4NXMO

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title A structural basis for streptomycin resistance
rcsb
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4nxmO00
4LF8O 2LW7A 4DR1O 1YZBA 4JI2O 1HNZO 1I94O 4JI0O 4GKJO 2UUBO 4LF6O 4JV5O 1J5EO 2N74A 2UU9O 4LF9O 2HHHO 4OX9O 5FLXN 4X64O 5BR8O 3J7AU 4JI7O 4JI3O 1FJGO 4LFBO 3R66A 1G1XB 5BXZA 4A5UB 4JI1O 4B3TO 3JAMN 4JI5O 4X65O 4DR7O 3J81N 1F7YA 4K0KO 3F5TA 4NXMO 1DK1A 1XNRO 1R6TA 4KHPO 2F4VO 2E5LO 3SDLA 4NXNO 2UUAO 1N32O 4LF7O 4DR4O 1IBLO 2JRIA 4DV6O 4DR5O 3RT3C 4AQYO 4DV7O 4LFAO 4DR6O 5BY1A 1IBKO 2ZKOA 4DR3O 2VQEO 4JI6O 4GKKO 4DV5O 1D2DA 2DOSA 5IWAO 1IBMO 1HNWO 2UXBO 1N34O 1XMOO 2DJVA 4B3MO 3O65A 2ZM6O 4YHHO 1R1BA 4B3RO 4DUYO 2Z0AA 1X59A 3T1HO 1FYJA 2AGAA 2UXDO 4DV1O 4B3SO 1AILA 1AB3A 4DV3O 2UUCO 1HR0O 4DV4O 1XNQO 4OPAA 4JI4O 4JYAO 4LF4O 1N36O 4DUZO 4OPHA 1NS1A 5LMNO 1XEQA 3M8AA 4LFCO 2VQFO 4DV2O 4DV0O 5H5NA 3OTOO 4DR2O 1KUQA 4YY3O 2FKXA 2UXCO 5LMUO 4JI8O 3T1YO 1FKAO 1HNXO 5A2QN 1N33O 3J80N 5LL6Y 4LF5O 4X62O 1A32A 1XMQO 4X66O 5IT9N
chains in the Genus database with same CATH superfamily
3JAWB 2DWDC 3WFVA 4YJ2B 3ASOC 1BCCH 4FIPC 2AZ2A 3CPWU 1WAZA 1LNQA 4TV9B 4H37A 5EC2C 1AJNA 4X1YB 3FYEB 1XMQB 4B3TB 1J5EO 1P4RA 1Q3EA 2FMLA 4OX9O 1XUQA 2BSKA 1I7FA 3QO8A 2QWPB 3LNNA 4MVRA 2WA3A 4BIOA 4A5UB 2PGGA 4E4EA 4JYYA 2LP7A 5EK0A 4AQYB 1AI4A 2GV9A 4PA3A 1ROPA 3ASNB 4X65O 2IJKA 3ZHVA 4IL6Z 3BA8A 4J41A 4F6EA 1QLNA 3K08A 2XTAA 4HAMA 3B2EE 5IJ0B 4PI2A 2YDEA 2IU0A 4PA6A 1RFYA 5KLVH 2KB1A 3RYHB 1BS3A 5EZYA 4JI6O 3FB7C 1IXMA 1XNQB 3JD2A 1K97A 1BQZA 4DR1B 2HHHB 2BOBC 3JD0A 2YXHA 2Y0PA 2WPDG 5LMUB 2VQFB 4PHZA 1AJPA 1YEWA 5CA0B 5LXTA 4JYAO 1XL4A 1VQ4V 4LF4O 3APOA 1KECA 2EIJC 2Q7EA 3X2QB 2WA4A 1NJIW 2WLHA 2PI5A 2XASA 1VF6A 1VF7A 2QTSA 3K3WA 3RYIA 1N33O 1I5XA 1ZL8A 5LL6Y 4CBCA 1S5LZ 4LF6B 1OJHA 2PI4A 4LNUA 5EIBD 4JASA 4UCSA 3BVOA 1VF6C 3CRMA 2QTOA 4MTXA 3UO2A 3U0ZA 2F1MA 3B4SA 5D5PA 1I5YA 3DGEA 3C3TA 4WFBV 2XUMA 1IBLB 2HHHO 5IJ9A 3HKBA 4DV3B 4JI3O 1TVKA 2OCCB 3FAVA 2A06H 1JA8A 1TUBA 1JR9A 1BT8A 1ZX3A 2BTOA 2N05A 3LNMB 1F23A 3EXAA 5L3BA 1Q7YW 2MK3A 5L3FA 3L70H 2Q0AA 4AQYO 3RBZA 2BTQB 2VQEO 4GKKO 2EINC 3MAQA 4O4HB 2JK5C 2IJHA 3UO3A 4N21A 1Y67A 4GT1A 3S3XA 4I50A 1GMGA 3T2MA 3WU2Z 4U3JA 3ABKC 1FYJA 1XQ8A 3AK3A 1MSDA 4WBNB 2P4KA 4F4LA 2F4VB 1EN4A 3DC5A 1HR0O 3ZRWB 2ZNJA 1DLBA 5DN6G 5JCOC 1H2MA 5F2VO 2E75B 2UU9B 3MHSC 4DW0A 4DR3B 1YHQV 3QNEA 1YXBA 3HKCB 2PUSA 4DV0O 5GTIZ 5ITZA 4CH6A 2A3QA 3BABA 1N36B 4CH3A 3JCUZ 4WFAV 4DV4B 4U3FH 3SJCC 2IM9A 1XDCA 1LR1A 4CS4A 4UVAA 2XAQA 4X9QA 2P22C 1Q5OA 4YJ2A 2C2AA 1VEWA 4UCOA 4JI0O 4IHJA 4X1IB 4O2AA 3F7YC 1K8AW 4JV5O 3W7TA 2P6JA 1K34A 1KB9F 4JI4B 3HB3B 1NTMH 4FLUA 1H8EG 2B1IA 4TUYB 2ZCEA 5LHIA 2WLIB 1IZ3A 2CDYA 2QEXV 4FPPA 1RSOB 3HKDA 2CUGA 4UV9A 5BXZA 2CGNA 2ZINA 3G67A 5CBGA 5LOVB 4WFFA 1FXHA 2HFEC 3ETEA 4QIWF 2F93B 1N34B 2PYJA 5CA1A 4ZIBA 4X1IA 3JSNA 4JI5B 2WWWA 4DV2B 2PYLA 4JAAA 2KG7B 5LYJA 5EBLC 1L0NH 5IYZA 4I4TB 4X1YA 2X6BA 4DR6B 1SQGA 5CB4A 5KHIA 2ADPA 1XOUA 2XT9A 4YHHO 1Q82W 3K57A 3CRQA 3EHBB 1Q6IA 1THZA 4RWUA 4TSFG 5L3EA 2Y69B 2CK3G 4DV1O 3ZRXA 2DE0X 5B1AC 4FZ1A 1DGSA 3CJHA 1E79G 3F7VC 5LP6A 5CMUA 1N36O 1KYOF 4JF3A 2ZE8A 4I0XB 3H1LH 2VQFO 5IYZB 1ZAUA 2DQ3A 1KUQA 5GTHZ 2B1GA 2A0LA 3K5OA 3CCSV 3M99B 2RNBA 4QGPA 1NI8A 2DYRB 3ETGA 1P84F 4FFKA 1JVMA 2GBOA 3QVNA 3JALA 3L72H 3Q4HA 1K3EA 4O4JB 1XHXA 4I55B 3SPCA 1K4CC 1Y74B 1IDSA 4JI7O 3JAWA 1Q8IA 4MS2A 4H44B 3PN1A 2AHZA 2VS0A 3A0BZ 4FLTA 4DRXB 1SC5B 3RW0A 1AP6A 4RQEA 5J2UB 2ZNIA 4NB5A 3W7XA 1DTOA 2YICA 3CP1A 1WLEA 5B3SB 2OYQA 3CC7V 3IGAC 1YCIA 4J42A 4N23A 3MDSA 4BIZA 2A79B 2YXLA 3FKSG 5IYCO 3CCEV 4NTXA 1GRJA 4JYAB 4O4JA 3DC6A 1U96A 3VQVA 1GH6A 3GWOA 1VMGA 3L71H 2X7RB 4XDJA 2HR3A 3IC7A 1S72V 5TISZ 4HYOA 4P30A 4U3JB 2CH7B 3SPIA 4GX0A 1VQLV 1AB3A 4RQFA 3TJTA 3AG1C 3CXCU 1QHTA 5LBQA 2LO1A 2NLJC 1Y76A 4DR2O 2UXCO 2Q68A 4JI8O 1W0KG 3K5MA 1FFTB 2D3OW 1IVSA 5CA0A 3WB2A 4IIJA 5C93A 2KSDA 2PY5A 3OTFA 3MHHC 5IY5B 2CH7A 3X2QC 4FFBB 2P90A 4K8XA 1M4UA 2GHYA 1Q81W 3N2KA 4PDMA 4CH4A 3CRRA 3KZIZ 2JGUA 3HPLC 5EYPB 5KX5B 4K0KO 3JASB 5KA5A 5LA6B 4XDKA 3SYPA 2LQTA 4CS3A 1HW7A 3I5DA 4NXNO 3D36A 3CC2V 4LH7A 1VQ9V 2QJ1A 2DQ0A 3OMAB 4DR6O 2QSAA 3ABLB 1HDJA 3AG2C 