4NXMO

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4nxmO00
4AQYO 4DR5O 3F5TA 4JI7O 4GKJO 2E5LO 4YHHO 5A2QN 5LMUO 4DV6O 3JAMN 4DR3O 5BXZA 4DUZO 3M8AA 1FJGO 3SDLA 4OPHA 5BY1A 2UXDO 4DR4O 1A32A 4JI1O 4LF8O 4X65O 1R6TA 4DV0O 4LF6O 4DUYO 3J81N 4DV1O 1F7YA 2VQEO 4JI4O 2N74A 5IWAO 5LMNO 4B3RO 1FYJA 4LFBO 2UUAO 4YY3O 2VQFO 1N33O 4JI6O 4NXNO 1I94O 4A5UB 1IBKO 4B3SO 4X62O 5FLXN 1FKAO 2ZKOA 3T1YO 4B3MO 1HNXO 4DV2O 4DR1O 4KHPO 1XMQO 1X59A 4DR6O 4LFCO 2ZM6O 4DV4O 4LF5O 4X66O 4B3TO 1DK1A 1N36O 3T1HO 1N32O 5H5NA 2FKXA 4OPAA 4JI2O 3RT3C 4JI3O 2DJVA 4LF7O 2LW7A 4NXMO 1XNRO 1AB3A 4DV5O 2HHHO 4DR2O 1HNZO 5LL6Y 1IBMO 4JI0O 3OTOO 4JI5O 4LF4O 4DR7O 1KUQA 5IT9N 2F4VO 2JRIA 1IBLO 4JYAO 2UU9O 4DV3O 4K0KO 2UUBO 4JV5O 3J80N 4JI8O 1G1XB 1D2DA 1AILA 1NS1A 1XMOO 2DOSA 4X64O 1N34O 2AGAA 4LFAO 2UXBO 1HNWO 4OX9O 2Z0AA 4DV7O 1YZBA 2UUCO 3J7AU 4GKKO 5BR8O 1XEQA 1HR0O 4LF9O 3R66A 2UXCO 1R1BA 1XNQO 3O65A 1J5EO
chains in the Genus database with same CATH superfamily
4R7CA 1BGYH 3E83A 4UCRA 1R3IC 4O4HA 2ZD9A 5J2TB 5GTIZ 4CH3A 1KP3A 3SJQC 4FLZA 2QDOA 3H1LH 1R6TA 2ILMA 4N21A 1RFYA 3K5MA 2N74A 5LGUA 2YXLA 3SYPA 1MZFA 1TVKB 3STLC 4MT8A 2ZIMA 2HFEC 3L74H 3QO5A 1PNKA 3AG7A 1COWG 3TXQA 4JASA 1BQ0A 4ZKIA 2GUZA 3JAWB 3FYEB 4KHPO 2OIEA 2RMKB 1OJHA 4DR3B 4B3RB 1YDXA 4DV4O 3RVYA 5ITZB 4I4TA 2Q69A 3WG7B 4D6TH 1VQ6V 1ORQC 1V9PA 2OIGA 3ZN1A 3OR7C 3BA8A 4DW1A 5DM6V 3T1HB 1WP7A 1GMGA 1NI8A 1VF5B 3S3XA 2LW7A 4NXMO 5EK0A 2CTQA 1AI6A 1F4MA 4LF6B 4KFMA 3U10A 3T2MA 2ETNA 1H8HG 3T1CA 4ZI7B 5B1OA 5BR8B 5EZYB 4KXRA 1QNMA 2HP8A 3C3TA 1JPXA 2UUAB 1J95A 1HNWO 4J80A 3CCRV 2XAQA 1FFTB 3DGEA 2LW1A 1PNLA 3B8NA 4B3MB 4I5SA 3AG4B 2EIJB 5GONB 3FB5C 2EIKB 4WCEV 1JR9A 2X6CA 1JQ0A 3ASNB 4GUNA 5IYCO 2EINB 4C7UA 4GX5A 2HJDA 1YEWA 2R70A 4BAYA 3Q4HB 3RN4A 1XOUA 1A32A 1CXZB 4X1KB 3N2GB 5KAFZ 3K5LA 2QA4V 1QVGU 3CPWU 1Q86W 3HB3B 4FLTA 1EBOA 5IWAO 4B3RO 4J9ZB 2YEVA 1N33O 5J2TA 1XDCA 3OMIB 1B04A 2WLLB 1WLEA 2Y69C 3VQVA 4XDJA 1E1RG 4O4IB 1JMKC 2BCCH 5CMUA 2WLIB 4X62B 3CX5F 3ZHQA 3CC4V 3A0RA 3ABKB 3OTFA 1SZTA 3QG5A 1ZTEA 3LSQA 3SYQA 5LOVA 1AROP 2HVKC 3OMNB 4QPKA 4FLXA 1NTKH 5KLVH 3ABTA 3RYCA 1FXVA 4FM0A 1X4TA 1VQ7V 4ZHQB 1NZ6A 1W0JG 5LL6Y 2AXTZ 1K7DA 4NVPA 4I7ZB 5DEDA 4YHHB 1IBMO 1YCIA 4PI2A 5KUKA 1ZL8B 4WFBV 1BHBA 1PV0A 2IM9A 2WA3A 3ASOC 1QHTA 3F5WC 3KKYA 4OGQB 3FFQA 1BHAA 3RWRD 3SYOA 4BIZA 5C93A 2QKCA 1EN6A 1U96A 4CC6A 4DUYB 2Q6AA 3UO2A 3KG2A 1Q6HA 1GN4A 3ZRWB 4GX0A 1XEQA 4MSWC 5L3BA 3R66A 1GK9A 1OCZC 3B2EE 1P7GA 2PF4E 2RDCA 5EIBD 2E5LO 3OE7G 2Q7EA 3K58A 1SQQH 5L3EA 2VWJA 1MA1A 1M4UA 1WPBA 2GSMB 2ZNIA 1YHQV 4DV1O 1TVKA 2IU0A 2UXBB 3FAVA 5KHHA 1I94O 4B7EA 5IYZB 4L87A 1OCOC 3OUSA 4I55B 4P30A 5HFMA 4FFBA 4LF9B 3L72H 2E75B 3F7VC 4PV1B 3ZRWA 1S0VA 4XBFA 4FIPC 2QM7A 2JGDA 1N36O 5TISZ 3TK1A 4DV0B 1NU1H 1KD1W 1K9MW 2WLMA 5EIBC 3CHXA 5B3SB 4JPRA 1XHZA 5LXTA 4RAIA 5LA6A 1DF4A 4PA6A 4CZZA 4LH6A 1KUQA 3HPLC 3IC7A 1Q81W 2BOCC 5EZYA 2N04A 3MDSA 1CP9A 5H2FZ 1V54B 4TWKA 4JI2B 1XL6A 3ZRVA 4MW8A 1XMOO 3CEIA 1ENVA 3OGIB 4ZOLB 4LFAO 4UXNA 4OX9O 2OCHA 5HFLA 2CH7A 1FFXA 5DN6G 2IJIA 2PI4A 4IT5A 3E8HA 1F4NA 3CRRA 4GX1A 4F6EA 4EFEA 3ETDA 1Z5VA 2VWKA 4IHJA 3SJBC 1GTOA 5LMUB 1ZUQA 2EZOA 3GB7C 4LC1A 3CD6V 1OCRB 1MNGA 3LDCA 3SDLA 3QTCA 4O4JA 3ZMSA 4X65O 4X88A 1YITV 4WBNB 1IXMA 2JJ1G 4NR1A 3CS5A 2UUAO 2A7WA 1M1KW 2OTJV 4B3SO 4IIJB 1KKDA 1P4RA 3H01A 2PI5A 3BEHA 2V1DA 4JYCA 5KA6A 1UJWB 3E22B 3W7UA 3P3PA 5CA1A 2QE7G 3C3SA 5GONA 4DV2O 5KHGA 3A2FA 1AI7A 4PA4A 4DR6O 2ZM6O 4FFBB 2B1GA 4FM2A 1DK1A 5AG2A 3STZC 4RQEA 2GTAA 2O57A 1Q6IA 2Z3YA 1QR9A 2RCVA 1DGSA 1G8MA 4X1IA 1N33B 1ZL8A 1MABG 2XAFA 4IL6Z 1YJ9V 4XDLA 4DV6B 4DV4B 5JWPA 2YUAA 4ZBMA 3ABKC 1Y67A 3W7WA 1VQLV 4FLWA 2G38A 4YJ3B 1VF6A 5L3DA 1PPJH 4YJ3A 3JD1A 1WJZA 1S77D 4J7KA 5LXTB 4CS3A 2E3CA 3D8CA 4P9OA 1L0LH 3B09A 1KMIZ 2A06H 2PZSA 2UXCO 3ZBHA 1B3QA 2JS3A 4JI0B 2JIZG 2HR3A 1Q90D 1HNWB 2P5OA 4JI5B 1WAZA 1I08A 5A2QN 2P06A 3ZRSA 2DW4A 4U7NA 4R8CA 1N8RW 4G27B 3ML0A 3DTUB 1OHHG 5BY1A 3E2EA 5IYZA 5BMVA 1BZKA 2XASA 1YTFB 4E4EA 4FVMA 3CRCA 5BMVB 4MVOA 3SPGA 1V55B 1NH2B 1H2KA 3JSNA 4FPPA 4JYBA 3HKDA 4DK0A 1GM8A 3P32A 1AI4A 2IW5A 4G28B 4O4HB 3T1YO 2Q7GA 3G4SV 4JYYA 1ZLZA 4O4LA 3JCZA 1AI5A 2AW9A 2QTOA 3AK3A 