I0X A;  2M6Y A;  3R65 A;  4O2A A;  4JGS A;  2CUG A;  2LW1 A;  4MVS A;  4ZHQ A;  2QDO A;  2BE3 A;  3JD0 A;  2BCC H;  2AGA A;  4JI5 B;  3N2K B;  5EZY B;  1VQ7 V;  4DUZ O;  4O4H B;  1YTF D;  3SPG A;  4BR6 A;  2E5L B;  3EFF K;  4JI3 O;  1ZL8 A;  5JWP A;  4KL1 A;  5DED A;  1LUW A;  5LP6 C;  1SQB H;  3X2Q C;  2CK3 G;  4FPP A;  5BMV B;  5LOV A;  3M7M X;  1VQN V;  3ETQ A;  2YXL A;  1YI2 V;  1NJI W;  5E79 Z;  1JCH A;  4E4E A;  2ODM A;  3BEH A;  4DR2 O;  3VQY A;  4J11 A;  4X8A A;  1NH2 D;  2W0F C;  3CB2 A;  3CXC U;  2OTJ V;  3JAR B;  5B1B C;  3CRA A;  5IY5 C;  1JFF A;  1JJ2 U;  3IFX A;  2F93 B;  4X66 O;  2DYS B;  2CTQ A;  3UO3 A;  5HFM A;  4TOI A;  2OCC B;  4RWU A;  2LW7 A;  1WA8 A;  4JV5 B;  3TET A;  3RYF B;  1T5E A;  1HNZ B;  2UUB B;  1Y67 A;  1THZ A;  4BW9 A;  1YTF B;  2OIE A;  3PJS K;  4OPA A;  4OX9 O;  4Z1V A;  3UO2 A;  3WG7 C;  5IJ0 B;  2E76 B;  3JAL B;  4F6R B;  1Y76 B;  3THO A;  5LHG A;  5KA5 A;  4PDR A;  3SYA A;  3BY6 A;  3ZN0 A;  1NH2 B;  1W2B U;  1V55 C;  2YEV B;  3SDL A;  3CCQ V;  1VQP V;  4O4L A;  4BAY A;  4WCE V;  5K1X A;  2GHY A;  3K79 A;  3OR6 C;  3CP1 A;  1LUV A;  1M56 B;  1NR1 A;  4ZOL B;  4RUE A;  3ZHR A;  1WN7 A;  1GRJ A;  5D5P A;  3G4S V;  1EM1 A;  1YDX A;  4FMT A;  3IC7 A;  2FML A;  2RJZ A;  3B2E E;  4L87 A;  1XBL A;  1D5A A;  3JAT B;  3SYP A;  4ZIB A;  1K7D A;  3I56 V;  4X1Y B;  2HVK C;  4JI1 O;  1GKF A;  4JI2 O;  3K5O A;  4J9Y B;  1Y6X A;  2BSK B;  3SYO A;  1XRE A;  4GYC B;  1XEQ A;  3D3I A;  1FFX A;  4H0L B;  5IJ9 B;  2NR5 A;  1OCR B;  4KP4 A;  2DWD C;  2L6L A;  1NVP B;  5KHK A;  1SES A;  2QM4 A;  2K9P A;  2WLI B;  4NXN O;  4DR6 B;  2UXN A;  1DGS A;  4I4T A;  4JI7 B;  1H2L A;  2WAM A;  1GM7 A;  3UT5 B;  3DGE A;  3ZMU A;  3RFR A;  4DR5 O;  3BCC H;  4TV8 B;  5BR8 B;  1FPO A;  3LUT B;  4X20 A;  1YXB A;  3U11 A;  5B1B B;  2RQ6 A;  1LR1 A;  3N27 A;  1AJQ A;  4RAI A;  3CSX A;  4DK0 A;  4ZHQ B;  1VF6 A;  3BAA A;  4PA4 A;  5EK0 A;  4DR4 O;  4I55 A;  2EIN B;  4DO2 A;  4K8Z A;  2X6A A;  4TQD A;  2QWQ B;  2Q4P A;  4MS2 A;  1ZL8 B;  4A5U B;  1NR7 A;  2X6B A;  4B3T B;  3WG7 B;  4FM0 A;  1VEW A;  1ENV A;  1FXK A;  2UXC B;  1CP9 A;  2Y4T A;  3MHH C;  3N2G A;  5LGU A;  4PDL A;  