4NXMO

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4nxmO00
2VQEO 1DK1A 3RT3C 1N34O 2UXCO 4JI0O 4X66O 5BXZA 1A32A 2F4VO 4GKJO 1R6TA 4DR7O 1HNWO 1N33O 3R66A 4DV6O 4LFAO 4DR6O 2UUAO 4B3TO 4AQYO 1XNRO 4JI2O 4A5UB 2UUBO 3OTOO 4JI5O 4JV5O 4GKKO 2ZM6O 4LF8O 1FKAO 4LFBO 3T1YO 4OX9O 4DR3O 4JI6O 4B3MO 5LMUO 5LMNO 1IBMO 4JYAO 1R1BA 4X62O 4DR4O 1HR0O 1F7YA 4JI8O 1YZBA 4DV5O 4OPAA 2LW7A 4DR1O 4DR2O 3T1HO 5BY1A 5FLXN 5H5NA 1XEQA 5LL6Y 1XMOO 2JRIA 4DV2O 5IT9N 4DV7O 4DV3O 1J5EO 4LF7O 1N32O 4DV1O 1FYJA 4LF6O 1HNXO 4X65O 3J7AU 2DOSA 2ZKOA 4YY3O 2UUCO 1HNZO 4LF9O 4JI3O 4YHHO 1KUQA 2HHHO 4B3SO 2UXBO 4DUYO 4LF5O 2UXDO 5BR8O 4OPHA 2AGAA 1IBLO 4NXNO 4LFCO 3J80N 2VQFO 1AILA 1XMQO 1N36O 1I94O 4JI7O 4NXMO 1XNQO 3M8AA 4LF4O 1NS1A 1X59A 1G1XB 3O65A 2N74A 4X64O 3SDLA 1AB3A 4JI1O 1FJGO 2FKXA 3J81N 4JI4O 4K0KO 4KHPO 1D2DA 4B3RO 3JAMN 5IWAO 2DJVA 1IBKO 2UU9O 2Z0AA 4DV0O 5A2QN 4DV4O 2E5LO 3F5TA 4DR5O 4DUZO
chains in the Genus database with same CATH superfamily
2VQEO 2UXNA 1U97A 1F4MA 3ZJZA 1A32A 4JASA 5LYJB 4JYBA 5BZBA 4JI2O 3VQVA 2IU0A 3H1IH 2W6IG 4PI0A 4U7OA 3OTOB 5B1AC 4B7KA 3K03A 2OT5A 3VOUA 3QVNA 3AK3A 2HJDA 1VP7A 2JS3A 3OT7A 2RDCA 4QJFB 4R7CA 2V7QG 1YSCA 2CE4A 2NR5A 3CJHA 3OEHG 2WSSG 2CH7B 1MNGA 2A79B 3E2EA 3SYAA 3JCUZ 1G6UA 2OTLV 3IC9A 4DR4O 1FPOA 1KECA 1YZBA 3FYEB 2EILC 4MVSA 3WG7C 4OGQB 1PP9H 3RYFB 4DRXB 2IM9A 3ZRWA 4EKWA 4YJ3B 1OCRC 3K57A 2EJ7A 4JV5B 2N05A 3BCCH 2FB5A 5H6RA 5KHJA 1UJWB 2D3OW 2HFEC 1EBOA 2DOSA 4DV7B 4JI3B 2ZT9B 4FLVA 2UUCO 4UB8Z 4GX2A 4X9QA 3ZMVA 4JGSA 5F2VO 1QNMA 2IU3A 1QHTA 1V9PA 3M7MX 1BSMA 5B1BC 3UT5A 1KMIZ 3HKCB 2ADQB 5LBQA 3AK1A 3FX7A 3W7TA 1AILA 4ZIBA 4U3JA 1I94O 4YIPA 3K58A 3CC2V 1NVPB 3F7VC 4CH4A 1FJGO 1UFIA 4TOIA 4I0XA 3TXQA 4ZHQA 1Y74B 3H1KH 5JJEB 2VQFB 1JFFA 1OCZC 2ZE8A 1OCZB 2NLJC 2FYUH 3B40A 4I0XB 2G38A 3K79A 2F4VO 3QG5A 2X0LA 4O4LB 5IJ0A 1BMFG 2JGDB 3FFQA 4TV9B 4P9OA 2QWRB 4A5UB 3D36A 3AG2C 4DV3B 1SQFA 4B3RB 2Q7EA 1IVSA 4ZOLB 5BMVB 2XAQA 1OCCC 2RMKB 4DV1B 4K0KB 3N2GB 4FJCC 1QLNA 2QTOA 4NKGB 4WFEA 2IBZH 4J42A 4FLXA 5KAIZ 1CEZA 1JQ0A 3BPZA 2P7TC 5CMUA 4J80A 3T1YB 2IJKA 4DV5O 3OMNB 3OGCC 3CC4V 2WA3A 2YXHA 3E8HA 4TQFA 5H5NA 3UT5B 1OCRB 1HNZB 1K33A 3K0DA 3OGIB 2L6LA 5LGNA 5IT9N 4JI5B 5LHIA 2Q4PA 3WG7B 4MTFA 3SR2C 3CXCU 2PI5A 4KP4A 5KUMA 4LF6O 1SQVH 5IY5B 5J2UB 2AZ2A 4KXRA 5J9PC 2UXCB 4E2LA 1HDJA 1E1QG 4YXWG 3T2MA 5JJNB 4AHCA 1P7GA 3ZHSA 3ZIAG 4WFHA 2WLIA 1YF2A 4NXNO 4DR5B 1R3IC 1HP8A 1BGYH 3J80N 1IBMB 1IBKB 2DW4A 4BAYA 1AR5A 2Q73A 4MTOA 3WB1A 3JD4A 3P3NA 1AP5A 2R9RB 3AG3C 4LF4B 2YICA 3JATB 4PHZA 2Z0AA 1OCOC 4NVPA 3K5OA 4LFBB 4O2BB 1YTFB 2Y48A 5FNVB 3SPIA 2IH1C 3HKDA 5IYZA 2W0FC 2P5OA 2P22C 2HKOA 3A0RA 5KHKA 5KHGA 2GTSA 2V4DA 2LFRA 1WB7A 1AI6A 2ARHA 1Q81W 1K7DA 3OMAB 4I50B 4LP8A 4MS2A 4H33A 1I7FA 4X66B 4LF8O 4WFFA 3G4SV 1S5LZ 1WNSA 3AG4C 4X62B 1N36B 4B3MB 3LUTB 5LMNO 4UVCA 3LNNA 2XTAA 4DR1O 4HYOA 2W6JG 3T1HO 2JIZG 1QR8A 5FLXN 3CC7V 3R65A 1BQ0A 2OCCC 2YXLA 3EXAA 5JH7B 4QE7A 1J5EB 5GTIZ 3J7AU 3DXRB 4HBNA 4MVOA 5EZYA 2Y0IA 3SPCA 4F6RB 1M90W 2Q9LA 2JGDA 3ZEDA 4LF7B 4J7ZA 2HVKC 1OCCB 3P32A 4IGGA 1WAZA 4MVMA 4BIOA 3FKSG 5EBWC 4FM1A 2DQ3A 5A2QN 4O2AA 3DXRA 3K5MA 1L1FA 4DR3B 5B1NA 3RT3C 4DUZO 4CZZA 1Q6HA 2A3QA 2QA4V 1TA8A 1S77D 4FFBA 3LDCA 1YVWA 1FD9A 4GT1A 1WP7A 1YJ9V 3JCZA 2DWDC 3IGAC 1N32B 1AP6A 1YTFD 2A0LA 3E8BA 4BW9A 4B7EA 2YI9A 2Y0PA 2ZR2A 4W4KA 3SJCC 3CRRA 4K8ZA 4IHJB 3CCSV 4JI8B 2ZE7A 3K3WA 4DK0A 2EZOA 4GKKB 3KG2A 4J9YB 2OWOA 4DR2O 2H94A 3GWOA 1V54B 2QM4A 1YJWV 1VARA 2JK5C 4UVBA 2IJIA 4X88A 3RVYA 4RWUA 4X20A 4GYCB 5LP6A 3D3IA 3I5DA 4O4JA 4GX5A 3LSUA 1GKFA 2EJRA 1S3JA 1JOYA 4B08A 3HKCA 1HNWB 4DR6B 3I55V 3E8GA 2QWNB 1KUQA 4BIZA 1IXBA 4DUYO 5IWAB 1I0HA 1NH2B 1RSOA 4UCOA 4RAIA 5IYDO 2QKSA 3JSLA 4LC1A 3G6BA 4YJ2A 1WPBA 2CAZC 2C2AA 3LDDA 1G1XB 2GUZA 4IHJA 1OCOB 1Q3EA 3TETA 2M7WA 1T5EA 2P6JA 4JYAB 3ABLC 3JAMN 5IWAO 3RYHB 1H2LA 3CWBH 4PA4A 1COWG 3E86A 1NZ6A 2OTJV 4EFEA 5B1BB 2P06A 2ZNIA 4GX1A 5KLVH 4NTXA 4IIJA 3H9VA 2QM7A 3AG1B 2DWEC 1RSOB 1N33O 2Q7GA 2UUAO 4UCTA 2UUBO 3GVMA 4I7ZB 4BIUA 4DV0B 4UV9A 5L3EA 1IDSA 2BTOA 3OE7G 2ATKC 4UXNA 3WFVA 1XOUA 4GKKO 2QWOB 3CCMV 2XUMA 3CX5F 3ZMUA 4PDLA 3VQYA 2JEXA 3ETQA 5KHHA 3X2QC 2WAMA 4LNUB 1GN4A 