5BZBA

Navms voltage-gated sodium channel pore and c-terminal domain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Ion transport protein
publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
total genus 34
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5bzbA00
2HJFC 4WFHA 1K4CC 1V55C 2EILC 3T1CA 1M57C 5EBMC 3SYCA 1V54C 2JK5C 4EKWA 4G28B 2P7TC 2Y69C 5IY5C 1OCZC 2HFEC 4I9WA 3GB7C 2Q68A 3FB6C 3FB8C 3IFXA 3RBZA 3STLC 3VOUA 2Q6AA 3SYOA 5EC2C 1P7BA 3BEHA 5KUMA 4UUJC 2Q69A 3KG2A 4RUFA 4G27B 5B1BC 4JTCB 4PA6A 3LDDA 1K4DC 4MVUA 2WLLA 3ASNC 3R65A 2X6CA 3HPLC 3OR7C 4HYOA 2IH1C 4MVOA 4XDJA 2BOBC 3E8FA 3SPJA 2ITCC 4DXWA 5KUKA 1R3KC 4LP8A 3T4DA 5EBWC 3LDEA 4P2ZA 2KB1A 3ASOC 3EFFK 4MSWC 4PDVA 1JVMA 2HVKC 2QKSA 3F7YC 4P30A 3T2MA 4MW3A 3AG1C 2ZD9A 3RW0A 4PDLA 3E8HA 4MS2A 4QE7A 4MVQA 4XDKA 2EIJC 4MVRA 1XL6A 1BL8A 4MTGA 5B1AC 4WFFA 4QNHB 5E1AC 3SPIA 4J9ZB 3SYAA 3RVYA 4JTDB 2X6AA 3UM7A 3LDCA 2H8PC 2HVJC 2A9HA 4P9PA 2Q67A 3LUTB 3X2QC 4LCUC 4P9OA 3UKMA 3SPHA 3AG2C 1XL4A 4R50A 3T4ZA 2WLKA 4BW5A 2NLJC 3F7VC 2WLMA 3JYCA 3FB5C 2HG5C 4GX5A 2WLIB 2EIKC 4GX1A 5CBFA 4WFGA 2W0FC 3K03A 3F5WC 4PA7A 4F4LA 3K0DA 2OCCC 2DWDC 3K04A 3AG4C 3K06A 3SPCA 4CBCA 5CBGA 1OCOC 2DWEC 4R8CA 4RO2A 5EC1C 4ZBMA 4QE9A 3STZC 3OUSA 3ABLC 5BZBA 4WFEA 4H37A 4PA4A 3E86A 4MTOA 5CBHA 2WLLB 3K0GA 4HZ3A 3ABKC 4R6ZA 1R3JC 3OUFA 3TCUA 3OGCC 3WG7C 1QLEC 4KFMA 2EIMC 4MVZA 4MVSA 2ITDC 4MVMA 3ZJZA 3PJSK 5J9PC 1ORQC 2ATKC 2A0LA 2DYSC 3OR6C 4TWKA 5EK0A 3SYQA 3AG3C 1G4YB 3E8BA 4H33A 3LNMB 3E8GA 4OXSA 1OCCC 2WLIA 3FB7C 5B3SC 4PDRA 2AHYA 1R3LC 4RAIA 4MTFA 2DYRC 2ZXWC 2WLJA 3ABMC 2WLNA 3IGAC 4GX2A 1S5HC 2EINC 2YEVA 3SYPA 4XDLA 4J9YB 3ZRSA 4PA3A 1J95A 4RUEA 1ZWIC 2IH3C 1R3IC 4PDMA 4X88A 2BOCC 2AHZA 2R9RB 4GX0A 2X6BA 3TETA 3RVZA 3SJQC 3E89A 4MW8A 4R7CA 4JTAB 2A79B 3E83A 1LNQA 3SPGA 4PA9A 2K1EA 1KKDA 4LBEC 5EBLC 2WLHA 3K08A 4X8AA 1OCRC 4X89A 2QTOA 1M56C
chains in the Genus database with same CATH superfamily
2WA4A 5EBMC 2P4KA 1H2LA 1OCZC 3CRAA 3WG7B 3FB6C 2EIMB 1HDJA 1AJNA 3N27A 2R70A 4FFKA 4Q6GA 1K4DC 3ZN1A 3OE7G 5CB4B 2F4VO 4QJFB 1GKFA 2CK3G 1XMQB 3QO8A 4CH3A 4J42A 4QGPA 4X64O 4MSWC 2GBOA 3F7YC 4F6EA 2IJJA 2A7WA 2YEVB 5EIBC 1YJ9V 5D5QA 1U97A 2XHBA 2BTOA 3SYAA 3G80A 2DOSA 3TXSA 3LDCA 2JEXA 2IJKA 2H8PC 3NXSA 5KMGA 5L3CA 4JAVA 1XL4A 4BW5A 3F7VC 3E35A 1PM9A 4IIJB 4I4TB 4EB6A 2EJ7A 1BHAA 2EIKC 3JCZA 4PA7A 5IYDO 3P30A 2ZT9B 4KHPO 4JI3B 4DYLA 4JI7O 4R6ZA 1DK1A 2CUGA 2KG7B 3OUFA 1R73A 2JRIA 1SQXH 4MVZA 2ITDC 4JF3A 2K9PA 1XDCA 1NVPB 4KP4A 4DR3O 4OXSA 5LA6B 2ETNA 5H6QA 4DR2B 4DK0A 2DYRC 1PP9H 1KB9F 5FLXN 3R66A 2DN9A 5IJ9A 2EZPA 3WFVA 1Y66A 4GT1A 2L35A 1MSWD 1COWG 5HFLA 4IL6Z 5D5PA 1L0LH 1NT2B 4LBEC 1WPXA 3QVNA 3ZHTA 4X66O 4IGGA 4DW1A 2JK5C 1IBMO 4JI8O 5KUMA 1XEQA 2ARHA 3W7XA 3JALA 4B3TB 1Y76A 2OT5A 3A0BZ 2KQXA 2QA4V 4ZOLB 2F93B 4DO2A 2AW9A 2UXDB 4ZI7A 2EINB 4DV5B 3BCCH 2KB1A 2HVKC 1S5JA 3AEIA 3CCUV 1SC5B 4FMTA 3VQXA 4UB6Z 4DV4B 3UT5B 1VP7A 3WU2Z 3SGIA 3SR2C 1SESA 2E3CA 2LGQA 4IT5A 3CE2A 4YIPA 4DV6B 1V55B 1M4UA 4C7UA 2WWWA 2FB5A 2ADPA 1KU9A 3CRMA 1GM9A 2P6JA 2W0XA 2W0FC 3K03A 3RFRA 1AR4A 2QM4A 1AVMA 1PD3A 5CBGA 4LFAB 1ENVA 3ML0A 1SZXA 4O2AB 5IE9A 3TCUA 2UUBB 3TK1A 2Q0OC 5CB4A 4PELA 4JYAO 1OCCC 5KHKA 1AR5A 4JGSA 1GK9A 1JR9A 2JS3A 3IGAC 1B04A 2YEVA 5LXTA 3RN4A 4UCUA 4FM0A 2ZM6O 2X6BA 3ABMB 1NU1H 4PA9A 4J80A 1XNQB 5KAFZ 3D36A 1GTOA 4IIJA 4I4TA 4B08A 2ZE7A 1S72V 2RCVA 3FB8C 1LR1A 3FKSG 3SYOA 3BHPA 4DR4O 4U7NA 3KG2A 4RUFA 4JTCB 3BRCA 1HNWO 3JAMN 5F2VO 3OMNB 1OCZB 3MD0A 2IH1C 2KG7A 1GM8A 1N32B 2ZIOA 4O4JB 3LSUA 4JI2O 1RFYA 1YZBA 4JI1B 1FXKC 4PDLA 3GWKC 2EIJC 1D2DA 2XT9A 4WFFA 4TQDA 2GHYA 1X4TA 2PYJA 1VF5B 4P9PA 2G38A 2JGDB 2HHHO 1NS1A 1R1BA 4LH7A 4JI4B 1RM1C 2V1DA 1XI1A 1I94B 1VQ4V 2OCCC 4O4LB 3K04A 4YJ3B 4CBCA 3N2KB 1G1XB 4G2KA 3ZX6A 5CBHA 3MHHC 1N33O 1R3JC 1HR0O 5IYZB 1FS0G 1EBOA 2QWNB 2RDCA 1N36B 4ZOLA 3E8BA 4FLYA 4OGQB 1H2MA 2PI4A 4Q20A 1DF4A 1YEWA 4I9QA 5BR8O 4CC6A 1R6NA 4GX0A 2ZQMA 1RPRA 2YXLA 2DYRB 1KKCA 2XASA 4LF4B 5JJEB 1OCOB 2WA3A 2C2AA 2Y0IA 1AJQA 3JSNA 1OCRC 4CC5A 2IJIA 2VQFB 3CX5F 2LJ2A 2HFEC 4H44B 1VQPV 3VOUA 1IX9A 1BZKA 3W7UA 4JYCA 4OX9B 3I55V 2CGNA 1K73W 4JV5B 1XBLA 4N21A 4O2AA 2CGOA 2PUSA 3J7AU 4DXWA 4JYBA 1UFIA 3U0ZA 3K5NA 3E2EA 1H2SB 4DV2O 4BIUA 4FJCC 2UXBB 2XAQA 4LWSA 5DECA 3T1YB 3B77A 3HKCB 3DC5A 2EILB 3UO3A 2VRZA 1QNMA 2WLMA 1F23A 3FB5C 2FKXA 2QWPB 3QG5A 5FPRA 3K0DA 5LBQA 2YXHA 4H13B 1CP9A 4PA4A 1I0HA 4IYHA 4HZ3A 4X1IB 5IWAB 1QLEC 5LMNB 2MW2B 4MVSA 1OJHA 4MVMA 1FJGB 3OR6C 1Q90D 1IVSA 4O4JA 4PDRA 3IC9A 1VQKV 1ZUQA 4TUYB 3BY6A 5JJJB 1B6QA 4LF9B 1BGYH 3RGBA 3UQ8A 3ZHRA 3SDLA 4JI6O 2E5LO 1JA8A 2BOCC 1I5YA 3APOA 4LFCB 2IJHA 1FPOA 4LF7B 4CS2A 5GTHZ 4DR6O 4B3MO 5H6RA 1X59A 1EN4A 2JGDA 2WLHA 4X8AA 1PNLA 3H1LH 2ZINA 5LOVB 2JDIG 2OWOA 1WB7A 1BT8A 5IY5C 1K3EA 1YJNV 2KKWA 3CB2A 5K1PA 4O4LA 4YJ3A 3N2KA 3AK3A 5B1BC 1S77D 2N04A 4GKJB 4JI0O 4B7KA 5IJ0B 1GN2A 3R65A 1GN3A 4IYIA 2IU3A 1VF7A 2Y0PA 3RYIB 2QM8A 5IYZA 4KXRA 2E74B 1DTOA 4UB8Z 1VQ8V 2HEPA 2UUAO 4MS2A 1IBLO 4UCOA 2P4VA 1JPXA 1KP2A 4J41A 5KA5A 4PJ0Z 1GAXA 4QNHB 4J9ZB 3AK1A 4E2LA 1H2NA 1SQQH 4DUYB 2H94A 3I5DA 4FPPA 1FXKB 2HP8A 4UFZA 5LMUB 1U96A 2EIJB 3T4ZA 4TT3G 2YIBD 4I50B 3OT7A 1YVWA 1NTMH 2LFSA 4BIOA 2CAZC 3K06A 1Q6UA 3BPZA 5IJ9B 5GW7A 3OEEG 1SQFA 3RWRD 4H37A 2ZDIC 4LF8O 1FYJA 5LGNA 2A06H 3H1KH 4NVPA 4DR7B 3HKDA 4DV3O 1QHTA 4K8XA 4RQEA 1FXVA 1EZJA 2ZE6A 5J9PC 4JAUA 1Q86W 3SYQA 5H2FZ 4B3SO 3QF7A 2BE3A 3LNMB 3CHXA 5KHGA 4RAIA 3WB0A 5CA1B 4HNAB 2QTSA 2AGAA 1MMMA 1ZAUA 1J95A 5BMVA 4I55B 3HKCA 3LSQA 3THOA 3E83A 2ADQB 5EBLC 1TVKB 3EXAA 5L3EA 4KHPB 3ABLB 3CYOA 2Z0AA 2Q73A 2L6LA 1HNXO 3FD9A 3L71H 4JI5B 2Y69C 