4TQDA 3D36C 2EBOA 2GSMB 4K35A 3TETA 1SRYA 2E5LB 2R70A 3ZHQA 3R65A 3OM3B 2QWOB 3CS5A 2GTAA 4GUNA 3ASNC 1W59A 1WP7A 4KUMA 4J7JA 4QPKA 3AK2A 1R6KA 2AGAA 2YIBD 1URFA 1FFXB 2CTRA 4DV6B 1QR8A 1QVFU 1SA0A 4W4LA 4DV5B 1OCCC 4MSWC 4O4HA 4JI6B 4K8ZA 1T5EA 4FLYA 3O9OA 5LP6C 3OTOO 2RDCA 4CC5A 4J11A 1MOFA 1COWG 5BR8B 1HNXO 1AR5A 2JGDA 2UUBB 5B66Z 5AG2A 2WLLA 2QKAA 5C8YB 4WF9V 1FD9A 1ZTEA 2B5UA 1MSWD 4C7UA 1QCEA 1R3KC 3ABLC 2KQXA 1KU9A 4NVPA 1LUVA 4LH6A 2XAFA 4D7SA 4ZBMA 5KX5A 4PV1B 2UXBB 1GTOA 3FB8C 1NH2D 4LCUC 1DF5A 5KA6A 3SPGA 2OWOA 3G71V 1XBLA 4GKKB 2QWQB 1YSCA 3E22A 3BA9A 1V54B 4EFBA 5B1BB 3OUSA 2LW1A 1OCRC 1JMKC 1YI2V 1EN5A 1FXVA 3CCLV 4DUZB 3OFNG 2ZIOA 3K0GA 2G38A 5EIBC 1IXBA 1MG1A 4QNHB 3CB2A 2JRIA 4DR5O 2IBZH 1GN3A 1NU1H 3RT3C 3IFXA 1PL4A 1JOYA 4DYLA 4DR3O 2YEVB 4IGGA 4U7OA 4GZRB 3RVZA 2ODMA 5LOVA 3JD1A 5IWAO 3FB5C 1I0HA 4QJFB 1XL6A 1AI7A 1KMIZ 4P9PA 2DW4A 5IE9A 2CE4A 3A2FA 3SYAA 1SF9A 3A0RA 3H1HH 3ZHRA 4YHHB 2UXDO 3SPJA 1WPXA 3ZX6A 4IYIA 1SESA 3OEHG 4H0LB 1AILA 3E8BA 3M7MX 1XNQO 2ZR2A 3ZS8C 2QGNA 4IYHA 1NR1A 3NXSA 3L9DA 2E3CA 3UKMA 3L74H 2VQEB 3CC4V 2VWKA 5D5QA 3ABUA 4LBEC 5KMGB 1L8DA 3GB7C 1HNZB 2Q7HA 4B3MB 3ZBHA 5A2QN 4J10A 1Y4MA 5JJNB 1SZXA 1OCOC 1H8HG 3HR0A 5KAFZ 3CCRV 4TV9A 1BZKA 3FB6C 5CBFA 2QR4A 4DR2B 3ZMUA 4X20B 4XDLA 3CJHB 1ZWIC 4DO2A 1S5HC 4I5SA 2N74A 2R9AA 2WLNA 2HEPA 3J7AU 2JEUA 4JZ2A 4RO2A 4ICGA 4G27B 4FK5C 4I9QA 1SQBH 5EYPA 2Q7GA 1DK1A 2UXXA 1G6UA 3APQA 1WJZA 4LFBB 4I9WA 2EZPA 4JI3B 2RQ6A 2OTLV 2ZXWB 4LC1A 5BMVA 1NZ6A 1JJOA 4YXWG 4ZOLA 5E1AC 2O57A 5CA1B 1OCRB 1SQXH 2NN4A 4DV7O 5B1BC 4TQFA 3K5NA 1S77D 1I08A 1H2GA 4XBFA 1B06A 1J5EB 2HKOA 3JATB 1JQ0A 4JZGA 4DUYO 2JJ2G 5FPRA 2RCVA 4B7EA 1KP3A 4FJCC 2ZE6A 4BW5A 5B1AB 5JCOA 1Q90D 5LP6B 1HP8A 3OT7A 1SKVA 4TUYA 1OCCB 4PI0A 1WB8A 3WB1A 1JFFB 3G80A 3B77A 4QE7A 4GYCB 4DR1O 3E2EA 1YZBA 3B8MA 5FNVB 1S76D 3UM7A 4FM1A 1KKCA 2YIAA 5JQGB 4EEQA 3ZN0A 4MW8A 3HKDB 3Q4HB 1V55C 3ABMC 3RYFB 1GKFA 1TAEA 1M57C 2CAZC 2JJ1G 3AG2B 3RFRA 3JD3A 1SQPH 2W6IG 3OR6C 4G28B 1NQTA 4LWSA 2OCHA 2ZR3A 2ZM6B 2Y48A 3N27A 1F7YA 1JJ2U 3ZRWA 5H6QA 2ZD9A 1Q86W 3W7UA 2HVKC 3OW2U 1GN4A 1D5AA 2V4DA 1XILA 3UQ8A 2ZIMA 3VOUA 4MW3A 1EBOA 2B9ZA 3SJQC 3OEEG 3I55V 1Z5VA 5KHHA 2DOSA 1WA8B 5KAIZ 1WN7A 2QA4V 1FXKB 1VP7A 3E86A 1XREA 2P4VA 1VIBA 4PA7A 1YVWA 5IY5C 4W4KA 2ILMA 3CWBH 4P9OA 2W0XA 1AROP 1PL0A 3ZCCA 1G8MA 1P7BA 1GM9A 2XAHA 1MABG 3K9SA 1RSOA 3SJBC 4ASUG 5L3GA 3HKCA 4GKJB 2K1EA 4OPHA 5LMNO 3AG1B 4O2BA 4BAYA 5LGNA 4DXWA 3CCUV 2QM4A 4K3AA 1NTZH 3PJSK 1NH2B 5KHJA 3RYFA 2X0LA 2EINB 4JI2O 1CEZA 1R3IC 1PD3A 3H1IH 1R6NA 4ZI7B 1OV9A 4GKJO 4JI7B 1FS0G 2FTKA 1BMFG 4MVOA 2BTQA 4DK0A 4LFBO 4MVSA 4JI1O 1AP5A 4JI5O 3D3QA 3IJ4A 1YF2A 4PA9A 1XHZA 4NXMO 4RUEA 1H38A 1P7GA 4IT5A 4KXRA 4ZI7A 3H9VA 1X4TA 4HZ3A 3LUTB 1BQ0A 4DR5B 4IHJB 1B04A 3P30A 4TT3G 1K5SA 5DM6V 4UVCA 1KBHA 3G4SV 3TXSA 4LFAB 1XMOO 2L35A 2JEXA 1KD1W 2HJFC 2LGQA 3HKEB 1NR7A 1L0LH 5KHGA 4EB6B 2M7WA 1O9HA 1FXKC 4HNAA 3JALB 3TCUA 1MNGA 1IBMB 1HNWB 2Z5UA 3VQWA 1F4NA 3T1YB 3ML0A 5FL7G 1VQMV 1BGYH 4BW9A 3M8AA 4JI0B 2F66C 1R73A 4J7KA 3RYHA 1NKDA 1B6QA 4WCEV 3SR2C 1AVMA 4X64B 4LF9B 2CTWA 2Y69C 1SQFA 1SETA 3TXQA 2PF4E 2YS8A 1RPRA 3L73H 1NTKH 1AI6A 1F51A 1QQCA 3CRCA 1AR4A 3H1KH 4L8JA 3A0HZ 3D3IA 3CCMV 4FLZA 4NYKA 2AHYA 3ZHUA 4JTDB 4UB8Z 1PNLA 2E74B 1GM7A 1G4YB 1K92A 5BMVB 3OTOB 4DV1B 3FFQA 4LFCB 3CE2A 2KKWA 2ZE5A 2DMXA 3QG5A 1WPBA 2Y4TA 3QF7A 4DW1A 4Z2WA 4DR7O 5CN0A 3F5TA 2VWJA 3JCZA 1R3LC 5EC1C 1ZL8B 3STZC 4D6TH 2WLIA 1ORQC 4D7TA 1YDXA 3ZMSA 2HVJC 3BY6A 4MVUA 2CTQA 3OMNB 1IBLO 1SQVH 3CEIA 2GDSA 2JS5A 1D5NA 3KKYA 3SYOA 3ASOB 2WLMA 1XMOB 1GM8A 4LF7B 3JYCA 2R9RB 1VQ7V 1O9GA 2EIKB 4UCVA 2ADQB 2FB5A 2EJRA 2NR5A 4B3RO 4YIPA 1X59A 3T1HO 1Q6HA 4ZHQB 2DYSB 1S5JA 2Q4PA 4B3SO 4TV8A 4DV3O 4FVMA 2IH1C 2N04A 5EZYB 1VQOV 4JI4O 4X65B 2Q67A 1SZTA 3WG7B 1M5IA 1N4CA 4QE9A 4DV7B 1ZLZA 4DV2O 5H5NA 2EIMC 5LMUO 2WLLB 4HNAB 1NBMG 4JPRA 2E76B 1CP9A 1FKAO 2QDOA 2QKCA 2RJZA 3G6EV 1EZVH 4BIUA 1XMQO 1AJQA 1VQKV 4B3TO 5IT9N 1J95A 3UCSC 3ABKB 3C90A 4J9ZB 3LSQA 4JI8B 1YJ9V 3AG4B 3AK1A 5B1OA 1KP2A 1PPJH 1L1FA 5J2TA 3E8FA 3QTCA 3KCYA 3BAAA 1U97A 4WBNA 2IU3A 5KHKA 1PV0A 4X64O 2H3OA 2FL4A 1SERA 2LGWA 2ETNA 3E35A 1BL8A 5DECA 1XNRO 4DK1A 4MTFA 