5B66Z 3FAVA 4ZI7A 5LMUB 2LW1A 2XAGA 1NR7A 3GB7C 5BY1A 3VQXA 5BMVA 1H2SB 1SRYA 3NR7A 1XNQB 3RYHA 1SKVA 1P49A 2P4VA 1VEWA 3B4SA 2YC0A 1SZTA 3MDSA 5IDJA 4HZ3A 1S5JA 2YSUB 4O4LA 2VWKA 1B3QA 1SC5B 3E35A 2X6AA 3F5WC 2QM8A 3BABA 2IJJA 2OYQA 4LF9O 4I55A 3G6EV 1XILA 2PTMA 3U11A 3CJHB 1N0JA 4NTWA 3CMEV 3LDEA 1IBLO 2CUGA 2FL4A 4P2ZA 4O4IA 2EIMB 4HNAA 3SJAC 2P90A 3JAKB 3JALB 3T1CA 2OIGA 2Q68A 2WLKA 2ZM6B 2EIKC 4TWKA 4X8AA 1GTOA 2DJVA 4JI6B 1D5NA 2WLLB 2WLNA 5JVDB 4MW8A 3ZX6A 4MTXA 3CCLV 3A0BZ 2ITCC 1P7BA 4MSWC 1KKDA 2HG5C 3R66A 3RYIB 4TV8B 1GH6A 2X6CA 2FTKA 3W7UA 3L74H 1FXVA 5KUKA 5AG2A 4R50A 3T1HB 4JI0B 2ZM6O 3IJ4A 1Q6UA 1QLEC 2LP7A 3W7XA 4DR1B 1YITV 1PM9A 2L35A 5DN6G 4NR1A 3SPGA 5EIBD 2YDEA 2YI8A 4B3MO 2HLDG 4NYKA 4X62O 1F4NA 1IBLB 3OAAG 5B1AB 1SA0B 2LW7A 5EBMC 2R9IA 3L9DA 1KBHA 3QF7A 1K73W 1K4DC 1NVPD 1ZSPA 5LL6Y 1SERA 1VF5B 5IJ0B 1IURA 2JRIA 3AG2B 2AW9A 2YIAA 4K3AA 1AR1B 1VIBA 1L0NH 1RPOA 4I4TA 2HP8A 5ITZB 2PGGA 2HHHB 1GO3F 1Y4MA 3K59A 4B3TB 4FMTA 2ZDIA 2PYJA 4RO2A 1ROPA 1PL4A 2HHHO 2BOCC 1ORQC 1R3KC 3T4ZA 2A7WA 1SESA 3N2KA 4DRXA 5J2TA 3BA9A 3FB7C 4TT3G 1B04A 4IT5A 1ZAUA 1WB8A 3AG1C 4CS2A 5JWPA 5L3GA 2OCCB 5IJ9B 1MABG 4MT8A 4UVAA 5LA6B 2PI4A 2GHYA 2N74A 4X64B 3KCYA 1W2BU 2EX3A 1GN6A 3OW2U 5C93A 3HR0A 2GDSA 2UU9O 4DV0O 2MW2B 2UUBB 1Q90D 3N2GA 1K97A 1U96A 1JCHA 2ADPA 3D3QA 1N34O 4X1YA 2DQ0A 2UXCO 4JI0O 1VF6A 1ZUQA 2PF4E 4DV6O 2B5UA 1O9GA 5LGTA 1VQ6V 5EC1C 4JI5O 1RP3B 4XDJA 2JDIG 3FB5C 3A2FA 3CD6V 1VF6C 5B1OA 1K3EA 4NTYA 2WLJA 3K06A 4IYHA 3T1YO 3RVZA 4X89A 5CN0A 4JI6O 1Y6XA 2Q7HA 3CB2A 5FPOA 1MMMA 5GTHZ 1BZKA 3H1HH 4U3JB 2B1IA 1M5IA 3P3PA 3O9OA 2HEPA 4LH6A 4JYYA 4DV3O 1FXHA 3BFRA 1AI5A 1I08A 2O57A 4PV1B 1BQZA 4X65O 3HKEB 4FLZA 2YIBA 1FFXA 4H44B 3JARA 2F23A 2A06H 3I56V 4X20B 4TSFG 1BHBA 1TUEB 4DR2B 4JF3A 3RYIA 1IX9A 1NBMG 5DM6V 3AG4B 4JTDB 4J7JA 4NXMO 1XNQO 4QGPA 1NTZH 5FPRA 1JA8A 1XQ8A 1ZL8A 5CBHA 1JJ2U 4TUYB 3ZHTA 4NXMB 1D2DA 1YCIA 1LUVA 4CS3A 3JARB 1E1RG 2QTSA 2CTRA 1XHXA 1DK1A 4L8JA 4UCSA 1F51A 3P30A 3RGBA 1H2KA 1XDCA 5IYCO 1EN5A 4JTCB 2EIJB 1JX9A 3JD2A 4X65B 4K8XA 2JJ1G 3D8CA 4GX0A 2BSKB 1ZTEA 4DW0A 4J41A 4YJ3A 4GUNA 1K4CC 5JQGB 3ZHUA 1FKAO 4DYLA 3HKDB 2JVDA 3VQWA 4JYAO 1X4TA 1XBLA 1KB9F 2IW5A 3ZMSA 4RUFA 5LOVA 1KD1W 1Q82W 2QSAA 5GONB 3JATA 1H2NA 1SQQH 1GN2A 4FFBB 2Y4UA 4LR3A 3SJBC 3SGIA 1J5EO 2H3OA 2EZPA 1Y67A 3A0HZ 4W4LA 4X1IA 2CTQA 5LP6B 1L0LH 5EC2C 1GM9A 2Q0AA 3MHHC 4DUYB 1PKXA 3QO7A 4R8CA 4QPJA 4DV6B 3JSNA 4AI8A 3G80A 4DV4B 1N34B 4R6ZA 1H8EG 2X7RB 2DYRC 2UU9B 1N36O 1P4RA 2KKWA 4KFMA 1XHZA 3PJSK 3RN4A 2Q69A 4X64O 4Q6GA 3QO5A 1WP8A 1FS0G 4HNAB 1XI1A 3MHSC 3K5LA 2ZIMA 3ABKC 5JH7A 2BE3A 5L3CA 4FLUA 3BVOA 3CEIA 4B3TO 4F6EA 1YHQV 2ITDC 2YXYA 3RYCB 1YIJV 5A9GA 3HB3B 1LR1A 3APOA 1M56C 2KB1A 1GMGA 3UCSC 1R3LC 4FM0A 2K1EA 2XOKG 4UV8A 3L70H 1CXZB 4BR6A 3WB2A 1YJNV 1QVFU 3HKBA 1DF4A 4OX9O 1Z5VA 4DR3O 3L71H 5LHGA 3QNEA 1BE3H 2CH7A 5B3SC 3OEEG 1N8RW 1IBMO 3ZRSA 3FAVB 3JD1A 2R70A 5D5QA 3CCQV 4PA6A 4I9QA 4O2AB 1QVGU 4FLWA 2F66C 4YIOA 4DV2O 5CBFA 4ASUG 4O4HA 4LF7O 1KP3A 2XNDG 5EIBC 4XBFA 2X6BA 1I5YA 2MK3A 4RQEA 5C8YA 1HNZO 4J7KA 1PNLA 2R72A 3SYCA 3K5NA 4L87A 3A8TA 2Q67A 4BW5A 4CC5A 3ABTA 4DV5B 3PN1A 1MSDA 2QR4A 2RJZA 2AXTZ 3ASNB 4EB6B 1PL0A 5KAFZ 5D5PA 1AJPA 1V54C 3DSQA 3JAWA 2DYRB 3OTFA 1AB3A 2QKAA 3ZRWB 3CRAA 2FKXA 1ZL8B 5JQGA 1TVKA 4K0KO 4CH3A 1FXKB 3DTUB 5CA0B 5LMNB 4B3RO 2UXDB 1US6A 3FB6C 2GV9A 1EZVH 1JFFB 1J95A 4LF8B 2LGWA 3ICXA 3CCJV 4X66O 2LGQA 4QE9A 4GKJO 4FPPA 4LF9B 2A9HA 4ZKIA 2KQXA 4CBCA 4TV9A 3K9SA 3ZRVA 1BHAA 3G71V 2AHYA 5KX5B 1JR9A 1Q6IA 5EZYB 4O4IB 1BT8A 1H8HG 3TCUA 5KA5A 2FMLA 4JAUA 3TJTA 3W7WA 1AJNA 4CH6A 5LXTB 4LFBO 2YEVB 5GW7A 5CA1A 1JMKC 5LYJA 5CA0A 2E3CA 1IXMA 1M57B 1Y74A 4WF9V 2LO1A 3H1JH 1K5QA 3K9AA 2ZXWB 5LMUO 4JZ2A 1I94B 5K1PA 3JAWB 2ZCEA 3QTCA 5EYPB 3DGEA 1W0KG 3IFXA 3ABKB 2EILB 4WCEV 2Y69C 1AR4A 2DYSB 1E79G 1XEQA 2V1DA 2VWJA 3DC5A 2ZIOA 4DV7O 2K9PA 3ZHQA 4D7TA 4LWSA 1XNRB 2QE7G 3OUFA 3APQA 2QEXV 1G4YB 1GN3A 2ZKOA 2WA4A 2UUAB 1SS3A 1MOFA 2ILMA 5KX5A 1N33B 1FXKA 4ICGA 4KL1A 4PA7A 3THOA 4DR4B 3K08A 3TXSA 1NH2D 1QLEB 2QWPB 2NN4A 3SYPA 1PNKA 3CCVV 1XMQB 2LFSA 1MZFA 3B2EE 4I5SA 4LWSB 5FL7G 3DC6A 3ML0A 3AG7A 1VQ9V 3M99B 5IJ9A 3D36C 3GWKC 