2B1GA

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Structure-based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase.
pubmed doi rcsb
source organism Gallus gallus
total genus 208
structure length 590
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2b1gA04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2b1gA01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1gA02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1gA03
1THZA 1G8MA 1A9XA 2YVQA 5H3LA 1M9NA 1PKXA 1M6VA 2X8WA 1ZCZA 1T36A 1VMDA 2IU3A 1CE8A 2B1IA 1P4RA 1IK4A 1C30A 1WO8A 1C3OA 2IU0A 1EGHA 1BXRA 1CS0A 1OZ0A 1B93A 1S89A 3ZZMA 4EHIA 2B1GA 4A1OA 1S8AA 1KEEA 1PL0A 2XW6A 1JDBB
chains in the Genus database with same CATH superfamily
4X6YA 5F7XA 3KSUA 3GOHA 3GRRA 4YREA 3O9ZA 3EOZA 4PQGA 2JKZA 2D1FA 1W85A 4PICA 2QMOA 2Y67A 5DRYA 3PF8A 3ZXYA 3G67A 4XWYA 3RRZA 4TYQA 2OG2A 1A0OA 4QGHA 3DMHA 4BFXA 4HFMA 5TB5A 1D2HA 2YWRA 1OLXB 1L5HA 1VSQA 2GHYA 1PK8A 3KHSA 5A5VA 1P33A 2GM4A 3ACCA 2BMDA 1VC2A 5JLAA 1PR2A 2FMKA 2BGIA 1UOOA 1OX4A 1ZN2A 4WMLA 1H2GA 1Y8QA 1J09A 1I94B 2YYZA 2E1PA 4UFOA 1T0JB 1XDDA 4IHJA 3OIYA 3AG2C 1KY2A 4BIOA 1Y4SA 3DBHB 1HKUA 2RHHA 4OJKA 3FD9A 1C80A 5L3EA 1CERA 5LZ7A 4NI5A 4CF7A 3CUSA 4OYRA 3E7WA 1MN6A 1C3LA 2NMVA 3BIWA 1X0VA 5LDGA 4B7KA 5BMVB 4J16A 1AJPA 2UUBO 3NX4A 3WWPA 2VXYA 3EQ8A 1EM8B 4KMMA 3WRWA 1SBYA 1N0HA 1JKMA 3WB2A 4O33A 3QGMA 4KDCA 1VE3A 4QODA 5JFTA 2C9YA 1T26A 1YBFA 4INOA 4AIRA 3U49A 3QU9A 1R16A 4BVGA 2D1QA 4R1NA 4GRAA 4X5OA 5EP3A 1ZRNA 2W2PA 5AOBA 3PQ3A 4I1VA 4PONA 4UXNA 2YIBD 3HNRA 2AN1A 4W4LA 2W83A 3LXUX 2EIHA 2IZZA 2YI9A 3GG9A 5CYOA 3BFVA 3AW9A 2AEFA 3O9OA 3R0VA 4EPWA 4DMGA 3GNQA 1A9XA 4DV0O 4GOJA 3DEAA 3RIYA 1TYBE 3HFJA 3CLVA 3R8FA 3HN6A 2TYSB 2O96A 1I2AA 4JEMA 1NW3A 4YRPA 3WHLA 4ZK6A 4YXWD 3OOJA 1R3JC 1E8DA 3IDQA 1T0PA 3LOPA 4A0RA 1T5DX 2FXIA 2O7NA 4YP0A 3VKGA 5GINE 1TPZA 3DDOA 3RRJA 1YH3A 1NM5A 1QMPA 3BGOS 1KKLA 3P45A 1N6PA 2JJYA 5KSZA 1JG6A 2WJAA 3OPQA 3TRHA 1TKCA 1DAEA 3IAHA 4F4CA 2QTOA 4C0LA 3O4FA 2BEVB 1W59A 1W1WA 5LQAA 1ZCZA 1CEYA 4DWWA 1OYWA 3JQFA 5KTNA 2HVJC 2CVOA 2A0YA 5DO9A 4JCOA 1Q91A 2HBRA 3OP1A 1NVGA 5M04A 2WC1A 2GZRA 3ZIAG 1X1BA 2BLLA 2MTBA 3H8WA 4JB3A 2OQIA 1DAKA 1YFZA 3NRCA 5LQRA 1J9EA 2GZAA 1LRJA 3GFQA 1GJRA 1MB2A 3AIOA 5HJ2A 1NE7A 4BVEA 4B5LA 2XT9A 2D00A 3K35A 1DLBA 4D02A 4V0OA 4J7JA 2WMOB 2DT8A 3UIEA 3PGKA 3W1VA 1NUUA 1GCUA 2OVFA 3QRWA 2JANA 4LWSB 1Y6FA 3I05A 3HLTA 2J45A 1R0XA 4I1UA 5KVAA 3JSNA 1IBLB 4J49A 1R9GA 3E6AA 4MA0A 1ZX1A 4W5QA 2GTIA 3QFHA 3KEOA 4RTQA 1K27A 1XTSA 4YLYA 3GEMA 2RC5A 1T3GA 4M1WA 1HC7A 4R31A 2X15A 2XF2A 4MV7A 4UCUA 5FUXA 1JA8A 1LSJA 3ES9A 4MS3B 4WCFA 4UOZA 4MCIA 3EXEA 4ABTA 1RE1A 1N5KA 3QIAA 5AD1A 4Q9NA 1Z5OA 2DQ3A 3OLXA 1P9NA 1LDBA 2HF9A 4J43A 4MUJA 3Q5GA 4D41A 1GAWA 3R77A 3NBXX 2EVWX 2X5OA 5LB2A 2HO5A 1ZLYA 4BFTA 3TLJA 1GZ7A 3UWMA 5BVHB 2MINB 2JGJA 1RHQA 4YN3A 1LVUA 2CD7A 1LPSA 3KUCA 3HJNA 4NMMA 1NSYA 2EGGA 2PV0A 1XFDA 2Q9UA 2R7NA 1CNMA 2P65A 2F9LA 4HUQB 4BQNA 3FPSA 3THYA 2VBGA 4PDRA 2A35A 4P54A 4MB0A 4B40A 1KFBB 1XNQO 2IPMA 3E61A 3VR0A 5LQCA 2I1LA 4RTMA 3W05A 4OXKA 4ZAWA 4JYPA 4NDAA 3IA2A 3BMQA 5I01A 5CB4B 1X3LA 2A3RA 4G67A 3SHTA 3EMKA 4UTRA 4C4YA 1UMBA 4U7OA 1MH9A 1FNSA 2HY7A 3RBXA 4PSCA 1NN3A 3BGVA 1MDBA 3CJHB 4M0CA 1R18A 3NEAA 1TAHA 2XXJA 4CTKA 3FTFA 1QK4A 5HBRA 2WMNB 5J63A 1Q43A 4FCWA 1VJDA 5DKFA 3H5WA 4LISA 4W82A 4NX2A 5D8DA 1BA3A 1RPAA 1KYWA 3DBOB 4K28A 3EFBA 3X2QB 1Y3IA 2Q2QA 2LP7A 3T94A 3I76A 1T3LA 4DADA 5E4JA 3CV3A 4QQRA 4JR1A 3S1AA 5FI0B 2QN3A 1GFSA 4N4AA 3DL4A 5PGMA 4FSHA 1Z4JA 1IB6A 3UATA 5JZBA 1IZ3A 2QLLA 3B3GA 4MQEA 1MT3A 4EK9A 3LCJA 1IX9A 3NHSA 1GRRA 2Q8NA 2GRJA 3S8MA 2E85A 1X1DA 4E70A 2ZIOA 1KPGA 2GZDA 4EEZA 4ZI7F 1C4KA 3G0HA 2WMYA 5CBPB 2QJ1A 5G0WA 1A2QA 2EIKB 2P1ZA 4WLNA 2G7ZA 4BS9A 2IITA 4MT8A 5GW7A 4IJQA 1MABG 4HT3B 1XVUA 2A2ZA 4ERXA 4AG6A 2DFPA 3M70A 1SB9A 3IXLA 5JUWA 1P2UA 4M8LA 4NFYA 2GJKA 3FI0A 1G6Q1 1H1DA 1K6IA 3M6LA 4ALMA 3KVNA 3V2HA 2H85A 4Z0TA 2ADMA 3IPAA 4RF3A 4OD0A 2QD5A 2R9AA 3EBLA 2HWWA 1VQ6V 3LXRA 1AKWA 4ZV9A 3HH8A 1YZQA 3STZC 5B57C 1KZ7B 3ZDXB 4RA6B 4Y98A 3ZI7A 2QLFA 3SZOA 3HDGA 2GO1A 4XLTA 2QR2A 1QH1B 3NI2A 4XRRA 3UZUA 4CM3A 2D30A 5T8KC 1T6BY 2XDAA 4M98A 5GVSA 5TIIA 3MCVA 2IS2A 5JS1A 3WK4A 3M6XA 1I94O 1KZGB 1KWKA 4DW8A 4FEYA 4K5QA 5H5JA 3RPEA 4ZFRA 1ONOA 3KYBA 4JJKA 2QN7A 2YQ4A 3ZU2A 1CS4C 3HBJA 4GP9A 5JDIC 2W6MA 3MRXA 4RIFA 2ENUA 2XIQA 3WLMA 4YUVA 4RHEA 1FP1D 3UPTA 5LP1A 1N7HA 1WV0A 4BX8A 3E9RA 2J4CA 2ETNA 4HWTA 1V1MB 1W6RA 3EX7C 4ER6A 1PDOA 1V3VA 4EHFA 1G3RA 1EFVA 3L05A 1SKAA 3L2OB 4AJKA 3OSZA 3ABMB 5ALOA 3O38A 4K7JA 4GPAA 4OVKA 4DK1A 1TD9A 2O1XA 2I76A 3TFOA 1XC7A 5JASA 1I6KA 2F17A 3D5TA 4N54A 3EWAA 1K2VN 3B5EA 3KOXA 4EJFA 4I3GA 4MSMA 4DB4A 3GFTA 4Z6KA 4MVSA 2JEYA 1E3JA 2ZTLA 3RN4A 3ZDZB 1CC1S 1AKEA 4GAEA 1YBVA 2DOKA 3WLKX 4M0DA 1FNBA 4BFWA 4UVDA 1R5NA 4BFYA 2GERA 2QZSA 4CHGA 4MB2A 3UV3A 4CM7A 2XNDD 5L4SA 4JUAA 3HEAA 3UPUA 1WSAA 4PC7A 1FUKA 2FTKE 4ZRNA 4C5CA 5HP4A 3I2JA 1I7NA 3PR1A 3ZY4A 5FPHA 2LUOA 2AOTA 1G2IA 3CYOA 3K0GA 1PR1A 