4DW1A

Crystal structure of the atp-gated p2x4 ion channel in the atp-bound, open state at 2.8 angstroms
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
324
structure length
324
Chain Sequence
RFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords P2X purinoceptor
publication title Molecular mechanism of ATP binding and ion channel activation in P2X receptors.
pubmed doi rcsb
source organism Danio rerio
total genus 80
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2012-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 4dw1A01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 4dw1A02
4DW0A 4DW1A 3H9VA 3I5DA
chains in the Genus database with same CATH superfamily
2YIDA 2W0FC 3K79A 4F6RB 4MW3A 3ZIAG 3M99B 3JAWB 2DQ0A 1SQQH 4LH6A 3CRAA 3K9SA 5J9PC 1XREA 1GN6A 4UB8Z 2R9RB 3N2KA 5A9GA 5CN0A 3FYIB 4DR5O 3CJHB 1NS1A 4KHPO 2CH7A 3ZN1A 1DF5A 4LF9O 2WLKA 5FNVA 3ZHRA 3JD0A 4I55A 2LJ2A 4JAAA 1FD9A 3BCCH 1HWYA 1EN6A 2UU9B 2P4KA 3CCLV 2JRIA 3JD2A 2AW9A 5LMUO 5LBQA 4QPKA 1IZ3A 3JD3A 4X9QA 3BEHA 4MVMA 1QCEA 3OEEG 3ZBHA 4BIUA 3BRCA 1NR1A 2BOBC 4ASUG 5BR8O 2OWOA 2JDIG 1D5AA 1N32O 4DV5O 3F5WC 2BOCC 3JD4A 5KA5A 1MSDA 4LF6B 3ZMTA 3H1JH 4W4KA 2GTAA 3ZRSA 3JASB 5J2UA 2QWOB 1I94O 1MZEA 1AI7A 2E5LB 3AK2A 4CBCA 5CA1A 3HKBA 5JJNB 5LOVB 4PA6A 1KP2A 4KFMA 4R7CA 4JGSA 2QEXV 1DLBA 4YJ2A 1NR7A 4O4JB 4LF8B 1EN5A 3SPGA 1T5EA 4JASA 3L71H 3BABA 1DK1A 4OXSA 2QKAA 4JI5B 4OPAA 1O9HA 4B3SB 2V7QG 2PF4E 3J81N 4FVMA 1S5HC 4GCZA 1M56C 3RYIB 1VQOV 2A06H 2QSAA 4AI8A 2ZIOA 1Z5WA 2LGWA 4UCSA 2PUSA 1MMMA 3VQXA 1IBKO 1AP6A 3ZX6A 1R1BA 4F4LA 1MOFA 4I0XA 4KP4A 1N34O 3PN1A 2N05A 1EFRG 4D7TA 4JZGA 2ZE7A 1YZBA 4UCVA 1THZA 2FB5A 3FB7C 1M1KW 3ZMVA 1B6QA 4J80A 2QKCA 2VQEO 1AI5A 1Q81W 1WJZA 3GWOA 4NTXA 2KSDA 4CC6A 5IY5B 4O4HA 1Y66A 2QWQB 3QVNA 1F7YA 4X1IB 4DV7O 4WBNA 4TUYB 2DWDC 4I50A 1P7GA 3W7WA 4NR1A 2A0LA 1CXZB 1HP8A 1N0NA 4KUMA 2F1MA 2QA4V 1M56B 3UT5B 4JYAB 2YSUB 3G4SV 1XMQB 2Y4TA 5K1XA 5LL6Y 2Y0IA 1YEWA 2JEXA 1NZ6A 1OJHA 3ZHQA 3P30A 2ADPA 2ZCEA 5IYDO 4FM1A 1H38A 4DW1A 4NXNB 5JVDA 1Q90D 4FFKA 1VQNV 5KAIZ 3F7YC 3A2FA 3LUTB 2ZKOA 3JATA 2Y69C 5JQGA 3U10A 2ZIMA 1KD1W 1VF6A 2P90A 3SYCA 4BWAA 2KQXA 2DOSA 2ETNA 3DTUB 4GKKO 1B06A 2NNUA 4NVPA 4NB5A 4MS2A 1N4CA 4EFBA 4UCOA 5KHJA 4QNHB 5LXTB 1TVKA 1GTOA 1Y4MA 4BIOA 5CB4A 2EJ7A 4LBEC 1MABG 4IGGA 4MVSA 1YI2V 1YF2A 2Q8VA 