4NXMO

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4nxmO00
2DJVA 1A32A 4X65O 1N34O 4LFAO 5BR8O 1XNRO 4A5UB 4JI4O 4X66O 3OTOO 4YHHO 4OX9O 4LFCO 4KHPO 2ZM6O 3J80N 1FYJA 4DV5O 2UXCO 3SDLA 4GKKO 4K0KO 2UXBO 3M8AA 1XMQO 2Z0AA 4X62O 4DV4O 4DR1O 4LF6O 4JI6O 1HR0O 4DR2O 1I94O 1HNWO 4JI3O 5A2QN 1HNZO 1R1BA 1N32O 3T1YO 4NXNO 3JAMN 4DUYO 1IBMO 4DV7O 3RT3C 5LMNO 5IT9N 2VQEO 2FKXA 4DV0O 5H5NA 4YY3O 4DV3O 4JI5O 3J81N 1X59A 4DR7O 4DUZO 4OPHA 1IBLO 4DR4O 1R6TA 4LF5O 1F7YA 1YZBA 4B3MO 4DR6O 4GKJO 4B3TO 2ZKOA 5LMUO 4DR3O 2UXDO 1G1XB 4JI2O 1AB3A 1XMOO 3R66A 2AGAA 4LF7O 4AQYO 2N74A 5BXZA 4JI1O 4LFBO 5LL6Y 1DK1A 4JI8O 4DR5O 1FKAO 1J5EO 4LF9O 4DV1O 2LW7A 5IWAO 1KUQA 2JRIA 1AILA 4LF8O 1NS1A 3F5TA 3O65A 1D2DA 4DV6O 2VQFO 4B3RO 4JI7O 1IBKO 2UUAO 5FLXN 2DOSA 1XEQA 4B3SO 4DV2O 1FJGO 3J7AU 2HHHO 4JI0O 1XNQO 1HNXO 4NXMO 2F4VO 3T1HO 2UUCO 4JV5O 2E5LO 4LF4O 2UUBO 1N36O 2UU9O 1N33O 4JYAO 4OPAA 4X64O 5BY1A
chains in the Genus database with same CATH superfamily
5B5EZ 1VQNV 4LFAO 1XHZA 1PV0A 4X89A 5FNVA 4IT5A 3UCSC 2X6BA 2ZNIA 4FZ0A 2YXLA 4JI1B 1VQ4V 4FVMA 3K5OA 4DR5B 1TVKA 2A7WA 5DEDA 4X1KB 2YS8A 3BVOA 4TV9B 3H01A 1NBMG 1OCOC 3L73H 4B3RB 2OIGA 3JASB 4O4LA 1VF7A 1R1BA 3CPWU 2E3CA 2P6JA 1XNQB 2FKXA 1ZL8A 3ZMUA 3OMIB 2FTKA 4PA4A 1IXBA 2K1EA 2JGDA 1SC5B 1JCHA 1IZ3A 3STZC 1XUQA 4UCTA 5CA1B 1WA8A 4JI1O 4KL1A 3ZRWB 2EIJC 4DR5O 5B66Z 5C93A 4TUYA 4B3RO 4EKWA 1EFRG 3LNNA 3OD4A 2RMKB 4DR1B 1SETA 3OW2U 4CH6A 2WLLA 1O9HA 1AP6A 3JAWB 3VQVA 2IJKA 5JJJB 5KLVH 1UPGA 3THOA 5B3SB 1TUBA 1XNQO 1M57B 2F66C 4J7ZA 4YJ2B 3FAVB 4FJCC 3JYCA 3X2QC 4B7KA 4X65O 1F4MA 4LF5B 4I7ZB 1RSOB 1AI4A 2KQXA 2B9ZA 1OHHG 1CP9A 2QE7G 4NTYA 4FFBA 1XMOB 2IH3C 1UFIA 5KX5B 2HJDA 4DV1B 5LGNA 4QE9A 4NTXA 4DR1O 5L3BA 1VEWA 3FB7C 3T1CA 4TQDA 1IURA 1IBKB 2PF4E 5A2QN 2WLJA 2JGUA 4BW9A 4IL6Z 5CA3A 5LOVB 1XQ8A 4G2KA 4Z1VA 1JOYA 2HP8A 3OEEG 2DYSB 4LNUA 3H1JH 4LF5O 2WLIB 1BS3A 2DYRC 3KCYA 1G1XB 4UVAA 1XMOO 1NTKH 4F6RA 2Y69B 1SF9A 4BAYA 1VQPV 5HFMA 4PELA 1FKAO 3ABLB 3A2FA 3VBBA 2YEVB 4UXNA 3FD9A 4DV1O 4MS2A 2E5LB 1CEZA 4PA9A 4K0KB 3S3XA 4GT1A 1IBKO 1S5HC 1QLEC 4DV4B 3RYFA 5LA6A 1VQKV 1V54C 5JJNB 1AVMA 4NB5A 1WJZA 3I55V 3TXSA 1QR8A 2KB1A 2GSMB 1G4YB 1Y74B 3E35A 5BMVA 3T1YB 1Q81W 2X7RB 4PDLA 4G28B 5GTIZ 4P9OA 4X64O 4MVUA 1W0KG 2DJVA 3O9OA 4GUNA 4WFBV 4JI6B 3P3NA 3PN1A 3A0RA 2PYLA 1FXKB 4JASA 4ZI7B 1FYJA 1F23A 4JTCB 3OUFA 3CJHA 3ZEDA 2OTLV 4K0KO 4DXWA 3OR6C 4WFAV 4LF8B 4DV4O 2QR4A 2OWOA 3LDCA 2LP7A 4DV6B 4GLXA 4XDKA 1SQBH 5B1BB 3W7TA 3AG1C 3T1YO 3GVMA 2Q0OC 3CC4V 3E22B 3F7YC 1PNKA 3ZHTA 1I08A 4QGPA 2XUMA 5F2VO 1NVPD 1NTMH 4X1IB 4WFHA 5J2UA 4FLWA 5H5NA 4YXWG 1S77D 1WPBA 5KHIA 2WLHA 5BZBA 1IDSA 3DXRB 4B3MO 1VIBA 1Q8IA 2GHYA 4YJ3B 3SYCA 3AEIA 2ZXWC 2WLNA 2IU0A 2CH7B 3JCZA 3H1LH 3LUTB 3D3QA 1VF6A 1Y6XA 2ATKC 3CWBH 4C7UA 2ZNJA 2ZM6B 1AROP 2M7WA 1ZLZA 2F95B 3N2KA 4LF8O 4I50A 1D2DA 4DV6O 2UXBB 3ABKB 1SA0B 5CBFA 1V55C 1YXBA 1BHBA 1HR0B 4RWUA 4EB6B 2BTQA 3HKEA 3SJCC 5B1NA 1SQGA 4DUYB 1EZVH 5JWPA 1UJWB 1W0JG 3SYOA 2JEXA 4FLYA 1RPRA 4DR4B 3F7VC 1A32A 3WB1A 3CMAV 4X62B 1DF5A 1N4CA 2Q68A 4FLXA 2R72A 2IU3A 3KZIZ 1OCOB 4QJFB 4NYKA 2ZM6O 1EZJA 4DK0A 1QLNA 1K5SA 3SYPA 4XBFA 4EFEA 2UXBO 4WCEV 2Z0AA 2EJ7A 1SQXH 5JJEB 3JARB 4J41A 4J10A 4ZOLB 1SRYA 4FLZA 2HKOA 1HR0O 3RBZA 5JQGA 2R70A 1FFXB 4QNHB 2ITDC 3FB5C 4DUYO 4JI2B 4TV8B 1X4TA 2GTSA 2W6IG 2GV9A 4MW3A 2FYUH 4IIJB 4DR4O 2Q6AA 3QVNA 4JYAB 5IE9A 3K5LA 2EIJB 3Q4HB 3VQWA 3OT7A 1EM1A 1M56C 1SS3A 4KUMA 5BR8B 3B77A 4JI4B 1I7FA 4FFKA 1K5QA 1PKXA 2JVDA 3ZRXA 3CCMV 3IC7A 1NS1A 3F5TA 4RAIA 1FAFA 2P7TC 2C2AA 3CP1A 5JH7A 4O4HA 4F6EA 1K9MW 3BPZA 4K8XA 4RUFA 1EBOA 1F51A 4XDJA 1P7BA 3X2QB 1NJIW 2LGQA 3C90A 1QQCA 3OTFA 4OX9B 5FPRA 2YSUB 4WBNA 4NKGB 4JYAO 2AZ2A 2Q9LA 4DV3B 3M7MX 3LSSA 1NR7A 3B40A 1AJQA 4NTWA 5BR8O 3AG2C 4JI4O 1VQ9V 1MABG 2F43G 1KP3A 3QO8A 2H3OA 2RJZA 4Z1MG 1Q82W 4FPPA 1WLEA 5EIBD 4DRXA 1PPJH 3LSQA 4ZHQB 3UKMA 4OGQB 4LF9B 4JAVA 5B1OA 3ZIAG 1Y66A 4B7EA 1AR5A 1XL4A 3JAKB 1NH2D 5B1AC 3CE2A 2Y0PA 3SPHA 2Q7GA 5IJ9A 5J9PC 2CTRA 2ZINA 3K57A 3K08A 3D36A 1BGYH 1FXVA 4R50A 1ZUQA 1JPXA 4H0LB 5IT9N 2LQTA 2DYRB 4X1KA 2OCCC 1B04A 4DV3O 1R73A 4OPHA 4PD4F 4ZIBA 2QWQB 2UU9B 3K59A 4BIOA 1G8MA 3JASA 4O4JB 4GKJO 