1EA7A 4HDMB 3VPBA 2R8OA 1G41A 2B5WA 1N6HA 3K06A 4KGDA 5ESXA 3GQBB 4AI6A 4DGQA 3Q0EA 1IIBA 1QAQA 4KP4A 3OLWA 4YMWA 3ASUA 2BFBA 4FDVA 3OSUA 1UMCB 4F8YA 2H7XA 2LKDA 2J07A 3D8UA 3QLUA 1I5YA 4M1OA 1L4KA 2ZT7A 2NZYA 4P9NA 1F51E 1NW7A 1PYDA 4AO8A 4TV8B 1RLIA 3RHFA 1K6MA 1P39A 3OWHA 1COWG 3VH1A 2FWPA 3ETJA 2BR5A 3NVDA 2WAMA 4JMLA 2OPHA 1JFRA 4MQBA 1NVEA 1GYQA 1A3CA 1XSEA 1UK6A 4EFEA 4NYJR 3A4VA 3EVAA 5CMUA 4Q9DA 3SYKA 3WWDA 1HDOA 3LWBA 1GG9A 1U8CB 5G3ZA 3T1NA 4CN8A 1QGYA 4W5TA 3ZJVA 4HYQA 4JQOA 3IVCA 3P9NA 1IB0A 4AYTA 4X7PA 4FX5A 1MQAA 3ISJA 4GOXA 4TTVA 2RHTA 3TDKA 2WFLB 3NTQA 2IZ1A 3AERB 2WF7A 1ZH0A 3L4BA 3DL2A 1Z4PX 1KU9A 4MLDA 4BLRA 4DCOA 4WFJA 1UP6A 3PNBA 2YYAA 4QNNA 1U8AA 2B82A 3HA7A 3UKMA 1G5QA 3SKXA 1NKTA 1AURA 2VPXA 4YQEA 1LDYA 2KB0A 2Y6VA 5IWCA 1RZ3A 5FBVB 3Q3EA 3S99A 3TRIA 4CCSA 3GIWA 1LTQA 3GQVA 3ABZA 4MJLA 3EBOA 3BX1A 4IH4A 3G0OA 2QD4A 3VR3A 3ESAA 4DF3A 4MTCA 4M99A 5EYPA 3SKVA 4LOHA 3EVCA 1SUAA 5IHXA 4ZBMA 4MH0R 1LPOA 4G97A 3LDAA 2NAFA 1S2IA 1FNMA 3N2KA 3TZQA 4RZSA 2WQ6A 1D1PA 3KP1A 3PCRB 5F4ZA 4BTEA 4OCLA 1U8YA 4L0CA 1AIPA 2PVPA 1RLTA 5JG7A 3M89A 5AK3A 1K0FA 3UG6A 3CCMV 3BSWA 1C9DB 3THOA 2ZR8A 3L82B 3JAWA 4ZDIA 5AVKA 1UKZA 4FC6A 4XR4A 2Q5LA 2DVMA 3WKCA 5BSRA 1J0BA 3HDYA 3OM9A 4NJEA 3HE3A 4Q9AA 2O2JA 2HMYB 2J5QA 3STTA 1UWCA 3JQ9A 4OUDA 3CX5F 3AT1A 4QXOA 5A6SA 5HRCA 3RFCA 4YGXB 1SXJD 3LOQA 3TZEA 1PQUA 3NDJA 4C1NA 3EAGA 3WNDA 1G8MA 1QP8A 1FX1A 2YMLA 1NS1A 1G64A 3MD9A 3SJAA 3DXFA 1GQYA 3FYSA 3O8RA 3WRYC 4RU1A 4YFVA 1AS0A 2W2VA 4GUAA 3FKQA 3PB3A 3QYAA 4O4LB 3U39A 4EPYA 5TF4A 4OI2A 1NQTA 3I1FA 1VIBA 4LC0A 4DABA 1YOBA 3LK7A 5F9HA 1UL1X 1T0IA 3OTOB 4CDGA 2FEOA 1CUIA 2R6GA 4B4UA 4GR9A 5K9ZA 5FBRB 3JWGA 3HEMA 1NZDA 3SQWA 4RYDA 2O7SA 4JYYA 1PM9A 3DXRA 1JZSA 1UWZA 2W8ZA 1ZA2A 2QTVB 4RZIA 1V4VA 6AT1A 1PFWA 2BV3A 1MC4A 4DZRA 4ER7A 2ZRIA 5I4KA 2V6MA 1VXOA 4TTRA 1AUOA 2GHIA 4OI4A 1C2YA 3UJDA 2WNIA 3IS3A 2IYQA 5KNBD 3O03A 1H42A 1ZGZA 4YRDA 2OHHA 3G5TA 4BN5A 1Z39A 4NH4A 2ZG6A 3ZTWA 1ENYA 1M75A 1KH2A 3FG9A 5LZ9A 2VDKB 1EK2A 4OK3A 3WTCA 1KAHA 1K2WA 3SC2A 3O4RA 3DTYA 5IYZB 4TWZA 4F3RA 1YJAA 2W6JG 1ZG3A 1S89A 3A4LA 4DJAA 2Q5HA 3C1UA 1D7OA 1TYZA 4WSOA 1DADA 4G4SO 1P0PA 1P4GA 4R40A 2XPCA 1T1IA 2B21A 2LIVA 4CMIA 4B75A 3OLZA 2X8JB 1FZTA 3THWA 1TQ6A 1VLJA 4O5AA 5FL7A 2AZMA 3VAAA 2OBNA 1HWYA 3QV2A 2DWQA 1AZWA 1V48A 1ZZEA 3LUPA 4QGAA 3CH7A 2EGUA 2O6HA 4FYXA 3BE5A 4GRDA 4J4BA 3KQQA 2FXVA 5EQJB 3D0QA 3FWKA 3PR2B 1JAIA 3UNXA 3QJ5A 5EUMA 1YGPA 3U1BA 2WHXA 4FMBB 1XU9A 2RJNA 3IRUA 3FMPB 3ZGNA 3F7OA 1I2DA 3AWDA 4ZMSA 4JXZA 2AE1A 221PA 2CLEB 3SX0A 3W6ZA 3HB7A 1F2TB 3E8BA 3CS3A 1NR7A 3DD1A 1Q92A 4I7ZB 5FB3A 2QE7D 1T4CA 2SKDA 5HMLA 3ND9A 3TE6A 2CXHA 3B20A 3QY0A 3ZD6A 1WXHA 2QV7A 1RFLA 2FW1A 4HFJA 2D59A 1QVVA 2DQSA 3GFBA 1H5UA 2DTXA 3UA3A 4ARVA 5DMHA 3CH5A 3B3FA 2BSKB 2ZJ1A 2QAGC 3FFBA 1ZBDA 4FCTA 4PRKA 3E83A 4UTOA 3E9YA 3HXPA 4UM7A 5M2QA 5LHGA 1ZC3A 1SOMA 1NT2B 2HJSA 4Q7MB 3ZLVA 4CU5A 4EB6B 3HA3A 1EM1A 4ZGWA 3TCNA 5K0ZA 3IILA 2XUQA 1FDOA 1RI5A 1YZHA 2VUIB 3IPCA 4MPJA 1EFAA 1W0KA 3IRVA 1A9PA 2H4FA 3NEYA 4OXNA 3GUYA 3WV4A 4CI9A 4ZCLA 3EGOA 3L4JA 2RHRA 2ZJ2A 5FTNA 1AN0A 1WXDA 1DCFA 2D3TA 2PY6A 4IV0A 3WQQA 1KP2A 5AI6A 1Q0LA 3U4DA 1TU0A 4YP6A 3FTQA 2WHQA 5BWNA 3M9XA 5JTUA 1Q81W 3VVBA 3LP6A 5C7IO 2CBZA 4DQXA 1XYVA 2L82A 4JASB 3BJIC 4RA9A 3G2KA 3UMRA 1AGXA 4HCJA 4P34A 5SYAA 4I1YA 3V8EA 3N76A 2JGIA 1A8QA 1E1CB 5ICEA 1YTUA 3SEZA 1P2TA 1R6KA 2I6UA 4XM0A 2Z57A 2H5LA 1EX9A 2DPXA 3C4VA 3KOYA 1Y9ZA 3PX7A 1Q74A 2FEMA 4XX0B 4XB2A 2PIAA 3SE0A 4G37A 2XW6A 2ZRAA 1OA0A 2WR8A 1ISFA 2CT8A 5ALKA 2VAXA 3NHRA 4G89A 4IBOA 1AR4A 4D4GA 1RQ7A 3AI2A 5JTTA 2CXQA 1ZN9A 1R0ZA 1FXHA 5EIBD 2EG5A 3CCSV 3CRVA 1W0JA 1OAAA 2HA4A 5ALWA 2XADA 3NOVA 3HP1A 4UVBA 1XNRB 4GT1A 4OQMA 3GLFA 3BE8A 3LPLA 3K7EA 3ZS9A 3R3VA 3KUDA 4CCAA 1XL0A 4MR7B 3R9IA 3STHA 1P3DA 1Q90D 4OGWA 3H1GA 1BN7A 2QDKA 5CBFA 1S3IA 2Q1WA 4HGOA 5LU9A 2V0NA 3NNDA 2I5PO 4B0PA 4DT1A 4Y67A 1HT1E 5EIAA 5IN4A 4U6QA 4V2IA 4AJPA 3IPLA 1QV9A 1O77A 4MIEA 2FPKA 1XA3A 1SOAA 3A3NA 3GEPA 4GEGA 2O8CA 5CFOA 2JLUA 1TM2A 1ZD4A 2FP4A 4CLHA 1YR2A 2JK1A 2C7RA 2E5WA 2XQVA 1KI4A 2ROQA 4HC4A 5FADA 3SYLA 3WVNA 4L5BA 4GYJA 4J1TC 5AK6A 3ZWWA 2O5EA 3FB7C 3COVA 3OZ7A 4ZVUA 4OY3A 3OP4A 8LDHA 1Y8RB 4YJGB 2P9BA 2PBZA 1VLZA 3FTCA 2NPFA 1E3IA 2YXHA 3DR5A 4M0UA 4YVFA 1R3KC 3H5AA 3L7NA 1N0NA 2DYSB 1K9VF 1DFHA 1PE0A 2JRCA 4OX9B 4L02A 1W5TA 2QLTA 1H2FA 3QEMA 3GMIA 4UW9A 3I58A 1ND6A 3FWNA 3I2KA 2OTCA 3KETA 1Z3AA 5E7MA 2ZRHA 1JDZA 4BJ3A 3WBBA 1AE1A 3AVVA 2WPDD 3CO5A 1E1NA 4EB3A 3H1BA 3EG5A 4YP7A 1DWQA 4ND6A 3CX8A 2H57A 3R65A 3ETDA 3T4XA 1PAUA 5SY4A 2PXCA 1QAOA 1RXYA 1TVEA 1XHEA 4OXXA 1B76A 1VSBA 4DFDA 1SUSA 1OXMA 2FR8C 2YJ4A 1Z0SA 1UK7A 5F98A 1GZ4A 3NP7A 3M8KA 2UXDO 3MTEA 4UCOA 4HO1X 1V11A 4JLAA 3OTOO 5BNWA 4Q7QA 1G98A 3ESBA 3LRXA 2ALJA 3M99B 2PMBA 3EIXA 5LBUA 5FUVA 1YAHA 2PUGA 1Z18A 4LW8A 4NCKA 4KUMA 2HMAA 5FULA 4UCRA 3VPGA 3GD5A 2KQUA 4BNNA 1U02A 4DEYA 4GP7A 1PS9A 4ZODA 3PC6A 1TTPB 5GADl 2Q5FA 1JR6A 2APJA 2G70A 4CJXA 3LQYA 3VVLA 3BZUA 5K8JB 2HFEC 3O8BA 4PR0A 5B7PA 