2B1IA 4HAMA 1Q8IA 4MVSA 1XMOB 3O9OA 1VF6C 5B1AC 5GW7A 5EYPB 4QGPA 3OMAB 4JYAB 2Y4TA 4LF7O 1BMFG 1Q3EA 1H2LA 4DV5O 2HHHO 5KHIA 4X64B 3WG7C 1PP9H 1SQFA 1SKVA 4CH4A 4I9WA 3LDDA 1RM1C 2CUGA 5LOVB 4B3SB 4DV3O 2F4VB 3CMEV 2E76B 4I55A 4GX2A 1DTOA 1CEZA 3K79A 3M7MX 4NB5A 2LJ2A 1M57B 4UVCA 3FB8C 3H9VA 3FB6C 3KZIZ 1N34O 1GH6A 1SQVH 1PD3A 3J7AU 2EBOA 4EB6A 4LF9O 3MHHC 3E86A 5F2VO 4U3FH 3O65A 4ABMA 5LP6C 5LBQA 4DR7B 4JI7O 1K4DC 2QM8A 1GN3A 1TUBB 4X1YA 1D5NA 2CGOA 3QO7A 5IY5B 2YSUB 1OCCC 4KUMA 4LF7B 1FJGO 3G80A 4IIJA 2EJ7A 4WBNA 2KG7A 2WLIA 3BY6A 1F51A 2N05A 5IY5C 3BFRA 1NR7A 1QLEC 4O2BA 1H2SB 4J9YB 3RYFA 3ICXA 4O2BB 5IYBO 2OT5A 4UV8A 3FYIB 3FAVB 5KUMA 3E22A 2E5LB 1XUQA 4FK5C 1KB9F 3SPCA 2XHBA 4K0KB 4ZIBA 3K9AA 3OTOB 2DYRB 4TQDA 2JEUA 1QR8A 4GCZA 5H6RA 1F23A 3CCQV 4LH7A 4X20A 2DYSC 4TV9B 4GLXA 1Y74A 1Q82W 4EB6B 1M90W 1YXBA 1E79G 3CCMV 4U7OA 1IX9A 1Y4MA 2MW2B 4RQFA 1IZ3A 5IJ9B 3ETEA 4AQYB 3BRCA 1BS3A 1Z2GA 1AR5A 5LA6B 4JI5O 2XAHA 4FM1A 3E8BA 5JCOA 2UXCB 5E79Z 4JV5O 2P6JA 4UCOA 1NS1A 4X64O 1K8AW 2GHYA 2GUZB 3JAWA 2OCCB 2LO1A 3SJAC 4CBCA 2M7WA 3JALA 1R1BA 1R6KA 5CN0A 2ZXWB 3HKEB 4JI1O 1J5EO 4G2KA 4WFGA 1RP3B 4PJ0Z 3HKEA 1VQ5V 4DV6O 2UXXA 4LNUA 1AJNA 3N27A 3H1IH 4DUZO 2ZNJA 4MTOA 1L0NH 2QM4A 3T1YB 5B66Z 3ZEDA 5DECA 2VQEO 3ZHUA 5EBMC 3SGIA 5LHIA 2JGDB 4UCUA 4EKWA 2JK5C 2X7RB 1AJQA 1R3KC 2ZE7A 4U3JB 1LNQA 2ODMA 3A8TA 1KC8W 2YIBA 3G6BA 3E35A 2YXYA 3BVOA 4TV8A 1S76D 4R6ZA 3B8MA 2Q5ZA 1TUEB 4DYLA 2CGNA 3DC6A 1LUWA 4MS2A 2YS8A 2K1EA 4TV9A 3ZMUA 2A0LA 1IXBA 4UFZA 1SQBH 4X1IB 1JJ2U 3CRQA 1HNZB 3K0DA 3CCUV 4B3TB 1VF7A 2YXHA 3U11A 5K1XA 4I4TB 3PN1A 4JI8B 3KCXA 2EULA 3CSXA 1VQNV 3K0GA 1YIJV 4O4IA 2LFSA 4ZI7A 1I7FA 1Y76A 4JTDB 1GM9A 1N34B 3DC5A 5LYJB 1JCHA 3LDEA 3RYHA 1MSDA 1NTZH 3W7XA 2P90A 2W0FC 2YIAA 4BIUA 1VQOV 2HVJC 5KAIZ 1OCRC 3FX7A 1HR0B 5KX5B 4CH5A 1FS0G 3JARA 3CRAA 2Y69B 2PYLA 4DV5B 3CJHB 4K8ZA 3A0HZ 3JAMN 4J11A 4OXSA 2Q73A 5L3GA 4YIOA 2D2CB 5CA0B 4QIWF 4UCSA 1M5IA 5BZBA 3BAAA 2L35A 4DV0O 1THZA 3J81N 4UUJC 1N36B 3T4DA 4DUZB 2P4KA 4MVZA 4NXNO 5FLXN 3SPJA 1UPGA 4Z1VA 2E74B 5KMGA 3S3WA 1K34A 3W7TA 1I5YA 4QPJA 4DR6B 1AVMA 1JFFA 4BR6A 1BSMA 1GM7A 2B5UA 4EFBA 1HP8A 3T1HO 4DV1B 3JATA 1LR1A 3RGBA 4DRXB 2AHYA 2IJKA 4YY3B 3P3NA 5L3FA 1KQSU 2ZXWC 3IAYA 4DR2B 4IYHA 4UVBA 2LP7A 2BSKA 1K97A 3K04A 2CE4A 2LQTA 3JAKB 5IYDO 1I5XA 5JVDA 5KHKA 2V4DA 1M93A 2HJFC 3E8GA 1Q43A 4UVAA 3GVMA 3OD4A 2FYUH 2VQEB 4HBNA 4HNAB 3WU2Z 1U97A 5EBWC 3RYHB 3ZHVA 2P22C 5H6QA 3F7YC 4RO2A 4YHHO 4WFFA 1KKCA 2XOKG 3HKDB 5BXZA 1XNRB 2W6JG 4PA9A 1SS3A 1NVPB 2EILC 3IC9A 1K5SA 1PM9A 4J7JA 1M56B 3L9DA 2WLNA 1PKXA 1KP2A 1W0KG 2XAGA 1SQXH 3VQXA 1R6NA 2WAMA 2XAJA 2P67A 1S5LZ 1QBZA 4DV2B 3CCLV 3C90A 1MG1A 2GBOA 4YXWG 1VQ4V 3FKSG 1M56C 1IBKO 5K1PA 3LNMB 1NH2D 4K8XA 4UB6Z 1HDJA 2WSSG 3ZJZA 3X2QB 4FLVA 2JJ2G 2QWOB 5LMNB 2QKAA 4HNAA 1ROPA 2QWQB 4X65B 1FXHA 1N32O 1XBLA 1WB8A 1SF9A 1SZXA 4LF4B 2WLLA 2ADQB 2EZPA 2LGQA 1MZEA 5IJ9A 2UXNA 3OEEG 1I94B 3K06A 1G4YB 3AEIA 1T5EA 5FNVB 2RQ6A 4P2ZA 5FNVA 4TUYA 3OTOO 1PL4A 1XNQB 4LF4O 4GKJB 4FLUA 3Q4HA 1H38A 4ICGA 2NNUA 4JYAO 5B1NA 2ITDC 1K3EA 4JTCB 4YIPA 2KSDA 1GKFA 2X0LA 3HKBB 4LF5B 3LUTB 2DOSA 2FMLA 5LP6B 3RYIB 1FXKA 4H37A 4O4JB 5LHGA 2EJRA 3K5OA 3JALB 4PA3A 4CS2A 3EHBB 4MVRA 5BR8O 3TGUH 3ABMC 3MHSC 3OGCC 4CH6A 1XNQO 4X9QA 1NBMG 5L3CA 3WB1A 5JQGB 1KECA 2GTSA 3QNEA 1R3JC 4LWSB 5LHHA 1SC5B 2CTWA 2QSAA 3ZX6A 5CA3A 1P84F 4TSFG 1BQZA 2KKWA 1K5QA 2V7QG 4MTGA 1OCZB 1URFA 1F7YA 2DWEC 4D7TA 1IBMB 4NXNB 2A9HA 5LMNO 5LYJA 1OV9A 4LFBO 3G67A 5IWAB 3AK2A 3TXSA 1NVPD 3BHPA 3VOUA 4A5UB 4F6RA 5B1AB 4X1KA 2DN9A 1Y74B 1N0NA 2QTSA 3PJSK 4FMTA 2H3OA 1RPRA 3T4ZA 3SJCC 3K9SA 2RN9A 5CBFA 2MK3A 3TJTA 1XMQO 4QJFB 3ZS8C 2UUCB 4F4LA 4TQFA 1KU9A 2IJHA 2ZCEA 1KYOF 2GV9A 3CCJV 1GRJA 3LNNA 3NXSA 1K33A 4PELA 1WNSA 3UM7A 1SETA 1S72V 2UXDB 3RT3C 2YIDA 5CB4A 5EC1C 1BL8A 2CTRA 5CA1B 2AZ0A 1EN5A 1JVMA 2VS0A 2EIJC 3OEHG 3ZCCA 3OFNG 5IT9N 4X8AA 1IBLO 2YI8A 3AG4C 2BTQA 1WN7A 4FFKA 3ASNC 3RFRA 4JI8O 1D2DA 1Q5OA 2R9RB 2CTPA 2ZE8A 3JD2A 1EN4A 1TA8A 2LGWA 4NYKA 2HG5C 4LR3A 3B77A 2M6YA 2QJ1A 1US6A 4J10A 4PDRA 3CJHA 3F5TA 1FXKB 1R3LC 4QNHB 4DR3O 2R9AA 1B06A 2LFRA 3M8AA 1VIBA 4AI8A 3RW0A 4OPHA 1YF2A 3K59A 2UXDO 3ABLB 4RUEA 