2B1GA

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Structure-based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 208
structure length 590
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2b1gA04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2b1gA01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1gA02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1gA03
2IU3A 1C30A 1PKXA 1T36A 3ZZMA 1P4RA 1ZCZA 1A9XA 1C3OA 1BXRA 2B1GA 1S89A 1PL0A 4A1OA 1KEEA 1B93A 1M6VA 1G8MA 1JDBB 1M9NA 1THZA 1CS0A 1CE8A 1EGHA 1VMDA 2IU0A 1OZ0A 4EHIA 2YVQA 2XW6A 5H3LA 1WO8A 1IK4A 1S8AA 2B1IA 2X8WA
chains in the Genus database with same CATH superfamily
3ENNA 3NT2A 1ORDA 1OX7A 1OV6A 1FNDA 4Y0AA 4TGLA 3GF4A 4URYR 4X0EA 5TNXA 3O1JC 5JARA 3SF0A 5BYKA 1FFBA 3FYHA 1VCOA 5D3QA 4YS6A 3QF4B 1X1TA 3JQRA 2Q5JA 3GL9A 1FC0A 3DDZX 4B3RB 2FCRA 4NFSA 4Q1AA 1MVLA 5PNTA 1K8QA 2QM8A 4YBZA 2I3AA 4PLVA 5D5HA 1MG0A 5JJIA 1U8YA 1AKUA 3TJTA 3MLBA 2Q41A 1VLQA 3K1JA 4G0OA 2AZ0A 1FTNA 2ZWAA 1FXKA 3P9CA 5EWLA 4AX8A 3EDQA 1W25A 5JJCA 1OCZB 4BJHB 1IM5A 3VPBA 1AE1A 4CF7A 4EIWA 1DBPA 1U0SY 1FYEA 5A5DA 1SQPH 3U13A 1JHYA 1KECA 4EYSA 3VU8A 3ORSA 4HEQA 1XEFA 3WWZA 2P6OA 1GDHA 2PZBA 2ZXWB 2HLHA 3QA3E 4FM0A 4A0SA 2ZI4A 4PVDA 1NXSA 3ZWMA 5AOAA 1Z5GA 2WTNA 1H2NA 2JAQA 1BDBA 1UEXC 4M6WB 5G1PA 4WVFA 3T7KA 3JPYA 1EK5A 2WB4A 1U9IA 2JLSA 1I94O 2O2DA 4G6ZA 5EQJB 2VS0A 4XLLA 5FBZA 1FFGA 2WSSD 4IGAA 2C2YA 3N58A 4LXIA 3KQKA 3IX7A 3CO5A 2JJ1A 1AQJA 3LOPA 2PY6A 2PFSA 3EG9A 5FWNA 1O8BA 5THQA 3O73A 2E4UA 2QRLA 1VHQA 5KPJA 4EEXA 1N2JA 2EF1A 1U9ZA 3RC3A 1U8AA 2DOKA 5C2OA 3T54A 3B8HA 5AYVA 3EBLA 1HV8A 3ZTTA 1M2VB 4G5QA 5C7LO 4A73A 3SZMA 5B1BC 1LW7A 3FFBA 3S2IA 2WJPA 4OCMB 4LX8A 4JC5A 4MO2A 4TZTA 4UMFA 3USZA 3COYA 2VJAA 5BZBA 3CLKA 1SPXA 4GGMX 2J5KA 5A9TA 1K0UA 1GG2A 3I5DA 1R0LA 3H9GA 1KRWA 1DV2A 5JS6A 2XNJA 3JARA 2L17A 1PV1A 1ZUD1 1M2FA 1DUVG 2QP4A 4AURA 3O0DA 4Z4IA 4BMVA 3L8YA 4RF4A 4N1AA 4X8MA 3LCUA 2LKDA 2C5BA 3OSZA 3EVFA 5L3CA 2G1KA 4I5EA 3QVTA 3ZJVA 1JJ7A 3TZQA 1OWLA 1EJ0A 2WKWA 2WMDA 4I43B 1CZLA 3WYDA 5G53C 3LPCA 4G5XA 5DTQA 2AMFA 1NMEA 2Y69C 2YCLA 3W34A 2DFLA 5I7SA 5HZGA 1QP4A 3ETEA 1E3QA 4ML3A 2EBWA 3S6JA 3EQZA 3PC2A 2WJWA 3R7BA 1E9VA 5CT5A 521PA 4G67A 2B5WA 3RT9A 5F7ZA 3QE9Y 1UUFA 5B1HA 3FOEC 4CZZA 3HVRA 2B3JA 4GBMA 1U0EA 5SICE 3NONA 1XGKA 3D6VA 1EDBA 4FKMA 5FBWB 4TMKA 3N75A 1BXRB 4X3PA 3CJHB 1SQGA 1OLOA 1FJ2A 3D7NA 3TZ6A 1OH6A 1SEVA 2Z3IA 4IFBA 4X60A 3I34X 2V96A 3C1OA 3P9ZA 3V7NA 2I1WA 1UMKA 1DBVO 3OF5A 4K9RA 4EB6B 1VYHA 3WDMA 3U44B 4FCVA 4LOHA 4L4YA 1XZIA 3ZIDA 2O96A 3EVCA 5E95A 4I1YA 1XZHA 4MAAA 1NW4A 3WMXA 4HGOA 4J16C 5B37A 3EQ8A 1SURA 4YUXA 4Q7MB 2XNSA 2D7JA 3H9EO 3ZIUA 3LT0A 3DXRA 1KL7A 4WD3A 5IJWA 1ACLA 4YJHA 3Q3VA 4E30A 2CH7A 1NZFA 5KYYB 2CLFB 2IZ7A 3STVA 1J97A 4RYLA 3PI6A 3OU6A 1OWMA 1JR3D 4LE2A 5EESA 3NATA 2CXUA 5LC1A 1YF2A 4UDYX 3TQTA 2W2PA 2FRDC 2B92A 5FA6A 4HDSA 2ISCA 2ZZMA 4JVLA 1Q0QA 2Q1TA 4MS4B 4JUAA 3QFFA 2B61A 5ALTA 1CUXA 3HXOA 1TE2A 2QTAA 2CGOA 3TOXA 3Q12A 3UWPA 5FADA 4C14A 2ZRGA 4G63A 3ZWAA 2W2KA 1B0ZA 3JQ9A 1G4AE 3CTMA 1Q17A 1XYYA 3K92A 3IVCA 4TKZA 2FKXA 4F3RA 5EMJA 5BW8A 1EM8A 1XVTA 3RJTA 1KYZA 1DGQA 4EW6A 4Z86A 1NX6A 3J7TA 3DFIA 1GTRA 1L9XA 4YREA 3DKKA 1UBRS 1GPJA 2Z6QA 3DM5A 2VZLA 3LDEA 3PF9A 421PA 3E9DA 1O3YA 2DQZA 4NVPA 2QT0A 1XMOO 4TMTA 3GMTA 5JAUA 3I09A 3UKDA 3TUZC 3WG7B 5EYPB 3OP4A 1FE8A 3UXMA 3I6MA 4HDRA 5JXJA 2GN6A 2PU5A 2DQKA 3SFTA 3PXGA 3WLEA 1RJGA 1I3LA 4OXIA 1MABA 4XX1A 2UYCA 4JJ4A 4P6VF 3THXB 3BPZA 5IT9N 4GF5A 5LQKA 1KMIZ 1M2JA 4H31A 1OILA 5H3LA 5ECGC 3NORA 3RV4A 2ODQA 3BFKA 1Z0UA 3U7EB 5B2EA 1UPAA 4UD2A 5JSYA 2Z4RA 1AH2A 3DMFA 3U7FB 2XUFA 2DKOA 2HVKC 4KW7A 4ZAFA 3U3MA 4OA5A 3DR5A 1NMZA 2PGOA 3OOHA 3BHJA 1ZH4A 4ETWA 5G2OA 3QYFA 4BPRA 2GH1A 5ADHA 1ZGHA 2J9ZB 1MW9X 3ELUA 1PYGA 2GAIA 4BWYA 4F1KA 2DHEA 4MVJF 1PEAA 1DKPA 3O2QB 1Y1QA 3CPSA 4HTFA 2CUKA 2WHPA 1W8DA 2WJAA 4CDNA 4DWOA 4D5GA 1CK4A 4OYRA 1UZLA 1QJCA 2IJHA 4OWPB 1UDBA 1ZMOA 1EUZA 4OK5A 2W6IG 3ILYA 2Q8PA 3OESA 1KI3A 1R6AA 4UARA 5BSEA 5TS2A 2GUZB 1EXNA 3L9WA 5LIPA 2YJ5A 4KH1A 2LCFA 3L0IB 4XGIA 1WIWA 1IOZA 3KKYA 1TIPA 3MYRA 4GRDA 3OCQA 1BQZA 1UKZA 1ZKDA 5KYWA 4PAGA 2AFHE 1G8PA 2C84A 2W8ZA 2EEPA 1IJBA 4HZ3A 4B75A 2FPGB 2GXUA 3SMQA 1AVMA 5IC5A 2YOHA 4EYOA 4HUQB 1I10A 1BMDA 2E5FA 3RVDA 4ZV7A 3JALA 3CNQS 2WYUA 3U62A 2YIBD 1K92A 2CVQA 5J4HA 2ONKA 3D1LA 3D1VA 3X3HA 3VQWA 1HDEA 1S3FA 4OM7A 4HWGA 1FCJA 3MCTA 5B5EZ 1E9RA 1M2HA 4CLOA 2I6SA 2VJNA 2PZKA 1W75A 4MJXA 1RWXA 4P3NA 4P81A 3VGJA 4ZDIA 1AQIA 2QSJA 2EVWX 1HORA 1UXIA 4ND4A 3KLNA 3T3EA 2A8NA 5L95A 1PNMA 2V58A 1A9YA 4UNNA 2Y0BA 4RZHA 3T7TA 3LDAA 1SKYB 5KKAA 4ARZA 3CWCA 2E4ZA 4LQCA 1KPHA 4O29A 4RKRA 1AROP 3N28A 1R73A 3BB3A 4WZBB 1O4VA 3DMTC 4ZYXA 1PHRA 2YHUA 4B84A 1L5MA 2MCFA 1NHWA 3ANTA 3I9V6 4K9QA 2ZVDA 5C18A 1QK5A 2ZBRA 4DLAA 1G8KA 3PEFA 3VJKA 1L8QA 4RPIA 3GLRA 3KAKA 1DRVA 2LZ0A 1L5ZA 3H2IA 1KMCA 2XOKA 4W7HA 5IWCA 4WKPA 1TRKA 3UUWA 3A1DA 4PYNA 4ZC1A 4Z0PA 1SCIA 4EZEA 3E9MA 5DN9A 1OZHA 1HDYA 5JDCC 4FMDB 1EWYA 1QLWA 2F2TA 