1IZ3 A;  4LWS B;  1V55 B;  3FFQ A;  2LQT A;  1AI6 A;  5KAF Z;  4PEL A;  1JJO A;  4CH5 A;  3AG2 C;  1XMO B;  3QO8 A;  3RVZ A;  4R50 A;  4X1K A;  2R9I A;  5CA1 A;  4DV5 B;  1VP7 A;  1WA8 B;  2RNB A;  3CRQ A;  2EIK C;  4KHP O;  1AI7 A;  2KQX A;  1YJ9 V;  1N0N A;  3APQ A;  3ZMT A;  5KUM A;  4WFA V;  1Q81 W;  2ARH A;  1NKD A;  3K0D A;  5JJN B;  4J9Z B;  2JEX A;  3E8G A;  3G71 V;  2JRI A;  4J7Z A;  3ASN C;  2B9Z A;  2HG5 C;  2PI5 A;  2Q68 A;  1JVM A;  3MAQ A;  4B3S O;  3OGC C;  1AI4 A;  1X4T A;  1K4C C;  2QWN B;  3AK2 A;  4MTF A;  3WB1 A;  1ZUQ A;  2DJV A;  4PA3 A;  1F23 A;  3JD2 A;  1K3E A;  1QLE B;  4O4L B;  3M99 B;  4JZ2 A;  1QNM A;  1SZT A;  1YIT V;  2ZIM A;  4LP8 A;  5EIB C;  2IW5 A;  3ZHQ A;  5IWA O;  1AR5 A;  3W7W A;  2D3O W;  2NLJ C;  1Q86 W;  1ARO P;  4FVM A;  1S3J A;  4ZKI A;  2LFS A;  4MTO A;  2Q9L A;  4MTG A;  3S3W A;  2ZD9 A;  1J95 A;  1QVG U;  1URF A;  3RYH A;  4Z2W A;  4UUJ C;  2NN4 A;  1YSC A;  1Q7Y W;  1N36 B;  1K8A W;  4FJC C;  4K0K O;  4WF9 V;  4DUY B;  4NTY A;  1GH6 A;  1ZX3 A;  1H8E G;  1IBK B;  2AW9 A;  1H8H G;  3C90 A;  1PV0 A;  2Q7E A;  2VRZ A;  2G38 A;  1FFX B;  1I94 O;  1SZX A;  4GKK B;  2F4V B;  4J42 A;  1TVK A;  3G6B A;  1SA0 A;  2K1E A;  2PYJ A;  2OIG A;  4QGP A;  3FB7 C;  1J5E B;  3IGA C;  4W4L A;  3STL C;  3K3W A;  4X9Q A;  2VQE B;  1EN5 A;  1QVF U;  2EBO A;  1QU7 A;  4I4T B;  3MDS A;  1HR0 O;  2A79 B;  2Q73 A;  4JI8 O;  2ILM A;  1NI8 A;  3K03 A;  1V54 C;  3FB8 C;  4LF4 B;  3O65 A;  1VQK V;  4MT8 A;  3T1H O;  3JCZ A;  2KSD A;  4X20 B;  1AR1 B;  2WWW A;  2R70 A;  4FIP C;  1R73 A;  3AG2 B;  2W6I G;  3CYO A;  1P84 F;  3BPZ A;  3ZRW A;  4CZZ A;  4I55 B;  3TXQ A;  1VMG A;  1D2D A;  1Q6U A;  3K04 A;  2DYR B;  2EIK B;  2P67 A;  1QR9 A; 
#chains in the Genus database with same CATH homology
 3SPH A;  1DF4 A;  1VQ6 V;  3ZJZ A;  3ZCC A;  5CA3 A;  2H94 A;  2DQ0 A;  3OAA G;  2A9H A;  2WLN A;  5EBL C;  4CBC A;  3SPJ A;  1UJW B;  4JF3 A;  1BMF G;  3G6E V;  3E8H A;  3UKM A;  1RPO A;  3QO5 A;  3AG1 C;  4MVQ A;  4WFE A;  4P9O A;  1M90 W;  1E79 G;  5LGT A;  2JDI G;  1FXK B;  3OE7 G;  5GW7 A;  3LDD A;  3CCR V;  3ETG A;  5H6Q A;  1QCE A;  4QPK A;  3ZMS A;  3GB7 C;  3FB5 