2G5TA 1YKSA 4CEHB 3LZ6A 1YSDA 2PW9A 4D2IA 5CD1A 1PCXA 1FVOA 5BMVA 2IHNA 2GJ9A 2OIGA 2GJSA 4IPTA 3OQIA 3L9DA 3B48A 3I5UA 1LPNA 3GLSA 3VR1A 2C3MA 3NHBA 2B9EA 1ESEA 3FXAA 2Q5IA 2PX8A 2DOSA 5KREA 2GK7A 3CKYA 1OT3A 2XHZA 4F8EA 4LOJA 4FDLA 4EUNA 2QZ9A 5D3ZA 4ZICA 4BZZA 5G02A 1U5AA 4EJ2A 1QQTA 1JHQA 1Z17A 3QE0A 4GBJA 1FNCA 1GO2A 3VHXA 1KVRA 3W8NA 1USUA 3HPRA 2ZXWB 4A10A 1F3OA 1Y98A 3F6PA 3ZU6A 1MC5A 2D2IA 4HZGA 2VQ6A 1SU6A 3IH5A 1DLJA 1I4WA 3W34A 2FG7C 1QGDA 2UZIR 3GEGA 3DO6A 3OIUA 4IDHA 3K0BA 2XH8A 3PNYA 2O2HA 2CNWA 5AW4A 1Y6QA 2WSMA 2JFUA 4FKMA 3H83A 3F8TA 4HAYA 4A1FA 3OH8A 4COKA 1P29A 4WNYA 4W1PA 4PF1A 3E3NA 2CAZC 2ZJFA 3OJFA 4Z1MA 3QTCA 1PU2A 1V55B 2BM1A 2Y0PA 3TB4A 5AVTA 1JG1A 3WBFA 4BMVA 3QVJA 5JV5A 3KVOA 4Y0VA 1RBMA 5DWDA 2IZOA 1UBHS 2AW3A 2RK3A 2VOJA 1OI7A 4RTLA 5BZBA 4P9EA 4MRPA 4TQAA 4QPZA 4Q3LA 2JKVA 3BKWA 5GWXA 4C21A 4QBHA 1XVVA 3HVKA 2BJWA 4KKXB 4WIAA 2BEVA 2MSKA 4EX6A 4RLHA 5F3WB 5D6OA 3H2GA 1TF7A 3E7FA 1A7UA 4M1YA 1WXEA 1X7XB 3TSZA 2O7QA 1GL9B 4YAEA 2VRCA 3JV7A 4AF6A 3SDZA 1S8NA 4XW2A 1BL8A 1JZQA 3L77A 1N34B 4PINA 4G86A 5E2BA 3K0CA 3UF0A 4ZYUA 2P06A 1E9AA 3QYFA 2FSGA 3H01A 3U3ZA 1Q2XA 4ESOA 4HN2A 4RKQA 4YWHA 5J23A 1IFXA 4NKRA 4A8TA 4JS0A 1G8PA 4OMDA 3BL8A 3DFMA 4W8OA 1PDVA 1DF5A 2FETA 5BVGB 5DSZA 4TQGA 5EZSA 1Q86W 3HI4A 4RF2A 4OCNA 3OO1A 4CMJA 4P81A 4Q4DA 1WO8A 2ZEJA 3WYGA 1BVUA 1UKCA 1VP3A 5HF8A 1KDZA 1BEUB 1JMVA 1TGVA 2R0QC 2C57A 2HFJA 2VUTA 1CY4A 1FFBA 3FPGA 1CUUA 2C1EA 2P5OA 2XBLA 3CX3A 3P9ZA 3WZMA 3M5WA 4U6SA 3VU9A 1OZGA 5E1AC 1WIWA 5BVHA 2QJFA 3CZPA 2J1LA 3GFPA 4HMQA 4DQVA 1NVWQ 3Q5DA 3RK4A 1XNRO 2V4UA 1V4NA 1HNXB 3SF0A 2PH5A 2WDPA 3CNHA 3V8PA 4OHWA 3SNKA 1DE0A 1JSCA 2BKAA 1EFPB 3N7UA 4O8CA 4QC2A 4QJ5A 4OPHA 2D0OB 2XEXA 2NXNA 1A9RA 2OXRA 4F2WA 4CLDA 4KIFA 2CUZA 5DWQA 3WJAA 3G80A 1VYUA 3NUZA 4J9YB 4YRBA 3KCQA 3OQMA 4IW3B 2QSJA 3X2FA 3CLRC 3E8HA 4CKEB 2JIZD 1ZHHA 4TRRA 1YDFA 1XPUA 2VWKA 3IPRA 2DB3A 1SGWA 2JCXA 2H4XA 1P81A 2QA4V 2AN9A 3FVRA 4BJ5A 3OIDA 4G25A 4E5PA 3OPXA 3IDOA 4KYIB 1M2VB 2BHSA 5AKXA 1FC0A 2CNKA 4DIMA 1KO8A 3DFFA 4JNCA 3O0TA 4Q1BA 4CG0A 2GSDA 5IJXA 4B7EA 1XZBA 2WU4A 1Y67A 1E1RA 1E3SA 4HKTA 4EGFA 1YXBA 1BW9B 2J9FA 1LVHA 2QYOA 4IDOA 2F66C 4N7BA 2ZE5A 1HE4A 3V1TC 1ZWKA 1M0EA 4LHYA 2HBZA 4OX9O 5HCUA 2W6CX 2HSWA 1UDWA 4B9EA 4UBKA 3UC5A 1QLEC 5FA6A 2YJ5A 5BN4A 4N9WA 4D9BA 1Z06A 4FFMA 2XB8A 3CJQA 4WI1A 5TPZD 1REQB 2R72A 1RAEA 3QEOA 1JKXA 5JRJA 4JQCA 1FFXB 1ZMTA 3ET5A 2O2GA 1XXHB 2OO5C 1PV2A 4GQIA 4CUZA 3W7UA 2J9GA 1AHIA 4ZXPA 2Z2KA 1P18A 1WCXA 1T1GA 1QH8B 5KUKA 1ZD9A 3WG9A 5ICMA 3UH0A 3ICQB 4JTCB 5A2GA 1HO3A 4RA6A 2QX6A 4GUNA 4WL0A 1JCHA 4O2BA 1IN1A 4ZTUB 2DQZA 4U9HS 1PWHA 1EDOA 1ENZA 1YE3A 4TYNA 4YMHA 3OLQA 4KN6A 4MLPA 5JAZA 4ZVTA 1L7NA 3O8NA 3QKUA 2DFNA 4YC7A 1RWWA 2E76B 2W4LA 4ABYA 1N33B 1Z8HA 2Z3HA 4M7WA 3V34A 2H5EA 2KSDA 4KXNA 4ZT6A 5B1BB 2BEWB 1WJZA 4OH7A 4WA7A 3VOUA 3NORA 1OPXA 1QP4A 1P91A 3APQA 3WLPA 4JI5B 4TQDA 1F0PA 1Z4MA 1VPWA 1N8KA 4BX2A 3T3MB 2ZIZA 1N3YA 1GXSB 2VJBA 3TW8B 5K99A 4BPRA 5CW2A 1AS3A 3L0DA 5B1NA 4R2WA 2JIBA 4P38A 3W6UA 4GLLA 1TAEA 2CK3A 2QY6A 8ABPA 2OV3A 4WUVA 3ORRA 4BO4A 3EX8A 4J1SA 2IHYA 1HEIA 2G6VA 1D3AA 1BQ3A 3HDJA 1IWBB 1V41E 2WZCA 2OZVA 2XZOA 5ADWA 2J87A 3RVQA 4FI3F 5EXSA 3E3OA 1RWVA 1KKCA 2WLIB 2IW3A 1N1MA 3ZQ6A 4W9NA 3KB8A 3O4IA 3OBIA 1NHGA 2FPWA 4ZOBA 5EWMA 4AN0A 1BHJA 2H07A 4V0MA 2Q8VA 4AKGA 1CVLA 3N7AA 3MGCA 3U0VA 1XEWX 3V4OA 2RHDA 1Q21A 4FS3A 2BOVA 4HZUB 2CHGA 4ANFA 3V7FA 1NJSA 3DR3A 1Z36A 2Z1DA 1QTQA 3TGWA 4BEJA 3IAS1 1HK7A 1ZN7A 4RMNA 3KOUA 2OCLA 5HOQA 1U2DA 5K0FA 1U94A 4MWOA 4NG4A 1EQ2A 2FX3A 3H19A 2RJ3A 5HRUA 1OHHG 1TA4A 1I3LA 3FSEA 1GYRA 2C1ZA 4IVRA 2GPSA 3MXTA 5C3MA 2AKAB 1KJ8A 3QKRA 5HUHA 1L5NA 2ADOA 3PYLA 4ZCPA 5M52C 4N48A 3QX8A 4MNTA 4FM1A 2AI3A 4BCCA 4KO8A 2BHRA 3PIDA 2XUJA 4R8VA 3ZJ5A 3NASA 4EQZA 2IXAA 5ALSA 4HNHA 4LC9A 1ACLA 3SEFA 1W52X 3LQKA 4UQLA 3BH0A 2I2WA 1TZKA 3TR6A 4QBTA 1BMTA 1FTQA 1C1HA 4TT3G 1P7VA 1N57A 1K3EA 4RS3A 5C93A 1LPBB 3PRHA 3G9UA 3A9VA 4KIGA 4HLUC 1S1CA 3HXLA 1Z2PX 1U28A 1R3LC 1RLMA 4D4HA 3ZGLA 3MXOA 1EN5A 2CFIA 2AFRA 2OQVA 1DBSA 2J6HA 2FQQA 5DH9A 2VSXA 1NKDA 1IK6A 2YXPX 4ILEA 1EAMA 3LX8A 1H2XA 3ZX5A 3KALA 4PYQA 2JEOA 1M2KA 3BMOB 3WP0A 2HSJA 3RGGA 1DL5A 3MTJA 4P84A 3ZBTA 2EOAA 4O8YB 4HY3A 1JLSA 4EA8A 1XA0A 3GGOA 2FG6C 4JC4A 4Z5XA 2HD4A 1HE8B 5BUZA 1HLDA 1CCWA 3KPVA 2D1YA 4D4IA 1EUDA 4XI9A 1VIVA 2FWNA 1NNUA 2PL3A 2DBZA 5SY6A 1M2EA 3NOXA 5HDBB 2CXPA 4FE7A 2P7IA 1O6CA 1QDEA 3RTEA 2QLMA 1OCZC 4F04A 3ORYA 1A69A 4OH1A 1S1MA 2WU1A 5DHUA 2JIPA 1JLLB 1QU2A 1ADJA 5GVRA 5K0EA 1E2BA 3DVRX 4S1VA 2VZ0A 4NFHA 3F5WC 2RI1A 4K6KA 1O0CA 1HNXO 5IEBA 4U7PB 2JIDA 5CA0F 4X1YA 4YBZA 3DOIA 3B4SA 2QN1A 3FTPA 3LKZA 5AJTA 1JT2A 1R0YA 2D2XA 1E9SA 1HYEA 2Q45A 1I6WA 2V6FA 5DNDA 1AUQA 4OATA 4Q1VA 2DFDA 1CLEA 3C45A 3CMAV 3PC7A 1JECA 1VSTA 1CUHA 1R6DA 2AEJA 1G63A 4DMHA 1K5DA 1ACMA 3CH6A 1KY4A 1VE6A 2QSAA 5LL6P 1AI4A 1DO0A 4EHKA 4CL2A 3RUIA 2PA0A 2BGRA 2O7PA 5ER6A 2WLLB 3L0SA 1CE8B 3O4HA 1K1EA 3KCXA 1J56A 1MG0A 2GF0A 4N18A 1OY1A 4QBKA 1N92A 3R5TA 1MXHA 4YB8A 