1HR0B 3NXSA 4K3AA 2H3OA 2ZXWC 3P3NA 4DR4B 4AHCA 4DYLA 1VQ6V 4DV3B 1RSOB 4MTFA 4LFCB 4GYCB 5B3SC 4DUZB 2HHHB 4MVOA 3SPCA 2IJHA 2E76B 3OTOB 1XDCA 2ILMA 1YTFB 2ZINA 5B1BC 3O9OA 4DV2O 4G27B 3CCSV 2BSKA 2B9ZA 1XHXA 4RUFA 2HVJC 4FZ0A 1J5EO 5C93A 3CE2A 1FXKC 1H2KA 3QO8A 2Q73A 3B8MA 1S76D 3SGIA 4YJ3A 3EFFK 4X66B 4IL6Z 2GHYA 4AQYB 3ETEA 1KB9F 3K5MA 3EHBB 3I55V 3T1HO 1H2GA 3RVZA 5EIBD 2VWKA 2JVDA 1GKFA 1HNXB 1ENVA 3N2GB 4X62O 1GO3F 5FLXN 4PELA 4LF5O 1I5XA 1H8HG 2X0LA 1MG1A 2ZXWB 4LFBB 1K5QA 3O65A 4MT8A 3OMAB 2OCCB 1M4UA 1XHZA 2IW5A 4XDKA 4U7NA 1XEQA 5B3SB 2VRZA 4DV6O 3E8FA 3G6BA 1XUQA 3HKEA 3LNMB 2CTQA 2IJKA 2X6CA 4LWSA 5B1BB 4YIPA 1JMKC 4ABMA 1G6UA 1Y76B 5IYZB 1VQ9V 5LGNA 1W59A 4QE7A 2D3OW 2ARHA 1SERA 4J41A 1FXKB 3TK1A 4B3MO 2ZDIC 2L6LA 4WFFA 2JK5C 4DR5B 3VQWA 4YY3O 4W4LA 3ABUA 4KHPB 4IHJB 4LF9B 1M5IA 3N2KB 3RYHA 2XNDG 4I9WA 3G6EV 2BTQA 3K0DA 2CH7B 5KA6A 3BHPA 2CTPA 1XBLA 5LA6A 2W0XA 5DEDA 4XBFA 5FNVB 4I55B 5LMUB 2HJDA 1Q6HA 2EIKC 2EJRA 5EK0A 5BR8B 1G8MA 3CCEV 4JI7O 2ZNJA 3RFRA 1N32B 3AEIA 4DV5B 1SZXA 4J7JA 5GTHZ 4DV4O 2WA3A 3OR6C 2F43G 2UXBO 4TV9A 1ZUQA 4JAVA 4O2AA 1I94B 2P7TC 5K1PA 2AGAA 2MW2B 3OUSA 5H6QA 3ZRWB 5IDJA 4GX0A 1LUWA 2WWWA 5CBHA 2Q7EA 4CH4A 4UXNA 2X7RB 4PD4F 4BAYA 4N23A 3D3IA 2EIKB 4JV5O 2QR4A 3ASNC 3AG1B 1BL8A 3THOA 2EINC 4ICGA 3LSUA 1US6A 2QWPB 3JAMN 2VWJA 3ABKC 4I5SA 2VQFO 1IBKB 1X59A 1DF4A 1VARA 5ITZB 3CCMV 2XASA 5LP6A 1AP5A 1U97A 1N34B 2ZD9A 1FPOA 3QO7A 4E4EA 4UV8A 4U3JA 3M7MX 2Q7HA 4D6TH 2AZ0A 1HNWO 4I0XB 4EB6B 2QJ1A 2VQEB 1VF6C 4JTAB 5GONA 2CTWA 2B1IA 2Q67A 4DV7B 1BHBA 4X1YA 5KMGA 4PI2A 1SQXH 3C90A 3FB5C 1VQ7V 4WF9V 1VMGA 1JPXA 2XAGA 1Q6IA 4NKGB 4O4HB 2Q4PA 3ASNB 1H2MA 2ZE6A 1XMOO 4JI2O 3ZRXA 3ABKB 2UUCO 3STLC 5J2TB 1MA1A 2CAZC 4J9YB 3E89A 4FM2A 2ZR3A 1M57C 4B7KA 1G4YB 3W7XA 2GBOA 4AILC 3MDSA 1V55B 3OE7G 4GKKB 3SDLA 1K73W 3K5NA 1M93A 5C8YB 3L70H 2RMKB 3UO3A 1MZFA 2JGUA 3HKCA 2WPDG 1BMFG 4J11A 1ZAUA 4QIWF 1K97A 4LH7A 3K59A 2BE3A 3OR7C 2CUGA 2XAJA 3K5LA 4UCTA 2OT5A 1AVMA 3L74H 2ZE5A 1K4CC 2O57A 2OTJV 4QPJA 2BTOA 3OAAG 4FLUA 1ZL8A 2ADQB 4O4IA 5LMNO 1YHQV 4CH3A 2V1DA 4DV2B 1Y67A 3TXQA 1JJOA 2Q5ZA 1WP7A 4H37A 1Y74A 1UPGA 1M57B 1FFXB 2WLMA 3UM7A 3JARB 2BCCH 4UVBA 1J5EB 4FMTA 4X65O 4E2LA 3SJQC 2DYRC 3WB0A 3T1HB 2NR5A 1K7DA 1TA8A 4ZBMA 5KX5A 3I56V 4O4LA 4YJ3B 4X62B 1Q82W 4LF5B 4JYBA 1VP7A 3ZMUA 4WFGA 2M6YA 1HW7A 5HFLA 4NXMO 