1Z2GA 1R73A 1Q5OA 1L8DA 3UO3A 1ZLZA 1SETA 2PUSA 1HNWO 4DR6O 5DEDA 4FLTA 1NTMH 3UO2A 4FFKA 1UPGA 1CP9A 3RYCA 1W59A 2WWWA 1QQCA 2XAJA 1ENVA 3N27A 2QKCA 1EN4A 4FM2A 3CCRV 1Q43A 1O9HA 2LQTA 2D2CB 3UQ8A 1S76D 1M9NA 2AZ0A 1R1BA 1VQ4V 1WN7A 1KQSU 4HAMA 1VQOV 4JI8O 3UKMA 1FJGB 4GCZA 1YI2V 5B5EZ 1EZJA 1NT2B 3X2QB 4EEQA 4B3SB 2B9ZA 1JPXA 2HR3A 2P4KA 2BTQA 1BCCH 1GRJA 1N32O 5GONA 4C7UA 3U0ZA 2LJ2A 4X1KA 4IL6Z 1KYOF 4YY3O 3CHXA 1URFA 1EFRG 2EIKB 4JI3O 3CCUV 2IH3C 2UXBO 1WA8B 2CTPA 1VQKV 1KKCA 4DUZB 1FFXB 3B8MA 4LBEC 4K35A 4DXWA 2EINB 4JI7O 5J2UA 3WB0A 1M93A 1OV9A 4MW3A 1AI7A 3J81N 2ODMA 3S3WA 3E89A 3FYIB 3ABUA 1M56B 1Q86W 3Q4HA 3HKEA 3JYCA 5LHHA 1DGSA 3ZHRA 4X1IB 1VQPV 3ETDA 5IY5C 3CXHF 1R6TA 1THZA 1AJQA 4AQYO 1WLEA 5LXTA 1SQGA 3OTOO 1PD3A 3TGUH 4U3FH 4E4EA 1R6KA 2RNBA 3OMIB 2QJ1A 1NQTA 1NTKH 4O2BA 4I9WA 2JJ2G 3UM7A 2VQEB 1SZXA 4TUYA 4FIPC 1Y66A 1YXBA 2HJFC 2Y69B 3RFRA 1OJHA 3SJQC 5EYPA 5L3FA 4OPAA 1SQBH 4ZHQB 3C90A 2F93B 1K92A 1XL6A 4NB5A 3AG3B 2F43G 2EINC 5B3SB 3HKBB 2ZR3A 3B77A 2QWQB 3ETEA 4Z1VA 4ABMA 4LFAB 4CH5A 4ZOLA 5BR8B 3EFFK 5H2FZ 1HNXO 2BSKA 3JAKA 4F4LA 1BL8A 4YHHB 4TQDA 1DTOA 1RFYA 1GM8A 1R6NA 4LF5O 3LSSA 4J11A 5JJJB 4LFCO 2BOBC 3CYOA 3LSQA 3S3XA 2IJHA 2Z5UA 4QPKA 1NS1A 4LF4O 1FXKC 5LP6C 3OUSA 2ZINA 2R9AA 2EULA 4FZ0A 4LFCB 1HR0B 3ABLB 3ASOB 1IBKO 2E5LO 3F5TA 4MVRA 3ZS8C 3KZIZ 2XASA 3CMAV 4DR5O 4NXNB 5L3DA 5KMGB 3SYOA 5KHIA 2PYLA 3ASOC 5EBLC 1EN6A 3ABMB 3F7YC 1Q8IA 2HVJC 1HNXB 4LFAO 5CA3A 3EVKA 1MA1A 4F6RA 1F23A 1H38A 4LF6B 4PA3A 2XHBA 4G27B 4DW1A 3MD0A 3L72H 2XAHA 5JCOA 3ZMZA 1XL4A 3CRMA 1NU1H 2BTQB 1M4UA 4I50A 4JAVA 3NXSA 1VQ7V 4U7NA 2Q0OC 4UCVA 2Y4TA 4FK5C 3KCXA 2WLIB 1K8AW 3RYFA 1SF9A 2XT9A 4MVQA 4DV1O 4AQYB 3BA8A 1FFTB 4X1YB 3ZHVA 2JGUA 1H2GA 2CGOA 1K34A 1AI4A 2Q6AA 5IYBO 2WLMA 4I4TB 2F4VB 1FAFA 1V55B 1I5XA 3H01A 4D6TH 3ZN0A 3CSXA 5LA6A 4MTGA 3SPJA 1BS3A 3JD0A 3LNMB 2VQFO 5FNVA 4BWAA 3ASNC 1WJZA 3K0GA 5L3BA 2ZD9A 3Q4HB 4O4JB 1X59A 3ZBHA 4MVZA 5E1AC 4N21A 1VQ8V 1GK9A 4JI7B 3L73H 4JI1O 1R3JC 4EB6A 3C3SA 1OZ0A 4KHPO 4UCRA 3E22A 2F1MA 4D7SA 1NKDA 3OR7C 2N04A 5LOVB 4WBNB 4YY3B 1XREA 5IE9A 2QGNA 4Z1MG 4PA9A 1QR9A 2UUCB 2GUZB 3HPLC 2RN9A 1N4CA 4JTAB 4FLYA 1K5SA 4JV5O 4DO2A 1OHHG 3CP1A 4KHPB 4KUMA 1DLBA 2Q8VA 3BAAA 3STZC 2Q5ZA 1QBZA 3E22B 1TVKB 2ZXWC 4PELA 4IIJB 1TAEA 1H2MA 1XUQA 2ZE5A 2BCCH 2DN9A 3ZN1A 4H0LB 1KC8W 1S72V 3FB8C 5TISZ 4P30A 2H8PC 4P9PA 1YEWA 1XMOO 2WPDG 3ZCCA 1IZ3A 2KG7A 3STLC 2EBOA 4LNUA 4PI2A 4JI2B 4PDRA 4QIWF 4PJ0Z 1CPYA 3T4DA 1M1KW 4Z2WA 3N2KB 5LGUA 5J2TB 3JASA 4J9ZB 3RBZA 4WBNA 1XMQO 1SA0A 4CC6A 1XMOB 1QU7A 1Y76B 3M8AA 3H1LH 4JI4B 1Q7YW 2ETNA 3ZRXA 3O65A 3BRCA 1VMGA 3SDLA 2CGNA 1G8MA 3OD4A 1KU9A 3IC7A 4WFBV 1HW7A 4ZBMA 1JJOA 1TGOA 2ZE6A 3RW0A 2DE0X 2GBOA 2E76B 1MZEA 5H9CA 4IYIA 4DR7O 4UB6Z 3JASB 1M57C 2JEUA 3U10A 1XNRO 2NNUA 2E5LB 5H6QA 4YJ2B 4WFGA 1MSWD 2PY5A 2GTAA 1VQLV 1VQNV 2ZDIC 2W0XA 2ZQMA 3G67A 1B6QA 4H13B 3CS5A 2RQ6A 2EIMC 2KG7B 1S0VA 2UXXA 1AVMA 4JYCA 2B1GA 2AHZA 4G2KA 4G28B 4TV8A 1QCEA 2YIBD 3CRQA 3MAQA 3TK1A 3CCEV 5CBGA 4JI1B 4LF5B 5E79Z 4H37A 1JVMA 1B06A 5ITZA 2WLLA 2CK3G 4UCUA 4OXSA 3AEIA 5K1XA 2YEVA 5CA1B 5DECA 4MVUA 3IAYA 1FYJA 2XAFA 4RQFA 1YDXA 4GKJB 2RCVA 1VQ5V 2QDOA 1RM1C 3ZMTA 1GM7A 1WA8A 3AK2A 2P67A 3E83A 3SYQA 2UXDO 1VF7A 5EK0A 3B8NA 3CPWU 2M6YA 3BEHA 4OPHA 4JAAA 1LUWA 3K04A 3L75H 2PZSA 3EHBB 2WLHA 3JD3A 1V55C 1SQPH 4PD4F 1WPXA 2KSDA 4N23A 4EFBA 2GSMB 2F95B 1K9MW 1W0JG 1PNMA 2JS5A 5IYZB 1DF5A 4X1KB 2OCHA 3WU2Z 2YIDA 4JZGA 3BHPA 4RUEA 2E75B 1AROP 1EM1A 5BXZA 4Q20A 4UFZA 1NR1A 1ZWIC 2CDYA 1PPJH 3B09A 4LCUC 5KMGA 3C3TA 3ETGA 5C8YB 5HFLA 4XDKA 4CS4A 1D5AA 2EIJC 4I55B 4DV2B 2VS0A 2OIEA 1TUBA 3BY6A 2YS8A 3QO8A 4GLXA 3RWRD 4O4HB 2Z3YA 1NJIW 1N0NA 1VQMV 1HWYA 5KA6A 4PDMA 1RPRA 1RM1B 4OX9B 1HR0O 1F7YA 1PV0A 5JVDA 4XDLA 1MG1A 4FZ1A 2UXBB 4FVMA 1KP2A 3ABMC 5HFMA 4QNHB 3OM3B 1NI8A 2CTWA 4DK1A 4LH7A 3CE2A 3JALA 2E74B 2DMXA 4ZI7B 5CB4B 2DYSC 4YHHO 4DR7B 1GAXA 1S5HC 3VBBA 3OR6C 3E8FA 4B3SO 5BR8O 4AILC 2AGAA 1ZX3A 3FD9A 3SPHA 5CB4A 2VRZA 1P84F 1SQXH 4GZRB 3KKYA 4J10A 4PDVA 1Y76A 1Z5WA 1LNQA 3CRCA 4UUJC 4WFAV 4JI4O 3OFNG 2ZNJA 4JPRA 5JCOC 3W7SA 4DV4O 1TUBB 2YUAA
chains in the Genus database with same CATH topology