1WAZA 5CA0A 4J7KA 1N34B 4N21A 3OMAB 2JDIG 4NVPA 2Q73A 4CS3A 1QLEB 3BA8A 4MTOA 3APOA 4LF9O 3B4SA 1K34A 3GB7C 3FKSG 3TETA 3DC6A 4UB8Z 5GONB 3H1KH 1Z5WA 4H37A 4LH6A 1VARA 5FLXN 3I56V 5IYBO 1I94B 2DQ0A 5GW7A 1VQ8V 4MTXA 5JVDA 3H1HH 1WN7A 1ENVA 4IHJB 3B09A 2GBOA 2Y0IA 3RW0A 1JA8A 2UU9O 4UCUA 2VQEB 1KB9F 4GX5A 5LP6A 1S5LZ 2AW9A 2FB5A 3E89A 3WG7C 1GKFA 2EBOA 1N34O 2ZIMA 3CB2A 3T4DA 1KMIZ 5LMUB 1GAXA 4CS2A 4O2BA 3MD0A 4MW8A 1H2GA 3RYHB 2V7QG 2HR3A 2YXYA 3ASOC 5ITZB 2FL4A 3AG1B 3M8AA 2WLKA 2QEXV 1Q6HA 4UCVA 4U3FH 3VQXA 1I94O 2W0XA 2ZE7A 3IAYA 3D3IA 5KAIZ 4U3JB 3RT3C 2KKWA 5KX5A 2VQEO 1QNMA 1HP8A 2ZXWB 3SPCA 3RYIA 1X59A 4PV1B 4U7OA 1IXMA 3TK1A 5LMUO 2XASA 1XBLA 2RCVA 2ZR2A 3SYAA 5LOVA 1H38A 5IJ0B 1S72V 3JSLA 1VQLV 1DK1A 1V55B 2A06H 1JVMA 5H6RA 4MVSA 1XI1A 2WA4A 1SZXA 2PYJA 2AHYA 2OT5A 3IGAC 2YDEA 1JFFB 4D6TH 3APQA 2B1GA 3ABTA 4GX2A 4FIPC 3TXQA 4X65B 2QWOB 4DR2B 2ITCC 3ZN0A 1ZSPA 1HNZB 5LYJB 3HKCB 4NXNB 4UUJC 3QO7A 5KUMA 3W7XA 1DTOA 4OPAA 1SQQH 2DMXA 3LNMB 1VQ5V 4YY3B 4LCUC 1Y76B 2EJRA 3N2GB 3JATA 1Y74A 4WFFA 1P49A 1M9NA 2XAQA 3JD0A 2E76B 4LF7B 1KKCA 4WFGA 3RFRA 2JJ1G 3ABUA 1L0NH 3AK1A 1OCRC 1WPXA 3OR7C 1Q86W 2KG7B 3U11A 5CB4B 3CCRV 1F4NA 4PA6A 4DR2O 5CBGA 5LGTA 1HNZO 3FYEB 4NXNO 1URFA 4P9PA 4X20A 1S5JA 1WP8A 2N04A 1M56B 4NXMB 4YY3O 3WU2Z 1YTFD 2E74B 1QVGU 1N33B 1WP7A 2WSSG 4CC6A 3JD4A 2G38A 4JYYA 1R3KC 2ZKOA 4JYCA 5FNVB 4LF7O 1GMGA 3CS5A 4Q20A 4X1IA 4B08A 4I55B 3JD1A 4LWSB 4I0XA 4TT3G 1XL6A 3CX5F 1KUQA 1YEWA 5IYDO 4ASUG 3HKDA 4X64B 3K03A 4FM2A 4MSWC 4BIZA 1J95A 1EN4A 1MNGA 1K33A 1HNWB 2GTAA 4O4LB 2RN9A 3HKBA 4CH5A 3G67A 4DW1A 4NXMO 3AG2B 2JS5A 4HYOA 3C3TA 5LMNB 1N33O 4X8AA 4TSFG 1ZL8B 3OGCC 4CH3A 1SZTA 1OCZC 2BSKA 4KP4A 4JI5B 3ZHQA 4CBCA 1GK9A 1IBLB 5JCOA 4P2ZA 4DR6B 1JJ2U 4A5UB 1HW7A 2ARHA 2YI8A 4PI2A 2CE4A 3CRMA 3CRQA 1IX9A 5EZYA 4AQYB 5B1AB 1G6UA 1K73W 3SJQC 2XAJA 3ETQA 3JD2A 3SDLA 5IWAB 4YIOA 2ZE5A 5IY5C 1VQ6V 4TUYB 1E1QG 5IYCO 5E1AC 1KKDA 2ODMA 4X9QA 1HNWO 2OCCB 2WLLB 4B3MB 3BCCH 2ZR3A 4FZ1A 1K3EA 5EYPA 1TUBB 2X0LA 2CUGA 3D8CA 1K92A 5LMNO 1YVWA 4JZ2A 3T1HB 5DM6V 3CCSV 4JV5B 2AXTZ 4JI5O 5EBWC 1IBLO 1R6TA 3NXSA 2X6AA 3I5DA 3ML0A 4DR6O 2P4KA 1XILA 5L3FA 3BHPA 2HJFC 3ZHSA 3AG3C 3R66A 3OE7G 4AQYO 3QG5A 4R8CA 1RP3B 4FFBB 2Q69A 3G71V 1KU9A 2HEPA 1MMMA 4JYBA 2V4DA 2A79B 5IWAO 2F23A 3RVYA 1JMKC 3PJSK 2CGOA 4W4LA 2YIDA 4LR3A 2BOCC 1OJHA 1YJWV 2N05A 4L87A 3G6BA 4K8ZA 3WG7B 1N32B 3ZMVA 2JEUA 3T1HO 2E75B 4JV5O 4D7TA 1GN3A 3P3PA 3QO5A 2PZSA 3UT5A 5BY1A 1EN5A 4LNUB 1SERA 3D36C 3ASOB 4HNAB 2HLDG 1K97A 4H33A 1S76D 3ZHUA 4BR6A 4F6RB 5D5QA 3CCVV 2AZ0A 3FYIB 3K3WA 3ZHVA 3SR2C 5FL7G 1JJOA 3AG7A 1GO3F 1PNLA 3OUSA 1NR1A 4TQFA 1BE3H 3E8BA 1Q43A 3CCLV 3QTCA 1JQ0A 5KHKA 2EZPA 2WLMA 5KMGA 3RYFB 2LFSA 2GUZA 3DTUB 2JS3A 5KA5A 2UUAB 4DO2A 1WNSA 1N32O 2H94A 1GN4A 1TA8A 2IBZH 4MT8A 1R3JC 2RNBA 3CCJV 4DV7O 3ZMZA 5IYZA 2QGNA 1E79G 4FLVA 3CC7V 1S3JA 3J81N 4DR7O 5FPOA 2UUBB 1P84F 5E79Z 1F7YA 1SQFA 5EBLC 1VQ7V 1R3IC 2A9HA 4RQEA 3ABMC 4X1YA 2ETNA 1XNRB 1DLBA 1LUVA 5KHJA 5LP6C 3GWKC 5TISZ 1PM9A 5EK0A 4E4EA 4KHPB 2Q5ZA 4CZZA 4Q6GA 3E2EA 4O4JA 4UVBA 4Z2WA 4IGGA 2XAHA 4I4TB 1H2LA 2Y48A 2UUAO 2YI9A 2W6JG 4ZBMA 1Z2GA 1NT2B 1U97A 1LR1A 2UUBO 5J2UB 5GONA 4RUEA 2ZE8A 3JSNA 2HG5C 1N0NA 5K1XA 2DW4A 1QHTA 4LH7A 1GN6A 5HFLA 4YIPA 3RWRD 3OFNG 1XNRO 1OCRB 1M5IA 3ZMSA 1VF5B 3WFVA 4IHJA 3F5WC 4KHPO 4LFBB 1YIJV 2EIMC 4H13B 2WA3A 3SPJA 4O4IB 2EZOA 1KP2A 2QTOA 4CC5A 2QKAA 3P32A 5H2FZ 4GKJB 5LHHA 3RYHA 2BTQB 5L3EA 5ITZA 4JAAA 1PNMA 1QU7A 4B3SB 4R7CA 3TJTA 2K9PA 1P4RA 1HWYA 3K9SA 4MTFA 3ICXA 1WB8A 4I9QA 5EIBC 1NZ6A 1N36B 1AJNA 1NTZH 2A0LA 4UV9A 4MTGA 3R65A 1N8RW 1ROPA 2A3QA 2X6CA 2NN4A 2KSDA 5KA6A 4X66B 4LFBO 4YHHB 1Q5OA 3OAAG 3FFQA 1R3LC 3G6EV 1Z5VA 1AILA 1GN2A 3L72H 4TV9A 5DECA 1HDJA 2VQFO 2UXCB 4GKKB 2ZDIA 2ADPA 2RDCA 4JZGA 3U0ZA 3ZBHA 2QWRB 5LXTB 4RO2A 2RQ6A 3BA9A 5DN6G 1YJNV 5JQGB 4ICGA 2VWKA 1THZA 1NI8A 1OCZB 4KFMA 3CCEV 1W59A 2WWWA 4B3SO 1XREA 3FB8C 3EHBB 3RGBA 4PHZA 1H8EG 1JX9A 1RFYA 1N36O 2PUSA 1AI7A 3HB3B 3CC2V 3L75H 1GM9A 5CA1A 5LHIA 4X66O 2UXDB 5LYJA 3OGIB 3HKCA 4YHHO 5IY5B 3ZRWA 3LSUA 2Y4TA 2XOKG 1VQOV 2ZQMA 2UXXA 1OCCC 1J5EB 4GKKO 2UXCO 4AI8A 2R9IA 1Y76A 3CXCU 1MSWD 3B8NA 1H2MA 3K06A 4R6ZA 