2B1GA

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
590
structure length
590
Chain Sequence
b'RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
molecule tags Transferase, hydrolase
source organism Gallus gallus
publication title Structure-based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase.
pubmed doi rcsb
total genus 208
structure length 590
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2b1gA04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2b1gA01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1gA02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1gA03
1P4RA 1IK4A 2B1GA 1S89A 1C3OA 1CE8A 1M6VA 1S8AA 3ZZMA 5H3LA 1A9XA 4EHIA 2YVQA 1JDBB 1G8MA 1PL0A 2X8WA 1CS0A 1M9NA 1OZ0A 1THZA 2B1IA 1VMDA 1T36A 1C30A 1EGHA 2IU3A 1BXRA 1ZCZA 1PKXA 4A1OA 1WO8A 2IU0A 2XW6A 1KEEA 1B93A
chains in the Genus database with same CATH superfamily
1P31A 2GPWA 1OXXK 2P78A 3ANLA 5K0TA 1FQWA 1JFVA 1JA9A 4YA6A 2YJGA 4MQEA 1PT9A 1OXUA 4K6MA 2PK3A 4YCBA 1YB5A 2PI4A 3IQEA 4M1YA 2AJBA 4MJ3A 4NLLA 4OKNA 4URVR 1FW6A 1FNBA 4R1PA 1YMVA 1DFIA 5T4BA 1UWCA 1H6CA 1DJLA 2HJGA 1KMIY 2X3UA 3W5HA 3CCQV 1ZSYA 2D3OW 1IATA 5B1BB 2AE2A 1Y74B 1FXWA 2Q5LA 5FHQA 2Y1KA 4P2ZA 4GZMA 5DX0A 5HE9A 3NGXA 4Q1CA 4K35A 3S2EA 2I6QA 1IBMO 1FZQA 3W7VA 1XYYA 2XD9A 4H9GA 4MVJI 2A84A 4YP0A 4FW9A 3IUNA 3G2NA 2G83A 2BGMA 4YIPA 1N25A 2IH3C 2ZDIC 1T2DA 3GPBA 4QOJA 4URFA 1CKEA 4DKXA 1SBZA 3W6ZA 4EUKA 1JKJB 3GLVA 4NCNA 3B20A 1D0IA 1NP7A 3MHPA 3IP9A 2O8FB 5DT2A 1NXXA 1W35A 2WWRA 3DYVA 4GL4A 4QDUA 4QUJA 3E3NA 1QTQA 1Q6HA 1DJPA 2IYPA 1KA9H 2ZATA 3ZE1B 1IU9A 4EDHA 1P2UA 2QV7A 5KHGA 2O0HA 4JUBA 1Z7BA 1A3CA 4MS4A 2IBTA 1ID8A 1R74A 4B7ZA 1M9NA 3CRZA 2FGJA 1EZZA 2EG9A 1QG6A 3B70A 2BMEA 4CKEB 3DZIA 4JJAA 5DYWA 4ZCTA 1W1IA 4LFAB 4Y9RA 2F8SA 4MKIA 2FMHA 2ZXWB 2IU6A 1S2NA 1QDUA 2QZ4A 3AFNA 1QWSA 3AI1A 4DLZA 2AZXA 3PPVA 3PQ3A 1T9AA 2DX7A 5EKDA 4L73A 2V58A 4YYZA 1H1TA 2M7WA 3NTOA 1BCRB 1IEWA 2BFMA 2VATA 2XRFA 5SYNA 3TMYA 4DLXA 2W4MA 4FLZA 1CG6A 3ZV6A 1GMGA 1EQ2A 4CM9A 3MUEA 3Q5DA 4NSNA 2CAZC 1P1RA 2GUGA 4LCEA 5BVHA 2F8TA 4RYDA 3CXHF 1J8VA 4GCZA 1A4IA 1JHMA 4PLCA 2RI0A 4MWSA 4KI7A 4PYQA 1F17A 1NVKA 1NE2A 2XNSA 2EKLA 3P1JA 4FC7A 4X3PA 2QL9A 4ZOEA 4EUSA 2GRAA 2C5SA 5I45A 3TFQA 1A9RA 2WLNA 4FMDF 1LBSA 4NXNB 2Z3YA 1HFKA 4BO6A 3IHKA 5JD3A 1OASA 3V9PA 1NQTA 3QX8A 4M60A 2QEXV 3ZWBA 2X3YA 3IAM1 4FEEA 4EGCB 3BH0A 4PHHA 4AROA 5EKXA 2PW9A 2AV6A 1W4CA 2ZTMA 4U2FA 5TT1A 4YT4A 5IKPA 5AXAA 3EVTA 3MWFA 3EF3A 4W6ZA 5A4MS 1IB0A 2DECA 1EXWA 3S7ZA 4UUNA 3SF0A 3IUBA 3GAFA 1ZGAA 4BY9E 2YIMA 1S77D 1A4XA 1W8IA 3WTBA 1IOVA 3TX2A 2ZXFA 5FNVF 2BL4A 3NXSA 4OXNA 2Y1EA 2H92A 3RKRA 1KOJA 3U7FB 3RVQA 1I7NA 4NKGB 5C18A 2QAGB 3H1FA 5AVKA 4AJIA 4TKVB 4PRLA 2WR8A 3T9EA 3T1NA 4Q7QA 4O29A 1RXSA 2N1BA 3VOBA 9LDBA 5LL6Y 1ZUQA 1EDEA 2IPXA 2F17A 2G1KA 4RY2A 4C05A 3CUYA 2OBMA 4Z9AA 3PDUA 1QCCA 3G13A 3UCEA 4DTCA 4AKHA 5T6MA 2O2DA 4YQZA 1RRPA 3ZWMA 2C4VA 1KBOA 2ZRBA 4FDUA 1OB5A 3F8SA 4YJ2F 1FUUA 3NHSA 4ZVVA 5BY2A 4P9OA 3K5HA 3MGBA 3LKDA 4RKQA 4OXXA 4AUMA 5B1NA 3JQFA 2C3UA 2QSUA 1FSPA 3P7MA 3HSSA 2E6KA 5BOSB 3CP1A 4UHBA 1U3CA 3IDSA 4JVNA 5H3HA 3E4DA 4WINA 2Y1LA 4IHJA 2G80A 2QVCA 1BMFG 2Q6OA 4GFDA 3FFXA 3ZW9A 5JAZA 3AUKA 2QN8A 2Y99A 4Q19A 3AHFA 4Q47A 1J5EB 3ZD7A 1FLNA 1KYIA 2QE7D 2ZB3A 3BIOA 3G02A 4BFUA 1G7RA 4EJ0A 1P9OA 2A67A 2SCUA 5CXXA 1IN8A 2K6GA 4D0LB 3PX2A 1ONNA 4ZHSA 3FAVB 1M0WA 4HWOA 5TT0A 1FTQA 2P4SA 1U3TA 1UK7A 2GR9A 3HRHA 3KHKA 4HWSA 1FYFA 1GP2A 3VGPA 2DULA 3RYHA 1QUFA 1RKUA 5HMLA 1R3IC 1YDMA 3L5OA 4FX5A 4O2LA 4MX8A 4A4DA 2GM4A 3HCEA 2C2AA 1XD8A 3RV3A 1NULA 3J7AU 5AM0A 1NVXQ 4XQEA 4JT9A 3CWBH 1NNUA 3INRA 4Z53A 3X43A 2G84A 4K9SA 3TBHA 1UAAA 3RASA 4P54A 4NCKA 1VFPA 2ZBUA 5KHAA 1NHGA 3FGZA 3TPFA 5AJUA 4DBLC 5L6MB 1QAQA 4LECA 5A5DA 4WCFA 1EBUA 1GZ7A 4C4XA 4GC9A 1QPZA 3WB1A 1TEHA 1PG0A 4FWIB 3LPCA 4PO1A 3BXGA 2IHZA 3VOUA 2XY4A 3Q1KA 4FFDA 4FUTA 5A3VA 3IOBA 3SPGA 1B73A 1IC6A 1YB4A 2FE1A 2Q4EA 1Q50A 1H2RS 2QSJA 3LQ1A 3PX3A 2FPGB 1C81A 3RAGA 1AF2A 3EFHA 4IDCA 4EF6A 3VR3A 1NQXA 2MHCA 4EK9A 2ZCJA 3Q4HB 2YN2A 4A6XA 2VJNA 5FTNA 3WFJA 5JAMA 4U7NA 1Z7GA 3VC7A 4RLQA 2J3EA 3F3YA 1W46A 5HPYB 1W0JA 5D2CA 4B3TB 1V6SA 4RX1A 4HNRA 4O2BB 2RBGA 3QUQA 2DTEA 2JCYA 5HR5A 4OFZA 4FNMA 2P6NA 2AKEA 4N7JA 3IBCA 4IL5A 5FEUA 1SU7A 4CEJB 4CS3A 3A4LA 1RHRA 3F74A 1H42A 3W7UA 4C7MA 4NH0A 2G8NA 2TRSB 2ZWOA 4GNRA 4M0KA 1NY6A 4XPZA 3IPCA 2JFWA 2VJKA 3QFHA 1D4ZA 3FR8A 2UUBB 5IKMA 4U7OA 1XNRO 1NJIW 2JFUA 2X4GA 1DQSA 1MBZA 3PWSA 4HK4A 1O58A 3IP5A 4M89A 2C8LA 3LUCA 3AH8A 2PH3A 1K6EA 4DIBA 2AQ8A 5K6AA 3ORHA 2DOSA 1DADA 1KFEB 1W96A 3FOAA 5DO9A 3VV2A 4F9GA 3A28A 1E7YA 1T8RA 2GJ9A 4M0DA 4MYRA 1QHFA 5IYDO 1ZQ9A 2V54A 2X76A 3OZCA 2I76A 3SVZA 3UANA 4A82A 2ZAMA 1ZCBA 4RSGA 3CVJA 2QI9C 4TQFA 4P4LA 4Q05A 3RB8A 3RHSA 1Y67A 1O6BA 5AK6A 3FGPA 1HDEA 1JN0A 2BFWA 5B6JA 5JD6A 1YCFA 3H1EA 1T5DX 3LDGA 5JASA 3Q11A 1VHQA 3A4VA 1SOVA 4FR0A 2Q5CA 3SAJA 5GP1A 4XWGA 5ILGA 2JIRA 4H1WA 3RS5A 2AHOA 4YX9A 3A1NA 2V7TA 3CC7V 3KQMA 3PQCA 4YUZA 1KMQA 5CBKA 2P7HA 3TLXA 2FKXA 2LW1A 4L27A 1OMOA 