5BZBA

Navms voltage-gated sodium channel pore and c-terminal domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
total genus 34
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5bzbA00
1BL8A 1KKDA 4KFMA 3E89A 4R8CA 3SPGA 2EIKC 2HVJC 3RBZA 3F5WC 2WLLB 1P7BA 3SPJA 4DXWA 4PA3A 1K4CC 4F4LA 2ZXWC 3X2QC 3OUFA 4WFEA 5EBLC 4WFFA 5KUKA 3SJQC 2NLJC 4RUEA 4MVRA 4CBCA 4GX1A 1M56C 2Q68A 2EIMC 3RW0A 2ITDC 2Q6AA 4R6ZA 3K03A 2ITCC 1M57C 3FB5C 4MW8A 1ZWIC 4PA4A 5IY5C 3IFXA 1G4YB 2EIJC 3T2MA 4ZBMA 3HPLC 4WFGA 3JYCA 4P9OA 3ZJZA 2WLMA 2K1EA 3E8BA 4QNHB 3SPCA 4XDKA 4BW5A 2H8PC 5EC1C 5CBFA 4X89A 2DWEC 2HFEC 2WLIA 3F7VC 3K0GA 3OGCC 4P9PA 2R9RB 4PA9A 2A0LA 3K08A 4TWKA 1OCCC 3PJSK 3ABMC 2DYRC 2IH1C 2QTOA 3FB8C 4X8AA 1OCOC 4XDLA 4PDLA 1R3IC 3T1CA 3LDEA 2A9HA 4GX5A 3SYCA 3E8GA 1OCRC 4GX2A 1JVMA 2X6AA 3ASNC 3FB7C 4HZ3A 5CBGA 4MVOA 3AG3C 2WLLA 4J9ZB 2Y69C 1LNQA 4P2ZA 3STZC 3UKMA 5EK0A 2BOBC 4EKWA 3E86A 3LDCA 4MS2A 3OR6C 2ZD9A 3K06A 4QE7A 2EINC 4RO2A 1R3JC 4MTOA 1V55C 2DYSC 2Q69A 3OR7C 4PDVA 3VOUA 4XDJA 3R65A 3AG1C 2AHZA 3SYPA 4I9WA 4JTCB 4G27B 4R50A 3OUSA 2IH3C 3WG7C 2WLNA 3RVYA 3ABKC 2EILC 4RAIA 4JTDB 2P7TC 4P30A 3LNMB 4OXSA 3TETA 2DWDC 3K04A 1K4DC 3T4ZA 5B3SC 4MW3A 4H33A 3FB6C 3ASOC 1XL6A 2X6CA 2AHYA 5B1BC 4X88A 3E83A 3ABLC 3E8HA 2KB1A 3LUTB 3AG4C 4LBEC 4PDRA 3SPHA 3EFFK 3KG2A 2HVKC 3SYQA 1V54C 1QLEC 4H37A 4J9YB 3SYOA 3IGAC 4QE9A 1R3LC 3K0DA 4LCUC 2WLKA 5E1AC 4MVSA 2QKSA 3LDDA 4G28B 4JTAB 2HJFC 4MVZA 5EBMC 2A79B 1S5HC 2W0FC 4MVUA 4MVQA 4RUFA 4MSWC 2Q67A 1XL4A 3F7YC 3BEHA 2JK5C 3AG2C 1OCZC 2WLHA 3E8FA 3T4DA 3RVZA 5BZBA 4R7CA 5KUMA 5J9PC 3GB7C 2BOCC 3TCUA 3STLC 5EC2C 1ORQC 1J95A 2OCCC 2WLJA 4LP8A 4UUJC 2WLIB 2HG5C 4HYOA 4PA7A 5B1AC 3UM7A 5CBHA 4WFHA 2YEVA 4MTFA 4PA6A 4PDMA 3SPIA 2ATKC 4MVMA 4GX0A 2X6BA 1R3KC 3ZRSA 3SYAA 4MTGA 5EBWC
chains in the Genus database with same CATH superfamily
4CS2A 2Y0PA 4OX9B 1R1BA 4JI2B 5LL6Y 4FPPA 1A32A 5KHGA 2Q5ZA 4NXMO 1NVPD 1DLBA 3WB0A 4DV7O 1YHQV 1PPJH 4X20A 3QF7A 4U3JB 1W0JG 2GV9A 1G4YB 1KB9F 4TUYB 2B1IA 5LGTA 2Q8VA 2H8PC 2IW5A 4FIPC 3OGCC 4B3SO 2A3QA 3A0BZ 4TWKA 1Y74B 3UT5B 2A9HA 4KHPB 2QDOA 4GX2A 2OCHA 1D5AA 4YY3B 1JPXA 3ZHSA 3Q4HB 4YJ3A 2QM7A 1PNLA 4IIJA 4JZ2A 3HKEB 4BAYA 5IYBO 4DR4O 3E22A 2HJDA 4G27B 4PV1B 4FM0A 5E79Z 3BA8A 5J2UA 1Y6XA 2M6YA 2HR3A 4JV5O 1AP5A 1TAEA 3JSLA 3KG2A 3IJ4A 3K5MA 4DV0B 3A0RA 3K0DA 2WPDG 4JI7O 3OTFA 5GONA 2OYQA 5EBMC 4LFAB 2ZNIA 2QTSA 2E5LO 3VBBA 2E75B 2K9PA 2QKCA 3E8FA 4FLXA 5L3BA 2BOCC 3TCUA 3B2EE 5B1AC 2Y48A 2BSKA 5B1AB 2PI5A 1N4CA 4DV5B 3E89A 2EULA 2LW7A 4L87A 4R8CA 4B3MO 5IJ0A 2M7WA 3CD6V 1OJHA 3CC7V 1BS3A 1XHZA 4MVRA 5JJNB 5KMGB 5LP6A 2CTRA 1DTOA 5CA0B 4EEQA 1AI5A 2DJVA 4PA9A 3K08A 4W4KA 1M9NA 4LF5B 4DR7O 1VF6A 1L1FA 3T1CA 4GX5A 4O2AB 4JI1B 1NTZH 2QGNA 4FFBA 4ICGA 3FFQA 1GKFA 1H2MA 5BR8B 4FLWA 4IT5A 1NH2B 2QWOB 3SJAC 3A8TA 2YXYA 5JQGB 2P4VA 4XBFA 1AJPA 1XOUA 2GDSA 1Q8IA 4DRXB 3T4ZA 3I56V 1QBZA 4YHHO 1BT8A 4FZ0A 2X6CA 1QHTA 3RYCA 3LUTB 3AG4C 2UXCB 2P90A 3IGAC 3AG4B 2MK3A 3TXQA 2QWPB 2ZINA 3ZN0A 2BTQA 5FLXN 2W0FC 3G67A 2P5OA 4WBNB 2ZIOA 2RMKB 2E74B 5J9PC 1PV0A 2WLJA 4DYLA 1H2GA 2HKOA 4MVMA 3JASA 5J2TA 1KKDA 3JSNA 1VQ9V 4KFMA 4ZOLB 5KLVH 4DV4O 1KP3A 1J5EO 3RYFB 2UUAO 5LBQA 3CJHA 3ABUA 4LWSB 4EFBA 4UVBA 3ZJZA 4GYCB 2QWNB 4AHCA 1Q6UA 2WWWA 4B3TO 4FLUA 3PJSK 2ARHA 4X62B 3BA9A 2ZM6B 4HBNA 3BHPA 3D36A 4X66B 4B3RB 4DW0A 2OTJV 2AZ2A 4G2KA 2DQ0A 2X0LA 3G71V 3OTOO 1AR1B 1RFYA 1IXMA 4HNAB 3ICXA 4GUNA 2FL4A 4X64B 5LOVA 1W59A 4NTWA 5ITZB 2YXHA 4NB5A 4DV3O 1GRJA 5LHHA 3HB3B 4TV9B 3FB6C 1PD3A 2CK3G 1WPXA 2CUGA 4UB6Z 1G6UA 2AHYA 3CCLV 4O4IB 3CCEV 2QJ1A 1QLEC 3GWKC 1XUQA 1R3LC 2YSUB 3RWRD 3ZMZA 4X1YA 1NBMG 3W7TA 5IYZB 3ZRWB 1NJIW 3P32A 1NS1A 1RPOA 4UCRA 3UO2A 4DV1B 1YDXA 3QO8A 4TV8A 3H1LH 4GT1A 2F95B 4DUYB 4JF3A 2B1GA 1BE3H 2XUMA 4H13B 4J80A 4ZIBA 1P7BA 4DXWA 5BMVA 4CS3A 3X2QC 4WFEA 5EBLC 3DSQA 3D3IA 4YXWG 3SDLA 5JJJB 1W2BU 3X2QB 1COWG 1CXZB 2K1EA 1FFXA 3KCXA 4X89A 1VQ8V 4JASA 2Y4UA 2ZR3A 2WSSG 2DYRC 4PDLA 3VQXA 2JGDB 1NR1A 2DYRB 1OCRC 3HKBB 2VWKA 2B5UA 1ZL8A 4K8ZA 1OCRB 2QA4V 3T1HO 1E79G 1GN2A 2UUCO 2DOSA 3STZC 4CC6A 5IE9A 2IU0A 1PM9A 3OR6C 1HNWB 1GN3A 4QE7A 3IAYA 5IY5B 4NVPA 5CMUA 5IYDO 4NKGB 4DR6B 1MMMA 3OUSA 1RSOB 3ETGA 2V7QG 1SERA 4B7KA 2NNUA 3MDSA 1NZ6A 3RYIA 4H44B 2YEVB 4Z2WA 2JS3A 4DV2B 4J7KA 1DGSA 2LGWA 4X1KA 3EFFK 3JD0A 4J9YB 5EZYB 4F6RA 1PL0A 4DR5O 2ETNA 2HJFC 2A79B 2Z0AA 4B3SB 2Q67A 1FXKA 2ZQMA 1X4TA 4CC5A 5LYJA 1Y66A 4JGSA 4A5UB 2QEXV 1S76D 1ORQC 4MTXA 3ZEDA 1NI8A 4K0KO 2ATKC 3K5OA 3LSQA 3J80N 2F4VB 3L74H 4JI5O 2EIKC 2JRIA 1B3QA 1DK1A 5LMNO 4BR6A 2EIKB 3OE7G 1K92A 3OW2U 1AI6A 3CXCU 1S5JA 3JAKA 4IHJA 4I4TA 4MW8A 1I0HA 5KHKA 4ZBMA 1CPYA 4WFGA 3U0ZA 4DR3B 1MOFA 3OMAB 1HNXO 4LF7B 5C93A 3P30A 3ABMC 3O9OA 1YZBA 4K35A 3ABMB 2ZE8A 2XT9A 4I7ZB 3LNNA 1ZTEA 3CRRA 1HR0O 3JALA 4MVOA 2E5LB 2ZDIA 1YI2V 3LDCA 4MS2A 1YJ9V 2PYLA 2EINC 1JOYA 1HWYA 3VQYA 2EJRA 4EB6B 5CA1A 1K5QA 1K97A 2EINB 3EVKA 3CWBH 4LF6O 4IYIA 4LF9B 2NR5A 1XNRB 3NR7A 1SKVA 2QKAA 1K8AW 2FKXA 4B3MB 2V4DA 3JD4A 5LMUO 1K33A 3EHBB 1B04A 4PDRA 1ROPA 1NQTA 1F4NA 1H8EG 3CSXA 3N2GA 4O4HA 4MVZA 2XAFA 4MVQA 4JYCA 1GM7A 1SETA 2UXBO 5A9GA 4X65B 1YCIA 4JAAA 3J7AU 4PJ0Z 4NR1A 2YIBD 1BGYH 2IJJA 3UM7A 1Q81W 3E2EA 4LFCO 1QVGU 4O4LB 2F1MA 4I50B 4YIOA 1K73W 3G4SV 1N32B 4YJ2B 5FNVA 4LF8B 3OUFA 4GZRB 1IBKB 2B9ZA 3PN1A 1BMFG 4JZGA 2ITDC 3FAVB 2HHHO 1FFTB 4QJFB 5LA6B 2YI8A 1SQGA 1ZWIC 2R72A 5BXZA 3JAWB 3B8MA 3RN4A 4P9OA 2CGOA 4QNHB 1AILA 2DQ3A 2HP8A 3ZRXA 1MNGA 4DV6B 3TGUH 3J81N 1AP6A 2ZCEA 4J42A 5K1XA 3R66A 1IBMO 5CBGA 1AI7A 4TQDA 5DN6G 1QVFU 1LNQA 3T1YB 4DR2O 2P22C 1I94B 1F51A 4J7JA 2OWOA 3JATA 4XDJA 4JI0B 