3MHSC 3BY6A 4JI7B 2CGNA 3JAWA 4RQFA 5JH7B 2HFEC 3JCUZ 1KYOF 3VOUA 2LW1A 2QWNB 4UV8A 3G80A 4YJ2A 2HHHB 3AG3B 3HR0A 2KG7A 3FAVA 1CXZB 3L9DA 1N0JA 4LF4B 4GX0A 3A0HZ 4MVQA 3ETGA 1H8HG 3CMEV 3CCUV 2P4VA 1RSOA 5J2TB 2FMLA 1NVPB 2UXDO 3VQYA 3QF7A 3RVZA 1BCCH 5KUKA 3E86A 2AGAA 2YICA 4QPKA 2XHBA 1TUEB 1FD9A 1S0VA 1J5EO 2L6LA 3C3SA 1ORQC 3CYOA 1L8DA 4CH4A 4DRXB 3K04A 1ZTEA 1SQVH 2QM4A 1GM8A 4J42A 4JI7O 3SJAC 1XMQB 3A0BZ 2ADQB 5CMUA 4I55A 5IJ9B 2QTSA 4O2AB 1AP5A 2VRZA 4LWSA 2EX3A 2HHHO 2UXNA 3AK3A 3UO2A 4FLUA 2DN9A 4LF4O 4XDLA 4MVOA 3BFRA 2WLIA 2W0FC 3EFFK 3QNEA 5LGUA 4NR1A 2JJ2G 4ZKIA 1IVSA 1SQPH 1JR9A 3E83A 2IJIA 5CA0B 4GX1A 5L3GA 1MOFA 4D7SA 3BRCA 5C8YB 1BMFG 3J80N 2YEVA 1COWG 1LNQA 1ZX3A 4FLTA 3A8TA 2QKCA 4MVRA 2XTAA 1XMQO 4OXSA 4L8JA 3MAQA 3CRCA 2OCHA 1BL8A 1L0LH 1ZAUA 2NNUA 1QR9A 3CRRA 3L74H 1PD3A 2R9AA 4N23A 3JALB 5JVDB 2WAMA 1M1KW 2UUCB 4J11A 3ABMB 2XAGA 2XNDG 1GM7A 5LP6B 1YZBA 2CAZC 3ETDA 3FX7A 1L1FA 2D2CB 1VF6C 3CEIA 1M4UA 3CSXA 4EEQA 2BCCH 4JAUA 5BXZA 3DGEA 3OTOB 1FXKA 4O2BB 4ZI7A 4IYHA 2Q0AA 4LFCB 3M99B 3E8FA 4DV5B 1NQTA 3BAAA 2YC0A 3RYCB 2PGGA 2EILC 2IM9A 3GWOA 4QE7A 3L70H 1TAEA 3ZJZA 2EIKC 2QSAA 2IJHA 4TOIA 4ABMA 3E22A 4JI3B 1US6A 3FB6C 1FS0G 2NR5A 2UUCO 2Q8VA 2XAFA 4JTDB 3K9AA 3STLC 2F1MA 2ZCEA 3RYIB 3DXRA 1TVKB 4PA3A 4YJ3A 3OMNB 2BE3A 2CH7A 2EIMB 2R9RB 2P22C 2IW5A 4DR3B 3OTOO 3DSQA 4LFCO 4J7JA 3K58A 3BABA 2LGWA 3OM3B 5AG2A 4DV5O 3ZS8C 3ETEA 1SA0A 3W7WA 3ZRSA 4HNAA 4TWKA 2ZD9A 2B1IA 3ZX6A 2QM8A 2JGDB 1TGOA 4JI3O 4EB6A 1VQMV 2V1DA 1YF2A 3JAMN 3L71H 4PDMA 1WA8B 2Y4UA 4DV2B 1NH2B 1FJGB 1K8AW 3ZN1A 2F4VB 1BT8A 3K5NA 5D5PA 5GTHZ 1GTOA 2QDOA 2EINC 4FMTA 4DR3O 1I5YA 2B5UA 2Z5UA 3ASNB 1RM1C 1R6NA 1U96A 3JATB 5KHGA 2N74A 1NKDA 3EVKA 3H9VA 1Q6UA 2BOBC 2P67A 3SGIA 4LP8A 5CN0A 2JRIA 2ZE6A 3JARA 4WFEA 4ZOLA 4CS4A 3AG4C 4JTAB 1SKVA 1FFXA 1I0HA 2PTMA 4UVCA 1DGSA 2OTJV 2HVKC 3WB0A 4TV8A 4DV2O 1FJGO 2F4VO 4X20B 2E5LO 2QWPB 4FK5C 1IBMB 2P90A 4GCZA 1YDXA 4IIJA 4J80A 1M93A 2PI4A 1FFTB 3CXHF 4I4TA 1V9PA 2PY5A 4JF3A 3MHHC 3Q4HA 4DUZB 4F4LA 1DF4A 3K0DA 4B3TB 1OCCB 2M6YA 1D5NA 1PL4A 3UM7A 4PDVA 2YIBD 1EN6A 4UCRA 4UCOA 2JK5C 2DWDC 2CDYA 4I0XB 4DV7B 1KD1W 2CTPA 2VWJA 3H1IH 3HKDB 4DR7B 1BQ0A 5L3DA 4JI6O 1KC8W 4X88A 5LBQA 3KKYA 1XOUA 3B8MA 3CD6V 1B6QA 1B3QA 2HVJC 3BEHA 3ZHRA 4K3AA 1IBMO 3HKBB 1MSDA 2ZDIC 3W7UA 4PA7A 3CHXA 4O4IA 4J9ZB 1D5AA 1FPOA 2P5OA 2Q4PA 4DUZO 2AHZA 4UCSA 4G27B 2YIAA 1CPYA 3KCXA 4JGSA 1K7DA 2BSKB 5EBMC 3SJBC 4BW5A 3T2MA 4B3TO 2CK3G 3K0GA 3ZMTA 1Y4MA 2Q67A 5LA6B 1SESA 3HPLC 1K4DC 1YHQV 3T4ZA 1BZKA 5EZYB 4H44B 5BMVB 1AR4A 4ZHQA 2LW7A 4EFBA 3CRAA 1R6KA 4WF9V 2ILMA 4IYIA 3O65A 4FM0A 2IH1C 3IFXA 3JAKA 1Y67A 4LBEC 1YI2V 2Q7EA 4LF6B 4DW0A 1K4CC 2MK3A 2ZT9B 4DK1A 1H2SB 1Q7YW 2YUAA 3RN4A 4HBNA 2QKSA 1MG1A 5EYPB 1BHAA 2CTWA 2JIZG 4BWAA 5H9CA 3CJHB 3SYQA 5B3SC 5LXTA 3W7SA 4PI0A 4GYCB 1M57C 3IJ4A 2H8PC 3ZRVA 3K79A 2OYQA 1YJ9V 5KAFZ 5EC1C 4W4KA 4JPRA 3E8GA 1QBZA 1VP7A 1OV9A 4X62O 4LF6O 4KXRA 3S3WA 3LDDA 3TGUH 2P06A 1MA1A 1VMGA 2DWEC 3EXAA 1YCIA 4MVZA 2QA4V 4QPJA 1B06A 1I5XA 1HNXB 1QVFU 4I5SA 3N2KB 3UT5B 4I50B 2PI5A 3G4SV 2VQFB 5IDJA 1LUWA 3CCQV 5EC2C 4JI2O 1AB3A 1QCEA 2DYSC 1YTFB 2EILB 3HKEB 2EIKB 4K35A 4GZRB 1YITV 5L3CA 2IJJA 2Y69C 3KG2A 4QIWF 4HZ3A 5J2TA 2YIBA 5LHGA 1YSCA 3ABLC 1WB7A 2OIEA 5KMGB 2GUZB 5H6QA 4U3JA 1H2KA 2QM7A 3J7AU 1KECA 1HNXO 1Q3EA 2LO1A 5A9GA 3K5MA 1H2NA 1NU1H 5IYZB 3NR7A 3ASNC 1GH6A 3WB2A 1P7GA 4DV0B 3JD3A 4PDRA 3E8HA 4O2AA 2MW2B 5IJ0A 2O57A 1PP9H 2Z3YA 3N27A 3SPGA 3MDSA 2D3OW 4X1YB 4OX9O 1T5EA 2GDSA 1AJPA 1XHXA 2DQ3A 1KBHA 2VS0A 4JI8B 3LDEA 2DE0X 2BTOA 3TCUA 1JFFA 1RPOA 1MZFA 3UQ8A 1FXKC 4J9YB 3DC5A 5C8YA 3OEHG 2CTQA 2NLJC 4U7NA 1MZEA 1OZ0A 2L35A 4UFZA 4I9WA 2Q7HA 2WPDG 2EINB 1W2BU 1V54B 3AK2A 1PL0A 1GRJA 4JI0B 3IC9A 3UO3A 4DV0O 1RM1B 4HAMA 3ZCCA 3B2EE 5B1BC 2QJ1A 4DYLA 1AI5A 3SPIA 5CBHA 2EULA 3U10A 4E2LA 3N2GA 1ZWIC 4LC1A 4LFAB 4PJ0Z 2YXHA 1M90W 1E1RG 4FM1A 2XT9A 5K1PA 3JALA 4O4HB 5LL6Y 3AG4B 4BIUA 2F93B 5KHHA 4JI8O 1BQZA 4MVMA 4P30A 4WBNB 5CB4A 1BSMA 1O9GA 4UB6Z 1XDCA 1Q90D 1AR1B 2ZIOA 1AI6A 2LFRA 2DOSA 1XEQA 1FXHA 1Q6IA 3ABKC 4AHCA 4JI0O 3P30A 1KQSU 5JCOC 3RYCA 4AILC 2LJ2A
chains in the Genus database with same CATH topology
