2B1GA

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Structure-based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 208
structure length 590
sequence length 590
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2005-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2b1gA04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2b1gA01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1gA02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2b1gA03
1THZA 2B1IA 2X8WA 1C3OA 1KEEA 2IU3A 1EGHA 1M9NA 2B1GA 1M6VA 4EHIA 4A1OA 1VMDA 3ZZMA 1PL0A 1S89A 1ZCZA 2YVQA 1PKXA 1C30A 1T36A 2XW6A 1A9XA 1IK4A 1P4RA 1CS0A 1S8AA 1OZ0A 1G8MA 1CE8A 1JDBB 2IU0A 1BXRA 1WO8A 1B93A 5H3LA
chains in the Genus database with same CATH superfamily
3L7YA 2XNDD 1UM9A 3U31A 4GRDA 2FZWA 1QR9A 4I1RA 3ZGZA 3NDJA 5EZ6B 2C9YA 2B6NA 3GCZA 1T8RA 2VHEA 3K71B 4P9OA 2YRXA 1H9BA 4LXIA 5EWLB 1O5TA 1SIOA 2BI4A 1GAQA 2DG2A 3CBGA 1ZICA 1G59A 4H7PA 3GRKA 2G72A 5F5XA 1AK9A 4UTXA 4F7OA 5HS4A 3DOFA 2VPQA 1WMFA 4GOOD 1GU7A 3ESXA 3ZZNA 2PNFA 5B1AB 4B4OA 4LYHA 3PWKA 3HTXA 3J81k 3NKVA 1RIIA 4ITUA 1GZHB 2VTEA 1CKEA 3ESAA 2O2XA 1XREA 3CUYA 1QRAA 2AH5A 3P9XA 1SZPA 4A2PA 1WBJB 3U13A 5BMVB 4AU1A 1PT6A 3I8XA 1XXHB 3IDAA 4YCSA 1YT5A 4J0GA 1U3FA 4DNFA 3NB0A 4YMGA 1HE1C 4LCPA 1MAWA 1NMYA 4G1EB 4F6EA 1UZNA 2YCLA 4HLUC 3VZBA 1LK5A 1O95C 2V98A 5AVJA 2IRWA 2W4LA 4GYYA 1FDTA 3GAAA 2W42A 4K9NA 4IWYA 4FU0A 2OUIA 2BMEA 4RV4A 1WCV1 4BC0A 2JS5A 2GLXA 4CKEA 1G1MA 4OHOA 5HK8A 5B1IA 4GD3Q 2X6BA 3GFSA 3BWYA 1DK1A 2OT3B 2RH5A 2IEIA 4LEIA 4P82A 5BQXA 1LTHR 2R4TA 1E1RG 1BXGB 2R0QC 3UC5A 1NXTA 3UB2A 3TBFA 3SX0A 1Q12A 1JDJA 2HT1A 3EEFA 3PHGA 4QYIB 1TMOA 2A14A 3CTPA 2XB2A 1NLUA 4PICA 4J3JA 4LJLA 1KNQA 1GH6A 1RBMA 3JVIA 1S8OA 1B0UA 1XZ8A 3CS5A 4YWHA 2D0DA 3CF4A 5JR3A 2ZXUA 3Q0IA 4OU4A 3WV4A 4IGGA 3D54D 4OK5A 5CFLA 4YMIA 1SK8A 6PFKA 4LJAA 4X65O 3MW8A 4H13B 3JYNA 5EGNA 5K3DA 1UBEA 1R0YA 2B98A 2N46A 2V0CA 4KG7A 2JBAA 2PRKA 3GU3A 1AQJA 4ZQFA 3L8ZA 4KQWA 3N75A 4PYMA 5IYZF 1I94O 2WSBA 4P86A 5JNLA 5CDTA 4JP2A 2XAQA 3ZN0A 2QWXA 3ZWNA 2O3SA 4J4TA 1T9KA 3UMFA 4B83A 1QH8B 3D5QA 2OBFA 2XNJA 4LBYA 1PX2A 3LBFA 3M1IA 3USCS 2NXJA 1L2TA 1MC4A 3RANA 4O3MA 2FFHA 4Y9RA 2O0MA 2REOA 5K4HA 1NXOA 2QV7A 3T3GA 5HUQA 1T0JB 1N75A 5A3SA 4XD2A 4L3VA 4LCEA 5L3VA 1K3FA 2WWYA 5JCXA 2JVDA 1FDVA 1XQ1A 1SD2A 2O5CA 1UP7A 3O95A 4K7JA 5KQLA 2LJ2A 1QV7A 3VDXA 1VYTA 2HHHB 4IMJB 2DWQA 2AHOA 1FP1D 2HIAA 2QG4A 5JBIA 3TX6A 2G8LA 2DMRA 1SC1A 2CKMA 3W6PA 1MJHA 4NJMA 5DGIA 1JG7A 4DC0A 4WLOA 1VQMV 3VPXA 1J8DA 1GN2A 4GYCB 3HR4A 1T10A 4CQMD 4DBVO 1M8GA 2GZAA 2IC5A 1QMPA 1V5FA 4IFTA 1ZAKA 4JDUA 1AQLA 4QVGA 2Z8XA 1SQPH 2LWIA 4Y6SA 3EXHC 1LFAA 1WZIA 2M6YA 1JR3E 1X42A 2DECA 3ACBA 4ZGWA 4K8OA 5L3QA 5EJMA 1E3WB 2HA6A 5BSFA 3UT6A 1YKFA 4QRHA 4E31A 1V96A 1UAAA 2NLOA 1YZYA 5FTJA 1XPOA 3S27A 5C1OA 1JG2A 3E58A 4DB2A 4EY4A 4XX1A 4IJQA 4S1PA 1VRCA 3KSAC 3GBVA 3I83A 3VBEA 4ZAFA 4WTOA 4Q7QA 5LMNB 1QZZA 5CXQA 4KFSA 1QO0A 1VIDA 1W9MA 2ZJ8A 4FHDA 1AHPA 3CEPB 3ANYB 4QX6A 1WQ3A 2V9PA 3DMTA 3JQAB 2D5LA 5FEMA 5A0FA 4YJ3A 3TVDA 4JJ6A 1XWIA 5C81A 3KYJB 4LNAA 3PTLA 1JT2A 4DIUA 5I45A 1K3UB 4M0MA 1JFLA 2VRBA 4AYWA 4P7FA 3TLJA 4IIHA 1FBTA 2WWFA 4MTOA 1VC2A 4ZVSA 1N7JA 4CGZA 4EHBA 2Y92A 3D8NA 2PFSA 2ZTLA 3EX8A 3TCXB 4LF9O 5EMJA 2X5JO 4E94A 4K0RA 5HF5A 3KAQA 3V2GA 2W2VA 3SKXA 3AL3A 4J43A 2P2YA 4FFDA 1EBUA 1N8TA 4RM2A 2QR3A 1IEVA 4A0GA 4YQFA 4RABA 2QE7A 5FQOA 5IAKA 3ZDAA 4JENA 3DAHA 4F4HA 3QLJA 3A28A 2GYWA 1BH6A 2WTNA 3HU3A 2Q1TA 3L93A 1WKVA 1YOVA 1N6LA 2JGFA 2VDWB 3VJKA 3RYFB 3GRCA 1L4YA 4TLEA 4UD6A 3Q7QA 3A4YA 2G0TA 4ZV4A 1DDIA 2O54A 4QE3A 1NP7A 3DMHA 2F55A 4JI0B 1B1CA 3HB4X 4RE6A 3QHQA 5FNVF 5E2AA 3ZDRA 4A8HA 1N0NA 5C3MA 4BXOB 2O5EA 4D6TH 3U56A 2CKDA 3E2IA 3IOEA 4AXXA 3L7DA 2QUIA 4DM4A 1RLIA 4PPNA 6AT1A 1TX4B 3E0XA 2J9GA 2OPBA 4LTMA 3AWDA 1D1TA 1M34A 2NO1A 4HZUB 3P26A 3LI2A 4B3RO 4YCJA 1M1KW 1L3IA 1EGAA 1Y37A 4UUPA 1HW7A 1MQ9A 3M4YA 5THKA 4N8SA 2QJTA 1NKTA 5IK2D 1ULZA 1GKYA 1E59A 3PFCA 3D8RA 1TK3A 4O4HB 4B46A 3GX1A 2DLCX 1HXHA 4QFBA 2DC1A 4TS3A 2EWVA 1Q3TA 1NJ2A 3S28A 1QGUB 1S3IA 2P1DA 4X1OA 3LVBA 2Y3IA 3T9BA 4QYMA 4ZXPA 1GTL1 1YRAA 6REQB 1ZJJA 3H1EA 1PV0A 5KUTA 4E1AA 1WW8A 3V8QA 5T67A 2O14A 1GAJA 2J07A 2OD2A 1YASA 1K9VF 4KDCA 3OQ1A 4I50A 1HSOA 2X3UA 2V4DA 4RANA 2Y0IA 3O47A 5B36A 1T4GA 4ALKA 2IU3A 3OTHA 3EVGA 1S01A 2ZITA 3SC2B 3SYCA 1EHIA 4ASUD 2ZINA 2P3OA 2VJOA 3BAZA 2NO9A 3IHWA 3VKUA 5EYPB 3IBTA 4JJEA 1TZKA 2EHJA 1P84F 2XD4A 1G4HA 4NBNA 3TLEA 4YV0A 5HDQA 3TF5A 3HBAA 2QTCA 5IF3A 4O4LF 3ROFA 3QW4B 4H6WA 3EZ9A 2ATCA 2QD3A 4UOZA 4I3HA 2FWJA 1VCMA 4ABYA 4OGQB 1EKXA 4AJJA 4Z4HA 2AXQA 5U9CA 3MA0A 4Q4HA 2QZJA 3TTYA 1MJFA 1RFGE 1H9CA 2HJ9A 5FI3A 3KE9A 5BYJA 4GQAA 3UC9A 3WMGA 1Y5IA 2CXUA 2EBFX 5A03A 1TZBA 1T1RA 2FUCA 4L5BA 2J46A 4Z49A 4P32A 2AD1A 4LF4O 1M7BA 4GHWA 2VNKA 3S5JA 4NATA 1IOZA 3T3HA 2G8NA 2VATA 3ROZA 1VRVA 3LZDA 3B4SA 1G8HA 4K3AA 4BO5A 4NRDA 2VK2A 1T4DA 3KE8A 1T24A 4O6VA 2Y93A 5MF6A 2Z6VA 2G77B 4Q3LA 4MKZA 4KKVA 4MRSA 3TNFA 2VHCA 4K9PA 1RM1C 2P7IA 2X6CA 2G3YA 