4LF6O 3UO3A 3ZHRA 4PDMA 1FYJA 1WA8A 3M99B 1Q6UA 1Y76B 5EBLC 2OYQA 2HEPA 2IH1C 4X62O 3L75H 1XMQB 3BABA 1RSOA 3JSLA 2BOBC 3ABMB 2Y48A 4KP4A 2ZKOA 3N2GA 2YICA 1QCEA 4DV7B 1IBLB 1VARA 4DR1O 3ZMVA 2CDYA 3ABUA 4MVUA 4WFAV 2VQFB 4X1YB 1TUBA 2WWWA 4KHPB 2RJZA 5B1BC 4JI2O 4X89A 3I5DA 4DR4B 4P9PA 2FTKA 2OCCC 4PI0A 4ASUG 3DSQA 1AB3A 5JH7A 1HNZO 1DLBA 5B1BB 2ZM6B 1XL4A 5JH7B 3JASB 3SPHA 2QWNB 1WP8A 2FL4A 5FPOA 4UV9A 2P7TC 3ZRXA 2BSKB 2JGUA 3JAKA 3APQA 2UUBO 5IJ0B 1AILA 3APOA 4LF8B 2KG7B 3CCVV 1V54C 2FB5A 3R65A 1K92A 1XILA 1K4CC 3QF7A 2D3OW 4PA7A 4GKJO 1JOYA 4WFEA 2Y0IA 5GTHZ 5LMUO 4R50A 5JCOC 3NR7A 1GN2A 2Z5UA 3IGAC 4GYCB 2IU3A 5D5QA 1PL0A 4OX9B 2PTMA 2WPDG 2ATKC 2ZT9B 3CC2V 4EEQA 3ZIAG 3CXCU 4JI4O 2QGNA 4JI6B 2NLJC 3IFXA 1P49A 2R9IA 2P4VA 2F66C 4IYIA 1NJIW 1SESA 3IJ4A 3CWBH 5H9CA 2XT9A 3ZHTA 4LP8A 1JX9A 1AP5A 1IBKB 1SRYA 5CB4B 4FZ0A 2F23A 1W2BU 5E1AC 3RYFB 5IE9A 3CC7V 4HYOA 1NT2B 3EFFK 3CB2A 1GO3F 3B40A 3CMAV 4D7SA 4X66B 1FD9A 1XNRO 1ZWIC 3EVKA 5D5PA 3X2QC 4XDKA 2R72A 1MSWD 1L8DA 2VRZA 3ETGA 3CCSV 2WLHA 2PY5A 4DR5B 1H8EG 2Q4PA 3AG3B 4TUYB 2Q7HA 3QO8A 2F4VO 3U0ZA 3SYAA 3H1KH 4MVQA 5FPRA 1VEWA 3LSUA 3J80N 5LP6A 3RBZA 2DYSB 4NTYA 1FPOA 1MOFA 3B4SA 4W4LA 1S3JA 3OW2U 2HHHB 4WF9V 3E8FA 1YJWV 4JV5B 2UXBO 3RYIA 3CE2A 4AILC 3OAAG 2ZDIA 3K03A 4TOIA 2EILB 4O4LB 1SQGA 2EIMC 4B08A 2UU9B 2XTAA 1RM1B 3P30A 2ARHA 4AQYO 4W4KA 1G6UA 2GDSA 3BA9A 4ZOLA 1M57C 4LFCB 4I50A 1QVFU 1SQPH 1S5JA 4JTAB 4JAUA 2KQXA 1K73W 3CP1A 4JI4B 1O9HA 2X6BA 3HKCA 3CYOA 1NKDA 2BE3A 4DUYO 3HKCB 4TT3G 4Z2WA 3OM3B 2ZDIC 1WPXA 2PUSA 3BCCH 3UQ8A 1FKAO 1XQ8A 3FB7C 3SYCA 4J42A 4B3MO 1NQTA 3UT5A 1HNXO 2WLKA 4FJCC 3KCYA 1IURA 1D5AA 2DQ3A 4X66O 1Z5WA 4BW9A 3JCUZ 4QE7A 1VQMV 1GN6A 1BCCH 2JDIG 1QQCA 2Q8VA 2FKXA 3HKBA 1NR1A 3K3WA 4F6RB 2H8PC 3ZMZA 2Q9LA 3D36A 1GAXA 4U3JA 1VQ8V 2DJVA 4FZ1A 3CRMA 2Q67A 4PDLA 3RYCB 1H2MA 2DWDC 2BTQB 5IJ0A 3H1HH 3OT7A 3ZN0A 1JA8A 5JQGA 5C8YA 4LNUB 3D36C 2Z0AA 2EIKC 4DV7O 1BE3H 4NKGB 3VQYA 1BT8A 1YZBA 2F43G 3THOA 1OZ0A 4DR1B 1VQPV 4B7KA 1EZJA 2OWOA 4O2AA 3EXAA 2Q0AA 4QE9A 1QLNA 2EX3A 2A3QA 4X20B 4UCVA 2ZR3A 1YI2V 2QR4A 2DQ0A 4NTXA 3TCUA 3GWKC 2C2AA 1I0HA 4IGGA 2QWPB 5JJNB 4LF8O 2ZE5A 3RVZA 4DW0A 1XI1A 5A9GA 5FL7G 1JFFB 3LSSA 4JGSA 5JVDB 2ZR2A 4DK1A 5IDJA 2ZINA 2PGGA 2WLJA 2OTLV 2UUBB 4YY3O 4GZRB 5CA0A 3DXRA 2QKSA 2Q0OC 3ETQA 4I0XB 5J9PC 3WFVA 4RWUA 2JS5A 4NXMB 1XREA 1SA0B 1KBHA 4JF3A 4B3TO 1M9NA 1UFIA 4Q6GA 4K3AA 2HKOA 2Y0PA 3K08A 5H5NA 4AHCA 1Y66A 4KL1A 2CK3G 4NTWA 2F1MA 4IHJB 5KMGB 1SERA 2Q68A 4JI0O 5KX5A 1N4CA 4N23A 2A79B 3JARB 2K9PA 3UKMA 4GKKB 2UU9O 3A0BZ 4DXWA 1VQKV 4H13B 3JATB 4DRXA 5J2UA 3G71V 2EINC 2AGAA 1YJNV 4BIOA 3JYCA 1V55C 1P7BA 4H0LB 4ZHQA 2UUCO 3L73H 4GKKO 1HR0O 1XHXA 3L71H 1W59A 3I56V 3JASA 1DF5A 2L6LA 3D3IA 4LBEC 3ABLC 5C8YB 2CAZC 2PYJA 5LGTA 3ZHSA 1VMGA 4DR5O 5EC2C 1RSOB 3I55V 5ITZA 1YVWA 4J7ZA 3AG1B 1AR1B 3AG2B 2ZQMA 1HNXB 2JVDA 4JZGA 5KA5A 4JI1B 1J5EB 3ZMTA 4JAAA 4Z1MG 1S5HC 4I0XA 4MTFA 2QWRB 3JD0A 1TAEA 3JD3A 3OUFA 1AP6A 4TV8B 4K35A 5KHJA 1EFRG 5B5EZ 2YEVB 2YI9A 1Y6XA 2EIMB 4UB8Z 4MW3A 4H33A 1NTMH 2YDEA 3QVNA 3FD9A 3BPZA 4LFAB 3SR2C 2BTOA 3WB2A 3MAQA 4LFCO 2RNBA 1VP7A 4LF5O 1VQ9V 4LWSA 4I50B 2IJJA 1AJPA 4CC5A 2YC0A 2F93B 1OCOB 4OPAA 2HLDG 1FAFA 2AZ2A 1EZVH 4JI3O 1RPOA 5EYPA 2ITCC 5J2UB 4RUFA 4CS4A 2DMXA 4DO2A 1H2GA 3K5NA 3H1JH 3UCSC 4YJ2B 2X6AA 4Q20A 1EM1A 3G6EV 4DR7O 1L1FA 4BWAA 1YTFD 1N32B 4K0KO 1ZX3A 3L70H 5B3SC 3AK1A 4JI3B 1OCCB 2Y4UA 1TGOA 1MMMA 2JEXA 4LFBB 5CBGA 4UCTA 2H94A 2XUMA 4J41A 4WFHA 3CCEV 1QLEB 2IH3C 3TETA 4GT1A 3AG3C 2NR5A 5LGNA 1IDSA 1FJGB 1AR4A 1JJOA 4PHZA 2YIBD 4JI7B 2DYRC 3ASOB 3OR6C 4DR4O 1ZAUA 4YJ2A 1LUVA 5JJEB 2NN4A 2W0XA 4I9QA 3VQWA 1O9GA 2VQFO 4JI6O 4HZ3A 1SA0A 3N2KA 4L8JA 4MVMA 3D3QA 3CXHF 1HWYA 2ADPA 1CPYA 1N0JA 4DV3B 3JD4A 1YSCA 2B9ZA 1B6QA 4O2AB 1FXKC 4BW5A 1X59A 2IBZH 4H44B 3GWOA 4PDVA 1R73A 1WB7A 5CBHA 1HW7A 1H2NA 1E1QG 1Q7YW 2AHZA 2CH7B 4JZ2A 4E2LA 2F95B 3UT5B 4DR2O 3SPIA 5JJJB 3MD0A 3W7SA 3E89A 3DXRB 2XNDG 2JRIA 1IVSA 2DE0X 3WB0A 3AG2C 4MTXA 3HR0A 1PNMA 4FLYA 1G1XB 3AG1C 2W6IG 1ZSPA 2KB1A 1QU7A 2ZE6A 2QEXV 3N2KB 4LCUC 2WA4A 4PD4F 1FFXB 4JAVA 2ZIOA 3VBBA 1WA8B 3K57A
chains in the Genus database with same CATH topology