2DJVA 1A32A 4X65O 1N34O 4LFAO 5BR8O 1XNRO 4A5UB 4JI4O 4X66O 3OTOO 4YHHO 4OX9O 4LFCO 4KHPO 2ZM6O 3J80N 1FYJA 4DV5O 2UXCO 3SDLA 4GKKO 4K0KO 2UXBO 3M8AA 1XMQO 2Z0AA 4X62O 4DV4O 4DR1O 4LF6O 4JI6O 1HR0O 4DR2O 1I94O 1HNWO 4JI3O 5A2QN 1HNZO 1R1BA 1N32O 3T1YO 4NXNO 3JAMN 4DUYO 1IBMO 4DV7O 3RT3C 5LMNO 5IT9N 2VQEO 2FKXA 4DV0O 5H5NA 4YY3O 4DV3O 4JI5O 3J81N 1X59A 4DR7O 4DUZO 4OPHA 1IBLO 4DR4O 1R6TA 4LF5O 1F7YA 1YZBA 4B3MO 4DR6O 4GKJO 4B3TO 2ZKOA 5LMUO 4DR3O 2UXDO 1G1XB 4JI2O 1AB3A 1XMOO 3R66A 2AGAA 4LF7O 4AQYO 2N74A 5BXZA 4JI1O 4LFBO 5LL6Y 1DK1A 4JI8O 4DR5O 1FKAO 1J5EO 4LF9O 4DV1O 2LW7A 5IWAO 1KUQA 2JRIA 1AILA 4LF8O 1NS1A 3F5TA 3O65A 1D2DA 4DV6O 2VQFO 4B3RO 4JI7O 1IBKO 2UUAO 5FLXN 2DOSA 1XEQA 4B3SO 4DV2O 1FJGO 3J7AU 2HHHO 4JI0O 1XNQO 1HNXO 4NXMO 2F4VO 3T1HO 2UUCO 4JV5O 2E5LO 4LF4O 2UUBO 1N36O 2UU9O 1N33O 4JYAO 4OPAA 4X64O 5BY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJV A;  1A32 A;  4X65 O;  1N34 O;  4LFA O;  5BR8 O;  1XNR O;  4A5U B;  4JI4 O;  4X66 O;  3OTO O;  4YHH O;  4OX9 O;  4LFC O;  4KHP O;  2ZM6 O;  3J80 N;  1FYJ A;  4DV5 O;  2UXC O;  3SDL A;  4GKK O;  4K0K O;  2UXB O;  3M8A A;  1XMQ O;  2Z0A A;  4X62 O;  4DV4 O;  4DR1 O;  4LF6 O;  4JI6 O;  1HR0 O;  4DR2 O;  1I94 O;  1HNW O;  4JI3 O;  5A2Q N;  1HNZ O;  1R1B A;  1N32 O;  3T1Y O;  4NXN O;  3JAM N;  4DUY O;  1IBM O;  4DV7 O;  3RT3 C;  5LMN O;  5IT9 N;  2VQE O;  2FKX A;  4DV0 O;  5H5N A;  4YY3 O;  4DV3 O;  4JI5 O;  3J81 N;  1X59 A;  4DR7 O;  4DUZ O;  4OPH A;  1IBL O;  4DR4 O;  1R6T A;  4LF5 O;  1F7Y A;  1YZB A;  4B3M O;  4DR6 O;  4GKJ O;  4B3T O;  2ZKO A;  5LMU O;  4DR3 O;  2UXD O;  1G1X B;  4JI2 O;  1AB3 A;  1XMO O;  3R66 A;  2AGA A;  4LF7 O;  4AQY O;  2N74 A;  5BXZ A;  4JI1 O;  4LFB O;  5LL6 Y;  1DK1 A;  4JI8 O;  4DR5 O;  1FKA O;  1J5E O;  4LF9 O;  4DV1 O;  2LW7 A;  5IWA O;  1KUQ A;  2JRI A;  1AIL A;  4LF8 O;  1NS1 A;  3F5T A;  3O65 A;  1D2D A;  4DV6 O;  2VQF O;  4B3R O;  4JI7 O;  1IBK O;  2UUA O;  5FLX N;  2DOS A;  1XEQ A;  4B3S O;  4DV2 O;  1FJG O;  3J7A U;  2HHH O;  4JI0 O;  1XNQ O;  1HNX O;  4NXM O;  2F4V O;  3T1H O;  2UUC O;  4JV5 O;  2E5L O;  4LF4 O;  2UUB O;  1N36 O;  2UU9 O;  1N33 O;  4JYA O;  4OPA A;  4X64 O;  5BY1 A; 
#chains in the Genus database with same CATH topology
 5B5E Z;  1VQN V;  4LFA O;  1XHZ A;  1PV0 A;  4X89 A;  5FNV A;  4IT5 A;  3UCS C;  2X6B A;  2ZNI A;  4FZ0 A;  2YXL A;  4JI1 B;  1VQ4 V;  4FVM A;  3K5O A;  4DR5 B;  1TVK A;  2A7W A;  5DED A;  4X1K B;  2YS8 A;  3BVO A;  4TV9 B;  3H01 A;  1NBM G;  1OCO C;  3L73 H;  4B3R B;  2OIG A;  3JAS B;  4O4L A;  1VF7 A;  1R1B A;  3CPW U;  2E3C A;  2P6J A;  1XNQ B;  2FKX A;  1ZL8 A;  3ZMU A;  3OMI B;  2FTK A;  4PA4 A;  1IXB A;  2K1E A;  2JGD A;  1SC5 B;  1JCH A;  1IZ3 A;  3STZ C;  1XUQ A;  4UCT A;  5CA1 B;  1WA8 A;  4JI1 O;  4KL1 A;  3ZRW B;  2EIJ C;  4DR5 O;  5B66 Z;  5C93 A;  4TUY A;  4B3R O;  4EKW A;  1EFR G;  3LNN A;  3OD4 A;  2RMK B;  4DR1 B;  1SET A;  3OW2 U;  4CH6 A;  2WLL A;  1O9H A;  1AP6 A;  3JAW B;  3VQV A;  2IJK A;  5JJJ B;  5KLV H;  1UPG A;  3THO A;  5B3S B;  1TUB A;  1XNQ O;  1M57 B;  2F66 C;  4J7Z A;  4YJ2 B;  3FAV B;  4FJC C;  3JYC A;  3X2Q C;  4B7K A;  4X65 O;  1F4M A;  4LF5 B;  4I7Z B;  1RSO B;  1AI4 A;  2KQX A;  2B9Z A;  1OHH G;  1CP9 A;  2QE7 G;  4NTY A;  4FFB A;  1XMO B;  2IH3 C;  1UFI A;  5KX5 B;  2HJD A;  4DV1 B;  5LGN A;  4QE9 A;  4NTX A;  4DR1 O;  5L3B A;  1VEW A;  3FB7 C;  3T1C A;  4TQD A;  1IUR A;  1IBK B;  2PF4 E;  5A2Q N;  2WLJ A;  2JGU A;  4BW9 A;  4IL6 Z;  5CA3 A;  5LOV B;  1XQ8 A;  4G2K A;  4Z1V A;  1JOY A;  2HP8 A;  3OEE G;  2DYS B;  4LNU A;  3H1J H;  4LF5 O;  2WLI B;  1BS3 A;  2DYR C;  3KCY A;  1G1X B;  4UVA A;  1XMO O;  1NTK H;  4F6R A;  2Y69 B;  1SF9 A;  4BAY A;  1VQP V;  5HFM A;  4PEL A;  1FKA O;  3ABL B;  3A2F A;  3VBB A;  2YEV B;  4UXN A;  3FD9 A;  4DV1 O;  4MS2 A;  2E5L B;  1CEZ A;  4PA9 A;  4K0K B;  3S3X A;  4GT1 A;  1IBK O;  1S5H C;  1QLE C;  4DV4 B;  3RYF A;  5LA6 A;  1VQK V;  1V54 C;  5JJN B;  1AVM A;  4NB5 A;  1WJZ A;  3I55 V;  3TXS A;  1QR8 A;  2KB1 A;  2GSM B;  1G4Y B;  1Y74 B;  3E35 A;  5BMV A;  3T1Y B;  1Q81 W;  2X7R B;  4PDL A;  4G28 B;  5GTI Z;  4P9O A;  4X64 O;  4MVU A;  1W0K