3I1IA 2ANCA 1CE8B 2BBTA 2QU8A 2PE5A 3MAGA 2YS7A 4LFCO 2QMOA 5IMSA 1P62B 1O03A 4ESOA 1PSDA 2V8BA 1JQDA 3U7HB 4S0ZA 1LPPA 4MHSA 2QQEA 4O2RA 1QG0A 2FLWA 3DBOB 1GL3A 4FFBB 4JNKA 1KI3A 3Q7SA 1LB1B 2DUMA 1LUVA 3A1FA 1ZJYA 2JCBA 4KZPA 4ZVLA 4ZALA 1IN4A 1XD2B 3PUIA 3PHHA 4EA6A 3F96A 3O2QB 3PGXA 3RC1A 1H05A 3RD5A 3DTVA 4OQQA 3TGWA 5EJFA 2VJMB 1KY5A 4NYKA 1D07A 3JSAA 4QLOA 3JSXA 3ABIA 3K5HA 1AO3A 5BWBA 5CITA 5EXTA 4LXXA 4GLFA 1PN3A 4PFQA 1MOZA 2I0FA 3BTUA 2ECQA 4QTYA 4TS1A 1VDMA 4QTTB 3JWEA 1GCIA 1PCXA 4IUYA 5A06A 2GPYA 3GJ8A 3CWZA 3JQFC 4WUTA 4IGEA 3TBHA 3RUPA 1RKQA 4IDPA 4J0QA 3WSWA 4O0MA 1EX6A 4YAFA 3FUWA 5DRTA 5J3JA 2ZKOA 1YJQA 1ZVVA 1OJHA 4OXRA 1GQSA 3NAZA 2BDUA 5BWLA 5A4FS 3T35A 3INGA 2D1RA 3K05A 3LVRE 1LDNA 2NSLA 4P2ZA 3B09A 4U6NA 3HEMA 1U2EA 5CYFA 3FMVA 4N48A 3UT5B 2EFGA 5IARA 2JIZG 3GQVA 3AHGA 1WQ4A 2PSSA 4ZGBA 4BN4A 4B7UA 3M4NA 1ZG3A 5HIMA 4ZOLF 4N76A 1G6HA 3AY7A 3EUAA 4ZMBA 5IU6A 4F2GA 1A72A 3RIYA 2BPOA 3HZHA 2EKPA 2R6ZA 3UW1A 3T3NA 1MVOA 3SGLA 1PJTA 4XGQA 3ZDEA 4CV0A 4ZZIA 1RXWA 1SZTA 1TUBB 3FDZB 2TYSB 2C54A 4QQ8A 2VVTA 2VWKA 1YZGA 4BFVA 2XQFA 3DEZA 2NP7A 5FOVA 1O0CA 5EIEA 2X9GA 3OD4A 1NP3A 2FPPB 4PWZA 2CVQA 3C6XA 4JTCB 4AI6A 1K0FA 3C16C 4DHWA 4AG5A 3EXIB 4P7BA 1A9TA 1P1CA 1P9NA 4CM3A 5LYJB 5CA1F 1U4OA 4XCQA 4C3UA 1N5RA 5EAIA 3WAGA 5ESXA 1Z5UA 3U5TA 2CVOA 1ZM4A 1P74A 1P49A 2NZXA 5F7JA 4EKGA 2HEPA 1K4MA 3E3AA 2JDIA 1ESMA 2O4UX 2GPAA 3QV2A 4WMLA 2NU9B 4WAUA 2JJ1G 4HH4A 2BEVA 3BE6A 1XQ9A 1KO1A 4B45A 1X86B 5EE1A 1P91A 1ECLA 2DKOA 4B7AA 2X7JA 4B81A 1W96A 4UM8B 4W63A 1PZNA 4MKRA 4D41A 1T5IA 3DO8A 4F8EA 2GK3A 1IWBB 2H16A 2XAHA 1NI8A 1L7QA 1OWLA 3AR5A 1NTOA 4EMTA 5I4KA 3G6EV 5JYEA 5NULA 4LA4A 1J0AA 3INYA 2FWMX 3HU2A 2CJWB 2FZVA 5BV7A 4HUQA 1J1ZA 4KYUA 4KVZA 3T1HB 1ZN8A 3IT3A 2VPZA 1L3CA 4D0GA 2QROA 3VJMA 5CFMA 1MV5A 3A1NA 2G17A 5IYDO 4TV8B 1Y6JA 4JLMA 4B3DA 1IEQA 1Y5RA 2WJHA 4C06A 2ZUFA 2JRCA 4DA6A 3H87A 3CMAV 3T1QA 4W7SA 2BRUC 2Q7GA 1W8DA 2NTVA 3EF1A 4CH5A 2QR5A 1GZSA 2QSYA 3EZGA 4N0PA 1WXEA 4QDKA 3RRMA 1I33A 1NJFA 3DL2A 4JZGA 1ECCA 3CLRC 2ERCA 2ZB2A 4GUDA 3QOYA 4BNXA 1OKKD 1FRZA 4X97A 5BSHA 1HK7A 2FMIA 5REQB 4RFSA 2VA8A 2FSGA 2XASA 4KAXA 2A1TR 4F38A 2ONJA 1PRYA 2WUFA 1EYZA 4CDGA 4P9NA 1OXBB 1PD3A 1Y6ZA 4EUFA 2NT4A 3BCHA 3PJFA 1S1MA 4N39A 4X1IA 3W5HA 3ACCA 1HOXA 4B3MO 4QFTA 3F1KA 1ODCA 1EP1B 2HM7A 1AXGA 3SYQA 2V7BA 2W8BB 5A1JA 5JW6A 3CPSA 1XTKA 1HA3A 3LWDA 5C1BA 4RHFA 2C5HA 4BE7B 2IPMA 4DDHA 4DMFA 4KHPO 1XUOA 1VJRA 2O3TA 2IZ5A 4BLUA 3VNRA 3VOTA 2PR2A 2YX1A 4JTAB 1CP9A 1IPHA 1F9EA 4UVGA 1VJTA 3ZXIA 5KYWB 5TY0A 3DFMA 3GRVA 4RD4A 3HU5A 3QKRA 2JASA 1JG1A 3NEYA 4NOMA 1NSTA 4CKBB 3L7LA 3BGSA 5IM4F 5D6OA 2XUPA 3EZXA 3QBJA 2D3TA 4QPCA 2D7JA 3A8TA 1JQ3A 1QH1A 4GLLA 1ELOA 3R0XA 5LQCA 4FBMA 3DDNA 4KN6A 4JT2A 2QN2A 1ZPDA 1JQ0A 4PA7A 4DV1O 1E2NA 4TN1A 4MVSA 4GSKA 1GDTA 5I51A 4YP1A 2EERA 2MR6A 4RJKA 3P8ZA 1ZRMA 3H1JH 3ZDDA 2FRVA 4PS0A 2CF5A 3Q41A 4YAOA 4XWYA 3P5BA 1D0IA 5DSXA 4XGKA 3QUSA 5KYYB 1X77A 4D3DA 1BE6A 3AB7A 5DZSA 5KTYA 2G9ZA 4GKKO 4FIDA 3OH8A 1BX0A 4YACA 1U6IA 1ODKA 4J41A 1YZBA 4EJSB 4OIFA 2CE7A 4RIEA 1S0UA 4OXIA 4RQFA 3T1OA 2OYRA 2UVPA 1FRFS 4DEYA 1UK6A 4K6OA 4DIDA 4DSOA 3FFBA 1WP8A 4ND7A 4JD5A 2OXRA 1Q84A 1B8NA 2OAP1 2CHQA 3OPYB 4Q1FA 2YJ6A 3PFNA 5CD1A 4ARZA 4CPDA 3CNOA 1EH5A 1XCOA 7GPBA 2QTRA 5DHPA 2WYHA 2G9UA 4DFDA 3LZCA 3HP4A 1SIWA 4YGXB 1Z8FA 3PC2A 2ZYWX 3G82C 2AT1A 3WB2A 1YK0A 5CW1A 4D9KA 5D3MB 4M7WA 5LXTF 3CPJB 5AI6A 1NVVR 4GQIA 1Z0FA 5DLDA 5TR9A 1T8WA 4IWXA 3BBPA 3LPNA 3GRAA 1BJRE 1HLGA 3UJHA 3PQEA 4F4DA 2POQX 1ISGA 2QJ1A 5KS2A 4JBNA 2FVYA 2R8PA 3QF7A 3E89A 5KDLA 1KZ6A 5J4LA 4TYMA 4LYGA 1IURA 2JGKA 3D0KA 2ABWA 1RACA 2WMYA 4EJ6A 4O4JB 1J9EA 4KNYA 2IA5A 3QFCA 3UJ6A 5KNCH 4US1R 3ADCA 4WOPA 2RFLA 2DBVO 5EE5B 2OBCA 4URVR 3NETA 5TQ0B 1HE2A 2I54A 4OMFG 2ZRCA 4PYOA 4ICIA 1F2UB 3ZWVA 3CRAA 1BYIA 1YVWA 1XLVA 4GMHA 4N4AA 4C1NA 4BLOA 3DAOA 5K0LA 3ZRWA 4PGMA 2JHCA 1FXUA 3VSEA 3UHAA 2YTZA 3T9EA 4KV7A 4BFXA 5EFOA 2CXXA 1E4EA 3C4JA 3DZDA 5DM4A 3CRRA 1QHHB 5HKKA 3OX4A 2EFDB 1PGNA 2QRHA 1GNSA 1H66A 1R64A 3I9NA 4RE5A 1EK2A 2XVXA 3DBVO 1NXVA 4ZCMA 3AR2A 4CUJA 3FIUA 3QYJA 3P2IA 1ZWIC 5A5FA 4LC5A 2F95B 3ZJVA 3DHYA 3I1YA 2MSCB 4NCBA 1VE1A 5BNZA 4EP1A 3EGCA 3H1KH 5HZMA 4F85A 3OU6A 5EPOA 3WC4A 2AVDA 4C01A 4M98A 1HMPA 1FUIA 2D1QA 1TA4A 5KQPA 2YJNA 3I55V 3E7PA 4P93A 3CCLV 2RK4A 4PX2A 1EDDA 2OL4A 2HFJA 4E6EA 4PXAA 2PX2A 4Q3DA 3Q2OA 1OBHA 4LE0A 4TVSA 1ZUNA 4A2WA 3GPDG 3WYGA 2KQXA 2NO7A 4TM7A 2AMJA 2NU8B 1KPIA 2RKWA 2HMAA 5CXXA 1YZFA 4EGJA 2G5GX 4F3RA 4DMRA 4DBZA 1N2SA 3M1LA 2GD2A 3FNQA 2FZGA 3ZY3A 3GUHA 1J2TA 4CI0B 1PFVA 3E7XA 4DAOA 3G67A 1QQ6A 3T54A 1XRMA 4M1WA 1TA9A 1YJ5A 2BH2A 2H4ZA 4UUJC 4DDKA 4PCUA 4LJRA 3LYAA 4LK3A 4C3OB 4ZU3A 2UU9O 3OIYA 5G41A 3QVKA 1Y4ZA 3OQVA 5K0EA 2GJKA 1GQQA 1KEUA 3V1YA 1P8AA 3EGDA 1EX7A 3RVMA 1T3ZA 4JVOA 4YT4A 1B00A 4ZVRA 2Y66A 2XDAA 1YJBA 1CK4A 3A6JA 3VOAA 4G9GA 4FJCC 3MK31 1M6VB 4ZQHA 4J2HA 2H2HA 4PWYA 1RPNA 3SYAA 1ZI6A 4DMLA 1D03A 2WWXA 4LOAA 4WZAA 4EBBA 1SCUB 4LBZA 3P9QA 4OLFA 3QOFA 4XB6B 4DLVA 2W5UA 1U99A 2BGKA 