3GB7C 1SERA 2BTQB 2V7QG 1OCRB 4DV7B 1AI4A 2LQTA 4Z1VA 5LYJA 1PPJH 1GM7A 1LUVA 4GKKB 3B2EE 3RYFB 3T4DA 4MT8A 1IBKO 1N4CA 2IBZH 2P67A 2N74A 2FYUH 2QKSA 1PL0A 2RN9A 2A3QA 5B1AC 4MTGA 4O4HB 1XREA 1H2GA 4NXNO 1Z5WA 1XMOO 4TUYA 3OW2U 3UM7A 2OIEA 3ZBHA 4X66B 3ZEDA 4P9OA 1AI6A 3S3XA 4W4LA 5JJNB 3CCEV 4FLTA 4NTXA 4OPAA 2HLDG 3ABTA 3HKBB 3TXQA 1L1FA 4AQYB 5LOVA 3AG4C 1Q3EA 4D7TA 4R8CA 3OUSA 5LXTB 3FFQA 1VEWA 5KLVH 2QGNA 2YSUB 5KHIA 4CH6A 5IJ0A 4TOIA 3BFRA 4UXNA 1L8DA 1VQMV 4PI0A 1NR1A 2RMKB 2WLIA 1QBZA 3RYIA 3ZIAG 4MTFA 1Y74B 1SQVH 4J7JA 1F4NA 3VQYA 3IJ4A 2X0LA 4ASUG 4RQFA 3ETEA 1TAEA 1MSDA 1QCEA 4FVMA 1FXKA 4FLZA 2QE7G 1VF6A 1JJOA 2EX3A 1M93A 3CSXA 4WFAV 4I50A 3B4SA 3OM3B 4KUMA 2XAJA 5KAIZ 1GN6A 4UUJC 2Q69A 2YIBA 4JYAB 2WPDG 1AJPA 3EHBB 4ZIBA 2ZXWB 5L3DA 1XNRO 4MVOA 4XDJA 4LF6O 3E22B 4X62B 3LDEA 4DV0O 5B1BB 2GUZB 2Q7EA 4TV8B 3AG1C 2Q0AA 1KC8W 1NTZH 4YHHO 2DMXA 1FFTB 5C93A 2X6AA 5CA1A 4HNAA 1M56B 2Q67A 5LP6C 3SPHA 1E79G 4I55A 3OAAG 1FXHA 4DR4B 2QR4A 3JSLA 1TVKA 1XILA 2WSSG 1YDXA 1XMQO 4JI2B 3E86A 1WPBA 2ZNIA 4X9QA 2BTQA 4NXMB 3OGCC 2O57A 4U3JB 1I5XA 3HB3B 2F66C 3K5LA 3D3IA 1CXZB 3RYFA 1RSOB 2M6YA 3B09A 4PV1B 2QSAA 3OFNG 1S5HC 2UUCB 1EM1A 3H9VA 4O4HA 2X7RB 1MG1A 1H8EG 2CTRA 1JQ0A 2CTPA 4JI3O 4WCEV 1TUEB 5JCOA 2V4DA 5DN6G 2HJFC 2P22C 5K1XA 1M57C 2ODMA 4FLUA 1K97A 4LWSB 3HKBA 4DR5B 4QIWF 4DR2O 1AP6A 1G8MA 3OMIB 3NR7A 3QO5A 3M8AA 4UVCA 3ZCCA 4DRXB 2UU9O 4FZ1A 3T2MA 1IDSA 5CMUA 3JAKB 4ICGA 4GUNA 5TISZ 1XL6A 5E1AC 1Y74A 1IXBA 2JGUA 5LHIA 5CN0A 3CEIA 1A32A 3OTOO 3CS5A 1SQBH 3W7WA 4R50A 5H5NA 5B1AB 2WLKA 3F5TA 5IYCO 2B1GA 5J2UA 1V9PA 3QNEA 4B3TO 2OYQA 4L8JA 3L75H 5KHHA 1PL4A 2YIDA 3CCVV 2CH7B 3JD4A 4QE9A 3JD3A 4DV5O 1PNKA 2ZKOA 4WFEA 1J5EO 2RNBA 2EBOA 4O2BB 2WLLB 2LW7A 3MAQA 4FLWA 2JJ2G 4LC1A 2DYSC 4DV6O 3K3WA 3OMAB 3AG3C 3E22A 4ZHQB 5B3SC 1K33A 2Q4PA 3BAAA 2JVDA 2B1IA 2GUZA 2XAFA 3CC2V 4K0KO 2JS5A 4TV8A 1W0KG 1B06A 1T5EA 1ZLZA 5C8YB 2ZCEA 1THZA 2VWKA 4DV1B 2PF4E 4PA3A 2EIKB 1K7DA 3JCUZ 1YF2A 4PDMA 3SJQC 1EFRG 4MW8A 1AILA 5LL6Y 3CXCU 1MA1A 1SA0B 1MNGA 2FTKA 5FNVB 1EN6A 3CMAV 1WAZA 1IURA 4X89A 3Q4HB 1ZX3A 3CJHB 2UXCO 2UUBO 1Q5OA 4LH6A 2Q8VA 2P7TC 2JEUA 1URFA 3H01A 3RBZA 2QM7A 4CS3A 1YCIA 1P7BA 1SQGA 4DUZB 1AB3A 3K57A 3ASNC 1K5QA 4K8ZA 3E8FA 1O9GA 3CRQA 4GYCB 4U3JA 4P2ZA 3ABUA 3EFFK 1JFFB 2QWOB 2ZDIA 3L9DA 4MW3A 1DGSA 1SZTA 1Y6XA 4B3MB 4B7EA 1R6TA 1ZSPA 1NTKH 1RSOA 4WF9V 1XNQO 1OHHG 3P3NA 4UCSA 3ETGA 2KSDA 3HKDB 3LUTB 4X20B 3AG1B 1US6A 3G6EV 2ZR3A 4WBNB 1DLBA 4X1YB 3GVMA 3L74H 2P5OA 3MHSC 4JI0B 2YC0A 5LP6B 5J2TB 3SPCA 3HKEB 2DWEC 5EC1C 1N32O 1QVFU 3CC7V 2CTWA 5BMVB 5DEDA 3MDSA 4JI1O 1QR8A 1Q82W 3WG7C 4I0XB 2EIMC 4D6TH 4TSFG 3ZRXA 2Q5ZA 3ZHVA 4E4EA 4DRXA 2XOKG 4NYKA 5JVDB 3SYPA 3JAKA 4BR6A 3ZRSA 5LYJB 1PNMA 2F43G 1I94O 1VQ6V 4X88A 2AHZA 3FYIB 4O4IB 3C90A 3ETDA 1KKDA 2DW4A 4LF5B 3CC4V 4LF8B 3H1HH 1Q6HA 1D5AA 4CH4A 4G28B 3S3WA 3UO2A 1I7FA 3IFXA 2ZNJA 2JJ1G 1N36O 1KQSU 2WAMA 3TGUH 2CH7A 4B3RO 2F95B 3DSQA 1HNZB 2VS0A 3LDDA 4X65O 1VQ5V 1S3JA 1M57B 4F6RB 2VQEB 4DR1B 5GTIZ 1OCCB 2LO1A 4O2BA 1WNSA 2WLLA 3M7MX 4YY3B 2X6CA 3JATB 1SETA 2F1MA 2BOBC 1H38A 1MOFA 3JAWA 3RYHB 2VWJA 3CCQV 1N34B 3LSSA 3CRRA 3K9SA 3FAVB 2ZD9A 3A0HZ 4LF4O 4ZHQA 3AK2A 4QE7A 4MVQA 5LGUA 2ZE5A 3K5OA 1FKAO 1R6KA 1BQZA 2AZ0A 2YS8A 2Y48A 3RVYA 5C8YA 1M1KW 2VQFO 1F51A 4YXWG 5EZYB 2BSKB 2PI5A 4OX9O 2HG5C 2H3OA 2WLIB 1OV9A 1SA0A 3BA8A 5FNVA 4JV5O 1K9MW 3CP1A 3T1HB 1WA8B 1Y67A 4UV9A 4JYYA 3Q4HA 3CJHA 1AP5A 1KBHA 3ZHSA 3CRCA 4PHZA 3ZMTA 3ABKC 2UXBO 2FMLA 4KL1A 2EZOA 5JH7A 3T1YO 1QQCA 3OEHG 1KYOF 1G4YB 1EN5A 4H33A 1TGOA 3FB7C 1XOUA 4PI2A 4WFBV 1VQNV 3WB2A 2WLNA 1JFFA 2F4VB 2EINC 3U10A 1H2KA 1XQ8A 3ICXA 5BXZA 4AILC 1RM1B 4RUEA 5B3SB 4ZKIA 4X64B 2QWRB 4LNUB 4EFEA 2OCCB 3RVZA 4JTAB 4X20A 1BCCH 4FM2A 1G6UA 1HWYA 2LP7A 4WBNA 5IWAO 2GTAA 1V55C 4X1YA 1SKVA 2R9AA 5LHGA 4YJ2B 5LP6A 5J2TA 1FJGO 3KZIZ 3HKEA 4G27B 2GDSA 1YJWV 2NR5A 1YTFD 5B5EZ 1YSCA 1EZVH 1NQTA 4HYOA 2YUAA 3KCYA 3SJCC 4BW9A 2GSMB 4LF9O 1R3KC 2Y4UA 3K59A 1S0VA 4I0XA 1RPOA 5KX5B 2XNDG 1JVMA 2BCCH 4LFCO 4LF7O 4X1KA 4JI7B 3ASNB 2QDOA 4XDKA 2M7WA 4MVRA 4JASA 4ABMA 5HFMA 1M90W 5JVDA 1L0NH 2HR3A 1YXBA 4DR3B 4L87A 3AG2C 1GN4A 2NLJC 4O4IA 4HBNA 4GX5A 2B9ZA 4GKJO 4K35A 1I08A 5A9GA 1AI7A 5A2QN 4RO2A 1XNRB 4ZBMA 1S5LZ 2Z5UA 2PZSA 4DW0A 3VBBA 1S76D 1IBMB 3OGIB 4F6RA 3KCXA 4JI8B 3JATA 2ATKC 5EK0A 3E8GA 1NBMG 2HJDA 3RYHA 2AHYA 5LMUO 2CDYA 2WLJA 2XAHA 3FAVA 1VQ9V 2R9IA 3CCSV 3CCMV 4QPKA 5IT9N 4LFBO 3J80N 3TETA 2OIGA 4YIOA 3E89A 1FD9A 5L3FA 4UCVA 3K08A 3K58A 5EZYA 1TA8A 2BSKA 4DR7O 1V54C 3JARB 1QLEB 1Z2GA 5B1NA 4D7SA 1WA8A 1AR1B 3J81N 2RJZA 3ZN0A 1Q43A 1B3QA 2D2CB 3K5MA 4FLXA 1LUWA 5J2UB 5KUKA 1K92A 1WP7A 2PY5A 5EBWC 1MABG 1GH6A 3ASOC 3JD0A 1UPGA 3A0RA 4MTXA 2YXYA 1NVPD 4JI5O 2P06A 5E79Z 5IY5B 4JZ2A 4LNUA 4FZ0A 4DV7O 5CBFA 1AROP 3F5WC 1N8RW 3ZHQA 2ZM6B 5JWPA 4GKKO 1NKDA 1OCOC 1W0JG 3STZC 4Z1MG 4YJ2A 4TV9B 4MTOA 3H1JH 2UU9B 2LW1A 1NZ6A 3C3SA 3A2FA 3WB1A 1ORQC 3L72H 1BHBA 3ABKB 3OTOB 4UV8A 1VQOV 1HNWB 4UVBA 5KX5A 2MK3A 4GX2A 1M5IA 5L3GA 1YIJV 4XDLA 2N05A 1HP8A 4AQYO 3QTCA 2QWQB 2PYLA 3SJBC 4R7CA 2A79B 4H0LB 3CMEV 1LNQA 3FX7A 1N0NA 3G67A 4UCRA 3VQVA 5JQGA 1JCHA 1J5EB 3E8HA 1TUBB 2QJ1A 2EILC 3SYCA 5AG2A 2HHHB 3BABA 3M99B 3BEHA 2LFRA 3DC6A 1KUQA 5EYPA 2XTAA 4MVUA 4K0KB 4NB5A 3SPJA 3DXRA 3ZRWB 4LP8A 1JOYA 3JASB 4I7ZB 4HAMA 2UXXA 1IXMA 3CXHF 4PDVA 1XHXA 4RWUA 3W7TA 1N33B 3RW0A 3CWBH 4FFBB 1HR0B 4PD4F 3P32A 1Q7YW 1RP3B 1VMGA 4LR3A 2D3OW 2A9HA 2UXCB 4J10A 3QO7A 3X2QC 3B8MA 2Y69B 3I56V 3PN1A 1D5NA 4EEQA 4CH5A 1YI2V 5BR8B 3UCSC 1BS3A 1Q81W 2YICA 3AG2B 4X62O 1FFXB 3CCJV 1XUQA 3JARA 5BZBA 1SQPH 3K0GA 3VQWA 2UXNA 1P84F 2E75B 2AZ2A 4FK5C 