G;  2DJV A;  3O9O A;  4GUN A;  4WFB V;  4JI6 B;  3P3N A;  3PN1 A;  3A0R A;  2PYL A;  1FXK B;  4JAS A;  4ZI7 B;  1FYJ A;  1F23 A;  4JTC B;  3OUF A;  3CJH A;  3ZED A;  2OTL V;  4K0K O;  4DXW A;  3OR6 C;  4WFA V;  4LF8 B;  4DV4 O;  2QR4 A;  2OWO A;  3LDC A;  2LP7 A;  4DV6 B;  4GLX A;  4XDK A;  1SQB H;  5B1B B;  3W7T A;  3AG1 C;  3T1Y O;  3GVM A;  2Q0O C;  3CC4 V;  3E22 B;  3F7Y C;  1PNK A;  3ZHT A;  1I08 A;  4QGP A;  2XUM A;  5F2V O;  1NVP D;  1NTM H;  4X1I B;  4WFH A;  5J2U A;  4FLW A;  5H5N A;  4YXW G;  1S77 D;  1WPB A;  5KHI A;  2WLH A;  5BZB A;  1IDS A;  3DXR B;  4B3M O;  1VIB A;  1Q8I A;  2GHY A;  4YJ3 B;  3SYC A;  3AEI A;  2ZXW C;  2WLN A;  2IU0 A;  2CH7 B;  3JCZ A;  3H1L H;  3LUT B;  3D3Q A;  1VF6 A;  1Y6X A;  2ATK C;  3CWB H;  4C7U A;  2ZNJ A;  2ZM6 B;  1ARO P;  2M7W A;  1ZLZ A;  2F95 B;  3N2K A;  4LF8 O;  4I50 A;  1D2D A;  4DV6 O;  2UXB B;  3ABK B;  1SA0 B;  5CBF A;  1V55 C;  1YXB A;  1BHB A;  1HR0 B;  4RWU A;  4EB6 B;  2BTQ A;  3HKE A;  3SJC C;  5B1N A;  1SQG A;  4DUY B;  1EZV H;  5JWP A;  1UJW B;  1W0J G;  3SYO A;  2JEX A;  4FLY A;  1RPR A;  4DR4 B;  3F7V C;  1A32 A;  3WB1 A;  3CMA V;  4X62 B;  1DF5 A;  1N4C A;  2Q68 A;  4FLX A;  2R72 A;  2IU3 A;  3KZI Z;  1OCO B;  4QJF B;  4NYK A;  2ZM6 O;  1EZJ A;  4DK0 A;  1QLN A;  1K5S A;  3SYP A;  4XBF A;  4EFE A;  2UXB O;  4WCE V;  2Z0A A;  2EJ7 A;  1SQX H;  5JJE B;  3JAR B;  4J41 A;  4J10 A;  4ZOL B;  1SRY A;  4FLZ A;  2HKO A;  1HR0 O;  3RBZ A;  5JQG A;  2R70 A;  1FFX B;  4QNH B;  2ITD C;  3FB5 C;  4DUY O;  4JI2 B;  4TV8 B;  1X4T A;  2GTS A;  2W6I G;  2GV9 A;  4MW3 A;  2FYU H;  4IIJ B;  4DR4 O;  2Q6A A;  3QVN A;  4JYA B;  5IE9 A;  3K5L A;  2EIJ B;  3Q4H B;  3VQW A;  3OT7 A;  1EM1 A;  1M56 C;  1SS3 A;  4KUM A;  5BR8 B;  3B77 A;  4JI4 B;  1I7F A;  4FFK A;  1K5Q A;  1PKX A;  2JVD A;  3ZRX A;  3CCM V;  3IC7 A;  1NS1 A;  3F5T A;  4RAI A;  1FAF A;  2P7T C;  2C2A A;  3CP1 A;  5JH7 A;  4O4H A;  4F6E A;  1K9M W;  3BPZ A;  4K8X A;  4RUF A;  1EBO A;  1F51 A;  4XDJ A;  1P7B A;  3X2Q B;  1NJI W;  2LGQ A;  3C90 A;  1QQC A;  3OTF A;  4OX9 B;  5FPR A;  2YSU B;  4WBN A;  4NKG B;  4JYA O;  2AZ2 A;  2Q9L A;  4DV3 B;  3M7M X;  3LSS A;  1NR7 A;  3B40 A;  1AJQ A;  4NTW A;  5BR8 O;  3AG2 C;  4JI4 O;  1VQ9 V;  1MAB G;  2F43 G;  1KP3 A;  3QO8 A;  2H3O A;  2RJZ A;  4Z1M G;  1Q82 W;  4FPP A;  1WLE A;  5EIB D;  4DRX A;  1PPJ H;  3LSQ A;  4ZHQ B;  3UKM A;  4OGQ B;  4LF9 B;  4JAV A;  5B1O A;  3ZIA G;  1Y66 A;  4B7E A;  1AR5 A;  1XL4 A;  3JAK B;  1NH2 D;  5B1A C;  3CE2 A;  2Y0P A;  3SPH A;  2Q7G A;  5IJ9 A;  5J9P C;  2CTR A;  2ZIN A;  3K57 A;  3K08 A;  3D36 A;  1BGY H;  1FXV A;  4R50 A;  1ZUQ A;  1JPX A;  4H0L B;  5IT9 N;  2LQT A;  2DYR B;  4X1K A;  2OCC C;  1B04 A;  4DV3 O;  1R73 A;  4OPH A;  4PD4 F;  4ZIB A;  2QWQ B;  2UU9 B;  3K59 A;  4BIO A;  1G8M A;  3JAS A;  4O4J B;  4GKJ O;  1WAZ A;  5CA0 A;  4J7K A;  1N34 B;  4N21 A;  3OMA B;  2JDI G;  4NVP A;  2Q73 A;  4CS3 A;  1QLE B;  3BA8 A;  4MTO A;  3APO A;  4LF9 O;  3B4S A;  1K34 A;  3GB7 C;  3FKS G;  3TET A;  3DC6 A;  4UB8 Z;  5GON B;  3H1K H;  1Z5W A;  4H37 A;  4LH6 A;  1VAR A;  5FLX N;  3I56 V;  5IYB O;  1I94 B;  2DQ0 A;  5GW7 A;  1VQ8 V;  4MTX A;  5JVD A;  3H1H H;  1WN7 A;  1ENV A;  4IHJ B;  3B09 A;  2GBO A;  2Y0I A;  3RW0 A;  1JA8 A;  2UU9 O;  4UCU A;  2VQE B;  1KB9 F;  4GX5 A;  5LP6 A;  1S5L Z;  2AW9 A;  2FB5 A;  3E89 A;  3WG7 C;  1GKF A;  2EBO A;  1N34 O;  2ZIM A;  3CB2 A;  3T4D A;  1KMI Z;  5LMU B;  1GAX A;  4CS2 A;  4O2B A;  3MD0 A;  4MW8 A;  1H2G A;  3RYH B;  2V7Q G;  2HR3 A;  2YXY A;  3ASO C;  5ITZ B;  2FL4 A;  3AG1 B;  3M8A A;  2WLK A;  2QEX V;  1Q6H A;  4UCV A;  4U3F H;  3VQX A;  1I94 O;  2W0X A;  2ZE7 A;  3IAY A;  3D3I A;  5KAI Z;  4U3J B;  3RT3 C;  2KKW A;  5KX5 A;  2VQE O;  1QNM A;  1HP8 A;  2ZXW B;  3SPC A;  3RYI A;  1X59 A;  4PV1 B;  4U7O A;  1IXM A;  3TK1 A;  5LMU O;  2XAS A;  1XBL A;  2RCV A;  2ZR2 A;  3SYA A;  5LOV A;  1H38 A;  5IJ0 B;  1S72 V;  3JSL A;  1VQL V;  1DK1 A;  1V55 B;  2A06 H;  1JVM A;  5H6R A;  4MVS A;  1XI1 A;  2WA4 A;  1SZX A;  2PYJ A;  2AHY A;  2OT5 A;  3IGA C;  2YDE A;  1JFF B;  4D6T H;  3APQ A;  2B1G A;  3ABT A;  4GX2 A;  4FIP C;  3TXQ A;  4X65 B;  2QWO B;  4DR2 B;  2ITC C;  3ZN0 A;  1ZSP A;  1HNZ B;  5LYJ B;  3HKC B;  4NXN B;  4UUJ C;  3QO7 A;  5KUM A;  3W7X A;  1DTO A;  4OPA A;  1SQQ H;  2DMX A;  3LNM B;  1VQ5 V;  4YY3 B;  4LCU C;  1Y76 B;  2EJR A;  3N2G B;  3JAT A;  1Y74 A;  4WFF A;  1P49 A;  1M9N A;  2XAQ A;  3JD0 A;  2E76 B;  4LF7 B;  1KKC A;  4WFG A;  3RFR A;  2JJ1 G;  3ABU A;  1L0N H;  3AK1 A;  1OCR C;  1WPX A;  3OR7 C;  1Q86 W;  2KG7 B;  3U11 A;  5CB4 B;  3CCR V;  1F4N A;  4PA6 A;  4DR2 O;  5CBG A;  5LGT A;  1HNZ O;  3FYE B;  4NXN O;  1URF A;  4P9P A;  4X20 A;  1S5J A;  1WP8 A;  2N04 A;  1M56 B;  4NXM B;  4YY3 O;  3WU2 Z;  1YTF D;  2E74 B;  1QVG U;  1N33 B;  1WP7 A;  2WSS G;  4CC6 A;  3JD4 A;  2G38 A;  4JYY A;  1R3K C;  2ZKO A;  4JYC A;  5FNV B;  4LF7 O;  1GMG A;  3CS5 A;  4Q20 A;  4X1I A;  4B08 A;  4I55 B;  3JD1 A;  4LWS B;  4I0X A;  4TT3 G;  1XL6 A;  3CX5 F;  1KUQ A;  1YEW A;  5IYD O;  4ASU G;  3HKD A;  4X64 B;  3K03 A;  4FM2 A;  4MSW C;  4BIZ A;  1J95 A;  1EN4 A;  1MNG A;  1K33 A;  1HNW B;  2GTA A;  4O4L B;  2RN9 A;  3HKB A;  4CH5 A;  3G67 A;  4DW1 A;  4NXM O;  3AG2 B;  2JS5 A;  4HYO A;  3C3T A;  5LMN B;  1N33 O;  4X8A A;  4TSF G;  1ZL8 B;  3OGC C;  4CH3 A;  1SZT A;  1OCZ C;  2BSK A;  4KP4 A;  4JI5 B;  3ZHQ A;  4CBC A;  1GK9 A;  1IBL B;  5JCO A;  4P2Z A;  4DR6 B;  1JJ2 U;  4A5U B;  1HW7 A;  2ARH A;  2YI8 A;  4PI2 A;  2CE4 A;  3CRM A;  3CRQ A;  1IX9 A;  5EZY A;  4AQY B;  5B1A B;  1G6U A;  1K73 W;  3SJQ C;  2XAJ A;  3ETQ A;  3JD2 A;  3SDL A;  5IWA B;  4YIO A;  2ZE5 A;  5IY5 C;  1VQ6 V;  4TUY B;  1E1Q G;  5IYC O;  5E1A C;  1KKD A;  2ODM A;  4X9Q A;  1HNW O;  2OCC B;  2WLL B;  4B3M B;  3BCC H;  2ZR3 A;  4FZ1 A;  1K3E A;  5EYP A;  1TUB B;  2X0L A;  2CUG A;  3D8C A;  1K92 A;  5LMN O;  1YVW A;  4JZ2 A;  3T1H B;  5DM6 V;  3CCS V;  4JV5 B;  2AXT Z;  4JI5 O;  5EBW C;  1IBL O;  1R6T A;  3NXS A;  2X6A A;  3I5D A;  3ML0 A;  4DR6 O;  2P4K A;  1XIL A;  5L3F A;  3BHP A;  2HJF C;  3ZHS A;  3AG3 C;  3R66 A;  3OE7 G;  4AQY O;  3QG5 A;  4R8C A;  1RP3 B;  4FFB B;  2Q69 A;  3G71 V;  1KU9 A;  2HEP A;  1MMM A;  4JYB A;  2V4D A;  2A79 B;  5IWA O;  2F23 A;  3RVY A;  1JMK C;  3PJS K;  2CGO A;  4W4L A;  2YID A;  4LR3 A;  2BOC C;  1OJH A;  1YJW V;  2N05 A;  4L87 A;  3G6B A;  4K8Z A;  3WG7 B;  1N32 B;  3ZMV A;  2JEU A;  3T1H O;  2E75 B;  4JV5 O;  4D7T A;  1GN3 A;  3P3P A;  3QO5 A;  2PZS A;  3UT5 A;  5BY1 A;  1EN5 A;  4LNU B;  1SER A;  3D36 C;  3ASO B;  4HNA B;  2HLD G;  1K97 A;  4H33 A;  1S76 D;  3ZHU A;  4BR6 A;  4F6R B;  5D5Q A;  3CCV V;  2AZ0 A;  3FYI B;  3K3W A;  3ZHV A;  3SR2 C;  5FL7 G;  1JJO A;  3AG7 A;  1GO3 F;  1PNL A;  3OUS A;  1NR1 A;  4TQF A;  1BE3 H;  3E8B A;  1Q43 A;  3CCL V;  3QTC A;  1JQ0 A;  5KHK A;  2EZP A;  2WLM A;  5KMG A;  3RYF B;  2LFS A;  2GUZ A;  3DTU B;  2JS3 A;  5KA5 A;  2UUA B;  4DO2 A;  1WNS A;  1N32 O;  2H94 A;  1GN4 A;  1TA8 A;  2IBZ H;  4MT8 A;  1R3J C;  2RNB A;  3CCJ V;  4DV7 O;  3ZMZ A;  5IYZ A;  2QGN A;  1E79 G;  4FLV A;  3CC7 V;  1S3J A;  3J81 N;  4DR7 O;  5FPO A;  2UUB B;  1P84 F;  5E79 Z;  1F7Y A;  1SQF A;  5EBL C;  1VQ7 V;  1R3I C;  2A9H A;  4RQE A;  3ABM C;  4X1Y A;  2ETN A;  1XNR B;  1DLB A;  1LUV A;  5KHJ A;  5LP6 C;  3GWK C;  5TIS Z;  1PM9 A;  5EK0 A;  4E4E A;  4KHP B;  2Q5Z A;  4CZZ A;  4Q6G A;  3E2E A;  4O4J A;  4UVB A;  4Z2W A;  4IGG A;  2XAH A;  4I4T B;  1H2L A;  2Y48 A;  2UUA O;  2YI9 A;  2W6J G;  4ZBM A;  1Z2G A;  1NT2 B;  1U97 A;  1LR1 A;  2UUB O;  5J2U B;  5GON A;  4RUE A;  2ZE8 A;  3JSN A;  2HG5 C;  1N0N A;  5K1X A;  2DW4 A;  1QHT A;  4LH7 A;  1GN6 A;  5HFL A;  4YIP A;  3RWR D;  3OFN G;  1XNR O;  1OCR B;  1M5I A;  3ZMS A;  1VF5 B;  3WFV A;  4IHJ A;  3F5W C;  4KHP O;  4LFB B;  1YIJ V;  2EIM C;  4H13 B;  2WA3 A;  3SPJ A;  4O4I B;  2EZO A;  1KP2 A;  2QTO A;  4CC5 A;  2QKA A;  3P32 A;  5H2F Z;  4GKJ B;  5LHH A;  3RYH A;  2BTQ B;  5L3E A;  5ITZ A;  4JAA A;  1PNM A;  1QU7 A;  4B3S B;  4R7C A;  3TJT A;  2K9P A;  1P4R A;  1HWY A;  3K9S A;  4MTF A;  3ICX A;  1WB8 A;  4I9Q A;  5EIB C;  1NZ6 A;  1N36 B;  1AJN A;  1NTZ H;  2A0L A;  4UV9 A;  4MTG A;  3R65 A;  1N8R W;  1ROP A;  2A3Q A;  2X6C A;  2NN4 A;  2KSD A;  5KA6 A;  4X66 B;  4LFB O;  4YHH B;  