5AHXA 3MSCA 2VDWA 1JVNA 3BREA 2ETVA 1A2KC 4YPVA 2QX4A 4PAWA 1AB6A 2FN4A 4LZOA 4HFNA 1UBNA 4DLUA 1ETHA 1HDCA 3MTQA 1I33A 3BGOS 2QQGA 4QEKA 1FFCA 2G70A 1G6Q1 2CD9A 1N2ZA 2OTLV 4BO8A 5J43A 4LRXA 3ES9A 4YWHA 4E33A 1P7ZA 2OQ2A 3JCZA 2NACA 2A92A 1V2GA 4FWIB 2OCCB 4QELA 1T4DA 1QHIA 3TW8A 2DBRA 4X00A 3IHLA 3H42B 5EA2A 4OHOA 3DEZA 4IF6A 1NYRA 5DHFA 3RABA 1XTRA 3PYLA 4H7KA 3ZN2A 3GU3A 2Y1KA 1T25A 3ROZA 4MKXA 3OT7A 2RAFA 2XECA 3WLNA 1C3XA 3IEXA 3DVSX 1UK8A 2IXBA 2XTNA 4UBOA 3AG1C 4IS3A 4Y6QA 4MVCA 3EFBA 2B98A 2MYNA 2B20A 5BV2P 2YVAA 1OTHA 2VVTA 2WIJA 3G71V 1JSLA 5JALA 3LSUA 1FMJA 5JBIA 1H5QA 2OZVA 4G3MA 5JJ5A 5CG1A 4LCEA 5IP5A 1BFKA 2R6JA 4XCVA 2EJUA 1BWPA 4O5OA 1Q7YW 5EPOA 1CR6A 2QVBA 3T0FA 1V1MA 1FXSA 2QY9A 5HEKA 3ZV3A 2ZTSA 1NI4A 2X6RA 5AKYA 2SCUB 2QRQA 4MI1A 4QHTA 3ZX5A 4ZHSA 2GM3A 2R8EA 2O20A 1ODKA 2ASVA 5HJ5A 1KZ1A 3OOSA 4TWRA 5I5GA 1C0EA 5REQB 5T4FA 5IJ9A 3RROA 1Q0PA 5YASA 4RTRA 2FP4B 4JP5A 4ENUA 4IS2A 3FTNA 4JUCA 4YCNA 3A6PC 4C88A 5K8UA 3EAQA 1DV1A 4Y6GB 5K6TA 5FT9A 2WUGA 3R66A 4QGPA 1RAHA 1YRQA 4J0DA 3I53A 4MR7A 1ESNA 5CA1A 3AKYA 4I6GA 3A0RB 3Q0IA 2LQTA 1E3LA 2QHXA 2XAUA 3TO5A 3UT5A 4A8JC 1V16B 3FPKA 1TUBB 1LI7A 4POAA 3OJXA 4C29A 1OI0A 3N1UA 2GEUA 2FVYA 2Q7XA 3WISA 1E2MA 3ROMA 2YR0A 4KBFA 5C3UA 1XEWY 4R69A 1L5WA 3PXDA 5THXA 3AK3A 4RHCA 4A8HA 2FPPA 2W6IA 4WK2B 3ZHSA 5TMPA 2RIRA 4WVLA 4V2UA 4EARA 1VQ5V 3OE4A 3Q85A 4H0CA 5I4IA 3ZD9A 3LC2O 1XEXB 4LF5B 1DPGA 1V7ZA 2PNFA 2PUEA 3KKPA 1JMYA 4LXHA 4ETIA 3H1IH 2JS7A 4F9FA 2PA3A 2OG1A 5AHWA 4M1YA 3J81N 1RQPA 3A0HZ 1OTYA 5AP9A 2HK6A 4WXHA 2FX3A 2IT1A 3W77A 4ZALA 2FMKA 2BZSA 2G9NA 5C1IA 4F3WA 3T9CA 3I45A 1TAQA 3BCHA 1LQUA 3H5RA 3T1HO 2Z98A 2WUWE 3OC0A 4HRXA 4H16A 2A0LA 5FFNA 4BFYA 1HEUA 3U48A 2ZIMA 5K1ZA 2KKSA 4LC1A 1LEHA 3DEIA 4YMLA 1GIAA 1H2MA 1GITA 1K6JA 1NFFA 4MO9A 4I36A 3EWSA 4NKRA 3D8NA 3K2BA 2WAXA 2JCXA 2DYRC 1RLIA 3TRJA 2C2XA 2O2HA 3NTXA 4NS4A 4UPEA 3H9UA 3F96A 3WRXC 3IVRA 3GJ4A 1V5IA 1EB8A 4WLUA 5AI9A 2RGRA 1HM5A 2ID8A 4NBRA 2IH5A 1Z2AA 2H48A 3SR2C 4ZJYA 2NTYC 5F77A 1SQSA 2KG7A 4DW8A 3IDFA 1X7WA 2EGGA 3FNEA 3ZCQA 3COWA 2XCSB 4OQZA 4LVUA 2CHFA 3QV1A 2NU9A 1VE9A 1FPQA 4J4TA 3REQB 5C1DA 5J4YA 3JASA 4EY6A 2HI0A 4L9WA 4D0RA 5DU2A 4LW8A 2O0KA 3QBDA 2P4KA 4C0BA 3CXRA 2FH5B 1DAGA 1G9TA 2XRFA 4XM0A 5M52C 2AG8A 4UBMA 3R8FA 1KY3A 4HAZA 1DRUA 3ZHUA 1QZTA 3N0XA 3BILA 3LT2A 3WO1A 2QZJA 5KHOC 3B82A 4KIJA 4MV5A 1GVNB 1Y4MA 3C6MA 1G0NA 5H4GA 2IUYA 1YFZA 4YRAA 5AIBA 3KQSA 3M5PA 2ZB2A 4C2TA 2J3IA 3K0SA 1RYZA 4IIJB 4OHWA 3LWNA 1BHSA 4IDGA 2JA2A 2EZOA 2WSMA 4S1NA 4CF3A 2W70A 3CUKA 4F45A 1FFDA 2VIIA 1W7AA 3KFVA 3S3XA 1OJHA 2OY0A 2NTEA 1SWWA 3RV3A 2R7LA 2QN1A 3UCEA 4XPZA 1Y6RA 3IXLA 1Z4MA 3KR1A 2BGJA 1P2FA 3HKBA 1A5TA 4MSJA 1C7ZA 2PL3A 2XIQA 4NBSA 5IDQA 3N6XA 4U7WA 3ZJZA 2C5HA 4JLOA 3ELBA 1PR2A 5KOJA 3QJYA 1NYLA 3GN1A 3G2HA 5LPNA 3OGCC 5FNVB 2PQ0A 3H1EA 2YXPX 3FB1A 4U00A 1NNUA 2E74B 1JPUA 2ZAIA 5I9BA 3SR0A 4KE6A 4KITB 3MMPA 5HWSA 5KKNB 2P1RA 1T1GA 1TZBA 3ANMA 3LGXA 2I0FA 3COZA 5GZ6A 2J9RA 1JU9A 1KO7A 2TECE 2CLDX 3HGQA 1Y6JA 3WWYA 4Q1EA 5KYUA 4BAGA 2JEZA 4QPNA 1EWQA 2PZEA 3GQBB 2IVFA 1Y7PA 4D7AA 1EIWA 1M72A 4TUYA 4HT3B 5JANA 1NLZA 4JHXA 5CYPA 2YV1A 4WLVA 4EA7A 3QVXA 4Y2HA 3BDIA 1SD5A 2VF4X 3F7VC 3QI2A 1TUGA 2P8JA 4EABA 1XLTC 16PKA 1MQ8B 4G24A 3GGDA 1KS9A 1NUUA 1HTWA 1LY1A 4ZAVA 3QNEA 1P5HA 2A0WA 3WJ7A 3U7QA 4WSOA 1UBHS 2GLTA 2UZ1A 4UHKA 1A1SA 4BLWA 1GN2A 1PWHA 4JLWA 3A4YA 3DBOB 2OFXA 1I08A 4BO4A 2WIFA 4XVQA 3UPDA 4ZVPA 3EXEB 5BSVA 2DBZA 4KACA 4DIBA 2I33A 3CZPA 2VF8A 4NK4A 2CLLB 3PQCA 3UJHA 4HLUA 4BAUA 3LVQE 1AKYA 1E4YA 4HXGA 1K34A 2ZRBA 4DSNA 4WGFA 3FAZA 3ZMVA 4OMFG 3ZKAA 4BLRA 2AK2A 3WX0A 2Q67A 3EIEA 2CLSA 1RM4A 2JAHA 2ZRAA 2GCOB 3E7DA 4BFCA 3NXSA 3HMKA 3ABTA 2O2GA 3ZC3A 1ESMA 2DVMA 4Q4CA 5LZ9A 5FFMA 1ZUQA 1G2PA 3IPXA 1RVV1 1P2BA 4ERXA 3RIEA 5CNJA 4AO7A 4UTZA 3KQVA 1SQVH 1CY4A 1T13A 4ALIA 1FNBA 2JGKA 3ZBQA 3L04A 4F5DA 4HR7A 2RGUA 4CN8A 2A9QA 4RK1A 3SAJA 1GARA 3FXAA 3PPXA 4UB6Z 2WYIA 5BN3B 1T5TA 4C3ZA 5CLGA 3Q87B 4G5SA 1AF2A 4PDRA 1MVNA 2LDBA 4II7A 2DXIA 4NR0A 5F7XA 1NY6A 1CZNA 5DBFA 4LQDA 1DX6A 3DDCA 5J59A 2JVIA 4CETA 3FFAA 3TQFA 2OB2A 5AOVA 4JX8A 4FGZA 2FCAA 1SKUA 2B5VA 4BNWA 5DLQC 2ONJA 2LW1A 1RWOA 5H7XA 3N2EA 3T7JA 3AEXA 4XQ9A 5FO0A 5EZ6B 1MNQA 1WV0A 5L3GA 4HLDA 3EEQA 2OHGA 1QLEB 1PR5A 2FUEA 5CJ2A 1IDOA 4F7WA 1UBTS 3EJ6A 3QVNA 3QIVA 1NJ8A 5HSGA 3JRWA 3M5WA 3H16A 2GT1A 2WYVA 3LBIA 1ZVJA 2QM4A 1P1KA 1GFSA 4RHEA 3IPLA 4MEBA 3GQVA 4XIFA 4EHBA 7REQB 4V03A 1QQTA 3VM6A 3CCQV 1WN6A 3RVKA 2ZDIA 4I6JA 4HY3A 3VR0A 2E21A 2D3WA 2PLAA 4TS9A 4M3NA 4LFBO 3EWAA 1A4RA 2YC4C 4I5GA 1NX9A 1P8JA 4E5UA 4DLVA 2PSFA 1GZ7A 1RZUA 3A4TA 1JWBB 1ZSNA 4I1VA 1G1AA 1Z6YA 1C7RA 4M9XA 2H92A 3UAYA 1QHYA 5A62A 3UAGA 2XDYA 2CCKA 3NP7A 4MP6A 2ZTVA 5IT0A 3FLEA 5E7IA 4ZVOA 1H23A 1RRKA 3CE2A 1CYEA 2WMYA 5ESDA 1JPNA 2C9YA 3IJRA 1TVKA 2CMGA 4WW0A 3C5EA 1K5HA 3AH8A 4WZAE 2GILA 5F76A 1Z07A 3L8DA 3LQKA 3HACA 5DGDA 4EKDA 3KYJB 5FEMA 3NQ41 1PZNA 2XHZA 3KTDA 2OKGA 3LF2A 2UUPA 1T6BY 3D0RA 3ROFA 3TF5A 4MULA 3L01A 3MINB 1L8XA 3FMGA 