2Z3YA 4O4IB 3FAVB 3ZJZA 3ZMVA 5IYDO 3DXRA 3SYCA 4LFAO 2GUZB 1IBKO 3K5LA 1QBZA 4U7NA 2OCCC 2YI8A 3SYQA 3TGUH 1K73W 5C8YA 1QNMA 4BWAA 4Z1MG 4EFEA 4KHPB 1MZFA 3K9AA 1NVPB 2HLDG 2P67A 5H2FZ 4CS2A 4YIOA 1RP3B 1H2KA 4O2BB 4WFEA 3ZN1A 1Y76B 1K4DC 4I7ZB 2NNUA 3BPZA 4EKWA 2XAJA 4X66B 1LUWA 5IJ9B 4X62B 4GLXA 4FMTA 1FXKA 2V1DA 4DR7B 5DEDA 3IAYA 2LFSA 1JX9A 1IBKB 2YSUB 3SPHA 4FLWA 1EZJA 4YY3O 4IIJB 4J80A 2JGDB 3IC9A 1V9PA 2A9HA 5L3CA 3ZRVA 3UT5A 2F43G 3P3NA 5J9PC 2EIMB 4PD4F 4TV8B 4JI2B 3CCJV 3GVMA 1V54C 3N2GA 2AW9A 1K7DA 2UUBO 2IW5A 3WG7C 5K1XA 5FLXN 4JAUA 1FPOA 3OGIB 3G6BA 3JARB 4OXSA 2QKSA 1M56C 2P7TC 4I50B 3RYCB 4KP4A 3RYIB 5J2TB 2OIEA 3P3PA 4DUYB 1K33A 2EULA 2EILB 4PJ0Z 3ETDA 3OD4A 3RN4A 1R6TA 4JAVA 4ZOLB 2ATKC 4JTAB 5KUKA 1K5QA 1CPYA 2D2CB 1N32O 1MMMA 3B40A 2Y0IA 4FLXA 4KFMA 3H1JH 3CSXA 1VQ5V 1RM1B 1M90W 2AZ0A 1I94B 1TGOA 2OT5A 5LA6A 2IJIA 1RPOA 4DV5O 2K9PA 4Q20A 2QM8A 5HFMA 1EN6A 2IJJA 1N34O 2EZOA 4H13B 2CGOA 4NR1A 1TVKB 4O2AB 4L87A 2EX3A 1YJNV 4QPJA 3W7SA 2YXYA 3OMIB 3SJAC 1YTFB 2UUCO 1EM1A 2ZDIC 5H6RA 1M1KW 1M93A 3CMEV 2LJ2A 1NVPD 4R6ZA 5JQGA 4F6RA 4OX9B 4DUZO 1NS1A 2UXDB 2QWNB 3T4ZA 4FLVA 3K03A 4MT8A 3JASA 4DR4B 2Q73A 2HP8A 2ZDIA 4JYBA 3AEIA 1VF5B 5CB4B 4MTOA 3AG3C 3FD9A 4JV5B 4X66O 3DXRB 4R50A 1QLEC 2WSSG 1HNXB 4NXMB 4K0KB 4UVBA 1QU7A 4KL1A 3K79A 1HNZO 1I94O 2ITCC 5LYJB 4X89A 1BHAA 3ZMTA 1YIJV 3JSLA 2QM7A 4GX2A 3N2GB 3EVKA 4O4LB 5IYBO 3R66A 1G1XB 3EFFK 1EFRG 3JAKA 1W0JG 4CZZA 1DF4A 1Z5WA 4G2KA 3BEHA 1N32B 1UFIA 2BE3A 1PM9A 4E2LA 4UV8A 2Q0OC 1NT2B 4UB6Z 4BR6A 3QO7A 1ZUQA 5JH7B 4YY3B 4PELA 3CMAV 5IJ0A 4PDLA 4TWKA 4MVQA 4DV6O 4TOIA 4RAIA 2AXTZ 3KCXA 1PNMA 5J2UA 1VQ8V 1D2DA 2UXBO 1KC8W 3CX5F 3DSQA 2JIZG 3W7WA 5GONA 2F23A 2OTJV 2Z0AA 5L3DA 1N0NA 2QE7G 4FM0A 4I55A 2GTSA 1YITV 2YIDA 3ZIAG 2CTPA 5B1NA 4X88A 1AI5A 4NTWA 4GX5A 1HR0B 4OPAA 2UXCB 5BZBA 4GCZA 4FZ0A 5H9CA 1Z2GA 3ICXA 3BCCH 4YJ3A 2M6YA 1TUEB 2P06A 5B3SC 1VQNV 4NXNB 4LF8O 3LDCA 4AILC 4PA4A 3VQXA 4Z1VA 4B3RB 2HG5C 5KUMA 4JGSA 3AG7A 1PKXA 2YI9A 2YEVA 3P32A 1E1QG 4LF4B 4O4IA 1SS3A 3CRAA 3LSSA 1FJGO 3TK1A 3B09A 3JARA 1R3JC 1WA8A 3QO5A 4LWSB 5EBMC 5JH7A 3BFRA 4MVZA 1N33B 4ZHQA 3N2KB 4JTCB 1TUBB 2DYRC 2XAGA 2F95B 4I4TA 2XOKG 4KHPO 3OE7G 2Q69A 3CXHF 2VRZA 3SDLA 1AR1B 5A9GA 1W2BU 4LP8A 3HKEA 2ZE7A 3K59A 5LGUA 4DR4O 1OCZC 4B3SB 4GX1A 3NR7A 4B08A 5LXTB 2ZKOA 1PP9H 1F4MA 1BE3H 4UCTA 5JJEB 5FPOA 2JVDA 3AG3B 4B3MO 1VARA 3STLC 4NKGB 3ZHSA 2ZT9B 2QWRB 1WP8A 4LR3A 1H2SB 2IH3C 3K58A 1M57B 5JVDB 1Y6XA 4R7CA 5FNVA 3E89A 1FJGB 1V55B 1JPXA 3ABMB 3LSUA 2PZSA 5JJJB 5JWPA 1JFFA 3ZRSA 3OAAG 3UT5B 2R72A 3CHXA 4WFGA 4F6RB 4LFCO 3FYIB 1GAXA 3CCVV 4LNUB 2PTMA 1SA0B 3ABTA 4MVMA 1BHBA 3CCQV 2ITDC 2Q6AA 1N0JA 2X6AA 3E83A 3S3WA 2LW7A 2R9IA 3T1HB 1XNRB 2A7WA 2Q8VA 4P2ZA 2RMKB 1B3QA 1IX9A 2YUAA 3E8GA 1RM1C 3LDDA 2Y4UA 3RWRD 3BHPA 2BSKB 2UU9O 4LF9O 5LGTA 4R8CA 1TA8A 5JVDA 3K04A 5BR8O 2UUAB 1HWYA 4LF8B 1GK9A 4UUJC 3OGCC 3U11A 3L75H 2EILC 3JAMN 4EB6A 2WAMA 1YJWV 3B8NA 1OCZB 3ZHTA 3J81N 2LFRA 1QVGU 4HBNA 4MTGA 5CBHA 1M56B 2F4VO 3D8CA 4PDVA 3SGIA 1MA1A 1JCHA 2H94A 4LF5B 3K06A 2XHBA 3RYCA 1P49A 2ZQMA 4Q6GA 4FFBA 5E79Z 2BCCH 1BSMA 4UCUA 1WNSA 2ZXWC 2W6JG 2UUCB 1H2NA 3H01A 5ITZB 1K9MW 2WLJA 4ZKIA 3K0DA 5CA3A 1KKDA 1GO3F 5GONB 2W0FC 3LDEA 1S0VA 4J7ZA 4ABMA 3ETQA 2UXNA 1IURA 1VQPV 1ENVA 1PNKA 1N8RW 4J9YB 2ARHA 3F5WC 1FFXA 5IWAB 3WB0A 1UPGA 4WFHA 5K1PA 4DRXA 5GW7A 1MZEA 2V7QG 1H2LA 2WLKA 2L6LA 1XEQA 4DV0B 3KG2A 4AHCA 2FKXA 4PDRA 5LHGA 1YTFD 3T1YO 3VBBA 1GN2A 1QR9A 2GUZA 1OHHG 2Q5ZA 4LF5O 3JD4A 5LHHA 1OCOB 1A32A 2DN9A 4B7KA 1Q43A 4X1KB 3JAKB 3T1CA 4UCRA 3JATA 3U10A 3VQYA 3T4DA 2XNDG 2YIBA 4LF6O 1M9NA 1XI1A 1ZSPA 1SQQH 4RUFA 2OIGA 2JDIG 2DWEC 4FM2A 1Y74A 3DTUB 2MW2B 4NTYA 4CH5A 3RVYA 2KG7A 3MD0A 2X6CA 3RGBA 5B5EZ 4X20A 4JYCA 3THOA 1S3JA 2E5LO 2UUAO 4LF7O 4O4LA 3OR7C 3FX7A 1OZ0A 3GWKC 2Q9LA 5BY1A 5IDJA 5KMGA 5LMNB 2EIJB 2BOCC 3AG4C 1KQSU 5HFLA 1E1RG 3E22B 2H8PC 1IBMO 1HNWO 4OGQB 5EBWC 3HKBB 4H33A 1WB7A 2DJVA 3O65A 2ZM6O 3BRCA 1CXZB 1R1BA 4AI8A 4X8AA 3E8HA 1QLEB 2RN9A 3C3SA 4I0XA 2YC0A 1US6A 3I56V 4DV4O 1Y66A 2EJ7A 3OUFA 3ZEDA 2DYSC 3CD6V 2FYUH 3CYOA 2HJDA 4UFZA 4X1KA 1FAFA 4CC6A 2P5OA 3A8TA 1GN6A 1VQ6V 4UXNA 1Q6UA 2JS3A 1UJWB 3J80N 4X62O 4JI1B 3ZMZA 2EIKC 4YJ3B