1RBZA 5DGDA 4LGCA 2NTNA 1N5MA 4HSEA 2WF6A 4ND8B 1WXWA 5EJ7A 4L72A 1K8XB 3FTQA 2WDZA 2Q2VA 3R2JA 4OHUA 5AM4A 1B6SA 4KZKA 4MUMA 4BJ1A 3CCFA 1XTZA 1HYGA 5EJGA 3ZLJA 1ODTC 3SQWA 1CRWG 4XQCA 1GG8A 1QTNA 3FSJX 4LRUA 3ZGOA 4IS3A 1B16A 3ESBA 2WJJA 4B6EA 5C5EA 4BNNA 1CT9A 4NS4A 4B6RA 1DAFA 3Q7RA 3TKYA 3AVPA 5AM2A 2WYVA 3N0VA 4LGVA 1SURA 2CL0X 2IYXA 1JWLA 2VFAA 3IVXA 3BG5A 4D8UA 6NULA 3PCXA 2FL4A 3LUGA 4ZVVA 1XC7A 3GQBA 5BSRA 4XX0B 2HDHA 1P7YA 5A7FA 4ZFNA 1FU7A 4B3FX 5HBRA 1OYVA 3RRYA 2YN4A 4YO7A 3PXBA 1U2GC 4JYMA 3DLIA 4KPYA 1JMKC 5A3RA 4LNHA 4MGEA 2JFVA 3AU9A 3NH6A 1DKQA 1XMQB 2VK8A 2P30A 3WQQA 4MUGA 3GLUA 3ASOC 4GZ3A 2WA3A 4FFMA 3HJTA 3R65A 4R1PA 1J6UA 4HAIA 1YCIA 3DR5A 1OHHA 1F4LA 1U2DA 1LK0A 1QANA 4OQPA 2AF3C 3W5AA 1KU0A 4W5NA 3MJEA 4WBNA 1DAEA 1FYWA 3D36C 4ZOBA 1H8HD 3PNMA 4JROA 2K2WA 4L6IA 1UK8A 4I5EA 2EDAA 5D87A 3VU3A 2Q8QA 1II8A 4WIGA 4AX4A 5CA3A 2IZ0A 1FMCA 3D4NA 2B2NA 2GNPA 3UGJA 3G80A 2O7VA 1WHTA 4J0KA 2KBEA 1IN1A 1DADA 2X9NA 3KKEA 1Y7PA 2SKEA 3UK2A 2V7QG 2WRZA 1R6KA 3A0HZ 5ALSA 4CF3A 4LC1A 3RC7A 1E66A 4GMFA 2WLIB 4L8YA 2X2PA 4L07A 2EBOA 2FFQA 2QRUA 2WLKA 4R16A 3SU8A 1NJIW 3BA9A 3QMMA 2HA2A 1UX1A 5D51S 4KRYA 1GM7A 1SOAA 1HNXO 4FLZA 1C4OA 1Z18A 1P39A 1NW9B 1WB6A 1DARA 1Z7WA 3J80N 2OG2A 4L16A 1OCEA 3QSGA 5JS8A 4NU0A 3OOHA 3AYXB 1SZCA 4D8XA 1AJEA 3W7SA 1ESCA 5E7QA 2H2WA 2PYJA 3G85A 1IDOA 4WGFA 1YI1A 3DE5X 3O4IA 4KAFA 3NLLA 3NYQA 1ZD9A 1W19A 2OECA 3GO4A 3NGMA 5F5LA 4ND2A 1H85A 2G67A 4G27B 3EEYA 1C8VB 1VP9A 1RPOA 3NATA 1DWUA 4BLQA 4YRGA 1Z5GA 3SYNA 1YMUA 1XMVA 4YXWD 1P4GA 3X2FA 3UY4A 2Z2JA 4ZP1A 3PF8A 1EMDA 4MI6A 3W2FA 1E6UA 4HWOA 2HWUA 4TM8A 4EG6A 3ESRA 2GUWA 3ZCTA 1HTWA 2Q8PA 4DJEC 4AS1A 1YTUA 3Q8WA 3RRFA 5HM6A 2BGWA 4ISCA 3FGPA 5FWNA 4N03A 1DJOA 1IH8A 2L18A 3U6BA 3L6CA 3C3KA 4OU5A 5LP6A 2I8CA 3NPAA 1I1QB 5ICGA 2CTWA 2ZWVA 1WVMA 4OTZA 3WLFA 1BGVA 1ZIOA 1Q3EA 2WQZA 1LI4A 4EEQA 1DLIA 3AHIA 4FONA 3PEYA 5KVVA 2QPLA 1YB6A 3G17A 2YFKA 3F7VC 1SXJC 1YDXA 1Q7RA 3MJDA 1EVIA 1YJCA 3ZV4A 4Q7MB 1ONPA 3LK7A 5J1SB 4JJAA 2SHKA 4PGGA 1I36A 5IVHA 4C76A 2OENG 3MCVA 4DCCA 2W6ZA 1DS6A 4IGIA 1KMCA 3BKWA 4V0MA 1ZMRA 2BE3A 4ZO7A 3T1YB 1WB7A 4MKIA 4PBRA 1W0JD 4Z99A 4YJ2F 2AFHA 3I73A 2PK3A 3TNYA 1B04A 2LFSA 4F46A 3OQIB 5HSGA 2YXDA 2I65A 2XHZA 4KXWA 4IV8A 4Z1MD 1VKZA 2FFJA 4PA6A 1LRJA 1U65A 4W5TA 5E4FA 1BQ3A 3CJHB 4OSPA 4EO7A 1Q0SA 3BSFA 5FUVA 5A71A 3DOHA 5CA0A 1CUZA 4X95A 2C2ZA 5CYOA 4DR7B 1TRHA 1DT3A 4BYMA 4I19A 4BO7A 4Y1RB 5E7IA 4K26A 2YV3A 3Q9LA 1Q8IA 2EINC 2B7LA 2G71A 1R88A 3WRXA 1XCGB 1F17A 2EFEB 4IFIA 2M6LA 3DV0B 3MWKA 1T5SA 3OLXA 2NYTA 2FP4A 4U7DA 3LLVA 1CQIB 4JASB 1ZYUA 4U7GA 1ZP6A 4YUAA 3T6KA 1YZKA 1R00A 1C8LA 1QC5A 2GZRA 3MHHC 5AK5A 3CT4A 2XOKG 3HJFA 1BE3H 2XXAA 1U2RA 3K5MA 1D1PA 4IIUA 3NVAA 2EW1A 3FTCA 1W35A 4MIEA 4CF4A 4H4DA 5IH3A 4HNHA 3NP9A 3S3WA 1IM5A 2H5LA 4Y6QA 4ZK2A 1P31A 2Q0SA 4YIPA 4DNOA 2Q41A 4IJ6A 3PXGA 2QL5A 1HM5A 1E7RA 3L92A 4ZEWA 4L8LA 3OZWA 3B3AA 1NTRA 3FNIA 3IXQA 3A3PA 5TE9A 3G5AA 3H1LH 3KAJA 1M2WA 2C77A 5DXFA 3I34X 1A2KC 4L51A 4MR8B 2GAJA 3WGKA 2CCGA 2OV8A 1JV2B 3R5FA 1CBUA 2OGUA 3AUFA 3UA4A 4R9UC 1B2RA 5CHYA 5IFKA 2G7ZA 3GLSA 1JHOA 1TM2A 2ZIUB 4HB4A 1FS5A 5HUJA 3WFVA 1JSRA 2FOXA 5HCUA 4WZBA 3Q85A 3EPLA 1HPLA 2IVZA 4I8DA 1KGDA 1E6WA 2YUTA 1UZLA 4JV5B 1QHEA 4KYIB 1LJUA 1JQAA 1VG8A 5DNDA 4EW6A 4CH4A 1GKKA 3MB8A 3QU9A 3GAMA 3QY9A 2M1XA 2WKPA 4B3CA 3AUSA 2GEDA 3KIPA 2YIBD 3W05A 5ALWA 1XT6A 5JD6A 2WBLC 3EA4A 1C0EA 5I7WA 3U0VA 4QXAA 4DLLA 1M75A 3QEMB 2R00C 3AK2A 1NATA 1IZ3A 2I6GA 3GRPA 4O1HA 4D26A 1P61B 3SGIA 2ISCA 2GCPA 3QOWA 1JZQA 2B8EA 2GDZA 3OP4A 3I2HA 2Q5CA 3ZPGA 2QDKA 2BGGA 4H0LB 1IZ7A 1D2NA 3VDQA 4OLHA 4J75A 2VZ0A 1LS6A 1W49A 3P2JA 4MDEA 2F7SA 1MNAA 1IHDA 4G9EA 4V39A 4LHYA 3G0BA 1FU8A 3W04A 3JD1A 4QO8A 1NQTA 5A4IS 4Z3DA 5BMVA 1PU2A 1M2EA 1NAHA 1KZ4A 3EK2A 1XXHA 3C3EA 4M87A 2XI4A 2IJJA 2WD9A 3MJFA 1UXJA 4M46A 3TRHA 4BQQA 2DQYA 1SZXA 1YDWA 3DOCA 1DTWA 4K35A 1U7TA 1QP8A 2VQFB 4OGGA 3LT0A 2ZBEA 2WHYA 2RC6A 4CIYA 2FWNA 1XIVA 2GN9A 3QYAA 4L4RA 2BV3A 2A9FA 1G9TA 1P2FA 1XO1A 2JFPA 1BMQA 3T3PB 2H17A 1DEHA 1XE3A 2JGNA 1UMCB 4Y1FA 1BXGA 1EUCB 1IRXA 3U4IA 5DO9A 1YQXA 3BZBA 2J7KA 3ZIAD 2QMUA 1KYYA 5JRZA 2P6RA 4GQBA 1W87A 5LQUA 1QLEB 4I8XA 5L9AA 4QNNA 2HCFA 4UC0A 4QYIA 1N0VC 4X6XA 4BE9A 5C34B 1K7DA 1EQAA 1KC8W 3SDSA 4Y7CA 3M5CA 3PDIB 3ZRVA 3ZZMA 4E33A 1APBA 3QO5A 3F8WA 1X3LA 3IJ5A 5DNCA 3T99A 3K04A 4CIDA 3ESYA 2RHRA 4ND3A 3FAZA 3RWRD 1XX6A 4PZUA 1Q2XA 5BSWA 2WYWA 3UWOA 5DI3B 4DLUA 3PD0A 1J1UA 2IEZA 3TG2A 3TJTA 4D82A 1NUTA 2GSWA 3OEHA 3KB1A 1XDWA 3LUDA 1QFZA 3CLUC 1NXWA 4FFPA 4LBWA 1KL7A 3JQ7A 5LMCA 4IXWA 2HNBA 1IU9A 2IHVA 3Q8KA 4F71A 4ROTA 3V9PA 3UV7A 2G1AA 5TPWA 3TAUA 3UF0A 2LVBA 4XASA 3BL5A 4NCIA 2PU5A 3FWZA 5A3VA 1R6UA 4KN8A 5GOZA 1SBYA 2C4VA 2GKGA 5AKXA 1KK1A 3ZKAA 5DM6V 5KB3A 1I1NA 2EJTA 4D4JA 3EH2A 1H3EA 1DOZA 4MICA 3EAGA 5FAXA 3R0QA 4PJ0Z 4B08A 4RCYA 3HY4A 1VHJA 1NOJA 4WKOA 2V54A 3D3JA 2VL7A 4BV8A 3KKZA 4DJFC 2ECFA 2GEKA 3L7CA 3SIXA 2ZSHA 4FEGA 3M9LA 3C8UA 2HPAA 2DP4E 4F3WA 3Q3IA 2I6XA 3JYPA 4KFUA 1ZW6A 1KE2A 2Q1UA 4DJAA 