3A8TA 4J11A 2ILMA 2UXDO 2B5UA 4DV4O 1ZL8B 3AG4B 3JAWB 4DV2B 3SPGA 1MZEA 2YI9A 1OZ0A 5GONB 2OTLV 2F23A 4A5UB 4NXMO 1JMKC 4EKWA 1VF6C 5LA6A 5EIBD 4I9WA 4EFBA 1IZ3A 5LGTA 3CPWU 1SS3A 4IHJB 1N0JA 3U11A 4TV9A 1V54B 4AHCA 4FLVA 3HPLC 4LFAO 1PV0A 2ITCC 2UUCO 5DM6V 4NKGB 1GO3F 3D3QA 3DTUB 1O9HA 4GCZA 1NI8A 1YHQV 2OTJV 1W59A 2P90A 2Z3YA 1PKXA 3O9OA 5CA0B 2Q7HA 2DJVA 4FIPC 3B8NA 1XHZA 1E1RG 5IDJA 3ASOB 2HVJC 2W6IG 4LCUC 4AI8A 3UKMA 5JH7B 3JYCA 4DR5O 4B3RB 2IU0A 4X65B 4JI6B 2E5LB 1TUBA 1JX9A 3ZS8C 3L70H 1P49A 4JPRA 4DR6B 3ABLC 5B1OA 3UT5A 3IC7A 1K5SA 2YIAA 4BAYA 2DQ3A 3C3TA 4KFMA 2LGWA 1WLEA 5CA3A 2QEXV 4U7OA 4UVAA 3ZJZA 3PJSK 2QKAA 5ITZB 3ZRWA 1AI5A 4TQFA 3JASA 3G6BA 2R72A 1VIBA 1WP8A 2CE4A 3LNNA 4FFBA 3EVKA 4J9YB 1ZWIC 1DF5A 3RT3C 2JIZG 3KKYA 2R9RB 2Y4TA 4QPJA 5KA6A 2UUAB 1IBLB 4J7ZA 1ROPA 2FL4A 2QTOA 4X1KB 2RQ6A 1VQLV 5JCOC 1QLNA 2CTQA 1QU7A 3G4SV 2Q68A 4FM1A 2Q6AA 2XUMA 4N23A 5EC2C 4JI4O 3P3PA 1FFXA 1WN7A 2GV9A 5FL7G 5L3BA 1WJZA 2IW5A 2QKCA 1JJ2U 3N2GB 4DV1O 1M9NA 2EULA 2PTMA 4BWAA 4P30A 4DV3B 5BY1A 3APQA 1BL8A 3D36C 3SPIA 2HKOA 1VQ7V 3RYCB 4JTDB 4NR1A 2EJRA 4B3SB 1GRJA 2YI8A 1SF9A 2GTSA 1CPYA 3ZRVA 1ZTEA 3ETQA 2DQ0A 4DUZO 1ZL8A 1NH2D 2ZR2A 1UJWB 3H1IH 3G71V 5GONA 3JD2A 3X2QB 3CCLV 2DWDC 5B66Z 1QVGU 1BMFG 1NH2B 3ZMZA 4DK1A 4GLXA 3B40A 1SRYA 3L73H 4NTWA 2OCHA 1BQ0A 1MZFA 1HNXB 2IM9A 4IHJA 3K79A 4TWKA 2NNUA 3ZMSA 1R3LC 2ZXWC 3IAYA 3BVOA 3CD6V 5KMGB 3K9AA 1F4MA 4OPHA 1IBKB 2PGGA 5CA0A 2IH3C 3D8CA 1Z5VA 1GMGA 5KHJA 1WB8A 4EB6B 5IYBO 1NR7A 4I5SA 2K1EA 1P7GA 3JD1A 4NXNB 1XMOB 1M56C 4WFHA 1K4CC 1F7YA 3T1CA 2Q7GA 4JAAA 4XBFA 3STLC 2ZIMA 1BE3H 3FYEB 2DYSB 4PA6A 3ZMUA 3AG3B 4JZGA 1KMIZ 1YITV 1KP3A 3OR7C 1KECA 5LHHA 2NN4A 2YDEA 1VARA 4LFBB 2AXTZ 5FPOA 5ITZA 5LMNO 3ZMVA 4LF5O 1P4RA 4U3FH 4CS4A 4NTYA 3HR0A 2W6JG 1W2BU 3AG7A 5H9CA 1K8AW 3W7SA 2XAGA 1HNZO 3O65A 1YTFB 3GWOA 3OTFA 4GX1A 2DE0X 4WFGA 2VQEO 4DR1O 1NJIW 1BSMA 4F4LA 1KD1W 1QR9A 4YY3O 3SJAC 4J7KA 4UCTA 4GZRB 3JALB 1N34O 1Y76B 4BIZA 4CZZA 4K3AA 1K34A 3DGEA 2ZE8A 1CEZA 4ZI7B 4Z2WA 5JQGB 1H8HG 1Q8IA 2A0LA 1Y4MA 3N2GA 4W4KA 1HW7A 1E1QG 3BA9A 3ZHUA 3ABMC 3TJTA 3OD4A 4LF6B 5EYPB 4DV0B 3T1HO 1R3IC 2Q9LA 3CCRV 2E76B 3RYCA 4X1IA 3DXRB 1FAFA 4YHHB 1Q6IA 4DUYO
chains in the Genus database with same CATH topology
2EILC 5EBMC 3SYCA 2JDIG 2P7TC 5IY5C 1YJNV 1K3EA 1OCZC 2JEUA 3WG7B 3H01A 3FB6C 3RBZA 2QM7A 2EIMB 3M99B 1P7BA 3BEHA 2LFRA 1AJNA 5B1BC 1S77D 1K4DC 4MVUA 3ZN1A 3OE7G 3ASNC 3R65A 1K5QA 3E8FA 2IU3A 3SPJA 4QJFB 1GKFA 3ZRWB 4LP8A 1JOYA 4P2ZA 2CK3G 2QM8A 2UXXA 3QO8A 4HAMA 3ABUA 1IXMA 3EFFK 4MSWC 4PDVA 3F7YC 1DTOA 2ZDIA 3W7TA 4MW3A 2IJJA 1VQ8V 2YEVB 1SZTA 3RW0A 4MS2A 1YJ9V 1JPXA 1KP2A 5KA5A 3P32A 4WF9V 1Q7YW 4QNHB 4J9ZB 3SYAA 1OHHG 4E2LA 2D3OW 3LDCA 2JEXA 2IJKA 2H8PC 2H94A 3ETGA 3NXSA 2A9HA 4FPPA 1FXKB 5L3CA 3LUTB 4JAVA 3QO7A 3X2QC 3AG1B 3B8MA 3G6EV 2ZR3A 2Y69B 1XL4A 2EIJB 3I56V 3T4ZA 4BW5A 1DLBA 3F7VC 3E35A 4TT3G 1BHAA 2EIKC 3JCZA 3MHSC 2LFSA 1YI2V 4PA7A 5IYDO 3P30A 3K06A 3SPCA 1Q81W 3AG2B 2DWEC 3OEEG 5EC1C 5GW7A 3CCJV 1QVFU 3CC7V 5BZBA 4H37A 2ZDIC 5LGNA 1QR8A 3K0GA 4R6ZA 1Q82W 3OUFA 3WG7C 1R73A 2EIMC 4MVZA 2ITDC 4RQEA 1FXVA 1EZJA 4JF3A 4TSFG 2UXNA 5J9PC 4JAUA 1Q86W 3SYQA 3ZRXA 1NVPB 4KP4A 3LNMB 4OXSA 4FK5C 5H6QA 4RAIA 2DYRC 2XOKG 3SYPA 3ZRSA 1PNMA 2EZPA 1J95A 2B5UA 2F43G 3WFVA 1VQ6V 1Y66A 4X88A 2AHZA 4GT1A 1MSWD 3LSQA 1COWG 3FYIB 5HFLA 3ETDA 3E83A 3AG4B 3SPGA 1KKDA 4LBEC 2DW4A 5EBLC 1WPXA 5L3EA 3ABLB 3CYOA 1OZ0A 2OTLV 3CC4V 4EKWA 2JK5C 4G28B 2Y69C 4I9WA 3GB7C 1SERA 3IFXA 2JJ1G 2V7QG 5KUMA 2WAMA 5LGTA 1KQSU 3CPWU 1OCRB 1AI4A 3W7XA 3LDDA 1VQ5V 1S3JA 1M57B 2OT5A 1V54B 1OCCB 1GM7A 2WLLA 2X6CA 3HPLC 1SETA 2QA4V 2BOBC 2ITCC 4DO2A 1H38A 5DM6V 1MOFA 2EINB 1GO3F 4MT8A 3T4DA 3CCQV 3LSSA 2P67A 3DTUB 2KB1A 2HVKC 2QKSA 3AEIA 3CCUV 1PL0A 4GCZA 1YHQV 4FMTA 2ZD9A 2OTJV 2P90A 4QE7A 2Z3YA 4MVQA 5LGUA 1PKXA 5B1AC 4MTGA 1R6KA 1H2GA 4FIPC 1SESA 3B8NA 2Y48A 1E1RG 3RVYA 5IDJA 3UM7A 3OW2U 3ASOB 1M1KW 2HVJC 1V55B 1F51A 4YXWG 2W6IG 4LCUC 4P9OA 1AI6A 3UKMA 2WWWA 3CCEV 2PI5A 3JYCA 2HG5C 1GM9A 2WLIB 2P6JA 2HLDG 3ABTA 2W0FC 3K03A 1K9MW 2IU0A 3CP1A 1L1FA 4UV9A 1JX9A 3AG4C 1PD3A 5CBGA 4R8CA 4JPRA 1ENVA 3OUSA 3ABLC 5B1OA 3IC7A 1K5SA 3ML0A 3ZMTA 3ABKC 2YSUB 4BAYA 2DQ3A 3TCUA 4KFMA 1WLEA 5CA3A 2QEXV 2EZOA 3TK1A 4U7OA 4UVAA 3ZJZA 3PJSK 4UXNA 3OEHG 4PELA 1G4YB 3ZRWA 4H33A 1VQMV 1NR1A 1OCCC 2WLIA 1AI5A 1QBZA 3FB7C 3ZIAG 4WFBV 4MTFA 1VQNV 4JGSA 2WLNA 1GK9A 3IGAC 2EINC 2YEVA 1F4NA 4J9YB 1RM1B 4RUEA 1ZWIC 1DF5A 5B3SB 2JIZG 2X0LA 4ASUG 4ZKIA 4RQFA 2R9RB 3ETEA 2X6BA 4QPJA 2OCCB 1QCEA 3ABMB 3RVZA 5KA6A 4JTAB 1FXKA 4PA9A 1ROPA 1HWYA 2LP7A 2QE7G 3D36A 2QTOA 1GTOA 1V55C 4WFAV 1VQLV 1S72V 5LHGA 1QLNA 3G4SV 2Q68A 3FB8C 3OM3B 4KUMA 2XAJA 2Q6AA 3FKSG 3SYOA 4N23A 5EC2C 4UUJC 2Q69A 3KG2A 4RUFA 4G27B 4U7NA 4JTCB 1YJWV 1YTFD 2WPDG 1AJPA 5FL7G 1YSCA 3OMNB 5L3BA 1NQTA 3EHBB 2IW5A 1OCZB 4HYOA 2ZXWB 3MD0A 5L3DA 2IH1C 4MVOA 4XDJA 2GSMB 1GM8A 1JJ2U 1R3KC 1M9NA 1S0VA 3LDEA 5B1BB 1RPOA 2XNDG 1JVMA 4P30A 1FXKC 3AG1C 1KC8W 3ASNB 4PDLA 4XDKA 2M7WA 2EIJC 4MVRA 1BL8A 4WFFA 4JASA 2GHYA 3SPIA 1FFTB 2HKOA 5C93A 1VQ7V 5HFMA 1M90W 4JTDB 2X6AA 2HR3A 2EJRA 1M56B 4P9PA 2Q67A 1CPYA 4L87A 3SPHA 1E79G 3AG2C 3ZRVA 2NLJC 2DQ0A 3OAAG 1FXHA 4GX5A 1RM1C 1NH2D 2ZR2A 2V1DA 1UJWB 3G71V 3X2QB 3JD2A 3CCLV 1AI7A 2DWDC 2OCCC 1VQ4V 3K04A 4CBCA 2WSSG 4RO2A 4ZBMA 1QVGU 2Z5UA 1BMFG 1NH2B 4G2KA 3ZMZA 3E86A 5CBHA 3MHHC 1SRYA 3VBBA 1R3JC 1S76D 3OGCC 1I5XA 1FS0G 1EBOA 3HB3B 3K79A 2ATKC 4TWKA 5EK0A 3D3IA 3E8BA 3E8GA 1NBMG 2NNUA 3ZMSA 2AHYA 1R3LC 2ZXWC 2WLJA 2PI4A 2XAHA 4Q20A 3CD6V 1DF4A 3OFNG 1VQ9V 1S5HC 2R9IA 3K9AA 3CCSV 1F4MA 3CCMV 4QPKA 2IH3C 2X7RB 1MG1A 1R6NA 