4FFBA 1K8AW 3VQVA 1RFYA 1XNRO 5H9CA 1MSWD 1BGYH 1S5JA 4A5UB 3IGAC 4DV6B 3B40A 3CC4V 4DR7O 1RP3B 5IJ0B 4X1KB 1GN2A 2YDEA 4X20A 3LNNA 3CHXA 3ABMC 3T1CA 4DK1A 2JGDA 4PJ0Z 2OYQA 3DXRB 2VS0A 1XOUA 1KBHA 4ZIBA 2AXTZ 1V9PA 4PDLA 4LWSB 1AJNA 3ETQA 3MHSC 4BIZA 4QJFB 4DR2O 3OT7A 2OIEA 4HNAB 4B3MB 2PI4A 4YY3B 3AG2C 5AG2A 1U96A 2DYRB 4DUYO 2Q6AA 2D2CB 2HFEC 3KG2A 1GM7A 3JALB 3WFVA 3P32A 4ZI7A 4F6EA 5IY5C 4JI8O 2UXNA 3H01A 1K4DC 1K5SA 4DR6O 1OCCC 4J7ZA 3RYHB 1PM9A 3OGIB 2BTQB 3ZS8C 2W6IG 3JCZA 2IH3C 2PZSA 3CCUV 4JI7B 1VQ8V 3E8GA 1DTOA 2MK3A 2Q0AA 5EBLC 1GN4A 3M8AA 4H44B 2FTKA 2YICA 4LNUB 3ABMB 3QNEA 1WA8A 2E74B 5L3DA 5CA0A 4WFBV 2GV9A 4JI3O 4DV4B 4OGQB 2UXBB 1YSCA 2LFSA 3FB6C 5BMVA 3E22B 3ZHUA 2ZR2A 4FJCC 2FL4A 1Q5OA 3Q4HA 5FPRA 4EFEA 4O2BA 3U11A 3AG2B 2Y4UA 1E1QG 1IXBA 2Q68A 2RN9A 4TV9B 2QE7G 3IC9A 2N74A 2IH1C 4O2AB 3BPZA 3OMIB 3VQYA 1KECA 3BY6A 1YTFD 2HKOA 2EZOA 1P4RA 3WB2A 1OCCB 2QM7A 3CCJV 3SYAA 4HAMA 4ZOLA 1Q8IA 3CRQA 2DQ3A 1IBLO 2PTMA 3JYCA 2YC0A 4JV5B 1W0KG 2LO1A 5LYJA 2YIBA 4FLWA 3KZIZ 4PDRA 4TT3G 2WLLB 1V54C 2P67A 1ZLZA 2F4VO 2NN4A 5B66Z 4DRXA 2VQFB 1H2SB 2HVKC 3RBZA 2K9PA 1OV9A 3H9VA 1L8DA 3RYFA 4JTDB 1RM1C 2X6BA 2XAQA 1UFIA 1MNGA 4Z2WA 2K1EA 3TETA 2XUMA 1TUBA 1VF7A 5KUMA 2EIMC 1IVSA 5LP6B 1AR1B 1BCCH 1FXHA 1BSMA 2GUZA 1AR5A 1HNWB 4B3TO 3ZJZA 2EULA 2DJVA 3T4DA 5L3BA 1Z5VA 2JJ2G 4TV8A 2WLIA 3JAKA 3G80A 2NLJC 3BAAA 2CGNA 2UXXA 2OCHA 1QLNA 1KYOF 2JS3A 5JCOA 1AB3A 5GONB 3N27A 2ITDC 1WPBA 2OCCC 4LC1A 1VQ5V 3CC2V 3B4SA 4FIPC 4X1YB 4L87A 1XMOB 4JI2B 3D36C 2KG7A 1V54B 2UUCB 4UB6Z 1K33A 1NU1H 1R6TA 4GKJO 4WFHA 2AZ2A 4GZRB 2QGNA 2DW4A 1N8RW 1DGSA 1D2DA 1RM1B 3TXSA 2IJJA 3FAVB 5JH7A 3AK1A 4MW8A 2WLHA 2EIMB 3IC7A 1OZ0A 4UCUA 5KHHA 3ZN0A 4DV1O 3TCUA 1AILA 3I5DA 3OUFA 3NR7A 5L3EA 1L0NH 3CD6V 1H2NA 2F95B 3CJHA 1XI1A 2C2AA 2G38A 4JF3A 3OM3B 1SF9A 1NH2B 3IFXA 5E79Z 4JAUA 4IIJB 4K8ZA 5CBGA 2A79B 1Q43A 2YI9A 4FLYA 2OTLV 1I5YA 5EC2C 1XL4A 3HR0A 3FX7A 1WLEA 2R9IA 3CRRA 4RUEA 1IURA 4CZZA 3QF7A 3APOA 4JI6O 4G2KA 1Y6XA 3EXAA 3GVMA 1PPJH 5IYBO 1R6KA 2H8PC 4Q20A 2JS5A 3OEHG 4X65B 4O4IB 1EZJA 2QWNB 4IYHA 1Y74B 1JFFA 1SQBH 4FLVA 3LSSA 4DR1O 3B09A 2QTSA 2YUAA 1BS3A 2YXYA 3ZCCA 5EZYA 3MAQA 2UUAO 5KHIA 4JZ2A 1GMGA 1IXMA 1ORQC 1KKDA 4HBNA 2QTOA 1IBMO 5E1AC 2B1GA 1SZTA 4NXMB 4DK0A 1VQLV 4FLXA 5IWAO 4X8AA 3CPWU 3UQ8A 1XNRB 4FZ1A 2RQ6A 2FKXA 1WB7A 1L1FA 3AG1C 4MSWC 