4JVSB 3E5NA 4MQFA 5DSTA 3DBOB 3V9AA 3HB0A 5BN1A 4X7MA 1K7YA 4NTXA 2PH7A 3KCQA 5AKZA 2A0KA 2IOHA 3ZDQA 1KI6A 3LDHA 3MLAA 4WK2B 4O4HA 1XLVA 2B4RO 3MTAA 2QZZA 3NH6A 5EMMA 5ED0A 4AKIA 4WERA 1V48A 4EATA 1VQMV 1FYDA 2WPDD 1Z7WA 4PC1A 1C7IA 3D7RA 3R9IA 3LAWA 2J9FA 1OI2A 3TSWA 1R1DA 2NTVA 2RH8A 1AROP 3HWWA 4DW8A 4RE6A 1CRLA 2RCVA 1Z5GA 2GBOA 4ZDWA 1CQPA 2IKQA 3JQEA 2F23A 1C2YA 4R9UC 3ZHVA 2XXBA 3L0YA 8ABPA 3NUGA 1BHBA 2A9JA 4YP6A 3U1VA 4F4JA 4YRZA 3MS4A 6ADHA 3DWGA 3EC1A 1R3KC 3QO7A 2FF5A 3FVRA 4OM8A 5LB4A 8GPBA 4YDQA 3EVBA 3F6SA 1H4SA 4IT5A 4X64O 5JBIA 2P0EA 1OBVA 2ADPA 2FF7A 3B12A 2WLMA 1NLFA 3RJ5A 3UB2A 2GUZB 4B4DA 4RULA 3CVVA 4LJ9A 4M38A 3MBOA 2HRBA 4ZI2A 7ABPA 1BEEA 4CIXA 2QX7A 2FI1A 3NBYC 3WADA 1CDZA 4FSDA 4HJXA 4N03A 2DVMA 4GYYA 4HFNA 4DB2A 1VIAA 1C1DB 2OHHA 3ES9A 3K70B 1WBDA 3RSCA 2X7JA 4W8HA 4QDXA 1K68A 5BQPA 1QVFU 1AKNA 2GRJA 1SIUA 3LF2A 2O96A 4OL0A 2G1JA 3DTVD 4P9PA 1DWQA 2BR3A 4HQ0A 1UXOA 1EXVA 3LXUX 3FR7A 1MSWD 1VBKA 5HCUA 4JKOA 5I7EA 3FFTA 1THMA 4IXWA 4LMAA 1VE7A 3B6JA 1ESNA 1LNQA 4MVZA 5J2UA 5JY6A 1FL9A 3CJTA 1SF9A 3MTBA 3PYLA 4URYR 3GBPA 1Z45A 3CR3C 3HI6A 2V8OA 3VHRA 3CVXA 1KK0A 5HKBA 1AD2A 4OMFG 2BFCB 4RY0A 4IY1A 5K6AC 5DYNA 2QA5A 3B3QA 3BAFA 1UJ5A 4D8YA 3VJLA 1ODLA 5ESWA 5H59A 1J1IA 3KJZA 4M6WB 1Q2XA 1OPRA 1EAYA 1S6YA 3AHDA 3QKSB 1W2GA 2CB0A 1HY3A 5COQA 5L3QB 3IV9A 1LC3A 5AJTA 1U81A 1XAJA 3JWHA 4E08A 1GPUA 1V3QE 1YR1A 2JRLA 4YLYA 2IIPA 3NR7A 2VUUA 2ZUTA 4ZOCA 3L1JA 1N32B 3L84A 4FSHA 5LZ9A 3SJUA 2NVOA 1TTPB 2ZSBA 3VNQA 5BNZA 3PPXA 4HAMA 5EJ4A 4H0LB 3LT4A 1OI4A 4X88A 4YHHO 1GPDG 3OQIB 4DAOA 3M33A 5IKXA 3OO1A 2GJ4A 2REQA 1WDTA 4MVXA 5CLQA 5FL7A 2FR8C 3CVOA 5IANA 3TAUA 1SVUA 1NE7A 3QVGB 4IIBA 1GXSA 4LC0A 1T5IA 4LZOA 2ZIGA 4Q9DA 5FOXA 1WB9A 1KRWA 2NO7A 5KOJB 4HAWA 4Y9TA 3IQFA 5ES3A 3Q2KA 2PT9A 1R88A 2G5GX 3TVDA 1V1MA 3C98A 2ZR2A 4TV9F 4IH4A 5CFZA 1ARZA 3TCKA 2BM1A 4G9EA 2LFSA 5DNDA 1F0NA 4YDRA 4HB4A 4QYIA 1QCEA 4DW1A 3HZRA 4EW6A 4ZRNA 1HR0B 2VS1A 3ZDYB 4EUFA 3D02A 1LY1A 1XQ6A 4KO2S 3CO5A 5EKUA 2HDOA 3D6MA 4NTWA 2WHQA 3A9RA 4Q3CA 1T5BA 3UFXB 4H7KA 1MRZA 1M0TA 2J9GA 5AJVB 2OCDA 1TM3E 1E2DA 3VO9A 1XTJA 3I8OA 1K7XB 3AVVA 3W78A 1MJ5A 3UW3A 1PNOA 3CCCA 4F6CA 4N54A 5HZGA 4RIFA 4MAAA 4BP9A 2QTNA 4JVMA 3M4NA 2B69A 1D5NA 4M1MA 5HZMA 3IJEB 4LWZA 1MTOA 2W37A 1WD5A 3L43A 2XYQA 4KRYA 4KDRA 4EW3A 4ENRA 4UCXA 2XUJA 3L05A 3NNNA 5HF9A 1E94E 4DF3A 2FRDA 3PITA 1U0HC 4IG9A 4BMOB 3U4QB 5K3AA 1M1ZA 2B9VA 3IKLA 3P9KA 2K7FA 1DCTA 4OX9B 1EP9A 3OP1A 4LY6A 1ONSA 4C2AA 4FLYA 3DBLA 3PDJA 1O9BA 3PI7A 1GQOA 3QYJA 4PR0A 1DRVA 3CCBA 3WV5A 3H1LH 3T3DA 4UREA 1GRJA 1GGMA 1M1NA 5BPHA 1HNZO 2HLHA 4HX2A 3UC5A 4V0QA 1P6OA 4AUEA 4RH3A 1O5TA 3SS8A 3GU3A 2QK4A 5I5EA 3D3JA 4J1SA 2ZS7A 1GG5A 3VPFA 2Q3BA 2FL4A 2OLJA 4UHHA 1Q82W 1F23A 4ZOAA 4CIAA 3GGSA 2IP2A 2X7RB 3C7CB 2EJVA 2WQ7A 1J0EA 2F66C 4RD2A 4F97A 2X6AA 3BGOS 4LGYA 2Y92A 1OLSB 1BSVA 5KYYA 2HJRA 5TPWA 1X0VA 4F9FA 1EEXB 1OUMA 5DEIA 1AIPA 3WQQA 1TYBE 4TWKA 1F0PA 2FVYA 1KP3A 4US0R 2GKOA 2OC9A 4PRYA 2VDKB 1XT6A 3VR6A 1J2TA 4G5HA 2H16A 2QF7A 3OIUA 2CGEA 3E2PA 1GUAA 1EB8A 1I0ZA 4WJKB 1NFRA 2CYCA 4KH0A 4GP6A 3CD6V 4N6GA 2G9NA 3A0UA 1K33A 1RWOA 1ZL2A 1EGAA 1FPQA 1TU0A 4PFKA 1QRDA 1PTKA 1E3LA 3DCIA 3VR3D 2Z2IA 2C7GA 1EFVB 3I8SA 1JZTA 4LFCB 2H65A 1Y4MA 2FCRA 3AFOA 4R9SA 3TJZA 3JASB 2AG5A 1WDLA 2BEJA 3W6NA 5JQWA 1NVAA 3FGOA 5A04A 4I9NA 1VSUA 3GEHA 3ROXA 3FJ1A 1G6UA 5KKCA 3B89A 3W8EA 1F0YA 1PS9A 5EE5B 1UC8A 5GJWC 1DMRA 1U5AA 4ZO6A 4B7CA 3FFWA 5JXJA 4DEXA 1U3WA 4IFTA 1Q1BA 2X7HA 1ZJ6A 3K0AB 1NF2A 4DMLA 4JA0A 1YKFA 2VQEO 4OXYA 2C78A 4M0MA 3HDTA 4TQDA 3BHPA 2ZIXB 3AFGA 3W4IA 2E49A 4Z4HA 4ZD5A 2JFVA 3W4JA 5CB8A 4CM5A 3FOWA 2IY9A 1C7ZA 1EHYA 1RKBA 2ZWIA 3A37A 1E5TA 2ORWA 4Q1VA 1SVWA 1XLWA 2AKAB 2WFZA 3GG9A 4KLAA 4MNTA 2Y6VA 3PRKE 3LGSA 4K9KA 4MAMA 4EI2A 1YBFA 3UJPA 2QUBA 3N7TA 2QUIA 1JDZA 4GZRB 3WKCA 5FBVB 4CM8A 2IKSA 3DDUA 2BJHA 4LBZA 4WLNA 3U80A 1H6AA 1U8TA 1T29A 2B8WA 1SN7A 4XYLA 2JJ2A 1PL0A 4P08A 5T57A 1B76A 3TLGA 3AZQA 3OUFA 3DAFA 3DP7A 2UYCA 1K5SA 3DMDA 4R9NA 5JH7B 3KOUA 2W9XA 3ND7A 4Q34A 2IBSA 1JDVA 1RSOB 2HA2A 3B6EA 4OP1A 1QCDA 3I6QA 3DEHA 3OQOA 2XRMA 3A14A 5GAOA 4G24A 4J94A 4LH6A 1LC0A 4L5BA 4A8HA 2HC9A 3HJTA 4X7RA 2X6QA 4S0XA 5LKRA 3RTGA 1J2UA 3B40A 1V7PC 4KWIA 1O5IA 3U3OA 3ND9A 3WWYA 4DR6O 2OTJV 1L4NA 3A6KA 4KXXA 4TMFA 1CF4A 2HMVA 2EKQA 2CTQA 4EG0A 1E8NA 1WUJS 4D92A 3M81A 2D3TA 3I4CA 4KZKA 4YB8A 2HU7A 5HJ7A 1NRXA 1QNMA 5IYBO 5HVNA 2DU8A 3A9WA 1GNTA 4B31A 2BKAA 2WTXA 3A06A 3E82A 4QOEA 3TE6A 2J9ZB 3M6FA 1QG0A 2ENWA 3KDPA 4MHTA 4DG9A 4LVUA 3RYCB 4LOJA 3S3XA 4EKYA 5IBCA 2V5VA 4ZIBA 2VDUE 5G0WA 5EMJA 2ONYA 2ZJAA 4KQ6A 1XVLA 4B6FA 5B55A 1RYEA 5IUJC 2NPIA 4M4SA 4A6PA 3MT9A 4BKRA 4DR4B 3Q87B 3U1BA 3S2FA 4E4YA 2YEVB 1CJTC 1RKXA 2XUIA 3P97A 4DQKA 5KNBD 1TMYA 1XDUA 2PQMA 2PMCA 3DMRA 2PUHA 2LGJA 3DEKA 3IC5A 3SPXA 3T3IA 1RJ9A 5AKJA 1ZI8A 3EAFA 5DWDA 3B8EA 3G68A 5BWLA 4TL8A 4R0MA 5JS8A 3S1LA 1ODFA 4E0QA 2VJMA 5EHZA 2DWDC 2XBMA 3BXXA 1E3IA 1N9GA 2OKGA 2I7DA 3M1AA 1XZQA 4CLRB 4DR3B 3D81A 3QG1A 5LQCA 2BISA 4MTOA 2WWXA 4YALA 3BYZA 3U7QA 