3H3XA 4OGWA 4BP1A 3ZLVA 3V1LA 4QNHB 2N9UA 4RF5A 4J0CA 2C5SA 1OWPA 3DQPA 5AVRA 5I7HA 3P9NA 1XALA 3CY6A 4ANFA 5TDHA 4RGVA 2B4TO 4GXNA 4KCGA 1G18A 1Q1EA 1E3WA 1WZUA 4Q02A 1TUGA 3KTOA 3LUHA 5JAZA 1SKYB 2WUGA 2FPRA 2PRYA 4V0SA 1NRJB 2EJCA 3GVCA 1DAGA 1E20A 1JLSA 3RWBA 4DDWA 5BQFA 1KU9A 2J09A 4GI1A 2HF8A 4Q00A 3DZIA 3TTWA 1XVTA 1GFIA 1CEZA 1NBAA 4KK3A 2FK8A 2AOXA 4BNJA 1UBGA 1H2MA 5EBWC 1Y4DE 3JQAA 1NW7A 1IXKA 1ZM7A 5DGTA 3O1HB 2G4VA 1W4CA 1OCZB 3G0OA 2BISA 3SPCA 3EIOA 3K1ZA 3QQPA 3SS9X 3THYB 5JAOA 2QVXX 1NVMB 1DV2A 2WSSG 3NH9A 1M1YA 1Q22A 3KZVA 1H1DA 1ZMBA 1QIHA 2AEMA 1XZHA 1FTGA 4NZZA 5LLSA 3TSYA 1VK9A 1TDJA 2N0SA 1P77A 1NKSA 1NVBA 1RYDA 2Z9CA 2H7XA 1JAHA 3R6LA 5KU7A 1K6IA 3E9CA 3C1AA 3L0BA 1SQBH 1R6NA 1VJGA 3AT1A 2C20A 4H1TA 1RAFA 2OCDA 4AKTA 2ZYHA 2VDWA 3KM0A 2V6IA 3RYFA 2WIJA 1LBQA 4RAIA 2FPKA 1YS4A 3GUVA 4RWZA 4CKXA 3H7IA 1M90W 2ZSBA 2RIRA 2XXJA 4IL6Z 3NV7A 3RHZA 4BXOA 3R0JA 3KT3A 3HCOA 4GZRB 1N2HA 5C8YA 1UINA 2CK3A 4RU1A 2RDCA 3R7DA 4XIIA 1ULAA 5KWJA 5AOCA 2OILA 1E3LA 3WK9A 2NTEA 3C3AA 4HZUA 1Q6IA 4QO7A 1J2YA 4EX6A 3GEDA 2ZSIA 1ZRNA 3H9JA 1CHDA 3H1TA 2IYVA 4DLNA 2ZNVA 4DV2O 4OL0A 2K7FA 1ZN9A 4AIRA 1I32A 1ENVA 4IXTA 3NDBB 3BB1A 2I2WA 2WM3A 4G67A 1C8BA 2ORIA 1W4BA 4O4HA 3P20A 3PFHA 4J0FA 4EVSA 4ETIA 1BRMA 3BZWA 1QGUA 4ZTBA 3WGQA 1JFRA 2YJTD 4I6EA 2G7MC 1U90A 3VR6D 4K8ZA 2I4IA 2XGJA 2QD1A 3CFYA 1GUAA 1G21B 3KBBA 1W2GA 3WADA 6REQA 3FVWA 4FGKA 1NQAO 1YR3A 3EFHA 5TX7A 2ZG6A 1N4DA 3TGLA 3ZDCA 1BMDA 4OJQA 3PNYA 3I2KA 3UGKA 3RAFC 5EVJA 1MJNA 1KU6A 4LNUA 1LXCA 3R77A 1PJZA 5LDGA 2MCFA 2PJRA 3P9CA 2VT3A 1PGPA 2GTIA 1HP8A 3SC2A 4NQZA 5KYVA 4DE5A 1JG6A 5CVTA 3BA6A 2BL4A 5EYPA 4NYJR 4LZOA 2OE2A 3X43A 1KYWA 5TVGA 1T5LA 2RGWA 1T6ZA 3QKSB 3IR5A 2QG6A 1DNPA 1LF5A 3YASA 1XJWA 5EMLA 4BBAA 3VI3B 4OXNA 4RSMA 3H5TA 2QIPA 2VP9A 1FJGO 1E5LA 2Q5LA 3RUCA 2HP8A 4C4RA 3ZX6A 3DGEC 2PTHA 1DRWA 4U7NA 2FWPA 4DCJA 4H7DA 4MCHA 1O2DA 1NH2D 3T12A 2NUPA 2Z3JA 1C9EA 2GD0A 1VE7A 4TKMA 1GVHA 4TL9A 3HM2A 3SLGA 1D5NA 4G85A 3V4VB 4FIZA 4RGBA 2FMTA 1VFNA 3N2ZB 3OOEA 3PQFA 1AK2A 1P7ZA 2M9MA 1SUSA 2KB0A 2O2HA 3DHVA 1SPBS 2WIGA 2ZRDA 3OPVA 1JPXA 1E3QA 1P0MA 1RLOA 4N7MA 4PG8A 1ZUHA 3ZWAA 2JIDA 3KEGA 4N8EA 3MT0A 2IYAA 4GWGA 4YT2A 3AR3A 1CE8A 2NZJA 2WTUA 3CF0A 1T0HB 1XRLA 2GS9A 2HRDA 3NHMA 4YCCA 4HNRA 5HRCA 4J9VA 3F7OA 1ODFA 2LTAA 1NHWA 2QENA 1I4TD 4FFBA 2ZT6A 4KWIA 3OTFA 3A25A 2OHOA 5I8ZA 1XD2A 1V43A 2X0KA 2R3SA 2AG1A 2YMMA 1U8EA 1VIMA 4B3BA 4BVLA 3QX7A 1MCZA 2RGNC 3HYCA 3EYAA 5IVKA 5MGBA 1E1LA 2GO7A 4LC9A 4BR6A 1Q57A 2ZBPA 4ARCA 2V1UA 5A7GA 1OVGA 1CNMA 4HFNA 1BDHA 1DXOA 4NEQA 4HR7A 4K9OA 3RWMB 4XCXA 1Z5NA 2AFRA 3TCUA 3OZSA 3B3GA 1UWZA 4OFZA 1SKQA 1P1RA 3A06A 3UAZA 2VAMA 4AZ3B 2FX2A 3RZVA 1Z15A 1TLFA 3LLSA 1L7EA 2WJYA 1T91A 2RB5A 3LTNC 2IELA 3OE7D 2O5VA 5AVKA 3COPA 3L04A 1M83A 3C5VA 3B89A 1SD5A 3AEUB 4F1KA 5I7SA 1H2ZA 2F59A 5J47A 3M49A 3UT5A 1IM8A 1BS3A 1R1DA 3A11A 4M4SA 2XUKA 4EB6B 3WWEA 3W2HA 4WFBV 3SR2C 4EYQA 3HWWA 1EJ0A 2W2KB 2YHSA 4G0WA 4D81A 4HNAA 3FLEA 2V7UA 4DCGA 1G8YA 4J8PA 4IUDS 3AJEA 1E1RA 2CHUA 1E92A 1AGNA 4BJHB 5T57A 1TUBA 3FDZA 3B70A 1JMVA 1ODJA 3A6PC 4DUZB 3E9RA 4MGZR 3VPAA 3QFSA 4FKMA 3DH1A 2FPPA 3EVFA 4WXMA 3TL3A 1L5OA 3BH6A 3WL7A 2ZBQA 2ZBFA 4DABA 3EXIA 1ZN2A 1N2JA 5LYJA 2OHJA 4GBED 3UG7A 3MJTA 2ILMA 3EXG2 4N5LA 5AM0A 3IP5A 3RN4A 4YCDA 1HFWA 3T5MA 4FE7A 2KPOA 1QPBA 2RJ3A 3ZJZA 1CF9A 3ZTYA 2RONA 3FFAA 3ER9A 3QLVA 2YDYA 2DYSB 3RGWS 2C8VA 2FUG6 3STWA 2NU9A 1VG1A 1A7JA 4D92A 5DMHA 1PIWA 1SNYA 2BSAA 3ICPA 1PGQA 1SC9A 2QBYB 2WTAA 2DWOA 5DB4A 1TTPB 4RQBA 2X9VA 3BERA 3ZWMA 1GUYA 2ES4A 4KGVA 1PFWA 1EUYA 4PELA 2AZDA 4G0NA 1OT5A 3HYLA 4O2LA 2HBRA 1M5RA 4QXPA 2DSTA 2GRJA 1FFXB 1JBKA 3BRSA 3P52A 3LSYA 4DUYO 2OZEA 4F9GA 3LNNA 2CJWA 3SXPA 3Q2KA 1CRZA 3AVVA 3QEAZ 1W36B 2CLLB 1XK7A 2HJFC 4IXDA 1A5BB 4TV8A 1RXYA 4RC9A 4IFBA 1SG6A 1I4WA 4P9PA 1DFHA 4JJKA 3UFXB 4YC7A 3IUQA 1RI1A 2WHRA 1UC8A 4GSLA 3EIQA 4S1WA 2AJ8A 1O0BA 4KGDA 1U0FA 2BFBB 3U7QA 3KSDO 4UFOA 1NVAA 4MAAA 3LA8A 1C0PA 2PBLA 3QTCA 3ZE9A 4QICA 1G5IA 1M56B 1CJSA 1N7IA 3W0LB 4N9WA 2Y1CA 1CUSA 1VL2A 2X42A 5REQA 4KSBA 3AUYA 1GZDA 2GEBA 1RYFA 3A6EA 2W7TA 4ZO8A 1NVUQ 3GGJA 4X62B 2W71A 3OG9A 2FTKE 1GNTA 3I9JA 2AOTB 1DKUA 1ZOOA 4DQDA 2HYIC 4MRNA 3W77A 2WD8A 1Q5PA 4MHOA 3HE3A 1OA0A 1RFLA 4ECEA 1OAKA 2XCTB 3WHIA 4DR5B 2X0JA 3PVSA 3VH2A 1E79D 4KX3A 5ENZA 1TCUA 3KLOA 1I7QB 1CJKC 2W8BA 2HMWA 4BMNA 1XRJA 4UXNA 2I3AA 4GSYA 2I6FA 5C7OO 3WSVA 3DS8A 4QT4A 1IJFA 4CXMA 4NNJA 1QORA 4LD2A 3WHLA 4UEQA 5KYUB 4FINA 5EHXA 1VP7A 4DPKA 5AVZA 4L6AA 2DWDC 1E3IA 5C2JB 5KYWA 3GP5A 2DUNA 2NZWA 3UB3A 4Z9BA 5IT5A 1Y3DE 5KOJB 5T64A 3EOZA 4C08A 1SBIA 1C9JA 1VL0A 1O6GA 4CKBA 3BXOA 4NFYA 3K08A 1BMFG 1BL8A 4PSKA 1CERA 3RNOA 3L0YA 3HCRA 4HGZA 4K9MA 4PIVA 2JEUA 4G84A 3A6GA 2NMVA 2DHEA 4ND5A 1J56A 4HFJA 2QAGB 2VTDA 3RS2A 1TFRA 1JAIA 4OI4A 4LMBA 2QD5A 4ZYLA 1T13A 3CSDA 1KDRA 2Q9UA 1SCIA 1C4WA 3OX1A 1KKUA 5CLLA 4ZCPA 3E2MA 1EXWA 2GZMA 2AFVA 3EARA 1EP9A 5KYYA 4UUOA 2JFZA 2IDZA 1EEHA 3PDWA 3KSUA 4H1HA 4P9CA 3CCJV 4E7OA 3HVIA 3Q9UA 3IB3A 4EJSA 3CVVA 5BWMA 