5GTHZ 4UCSA 4I9WA 5LGUA 3ZHRA 2DN9A 3ABKC 4O2BB 1FAFA 4MT8A 4X1IA 3C3TA 4LNUB 3H01A 4GLXA 3K04A 4E4EA 1S72V 3ASOC 4PHZA 4BIOA 4ZI7B 3D36C 2JJ2G 3ASOB 3QG5A 3SPHA 5IJ9B 2CH7B 5H9CA 2UXNA 4KXRA 4DW1A 2RNBA 1Z5VA 1S77D 1EM1A 1D2DA 2EZPA 1TVKB 1XMOB 3M99B 4JI6B 4B3TB 3TK1A 1GAXA 5JVDA 3AG2C 4TSFG 3T4DA 3RVZA 3AG2B 4I0XA 3K57A 4PDMA 4NTYA 2WA3A 1UJWB 3APQA 1HNZB 1PNKA 4UCOA 1WJZA 1VQKV 1GMGA 4QPJA 1WNSA 4GKJO 3AG7A 3OD4A 4FFKA 2XAHA 1YXBA 5KUKA 2Q0OC 4RUEA 4CBCA 3RW0A 4DV3B 2Q6AA 1L8DA 3N2KB 5IT9N 4JI8O 3G6EV 4J10A 2P67A 5H5NA 3OEEG 2HFEC 3K59A 2WAMA 1SA0B 3UQ8A 2QTOA 3C90A 5L3FA 1MZEA 2QR4A 4J7ZA 4PD4F 1EFRG 2QSAA 2WLLA 4UFZA 4FK5C 3RGBA 2P6JA 4DUZO 3UKMA 2X7RB 4ZHQB 2FB5A 3UCSC 2W6IG 3CXHF 2Q69A 2A06H 1QNMA 3BRCA 4GKKO 3TETA 2ZR2A 4BIUA 4AQYB 3WB2A 4LFBO 4I55B 1ENVA 5H6RA 1FPOA 1TUBB 5FPRA 1WN7A 1XMQB 4QE9A 1MA1A 4LCUC 4H0LB 2RJZA 1Y76A 1N36B 1ZL8B 1FKAO 2CAZC 2YIAA 4JI3B 1DF5A 2UXDO 2O57A 3STLC 4K8XA 1J95A 4LP8A 3C3SA 2JIZG 5JH7B 4L8JA 3CCMV 3ZS8C 3ZRVA 2JJ1G 4K3AA 1F23A 2GTSA 3RYHA 2UUCB 4DR1O 2YXLA 3JD2A 4JYAO 3ZMVA 1ZUQA 2GUZB 3CC2V 1N34B 3M8AA 3OGIB 2ILMA 3SJBC 1H8HG 2EIJC 1Q3EA 4WFAV 5L3CA 4OX9O 4JI2O 4UV9A 1JFFB 4BW5A 2EIJB 2YC0A 4YIPA 5C8YB 1THZA 1OZ0A 1S5LZ 4FVMA 4CH5A 1SQXH 2KG7B 3H1IH 1YEWA 2GSMB 4J41A 2JEUA 3O65A 2N04A 2YUAA 5FL7G 2V1DA 3K79A 1W0KG 2CTPA 4UV8A 2JEXA 4J9ZB 2Y69C 1VEWA 2RN9A 2BOBC 2Q7GA 3E86A 3A2FA 5CB4B 2Y69B 1Q7YW 4U3JA 4KHPO 4TUYA 3VOUA 1FJGB 2HLDG 4YY3O 1P49A 2QM4A 3RVYA 1BCCH 3CCQV 4OXSA 1D5NA 5L3GA 4O4JB 1FD9A 2CGNA 1Y74A 2LJ2A 2KQXA 3SJCC 3JCZA 3UT5A 1JQ0A 2VQFB 2UXXA 3UO3A 1LUWA 3E83A 1M1KW 3E8HA 4F6EA 3Q4HA 1XNQB 2RCVA 5KX5B 4BWAA 1K34A 4NXNB 3HKEA 4MVSA 4JTAB 2PZSA 2ZKOA 4MVUA 2F66C 1I7FA 4I9QA 1I08A 1S0VA 1MG1A 5B5EZ 1HDJA 3H9VA 3HKCB 4CS4A 2WLIB 4UB8Z 1ZX3A 1JJ2U 4UCVA 2X6BA 4LFAO 4FM2A 1YVWA 4FLTA 1QLEB 4EFEA 4RWUA 1VMGA 3RBZA 1KUQA 2JS5A 1M90W 3ZHVA 3JARB 2YICA 4GX1A 1M56C 2EIMC 1TA8A 3K03A 4JAVA 4DV5O 3DXRA 1YTFB 1M56B 1WP7A 1KU9A 2EIMB 3JYCA 3E8BA 3RT3C 2DE0X 1U96A 3ETDA 3L73H 2CTWA 1VF5B 2R9RB 4LF4B 2OTLV 2L6LA 1OCOC 4LR3A 1R3IC 3CYOA 1SC5B 1XREA 3KZIZ 3LDEA 3SR2C 3SYCA 1SZXA 1OCOB 1JVMA 2OIGA 3E35A 4CZZA 2JGUA 2NN4A 1NR7A 3ETEA 2LFRA 4EKWA 4LF5O 2QWRB 1QR8A 2XAQA 5KMGA 5FNVB 1K3EA 4RO2A 2IBZH 3QTCA 4JI1O 5LXTB 3AG1C 4LFCB 5CA0A 1MSWD 2WLNA 4JTDB 5IWAB 2DW4A 4UXNA 2EX3A 5BR8O 1ZLZA 4OPHA 1N33B 1MZFA 1WB8A 1XEQA 1VQLV 3HKDB 1WAZA 4ASUG 2KB1A 1BZKA 5KHJA 3I5DA 3SYQA 1V54C 3OM3B 5IYCO 1V54B 2VQEB 5E1AC 3LDDA 4G28B 3OMIB 2AW9A 3G80A 2UU9B 4IYHA 4X20B 1N8RW 5D5PA 1JR9A 3GVMA 4U7NA 2UXCO 2WLHA 5JQGA 4LH7A 1Q86W 4ZKIA 1S3JA 3AEIA 3JCUZ 4NXMB 1QLNA 1BQ0A 3AK3A 4DV7B 2ZIMA 1IBLO 1EN6A 2Q0AA 3W7WA 2Q9LA 2P06A 1SQBH 1QQCA 4YJ3B 2PYJA 1YIJV 1JA8A 4PA3A 1K4CC 1Q82W 4IIJB 2W6JG 2IM9A 3E22B 4WBNA 2ZT9B 1UFIA 3T2MA 1SQQH 5GTIZ 1VF7A 4BW9A 3K0GA 5J2UB 2Y0IA 2CTQA 3U10A 1M4UA 4DR4B 1U97A 1PNMA 4DK0A 4ZOLA 2GHYA 4JYYA 1NTMH 4KL1A 2YIBA 4X9QA 5GW7A 3RYFA 5D5QA 5A2QN 5EK0A 5GONB 4JV5B 4X62O 1KD1W 2ZM6O 4B3RO 1FXVA 2IJKA 4X66O 2Q7EA 5JJEB 4RAIA 1K7DA 2ZE6A 3ZX6A 2YS8A 3K9AA 1CP9A 4JI7B 1AJQA 5H2FZ 2BSKB 2BE3A 3K9SA 1XL6A 4X64O 3L70H 4AILC 4LBEC 1KC8W 3CHXA 2Y4TA 3SYOA 5IJ0B 3CP1A 1X59A 5H6QA 2R9AA 3QVNA 5LP6C 4HNAA 4B08A 3CMEV 1AI4A 1S5HC 3ZHQA 1SQPH 3FKSG 5LP6B 2JK5C 1M5IA 2XASA 5ITZA 1H2KA 5KUMA 1O9GA 2F43G 1VF6C 5EYPA 1G8MA 3CRQA 1R6TA 4GX0A 4FLYA 3CCJV 4TOIA 2C2AA 2EZOA 4O4IA 3CCUV 1VQOV 4DV1O 1E1RG 3D8CA 3H1HH 5DEDA 4CH3A 4TT3G 4FFBB 1HP8A 1RM1C 4WFFA 4I5SA 1Q6HA 4DR7B 4KUMA 1RM1B 5KA5A 5IYZA 3ZRWA 2ITCC 3FB5C 1KMIZ 4DUYO 2LW1A 4JPRA 5EC1C 4WF9V 5CBFA 2DWEC 3F7VC 4FJCC 1OCCC 2IH1C 2MW2B 1OCCB 1Z2GA 3RYCB 2ODMA 2X6AA 3FD9A 4HAMA 4HZ3A 5CA3A 1BQZA 2YI9A 3AG3C 2Q4PA 4P2ZA 1K5SA 1H2NA 3AG3B 4YHHB 2BTQB 1TUEB 5LHGA 4FM1A 1R3JC 4NYKA 1M93A 1V55C 1Q43A 3OR7C 3CRAA 1DF4A 5JCOA 2PTMA 1IZ3A 3P3PA 4D7SA 3WG7C 1V55B 1H2SB 5EIBC 2DWDC 1LUVA 2IJHA 3ETQA 3WG7B 2AZ0A 1EN4A 3OMNB 4WCEV 5B1NA 1HNWO 2OT5A 3DC5A 2A7WA 3JASB 2JGDA 1XQ8A 4X88A 5J2TB 3K3WA 2UUBO 3ABLC 2YDEA 3HKBA 3EXAA 3ABLB 3B09A 3WB1A 1AR5A 3TXSA 1SRYA 1AROP 2EBOA 3WU2Z 4D6TH 3CJHB 4Q6GA 2BCCH 4DV2O 3ZN1A 1JJOA 1PKXA 1XDCA 3ABKB 1RSOA 4DV4B 1J5EB 3MD0A 5FPOA 2XHBA 4QIWF 2RDCA 2UUAB 2HG5C 4PA7A 1JX9A 2YEVA 3SYAA 3L72H 4JI4O 3K5NA 1ZAUA 1YTFD 5EZYA 3OT7A 1V9PA 3P3NA 1E1QG 3ABTA 1UPGA 2F4VO 3IC9A 5LOVB 1MSDA 2FTKA 4DO2A 2N74A 2WLMA 3CS5A 1L0NH 3OTOB 1WP8A 5L3EA 4CH6A 1IURA 3GWOA 5AG2A 2H3OA 3FX7A 2Q7HA 3E8GA 4Z1VA 1Q90D 1JCHA 1T5EA 4DR3O 1P7GA 1HW7A 4LF7O 1WPBA 4LH6A 4ABMA 1GN6A 2XAJA 4X1YB 2E76B 2ZD9A 1KECA 4MTOA 2DYSC 3THOA 2DMXA 3OEHG 2IH3C 3W7XA 2DYSB 4LC1A 1K4DC 3DXRB 1H38A 4MW3A 4TV8B 1GTOA 2PI4A 1Y4MA 3IC7A 4H37A 5DM6V 3I55V 4LF9O 1XNRO 2LFSA 5BMVB 1YITV 5K1PA 3W7UA 3FYIB 1BHAA 4RUFA 4MSWC 4EB6A 1SQFA 3F7YC 1G1XB 1FFXB 1KQSU 4IL6Z 2JDIG 1I5XA 3F5TA 1VARA 3BCCH 4PA6A 1WA8A 1BL8A 1LR1A 3H1KH 1QU7A 2Z5UA 4X65O 4FLZA 2HVJC 3NXSA 3SPJA 4JAUA 2GBOA 2P4KA 3HR0A 1WB7A 4NTXA 1XHXA 2Q68A 2XOKG 2D3OW 1F4MA 4C7UA 3ZIAG 4TQFA 1YJNV 1N32O 1US6A 2N05A 3T1HB 5B66Z 1YSCA 4P9PA 3L75H 4LF8O 1YF2A 2A0LA 4N23A 3K5LA 1FXHA 4O4LA 1IBKO 4I50A 3RYIB 4X8AA 3CX5F 3SGIA 2VS0A 4Q20A 2ADPA 4X1KB 1GM9A 4YJ2A 3ZHTA 2VWJA 4F6RB 1P84F 5DECA 4DV6O 1SESA 2PF4E 5F2VO 1FXKC 3AK2A 3FAVA 5LA6A 2ZNJA 3RFRA 3BAAA 3JAWA 1FXKB 4JTCB 4R50A 3A0HZ 3K58A 1XBLA 1IBLB 5LYJB 2EILC 1Z5WA 1KBHA 3B4SA 3T1YO 2E3CA 4DR5B 2EILB 1I94O 1QCEA 2FMLA 1GH6A 2KSDA 1KP2A 3QO5A 4JI0O 1IVSA 3TJTA 3KKYA 3LSUA 3U11A 2HVKC 3ZMUA 3ZCCA 4BIZA 1VQNV 4CH4A 3LSSA 3DTUB 4K0KB 3JAKB 4IHJB 1BHBA 4I4TB 1Q5OA 2LQTA 4U3FH 1PL4A 4JI5B 2CE4A 1Q6IA 3S3WA 5LMNB 5BZBA 1AB3A 4O2BA 3ML0A 1VIBA 