4AQYO 4DR5O 3F5TA 4JI7O 4GKJO 2E5LO 4YHHO 5A2QN 5LMUO 4DV6O 3JAMN 4DR3O 5BXZA 4DUZO 3M8AA 1FJGO 3SDLA 4OPHA 5BY1A 2UXDO 4DR4O 1A32A 4JI1O 4LF8O 4X65O 1R6TA 4DV0O 4LF6O 4DUYO 3J81N 4DV1O 1F7YA 2VQEO 4JI4O 2N74A 5IWAO 5LMNO 4B3RO 1FYJA 4LFBO 2UUAO 4YY3O 2VQFO 1N33O 4JI6O 4NXNO 1I94O 4A5UB 1IBKO 4B3SO 4X62O 5FLXN 1FKAO 2ZKOA 3T1YO 4B3MO 1HNXO 4DV2O 4DR1O 4KHPO 1XMQO 1X59A 4DR6O 4LFCO 2ZM6O 4DV4O 4LF5O 4X66O 4B3TO 1DK1A 1N36O 3T1HO 1N32O 5H5NA 2FKXA 4OPAA 4JI2O 3RT3C 4JI3O 2DJVA 4LF7O 2LW7A 4NXMO 1XNRO 1AB3A 4DV5O 2HHHO 4DR2O 1HNZO 5LL6Y 1IBMO 4JI0O 3OTOO 4JI5O 4LF4O 4DR7O 1KUQA 5IT9N 2F4VO 2JRIA 1IBLO 4JYAO 2UU9O 4DV3O 4K0KO 2UUBO 4JV5O 3J80N 4JI8O 1G1XB 1D2DA 1AILA 1NS1A 1XMOO 2DOSA 4X64O 1N34O 2AGAA 4LFAO 2UXBO 1HNWO 4OX9O 2Z0AA 4DV7O 1YZBA 2UUCO 3J7AU 4GKKO 5BR8O 1XEQA 1HR0O 4LF9O 3R66A 2UXCO 1R1BA 1XNQO 3O65A 1J5EO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY O;  4DR5 O;  3F5T A;  4JI7 O;  4GKJ O;  2E5L O;  4YHH O;  5A2Q N;  5LMU O;  4DV6 O;  3JAM N;  4DR3 O;  5BXZ A;  4DUZ O;  3M8A A;  1FJG O;  3SDL A;  4OPH A;  5BY1 A;  2UXD O;  4DR4 O;  1A32 A;  4JI1 O;  4LF8 O;  4X65 O;  1R6T A;  4DV0 O;  4LF6 O;  4DUY O;  3J81 N;  4DV1 O;  1F7Y A;  2VQE O;  4JI4 O;  2N74 A;  5IWA O;  5LMN O;  4B3R O;  1FYJ A;  4LFB O;  2UUA O;  4YY3 O;  2VQF O;  1N33 O;  4JI6 O;  4NXN O;  1I94 O;  4A5U B;  1IBK O;  4B3S O;  4X62 O;  5FLX N;  1FKA O;  2ZKO A;  3T1Y O;  4B3M O;  1HNX O;  4DV2 O;  4DR1 O;  4KHP O;  1XMQ O;  1X59 A;  4DR6 O;  4LFC O;  2ZM6 O;  4DV4 O;  4LF5 O;  4X66 O;  4B3T O;  1DK1 A;  1N36 O;  3T1H O;  1N32 O;  5H5N A;  2FKX A;  4OPA A;  4JI2 O;  3RT3 C;  4JI3 O;  2DJV A;  4LF7 O;  2LW7 A;  4NXM O;  1XNR O;  1AB3 A;  4DV5 O;  2HHH O;  4DR2 O;  1HNZ O;  5LL6 Y;  1IBM O;  4JI0 O;  3OTO O;  4JI5 O;  4LF4 O;  4DR7 O;  1KUQ A;  5IT9 N;  2F4V O;  2JRI A;  1IBL O;  4JYA O;  2UU9 O;  4DV3 O;  4K0K O;  2UUB O;  4JV5 O;  3J80 N;  4JI8 O;  1G1X B;  1D2D A;  1AIL A;  1NS1 A;  1XMO O;  2DOS A;  4X64 O;  1N34 O;  2AGA A;  4LFA O;  2UXB O;  1HNW O;  4OX9 O;  2Z0A A;  4DV7 O;  1YZB A;  2UUC O;  3J7A U;  4GKK O;  5BR8 O;  1XEQ A;  1HR0 O;  4LF9 O;  3R66 A;  2UXC O;  1R1B A;  1XNQ O;  3O65 A;  1J5E O; 
#chains in the Genus database with same CATH topology
 4R7C A;  1BGY H;  3E83 A;  4UCR A;  1R3I C;  4O4H A;  2ZD9 A;  5J2T B;  5GTI Z;  4CH3 A;  1KP3 A;  3SJQ C;  4FLZ A;  2QDO A;  3H1L H;  1R6T A;  2ILM A;  4N21 A;  1RFY A;  3K5M A;  2N74 A;  5LGU A;  2YXL A;  3SYP A;  1MZF A;  1TVK B;  3STL C;  4MT8 A;  2ZIM A;  2HFE C;  3L74 H;  3QO5 A;  1PNK A;  3AG7 A;  1COW G;  3TXQ A;  4JAS A;  1BQ0 A;  4ZKI A;  2GUZ A;  3JAW B;  3FYE B;  4KHP O;  2OIE A;  2RMK B;  1OJH A;  4DR3 B;  4B3R B;  1YDX A;  4DV4 O;  3RVY A;  5ITZ B;  4I4T A;  2Q69 A;  3WG7 B;  4D6T H;  1VQ6 V;  1ORQ C;  1V9P A;  2OIG A;  3ZN1 A;  3OR7 C;  3BA8 A;  4DW1 A;  5DM6 V;  3T1H B;  1WP7 A;  1GMG A;  1NI8 A;  1VF5 B;  3S3X A;  2LW7 A;  4NXM O;  5EK0 A;  2CTQ A;  1AI6 A;  1F4M A;  4LF6 B;  4KFM A;  3U10 A;  3T2M A;  2ETN A;  1H8H G;  3T1C A;  4ZI7 B;  5B1O A;  5BR8 B;  5EZY B;  4KXR A;  1QNM A;  2HP8 A;  3C3T A;  1JPX A;  2UUA B;  1J95 A;  1HNW O;  4J80 A;  3CCR V;  2XAQ A;  1FFT B;  3DGE A;  2LW1 A;  1PNL A;  3B8N A;  4B3M B;  4I5S A;  3AG4 B;  2EIJ B;  5GON B;  3FB5 C;  2EIK B;  4WCE V;  1JR9 A;  2X6C A;  1JQ0 A;  3ASN B;  4GUN A;  5IYC O;  2EIN B;  4C7U A;  4GX5 A;  2HJD A;  1YEW A;  2R70 A;  4BAY A;  3Q4H B;  3RN4 A;  1XOU A;  1A32 A;  1CXZ B;  4X1K B;  3N2G B;  5KAF Z;  3K5L A;  2QA4 V;  1QVG U;  3CPW U;  1Q86 W;  3HB3 B;  4FLT A;  1EBO A;  5IWA O;  4B3R O;  4J9Z B;  2YEV A;  1N33 O;  5J2T A;  1XDC A;  3OMI B;  1B04 A;  2WLL B;  1WLE A;  2Y69 C;  3VQV A;  4XDJ A;  1E1R G;  4O4I B;  1JMK C;  2BCC H;  5CMU A;  2WLI B;  4X62 B;  3CX5 F;  3ZHQ A;  3CC4 V;  3A0R A;  3ABK B;  3OTF A;  1SZT A;  3QG5 A;  1ZTE A;  3LSQ A;  3SYQ A;  5LOV A;  1ARO P;  2HVK C;  3OMN B;  4QPK A;  4FLX A;  1NTK H;  5KLV H;  3ABT A;  3RYC A;  1FXV A;  4FM0 A;  1X4T A;  1VQ7 V;  4ZHQ B;  1NZ6 A;  1W0J G;  5LL6 Y;  2AXT Z;  1K7D A;  4NVP A;  4I7Z B;  5DED A;  4YHH B;  1IBM O;  1YCI A;  4PI2 A;  5KUK A;  1ZL8 B;  4WFB V;  1BHB A;  1PV0 