3TLCA 2CGEA 3Q6MA 4NAHA 3LSSA 2F9FA 2R5FA 4RD1A 1MFPA 4P54A 1LC3A 3L9DA 2BFCA 4PPQA 2WAAA 4PDLA 2VEOA 3D8UA 3QVUA 2DR2A 1I4WA 4Q3OA 4CC6A 4LDAA 5LP6C 2Q46A 4KMRA 2RBEA 4A0RA 1CQWA 1A4UA 4OG2A 2YMQA 3T1YB 4NS1A 2Q9LA 1HRDA 4IDNA 1M2OB 3TZKA 1YZNA 1RWQA 3A7EA 3CO0S 3BQMB 4FMBB 4TWZA 3TXQA 2NN3C 4I50B 5HHTA 5DLPA 1OI4A 5H5NA 2VTDA 3CUSA 2ZUEA 4M1SA 4E46A 1W5EA 2YXHA 3DZDA 5I7UA 3SYKA 2AC7A 4CQNA 3BEHA 4LRWA 4OATA 3GR6A 4ITUA 4GYWA 4LRSB 5JH7B 4Y2PA 5E8JA 2HLPA 5C7IO 3EIXA 3WIEA 4GMKA 4JVMA 4N40A 3B48A 3PFKA 3K58A 1NVMB 4IQ4A 5C93A 1N2EA 4FHEA 3Q7EA 4J0JA 1Z12A 2Y71A 4YONB 5IYZF 4M36A 4Y1RA 4OV6B 4BCBA 2E55A 5EJGA 2GVZC 2V6BA 3GT4A 4Q7EA 3FTPA 3BT7A 1L4YA 1E0DA 3I9FA 3EMDA 2G5CA 3AJ8A 2DAPA 1JDJA 3ZDDA 3EFOB 5ILOA 3ZVKA 2RGAA 3ESXA 3KQLA 4DIDA 4QT4A 3MJTA 1PE0A 2O8CA 1F8FA 5IDXA 4RTSA 3FUWA 1QKJA 4KX3A 1YJ9V 4IWXA 2YRWA 1LRLA 4BPBA 3LRXA 2OBMA 3D2LA 2EX4A 5HTOA 3UF0A 4YK7A 1G60A 1O5OA 3H5LA 4KYUA 4LMPA 4B4WA 1EQAA 4ME6A 3OTWA 4O8XA 4RK5A 3E27A 3NIBA 1Y5NA 3IS3A 1L4LA 1KAQA 3OEEG 2BT4A 6AT1A 4ER6A 4K5QA 3A9VA 4EITA 2H65A 2QSZA 3W0LB 2RGWA 1AUPA 2P2DA 1KZYC 1CVLA 1M5UA 4ZYZA 1XMQB 3KZIZ 1NZDA 2IQ5A 2JGRA 1PR9A 3G7UA 4HYOA 2YIVX 4TT3G 1QWOA 5LLDA 4E2LA 2IEYA 3V4RA 3DVQX 4UXHA 1BCSA 1CCWA 4MZDA 4RD0A 1OCRC 2PUJA 5H8WA 3LX6A 4PA3A 4WK6A 5JO9A 4RQEA 4H7IA 3KDPA 4FNGA 2PSSA 1IFXA 1UAQA 3KOMA 1E99A 4I5DA 3GCXA 2AEJA 1KAOA 3MMZA 1GKUB 2JAWA 3L1KA 3SS7X 1CR0A 1LPSA 4U2CA 1L7RA 5F7JA 4M8NE 3NHBA 1YHYA 5M29A 1XDWA 3WJAA 4HB0A 3C7TA 3ZQJA 1KJNA 4ENTA 2Y67A 4Q3KA 4FCWA 4YGXB 4E03A 2PX0A 3BRQA 2C2ZA 2PS0A 3ASOB 4BEWA 3BSWA 1SZTA 2RK4A 1PZXA 3QPWA 1E62A 4BZWA 2GBFA 3WL5A 4PZEA 3W9UA 5KQMA 2IU6A 4JI7O 2YINC 4YR9A 4KWTA 3LSTA 3KPJA 2XR1A 2PGIA 3GPIA 1X74A 5B3SB 4LDRA 4JNKA 3DOFA 5DM4A 3J80N 3JY6A 3BCSA 3ESAA 1EJ6A 4KAAA 4GLJA 4YRFA 4JXKA 4URHA 1QR2A 2LXNA 1RWBA 4TYMA 4W8GA 1BHAA 1GXSB 3R2NA 4NU5A 3DBLA 3TLGA 3IMEA 2VRCA 3A6LA 2XQFA 1IM8A 2J6HA 3NIDB 1YB2A 1IK6A 1L4HA 3E53A 4I5SA 4Q19A 2PJUA 3OQ1A 2RJZA 4P7BA 4U2DA 1U5AA 2XUIA 3T15A 1X94A 4ESOA 1P4RA 1N2HA 1BGVA 4Q4JB 3GJ6A 1BDIA 3TPFA 2YMMA 4C7KA 3Q98A 5I45A 1ICIA 4NMXB 4NTXA 1BMTA 2JJ1G 5TQ0A 5ALVA 3LUTB 3K6KA 4HWOA 1L6RA 3NHKA 1PTJA 2AS0A 1QUFA 3GGCA 4Q3BA 5JQGA 4P36A 1R0YA 1H2YA 3NDPA 4Q00A 5JJJB 4BFTA 2W2OA 3EXFB 2G88A 4NYJQ 3RD5A 1QGOA 1A3CA 4FW8A 4JVSB 4RDHA 3ROGA 1BIFA 3FDJA 1XAGA 4N41A 2REQB 1MSWD 2P06A 2BOVA 2YW9A 1HURA 3DFZA 3OQOA 1NJ6A 3P8ZA 5JAPA 4C2UA 2QMQA 4LFAB 2CVFA 4BQEA 2DHCA 3AF1A 4U8HA 1GCOA 3PUZA 2QNRA 2YHBA 3WR5A 5LVAA 2P65A 1A9ZA 1H38A 2NN4A 2D0PB 4YBRA 3QE0A 5DX1A 3SN6A 1EAMA 4G4SO 5IKMA 3LD9A 5CNKA 5IBCA 3TQSA 1DBWA 5EMLA 2BSKA 3VDXA 2NUPB 1QFXA 4C4YA 1T0JB 1V5EA 3G89A 3GUVA 1JW9B 1TK2A 4GI1A 5A6SB 1H2GA 4EUHA 1JEQB 5DEOA 1P5RA 4RQAA 3S44A 1PGOA 3TSCA 3M6MD 1YR3A 5TVGA 3VR2D 2WLIA 2ADFA 3SJQC 2I6QA 4M88A 4HJRA 1H2XA 3AT1A 5ER6A 5C8VA 2EQBA 4LOKA 4ND7A 4ZCTA 2FWPA 4JSYA 3GD5A 3D54D 1R0BA 5SYAA 2F1HA 2D7CA 2D74A 4ISBA 4DT1B 5EPUA 5MN4A 2Z9BA 4H44B 3TLKA 2QR5A 2QWXA 1F1BA 2QT9A 3MB5A 4G2KA 2NYUA 4BCDA 2N46A 4WLFA 3LNTA 2GJKA 2JFGA 4TTJA 1Y81A 3CWBH 4RA6B 2GQ0A 2R7NA 2PMEA 4RA9B 1YQUA 1YNOA 4ZQFA 3WMWA 1E1RG 3SJAA 2GF9A 5J2UF 4Q1BA 1GNRA 3P96A 4YRIA 2X9NA 4MLCA 4M54A 4IDCA 5CXSA 2P30A 3SQLA 2W6OA 4RK4A 5CR9A 3CBGA 3I3SR 3BJMA 2OIGA 1ZC3A 1D1TA 2Q9CA 4LE0A 1WXQA 2HQSA 1JKFA 3R5KA 2DRIA 3H04A 1ULTA 2YRXA 3W05A 3W9YA 4U0JA 2ZJ2A 3B51X 4IIHA 4YDHB 1H42A 1WUKS 4G1MB 3DVRX 3K0FB 4ZQHA 3EXHC 1QVAA 2WTBA 1PZHA 4D41A 5DI3B 5LXTA 1EM6A 3P26A 3AKDA 3N3AC 2K2WA 4ABTA 2P3OA 1X1EA 1HR0O 3OEEA 4ZHQA 1ODSA 4GSLA 4LWPA 3THYA 3OR7C 4IVPA 3ZQ4A 5FTNA 4JZ2A 2IKSA 1GGFA 5CT4A 2R4TA 3PIRA 3WNBA 3KT0A 2Z3JA 4EDHA 1EPUA 5E6RA 4F6RB 3HKDB 2PSHA 3CLRD 2HRBA 5AW4A 1K5DA 3BAZA 5FBHA 3HVUA 4HH1A 2OWOA 3HDQA 4BNUA 4XWWA 3RBAA 1YZKA 1IN1A 3CH5A 4PZCA 3FBTA 3OTIA 3ZX6A 2Q4BA 3NWBA 2NZ8A 2HO4A 3LBFA 1CE8B 2RDCA 3F3SA 1MVOA 4OCLB 4HNGA 4CDMA 1ZISA 1T3GA 1N5IA 2Z5LA 1N36B 1JG2A 3A04A 1J23A 2ZQMA 3PA6A 3EOBI 3VR5A 5EFZA 4OMCA 4JP1A 2Q1UA 4ZKEA 4P7FA 3T4EA 2FW8A 2X5XA 3RH0A 4NE9A 2PX6A 4I8DA 4LPKA 5EBMC 3HA3A 2QL9A 3TGLA 2QUBA 4NBWA 5LQRA 2QWRB 1AGNA 3A2NA 3BXOA 2GBGA 4F2GA 3O92A 4DY6A 4TTAA 1RRPA 4C7VA 2V59A 2G28A 3H9CA 4WL0A 4NABA 1IZ8A 4RJLA 4P4SB 4W5QA 3DDWA 2VP2A 1JFSA 3QO8A 1WRBA 1QXSA 1MABG 1IVYA 1W9HA 2ZU6A 2FHSA 2OLEA 3LYLA 2G83A 1IJEA 5H9VA 3A11A 4HAXA 5H80A 4DIFA 2JFWA 1A5BB 3AM4A 1N2CA 4EO4A 1QTNA 4NJMB 1S01A 3ZI7A 1E6WA 2QB5A 4KR6A 1AS3A 2YUIA 1RRCA 3HDHA 1Q0ZA 2J48A 3RGWS 3EQ7A 1OAOA 4MR8A 4ZZ1A 1R6UA 4EVIA 4HCJA 1U1FA 3RU2A 1YR7A 2ZSBA 3LZDA 3MJDA 3L06A 1NMYA 3BMOB 5FTKA 4BVFA 4EBFA 4X1KB 1JDSA 3BWXA 3O8BA 1MB0A 1Z68A 3OICA 3LJKA 4LV6A 3QFSA 3TXSA 4MAMA 2OGWA 1TIYA 3LNCA 1HZJA 2HM7A 5JRZA 1DC7A 4X54A 1FEZA 1QE3A 5K0CA 2LWIA 3W8FA 3QHQA 3IMFA 5TEWA 1J2TA 5KC9A 4BBPA 3LG2A 1G19A 4RZUA 3S5UA 4K9NA 1DG9A 5C52B 1U3FA 3WAKA 4LZZA 3FYTA 5FNZA 1RXVA 4DM3A 1TNDA 3JZDA 4KPYA 4YUZA 3E5NA 4IFIA 3FCSB 1MGOA 2V7PA 5EXTA 2FP3A 1K8RA 3QBEA 2J5QA 4LDPA 5LOVB 4PQGA 3QIAA 1DO0A 2QP9X 4EW3A 1GZDA 1RI2A 