4LNUA 4QGPA 4UUJC 3CPWU 1O9HA 3SPIA 2EJ7A 1R3KC 3ZRSA 1AJNA 2Z3YA 1XMOO 4OPAA 4JI6O 4ZI7A 5B1OA 1IXBA 5IJ9A 3B40A 2CH7A 3JD1A 2ZDIC 4B7EA 3JALB 1HNXB 1KKCA 3DGEA 3H1JH 2Q73A 3L9DA 4F4LA 2ZXWC 1FS0G 3WFVA 1B06A 1TVKA 2H94A 2G38A 2NLJC 1HNZO 2ZXWB 4DV0O 4R6ZA 2QM8A 3BVOA 1IDSA 5CA1B 4FZ1A 1HR0B 1P4RA 4AI8A 4UCUA 1NVPB 2ZE5A 5KA6A 5KAIZ 3MHHC 2ZE7A 3B77A 3S3XA 5EYPB 1N0NA 4GCZA 2LP7A 3FB7C 4LF6B 5TISZ 4J11A 1QR9A 3G6BA 2AXTZ 3N2GB 4O4HB 3VQVA 2LO1A 5LMUB 1VQMV 5EIBD 1MABG 3OAAG 1FYJA 3N2KA 5LGNA 4PDVA 3SYPA 2KKWA 3KCYA 2F93B 1SA0A 1ZSPA 4RQEA 4IGGA 2UXBB 2LGQA 2R9IA 3CEIA 2VRZA 4UCTA 1SZTA 2OIEA 5HFLA 2WLKA 2QKSA 4AQYO 4ZHQA 1R6KA 2D2CB 3AG1B 1VQ4V 3APOA 3BEHA 3L71H 4UVAA 5JCOC 3FYEB 1XMQO 5EC2C 4O2AA 3BPZA 4HYOA 2PUSA 4WFHA 4MTFA 1N36O 1VQPV 1OV9A 4I55A 2PGGA 2HHHB 2ADQB 5EBWC 2FYUH 5BY1A 3CRMA 4JI3O 1TUBA 3MAQA 3SPGA 1OHHG 1YJWV 1F7YA 3BY6A 2RQ6A 4JYBA 1K9MW 1M57C 4DRXA 5IY5C 3JATB 1IBMB 3HPLC 1RP3B 1M57B 3SPCA 4FLVA 1N34O 1AVMA 2YIDA 4X1IB 5JH7A 2UUBB 4DR2B 3FB8C 3CRCA 4PELA 4E2LA 4D7TA 1N0JA 1IX9A 1R73A 3ZHUA 1Y67A 2GUZA 2QWQB 5CN0A 1KYOF 4FMTA 1H2LA 3D3QA 1NU1H 1WLEA 4PI2A 3R65A 2AHZA 5JVDB 1JFFA 4JI4B 2P7TC 5C8YA 4PI0A 4I0XB 5B3SC 2PY5A 1GM8A 2XTAA 4N21A 2KG7A 5KHHA 3B8NA 3VQWA 5B3SB 1VP7A 3CE2A 4WFBV 1FJGO 4DK1A 2BTOA 2IJIA 1EZVH 4LWSA 1URFA 5CB4A 1AR4A 5LHIA 2VQFO 3MHSC 1L0LH 1OCZC 4GKJB 1XNQO 4R7CA 1XI1A 1NT2B 3GB7C 4NXNO 1JMKC 1EN5A 1OCZB 2IU3A 4O4JA 4U7OA 1PP9H 3ZMTA 4MTGA 4JI8B 3F5WC 5KX5A 1NH2D 2WLLB 1EBOA 1RPRA 1EZJA 4UVCA 3M7MX 4RQFA 3SJQC 2WA4A 1GO3F 2R70A 3DC6A 5KAFZ 4PA4A 3IFXA 4TV9A 3CB2A 3HKCA 4XDKA 2QE7G 3AK1A 2WLIA 4DUZB 3ZBHA 3QO7A 3N27A 5HFMA 4XDLA 2GTAA 2L35A 3ASNC 5IDJA 3W7SA 1WA8B 4GKKB 2CDYA 1SF9A 3ASNB 3JARA 4LF4O 1Y76B 3CCRV 4LFBB 1VQ7V 3K06A 2F23A 2AGAA 1NTKH 3QNEA 2XAGA 1SS3A 1SQVH 4KP4A 4P30A 3LNMB 1I5YA 4OGQB 4H33A 3CCSV 1NKDA 2JVDA 1R6NA 5B1BC 3RYHB 2UXDB 5B1BB 3ZMSA 3JAMN 4W4LA 5KHIA 5IWAO 3BFRA 1GK9A 2XNDG 1N33O 1BSMA 1VQ5V 3JD3A 2W0XA 4DR1B 5LXTA 1XL4A 4QPKA 4JYAB 1B6QA 3CCVV 1XILA 3CMAV 1GN4A 1VQ6V 2OCCC 1CEZA 4Z1MG 3OFNG 2VQEO 3BABA 5CBHA 1TGOA 5L3DA 4DR6O 2OCCB 2HEPA 3HKDA 3CC4V 5JWPA 2UU9O
chains in the Genus database with same CATH topology
3LSQA 1BL8A 1QLEB 2EIKC 2Z5UA 2HVJC 4FPPA 3RBZA 3NXSA 2EIKB 3SPJA 4JAUA 3OE7G 1K92A 1NVPD 1M90W 3OW2U 1DLBA 1AI6A 3CXCU 1YHQV 4GX1A 1M56C 2Q68A 2EIMC 2XOKG 2D3OW 1F4MA 3K03A 4MW8A 1W0JG 3ZIAG 4JAVA 1G4YB 1YTFB 1M56B 1YJNV 2EIMB 2B1IA 4ZBMA 1CPYA 4WFGA 3JYCA 3E8BA 5LGTA 1MOFA 3OMAB 3ETDA 2H8PC 1YSCA 4P9PA 2IW5A 5C93A 4FIPC 3OGCC 2R9RB 3P30A 2A0LA 4N23A 4TWKA 2OTLV 1FXHA 3ABMC 4X8AA 1OCOC 1R3IC 3CYOA 3LDEA 2A9HA 3ABMB 4Q20A 3SYCA 4GX2A 1OCOB 1JVMA 1JPXA 1GM9A 3E35A 4MVOA 4CZZA 2QM7A 1PNLA 2ZDIA 1NR7A 3ETEA 2LFRA 1YI2V 4EKWA 3LDCA 4MS2A 4BAYA 1QR8A 1SESA 2XAQA 5IYBO 1YJ9V 1FXKC 2EINC 1K3EA 1HWYA 4RO2A 1JOYA 2EJRA 3AG1C 1FXKB 1K5QA 1MSWD 1K97A 2EINB 4JTCB 4G27B 4R50A 2WLNA 2EILC 4JTDB 2DW4A 1K8AW 2EILB 4UXNA 3JD4A 1QCEA 2HR3A 1K33A 3EHBB 1KP2A 1VQLV 3QO5A 4ASUG 2KB1A 4PDRA 3KG2A 2HVKC 3SYQA 1V54C 3ZMUA 3ZCCA 4BIZA 1VQNV 3OM3B 5IYCO 1ROPA 1NQTA 1F4NA 1H8EG 3A0RA 3K0DA 1V54B 2WPDG 5E1AC 3LSSA 3DTUB 3LDDA 4G28B 3OMIB 4MVZA 2XAFA 5EBMC 4MVQA 1BHBA 4JYCA 1GM7A 3VBBA 1N8RW 1SETA 4U7NA 2WLHA 3E8FA 5BZBA 3ML0A 5L3BA 2BOCC 3TCUA 1Q86W 4ZKIA 3AEIA 1S3JA 5B1AC 1QLNA 4UUJC 2IJJA 3UM7A 1Q81W 2Y48A 3CPWU 3E2EA 3SPIA 1QVGU 5B1AB 1R3KC 3ZRSA 2PI5A 2Z3YA 1AJNA 1K73W 3E89A 5B1OA 4R8CA 4L87A 3W7WA 3G4SV 3JD1A 2ZDIC 2M7WA 3CD6V 3CC7V 3DGEA 1YIJV 4PA3A 1K4CC 4F4LA 2ZXWC 1Q82W 3OUFA 1FS0G 2W6JG 3WFVA 2H94A 2NLJC 4MVRA 2ZXWB 1BMFG 2ITDC 1FFTB 4R6ZA 4QJFB 2QM8A 1ZWIC 1DTOA 3T2MA 3B8MA 4P9OA 4QNHB 1AI5A 1P4RA 2DQ3A 1NVPB 3ZRXA 5KA6A 3K0GA 4PA9A 3K08A 1M9NA 3MHHC 1L1FA 3T1CA 3B77A 1PNMA 4GX5A 2GHYA 4GCZA 2LP7A 3FB7C 5CBGA 5GW7A 1AI7A 5DN6G 1QVFU 1LNQA 1QR9A 1GKFA 5EK0A 1F51A 1VQMV 1NH2B 1KD1W 1MABG 3OAAG 1FXVA 2IJKA 5LGNA 4PDVA 4XDJA 3SYPA 4I9WA 5LGUA 3ABKC 4RAIA 1K7DA 1AJPA 4MT8A 4XBFA 3K9AA 3H01A 3K04A 3T4ZA 1CP9A 3I56V 1AJQA 1QBZA 1S72V 3ASOC 4RQEA 1XL6A 2X6CA 3LUTB 2JJ2G 2R9IA 3AG4C 3ASOB 4LBEC 3SPHA 1KC8W 2P90A 5H9CA 3SYOA 2UXNA 3IGAC 3AG4B 3CP1A 2MK3A 1SZTA 5H6QA 5HFLA 3ZN0A 2WLKA 1S77D 3CMEV 2EZPA 2QKSA 1AI4A 2W0FC 1S5HC 1R6KA 3AG1B 3FKSG 3M99B 1VQ4V 3TK1A 3BEHA 4UVAA 2JK5C 3AG2C 4TSFG 2XASA 3T4DA 3RVZA 5KUMA 3FYEB 5J9PC 5EC2C 3AG2B 2WLJA 2F43G 4HYOA 1H2GA 4WFHA 2HKOA 4MTFA 4PDMA 1G8MA 1VQPV 4MVMA 4GX0A 1UJWB 3CCJV 1PNKA 5EBWC 2C2AA 1KKDA 1VQ9V 4KFMA 1VQKV 2EZOA 3CCUV 1GMGA 4QPJA 3SPGA 1OHHG 1YJWV 1VQOV 3BY6A 1E1RG 1KP3A 4TT3G 1RM1C 2XAHA 5LBQA 5KUKA 4WFFA 4I5SA 4RUEA 4CBCA 4KUMA 1RM1B 3ABUA 5KA5A 4JYBA 3RW0A 1K9MW 2Q6AA 3ZRWA 2ITCC 1M57C 3FB5C 5IY5C 4UVBA 3HPLC 3ZJZA 3G6EV 1M57B 4JPRA 3SPCA 2P67A 5EC1C 4WF9V 3OEEG 5CBFA 2DWEC 2HFEC 3F7VC 2WWWA 4FJCC 2WAMA 1OCCC 3PJSK 2QTOA 2IH1C 3FB8C 4PELA 4E2LA 5L3FA 1OCCB 3D36A 2OTJV 1R73A 2X6AA 4HAMA 4G2KA 2DQ0A 4HZ3A 5CA3A 2X0LA 1EFRG 3AG3C 3G71V 2WLLA 1AR1B 4FK5C 2P6JA 4P2ZA 1K5SA 5CN0A 3UKMA 3AG3B 1IXMA 2X7RB 4FMTA 1TUEB 5LHGA 2W6IG 1R3JC 1V55C 1WLEA 2Q69A 3OR7C 1DF4A 3R65A 2AHZA 3WG7C 1V55B 2P7TC 3TETA 2DWDC 2IJHA 2ZR2A 3WG7B 4BIUA 5B3SC 5LHHA 3HB3B 1GM8A 3OMNB 3FB6C 4N21A 5B1NA 4WCEV 2OT5A 3B8NA 5B3SB 1PD3A 2CK3G 1WPXA 1ENVA 2AHYA 4X88A 5H6RA 3K3WA 4WFBV 3ABLC 3CCLV 3CCEV 1QLEC 3ABLB 2IJIA 4QE9A 1R3LC 1SRYA 2YSUB 4LCUC 3ZMZA 1AROP 2EBOA 1NBMG 3W7TA 5LHIA 3ZRWB 1NJIW 3MHSC 3P32A 3ZN1A 1PKXA 1DF5A 3ABKB 1OCZC 1RPOA 4R7CA 3MD0A 3GB7C 4QIWF 3STLC 1J95A 4LP8A 1OCZB 2IU3A 2JIZG 2HG5C 4PA7A 1JX9A 3CCMV 4U7OA 2YEVA 3ZRVA 2JJ1G 1F23A 3QO8A 3SYAA 3ZMTA 4MTGA 4GT1A 3JD2A 3ZMVA 4JF3A 2B1GA 1YTFD 