C;  5KUK A;  1PKX A;  2ZXW C;  4LCU C;  3ZRS A;  3ZRV A;  2XAQ A;  1AJN A;  2XAJ A;  2DQ3 A;  4R6Z A;  3ZMV A;  4GT1 A;  3ZMZ A;  2IJI A;  3R65 A;  4U7N A;  1P4R A;  4JGS A;  4MVS A;  1G4Y B;  4HYO A;  4X89 A;  3JD0 A;  1BHB A;  1JPX A;  2FTK A;  2P7T C;  1R6K A;  2IH1 C;  1VQ7 V;  4G28 B;  1Y66 A;  1YTF D;  3SPG A;  4WFH A;  1QLE C;  3ABT A;  1R3J C;  2YSU B;  4R8C A;  3RW0 A;  3EFF K;  3MD0 A;  4BIZ A;  5IDJ A;  1KC8 W;  1VQ4 V;  3AG4 C;  4QE9 A;  1P7B A;  2Y69 B;  1S72 V;  3LNM B;  5HFL A;  2EIL B;  3OM3 B;  3X2Q C;  2CK3 G;  3K9A A;  3P32 A;  4FPP A;  1VQN V;  2IJJ A;  3LSS A;  1YI2 V;  1NJI W;  1JCH A;  2EIJ C;  3BEH A;  3DTU B;  2IU3 A;  5IYB O;  2DWE C;  2ITC C;  2F43 G;  3RVY A;  3CCM V;  1KP2 A;  1EZJ A;  4X8A A;  1NH2 D;  2H8P C;  1K5S A;  4XDJ A;  1R3L C;  2ATK C;  2W0F C;  3CC4 V;  3CXC U;  1YJW V;  1S77 D;  2WLK A;  2OTJ V;  3ABM C;  5B1B C;  4E2L A;  5E1A C;  5IY5 C;  1M57 B;  5L3C A;  1JJ2 U;  2HJF C;  3IFX A;  1K92 A;  2UXX A;  4P30 A;  1B6Q A;  1NQT A;  2DYS B;  3VBB A;  5CBF A;  3CCU V;  3TK1 A;  5HFM A;  2OCC B;  2W6J G;  3E8B A;  4UVB A;  3CCE V;  3TET A;  4X88 A;  4UV8 A;  1THZ A;  4I9W A;  1YTF B;  1FXH A;  3PJS K;  2AHZ A;  4WFG A;  1F4M A;  5J9P C;  3OFN G;  1I5X A;  3WG7 C;  5EC2 C;  3WFV A;  4TT3 G;  5L3F A;  1KQS U;  5LHG A;  5KA5 A;  2WPD G;  3JD3 A;  3QNE A;  2PI4 A;  2QM7 A;  4PDR A;  3SYA A;  3BY6 A;  3ZN0 A;  5B1A C;  4MVR A;  1NH2 B;  1W2B U;  2QE7 G;  1V55 C;  3A0R A;  3B77 A;  5B1O A;  2YEV B;  3E86 A;  3JD4 A;  3CCQ V;  3OMI B;  1VQP V;  4MW8 A;  2JIZ G;  1SRY A;  1ROP A;  3T4Z A;  4OXS A;  3T1C A;  2MK3 A;  2HVJ C;  4BAY A;  4WCE V;  3ASO C;  2GHY A;  3K79 A;  1F4N A;  1WPX A;  3CP1 A;  3OR6 C;  1PNM A;  2ZR3 A;  1OHH G;  2WLH A;  5B3S B;  3FYI B;  1RPR A;  4BW5 A;  2GSM B;  3CCV V;  2IU0 A;  1M56 B;  4PDV A;  1NR1 A;  4TWK A;  1OCO C;  3F7V C;  2Q6A A;  1OCC B;  3ZRX A;  1W0J G;  4RUE A;  3ABL B;  2XAH A;  1VQ8 V;  4JTC B;  3ASN B;  3E35 A;  3HPL C;  2DYR C;  1PNL A;  3T4D A;  1Q82 W;  4QE7 A;  4HZ3 A;  2IJH A;  4QPJ A;  3G4S V;  4GX0 A;  4H33 A;  3SJQ C;  3W7U A;  4FMT A;  4PDM A;  3IC7 A;  5IYD O;  3AG3 B;  1ORQ C;  2LP7 A;  2QEX V;  