1YZ3A 1EGVB 3NHYA 2WYWA 1ML4A 2ZR7A 3KSMA 3AP3A 3KKLA 4XOUA 4NXNO 3L7LA 3PQ5A 1TTQB 3IPCA 2XUJA 4PC3A 2ZNRA 3RVBA 1XQ8A 4X8AA 3WK5A 4B9EA 3KZKA 3Q8KA 2IYNA 2OHOA 5B1OA 3KPVA 2DWCA 2QW1A 5BUCA 1ZSPA 3RT7A 4ECEA 4DLWA 4R7TA 3USCS 2PGXA 1YR1A 2JFZA 5K0ZA 4HAWA 4OXYA 3RUEA 1CY6A 3BGDA 3VR6H 3K2EA 5AI8A 3KQNA 3HXLA 1E1RA 2VHYA 1F38A 2AI2A 3SOPA 3K4HA 1IBMB 4RABA 5CPBA 2PUFA 3RYCB 2NT4A 2I2DA 2G63A 3TMYA 3U16A 5KHIA 1RD4A 4HFJA 2QAGA 5HS6A 1L5KA 3SQNA 2XOKG 2OBFA 4AROA 4J43A 4DB4A 3ZD7A 1I3NA 3G7SA 2G38A 3LHKA 3H65A 2AD1A 2PAFA 3P97A 5TVKA 2EYQA 1YS6A 2OYSA 4YRTA 2QENA 3EN0A 3EJWA 5JEEA 4GMHA 2PSJA 4WKOA 3JQFC 4J76A 5EZYF 3TRHA 2JGUA 2JAXA 5GIPE 1THZA 3MM4A 3C6KA 1DJQA 1ZY2A 3OKAA 1WXEA 4P3PA 4BNKA 3G9ZA 4EKIA 4EY3A 3HKCB 2BFEB 3LFHA 2OA0A 4CT5A 2J6IA 2Y0PA 3IJ5A 5FPKA 3MILA 4DQLA 2POCA 3DPUA 4RKWA 1Y6ZA 2A9FA 3AFNA 5CIWA 4QXQA 1WP7A 3RVYA 3UG7A 4D4KA 4B9AA 3BVOA 4WFAV 1J20A 1BO6A 2AQ8A 4N8EA 5EHIA 1G21A 3VTKA 1ZINA 5KX5A 1R37A 4TQAA 2VL7A 2B3TA 3MJFA 3PQDA 2XD9A 4IX9A 5J5AA 4UCRA 4BNMA 5BV8A 3OO0A 1APBA 1SC5B 2Z09A 3EWNA 2ZIXB 1OGIA 2R48A 1DZIA 3SS8A 3IAYA 4MQEA 1K1EA 5DV9A 3IVGA 3A8TA 621PA 3FGNA 5I7HA 1X3LA 4Y18A 1KDTA 1N0UA 1KKMA 1NVWQ 1RADA 5K8TA 1DQNA 1KVRA 3HYCA 1D1PA 1J8QA 3BIOA 2NXNA 2IITA 4B6JA 3VDNB 3HP4A 3NXKA 4CS3A 1WXHA 5EEHA 4J10A 3COPA 3NV7A 1SESA 2RGXA 2UZAA 4B76A 2FN8A 1Z22A 3PDUA 4CLEA 3RAPR 2ZB3A 4BGDC 1ISJA 2N75A 1GYPA 4ROSA 5BYAA 4V0LA 4EPYA 4PYLA 1U7XA 1CY1A 3H8JA 1H2BA 1OKKA 1XA4A 2WF9A 1U3TA 4MDFA 1CULC 1E8MA 5FHRA 1AXGA 2OWDA 2ZUUA 1GRNA 2IUSA 4EJFA 3F8TA 2I2XB 4NICA 1PP4A 2BYTA 3G6EV 1FDOA 3PUHA 5JZSA 4UV8A 1JR4A 4R01A 2EX1A 2ZTHA 1TLFA 1A2OA 1CEEA 2CXOA 2QLMA 2RC5A 4F04A 1C9EA 1CC1S 4IBOA 2XAHA 1PCXA 3CPHA 1Y4ZA 3JV7A 1J42A 3ISJA 1Y5MA 4J2TA 2PMWB 1S2GA 3SJBA 4GX2A 4QGSA 1FIUA 1T5DX 4R2HA 1P29A 4NENB 5HOEA 1MO3A 1XQ1A 1EBFA 3TZHA 3UK1A 3HA5A 4MP3A 3C45A 3OE7D 1VDMA 3IUBA 2GEFA 2UV8A 4RHFA 2GK7A 4UVHA 3ZLTA 1JU3A 4M9ZA 4AVYA 4PXAA 1P7PA 1NVBA 1E3SA 2O2ZA 2FPXA 5EZSA 4AIIA 4F4HA 3C3JA 3HDJA 1M1YB 3FYUA 2QRMA 5KTKA 4X7BA 1I7QB 1COZA 1BVUA 3I6QA 1EUCB 3DL7A 3OQMA 3RYHA 3GI1A 1WDMA 1JDBC 2GZAA 2Q49A 1AJNA 3ZEIA 2B3DA 4ACBA 2H3HA 5D3MA 2W4LA 4QM6A 4H60A 8AT1A 3MB8A 1WZCA 4W5HA 2QQEA 3N53A 1FMFA 2J32A 1FUKA 1AUVA 1HT3A 2LGQA 1CRPA 3TXXA 4DSZA 1OBFO 2H7YA 5GV8A 2KCQA 4R1SA 1PK9A 1OHHG 4MHTA 3LHIA 5A4KA 4GOMD 3H8SA 1S1CA 2ZLBA 1CQIB 2ADOA 3U9LA 1A82A 3DV9A 4KQJA 1KY4A 1OCOB 3K96A 3ZE9A 4K2AA 4C4PA 3VPFA 2WW8A 3TL6A 4JQCA 2X7JA 4HGPA 1KOJA 3AHIA 4XDHA 3CZMA 2R86A 2YI9A 1WP9A 4PCLA 3M6XA 4A16A 3C5VA 3C3SA 3O65A 5BY2A 4HWPA 1IEXA 5KA5A 2ZRFA 1GGMA 3IOCA 4M1OA 2JFBA 3WWOA 4J42A 5EP2A 1W59A 3B3JA 4KIFA 4Q16A 3LCCA 3K5LA 2WTAA 3GOQA 4BO9A 2V7QD 3HKEA 2I7XA 5JMTA 4UB8Z 1DO8A 1T6YA 2VDUE 2QYHA 1VBKA 2OB1A 4YECA 4RVOA 2QX7A 1EGMB 3ZI4A 1C8BA 4QATA 1LBHA 4LGYA 3ZR4B 5HVNA 3ZHYA 4XVUA 4FGKA 4WNAB 4IIEA 3HFSA 4MRSA 4RV9A 1ZUNB 3WG9A 2YJTD 4UW9A 1TK9A 2N47A 3CF2A 1R3UA 1I9CA 3S3TA 3MTEA 4O63O 1SK8A 3O2JA 3ZZTA 2CJPA 4RU1A 4TWJA 2X23A 4EFNA 2OV1A 2ITDC 4Z4EA 1V43A 2R25B 1XVUA 4ALMA 1UFVA 1NJ5A 2EP7A 4AM8A 5D6OA 2EGHA 1GLNA 1N2XA 4J1QA 4ETMA 2DYKA 3JVDA 4QVKA 1WEKA 1MPXA 4RSMA 1SQBH 4ASUG 4XA8A 5I7OA 3TNDA 3T2MA 3H99A 3BICA 3GGGA 1LBQA 4NL4H 1W44A 2YJGA 4HMQA 5AIAA 2AEMA 3IEKA 3Q3JB 3BOSA 4BRZA 1YIJV 4Y30A 4J03A 2PXHA 4MRVA 1X1RA 2ZYDA 1GFZA 1Q92A 4GH5A 3VJRA 4U9UA 3HB7A 1FJGB 1M6HA 4XQEA 1Z7GA 3KTAB 4QPDA 4K8XA 3WKBA 1MXHA 2LCIA 3ZDCA 1Q0TA 4X66O 2R97A 1XD2B 3KXPA 5B5SA 2WHRA 5FOUA 1P3JA 3ABQB 4ZQBA 1XRMA 4N7MA 5ECYA 5DNWA 2H8KA 5EKTA 5B3JA 3OAAG 2CHGA 3UQ8A 2X4DA 4PTLA 1F51A 1OYYA 3AX6A 4J9UE 3GXBA 3GWOA 5K8IA 1IY2A 2WNSA 1T6NA 3CEMA 1XAHA 4RUEA 1AHPA 4YT8A 3KRTA 1LU9A 2A5GA 1E9DA 3A9TA 3M34A 2O3TA 4PZ9A 1I5RA 4JJGA 3B1ZA 1NUPA 1S7GA 5MF6A 4K0KB 1QVGU 5LZ7A 2Q6AA 1O94C 2DQ3A 2HWUA 4QNHB 1R9GA 4ZVKA 3K9SA 4S0ZA 4FSDA 2V9PA 1HQDA 3T4XA 1RJFA 1VHJA 3A0UA 4LGMA 3O1IC 3IEUA 2WIAA 5BWNA 1IZZA 2V1XA 3A1TA 2CJWA 3OQNA 5DYYA 2DUUA 1E1LA 1ODCA 3SSOA 1RCTE 4LJ6A 3NCHA 3FN4A 2D2FA 3TLYA 3NWEA 4OH7A 5LUBA 1JNXX 4B3JA 4FJ1A 3OMNB 1ODJA 4ESVA 4W5JA 4G0YA 2VHEA 2X5JO 4M0CA 5E9QA 1Y8RA 3UBTA 3THWB 4E09A 3VA7A 3HCFA 4XSGA 5L4NA 4W9NA 3RQIA 3M1YA 2PEYA 4EHJA 5LHHA 2HSEA 3A32A 1GCGA 4L72A 2A9VA 5GW7A 1E5LA 3IYLW 5IASA 3Q0TA 4HBGA 2PTMA 3T1VA 1UKEA 3RDPA 1EFVA 3MLEA 4LJYA 2O59A 1Z2EA 5CVJA 2AW5A 3TQRA 1V54C 1JKJA 1AMUA 2QAJA 3QPVA 3EX7C 5ITSA 2FZ5A 1HLPA 3QVJA 2CD7A 1DP4A 2WP8J 2HU7A 4M2LA 1EX7A 4ZK6A 1NNSA 2J4DA 1OY1A 2OHJA 3LKZA 1DHTA 4YJFA 3OOYA 5HKBA 1OWNA 1ILWA 4JHLA 4G56A 3STHA 1KK2A 1VE5A 4RQTA 4PG4A 5DTRA 5KU1A 5DLYA 1XA0A 4L3VA 3DV2A 1HLDA 4TKVB 2WDPA 5E4JA 3SR4A 3UAXA 3IJFX 1OHHA 3KALA 1FU8A 2D8AA 1W8IA 1GSIA 3QELA 2QZPA 3V9PA 3AY0A 2QWOB 4B3MB 3AEUB 3G6BA 5EIOA 1KSGA 2GEVA 2OZKA 1WO8A 4O4HB 1DQSA 5C5DA 4BLTA 3FE2A 2VJDA 4OYYA 3VNVA 3ABLC 4N5DA 3BRWA 2YZGA 4MS7A 2JZNA 5CX4A 2QI9F 4B4OA 1X6VA 1ICEA 4D3FA 3C5HA 3I23A 3LP5A 4CT4B 2FRVA 4OYHA 2Z4SA 5IH3A 1RNLA 3SGLA 4M0MA 3RVNA 3H5AA 4G09A 2OWEA 5JCXA 3OD4A 4GPAA 4JU9A 