chains in the Genus database with same CATH topology
4LF8O 2LW7A 4DR1O 1YZBA 4JI2O 1HNZO 1I94O 4JI0O 4GKJO 2UUBO 4LF6O 4JV5O 1J5EO 2N74A 2UU9O 4LF9O 2HHHO 4OX9O 5FLXN 4X64O 5BR8O 3J7AU 4JI7O 4JI3O 1FJGO 4LFBO 3R66A 1G1XB 5BXZA 4A5UB 4JI1O 4B3TO 3JAMN 4JI5O 4X65O 4DR7O 3J81N 1F7YA 4K0KO 3F5TA 4NXMO 1DK1A 1XNRO 1R6TA 4KHPO 2F4VO 2E5LO 3SDLA 4NXNO 2UUAO 1N32O 4LF7O 4DR4O 1IBLO 2JRIA 4DV6O 4DR5O 3RT3C 4AQYO 4DV7O 4LFAO 4DR6O 5BY1A 1IBKO 2ZKOA 4DR3O 2VQEO 4JI6O 4GKKO 4DV5O 1D2DA 2DOSA 5IWAO 1IBMO 1HNWO 2UXBO 1N34O 1XMOO 2DJVA 4B3MO 3O65A 2ZM6O 4YHHO 1R1BA 4B3RO 4DUYO 2Z0AA 1X59A 3T1HO 1FYJA 2AGAA 2UXDO 4DV1O 4B3SO 1AILA 1AB3A 4DV3O 2UUCO 1HR0O 4DV4O 1XNQO 4OPAA 4JI4O 4JYAO 4LF4O 1N36O 4DUZO 4OPHA 1NS1A 5LMNO 1XEQA 3M8AA 4LFCO 2VQFO 4DV2O 4DV0O 5H5NA 3OTOO 4DR2O 1KUQA 4YY3O 2FKXA 2UXCO 5LMUO 4JI8O 3T1YO 1FKAO 1HNXO 5A2QN 1N33O 3J80N 5LL6Y 4LF5O 4X62O 1A32A 1XMQO 4X66O 5IT9N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 O;  2LW7 A;  4DR1 O;  1YZB A;  4JI2 O;  1HNZ O;  1I94 O;  4JI0 O;  4GKJ O;  2UUB O;  4LF6 O;  4JV5 O;  1J5E O;  2N74 A;  2UU9 O;  4LF9 O;  2HHH O;  4OX9 O;  5FLX N;  4X64 O;  5BR8 O;  3J7A U;  4JI7 O;  4JI3 O;  1FJG O;  4LFB O;  3R66 A;  1G1X B;  5BXZ A;  4A5U B;  4JI1 O;  4B3T O;  3JAM N;  4JI5 O;  4X65 O;  4DR7 O;  3J81 N;  1F7Y A;  4K0K O;  3F5T A;  4NXM O;  1DK1 A;  1XNR O;  1R6T A;  4KHP O;  2F4V O;  2E5L O;  3SDL A;  4NXN O;  2UUA O;  1N32 O;  4LF7 O;  4DR4 O;  1IBL O;  2JRI A;  4DV6 O;  4DR5 O;  3RT3 C;  4AQY O;  4DV7 O;  4LFA O;  4DR6 O;  5BY1 A;  1IBK O;  2ZKO A;  4DR3 O;  2VQE O;  4JI6 O;  4GKK O;  4DV5 O;  1D2D A;  2DOS A;  5IWA O;  1IBM O;  1HNW O;  2UXB O;  1N34 O;  1XMO O;  2DJV A;  4B3M O;  3O65 A;  2ZM6 O;  4YHH O;  1R1B A;  4B3R O;  4DUY O;  2Z0A A;  1X59 A;  3T1H O;  1FYJ A;  2AGA A;  2UXD O;  4DV1 O;  4B3S O;  1AIL A;  1AB3 A;  4DV3 O;  2UUC O;  1HR0 O;  4DV4 O;  1XNQ O;  4OPA A;  4JI4 O;  4JYA O;  4LF4 O;  1N36 O;  4DUZ O;  4OPH A;  1NS1 A;  5LMN O;  1XEQ A;  3M8A A;  4LFC O;  2VQF O;  4DV2 O;  4DV0 O;  5H5N A;  3OTO O;  4DR2 O;  1KUQ A;  4YY3 O;  2FKX A;  2UXC O;  5LMU O;  4JI8 O;  3T1Y O;  1FKA O;  1HNX O;  5A2Q N;  1N33 O;  3J80 N;  5LL6 Y;  4LF5 O;  4X62 O;  1A32 A;  1XMQ O;  4X66 O;  5IT9 N; 
#chains in the Genus database with same CATH topology
 3JAW B;  2DWD C;  3WFV A;  4YJ2 B;  3ASO C;  1BCC H;  4FIP C;  2AZ2 A;  3CPW U;  1WAZ A;  1LNQ A;  4TV9 B;  4H37 A;  5EC2 C;  1AJN A;  4X1Y B;  3FYE B;  1XMQ B;  4B3T B;  1J5E O;  1P4R A;  1Q3E A;  2FML A;  4OX9 O;  1XUQ A;  2BSK A;  1I7F A;  3QO8 A;  2QWP B;  3LNN A;  4MVR A;  2WA3 A;  4BIO A;  4A5U B;  2PGG A;  4E4E A;  4JYY A;  2LP7 A;  5EK0 A;  4AQY B;  1AI4 A;  2GV9 A;  4PA3 A;  1ROP A;  3ASN B;  4X65 O;  2IJK A;  3ZHV A;  4IL6 Z;  3BA8 A;  4J41 A;  4F6E A;  1QLN A;  3K08 A;  2XTA A;  4HAM A;  3B2E E;  5IJ0 B;  4PI2 A;  2YDE A;  2IU0 A;  4PA6 A;  1RFY A;  5KLV H;  2KB1 A;  3RYH B;  1BS3 A;  5EZY A;  4JI6 O;  3FB7 C;  1IXM A;  1XNQ B;  3JD2 A;  1K97 A;  1BQZ A;  4DR1 B;  2HHH B;  2BOB C;  3JD0 A;  2YXH A;  2Y0P A;  2WPD G;  5LMU B;  2VQF B;  4PHZ A;  1AJP A;  1YEW A;  5CA0 B;  5LXT A;  4JYA O;  1XL4 A;  1VQ4 V;  4LF4 O;  3APO A;  1KEC A;  2EIJ C;  2Q7E A;  3X2Q B;  2WA4 A;  1NJI W;  2WLH A;  2PI5 A;  2XAS A;  1VF6 A;  1VF7 A;  2QTS A;  3K3W A;  3RYI A;  1N33 O;  1I5X A;  1ZL8 A;  5LL6 Y;  4CBC A;  1S5L Z;  4LF6 B;  1OJH A;  2PI4 A;  4LNU A;  5EIB D;  4JAS A;  4UCS A;  3BVO A;  1VF6 C;  3CRM A;  2QTO A;  4MTX A;  3UO2 A;  3U0Z A;  2F1M A;  3B4S A;  5D5P A;  1I5Y A;  3DGE A;  3C3T A;  4WFB V;  2XUM A;  1IBL B;  2HHH O;  5IJ9 A;  3HKB A;  4DV3 B;  4JI3 O;  1TVK A;  2OCC B;  3FAV A;  2A06 H;  1JA8 A;  1TUB A;  1JR9 A;  1BT8 A;  1ZX3 A;  2BTO A;  2N05 A;  3LNM B;  1F23 A;  3EXA A;  5L3B A;  1Q7Y W;  2MK3 A;  5L3F A;  3L70 H;  2Q0A A;  4AQY O;  3RBZ A;  2BTQ B;  2VQE O;  4GKK O;  2EIN C;  3MAQ A;  4O4H B;  2JK5 C;  2IJH A;  3UO3 A;  4N21 A;  1Y67 A;  4GT1 A;  3S3X A;  4I50 A;  1GMG A;  3T2M A;  3WU2 Z;  4U3J A;  3ABK C;  1FYJ A;  1XQ8 A;  3AK3 A;  1MSD A;  4WBN B;  2P4K A;  4F4L A;  2F4V B;  1EN4 A;  3DC5 A;  1HR0 O;  3ZRW B;  2ZNJ A;  1DLB A;  5DN6 G;  5JCO