A;  2IM9 A;  2WA3 A;  3ASO C;  1QHT A;  3F5W C;  3KKY A;  4OGQ B;  3FFQ A;  1BHA A;  3RWR D;  3SYO A;  4BIZ A;  5C93 A;  2QKC A;  1EN6 A;  1U96 A;  4CC6 A;  4DUY B;  2Q6A A;  3UO2 A;  3KG2 A;  1Q6H A;  1GN4 A;  3ZRW B;  4GX0 A;  1XEQ A;  4MSW C;  5L3B A;  3R66 A;  1GK9 A;  1OCZ C;  3B2E E;  1P7G A;  2PF4 E;  2RDC A;  5EIB D;  2E5L O;  3OE7 G;  2Q7E A;  3K58 A;  1SQQ H;  5L3E A;  2VWJ A;  1MA1 A;  1M4U A;  1WPB A;  2GSM B;  2ZNI A;  1YHQ V;  4DV1 O;  1TVK A;  2IU0 A;  2UXB B;  3FAV A;  5KHH A;  1I94 O;  4B7E A;  5IYZ B;  4L87 A;  1OCO C;  3OUS A;  4I55 B;  4P30 A;  5HFM A;  4FFB A;  4LF9 B;  3L72 H;  2E75 B;  3F7V C;  4PV1 B;  3ZRW A;  1S0V A;  4XBF A;  4FIP C;  2QM7 A;  2JGD A;  1N36 O;  5TIS Z;  3TK1 A;  4DV0 B;  1NU1 H;  1KD1 W;  1K9M W;  2WLM A;  5EIB C;  3CHX A;  5B3S B;  4JPR A;  1XHZ A;  5LXT A;  4RAI A;  5LA6 A;  1DF4 A;  4PA6 A;  4CZZ A;  4LH6 A;  1KUQ A;  3HPL C;  3IC7 A;  1Q81 W;  2BOC C;  5EZY A;  2N04 A;  3MDS A;  1CP9 A;  5H2F Z;  1V54 B;  4TWK A;  4JI2 B;  1XL6 A;  3ZRV A;  4MW8 A;  1XMO O;  3CEI A;  1ENV A;  3OGI B;  4ZOL B;  4LFA O;  4UXN A;  4OX9 O;  2OCH A;  5HFL A;  2CH7 A;  1FFX A;  5DN6 G;  2IJI A;  2PI4 A;  4IT5 A;  3E8H A;  1F4N A;  3CRR A;  4GX1 A;  4F6E A;  4EFE A;  3ETD A;  1Z5V A;  2VWK A;  4IHJ A;  3SJB C;  1GTO A;  5LMU B;  1ZUQ A;  2EZO A;  3GB7 C;  4LC1 A;  3CD6 V;  1OCR B;  1MNG A;  3LDC A;  3SDL A;  3QTC A;  4O4J A;  3ZMS A;  4X65 O;  4X88 A;  1YIT V;  4WBN B;  1IXM A;  2JJ1 G;  4NR1 A;  3CS5 A;  2UUA O;  2A7W A;  1M1K W;  2OTJ V;  4B3S O;  4IIJ B;  1KKD A;  1P4R A;  3H01 A;  2PI5 A;  3BEH A;  2V1D A;  4JYC A;  5KA6 A;  1UJW B;  3E22 B;  3W7U A;  3P3P A;  5CA1 A;  2QE7 G;  3C3S A;  5GON A;  4DV2 O;  5KHG A;  3A2F A;  1AI7 A;  4PA4 A;  4DR6 O;  2ZM6 O;  4FFB B;  2B1G A;  4FM2 A;  1DK1 A;  5AG2 A;  3STZ C;  4RQE A;  2GTA A;  2O57 A;  1Q6I A;  2Z3Y A;  1QR9 A;  2RCV A;  1DGS A;  1G8M A;  4X1I A;  1N33 B;  1ZL8 A;  1MAB G;  2XAF A;  4IL6 Z;  1YJ9 V;  4XDL A;  4DV6 B;  4DV4 B;  5JWP A;  2YUA A;  4ZBM A;  3ABK C;  1Y67 A;  3W7W A;  1VQL V;  4FLW A;  2G38 A;  4YJ3 B;  1VF6 A;  5L3D A;  1PPJ H;  4YJ3 A;  3JD1 A;  1WJZ A;  1S77 D;  4J7K A;  5LXT B;  4CS3 A;  2E3C A;  3D8C A;  4P9O A;  1L0L H;  3B09 A;  1KMI Z;  2A06 H;  2PZS A;  2UXC O;  3ZBH A;  1B3Q A;  2JS3 A;  4JI0 B;  2JIZ G;  2HR3 A;  1Q90 D;  1HNW B;  2P5O A;  4JI5 B;  1WAZ A;  1I08 A;  5A2Q N;  2P06 A;  3ZRS A;  2DW4 A;  4U7N A;  4R8C A;  1N8R W;  4G27 B;  3ML0 A;  3DTU B;  1OHH G;  5BY1 A;  3E2E A;  5IYZ A;  5BMV A;  1BZK A;  2XAS A;  1YTF B;  4E4E A;  4FVM A;  3CRC A;  5BMV B;  4MVO A;  3SPG A;  1V55 B;  1NH2 B;  1H2K A;  3JSN A;  4FPP A;  4JYB A;  3HKD A;  4DK0 A;  1GM8 A;  3P32 A;  1AI4 A;  2IW5 A;  4G28 B;  4O4H B;  3T1Y O;  2Q7G A;  3G4S V;  4JYY A;  1ZLZ A;  4O4L A;  3JCZ A;  1AI5 A;  2AW9 A;  2QTO A;  3AK3 A;  2B1I A;  4HAM A;  1Q8I A;  4MVS A;  1XMO B;  3O9O A;  1VF6 C;  5B1A C;  5GW7 A;  5EYP B;  4QGP A;  3OMA B;  4JYA B;  2Y4T A;  4LF7 O;  1BMF G;  1Q3E A;  1H2L A;  4DV5 O;  2HHH O;  5KHI A;  4X64 B;  3WG7 C;  1PP9 H;  1SQF A;  1SKV A;  4CH4 A;  4I9W A;  3LDD A;  1RM1 C;  2CUG A;  5LOV B;  4B3S B;  4DV3 O;  2F4V B;  3CME V;  2E76 B;  4I55 A;  4GX2 A;  1DTO A;  1CEZ A;  3K79 A;  3M7M X;  4NB5 A;  2LJ2 A;  1M57 B;  4UVC A;  3FB8 C;  3H9V A;  3FB6 C;  3KZI Z;  1N34 O;  1GH6 A;  1SQV H;  1PD3 A;  3J7A U;  2EBO A;  4EB6 A;  4LF9 O;  3MHH C;  3E86 A;  5F2V O;  4U3F H;  3O65 A;  4ABM A;  5LP6 C;  5LBQ A;  4DR7 B;  4JI7 O;  1K4D C;  2QM8 A;  1GN3 A;  1TUB B;  4X1Y A;  1D5N A;  2CGO A;  3QO7 A;  5IY5 B;  2YSU B;  1OCC C;  4KUM A;  4LF7 B;  1FJG O;  3G80 A;  4IIJ A;  2EJ7 A;  4WBN A;  2KG7 A;  2WLI A;  3BY6 A;  1F51 A;  2N05 A;  5IY5 C;  3BFR A;  1NR7 A;  1QLE C;  4O2B A;  1H2S B;  4J9Y B;  3RYF A;  3ICX A;  4O2B B;  5IYB O;  2OT5 A;  4UV8 A;  3FYI B;  3FAV B;  5KUM A;  3E22 A;  2E5L B;  1XUQ A;  4FK5 C;  1KB9 F;  3SPC A;  2XHB A;  4K0K B;  4ZIB A;  3K9A A;  3OTO B;  2DYR B;  4TQD A;  2JEU A;  1QR8 A;  4GCZ A;  5H6R A;  1F23 A;  3CCQ V;  4LH7 A;  4X20 A;  2DYS C;  4TV9 B;  4GLX A;  1Y74 A;  1Q82 W;  4EB6 B;  1M90 W;  1YXB A;  1E79 G;  3CCM V;  4U7O A;  1IX9 