3DO5A 4WOCA 3IPXA 2ZPUA 4Z51A 5BORA 1XCLA 1LC0A 1PSWA 3EC1A 5K1XA 4TMVA 5FFMA 1H0HA 1UAQA 1CU1A 5EPEA 4D3XA 2HQRA 3OZUA 4GL4A 5I01A 4LMRA 2QAIA 3WJ1A 1ZR2A 2YXNA 3WQRA 2CLSA 4PLYA 3QVLA 4LF5B 1F8GA 3T9AA 3HUDA 3PQ3A 5CM8B 5GV7A 4HD8A 4JS0A 3FPAA 4DIBA 4R7CA 4G25A 1U0TA 3R3XA 1NPDA 1Y76B 4DLYA 2VJBA 3DMDA 2HCRA 1JF8A 2QRKA 3TLCA 3HCDA 1DC8A 2A7WA 5CPFA 1JT9A 4D9MA 2EZ9A 4IG9A 1UEJA 2AX3A 4IO1A 5JT1A 3V32A 5FPPA 3E1GA 2P9ZA 4OPAA 3RW9A 5F1PA 2VO1A 5DSTA 4KR9A 4BWYA 5L3DA 2BEUA 3OFND 1JIQA 1PWXA 2QX7A 3DUFB 2C0PA 2QXUA 1J06A 3L0PA 3UKJA 5A7HA 2KG7B 3SHFA 2VH5R 4AXBA 2JRLA 1JJOA 2RGDA 3C70A 4M49A 5CLFA 1B14A 1P1IA 5B7GA 5A5DA 4UVCA 3Q1KA 2C29D 4Q19A 4O4JA 3JYLA 3HADA 4KQGA 2GYVA 3VPGA 4MR9B 2PY6A 5KOIA 3R74A 2JHPA 4YMSA 2JZNA 4JQSA 5TQ0A 2PZGA 3MBKA 5KHOC 3ZBQA 1F2UA 3OZTA 4YYZA 3QVWA 1D4OA 1GL7A 2P2SA 3HBFA 5HOEA 3ZEDA 4WKPA 5LL6Y 2ZTMA 3FTPA 4XFDA 3SM3A 2H3OA 4IGAA 3M5WA 4MWEA 5EIWA 2HJVA 1QG4A 3L1HA 2HU7A 1XHLA 2EP5A 2OGTA 2WYUA 3PHLA 3L7NA 1S3JA 1LQ2A 1KR2A 1BGWA 3HJHA 1QHHA 2G63A 4DREA 5HFNA 4URFA 3U9LA 2Z3YA 4LJKA 1XLTC 2UV8A 4FFLA 1NURA 4DGSA 2GN1A 3MNFA 3UJDA 5DWDA 4P2BA 3JALB 3IEIA 2FR5A 3KAPA 2BOVA 3K57A 4MQUA 4QBGB 2G04A 1R3JC 1Z35A 1Z33A 1Z6ZA 2KMLA 3HABA 1P4RA 2CB9A 1J39A 1CXZB 1VSTA 5AQ1A 2QDOA 1E2DA 4B2PA 5KTPA 3B1VA 5C4IA 1Q0HA 3SC6A 1U1DA 4M1SA 1U0GA 1CQWA 3CXUA 4ILKA 3FMPB 1Z7BA 4UQOA 2ISSD 3K4PA 3AJRA 2Q2QA 1YI0A 1RQRA 3CISA 1SPXA 4UE6A 2XZPA 1G20B 3Q98A 3LLMA 3L5KA 4KXYA 2ZB8A 5F9FA 5T41A 4Q3AA 2NU8A 3L7AA 4ZRNA 1LWOA 4GX0A 3VR0A 4HNTA 2CL5A 2V7XA 2ZQYA 2ZYRA 1JB9A 2XUIA 3KL4A 5TISZ 3AQIA 2ZBGA 1O5OA 4C1BA 4A91A 4P3PA 2Q62A 2Y77A 2YNMD 3C24A 4ZBMA 1EX9A 4BGDA 1KP2A 3T52A 2G1UA 4Y9DA 1TTQB 1Y1KE 3E03A 3K92A 1JDNA 1QS0A 2QYOA 3FWKA 4LF6O 3BE8A 2OQ2A 3G2KA 5IEBA 4CT5A 2XAGA 4A8JB 5I9SA 2Y1FA 1NUQA 2FEKA 4FMTA 2Z1MA 1K8YB 2WA4A 5AK0A 4LJ5A 1FP7A 2FW6A 4H3HB 1HT3A 5JJ5A 3QNEA 3HWSA 2QX4A 4DDUA 4GOJA 2B0CA 1M6VA 3I5MA 1JEQB 1PJAA 4O02B 4HAZA 3F5SA 4UTPA 1E1DA 3DR3A 2PYZA 5BW4A 1BNCA 5DNWA 1TF7A 1SCUA 4FM0A 4D80A 3OHPA 3T7RA 1AN9A 3CH6A 2C92A 3LE8A 2EULA 1SVNA 2PXCA 3KKOA 1AGXA 2F3PA 2YWRA 1X1DA 4EY8A 1OXUA 3VR3A 3DE4X 4IHJF 4QU0A 4EHJA 1KAQA 4KR7A 2A4KA 4MTGA 5E2IA 2Q4DA 4ZQEA 4ND8A 3WLTA 3P2KA 3JQ9C 1XDDA 2JIZA 3CRW1 3W8NA 1YSDA 3MPUA 3IJRA 3E9NA 1P80A 4M22A 3A27A 4L8GA 1QF9A 4QJ3A 1IIBA 1RYMA 3TOVA 4XYBA 3KV3O 4FYPA 4L1KA 3CNLA 2NAFA 1IDN1 5CBGA 1QIJA 5J63A 5AFSA 5BUSA 2YXEA 4GM0A 1XVLA 3MT7A 3FOCA 4V0QA 3OIDA 1AS2A 1ZA2A 3N6XA 4XX0A 1XRRA 3L7IA 4R1LA 1WMSA 1WR8A 4ML3A 5T3YA 3V5NA 4M8IA 3W9UA 1Q6ZA 2C2XA 4NIMA 1L5VA 2CJYA 1DO0A 3Q7EA 3FY4A 3E18A 1KDTA 2RGEA 3MJVA 1DRJA 2J9XB 4PZ9A 4YYEA 4EZIA 5I7OA 3K58A 5DW3A 4C7VA 4GFDA 3IMEA 4D97A 1CY2A 5AOAA 2Q67A 3QLTA 3BWBA 4PA4A 5CB4A 2JJ1A 2NACA 5AK6A 1N2CE 1C7FA 3HO6A 5LD2B 5B3JA 2EFYA 4IOMA 1KBZA 5CDFE 1SO8A 4O1MA 3A14A 5KJFA 5CM9C 2I62A 2REQB 2ZCJA 4EJ2A 4B71A 2Y6UA 4IX9A 3DVRX 4HB3A 3LVQE 1M33A 1UKEA 2OSVA 2CBZA 2J5KA 1SCDA 4G3XA 4CMKA 5AW8A 3PUKA 4FGSA 1CUXA 4B75A 5EIBD 1J1IA 1N32B 1QYRA 3Q8LA 2OXTA 2VPXA 1D6MA 4KQ6A 4YRKA 3EISA 1K7FB 1CLUA 3NS7A 1XTUA 4BFYA 5BMOA 1P2UA 1RWBA 1M7HA 2PUFA 1YACA 3ZG6A 1KH1A 1V9SA 3ZS8A 3TSWA 5K8LA 1CUAA 1MNQA 2YVUA 1PWHA 3AOEA 4NARA 4IDQA 3FKSG 1IBMB 2P5OA 2FGJA 2D0OB 3PI6A 3HPRA 3SF0A 1COZA 2Z2XA 2FR1A 2VXCA 2IV3A 4AQDA 3K9HA 4YROA 5AIBA 3GJQA 2C2BA 2A7QA 1H93A 4NBSA 2BUBA 3T5AA 1UKBA 4PDRA 3C14C 1HEIA 4MUJA 4TV9B 4PN3A 3RSQA 3MF4A 2I80A 2HR3A 1Y33E 2ZIXB 2F6RA 1XLUA 4PLGA 2WU3A 2NYRA 3K0AB 3EA0A 3EVAA 2YR0A 4DR3O 1D2MA 5CT9A 5J2UB 1FYDA 1F3LA 4I4LA 1RKXA 2NZUG 2QRNA 1D5WA 4NVPA 3DG9A 1YTFB 5E3JA 1TT5B 1Z45A 3HBMA 4WBNF 3KHKA 5IC5A 2V4MA 3ZQ4A 5CT8A 4IOLA 3LX6A 3F4LA 2A88A 2PKQP 3UO3A 2BELA 1AB5A 1Q82W 5B1EA 4AZVA 4MH0R 4MVJH 1Q0ZA 2R70A 4NONA 3GPLA 3OA0A 1GLGA 4N3BA 1OV6A 3TX2A 1Q0LA 1MX5A 1X9GA 5AVTA 4D99A 5EZSA 1K3EA 3UKDA 1FPMA 4PYKA 3R3YA 3JTEA 3K9GA 1P0QA 3WYBA 2C31A 2VA9A 1KI4A 4NHEA 1Y82A 4AT1A 2ZR3A 4K9QA 4XDKA 4NE2A 2Q7HA 3C3XA 2PGNA 3HR7A 4A5OA 2IYQA 4GKVA 3GVMA 4JMPA 5F35A 3K9QO 3OETA 4J16C 4V0KA 3ZVMA 3SPIA 221PA 1OFUA 1IXYA 3SQMA 2GR9A 3FOFC 1JECA 4TYWA 1J8FA 1EVZA 4IIEA 2CFRA 2WMNB 4OHWA 3D31A 1E7YA 3ASNC 3ZN2A 4RS4A 2H52A 5IKXA 4A4DA 2Z2KA 4KQ2A 3G0HA 2C99A 4C7MA 2X1HA 2OCCC 3IJ4A 4MW5A 4ZI7B 5BPHA 1MO3A 3OKFA 5EC1C 1TVKB 1RYHA 3EIWA 1PGOA 3OQIA 1KDPA 4KLZA 3UTDA 3L0CA 2GTPA 1A5SB 3UAWA 2FVXA 2ORED 4GYWA 2Z57A 4M37A 2TMGA 3HLKA 3LHDA 4RZIA 3DEHA 1PL8A 3CJHA 5TJ9A 3SIPA 3ENNA 5FWAA 5KSOA 1KEZA 4UB8Z 3GB7C 3OMAB 1LU9A 3D81A 2I8LA 2H1OA 1X2EA 1VI5A 3HL4A 3RS8A 4M1OA 3IUMA 3CRZA 1Z5OA 3E1KA 2R44A 2WWTA 3JPWA 5GTDA 4LUCA 1KZ9A 3BSYA 4TTVA 3K4HA 1P7BA 3CG0A 3AX6A 4N49A 3W7AA 4UMVA 1OX4B 3LHKA 1VJ1A 4QBFA 1EVQA 4DYLA 1G3QA 5K6RA 1CQIA 4JASA 2JK0A 4RY9A 4RQUA 521PA 1Y6RA 3O2SB 5LP6F 2WP0A 1MABG 2XMRA 2HRQA 4IKOA 4C4TA 1OYOA 4FEYA 4TMKA 5B4VA 5IXJA 4F4JA 1T1SA 4OP1A 2VZ9A 2IE0A 4L9WA 4PLZA 4WKBA 3ORSA 2MJLA 5K20A 3ABQB 4MQFB 5AVSA 4N3NA 5BN5B 3V55A 5DISB 4K9DA 2XCOA 4ZQBA 4BPRA 4RK7A 4YB8A 4ZT2A 5C1DA 4GRIA 2IPNA 1E9SA 3O2JA 