2VQEO 1DK1A 3RT3C 1N34O 2UXCO 4JI0O 4X66O 5BXZA 1A32A 2F4VO 4GKJO 1R6TA 4DR7O 1HNWO 1N33O 3R66A 4DV6O 4LFAO 4DR6O 2UUAO 4B3TO 4AQYO 1XNRO 4JI2O 4A5UB 2UUBO 3OTOO 4JI5O 4JV5O 4GKKO 2ZM6O 4LF8O 1FKAO 4LFBO 3T1YO 4OX9O 4DR3O 4JI6O 4B3MO 5LMUO 5LMNO 1IBMO 4JYAO 1R1BA 4X62O 4DR4O 1HR0O 1F7YA 4JI8O 1YZBA 4DV5O 4OPAA 2LW7A 4DR1O 4DR2O 3T1HO 5BY1A 5FLXN 5H5NA 1XEQA 5LL6Y 1XMOO 2JRIA 4DV2O 5IT9N 4DV7O 4DV3O 1J5EO 4LF7O 1N32O 4DV1O 1FYJA 4LF6O 1HNXO 4X65O 3J7AU 2DOSA 2ZKOA 4YY3O 2UUCO 1HNZO 4LF9O 4JI3O 4YHHO 1KUQA 2HHHO 4B3SO 2UXBO 4DUYO 4LF5O 2UXDO 5BR8O 4OPHA 2AGAA 1IBLO 4NXNO 4LFCO 3J80N 2VQFO 1AILA 1XMQO 1N36O 1I94O 4JI7O 4NXMO 1XNQO 3M8AA 4LF4O 1NS1A 1X59A 1G1XB 3O65A 2N74A 4X64O 3SDLA 1AB3A 4JI1O 1FJGO 2FKXA 3J81N 4JI4O 4K0KO 4KHPO 1D2DA 4B3RO 3JAMN 5IWAO 2DJVA 1IBKO 2UU9O 2Z0AA 4DV0O 5A2QN 4DV4O 2E5LO 3F5TA 4DR5O 4DUZO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE O;  1DK1 A;  3RT3 C;  1N34 O;  2UXC O;  4JI0 O;  4X66 O;  5BXZ A;  1A32 A;  2F4V O;  4GKJ O;  1R6T A;  4DR7 O;  1HNW O;  1N33 O;  3R66 A;  4DV6 O;  4LFA O;  4DR6 O;  2UUA O;  4B3T O;  4AQY O;  1XNR O;  4JI2 O;  4A5U B;  2UUB O;  3OTO O;  4JI5 O;  4JV5 O;  4GKK O;  2ZM6 O;  4LF8 O;  1FKA O;  4LFB O;  3T1Y O;  4OX9 O;  4DR3 O;  4JI6 O;  4B3M O;  5LMU O;  5LMN O;  1IBM O;  4JYA O;  1R1B A;  4X62 O;  4DR4 O;  1HR0 O;  1F7Y A;  4JI8 O;  1YZB A;  4DV5 O;  4OPA A;  2LW7 A;  4DR1 O;  4DR2 O;  3T1H O;  5BY1 A;  5FLX N;  5H5N A;  1XEQ A;  5LL6 Y;  1XMO O;  2JRI A;  4DV2 O;  5IT9 N;  4DV7 O;  4DV3 O;  1J5E O;  4LF7 O;  1N32 O;  4DV1 O;  1FYJ A;  4LF6 O;  1HNX O;  4X65 O;  3J7A U;  2DOS A;  2ZKO A;  4YY3 O;  2UUC O;  1HNZ O;  4LF9 O;  4JI3 O;  4YHH O;  1KUQ A;  2HHH O;  4B3S O;  2UXB O;  4DUY O;  4LF5 O;  2UXD O;  5BR8 O;  4OPH A;  2AGA A;  1IBL O;  4NXN O;  4LFC O;  3J80 N;  2VQF O;  1AIL A;  1XMQ O;  1N36 O;  1I94 O;  4JI7 O;  4NXM O;  1XNQ O;  3M8A A;  4LF4 O;  1NS1 A;  1X59 A;  1G1X B;  3O65 A;  2N74 A;  4X64 O;  3SDL A;  1AB3 A;  4JI1 O;  1FJG O;  2FKX A;  3J81 N;  4JI4 O;  4K0K O;  4KHP O;  1D2D A;  4B3R O;  3JAM N;  5IWA O;  2DJV A;  1IBK O;  2UU9 O;  2Z0A A;  4DV0 O;  5A2Q N;  4DV4 O;  2E5L O;  3F5T A;  4DR5 O;  4DUZ O; 
#chains in the Genus database with same CATH topology
 2VQE O;  2UXN A;  1U97 A;  1F4M A;  3ZJZ A;  1A32 A;  4JAS A;  5LYJ B;  4JYB A;  5BZB A;  4JI2 O;  3VQV A;  2IU0 A;  3H1I H;  2W6I G;  4PI0 A;  4U7O A;  3OTO B;  5B1A C;  4B7K A;  3K03 A;  2OT5 A;  3VOU A;  3QVN A;  3AK3 A;  2HJD A;  1VP7 A;  2JS3 A;  3OT7 A;  2RDC A;  4QJF B;  4R7C A;  2V7Q G;  1YSC A;  2CE4 A;  2NR5 A;  3CJH A;  3OEH G;  2WSS G;  2CH7 B;  1MNG A;  2A79 B;  3E2E A;  3SYA A;  3JCU Z;  1G6U A;  2OTL V;  3IC9 A;  4DR4 O;  1FPO A;  1KEC A;  1YZB A;  3FYE B;  2EIL C;  4MVS A;  3WG7 C;  4OGQ B;  1PP9 H;  3RYF B;  4DRX B;  2IM9 A;  3ZRW A;  4EKW A;  4YJ3 B;  1OCR C;  3K57 A;  2EJ7 A;  4JV5 B;  2N05 A;  3BCC H;  2FB5 A;  5H6R A;  5KHJ A;  1UJW B;  2D3O W;  2HFE C;  1EBO A;  2DOS A;  4DV7 B;  4JI3 B;  2ZT9 B;  4FLV A;  2UUC O;  4UB8 Z;  4GX2 A;  4X9Q A;  3ZMV A;  4JGS A;  5F2V O;  1QNM A;  2IU3 A;  1QHT A;  1V9P A;  3M7M X;  1BSM A;  5B1B C;  3UT5 A;  1KMI Z;  3HKC B;  2ADQ B;  5LBQ A;  3AK1 A;  3FX7 A;  3W7T A;  1AIL A;  4ZIB A;  4U3J A;  1I94 O;  4YIP A;  3K58 A;  3CC2 V;  1NVP B;  3F7V C;  4CH4 A;  1FJG O;  1UFI A;  4TOI A;  4I0X A;  3TXQ A;  4ZHQ A;  1Y74 B;  3H1K H;  5JJE B;  2VQF B;  1JFF A;  1OCZ C;  2ZE8 A;  1OCZ B;  2NLJ C;  2FYU H;  3B40 A;  4I0X B;  2G38 A;  3K79 A;  2F4V O;  3QG5 A;  2X0L A;  4O4L B;  5IJ0 A;  1BMF G;  2JGD B;  3FFQ A;  4TV9 B;  4P9O A;  2QWR B;  4A5U B;  3D36 A;  3AG2 C;  4DV3 B;  1SQF A;  4B3R B;  2Q7E A;  1IVS A;  4ZOL B;  5BMV B;  2XAQ A;  1OCC C;  2RMK B;  4DV1 B;  4K0K B;  3N2G B;  4FJC C;  1QLN A;  2QTO A;  4NKG B;  4WFE A;  2IBZ H;  4J42 A;  4FLX A;  5KAI Z;  1CEZ A;  1JQ0 A;  3BPZ A;  2P7T C;  5CMU A;  4J80 A;  3T1Y B;  2IJK A;  4DV5 O;  3OMN B;  3OGC C;  3CC4 V;  2WA3 A;  2YXH A;  3E8H A;  4TQF A;  5H5N A;  3UT5 B;  1OCR B;  1HNZ B;  1K33 A;  3K0D A;  3OGI B;  2L6L A;  5LGN A;  5IT9 N;  4JI5 B;  5LHI A;  2Q4P A;  3WG7 B;  4MTF A;  3SR2 C;  3CXC U;  2PI5 A;  4KP4 