5EC1C 1YJNV 3H1LH 1SQGA 1NBMG 1XL6A 3F5TA 4DR7B 3T4ZA 4QE9A 1NTZH 1NTKH 3LDDA 3F7VC 1QR8A 2H94A 5L3GA 2FYUH 1N33O 3ZRVA 2RJZA 1WNSA 4DR2B 1XQ8A 1GK9A 2QWRB 4ZKIA 1Q86W 4PA4A 3APQA 3WG7C 4DUYB 3CMEV 5J2UB 1CPYA 3U0ZA 4TWKA 5CA1B 3HKBB 2RNBA 4JI8B 1QU7A 2UXCO 1JQ0A 3EVKA 2LW7A 1I0HA 4FK5C 4YJ2B 4CS3A 4DR6B 1R3IC 3ABLB 5EYPA 4TUYA 3SJBC 4MTGA 1H8EG 4X64O 4P30A 3UT5A 3T2MA 3K04A 4PA3A 3ZHTA 4B7EA 3KCXA 2YEVA 2YI8A 2PGGA 1OCZC 2CE4A 4JI3B 5JJJB 2QKSA 1HNZO 1NVPB 1GAXA 4JI4O 4MVQA 3RW0A 4LCUC 2CGOA 2IU3A 1UJWB 1JOYA 1WA8B 3SYOA 1BHAA 3FKSG 3DC5A 1GN3A 4UCRA 1V55C 1S5LZ 3WG7B 2R9AA 5IT9N 1FJGO 4CS4A 5FPOA 3K3WA 3PJSK 3L75H 3AG4C 1F23A 4BW9A 1BZKA 1K9MW 5GW7A 2F23A 4GT1A 5D5QA 2Z0AA 3CS5A 2EBOA 3E86A 5LXTA 2LFRA 5CBFA 4YHHO 1NJIW 1IBLB 3KCYA 3TJTA 2IJIA 4DXWA 4WBNB 4H33A 3B2EE 1VIBA 4I50B 4U3FH 4ZOLB 1E79G 4JYCA 2B5UA 1ROPA 1N0JA 1OCZB 4MTXA 2A7WA 4LF4O 2F4VB 1NTMH 1CP9A 4DR3O 3QO5A 3DGEA 1YIJV 4I4TA 3SR2C 5L3FA 3CXHF 5IE9A 5KUKA 3W7SA 4DRXB 3C3TA 2JJ1G 1BE3H 4UVAA 3RYCA 5JVDB 1Q3EA 3IJ4A 3RYFB 1NT2B 1PL4A 3JATB 3AG4B 4B3TB 1BQZA 2YXLA 5JQGB 5KLVH 4WFAV 1G1XB 3H1HH 2DWEC 2CTRA 4OX9O 4QGPA 4I9QA 1VQKV 3N2GA 4JTCB 4TV8B 4ZHQA 1TVKB 1N36O 2Y48A 5CB4B 4P9PA 4MVUA 4CS2A 3A0HZ 1JJ2U 3K57A 2E3CA 4C7UA 2ZT9B 3K5OA 4GKJB 1QVFU 1PD3A 1SQFA 5BZBA 1QLEC 1KC8W 2KB1A 1GH6A 1WB8A 1WP8A 2XT9A 4N21A 2P6JA 2KG7B 1Y76A 5IJ9A 2PYJA 3C3SA 1K34A 1OCOC 1NI8A 3AG3B 3CXCU 2PI5A 2BSKB 1FXKA 4DV1B 1FAFA 3X2QB 4FM0A 1TUEB 5JH7B 5B5EZ 2WLJA 5KAFZ 1X4TA 2GTSA 3OTFA 3LSQA 2UXDO 4IHJA 4UV9A 3R66A 2ZM6O 2WSSG 2JIZG 2XAFA 4YIOA 4NTYA 3FYEB 2WLNA 2HLDG 2ZE8A 2WAMA 3ETGA 3CRMA 3W7UA 2CK3G 3E8HA 3HKDA 2R70A 1BQ0A 2WA4A 4EKWA 1QLEB 2Q9LA 5H5NA 1R3LC 4B3RO 2GDSA 3A8TA 4JI6B 1ZTEA 3E83A 2N04A 3HKEB 1OCOB 1OCRC 4TSFG 2PY5A 3RGBA 3HPLC 4EEQA 4FLZA 2DMXA 1Q7YW 5IYCO 2ZDIA 3T1YO 1XNQO 1AJPA 4DR1B 1JX9A 1GM9A 1AJQA 5HFMA 3ZRWA 4DO2A 2UUAB 3SYQA 4HYOA 4PHZA 4NTWA 1S77D 4X89A 3QG5A 1JFFB 4FPPA 3SJAC 2AHYA 4CH6A 1E1RG 1IBMB 2P5OA 4K8XA 3GB7C 5EZYB 5IWAB 1A32A 3B8NA 2EIJC 2L35A 2OIGA 1SQVH 2HEPA 1LUVA 5LA6B 3J7AU 3FD9A 3G71V 4JI0O 4HZ3A 1YXBA 4RQFA 2UUBO 3BA8A 3S3XA 1OCRB 1N33B 5ITZA 1JCHA 3DSQA 3LDEA 1SKVA 1R3KC 4LFAO 5LP6C 5LHHA 1EN4A 1TGOA 5H2FZ 4K35A 3ETDA 4EB6A 2UXCB 2QM8A 4KL1A 3HB3B 3DC6A 1KQSU 1H2LA 2XAHA 1QR9A 4TOIA 4PA9A 4CH5A 2EIJB 1SA0A 3ZHVA 1WAZA 5DECA 1I7FA 2RCVA 5L3CA 