1YZNA 4EKGA 3ANTA 2Z3VA 5LMUB 2HNAA 3IUEA 4U8GA 1TUEB 3B53X 2RMKB 5ESDA 3ZQ4A 2MYPA 1TAEA 2HGSA 3EN0A 5JECA 2B78A 4WN9B 1E92A 1OR8A 4YRMA 1R9MA 1UDCA 2XWQA 1YXMA 1TJNA 1PGOA 2UDPA 4J07A 4RDXA 1YOBA 2DQ0A 5AKXA 3V7NA 2Z4SA 4F21A 4FYMA 4A1FA 4O8YA 2ZI7A 4JBXA 2OG2A 2XV1A 4ASUG 3I72A 1SBCA 3EWAA 3A1FA 4LF6O 5FQOA 3SC4A 5KWSA 5F7ZA 4DLUA 1WA8B 2OWEA 5B7PA 2ZWAA 3EVNA 3ORRA 3TECE 3LSTA 3DH1A 2JBAA 2Q3EA 4FU0A 1FTSA 1G8YA 1L8OA 2IUSA 4N65A 3K0EA 3JV7A 1WLSA 2OXTA 3WGMA 2DLCX 1AP6A 1DSSG 1G5FA 2JHPA 3ZHYA 3WYGA 1QHXA 1IBKB 3FOEC 3DP9A 4QO7A 4MV4A 3GLRA 4CMIA 1TTTA 4PQTA 2C5EA 3O4FA 1KUQA 1C14A 4FHDA 2CCGA 1JFTA 4QAJA 2E3CA 3ZNQA 4XCXA 5J2TB 4A92A 4ENQA 1NBMA 2OP0A 2Z98A 5IAOA 5E4FA 3BDIA 2WPNA 5GQSA 2WYWA 1PNLA 4Y2YA 5C8DA 4I3HA 1DTEA 1CUIA 1ECCA 3D8UA 1CQJA 3KJFA 4JFAA 5B7QA 5M52C 3ZRSA 4ZVUA 3H5AA 4F6LA 1YK0A 2YVQA 2O20A 2ROQA 1SZPA 4NFLA 4YP9A 4EGFA 4NARA 5K0ZA 3IIKA 2J0SA 2IX9A 5EIEA 1CB7A 1EVEA 2CXUA 4UU0A 3OMNB 2YV2A 1DKQA 3KKMA 2I3DA 3PHJA 1TJ4A 1J0XO 3HCDA 3BBPA 4ZV4A 2G0NA 4LCOA 2CE7A 2ISSD 1QB7A 2RGCA 2GCIA 3NRBA 1LPAB 1N36B 5AW2A 3K8YA 5KX5A 2IYAA 3N0TA 3DL0A 4BTEA 4HLUC 4KE9A 3VU1A 1SUAA 4B46A 3RBVA 5IWCA 4WI1A 2PN1A 3M1LA 3V3KA 4CLXA 3VKGA 1NN1A 4TL9A 4L9SA 1T25A 3WGOA 4DIDA 2WP8J 3N53A 3I45A 1UC5B 5D87A 3TTXA 3CSXA 1G8HA 2J3QA 2VNKA 1OBCA 2I54A 4A03A 1D2GA 4X1IB 2PCLA 4D25A 2GZ3A 2EGHA 3PUZA 4GLFA 4J1TA 5EL0A 4HOYA 5IAKA 2EW8A 1BOOA 2X9GA 1KO5A 1ST3A 1N4AA 3RG2A 4WN9A 1K8RA 3QW4B 4JI3O 4IQGA 4B09A 1I7DA 5B7GA 2Y0BA 2YUIA 2PMEA 2UXCB 3QQPA 4ZTZB 3RSHA 2VXYA 5LN1A 3JD0A 1KAGA 1KI2A 5FJIA 5JTUA 3I61A 3R7FA 1M2OA 1EP2B 5DRYA 2ZLBA 5I9MA 3IVGA 3ZWNA 5L3FA 4IIJA 1Q8IA 4UNQA 4ND5A 3H8SA 3RT3C 1N2XA 3D8RA 4OU5A 2QTLA 2O7NA 4Y6PA 3S2ZA 3VC3A 3RC9A 4EHLA 1A88A 1RHQA 2KW5A 2ODEA 2CTRA 1P0IA 2IOYA 5SYMA 1XA3A 4BUCA 2J0EA 2HF9A 4ZXFA 1HM5A 5KQLA 3A2KA 4TL7A 4U63A 4UC0A 3DJYA 1R3DA 5HKLA 1UOEA 2VQ3A 2BOVA 2NUAA 1PZXA 1TF5A 2J3DA 3G59A 2HKOA 4LHWA 2WI8A 1JQJC 1ISMA 1KO4A 1OXKB 5EP1A 1RRCA 2Y27A 4FK8A 1UOQA 3VR6D 3VPCA 1ZM2A 4EG2A 4WLUA 3L1HA 2XGOA 3I2JA 3TZHA 3MUFA 3HVRA 4B3RB 2HQBA 3GQVA 5LQMA 1G6HA 3JQRA 1H8HG 4Y30A 3KLMX 4R1UA 2Y0IA 4KFSA 2HSDA 3KL2A 3UENA 3DVLA 2G1PA 1GFZA 2TMKA 1DAOA 4HQLA 2AD1A 4YH1A 1RPAA 1LF5A 3PUWA 5KBYA 1JMYA 1TA4A 4JLOA 4PX3A 1FMTA 1YHQV 4OHBA 3O8NA 3PQEA 4LTMA 1VCHA 2JCGA 4TQGA 4B6RA 4JS0A 2RKWA 2X2EA 5ECGC 3R65A 3SHFA 1NHWA 4A0SA 1U8UA 4C20A 4AXBA 4KXLA 4P3OA 4BO1A 2FZEA 1Z5VA 5AXBA 2Y1XA 1DTWA 4N3BA 3OT7A 1PZMA 2R7NA 3RK4A 4D7AA 1F0KA 3BERA 4N9QA 4Z8YA 1Y3IA 4HLUA 3T7AA 1XD9A 5DIZA 3TPZA 2GFHA 1XAIA 3DZJA 3T4ZA 1TMOA 3AR5A 4IMIB 4D6PA 3P9NA 1JI0A 4XB2A 5BP7A 3RARA 5C8VA 4ML3A 3H5OA 4GC5A 3OZFA 3TN7A 2XJ9A 4ZIRA 2YZNA 1AKWA 4HAOA 3G6BA 2ZIXA 1JF8A 1SULA 3KJHA 4ZT5A 2B9ZA 1DDOA 3FWKA 5HWSA 3F7VC 4MLDA 2CC2A 3C5WP 1OFUX 4GVXA 3EK2A 2VUHB 4Z4CA 3NHYA 3BCRA 2RHWA 4TTTS 1E6UA 2JGMA 4HZ3A 1QH8A 1L7BA 1R4MA 3U3RA 5J2UF 4U7JA 3E1UA 4RTQA 1Z2EA 3P9RA 1OX5A 2WD8A 1P2DA 2ZI5A 1OCCC 4N1AA 4OX9Y 1RWNA 3DW3X 2MINB 3CEMA 1ZGBA 3DMNA 2X4DA 3OZRA 4P7FA 2CLFB 3A6FA 1A9XA 3ZCPA 3N2LA 2ZIUB 4WCVA 3TZ6A 4D45A 3ICVA 4W9NC 2RAVA 2W2MA 5FNVA 4KQGA 3QXJA 1M5UA 4CF4A 2BJWA 1QCZA 1EU1A 2AYZA 1I3NA 1EJ0A 1RZRA 4AZ0B 3A6JA 3OQMA 4HFMA 4U7HA 5AM3A 3F67A 4Q3LA 3ITEA 3AEKB 2N1MA 3FMGA 5JDCA 4YRLA 4Y1RA 3LQRA 3PWZA 5GONB 4AQYO 2JVIA 4PE5B 3IRUA 3A9UA 4CF3A 4EX6A 5FA5A 2EJWA 1ADCA 1GKUB 5IVPA 1UPFA 3HBLA 4J10A 1R5TA 3E2EA 2MYNA 2QPLA 4W5NA 4MVSA 5EFZA 2WHRA 1HDOA 4IOLA 1JAZA 2O8DA 1GQRA 3IKMB 2GDSA 4AD8A 3MINB 1FP2A 3DOUA 1YR8A 3IFXA 4RVUA 5BN4B 2VLIA 3SR3A 1BN6A 2RAPA 5F33A 4C5CA 2QHXA 3FX2A 2Y9MB 3QTLA 4RPGA 4URUR 4NDZA 3W6PA 3DOHA 5L4SA 3RREA 3G82C 3VU9A 2BMDA 4U7FA 5EIFA 1JA8A 4HL6A 3GRKA 1PJLA 3KZIZ 3AJEA 3MOGA 1I1HA 3SJ7A 2BVNA 4TSFD 5AOVA 2HVJC 1DC7A 1L7EA 3A0RB 3DXZA 3GMIA 1E9BA 2AQKA 3ONWA 3RYFA 4KLNA 4WJLA 2WM3A 3W3AD 1IVNA 3L0SA 5GJVC 2R44A 3HKEA 1LW7A 4WK4B 1LV7A 3QVUA 4D2IA 2C2MA 1R0SA 1XE3A 1J8MF 4Z0HO 1NTKH 2G6VA 3T5PA 2W2KB 5C3MA 5ALWA 3C1AA 1YQWA 4D3YA 3QUBA 4R7CA 3CXUA 3EXEB 2FN9A 2FLVA 3WIOA 3OU6A 2CEKA 4G1UC 1S4QA 2HF2A 4BMZA 5H1YA 4ZI7F 1NWHA 4FYPA 3NHKA 2PX2A 1HPLA 3VR2D 3MCTA 2F93B 1YJWV 1G8GA 5DLEA 4B3XA 1N6KA 1OHHA 4CMJA 2QN6A 3VKWA 1Z2AA 3WNDA 5FV4A 1JBKA 3BH6A 1B0PA 4TMKA 2VJPA 3CNOA 4NK4A 3NEYA 1ORHA 3KPJA 3HCBA 1AN0A 2FQWA 1QHHB 2WQZA 2ZI6A 2ZS9A 3GPCA 4UU8A 3Q7EA 1Z4OA 3R5SA 4ZYVA 1N5KA 3U4MA 1RBZA 5C31A 1I8TA 3CEPB 3I39X 3N0WA 1K4CC 2IWRA 5AUPB 2X0FA 2WWGA 3LL7A 2IXFA 4KHPB 1R8QA 1UQTA 2B25A 3BWMA 3GLSA 3H2BA 3M83A 2XCLA 2PUVA 2XA9A 4P86A 4WXEA 3SYKA 2ORYA 1QPBA 2Q50A 2W2KA 2XA2A 4MKXA 1KARA 4MRMB 4F5ZA 2PUCA 1BVHA 1XP8A 4UM7A 3MCVA 1P4GA 4BZQA 1NW3A 3PD1A 5GM2A 4A27A 3LX4A 1T5HX 2RBEA 1SCNE 3LDDA 1ZC4A 2X0LA 1YCIA 1GZUA 2VJOA 4KR0A 4KOEC 3EFFK 2FPIB 2I67A 1NZJA 4DRYA 4RJLA 3K08A 4Q4CA 2B3TA 3ED1A 2Q4TA 2J3MA 4H77A 2WB2A 1L5VA 2WSMA 3KPYA 1FQOA 4B73A 4Y67A 1JJVA 5JCOA 2VCYA 2WC1A 3ZNNA 1BJTA 3G9UA 1OZGA 1RWWA 4KGVA 3RAPR 3TI7A 4NZZA 4NBLA 1R0YA 1G5QA 1L8AA 2NVWA 2YRFA 3I9V6 3KOOA 5D84A 3LUKA 5K7SA 2HGZA 1RCTE 2NYRA 