1Q5O A;  3OAA G;  3FFQ A;  1R3L C;  3G6E V;  1Z5V A;  1AIL A;  1GN2 A;  3L72 H;  4TV9 A;  5DEC A;  1HDJ A;  2VQF O;  2UXC B;  4GKK B;  2ZDI A;  2ADP A;  2RDC A;  4JZG A;  3U0Z A;  3ZBH A;  2QWR B;  5LXT B;  4RO2 A;  2RQ6 A;  3BA9 A;  5DN6 G;  1YJN V;  5JQG B;  4ICG A;  2VWK A;  1THZ A;  1NI8 A;  1OCZ B;  4KFM A;  3CCE V;  1W59 A;  2WWW A;  4B3S O;  1XRE A;  3FB8 C;  3EHB B;  3RGB A;  4PHZ A;  1H8E G;  1JX9 A;  1RFY A;  1N36 O;  2PUS A;  1AI7 A;  3HB3 B;  3CC2 V;  3L75 H;  1GM9 A;  5CA1 A;  5LHI A;  4X66 O;  2UXD B;  5LYJ A;  3OGI B;  3HKC A;  4YHH O;  5IY5 B;  3ZRW A;  3LSU A;  2Y4T A;  2XOK G;  1VQO V;  2ZQM A;  2UXX A;  1OCC C;  1J5E B;  4GKK O;  2UXC O;  4AI8 A;  2R9I A;  1Y76 A;  3CXC U;  1MSW D;  3B8N A;  1H2M A;  3K06 A;  4R6Z A;  3MHS C;  3BY6 A;  4JI7 B;  2CGN A;  3JAW A;  4RQF A;  5JH7 B;  2HFE C;  3JCU Z;  1KYO F;  3VOU A;  2LW1 A;  2QWN B;  4UV8 A;  3G80 A;  4YJ2 A;  2HHH B;  3AG3 B;  3HR0 A;  2KG7 A;  3FAV A;  1CXZ B;  3L9D A;  1N0J A;  4LF4 B;  4GX0 A;  3A0H Z;  4MVQ A;  3ETG A;  1H8H G;  3CME V;  3CCU V;  2P4V A;  1RSO A;  5J2T B;  2FML A;  1NVP B;  2UXD O;  3VQY A;  3QF7 A;  3RVZ A;  1BCC H;  5KUK A;  3E86 A;  2AGA A;  2YIC A;  4QPK A;  2XHB A;  1TUE B;  1FD9 A;  1S0V A;  1J5E O;  2L6L A;  3C3S A;  1ORQ C;  3CYO A;  1L8D A;  4CH4 A;  4DRX B;  3K04 A;  1ZTE A;  1SQV H;  2QM4 A;  1GM8 A;  4J42 A;  4JI7 O;  3SJA C;  1XMQ B;  3A0B Z;  2ADQ B;  5CMU A;  4I55 A;  5IJ9 B;  2QTS A;  4O2A B;  1AP5 A;  2VRZ A;  4LWS A;  2EX3 A;  2HHH O;  2UXN A;  3AK3 A;  3UO2 A;  4FLU A;  2DN9 A;  4LF4 O;  4XDL A;  4MVO A;  3BFR A;  2WLI A;  2W0F C;  3EFF K;  3QNE A;  5LGU A;  4NR1 A;  2JJ2 G;  4ZKI A;  1IVS A;  1SQP H;  1JR9 A;  3E83 A;  2IJI A;  5CA0 B;  4GX1 A;  5L3G A;  1MOF A;  4D7S A;  3BRC A;  5C8Y B;  1BMF G;  3J80 N;  2YEV A;  1COW G;  1LNQ A;  1ZX3 A;  4FLT A;  3A8T A;  2QKC A;  4MVR A;  2XTA A;  1XMQ O;  4OXS A;  4L8J A;  3MAQ A;  3CRC A;  2OCH A;  1BL8 A;  1L0L H;  1ZAU A;  2NNU A;  1QR9 A;  3CRR A;  3L74 H;  1PD3 A;  2R9A A;  4N23 A;  3JAL B;  5JVD B;  2WAM A;  1M1K W;  2UUC B;  4J11 A;  3ABM B;  2XAG A;  2XND G;  1GM7 A;  5LP6 B;  1YZB A;  2CAZ C;  3ETD A;  3FX7 A;  1L1F A;  2D2C B;  1VF6 C;  3CEI A;  1M4U A;  3CSX A;  4EEQ A;  2BCC H;  4JAU A;  5BXZ A;  3DGE A;  3OTO B;  1FXK A;  4O2B B;  4ZI7 A;  4IYH A;  2Q0A A;  4LFC B;  3M99 B;  3E8F A;  4DV5 B;  1NQT A;  3BAA A;  2YC0 A;  3RYC B;  2PGG A;  2EIL C;  2IM9 A;  3GWO A;  4QE7 A;  3L70 H;  1TAE A;  3ZJZ A;  2EIK C;  2QSA A;  2IJH A;  4TOI A;  4ABM A;  3E22 A;  4JI3 B;  1US6 A;  3FB6 C;  1FS0 G;  2NR5 A;  2UUC O;  2Q8V A;  2XAF A;  4JTD B;  3K9A A;  3STL C;  2F1M A;  2ZCE A;  3RYI B;  3DXR A;  1TVK B;  4PA3 A;  4YJ3 A;  3OMN B;  2BE3 A;  2CH7 A;  2EIM B;  2R9R B;  2P22 C;  2IW5 A;  4DR3 B;  3OTO O;  3DSQ A;  4LFC O;  4J7J A;  3K58 A;  3BAB A;  2LGW A;  3OM3 B;  5AG2 A;  4DV5 O;  3ZS8 C;  3ETE A;  1SA0 A;  3W7W A;  3ZRS A;  4HNA A;  4TWK A;  2ZD9 A;  2B1I A;  3ZX6 A;  2QM8 A;  2JGD B;  1TGO A;  4JI3 O;  4EB6 A;  1VQM V;  2V1D A;  1YF2 A;  3JAM N;  3L71 H;  4PDM A;  1WA8 B;  2Y4U A;  4DV2 B;  1NH2 B;  1FJG B;  1K8A W;  3ZN1 A;  2F4V B;  1BT8 A;  3K5N A;  5D5P A;  5GTH Z;  1GTO A;  2QDO A;  2EIN C;  4FMT A;  4DR3 O;  1I5Y A;  2B5U A;  2Z5U A;  3ASN B;  1RM1 C;  1R6N A;  1U96 A;  3JAT B;  5KHG A;  2N74 A;  1NKD A;  3EVK A;  3H9V A;  1Q6U A;  2BOB C;  2P67 A;  3SGI A;  4LP8 A;  5CN0 A;  2JRI A;  2ZE6 A;  3JAR A;  4WFE A;  4ZOL A;  4CS4 A;  3AG4 C;  4JTA B;  1SKV A;  1FFX A;  1I0H A;  2PTM A;  4UVC A;  1DGS A;  2OTJ V;  2HVK C;  3WB0 A;  4TV8 A;  4DV2 O;  1FJG O;  2F4V O;  4X20 B;  2E5L O;  2QWP B;  4FK5 C;  1IBM B;  2P90 A;  4GCZ A;  1YDX A;  4IIJ A;  4J80 A;  1M93 A;  2PI4 A;  1FFT B;  3CXH F;  4I4T A;  1V9P A;  2PY5 A;  4JF3 A;  3MHH C;  3Q4H A;  4DUZ B;  4F4L A;  1DF4 A;  3K0D A;  4B3T B;  1OCC B;  2M6Y A;  1D5N A;  1PL4 A;  3UM7 A;  4PDV A;  2YIB D;  1EN6 A;  4UCR A;  4UCO A;  2JK5 C;  2DWD C;  2CDY A;  4I0X B;  4DV7 B;  1KD1 W;  2CTP A;  2VWJ A;  3H1I H;  3HKD B;  4DR7 B;  1BQ0 A;  5L3D A;  4JI6 O;  1KC8 W;  4X88 A;  5LBQ A;  3KKY A;  1XOU A;  3B8M A;  3CD6 V;  1B6Q A;  1B3Q A;  2HVJ C;  