4GX0A 2ZQMA 1GMGA 1RPRA 1H8EG 2DYRB 3TETA 3E89A 2XASA 1JQ0A 5L3FA 5IYBO 1NR7A 4I5SA 1OCOB 4WCEV 2K1EA 2C2AA 1TUEB 3K08A 1AJQA 1OCRC 3JD1A 2IJIA 5DN6G 1M56C 2HJFC 4WFHA 1K4CC 3T1CA 1M57C 1V54C 1K97A 1QLEB 2HFEC 5B1NA 4XBFA 1VQPV 3VOUA 3STLC 3W7UA 3FYEB 1AR1B 4JYCA 2DYSB 4PA6A 4QIWF 3ZMUA 3I55V 3AG3B 3ZN0A 1K73W 1G8MA 3OMIB 1YITV 1KP3A 4N21A 3OR7C 1KECA 5LHHA 5KUKA 1K92A 3QO5A 4DXWA 4JYBA 5EBWC 1MABG 4UVCA 3ZCCA 3ASOC 3T2MA 3JD0A 3E2EA 5CMUA 3A0RA 4BIUA 4FJCC 2XAQA 3ZMVA 1XL6A 5E1AC 1P4RA 3B77A 4MTXA 1NVPD 5LHIA 5CN0A 2EILB 2W6JG 3W7WA 1W2BU 5IY5B 4R50A 5H9CA 5B1AB 2WLKA 3W7SA 5IYCO 2B1GA 2XAGA 1K8AW 2WLMA 1F23A 3FB5C 3QNEA 1YTFB 3GWOA 4GX1A 5CBFA 4WFGA 1AROP 3F5WC 1NJIW 1N8RW 4F4LA 3K0DA 1KD1W 1QR9A 5LBQA 1CP9A 3CCVV 1NKDA 1OCOC 3JD4A 1W0JG 4QE9A 3JD3A 3STZC 4Z1MG 1PNKA 4WFEA 4BIZA 4PA4A 4CZZA 2EBOA 4MTOA 2WLLB 4HZ3A 1K34A 3DGEA 1QLEC 1CEZA 2JJ2G 1H8HG 4MVSA 4MVMA 4LC1A 1ORQC 3OR6C 2A0LA 2DYSC 3K3WA 3OMAB 1Y4MA 3AG3C 1BHBA 5B3SC 3ABKB 1E1QG 1K33A 4PDRA 4UV8A 1VQOV 4UVBA 2XAFA 2B1IA 2MK3A 3CC2V 3ABMC 1W0KG 1VQKV 4GX2A 3BY6A 1B6QA 5L3GA 1YIJV 1THZA 4XDLA 4PA3A 2EIKB 1K7DA 1R3IC 3CCRV 4PDMA 2BOCC 1I5YA 2IJHA 3SJQC 1EFRG 4MW8A 4R7CA 5H6RA 3CXCU 2A79B 3CMEV 1LNQA 2FTKA 2WLHA 4X8AA 1PNLA 3CMAV 1JCHA 3E8HA 4X89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJF C;  4WFH A;  1K4C C;  1V55 C;  2EIL C;  3T1C A;  1M57 C;  5EBM C;  3SYC A;  1V54 C;  2JK5 C;  4EKW A;  4G28 B;  2P7T C;  2Y69 C;  5IY5 C;  1OCZ C;  2HFE C;  4I9W A;  3GB7 C;  2Q68 A;  3FB6 C;  3FB8 C;  3IFX A;  3RBZ A;  3STL C;  3VOU A;  2Q6A A;  3SYO A;  5EC2 C;  1P7B A;  3BEH A;  5KUM A;  4UUJ C;  2Q69 A;  3KG2 A;  4RUF A;  4G27 B;  5B1B C;  4JTC B;  4PA6 A;  3LDD A;  1K4D C;  4MVU A;  2WLL A;  3ASN C;  3R65 A;  2X6C A;  3HPL C;  3OR7 C;  4HYO A;  2IH1 C;  4MVO A;  4XDJ A;  2BOB C;  3E8F A;  3SPJ A;  2ITC C;  4DXW A;  5KUK A;  1R3K C;  4LP8 A;  3T4D A;  5EBW C;  3LDE A;  4P2Z A;  2KB1 A;  3ASO C;  3EFF K;  4MSW C;  4PDV A;  1JVM A;  2HVK C;  2QKS A;  3F7Y C;  4P30 A;  3T2M A;  4MW3 A;  3AG1 C;  2ZD9 A;  3RW0 A;  4PDL A;  3E8H A;  4MS2 A;  4QE7 A;  4MVQ A;  4XDK A;  2EIJ C;  4MVR A;  1XL6 A;  1BL8 A;  4MTG A;  5B1A C;  4WFF A;  4QNH B;  5E1A C;  3SPI A;  4J9Z B;  3SYA A;  3RVY A;  4JTD B;  2X6A A;  3UM7 A;  3LDC A;  2H8P C;  2HVJ C;  2A9H A;  4P9P A;  2Q67 A;  3LUT B;  3X2Q C;  4LCU C;  4P9O A;  3UKM A;  3SPH A;  3AG2 C;  1XL4 A;  4R50 A;  3T4Z A;  2WLK A;  4BW5 A;  2NLJ C;  3F7V C;  2WLM A;  3JYC A;  3FB5 C;  2HG5 C;  4GX5 A;  2WLI B;  2EIK C;  4GX1 A;  5CBF A;  4WFG A;  2W0F C;  3K03 A;  3F5W C;  4PA7 A;  4F4L A;  3K0D A;  2OCC C;  2DWD C;  3K04 A;  3AG4 C;  3K06 A;  3SPC A;  4CBC A;  5CBG A;  1OCO C;  2DWE C;  4R8C A;  4RO2 A;  5EC1 C;  4ZBM A;  4QE9 A;  3STZ C;  3OUS A;  3ABL C;  5BZB A;  4WFE A;  4H37 A;  4PA4 A;  3E86 A;  4MTO A;  5CBH A;  2WLL B;  3K0G A;  4HZ3 A;  3ABK C;  4R6Z A;  1R3J C;  3OUF A;  3TCU A;  3OGC C;  3WG7 C;  1QLE C;  4KFM A;  2EIM C;  4MVZ A;  4MVS A;  2ITD C;  4MVM A;  3ZJZ A;  3PJS K;  5J9P C;  1ORQ C;  2ATK C;  2A0L A;  2DYS C;  3OR6 C;  4TWK A;  5EK0 A;  3SYQ A;  3AG3 C;  1G4Y B;  3E8B A;  4H33 A;  3LNM B;  3E8G A;  4OXS A;  1OCC C;  2WLI A;  3FB7 C;  5B3S C;  4PDR A;  2AHY A;  1R3L C;  4RAI A;  4MTF A;  2DYR C;  2ZXW C;  2WLJ A;  3ABM C;  2WLN A;  3IGA C;  4GX2 A;  1S5H C;  2EIN C;  2YEV A;  3SYP A;  4XDL A;  4J9Y B;  3ZRS A;  4PA3 A;  1J95 A;  4RUE A;  1ZWI C;  2IH3 C;  1R3I C;  4PDM A;  4X88 A;  2BOC C;  2AHZ A;  2R9R B;  4GX0 A;  2X6B A;  3TET A;  3RVZ A;  3SJQ C;  3E89 A;  4MW8 A;  4R7C A;  4JTA B;  2A79 B;  3E83 A;  1LNQ A;  3SPG A;  4PA9 A;  2K1E A;  1KKD A;  4LBE C;  5EBL C;  2WLH A;  3K08 A;  4X8A A;  1OCR C;  4X89 A;  2QTO A;  1M56 C; 
#chains in the Genus database with same CATH topology
 2WA4 A;  5EBM C;  2P4K A;  1H2L A;  1OCZ C;  3CRA A;  3WG7 B;  3FB6 C;  2EIM B;  1HDJ A;  1AJN A;  3N27 A;  2R70 A;  4FFK A;  4Q6G A;  1K4D C;  3ZN1 A;  3OE7 G;  5CB4 B;  2F4V O;  4QJF B;  1GKF A;  2CK3 G;  1XMQ B;  3QO8 A;  4CH3 A;  4J42 A;  4QGP A;  4X64 O;  4MSW C;  2GBO A;  3F7Y C;  4F6E A;  2IJJ A;  2A7W A;  2YEV B;  5EIB C;  1YJ9 V;  5D5Q A;  1U97 A;  2XHB A;  2BTO A;  3SYA A;  3G80 A;  2DOS A;  3TXS A;  3LDC A;  2JEX A;  2IJK A;  2H8P C;  3NXS A;  5KMG A;  5L3C A;  4JAV A;  1XL4 A;  4BW5 A;  3F7V C;  3E35 A;  1PM9 A;  4IIJ B;  4I4T B;  4EB6 A;  2EJ7 A;  1BHA A;  2EIK C;  3JCZ A;  4PA7 A;  5IYD O;  3P30 A;  2ZT9 B;  4KHP O;  4JI3 B;  4DYL A;  4JI7 O;  4R6Z A;  1DK1 A;  2CUG A;  2KG7 B;  3OUF A;  1R73 A;  2JRI A;  1SQX H;  4MVZ A;  2ITD C;  4JF3 A;  2K9P A;  1XDC A;  1NVP B;  4KP4 A;  4DR3 O;  4OXS A;  5LA6 B;  2ETN A;  5H6Q A;  4DR2 B;  4DK0 A;  2DYR C;  1PP9 H;  1KB9 F;  5FLX N;  3R66 A;  2DN9 A;  5IJ9 A;  2EZP A;  3WFV A;  1Y66 A;  4GT1 A;  2L35 A;  1MSW D;  1COW G;  5HFL A;  4IL6 Z;  5D5P A;  1L0L H;  1NT2 B;  4LBE C;  1WPX A;  3QVN A;  3ZHT A;  4X66 O;  4IGG A;  4DW1 A;  2JK5 C;  1IBM O;  4JI8 O;  5KUM A;  1XEQ A;  2ARH A;  3W7X A;  3JAL A;  4B3T B;  1Y76 A;  2OT5 A;  3A0B Z;  2KQX A;  2QA4 V;  4ZOL B;  2F93 B;  4DO2 A;  2AW9 A;  2UXD B;  4ZI7 A;  2EIN B;  4DV5 B;  3BCC H;  2KB1 A;  2HVK C;  1S5J A;  3AEI A;  3CCU V;  1SC5 B;  4FMT A;  3VQX A;  4UB6 Z;  4DV4 B;  3UT5 B;  1VP7 A;  3WU2 Z;  3SGI A;  3SR2 C;  1SES A;  2E3C A;  2LGQ A;  4IT5 A;  3CE2 A;  4YIP A;  4DV6 B;  1V55 B;  1M4U A;  4C7U A;  2WWW A;  2FB5 A;  2ADP A;  1KU9 A;  3CRM A;  1GM9 A;  2P6J A;  2W0X A;  2W0F C;  3K03 A;  3RFR A;  1AR4 A;  2QM4 A;  1AVM A;  1PD3 A;  5CBG A;  4LFA B;  1ENV A;  3ML0 A;  1SZX A;  4O2A B;  5IE9 A;  3TCU A;  2UUB