3OLZA 4BCCA 4BMCA 3BREA 3OEED 4WY2A 4GZ3A 2HHHO 4MRMA 4UW9A 3ZDZB 1E18A 1MC4A 2PZGA 4RPJA 5KSZA 1E2BA 3A4MA 1I51A 3PUJA 2WHPB 4OYLA 2PS0A 2OIEA 3I83A 3N6XA 1SXJD 1F5NA 1VCNA 3DTVB 3OJOA 3H3FA 3F97A 2W6JA 4D4IA 1JLHA 4JODA 1MENA 4EAAA 4NWIA 3K59A 5L3QA 3H5NA 2V7QA 1YVPA 3R0QA 3WGZA 5A0TA 4FNAA 4Z54A 2MU1A 1FUYB 2ZJOA 3LW7A 5CB0A 4DGSA 2BI7A 1VKJA 1WE2A 3GLHE 2OWDA 3NHWA 3Q10A 1O8BA 2ZUFA 2CHGA 3G5AA 3PI6A 4C14A 4RQBA 1VG1A 2D1FA 2EWWA 2D13A 4I9QA 4XM1A 4WOBA 1OTYA 4MXDA 1CY2A 3QFTA 4WRRA 3WY9A 1JR3D 3I5UA 1RTKA 1MAAA 2O1EA 5BSWA 4MVJH 1X1DA 2HNKA 1AKTA 1WXGA 3F90A 5DASA 2R6HA 1TYAE 2JJYA 3PCRB 1NDHA 4IXNA 4HVAA 2QI9F 4BS9A 5D5HA 4V1CI 5K05A 4DK1A 1XU7A 5LOVF 1WZEA 4UU7A 3ISVA 5CJJA 4LDQA 3KVRA 2QGZA 3PG5A 1T2NA 2SBTA 2DHQA 2P2ZA 1YU6A 5FTJA 4CL0A 4Z3KA 4OHOA 4M0FA 1ZOSA 3QY9A 4CL2A 3HGTA 3ML1A 5CH3A 3WLJA 4KMSA 2OBXA 3B60A 5IF3A 1I94B 1JFLA 3LYHA 1DC5A 1Z33A 3OLVA 3RABA 1PZNA 2GGSA 1MB0A 2QLMA 3L46A 1KDZA 3ZDEA 4B44A 5KVAA 1YTUA 1KAEA 3NM5A 5DHRA 1IZ3A 2DY1A 2Q73A 4JEIA 5KQRA 1JHZA 1PWZA 2ZYAA 2AUTA 1QOPB 4I1IA 3HZOA 4EGSA 1O4WA 3E27A 3HC7A 4YFVA 2D7JA 1RC8A 2JG3A 1ZW6A 2X1LA 3FOBA 4ZTUB 2IYLD 2D1YA 2PZBA 4Y6QA 3SNHA 1NMZA 4BNJA 1GGKA 2H7YA 1MAUA 2OHVA 3V34A 1Z63A 3HA3A 4Z4GA 1P6XA 2I1VB 4PLWA 1Z6ZA 2QRHA 4ZAWA 1MO2A 1VYHA 1C1XA 1VHJA 1MJGM 4IIFA 3STZC 4Z0NA 5BQ5A 2ONJA 3WLPA 4WFBV 5LMCA 2PGNA 1XKTA 2X9LA 1UUFA 1U4NA 3HVIA 1X6VA 1Z17A 2LIVA 4II2A 4EEZA 4DADA 5IT5A 2R9RB 1D3AA 1VDMA 2BHSA 1U7OA 1Y8QB 4EKWA 4LFAO 2IYUA 2PTMA 3ASUA 5EIHA 3CZAA 3TDNA 3QFCA 3R74A 3T12A 2FJUA 4MW2A 5E2AA 3I9MA 3BRQA 3RLIA 2EKPA 3ZQJA 2ZK7A 121PA 3AI2A 4PZDA 4BUJA 2NV2B 5EC8A 4K28A 1U3VA 1Z2GA 4UUMA 1A82A 3BIFA 3D2AA 4RZUA 3MWEA 3RHZA 3C3BA 3BE5A 1RXIA 1EK6A 1FNNA 3KT0A 4IO0A 2BGNA 3QEJA 4Y2PA 4KITC 3IAYA 1GH6A 2QTBA 1A9TA 5DBFA 2X4LA 1NBIA 1PP4A 1RQ2A 2WAOA 4B48A 3HNRA 2DPHA 2Q7DA 1F06A 4ZQHA 2ZT9B 1QP7A 3WRWA 1F7UA 3ZY4A 2IHVA 3IJPA 2NQ2C 1PL6A 2NX2A 2ZRPA 2ZU6A 2IE8A 2Z4TA 2RARA 5BQXA 4L5CA 2BM0A 2H59A 4EUHA 1GWNA 1B93A 4EQ6B 4BLUA 4RWUA 1UPAA 5H5NA 2QE7A 4DMKA 3EVFA 1Y1QA 1OILA 1Z8FA 2WYVA 3Q3EA 4FGUA 4X00A 3WOHA 1GAWA 2XSZD 4F2PA 3AONB 3L0PA 4WZAE 5FUVA 3OT1B 3EIUA 4D80A 1UWVA 3OZIA 4XI9A 1SKVA 2ZZMA 2WUFA 4R2JA 1KORA 3IVCA 2H00A 2R7AA 1G42A 2QTTA 3PUYA 2WNHA 3FDJA 4I5DA 4F9TA 3IL2A 2BUBA 4RJIA 1YL7A 4HDOB 4X9XA 1A2BA 4V0SA 1YB6A 3NO4A 1II9A 2JFFA 3LFTA 3DF9A 3TFWA 3E7FA 2RB4A 5D5QA 1HDZA 4OB8A 2F7SA 3T1HB 1W4BA 3AUAA 3U39A 2KKSA 2QD5A 2HBZA 4UM9B 4HPXB 5GWXA 4BFTA 5ADUS 1BE6A 4MWEA 2EGUA 4HGRA 4X91A 5CAEB 2H7VA 1BL8A 3BMQB 3QX9A 2JHGA 1RXEA 4PVDA 5K8IA 3UYKA 2GZHA 4KJXA 2H06A 5JRDS 4PTZA 5AIBA 4CV1A 2WNSA 1GL7A 1G8AA 1TB4A 2D1RA 1BRMA 2WIDA 3B1VA 4NNJA 1P4JA 1QP8A 4M83A 3ZQ6A 4WHMA 2YBEA 3T9AA 3FA2A 1CP2A 3QYAA 4MB6A 3DHEA 3ZD9A 2JLXA 4WCFB 3ULKA 3CXRA 5CR9A 5DHFA 3TLCA 2RHJA 4L5IA 2P6RA 3OPVA 2HREA 5KTNA 3R2NA 3A1WA 3DT9A 4AU1A 4O4JA 3M1YA 4Z1MD 2GAJA 1W0JD 1OCOB 2BUCA 1JSXA 4FYYA 2P5SA 5DCYA 3Q2OA 5ALEA 3SPHA 4YMIA 2RIRA 3OEHA 1HXHA 3AM4A 2C61A 3EC2A 4RIHA 1PFVA 5IC4A 1SOMA 5LU9A 2A0FA 2BAGA 3PHIA 1NVFA 4PA3A 2GTHA 4HMPA 2B1GA 4HVTA 9ATCA 1JAXA 2PJRA 1K3FA 4DA6A 2ENUA 1CUGA 3WIUA 1S2GA 2C1ZA 4MV1A 3IHWA 3A9VA 2DR0A 3AF4A 1NASA 3T1YO 4LC9A 3WYBA 4TSFA 4WV3A 5AVTA 3KEQA 4PZYA 3J7AC 2UZAA 5JE8A 4WFQA 4DR5O 5FLYA 2UZ0A 1UFVA 2B34A 4UULA 3SJBC 2PJDA 1IQ0A 1IG3A 3T7SA 2OCCB 5LD2C 4KVFA 3OESA 1CUEA 4JN6B 3D59A 1C3JA 1PR5A 1XKLA 2CLKB 1MKYA 3TAXA 4BB0A 4QJ3A 2IHTA 8ATCA 4DQLA 4D8UA 5KYXA 2QUKA 3COJA 1IK4A 4HDKB 3F4KA 1U90A 1NW7A 1HK7A 2DOKA 1VQOV 1Y7LA 2WUWE 1DWUA 4HWPA 1BKDR 4QECA 3RD5A 4CTOA 1AS0A 2X2PA 5BYAA 1M7BA 1AUVA 3A6HA 4OH7A 3B6IA 1BYIA 1CY1A 4NG4A 2HFEC 1LRLA 3LUDA 4ESOA 1MO6A 1PFQA 3O0TA 3AX6A 3GD7A 3VDXA 4K3AA 4J41A 4LGMA 4CKZA 1KD1W 2I91A 2PZMA 2JHFA 3KOYA 4UTOA 1AGPA 1GAQA 1Q0LA 2WA2A 1QGED 1HFEL 2YIJA 4FZJA 3B2EE 1GRQA 2RHMA 1A7KA 1XOIA 1RJGA 2O5RA 1IWPB 4GW3A 5FL3A 4PDVA 3CWZA 1BXKA 1TC2A 4Y8VA 2PO7A 5DF1A 5FI3A 2D5NA 5IC6A 4YPFA 3EW9A 4PHGA 3V1YA 2CYBA 3GMSA 4JBNA 2Y67A 1N1EA 5EPEA 3G7NA 4YAKA 4ZV7A 1W29A 2HYIC 4JMPA 4UXIA 4YI3A 4G89A 4O02B 5ITZA 5JVDA 2QL7A 1EA5A 3PCTA 1CY4A 3LLUA 5HF5A 4F5EA 1QF6A 4GYWA 2CVHA 3UM7A 4JYZA 4TYNA 4W7IA 2A30A 1E6EA 3OM9A 4ARBA 4D3DA 5KTOA 4TZKA 1Q1GA 3PNMA 3FYEB 1ZISA 4R1SA 3WLEA 4JB0A 4DKJA 1FRNA 5FR2A 1OREA 4J49A 4R1LA 4XDKA 3DLPX 2FPPA 3I2YX 3LVBA 4RV5A 4K9OA 4X8OA 3HDQA 4FI3C 5CK4A 3ER6A 5FUXA 5TPZD 3K73O 1P1BA 3T54A 3V1NA 2C7PA 3EWIA 3QBEA 2P2CA 1V25A 4Z9YA 3KZCA 2FR0A 3L1IA 3LT2A 5TEWA 3SU8A 2D06A 3AYZB 3MXTA 3N3AC 5IYZF 2LGQA 1FVXA 3UMSA 3X2SA 3UKDA 2QYSA 4P7KA 4KSBA 4WX2B 3ZUPA 2JS3A 1JDBC 1F1JA 4Q03A 1N1GA 1EFVA 1UBKS 2DHEA 3L49A 4PFJA 4RK4A 2PRZA 4GQBA 3TTSA 4L1KA 4RK1A 5CVVA 5AOCA 1D4OA 1SZTA 2V7QD 2CDRA 2Q0HA 5KUKA 3UCSC 1FDSA 1LS1A 1ZTEA 3EJ6A 4YC7A 1SU6A 5TMPA 1NKTA 3FB6C 5HXAA 2XRZA 2XA1A 3N0VA 5T6BA 2X22A 2YIDA 1P73A 3QW2A 3GK3A 3C45A 3EVDA 2V1DA 2XXAB 2CKMA 4ACBA 3CGGA 4Q4AB 2XMCA 3WISA 3WV4A 5B64A 4KCGA 1QQ6A 2J4DA 3GOQA 1J99A 3EXAA 1OXSC 3ZE7A 2OV1A 5L53A 1RC0A 2A35A 2E4UA 2I6GA 4R8MA 4E7PA 