5U4QA 3E22B 3UT0A 2ZBGA 1QH0A 1FX0B 3NHPA 1BE0A 4GUNA 2HEGA 4GZ5A 4POOA 3TEJA 2PUVA 3J81k 4E15A 4LWSB 4FFKA 1G64A 1RXYA 3H1AA 3T5TA 2CSXA 5HF9A 2LVBA 1NXOA 4MWEA 5GONA 2NSDA 4DV1O 3B5JA 4CLRA 2I4LA 3IAXA 1M1KW 1ADJA 4UUOA 4X1IA 2AGVA 4M89A 2ZJFA 2Z2ZA 5H02A 1U63A 5EE3A 1FLDA 3SBOA 5B1IA 2PFKA 2WF8A 2GWRA 2AL7A 3KU1A 1A8QA 3RUPA 3QW4B 1MIOA 3BHPA 4LNUB 2LRHA 5K1XA 1MO4A 2G36A 3RVRA 4IH9A 1DRJA 3V1MA 1JH9A 4UCXA 3HCBA 5GM1A 1TAEA 3WA7A 4Q9HA 1YL7A 2ZAMA 4ASUA 1YOVA 3K31A 4U7JA 3GFRA 5I47A 2B4RO 3GROA 4MS2A 1PBTA 2PO7A 2MSEB 3ZE1B 1JDVA 2WKSA 5ICSA 2OK7A 3M82A 3KSBC 4HRQA 1KSHA 3O2NA 2H7XA 1LK7A 2JVJA 4PX5A 3WL3A 1C9NA 3HCOA 4FONA 1UMDB 1ZWIC 4CDGA 1YRLA 1KEVA 1TA4A 2P2GA 4RV4A 4IUBS 2HKOA 2GI4A 1W36D 1JH8A 1UM8A 4JL5A 1E3WB 1W87A 3IOBA 3ONNA 1IOLA 3IUJA 3TIXB 2OV3A 4MW7A 5IY5C 4C7UA 3AP1A 3H7AA 4WH0A 3U3DA 1M8GA 2VAWA 2PI5A 1XK7A 5AHRA 3G0GA 4TRRA 3EUEA 3EISA 2ARHA 3HEAA 4YI3A 2FDXA 1UMBB 4K8ZA 1RMQA 2FJUA 4D6PA 3OAAA 4NOLA 2BTQA 1PI3A 1VFNA 3AHCA 3GZJA 3PIDA 4M1WA 2I8LA 3TM4A 2DFVA 1CJKC 5IM4A 5I7WA 4B0OA 1ISMA 5DHPA 4FM1A 1TA8A 5CD9A 1Z4PX 1RBMA 5HKOA 2BE7A 2O2YA 2V45A 3WGUA 4NK5A 4C1BA 1VE7A 3D8RA 2HO5A 1ZD1A 3PRHA 2R7KA 5DB4A 4S1TA 3C41J 1BXZA 2P40A 5AI5A 4Y3UA 3L75H 2WJIA 1JUDA 4LHVA 4XDJA 4I1RA 3W78A 3U80A 3H01A 4JI2O 1OOEA 1Y8QB 2YMPA 3BF8A 4WECA 4CF6A 3INNA 3A06A 3DAOA 3DOEA 3T1CA 4D0SA 1P72A 3AUUA 4MVJA 1URPA 2D3TA 1PD1A 4U7FA 4L51A 2AMLA 2D00A 1J5PA 3HL4A 1B0UA 2AHZA 2YHIA 1DAFA 1SC1A 3SF8A 3OQVA 2DQ0A 2ZWIA 1ZOPA 1A9TA 4HYTA 1PWXA 4Z4HA 2FFHA 5AUNB 3ONVA 4LOJA 3KLMX 1N1MA 1YHZA 1R0SA 4O4JB 3NG1A 1QRAA 4U2KA 4QOSA 3QNUA 1SOUA 1OVGA 2QDOA 1CTTA 3ELWA 3GV0A 1VF6A 3L1VA 3ET4A 3G2QA 5ELXA 1K3FA 1BG6A 4PSUA 3EGXB 4MWDA 3TVYA 2HF2A 3VYUB 1I9GA 1KU9A 2HK7A 2WQ7A 2WF6A 3PX7A 3ENKA 4LXTA 1JEDA 3NBUA 2M6SA 3W6PA 3DF7A 3RIHA 1H0KA 3U61B 2XTZA 1WU7A 1UOQA 3TD6A 2R84A 1GOTA 4AY5A 3W8NA 3RFXA 3UZUA 3OTFA 2IP4A 3QO5A 1U2PA 3OIFA 1O58A 5GPBA 5F1KA 1L3BA 1Y3AA 3AG5A 1MAAA 3KBBA 3AJDA 3JD2A 2BGUA 5K3AA 4GPTA 1MTOA 5ITZB 1QO0D 4BW9A 3GNTA 4KUEA 5LWQA 1L4BA 4BY9E 1N0JA 3M1LA 4EX7A 4C05A 3NTLA 1O95C 2DUJA 3F97A 2VQEB 4HN2A 5DM70 2H1CA 5BOSB 4KOEC 1O7JA 2K5UA 1DPFA 3KUDA 4JLVA 1RBYA 5CJJA 4B31A 4HKTA 1XZGA 1EIZA 5K6AA 5JQWA 1VGQA 1NU6A 4JK3A 1E58A 1H6CA 4FVTA 1XU9A 2DQSA 1J5XA 2VBFA 2VSQA 2WD9A 3A1NA 4F9TA 3BSFA 5HRAA 1QS0B 4MVQA 3W5SA 3FNBA 2MT9A 3AB7A 4LWOA 4R8SA 4UMEA 1MU0A 3SGIA 3R5SA 2PS3A 4EHNA 1F2TA 3RVPA 2DB3A 4JA2A 4FZ5A 1VQ9V 4LTNA 2FYUH 4AQYB 2Q8QA 3VR4A 1L5VA 2WF5A 5EL0A 3EH2A 2UXXA 4XI9A 4B83A 1WB4A 5GZ1A 4ZJZA 4P30A 1X1SA 1G2IA 3TM5A 3CMEV 5D5PA 1KEUA 1ARZA 4G2TA 1N0HA 2XUDA 2NVUA 4ZU3A 3P0FA 4DN6A 1DAKA 2FPSA 4M8KA 1IX9A 1TD9A 5EQFA 2R5NA 1WS6A 1TGVA 2W5UA 2DT5A 2HRQA 4DMMA 1IXZA 1T1SA 4NU6A 5DSZA 5G02A 1T4BA 4BP1A 2Q9UA 3LKVA 3AIIA 2B0JA 1YB1A 1M5IA 4DV6B 1NE2A 4BMZA 4V0QA 1J95A 1AMOA 2ZCEA 5GINE 3RVZA 5CYGA 3DL2A 1X2BA 1G8SA 4Q12A 1MEEA 2GTHA 1XL6A 2CFOA 3KSAC 1A0OA 4CHGA 4FYYA 2XVYA 1WBJB 1OW3B 4EI7A 2RNBA 1XHEA 4KPFC 2RI0A 3AG2C 2PSEA 2ZYAA 4F6EA 3ERCA 5EHZA 2WOJA 1VLVA 2QRVB 3H5OA 6ABPA 3Q3CA 4NR1A 2C3MA 1S3GA 5ULLA 3JAWB 1W36B 4RW0A 2ZNVA 4QAQA 4I0WB 5BSRA 5CEEA 1C8KA 4BO0A 5GZ3A 4GPBA 2R6DA 1AY0A 4PLGA 4NFLA 2NSHA 5G1NA 2RK3A 2YN4A 4X1OA 3WK4A 3MIZA 3E2IA 2K7FA 1RHUA 2PVCA 1KSJA 1J9GA 3LZCA 1CF9A 4HO1X 4TWKA 1VJ1A 1YXMA 4XDKA 4MW1A 1YJ8A 1GT91 2CL6X 3ZHQA 4TQFA 2RH9B 3R5HA 4JASB 3GGJA 3RRMA 2C0CA 3SICE 4L75A 2VWJA 1NVGA 5IANA 3L40A 4BV3A 2Y6VA 2O9JA 1D6MA 2J3EA 4KB5A 2Z08A 2ZR2A 2HUNA 2ZUFA 3ZE0B 3BZBA 5HQ3A 1HOXA 3CZQA 4ZOLF 5P21A 4H59A 4K9PA 1RQ2A 2PX2A 3MT8A 1X7ZA 5IMBA 1L4UA 3SHFA 4KWCA 2FSSA 1D2MA 3X2QC 3SJZA 1FFEA 1RPJA 1SZPA 4URUR 1XFDA 2OSVA 4HEA6 3FB5C 3PQEA 1R4MA 3VPAA 3E3OA 1M0WA 5IZCA 1N33B 1BQ3A 2PL1A 2HDWA 1U6IA 1BFDA 2DG2A 2YSUB 1D9XA 1JR2A 1Q57A 2QL5A 5A6VA 2V5AA 5HFJA 3IBFA 1Q6IA 3ASNB 3S8YA 2FTKE 2GWHA 4DCCA 2JAOA 2BP7A 4OBBA 5F12A 1D9ZA 4Q3EA 3U11A 4RXMA 3TAHA 1IB0A 1IBRA 4WIAA 4ZV9A 4RQBA 3P2EA 4J29A 3L4BC 3GLGB 3KVOA 4P2ZA 5KJEA 3FFXA 1AF7A 1RYEA 4OHVA 5A3JA 1NIJA 5HJ7A 4ABYA 4B08A 5HIKA 2ZKIA 1NH2D 3B1XA 5J5VA 2HK9A 2B34A 4ZDKA 5LA6F 3VV2A 3RUCA 4MVSA 1N25A 3VC7A 1W2GA 4O4LA 3D0OA 3A36A 4ADSG 2QLCA 4QEZA 2CFTA 3IT0A 4MS1B 3MG9A 1V2HE 3LY5A 2H59A 1Y3HA 4TMVA 5B7QA 5BWBA 4ZTBA 3KCNA 5CX1B 4M1TA 4QQRA 5FL3A 3FCOA 4KRXA 4XIJA 3OH8A 5HR5A 4QBFA 3ITDA 4M55A 1PK7A 1PGNA 2A4MA 3NIWA 4C08A 4C3UA 5ICMA 1WHTA 2VT6A 1I7SB 3ZUPA 4WGGA 5LQSA 1GRQA 1CJCA 4R8LA 1Z82A 3U60B 2QRHA 5LYJB 2EIHA 4X20A 3WGHA 2ZTUA 3LHSA 4G1CA 1D0VA 4FR5A 3WYCA 2JASA 3DPIA 3LA6A 1SFRA 3STUA 3CY6A 1SXQA 3I2JA 4PHGA 1XELA 1K4YA 2XUQA 1ELOA 3F7TA 1FP4B 3DZHA 4DMRA 1DQRA 4OYLA 2WFZA 3TX6A 3STWA 4JI6O 4DA9A 1GM9A 4MCIA 4QTZA 4UAUA 4AG6A 4PO9A 3GPLA 5IHPA 4YMUA 2RKOA 1WOYA 5AJZA 2FW9A 2RARA 3SQDA 1R6DA 3UB3A 4P80A 3GDFA 2YDXA 3ZCSA 4PG5A 2FPOA 2FQQA 3HA2A 2W93A 1K9SA 3ORRA 3R76A 3C97A 1WXGA 2YS7A 2P4UA 3D5EA 1VJRA 1HE8B 5JLAA 2HA4A 1XXLA 4C0HA 4B74A 4G65A 3F5DA 3GFBA 1Z3IX 3WDLA 1UC8A 1D4AA 3GLIE 4DCGA 1MQSA 2AQKA 4ONEA 4F06A 