B;  3TK1 A;  2Q0O C;  5CB4 A;  4PEL A;  4JYA O;  1OCC C;  5KHK A;  1AR5 A;  4JGS A;  1GK9 A;  1JR9 A;  2JS3 A;  3IGA C;  1B04 A;  2YEV A;  5LXT A;  3RN4 A;  4UCU A;  4FM0 A;  2ZM6 O;  2X6B A;  3ABM B;  1NU1 H;  4PA9 A;  4J80 A;  1XNQ B;  5KAF Z;  3D36 A;  1GTO A;  4IIJ A;  4I4T A;  4B08 A;  2ZE7 A;  1S72 V;  2RCV A;  3FB8 C;  1LR1 A;  3FKS G;  3SYO A;  3BHP A;  4DR4 O;  4U7N A;  3KG2 A;  4RUF A;  4JTC B;  3BRC A;  1HNW O;  3JAM N;  5F2V O;  3OMN B;  1OCZ B;  3MD0 A;  2IH1 C;  2KG7 A;  1GM8 A;  1N32 B;  2ZIO A;  4O4J B;  3LSU A;  4JI2 O;  1RFY A;  1YZB A;  4JI1 B;  1FXK C;  4PDL A;  3GWK C;  2EIJ C;  1D2D A;  2XT9 A;  4WFF A;  4TQD A;  2GHY A;  1X4T A;  2PYJ A;  1VF5 B;  4P9P A;  2G38 A;  2JGD B;  2HHH O;  1NS1 A;  1R1B A;  4LH7 A;  4JI4 B;  1RM1 C;  2V1D A;  1XI1 A;  1I94 B;  1VQ4 V;  2OCC C;  4O4L B;  3K04 A;  4YJ3 B;  4CBC A;  3N2K B;  1G1X B;  4G2K A;  3ZX6 A;  5CBH A;  3MHH C;  1N33 O;  1R3J C;  1HR0 O;  5IYZ B;  1FS0 G;  1EBO A;  2QWN B;  2RDC A;  1N36 B;  4ZOL A;  3E8B A;  4FLY A;  4OGQ B;  1H2M A;  2PI4 A;  4Q20 A;  1DF4 A;  1YEW A;  4I9Q A;  5BR8 O;  4CC6 A;  1R6N A;  4GX0 A;  2ZQM A;  1RPR A;  2YXL A;  2DYR B;  1KKC A;  2XAS A;  4LF4 B;  5JJE B;  1OCO B;  2WA3 A;  2C2A A;  2Y0I A;  1AJQ A;  3JSN A;  1OCR C;  4CC5 A;  2IJI A;  2VQF B;  3CX5 F;  2LJ2 A;  2HFE C;  4H44 B;  1VQP V;  3VOU A;  1IX9 A;  1BZK A;  3W7U A;  4JYC A;  4OX9 B;  3I55 V;  2CGN A;  1K73 W;  4JV5 B;  1XBL A;  4N21 A;  4O2A A;  2CGO A;  2PUS A;  3J7A U;  4DXW A;  4JYB A;  1UFI A;  3U0Z A;  3K5N A;  3E2E A;  1H2S B;  4DV2 O;  4BIU A;  4FJC C;  2UXB B;  2XAQ A;  4LWS A;  5DEC A;  3T1Y B;  3B77 A;  3HKC B;  3DC5 A;  2EIL B;  3UO3 A;  2VRZ A;  1QNM A;  2WLM A;  1F23 A;  3FB5 C;  2FKX A;  2QWP B;  3QG5 A;  5FPR A;  3K0D A;  5LBQ A;  2YXH A;  4H13 B;  1CP9 A;  4PA4 A;  1I0H A;  4IYH A;  4HZ3 A;  4X1I B;  5IWA B;  1QLE C;  5LMN B;  2MW2 B;  4MVS A;  1OJH A;  4MVM A;  1FJG B;  3OR6 C;  1Q90 D;  1IVS A;  4O4J A;  4PDR A;  3IC9 A;  1VQK V;  1ZUQ A;  4TUY B;  3BY6 A;  5JJJ B;  1B6Q A;  4LF9 B;  1BGY H;  3RGB A;  3UQ8 A;  3ZHR A;  3SDL A;  4JI6 O;  2E5L O;  1JA8 A;  2BOC C;  1I5Y A;  3APO A;  4LFC B;  2IJH A;  1FPO A;  4LF7 B;  4CS2 A;  5GTH Z;  4DR6 O;  4B3M O;  5H6R A;  1X59 A;  1EN4 A;  2JGD A;  2WLH A;  4X8A A;  1PNL A;  3H1L H;  2ZIN A;  5LOV B;  2JDI G;  2OWO A;  1WB7 A;  1BT8 A;  5IY5 C;  1K3E A;  1YJN V;  2KKW A;  3CB2 A;  5K1P A;  4O4L A;  4YJ3 A;  3N2K A;  3AK3 A;  5B1B C;  1S77 D;  2N04 A;  4GKJ B;  4JI0 O;  4B7K A;  5IJ0 B;  1GN2 A;  3R65 A;  1GN3 A;  4IYI A;  2IU3 A;  1VF7 A;  2Y0P A;  3RYI B;  2QM8 A;  5IYZ A;  4KXR A;  2E74 B;  1DTO A;  4UB8 Z;  1VQ8 V;  2HEP A;  2UUA O;  4MS2 A;  1IBL O;  4UCO A;  2P4V A;  1JPX A;  1KP2 A;  4J41 A;  5KA5 A;  4PJ0 Z;  1GAX A;  4QNH B;  4J9Z B;  3AK1 A;  4E2L A;  1H2N A;  1SQQ H;  4DUY B;  2H94 A;  3I5D A;  4FPP A;  1FXK B;  2HP8 A;  4UFZ A;  5LMU B;  1U96 A;  2EIJ B;  3T4Z A;  4TT3 G;  2YIB D;  4I50 B;  3OT7 A;  1YVW A;  1NTM H;  2LFS A;  4BIO A;  2CAZ C;  3K06 A;  1Q6U A;  3BPZ A;  5IJ9 B;  5GW7 A;  3OEE G;  1SQF A;  3RWR D;  4H37 A;  2ZDI C;  4LF8 O;  1FYJ A;  5LGN A;  2A06 H;  3H1K H;  4NVP A;  4DR7 B;  3HKD A;  4DV3 O;  1QHT A;  4K8X A;  4RQE A;  1FXV A;  1EZJ A;  2ZE6 A;  5J9P C;  4JAU A;  1Q86 W;  3SYQ A;  5H2F Z;  4B3S O;  3QF7 A;  2BE3 A;  3LNM B;  3CHX A;  5KHG A;  4RAI A;  3WB0 A;  5CA1 B;  4HNA B;  2QTS A;  2AGA A;  1MMM A;  1ZAU A;  1J95 A;  5BMV A;  4I55 B;  3HKC A;  3LSQ A;  3THO A;  3E83 A;  2ADQ B;  5EBL C;  1TVK B;  3EXA A;  5L3E A;  4KHP B;  3ABL B;  3CYO A;  2Z0A A;  2Q73 A;  2L6L A;  1HNX O;  3FD9 A;  3L71 H;  4JI5 B;  2Y69 C;  3GB7 C;  1SER A;  2BTQ B;  2V7Q G;  1OCR B;  4DV7 B;  1AI4 A;  2LQT A;  4Z1V A;  5LYJ A;  1PPJ H;  1GM7 A;  1LUV A;  4GKK B;  3B2E E;  3RYF B;  3T4D A;  4MT8 A;  1IBK O;  1N4C A;  2IBZ H;  2P67 A;  2N74 A;  2FYU H;  2QKS A;  1PL0 A;  2RN9 A;  2A3Q A;  5B1A C;  4MTG A;  4O4H B;  1XRE A;  1H2G A;  4NXN O;  1Z5W A;  1XMO O;  4TUY A;  3OW2 U;  3UM7 A;  2OIE A;  3ZBH A;  4X66 B;  3ZED A;  4P9O A;  1AI6 A;  3S3X A;  4W4L A;  5JJN B;  3CCE V;  4FLT A;  4NTX A;  4OPA A;  2HLD G;  3ABT A;  3HKB B;  3TXQ A;  1L1F A;  4AQY B;  5LOV A;  3AG4 C;  1Q3E A;  4D7T A;  4R8C A;  3OUS A;  5LXT B;  3FFQ A;  1VEW A;  5KLV H;  2QGN A;  2YSU B;  5KHI A;  4CH6 A;  5IJ0 A;  4TOI A;  3BFR A;  4UXN A;  1L8D A;  1VQM V;  4PI0 A;  1NR1 A;  2RMK B;  2WLI A;  1QBZ A;  3RYI A;  3ZIA G;  4MTF A;  1Y74 B;  1SQV H;  4J7J A;  1F4N A;  3VQY A;  3IJ4 A;  2X0L A;  4ASU G;  4RQF A;  3ETE A;  1TAE A;  1MSD A;  1QCE A;  4FVM A;  1FXK A;  4FLZ A;  2QE7 G;  1VF6 A;  1JJO A;  2EX3 A;  1M93 A;  3CSX A;  4WFA V;  4I50 A;  3B4S A;  3OM3 B;  4KUM A;  2XAJ A;  5KAI Z;  1GN6 A;  4UUJ C;  2Q69 A;  2YIB A;  4JYA B;  2WPD G;  1AJP A;  3EHB B;  4ZIB A;  2ZXW B;  5L3D A;  1XNR O;  4MVO A;  4XDJ A;  4LF6 O;  3E22 B;  4X62 B;  3LDE A;  4DV0 O;  5B1B B;  2GUZ B;  2Q7E A;  4TV8 B;  3AG1 C;  2Q0A A;  1KC8 W;  1NTZ H;  4YHH O;  2DMX A;  1FFT B;  5C93 A;  2X6A A;  5CA1 A;  4HNA A;  1M56 B;  2Q67 A;  5LP6 C;  3SPH A;  1E79 G;  4I55 A;  3OAA G;  1FXH A;  4DR4 B;  2QR4 A;  3JSL A;  1TVK A;  1XIL A;  2WSS G;  1YDX A;  1XMQ O;  4JI2 B;  3E86 A;  1WPB A;  2ZNI A;  4X9Q A;  2BTQ A;  4NXM B;  3OGC C;  2O57 A;  4U3J B;  1I5X A;  3HB3 B;  2F66 C;  3K5L A;  3D3I A;  1CXZ B;  3RYF A;  1RSO B;  2M6Y A;  3B09 A;  4PV1 B;  2QSA A;  3OFN G;  1S5H C;  2UUC B;  1EM1 A;  3H9V A;  4O4H A;  2X7R B;  1MG1 A;  1H8E G;  2CTR A;  1JQ0 A;  2CTP A;  4JI3 O;  4WCE V;  1TUE B;  5JCO A;  2V4D A;  5DN6 G;  2HJF C;  2P22 C;  5K1X