1AY0A 1HE1C 1UC8A 5K3FA 1VA4A 5CCDA 4PDVA 3L7OA 5HR5A 2PUBA 3QU5A 2YV1A 3IO5A 1GYPA 4R4JA 5FI1B 2NX2A 4AN1A 3UGJA 4B8YA 1PJSA 1TVKB 3G2IA 4XUDA 4K6GA 4ZRMA 3RDPA 3U62A 4O4LA 4Y3UA 2BBSA 4RHFA 3R7SA 4D45A 4M36A 5AVWA 4MW7A 2BD0A 4JSTA 3UOGA 1Y74A 2ZANA 1PEAA 1WB6A 1AQUA 5IXYA 3MVEA 3A2LA 4FFOA 3FCYA 1ELOA 2ZVJA 3GVCA 1PZNA 3AKCA 1IBSA 2ZYGA 2VVTA 4IDGA 3LSQA 3FI9A 1R4ZA 4X94A 1NUQA 5IC4A 3SGIA 4F6RA 3E3AA 1LUWA 1SBTA 3AXTA 3ABTA 3C70A 2JLZA 3CZ4A 4PZ0A 1LUAA 3UTDA 4RXMA 4BKUA 1AHPA 4GE3A 3U9TA 4FHDA 3PXXA 3A28A 3VZCA 3UW1A 4TUYA 3FGNA 1XQXA 5IDYA 5F2OA 1QWOA 1YHNA 4BNXA 2CLHB 2VRBA 3VR6H 4RSRA 2E4UA 2PLRA 3ESQA 4OF4A 3BF8A 3UA4A 2PUHA 2HKOA 1M83A 2ATXA 4BE7B 2HJDA 4UTNA 2Q3JA 3PJRA 1QIMA 2DR3A 1J2RA 4QFTA 4DBLE 4D6XA 5LB4A 1OU4A 1SXIA 5LM3A 1PO7A 2PS0A 5B4TA 3TCUA 1Z5WA 3TLBA 1X3SA 1FDSA 4FMDF 1QHHB 2R8XA 3ILYA 3SYRA 3UK1A 1UBLS 2CL0X 3ROZA 2X8JA 3QQ5A 1N33O 3WXBA 2IBSA 1R1DA 2CTQA 2WKRA 5K3OA 5C2JB 4BC0A 4UVCA 4ZCRA 3JD4A 3HCCA 1R3IC 5FFNA 1WZNA 1KVUA 1RJEA 2PGDA 1T6YA 3RU7A 3L6UA 4JI5O 4QEKA 4MLZA 3P2YA 4D3SA 1S8AA 2OLJA 2WQ7A 3CCBA 1BDHA 5EJ8A 5LJIA 3H2HA 1R50A 2MW2B 3THSA 2OV1A 5DB4A 1R4NA 1JB9A 3S2UA 2X4LA 2AG0A 1AVTA 3VPCA 2BEUA 3PNQA 1E3EA 1QX3A 3A8TA 2HA5A 3NNNA 4D8WA 2BGWA 5K1ZA 2ZYRA 1E2LA 5HDQA 4X20A 4DA4A 5LL6Y 3FPEA 2C4UA 3RFVA 3T6KA 4K9KA 4BMOB 1N2EA 3PPIA 3NAZA 1IXBA 5JDCA 2MT9A 5ICGA 1A2OA 1YRHA 4UREA 4AZVA 4NBLA 3GLIA 3MAQA 4HGQA 4F60A 2QG9A 1PBNA 3H7IA 2AFHE 4OMUA 1PWZA 5LXTB 2G82A 3MWEB 5HWSA 3VNVA 2Y4UA 1NC3A 4WZAE 3CWQA 2UZ3A 3CEAA 2P6PA 1N0IA 3ABKC 4LPKA 4NONA 4BRWA 2G5PA 4KWEA 5TV2A 5TLSA 3RVNA 4JEHA 4E2XA 5A3SA 1A2BA 1OXUA 4YYEA 1G20A 2N47A 4B1FA 2EIJC 2PX5A 3FKSG 4C4OA 4IFTA 2VPPA 2X8LA 2WYOA 5IBRA 3T3GA 3QMVA 5HXAA 4FCCA 3NVMB 4WASA 1IY8A 1G9TA 3RTCA 2JLRA 4RCYA 2YINC 5FUMA 2QF7A 4JASA 2QW8A 3LGXA 3T9CA 2ODBA 1Q0TA 3H1KH 1E1MA 2Q5JA 4B3IA 2ZI7A 3E05A 5JH7B 1S76D 2IS6A 5K3SA 3PUJA 4AY4A 4PPNA 4KACA 4UDNA 4OPMA 1Z62A 4XX0A 2CYAA 4DSNA 2NU7A 1ZUQA 4PYNA 5DM1A 4PAOA 1TT7A 2ZSFA 1PI3A 1RTKA 4EI2A 4FXPA 2OEPA 7ADHA 3WLAA 2XMGA 5HKBA 2ID9A 5LBTA 3ILVA 1PJZA 2G83A 4RELA 2YV5A 2O2DA 1U0FA 5EJ4A 5AO9A 5J2TA 5EJ2A 2WBLC 1J33A 3OWOA 5LA6B 1TU4A 4PG6A 2V7EA 4NCJA 3HSYA 2JJ2A 1N9ZA 3H2KA 1QYRA 3QX7A 3DA8A 4N3GA 4YEDA 1IHDA 3LQ1A 2GA8A 1QIIA 2JGKA 4G0YA 5IULC 3HM9A 1DB3A 4H3KB 4O0LA 3OEEA 2QY9A 1NDQA 4XWKA 1FE8A 3AG5A 2J09A 2QWOB 2QMZA 1LS6A 1D4AA 2P9HA 3ASOC 1QLHA 3EDMA 2VQSA 1KQPA 1N0VC 3WJ7A 1DQPA 1T9HA 3JYHA 3T1HB 3MLBA 2Z1MA 4BKQA 1BE8A 2DN9A 3EMBA 5C8YB 1DRJA 3VOTA 1Z2AA 1GPWB 1NOJA 4XLZA 1IJEA 4UZSA 3IDFA 4HQFA 5IX8A 3ZVMA 1ZRSA 1J0XO 4YS6A 2M2IA 1M0SA 4AS2A 2D4HA 3MWJA 1P1JA 4B7ZA 1MSWD 3V5NA 1C3EA 3EXIA 3SHQA 4JLKA 2FMFA 4WNIA 4C2UA 2GM5A 5ANRB 2DETA 1BYUA 4V39A 1J6UA 3VV2A 2BHNA 4M53A 3BDVA 3P30A 3KSDO 3L1UA 3PKIA 1OH8A 3ZWVA 2BSQA 3ELYA 4NC9A 1T2CA 1D09A 4H15A 5E6SB 1YZUA 2X6RA 5TEWA 1K5QA 3JY6A 2B5OA 4MULA 2HK8A 4PYRA 3C3KA 4UUQA 2JIRA 2WF9A 2PMCA 4CLRB 1IXSB 1E0SA 4PQYA 4KK3A 1HDJA 4LAFA 3ICCA 1A71A 3EIFA 3R3JA 4BVHA 3KD3A 2MSWA 1RVDA 2Q3EA 1D2RA 4K05A 5GPBA 3M34A 2OLEA 1DJNA 1Q6IA 2DKOA 1CG6A 3GJ8A 2IIBA 2FWRA 5TGZA 4C4RA 2WTXA 1QCCA 3RTGA 2VAWA 2GM3A 3UO8B 1QV7A 3L0PA 3H4TA 4D4LA 1WJGA 4BRUA 4HAZA 2CLSA 4PPYA 4EY3A 2W4QA 4RVDA 2FPPA 3EXFA 4HDRA 1QWSA 1A5BB 4CNQA 1ZABA 2QNIA 2OHJA 3FM9A 5IMBA 5CR9A 1SEVA 1SQFA 2GH1A 4ZQFA 3RC7A 2XAJA 4X9XA 3ZU3A 1NTRA 4GPZA 3MRSA 1M90W 1D2MA 4D3YA 2XUPA 2PI5A 1ES9A 1L1EA 4HNVA 4B3DA 5IXSA 4YROA 3DFUA 4POOA 3TETA 2VT3A 5HIKA 3LHFA 1QU3A 3FB8C 3ZG6A 1DTEA 5DTRA 1T6NA 5TT1A 2B1IA 1A97A 3C3WA 1PJAA 4FTWA 4EA7A 3ZMTA 2QNBA 1OREA 4NMXB 1FUIA 3UQYS 4XUCA 4E5YA 3O90A 5LWQA 4HH3C 1DKMA 4YDQA 3UBTA 1NF3A 4UMVA 1KTVA 1HUQA 4N3AA 1QQAA 1HFEL 2XWPA 4EW2A 1ZOPA 5IAKA 1D4FA 4OHVA 3GZNA 4LVNA 4CT5A 2YWHA 2ZIFA 4KXYA 4QGFA 3RH0A 3JQQA 4IDFA 3ON5A 3BFJA 1VL8A 5JRZA 1L4NA 1ZLXA 1OTXA 2EIMC 2I71A 1USIA 2ZPTX 4RBNA 1Z9BA 4BO8A 4MVJH 3DNMA 3WL5A 3RVJA 5KOYA 1FF9A 2DSNA 4ER3A 5JATA 1LBHA 1QK5A 3L7DA 4L0DA 4OO3A 3K9CA 4GVXA 3A4NA 4IIJB 3DBLA 3SHWA 1PRYA 5FPYA 3LYUA 3MERA 3J80A 4NYIQ 2X9NA 3SQLA 2NZWA 1M2JA 2AH5A 4ZAZA 2X9VA 5E1MA 1PT9A 1WMSA 2FMLA 4F0JA 2GEVA 1DUSA 1WQ4A 2E4XA 3VTAA 5MN6A 4HYYA 5EXEA 1IBLO 1OZFA 2JJ1G 2F1OA 3FYTA 3SYCA 3UGTA 3JATB 2B2CA 2ZRGA 5D84A 2KB1A 2GZ2A 1CHDA 4F2DA 3B2EE 2C78A 5KA5A 3H7AA 1H8HD 1FVXA 3BHPA 1QYDA 2XAAA 1IULA 4MB6A 4JENA 2JHPA 3RCBA 1ZNXA 3TW0A 3UAXA 2A84A 1HFKA 4U2FA 3NUGA 3R6LA 3I1YA 4RXTA 5CB8A 2Q3FA 2IM9A 5KO2A 1E2HA 4GSYA 3L0IB 3G5MA 3PQ2A 1IJBA 4ROSA 5ALRA 1Z6GA 2YXEA 2C8KA 3DH1A 6CHYA 1Q6YA 4G2KA 3DAOA 5SYNA 1AB3A 1X7XA 4JVNA 3WIVA 4UEOA 1M56C 3PGJA 3RWMB 5CFRA 2NACA 2RCNA 2AOVA 1Q57A 2D62A 5TY0A 1DAMA 1GDHA 3S7TA 4AY2A 3G13A 2PSDA 3CBGA 1GPAA 3JQAB 2H1CA 3QUTA 2O9JA 3W2HA 4U7GA 3OMLA 4RMIA 1KI7A 2GR9A 2XV1A 1XRMA 1CZHA 3CMMA 4G1EB 1J5EB 2ILTA 1BOOA 4A82A 1FX0A 3I2FA 2OT3B 4D92A 2YNMA 1E9FA 2YVLA 1T9GR 4FIZA 3ZE1B 1IUNA 3VR3D 5EBWC 2BMVA 2Q1YA 3E58A 4R1MA 3SSMA 3C6XA 1Q95A 1Z5UA 2D5AA 3U37A 4URYR 4CMGA 1R6AA 5FR2A 3WK8A 4U0KA 4MKHA 3DVAA 