A;  1Y4M A;  2MW2 B;  4RQF A;  1IZ3 A;  5IJ9 B;  3ETE A;  4AQY B;  3BRC A;  1BS3 A;  1Z2G A;  1AR5 A;  5LA6 B;  4JI5 O;  2XAH A;  4FM1 A;  3E8B A;  5JCO A;  2UXC B;  5E79 Z;  4JV5 O;  2P6J A;  4UCO A;  1NS1 A;  4X64 O;  1K8A W;  2GHY A;  2GUZ B;  3JAW A;  2OCC B;  2LO1 A;  3SJA C;  4CBC A;  2M7W A;  3JAL A;  1R1B A;  1R6K A;  5CN0 A;  2ZXW B;  3HKE B;  4JI1 O;  1J5E O;  4G2K A;  4WFG A;  1RP3 B;  4PJ0 Z;  3HKE A;  1VQ5 V;  4DV6 O;  2UXX A;  4LNU A;  1AJN A;  3N27 A;  3H1I H;  4DUZ O;  2ZNJ A;  4MTO A;  1L0N H;  2QM4 A;  3T1Y B;  5B66 Z;  3ZED A;  5DEC A;  2VQE O;  3ZHU A;  5EBM C;  3SGI A;  5LHI A;  2JGD B;  4UCU A;  4EKW A;  2JK5 C;  2X7R B;  1AJQ A;  1R3K C;  2ZE7 A;  4U3J B;  1LNQ A;  2ODM A;  3A8T A;  1KC8 W;  2YIB A;  3G6B A;  3E35 A;  2YXY A;  3BVO A;  4TV8 A;  1S76 D;  4R6Z A;  3B8M A;  2Q5Z A;  1TUE B;  4DYL A;  2CGN A;  3DC6 A;  1LUW A;  4MS2 A;  2YS8 A;  2K1E A;  4TV9 A;  3ZMU A;  2A0L A;  1IXB A;  4UFZ A;  1SQB H;  4X1I B;  1JJ2 U;  3CRQ A;  1HNZ B;  3K0D A;  3CCU V;  4B3T B;  1VF7 A;  2YXH A;  3U11 A;  5K1X A;  4I4T B;  3PN1 A;  4JI8 B;  3KCX A;  2EUL A;  3CSX A;  1VQN V;  3K0G A;  1YIJ V;  4O4I A;  2LFS A;  4ZI7 A;  1I7F A;  1Y76 A;  4JTD B;  1GM9 A;  1N34 B;  3DC5 A;  5LYJ B;  1JCH A;  3LDE A;  3RYH A;  1MSD A;  1NTZ H;  3W7X A;  2P90 A;  2W0F C;  2YIA A;  4BIU A;  1VQO V;  2HVJ C;  5KAI Z;  1OCR C;  3FX7 A;  1HR0 B;  5KX5 B;  4CH5 A;  1FS0 G;  3JAR A;  3CRA A;  2Y69 B;  2PYL A;  4DV5 B;  3CJH B;  4K8Z A;  3A0H Z;  3JAM N;  4J11 A;  4OXS A;  2Q73 A;  5L3G A;  4YIO A;  2D2C B;  5CA0 B;  4QIW F;  4UCS A;  1M5I A;  5BZB A;  3BAA A;  2L35 A;  4DV0 O;  1THZ A;  3J81 N;  4UUJ C;  1N36 B;  3T4D A;  4DUZ B;  2P4K A;  4MVZ A;  4NXN O;  5FLX N;  3SPJ A;  1UPG A;  4Z1V A;  2E74 B;  5KMG A;  3S3W A;  1K34 A;  3W7T A;  1I5Y A;  4QPJ A;  4DR6 B;  1AVM A;  1JFF A;  4BR6 A;  1BSM A;  1GM7 A;  2B5U A;  4EFB A;  1HP8 A;  3T1H O;  4DV1 B;  3JAT A;  1LR1 A;  3RGB A;  4DRX B;  2AHY A;  2IJK A;  4YY3 B;  3P3N A;  5L3F A;  1KQS U;  2ZXW C;  3IAY A;  4DR2 B;  4IYH A;  4UVB A;  2LP7 A;  2BSK A;  1K97 A;  3K04 A;  2CE4 A;  2LQT A;  3JAK B;  5IYD O;  1I5X A;  5JVD A;  5KHK A;  2V4D A;  1M93 A;  2HJF C;  3E8G A;  1Q43 A;  4UVA A;  3GVM A;  3OD4 A;  2FYU H;  2VQE B;  4HBN A;  4HNA B;  3WU2 Z;  1U97 A;  5EBW C;  3RYH B;  3ZHV A;  2P22 C;  5H6Q A;  3F7Y C;  4RO2 A;  4YHH O;  4WFF A;  1KKC A;  2XOK G;  3HKD B;  5BXZ A;  1XNR B;  2W6J G;  4PA9 A;  1SS3 A;  1NVP B;  2EIL C;  3IC9 A;  1K5S A;  1PM9 A;  4J7J A;  1M56 B;  3L9D A;  2WLN A;  1PKX A;  1KP2 A;  1W0K G;  2XAG A;  1SQX H;  3VQX A;  1R6N A;  2WAM A;  2XAJ A;  2P67 A;  1S5L Z;  1QBZ A;  4DV2 B;  3CCL V;  3C90 A;  1MG1 A;  2GBO A;  4YXW G;  1VQ4 V;  3FKS G;  1M56 C;  1IBK O;  5K1P A;  3LNM B;  1NH2 D;  4K8X A;  4UB6 Z;  1HDJ A;  2WSS G;  3ZJZ A;  3X2Q B;  4FLV A;  2JJ2 G;  2QWO B;  5LMN B;  2QKA A;  4HNA A;  1ROP A;  2QWQ B;  4X65 B;  1FXH A;  1N32 O;  1XBL A;  1WB8 A;  1SF9 A;  1SZX A;  4LF4 B;  2WLL A;  2ADQ B;  2EZP A;  2LGQ A;  1MZE A;  5IJ9 A;  2UXN A;  3OEE G;  1I94 B;  3K06 A;  1G4Y B;  3AEI A;  1T5E A;  5FNV B;  2RQ6 A;  4P2Z A;  5FNV A;  4TUY A;  3OTO O;  1PL4 A;  1XNQ B;  4LF4 O;  4GKJ B;  4FLU A;  3Q4H A;  1H38 A;  4ICG A;  2NNU A;  4JYA O;  5B1N A;  2ITD C;  1K3E A;  4JTC B;  4YIP A;  2KSD A;  1GKF A;  2X0L A;  3HKB B;  4LF5 B;  3LUT B;  2DOS A;  2FML A;  5LP6 B;  3RYI B;  1FXK A;  4H37 A;  4O4J B;  5LHG A;  2EJR A;  3K5O A;  3JAL B;  4PA3 A;  4CS2 A;  3EHB B;  4MVR A;  5BR8 O;  3TGU H;  3ABM C;  3MHS C;  3OGC C;  4CH6 A;  1XNQ O;  4X9Q A;  1NBM G;  5L3C A;  3WB1 A;  5JQG B;  1KEC A;  2GTS A;  3QNE A;  1R3J C;  4LWS B;  5LHH A;  1SC5 B;  2CTW A;  2QSA A;  3ZX6 A;  5CA3 A;  1P84 F;  4TSF G;  1BQZ A;  2KKW A;  1K5Q A;  2V7Q G;  4MTG A;  1OCZ B;  1URF A;  1F7Y A;  2DWE C;  4D7T A;  1IBM B;  4NXN B;  2A9H A;  5LMN O;  5LYJ A;  1OV9 A;  4LFB O;  3G67 A;  5IWA B;  3AK2 A;  3TXS A;  1NVP D;  3BHP A;  3VOU A;  4A5U B;  4F6R A;  5B1A B;  4X1K A;  2DN9 A;  1Y74 B;  1N0N A;  2QTS A;  3PJS K;  4FMT A;  2H3O A;  1RPR A;  3T4Z A;  3SJC C;  3K9S A;  2RN9 A;  5CBF A;  2MK3 A;  3TJT A;  1XMQ O;  4QJF B;  3ZS8 