A;  1M57 C;  2ODM A;  4FLU A;  1K97 A;  4LWS B;  3HKB A;  4DR5 B;  4QIW F;  4DR2 O;  1AP6 A;  1G8M A;  3OMI B;  3NR7 A;  3QO5 A;  3M8A A;  4UVC A;  3ZCC A;  4DRX B;  2UU9 O;  4FZ1 A;  3T2M A;  1IDS A;  5CMU A;  3JAK B;  4ICG A;  4GUN A;  5TIS Z;  1XL6 A;  5E1A C;  1Y74 A;  1IXB A;  2JGU A;  5LHI A;  5CN0 A;  3CEI A;  1A32 A;  3OTO O;  3CS5 A;  1SQB H;  3W7W A;  4R50 A;  5H5N A;  5B1A B;  2WLK A;  3F5T A;  5IYC O;  2B1G A;  5J2U A;  1V9P A;  3QNE A;  4B3T O;  2OYQ A;  4L8J A;  3L75 H;  5KHH A;  1PL4 A;  2YID A;  3CCV V;  2CH7 B;  3JD4 A;  4QE9 A;  3JD3 A;  4DV5 O;  1PNK A;  2ZKO A;  4WFE A;  1J5E O;  2RNB A;  2EBO A;  4O2B B;  2WLL B;  2LW7 A;  3MAQ A;  4FLW A;  2JJ2 G;  4LC1 A;  2DYS C;  4DV6 O;  3K3W A;  3OMA B;  3AG3 C;  3E22 A;  4ZHQ B;  5B3S C;  1K33 A;  2Q4P A;  3BAA A;  2JVD A;  2B1I A;  2GUZ A;  2XAF A;  3CC2 V;  4K0K O;  2JS5 A;  4TV8 A;  1W0K G;  1B06 A;  1T5E A;  1ZLZ A;  5C8Y B;  2ZCE A;  1THZ A;  2VWK A;  4DV1 B;  2PF4 E;  4PA3 A;  2EIK B;  1K7D A;  3JCU Z;  1YF2 A;  4PDM A;  3SJQ C;  1EFR G;  4MW8 A;  1AIL A;  5LL6 Y;  3CXC U;  1MA1 A;  1SA0 B;  1MNG A;  2FTK A;  5FNV B;  1EN6 A;  3CMA V;  1WAZ A;  1IUR A;  4X89 A;  3Q4H B;  1ZX3 A;  3CJH B;  2UXC O;  2UUB O;  1Q5O A;  4LH6 A;  2Q8V A;  2P7T C;  2JEU A;  1URF A;  3H01 A;  3RBZ A;  2QM7 A;  4CS3 A;  1YCI A;  1P7B A;  1SQG A;  4DUZ B;  1AB3 A;  3K57 A;  3ASN C;  1K5Q A;  4K8Z A;  3E8F A;  1O9G A;  3CRQ A;  4GYC B;  4U3J A;  4P2Z A;  3ABU A;  3EFF K;  1JFF B;  2QWO B;  2ZDI A;  3L9D A;  4MW3 A;  1DGS A;  1SZT A;  1Y6X A;  4B3M B;  4B7E A;  1R6T A;  1ZSP A;  1NTK H;  1RSO A;  4WF9 V;  1XNQ O;  1OHH G;  3P3N A;  4UCS A;  3ETG A;  2KSD A;  3HKD B;  3LUT B;  4X20 B;  3AG1 B;  1US6 A;  3G6E V;  2ZR3 A;  4WBN B;  1DLB A;  4X1Y B;  3GVM A;  3L74 H;  2P5O A;  3MHS C;  4JI0 B;  2YC0 A;  5LP6 B;  5J2T B;  3SPC A;  3HKE B;  2DWE C;  5EC1 C;  1N32 O;  1QVF U;  3CC7 V;  2CTW A;  5BMV B;  5DED A;  3MDS A;  4JI1 O;  1QR8 A;  1Q82 W;  3WG7 C;  4I0X B;  2EIM C;  4D6T H;  4TSF G;  3ZRX A;  2Q5Z A;  3ZHV A;  4E4E A;  4DRX A;  2XOK G;  4NYK A;  5JVD B;  3SYP A;  3JAK A;  4BR6 A;  3ZRS A;  5LYJ B;  1PNM A;  2F43 G;  1I94 O;  1VQ6 V;  4X88 A;  2AHZ A;  3FYI B;  4O4I B;  3C90 A;  3ETD A;  1KKD A;  2DW4 A;  4LF5 B;  3CC4 V;  4LF8 B;  3H1H H;  1Q6H A;  1D5A A;  4CH4 A;  4G28 B;  3S3W A;  3UO2 A;  1I7F A;  3IFX A;  2ZNJ A;  2JJ1 G;  1N36 O;  1KQS U;  2WAM A;  3TGU H;  2CH7 A;  4B3R O;  2F95 B;  3DSQ A;  1HNZ B;  2VS0 A;  3LDD A;  4X65 O;  1VQ5 V;  1S3J A;  1M57 B;  4F6R B;  2VQE B;  4DR1 B;  5GTI Z;  1OCC B;  2LO1 A;  4O2B A;  1WNS A;  2WLL A;  3M7M X;  4YY3 B;  2X6C A;  3JAT B;  1SET A;  2F1M A;  2BOB C;  1H38 A;  1MOF A;  3JAW A;  3RYH B;  2VWJ A;  3CCQ V;  1N34 B;  3LSS A;  3CRR A;  3K9S A;  3FAV B;  2ZD9 A;  3A0H Z;  4LF4 O;  4ZHQ A;  3AK2 A;  4QE7 A;  4MVQ A;  5LGU A;  2ZE5 A;  3K5O A;  1FKA O;  1R6K A;  1BQZ A;  2AZ0 A;  2YS8 A;  2Y48 A;  3RVY A;  5C8Y A;  1M1K W;  2VQF O;  1F51 A;  4YXW G;  5EZY B;  2BSK B;  2PI5 A;  4OX9 O;  2HG5 C;  2H3O A;  2WLI B;  1OV9 A;  1SA0 A;  3BA8 A;  5FNV A;  4JV5 O;  1K9M W;  3CP1 A;  3T1H B;  1WA8 B;  1Y67 A;  4UV9 A;  4JYY A;  3Q4H A;  3CJH A;  1AP5 A;  1KBH A;  3ZHS A;  3CRC A;  4PHZ A;  3ZMT A;  3ABK C;  2UXB O;  2FML A;  4KL1 A;  2EZO A;  5JH7 A;  3T1Y O;  1QQC A;  3OEH G;  1KYO F;  1G4Y B;  1EN5 A;  4H33 A;  1TGO A;  3FB7 C;  1XOU A;  4PI2 A;  4WFB V;  1VQN V;  3WB2 A;  2WLN A;  1JFF A;  2F4V B;  2EIN C;  3U10 A;  1H2K A;  1XQ8 A;  3ICX A;  5BXZ A;  4AIL C;  1RM1 B;  4RUE A;  5B3S B;  4ZKI A;  4X64 B;  2QWR B;  4LNU B;  4EFE A;  2OCC B;  3RVZ A;  4JTA B;  4X20 A;  1BCC H;  4FM2 A;  1G6U A;  1HWY A;  2LP7 A;  4WBN A;  5IWA O;  2GTA A;  1V55 C;  4X1Y A;  1SKV A;  2R9A A;  5LHG A;  4YJ2 B;  5LP6 A;  5J2T A;  1FJG O;  3KZI Z;  3HKE A;  4G27 B;  2GDS A;  1YJW V;  2NR5 A;  1YTF D;  5B5E Z;  1YSC A;  1EZV H;  1NQT A;  4HYO A;  2YUA A;  3KCY A;  3SJC C;  4BW9 A;  2GSM B;  4LF9 O;  1R3K C;  2Y4U A;  3K59 A;  1S0V A;  4I0X A;  1RPO A;  5KX5 B;  2XND G;  1JVM A;  2BCC H;  4LFC O;  4LF7 O;  4X1K A;  4JI7 B;  3ASN B;  2QDO A;  4XDK A;  2M7W A;  4MVR A;  4JAS A;  4ABM A;  5HFM A;  1M90 W;  5JVD A;  1L0N H;  2HR3 A;  1YXB A;  4DR3 B;  4L87 A;  3AG2 C;  1GN4 A;  2NLJ C;  4O4I A;  4HBN A;  4GX5 A;  2B9Z A;  4GKJ O;  4K35 A;  1I08 A;  5A9G A;  1AI7 A;  5A2Q N;  4RO2 A;  1XNR B;  4ZBM A;  1S5L Z;  2Z5U A;  2PZS A;  4DW0 A;  3VBB A;  1S76 D;  1IBM B;  3OGI B;  4F6R A;  3KCX A;  4JI8 B;  3JAT A;  2ATK C;  5EK0 A;  3E8G A;  1NBM G;  2HJD A;  3RYH A;  2AHY A;  5LMU O;  2CDY A;  2WLJ A;  2XAH A;  3FAV A;  1VQ9 V;  2R9I A;  3CCS V;  3CCM V;  4QPK A;  5IT9 N;  4LFB O;  3J80 N;  3TET A;  2OIG A;  4YIO A;  3E89 A;  1FD9 A;  5L3F A;  4UCV A;  3K08 A;  3K58 A;  5EZY A;  1TA8 A;  2BSK A;  4DR7 O;  1V54 C;  3JAR B;  1QLE B;  1Z2G A;  5B1N A;  4D7S A;  1WA8 A;  1AR1 B;  3J81 N;  2RJZ A;  3ZN0 A;  1Q43 A;  1B3Q A;  2D2C B;  3K5M A;  4FLX A;  1LUW A;  5J2U B;  5KUK A;  1K92 A;  1WP7 A;  2PY5 A;  5EBW C;  1MAB G;  1GH6 A;  3ASO C;  3JD0 A;  1UPG A;  3A0R A;  4MTX A;  2YXY A;  1NVP D;  4JI5 O;  2P06 A;  5E79 Z;  5IY5 B;  4JZ2 A;  4LNU A;  4FZ0 A;  4DV7 O;  5CBF A;  1ARO P;  3F5W C;  1N8R W;  3ZHQ A;  2ZM6 B;  5JWP A;  4GKK O;  1NKD A;  1OCO C;  1W0J G;  3STZ C;  4Z1M G;  4YJ2 A;  4TV9 B;  4MTO A;  3H1J H;  2UU9 B;  2LW1 A;  1NZ6 A;  3C3S A;  3A2F A;  3WB1 A;  1ORQ C;  3L72 H;  1BHB A;  3ABK B;  3OTO B;  4UV8 A;  1VQO V;  1HNW B;  4UVB A;  5KX5 A;  2MK3 A;  4GX2 A;  1M5I A;  5L3G A;  1YIJ V;  4XDL A;  2N05 A;  1HP8 A;  4AQY O;  3QTC A;  2QWQ B;  2PYL