3CC2V 3F5WC 1NH2D 2WLLB 1EBOA 1P7BA 1RPRA 4DXWA 1EZJA 3X2QC 4WFEA 4UVCA 5EBLC 4RQFA 3SJQC 3D3IA 4YXWG 1W2BU 1E1QG 1GO3F 3X2QB 3ABTA 1H8HG 1COWG 4PA4A 3IFXA 2EIJC 2FTKA 4WFAV 5L3CA 4DO2A 2WLMA 2K1EA 4UV9A 4XDKA 2QE7G 4BW5A 2EIJB 4X89A 1VQ8V 2WLIA 1THZA 1OZ0A 5L3EA 4JASA 2ZR3A 3QO7A 2WSSG 3GWOA 2DYRC 5HFMA 4XDLA 4PDLA 1NR1A 2GSMB 2DYRB 1OCRC 3E8GA 2JEUA 3ASNC 5IDJA 5FL7G 2V1DA 1JCHA 2B5UA 3K79A 1W0KG 1OCRB 3W7SA 2QA4V 4UV8A 2JEXA 1E79G 3ASNB 4J9ZB 2Y69C 3STZC 2BOBC 3E86A 2IU0A 3CCRV 3OR6C 2XAJA 2Y69B 2ZD9A 1VQ7V 3K06A 1KECA 4QE7A 5IY5B 1Q7YW 4MTOA 5CMUA 2DYSC 3VOUA 5IYDO 2HLDG 3OEHG 3OUSA 2IH3C 3QNEA 3ETGA 2DYSB 2V7QG 3RVYA 3W7XA 2XAGA 4LC1A 4KP4A 4P30A 3LNMB 4OXSA 3CCQV 1I5YA 1SERA 5L3GA 1K4DC 1H38A 4MW3A 2NNUA 4H33A 3CCSV 1NKDA 2YEVB 3JCZA 1R6NA 1GTOA 1JQ0A 2UXXA 5B1BC 3E83A 1M1KW 2PI4A 3E8HA 1Y4MA 3EFFK 3IC7A 3JD0A 5B1BB 4H37A 4J9YB 3ZMSA 5DM6V 3I55V 1K34A 2LFSA 1GK9A 1PL0A 1YITV 2XNDG 4MVSA 3W7UA 4JTAB 1VQ5V 2HJFC 3JD3A 3FYIB 2A79B 4MVUA 1BHAA 4RUFA 4MSWC 2Q67A 1XL4A 1FXKA 3F7YC 2ZQMA 4QPKA 1S0VA 1MG1A 1B6QA 1Y66A 4JGSA 1KQSU 3CCVV 3CMAV 2QEXV 1S76D 2JDIG 1ORQC 1VQ6V 2OCCC 1CEZA 4Z1MG 2WLIB 1I5XA 3OFNG 4MTXA 5CBHA 5L3DA 1JJ2U 4PA6A 2ATKC 2OCCB 2X6BA 3CC4V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL8 A;  1KKD A;  4KFM A;  3E89 A;  4R8C A;  3SPG A;  2EIK C;  2HVJ C;  3RBZ A;  3F5W C;  2WLL B;  1P7B A;  3SPJ A;  4DXW A;  4PA3 A;  1K4C C;  4F4L A;  2ZXW C;  3X2Q C;  3OUF A;  4WFE A;  5EBL C;  4WFF A;  5KUK A;  3SJQ C;  2NLJ C;  4RUE A;  4MVR A;  4CBC A;  4GX1 A;  1M56 C;  2Q68 A;  2EIM C;  3RW0 A;  2ITD C;  2Q6A A;  4R6Z A;  3K03 A;  2ITC C;  1M57 C;  3FB5 C;  4MW8 A;  1ZWI C;  4PA4 A;  5IY5 C;  3IFX A;  1G4Y B;  2EIJ C;  3T2M A;  4ZBM A;  3HPL C;  4WFG A;  3JYC A;  4P9O A;  3ZJZ A;  2WLM A;  2K1E A;  3E8B A;  4QNH B;  3SPC A;  4XDK A;  4BW5 A;  2H8P C;  5EC1 C;  5CBF A;  4X89 A;  2DWE C;  2HFE C;  2WLI A;  3F7V C;  3K0G A;  3OGC C;  4P9P A;  2R9R B;  4PA9 A;  2A0L A;  3K08 A;  4TWK A;  1OCC C;  3PJS K;  3ABM C;  2DYR C;  2IH1 C;  2QTO A;  3FB8 C;  4X8A A;  1OCO C;  4XDL A;  4PDL A;  1R3I C;  3T1C A;  3LDE A;  2A9H A;  4GX5 A;  3SYC A;  3E8G A;  1OCR C;  4GX2 A;  1JVM A;  2X6A A;  3ASN C;  3FB7 C;  4HZ3 A;  5CBG A;  4MVO A;  3AG3 C;  2WLL A;  4J9Z B;  2Y69 C;  1LNQ A;  4P2Z A;  3STZ C;  3UKM A;  5EK0 A;  2BOB C;  4EKW A;  3E86 A;  3LDC A;  4MS2 A;  3OR6 C;  2ZD9 A;  3K06 A;  4QE7 A;  2EIN C;  4RO2 A;  1R3J C;  4MTO A;  1V55 C;  2DYS C;  2Q69 A;  3OR7 C;  4PDV A;  3VOU A;  4XDJ A;  3R65 A;  3AG1 C;  2AHZ A;  3SYP A;  4I9W A;  4JTC B;  4G27 B;  4R50 A;  3OUS A;  2IH3 C;  3WG7 C;  2WLN A;  3RVY A;  3ABK C;  2EIL C;  4RAI A;  4JTD B;  2P7T C;  4P30 A;  3LNM B;  4OXS A;  3TET A;  2DWD C;  3K04 A;  1K4D C;  3T4Z A;  5B3S C;  4MW3 A;  4H33 A;  3FB6 C;  3ASO C;  1XL6 A;  2X6C A;  2AHY A;  5B1B C;  4X88 A;  3E83 A;  3ABL C;  3E8H A;  2KB1 A;  3LUT B;  3AG4 C;  4LBE C;  4PDR A;  3SPH A;  3EFF K;  3KG2 A;  2HVK C;  3SYQ A;  1V54 C;  1QLE C;  4H37 A;  4J9Y B;  3SYO A;  3IGA C;  4QE9 A;  1R3L C;  3K0D A;  4LCU C;  2WLK A;  5E1A C;  4MVS A;  2QKS A;  3LDD A;  4G28 B;  4JTA B;  2HJF C;  4MVZ A;  5EBM C;  2A79 B;  1S5H C;  2W0F C;  4MVU A;  4MVQ A;  4RUF A;  4MSW C;  2Q67 A;  1XL4 A;  3F7Y C;  3BEH A;  2JK5 C;  3AG2 C;  1OCZ C;  2WLH A;  3E8F A;  3T4D A;  3RVZ A;  5BZB A;  4R7C A;  5KUM A;  5J9P C;  3GB7 C;  2BOC C;  3TCU A;  3STL C;  5EC2 C;  1ORQ C;  1J95 A;  2OCC C;  2WLJ A;  4LP8 A;  4UUJ C;  2WLI B;  2HG5 C;  4HYO A;  4PA7 A;  5B1A C;  3UM7 A;  5CBH A;  4WFH A;  2YEV A;  4MTF A;  4PA6 A;  4PDM A;  3SPI A;  2ATK C;  4MVM A;  4GX0 A;  2X6B A;  1R3K C;  3ZRS A;  3SYA A;  4MTG A;  5EBW C; 
#chains in the Genus database with same CATH topology
 4CS2 A;  2Y0P A;  4OX9 B;  1R1B A;  4JI2 B;  5LL6 Y;  4FPP A;  1A32 A;  5KHG A;  2Q5Z A;  4NXM O;  1NVP D;  1DLB A;  3WB0 A;  4DV7 O;  1YHQ V;  1PPJ H;  4X20 A;  3QF7 A;  4U3J B;  1W0J G;  2GV9 A;  1G4Y B;  1KB9 F;  4TUY B;  2B1I A;  5LGT A;  2Q8V A;  2H8P C;  2IW5 A;  4FIP C;  3OGC C;  4B3S O;  2A3Q A;  3A0B Z;  4TWK A;  1Y74 B;  3UT5 B;  2A9H A;  4KHP B;  2QDO A;  4GX2 A;  2OCH A;  1D5A A;  4YY3 B;  1JPX A;  3ZHS A;  3Q4H B;  4YJ3 A;  2QM7 A;  1PNL A;  4IIJ A;  4JZ2 A;  3HKE B;  4BAY A;  5IYB O;  4DR4 O;  3E22 A;  2HJD A;  4G27 B;  4PV1 B;  4FM0 A;  5E79 Z;  3BA8 A;  5J2U A;  1Y6X A;  2M6Y A;  2HR3 A;  4JV5 O;  1AP5 A;  1TAE A;  3JSL A;  3KG2 A;  3IJ4 A;  3K5M A;  4DV0 B;  3A0R A;  3K0D A;  2WPD G;  4JI7 O;  3OTF A;  5GON A;  2OYQ A;  5EBM C;  4LFA B;  2ZNI A;  2QTS A;  2E5L O;  3VBB A;  2E75 B;  2K9P A;  2QKC A;  3E8F A;  4FLX A;  5L3B A;  2BOC C;  3TCU A;  3B2E E;  5B1A C;  2Y48 A;  2BSK A;  5B1A B;  2PI5 A;  1N4C A;  4DV5 B;  3E89 A;  2EUL A;  2LW7 A;  4L87 A;  4R8C A;  4B3M O;  5IJ0 A;  2M7W A;  3CD6 V;  1OJH A;  3CC7 V;  1BS3 A;  1XHZ A;  4MVR A;  5JJN B;  5KMG B;  5LP6 A;  2CTR A;  1DTO A;  5CA0 B;  4EEQ A;  1AI5 A;  2DJV A;  4PA9 A;  3K08 A;  4W4K A;  1M9N A;  4LF5 B;  4DR7 O;  1VF6 A;  1L1F A;  3T1C A;  4GX5 A;  4O2A B;  4JI1 B;  1NTZ H;  2QGN A;  4FFB A;  4ICG A;  3FFQ A;  1GKF A;  1H2M A;  5BR8 B;  4FLW A;  4IT5 A;  1NH2 B;  2QWO B;  3SJA C;  3A8T A;  2YXY A;  5JQG B;  2P4V A;  4XBF A;  1AJP A;  1XOU A;  2GDS A;  1Q8I A;  4DRX B;  3T4Z A;  3I56 V;  1QBZ A;  4YHH O;  1BT8 A;  4FZ0 A;  2X6C A;  1QHT A;  3RYC A;  3LUT B;  3AG4 C;  2UXC B;  2P90 A;  3IGA C;  3AG4 B;  2MK3 A;  3TXQ A;  2QWP B;  2ZIN A;  3ZN0 A;  2BTQ A;  5FLX N;  2W0F C;  3G67 A;  2P5O A;  4WBN B;  2ZIO A;  2RMK B;  2E74 B;  5J9P C;  1PV0 A;  2WLJ A;  4DYL A;  1H2G A;  2HKO A;  