C;  2UUC B;  4F4L A;  4TQF A;  1KU9 A;  2IJH A;  2ZCE A;  1KYO F;  2GV9 A;  3CCJ V;  1GRJ A;  3LNN A;  3NXS A;  1K33 A;  4PEL A;  1WNS A;  3UM7 A;  1SET A;  1S72 V;  2UXD B;  3RT3 C;  2YID A;  5CB4 A;  5EC1 C;  1BL8 A;  2CTR A;  5CA1 B;  2AZ0 A;  1EN5 A;  1JVM A;  2VS0 A;  2EIJ C;  3OEH G;  3ZCC A;  3OFN G;  5IT9 N;  4X8A A;  1IBL O;  2YI8 A;  3AG4 C;  2BTQ A;  1WN7 A;  4FFK A;  3ASN C;  3RFR A;  4JI8 O;  1D2D A;  1Q5O A;  2R9R B;  2CTP A;  2ZE8 A;  3JD2 A;  1EN4 A;  1TA8 A;  2LGW A;  4NYK A;  2HG5 C;  4LR3 A;  3B77 A;  2M6Y A;  2QJ1 A;  1US6 A;  4J10 A;  4PDR A;  3CJH A;  3F5T A;  1FXK B;  1R3L C;  4QNH B;  4DR3 O;  2R9A A;  1B06 A;  2LFR A;  3M8A A;  1VIB A;  4AI8 A;  3RW0 A;  4OPH A;  1YF2 A;  3K59 A;  2UXD O;  3ABL B;  4RUE A;  4LF6 O;  3UO3 A;  3ZHR A;  4PDM A;  1FYJ A;  1WA8 A;  3M99 B;  1Q6U A;  1Y76 B;  5EBL C;  2OYQ A;  2HEP A;  2IH1 C;  4X62 O;  3L75 H;  1XMQ B;  3BAB A;  1RSO A;  3JSL A;  2BOB C;  3ABM B;  2Y48 A;  4KP4 A;  2ZKO A;  3N2G A;  2YIC A;  1QCE A;  4DV7 B;  1IBL B;  1VAR A;  4DR1 O;  3ZMV A;  2CDY A;  3ABU A;  4MVU A;  4WFA V;  2VQF B;  4X1Y B;  1TUB A;  2WWW A;  4KHP B;  2RJZ A;  5B1B C;  4JI2 O;  4X89 A;  3I5D A;  4DR4 B;  4P9P A;  2FTK A;  2OCC C;  4PI0 A;  4ASU G;  3DSQ A;  1AB3 A;  5JH7 A;  1HNZ O;  1DLB A;  5B1B B;  2ZM6 B;  1XL4 A;  5JH7 B;  3JAS B;  3SPH A;  2QWN B;  1WP8 A;  2FL4 A;  5FPO A;  4UV9 A;  2P7T C;  3ZRX A;  2BSK B;  2JGU A;  3JAK A;  3APQ A;  2UUB O;  5IJ0 B;  1AIL A;  3APO A;  4LF8 B;  2KG7 B;  3CCV V;  1V54 C;  2FB5 A;  3R65 A;  1K92 A;  1XIL A;  1K4C C;  3QF7 A;  2D3O W;  4PA7 A;  4GKJ O;  1JOY A;  4WFE A;  2Y0I A;  5GTH Z;  5LMU O;  4R50 A;  5JCO C;  3NR7 A;  1GN2 A;  2Z5U A;  3IGA C;  4GYC B;  2IU3 A;  5D5Q A;  1PL0 A;  4OX9 B;  2PTM A;  2WPD G;  2ATK C;  2ZT9 B;  3CC2 V;  4EEQ A;  3ZIA G;  3CXC U;  4JI4 O;  2QGN A;  4JI6 B;  2NLJ C;  3IFX A;  1P49 A;  2R9I A;  2P4V A;  2F66 C;  4IYI A;  1NJI W;  1SES A;  3IJ4 A;  3CWB H;  5H9C A;  2XT9 A;  3ZHT A;  4LP8 A;  1JX9 A;  1AP5 A;  1IBK B;  1SRY A;  5CB4 B;  4FZ0 A;  2F23 A;  1W2B U;  5E1A C;  3RYF B;  5IE9 A;  3CC7 V;  4HYO A;  1NT2 B;  3EFF K;  3CB2 A;  1GO3 F;  3B40 A;  3CMA V;  4D7S A;  4X66 B;  1FD9 A;  1XNR O;  1ZWI C;  3EVK A;  5D5P A;  3X2Q C;  4XDK A;  2R72 A;  1MSW D;  1L8D A;  2VRZ A;  3ETG A;  3CCS V;  2WLH A;  2PY5 A;  4DR5 B;  1H8E G;  2Q4P A;  3AG3 B;  4TUY B;  2Q7H A;  3QO8 A;  2F4V O;  3U0Z A;  3SYA A;  3H1K H;  4MVQ A;  5FPR A;  1VEW A;  3LSU A;  3J80 N;  5LP6 A;  3RBZ A;  2DYS B;  4NTY A;  1FPO A;  1MOF A;  3B4S A;  4W4L A;  1S3J A;  3OW2 U;  2HHH B;  4WF9 V;  3E8F A;  1YJW V;  4JV5 B;  2UXB O;  3RYI A;  3CE2 A;  4AIL C;  3OAA G;  2ZDI A;  3K03 A;  4TOI A;  2EIL B;  4O4L B;  1SQG A;  2EIM C;  4B08 A;  2UU9 B;  2XTA A;  1RM1 B;  3P30 A;  2ARH A;  4AQY O;  4W4K A;  1G6U A;  2GDS A;  3BA9 A;  4ZOL A;  1M57 C;  4LFC B;  4I50 A;  1QVF U;  1SQP H;  1S5J A;  4JTA B;  4JAU A;  2KQX A;  1K73 W;  3CP1 A;  4JI4 B;  1O9H A;  2X6B A;  3HKC A;  3CYO A;  1NKD A;  2BE3 A;  4DUY O;  3HKC B;  4TT3 G;  4Z2W A;  3OM3 B;  2ZDI C;  1WPX A;  2PUS A;  3BCC H;  3UQ8 A;  1FKA O;  1XQ8 A;  3FB7 C;  3SYC A;  4J42 A;  4B3M O;  1NQT A;  3UT5 A;  1HNX O;  2WLK A;  4FJC C;  3KCY A;  1IUR A;  1D5A A;  2DQ3 A;  4X66 O;  1Z5W A;  4BW9 A;  3JCU Z;  4QE7 A;  1VQM V;  1GN6 A;  1BCC H;  2JDI G;  1QQC A;  2Q8V A;  2FKX A;  3HKB A;  1NR1 A;  3K3W A;  4F6R B;  2H8P C;  3ZMZ A;  2Q9L A;  3D36 A;  1GAX A;  4U3J A;  1VQ8 V;  2DJV A;  4FZ1 A;  3CRM A;  2Q67 A;  4PDL A;  3RYC B;  1H2M A;  2DWD C;  2BTQ B;  5IJ0 A;  3H1H H;  3OT7 A;  3ZN0 A;  1JA8 A;  5JQG A;  5C8Y A;  4LNU B;  3D36 C;  2Z0A A;  2EIK C;  4DV7 O;  1BE3 H;  4NKG B;  3VQY A;  1BT8 A;  1YZB A;  2F43 G;  3THO A;  1OZ0 A;  4DR1 B;  1VQP V;  4B7K A;  1EZJ A;  2OWO A;  4O2A A;  3EXA A;  2Q0A A;  4QE9 A;  1QLN A;  2EX3 A;  2A3Q A;  4X20 B;  4UCV A;  2ZR3 A;  1YI2 V;  2QR4 A;  2DQ0 A;  4NTX A;  3TCU A;  3GWK C;  2C2A A;  1I0H A;  4IGG A;  2QWP B;  5JJN B;  4LF8 O;  2ZE5 A;  3RVZ A;  4DW0 A;  1XI1 A;  5A9G A;  5FL7 G;  1JFF B;  3LSS A;  4JGS A;  5JVD B;  2ZR2 A;  4DK1 A;  5IDJ A;  2ZIN A;  2PGG A;  2WLJ A;  2OTL V;  