3S2ZA 4JVLA 3LGAA 3T4UA 2V7TA 3A31A 3PNPA 1UOEA 1FYJA 1PFYA 3W6NA 3QVVA 4MR8A 3SFZA 1N8RW 2C2OA 2BJWA 2DPHA 1XCMA 1U4SA 1COWD 3KSMA 3MHSC 5DN6D 2PGAA 1JJ2U 4UM7A 3RBAA 4KTVE 1F51E 2SICE 3D6MA 3ED5A 1Z4QA 1J33A 2OMEA 3ACDA 2PUTA 5FTWA 3NOQA 2PH1A 1I5RA 2CUTA 4PRLA 2BF4A 1WV1A 2CL6X 3AHJA 3VQTA 5EVCA 5IJ9B 3MLAA 3N2YA 2BT4A 3D6TB 4HH3C 1KA9H 2HU2A 2VHZA 2WIAA 5FOWA 2PYIA 5J5AA 4OEHA 2HHHO 2LO1A 1P0IA 1EE9A 5C7LO 1OT3A 4C4ZA 4MRPA 1AM4D 2UVDA 1SB9A 5FJJA 2X40A 5C80A 1K33A 1U0BB 3BE4A 2GZDA 5FOXA 3WBJA 1O94D 4D9FA 1L5HB 3FB7C 4GAEA 2P87A 3IIMA 3J81N 4UE3S 3VBBA 2P9JA 4J7UA 1A76A 3DQZA 2W2QA 3QEMA 1GITA 4N40A 5TMDA 4EYEA 2OTJV 1U8TA 4XLTA 1TKBA 4EG4A 1PJ8A 3AB8A 1UFOA 3U7GA 4LRTB 1R6VA 2FMUA 9ABPA 4DLTA 1NMSA 1GAWA 4DV0B 1QHGA 5E95A 4IILA 4ZARA 3KVVA 2PAFA 4FZRA 1KI6B 2JARA 2C8JA 3VTFA 1B23P 4I81A 5EKTA 2C59A 4IGFA 2IOHA 1SULA 3HXTA 3Q7PA 1OB2A 4PQGA 1VQ2A 4JAVA 1DBPA 1CJMA 2QQFA 2ZUUA 3PRKE 1VPDA 3T3OA 5LMNO 6CHYA 3OESA 2GF2A 3U39A 3TZQA 1W5BA 5EUBA 1UPGA 1QE0A 3T1VA 4JDPA 1YULA 3QPDA 3RAJA 1M73E 1UPUA 2A57A 2I7XA 3EFOA 3WTCA 1XV5A 3MGKA 1WXGA 2AN1A 1KMMA 1I08A 1TK2A 5LNK6 4ACAA 3AVYA 2Z3WA 4LXYA 1P6UA 4PW0A 3TZEA 1HDXA 1YZVA 3KQHA 4H35A 3Q4HB 4BMZA 1Y34E 5B1BB 4XVHA 4UCRA 2Z6UA 2Q7XA 2YWBA 2H1RA 1NULA 1EXDA 3HB7A 2Q1SA 3ROXA 2RD2A 3GXOA 1O6ZA 2H4FA 4WLEA 1UMCA 3L6DA 4JGSA 2JGLA 1EUCA 4BIIA 5DMXA 1ZCAA 2VSOA 1Q5OA 1WRBA 3OTIA 1AMNA 3SZUA 2XEXA 1B3RA 5IWAB 1HFEL 2I34A 4XQEA 3SM9A 3RVLA 4TL7A 4WY8A 1Z5VA 1V26A 4DLKA 1KVRA 4OYLA 3T8YA 3PDIA 4DF3A 1Q86W 3PPYA 1E2HA 1T0PA 3EGVA 1K5SA 2QK4A 3PS9A 4KDRA 5K45A 5B2FA 5E3HA 5LQJA 1KJJA 4JI0O 4CF5A 1NI5A 5FLXA 3QI2A 5EWLA 4DJ5X 4B31A 1ODLA 4OAQA 1M4UA 4BMPB 2P6OA 4KXRA 5BPFA 2AR7A 5ANRB 2PTGA 4Y2QA 2CF6A 4UXJA 3SZ3A 4AQYB 1ODIA 1NN3A 3IFSA 2ZPAA 1NVXQ 2ZSFA 3NBMA 1MAAA 4X66B 2QRJA 5E9WA 2IW1A 5I8WA 2IW5A 1IC6A 3U7JA 2WJ4A 4ID9A 4I9HA 3TPZA 4Z5XA 2OOSA 1BS1A 1MTOA 2O19A 4ZJYA 5AVOA 4RZ3A 4KFCA 1KKCA 1FS4A 5D86A 4KQ9A 1QH9A 5B1SA 5EWMB 1K88A 1MD9A 3RVNA 3ME5A 4NXNB 2IDMA 1T5TA 2R96A 2ZT5A 1A7KA 5KEIA 3WNCA 4AB1A 3KOUA 2AMLA 5F77A 1A1VA 4LWPA 8ATCA 2BGNA 4X93A 3ZHOA 4O3FA 1SC5B 1ZESA 2J3IA 5EC8A 5IYCO 1JRLA 1U1CA 4BCBA 4W82A 1W6RA 3L0IB 4GI7A 4FNAA 2H92A 4URXR 3NTVA 5IJWA 1J09A 1EVYA 1E1MA 1I3LA 1NFFA 1DKNA 3W3AH 2RHCA 1P17A 2TMKA 1GPWB 3PX7A 2BOCC 4JI1B 2IX9A 4XDYA 4I6JA 2CVZA 4B0PA 4BZWA 1OAOC 4P3OA 2LIPA 2V7QA 5AJUA 1WWRA 2E5FA 1AKRA 4YWJA 2ZR8A 4HPJB 5CVCA 2OVFA 2X76A 3BCRA 2DBQA 4TYQA 4HPWA 3WAJA 5LQAA 2NNLD 1NM5A 2HADA 2W6OA 5LSAA 3RV4A 3ZMUA 3TUIC 2Q29A 1EDEA 3R5KA 1FX1A 2ZJZA 4HUTA 4C14A 1TJ3A 2QRMA 1BRTA 4C6HA 4X8HA 2VBIA 1N36B 4DCMA 5KSYA 2GBLA 2JCSA 1UBFA 3JWPA 2J5QA 2VJPA 2ZJAA 1JLRA 2RJOA 1FIUA 4PBTA 2ECKA 5CN0A 1U98A 2WSIA 2NQ8A 2B61A 1KQPA 3FHCB 5ADWA 2ATEA 2VYND 1QIGA 3ODGA 4M0LA 2V7VA 1PT9A 2POCA 3CF2A 5MN4A 3NTUA 1G64A 1OCRB 3DEFA 1CY6A 1QH8A 1XL4A 1U1EA 2C4TA 4KQ1A 4Q7KA 5JS7A 3THYA 1QDUA 4UNSA 5K1PA 3GP3A 4DV5B 4IICA 3HKCB 5PGMA 2MK3A 5KIAA 1WSDA 1Y1QA 4QUDA 8ABPA 3A3NA 4XDLA 3RG2A 1GKLA 1QQCA 3LM8A 1KS9A 5KAIZ 4MYUA 2CXRA 4MUNA 2GF9A 2J08A 2VHVA 3KNZA 1U7WA 4QFDA 4ZO9A 1H1TA 1MU0A 1NPYA 2OD7A 5JFGA 2VQEB 1ZU5A 2VZEA 1J99A 4OH1A 4QDXA 3MOGA 1GA6A 2EX3A 1SOUA 4YT8A 4EVRA 4ZVUA 1SQFA 2M6SA 1TQHA 5EXEA 3NFYA 1YAHA 16PKA 3B48A 2OYQA 2ZRAA 2WKSA 3L18A 2UXCO 3RM3A 2GAOA 3TLAA 3EIHA 2YS8A 3B6EA 1C4XA 1LLDA 2OLJA 2YNMC 4G1MB 4ENSA 3RIHA 2HBQA 3IL2A 3BX1A 3SSAA 2DCUA 3SE7A 2OO5A 3N7TA 2OBYA 3T5TA 3FPLA 4BECA 3R3HA 1LDGA 4Y2JA 4IQ0A 2OCLA 2H57A 3QPBA 4PNPA 4MPTA 1FP6A 2VCEA 2P8JA 1GU1A 2RHTA 1T3LA 4WBXC 3K0FB 4XD7A 4BX3A 1O6FA 5J4HA 2JJ8A 2P06A 1EFLA 2EFHB 1HYHA 2QKCA 3C97A 3L0ZA 3HCEA 3H8VA 4P38A 1G21A 5CR9A 4TMYA 5KBYA 2BUAA 1EK0A 5KWIA 3SK0A 1K5DA 3HJGA 1HO3A 1L4GA 1YJ9V 1KMNA 2FCAA 4OYHA 4A15A 3P0FA 1D7AA 3EOAI 2AFIE 2Q3FA 1U96A 2A0YA 1E4VA 2RGAA 4QA9A 4B9AA 3H6HA 4XUCA 3ZIDA 2GXQA 4MJ3A 3IO3A 4WBSA 1I10A 1MGOA 2CXSA 1SG0A 5IVIA 4XCVA 3TQRA 3HDJA 1E7QA 1LLQA 1QKIA 1GR1A 4IOKA 4OHMA 1H38A 1MABB 1LPNA 1GY8A 1DG3A 2XOKA 1BIFA 3QKSA 4Q6WA 3DC5A 3GPBA 1HNZB 2LCFA 1JL3A 2PAAA 3PFKA 2C9CA 3LSUA 2IOQA 4GP7A 4C4AA 1A7AA 3H1FA 2ZI4A 4JP1A 1NN5A 1F0PA 4PTLA 1HR0B 3KJHA 1QU2A 2I76A 3R9IA 3E27A 1W34A 3STZC 3A6ZA 5C8YF 3COZA 5BXZA 3X1KA 3O1JC 3TNJA 5ABPA 4HP8A 1ZONA 1PJ3A 1A8UA 1GPH1 4EHLA 1Z0AA 1PZXA 3JR3A 1ZH6A 2Q3JA 4DW1A 4Q1EA 3EGXB 4TKUB 3P71T 4BRUA 3ETGA 2Z04A 4EHHA 4Y98A 4JSYA 1GCOA 4R2JA 3Q2IA 2CLOB 3TINA 4Z7JA 5I9NA 3AEYA 2BCGY 2NXNA 1SBHA 1E2BA 4EI2A 3HZRA 2IHJA 4F04A 4TTAA 5EQDA 3KCNA 1Q1NA 1SIUA 4O4HF 2C4WA 4NMLA 5TPZA 3FUUA 3U3MA 5LMZA 1YQTA 3T1HO 3NBYC 1CTTA 4HV4A 2HQBA 1B8PA 4YJ3F 4CV1A 3FWHA 5ERXA 4OHFA 4OBXA 2Y0BA 1OI2A 1IJEA 2G06A 2Q4OA 2DY0A 1ZCBA 2Q3DA 4I55B 1MPTA 2FG7C 1ABEA 2R25B 4Z3KA 3L8MA 1P2GA 4L87A 2Q21A 3ASYA 2ITDC 2Q0QA 4F6RB 1MOQA 1T2FA 4EGQA 4KC0A 4Z2AA 4Z0TA 3ICXA 4C7OB 3RBXA 2X7HA 5TF0A 2VYVD 4MGKR 1QB7A 1N6RA 5LJIA 3KPYA 4KYVA 1ZHHA 3COSA 3ANSA 2YOFA 2YFQA 3RFFA 2WV7A 1GQYA 2LE0A 4GXRA 1DRKA 1EP3B 1K6JA 3GGSA 4G0XA 5ALDA 4F92B 4NENB 4KOEC 1L5RA 4AYXA 