3OR7 C;  5L3B A;  4L87 A;  3CMA V;  3SYP A;  1K7D A;  4R7C A;  1F51 A;  2WLL B;  4GX2 A;  3I56 V;  2HVK C;  3K06 A;  4XDL A;  4PA6 A;  1FXK C;  1GKF A;  3SPI A;  4J9Y B;  3SPC A;  1KKD A;  1RM1 B;  1AI5 A;  3SYO A;  5DN6 G;  4UVA A;  5H9C A;  4UV9 A;  3CC2 V;  2ITD C;  3D3I A;  1JQ0 A;  2JJ2 G;  4WFF A;  1KP3 A;  1OCR B;  2WLM A;  4HAM A;  3F7Y C;  3ETD A;  5L3D A;  2LFR A;  4KP4 A;  2DWD C;  4JYB A;  3EHB B;  1NVP B;  2M7W A;  1K97 A;  3AG4 B;  1QBZ A;  1SES A;  2B1I A;  1R3K C;  2WLI B;  4MVM A;  3OUS A;  3W7S A;  2UXN A;  1COW G;  1MOF A;  3RBZ A;  2EIJ B;  4KFM A;  4MVO A;  2WAM A;  1GM7 A;  2Y69 C;  3ZN1 A;  2EIL C;  3DGE A;  3ZMU A;  1XL6 A;  5C93 A;  1MSW D;  2Z3Y A;  1M9N A;  4F4L A;  3TCU A;  3E83 A;  3I55 V;  5CN0 A;  3LUT B;  3SYC A;  3ABM B;  5B1B B;  4KUM A;  5LHI A;  3ML0 A;  5KA6 A;  1QLN A;  2V1D A;  3ABK C;  4RO2 A;  1AJQ A;  4RAI A;  1HWY A;  1MAB G;  1R6N A;  2A0L A;  2EJR A;  1KEC A;  1BL8 A;  4PA7 A;  2WLJ A;  1ZWI C;  2BOB C;  2XAF A;  4PA4 A;  5EK0 A;  1VQM V;  4JYC A;  4DO2 A;  2EIN B;  2QTO A;  4QIW F;  1AJP A;  1XL4 A;  2X6A A;  4JPR A;  4QNH B;  2P90 A;  4MS2 A;  1OCZ B;  3ABU A;  3STZ C;  3OW2 U;  3W7X A;  5FL7 G;  4RQF A;  1G8M A;  2KB1 A;  3OEH G;  2XAG A;  1V54 B;  1VQO V;  1NR7 A;  1R3I C;  2X6B A;  2Y48 A;  3CC7 V;  1N8R W;  3WG7 B;  4N21 A;  1ENV A;  4LC1 A;  1TUE B;  1FXK A;  1KD1 W;  4U7O A;  3NXS A;  3CCS V;  1SER A;  1CP9 A;  3MHH C;  5DM6 V;  5LGU A;  4PDL A;  1W0K G;  2C2A A;  2EIM C;  1V55 B;  2AHY A;  4BIU A;  5L3G A;  3OMA B;  1GTO A;  3B8N A;  4FK5 C;  1NVP D;  1AI6 A;  1GM8 A;  3LDC A;  3AEI A;  4PEL A;  3LSQ A;  1YIJ V;  3AG2 C;  3QO8 A;  3RVZ A;  4JAU A;  1VQ5 V;  2QKS A;  4R50 A;  3GWO A;  3OUF A;  3SYQ A;  4H37 A;  5B1N A;  1OZ0 A;  4PA9 A;  2R9I A;  1L1F A;  4LBE C;  3LDE A;  4XBF A;  1H38 A;  4JAV A;  1JX9 A;  1K4D C;  4UVC A;  1PL0 A;  2OTL V;  2XND G;  2EIK C;  3T2M A;  1AI7 A;  1SET A;  1FFT B;  2Q69 A;  1YJ9 V;  3ZMT A;  3AG1 B;  5KUM A;  4WFA V;  1K33 A;  4MW3 A;  3HB3 B;  1Q81 W;  1Y4M A;  1JOY A;  1NKD A;  3K0D A;  1OCC C;  1DTO A;  4J9Z B;  3ABL C;  2JEX A;  3E8G A;  5EBM C;  3G71 V;  2ZXW B;  1M1K W;  3ASN C;  4UXN A;  