A;  3SJB C;  4R7C A;  2A79 B;  4H0L B;  3CME V;  1LNQ A;  3FX7 A;  1N0N A;  3G67 A;  4UCR A;  3VQV A;  5JQG A;  1JCH A;  1J5E B;  3E8H A;  1TUB B;  2QJ1 A;  2EIL C;  3SYC A;  5AG2 A;  2HHH B;  3BAB A;  3M99 B;  3BEH A;  2LFR A;  3DC6 A;  1KUQ A;  5EYP A;  2XTA A;  4MVU A;  4K0K B;  4NB5 A;  3SPJ A;  3DXR A;  3ZRW B;  4LP8 A;  1JOY A;  3JAS B;  4I7Z B;  4HAM A;  2UXX A;  1IXM A;  3CXH F;  4PDV A;  1XHX A;  4RWU A;  3W7T A;  1N33 B;  3RW0 A;  3CWB H;  4FFB B;  1HR0 B;  4PD4 F;  3P32 A;  1Q7Y W;  1RP3 B;  1VMG A;  4LR3 A;  2D3O W;  2A9H A;  2UXC B;  4J10 A;  3QO7 A;  3X2Q C;  3B8M A;  2Y69 B;  3I56 V;  3PN1 A;  1D5N A;  4EEQ A;  4CH5 A;  1YI2 V;  5BR8 B;  3UCS C;  1BS3 A;  1Q81 W;  2YIC A;  3AG2 B;  4X62 O;  1FFX B;  3CCJ V;  1XUQ A;  3JAR A;  5BZB A;  1SQP H;  3K0G A;  3VQW A;  2UXN A;  1P84 F;  2E75 B;  2AZ2 A;  4FK5 C;  3A8T A;  4J11 A;  2ILM A;  2UXD O;  2B5U A;  4DV4 O;  1ZL8 B;  3AG4 B;  3JAW B;  4DV2 B;  3SPG A;  1MZE A;  2YI9 A;  1OZ0 A;  5GON B;  2OTL V;  2F23 A;  4A5U B;  4NXM O;  1JMK C;  4EKW A;  1VF6 C;  5LA6 A;  5EIB D;  4I9W A;  4EFB A;  1IZ3 A;  5LGT A;  3CPW U;  1SS3 A;  4IHJ B;  1N0J A;  3U11 A;  4TV9 A;  1V54 B;  4AHC A;  4FLV A;  3HPL C;  4LFA O;  1PV0 A;  2ITC C;  2UUC O;  5DM6 V;  4NKG B;  1GO3 F;  3D3Q A;  3DTU B;  1O9H A;  4GCZ A;  1NI8 A;  1YHQ V;  2OTJ V;  1W59 A;  2P90 A;  2Z3Y A;  1PKX A;  3O9O A;  5CA0 B;  2Q7H A;  2DJV A;  4FIP C;  3B8N A;  1XHZ A;  1E1R G;  5IDJ A;  3ASO B;  2HVJ C;  2W6I G;  4LCU C;  4AI8 A;  3UKM A;  5JH7 B;  3JYC A;  4DR5 O;  4B3R B;  2IU0 A;  4X65 B;  4JI6 B;  2E5L B;  1TUB A;  1JX9 A;  3ZS8 C;  3L70 H;  1P49 A;  4JPR A;  4DR6 B;  3ABL C;  5B1O A;  3UT5 A;  3IC7 A;  1K5S A;  2YIA A;  4BAY A;  2DQ3 A;  3C3T A;  4KFM A;  2LGW A;  1WLE A;  5CA3 A;  2QEX V;  4U7O A;  4UVA A;  3ZJZ A;  3PJS K;  2QKA A;  5ITZ B;  3ZRW A;  1AI5 A;  4TQF A;  3JAS A;  3G6B A;  2R72 A;  1VIB A;  1WP8 A;  2CE4 A;  3LNN A;  4FFB A;  3EVK A;  4J9Y B;  1ZWI C;  1DF5 A;  3RT3 C;  2JIZ G;  3KKY A;  2R9R B;  2Y4T A;  4QPJ A;  5KA6 A;  2UUA B;  1IBL B;  4J7Z A;  1ROP A;  2FL4 A;  2QTO A;  4X1K B;  2RQ6 A;  1VQL V;  5JCO C;  1QLN A;  2CTQ A;  1QU7 A;  3G4S V;  2Q68 A;  4FM1 A;  2Q6A A;  2XUM A;  4N23 A;  5EC2 C;  4JI4 O;  3P3P A;  1FFX A;  1WN7 A;  2GV9 A;  5FL7 G;  5L3B A;  1WJZ A;  2IW5 A;  2QKC A;  1JJ2 U;  3N2G B;  4DV1 O;  1M9N A;  2EUL A;  2PTM A;  4BWA A;  4P30 A;  4DV3 B;  5BY1 A;  3APQ A;  1BL8 A;  3D36 C;  3SPI A;  2HKO A;  1VQ7 V;  3RYC B;  4JTD B;  4NR1 A;  2EJR A;  4B3S B;  1GRJ A;  2YI8 A;  1SF9 A;  2GTS A;  1CPY A;  3ZRV A;  1ZTE A;  3ETQ A;  2DQ0 A;  4DUZ O;  1ZL8 A;  1NH2 D;  2ZR2 A;  1UJW B;  3H1I H;  3G71 V;  5GON A;  3JD2 A;  3X2Q B;  3CCL V;  2DWD C;  5B66 Z;  1QVG U;  1BMF G;  1NH2 B;  3ZMZ A;  4DK1 A;  4GLX A;  3B40 A;  1SRY A;  3L73 H;  4NTW A;  2OCH A;  1BQ0 A;  1MZF A;  1HNX B;  2IM9 A;  4IHJ A;  3K79 A;  4TWK A;  2NNU A;  3ZMS A;  1R3L C;  2ZXW C;  3IAY A;  3BVO A;  3CD6 V;  5KMG B;  3K9A A;  1F4M A;  4OPH A;  1IBK B;  2PGG A;  5CA0 A;  2IH3 C;  3D8C A;  1Z5V A;  1GMG A;  5KHJ A;  1WB8 A;  4EB6 B;  5IYB O;  1NR7 A;  4I5S A;  2K1E A;  1P7G A;  3JD1 A;  4NXN B;  1XMO B;  1M56 C;  4WFH A;  1K4C C;  1F7Y A;  3T1C A;  2Q7G A;  4JAA A;  4XBF A;  3STL C;  2ZIM A;  1BE3 H;  3FYE B;  2DYS B;  4PA6 A;  3ZMU A;  3AG3 B;  4JZG A;  1KMI Z;  1YIT V;  1KP3 A;  3OR7 C;  1KEC A;  5LHH A;  2NN4 A;  2YDE A;  1VAR A;  4LFB B;  2AXT Z;  5FPO A;  5ITZ A;  5LMN O;  3ZMV A;  4LF5 O;  1P4R A;  4U3F H;  4CS4 A;  4NTY A;  3HR0 A;  2W6J G;  1W2B U;  3AG7 A;  5H9C A;  1K8A W;  3W7S A;  2XAG A;  1HNZ O;  3O65 A;  1YTF B;  3GWO A;  3OTF A;  4GX1 A;  2DE0 X;  4WFG A;  2VQE O;  4DR1 O;  1NJI W;  1BSM A;  4F4L A;  1KD1 W;  1QR9 A;  4YY3 O;  3SJA C;  4J7K A;  4UCT A;  4GZR B;  3JAL B;  1N34 O;  1Y76 B;  4BIZ A;  4CZZ A;  4K3A A;  1K34 A;  3DGE A;  2ZE8 A;  1CEZ A;  4ZI7 B;  4Z2W A;  5JQG B;  1H8H G;  1Q8I A;  2A0L A;  1Y4M A;  3N2G A;  4W4K A;  1HW7 A;  1E1Q G;  3BA9 A;  3ZHU A;  3ABM C;  3TJT A;  3OD4 A;  4LF6 B;  5EYP B;  4DV0 B;  3T1H O;  1R3I C;  2Q9L A;  3CCR V;  2E76 B;  3RYC A;  4X1I A;  3DXR B;  1FAF A;  4YHH B;  1Q6I A;  4DUY O; 
#chains in the Genus database with same CATH homology
 2EIL C;  5EBM C;  3SYC A;  2JDI G;  2P7T C;  5IY5 C;  1YJN V;  1K3E A;  1OCZ C;  2JEU A;  3WG7 B;  3H01 A;  3FB6 C;  3RBZ A;  2QM7 A;  2EIM B;  3M99 B;  1P7B A;  3BEH A;  2LFR A;  1AJN A;  5B1B C;  1S77 D;  1K4D C;  4MVU A;  3ZN1 A;  3OE7 G;  3ASN C;  3R65 A;  1K5Q A;  3E8F A;  2IU3 A;  3SPJ A;  4QJF B;  1GKF A;  3ZRW B;  4LP8 A;  1JOY A;  4P2Z A;  2CK3 G;  2QM8 A;  2UXX A;  3QO8 A;  4HAM A;  3ABU A;  1IXM A;  3EFF K;  4MSW C;  4PDV A;  3F7Y C;  1DTO A;  2ZDI A;  3W7T A;  4MW3 A;  2IJJ A;  1VQ8 V;  2YEV B;  1SZT A;  3RW0 A;  4MS2 A;  1YJ9 V;  1JPX A;  1KP2 A;  5KA5 A;  3P32 A;  4WF9 V;  1Q7Y W;  4QNH B;  4J9Z B;  3SYA A;  1OHH G;  4E2L A;  2D3O W;  3LDC A;  2JEX A;  2IJK A;  2H8P C;  2H94 A;  3ETG A;  3NXS A;  2A9H A;  4FPP A;  1FXK B;  5L3C A;  3LUT B;  4JAV A;  3QO7 A;  3X2Q C;  3AG1 B;  3B8M A;  3G6E V;  2ZR3 A;  2Y69 B;  1XL4 A;  2EIJ B;  3I56 V;  3T4Z A;  4BW5 A;  1DLB A;  3F7V C;  3E35 A;  4TT3 G;  1BHA A;  2EIK C;  3JCZ A;  3MHS C;  2LFS A;  1YI2 V;  4PA7 A;  5IYD O;  3P30 A;  3K06 A;  3SPC A;  1Q81 W;  3AG2 B;  2DWE C;  3OEE G;  5EC1 C;  5GW7 A;  3CCJ V;  1QVF U;  3CC7 V;  5BZB A;  4H37 A;  2ZDI C;  5LGN A;  1QR8 A;  3K0G A;  4R6Z A;  1Q82 W;  3OUF A;  3WG7 C;  1R73 A;  2EIM C;  4MVZ A;  2ITD C;  4RQE A;  1FXV A;  1EZJ A;  4JF3 A;  4TSF G;  2UXN A;  5J9P C;  4JAU A;  1Q86 W;  3SYQ A;  3ZRX