1J9ZA 2WPDG 1WDTA 2EL9A 4OPHA 2OT5A 1DCTA 4MYSA 5JDCC 4NULA 1H5NA 2HJWA 3E6AA 1ML4A 3I5XA 1V8PA 3GG9A 3PDJA 5K0ZA 1K7EB 3IUPA 5FPSA 4DCPA 2EIKC 4AZ3A 2QZ9A 2Y0PA 3ZGYA 4RVFA 1RCUA 5ILOA 4F5DA 1PT5A 4UZFA 3ZCXA 1DMRA 4Q3KA 1XHXA 3AHHA 3CXHF 4AWXA 3V7WA 3QO7A 4HVTA 3FFTA 3E8GA 3DHEA 1XPJA 1NW5A 4LOIA 1JKMA 4EYOA 4RTJA 3OOSA 4LYAA 4EB6A 2CNNA 1ZGJA 4C03A 1F7UA 3V4RA 1KJ8A 5CPBA 1R6BX 4DV4B 4CLEA 4U9UA 2W2KA 4MGYR 3N0XA 3P0HA 4TVOA 3TIIA 1L7OA 2Z4RA 5IE9A 3LSQA 3SHQA 3H2GA 4MA5A 4JOCA 1MV8A 2QI9C 4D8VA 5FADA 1Z6QA 2Q28A 1G8PA 4PZEA 3SJCA 2QY9A 3NQ41 2SCUB 1UBMS 3FF1A 1J8YF 1QJCA 2C5BA 1IY1A 7MHTA 3J7AU 1QO0D 3TLZA 2YFHA 4CIVA 3AKYA 2NW6A 1XZKA 1O87A 4OSOA 4Z9XA 1D5AA 4AC9A 5EIHA 2JL1A 1E6EA 4YAWA 4I50F 5LFAA 3PKIA 1I3CA 1VIBA 1B4DA 2DR0A 4PO1A 2UZ1B 4GPZA 3VQYA 4DKXA 1OFIA 2JI6A 3ZCCA 3IV6A 3LC7O 4HLQB 4PX9A 4B7KA 1RZRA 2QSAA 1S1CA 4M9SA 2GV9A 3ZBTA 1LH0A 1U0RA 2R87A 5HEKA 4KPUB 2HK8A 4RQAA 3AUTA 2VJMA 4RH3A 3RPEA 2QIOA 1WOMA 4DT1B 5LM3A 2VWHA 1KIMA 3EZFA 2G6TA 3U4DA 1C8KA 3BMNB 1J25A 1F4MA 1MFZA 4GC5A 1IDSA 1XEWY 4MVCA 4RD6A 2QE7D 1O3YA 3CUSA 4YY3B 3EVTA 5EE9A 1A0OA 1FFXA 5DT2A 1XNGA 5B64A 4R1OA 3KTFA 1Z28A 2GJ9A 4PZDA 4EDHA 2XB8A 1G4AE 5DGCA 3ELDA 3HA7A 3E8XA 3RC8A 2O8CB 3VOSA 5K3SA 1TA0A 3CUEF 3HB0A 3G0GA 1CDEA 2BFDB 5FF9A 2G08A 3BA8A 3VO8A 5GADl 3UFXA 4BEVA 4HCJA 3N2NA 4LH7A 2SNIE 4KV9A 1J7JA 1SBCA 2W6IG 4LC0A 2HXGA 4KGZA 4Q15A 3HP7A 1POXA 1V54B 2BFBA 3MWLA 2N05A 3NHAA 3ORQA 2C98A 3ADOA 3MTJA 3OKCA 3QPUA 1HX7A 1CQPA 1IHPA 3EG9B 5FUMA 4MUEA 1IN7A 3FBGA 2WT4A 4LQLA 2HVWA 3WOVA 3UW3A 1UZMA 2QNIA 3TE7A 3IDFA 5KSWB 4MIOA 5BW5A 1MW8X 3C6MA 5C8DA 1MNGA 3WIUA 1ULSA 1HDGO 2B6HA 4JHLA 5LYJF 3D7KA 4WD3A 3FUVA 4EY3A 2HSEA 3LO5A 4U7WA 5DW0A 2AOTA 1FBNA 4NLLA 1ZD1A 4HAVA 4R2KA 3W4IA 4MQ5A 2JH8A 2H1CA 4EOGA 4PLPA 4KREA 4ZDJA 3TDNA 2YIVX 2H0AA 1FNMA 3GLVA 1USGA 4TT3G 1Z7YA 3U62A 5CNMA 2WFZA 3SYRA 4BUZA 1ZRSA 4JXXA 5JD4A 3QJ5A 4TSFD 4Q1DA 2QMEA 3EC2A 4C78A 2P62A 5IUNC 3FB4A 4BO9A 2AMFA 1A7UA 3AM5A 4ZDWA 3KDSE 5SICE 1AQUA 3ON5A 4RQTA 2IJKA 3DONA 1V41E 3R9WA 3ZIUA 4AY3A 5KOJA 2WEKA 1AI4A 5EKSA 2HPZA 4C07A 3HDTA 1EAYA 4OHRA 5KNDA 4GPBA 3L5OA 2WSSA 1KRHA 3QVMA 5CNKA 3V1TC 4RHCA 2HB6A 1UJCA 1PVVA 3V1KA 4OB7A 5DIZA 3UNXA 4WFKA 3KOZA 2HMUA 1GRJA 1VMEA 2IDJA 1DX9A 2OG1A 4MUHA 2GETA 4EBFA 1BDMA 2ZD9A 3HYNA 4QC2A 1A5AB 3WLMA 3ZBHA 1T3HA 3T0GA 1I5OA 5K6AC 2O3JA 1WABA 2FSUA 1J90A 5JSQA 3VAYA 2ZB3A 4I4TB 2XKBA 1BQ4A 2P78A 1P1KA 2IXDA 1ICEA 1KMIZ 1NF8A 1K6XA 2Q49A 4EPYA 2VWQA 4FM9A 2GHIA 1O9BA 1P6XA 1M8FA 3WLKX 1S2LA 4C21A 2QZ4A 2G09A 3G49A 1LDEA 2WM2A 1FD9A 3G79A 3LU1A 1KPGA 3ONFA 1OTXA 2UUAB 4ZOQI 1P9OA 1SXIA 2JPDA 2CV0A 2GWRA 4D4LA 3H42B 1PS0A 4G1VA 4Z86A 1EFRG 4RJIA 3MAQA 3EG5A 3VSCA 1IQ0A 4F60A 3MTEA 4Q3NA 2QUZA 4E4TA 1AIPA 1V5GA 2AL7A 3MBOA 3NG1A 1WDLA 2A06H 1ZH8A 2GA8A 3NONA 1Y76A 1QR6A 4D10F 4MWSA 4KBGA 4HQRA 4DYHA 1YXMA 2F3UA 2VP6A 4R6XA 1FTQA 4IDAA 3IHLA 1MZEA 1ID1A 2QTOA 3QYFA 3KZXA 4Q0MA 3IB6A 1VE9A 1OCCB 5EEGA 1FVXA 2LBPA 1NUPA 1Y8CA 3N7UA 4RHXA 2CDRA 2ZJYA 1KYIA 4WXYB 2B4RO 4D46A 2GBOA 4QWWA 1PWYE 2WY2D 3DUFA 4RA6B 3GYBA 4BWGA 3EIXA 1XZNA 3H04A 2ODNA 3SYLA 3CUVA 3BJRA 1T4BA 1NMXA 3OZAA 1YQQA 2QU7A 2B1IA 3L0DA 3ZU6A 1WXQA 2A1UB 3I9LA 1K5PA 4IIJB 4MRMB 5JEEA 1BU5A 2YJGA 3PGJA 5FJIA 1V1RB 5AXCA 4FYVA 4YP0A 3OM0A 1GPKA 1QDEA 1JW9B 2V58A 4H6XA 4XTCS 4CNQA 3BHPA 2BH9A 4WJLA 2PNJA 4WJZA 5AKGA 5COQA 4IMIB 3P0JA 1WJZA 4M9CA 2HNAA 5L40A 3RARA 3VKHA 2OB1A 1XMQO 4D0NA 2ZTUA 1JIUA 2NSHA 2EKZA 2AKYA 3FB5C 4QDUA 4QT0A 4R8LA 4U9HS 4F3YA 2CFSA 2Q1WA 4EZBA 3BRCA 1QFMA 4OQZA 3DDSA 3O31A 5M29A 4OKSA 4XWOA 1DKOA 2I91A 1C14A 5EP1A 1DELA 2UZAA 1Z4NA 2FWBA 3CU5A 3EZ2A 4DRYA 3DZJA 3VKFA 2LCQA 3JALA 1KYZA 3LY9A 2FA9A 2OG4A 3SJQC 3KYBA 3OBBA 1MG0A 3OPYA 5HX7A 2DWCA 2OV1A 3I5UA 4QFMA 2NPFA 2Y05A 2H2AA 2ZIOA 1XL6A 1T2CA 3GRFA 3AVUA 4YAKA 2C4UA 1RPZA 4ESHA 1AS0A 3WV5A 1CY0A 5MGNA 1R27A 4H9GA 4X8MA 3RK0A 3RKSA 2CNBA 3VR4H 1C7JA 1L7PA 2XJ4A 1IFXA 4RCVA 2ZAYA 3PJEA 3N8DA 4NYIR 2HV9A 3S3XA 5D3MA 4YRJA 3MIZA 4F9TA 1E9CA 3WG7B 2WHPB 3ECSA 1G20A 1IPFA 2JDID 2PZJA 4I7EA 1OROA 3GELA 3NEAA 1TVCA 2EATA 3G5LA 3LUKA 1H2KA 2DKNA 4YPVA 4M54A 2OWEA 5EWJB 4CH6A 4JP3A 3UV6A 4FI3C 4X9XA 4DXWA 2CVHA 2VQSA 2X0IA 4O4JF 3EDOA 2Y71A 3A4MA 1KJYA 5DECA 1WETA 1SQVH 2AW9A 2HKOA 3ZN1A 1T0UA 4R54A 1DC7A 4INPA 3PUVA 4FBLA 1Z73A 1YS1X 4BZXA 2RHWA 3FRHA 4X45A 3I8SA 2D00A 4MCJA 1SY7A 2Q9BA 3CNQS 4HAWA 1GTJ1 4M7RA 1PHRA 1OXVA 4XIGS 1M34E 2PUDA 3EQ7A 1XZQA 4Z7QB 4HYTA 4A8JA 5JARA 3THOA 2FH5B 5JAHA 5KQMA 4LQ4A 4FDLA 2H1VA 4CDRA 5JQGB 1JVMA 4KO4S 1C7IA 3IO5A 3I37X 2D4HA 2FN7A 2DFVA 4CKCB 3ORFA 4C0QC 4AF8A 3KJNA 4NECA 1JEQA 3L4BA 4UCSA 1SESA 5IT4A 3S70A 5J5CA 4ZANA 1RRGA 4MKGA 3G8BA 3GH1A 2G25A 5DEDA 5JO9A 4OO3A 3KKPA 2WILA 2DTEA 4ZCQA 5F12A 2D62A 2HVJC 2Z4TA 2PUWA 1AB3A 4L4SA 2JLWA 2MINB 3NHLA 2B99A 2H2IA 4WCFB 3SOPA 5ER6A 1JFFB 4Y6RA 4EUEA 3GFFA 4MI1A 4M7PA 5JFOA 2RH8A 2W6IA 3GMDA 1U0HC 3M5DA 1XA4A 2C2KA 2A0UA 3VHLB 3W7BA 5C46F 3MSXA 2FF5A 1XQXA 2QZZA 2M2IA 1LUWA 4JELA 3EVBA 2E7ZA 1Q7EA 5AVYA 4QUIA 