2HG5 C;  2PI5 A;  2Q68 A;  1JVM A;  1S76 D;  3OGC C;  1AI4 A;  4Z1M G;  4EKW A;  1IXM A;  1QR8 A;  1K4C C;  3OMN B;  3JD1 A;  5EC1 C;  2HR3 A;  3AG3 C;  4MTF A;  1DLB A;  4GX1 A;  1MG1 A;  3KG2 A;  4P9P A;  3ZIA G;  2V7Q G;  4PA3 A;  2XAS A;  1F23 A;  3P30 A;  3JD2 A;  1FXV A;  3ZRW B;  2HFE C;  1K3E A;  2QA4 V;  1K9M W;  1QLE B;  3CCL V;  4JTD B;  3MHS C;  4RQE A;  3JYC A;  3M99 B;  1SZT A;  1YIT V;  4LP8 A;  1RM1 C;  2IW5 A;  3X2Q B;  3W7W A;  1VQL V;  2JK5 C;  2D3O W;  5CBH A;  2BOC C;  2NLJ C;  1Q86 W;  1ARO P;  2ZDI A;  1S3J A;  4ZKI A;  5LHH A;  1OCR C;  3CME V;  4MVZ A;  2LFS A;  1K5Q A;  4TSF G;  4MTO A;  3E8F A;  2R9R B;  4MTG A;  3FYE B;  2X6C A;  1EBO A;  1BHA A;  1LNQ A;  2ZD9 A;  4JTA B;  4GX5 A;  3W7T A;  1S0V A;  1J95 A;  2QM8 A;  3E89 A;  3ETE A;  1QVG U;  2DW4 A;  1GK9 A;  4UUJ C;  5IY5 B;  1YSC A;  1Q7Y W;  1K8A W;  2P6J A;  3ABK B;  1VQ9 V;  3CPW U;  4FJC C;  1GO3 F;  2Z5U A;  2YEV A;  4WF9 V;  2Q67 A;  1YJN V;  1K34 A;  1K73 W;  1H8E G;  2EZO A;  2X0L A;  1E1R G;  4MTX A;  4P2Z A;  1S5H C;  1DF5 A;  3B8M A;  1M57 C;  2B1G A;  1H8H G;  4ZBM A;  2NNU A;  2ZR2 A;  3D36 A;  3UM7 A;  4QJF B;  2DYS C;  3OEE G;  4ASU G;  1GM9 A;  2OCC C;  4MVU A;  5CBG A;  1CEZ A;  2K1E A;  3H01 A;  2EIN C;  4G27 B;  5H6R A;  2HLD G;  4WFB V;  3QO7 A;  3FB7 C;  2OT5 A;  2ZDI C;  3IGA C;  3STL C;  3K3W A;  3FKS G;  1PNK A;  1OCZ C;  1QVF U;  3K0G A;  4G2K A;  2EBO A;  5LBQ A;  3F5W C;  5IYC O;  5L3E A;  2A79 B;  3K08 A;  2JEU A;  1EFR G;  3K03 A;  4RUF A;  2IJK A;  5B1A B;  2EZP A;  4JAS A;  1V54 C;  3FB8 C;  1VQK V;  4MT8 A;  3FB6 C;  3JCZ A;  5BZB A;  2B5U A;  4YXW G;  5LGN A;  2JJ1 G;  2WLL A;  2EIM B;  1FS0 G;  5CMU A;  1AR1 B;  1H2G A;  2WWW A;  3ASO B;  4Q20 A;  4FIP C;  1PD3 A;  1R73 A;  1NBM G;  2X7R B;  3E2E A;  3AG2 B;  2WSS G;  3CCJ V;  1WLE A;  2XOK G;  1GMG A;  3VOU A;  1I5Y A;  4GCZ A;  2W6I G;  1OCO B;  1CPY A;  3CYO A;  4N23 A;  4DXW A;  1E1Q G;  4I5S A;  4MSW C;  3ZRW A;  4CZZ A;  3CD6 V;  2IH3 C;  3K04 A;  5B3S C;  2DYR B;  2EIK B;  1YHQ V;  2P67 A;  2ZQM A;  1M56 C;  1QR9 A;  4XDK A;  2HKO A;  5EBW C;  2WLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...