4GFDA 3K5IA 4QU5A 3T12A 1MXFA 2UVPA 4I08A 4Y8VA 3GJXC 4BJ5A 4MB6A 1U1CA 2WI8A 1J8DA 1NI5A 3CZ5A 2IX9A 1KY5A 2GN4A 5AW8A 4GP7A 3PBKA 3EDYA 4YO7A 2QORA 3BGIA 5ALLA 3VAZA 1VOTA 3I8XA 3O4RA 3PNMA 3SS9X 3J7AC 4R1MA 3VU1A 4QA9A 5IEJA 3QEMB 1SG6A 4PIMA 1A88A 2NU6A 1GN9A 3KT8A 4IMPA 2PUWA 3NJ8A 1W88B 2F4VO 6CHYA 3BB1A 2C92A 5HJ2A 1RAAA 1JWLA 4LE1A 4RWEA 2H9IA 3EA5A 3S7ZA 2WVJA 3UO8B 1BDMA 5KHHA 2ATCA 1E6UA 3ML0A 2HA0A 3HWX1 3W5VA 2IYPA 2ZBEA 5L3EA 3W6OA 2FK7A 2O8EB 4WAUA 2MDTA 2BEUA 1Z7BA 2R79A 2XQGA 2FWMX 3QXGA 2PDAA 2OHIA 4MSUA 3UOAB 1N77A 4KZPA 1L5HB 3TN7A 4O2BB 1FMCA 5FO1A 3DAGA 3WQRA 2GXAA 3ODPA 1CLUA 1QB7A 4NYJR 4K81B 1W30A 2W6JG 1Z2CA 3EHEA 5A5EA 5H82A 5LNK6 1IZ9A 2V54A 4FFSA 4EB8A 2X0LA 4CR8A 3VQYA 3I04A 3LQFA 1SZDA 3A1CA 1ZITA 4D3XA 1J06A 1KYOF 4B3XA 3KZVA 4XEUA 1ZUIA 2XEDA 4XJSA 4LV8B 4IRUB 2ZOSA 3BXHA 2V7VA 2BGLA 4G1EB 1YVWA 4FKZA 3RS9A 4E6EA 2B9ZA 5A3RA 3SYAA 5H3HA 4NZMA 4UHBA 1EESA 3TKAA 1LFDB 4FSXA 4NV1A 4UM7A 3IILA 1N9GB 1Y1RA 1VL0A 4YP7A 5B6PA 5DF1A 4JAVA 1XYVA 5BUSA 1ZA1A 4P84A 1UL1X 1TGOA 2Z43A 3D3EA 3PK0A 1VQ6V 4R05A 1Z5VA 4Y2UA 1NG1A 4JB2A 4GUDA 1Q0UA 2H1FA 2A30A 4UPDA 4ND8B 3OOEA 5KCZA 4QYTA 1E18A 2REXB 2W6NA 3VH1A 4KDEA 5FDFA 3M4JA 1SC3A 4LF6O 2B36A 3NP9A 5HK9A 1UJBA 1RM1C 1VQKV 3N6RA 3OT5A 2COEA 4DR6O 3W7WA 2GS9A 5F5NA 3TOCA 1NBMA 4LZWA 1EWVA 4R51A 3U5TA 4DQUA 4K0RA 3DEHA 5JT1A 4MOWA 2PYIA 1HC7A 1D2AA 3GVPA 3E9NA 2J6CA 2YOFA 2KI5A 5UKDA 3DZIA 2IV3A 1R5JA 3G13A 2ZROA 2MK3A 4BUJA 5AM5A 3KJFA 2IKQA 2PX3A 3L0BA 4QQKA 3S2EA 3AK4A 1DT5A 3U5ZB 5DCUA 1UZUA 2AVDA 3UAWA 3KETA 4LCNA 4BDTA 4Y2GA 2DPLA 4GO1A 3NDBB 2Y1DA 4LOIA 3QYPA 4JZKA 4DR3B 4LYJA 4LPSA 1YZTA 2QTCA 2FWNA 4RM3A 1SQ6A 3HXMA 3VNSA 5E6SA 4F6CA 4TSFD 3HJFA 1GPH1 4GC9A 1TMOA 3EAGA 1UBLS 2WM8A 2I3GA 1JA0A 2AUMA 2DT8A 1M6VA 4WCFB 1TU3A 3HR4A 2JBAB 1G9XA 3ICVA 4C7MA 2GJ4A 1MKYA 1FY2A 2PKXA 2ZP1A 2Q7EA 5DNEA 2PLFA 2PWAA 4JKIA 4F9EA 3R9XA 3KUCA 4WERA 1S0VA 1MB9A 5CLIA 3BRSA 5FL7G 4PXSA 1X0VA 1PL8A 2BVNA 3IBCA 4CH6A 5ALOA 2MIIA 3ICPA 2BEJA 1US8B 1N6PA 4FI3C 2WTUA 3HSYA 3CUUA 3OX2A 3IQDB 4K88A 3Q8LA 1GA4A 4PQTA 1CZUA 1WSAA 4ZD4A 4MIYA 1NJ2A 4YJKA 1XVAA 2EKQA 3GH1A 3PRJA 2ZE6A 5TJHA 3I1IA 1FJHA 4WESA 4RPHA 4BKRA 1NJFA 2C4NA 4AS2A 1QR8A 1CY8A 1JEJA 3DO8A 1ZD3A 5IARA 2VYVA 4KHPB 4KG7A 3VNRA 4DV4O 1YWGO 1MF7A 1IXRC 3TRDA 1V26A 3NWOA 2DJIA 1X7XA 1XPRA 3LL4A 4S2UA 1U8FO 5LDGA 3IP8A 4A6PA 5C2JB 1JQ3A 1UJNA 2AUNA 1JNYA 1X7YB 3RTCA 5SY9A 3SX0A 3MT7A 3H0EA 2EG9A 4MGZR 4FWTA 3ASYA 2FSVA 3UHJA 4KN5A 1JXAA 2OLKA 2B35A 3OOWA 1R8YA 2A0FA 1IAVA 3K9HA 1MDFA 2NYTA 3U40A 1QNFA 3TOSA 4GXRA 1NKTA 4YAFA 3ZIAG 2IIVA 2P6RA 3TZBA 4QJFB 4QNRA 3M1IA 3BFVA 4RD2A 1GP2A 1F0NA 3WIDA 4JZGA 3P0RA 4ZZ0A 2E1RA 2IYZA 2QD3A 1OTXA 4J1TA 4QGAA 3KJHA 3K9NA 2O5CA 1TIKA 1RYYA 1RQ7A 1YVPA 4UUBA 4OMUA 4CIXA 4QLBA 2HMYB 4YMHA 1PNTA 1K2WA 1ZA2A 1E2GA 1MORA 4D96A 2ZNIA 4HWSA 3ABUA 4V1CB 4IZOA 2WU1A 1ORTA 4X91A 1GEEA 1KZ6A 4JLUA 3ZQUA 5E1MA 4OGKA 2PZJA 1KAGA 1Y8CA 1HKUA 1L1RA 1CDEA 1FB5A 3T3GA 1SXJA 3QFCA 1TJ3A 4IO1A 3WLAA 2ZRJA 4NTZA 2W6JA 2Z8ZA 1WUTA 1OJ7A 2BEWB 1VP9A 1QAMA 3W5IA 1CKEA 4ZVQA 1ESDA 4AC9A 1QG2A 5A5VA 3CRMA 1CPYA 2G06A 1YFKA 3RANA 4FHGA 5K0TA 4JD5A 4WA7A 2HLDG 3RC9A 2HRDA 2CYBA 1YJXA 1P6XA 4FEEA 3K09C 1SMKA 2IOYA 1AX9A 4MYSA 2R7AA 4O4IA 1Z6ZA 2Y1GA 2OD2A 3W7AA 3LUHA 1C4XA 3C1UA 2GLUA 3STXA 5EZ5A 1Q7TA 3EB9A 5BQPA 4NYKA 2ZANA 1C9MA 1GZUA 1N0IA 3APQA 5KTPA 3VBCA 4C0LA 1M6NA 4MVRA 3B89A 3CM0A 3CIFA 4INOA 4MQLA 4X44A 3U9SA 4DB2A 1Q5PA 2FOXA 2LR0A 3LHDA 3O4GA 4WKGA 3TDMA 1PG0A 1MZFA 1ZQ1A 1G7SA 3HDVA 1BS1A 1A76A 2OK8A 1FNNA 4JL6A 3IUSA 5HFLA 3U1BA 5KIAA 3P27A 1R27A 1S2DA 4C7JA 3QEOA 5BW4A 1R5TA 4ZVTA 1QGUA 2P4EA 1Z5NA 1HNXB 3C7KA 5B3KA 1AHIA 3MF4A 3WSVA 5HOQA 3E48A 4OBXA 2P4VA 3B1WA 3MQFA 3RJ5A 3WDKA 2I9KA 5AW1A 1GKYA 3G5UA 2GMWA 4GBJA 4AJJA 3RSLA 1ZVVA 1E5VA 1JFLA 3CXCU 4OH1A 5CCXA 4JQYA 3E89A 5ERYA 1C3VA 1ZGGA 4L50A 2AW3A 4G26A 3TIGA 4JYCA 4GVXA 2Q28A 1EX1A 4B6SA 4IH1A 4QLOA 1H3NA 5DEIA 2G8NA 1PW5A 3FTFA 1SJ9A 3KZ1E 2RHRA 3A31A 4Z3DA 3PE6A 2JAUA 3PE4A 3TGPA 1U8ZA 3BA9A 3VX4A 1P77A 4GQBA 3H86A 1WQ1R 2FOLA 1Q2XA 1XOIA 7YASA 4YAOA 1SRYA 4L4ZA 2YY5A 3OCJA 1L3CA 1J1IA 1B6RA 5IKEA 4A5UB 4OHMA 2IOQA 2NV6A 4ZANA 7ABPA 3WVNA 4I50F 3TD2A 1WTAA 1XFAA 2PTHA 4AJOA 2Q62A 5FUXA 2NX8A 3D81A 4CZ2A 3EY4A 3LI2A 2PKYX 5J2TF 4DV7B 4V0RA 2RQ6A 1X7HA 1J9EA 3WYEA 1QZXA 3WMEA 5FL7A 4JENA 3KQYA 4RO2A 5IT9A 2ONZA 4DM7A 3BIWA 1PRYA 4N5IX 2JZOA 2PZAA 2M9MA 4QYWA 5AW5A 1PO7A 5FPQA 4XASA 4MIOA 4ITVA 2FPMA 3HU2A 4YLYA 1L9KA 1Q8IA 2A9KA 4FX2A 1LSSA 3UY4A 5CA0B 2AN4A 2OESA 1LX6A 3F5FA 3WMFA 3PCRB 5KSYA 2QG4A 4CV1A 3T8YA 4PY2A 2OV2A 1VPLA 1UDWA 2VNKA 3UTDA 5ALGA 4Z4FA 5EE1A 3R74A 2NLJC 4B85A 1Y37A 3ENZA 2P7TC 1KI2A 3R8XA 1QNLA 2GYYA 4PSKA 4LH6A 4BB0A 4NDNE 3GJQA 1ZM9A 2GN2A 5HBRA 1FRZA 2PPLA 2WDZA 5K3FA 3HJRA 2YHAA 2C42A 2B25A 3GPBA 4W1SA 4AHCA 4WK4B 3AJ9A 1HZZA 5CVDA 2QSAA 2GEKA 4F8EA 1Z5OA 2YNMC 2NUAA 1WCYA 2XBLA 3WYFA 1YQXA 2HLNA 4I9GA 4PAQA 1MJNA 2UYGA 4DA0A 5EJ9A 5DX0A 1Q7GA 5JFTA 2IE0A 2OP1A 4RLFA 1IQPA 3F7NA 