4R2HA 1RPTA 1P6QA 3F5SA 1AU9A 1SKUA 1Y7IA 2D5AA 1Z37A 1KZ6A 2A9OA 2PYIA 3CSUA 3U9TA 4AN0A 1LCIA 2W0SA 4RUFA 2FX5A 4K9MA 4AMGA 5GOTA 3SK0A 3S8EA 2ZXUA 1PSWA 1XLTA 1U94A 1J2RA 1G9SA 1LLUA 2XQJA 2IEDA 2CXPA 1V54B 1RYMA 2R00A 3HHEA 5T3UA 2JEUA 4CH6A 1NYLA 2E85A 2XF2A 3TIFA 1S1MA 3TW8A 3U31A 4I4TA 1S4MA 1IBRA 1Q7TA 3BUSA 1FP4B 3BZWA 1J22A 4BLQA 2VJCA 4N01A 1N4CA 2A86A 3B48A 4B6QA 2B4YA 1A69A 4FFBA 3KLPX 4LXTA 3BSSA 2QW1A 2YCLA 3CNNA 3RGBA 2NADA 3CHXA 2NUTA 2R25B 3TH5A 1AJEA 1QMGA 3F6RA 2ZSUA 3JAMA 3TTWA 1FVHA 3GY0A 3TKAA 5DBEX 4NE2A 4XOUA 2IH2A 3DV9A 4C0KA 1RAIA 4IVNA 1CUCA 1O94D 3HR0A 1FRFS 4ONEA 4AURA 5A6VA 3JRWA 1GFSA 1Q1EA 3CRW1 3LS2A 3AW9A 3GJYA 5EKSA 3OEEA 1Q1NA 1QQTA 5IJ0A 2XUHA 3F8WA 3GJ4A 3QTTA 4I5GA 4JOQA 1HT0A 2UZIR 4UNSA 4CCWA 4D43A 4POOA 5B4VA 3MW8A 3IEKA 2ODTX 1QRTA 1SD1A 4KNWA 5MF6A 3VH3A 4EBFA 2AF4C 4UMDA 2CW5A 4ZCQA 1HO3A 2OR3A 3CY6A 3EASA 4NG5A 4OMCA 4TKZA 1BNCA 1Z2OX 1R6NA 4ZEWA 1IOWA 2VPXA 2YJ4A 2RK4A 3NASA 8OHMA 4LCPA 1KO7A 4GKJB 3G89A 3LCRA 1NONA 3M7IA 2H63A 4ILEA 1GEGA 2ARKA 3QSGA 2A1TR 2P0YA 3H9VA 2P9CA 1ZLYA 3FDZA 4LRXA 4QGGA 4N6NA 5H5JA 4D9NA 5FPKA 3HA5A 1TGYA 3N2IA 2GNAA 1Y9AA 2NXNA 4B81A 5I7WA 4F4UA 4BNXA 1J97A 3VBCA 4ZZ0A 2J5RA 3G85A 3I1IA 4FCVA 2IZOA 3L18A 4YROA 4LDZA 2JJ1G 1KIFA 1MOFA 4ZO4A 4CM8B 5L3GA 2P6UA 2IEBA 4BNVA 1CYDA 2D8MA 4IIDA 4AX4A 2X0KA 2BEVA 3AJ9A 2OA0A 4XDLA 1EK2A 4BV2A 1K6IA 3FVWA 5DBGA 5JTTA 3WQRA 3R5HA 3NP9A 2ZUEA 4I9WA 1JPJA 3W8RA 1QJCA 5CFOA 1DJMA 1YZYA 3GJQA 3ACCA 3BXHA 4EG5A 3R09A 5FA8A 2BBSA 1AHHA 2HMUA 3GVIA 5L3ZA 1WAMA 2EFDB 1KETA 2W93A 3X1ZA 1S2LA 1Z2DA 3TLGB 1E0DA 5EIXA 3N8HA 3GPDG 2GPJA 4JJ7A 3AEQA 4NYIQ 1KMCA 4A7PA 5KPDA 4L95C 1P7BA 1SVOA 4COOA 4JAVC 3WMXA 3RW0A 4OWPB 2QLFA 2KI5A 2I62A 2Q3DA 3DNFA 3KKLA 4MI6A 1YJNV 2I2XB 2IV3A 2O7QA 4QBKA 4XVQA 5ANRB 4Q1EA 4Q9AA 4D5EA 1K8ZB 2IUYA 5EFOA 3ZZ1A 3SE7A 1YJBA 3ZZUA 3NBMA 4K05A 3K70C 4LY3A 1I0LA 4XZ3A 1ZS9A 5ENDA 4K0KB 3MRVA 4GP7A 4M7OA 4A0GA 4GT1A 1WCXA 5A0VA 2DH6A 3VC1A 1ORVA 4G4IA 3M4JA 1RCFA 4ADSG 2OUIA 4YAGA 1QBZA 1U2EA 2WABA 3DXYA 4BWGA 1NX9A 5JCPA 1QHGA 4PDMA 4LF7B 2BE3A 1E9FA 2XNDG 1BX0A 5K8VA 1LVHA 4MUJA 5GZ6A 3A7EA 1THGA 4A5OA 4F6EA 3S2IA 2QN2A 2B3ZA 1DC8A 1I2ZA 1K9VF 4QXAA 4Q4LA 1XWIA 4R1NA 3TSCA 3OZDA 3GWKC 3QF7A 1E3DA 2BBTA 1P91A 2VUSA 2CLMB 1XC7A 5KVSA 3RWMB 3E3OA 5AKHA 1ZL0A 3K5OA 2H4YA 1V3TA 2YUTA 2GTIA 1L1QA 4UBNA 1LBIA 1FS5A 4YONB 3NU1A 2R97A 2X4IA 3QLJA 1MMFB 4M8IA 4TKLA 3TNFA 1WDWB 4IINA 4II7A 5JO9A 3MAQA 1KGSA 1Y33E 1ZH2A 2XH8A 3RKUA 3V8MA 1THZA 1OI3A 4H1UA 1JZQA 4F7WA 3RF6A 4G6ZA 2F1MA 1TADA 1V47A 3TXQA 3KHSA 3LZDA 4NQLA 4EJ6A 3T4UA 5AVJA 1KWKA 4FFMA 4MJXA 4YRPA 4D56A 1A8IA 4NCHA 3M7MX 1QP0A 1R27A 2G6BA 3UF0A 2PVSA 3A9TA 2AZ4A 2JS7A 3MIIA 3QITA 4I08A 2W6MA 3UAYA 1GQSA 4UCUA 3A32A 2GWRA 2F1IA 3B3GA 1UJ4A 3HYCA 4HNSA 5F52A 3UWDA 4IKOA 4LVOA 1MJFA 4AQ7A 2O8EA 4Z2WA 1XRRA 2QLTA 2UYYA 2BJVA 1JALA 2XSZA 3ILHA 4KU4A 3NNSA 3NYQA 3K0BA 3PEWA 2OV4A 1BE1A 4B4VA 4EZEA 1IN4A 3QUTA 4EB6A 2VT6A 3FSGA 3HB4X 5MN6A 3PFHA 5BUCA 1XD2A 1RLIA 1U11A 4C01A 4Q1DA 4UBMA 3FN4A 4RY8A 4FMCB 4J0CA 2EHJA 4P84A 4R4JA 5FI0B 2C82A 3EZ6A 2GYYA 3VMMA 5HJ2A 4ZYLA 1ORIA 2IPLA 2KM1A 4L9AA 3ZXSA 4AJ4A 2PPLA 2Q69A 3G2LA 3PJFA 5E9JA 1AZSC 5JJIA 3SSNA 4EW1A 1YKGA 4HH4A 4RHYA 1ORRA 5CT8A 1EFRG 2DLNA 1ML4A 1AOXA 1CJVC 1DCFA 2OCGA 1DBSA 2R8PA 2V59A 1GYPA 1HTTA 1AY0A 3KXIA 5DTIA 3RNLA 3L07A 4DCTA 1FFWA 5BMVA 2G72A 2EARA 2HIAA 2QT0A 1C1DA 3BOSA 4FZ3A 1ESEA 3T3HA 1MVLA 1HLGA 5JHGB 1ZGHA 1C29B 1NR5A 1T9ZA 2CHEA 1QGZA 3O47A 4GUDA 2IF0A 1UBNA 4Q4HA 4JAVA 5K0CA 4E0BA 4TYQA 1R1BA 4JYCA 3U81A 1E99A 2GBGA 3E8XA 1C3OB 5B4TA 2AMFA 4WVFA 1F6WA 1JP7A 3H3XA 3ZWYA 3R5JA 5NULA 2Q1TA 3TQCA 1QBKC 3YASA 2VHJA 3R8CA 2ERCA 1QS0B 3OMXA 4AF8A 4Z4IA 1DU4A 4MZXA 2BTEA 2O5CA 3OAAG 4NMLA 2A92A 1ZWLA 1NU1H 2Q6TA 4JJ4A 4UPEA 3PZRA 5B36A 1GKYA 5A3RA 3DFZA 4JLNA 2OAP1 4ZC8A 1NUTA 2BSXA 1CIJA 3AM5A 1HWYA 2VHTA 4J6FA 2FW8A 3IAAA 5ILOA 1HR0O 1C1YA 1L8QA 4KTTE 3FYUC 1GNRA 5G1NA 3JW8A 3BGDA 1Y34E 4B3GA 3AR6A 1AV6A 1UDXA 3OSUA 4DWWA 1L5FA 3V2UA 3OOEA 4IUCS 3K09C 4J7JA 3ZWQA 3IPYA 5A2QA 5LLDA 3QEBZ 3TQFA 5FI5A 1P9NA 3I6MA 1KJ8A 2F55A 3KR2A 2WWWA 2ATEA 2EFJA 2X5KO 5G0SA 1EDBA 4BZZA 3ZDAA 1JSZA 2YDXA 5IE9A 1NNSA 2ZDQA 4URWR 4X84A 3UJ3X 3K0GA 2A06H 1C9NA 4Z99A 4A23A 4BEBA 1IVYA 4DHEA 3GT4A 4MW0A 2J32A 1RI3A 4IIXA 3U9SA 1KJQA 4YBRA 3DLTA 3WGNA 1KXJA 5GIPE 1M34A 1D2DA 3HA7A 3ZU2A 2PA3A 4IHJF 4BBPA 4NNPA 3VVMA 2CTWA 4WKGA 2QWOB 4EGAA 2R751 1W4RA 2C4TA 4GXNA 1GA6A 3KQWA 1QLEB 4I1UA 4NFYA 4G8CA 1NN5A 5TQ0A 4WIGA 2NSHA 4AS3A 2JC3A 4JBYA 1FVOA 5JCJD 4M8KA 5E6RB 5K20A 1CQIB 1W5AA 2D5IA 3QO8A 1TYZA 3GRYA 4EYSA 2SECE 4RGQA 4EHFA 3AK2A 3TD2A 4PTLA 2HEIA 1F2DA 4QBGB 4I0XA 2C94A 3TRJA 3CKKA 4XLLA 1DKNA 4QARA 4MGHA 1R66A 2R65A 1NUQA 4AX8A 4EY4A 3WNBA 1JJ7A 2EF1A 2JFNA 1SQ6A 1SERA 1QLEC 1C8LA 4YCSA 3NHUA 3SD7A 1DEKA 1X9IA 2V4MA 2B3DA 5K4HA 1WG8A 4MW4A 2E48A 4IZ6A 2LPMA 1DQNA 1AKRA 2WYOA 3A25A 1DRUA 2HY7A 1DPFA 2R8RA 1OW3B 3CH6A 3CT6A 3H5IA 4DPKA 2BIFA 1PNQA 2VYQA 3E84A 1N6OA 1O2DA 4ZFRA 1G8MA 5FLXN 1GLGA 4L4YA 1MLDA 