C;  1H2M A;  5F2V O;  2E75 B;  2UU9 B;  3MHS C;  4DW0 A;  4DR3 B;  1YHQ V;  3QNE A;  1YXB A;  3HKC B;  2PUS A;  4DV0 O;  5GTI Z;  5ITZ A;  4CH6 A;  2A3Q A;  3BAB A;  1N36 B;  4CH3 A;  3JCU Z;  4WFA V;  4DV4 B;  4U3F H;  3SJC C;  2IM9 A;  1XDC A;  1LR1 A;  4CS4 A;  4UVA A;  2XAQ A;  4X9Q A;  2P22 C;  1Q5O A;  4YJ2 A;  2C2A A;  1VEW A;  4UCO A;  4JI0 O;  4IHJ A;  4X1I B;  4O2A A;  3F7Y C;  1K8A W;  4JV5 O;  3W7T A;  2P6J A;  1K34 A;  1KB9 F;  4JI4 B;  3HB3 B;  1NTM H;  4FLU A;  1H8E G;  2B1I A;  4TUY B;  2ZCE A;  5LHI A;  2WLI B;  1IZ3 A;  2CDY A;  2QEX V;  4FPP A;  1RSO B;  3HKD A;  2CUG A;  4UV9 A;  5BXZ A;  2CGN A;  2ZIN A;  3G67 A;  5CBG A;  5LOV B;  4WFF A;  1FXH A;  2HFE C;  3ETE A;  4QIW F;  2F93 B;  1N34 B;  2PYJ A;  5CA1 A;  4ZIB A;  4X1I A;  3JSN A;  4JI5 B;  2WWW A;  4DV2 B;  2PYL A;  4JAA A;  2KG7 B;  5LYJ A;  5EBL C;  1L0N H;  5IYZ A;  4I4T B;  4X1Y A;  2X6B A;  4DR6 B;  1SQG A;  5CB4 A;  5KHI A;  2ADP A;  1XOU A;  2XT9 A;  4YHH O;  1Q82 W;  3K57 A;  3CRQ A;  3EHB B;  1Q6I A;  1THZ A;  4RWU A;  4TSF G;  5L3E A;  2Y69 B;  2CK3 G;  4DV1 O;  3ZRX A;  2DE0 X;  5B1A C;  4FZ1 A;  1DGS A;  3CJH A;  1E79 G;  3F7V C;  5LP6 A;  5CMU A;  1N36 O;  1KYO F;  4JF3 A;  2ZE8 A;  4I0X B;  3H1L H;  2VQF O;  5IYZ B;  1ZAU A;  2DQ3 A;  1KUQ A;  5GTH Z;  2B1G A;  2A0L A;  3K5O A;  3CCS V;  3M99 B;  2RNB A;  4QGP A;  1NI8 A;  2DYR B;  3ETG A;  1P84 F;  4FFK A;  1JVM A;  2GBO A;  3QVN A;  3JAL A;  3L72 H;  3Q4H A;  1K3E A;  4O4J B;  1XHX A;  4I55 B;  3SPC A;  1K4C C;  1Y74 B;  1IDS A;  4JI7 O;  3JAW A;  1Q8I A;  4MS2 A;  4H44 B;  3PN1 A;  2AHZ A;  2VS0 A;  3A0B Z;  4FLT A;  4DRX B;  1SC5 B;  3RW0 A;  1AP6 A;  4RQE A;  5J2U B;  2ZNI A;  4NB5 A;  3W7X A;  1DTO A;  2YIC A;  3CP1 A;  1WLE A;  5B3S B;  2OYQ A;  3CC7 V;  3IGA C;  1YCI A;  4J42 A;  4N23 A;  3MDS A;  4BIZ A;  2A79 B;  2YXL A;  3FKS G;  5IYC O;  3CCE V;  4NTX A;  1GRJ A;  4JYA B;  4O4J A;  3DC6 A;  1U96 A;  3VQV A;  1GH6 A;  3GWO A;  1VMG A;  3L71 H;  2X7R B;  4XDJ A;  2HR3 A;  3IC7 A;  1S72 V;  5TIS Z;  4HYO A;  4P30 A;  4U3J B;  2CH7 B;  3SPI A;  4GX0 A;  1VQL V;  1AB3 A;  4RQF A;  3TJT A;  3AG1 C;  3CXC U;  1QHT A;  5LBQ A;  2LO1 A;  2NLJ C;  1Y76 A;  4DR2 O;  2UXC O;  2Q68 A;  4JI8 O;  1W0K G;  3K5M A;  1FFT B;  2D3O W;  1IVS A;  5CA0 A;  3WB2 A;  4IIJ A;  5C93 A;  2KSD A;  2PY5 A;  3OTF A;  3MHH C;  5IY5 B;  2CH7 A;  3X2Q C;  4FFB B;  2P90 A;  4K8X A;  1M4U A;  2GHY A;  1Q81 W;  3N2K A;  4PDM A;  4CH4 A;  3CRR A;  3KZI Z;  2JGU A;  3HPL C;  5EYP B;  5KX5 B;  4K0K O;  3JAS B;  5KA5 A;  5LA6 B;  4XDK A;  3SYP A;  2LQT A;  4CS3 A;  1HW7 A;  3I5D A;  4NXN O;  3D36 A;  3CC2 V;  4LH7 A;  1VQ9 V;  2QJ1 A;  2DQ0 A;  3OMA B;  4DR6 O;  2QSA A;  3ABL B;  1HDJ A;  3AG2 C;  4TQD A;  3D36 C;  2EBO A;  2GSM B;  4K35 A;  3TET A;  1SRY A;  2E5L B;  2R70 A;  3ZHQ A;  3R65 A;  3OM3 B;  2QWO B;  3CS5 A;  2GTA A;  4GUN A;  3ASN C;  1W59 A;  1WP7 A;  4KUM A;  4J7J A;  4QPK A;  3AK2 A;  1R6K A;  2AGA A;  2YIB D;  1URF A;  1FFX B;  2CTR A;  4DV6 B;  1QR8 A;  1QVF U;  1SA0 A;  4W4L A;  4DV5 B;  1OCC C;  4MSW C;  4O4H A;  4JI6 B;  4K8Z A;  1T5E A;  4FLY A;  3O9O A;  5LP6 C;  3OTO O;  2RDC A;  4CC5 A;  4J11 A;  1MOF A;  1COW G;  5BR8 B;  1HNX O;  1AR5 A;  2JGD A;  2UUB B;  5B66 Z;  5AG2 A;  2WLL A;  2QKA A;  5C8Y B;  4WF9 V;  1FD9 A;  1ZTE A;  2B5U A;  1MSW D;  4C7U A;  1QCE A;  1R3K C;  3ABL C;  2KQX A;  1KU9 A;  4NVP A;  1LUV A;  4LH6 A;  2XAF A;  4D7S A;  4ZBM A;  5KX5 A;  4PV1 B;  2UXB B;  1GTO A;  3FB8 C;  1NH2 D;  4LCU C;  1DF5 A;  5KA6 A;  3SPG A;  2OWO A;  3G71 V;  1XBL A;  4GKK B;  2QWQ B;  1YSC A;  3E22 A;  3BA9 A;  1V54 B;  4EFB A;  5B1B B;  3OUS A;  2LW1 A;  1OCR C;  1JMK C;  1YI2 V;  1EN5 A;  1FXV A;  3CCL V;  4DUZ B;  3OFN G;  2ZIO A;  3K0G A;  2G38 A;  5EIB C;  1IXB A;  1MG1 A;  4QNH B;  3CB2 A;  2JRI A;  4DR5 O;  2IBZ H;  1GN3 A;  1NU1 H;  3RT3 C;  3IFX A;  1PL4 A;  1JOY A;  4DYL A;  4DR3 O;  2YEV B;  4IGG A;  4U7O A;  4GZR B;  3RVZ A;  2ODM A;  5LOV A;  3JD1 A;  5IWA O;  3FB5 C;  1I0H A;  4QJF B;  1XL6 A;  1AI7 A;  1KMI Z;  4P9P A;  2DW4 A;  5IE9 A;  2CE4 A;  3A2F A;  3SYA A;  1SF9 A;  3A0R A;  3H1H H;  3ZHR A;  