4GPEA 2PX5A 3OMWA 3IERA 1I30A 4LDNA 3ZIAA 1TAUA 3AI3A 4B6EA 1YS7A 4PEVA 2VJMA 1GADO 1RWNA 4MWBA 2Y05A 3WQBA 1WNTA 1L7DA 2C4TA 2F48A 2FPLA 2H2HA 4MV7A 5AW6A 4B3RO 1SZXA 3OM0A 4MUXA 1ZM3A 1XCLA 1MHTA 1ALNA 1NAHA 1KFBB 2N3ZA 3MPUA 4HB2A 4A27A 4QOHA 2AZDA 3I4FA 4NZYA 4RSRA 4P9DA 2GYVA 3HYSA 1EGHA 4OO3A 1RZRD 3HDYA 3T3OA 3UANA 2XJ9A 3FWNA 4AQDA 2ORIA 3K5NA 1FS0G 1U0TA 3LP6A 1BGXT 1RXWA 1KEEA 2FKAA 4RTQA 3GP3A 3MT0A 5HF8A 5E8RA 2AMVA 2OP0A 3DD5A 1S4MA 4BNIA 5T6MA 1EJBA 1M34A 4JOSA 1SCUA 3ZW8A 1SQ5A 3N0RA 1Q50A 3AILA 3UMMA 3C3DA 4HH3C 3TMKA 1IM2A 2XVZA 3VZPA 3TBKA 2HLDA 1VKHA 3ZZUA 2QD5A 4MWOA 3E8MA 3GBPA 4D6YA 3LIIA 4RZIA 5SYNA 1PEDA 3H6GA 2J5RA 1QO9A 5JSUA 2CJXA 4N23A 3L7BA 1E2LA 4G0VA 3K1YA 3MPZA 5CGZA 1TD1A 2VBCA 1U5BB 1K4DC 4IF4A 4LKOA 3DCNA 4LTMA 4AUMA 2JG3A 1XRNA 3D6NB 1ONNA 3CUYA 4ZYUA 5AQEA 1P5ZB 3T5CA 2Z5GA 3T5MA 2P6JA 1Z33A 3KQMA 2YXYA 2RHTA 4LVNA 2L42A 4NNJA 3OLCX 2C9ZA 1HYGA 1SKMA 4FJ0A 3PDJA 2IPNA 2XAQA 5BSWA 5CH3A 1WVGA 1GUDA 3C85A 1FP2A 4PX2A 2FFRA 1NA5A 4YY3O 1NTMH 1I0ZA 3U0BA 1KAHA 4UCQA 3QRWA 4RMIA 3K2QA 4Z8XA 1I2CA 4WXEA 2C4HA 1R8QA 1MX3A 3KJIA 4BKMA 5CTJA 1ACJA 1YUBA 1YDXA 3AEQB 3P2JA 1GU7A 3NJRA 5J2UA 4AWXA 5AUPB 2P2ZA 2CYAA 2VUTA 5FUYA 3ROPA 4PANA 2J0VA 3HU1A 3G6KA 2ANCA 1BE1A 1N6RA 4EUSA 1REQB 4BB9A 4R7GA 4MCJA 1D6JA 3NOQA 2VI5A 2XT6A 4BASA 5AJHA 3QXSA 2V3WA 5JCZA 2OM6A 1WA8B 1U1EA 4S3MA 3V1YA 4RIIA 2RCNA 1K8ZB 2XVXA 2Q3LA 1Q3EA 2I78A 3QKRB 3RUAA 2VTBA 4GP6A 1T2DA 3FNIA 4WIFA 3L0ZA 1CEYA 5LGTA 4MRMB 1I6LA 2XASA 4HAVA 4HLCA 4X61A 5L3SA 3SG0A 4F8JA 2IY7A 1KMHA 1IULA 1GZVA 2HU8A 2ADQB 4RGBA 4HZUB 1YHNA 3ICOA 1ZWLA 1CZOA 2D4HA 5LLSA 3MXOA 1U0RA 2FUKA 2I1VB 5LGUA 2DF8A 1I4DD 4DYHA 2ZT6A 2QA5A 2YJ3A 3CCEV 3C4JA 3KWJA 1PQUA 2QMHA 3M9WA 2Q3EA 1N3BA 2QTSA 1ZRHA 2JARA 4G89A 2EARA 2IEZA 3VHXB 1JIKA 3NHWA 2HU2A 4WY8A 4R2IA 1I80A 1RBQA 5BSKA 2RKWA 3MTGA 4NNPA 2GUWA 1CUDA 1UX0A 2UUCB 1IRIA 4MEJA 4CMGA 3QVSA 4UKDA 1E3MA 1K27A 4LSMA 4IGFA 4PONA 3HLTA 1BS3A 1DDIA 2IHJA 4OY3A 3PDHA 4CL2A 3U7GA 3URMA 2O57A 5EXEA 5C8YB 1YUMA 2HCJB 1V55C 3CS3A 5J3JA 2EIMC 4U2EA 2ZDHA 2E4VA 2R1TB 1ZMXA 2BM1A 3OTGA 4JLPA 1Z6GA 2CUZA 4RIGA 1CF4A 5EWJA 5JNSA 1WW3A 2CZCA 3HYRA 3UGJA 2X41A 1JR9A 1C3JA 4ZI5A 5AKZA 2G0TA 3IE2A 3ASZA 4RCVA 3QX9A 2VP4A 4NEGA 3P9YA 4J07A 4H77A 1V8FA 2QRNA 4E21A 4CNQA 2GBLC 2G07A 4BP8A 1S96A 3PD1A 4ZEWA 4D46A 3K0HA 4AY3A 3AERA 3ULKA 1H9CA 2WV7A 4N01A 5B30A 2HQBA 4L9SA 2ZYSA 1U0HC 2MINA 1VJCA 3KLBA 3E7FA 4RTOA 2KX7A 1NJSA 2X7RB 2Z2XA 1XTQA 4P7GA 4PELA 3O26A 3J81A 3NC1C 1RP7A 1SBZA 1UKAA 3QI7A 5EJ6A 1M8PA 1KJWA 3K0EA 3TLMA 5DCYA 3SHWA 1S02A 1FZTA 1OBHA 2PBZA 2IUUA 3FYIB 5L51A 4MVJG 4M8IA 3BWDD 5M59B 3O93A 1W1WA 3PFGA 5ISMA 4ZQEA 1UMCB 3KR9A 4MDYA 3GJRA 3HG7A 1GN6A 2JS3A 2E2WA 1FDIA 4BBAA 4WUTA 4P86A 5A3VA 3AWIA 1M5RA 1XROA 4DILA 2E76B 3BBPA 2EBHX 3UJAA 4DYVA 1IY0A 3UFXB 2H85A 4I4IA 1T9AA 5JISA 2X22A 3W3AA 3HB9A 3HCWA 1YO6A 5JS8A 2I55A 2C5FA 3O3MB 2DH5A 3ZRVA 3U4DA 3DTNA 3SDZA 4HX2A 4CC5A 4D2IA 3LECA 5E6UA 3AUFA 3BFPA 2GJ9A 4XWOA 4YMVA 1M1NB 3P0HA 1SUPA 4X6XA 3RS8A 4A0GA 3GJ7A 1MRZA 3BD7A 3OA0A 1LF0A 2O07A 2DKNA 1F1JA 4OXKA 4ZFTA 3VMMA 3SJUA 4EEZA 5AHKA 2HJDA 5FQOA 1M2KA 4RF3A 4FYXA 5HE9A 3PSAA 1OR8A 3EVEA 3N2KB 4GKKB 2N74A 2VKTA 1SPBS 3ZU4A 3NR7A 3G2OA 4EGFA 1M7BA 1VQMV 5KC8A 4P3XA 1PG2A 2JK0A 4PA9A 1E2UA 4PLFA 1H2SB 3LCJA 4ALJA 3ITKA 3JSAA 3FDZA 3RS3A 4Q9LA 3RK4A 4B7EA 4WBSA 1K8YB 2Y3IA 3LOUA 4M9RA 3C3PA 2AFHB 4RDIA 5CAEA 3LSYA 1PJAA 3FUTA 2R751 1I1NA 1SCBA 3PJRA 1T0UA 3ANLA 3F71A 4PHTA 4A1FA 2FR0A 3LQ4A 2X6CA 1TUEB 4DE5A 3OPYB 4KFSA 4RKYA 4CLXA 2YFYA 3ITNA 3ETJA 4J7AA 4UXIA 3CNNA 2AQIA 2PLWA 4FW9A 4Z4QA 3KE9A 4GL2A 4MVOA 4MVZA 2EWMA 1DNPA 3REOA 4FQ8A 4WFKA 3FG9A 2PBLA 5BPFA 2X8JB 4WN3A 4XR9A 2VZ0A 1RJEA 1SBYA 2I7CA 3V48A 3WBJA 1PZMA 3FYCA 2FZGA 2I76A 3HRIA 1BU5A 5KYXA 2CLEB 3KAPA 1Z74A 4QJIA 1TMYA 3AONB 3QSYA 2IYSA 1Z8DA 2ZS8A 4E70A 2Q3DA 5JE8A 2NVWA 2VJYA 2NM0A 3H8WA 3DSRA 4EYKA 1IZ3A 2XGOA 4C0QC 2QVYX 2A9OA 3KWFA 5EZYA 3IBGA 2YWXA 3FZGA 1Z45A 1JE0A 3GEBA 3PXCX 1TCBA 1IBSA 5ALSA 2VYND 2PZLA 4GIBA 4ZOEA 3GEPA 2XQIA 1AOXA 5LOVF 1E4EB 2FFJA 1OLXA 2WLJA 1QAQA 2OBCA 3ETDA 4UEJA 3CRCA 1C2YA 4PCAA 4A2WA 4UXJA 4F21A 4OD0A 3SYRA 4E31A 1UXOA 5HFNA 2GA9A 5KYVA 1IURA 2ZUCA 2YKGA 1KO4A 4ZYYA 4MTOA 1X80B 1EVYA 3H6KA 3OFNG 2Q5IA 4CJXA 2ADMA 3AW8A 5ENVA 2O7SA 3TCNA 1ZR2A 3C7DB 4FQ7A 5J9FA 1MAUA 2IPAB 5D3KA 4GRIA 1TTTA 4LMRA 4IP0A 1FP1D 3JVUA 5AVXA 1D03A 2ZJ4A 3Q1KA 2C0QA 5ICEA 3BWCA 3HHPA 5ICFA 4M37A 1GRRA 3EEBA 1UBJS 5K2OA 4Q4HA 2P68A 2E87A 2VZ9A 4JX9A 4HG2A 4GOLD 2O14A 2SBTA 3CYFA 3FAVA 2VP3A 3D31A 1UBSB 1LI5A 1WHSA 4MLDA 4X62B 3PCXA 2GV9A 1RHMA 3BG5A 4MVUA 4HUTA 3FLMA 3O94A 1T2CA 4RXTA 1QBZA 4BQOA 4H7JA 3L7JA 1XZJA 2A1IA 5TGTA 4EX6A 2P1ZA 2IBZH 3ND6A 3GLFE 2W43A 3I58A 2DMRA 3MQ2A 4CN9A 3V1LA 1C7JA 1OXSC 2GR9A 2BCCH 5B57C 4DA7A 1HQCA 4DABA 2FPRA 1BMFD 1N2BA 5FHQA 3ZEAA 3CZCA 1KR5A 4QARA 3EVDA 1KMNA 3UGTA 1N0VC 2WINI 1WSWA 3NOOA 4J0QA 2FJ0A 3W7TA 4OQYA 4RVNA 1J8YF 3HXPA 3AFMA 3AO0B 4MQFA 3WAJA 3SPCA 3C8HA 3CONA 1FS4A 