A;  5KUM A;  4LF6 O;  1SQV H;  5IY5 B;  5J2U B;  2AZ2 A;  4KXR A;  5J9P C;  2UXC B;  4E2L A;  1HDJ A;  1E1Q G;  4YXW G;  3T2M A;  5JJN B;  4AHC A;  1P7G A;  3ZHS A;  3ZIA G;  4WFH A;  2WLI A;  1YF2 A;  4NXN O;  4DR5 B;  1R3I C;  1HP8 A;  1BGY H;  3J80 N;  1IBM B;  1IBK B;  2DW4 A;  4BAY A;  1AR5 A;  2Q73 A;  4MTO A;  3WB1 A;  3JD4 A;  3P3N A;  1AP5 A;  2R9R B;  3AG3 C;  4LF4 B;  2YIC A;  3JAT B;  4PHZ A;  2Z0A A;  1OCO C;  4NVP A;  3K5O A;  4LFB B;  4O2B B;  1YTF B;  2Y48 A;  5FNV B;  3SPI A;  2IH1 C;  3HKD A;  5IYZ A;  2W0F C;  2P5O A;  2P22 C;  2HKO A;  3A0R A;  5KHK A;  5KHG A;  2GTS A;  2V4D A;  2LFR A;  1WB7 A;  1AI6 A;  2ARH A;  1Q81 W;  1K7D A;  3OMA B;  4I50 B;  4LP8 A;  4MS2 A;  4H33 A;  1I7F A;  4X66 B;  4LF8 O;  4WFF A;  3G4S V;  1S5L Z;  1WNS A;  3AG4 C;  4X62 B;  1N36 B;  4B3M B;  3LUT B;  5LMN O;  4UVC A;  3LNN A;  2XTA A;  4DR1 O;  4HYO A;  2W6J G;  3T1H O;  2JIZ G;  1QR8 A;  5FLX N;  3CC7 V;  3R65 A;  1BQ0 A;  2OCC C;  2YXL A;  3EXA A;  5JH7 B;  4QE7 A;  1J5E B;  5GTI Z;  3J7A U;  3DXR B;  4HBN A;  4MVO A;  5EZY A;  2Y0I A;  3SPC A;  4F6R B;  1M90 W;  2Q9L A;  2JGD A;  3ZED A;  4LF7 B;  4J7Z A;  2HVK C;  1OCC B;  3P32 A;  4IGG A;  1WAZ A;  4MVM A;  4BIO A;  3FKS G;  5EBW C;  4FM1 A;  2DQ3 A;  5A2Q N;  4O2A A;  3DXR A;  3K5M A;  1L1F A;  4DR3 B;  5B1N A;  3RT3 C;  4DUZ O;  4CZZ A;  1Q6H A;  2A3Q A;  2QA4 V;  1TA8 A;  1S77 D;  4FFB A;  3LDC A;  1YVW A;  1FD9 A;  4GT1 A;  1WP7 A;  1YJ9 V;  3JCZ A;  2DWD C;  3IGA C;  1N32 B;  1AP6 A;  1YTF D;  2A0L A;  3E8B A;  4BW9 A;  4B7E A;  2YI9 A;  2Y0P A;  2ZR2 A;  4W4K A;  3SJC C;  3CRR A;  4K8Z A;  4IHJ B;  3CCS V;  4JI8 B;  2ZE7 A;  3K3W A;  4DK0 A;  2EZO A;  4GKK B;  3KG2 A;  4J9Y B;  2OWO A;  4DR2 O;  2H94 A;  3GWO A;  1V54 B;  2QM4 A;  1YJW V;  1VAR A;  2JK5 C;  4UVB A;  2IJI A;  4X88 A;  3RVY A;  4RWU A;  4X20 A;  4GYC B;  5LP6 A;  3D3I A;  3I5D A;  4O4J A;  4GX5 A;  3LSU A;  1GKF A;  2EJR A;  1S3J A;  1JOY A;  4B08 A;  3HKC A;  1HNW B;  4DR6 B;  3I55 V;  3E8G A;  2QWN B;  1KUQ A;  4BIZ A;  1IXB A;  4DUY O;  5IWA B;  1I0H A;  1NH2 B;  1RSO A;  4UCO A;  4RAI A;  5IYD O;  2QKS A;  3JSL A;  4LC1 A;  3G6B A;  4YJ2 A;  1WPB A;  2CAZ C;  2C2A A;  3LDD A;  1G1X B;  2GUZ A;  4IHJ A;  1OCO B;  1Q3E A;  3TET A;  2M7W A;  1T5E A;  2P6J A;  4JYA B;  3ABL C;  3JAM N;  5IWA O;  3RYH B;  1H2L A;  3CWB H;  4PA4 A;  1COW G;  3E86 A;  1NZ6 A;  2OTJ V;  4EFE A;  5B1B B;  2P06 A;  2ZNI A;  4GX1 A;  5KLV H;  4NTX A;  4IIJ A;  3H9V A;  2QM7 A;  3AG1 B;  2DWE C;  1RSO B;  1N33 O;  2Q7G A;  2UUA O;  4UCT A;  2UUB O;  3GVM A;  4I7Z B;  4BIU A;  4DV0 B;  4UV9 A;  5L3E A;  1IDS A;  2BTO A;  3OE7 G;  2ATK C;  4UXN A;  3WFV A;  1XOU A;  4GKK O;  2QWO B;  3CCM V;  2XUM A;  3CX5 F;  3ZMU A;  4PDL A;  3VQY A;  2JEX A;  3ETQ A;  5KHH A;  3X2Q C;  2WAM A;  4LNU B;  1GN4 A;  5B66 Z;  3FAV A;  4ZI7 A;  5LMU B;  2LW1 A;  2XAG A;  1NR7 A;  3GB7 C;  5BY1 A;  3VQX A;  5BMV A;  1H2S B;  1SRY A;  3NR7 A;  1XNQ B;  3RYH A;  1SKV A;  1P49 A;  2P4V A;  1VEW A;  3B4S A;  2YC0 A;  1SZT A;  3MDS A;  5IDJ A;  4HZ3 A;  1S5J A;  2YSU B;  4O4L A;  2VWK A;  1B3Q A;  1SC5 B;  3E35 A;  2X6A A;  3F5W C;  2QM8 A;  3BAB A;  2IJJ A;  2OYQ A;  4LF9 O;  4I55 A;  3G6E V;  1XIL A;  2PTM A;  3U11 A;  3CJH B;  1N0J A;  4NTW A;  3CME V;  3LDE A;  1IBL O;  2CUG A;  2FL4 A;  4P2Z A;  4O4I A;  2EIM B;  4HNA A;  3SJA C;  2P90 A;  3JAK B;  3JAL B;  3T1C A;  2OIG A;  2Q68 A;  2WLK A;  2ZM6 B;  2EIK C;  4TWK A;  4X8A A;  1GTO A;  2DJV A;  4JI6 B;  1D5N A;  2WLL B;  2WLN A;  5JVD B;  4MW8 A;  3ZX6 A;  4MTX A;  3CCL V;  3A0B Z;  2ITC C;  1P7B A;  4MSW C;  1KKD A;  2HG5 C;  3R66 A;  3RYI B;  4TV8 B;  1GH6 A;  2X6C A;  2FTK A;  3W7U A;  3L74 H;  1FXV A;  5KUK A;  5AG2 A;  4R50 A;  3T1H B;  4JI0 B;  2ZM6 O;  3IJ4 A;  1Q6U A;  1QLE C;  2LP7 A;  3W7X A;  4DR1 B;  1YIT V;  1PM9 A;  2L35 A;  5DN6 G;  4NR1 A;  3SPG A;  5EIB D;  2YDE A;  2YI8 A;  4B3M O;  2HLD G;  4NYK A;  4X62 O;  1F4N A;  1IBL B;  3OAA G;  5B1A B;  1SA0 B;  2LW7 A;  5EBM C;  2R9I A;  3L9D A;  1KBH A;  3QF7 A;  1K73 W;  1K4D C;  1NVP D;  1ZSP A;  5LL6 Y;  1SER A;  1VF5 B;  5IJ0 B;  1IUR A;  2JRI