4MVM A;  3JAS A;  5J2T A;  1KKD A;  3JSN A;  1VQ9 V;  4KFM A;  4ZOL B;  5KLV H;  4DV4 O;  1KP3 A;  1J5E O;  3RYF B;  2UUA O;  5LBQ A;  3CJH A;  3ABU A;  4LWS B;  4EFB A;  4UVB A;  3ZJZ A;  4GYC B;  2QWN B;  4AHC A;  1Q6U A;  2WWW A;  4B3T O;  4FLU A;  3PJS K;  2ARH A;  4X62 B;  3BA9 A;  2ZM6 B;  4HBN A;  3BHP A;  3D36 A;  4X66 B;  4B3R B;  4DW0 A;  2OTJ V;  2AZ2 A;  4G2K A;  2DQ0 A;  2X0L A;  3G71 V;  3OTO O;  1AR1 B;  1RFY A;  1IXM A;  4HNA B;  3ICX A;  4GUN A;  2FL4 A;  4X64 B;  5LOV A;  1W59 A;  4NTW A;  5ITZ B;  2YXH A;  4NB5 A;  4DV3 O;  1GRJ A;  5LHH A;  3HB3 B;  4TV9 B;  3FB6 C;  1PD3 A;  2CK3 G;  1WPX A;  2CUG A;  4UB6 Z;  1G6U A;  2AHY A;  3CCL V;  4O4I B;  3CCE V;  2QJ1 A;  1QLE C;  3GWK C;  1XUQ A;  1R3L C;  2YSU B;  3RWR D;  3ZMZ A;  4X1Y A;  1NBM G;  3W7T A;  5IYZ B;  3ZRW B;  1NJI W;  3P32 A;  1NS1 A;  1RPO A;  4UCR A;  3UO2 A;  4DV1 B;  1YDX A;  3QO8 A;  4TV8 A;  3H1L H;  4GT1 A;  2F95 B;  4DUY B;  4JF3 A;  2B1G A;  1BE3 H;  2XUM A;  4H13 B;  4J80 A;  4ZIB A;  1P7B A;  4DXW A;  5BMV A;  4CS3 A;  3X2Q C;  4WFE A;  5EBL C;  3DSQ A;  3D3I A;  4YXW G;  3SDL A;  5JJJ B;  1W2B U;  3X2Q B;  1COW G;  1CXZ B;  2K1E A;  1FFX A;  3KCX A;  4X89 A;  1VQ8 V;  4JAS A;  2Y4U A;  2ZR3 A;  2WSS G;  2DYR C;  4PDL A;  3VQX A;  2JGD B;  1NR1 A;  2DYR B;  1OCR C;  3HKB B;  2VWK A;  2B5U A;  1ZL8 A;  4K8Z A;  1OCR B;  2QA4 V;  3T1H O;  1E79 G;  1GN2 A;  2UUC O;  2DOS A;  3STZ C;  4CC6 A;  5IE9 A;  2IU0 A;  1PM9 A;  3OR6 C;  1HNW B;  1GN3 A;  4QE7 A;  3IAY A;  5IY5 B;  4NVP A;  5CMU A;  5IYD O;  4NKG B;  4DR6 B;  1MMM A;  3OUS A;  1RSO B;  3ETG A;  2V7Q G;  1SER A;  4B7K A;  2NNU A;  3MDS A;  1NZ6 A;  3RYI A;  4H44 B;  2YEV B;  4Z2W A;  2JS3 A;  4DV2 B;  4J7K A;  1DGS A;  2LGW A;  4X1K A;  3EFF K;  3JD0 A;  4J9Y B;  5EZY B;  4F6R A;  1PL0 A;  4DR5 O;  2ETN A;  2HJF C;  2A79 B;  2Z0A A;  4B3S B;  2Q67 A;  1FXK A;  2ZQM A;  1X4T A;  4CC5 A;  5LYJ A;  1Y66 A;  4JGS A;  4A5U B;  2QEX V;  1S76 D;  1ORQ C;  4MTX A;  3ZED A;  1NI8 A;  4K0K O;  2ATK C;  3K5O A;  3LSQ A;  3J80 N;  2F4V B;  3L74 H;  4JI5 O;  2EIK C;  2JRI A;  1B3Q A;  1DK1 A;  5LMN O;  4BR6 A;  2EIK B;  3OE7 G;  1K92 A;  3OW2 U;  1AI6 A;  3CXC U;  1S5J A;  3JAK A;  4IHJ A;  4I4T A;  4MW8 A;  1I0H A;  5KHK A;  4ZBM A;  1CPY A;  4WFG A;  3U0Z A;  4DR3 B;  1MOF A;  3OMA B;  1HNX O;  4LF7 B;  5C93 A;  3P30 A;  3ABM C;  3O9O A;  1YZB A;  4K35 A;  3ABM B;  2ZE8 A;  2XT9 A;  4I7Z B;  3LNN A;  1ZTE A;  3CRR A;  1HR0 O;  3JAL A;  4MVO A;  2E5L B;  2ZDI A;  1YI2 V;  3LDC A;  4MS2 A;  1YJ9 V;  2PYL A;  2EIN C;  1JOY A;  1HWY A;  3VQY A;  2EJR A;  4EB6 B;  5CA1 A;  1K5Q A;  1K97 A;  2EIN B;  3EVK A;  3CWB H;  4LF6 O;  4IYI A;  4LF9 B;  2NR5 A;  1XNR B;  3NR7 A;  1SKV A;  2QKA A;  1K8A W;  2FKX A;  4B3M B;  2V4D A;  3JD4 A;  5LMU O;  1K33 A;  3EHB B;  1B04 A;  4PDR A;  1ROP A;  1NQT A;  1F4N A;  1H8E G;  3CSX A;  3N2G A;  4O4H A;  4MVZ A;  2XAF A;  4MVQ A;  4JYC A;  1GM7 A;  1SET A;  2UXB O;  5A9G A;  4X65 B;  1YCI A;  4JAA A;  3J7A U;  4PJ0 Z;  4NR1 A;  2YIB D;  1BGY H;  2IJJ A;  3UM7 A;  1Q81 W;  3E2E A;  4LFC O;  1QVG U;  4O4L B;  2F1M A;  4I50 B;  4YIO A;  1K73 W;  3G4S V;  1N32 B;  4YJ2 B;  5FNV A;  4LF8 B;  3OUF A;  4GZR B;  1IBK B;  2B9Z A;  3PN1 A;  1BMF G;  4JZG A;  2ITD C;  3FAV B;  2HHH O;  1FFT B;  4QJF B;  5LA6 B;  2YI8 A;  1SQG A;  1ZWI C;  2R72 A;  5BXZ A;  3JAW B;  3B8M A;  3RN4 A;  4P9O A;  2CGO A;  4QNH B;  1AIL A;  2DQ3 A;  2HP8 A;  3ZRX A;  1MNG A;  4DV6 B;  3TGU H;  3J81 N;  1AP6 A;  2ZCE A;  4J42 A;  5K1X A;  3R66 A;  1IBM O;  5CBG A;  1AI7 A;  4TQD A;  5DN6 G;  1QVF U;  1LNQ A;  3T1Y B;  4DR2 O;  2P22 C;  1I94 B;  1F51 A;  4J7J A;  2OWO A;  3JAT A;  4XDJ A;  4JI0 B;  5GTH Z;  4UCS A;  4I9W A;  5LGU A;  3ZHR A;  2DN9 A;  3ABK C;  4O2B B;  1FAF A;  4MT8 A;  4X1I A;  3C3T A;  4LNU B;  3H01 A;  4GLX A;  3K04 A;  4E4E A;  1S72 V;  3ASO C;  4PHZ A;  4BIO A;  4ZI7 B;  3D36 C;  2JJ2 G;  3ASO B;  3QG5 A;  3SPH A;  5IJ9 B;  2CH7 B;  5H9C A;  2UXN A;  4KXR A;  4DW1 A;  2RNB A;  1Z5V A;  1S77 D;  1EM1 A;  1D2D A;  2EZP A;  1TVK B;  1XMO B;  3M99 B;  4JI6 B;  4B3T B;  3TK1 A;  1GAX A;  5JVD A;  3AG2 C;  4TSF G;  3T4D A;  3RVZ A;  3AG2 B;  4I0X A;  3K57 A;  4PDM A;  4NTY A;  2WA3 A;  1UJW B;  3APQ A;  1HNZ B;  1PNK A;  4UCO A;  1WJZ A;  1VQK V;  1GMG A;  4QPJ A;  1WNS A;  4GKJ O;  3AG7 A;  3OD4 A;  4FFK A;  2XAH A;  1YXB A;  5KUK A;  2Q0O C;  4RUE A;  4CBC A;  3RW0 A;  4DV3 B;  2Q6A A;  1L8D A;  3N2K B;  5IT9 N;  4JI8 O;  3G6E V;  4J10 A;  2P67 A;  5H5N A;  3OEE G;  2HFE C;  3K59 A;  2WAM A;  1SA0 B;  3UQ8 A;  2QTO A;  3C90 A;  5L3F A;  1MZE A;  2QR4 A;  4J7Z A;  4PD4 F;  1EFR G;  2QSA A;  2WLL A;  4UFZ A;  4FK5 C;  3RGB A;  2P6J A;  4DUZ O;  3UKM A;  2X7R B;  4ZHQ B;  2FB5 A;  3UCS C;  2W6I G;  3CXH F;  2Q69 A;  2A06 H;  1QNM A;  3BRC A;  4GKK O;  3TET A;  2ZR2 A;  4BIU A;  4AQY B;  3WB2 A;  4LFB O;  4I55 B;  1ENV A;  5H6R A;  1FPO A;  1TUB B;  5FPR A;  1WN7 A;  1XMQ B;  4QE9 A;  1MA1 A;  4LCU C;  4H0L B;  2RJZ A;  1Y76 A;  1N36 B;  1ZL8 B;  1FKA O;  2CAZ C;  2YIA A;  4JI3 B;  1DF5 A;  2UXD O;  2O57 A;  3STL C;  4K8X A;  1J95 A;  4LP8 A;  3C3S A;  2JIZ G;  5JH7 B;  4L8J A;  3CCM V;  3ZS8 C;  3ZRV A;  2JJ1 G;  4K3A A;  1F23 A;  2GTS A;  3RYH A;  2UUC B;  4DR1 O;  2YXL A;  3JD2 A;  4JYA O;  3ZMV A;  1ZUQ A;  2GUZ B;  3CC2 V;  1N34 B;  3M8A A;  3OGI B;  2ILM A;  3SJB C;  1H8H G;  2EIJ C;  1Q3E A;  4WFA V;  5L3C A;  4OX9 O;  4JI2 O;  4UV9 A;  1JFF B;  4BW5 A;  2EIJ B;  2YC0 A;  4YIP A;  5C8Y B;  1THZ A;  1OZ0 A;  1S5L Z;  4FVM A;  4CH5 A;  