4YHH B;  2UXD O;  3SPJ A;  1WPX A;  3ZX6 A;  4IYI A;  1SES A;  3OEH G;  4H0L B;  1AIL A;  3E8B A;  3M7M X;  1XNQ O;  2ZR2 A;  3ZS8 C;  2QGN A;  4IYH A;  1NR1 A;  3NXS A;  3L9D A;  2E3C A;  3UKM A;  3L74 H;  2VQE B;  3CC4 V;  2VWK A;  5D5Q A;  3ABU A;  4LBE C;  5KMG B;  1L8D A;  3GB7 C;  1HNZ B;  2Q7H A;  4B3M B;  3ZBH A;  5A2Q N;  4J10 A;  1Y4M A;  5JJN B;  1SZX A;  1OCO C;  1H8H G;  3HR0 A;  5KAF Z;  3CCR V;  4TV9 A;  1BZK A;  3FB6 C;  5CBF A;  2QR4 A;  4DR2 B;  3ZMU A;  4X20 B;  4XDL A;  3CJH B;  1ZWI C;  4DO2 A;  1S5H C;  4I5S A;  2N74 A;  2R9A A;  2WLN A;  2HEP A;  3J7A U;  2JEU A;  4JZ2 A;  4RO2 A;  4ICG A;  4G27 B;  4FK5 C;  4I9Q A;  1SQB H;  5EYP A;  2Q7G A;  1DK1 A;  2UXX A;  1G6U A;  3APQ A;  1WJZ A;  4LFB B;  4I9W A;  2EZP A;  4JI3 B;  2RQ6 A;  2OTL V;  2ZXW B;  4LC1 A;  5BMV A;  1NZ6 A;  1JJO A;  4YXW G;  4ZOL A;  5E1A C;  2O57 A;  5CA1 B;  1OCR B;  1SQX H;  2NN4 A;  4DV7 O;  5B1B C;  4TQF A;  3K5N A;  1S77 D;  1I08 A;  1H2G A;  4XBF A;  1B06 A;  1J5E B;  2HKO A;  3JAT B;  1JQ0 A;  4JZG A;  4DUY O;  2JJ2 G;  5FPR A;  2RCV A;  4B7E A;  1KP3 A;  4FJC C;  2ZE6 A;  4BW5 A;  5B1A B;  5JCO A;  1Q90 D;  5LP6 B;  1HP8 A;  3OT7 A;  1SKV A;  4TUY A;  1OCC B;  4PI0 A;  1WB8 A;  3WB1 A;  1JFF B;  3G80 A;  3B77 A;  4QE7 A;  4GYC B;  4DR1 O;  3E2E A;  1YZB A;  3B8M A;  5FNV B;  1S76 D;  3UM7 A;  4FM1 A;  1KKC A;  2YIA A;  5JQG B;  4EEQ A;  3ZN0 A;  4MW8 A;  3HKD B;  3Q4H B;  1V55 C;  3ABM C;  3RYF B;  1GKF A;  1TAE A;  1M57 C;  2CAZ C;  2JJ1 G;  3AG2 B;  3RFR A;  3JD3 A;  1SQP H;  2W6I G;  3OR6 C;  4G28 B;  1NQT A;  4LWS A;  2OCH A;  2ZR3 A;  2ZM6 B;  2Y48 A;  3N27 A;  1F7Y A;  1JJ2 U;  3ZRW A;  5H6Q A;  2ZD9 A;  1Q86 W;  3W7U A;  2HVK C;  3OW2 U;  1GN4 A;  1D5A A;  2V4D A;  1XIL A;  3UQ8 A;  2ZIM A;  3VOU A;  4MW3 A;  1EBO A;  2B9Z A;  3SJQ C;  3OEE G;  3I55 V;  1Z5V A;  5KHH A;  2DOS A;  1WA8 B;  5KAI Z;  1WN7 A;  2QA4 V;  1FXK B;  1VP7 A;  3E86 A;  1XRE A;  2P4V A;  1VIB A;  4PA7 A;  1YVW A;  5IY5 C;  4W4K A;  2ILM A;  3CWB H;  4P9O A;  2W0X A;  1ARO P;  1PL0 A;  3ZCC A;  1G8M A;  1P7B A;  1GM9 A;  2XAH A;  1MAB G;  3K9S A;  1RSO A;  3SJB C;  4ASU G;  5L3G A;  3HKC A;  4GKJ B;  2K1E A;  4OPH A;  5LMN O;  3AG1 B;  4O2B A;  4BAY A;  5LGN A;  4DXW A;  3CCU V;  2QM4 A;  4K3A A;  1NTZ H;  3PJS K;  1NH2 B;  5KHJ A;  3RYF A;  2X0L A;  2EIN B;  4JI2 O;  1CEZ A;  1R3I C;  1PD3 A;  3H1I H;  1R6N A;  4ZI7 B;  1OV9 A;  4GKJ O;  4JI7 B;  1FS0 G;  2FTK A;  1BMF G;  4MVO A;  2BTQ A;  4DK0 A;  4LFB O;  4MVS A;  4JI1 O;  1AP5 A;  4JI5 O;  3D3Q A;  3IJ4 A;  1YF2 A;  4PA9 A;  1XHZ A;  4NXM O;  4RUE A;  1H38 A;  1P7G A;  4IT5 A;  4KXR A;  4ZI7 A;  3H9V A;  1X4T A;  4HZ3 A;  3LUT B;  1BQ0 A;  4DR5 B;  4IHJ B;  1B04 A;  3P30 A;  4TT3 G;  1K5S A;  5DM6 V;  4UVC A;  1KBH A;  3G4S V;  3TXS A;  4LFA B;  1XMO O;  2L35 A;  2JEX A;  1KD1 W;  2HJF C;  2LGQ A;  3HKE B;  1NR7 A;  1L0L H;  5KHG A;  4EB6 B;  2M7W A;  1O9H A;  1FXK C;  4HNA A;  3JAL B;  3TCU A;  1MNG A;  1IBM B;  1HNW B;  2Z5U A;  3VQW A;  1F4N A;  3T1Y B;  3ML0 A;  5FL7 G;  1VQM V;  1BGY H;  4BW9 A;  3M8A A;  4JI0 B;  2F66 C;  1R73 A;  4J7K A;  3RYH A;  1NKD A;  1B6Q A;  4WCE V;  3SR2 C;  1AVM A;  4X64 B;  4LF9 B;  2CTW A;  2Y69 C;  1SQF A;  1SET A;  3TXQ A;  2PF4 E;  2YS8 A;  1RPR A;  3L73 H;  1NTK H;  1AI6 A;  1F51 A;  1QQC A;  3CRC A;  1AR4 A;  3H1K H;  4L8J A;  3A0H Z;  3D3I A;  3CCM V;  4FLZ A;  4NYK A;  2AHY A;  3ZHU A;  4JTD B;  4UB8 Z;  1PNL A;  2E74 B;  1GM7 A;  1G4Y B;  1K92 A;  5BMV B;  3OTO B;  4DV1 B;  3FFQ A;  4LFC B;  3CE2 A;  2KKW A;  2ZE5 A;  2DMX A;  3QG5 A;  1WPB A;  2Y4T A;  3QF7 A;  4DW1 A;  4Z2W A;  4DR7 O;  5CN0 A;  3F5T A;  2VWJ A;  3JCZ A;  1R3L C;  5EC1 C;  1ZL8 B;  3STZ C;  4D6T H;  2WLI A;  1ORQ C;  4D7T A;  1YDX A;  3ZMS A;  2HVJ C;  3BY6 A;  4MVU A;  2CTQ A;  3OMN B;  1IBL O;  1SQV H;  3CEI A;  2GDS A;  2JS5 A;  1D5N A;  3KKY A;  3SYO A;  3ASO B;  2WLM A;  1XMO B;  1GM8 A;  4LF7 B;  3JYC A;  2R9R B;  1VQ7 V;  1O9G A;  2EIK B;  4UCV A;  2ADQ B;  2FB5 A;  2EJR A;  2NR5 A;  4B3R O;  4YIP A;  1X59 A;  3T1H O;  1Q6H A;  4ZHQ B;  2DYS B;  1S5J A;  2Q4P A;  4B3S O;  4TV8 A;  4DV3 O;  4FVM A;  