A;  3AG2 B;  2AW9 A;  2YIA A;  4K3A A;  1AR1 B;  1VIB A;  1L0N H;  1RPO A;  4I4T A;  2HP8 A;  5ITZ B;  2PGG A;  2HHH B;  1GO3 F;  1Y4M A;  3K59 A;  4B3T B;  4FMT A;  2ZDI A;  2PYJ A;  4RO2 A;  1ROP A;  1PL4 A;  2HHH O;  2BOC C;  1ORQ C;  1R3K C;  3T4Z A;  2A7W A;  1SES A;  3N2K A;  4DRX A;  5J2T A;  3BA9 A;  3FB7 C;  4TT3 G;  1B04 A;  4IT5 A;  1ZAU A;  1WB8 A;  3AG1 C;  4CS2 A;  5JWP A;  5L3G A;  2OCC B;  5IJ9 B;  1MAB G;  4MT8 A;  4UVA A;  5LA6 B;  2PI4 A;  2GHY A;  2N74 A;  4X64 B;  3KCY A;  1W2B U;  2EX3 A;  1GN6 A;  3OW2 U;  5C93 A;  3HR0 A;  2GDS A;  2UU9 O;  4DV0 O;  2MW2 B;  2UUB B;  1Q90 D;  3N2G A;  1K97 A;  1U96 A;  1JCH A;  2ADP A;  3D3Q A;  1N34 O;  4X1Y A;  2DQ0 A;  2UXC O;  4JI0 O;  1VF6 A;  1ZUQ A;  2PF4 E;  4DV6 O;  2B5U A;  1O9G A;  5LGT A;  1VQ6 V;  5EC1 C;  4JI5 O;  1RP3 B;  4XDJ A;  2JDI G;  3FB5 C;  3A2F A;  3CD6 V;  1VF6 C;  5B1O A;  1K3E A;  4NTY A;  2WLJ A;  3K06 A;  4IYH A;  3T1Y O;  3RVZ A;  4X89 A;  5CN0 A;  4JI6 O;  1Y6X A;  2Q7H A;  3CB2 A;  5FPO A;  1MMM A;  5GTH Z;  1BZK A;  3H1H H;  4U3J B;  2B1I A;  1M5I A;  3P3P A;  3O9O A;  2HEP A;  4LH6 A;  4JYY A;  4DV3 O;  1FXH A;  3BFR A;  1AI5 A;  1I08 A;  2O57 A;  4PV1 B;  1BQZ A;  4X65 O;  3HKE B;  4FLZ A;  2YIB A;  1FFX A;  4H44 B;  3JAR A;  2F23 A;  2A06 H;  3I56 V;  4X20 B;  4TSF G;  1BHB A;  1TUE B;  4DR2 B;  4JF3 A;  3RYI A;  1IX9 A;  1NBM G;  5DM6 V;  3AG4 B;  4JTD B;  4J7J A;  4NXM O;  1XNQ O;  4QGP A;  1NTZ H;  5FPR A;  1JA8 A;  1XQ8 A;  1ZL8 A;  5CBH A;  1JJ2 U;  4TUY B;  3ZHT A;  4NXM B;  1D2D A;  1YCI A;  1LUV A;  4CS3 A;  3JAR B;  1E1R G;  2QTS A;  2CTR A;  1XHX A;  1DK1 A;  4L8J A;  4UCS A;  1F51 A;  3P30 A;  3RGB A;  1H2K A;  1XDC A;  5IYC O;  1EN5 A;  4JTC B;  2EIJ B;  1JX9 A;  3JD2 A;  4X65 B;  4K8X A;  2JJ1 G;  3D8C A;  4GX0 A;  2BSK B;  1ZTE A;  4DW0 A;  4J41 A;  4YJ3 A;  4GUN A;  1K4C C;  5JQG B;  3ZHU A;  1FKA O;  4DYL A;  3HKD B;  2JVD A;  3VQW A;  4JYA O;  1X4T A;  1XBL A;  1KB9 F;  2IW5 A;  3ZMS A;  4RUF A;  5LOV A;  1KD1 W;  1Q82 W;  2QSA A;  5GON B;  3JAT A;  1H2N A;  1SQQ H;  1GN2 A;  4FFB B;  2Y4U A;  4LR3 A;  3SJB C;  3SGI A;  1J5E O;  2H3O A;  2EZP A;  1Y67 A;  3A0H Z;  4W4L A;  4X1I A;  2CTQ A;  5LP6 B;  1L0L H;  5EC2 C;  1GM9 A;  2Q0A A;  3MHH C;  4DUY B;  1PKX A;  3QO7 A;  4R8C A;  4QPJ A;  4DV6 B;  3JSN A;  4AI8 A;  3G80 A;  4DV4 B;  1N34 B;  4R6Z A;  1H8E G;  2X7R B;  2DYR C;  2UU9 B;  1N36 O;  1P4R A;  2KKW A;  4KFM A;  1XHZ A;  3PJS K;  3RN4 A;  2Q69 A;  4X64 O;  4Q6G A;  3QO5 A;  1WP8 A;  1FS0 G;  4HNA B;  1XI1 A;  3MHS C;  3K5L A;  2ZIM A;  3ABK C;  5JH7 A;  2BE3 A;  5L3C A;  4FLU A;  3BVO A;  3CEI A;  4B3T O;  4F6E A;  1YHQ V;  2ITD C;  2YXY A;  3RYC B;  1YIJ V;  5A9G A;  3HB3 B;  1LR1 A;  3APO A;  1M56 C;  2KB1 A;  1GMG A;  3UCS C;  1R3L C;  4FM0 A;  2K1E A;  2XOK G;  4UV8 A;  3L70 H;  1CXZ B;  4BR6 A;  3WB2 A;  1YJN V;  1QVF U;  3HKB A;  1DF4 A;  4OX9 O;  1Z5V A;  4DR3 O;  3L71 H;  5LHG A;  3QNE A;  1BE3 H;  2CH7 A;  5B3S C;  3OEE G;  1N8R W;  1IBM O;  3ZRS A;  3FAV B;  3JD1 A;  2R70 A;  5D5Q A;  3CCQ V;  4PA6 A;  4I9Q A;  4O2A B;  1QVG U;  4FLW A;  2F66 C;  4YIO A;  4DV2 O;  5CBF A;  4ASU G;  4O4H A;  4LF7 O;  1KP3 A;  2XND G;  5EIB C;  4XBF A;  2X6B A;  1I5Y A;  2MK3 A;  4RQE A;  5C8Y A;  1HNZ O;  4J7K A;  1PNL A;  2R72 A;  3SYC A;  3K5N A;  4L87 A;  3A8T A;  2Q67 A;  4BW5 A;  4CC5 A;  3ABT A;  4DV5 B;  3PN1 A;  1MSD A;  2QR4 A;  2RJZ A;  2AXT Z;  3ASN B;  4EB6 B;  1PL0 A;  5KAF Z;  5D5P A;  1AJP A;  1V54 C;  3DSQ A;  3JAW A;  2DYR B;  3OTF A;  1AB3 A;  2QKA A;  3ZRW B;  3CRA A;  2FKX A;  1ZL8 B;  5JQG A;  1TVK A;  4K0K O;  4CH3 A;  1FXK B;  3DTU B;  5CA0 B;  5LMN B;  4B3R O;  2UXD B;  1US6 A;  3FB6 C;  2GV9 A;  1EZV H;  1JFF B;  1J95 A;  4LF8 B;  2LGW A;  3ICX A;  3CCJ V;  4X66 O;  2LGQ A;  4QE9 A;  4GKJ O;  4FPP A;  4LF9 B;  2A9H A;  4ZKI A;  2KQX A;  4CBC A;  4TV9 A;  3K9S A;  3ZRV A;  1BHA A;  3G71 V;  2AHY A;  5KX5 B;  1JR9 A;  1Q6I A;  5EZY B;  4O4I B;  1BT8 A;  1H8H G;  3TCU A;  5KA5 A;  2FML A;  4JAU A;  3TJT A;  3W7W A;  1AJN A;  4CH6 A;  5LXT B;  4LFB O;  2YEV B;  5GW7 A;  5CA1 A;  1JMK C;  5LYJ A;  5CA0 A;  