1RI1A 1XPRA 4UE6A 4EI9A 3GO4A 3LUGA 3JD2A 1GNPA 3Q3GE 3R44A 4NP6A 2ZUWA 4E5SA 2Z57A 2ZB8A 4B6JA 1ZCZA 4Q4HB 1SRQA 4WZBB 2H3EA 1DUVG 4K87A 2GXSA 4N0PA 1S0VA 3FAZA 3A2FA 4MVYA 4MS1A 1CQIA 2IJGX 2VRBA 1L0LH 4C07A 2PNJA 4MQFB 2DCMA 3CLVA 1JG1A 1YB7A 3GVCA 1U7UA 3I9JA 1RKQA 2F1JA 1WUYA 2OECA 2GESA 3VU3A 2SKEA 1C9DB 4AZVA 5I3ZA 1X1TA 3RTAA 1XXHE 4L2IA 4Q82A 3JCZA 4LF7O 2FU5C 2WWTA 4QGSA 5M04A 2R84A 1ECLA 3F6PA 1XFDA 2XIQA 1LRJA 3KUKA 1CEEA 3FYUA 4QKQA 3FHLA 1NL3A 3DOCA 2HA3A 3BWVA 2WZDA 4G2KA 5EAIA 3UWKA 1EVQA 1NI3A 3L8CA 1XRPA 5T67A 1HEUA 2D00A 1OH6A 3WGTA 1OAOC 2PGDA 1QK3A 2YOFA 2PGGA 2DH5A 1H3EA 1SBYA 2ZYGA 1H8EG 3PIDA 2EKZA 4LJ6A 3Q5EA 4LE1A 4MQ5A 5LUBA 5IH7A 3A4IA 4UD6A 4C2UA 1WQ1R 13PKA 1CF2O 4E88A 1GAXA 3MWLA 2D3WA 4MVJA 3V1LA 3EQ6A 2FOXA 2GN4A 3MCAA 5BWNA 4AILC 4QPCA 2J7KA 1VIYA 2XMBA 3LO8A 3ZKWB 1IMOA 1T9KA 3PS9A 3U40A 2VDJA 2VTEA 4UAGA 3Q7IA 2P06A 5LVAA 4JLBA 2AHZA 3A3KA 1X9GA 2IYRA 2J0VA 3SVLA 5FOTA 4BDSA 4XQ9A 3GFOA 5JCOC 2VHZA 3ZMUA 4G5YA 1FKAO 1EGVB 1MCZA 1KYWA 2LKCA 3MYRA 1AB5A 3IYLW 2X23A 2RKBA 4JQCA 1BGVA 1SO8A 2WU8A 3C3TA 5EBMC 2YZ2A 4FFVA 1G8JA 2NZUG 1B7GO 1A2QA 1USUA 1WW2A 3QKTA 1PLKA 1E1CB 1OGYA 4L3OA 4RFSB 5F35A 4ECEA 2OVBA 2Q9AA 1BDBA 3TW8B 4P9EA 3ZPGA 4FJ1A 2HK8A 4BNMA 4DBVO 3KU4A 4QPZA 1KU9A 3V4OA 1I30A 1D6JA 3IS3A 4MW1A 4DARA 4JTDB 4MYHA 4UQLA 2C2GA 1DT5A 1GAJA 1O77A 2P4HX 1VDZA 4FQ7A 1UBTS 2JGEA 2VWJA 2HA0A 2YW9A 2GV9A 5D3ZA 4ZICA 4IEIA 1CERA 3IODA 1GTOA 2XBLA 2QTOA 4OHUA 4MI9A 4ZAFA 4DCVA 5HF8A 4GRIA 3JTEA 2HOQA 3WGGA 2WOJA 1ETUA 1NTRA 2EV9A 2G5PA 2GN2A 4BVJA 4QFTA 4B7EA 1UF9A 4INZA 3UXMA 3OH8A 2XOEA 3PDHA 1X80B 3ENKA 1JJOA 4O0LA 1R4NA 5A05A 3RC7A 2FPOA 1WPXA 2PFKA 3JQGA 1ULBA 4JLUA 4L3VA 5C37A 3KJNA 4WACA 1PFUA 4DLAA 3EXEA 3ZD8A 4YJ2B 4JLAA 1IHOA 2CUNA 1IZZA 3QLVC 2NTNA 2Z5UA 2YTZA 3VR5H 5MFZA 3VNVA 3OUSA 2GPBA 1GV1A 3VYVA 2I55A 2IC5A 5ELLA 1XCJA 3JWPA 2PSSA 4D4MA 4KE7A 1C80A 3PGXA 1PBNA 1EWVA 2QX9A 1DBQA 4OHMA 2VO1A 2XOKG 2DTXA 2VKQA 2XCQA 3I53A 4YWHA 3LF1A 3RIGA 3Q0EA 4DJTA 4YHHB 4DPLA 2YV4A 1S2DA 2N04A 1EB9A 1EA7A 2QYTA 4QPJA 1IJFA 4MQEB 3K70D 4TLEA 3MNFA 4YLGA 1RACA 2NG1A 4WH0A 1L7OA 4HEJA 2VRCD 1CZUA 2Q0OC 1DDIA 1AGXA 4AQDA 5I5GA 1ZHFA 3EZ9A 2XHBA 1ECJA 2IZ5A 1J95A 1CNEA 2MYTA 3BIXA 3F47A 1M0SA 3QOWA 1VKHA 4RMGA 1GUBA 1I7PA 3TR0A 1AKMA 2FPIA 4ESVA 1E5VA 1XHXA 1UBGA 4G63A 3RFTA 4Q7KA 3PHCA 4MVWA 1V7CA 3LWNA 1TKCA 3L7IA 2PSEA 3EEIA 3LWDA 5IUKC 3JQPA 3RFXA 1GZ6A 1U0NA 3LW8A 3ESAA 4EA6A 1XZIA 1L6RA 2J1LA 3A6PC 1TW3A 1GN9A 1XKQA 1AP5A 2EIXA 4XJVA 3PC8A 1LEHA 3VHXA 3DO5A 2GH1A 3QWAA 2IU4A 4M55A 4Q3BA 3HXOA 3PGJA 2A1UA 2PZ8A 1SKMA 5L9AA 4B2PA 2C5FA 2QZ9A 4Q6BA 5DRTA 4KOAA 1SC3A 1ZJZA 4LR3A 4U4AA 2C58A 2E5LB 3KZNA 1Z88A 1KZ7B 3KCYA 2VDPB 2WSSA 3OLYA 3QVSA 2PMBA 4FI3F 3KFXA 4M0UA 5TARA 1OROA 4O63O 4W5JA 2X6CA 1ZN8A 3EHDA 3H2YA 2P91A 4KN8A 5C93A 5H81A 3RJZA 4DDHA 5JOQA 1A77A 4FFBB 1WUHS 1YR7A 2WPDG 2L17A 4EY7A 1VE3A 2SNIE 2HJSA 2VJAA 4IRMA 4AWXA 1JJ2U 5C8XA 4J7ZA 1IN6A 1WXFA 1VI5A 1C3EA 1XN1A 3R4VA 3SZOA 5ALVA 2MCFA 1IHYA 1P75A 4A1OA 4DUZB 1NW4A 1N5OX 3N6VA 4KQFA 3K5WA 4AG3A 5EWJB 4EG8A 3VYWA 4G65A 2ZUSA 1AVTA 3IO5A 3LQQA 4WKOA 4BVLA 3W4KA 4DLVA 4OQYA 5MGBA 4NENA 2J31A 4QGBA 5DCLA 2JGKA 4EI8A 3U13A 2C4KA 5COAA 2YYAA 2CZQA 5K5EA 3NDBB 4PSAA 2DHDA 1BCRA 1ZNYA 3OPNA 4RADA 4W1QA 1NYTA 5BYBA 3ETEA 3RJMA 3CMEV 2BGRA 4EFMA 1UJWB 3JZFA 4URXR 4K81B 1ZM4A 3S2GA 3K9QO 2EX3A 4CTNA 4R8KA 3K1TA 4TS3A 4CR7A 3X2QC 5HGXA 3H16A 4GVLA 4WFEA 3IDAA 4YVFA 5H70A 4BW9A 5IM4A 3CX4A 1JU9A 4EJFA 2FMFA 4RTSA 1R6DA 4QSHA 5KNDA 4ZI7B 1MV5A 2CV0A 1XNQO 1NZDA 4AKTA 1SNYA 2BP7A 4W5OA 3D1JA 1JHYA 1KJWA 3WL4A 5ESRA 3RIXA 2YFKA 3C3AA 3PYMA 1Z0IA 3EWNA 4H2DA 1JV2B 2K2WA 1MC5A 4EF4A 5A4DA 3BXFA 5KREA 3QTBA 4EX7A 1TA9A 2AXPA 3HBAA 1LDMA 4IBOA 3AT1A 4RAQA 5E6SB 5E3IA 1NJ1A 3H4MA 4BN5A 1JEDA 4DV5O 3RF7A 1LDBA 3MB5A 5DI9A 1MTZA 4TV8F 5DTEA 1EFKA 2IYYA 1MIOB 3P9IA 5GIOE 1Q11A 2QLLA 2FK7A 3GJ5A 4HO1X 3P8ZA 1L1RA 2DBZA 2CXQA 5H8WA 1H65A 5FWYA 5L6LB 1II0A 1XLUA 1MB4A 1MXFA 2FR1A 3LPLA 4RA6B 2BYTA 5KYUA 2DC1A 1GCAA 3RBZA 4OMDA 3A9CA 3DQPA 1F14A 1ULTA 5FADA 3HV2A 1M5IA 4A9AA 2KSDA 4FM2A 1O9GA 1QQ5A 3HCCA 1J2EA 1CK4A 5BNTA 1YE3A 3ONEA 2FW6A 3FSRA 3T15A 1N2GA 3OJXA 3VVLA 2F1KA 4AI8A 1UX0A 1Y48E 4YXWG 5LXTB 1L4UA 1OZHA 5LQRA 1TAUA 3HY4A 1N8KA 1ZMRA 2YHSA 2Z3ZA 4J0QA 1KJIA 3D8BA 3L8HA 3SJBA 4FHZA 1K27A 4OFWA 3ZV5A 5ICCA 3MPZA 1A27A 1IPHA 3NOVA 1AQNA 3ZJUA 2KG7A 1XHEA 2HJVA 2VDWB 4MDHA 1XKXA 4RMNA 2E0IA 1NYQA 1X42A 5ADHA 1QYVA 3QZUA 2Q9LA 4LNHA 1Q1AA 2Q2OA 3DEFA 3EDYA 5HDQA 2QR4A 4B76A 2FPMA 1NVEA 1BWSA 1F12A 2PWZA 4A15A 4POAA 3ROEA 3TOZA 2I8AA 1AHIA 2DYSC 3ELDA 2AS0A 3KE9A 1BA2A 4MKFA 4OUDA 3OHSX 2V97A 4LYFA 4OH1A 4PBTA 5MN4A 1JQ5A 2AUNA 4F4HA 1R18A 4PXAA 3DFUA 5BZBA 4YAJA 5CG1A 1M2JA 3LHFA 2E75B 4G8JA 4QQFA 2AW3A 3VDRA 4LOLA 4DUGA 3KCXA 1IZ9A 4J9ZB 2G38A 4LVCA 3WMWA 1G2IA 2BCGY 2IOFA 4TTAA 5JWOA 3FI9A 4LJRA 5C7OO 5HMMA 4AJPA 1FFTB 4Z4FA 4C76A 4XVHA 3GJ7A 3QOXA 2GDZA 3ECCA 5LLSA 3SMQA 3V7UA 4GKBA 4OHYA 4WFHA 2C4WA 3MWDB 2VWKA 2AUMA 3DGEC 3T4PA 2OGTA 3CF2A 1T0HB 1F51E 3B9QA 3O3NB 4PA4A 3QKWA 1FJHA 1UODA 2XZLA 1KI3A 2MSDB 3NBKA 1FEZA 1GZSA 4HDQB 4IMJB 2QD3A 3M49A 3F8TA 1R0BA 1AURA 4I1OA 1AH2A 1TT5A 1WUTA 2ZPAA 4RQEA 1XQ8A 4TTJA 4LZPA 3IH5A 1G7CA 1HC7A 4P5DA 4C0LA 3AVOA 1ZOIA 1M76A 2IRWA 1FDUA 3GT3A 5ECWA 3CH7A 5DZSA 2ZWPA 3F5FA 5B58C 1UINA 3D3IA 2MK3A 2JH9A 3CUSA 2EP5A 3PP8A 1CEQA 4BEVA 3IPAA 4ZP1A 1UZLA 2A0UA 2QAIA 7ADHA 5L95A 1RCUA 3O8DA 1KDTA 3P2IA 2H9YA 1JR6A 2B4KA 4OFBA 5AVUA 2AOWA 4BFWA 2OO5C 5BT9A 2EKBA 2AQHA 2JRCA 1YVWA 3LQ2A 4DBZA 2J4CA 3ICPA 1E0KA 2DF8A 1KU6A 1TVEA 1XEXA 5HCNA 4C7BA 1VMIA 1Q0TA 4EYKA 2C1XA 1SVSA 3PENA 4MB0A 4FIZA 1JJIA 1VA4A 1N77A 1A4UA 3THYA 4P36A 4NC9A 5BRNA 2CMFA 3HKDB 2EWMA 1S72V 4CZ2A 3O1JC 2P1DA 2YBDA 1H2GA 1A7UA 2GCOA 2Q3CA 1DLIA 2VQDA 3CR7A 3PNYA 4TQ9A 5DWVA 4DMCA 3QE2A 5K3BA 2B8EA 3E1SA 1H2SB 1Z0KA 4TMTA 4HNQA 5DBIA 3F2VA 5BURA 1MUUA 5SZIA 1JJFA 5JATA 4GYKA 1LTQA 4K9PA 4FPXA 4UEOA 1OIXA 2QMZA 1H5QA 1Q15A 1UAGA 2ADOA 2QVLA 4YFYA 3OC0A 4Y6SA 4BO3A 5KA6A 3CX6A 4ENUA 3V4RA 4JITA 4Z4EA 4RL4A 4OQQA 5AFSA 2YXNA 2YHIB 1JIVA 4XJSA 1KH2A 5PGMA 4AMYA 4C4OA 3K9HA 1S8OA 4DHWA 2Q4BA 5KWEA 3AL0C 3AG1B 2B0CA 2YC2C 1WSWA 3V8BA 1DO2A 4ZI7A 2AWOA 2LDBA 5HFMA 2AFHB 2ZB4A 4PO9A 4Q3KA 3WWCA 1VHLA 2BFEA 2Q28A 2AFIA 3ASOB 2FRVA 1TQHA 2FZVA 2JVKA 3GARA 3JYPA 3KWJA 4IOMA 2ECOA 1ESDA 4NOLA 4MTXA 3CPHA 1DBVO 4WIAA 4TRNA 1E8MA 3NYWA 3FKJA 3MSCA 3AQIA 4PM4A 3OFKA 2ZNJA 2JGIA 1ZUHA 3INNA 2XYRA 2AA3A 4DL9A 4XOIA 4RD3A 3ZD6A 4BOYA 1YSBA 1UFOA 2Z56A 4X45A 5D6NA 2ZXEA 3L9DA 4CM3A 3A3PA 3RIYA 1ZAKA 3ZE9A 1Y3DE 1TT5B 3TVTA 1I7LA 4F8EA 3ISJA 2ZRFA 1EP1B 4MW5A 5A71A 1L5HA 1A71A 2OZPA 1CVRA 1B23P 3M6VA 3PR1A 4FGWA 4HAVA 3LFUA 3DGEA 2FH5B 2NTYC 1ES9A 3ROPA 4HYTA 2HVKC 4LYDA 4JDUA 2JAWA 5LMNB 4NPCA 2AWNA 2F4VB 4XCQA 3IAFA 2PX8A 1BDMA 3FCXA 3STUA 1O96A 5ALIA 4DA8A 3ND5A 1Z0UA 1TJPB 4UOZA 2OY0A 1SCBA 5HNKA 3NHAA 3U11A 3N2NA 1K5DA 1JFFB 2VQFO 1RWXA 1J56A 2JIBA 4PHZA 3IRVA 4IRUB 5AVXA 3GLIE 4MUEA 4JFRA 3SX0A 3CT4A 2HD4A 5LOVB 1LSOA 1SK9A 1I7FA 1N6IA 4CCAA 1RRKA 2VC2B 1ZCFA 2D5CA 1IMJA 4O8XB 3ICXA 1P39A 4QBFA 1L7NA 3SEZA 4YMVA 1DBPA 2QL6A 4G0XA 3SC2B 3ZDBA 1ENZA 4NH4A 4S2EA 4DGQA 4I1PA 1PIWA 1YUMA 2NGRA 2XT0A 2OO5A 3C3KA 1UMBB 5ALZA 4DYHA 2RN9A 4PIMA 3SXUB 4UTRA 1VQ7V 3O83A 4ZQIA 1JXOA 3B77A 1DRWA 3IMEA 3CZCA 3K9GA 4EQ6A 2DHRA 2DG2A 1NG9A 4A6EA 2EZUA 1N7IA 4AQYB 5BSUA 4INOA 2OHFA 4HMQA 2H5JA 3HBJA 4GRAA 3MPOA 1QU3A 1FAFA 3KPWA 3Q4GA 4N6OA 2PY6A 5LYJA 1G5HA 5F2VO 1YKSA 1M66A 1YNOA 2PD3A 4G84A 4J1NA 4LRYA 4IZOA 3H1GA 3WKEA 3V42A 4G4SP 4YJFA 2LCIA 3JALB 2C5BA 2DTDA 3BULA 3EIHA 3MQ2A 3OZEA 4HGOA 2Q1XA 1YC5A 2CXOA 2IX3A 1A9SA 1KJYA 1XZBA 5KS2A 1R15A 4IXDA 1KZ9A 1VC2A 2JHAA 2PI5A 1C3XA 1RT9A 1T0PA 2V7GA 2YFQA 3JS5A 3LIPA 2C20A 4FEYA 3Q8KA 3L7JA 3BPZA 4ZEXA 1E2EA 2BGTA 4NBUA 4TLAA 4XUGB 3BL6A 4E2YA 3OCWA 2QVZX 1BD4A 3PPIA 1TL7C 1UC4B 2P6JA 1SUCA 4F3CA 4OM7A 3OURA 5EWMA 3B1XA 2N47A 1JEAA 2WHPA 5B66Z 4HTFA 2GK3A 3ZDCA 3DHNA 2GD1O 4B6GA 5C8YA 1TCBA 2DFKB 4LMBA 3NIWA 1JYFA 3BQ9A 4KXFB 1K1EA 4NXMO 2WT8A 1TW2A 2PTHA 1K08A 1SVKA 1LQ2A 2AR7A 2OZKA 3L9XA 4EGQA 1W49A 4GUAA 2FB5A 3CC8A 4Q20A 4RO2A 1S76D 2IIBA 2IT1A 3PD7A 4V0LA 4B8ZA 5JS1A 4CH4A 1K3EA 1HNXB 1FU4A 1KYQA 3NAQA 5KHKA 2FSVC 2BRUA 3RFVA 1J07A 2ATCA 3ZDRA 4YI5A 5I4IA 1YMQA 2YHUA 4M22A 2W6ID 3NC1C 3PEEA 3TOCA 4PEVA 5IN4A 4G85A 1QGUB 1UOPA 2QRVA 4FOPA 3MCWA 1P81A 3WGHA 5JI3E 3DE3X 3B82A 1C7QA 5JJJB 1KC1A 1JXAA 2UYOA 2VFAA 1IPEA 2XWBF 1FMCA 1NP6A 3DPSA 3IP7A 3MAGA 1P1CA 4HRXA 3QVWA 4OHWA 3ROFA 1GGFA 1E1RG 3ANYB 4FW8A 2ZZKA 4CTJA 5I7FA 5KYWA 1GM8A 1CUSA 2PMWB 5EIWA 4DR5B 2HLNA 1HMYA 1Y6FA 2KJQA 5SV2A 4GGPA 7MDHA 1MOPA 3O4IA 4B4WA 3QNWA 4RFSA 4NENB 4H0CA 4X71A 5ULLA 3SBXA 3E3MA 1C9MA 1T2FA 2P7TC 5AW4A 3JR3A 1NQWA 3HV0A 1WULS 3AZPA 1AS2A 1UPTA 2JKZA 1N5JA 1TIKA 1TMGE 3L93A 2Q3LA 4NV3A 4XEHA 2OQRA 5AVSA 3E9EA 4AJ9A 3FGNA 3BMCB 3LLCA 1DF4A 3NGMA 4ZOQI 5ABPA 3GCWA 9LDTA 5HW0A 4YPOA 2PLWA 1EN4A 3DBRB 3DG9A 3KTFA 3OJFA 1CS0A 3T4XA 2D0DA 4TM8A 3U19A 1EUYA 2JANA 3KOWA 4HYOA 5EVJA 2PT6A 3FSEA 4K88A 4FWTA 3UXYA 4EPRA 1RHMA 1YB1A 1YAHA 5FB3A 4DRZA 3AFIA 1J20A 2GJKA 1CY7A 2HCJB 4LRUA 4OQXA 1Z75A 3UJBA 5TQ2B 5KU1A 3W7TA 2AXNA 4QJIA 3ABMC 2YZ7A 1JQBA 2C5AA 2OCKA 3HB5X 1QZXA 3M2PA 2Q5OA 2WYHA 3OFJA 4WQMA 4YR7A 3T61A 4MV3A 4EA7A 3W1EA 4YJ2A 3W7XA 4MHSA 3CCEV 4RDIA 1FFSA 5FTWA 4MV0A 2ZGVA 3PQ4A 2F48A 3MJHA 5CBHA 1ENOA 1RM5A 3K32A 3P4YA 4BKPA 4C4SA 2V4DA 1Q95A 4KFCA 1AQ6A 1E3WB 1N2SA 3OOJA 1G20A 3WHIA 1PDWA 5EZYB 2JLCA 4R40A 3U48A 4EITA 3IX7A 4BVKA 1PJZA 4P9NA 3D4IA 2FDXA 4B3SB 1BMDA 3IA2A 3SBDA 2F2TA 1X8XA 3WAJA 2WLLB 1CUBA 2FMKA 4E5YA 4X20B 4ZKIA 2LJ2A 4DR7B 4FCTA 1MDFA 2HN9A 3CGWA 1M3SA 1I4OA 2X19A 3TQRA 4NBVA 3BVPA 3SZRA 3UTCA 3EXFA 2FHPA 3B2EA 2ESRA 3OTIA 3N7UA 1V8ZA 1J8YF 3V1UA 3D36C 5JAQA 3EDCA 4IDQA 4RHFA 1A96A 3CCVV 2B92A 1TF2A 1P8AA 2BH9A 2XBUA 3HCWA 2QM8A 2IW1A 5HSGA 2EAUA 2PWYA 1Q2UA 1X70A 1VHDA 4L9RA 1C2TA 3EUFA 4EYQA 1M4UA 2P2SA 4YP7A 4C43A 1LJLA 2BDUA 2CBZA 3QXCA 4UUQA 4MPDA 3UMYA 3QVTA 2PGOA 4IDAA 1ZVJA 3M5WA 1WR8A 5F1YA 3DOOA 5LR6A 2OM6A 3ANXA 4LD2A 2QU7A 1XQ1A 3UICA 4GOJA 