2UUB B;  4YY3 O;  4GZR B;  5CA0 A;  3DXR A;  2QKS A;  2Q0O C;  3ETQ A;  4I0X B;  5J9P C;  3WFV A;  4RWU A;  2JS5 A;  4NXM B;  1XRE A;  1SA0 B;  1KBH A;  4JF3 A;  4B3T O;  1M9N A;  1UFI A;  4Q6G A;  4K3A A;  2HKO A;  2Y0P A;  3K08 A;  5H5N A;  4AHC A;  1Y66 A;  4KL1 A;  2CK3 G;  4NTW A;  2F1M A;  4IHJ B;  5KMG B;  1SER A;  2Q68 A;  4JI0 O;  5KX5 A;  1N4C A;  4N23 A;  2A79 B;  3JAR B;  2K9P A;  3UKM A;  4GKK B;  2UU9 O;  3A0B Z;  4DXW A;  1VQK V;  4H13 B;  3JAT B;  4DRX A;  5J2U A;  3G71 V;  2EIN C;  2AGA A;  1YJN V;  4BIO A;  3JYC A;  1V55 C;  1P7B A;  4H0L B;  4ZHQ A;  2UUC O;  3L73 H;  4GKK O;  1HR0 O;  1XHX A;  3L71 H;  1W59 A;  3I56 V;  3JAS A;  1DF5 A;  2L6L A;  3D3I A;  4LBE C;  3ABL C;  5C8Y B;  2CAZ C;  2PYJ A;  5LGT A;  3ZHS A;  1VMG A;  4DR5 O;  5EC2 C;  1RSO B;  3I55 V;  5ITZ A;  1YVW A;  4J7Z A;  3AG1 B;  1AR1 B;  3AG2 B;  2ZQM A;  1HNX B;  2JVD A;  4JZG A;  5KA5 A;  4JI1 B;  1J5E B;  3ZMT A;  4JAA A;  4Z1M G;  1S5H C;  4I0X A;  4MTF A;  2QWR B;  3JD0 A;  1TAE A;  3JD3 A;  3OUF A;  1AP6 A;  4TV8 B;  4K35 A;  5KHJ A;  1EFR G;  5B5E Z;  2YEV B;  2YI9 A;  1Y6X A;  2EIM B;  4UB8 Z;  4MW3 A;  4H33 A;  1NTM H;  2YDE A;  3QVN A;  3FD9 A;  3BPZ A;  4LFA B;  3SR2 C;  2BTO A;  3WB2 A;  3MAQ A;  4LFC O;  2RNB A;  1VP7 A;  4LF5 O;  1VQ9 V;  4LWS A;  4I50 B;  2IJJ A;  1AJP A;  4CC5 A;  2YC0 A;  2F93 B;  1OCO B;  4OPA A;  2HLD G;  1FAF A;  2AZ2 A;  1EZV H;  4JI3 O;  1RPO A;  5EYP A;  2ITC C;  5J2U B;  4RUF A;  4CS4 A;  2DMX A;  4DO2 A;  1H2G A;  3K5N A;  3H1J H;  3UCS C;  4YJ2 B;  2X6A A;  4Q20 A;  1EM1 A;  3G6E V;  4DR7 O;  1L1F A;  4BWA A;  1YTF D;  1N32 B;  4K0K O;  1ZX3 A;  3L70 H;  5B3S C;  3AK1 A;  4JI3 B;  1OCC B;  2Y4U A;  1TGO A;  1MMM A;  2JEX A;  4LFB B;  5CBG A;  4UCT A;  2H94 A;  2XUM A;  4J41 A;  4WFH A;  3CCE V;  1QLE B;  2IH3 C;  3TET A;  4GT1 A;  3AG3 C;  2NR5 A;  5LGN A;  1IDS A;  1FJG B;  1AR4 A;  1JJO A;  4PHZ A;  2YIB D;  4JI7 B;  2DYR C;  3ASO B;  3OR6 C;  4DR4 O;  1ZAU A;  4YJ2 A;  1LUV A;  5JJE B;  2NN4 A;  2W0X A;  4I9Q A;  3VQW A;  1O9G A;  2VQF O;  4JI6 O;  4HZ3 A;  1SA0 A;  3N2K A;  4L8J A;  4MVM A;  3D3Q A;  3CXH F;  1HWY A;  2ADP A;  1CPY A;  1N0J A;  4DV3 B;  3JD4 A;  1YSC A;  2B9Z A;  1B6Q A;  4O2A B;  1FXK C;  4BW5 A;  1X59 A;  2IBZ H;  4H44 B;  3GWO A;  4PDV A;  1R73 A;  1WB7 A;  5CBH A;  1HW7 A;  1H2N A;  1E1Q G;  1Q7Y W;  2AHZ A;  2CH7 B;  4JZ2 A;  4E2L A;  2F95 B;  3UT5 B;  4DR2 O;  3SPI A;  5JJJ B;  3MD0 A;  3W7S A;  3E89 A;  3DXR B;  2XND G;  2JRI A;  1IVS A;  2DE0 X;  3WB0 A;  3AG2 C;  4MTX A;  3HR0 A;  1PNM A;  4FLY A;  1G1X B;  3AG1 C;  2W6I G;  1ZSP A;  2KB1 A;  1QU7 A;  2ZE6 A;  2QEX V;  3N2K B;  4LCU C;  2WA4 A;  4PD4 F;  1FFX B;  4JAV A;  2ZIO A;  3VBB A;  1WA8 B;  3K57 A; 
#chains in the Genus database with same CATH homology
 4AQY O;  4DR5 O;  3F5T A;  4JI7 O;  4GKJ O;  2E5L O;  4YHH O;  5A2Q N;  5LMU O;  4DV6 O;  3JAM N;  4DR3 O;  5BXZ A;  4DUZ O;  3M8A A;  1FJG O;  3SDL A;  4OPH A;  5BY1 A;  2UXD O;  4DR4 O;  1A32 A;  4JI1 O;  4LF8 O;  4X65 O;  1R6T A;  4DV0 O;  4LF6 O;  4DUY O;  3J81 N;  4DV1 O;  1F7Y A;  2VQE O;  4JI4 O;  2N74 A;  5IWA O;  5LMN O;  4B3R O;  1FYJ A;  4LFB O;  2UUA O;  4YY3 O;  2VQF O;  1N33 O;  4JI6 O;  4NXN O;  1I94 O;  4A5U B;  1IBK O;  4B3S O;  4X62 O;  5FLX N;  1FKA O;  2ZKO A;  3T1Y O;  4B3M O;  1HNX O;  4DV2 O;  4DR1 O;  4KHP O;  1XMQ O;  1X59 A;  4DR6 O;  4LFC O;  2ZM6 O;  4DV4 O;  4LF5 O;  4X66 O;  4B3T O;  1DK1 A;  1N36 O;  3T1H O;  1N32 O;  5H5N A;  2FKX A;  4OPA A;  4JI2 O;  3RT3 C;  4JI3 O;  2DJV A;  4LF7 O;  2LW7 A;  4NXM O;  1XNR O;  1AB3 A;  4DV5 O;  2HHH O;  4DR2 O;  1HNZ O;  5LL6 Y;  1IBM O;  4JI0 O;  3OTO O;  4JI5 O;  4LF4 O;  4DR7 O;  1KUQ A;  5IT9 N;  2F4V O;  2JRI A;  1IBL O;  4JYA O;  2UU9 O;  4DV3 O;  4K0K O;  2UUB O;  4JV5 O;  3J80 N;  4JI8 O;  1G1X B;  1D2D A;  1AIL A;  1NS1 A;  1XMO O;  2DOS A;  4X64 O;  1N34 O;  2AGA A;  4LFA O;  2UXB O;  1HNW O;  4OX9 O;  2Z0A A;  4DV7 O;  1YZB A;  2UUC O;  3J7A U;  4GKK O;  5BR8 O;  1XEQ A;  1HR0 O;  4LF9 O;  3R66 A;  2UXC O;  1R1B A;  1XNQ O;  3O65 A;  1J5E O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...