2E3C A;  1IXM A;  1M57 B;  1Y74 A;  4WF9 V;  2LO1 A;  3H1J H;  1K5Q A;  3K9A A;  2ZXW B;  5LMU O;  4JZ2 A;  1I94 B;  5K1P A;  3JAW B;  2ZCE A;  3QTC A;  5EYP B;  3DGE A;  1W0K G;  3IFX A;  3ABK B;  2EIL B;  4WCE V;  2Y69 C;  1AR4 A;  2DYS B;  1E79 G;  1XEQ A;  2V1D A;  2VWJ A;  3DC5 A;  2ZIO A;  4DV7 O;  2K9P A;  3ZHQ A;  4D7T A;  4LWS A;  1XNR B;  2QE7 G;  3OUF A;  3APQ A;  2QEX V;  1G4Y B;  1GN3 A;  2ZKO A;  2WA4 A;  2UUA B;  1SS3 A;  1MOF A;  2ILM A;  5KX5 A;  1N33 B;  1FXK A;  4ICG A;  4KL1 A;  4PA7 A;  3THO A;  4DR4 B;  3K08 A;  3TXS A;  1NH2 D;  1QLE B;  2QWP B;  2NN4 A;  3SYP A;  1PNK A;  3CCV V;  1XMQ B;  2LFS A;  1MZF A;  3B2E E;  4I5S A;  4LWS B;  5FL7 G;  3DC6 A;  3ML0 A;  3AG7 A;  1VQ9 V;  3M99 B;  5IJ9 A;  3D36 C;  3GWK C;  1Z2G A;  1R73 A;  1Q5O A;  1L8D A;  3UO3 A;  1ZLZ A;  1SET A;  2PUS A;  1HNW O;  4DR6 O;  5DED A;  4FLT A;  1NTM H;  3UO2 A;  4FFK A;  1UPG A;  1CP9 A;  3RYC A;  1W59 A;  2WWW A;  1QQC A;  2XAJ A;  1ENV A;  3N27 A;  2QKC A;  1EN4 A;  4FM2 A;  3CCR V;  1Q43 A;  1O9H A;  2LQT A;  2D2C B;  3UQ8 A;  1S76 D;  1M9N A;  2AZ0 A;  1R1B A;  1VQ4 V;  1WN7 A;  1KQS U;  4HAM A;  1VQO V;  4JI8 O;  3UKM A;  1FJG B;  4GCZ A;  1YI2 V;  5B5E Z;  1EZJ A;  1NT2 B;  3X2Q B;  4EEQ A;  4B3S B;  2B9Z A;  1JPX A;  2HR3 A;  2P4K A;  2BTQ A;  1BCC H;  1GRJ A;  1N32 O;  5GON A;  4C7U A;  3U0Z A;  2LJ2 A;  4X1K A;  4IL6 Z;  1KYO F;  4YY3 O;  3CHX A;  1URF A;  1EFR G;  2EIK B;  4JI3 O;  3CCU V;  2IH3 C;  2UXB O;  1WA8 B;  2CTP A;  1VQK V;  1KKC A;  4DUZ B;  1FFX B;  3B8M A;  4LBE C;  4K35 A;  4DXW A;  2EIN B;  4JI7 O;  5J2U A;  3WB0 A;  1M93 A;  1OV9 A;  4MW3 A;  1AI7 A;  3J81 N;  2ODM A;  3S3W A;  3E89 A;  3FYI B;  3ABU A;  1M56 B;  1Q86 W;  3Q4H A;  3HKE A;  3JYC A;  5LHH A;  1DGS A;  3ZHR A;  4X1I B;  1VQP V;  3ETD A;  5IY5 C;  3CXH F;  1R6T A;  1THZ A;  1AJQ A;  4AQY O;  1WLE A;  5LXT A;  1SQG A;  3OTO O;  1PD3 A;  3TGU H;  4U3F H;  4E4E A;  1R6K A;  2RNB A;  3OMI B;  2QJ1 A;  1NQT A;  1NTK H;  4O2B A;  4I9W A;  2JJ2 G;  3UM7 A;  2VQE B;  1SZX A;  4TUY A;  4FIP C;  1Y66 A;  1YXB A;  2HJF C;  2Y69 B;  3RFR A;  1OJH A;  3SJQ C;  5EYP A;  5L3F A;  4OPA A;  1SQB H;  4ZHQ B;  3C90 A;  2F93 B;  1K92 A;  1XL6 A;  4NB5 A;  3AG3 B;  2F43 G;  2EIN C;  5B3S B;  3HKB B;  2ZR3 A;  3B77 A;  2QWQ B;  3ETE A;  4Z1V A;  4ABM A;  4LFA B;  4CH5 A;  4ZOL A;  5BR8 B;  3EFF K;  5H2F Z;  1HNX O;  2BSK A;  3JAK A;  4F4L A;  1BL8 A;  4YHH B;  4TQD A;  1DTO A;  1RFY A;  1GM8 A;  1R6N A;  4LF5 O;  3LSS A;  4J11 A;  5JJJ B;  4LFC O;  2BOB C;  3CYO A;  3LSQ A;  3S3X A;  2IJH A;  2Z5U A;  4QPK A;  1NS1 A;  4LF4 O;  1FXK C;  5LP6 C;  3OUS A;  2ZIN A;  2R9A A;  2EUL A;  4FZ0 A;  4LFC B;  1HR0 B;  3ABL B;  3ASO B;  1IBK O;  2E5L O;  3F5T A;  4MVR A;  3ZS8 C;  3KZI Z;  2XAS A;  3CMA V;  4DR5 O;  4NXN B;  5L3D A;  5KMG B;  3SYO A;  5KHI A;  2PYL A;  3ASO C;  5EBL C;  1EN6 A;  3ABM B;  3F7Y C;  1Q8I A;  2HVJ C;  1HNX B;  4LFA O;  5CA3 A;  3EVK A;  1MA1 A;  4F6R A;  1F23 A;  1H38 A;  4LF6 B;  4PA3 A;  2XHB A;  4G27 B;  4DW1 A;  3MD0 A;  3L72 H;  2XAH A;  5JCO A;  3ZMZ A;  1XL4 A;  3CRM A;  1NU1 H;  2BTQ B;  1M4U A;  4I50 A;  4JAV A;  3NXS A;  1VQ7 V;  4U7N A;  2Q0O C;  4UCV A;  2Y4T A;  4FK5 C;  3KCX A;  2WLI B;  1K8A W;  3RYF A;  1SF9 A;  2XT9 A;  4MVQ A;  4DV1 O;  4AQY B;  3BA8 A;  1FFT B;  4X1Y B;  3ZHV A;  2JGU A;  1H2G A;  2CGO A;  1K34 A;  1AI4 A;  2Q6A A;  5IYB O;  2WLM A;  4I4T B;  2F4V B;  1FAF A;  1V55 B;  1I5X A;  3H01 A;  4D6T H;  3ZN0 A;  3CSX A;  5LA6 A;  4MTG A;  3SPJ A;  1BS3 A;  3JD0 A;  3LNM B;  2VQF O;  5FNV A;  4BWA A;  3ASN C;  1WJZ A;  3K0G A;  5L3B A;  2ZD9 A;  3Q4H B;  4O4J B;  1X59 A;  3ZBH A;  4MVZ A;  5E1A C;  4N21 A;  1VQ8 V;  1GK9 A;  4JI7 B;  3L73 H;  4JI1 O;  1R3J C;  4EB6 A;  3C3S A;  1OZ0 A;  4KHP O;  4UCR A;  3E22 A;  2F1M A;  4D7S A;  1NKD A;  3OR7 C;  2N04 A;  5LOV B;  4WBN B;  4YY3 B;  1XRE A;  5IE9 A;  2QGN A;  4Z1M G;  4PA9 A;  1QR9 A;  2UUC B;  2GUZ B;  3HPL C;  2RN9 A;  1N4C A;  4JTA B;  4FLY A;  1K5S A;  4JV5 O;  4DO2 A;  1OHH G;  3CP1 A;  4KHP B;  4KUM A;  1DLB A;  2Q8V A;  3BAA A;  3STZ C;  2Q5Z A;  1QBZ A;  3E22 B;  1TVK B;  