4PW0A 4HQKA 4LIPD 1RHQA 3CN7A 3WMRA 1A2BA 3FDFA 4PBRA 4EI2A 1VP7A 1T4MA 4EG7A 3GYBA 4I4CA 3SXUA 2XXAB 3B2EE 2PUBA 1PX0A 2EXXA 2EJ7A 1P18A 1AA9A 3EARA 3PUXA 1VPEA 4RJKA 4IRXA 3ZQKA 5C4MA 2B99A 3CJQA 2DHQA 2X6QA 4KJZA 3GUCA 1JS1X 1CEZA 4DW1A 3FHCB 5EKSA 5EE9A 1U2GC 1QF9A 4DZRA 3R7WA 4TL9A 3AF6A 3ADKA 4P93A 3RTGA 2JGMA 1IRXA 2HWKA 4N0MA 4OKNA 5CFQA 2C97A 1GT6A 3RM3A 3C6XA 2PMFA 5FIUA 3R3XA 1S8FA 3TNYA 4QREA 1QZZA 5CBKA 5DVZA 4IO0A 4OPHA 3UHPA 1KEWA 5B1BB 2H2DA 2EKPA 3ORYA 2NSYA 4ZQGA 3AF0A 3R0XA 1FA9A 4DLSA 1TYCA 5KJCA 1SERA 1DC3A 1RPZA 3KQQA 3I6YA 1T8RA 1QFYA 4MPJA 5LZ4A 3QPUA 2VRZA 4KPUB 1G8GA 4DMGA 1I2ZA 4ZCRA 4XSVA 1KDRA 2C2MA 3W2GA 2NZ2A 5IYCO 2R60A 3F9RA 4XYEA 4RE5A 1L4GA 2V1UA 3WNQA 5TR9A 1V1RB 4A9AA 4QTTB 5BSHA 4HOYA 4YACA 4FUQA 3QXJA 4MJ3A 5BWOA 4JR1A 5L53A 4UV9A 2WIGA 2BPOA 2NADA 2ZJ0A 4NYIQ 5SV2A 1Z5PA 3T5GA 4LF5O 2ODMA 2DC1A 2RCVA 2DE0X 3LM8A 3GAMA 1C3OA 2Y69B 3OZFA 2XYHA 3DHVA 3SCZA 3FYDA 4NYIR 4Q0MA 4PFQA 1DTWA 4L22A 3OEHG 4IG9A 1U99A 3IAFA 3CCMV 3KZOA 1RJ9B 1PS0A 2ON6A 1I7LA 2UXCB 1JVMA 2BMJA 2R1UA 4GPIB 3PFBA 1IUPA 2HDOA 2C8VA 4NCKA 1Z35A 4MVJM 2OZEA 4H37A 2XITA 1ZIXA 10MHA 1YBMA 2QS9A 3LYHA 3JD1A 1KH1A 3EXG2 2ZCVA 1DOZA 4D57A 3OOJA 1IXSB 1NVFA 3L73H 2NXJA 1S77D 1Q6HA 2Y99A 3PQ6A 3LUDA 2QJTA 1YVRA 1U6KA 3PT9A 1KERA 2LDXA 1EK0A 1S2MA 1PFWA 1AP6A 3PSHA 4EA8A 4F60A 1Z56C 1LNSA 4BV2A 2HBYA 2REOA 4HQLA 1EH5A 1T24A 2B4YA 2PYZA 3FTDA 3CHXA 3ND8A 1XNQB 1HA3A 3TDNA 4ALLA 3AK1A 2HGSA 4YA6A 4DIUA 1TT7A 4TX1A 2VK4A 4AKIA 4U3JB 3ZCXA 4D8TA 1U97A 3P2YA 4CKWB 4WUVA 4AMVA 4NKGB 1D7AA 3JSNA 4BYMA 3M6FA 1OPXA 3OFNA 1K6EA 1QFZA 3R44A 2Z3WA 1N7GA 2VYCA 3IJEB 1EK2A 3DPSA 1XR3A 5KEIA 4FC7A 4PNPA 4H3KB 3GVCA 3FHJA 1Z75A 2E9SA 2H08A 3UG6A 1YR9A 2QRZA 1CNMA 3IRUA 2C2OA 5K1PA 2MSCB 4U3FH 2GVDC 1E20A 3WL4A 2XEXA 2FI1A 3UH0A 3DZFA 2W4QA 2IYAA 5LMNB 1WJZA 4MLZA 1FSZA 3EK2A 1USUA 1A7KA 1HG0A 3LLMA 1KI7A 1XO1A 4J1NA 4K1RA 2ODPA 3KWLA 2CUTA 1RI4A 3I8SA 2G7ZA 5LZ5A 3DOHA 5T67A 2WZQA 2BJHA 5CLHA 1PM9A 2JDID 4TTVA 5I9IA 2XB6A 5DXAA 4D02A 5JSFA 1Z47A 2GLXA 1P74A 5JAMA 3HJGA 5JI3E 1QMGA 5EUQB 2G0AA 4FMDF 4PLWA 3D3KA 2B69A 2PMDA 4J0GA 4EFLA 2PWZA 3VV3A 1VMEA 4HQFA 4YAUA 1JA8A 3DTTA 2ZNJA 4ZYVA 3EC7A 1FW6A 3TCUA 1XRJA 3CX3A 4AYXA 2AOWA 5HZKA 3WWPA 1D8AA 4K1LA 2D5CA 3P9SA 1NF3A 1OIVA 4V3CA 1R8XA 5LD2C 4MVJI 4DHWA 4KN8A 1T5BA 1WQ4A 2P78A 4MW6A 4FLEA 2VUIB 3LK7A 1NJ1A 1SB9A 1X59A 2DUMA 1D6NA 2ZB7A 2ZWMA 5AW2A 2ILMA 5AW3A 3DE7X 5JW6A 3MOIA 2BR4A 4CEHB 4HNAB 4QODA 2AGAA 1WXIA 3I9V1 1UK9A 3B5IA 3ZY3A 3PUIA 3ZGVA 3V3KA 4CMJA 1E6EA 1ZBQA 5B2ZA 2FLKA 3E9CA 1IVNA 4RD4A 4TN1A 4P2BA 1L2TA 4PAOA 2QUAA 2CC2A 2V8OA 5IKXA 4P0QB 1NBMG 4OGLA 1N75A 2YW2A 2J41A 5TDHA 4NV3A 1YA6A 4B6PA 2QX9A 3DTYA 3FPHA 3LYAA 4FYHA 1U2DA 4DUGD 1VIMA 4L73A 4OJQA 3DE6X 3FOCA 4PC6A 4JI3B 4E5VA 1WCWA 1H85A 4FWBA 3VTAA 3BHNA 4HDMB 4BR6A 4EJSA 1QH9A 4KVAA 3LXXA 3NVDA 3PUJA 4LK2A 3ZY2A 2O8BB 4W9MC 1H1LA 4O1HA 2ZIUB 1XSEA 2A6PA 3F7MA 3PLRA 4D4JA 4YO8A 3RSQA 5EINA 2X0JA 5EOVA 5DM6V 5CFNA 1HH4A 3W5BA 2R66A 1C7EA 2HA6A 2IXEA 2Y1OA 1ZLXA 2ZRNA 4CLHA 1MQ9A 3KU4A 2TMYA 4FYVA 2FR8A 5BSMA 4B81A 1RLOA 1UK7A 1RQLA 5HG0A 5D3ZA 1G59A 3BDVA 2VQ6A 1IY8A 4B7KA 3WSWA 1WAZA 1EUYA 4RF5A 3DKVA 5ALWA 3PDIB 1QV7A 1OUMA 4UVBA 1T0HB 4WDRA 3N5CA 1BYUA 3HJAA 4KREA 4Q93A 5SZJA 3DVAA 1UR5A 4Y6RA 2ZM5A 3LE8A 3RKRA 4AICA 2W4IA 4G85A 3OEHA 4P0TA 1U28A 2G6VA 1AS0A 1VA5A 1TJ4A 4BIIA 1LK5A 2H18A 2ZSKA 2Z0AA 2Y0CA 2MMCA 4DIKA 2WZDA 3CKKA 4FK5C 3JYQA 1CXZA 2WPDD 1XDGA 1UWKA 4JH0A 1ZM4A 4L8GA 1QG4A 2O5RA 1FSSA 4AJ4A 4GC5A 3C1TA 4KUGA 1VCIA 2SECE 3WZMA 1A50B 5DYWA 4PRYA 3A3NA 1OAAA 3K79A 2AKEA 3AFIA 1YKGA 2RMKA 5DGHA 2YZ2A 5HBGA 1JLKA 3T1NA 1ML3A 3OD5A 1XZNA 3RFCA 4LY0A 3QM1A 4US0R 1S72V 4B3SB 1GVHA 1G20E 4LF4B 1ADGA 1NLFA 1WXDA 1X4TA 1KQ3A 1LBIA 2AJBA 5ALDA 4D9FA 1P2SA 1X15A 2WILA 1CB0A 1TYAE 2NUTA 1ZYUA 4JI1B 5L3FA 3UWKA 1WUIS 2RHGB 3ILSA 4KR2A 3S81A 2P9EA 4N21A 4DKJA 4BV8A 3DZGA 4GLFA 2QTGA 1TKBA 2Y27A 1GM5A 2A9RA 1EZJA 3EXIA 1FX1A 2XMGA 4M0DA 2B7CA 3FRHA 4O02B 3GLHA 2GERA 1F9EA 3T3DA 2QUKA 3JQ8A 5ALJA 3MWGA 2XMQA 4NP6A 3SM9A 1J33A 3GBVA 4WQMA 5CB4B 1VEWA 4RPGA 1RYFA 1A9XB 2JJQA 1HTTA 2PRKA 3E9RA 2AX4A 3CC8A 2JIZD 2PNJA 1USVA 2H0AA 1Q44A 3PFFA 4QG7A 1DU4A 2BMFA 3ZS9A 4RDXA 3BEOA 4RCYA 1HDZA 3JD3A 3MMSA 5BPHA 2ZIZA 2NQTA 2E7ZA 3WKEA 4R9VA 5AM1A 5MN6A 3P2MA 4LJRA 3V8RA 4A5OA 1CF2O 1CJUC 3OUZA 4KXYA 4UDOA 1H9BA 4F5ZA 3A2KA 2YFKA 3AG1B 4I4TB 2LP4Y 3DXZA 4CMEA 2IE8A 3VOBA 3ZJ4A 4BWFB 3B4SA 1DX4A 4QU0A 1KI1A 2FQ1A 2Q73A 5A02A 3VQXA 5DO9A 1CW2B 2AOVA 2PO5A 3D2AA 4AG3A 2ZK7A 1FTQA 5AKIA 4B4VA 2BFMA 1B3BA 1B8NA 1YS4A 4EVSA 3IE1A 2XB4A 3VO8A 5CGQB 3TFQA 4WY2A 4XJVA 4WZAB 1O5TA 1JLLB 2PN1A 2WTMA 4GZ6A 2RGYA 4JXJA 4LRTB 1MJFA 1PJ2A 4B8WA 3ETNA 1JQKA 4N49A 4DL9A 4PYKA 5ALUA 5AOCA 1Q11A 3G9QA 2AJ8A 2Z6VA 4KE7A 5E3JA 1DAOA 4JS0A 1DKUA 5H68A 5BXYA 1C1HA 3BY6A 1C1DA 1TUIA 1V71A 3AR5A 3EDCA 3NCTA 5EE0A 3HO1A 4IIJF 5DEDA 5FOQA 2YXLA 4ARUA 3FFWA 3RFVA 1X1DA 1RI1A 2L0XA 4KK3A 4NCAA 3FKSD 3CSSA 1FZQA 3W8RA 3D3QA 1NQUA 5EHGA 2ZXEA 4JKOA