4B6SA 1FUEA 3KZIZ 1PQ4A 4WXHA 3SN6A 4P86A 3HWRA 3BFKA 2HV8A 1V95A 4QPNA 2K2QB 4ZPJA 4Q6BA 5L3ZA 4TV9A 4PO3X 2OFXA 2OSBA 3RUFA 2J9XB 3PZBA 2P3QA 3IEXA 2KS6A 4O02B 4EFLA 5JPIA 4CS4A 3EJ6A 3H5IA 1FMJA 3U0ZA 1PZXA 3FYHA 4P2GA 4Z53A 4JXJA 3OQNA 5EIWA 3ANNA 2XITA 4X6LA 4YV1A 2XY4A 3TF5A 1LTKA 2ZIWB 1N78A 2CLFB 3VR5H 1DBWA 2ZSEA 5EJGA 1JU4A 3VBBA 5E2AA 3DO5A 2VTBA 1XBTA 1ANKA 2HVVA 3AQ4A 4C5AA 1BN6A 2OM6A 1TZ2A 1I1NA 4GIBA 3PE6A 2PXAA 1T2FA 3IAM1 3UCSC 3T1HO 3G68A 3HKEB 4ENVA 4LV5B 1XPRA 4PA7A 2DR0A 3H0KA 1NVPD 1W30A 4L0QA 4S1WA 1WZUA 4HXYA 1XZQA 1UZUA 1X92A 1TEHA 2W2KB 4IKEA 3ZS8C 2YWFA 5FNVA 4HR7A 1AUXA 1XREA 2BZ1A 3GA7A 1ZAUA 2YN4A 3JS5A 4HSEA 4C03A 2QU7A 2XZTA 1CWUA 3N8GA 2PGLA 9ABPA 4O4JF 4AB1A 3ZEDA 3L6BA 3F7MA 1BW9A 4QEZA 4PI0A 3QOWA 5HFMA 3V1YA 1J4AA 1MB9A 3B6JA 2MYNA 2RPZA 1HR0B 2G38A 2ATEA 4WQMA 2A9HA 1JF8A 2OZLB 4IVPA 4KQGA 1ILWA 1ZMOA 1FDIA 1N1DA 1XDSA 1BNCA 5C18A 2N04A 5AW2A 3FA2A 2BLNA 4IKPA 3WYFA 4PGGA 4EMBA 1YF2A 3ESCA 3LCCA 4DRZA 3K72B 3OJCA 4JP2A 3RRBA 1PZEA 1WD5A 3W5IA 3T61A 2PKWA 3S7ZA 2WG2A 1PV4A 5BRNA 3WGTA 5LGNA 4M8SA 5KX5A 3IHWA 1ATIA 3RT7A 5L7TA 2XT6A 4CBCA 3KSAC 5IJ9B 4UZFA 4LJ5A 3KHUA 2JW5A 3GLTA 4CV3A 4KITC 4DA9A 4PRZA 1G21E 2CL5A 4RD6A 2PMEA 4D8VA 1T5TA 1PKEA 1HYHA 4B2PA 2NTEA 4UATA 1NU1H 1NQOA 3PDJA 5FL7D 3GLGE 3O5AA 5AVUA 5KTYA 1U7PA 5E6RA 3QEAZ 4CG3A 3IT3A 3LBYA 2MHCA 1MZPA 5AVSA 4TTIA 4DNQA 2FFBA 3QHPA 2GX6A 2GVDC 1SU8A 4UTZA 2ABWA 4UQPA 1Z74A 2YFQA 4FQ7A 3PTZA 2CXTA 1FKAO 3RE1A 3K6JA 1Z25A 4DVJA 1MIOB 2R8YA 1KI1A 3KAPA 5BYAA 3KZNA 1L1FA 1XMVA 1RYYA 3NUQA 3ZWAA 4OCMB 1M0WA 2DSTA 2IUSA 3PKJA 5FYDA 1UBOS 3HV0A 1GXSA 3WX0A 1SQQH 1RQLA 2ZSKA 5AKYA 3NZEA 3H6KA 4FGSA 4BW9A 5DN6A 2EHDA 1B7GO 3DV0A 3R5JA 3A4MA 1J0EA 5L3SB 1P7ZA 4CDNA 4DYDA 4EGSA 4I4TA 3IXQA 3DMRA 2QM0A 4JOSA 4P4NA 3SOZA 4BMSA 2O7VA 1I1OA 1MX1A 2ZRPA 3NIFB 1Z6TA 2UAGA 3FOAA 1W73A 4DIEA 2B1RA 1MKYA 1QV6A 4D9HA 2GSMB 1Y6ZA 2FAXA 4KQCA 3FGOA 5KHGA 3D8HA 3P94A 4KZKA 3UWPA 1W34A 3UJNA 4H0CA 1XFAA 4HL6A 1ITZA 4UUNA 3FETA 3GAZA 4HZUA 4QAJA 3A3YA 5F1OA 2OE2A 1JHZA 3M7MX 4TM7A 2DJ5A 3JX9A 1FLDA 3BCRA 2P4VA 5HW0A 4XIYA 1M7BA 3OT1B 3JVVA 1Z68A 1WW3A 3OX4A 4LRTB 1LWNA 3ROKA 3R7WB 2I3AA 5LZ2A 2J3HA 1XRRA 1U3VA 1PLLA 3OUUA 5DT2A 3QE2A 3MB5A 4HVAA 3P4XA 9LDTA 5HCNA 4B6RA 4KIJA 3G3EA 1YRBA 4JUDX 2ODPA 2Z4TA 2XAQA 3UT5B 4G0MA 1Q7BA 4TYPA 2B8NA 5D86A 2JFFA 3VDNB 4JBLA 2Q7OE 4YCLA 2HN9A 1C1XB 1W0JD 4TVBA 4X3PA 3CU5A 3AHGA 2WJ4A 2PX6A 2RG7A 4IL6Z 1LBQA 1U7WA 1VDZA 4QE3A 4AKIA 1TFRA 4ZAFA 5B58T 5KOJB 3VYRB 3TQSA 3SHVA 4P3OA 3L92A 4L85A 1NBEA 2XD9A 1GPYA 2YN0A 4PZ9A 4GUDA 1I7FA 1C1DB 3PRYA 2GFQA 5E3IA 1AGPA 1J5EO 4I9HA 3EDYA 1L7QA 4OGFA 5JYDA 1Z4IA 4M9XA 2VHEA 1KAQA 3M9LA 3ZBPA 3RAEC 3EAFA 1ENOA 2RK6A 3IB3A 1KH1A 3GYBA 2FQYA 4KUGA 3A7EA 4K6OA 1EX1A 5K3DA 3RFTA 3IMFA 2HPZA 1QLNA 1WQ3A 3SX4A 3RRMA 2QMQA 1WKVA 3GRZA 3FPBA 2HCBA 3WP1B 4FI3C 2FR0A 4Y0NA 3LMKA 3MYYA 3GDHA 1DTWB 3X1WA 2A5GA 3JWPA 1MC1A 3ECCA 1U0TA 4NCIA 4ZO4A 1YTFB 1JFVA 3CEMA 4KQFA 2HRQA 4MUGA 1XYYA 1JLLA 1D9XA 3RF7A 5JANA 4MUMA 1YC5A 1SHZA 1BVHA 4TQ9A 2R68A 1HBJA 2P35A 5ECDA 1EP3B 1OLXA 3O8QB 1JHUA 1CVIA 1CJCA 2WIBA 3UWOA 5JMTA 3SPIA 4RSMA 4JODA 4JI6B 3DTNA 3OPYI 4ILKA 4RDCA 5ITVA 2C0CA 4REQB 1QCYA 2REBA 3HM2A 3MAGA 1P4JA 1JU9A 3EZGA 3PI7A 2TMKA 2ZUFA 4ZCSA 1K5HA 1RWBA 2WU3A 3TCKA 3DBHA 4PVDA 5DDIP 3D3JA 1C3VA 4CS3A 1SKUA 5TJHA 1G9XA 4F5EA 4WK4B 1J06A 2PZKA 4DPMA 3R2NA 4WFFA 1E94E 3F90A 2CLMB 1G5RA 3PTLA 4HYEA 3D0KA 3ZWPA 3S8EA 4MUXA 4RJJA 1XJ0A 3DL7A 1DKUA 4U7WA 2IW1A 1EM8A 2A1TS 4GGOA 4C2BA 4ACBA 1TVKA 3NDRA 5CD9A 2VC2B 4IZIA 1FS5A 2OBMA 3HUUA 5LDDC 1JP7A 1UWKA 4LFCB 4D6YA 4XGIA 3IAUA 4L08A 5E1OA 1UWLA 1B26A 1HR0O 4JYCA 5KQRA 4OCZA 3BSSA 1X2EA 1GKUB 2H1LA 3AI1A 4NS1A 4EGQA 5AKZA 2QTGA 3TNFA 4Z86A 3FMVA 2XUOA 3WKBA 1RZUA 1PP4A 3IVRA 1AH2A 3SCZA 3PHBE 2PV7A 5CVDA 4KQKA 1V6SA 4NCHA 2G5GX 1FRQA 5E0KB 3G0IA 2W6OA 2VHZA 1D0VA 1NYLA 4EPRA 4QTTB 3RV4A 1Z3CA 1SC4A 4MRAA 5CEJA 4CWAA 3HN7A 5GV7A 2BGNA 2A5DA 5J9FA 4E07A 1C0EA 4KN9S 4XM1A 2F59A 2C7PA 3MWLA 5BUQA 2P11A 1KAOA 2WM2A 4C3ZA 4JTDB 4WIFA 5D87A 2YFHA 4FM0A 2FRXA 1W48A 4PPGA 2X6AA 4D4JA 3E0XA 3LL7A 3TL2A 4YO7A 4AZSA 1G3MA 1YK0A 3LAWA 2QUBA 3PSAA 2C77A 1KOJA 3QXCA 3ILXA 3QUCA 2ZYSA 3P97A 3O31A 3FVVA 1JSLA 4HNRA 4N0PA 4QRDA 4KE9A 4M1SA 2QP4A 4RQUA 1IQ0A 1ESMA 3LT1A 2NAPA 4BP9A 4W5OA 5EP2A 3NKVA 1RWKA 1NQ5A 5B6JA 5GJVC 4FB4A 4M46A 1LW6E 3EF0A 4AY6A 5KVQA 4Q9IA 3RNLA 1IY0A 3QXJA 4N0MA 4D9EA 4JQSA 4B3RB 5GV8A 4F4IA 1K9SA 3L8ZA 2CLOB 3RLIA 4G8CA 3PQFA 4MZDA 1UK9A 4LWSA 2FZWA 4M9ZA 4BMZA 2Q6LA 4PIVA 5JVDB 4IWNA 3DE1X 4QHTA 2N42A 3DJFA 3P9QA 1UZMA 4BX0A 2YSUB 1FP4B 2NO6A 1K5PA 3G8BA 4QVGA 3H11B 4E15A 1FFWA 4D42A 1M8KA 1A04A 1UUFA 3WMFA 3ZV4A 4E7OA 1RZRA 4MS3A 3PJDA 4EY4A 4DLKA 3P3NA 1WXFA 3V7UA 3DOOA 5AW1A 2AC4A 3O91A 2VF7A 1EVQA 3PPXA 1JWLA 5AK4A 2A57A 3QEBZ 1V9PA 1V35A 2Y0DA 4TLMB 3AU9A 3NHLA 1IXYA 2AG5A 2O3JA 5FQOA 3LT2A 3LY5A 2CUTA 4D3DA 2QAJA 3WRXC 1NASA 1CW2B 4YACA 2MINA 2PVSA 4J7XA 3CRMA 5KHOC 1EHCA 5JSQA 2H16A 3TGLA 3K1YA 3AL0C 3HYTA 4CYMA 1VJGA 