3RT3C 4X64B 4DV0O 1RPOA 2PYLA 1QQCA 5FL7G 5EYPB 1EM1A 5JJEB 4JI1O 1HNZB 1ZSPA 1EZVH 4GLXA 4JI4B 2HJFC 1F4MA 3W7TA 5J2TA 4K0KO 5KHGA 2YEVB 1SRYA 1QNMA 1NH2D 1J95A 2RDCA 3K08A 5BY1A 4RWUA 1FJGB 1SESA 1IDSA 1W2BU 4TQDA 2GSMB 2W6JG 3JSNA 3BFRA 4U3JB 5C8YA 3MD0A 3GWKC 2QM4A 4LF7O 4JYYA 4GX1A 1PKXA 4YHHB 2DE0X 3K03A 3D8CA 5F2VO 1AR4A 3G67A 3ZMZA 2QDOA 4G28B 1R73A 5KMGB 3CRCA 4IYIA 4H13B 3CMAV 4X88A 5H6RA 3A0RA 3R65A 4LF4B 4TQFA 4XDJA 1QBZA 4F6RA 3JSLA 3CP1A 4DR3B 2Q0OC 4P9OA 2M7WA 2KKWA 1M90W 3JAWA 2HR3A 3UO2A 2F93B 3SPHA 1FFXA 3JARA 4I4TB 5BXZA 1SETA 2EZPA 2Y0PA 3BVOA 4R50A 3K58A 1ZX3A 4UFZA 2HG5C 4RAIA 5D5PA 3RYCB 2EILC 1KP3A 2ZQMA 2Y69B 3AG7A 3JD1A 3SPJA 4OX9B 4B08A 3VOUA 5EBWC 3HKCB 1BT8A 1B3QA 4UUJC 3CSXA 4OPHA 2LW1A 2ATKC 3H1IH 1N36B 5DN6G 1F51A 1K3EA 1F4NA 4ZHQB 2UU9O 3UKMA 3LDCA 1QHTA 1VF5B 3L73H 3ML0A 3CCVV 5LMNB 1YITV 4RQEA 5IJ0A 3AK3A 2A9HA 4X1KA 3P3PA 2F66C 1PP9H 1YCIA 1ZL8B 5LHGA 5EIBC 1R6NA 5B1OA 3DXRA 1YDXA 4PDMA 3JCUZ 3JASA 1XILA 3OFNG 4J7KA 2XTAA 4HNAA 4LF6O 5IJ9B 1RPRA 4PI0A 3BA9A 4PV1B 5LOVA 1AI4A 4BR6A 2EILB 2UXDB 1PL0A 2ZM6B 4O4JA 3FFQA 3JALA 2P4VA 3WB1A 2E5LO 3SPIA 1PNKA 1O9GA 1NVPD 5JWPA 5KX5B 1FYJA 5LHIA 1S72V 1B04A 4O4LB 3ABLC 3SYPA 2FMLA 4LF8O 4XDLA 2Z5UA 1Q6UA 5B1AC 4U7OA 1KUQA 4FFBB 1LNQA 1JVMA 4PA7A 3RYIA 4JI5O 3CCRV 4GX2A 2Z3YA 3CYOA 4B3SO 1URFA 4IT5A 4B3RB 1YJWV 5LGUA 1PNLA 4GX5A 4LNUA 1HDJA 4YXWG 1KMIZ 1R3JC 3HKDB 4FLTA 3FB8C 1FS0G 4X20B 4Z1VA 4PDVA 4UVCA 4Z1MG 3E22A 4H0LB 2JGDB 3K0GA 2ODMA 2P06A 3ZHSA 1KU9A 4WCEV 3T1YB 1XNQB 3OMNB 2E75B 1I08A 3S3WA 1NKDA 3RN4A 2YIBD 4P2ZA 1IX9A 1QVGU 3H1KH 4ZI7B 4X1IA 2YS8A 4MVZA 3TGUH 1YVWA 4L8JA 3E2EA 5B1AB 2YIAA 3CB2A 3QTCA 3ZEDA 3E8BA 1VQMV 4J10A 2YXHA 1S0VA 2WLLA 4JI0B 2JEUA 1CEZA 5B1NA 4MTOA 1COWG 2UUBB 3MHHC 4NYKA 5LGTA 1P84F 4J9ZB 4JYAO 5A2QN 3UCSC 1XMQO 3ZMSA 4LR3A 1M9NA 3WU2Z 5CA0B 1FXVA 1GRJA 4R6ZA 4LFAB 5BMVB 1VQ4V 2X6AA 1KKCA 1AI6A 2ZNIA 4NXNO 1SQPH 3Q4HB 5CA3A 2IU0A 4O2BB 5KHKA 3RWRD 4LP8A 2DYSC 1OHHG 2DN9A 3CWBH 1AROP 3ABTA 1FKAO 4Q6GA 1YJ9V 1VQPV 4KXRA 2Q69A 3CX5F 1ZWIC 3OD4A 3STZC 1PV0A 3CCQV 3ASOC 4DV0B 1L0LH 1VEWA 1P49A 1Z2GA 2EX3A 1D5NA 3J80N 1K92A 5JCOC 3KKYA 1RSOA 5LYJB 1SA0B 3K06A 3K9AA 4JI1B 1P7BA 1SC5B 1HR0O 2Q7GA 3B77A 4DR4O 2CDYA 4K0KB 2IBZH 2XOKG 1WPXA 2P22C 3E35A 4BW5A 4D7SA 4DV3O 2EINB 3D3QA 4LFCO 2R72A 4DUZO 3AG3C 2HHHO 2A3QA 3FAVA 3OTOO 