2ZXW C;  4PEL A;  4IIJ B;  1TAE A;  1H2M A;  1XUQ A;  2ZE5 A;  2BCC H;  2DN9 A;  3ZN1 A;  4H0L B;  1KC8 W;  1S72 V;  3FB8 C;  5TIS Z;  4P30 A;  2H8P C;  4P9P A;  1YEW A;  1XMO O;  2WPD G;  3ZCC A;  1IZ3 A;  2KG7 A;  3STL C;  2EBO A;  4LNU A;  4PI2 A;  4JI2 B;  4PDR A;  4QIW F;  4PJ0 Z;  1CPY A;  3T4D A;  1M1K W;  4Z2W A;  3N2K B;  5LGU A;  5J2T B;  3JAS A;  4J9Z B;  3RBZ A;  4WBN A;  1XMQ O;  1SA0 A;  4CC6 A;  1XMO B;  1QU7 A;  1Y76 B;  3M8A A;  3H1L H;  4JI4 B;  1Q7Y W;  2ETN A;  3ZRX A;  3O65 A;  3BRC A;  1VMG A;  3SDL A;  2CGN A;  1G8M A;  3OD4 A;  1KU9 A;  3IC7 A;  4WFB V;  1HW7 A;  4ZBM A;  1JJO A;  1TGO A;  2ZE6 A;  3RW0 A;  2DE0 X;  2GBO A;  2E76 B;  1MZE A;  5H9C A;  4IYI A;  4DR7 O;  4UB6 Z;  3JAS B;  1M57 C;  2JEU A;  3U10 A;  1XNR O;  2NNU A;  2E5L B;  5H6Q A;  4YJ2 B;  4WFG A;  1MSW D;  2PY5 A;  2GTA A;  1VQL V;  1VQN V;  2ZDI C;  2W0X A;  2ZQM A;  3G67 A;  1B6Q A;  4H13 B;  3CS5 A;  2RQ6 A;  2EIM C;  2KG7 B;  1S0V A;  2UXX A;  1AVM A;  4JYC A;  2B1G A;  2AHZ A;  4G2K A;  4G28 B;  4TV8 A;  1QCE A;  2YIB D;  3CRQ A;  3MAQ A;  3TK1 A;  3CCE V;  5CBG A;  4JI1 B;  4LF5 B;  5E79 Z;  4H37 A;  1JVM A;  1B06 A;  5ITZ A;  2WLL A;  2CK3 G;  4UCU A;  4OXS A;  3AEI A;  5K1X A;  2YEV A;  5CA1 B;  5DEC A;  4MVU A;  3IAY A;  1FYJ A;  2XAF A;  4RQF A;  1YDX A;  4GKJ B;  2RCV A;  1VQ5 V;  2QDO A;  1RM1 C;  3ZMT A;  1GM7 A;  1WA8 A;  3AK2 A;  2P67 A;  3E83 A;  3SYQ A;  2UXD O;  1VF7 A;  5EK0 A;  3B8N A;  3CPW U;  2M6Y A;  3BEH A;  4OPH A;  4JAA A;  1LUW A;  3K04 A;  3L75 H;  2PZS A;  3EHB B;  2WLH A;  3JD3 A;  1V55 C;  1SQP H;  4PD4 F;  1WPX A;  2KSD A;  4N23 A;  4EFB A;  2GSM B;  2F95 B;  1K9M W;  1W0J G;  1PNM A;  2JS5 A;  5IYZ B;  1DF5 A;  4X1K B;  2OCH A;  3WU2 Z;  2YID A;  4JZG A;  3BHP A;  4RUE A;  2E75 B;  1ARO P;  1EM1 A;  5BXZ A;  4Q20 A;  4UFZ A;  1NR1 A;  1ZWI C;  2CDY A;  1PPJ H;  3B09 A;  4LCU C;  5KMG A;  3C3T A;  3ETG A;  5C8Y B;  5HFL A;  4XDK A;  4CS4 A;  1D5A A;  2EIJ C;  4I55 B;  4DV2 B;  2VS0 A;  2OIE A;  1TUB A;  3BY6 A;  2YS8 A;  3QO8 A;  4GLX A;  3RWR D;  4O4H B;  2Z3Y A;  1NJI W;  1N0N A;  1VQM V;  1HWY A;  5KA6 A;  4PDM A;  1RPR A;  1RM1 B;  4OX9 B;  1HR0 O;  1F7Y A;  1PV0 A;  5JVD A;  4XDL A;  1MG1 A;  4FZ1 A;  2UXB B;  4FVM A;  1KP2 A;  3ABM C;  5HFM A;  4QNH B;  3OM3 B;  1NI8 A;  2CTW A;  4DK1 A;  4LH7 A;  3CE2 A;  3JAL A;  2E74 B;  2DMX A;  4ZI7 B;  5CB4 B;  2DYS C;  4YHH O;  4DR7 B;  1GAX A;  1S5H C;  3VBB A;  3OR6 C;  3E8F A;  4B3S O;  5BR8 O;  4AIL C;  2AGA A;  1ZX3 A;  3FD9 A;  3SPH A;  5CB4 A;  2VRZ A;  1P84 F;  1SQX H;  4GZR B;  3KKY A;  4J10 A;  4PDV A;  1Y76 A;  1Z5W A;  1LNQ A;  3CRC A;  4UUJ C;  4WFA V;  4JI4 O;  3OFN G;  2ZNJ A;  4JPR A;  5JCO C;  3W7S A;  4DV4 O;  1TUB B;  2YUA A; 
#chains in the Genus database with same CATH homology
 2VQE O;  1DK1 A;  3RT3 C;  1N34 O;  2UXC O;  4JI0 O;  4X66 O;  5BXZ A;  1A32 A;  2F4V O;  4GKJ O;  1R6T A;  4DR7 O;  1HNW O;  1N33 O;  3R66 A;  4DV6 O;  4LFA O;  4DR6 O;  2UUA O;  4B3T O;  4AQY O;  1XNR O;  4JI2 O;  4A5U B;  2UUB O;  3OTO O;  4JI5 O;  4JV5 O;  4GKK O;  2ZM6 O;  4LF8 O;  1FKA O;  4LFB O;  3T1Y O;  4OX9 O;  4DR3 O;  4JI6 O;  4B3M O;  5LMU O;  5LMN O;  1IBM O;  4JYA O;  1R1B A;  4X62 O;  4DR4 O;  1HR0 O;  1F7Y A;  4JI8 O;  1YZB A;  4DV5 O;  4OPA A;  2LW7 A;  4DR1 O;  4DR2 O;  3T1H O;  5BY1 A;  5FLX N;  5H5N A;  1XEQ A;  5LL6 Y;  1XMO O;  2JRI A;  4DV2 O;  5IT9 N;  4DV7 O;  4DV3 O;  1J5E O;  4LF7 O;  1N32 O;  4DV1 O;  1FYJ A;  4LF6 O;  1HNX O;  4X65 O;  3J7A U;  2DOS A;  2ZKO A;  4YY3 O;  2UUC O;  1HNZ O;  4LF9 O;  4JI3 O;  4YHH O;  1KUQ A;  2HHH O;  4B3S O;  2UXB O;  4DUY O;  4LF5 O;  2UXD O;  5BR8 O;  4OPH A;  2AGA A;  1IBL O;  4NXN O;  4LFC O;  3J80 N;  2VQF O;  1AIL A;  1XMQ O;  1N36 O;  1I94 O;  4JI7 O;  4NXM O;  1XNQ O;  3M8A A;  4LF4 O;  1NS1 A;  1X59 A;  1G1X B;  3O65 A;  2N74 A;  4X64 O;  3SDL A;  1AB3 A;  4JI1 O;  1FJG O;  2FKX A;  3J81 N;  4JI4 O;  4K0K O;  4KHP O;  1D2D A;  4B3R O;  3JAM N;  5IWA O;  2DJV A;  1IBK O;  2UU9 O;  2Z0A A;  4DV0 O;  5A2Q N;  4DV4 O;  2E5L O;  3F5T A;  4DR5 O;  4DUZ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...