3UMMA 3EHBB 4XBFA 5JCOC 5KINB 3GUZA 2JH9A 5JHGB 4HUQA 1U9IC 2C5GA 4GSKA 3CUVA 2ZWVA 5CNIA 3SZGA 2HXSA 1TIKA 3GVHA 5A04A 2X7RB 1E99A 3BGSA 2NNWB 5CB4A 2HBYA 3H2BA 2PTGA 4XQCA 1EVJA 1O2DA 3SIXA 1ZJJA 2O2EA 3J81k 3KXKA 1Z0DA 4Z1OA 4BVAA 4DIKA 2ZWIA 2IL1A 3CJHA 1QZ3A 2P9TA 3CX7A 4LDZA 4D0LB 3BGIA 4N40A 4PDMA 4K88A 1W5SA 2MYUA 1NQVA 4QJ3A 1GM5A 1CUEA 2ETVA 3ADKA 2E74B 4ZP1A 4O2AB 4C1BA 1HORA 4JT2A 4OQXA 4P2ZA 2HK6A 3JASB 4LSWA 1M1ZA 3FPFA 1HLFA 1P5FA 3RU3A 4BQSA 4CCWA 4WVFA 4ENWA 1FTGA 2QPTA 5JS7A 3GARA 4BLOA 4ND3A 3ITKA 3OQHA 3CJTA 2HJGA 3GA0A 3HFGA 2CKMA 4LDNA 3EXAA 1T8PA 1I24A 3FZYA 3QI2A 2HSEA 3TVDA 4A15A 3ERCA 1LBSA 1VQLV 2Y0CA 1WZEA 3TZHA 5FI3A 3MNFA 1FW6A 4BWAA 4YCSA 1OF1A 2C7QA 3B6IA 5CBPA 1VCIA 4UULA 2PRYA 2E3JA 5AKHA 4ND2A 3CCRV 5C53B 1O97D 1HL7A 1MEOA 2TMYA 3RSLA 3R4CA 4CT0A 1J22A 1RP1A 2Q3HA 3F97A 2HZBA 2XYHA 3EIQA 1PZFA 2NQ2C 3EWSA 1S7GA 2WJGA 2GD2A 5LP6F 4QEDA 1SCBA 1PEYA 1F0KA 5GOTA 1WA5A 3UYLA 4Y2YA 1QHIA 4ZO7A 1E1RD 2WILA 3UMVA 9MHTA 4CTMA 3RAGA 4Z3KA 1E79G 5TSDA 3AYZB 2H8GA 2RHLA 3V1MA 2H94A 3K5NA 5KNCD 3EDCA 4ZQBA 1OLOA 3ZMUA 3OECA 4M22A 3VHQA 3L9WA 5DHRA 3HCWA 3VYVA 1L7BA 1JALA 1QH1A 5L6LB 3TOXA 2FZEA 3C8DA 2FPRA 2H48A 2NLJC 1G8JA 2G28A 2XSZA 2XOXA 4S1OA 1ADGA 5IMSA 1QZTA 1KJWA 3HJHA 3GRUA 2PPVA 4KGXA 3FDFA 3G6WA 5E6SA 1IN8A 4CZ2A 2A92A 5K3CA 1X1QA 1X80B 2PF4E 1IZ8A 1S6YA 5B3AA 3K15A 2X4DA 2CH7B 4PC6A 4OJYA 4BYGA 1M57C 3KUXA 1QCDA 1LTHR 1UXGA 1KZ9A 4C88A 2UKDA 2IXEA 3EXHB 4EMTA 4BBPA 2Z9CA 4J0QA 1UT6A 4GPTA 5DXFA 3VJKA 2XX3A 3P0IA 5IC6A 1B2RA 1WDMA 3AFIA 5A4AA 4PNHA 3FDZB 4ZJUA 3W06A 1K08A 4DLTA 1Q2UA 1GNSA 1V1MA 5H16A 1I6LA 1UKBA 4KCGA 4UD2A 3W7XA 1RHJA 2HJVA 2GZ3A 3L7BA 3C98A 3EGWA 3UMJA 4NB5A 2QUJA 4LFCO 2I6QA 1SS3A 5EIXA 1L0LH 4F7DA 4TS9A 2C83A 4KXLA 3TOSA 1VE5A 3SFVA 3PZRA 2HDOA 3BWVA 4JJAA 3QWIA 2R44A 1LX7A 5HFAA 2GAOA 1GY8A 3DMYA 1WB9A 5DYIA 1PTJC 4CIVA 2OCXA 3UK7A 4G4GA 1TQ8A 2ACWA 3DNPA 1Q6UA 3ODGA 1S01A 3VPFA 4MPRA 2P6RA 3S29A 1HFWA 3EF1A 4ZTZB 1YQXA 5E9AA 1X2BA 1IEVA 4NQZA 5E8JA 3OFNG 4B6QA 1CZNA 3KNZA 3JTMA 3E7DA 3BS4A 1R4AA 1A9SA 4WPGA 2WJ6A 3PHCA 2C9MA 5I5GA 2CK3D 2DBVO 2B6NA 1NVMB 4HDMA 2W6IA 5A5EA 1SPBS 3JAMN 3GQBA 5EZ6B 3U3KA 1D5NA 4X63A 2ZBEA 4TL9A 2DECA 3BG5A 4KJZA 3WKAA 4UB6Z 4KBGA 4JL8A 1OE0A 2IEIA 5CLQA 4JR2A 4Z4IA 3WLRA 2NSDA 1UMCA 1VL1A 4GEKA 1X4TA 1P1CA 4MQ5A 2PLNA 2G1JA 3VO9A 2R65A 4NENB 5CPFA 3AVTA 4TV8A 2EF1A 5PNTA 1UBEA 4QUHA 4EGAA 2EILB 1IN5A 2DPMA 4R05A 4B87A 5B64A 1AD2A 1A88A 5CH8A 2AG1A 2ZJ3A 4JLDA 1RLOA 4Z9XA 3F6EX 4HEHA 4ZHQF 4BP1A 1YL6A 3RU2A 1JKJB 2BFNA 3FAKA 2ZJ5A 1EFRA 2V6IA 3OFJA 2EP5A 4MQ6A 3FSGD 4A6DA 3MIIA 3GVIA 4X0EA 1RB7A 2X8AA 4E4YA 1N34O 1JWBB 3LU1A 2WFLA 1XP5A 4QUGA 2J3EA 1JJ2U 3CG0A 1LPPA 4ZQIA 4DCPA 5EZ5A 1PFYA 3AERA 1XZKA 3D7RA 1AR1B 3DE2X 2FPGB 3QO8A 4DREA 1HE3A 2JH8A 1YDHA 2CMHA 1GTRA 3BRCA 2PR7A 2WA1A 4ZWNA 3DXZA 3EFEA 4Q4JB 3I1JA 3NDIA 3EHEA 4HGZA 2Q7DA 4ONEA 4H27A 1N4DA 1DKLA 4OKNA 3E3MA 2I6GA 4LXUA 3IOYA 3AG3B 2IPNA 1JHVA 3A14A 1QIGA 1QYVA 2H6EA 3GJ7A 4KPYA 2DT5A 2DH5A 1E2MA 4IGFA 3BWCA 4KGVA 3GAMA 4H1VA 4C9BA 1UBRS 3MFQA 4II7A 4NIMA 5C4MA 3WAJA 4XA8A 5HZKA 5BOSB 1EFCA 3DFZA 2CEKA 1JBEA 1LJLA 1F8FA 2ZS9A 2ZITA 3GUUA 4ZAYA 4AICA 4HF7A 2VTDA 5JJLA 1I80A 2A0FA 3MBOA 3Q7QA 5AKJA 4RKEA 2YS8A 1DC6A 1T1EA 2DUNA 2F00A 4F3YA 2J6IA 2YY7A 4YV0A 3OIVA 3UAVA 3DLPX 5EOVA 4C04A 3OZFA 3DTVB 1AKYA 3JQAA 2RJOA 1WR8A 3PHIA 3UY4A 2C20A 2BKLA 4TX1A 1U80A 5B1DA 2ZBDA 1E1YA 4QE9A 3NFYA 4CMEC 1N8NA 1J8YF 2ZR2A 4E3WA 3DCIA 4CW7A 3LY9A 1VXRA 2SECE 4TMZA 4OV6B 5C3UA 3MPZA 2XTZA 1HL3A 5FA8A 4UEKA 2B34A 1LBEA 1B3BA 3H2JA 3URKA 5AFSA 3UICA 3N5CA 5HUQA 6ADHA 3K96A 1DX6A 4UHDA 2EZPA 2WQZA 4RFVA 4BAGA 3B1WA 2GI4A 1RTTA 4P2BA 1LR1A 5EWJB 3M5PA 1XUQA 1OIVA 1B8OA 2O0HA 1TJ4A 2VJAA 4FLZA 1KYYA 1M1YE 2ACEA 1VKZA 4YP1A 1YJXA 3WLEA 1E1LA 4U2KA 2DE0X 2QTZA 4K81B 3ZHSA 4BQQA 5BQXA 10MHA 3LUBA 5JALA 4GGPA 4NU8X 3L7LA 1H2HA 4H0NA 4RAOA 1WOYA 2GBCA 1CIJA 3VM6A 4TLAA 1OVMA 3CRCA 1YOVB 4TLCA 3OM1A 2JLYA 4ND7A 5DTJA 1DIAA 1VJ0A 2B5VA 4X92A 2QUAA 5K6AA 3VNUA 2GCNA 2YYSA 4YCMA 2QTVA 5AJUA 5CIQA 4W7IA 1B0AA 5AJWA 4FVTA 4NP6A 4TXMA 3FPKA 2II6A 4OK6A 1GRQA 1PGOA 2QLCA 2B2XA 2DYRB 5BY2A 5JSUA 4MPTA 4BNYA 3NRBA 1GG5A 4I8XA 2OV8A 2MDTA 3WYAA 4RAIA 3D3WB 3COWA 1NN1A 4LD4A 2W2KA 3Q2KA 3DMDA 4I6GA 2WIFA 2IYNA 2DMXA 1KECA 4XYBA 4JAUA 1N0JA 4C0SA 4CL0A 3VAYA 5IYZA 4LPSA 1Y48E 1XRNA 5CJPA 4QQKA 4ITUA 3I4FA 1E9DA 2FUG1 2X19A 1N0WA 1JG2A 2GCOB 3ETHA 4KXMA 1V7ZA 1UAYA 1NHWA 4RIGA 3B6KA 4N0QA 2XTMA 4P80A 3B09A 3AVPA 4CTOA 1YB1A 4GQAA 4MI6A 3ZJ4A 5I47A 1ICIA 1H9CA 3LWNA 4BIMA 4R1PA 5H9CA 3PJSK 4GD3Q 4PIMA 3HWWA 3TJRA 2ZI9A 4I3HA 3NTUA 3QKWA 3FOEC 2CVQA 2QTTA 3SY8A 3ROGA 2ST1A 5DYGA 4MWDA 5BWBA 5ENVA 1O95C 3VC3A 4MXDA 2PWBA 3PF9A 1MZFA 3F9CA 1JR9A 2OCAA 2PT7A 5IF9A 1YDWA 3N3BC 5IKXA 3ZWNA 1Q0ZA 2MMGA 1FVFA 4A92A 4DBLC 4Q16A 1KZ1A 3V4VB 4JB8A 4LP8A 4G5SA 5CFQA 3PD0A 4FJCC 5J4KA 1F2TA 5ILGA 2H5IA 5LMUB 3E23A 1QRUA 4D9NA 5K4GA 2FSVC 3ZE6A 1RRGA 2F8SA 3KELA 5LMCA 4YPOA 1G9SA 1V5GA 2ZVDA 2C98A 1UXKA 4I55B 1KDVA 