5GTIZ 2LGQA 3L9DA 1EBOA 2HP8A 3X2QC 1TUBB 1GM8A 1LR1A 5DM6V 2XHBA 2DYSB 1WN7A 4WFEA 1PNMA 4DW0A 2GUZB 3RVYA 3OGCC 2AHZA 4LF7B 4R8CA 4JPRA 1JR9A 3SJCC 4X66O 1FFTB 1SS3A 4AQYO 1JA8A 4CC5A 3CEIA 2WLIB 2LP7A 3JAKB 3CC7V 3ASOB 4GUNA 4MVRA 4IIJA 1HNXO 3ICXA 3A0BZ 5EBMC 2LQTA 3D36A 3VBBA 5CMUA 4I7ZB 2IM9A 1S3JA 4LFBO 3IAYA 1W0JG 4RO2A 2ITCC 1TAEA 2V4DA 3OW2U 4J42A 5TISZ 3L72H 5IYZA 1NQTA
chains in the Genus database with same CATH topology
4DW0A 4DW1A 3H9VA 3I5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DW0 A;  4DW1 A;  3H9V A;  3I5D A; 
#chains in the Genus database with same CATH topology
 2YID A;  2W0F C;  3K79 A;  4F6R B;  4MW3 A;  3ZIA G;  3M99 B;  3JAW B;  2DQ0 A;  1SQQ H;  4LH6 A;  3CRA A;  3K9S A;  5J9P C;  1XRE A;  1GN6 A;  4UB8 Z;  2R9R B;  3N2K A;  5A9G A;  5CN0 A;  3FYI B;  4DR5 O;  3CJH B;  1NS1 A;  4KHP O;  2CH7 A;  3ZN1 A;  1DF5 A;  4LF9 O;  2WLK A;  5FNV A;  3ZHR A;  3JD0 A;  4I55 A;  2LJ2 A;  4JAA A;  1FD9 A;  3BCC H;  1HWY A;  1EN6 A;  2UU9 B;  2P4K A;  3CCL V;  2JRI A;  3JD2 A;  2AW9 A;  5LMU O;  5LBQ A;  4QPK A;  1IZ3 A;  3JD3 A;  4X9Q A;  3BEH A;  4MVM A;  1QCE A;  3OEE G;  3ZBH A;  4BIU A;  3BRC A;  1NR1 A;  2BOB C;  4ASU G;  5BR8 O;  2OWO A;  2JDI G;  1D5A A;  1N32 O;  4DV5 O;  3F5W C;  2BOC C;  3JD4 A;  5KA5 A;  1MSD A;  4LF6 B;  3ZMT A;  3H1J H;  4W4K A;  2GTA A;  3ZRS A;  3JAS B;  5J2U A;  2QWO B;  1I94 O;  1MZE A;  1AI7 A;  2E5L B;  3AK2 A;  4CBC A;  5CA1 A;  3HKB A;  5JJN B;  5LOV B;  4PA6 A;  1KP2 A;  4KFM A;  4R7C A;  4JGS A;  2QEX V;  1DLB A;  4YJ2 A;  1NR7 A;  4O4J B;  4LF8 B;  1EN5 A;  3SPG A;  1T5E A;  4JAS A;  3L71 H;  3BAB A;  1DK1 A;  4OXS A;  2QKA A;  4JI5 B;  4OPA A;  1O9H A;  4B3S B;  2V7Q G;  2PF4 E;  3J81 N;  4FVM A;  1S5H C;  4GCZ A;  1M56 C;  3RYI B;  1VQO V;  2A06 H;  2QSA A;  4AI8 A;  2ZIO A;  1Z5W A;  2LGW A;  4UCS A;  2PUS A;  1MMM A;  3VQX A;  1IBK O;  1AP6 A;  3ZX6 A;  1R1B A;  4F4L A;  1MOF A;  4I0X A;  4KP4 A;  1N34 O;  3PN1 A;  2N05 A;  1EFR G;  4D7T A;  4JZG A;  2ZE7 A;  1YZB A;  4UCV A;  1THZ A;  2FB5 A;  3FB7 C;  1M1K W;  3ZMV A;  1B6Q A;  4J80 A;  2QKC A;  2VQE O;  1AI5 A;  1Q81 W;  1WJZ A;  3GWO A;  4NTX A;  2KSD A;  4CC6 A;  5IY5 B;  4O4H A;  1Y66 A;  2QWQ B;  3QVN A;  1F7Y A;  4X1I B;  4DV7 O;  4WBN A;  4TUY B;  2DWD C;  4I50 A;  1P7G A;  3W7W A;  4NR1 A;  2A0L A;  