3BEH A;  3ZHR A;  4K3A A;  1IBM O;  3HKB B;  1MSD A;  2ZDI C;  3W7U A;  4PA7 A;  3CHX A;  4O4I A;  4J9Z B;  1D5A A;  1FPO A;  2P5O A;  2Q4P A;  4DUZ O;  2AHZ A;  4UCS A;  4G27 B;  2YIA A;  1CPY A;  3KCX A;  4JGS A;  1K7D A;  2BSK B;  5EBM C;  3SJB C;  4BW5 A;  3T2M A;  4B3T O;  2CK3 G;  3K0G A;  3ZMT A;  1Y4M A;  2Q67 A;  5LA6 B;  1SES A;  3HPL C;  1K4D C;  1YHQ V;  3T4Z A;  1BZK A;  5EZY B;  4H44 B;  5BMV B;  1AR4 A;  4ZHQ A;  2LW7 A;  4EFB A;  3CRA A;  1R6K A;  4WF9 V;  2ILM A;  4IYI A;  3O65 A;  4FM0 A;  2IH1 C;  3IFX A;  3JAK A;  1Y67 A;  4LBE C;  1YI2 V;  2Q7E A;  4LF6 B;  4DW0 A;  1K4C C;  2MK3 A;  2ZT9 B;  4DK1 A;  1H2S B;  1Q7Y W;  2YUA A;  3RN4 A;  4HBN A;  2QKS A;  1MG1 A;  5EYP B;  1BHA A;  2CTW A;  2JIZ G;  4BWA A;  5H9C A;  3CJH B;  3SYQ A;  5B3S C;  5LXT A;  3W7S A;  4PI0 A;  4GYC B;  1M57 C;  3IJ4 A;  2H8P C;  3ZRV A;  3K79 A;  2OYQ A;  1YJ9 V;  5KAF Z;  5EC1 C;  4W4K A;  4JPR A;  3E8G A;  1QBZ A;  1VP7 A;  1OV9 A;  4X62 O;  4LF6 O;  4KXR A;  3S3W A;  3LDD A;  3TGU H;  2P06 A;  1MA1 A;  1VMG A;  2DWE C;  3EXA A;  1YCI A;  4MVZ A;  2QA4 V;  4QPJ A;  1B06 A;  1I5X A;  1HNX B;  1QVF U;  4I5S A;  3N2K B;  3UT5 B;  4I50 B;  2PI5 A;  3G4S V;  2VQF B;  5IDJ A;  1LUW A;  3CCQ V;  5EC2 C;  4JI2 O;  1AB3 A;  1QCE A;  2DYS C;  1YTF B;  2EIL B;  3HKE B;  2EIK B;  4K35 A;  4GZR B;  1YIT V;  5L3C A;  2IJJ A;  2Y69 C;  3KG2 A;  4QIW F;  4HZ3 A;  5J2T A;  2YIB A;  5LHG A;  1YSC A;  3ABL C;  1WB7 A;  2OIE A;  5KMG B;  2GUZ B;  5H6Q A;  4U3J A;  1H2K A;  2QM7 A;  3J7A U;  1KEC A;  1HNX O;  1Q3E A;  2LO1 A;  5A9G A;  3K5M A;  1H2N A;  1NU1 H;  5IYZ B;  3NR7 A;  3ASN C;  1GH6 A;  3WB2 A;  1P7G A;  4DV0 B;  3JD3 A;  4PDR A;  3E8H A;  4O2A A;  2MW2 B;  5IJ0 A;  2O57 A;  1PP9 H;  2Z3Y A;  3N27 A;  3SPG A;  3MDS A;  2D3O W;  4X1Y B;  4OX9 O;  1T5E A;  2GDS A;  1AJP A;  1XHX A;  2DQ3 A;  1KBH A;  2VS0 A;  4JI8 B;  3LDE A;  2DE0 X;  2BTO A;  3TCU A;  1JFF A;  1RPO A;  1MZF A;  3UQ8 A;  1FXK C;  4J9Y B;  3DC5 A;  5C8Y A;  3OEH G;  2CTQ A;  2NLJ C;  4U7N A;  1MZE A;  1OZ0 A;  2L35 A;  4UFZ A;  4I9W A;  2Q7H A;  2WPD G;  2EIN B;  1W2B U;  1V54 B;  3AK2 A;  1PL0 A;  1GRJ A;  4JI0 B;  3IC9 A;  3UO3 A;  4DV0 O;  1RM1 B;  4HAM A;  3ZCC A;  3B2E E;  5B1B C;  2QJ1 A;  4DYL A;  1AI5 A;  3SPI A;  5CBH A;  2EUL A;  3U10 A;  4E2L A;  3N2G A;  1ZWI C;  4LC1 A;  4LFA B;  4PJ0 Z;  2YXH A;  1M90 W;  1E1R G;  4FM1 A;  2XT9 A;  5K1P A;  3JAL A;  4O4H B;  5LL6 Y;  3AG4 B;  4BIU A;  2F93 B;  5KHH A;  4JI8 O;  1BQZ A;  4MVM A;  4P30 A;  4WBN B;  5CB4 A;  1BSM A;  1O9G A;  4UB6 Z;  1XDC A;  1Q90 D;  1AR1 B;  2ZIO A;  1AI6 A;  2LFR A;  2DOS A;  1XEQ A;  1FXH A;  1Q6I A;  3ABK C;  4AHC A;  4JI0 O;  3P30 A;  1KQS U;  5JCO C;  3RYC A;  4AIL C;  2LJ2 A; 
#chains in the Genus database with same CATH homology
 2DJV A;  1A32 A;  4X65 O;  1N34 O;  4LFA O;  5BR8 O;  1XNR O;  4A5U B;  4JI4 O;  4X66 O;  3OTO O;  4YHH O;  4OX9 O;  4LFC O;  4KHP O;  2ZM6 O;  3J80 N;  1FYJ A;  4DV5 O;  2UXC O;  3SDL A;  4GKK O;  4K0K O;  2UXB O;  3M8A A;  1XMQ O;  2Z0A A;  4X62 O;  4DV4 O;  4DR1 O;  4LF6 O;  4JI6 O;  1HR0 O;  4DR2 O;  1I94 O;  1HNW O;  4JI3 O;  5A2Q N;  1HNZ O;  1R1B A;  1N32 O;  3T1Y O;  4NXN O;  3JAM N;  4DUY O;  1IBM O;  4DV7 O;  3RT3 C;  5LMN O;  5IT9 N;  2VQE O;  2FKX A;  4DV0 O;  5H5N A;  4YY3 O;  4DV3 O;  4JI5 O;  3J81 N;  1X59 A;  4DR7 O;  4DUZ O;  4OPH A;  1IBL O;  4DR4 O;  1R6T A;  4LF5 O;  1F7Y A;  1YZB A;  4B3M O;  4DR6 O;  4GKJ O;  4B3T O;  2ZKO A;  5LMU O;  4DR3 O;  2UXD O;  1G1X B;  4JI2 O;  1AB3 A;  1XMO O;  3R66 A;  2AGA A;  4LF7 O;  4AQY O;  2N74 A;  5BXZ A;  4JI1 O;  4LFB O;  5LL6 Y;  1DK1 A;  4JI8 O;  4DR5 O;  1FKA O;  1J5E O;  4LF9 O;  4DV1 O;  2LW7 A;  5IWA O;  1KUQ A;  2JRI A;  1AIL A;  4LF8 O;  1NS1 A;  3F5T A;  3O65 A;  1D2D A;  4DV6 O;  2VQF O;  4B3R O;  4JI7 O;  1IBK O;  2UUA O;  5FLX N;  2DOS A;  1XEQ A;  4B3S O;  4DV2 O;  1FJG O;  3J7A U;  2HHH O;  4JI0 O;  1XNQ O;  1HNX O;  4NXM O;  2F4V O;  3T1H O;  2UUC O;  4JV5 O;  2E5L O;  4LF4 O;  2UUB O;  1N36 O;  2UU9 O;  1N33 O;  4JYA O;  4OPA A;  4X64 O;  5BY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...