1CZOA 1E9BA 2Q9BA 2XMZA 2IUFA 4MGZR 4P5EA 2FK8A 5LQMA 1OFVA 1EE9A 3QXGA 5JR3A 1GZHB 1J9ZA 4N6GA 2BSKA 2X2PA 5CJJA 3JAKB 4RKYA 3QOXA 1FS4A 3K32A 2QP3A 4Y8VA 5C5EA 4EHHA 2BR4A 2Q50A 1IPHA 1Y81A 1NT2A 2VHWA 3U40A 3CURA 1KQ3A 4EB6A 1L5VA 5IT9N 4WK2B 4C76A 4Q34A 1OSNA 3COYA 3B1FA 5L3RA 5DWVA 3JXEA 4QNRA 4G6ZA 1KIFA 2EX3A 2QMUA 3IA7A 2OM2A 4DRYA 2O3QA 1U63A 2ZYTX 1C9YA 4ROTA 5EZYB 4B74A 4PWZA 1KR2A 1GRVA 1OTYA 2OA0A 5K0CA 3EN0A 1KHTA 1GQOA 1ULHA 2V1UA 5LQDA 3DBIA 4LBYA 3OMAB 3CEHA 1QX4A 2PNJA 2YHBA 2J33A 2GFHA 4K6MA 3O47A 3C8ZA 4CR8A 2Q5QA 2QDOA 1U3GA 1E1CA 2LQTA 3AZOA 2Q0OC 5JE8A 4ZEMA 4BWGA 3PNLA 2ZSAA 3GFFA 4QREA 4KN8A 3RVRA 4ND4A 3SNHA 3RRNA 1H6AA 4A7PA 5IKEA 1TRHA 1G7RA 4LE2A 4LWOA 4UNPA 4L87A 2EEPA 3IOMA 1EDEA 2BGLA 4GZLA 1L4MA 2H2AA 5AK5A 3AF3A 2B8EA 1C7EA 3RC9A 2X41A 4HGPA 1Q3EA 4WBSA 1FLAA 4RPKA 1MMMA 3FCAA 3ZI4A 3X1JA 1VLLA 3GH1A 4Y1GA 2PS3A 4YYZA 4MR7A 2HM7A 3EC7A 1DSSG 3LYHA 2C4MA 1JE0A 1UODA 3EQ6A 3UKJA 2YDEA 4A6PA 1SOWA 2A9VA 2DQYA 4R83A 2QHXA 3PT5A 2WLKA 1US8B 5FI5A 4O8XB 4CG1A 1YR9A 2C7BA 2XRYA 1QDLB 2VNIA 1VF6C 3FW1A 4NOLA 5BRJA 4YMSA 4YRCA 1JGTA 1JMYA 3NONA 4RQEA 5BR7A 1Z83A 4Z8XA 1UKEA 1B0ZA 1JKIA 1U3CA 3R5KA 2Q4OA 4HK4A 3UHFA 2NUAB 4RH0A 4V24A 1WMFA 3DYIA 4BNWA 4FFRA 4QTUB 1STOA 2JJ2D 2BL4A 3H5RA 1ML4A 1JYEA 2PTHA 2I78A 1LV7A 3V48A 4XD2A 3ZVNA 1Y8RA 2WM8A 2ZE6A 1XZNA 1GA4A 4YJGA 2P6MA 1XCBA 2JCBA 5C80A 2ZBQA 1Z5PA 2FWAA 2LR0A 2R9VA 4DZTA 3VSBA 5DHFA 5J4HA 3BDIA 3NBUA 5GGYA 5H3CA 1PNQA 2W11A 3C39A 4OXYA 4MVOA 2HU7A 5HZHA 3P5BA 1RPZA 5JI2E 1XF9A 1XILA 1SJ9A 4P53A 5AXBA 3EGIA 5CFMA 3KSBC 2I1WA 4U2EA 4A8PA 2C00A 4WW0A 4BO3A 2XEDA 4FEAA 1W19A 3GDWA 1YIOA 5K0GA 3LUTB 1N7IA 4ENQA 4JLBA 2MWMA 3CWCA 4PLGA 3SPCA 3CWZA 4MR8B 5JIBA 4LNUB 4JFRA 3GCZA 3CTPA 5FOVA 4G8BA 1X9GA 4WXYB 3N28A 4BFZA 3ER8A 1H66A 3KKOA 4MGEA 5BR4A 4WY5A 3V55A 2RBGA 2JJ8A 2I99A 3Q4GA 2XGGA 4KHZA 5ELLA 1JTEA 1II9A 4N65A 4OYLA 2VWHA 4B6FA 2FMUA 1AK9A 1B6SA 5CDFA 2VUHB 3KLPX 1U6IA 2LZ0A 4P4GA 5ERYA 1SCJA 3GN2A 3VISA 4YXWG 2Q49A 2C8JA 1QVZA 2EXXA 3FCCA 1KK0A 4OJMX 2CLKB 2COUA 3T2MA 1KRXA 4MYCA 1LLCA 5GONB 4G4JA 5THXA 3ZN1A 1RFGE 3ZGOA 2HRBA 4BUJA 4F93B 1JQDA 4HWRA 5JD3A 1FXKC 2Y1DA 4TLBA 1U2GC 1OXVA 4V0NA 2JGFA 4YJKA 3GCXA 2DP4E 1CS0B 2QUHA 1TTQB 1QU7A 3ABRB 2P68A 1LI7A 2QX9A 1OKKA 4CEHA 3FR7A 1OIWA 3QPWA 2DLNA 2XKAA 2G1KA 3M6FA 4WZBE 1Z73A 1PQYA 4A27A 3RTAA 3R76A 4HB2A 1XO1A 5TMEA 4LH6A 1SU4A 3N75A 2GQ0A 4US1R 4L6AA 2SCUB 1NOKA 4B3TB 1D4ZA 3NYQA 4MOWA 1VB3A 3CZQA 5A9SB 2PKYX 4ZGBA 2DHCA 3R20A 3N6VA 5EE0A 4OHCA 3M49A 3UK2A 1MAWA 4QPJA 5B1HA 3NPAA 3IKLA 4JAVA 1JVNA 2HCFA 2IPOA 1PX2A 3N0VA 4CE6A 4LEIA 4K8XA 4LYYA 2YJ3A 3STYA 2B1GA 2PQ2A 1HRKA 4AKTA 1X15A 3WLFA 4R7TA 1KC8W 4INPA 1K7CA 5EC1C 1YR6A 2IWRA 3PQ4A 2QWQB 4XJSA 1VYHA 1WDTA 1XQ9A 4Q4HB 1YKFA 3ZE2B 3LNTA 5A4FS 1DO8A 3E5MA 3TSYA 1NQXA 2LV8A 1KK3A 2WWGA 2V7QG 1C0LA 3W6NA 1J07A 2BI4A 1QKKA 3FNIA 3R8CA 5C51B 3QPDA 1W581 4M7OA 3KR9A 1KIMA 1U2RA 4C06A 1GTG1 2J0QA 5U4QA 1NULA 3HJRA 1JFTA 3P2JA 5EBLC 5JY1A 4G5RA 5LMUO 4OIMA 4AX4A 2V98A 1U31A 1ZD1A 5L3CA 5C1DA 5BV2P 3LY8A 4HGNA 2AJDA 2VXOA 3E1SA 5IJZA 1AZSC 4G07A 4LDPA 4BMDA 5GJCA 5IYCO 3GJQA 2H2WA 1ZEJA 1UAGA 1GKLA 3BIOA 2VH1A 2IYVA 3BXZA 3S2GA 1LRKA 3G9QA 2PKCA 3B2QA 5HNKA 1QGUB 1QHFA 4NPCA 3G49A 1GN8A 4CGYA 3UMCA 2XNKA 1CUGA 2FA9A 2IHZA 3KS9A 1TGOA 5TRTA 2CMKA 4E94A 4LE1A 2W22A 3V32A 2CXUA 2ZREA 3G8QA 3OZAA 3BYZA 3ZNNA 4ISBA 3QLVA 4US2R 2PZAA 2ZIEA 5KNDA 5A9GA 5T4EA 3ND8A 3WRVA 3AVXA 5C35A 2ZZNA 3P9RA 1CQIB 1M34B 5JVDA 4Y9RA 4UOEA 4JOQA 3BHMA 3WLIA 1AQNA 5BVGA 2VWPA 2G4CA 4KDEA 2I2XB 2W00A 4HPWA 3GC6A 1XOUA 4OU5A 2PYDA 4YK7A 1D5AA 2BGKA 2HO4A 4TLDA 2GV9A 3DE4X 3TBHA 3C6KA 2C03A 4NXNB 3KFXA 1RYBA 4UQOA 2OV6A 4RLSA 2Z5VA 3GLQA 3LUCA 3FAVB 3SMVA 3CA8A 2OWDA 5JNLA 4M49A 4BMXA 2JA1A 4IDEA 1SUFA 1NU6A 1X8JA 2OCKA 2J31A 4UEWA 1HE5A 1KQNA 3GAAA 4PQTA 3AR6A 2BKEA 1KETA 3X2SA 4ZC8A 2X5JO 3OX3A 2CXOA 2HMWA 3R3ZA 4XCVA 1EFPA 4OMCA 4R8MA 1P77A 2HIMA 2DM6A 2HIAA 4KWCA 1ISSA 2P67A 2YZNA 1BDMA 3F6SA 5CVJA 1ZYUA 5IASA 1XNJA 2GEBA 2CUGA 5KQLA 3WI7A 3HCAA 1C3JA 1PGQA 4L9WA 3LW8A 4KQMA 2HQRA 2KLBA 2IPAB 1E2QA 4CKEA 4TTSA 4K9PA 3PXBA 3G1UA 4GI2A 4ZDJA 1JQJC 4YIHA 1JQ3A 1Q5OA 4IQFA 2PN1A 2WYUA 4JLJA 3QO7A 4EHBA 4Y9UA 3W8DA 2OG4A 3ZHBA 2NZ8A 1V5FA 1OWNA 3DOJA 2JFHA 2WWFA 5IBQA 5GIPE 4R98A 1W36C 1M2VA 2WUGA 1M5UA 5AI8A 4R0NA 3V7NA 3DGEC 3AFNA 3QXHA 5J3JA 4IGEA 1QJ4A 1AOXA 4WZZA 2N3ZA 4BNVA 5BQ5A 2B8JA 4S05A 3SAJA 2WSLA 4J1QA 3KWJA 3F0TA 2EX4A 4YXFA 5SZJA 4YRQA 3BB1A 5L4LA 3FYCA 3ICOA 2C4HA 1T9KA 1U8FO 1BIFA 2ZIXB 4ZO6A 1KY5A 3FMFA 1IVNA 3WIDA 1PVOA 3RYCB 3K20A 3ZXXA 5D3KA 1R9JA 4A91A 3U9SA 4X1KB 1B1CA 1SVNA 3PQ7A 4EZIA 1NOIA 3DE3X 4W7HA 3MJ4A 3AO0B 4CMHA 2NX8A 3KM0A 4RMJA 5ISMA 4RH1A 1MRSA 3OURA 5K8LA 1XCJA 1REQA 1E7QA 1NRJB 1EFKA 5DCYA 5B3SB 2BCEA 1TYCA 2H8PC 4LGVA 1FFXA 1H4TA 4HQ0A 3IO3A 2XNDG 1XXHA 4UARA 3AEXA 5L45A 4HMOA 3DOEA 5CNMA 1KJNA 4CZZA 5H4GA 4J9ZB 4LD2A 1QH8A 2QK4A 2VYCA 2GYUA 5F2KA 4DYHA 4EABA 2G8NA 4RHYA 1KP9A 2CFCA 4ARIA 1L7EA 3AEUB 4RJIA 5AHKA 3PE4A 1VIMA 