1CXZ B;  1HP8 A;  1N0N A;  4KUM A;  2F1M A;  2QA4 V;  1M56 B;  3UT5 B;  4JYA B;  2YSU B;  3G4S V;  1XMQ B;  2Y4T A;  5K1X A;  5LL6 Y;  2Y0I A;  1YEW A;  2JEX A;  1NZ6 A;  1OJH A;  3ZHQ A;  3P30 A;  2ADP A;  2ZCE A;  5IYD O;  4FM1 A;  1H38 A;  4DW1 A;  4NXN B;  5JVD A;  1Q90 D;  4FFK A;  1VQN V;  5KAI Z;  3F7Y C;  3A2F A;  3LUT B;  2ZKO A;  3JAT A;  2Y69 C;  5JQG A;  3U10 A;  2ZIM A;  1KD1 W;  1VF6 A;  2P90 A;  3SYC A;  4BWA A;  2KQX A;  2DOS A;  2ETN A;  3DTU B;  4GKK O;  1B06 A;  2NNU A;  4NVP A;  4NB5 A;  4MS2 A;  1N4C A;  4EFB A;  4UCO A;  5KHJ A;  4QNH B;  5LXT B;  1TVK A;  1GTO A;  1Y4M A;  4BIO A;  5CB4 A;  2EJ7 A;  4LBE C;  1MAB G;  4IGG A;  4MVS A;  1YI2 V;  1YF2 A;  2Q8V A;  1HR0 B;  3NXS A;  4K3A A;  2H3O A;  2ZXW C;  3P3N A;  4DR4 B;  4AHC A;  4DYL A;  1VQ6 V;  4DV3 B;  1RSO B;  4MTF A;  4LFC B;  4GYC B;  5B3S C;  4DUZ B;  2HHH B;  4MVO A;  3SPC A;  2IJH A;  2E76 B;  3OTO B;  1XDC A;  2ILM A;  1YTF B;  2ZIN A;  5B1B C;  3O9O A;  4DV2 O;  4G27 B;  3CCS V;  2BSK A;  2B9Z A;  1XHX A;  4RUF A;  2HVJ C;  4FZ0 A;  1J5E O;  5C93 A;  3CE2 A;  1FXK C;  1H2K A;  3QO8 A;  2Q73 A;  3B8M A;  1S76 D;  3SGI A;  4YJ3 A;  3EFF K;  4X66 B;  4IL6 Z;  2GHY A;  4AQY B;  3ETE A;  1KB9 F;  3K5M A;  3EHB B;  3I55 V;  3T1H O;  1H2G A;  3RVZ A;  5EIB D;  2VWK A;  2JVD A;  1GKF A;  1HNX B;  1ENV A;  3N2G B;  4X62 O;  1GO3 F;  5FLX N;  4PEL A;  4LF5 O;  1I5X A;  1H8H G;  2X0L A;  1MG1 A;  2ZXW B;  4LFB B;  1K5Q A;  3O65 A;  4MT8 A;  3OMA B;  2OCC B;  1M4U A;  1XHZ A;  2IW5 A;  4XDK A;  4U7N A;  1XEQ A;  5B3S B;  2VRZ A;  4DV6 O;  3E8F A;  3G6B A;  1XUQ A;  3HKE A;  3LNM B;  2CTQ A;  2IJK A;  2X6C A;  4LWS A;  5B1B B;  4YIP A;  1JMK C;  4ABM A;  1G6U A;  1Y76 B;  5IYZ B;  1VQ9 V;  5LGN A;  1W59 A;  4QE7 A;  2D3O W;  2ARH A;  1SER A;  4J41 A;  1FXK B;  3TK1 A;  4B3M O;  2ZDI C;  2L6L A;  4WFF A;  2JK5 C;  4DR5 B;  3VQW A;  4YY3 O;  4W4L A;  3ABU A;  4KHP B;  4IHJ B;  4LF9 B;  1M5I A;  3N2K B;  3RYH A;  2XND G;  4I9W A;  3G6E V;  2BTQ A;  3K0D A;  2CH7 B;  5KA6 A;  3BHP A;  2CTP A;  1XBL A;  5LA6 A;  2W0X A;  5DED A;  4XBF A;  5FNV B;  4I55 B;  5LMU B;  2HJD A;  1Q6H A;  2EIK C;  2EJR A;  5EK0 A;  5BR8 B;  1G8M A;  3CCE V;  4JI7 O;  2ZNJ A;  3RFR A;  1N32 B;  3AEI A;  4DV5 B;  1SZX A;  4J7J A;  5GTH Z;  4DV4 O;  2WA3 A;  3OR6 C;  2F43 G;  2UXB O;  