1Z62A 1ULHA 1XZMA 2P35A 1R5NA 4M1ZA 4IHKA 3APOA 1R6XA 5LGNA 1QGAA 1W76A 1ZD3A 2GEUA 4I46A 3WDKA 4MOWA 5AKYA 5F5NA 1LJ8A 1WZ2A 4F3RA 3STLC 1XTVA 2D2EA 4OHVA 4EYGA 4IIYA 4LC1A 5DM2A 5CX1A 3PVSA 2C7VA 3LXRA 1UAYA 3H86A 4YK7A 4CTKA 1ZICA 5CDYA 1AI5A 3RS0A 4LFBB 4DM4A 5AW8A 3JVEA 2BD0A 4JD5A 1PV0A 1F4NA 5C80A 3TQSA 1GSIA 2GM9A 2XVYA 2A5GA 3WIEA 3CH5A 4K9NA 4RPLA 3WLSA 2ZJYA 3Q9NA 1IBLB 4W4TA 3H0CA 1HYBA 1F2VA 4Q02A 1J25A 4UVGA 3U56A 3PTAA 1X1EA 2RH9B 1QE3A 3BH7A 4R84A 4Z4QA 1CXZA 3JQDA 1SBHA 1MAHA 2PYZA 3N8DA 3OZXA 5GY7A 3U62A 3W3ZB 1EX1A 4A8TA 3HSYA 4DCMA 2VNIA 3IJ5A 4EMBA 3FCYA 1JEOA 3ZHSA 1AC5A 1GFIA 3GROA 2ZIFA 3F78A 2ATXA 2PZAA 3QOYA 1N0UA 1G2QA 3LX5A 4ER0A 2R8BA 1Q92A 1XZNA 4ZV9A 2QN7A 1L4YA 2Z6VA 3PU6A 1N8RW 1W4ZA 1KY5A 1ZESA 2F8MA 5D01A 5ALTA 4D57A 5CU7A 3HR4A 2H4JA 2R11A 2VSFA 4LOKA 4OL9A 4NBKA 4UM9D 1TI7A 3QF4B 1VJGA 1Z4KA 1VLZA 3T5AA 3OTFA 1JJAA 2FZLA 5TX7A 4K8ZA 2OIGA 1DJOA 4KXUA 2YOHA 3NJ8A 2TYSB 4P33A 4F4LA 2CJFA 3KSAC 3HI4A 2NNUA 2IVFA 2ZS8A 4MLCA 4GLXA 1PR2A 3CJQA 3BWCA 3IUPA 3JQQA 1FDTA 3QEMB 4IIUA 2Y4TA 3CPSA 4AZ0A 3GOHA 4KE6A 1ZNWA 4RY9A 4XB1A 1U8XX 3EZ2A 1O97D 4E94A 4KVAA 1Z73A 4DV1O 4HH3C 1KVSA 4YRSA 3N1UA 2QG4A 1ROPA 2OFOA 1Q16A 3ETHA 2JRIA 2R86A 2C2ZA 2YWEA 3GUYA 3R7BA 2D0IA 1PFWA 4A36A 3U0VA 2JZNA 3HQ4O 3O2NA 3GLTA 4L22A 2W2TA 1GGJA 3I04M 2QXYA 1XTQA 2WB4A 1M67A 2ZJ5A 3LQYA 2VPWA 1SELA 3PTZA 1XG5A 4GM0A 3T1TA 4GI2A 1WIWA 3C70A 4XWOA 3BRCA 3VI4B 5B3AA 1EZVH 4BTLA 9MHTA 1ISGA 1PR9A 1RLJA 3AKYA 5C7IO 2JLUA 5JI2E 1GIAA 3BWXA 2AHYA 3M5PA 2N75A 4LIPD 4B45A 4KQMA 4PZLA 1PQUA 3F4BA 3CZQA 2PYLA 4CF6A 4I50A 1LDNA 3RUPA 3UK2A 4US2R 2QWPB 3L70H 1JEJA 2FSHA 4NXNO 1QFJA 4J4BA 4KACA 4P3YA 3RFFA 3AJAA 1S3JA 5JZVA 4Z7OB 4GMKA 3DNMA 5CVUA 4UDYX 4QUGA 3ROGA 2HJWA 4GI3A 3EX7C 1Z74A 5CG2A 1MP0A 2PUJA 2PYDA 4XDHA 3TNYA 4BFVA 2XITA 4PHTA 2ZTVA 1SKYB 3KZXA 2EQ5A 3A3YA 3CG0A 1L5NA 1KL7A 1L4MA 3SXUA 3ZBPA 5UKDA 5J2TA 4DS3A 3CCJV 5E8JA 2SICE 2DFNA 4L8LA 1NC1A 1W73A 4C4TA 1M6EX 2DKOA 3CX8A 3OE7D 4GYJA 3RYHB 1R5JA 3G23A 5IAJA 4DDMA 5J1SB 4UKDA 1RP3B 3F3SA 3MWYW 5EHQA 3ZVLA 1M2OB 4C0HA 3O26A 1W0KG 3TLEA 2WINI 3QYFA 4KC0A 3KYDB 1XZPA 3EHEA 3NAMA 2ZTUA 1RP7A 3LGXA 4JVOA 1WWRA 2FEPA 2X5XA 3RT1A 2FNAA 2GCNA 4RVGA 3UAVA 1RWPA 4E11A 4EABA 3ZOKA 3LHSA 3WKBA 3ELUA 2IHYA 3EPJA 4E2ZA 4M1TA 4LY0A 3U5TA 3LY8A 4X1YB 5KAMA 5HTKA 4R2WA 1UIRA 3Q3CA 1QQCA 3OBBA 2J48A 4N0QA 1QUEA 2PGXA 2QMOA 3K04A 3AUXA 4TYPA 4JMLA 2IV7A 4WADA 3TIXB 2WBLC 1C0PA 4XX0B 2GCOB 4JQYA 1WB5A 1C1HA 3VYRB 3AERA 4PSVA 2Q0QA 5I6DA 4IS3A 2XEDA 1TUEA 3WGYA 4BIZA 4BC0A 1E1QG 1X7XB 4ZN6A 3EPHA 1HV8A 1ND6A 4LA4A 2ZIOA 2Z95A 5KSYA 1ISRA 3K4HA 1WDKA 4MWGA 1K0FA 1X94A 2QMYA 4XUDA 5DX8A 4RETA 2K7ZA 1KVRA 4EHJA 2IGTA 2JA2A 4EJSB 3OKCA 3FYHA 4HN9A 4HATA 4BVFA 4BEWA 5JQGF 1BMFA 3K0KA 5SZKB 5CJPA 1L5SA 4U02A 5AHXA 4UVHA 1P33A 2L69A 4EY5A 4XIGS 4JTCB 3U6BA 4LV5B 5KKNB 1H22A 3F5DA 5EJFA 3G0GA 5CX4A 3S8YA 1HNWO 1L7PA 4RV9A 2RD2A 1A1VA 4I43B 5KOYA 3N5KA 4RM2A 2O1WA 2GS9A 3B8MA 4OLAA 4FOLA 1BG6A 3FPCA 1OOEA 3QO5A 5CA1B 1QLHA 2XOXA 3VNAA 3ZLTA 4B5KA 3T7EA 1SOAA 4OI1A 4C88A 5BUSA 3RYCA 1AUQA 4PCLA 4QPJC 2JZOA 4WFIA 3EF1A 1ULUA 4JASA 3SYCA 5JQGA 3FHJA 4RKWA 3SSAA 1L5YA 1YIDA 2DAPA 3W3AA 4DLWA 5JNUA 1GADO 3KKPA 4OGLA 4ZWNA 4Y0AA 2X6RA 5F23A 3PC7A 1XTZA 2PU7A 1BH6A 1QE5A 3EFOB 4KBGA 4LXYA 4WLFA 2BLNA 4MGKR 3UGKA 4EHAA 1V9CA 1PEAA 1TUGA 3A7DA 2J08A 2RGBA 1FE8A 4XSHA 3O3CA 3HR7A 1TJYA 3MB8A 2O3UA 1C8BA 3ZQKA 1V11A 4YUYA 1F2TB 2JD2A 4DV7O 1IZ7A 4ICGA 1QIFA 1IBMB 1QX3A 1YONA 3A05A 5EUMA 4BC1A 7YASA 1Y8ZA 2I22A 4MTCA 3ILSA 2BR4A 4ZU3A 1ZIYA 3AUYA 3U7QB 3ENQA 3RTEA 3GNQA 5KOIA 4WZAA 1IHPA 4W5QA 3MLBA 3PC8C 1B00A 2F1RA 2IODA 2GAIA 2WOOA 4UUBA 1YIAA 3UMVA 2DUMA 2FWNA 3KYBA 5AVRA 3DW1X 3BF7A 1JAYA 4O5OA 2OAEA 1HZJA 4TVOA 3PN1A 4F56A 4UEKA 1F1BA 4WPGA 4X1OA 3U4DA 1V16B 2KCQA 1V9LA 1KR2A 5E0KB 5JS6A 4MARA 4GPZA 1RPRA 2A9KA 5EWLB 2QG9A 1O3YA 4MIOA 4CKEA 1Z3AA 3FDZB 3ZLVA 4RA9A 1S0UA 2NSLA 3ZMZA 1DKPA 4ZQBA 2HQRA 4OJKA 3ZBHA 2WRZA 4WXHA 2YXLA 2WF6A 3NDPA 3DV0A 5F9MA 1GNQA 1NLUA 2IS4A 3KSZO 2QAGA 4ZAYA 3T0GA 2R7MA 5IVIA 3INGA 3GNLA 4D0NA 3IGAC 2QJRA 4F8YA 2NYAA 1P72A 2O05A 2RHLA 3HDHA 4TSFG 4QJFB 1XZEA 1H9BA 3VVCA 4B0PA 1XP5A 2X9NA 3SQDA 1QO9A 2QN9A 3DLCA 3KQYA 4DSZA 3OT4A 1PZGA 4FHCA 5CYFA 1OLUB 2HLPA 1WKBA 1G66A 1T24A 2XEXA 4AB1A 4MWTA 4TYYA 5HP4A 1GZ4A 3EXG2 5EPUA 3UCFA 4LX8A 1OU4A 4LRSB 4C4YA 1SXJA 1HURA 1N2CB 2HXSA 5AKGA 1WNFA 3VV3A 1CYEA 1L1FA 1H2LA 5KU7A 3BN3A 5A4JA 2UV8A 3HU5A 3R76A 2PL1A 1SKYE 4BATA 3MUNA 3I01A 4FR2A 4EB8A 3RFCA 1RLTA 2PKCA 1E6MA 1KK2A 2IUFA 4G0PA 2LGWA 3LJKA 3K71B 5ESXA 3I5YA 1YJ9V 1T8TA 2FZGA 1LPBB 3F3MA 5BWMA 1NN0A 1UJ2A 1X3SA 3OOHA 4D9GA 2O3SA 2Y1CA 4MR9B 4X41A 2GPNA 1PNVA 2FZWA 3IUQA 3L7BA 2QG6A 1E7SA 4FX2A 4OHCA 4FYVA 2CSXA 2PUFA 2X0NA 5G40A 1BGYH 7AT1A 1YS6A 1VLMA 2ZSIA 5DLPA 3UO3A 3OCYA 2R4UA 3BK2A 3RVSA 3T5MA 1JJBA 1K66A 4KREA 1P49A 1CR2A 1OT3A 1X2EA 3EDQA 5DN6D 2W6CX 4R3WA 1O6ZA 4EUNA 1WXEA 4EY8A 2Z3JA 2YHBA 2H3HA 4BV9A 4MYUA 5LIPA 3FM9A 1UKBA 1H2XA 2P3QA 2PS9A 1CP3A 3TW6A 4ZO7A 4D8VA 4QTUB