1SQX H;  2KG7 B;  3H1I H;  1YEW A;  2GSM B;  4J41 A;  2JEU A;  3O65 A;  2N04 A;  2YUA A;  5FL7 G;  2V1D A;  3K79 A;  1W0K G;  2CTP A;  4UV8 A;  2JEX A;  4J9Z B;  2Y69 C;  1VEW A;  2RN9 A;  2BOB C;  2Q7G A;  3E86 A;  3A2F A;  5CB4 B;  2Y69 B;  1Q7Y W;  4U3J A;  4KHP O;  4TUY A;  3VOU A;  1FJG B;  2HLD G;  4YY3 O;  1P49 A;  2QM4 A;  3RVY A;  1BCC H;  3CCQ V;  4OXS A;  1D5N A;  5L3G A;  4O4J B;  1FD9 A;  2CGN A;  1Y74 A;  2LJ2 A;  2KQX A;  3SJC C;  3JCZ A;  3UT5 A;  1JQ0 A;  2VQF B;  2UXX A;  3UO3 A;  1LUW A;  3E83 A;  1M1K W;  3E8H A;  4F6E A;  3Q4H A;  1XNQ B;  2RCV A;  5KX5 B;  4BWA A;  1K34 A;  4NXN B;  3HKE A;  4MVS A;  4JTA B;  2PZS A;  2ZKO A;  4MVU A;  2F66 C;  1I7F A;  4I9Q A;  1I08 A;  1S0V A;  1MG1 A;  5B5E Z;  1HDJ A;  3H9V A;  3HKC B;  4CS4 A;  2WLI B;  4UB8 Z;  1ZX3 A;  1JJ2 U;  4UCV A;  2X6B A;  4LFA O;  4FM2 A;  1YVW A;  4FLT A;  1QLE B;  4EFE A;  4RWU A;  1VMG A;  3RBZ A;  1KUQ A;  2JS5 A;  1M90 W;  3ZHV A;  3JAR B;  2YIC A;  4GX1 A;  1M56 C;  2EIM C;  1TA8 A;  3K03 A;  4JAV A;  4DV5 O;  3DXR A;  1YTF B;  1M56 B;  1WP7 A;  1KU9 A;  2EIM B;  3JYC A;  3E8B A;  3RT3 C;  2DE0 X;  1U96 A;  3ETD A;  3L73 H;  2CTW A;  1VF5 B;  2R9R B;  4LF4 B;  2OTL V;  2L6L A;  1OCO C;  4LR3 A;  1R3I C;  3CYO A;  1SC5 B;  1XRE A;  3KZI Z;  3LDE A;  3SR2 C;  3SYC A;  1SZX A;  1OCO B;  1JVM A;  2OIG A;  3E35 A;  4CZZ A;  2JGU A;  2NN4 A;  1NR7 A;  3ETE A;  2LFR A;  4EKW A;  4LF5 O;  2QWR B;  1QR8 A;  2XAQ A;  5KMG A;  5FNV B;  1K3E A;  4RO2 A;  2IBZ H;  3QTC A;  4JI1 O;  5LXT B;  3AG1 C;  4LFC B;  5CA0 A;  1MSW D;  2WLN A;  4JTD B;  5IWA B;  2DW4 A;  4UXN A;  2EX3 A;  5BR8 O;  1ZLZ A;  4OPH A;  1N33 B;  1MZF A;  1WB8 A;  1XEQ A;  1VQL V;  3HKD B;  1WAZ A;  4ASU G;  2KB1 A;  1BZK A;  5KHJ A;  3I5D A;  3SYQ A;  1V54 C;  3OM3 B;  5IYC O;  1V54 B;  2VQE B;  5E1A C;  3LDD A;  4G28 B;  3OMI B;  2AW9 A;  3G80 A;  2UU9 B;  4IYH A;  4X20 B;  1N8R W;  5D5P A;  1JR9 A;  3GVM A;  4U7N A;  2UXC O;  2WLH A;  5JQG A;  4LH7 A;  1Q86 W;  4ZKI A;  1S3J A;  3AEI A;  3JCU Z;  4NXM B;  1QLN A;  1BQ0 A;  3AK3 A;  4DV7 B;  2ZIM A;  1IBL O;  1EN6 A;  2Q0A A;  3W7W A;  2Q9L A;  2P06 A;  1SQB H;  1QQC A;  4YJ3 B;  2PYJ A;  1YIJ V;  1JA8 A;  4PA3 A;  1K4C C;  1Q82 W;  4IIJ B;  2W6J G;  2IM9 A;  3E22 B;  4WBN A;  2ZT9 B;  1UFI A;  3T2M A;  1SQQ H;  5GTI Z;  1VF7 A;  4BW9 A;  3K0G A;  5J2U B;  2Y0I A;  2CTQ A;  3U10 A;  1M4U A;  4DR4 B;  1U97 A;  1PNM A;  4DK0 A;  4ZOL A;  2GHY A;  4JYY A;  1NTM H;  4KL1 A;  2YIB A;  4X9Q A;  5GW7 A;  3RYF A;  5D5Q A;  5A2Q N;  5EK0 A;  5GON B;  4JV5 B;  4X62 O;  1KD1 W;  2ZM6 O;  4B3R O;  1FXV A;  2IJK A;  4X66 O;  2Q7E A;  5JJE B;  4RAI A;  1K7D A;  2ZE6 A;  3ZX6 A;  2YS8 A;  3K9A A;  1CP9 A;  4JI7 B;  1AJQ A;  5H2F Z;  2BSK B;  2BE3 A;  3K9S A;  1XL6 A;  4X64 O;  3L70 H;  4AIL C;  4LBE C;  1KC8 W;  3CHX A;  2Y4T A;  3SYO A;  5IJ0 B;  3CP1 A;  1X59 A;  5H6Q A;  2R9A A;  3QVN A;  5LP6 C;  4HNA A;  4B08 A;  3CME V;  1AI4 A;  1S5H C;  3ZHQ A;  1SQP H;  3FKS G;  5LP6 B;  2JK5 C;  1M5I A;  2XAS A;  5ITZ A;  1H2K A;  5KUM A;  1O9G A;  2F43 G;  1VF6 C;  5EYP A;  1G8M A;  3CRQ A;  1R6T A;  4GX0 A;  4FLY A;  3CCJ V;  4TOI A;  2C2A A;  2EZO A;  4O4I A;  3CCU V;  1VQO V;  4DV1 O;  1E1R G;  3D8C A;  3H1H H;  5DED A;  4CH3 A;  4TT3 G;  4FFB B;  1HP8 A;  1RM1 C;  4WFF A;  4I5S A;  1Q6H A;  4DR7 B;  4KUM A;  1RM1 B;  5KA5 A;  5IYZ A;  3ZRW A;  2ITC C;  3FB5 C;  1KMI Z;  4DUY O;  2LW1 A;  4JPR A;  5EC1 C;  4WF9 V;  5CBF A;  2DWE C;  3F7V C;  4FJC C;  1OCC C;  2IH1 C;  2MW2 B;  1OCC B;  1Z2G A;  3RYC B;  2ODM A;  2X6A A;  3FD9 A;  4HAM A;  4HZ3 A;  5CA3 A;  1BQZ A;  2YI9 A;  3AG3 C;  2Q4P A;  4P2Z A;  1K5S A;  1H2N A;  3AG3 B;  4YHH B;  2BTQ B;  1TUE B;  5LHG A;  4FM1 A;  1R3J C;  4NYK A;  1M93 A;  1V55 C;  1Q43 A;  3OR7 C;  3CRA A;  1DF4 A;  5JCO A;  2PTM A;  1IZ3 A;  3P3P A;  4D7S A;  3WG7 C;  1V55 B;  1H2S B;  5EIB C;  2DWD C;  1LUV A;  2IJH A;  3ETQ A;  3WG7 B;  2AZ0 A;  1EN4 A;  3OMN B;  4WCE V;  5B1N A;  1HNW O;  2OT5 A;  3DC5 A;  2A7W A;  3JAS B;  2JGD A;  1XQ8 A;  4X88 A;  5J2T B;  3K3W A;  2UUB O;  3ABL C;  2YDE A;  3HKB A;  3EXA A;  3ABL B;  3B09 A;  3WB1 A;  1AR5 A;  3TXS A;  1SRY A;  1ARO P;  2EBO A;  3WU2 Z;  4D6T H;  3CJH B;  4Q6G A;  2BCC H;  4DV2 O;  3ZN1 A;  1JJO A;  1PKX A;  1XDC A;  3ABK B;  1RSO A;  4DV4 B;  1J5E B;  3MD0 A;  5FPO A;  2XHB A;  4QIW F;  2RDC A;  2UUA B;  2HG5 C;  4PA7 A;  1JX9 A;  2YEV A;  3SYA A;  3L72 H;  4JI4 O;  3K5N A;  1ZAU A;  1YTF D;  5EZY A;  3OT7 A;  1V9P A;  3P3N A;  1E1Q G;  3ABT A;  1UPG A;  2F4V O;  3IC9 A;  5LOV B;  1MSD A;  2FTK A;  4DO2 A;  2N74 A;  2WLM A;  3CS5 A;  1L0N H;  3OTO B;  1WP8 A;  5L3E A;  4CH6 A;  1IUR A;  3GWO A;  5AG2 A;  2H3O A;  3FX7 A;  2Q7H A;  3E8G A;  4Z1V A;  1Q90 D;  1JCH A;  1T5E A;  4DR3 O;  1P7G A;  1HW7 A;  4LF7 O;  1WPB A;  4LH6 A;  4ABM A;  1GN6 A;  2XAJ A;  4X1Y B;  2E76 B;  2ZD9 A;  1KEC A;  4MTO A;  2DYS C;  3THO A;  2DMX A;  3OEH G;  2IH3 C;  3W7X A;  2DYS B;  4LC1 A;  1K4D C;  3DXR B;  1H38 A;  4MW3 A;  4TV8 B;  1GTO A;  2PI4 A;  1Y4M A;  3IC7 A;  4H37 A;  5DM6 V;  3I55 V;  4LF9 O;  1XNR O;  2LFS A;  5BMV B;  1YIT V;  5K1P A;  3W7U A;  3FYI B;  1BHA A;  4RUF A;  4MSW C;  4EB6 A;  1SQF A;  3F7Y C;  1G1X B;  1FFX B;  1KQS U;  4IL6 Z;  2JDI G;  1I5X A;  3F5T A;  1VAR A;  3BCC H;  4PA6 A;  1WA8 A;  1BL8 A;  1LR1 A;  3H1K H;  1QU7 A;  2Z5U A;  4X65 O;  4FLZ A;  2HVJ C;  3NXS A;  3SPJ A;  4JAU A;  2GBO A;  2P4K A;  3HR0 A;  1WB7 A;  4NTX A;  1XHX A;  2Q68 A;  2XOK G;  2D3O W;  1F4M A;  4C7U A;  3ZIA G;  4TQF A;  1YJN V;  