4D9FA 3O3CA 3QUAA 5JJBA 5I4IA 4FBGA 3NIWA 3K9AA 1SCUB 2RE8A 4HTAA 3OJ6A 4AO7A 1W0CA 3D8RA 3D0OA 4DSZA 3TRFA 5C5CA 2PMFA 2QXTA 3HDTA 5JS8A 1W9HA 4R6WA 4N9QA 1ADFA 2L0XA 2CW5A 4A16A 4KR6A 1P8AA 3DWEX 3CXRA 2V7UA 3NHUA 1V8DA 2CH7A 5KYWB 4NTYA 3KZXA 1Q1AA 4IHJF 2CZQA 4GLOA 1A9TA 2BEWA 4LVUA 1FDTA 2AOWA 2VKTA 1N5RA 3ABUA 2PZSA 5FOSA 2YW9A 5BUCA 5IY5C 2GKOA 1F8XA 3RUCA 1G2PA 3STVA 3KAKA 3D7MA 7REQB 3ZY2A 5L3FA 4B3TO 4FNGA 1EUYA 2EZOA 3TW8A 3JTEA 3L8HA 1TZBA 3GT0A 4LC5A 3AF5A 3V33A 3KJIA 1X38A 4CEIB 3WLJA 1SXJE 3KQTA 2CDAA 3WB1A 5F4BA 1OGIA 4WKBA 2XUGA 2WSBA 5G0VA 3NBKA 3FPAA 1WHTB 4ARUA 3UB3A 2HU2A 3E4DA 1KDYA 2Z3JA 2AZ0A 1VRCA 1N6NA 3RFXA 3CZCA 3OZTA 4NBVA 3EODA 3GFSA 5A6VA 5KUMA 2WLIA 2VR1A 3BQNB 5A7GA 1XP8A 4A8JC 1U0OC 2UDPA 5HQ3B 4R6XA 4D0NA 4BE9A 3PDUA 1TOAA 1UPAA 4KXUA 5HIAA 2FW7A 3ZC3A 1W0KD 2WAXA 4BZXA 4LTDA 3LC1O 3MELA 1FUYB 2YY6A 4R5HA 3SU8A 3D4NA 2VTEA 3FRHA 2Z08A 4JHLA 4FHCA 4WWHA 4X97A 1TUGA 5DN6D 5K3EA 3ZCSA 1R73A 2NLOA 3SVTA 2OUIA 4BFUA 4LV8B 2E55A 4LJSA 1GGHA 1VECA 1R0CA 1SXJC 4XLLA 5AM5A 4IIEA 2IIVA 2AXTZ 2ZJ6A 3EEFA 4CIWA 1O89A 4INAA 3FYUB 2EGHA 3GAFA 2UXXA 1E0JA 3H8SA 3H13A 4RK7A 3ZDQA 1PR0A 1YNOA 3L8FA 4X8MA 2MSLA 3DHWC 3IQXA 3QYPA 4MINA 4NZ9A 1RC1A 4IDAA 3F9RA 1CRWG 1EGVB 5AJXA 1PL0A 4HRYA 4PS1A 1YRLA 4IGGA 4Z7OB 3J7AC 2YV4A 1BMFA 1ZUNB 4KSCA 4DYLA 3O3OB 4F72A 5EMNA 2C2YA 4FMTA 3H5TA 4NATA 1U0RA 2IE8A 1CKEA 1O96B 4PZUA 3EA0A 5FOTA 3JWIA 4P3KA 3OR7C 3UMYA 4KO1S 4BRZA 1JG4A 3UB2A 2FPGA 4EFNA 1WCIB 3N0WA 3UANA 2ZJZA 1Y3FE 4ZYWA 3H87A 2ODMA 3PPYA 3BMOA 4C08A 4JXKA 2I1QA 2CF6A 3G2MA 5KC9A 5EJEA 3R4VA 1V37A 4OXIA 5DEOA 1H05A 1JTKA 1MPXA 1E2EA 4BOYA 3CF2A 4O8YA 4D8UA 1XMQB 1Q15A 4XIFA 4B4KA 4NXNO 4FHFA 3AOEA 4Y6LA 1F9AA 4A9AA 1F4MA 2VDLB 3MM4A 5BOSA 1VI5A 3WK5A 3GLVA 3ANXA 1IWOA 2JDIG 4HB0A 3K5PA 4GG1A 3MJDA 4F2PA 3JRXA 3KCYA 1QO0A 1R8SA 1I08A 1FW8A 2LDXA 3IP1A 2A5LA 2AZ2A 2PFSA 2PXHA 4O63O 1FMFA 1LFDB 4I4IA 3SX2A 3O0DA 3ZV3A 3ND7A 3KSMA 4TTJA 4QFCA 1N6OA 2MR6A 4ZU1X 2PE5A 3F71A 1GZUA 2W7TA 4ALKA 2GN9A 5T5QA 4MGYR 1APBA 2CSUA 2AJ8A 3SI7A 3AX6A 3C87A 3DMTA 5F2VO 1B6GA 3R3HA 3PDIB 1CSEE 3OZBA 4KSYA 1P31A 1M93A 1U98A 3CG4A 3HR0A 3CKLA 3ZZUA 1T5LA 5K0BA 1IN4A 4NU0A 3LYLA 5THKA 1GZ6A 1HV8A 4AQ7A 1WSDA 5EGNA 4DJDC 4JLUA 2WLLA 1CE8A 5K1XA 1RYFA 4HH4A 2Z98A 5DCUA 2AHOA 3DMPA 4JYMA 3Q12A 3PVZA 4MAAA 5FWNA 2QGNA 1OYYA 4B3CA 721PA 3CCVV 1SH7A 2B36A 2LW1A 3K5IA 2PANA 4LYGA 4NDNE 1NF8A 5K2OA 4G5XA 5FOWA 1A9YA 3AJEA 4DKXA 3P20A 5IZCA 1T2AA 4EYKA 3K08A 1BEZA 2EAUA 1W4ZA 2IDZA 2HMSA 1YDGA 3DFIA 2VZEA 1QPZA 2VL7A 4PLCA 2NTNA 2G8LA 1E9EA 4KB5A 2IYXA 3I6ZA 2GBLA 5M5BA 4NHEA 1NAIA 1ST2A 4QBFA 3R3SA 2XWQA 2GHQA 1TA9A 2PUVA 4O08A 2J9YB 3SIWA 1TB4A 1XMIA 3DE5X 3NIGB 1GPDG 5EUBA 3MCTA 1P80A 1QVRA 4RHXA 2QE7G 4JVLA 1TMYA 2X4GA 1IM8A 1KYZA 4AK9A 2EFDB 1TVCA 3V46A 1K4MA 2V4DA 2HRRA 4H1UA 5LQUA 4UBIA 2G3YA 1GEGA 1WD7A 2WJZB 1C30B 4B09A 2IYFA 4B3JA 3GFOA 2BF7A 4I5EA 3ROFA 1RKXA 1UC5B 1GTOA 1O87A 1MNQA 1BKYA 1KEKA 2XLCA 1OASA 2ITCC 3NR7A 4RUEA 2BH2A 1TO2E 2O14A 5DSTA 3W6PA 2JLWA 5YASA 1CBUA 3THRA 4IS3A 3AHEA 4ZQHA 1MEEA 4MVMA 1F14A 4IXTA 1TX4B 1XLTA 3R75A 4AM8A 2VLBA 2X77A 2C54A 4HDKB 4NLLA 1QHHA 1AHNA 1UKYA 5EIBC 4Y2XA 4Q24A 4E51A 2Q6VA 2OTJV 3TI9A 2Z3ZA 3T1OA 2PX0A 4MW2A 1E5TA 3WIOA 1CUYA 4R2MA 3A9UA 4D9IA 2YW2A 3I6IA 3SJCC 4KG7A 4Y1FA 2CNWD 3FNBA 5HTOA 4ZVVA 1RM5A 4EJSC 4ENRA 3ND6A 2AHYA 5ALPA 3HYSA 4Z1MD 3OX2A 1ZS9A 1M72A 3M1LA 4YMGA 5FUBA 1YDXA 1IZ7A 3CF4A 5K03A 1BGXT 2NVBA 3MQ2A 1NLZA 2O06A 1LK5A 4N0DA 2ZR9A 3IULA 2OY0A 3AR5A 5G41A 3FLAA 3UK0A 1NUAA 1Q6HA 2I9KA 4X9QA 2P9FA 4Z9BA 1VJ1A 1RWNA 4AJ4A 2VBCA 3K9GA 3IIIA 1VHLA 2IKSA 3HCPA 2OK7A 4IV5A 4N7MA 4MV8A 4NZOA 2AUMA 4DUGA 3CUTA 5DHTA 3PCTA 2D1TA 2XUZA 3QFSA 5JNVA 1QFZA 3H3JA 1ODKA 1E6EA 1JIVA 2WFZA 1JDBC 1RJ9B 2ONZA 4KQJA 1W35A 3IHKA 2VRCD 4MUHA 2C58A 3C5EA 2X42A 4FFSA 1KBHA 4GMGA 1TGYA 4BTLA 4MZXA 3W5BA 2PZJA 1P0QA 1QJCA 3G2JA 1CR0A 4EUEA 1J0AA 5LXTA 5CM9C 3MWEA 2PO5A 1R5BA 4R8LA 5JSYA 5AW8A 4AWBA 2B3TA 4TXHA 3FCEA 2F3QA 1P2SA 4B43A 1FFEA 1GGNA 1NI3A 4XASA 2JRIA 1W49A 4RUKA 2Q1XA 1U0NA 2J85A 3DT8A 4J2OA 1Y6RA 2HEPA 4EO4A 5FTKA 4ZI2A 1GCGA 4AP9A 3B12A 1LK7A 5EZYA 3DKIA 2J6CA 3MAAC 1DAHA 4KO4S 3K70B 3GO4A 1RZRD 5HJ5A 2JFQA 1NXOA 4QE7A 3C14C 5KQGA 4B0OA 1W2WB 3SHOA 2O8NA 4HAMA 1LX6A 2QL6A 1BGVA 3TSOA 2UZ0A 3ABLB 1L8DA 5FPSA 3TGUH 1C3XA 1QZXA 1XZ8A 3TIIA 4EKDA 5JH7A 3K0HA 5ED0A 1TRKA 5C8ZA 1HQCA 1FXSA 4NOKA 1GQFA 3B9QA 4ZIBA 2VT6A 2WPDG 1RJGA 3CR3C 3GMSA 5T67A 2F55A 2HREA 1DOZA 2B8TA 1LWOA 4IX1A 5GIOE 4G5QA 2BCCH 2V6BA 3DCJA 2ADPA 5E95A 3R24A 4LA4A 5DYWA 3JQ7B 3OOWA 4X8AA 4IQ0A 3HJAA 1PW7A 3QBDA 3GT3A 2H7CA 1JHYA 1CEXA 1ZESA 5LA6A 4OQ4A 3MPUA 3O1HB 1T36B 5CUQA 5TGTA 2WLJA 3ZXUB 3CNEA 1R3DA 4O1IA 4JBXA 3G2OA 3OF2A 4YP5A 3RRYA 4JP8A 3DEFA 1US8A 3FBWA 4JAAA 3WYDA 1XMQO 4GU5A 4O8XA 4G9BA 4ZFNA 3S1LA 2AUNA 2YZKA 2QV0A 4EI7A 3Q8WA 2NSLA 4MKRA 4MHSA 3QVWA 1OIXA 3JQGB 3N3AC 5LIRA 1O9BA 2AV6A 2GNPA 2Q28A 2HWUA 1T6ZA 2DHQA 3OD4A 2CYBA 1JJFA 2C7VA 3PQDA 2I4LA 1PJQA 3DGFC 5C8YA 3ZGVA 3B1YA 2B7LA