2IH1 C;  2N04 A;  5EZY B;  1VQO V;  4JI4 O;  4X65 B;  2Q67 A;  1SZT A;  3WG7 B;  1M5I A;  1N4C A;  4QE9 A;  4DV7 B;  1ZLZ A;  4DV2 O;  5H5N A;  2EIM C;  5LMU O;  2WLL B;  4HNA B;  1NBM G;  4JPR A;  2E76 B;  1CP9 A;  1FKA O;  2QDO A;  2QKC A;  2RJZ A;  3G6E V;  1EZV H;  4BIU A;  1XMQ O;  1AJQ A;  1VQK V;  4B3T O;  5IT9 N;  1J95 A;  3UCS C;  3ABK B;  3C90 A;  4J9Z B;  3LSQ A;  4JI8 B;  1YJ9 V;  3AG4 B;  3AK1 A;  5B1O A;  1KP2 A;  1PPJ H;  1L1F A;  5J2T A;  3E8F A;  3QTC A;  3KCY A;  3BAA A;  1U97 A;  4WBN A;  2IU3 A;  5KHK A;  1PV0 A;  4X64 O;  2H3O A;  2FL4 A;  1SER A;  2LGW A;  2ETN A;  3E35 A;  1BL8 A;  5DEC A;  1XNR O;  4DK1 A;  4MTF A;  2Z3Y A;  4O4I B;  3FAV B;  3ZJZ A;  3ZMV A;  5IYD O;  3DXR A;  3SYC A;  4LFA O;  2GUZ B;  1IBK O;  3K5L A;  1QBZ A;  4U7N A;  2OCC C;  2YI8 A;  3SYQ A;  3TGU H;  1K73 W;  5C8Y A;  1QNM A;  4BWA A;  4Z1M G;  4EFE A;  4KHP B;  1MZF A;  3K9A A;  1NVP B;  2HLD G;  2P67 A;  5H2F Z;  4CS2 A;  4YIO A;  1RP3 B;  1H2K A;  4O2B B;  4WFE A;  3ZN1 A;  1Y76 B;  1K4D C;  4I7Z B;  2NNU A;  3BPZ A;  4EKW A;  2XAJ A;  4X66 B;  1LUW A;  5IJ9 B;  4X62 B;  4GLX A;  4FMT A;  1FXK A;  2V1D A;  4DR7 B;  5DED A;  3IAY A;  2LFS A;  1JX9 A;  1IBK B;  2YSU B;  3SPH A;  4FLW A;  1EZJ A;  4YY3 O;  4IIJ B;  4J80 A;  2JGD B;  3IC9 A;  1V9P A;  2A9H A;  5L3C A;  3ZRV A;  3UT5 A;  2F43 G;  3P3N A;  5J9P C;  2EIM B;  4PD4 F;  4TV8 B;  4JI2 B;  3CCJ V;  3GVM A;  1V54 C;  3N2G A;  2AW9 A;  1K7D A;  2UUB O;  2IW5 A;  3WG7 C;  5K1X A;  5FLX N;  4JAU A;  1FPO A;  3OGI B;  3G6B A;  3JAR B;  4OXS A;  2QKS A;  1M56 C;  2P7T C;  4I50 B;  3RYC B;  4KP4 A;  3RYI B;  5J2T B;  2OIE A;  3P3P A;  4DUY B;  1K33 A;  2EUL A;  2EIL B;  4PJ0 Z;  3ETD A;  3OD4 A;  3RN4 A;  1R6T A;  4JAV A;  4ZOL B;  2ATK C;  4JTA B;  5KUK A;  1K5Q A;  1CPY A;  2D2C B;  1N32 O;  1MMM A;  3B40 A;  2Y0I A;  4FLX A;  4KFM A;  3H1J H;  3CSX A;  1VQ5 V;  1RM1 B;  1M90 W;  2AZ0 A;  1I94 B;  1TGO A;  2OT5 A;  5LA6 A;  2IJI A;  1RPO A;  4DV5 O;  2K9P A;  4Q20 A;  2QM8 A;  5HFM A;  1EN6 A;  2IJJ A;  1N34 O;  2EZO A;  4H13 B;  2CGO A;  4NR1 A;  1TVK B;  4O2A B;  4L87 A;  2EX3 A;  1YJN V;  4QPJ A;  3W7S A;  2YXY A;  3OMI B;  3SJA C;  1YTF B;  2UUC O;  1EM1 A;  2ZDI C;  5H6R A;  1M1K W;  1M93 A;  3CME V;  2LJ2 A;  1NVP D;  4R6Z A;  5JQG A;  4F6R A;  4OX9 B;  4DUZ O;  1NS1 A;  2UXD B;  2QWN B;  3T4Z A;  4FLV A;  3K03 A;  4MT8 A;  3JAS A;  4DR4 B;  2Q73 A;  2HP8 A;  2ZDI A;  4JYB A;  3AEI A;  1VF5 B;  5CB4 B;  4MTO A;  3AG3 C;  3FD9 A;  4JV5 B;  4X66 O;  3DXR B;  4R50 A;  1QLE C;  2WSS G;  1HNX B;  4NXM B;  4K0K B;  4UVB A;  1QU7 A;  4KL1 A;  3K79 A;  1HNZ O;  1I94 O;  2ITC C;  5LYJ B;  4X89 A;  1BHA A;  3ZMT A;  1YIJ V;  3JSL A;  2QM7 A;  4GX2 A;  3N2G B;  3EVK A;  4O4L B;  5IYB O;  3R66 A;  1G1X B;  3EFF K;  1EFR G;  3JAK A;  1W0J G;  4CZZ A;  1DF4 A;  1Z5W A;  4G2K A;  3BEH A;  1N32 B;  1UFI A;  2BE3 A;  1PM9 A;  4E2L A;  4UV8 A;  2Q0O C;  1NT2 B;  4UB6 Z;  4BR6 A;  3QO7 A;  1ZUQ A;  5JH7 B;  4YY3 B;  4PEL A;  3CMA V;  5IJ0 A;  4PDL A;  4TWK A;  4MVQ A;  4DV6 O;  4TOI A;  4RAI A;  2AXT Z;  3KCX A;  1PNM A;  5J2U A;  1VQ8 V;  1D2D A;  2UXB O;  1KC8 W;  3CX5 F;  3DSQ A;  2JIZ G;  3W7W A;  5GON A;  2F23 A;  2OTJ V;  2Z0A A;  5L3D A;  1N0N A;  2QE7 G;  4FM0 A;  4I55 A;  2GTS A;  1YIT V;  2YID A;  3ZIA G;  2CTP A;  5B1N A;  4X88 A;  1AI5 A;  4NTW A;  4GX5 A;  1HR0 B;  4OPA A;  2UXC B;  5BZB A;  4GCZ A;  4FZ0 A;  5H9C A;  1Z2G A;  3ICX A;  3BCC H;  4YJ3 A;  2M6Y A;  1TUE B;  2P06 A;  5B3S C;  1VQN V;  4NXN B;  4LF8 O;  3LDC A;  4AIL C;  4PA4 A;  3VQX A;  4Z1V A;  4B3R B;  2HG5 C;  5KUM A;  4JGS A;  3AG7 A;  1PKX A;  2YI9 A;  2YEV A;  3P32 A;  1E1Q G;  4LF4 B;  4O4I A;  1SS3 A;  3CRA A;  3LSS A;  1FJG O;  3TK1 A;  3B09 A;  3JAR A;  1R3J C;  1WA8 A;  3QO5 A;  4LWS B;  5EBM C;  5JH7 A;  3BFR A;  4MVZ A;  1N33 B;  4ZHQ A;  3N2K B;  4JTC B;  1TUB B;  2DYR C;  2XAG A;  2F95 B;  4I4T A;  2XOK G;  4KHP O;  3OE7 G;  2Q69 A;  3CXH F;  2VRZ A;  3SDL A;  1AR1 B;  5A9G A;  1W2B U;  4LP8 A;  3HKE A;  2ZE7 A;  3K59 A;  5LGU A;  4DR4 O;  1OCZ C;  4B3S B;  4GX1 A;  3NR7 A;  4B08 A;  5LXT B;  2ZKO A;  1PP9 H;  1F4M A;  1BE3 