1N32 O;  1US6 A;  2N05 A;  3T1H B;  5B66 Z;  1YSC A;  4P9P A;  3L75 H;  4LF8 O;  1YF2 A;  2A0L A;  4N23 A;  3K5L A;  1FXH A;  4O4L A;  1IBK O;  4I50 A;  3RYI B;  4X8A A;  3CX5 F;  3SGI A;  2VS0 A;  4Q20 A;  2ADP A;  4X1K B;  1GM9 A;  4YJ2 A;  3ZHT A;  2VWJ A;  4F6R B;  1P84 F;  5DEC A;  4DV6 O;  1SES A;  2PF4 E;  5F2V O;  1FXK C;  3AK2 A;  3FAV A;  5LA6 A;  2ZNJ A;  3RFR A;  3BAA A;  3JAW A;  1FXK B;  4JTC B;  4R50 A;  3A0H Z;  3K58 A;  1XBL A;  1IBL B;  5LYJ B;  2EIL C;  1Z5W A;  1KBH A;  3B4S A;  3T1Y O;  2E3C A;  4DR5 B;  2EIL B;  1I94 O;  1QCE A;  2FML A;  1GH6 A;  2KSD A;  1KP2 A;  3QO5 A;  4JI0 O;  1IVS A;  3TJT A;  3KKY A;  3LSU A;  3U11 A;  2HVK C;  3ZMU A;  3ZCC A;  4BIZ A;  1VQN V;  4CH4 A;  3LSS A;  3DTU B;  4K0K B;  3JAK B;  4IHJ B;  1BHB A;  4I4T B;  1Q5O A;  2LQT A;  4U3F H;  1PL4 A;  4JI5 B;  2CE4 A;  1Q6I A;  3S3W A;  5LMN B;  5BZB A;  1AB3 A;  4O2B A;  3ML0 A;  1VIB A;  4LNU A;  4QGP A;  4UUJ C;  3CPW U;  1O9H A;  3SPI A;  2EJ7 A;  1R3K C;  3ZRS A;  1AJN A;  2Z3Y A;  1XMO O;  4OPA A;  4JI6 O;  4ZI7 A;  5B1O A;  1IXB A;  5IJ9 A;  3B40 A;  2CH7 A;  3JD1 A;  2ZDI C;  4B7E A;  3JAL B;  1HNX B;  1KKC A;  3DGE A;  3H1J H;  2Q73 A;  3L9D A;  4F4L A;  2ZXW C;  1FS0 G;  3WFV A;  1B06 A;  1TVK A;  2H94 A;  2G38 A;  2NLJ C;  1HNZ O;  2ZXW B;  4DV0 O;  4R6Z A;  2QM8 A;  3BVO A;  1IDS A;  5CA1 B;  4FZ1 A;  1HR0 B;  1P4R A;  4AI8 A;  4UCU A;  1NVP B;  2ZE5 A;  5KA6 A;  5KAI Z;  3MHH C;  2ZE7 A;  3B77 A;  3S3X A;  5EYP B;  1N0N A;  4GCZ A;  2LP7 A;  3FB7 C;  4LF6 B;  5TIS Z;  4J11 A;  1QR9 A;  3G6B A;  2AXT Z;  3N2G B;  4O4H B;  3VQV A;  2LO1 A;  5LMU B;  1VQM V;  5EIB D;  1MAB G;  3OAA G;  1FYJ A;  3N2K A;  5LGN A;  4PDV A;  3SYP A;  2KKW A;  3KCY A;  2F93 B;  1SA0 A;  1ZSP A;  4RQE A;  4IGG A;  2UXB B;  2LGQ A;  2R9I A;  3CEI A;  2VRZ A;  4UCT A;  1SZT A;  2OIE A;  5HFL A;  2WLK A;  2QKS A;  4AQY O;  4ZHQ A;  1R6K A;  2D2C B;  3AG1 B;  1VQ4 V;  3APO A;  3BEH A;  3L71 H;  4UVA A;  5JCO C;  3FYE B;  1XMQ O;  5EC2 C;  4O2A A;  3BPZ A;  4HYO A;  2PUS A;  4WFH A;  4MTF A;  1N36 O;  1VQP V;  1OV9 A;  4I55 A;  2PGG A;  2HHH B;  2ADQ B;  5EBW C;  2FYU H;  5BY1 A;  3CRM A;  4JI3 O;  1TUB A;  3MAQ A;  3SPG A;  1OHH G;  1YJW V;  1F7Y A;  3BY6 A;  2RQ6 A;  4JYB A;  1K9M W;  1M57 C;  4DRX A;  5IY5 C;  3JAT B;  1IBM B;  3HPL C;  1RP3 B;  1M57 B;  3SPC A;  4FLV A;  1N34 O;  1AVM A;  2YID A;  4X1I B;  5JH7 A;  2UUB B;  4DR2 B;  3FB8 C;  3CRC A;  4PEL A;  4E2L A;  4D7T A;  1N0J A;  1IX9 A;  1R73 A;  3ZHU A;  1Y67 A;  2GUZ A;  2QWQ B;  5CN0 A;  1KYO F;  4FMT A;  1H2L A;  3D3Q A;  1NU1 H;  1WLE A;  4PI2 A;  3R65 A;  2AHZ A;  5JVD B;  1JFF A;  4JI4 B;  2P7T C;  5C8Y A;  4PI0 A;  4I0X B;  5B3S C;  2PY5 A;  1GM8 A;  2XTA A;  4N21 A;  2KG7 A;  5KHH A;  3B8N A;  3VQW A;  5B3S B;  1VP7 A;  3CE2 A;  4WFB V;  1FJG O;  4DK1 A;  2BTO A;  2IJI A;  1EZV H;  4LWS A;  1URF A;  5CB4 A;  1AR4 A;  5LHI A;  2VQF O;  3MHS C;  1L0L H;  1OCZ C;  4GKJ B;  1XNQ O;  4R7C A;  1XI1 A;  1NT2 B;  3GB7 C;  4NXN O;  1JMK C;  1EN5 A;  1OCZ B;  2IU3 A;  4O4J A;  4U7O A;  1PP9 H;  3ZMT A;  4MTG A;  4JI8 B;  3F5W C;  5KX5 A;  1NH2 D;  2WLL B;  1EBO A;  1RPR A;  1EZJ A;  4UVC A;  3M7M X;  4RQF A;  3SJQ C;  2WA4 A;  1GO3 F;  2R70 A;  3DC6 A;  5KAF Z;  4PA4 A;  3IFX A;  4TV9 A;  3CB2 A;  3HKC A;  4XDK A;  2QE7 G;  3AK1 A;  2WLI A;  4DUZ B;  3ZBH A;  3QO7 A;  3N27 A;  5HFM A;  4XDL A;  2GTA A;  2L35 A;  3ASN C;  5IDJ A;  3W7S A;  1WA8 B;  4GKK B;  2CDY A;  1SF9 A;  3ASN B;  3JAR A;  4LF4 O;  1Y76 B;  3CCR V;  4LFB B;  1VQ7 V;  3K06 A;  2F23 A;  2AGA A;  1NTK H;  3QNE A;  2XAG A;  1SS3 A;  1SQV H;  4KP4 A;  4P30 A;  3LNM B;  1I5Y A;  4OGQ B;  4H33 A;  3CCS V;  1NKD A;  2JVD A;  1R6N A;  5B1B C;  3RYH B;  2UXD B;  5B1B B;  3ZMS A;  3JAM N;  4W4L A;  5KHI A;  5IWA O;  3BFR A;  1GK9 A;  2XND G;  1N33 O;  1BSM A;  1VQ5 V;  3JD3 A;  2W0X A;  4DR1 B;  5LXT A;  1XL4 A;  4QPK A;  4JYA B;  1B6Q A;  3CCV V;  1XIL A;  3CMA V;  1GN4 A;  1VQ6 V;  2OCC C;  1CEZ A;  4Z1M G;  3OFN G;  2VQE O;  3BAB A;  5CBH A;  1TGO A;  5L3D A;  4DR6 O;  2OCC B;  2HEP A;  3HKD A;  3CC4 V;  5JWP A;  2UU9 O; 
#chains in the Genus database with same CATH homology
 3LSQ A;  1BL8 A;  1QLE B;  2EIK C;  2Z5U A;  2HVJ C;  4FPP A;  3RBZ A;  3NXS A;  2EIK B;  3SPJ A;  4JAU A;  3OE7 G;  1K92 A;  1NVP D;  1M90 W;  3OW2 U;  1DLB A;  1AI6 A;  3CXC U;  1YHQ V;  4GX1 A;  1M56 C;  2Q68 A;  2EIM C;  2XOK G;  2D3O W;  1F4M A;  3K03 A;  4MW8 A;  1W0J G;  3ZIA G;  4JAV A;  1G4Y B;  1YTF B;  1M56 B;  1YJN V;  2EIM B;  2B1I A;  4ZBM A;  1CPY A;  4WFG A;  3JYC A;  3E8B A;  5LGT A;  1MOF A;  3OMA B;  3ETD A;  2H8P C;  1YSC A;  4P9P A;  2IW5 A;  5C93 A;  4FIP C;  3OGC C;  2R9R B;  3P30 A;  2A0L A;  4N23 A;  4TWK A;  2OTL V;  1FXH A;  3ABM C;  4X8A A;  1OCO C;  1R3I C;  3CYO A;  3LDE A;  2A9H A;  3ABM B;  4Q20 A;  3SYC A;  4GX2 A;  1OCO B;  1JVM A;  1JPX A;  1GM9 A;  3E35 A;  4MVO A;  4CZZ A;  2QM7 A;  1PNL A;  2ZDI A;  1NR7 A;  3ETE A;  2LFR A;  1YI2 V;  4EKW A;  3LDC A;  4MS2 A;  4BAY A;  1QR8 A;  1SES A;  2XAQ A;  5IYB O;  1YJ9 V;  1FXK C;  2EIN C;  1K3E A;  1HWY A;  4RO2 A;  1JOY A;  2EJR A;  3AG1 C;  1FXK B;  1K5Q A;  1MSW D;  1K97 A;  2EIN B;  4JTC B;  4G27 B;  4R50 A;  2WLN A;  2EIL C;  4JTD B;  2DW4 A;  1K8A W;  2EIL B;  4UXN A;  3JD4 A;  1QCE A;  2HR3 A;  1K33 A;  3EHB B;  1KP2 A;  1VQL V;  3QO5 A;  4ASU G;  2KB1 A;  4PDR A;  3KG2 A;  2HVK C;  3SYQ A;  1V54 C;  3ZMU A;  3ZCC A;  4BIZ A;  1VQN V;  3OM3 B;  5IYC O;  1ROP A;  1NQT A;  1F4N A;  1H8E G;  3A0R A;  3K0D A;  1V54 B;  2WPD