3PG5A 1PNLA 2DBRA 5DYTA 3AILA 5A0VA 5EZYB 4C7XA 4L6CA 4YJGB 2ZE5A 4QM6A 1XMSA 1TRKA 3LQQA 1JEDA 3LSTA 3NTOA 3FR8A 3BK1A 3E9YA 3G8AA 2O3RA 1RQ2A 2HHJA 2HZ7A 1YB5A 3GVXA 4OQFA 1OSNA 1FSPA 1TM4E 2IYTA 4LPSA 3ODPA 1M74A 5CFNA 1HZZC 2Z2ZA 3HVJA 3T1YO 5EUQB 2O95A 2DUWA 5HZGA 3PWZA 5CXSA 2NN4A 2PH7A 3TW0A 4IINA 5ALVA 4ND4A 1MAUA 4U7FA 5A4KA 4D0RA 5E9AA 5IW8A 4XRRA 3Q87B 1W94A 4HS9A 1SC4A 2QRGA 3ILHA 2RCYA 3L1KA 3VNVA 4DR7O 1O0SA 4B3GA 3FM9A 1V9CA 1Q14A 2P3QA 2CVFA 3KSZO 4PGFA 4Q39A 5TS2A 5I6DA 5KNBD 1R4NB 1S2DA 5ALZA 4Z1OA 1X7DA 1MMFB 2NVWA 1M57B 4I43B 3TUZC 3BOSA 4JP8A 4EMBA 1F2VA 2XYGA 1LSJA 1QZTA 4G5HA 2H1IA 2ZZMA 1YJ8A 5EQTA 5F64A 2H9YA 1PNTA 5EBMC 4PV7A 1OPXA 3T5CA 5AM1A 2PZMA 1BSMA 4L5YA 3UXMA 3O3NB 1BXRB 4ARBA 1VE3A 3M6FA 3ORYA 2ONYA 4R9VA 3OY2A 4HGRA 1LBTA 1KY3A 4MVWA 3W6ZA 2IIPA 3DZKA 3KJIA 1N4CA 1ZK3A 3T5DA 5IANA 3K70D 1C2TA 2UUCB 3KQMA 1U9ZA 4UNIA 4YX9A 3P3PA 3WG9A 1EI9A 3EHEA 3N74A 2QW8A 5JAIA 3IAM6 3FMOB 1EB9A 1NNI1 2JAWA 1EXVA 3LYLA 4DYVA 5ICMA 5LZ8A 3U4CA 1N0UA 4C88A 2B9ZA 1KYTA 2VPYA 1CUIA 1SQXH 1YOBA 4IQ4A 2Y1DA 3ABZA 3U4QB 2FN3A 3S8EA 4OJTA 5B3KA 3ZHTA 5CH8A 4OWPB 1KJ9A 4G5XA 2WZBA 3DMOA 2ZIXA 4YRIA 1ODSA 1I1HA 3MBIA 3FVTA 1CY8A 1DZIA 2XCIA 3K0AA 4EHNA 1LRKA 3ZWPA 3CVOA 4P4LA 1WNSA 2QVGA 3E9MA 4R7ZA 3ZPCA 3HGQA 1NLMA 3LDEA 2ATVA 2CMHA 1E62A 2F3TA 3RAEC 1OILA 4U2BA 5CB4F 2ZWMA 3AMVA 3R24A 4HUJA 2ZBDA 4IO0A 4LQDA 4DA9A 1NBWB 2W6JD 5AXAA 4TKVB 3K09A 4MGIR 3U3ZA 3K1TA 3KUCA 3DM5A 4JUIA 1T2DA 1TAHA 3GB9A 1XQYA 3PR2B 2FLVA 5KO2A 1HT1E 1QYWA 3OZEA 3T41A 3JY6A 1W1WA 1Y6FA 1ABFA 4JV5O 2A79B 4R9RA 3BDIA 4JZ2A 1DP4A 1MXHA 2YINC 4UUBA 3U2QA 4K3UA 1NUUA 5LLTA 4IVPA 4EUHA 2EX1A 1N8KA 2ATIA 3R8CA 1BMFA 4DMKA 1FFGA 2EJVA 1V39A 2B69A 4B80A 1NVPB 4G2KA 2NSJA 1R0BA 3HHEA 3AFGA 1W5FA 1WXXA 2BZ1A 3PI7A 2GI4A 5JIBA 1QHNA 4XAQA 1U04A 2R2GA 4C4XA 5KYNA 5HKKD 4CR8A 3ND6A 1E2PA 2DWUA 3OMXA 2WLIA 5L45A 1GFWA 2PY5A 3KOWA 2Q5EA 3N3AC 4BVHA 5I7UA 3QE9Y 3KVRA 1T26A 4R4JA 4KI7A 4JF3A 3K0CC 5GM1A 2Q9AA 4ZI7A 1CTUA 4R6WA 1TVKA 2VDUE 3FVRA 4JUDX 3RVJA 2RARA 2FEOA 2JB9A 1SUCA 2A7XA 3DFFA 1C0LA 5B7NA 1QDLB 1KO4A 2PKXA 2QLCA 3PYLA 2VQFO 4LDNA 4S1VA 2JI7A 2ACVA 3AF3A 1K27A 3VR5D 5FO0A 3RKUA 5BVGB 1WKBA 2JKYA 3H6GA 2HLDG 3DVQX 1HE4A 1XRQA 1NY5A 1XKTA 3I64A 1EG2A 1HH4A 3UMVA 1JKFA 4BFZA 3HNRA 4UJ5A 1CPYA 2IQIA 3CNNA 4TWKA 1G3IA 3WGTA 1XZGA 2YZGA 5CIQA 3BD6A 1OX4A 1TU3A 5LZ7A 5H6RA 2A5FA 4JYBA 2WLNA 3MJSA 2HX1A 3IC9A 4EYGA 4MVXA 4MX8A 4TVKA 2ZDGA 3PUZA 1R73A 1IAQA 1B43A 4L0QA 1XFDA 1JAXA 3TL6A 3VVCA 3C8HA 5CG1A 4O33A 3CBQA 3KSBC 2Q6VA 2TECE 4E4EA 2JH3A 1GGHA 4BV9A 1EIZA 4WRRA 2MW2B 3DT6A 5CCDA 3JQ8B 3NWEA 3ENVA 1HEYA 4E32A 5FPRA 4BIUA 1G3UA 1XELA 3F71A 2Y76A 3PE6A 1WE2A 4MQFA 3GEIA 2E82A 5BN5A 4PS1A 4D3FA 3EEQA 2BC9A 3QUBA 1ZMOA 2E1PA 1LQTA 1T4CB 3RVYA 3CH5A 2ZI9A 4FEEA 4KODA 2R2AA 5BQOA 3U40A 2Q2OA 2H4XA 5FYQA 4MP6A 4QBHA 3PUYA 3N8GA 4WOKA 3R0VA 1T6BY 4CC5A 2GB4A 5KA5A 1NP6A 5AVQA 3FYDA 3ETNA 4OHYA 3KKMA 3SYKA 3VNAA 1MPXA 2CEKA 2I6QA 1RRCA 2A9JA 1CJUC 3ZY5A 4HEJA 1PD0A 5FUQA 3WFJA 1HRKA 1Z9BA 2ILVA 3RYIB 5AHKA 4MSDA 3T9CA 2BFCB 4GO1A 2VP3A 5IT9N 2Z9DA 3APOA 4HAUA 4MW3A 5IJ9A 1ZWLA 1CFJA 1K66A 1P8JA 3IRVA 4K87A 4BNKA 1ULUA 2GX6A 4BX9A 4LCJA 5LQDA 1PDVA 1WLEA 4F3CA 5CCEA 1YFJA 3UXYA 4N1AA 5BQ5A 1C80A 5L3RA 2D1YA 4Y1RA 1E1YA 4BS9A 3HY6A 1L5HA 5F33A 4A36A 2V3CC 2JI9A 3DAFA 4DPLA 4G1FA 1F12A 3KKNA 4RL6A 3HM9A 5GY7A 2VPTA 1K3TA 1AURA 3QTBA 4LS3A 2O0LA 4NYMQ 1X80B 4EF6A 1ENYA 1NZJA 4UQPA 3DV0A 3GHHA 1TCCA 3BMQB 4LVCA 4XH9B 4EPXA 10MHA 4UZSA 1T6YA 1OHHD 4H1VA 3JAMA 1OWMA 3L4JA 5K8IA 1KI6A 1R74A 5FOUA 3T7AA 3OP1A 4EF5A 3U3RA 5JLJA 3GUZA 3Q0TA 3V4ZA 3NHUA 4J7JA 2O1XA 4HDSB 2GJ8A 4G0MA 1V55B 5AXDA 5ENDA 3RHTA 1ZJZA 1RI4A 2B5UA 3SR0A 3ZU4A 3AK3A 2XF2A 5G0SA 3MYYA 5EG5A 2C2WA 2ERYA 3L06A 4D9EA 3NXKA 3AJDA 3S2YA 3N76A 3ZBPA 1L7VC 3ZEFB 2H4JA 4OFXA 3WBFA 5FPOA 2RAPA 3GNSA 3C5WP 4RZSA 4AUEA 4WADA 2B92A 3ID6C 3Q4HA 1XUQA 3QVOA 5EMKA 1IJBA 5FV7A 5JFTA 5EIAA 1LUAA 3VMFA 2VG8A 3LPLA 4G5FA 1XYYA 3L77A 5BV1A 2BMJA 1KOJA 1L4FA 1J4AA 3RTDA 2W37A 5CA0F 2VHJA 4GOLD 4IYIA 2B21A 3A1VA 2P7TC 1ZSPA 3AG1C 1CVRA 3JVDA 1BGXT 3DW3X 1SELA 2Z9BA 3P97A 1CUJA 4P54A 3OKPA 4MVZA 1VEWA 4GZMA 3CJRA 4FE4A 3C74A 1WPBA 1JSLA 5SY6A 2OMKA 3PUXA 1YF3A 4IT5A 4BJ6A 1GV0A 4AWAA 3AZOA 1NUSA 1Z16A 2HEIA 2ZRPA 5JHGB 3VYUB 4ZQIA 1ZLZA 2PGDA 3A2FA 5CMLA 5G1NA 2YV4A 3QVJA 5HXAA 4HXFB 3TDKA 2P4KA 4V1CI 4HSGA 3BICA 3BD8A 2OIEA 2GESA 1CUVA 1ZGGA 2R7KA 1V5EA 5DTIA 5E2BA 4U8HA 3WSTA 2RMKB 2JF0A 2ZEJA 4H3SA 3HNOA 2R7MA 5B5SA 4ZD6A 1X1BA 3PGMA 4BP9A 5EWMA 1R3KC 3GOQA 1R0LA 5DYYA 3SEQA 1JHRA 1YZNA 5IWCA 1SB8A 4QBIA 1S7CA 3LWBA 4IDDA 4GUNA 1M2VB 3UWKA 1DJMA 2ZJ3A 1FAFA 3E05A 1QTIA 2PCLA 3SJUA 3H1IH 1PP9H 1DEOA 3IV9A 5IC4A 1H2BA 3Q1LA 4OBWA 4X54A 1W4LA 2AC4A 1RRVA 4RO2A 3KR1A 3V6LA 2ZTHA 4EL0A 3QO8A 3AUUA 1M2JA 3T3EA 2FUNB 3W4JA 1WWKA 3NOVA 1GYRA 1JCHA 4J90A 1JILA 2RGGA 3DMNA 1E61A 3S99A 3G1WA 3ZWYA 4FCVA 3IEPA 4PNHA 1Z2DA 3ST7A 1E3TA 3I52A 2H1HA 3OCZA 4L5JA 3PEFA 2IU4A 2PWZA 4CMBA 1CB0A 2WF7A 2P90A 4MUXA 1W75A