H;  4UCT A;  5JJE B;  5FPO A;  2JVD A;  3AG3 B;  4B3M O;  1VAR A;  3STL C;  4NKG B;  3ZHS A;  2ZT9 B;  2QWR B;  1WP8 A;  4LR3 A;  1H2S B;  2IH3 C;  3K58 A;  1M57 B;  5JVD B;  1Y6X A;  4R7C A;  5FNV A;  3E89 A;  1FJG B;  1V55 B;  1JPX A;  3ABM B;  3LSU A;  2PZS A;  5JJJ B;  5JWP A;  1JFF A;  3ZRS A;  3OAA G;  3UT5 B;  2R72 A;  3CHX A;  4WFG A;  4F6R B;  4LFC O;  3FYI B;  1GAX A;  3CCV V;  4LNU B;  2PTM A;  1SA0 B;  3ABT A;  4MVM A;  1BHB A;  3CCQ V;  2ITD C;  2Q6A A;  1N0J A;  2X6A A;  3E83 A;  3S3W A;  2LW7 A;  2R9I A;  3T1H B;  1XNR B;  2A7W A;  2Q8V A;  4P2Z A;  2RMK B;  1B3Q A;  1IX9 A;  2YUA A;  3E8G A;  1RM1 C;  3LDD A;  2Y4U A;  3RWR D;  3BHP A;  2BSK B;  2UU9 O;  4LF9 O;  5LGT A;  4R8C A;  1TA8 A;  5JVD A;  3K04 A;  5BR8 O;  2UUA B;  1HWY A;  4LF8 B;  1GK9 A;  4UUJ C;  3OGC C;  3U11 A;  3L75 H;  2EIL C;  3JAM N;  4EB6 A;  2WAM A;  1YJW V;  3B8N A;  1OCZ B;  3ZHT A;  3J81 N;  2LFR A;  1QVG U;  4HBN A;  4MTG A;  5CBH A;  1M56 B;  2F4V O;  3D8C A;  4PDV A;  3SGI A;  1MA1 A;  1JCH A;  2H94 A;  4LF5 B;  3K06 A;  2XHB A;  3RYC A;  1P49 A;  2ZQM A;  4Q6G A;  4FFB A;  5E79 Z;  2BCC H;  1BSM A;  4UCU A;  1WNS A;  2ZXW C;  2W6J G;  2UUC B;  1H2N A;  3H01 A;  5ITZ B;  1K9M W;  2WLJ A;  4ZKI A;  3K0D A;  5CA3 A;  1KKD A;  1GO3 F;  5GON B;  2W0F C;  3LDE A;  1S0V A;  4J7Z A;  4ABM A;  3ETQ A;  2UXN A;  1IUR A;  1VQP V;  1ENV A;  1PNK A;  1N8R W;  4J9Y B;  2ARH A;  3F5W C;  1FFX A;  5IWA B;  3WB0 A;  1UPG A;  4WFH A;  5K1P A;  4DRX A;  5GW7 A;  1MZE A;  2V7Q G;  1H2L A;  2WLK A;  2L6L A;  1XEQ A;  4DV0 B;  3KG2 A;  4AHC A;  2FKX A;  4PDR A;  5LHG A;  1YTF D;  3T1Y O;  3VBB A;  1GN2 A;  1QR9 A;  2GUZ A;  1OHH G;  2Q5Z A;  4LF5 O;  3JD4 A;  5LHH A;  1OCO B;  1A32 A;  2DN9 A;  4B7K A;  1Q43 A;  4X1K B;  3JAK B;  3T1C A;  4UCR A;  3JAT A;  3U10 A;  3VQY A;  3T4D A;  2XND G;  2YIB A;  4LF6 O;  1M9N A;  1XI1 A;  1ZSP A;  1SQQ H;  4RUF A;  2OIG A;  2JDI G;  2DWE C;  4FM2 A;  1Y74 A;  3DTU B;  2MW2 B;  4NTY A;  4CH5 A;  3RVY A;  2KG7 A;  3MD0 A;  2X6C A;  3RGB A;  5B5E Z;  4X20 A;  4JYC A;  3THO A;  1S3J A;  2E5L O;  2UUA O;  4LF7 O;  4O4L A;  3OR7 C;  3FX7 A;  1OZ0 A;  3GWK C;  2Q9L A;  5BY1 A;  5IDJ A;  5KMG A;  5LMN B;  2EIJ B;  2BOC C;  3AG4 C;  1KQS U;  5HFL A;  1E1R G;  3E22 B;  2H8P C;  1IBM O;  1HNW O;  4OGQ B;  5EBW C;  3HKB B;  4H33 A;  1WB7 A;  2DJV A;  3O65 A;  2ZM6 O;  3BRC A;  1CXZ B;  1R1B A;  4AI8 A;  4X8A A;  3E8H A;  1QLE B;  2RN9 A;  3C3S A;  4I0X A;  2YC0 A;  1US6 A;  3I56 V;  4DV4 O;  1Y66 A;  2EJ7 A;  3OUF A;  3ZED A;  2DYS C;  3CD6 V;  2FYU H;  3CYO A;  2HJD A;  4UFZ A;  4X1K A;  1FAF A;  4CC6 A;  2P5O A;  3A8T A;  1GN6 A;  1VQ6 V;  4UXN A;  1Q6U A;  2JS3 A;  1UJW B;  3J80 N;  4X62 O;  4JI1 B;  3ZMZ A;  2EIK C;  4YJ3 B; 
#chains in the Genus database with same CATH homology
 4LF8 O;  2LW7 A;  4DR1 O;  1YZB A;  4JI2 O;  1HNZ O;  1I94 O;  4JI0 O;  4GKJ O;  2UUB O;  4LF6 O;  4JV5 O;  1J5E O;  2N74 A;  2UU9 O;  4LF9 O;  2HHH O;  4OX9 O;  5FLX N;  4X64 O;  5BR8 O;  3J7A U;  4JI7 O;  4JI3 O;  1FJG O;  4LFB O;  3R66 A;  1G1X B;  5BXZ A;  4A5U B;  4JI1 O;  4B3T O;  3JAM N;  4JI5 O;  4X65 O;  4DR7 O;  3J81 N;  1F7Y A;  4K0K O;  3F5T A;  4NXM O;  1DK1 A;  1XNR O;  1R6T A;  4KHP O;  2F4V O;  2E5L O;  3SDL A;  4NXN O;  2UUA O;  1N32 O;  4LF7 O;  4DR4 O;  1IBL O;  2JRI A;  4DV6 O;  4DR5 O;  3RT3 C;  4AQY O;  4DV7 O;  4LFA O;  4DR6 O;  5BY1 A;  1IBK O;  2ZKO A;  4DR3 O;  2VQE O;  4JI6 O;  4GKK O;  4DV5 O;  1D2D A;  2DOS A;  5IWA O;  1IBM O;  1HNW O;  2UXB O;  1N34 O;  1XMO O;  2DJV A;  4B3M O;  3O65 A;  2ZM6 O;  4YHH O;  1R1B A;  4B3R O;  4DUY O;  2Z0A A;  1X59 A;  3T1H O;  1FYJ A;  2AGA A;  2UXD O;  4DV1 O;  4B3S O;  1AIL A;  1AB3 A;  4DV3 O;  2UUC O;  1HR0 O;  4DV4 O;  1XNQ O;  4OPA A;  4JI4 O;  4JYA O;  4LF4 O;  1N36 O;  4DUZ O;  4OPH A;  1NS1 A;  5LMN O;  1XEQ A;  3M8A A;  4LFC O;  2VQF O;  4DV2 O;  4DV0 O;  5H5N A;  3OTO O;  4DR2 O;  1KUQ A;  4YY3 O;  2FKX A;  2UXC O;  5LMU O;  4JI8 O;  3T1Y O;  1FKA O;  1HNX O;  5A2Q N;  1N33 O;  3J80 N;  5LL6 Y;  4LF5 O;  4X62 O;  1A32 A;  1XMQ O;  4X66 O;  5IT9 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...