A;  1NVP B;  4KP4 A;  3LNM B;  4OXS A;  4FK5 C;  5H6Q A;  4RAI A;  2DYR C;  2XOK G;  3SYP A;  3ZRS A;  1PNM A;  2EZP A;  1J95 A;  2B5U A;  2F43 G;  3WFV A;  1VQ6 V;  1Y66 A;  4X88 A;  2AHZ A;  4GT1 A;  1MSW D;  3LSQ A;  1COW G;  3FYI B;  5HFL A;  3ETD A;  3E83 A;  3AG4 B;  3SPG A;  1KKD A;  4LBE C;  2DW4 A;  5EBL C;  1WPX A;  5L3E A;  3ABL B;  3CYO A;  1OZ0 A;  2OTL V;  3CC4 V;  4EKW A;  2JK5 C;  4G28 B;  2Y69 C;  4I9W A;  3GB7 C;  1SER A;  3IFX A;  2JJ1 G;  2V7Q G;  5KUM A;  2WAM A;  5LGT A;  1KQS U;  3CPW U;  1OCR B;  1AI4 A;  3W7X A;  3LDD A;  1VQ5 V;  1S3J A;  1M57 B;  2OT5 A;  1V54 B;  1OCC B;  1GM7 A;  2WLL A;  2X6C A;  3HPL C;  1SET A;  2QA4 V;  2BOB C;  2ITC C;  4DO2 A;  1H38 A;  5DM6 V;  1MOF A;  2EIN B;  1GO3 F;  4MT8 A;  3T4D A;  3CCQ V;  3LSS A;  2P67 A;  3DTU B;  2KB1 A;  2HVK C;  2QKS A;  3AEI A;  3CCU V;  1PL0 A;  4GCZ A;  1YHQ V;  4FMT A;  2ZD9 A;  2OTJ V;  2P90 A;  4QE7 A;  2Z3Y A;  4MVQ A;  5LGU A;  1PKX A;  5B1A C;  4MTG A;  1R6K A;  1H2G A;  4FIP C;  1SES A;  3B8N A;  2Y48 A;  1E1R G;  3RVY A;  5IDJ A;  3UM7 A;  3OW2 U;  3ASO B;  1M1K W;  2HVJ C;  1V55 B;  1F51 A;  4YXW G;  2W6I G;  4LCU C;  4P9O A;  1AI6 A;  3UKM A;  2WWW A;  3CCE V;  2PI5 A;  3JYC A;  2HG5 C;  1GM9 A;  2WLI B;  2P6J A;  2HLD G;  3ABT A;  2W0F C;  3K03 A;  1K9M W;  2IU0 A;  3CP1 A;  1L1F A;  4UV9 A;  1JX9 A;  3AG4 C;  1PD3 A;  5CBG A;  4R8C A;  4JPR A;  1ENV A;  3OUS A;  3ABL C;  5B1O A;  3IC7 A;  1K5S A;  3ML0 A;  3ZMT A;  3ABK C;  2YSU B;  4BAY A;  2DQ3 A;  3TCU A;  4KFM A;  1WLE A;  5CA3 A;  2QEX V;  2EZO A;  3TK1 A;  4U7O A;  4UVA A;  3ZJZ A;  3PJS K;  4UXN A;  3OEH G;  4PEL A;  1G4Y B;  3ZRW A;  4H33 A;  1VQM V;  1NR1 A;  1OCC C;  2WLI A;  1AI5 A;  1QBZ A;  3FB7 C;  3ZIA G;  4WFB V;  4MTF A;  1VQN V;  4JGS A;  2WLN A;  1GK9 A;  3IGA C;  2EIN C;  2YEV A;  1F4N A;  4J9Y B;  1RM1 B;  4RUE A;  1ZWI C;  1DF5 A;  5B3S B;  2JIZ G;  2X0L A;  4ASU G;  4ZKI A;  4RQF A;  2R9R B;  3ETE A;  2X6B A;  4QPJ A;  2OCC B;  1QCE A;  3ABM B;  3RVZ A;  5KA6 A;  4JTA B;  1FXK A;  4PA9 A;  1ROP A;  1HWY A;  2LP7 A;  2QE7 G;  3D36 A;  2QTO A;  1GTO A;  1V55 C;  4WFA V;  1VQL V;  1S72 V;  5LHG A;  1QLN A;  3G4S V;  2Q68 A;  3FB8 C;  3OM3 B;  4KUM A;  2XAJ A;  2Q6A A;  3FKS G;  3SYO A;  4N23 A;  5EC2 C;  4UUJ C;  2Q69 A;  3KG2 A;  4RUF A;  4G27 B;  4U7N A;  4JTC B;  1YJW V;  1YTF D;  2WPD G;  1AJP A;  5FL7 G;  1YSC A;  3OMN B;  5L3B A;  1NQT A;  3EHB B;  2IW5 A;  1OCZ B;  4HYO A;  2ZXW B;  3MD0 A;  5L3D A;  2IH1 C;  4MVO A;  4XDJ A;  2GSM B;  1GM8 A;  1JJ2 U;  1R3K C;  1M9N A;  1S0V A;  3LDE A;  5B1B B;  1RPO A;  2XND G;  1JVM A;  4P30 A;  1FXK C;  3AG1 C;  1KC8 W;  3ASN B;  4PDL A;  4XDK A;  2M7W A;  2EIJ C;  4MVR A;  1BL8 A;  4WFF A;  4JAS A;  2GHY A;  3SPI A;  1FFT B;  2HKO A;  5C93 A;  1VQ7 V;  5HFM A;  1M90 W;  4JTD B;  2X6A A;  2HR3 A;  2EJR A;  1M56 B;  4P9P A;  2Q67 A;  1CPY A;  4L87 A;  3SPH A;  1E79 G;  3AG2 C;  3ZRV A;  2NLJ C;  2DQ0 A;  3OAA G;  1FXH A;  4GX5 A;  1RM1 C;  1NH2 D;  2ZR2 A;  2V1D A;  1UJW B;  3G71 V;  3X2Q B;  3JD2 A;  3CCL V;  1AI7 A;  2DWD C;  2OCC C;  1VQ4 V;  3K04 A;  4CBC A;  2WSS G;  4RO2 A;  4ZBM A;  1QVG U;  2Z5U A;  1BMF G;  1NH2 B;  4G2K A;  3ZMZ A;  3E86 A;  5CBH A;  3MHH C;  1SRY A;  3VBB A;  1R3J C;  1S76 D;  3OGC C;  1I5X A;  1FS0 G;  1EBO A;  3HB3 B;  3K79 A;  2ATK C;  4TWK A;  5EK0 A;  3D3I A;  3E8B A;  3E8G A;  1NBM G;  2NNU A;  3ZMS A;  2AHY A;  1R3L C;  2ZXW C;  2WLJ A;  2PI4 A;  2XAH A;  4Q20 A;  3CD6 V;  1DF4 A;  3OFN G;  1VQ9 V;  1S5H C;  2R9I A;  3K9A A;  3CCS V;  1F4M A;  3CCM V;  4QPK A;  2IH3 C;  2X7R B;  1MG1 A;  1R6N A;  4GX0 A;  2ZQM A;  1GMG A;  1RPR A;  1H8E G;  2DYR B;  3TET A;  3E89 A;  2XAS A;  1JQ0 A;  5L3F A;  5IYB O;  1NR7 A;  4I5S A;  1OCO B;  4WCE V;  2K1E A;  2C2A A;  1TUE B;  3K08 A;  1AJQ A;  1OCR C;  3JD1 A;  2IJI A;  5DN6 G;  1M56 C;  2HJF C;  4WFH A;  1K4C C;  3T1C A;  1M57 C;  1V54 C;  1K97 A;  1QLE B;  2HFE C;  5B1N A;  4XBF A;  1VQP V;  3VOU A;  3STL C;  3W7U A;  3FYE B;  1AR1 B;  4JYC A;  2DYS B;  4PA6 A;  4QIW F;  3ZMU A;  3I55 V;  3AG3 B;  3ZN0 A;  1K73 W;  1G8M A;  3OMI B;  1YIT V;  1KP3 A;  4N21 A;  3OR7 C;  1KEC A;  5LHH A;  5KUK A;  1K92 A;  3QO5 A;  4DXW A;  4JYB A;  5EBW C;  1MAB G;  4UVC A;  3ZCC A;  3ASO C;  3T2M A;  3JD0 A;  3E2E A;  5CMU A;  3A0R A;  4BIU A;  4FJC C;  2XAQ A;  3ZMV A;  1XL6 A;  5E1A C;  1P4R A;  3B77 A;  4MTX A;  1NVP D;  5LHI A;  5CN0 A;  2EIL B;  2W6J G;  3W7W A;  1W2B U;  5IY5 B;  4R50 A;  5H9C A;  5B1A B;  2WLK A;  3W7S A;  5IYC O;  2B1G A;  2XAG A;  1K8A W;  2WLM A;  1F23 A;  3FB5 C;  3QNE A;  1YTF B;  3GWO A;  4GX1 A;  5CBF A;  4WFG A;  1ARO P;  3F5W C;  1NJI W;  1N8R W;  4F4L A;  3K0D A;  1KD1 W;  1QR9 A;  5LBQ A;  1CP9 A;  3CCV V;  1NKD A;  1OCO C;  3JD4 A;  1W0J G;  4QE9 A;  3JD3 A;  3STZ C;  4Z1M G;  1PNK A;  4WFE A;  4BIZ A;  4PA4 A;  4CZZ A;  2EBO A;  4MTO A;  2WLL B;  4HZ3 A;  1K34 A;  3DGE A;  1QLE C;  1CEZ A;  2JJ2 G;  1H8H G;  4MVS A;  4MVM A;  4LC1 A;  1ORQ C;  3OR6 C;  2A0L A;  2DYS C;  3K3W A;  3OMA B;  1Y4M A;  3AG3 C;  1BHB A;  5B3S C;  3ABK B;  1E1Q G;  1K33 A;  4PDR A;  4UV8 A;  1VQO V;  4UVB A;  2XAF A;  2B1I A;  2MK3 A;  3CC2 V;  3ABM C;  1W0K G;  1VQK V;  4GX2 A;  3BY6 A;  1B6Q A;  5L3G A;  1YIJ V;  1THZ A;  4XDL A;  4PA3 A;  2EIK B;  1K7D A;  1R3I C;  3CCR V;  4PDM A;  2BOC C;  1I5Y A;  2IJH A;  3SJQ C;  1EFR G;  4MW8 A;  4R7C A;  5H6R A;  3CXC U;  2A79 B;  3CME V;  1LNQ A;  2FTK A;  2WLH A;  4X8A A;  1PNL A;  3CMA V;  1JCH A;  3E8H A;  4X89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...