G;  5E1A C;  3LSS A;  3DTU B;  3LDD A;  4G28 B;  3OMI B;  4MVZ A;  2XAF A;  5EBM C;  4MVQ A;  1BHB A;  4JYC A;  1GM7 A;  3VBB A;  1N8R W;  1SET A;  4U7N A;  2WLH A;  3E8F A;  5BZB A;  3ML0 A;  5L3B A;  2BOC C;  3TCU A;  1Q86 W;  4ZKI A;  3AEI A;  1S3J A;  5B1A C;  1QLN A;  4UUJ C;  2IJJ A;  3UM7 A;  1Q81 W;  2Y48 A;  3CPW U;  3E2E A;  3SPI A;  1QVG U;  5B1A B;  1R3K C;  3ZRS A;  2PI5 A;  2Z3Y A;  1AJN A;  1K73 W;  3E89 A;  5B1O A;  4R8C A;  4L87 A;  3W7W A;  3G4S V;  3JD1 A;  2ZDI C;  2M7W A;  3CD6 V;  3CC7 V;  3DGE A;  1YIJ V;  4PA3 A;  1K4C C;  4F4L A;  2ZXW C;  1Q82 W;  3OUF A;  1FS0 G;  2W6J G;  3WFV A;  2H94 A;  2NLJ C;  4MVR A;  2ZXW B;  1BMF G;  2ITD C;  1FFT B;  4R6Z A;  4QJF B;  2QM8 A;  1ZWI C;  1DTO A;  3T2M A;  3B8M A;  4P9O A;  4QNH B;  1AI5 A;  1P4R A;  2DQ3 A;  1NVP B;  3ZRX A;  5KA6 A;  3K0G A;  4PA9 A;  3K08 A;  1M9N A;  3MHH C;  1L1F A;  3T1C A;  3B77 A;  1PNM A;  4GX5 A;  2GHY A;  4GCZ A;  2LP7 A;  3FB7 C;  5CBG A;  5GW7 A;  1AI7 A;  5DN6 G;  1QVF U;  1LNQ A;  1QR9 A;  1GKF A;  5EK0 A;  1F51 A;  1VQM V;  1NH2 B;  1KD1 W;  1MAB G;  3OAA G;  1FXV A;  2IJK A;  5LGN A;  4PDV A;  4XDJ A;  3SYP A;  4I9W A;  5LGU A;  3ABK C;  4RAI A;  1K7D A;  1AJP A;  4MT8 A;  4XBF A;  3K9A A;  3H01 A;  3K04 A;  3T4Z A;  1CP9 A;  3I56 V;  1AJQ A;  1QBZ A;  1S72 V;  3ASO C;  4RQE A;  1XL6 A;  2X6C A;  3LUT B;  2JJ2 G;  2R9I A;  3AG4 C;  3ASO B;  4LBE C;  3SPH A;  1KC8 W;  2P90 A;  5H9C A;  3SYO A;  2UXN A;  3IGA C;  3AG4 B;  3CP1 A;  2MK3 A;  1SZT A;  5H6Q A;  5HFL A;  3ZN0 A;  2WLK A;  1S77 D;  3CME V;  2EZP A;  2QKS A;  1AI4 A;  2W0F C;  1S5H C;  1R6K A;  3AG1 B;  3FKS G;  3M99 B;  1VQ4 V;  3TK1 A;  3BEH A;  4UVA A;  2JK5 C;  3AG2 C;  4TSF G;  2XAS A;  3T4D A;  3RVZ A;  5KUM A;  3FYE B;  5J9P C;  5EC2 C;  3AG2 B;  2WLJ A;  2F43 G;  4HYO A;  1H2G A;  4WFH A;  2HKO A;  4MTF A;  4PDM A;  1G8M A;  1VQP V;  4MVM A;  4GX0 A;  1UJW B;  3CCJ V;  1PNK A;  5EBW C;  2C2A A;  1KKD A;  1VQ9 V;  4KFM A;  1VQK V;  2EZO A;  3CCU V;  1GMG A;  4QPJ A;  3SPG A;  1OHH G;  1YJW V;  1VQO V;  3BY6 A;  1E1R G;  1KP3 A;  4TT3 G;  1RM1 C;  2XAH A;  5LBQ A;  5KUK A;  4WFF A;  4I5S A;  4RUE A;  4CBC A;  4KUM A;  1RM1 B;  3ABU A;  5KA5 A;  4JYB A;  3RW0 A;  1K9M W;  2Q6A A;  3ZRW A;  2ITC C;  1M57 C;  3FB5 C;  5IY5 C;  4UVB A;  3HPL C;  3ZJZ A;  3G6E V;  1M57 B;  4JPR A;  3SPC A;  2P67 A;  5EC1 C;  4WF9 V;  3OEE G;  5CBF A;  2DWE C;  2HFE C;  3F7V C;  2WWW A;  4FJC C;  2WAM A;  1OCC C;  3PJS K;  2QTO A;  2IH1 C;  3FB8 C;  4PEL A;  4E2L A;  5L3F A;  1OCC B;  3D36 A;  2OTJ V;  1R73 A;  2X6A A;  4HAM A;  4G2K A;  2DQ0 A;  4HZ3 A;  5CA3 A;  2X0L A;  1EFR G;  3AG3 C;  3G71 V;  2WLL A;  1AR1 B;  4FK5 C;  2P6J A;  4P2Z A;  1K5S A;  5CN0 A;  3UKM A;  3AG3 B;  1IXM A;  2X7R B;  4FMT A;  1TUE B;  5LHG A;  2W6I G;  1R3J C;  1V55 C;  1WLE A;  2Q69 A;  3OR7 C;  1DF4 A;  3R65 A;  2AHZ A;  3WG7 C;  1V55 B;  2P7T C;  3TET A;  2DWD C;  2IJH A;  2ZR2 A;  3WG7 B;  4BIU A;  5B3S C;  5LHH A;  3HB3 B;  1GM8 A;  3OMN B;  3FB6 C;  4N21 A;  5B1N A;  4WCE V;  2OT5 A;  3B8N A;  5B3S B;  1PD3 A;  2CK3 G;  1WPX A;  1ENV A;  2AHY A;  4X88 A;  5H6R A;  3K3W A;  4WFB V;  3ABL C;  3CCL V;  3CCE V;  1QLE C;  3ABL B;  2IJI A;  4QE9 A;  1R3L C;  1SRY A;  2YSU B;  4LCU C;  3ZMZ A;  1ARO P;  2EBO A;  1NBM G;  3W7T A;  5LHI A;  3ZRW B;  1NJI W;  3MHS C;  3P32 A;  3ZN1 A;  1PKX A;  1DF5 A;  3ABK B;  1OCZ C;  1RPO A;  4R7C A;  3MD0 A;  3GB7 C;  4QIW F;  3STL C;  1J95 A;  4LP8 A;  1OCZ B;  2IU3 A;  2JIZ G;  2HG5 C;  4PA7 A;  1JX9 A;  3CCM V;  4U7O A;  2YEV A;  3ZRV A;  2JJ1 G;  1F23 A;  3QO8 A;  3SYA A;  3ZMT A;  4MTG A;  4GT1 A;  3JD2 A;  3ZMV A;  4JF3 A;  2B1G A;  1YTF D;  3CC2 V;  3F5W C;  1NH2 D;  2WLL B;  1EBO A;  1P7B A;  1RPR A;  4DXW A;  1EZJ A;  3X2Q C;  4WFE A;  4UVC A;  5EBL C;  4RQF A;  3SJQ C;  3D3I A;  4YXW G;  1W2B U;  1E1Q G;  1GO3 F;  3X2Q B;  3ABT A;  1H8H G;  1COW G;  4PA4 A;  3IFX A;  2EIJ C;  2FTK A;  4WFA V;  5L3C A;  4DO2 A;  2WLM A;  2K1E A;  4UV9 A;  4XDK A;  2QE7 G;  4BW5 A;  2EIJ B;  4X89 A;  1VQ8 V;  2WLI A;  1THZ A;  1OZ0 A;  5L3E A;  4JAS A;  2ZR3 A;  3QO7 A;  2WSS G;  3GWO A;  2DYR C;  5HFM A;  4XDL A;  4PDL A;  1NR1 A;  2GSM B;  2DYR B;  1OCR C;  3E8G A;  2JEU A;  3ASN C;  5IDJ A;  5FL7 G;  2V1D A;  1JCH A;  2B5U A;  3K79 A;  1W0K G;  1OCR B;  3W7S A;  2QA4 V;  4UV8 A;  2JEX A;  1E79 G;  3ASN B;  4J9Z B;  2Y69 C;  3STZ C;  2BOB C;  3E86 A;  2IU0 A;  3CCR V;  3OR6 C;  2XAJ A;  2Y69 B;  2ZD9 A;  1VQ7 V;  3K06 A;  1KEC A;  4QE7 A;  5IY5 B;  1Q7Y W;  4MTO A;  5CMU A;  2DYS C;  3VOU A;  5IYD O;  2HLD G;  3OEH G;  3OUS A;  2IH3 C;  3QNE A;  3ETG A;  2DYS B;  2V7Q G;  3RVY A;  3W7X A;  2XAG A;  4LC1 A;  4KP4 A;  4P30 A;  3LNM B;  4OXS A;  3CCQ V;  1I5Y A;  1SER A;  5L3G A;  1K4D C;  1H38 A;  4MW3 A;  2NNU A;  4H33 A;  3CCS V;  1NKD A;  2YEV B;  3JCZ A;  1R6N A;  1GTO A;  1JQ0 A;  2UXX A;  5B1B C;  3E83 A;  1M1K W;  2PI4 A;  3E8H A;  1Y4M A;  3EFF K;  3IC7 A;  3JD0 A;  5B1B B;  4H37 A;  4J9Y B;  3ZMS A;  5DM6 V;  3I55 V;  1K34 A;  2LFS A;  1GK9 A;  1PL0 A;  1YIT V;  2XND G;  4MVS A;  3W7U A;  4JTA B;  1VQ5 V;  2HJF C;  3JD3 A;  3FYI B;  2A79 B;  4MVU A;  1BHA A;  4RUF A;  4MSW C;  2Q67 A;  1XL4 A;  1FXK A;  3F7Y C;  2ZQM A;  4QPK A;  1S0V A;  1MG1 A;  1B6Q A;  1Y66 A;  4JGS A;  1KQS U;  3CCV V;  3CMA V;  2QEX V;  1S76 D;  2JDI G;  1ORQ C;  1VQ6 V;  2OCC C;  1CEZ A;  4Z1M G;  2WLI B;  1I5X A;  3OFN G;  4MTX A;  5CBH A;  5L3D A;  1JJ2 U;  4PA6 A;  2ATK C;  2OCC B;  2X6B A;  3CC4 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...