4TV9 A;  1ZUQ A;  4JAV A;  4O2A A;  1I94 B;  2P7T C;  5K1P A;  2AGA A;  2MW2 B;  3OUS A;  5H6Q A;  3ZRW B;  5IDJ A;  4GX0 A;  1LUW A;  2WWW A;  5CBH A;  2Q7E A;  4CH4 A;  4UXN A;  2X7R B;  4PD4 F;  4BAY A;  4N23 A;  3D3I A;  2EIK B;  4JV5 O;  2QR4 A;  3ASN C;  3AG1 B;  1BL8 A;  3THO A;  2EIN C;  4ICG A;  3LSU A;  1US6 A;  2QWP B;  3JAM N;  2VWJ A;  3ABK C;  4I5S A;  2VQF O;  1IBK B;  1X59 A;  1DF4 A;  1VAR A;  5ITZ B;  3CCM V;  2XAS A;  5LP6 A;  1AP5 A;  1U97 A;  1N34 B;  2ZD9 A;  1FPO A;  3QO7 A;  4E4E A;  4UV8 A;  4U3J A;  3M7M X;  2Q7H A;  4D6T H;  2AZ0 A;  1HNW O;  4I0X B;  4EB6 B;  2QJ1 A;  2VQE B;  1VF6 C;  4JTA B;  5GON A;  2CTW A;  2B1I A;  2Q67 A;  4DV7 B;  1BHB A;  4X1Y A;  5KMG A;  4PI2 A;  1SQX H;  3C90 A;  3FB5 C;  1VQ7 V;  4WF9 V;  1VMG A;  1JPX A;  2XAG A;  1Q6I A;  4NKG B;  4O4H B;  2Q4P A;  3ASN B;  1H2M A;  2ZE6 A;  1XMO O;  4JI2 O;  3ZRX A;  3ABK B;  2UUC O;  3STL C;  5J2T B;  1MA1 A;  2CAZ C;  4J9Y B;  3E89 A;  4FM2 A;  2ZR3 A;  1M57 C;  4B7K A;  1G4Y B;  3W7X A;  2GBO A;  4AIL C;  3MDS A;  1V55 B;  3OE7 G;  4GKK B;  3SDL A;  1K73 W;  3K5N A;  1M93 A;  5C8Y B;  3L70 H;  2RMK B;  3UO3 A;  1MZF A;  2JGU A;  3HKC A;  2WPD G;  1BMF G;  4J11 A;  1ZAU A;  4QIW F;  1K97 A;  4LH7 A;  3K59 A;  2BE3 A;  3OR7 C;  2CUG A;  2XAJ A;  3K5L A;  4UCT A;  2OT5 A;  1AVM A;  3L74 H;  2ZE5 A;  1K4C C;  2O57 A;  2OTJ V;  4QPJ A;  2BTO A;  3OAA G;  4FLU A;  1ZL8 A;  2ADQ B;  4O4I A;  5LMN O;  1YHQ V;  4CH3 A;  2V1D A;  4DV2 B;  1Y67 A;  3TXQ A;  1JJO A;  2Q5Z A;  1WP7 A;  4H37 A;  1Y74 A;  1UPG A;  1M57 B;  1FFX B;  2WLM A;  3UM7 A;  3JAR B;  2BCC H;  4UVB A;  1J5E B;  4FMT A;  4X65 O;  4E2L A;  3SJQ C;  2DYR C;  3WB0 A;  3T1H B;  2NR5 A;  1K7D A;  1TA8 A;  4ZBM A;  5KX5 A;  3I56 V;  4O4L A;  4YJ3 B;  4X62 B;  1Q82 W;  4LF5 B;  4JYB A;  1VP7 A;  3ZMU A;  4WFG A;  2M6Y A;  1HW7 A;  5HFL A;  4NXM O;  4FFB A;  1K8A W;  3VQV A;  1RFY A;  1XNR O;  5H9C A;  1MSW D;  1BGY H;  1S5J A;  4A5U B;  3IGA C;  4DV6 B;  3B40 A;  3CC4 V;  4DR7 O;  1RP3 B;  5IJ0 B;  4X1K B;  1GN2 A;  2YDE A;  4X20 A;  3LNN A;  3CHX A;  3ABM C;  3T1C A;  4DK1 A;  2JGD A;  4PJ0 Z;  2OYQ A;  3DXR B;  2VS0 A;  1XOU A;  1KBH A;  4ZIB A;  2AXT Z;  1V9P A;  4PDL A;  4LWS B;  1AJN A;  3ETQ A;  3MHS C;  4BIZ A;  4QJF B;  4DR2 O;  3OT7 A;  2OIE A;  4HNA B;  4B3M B;  2PI4 A;  4YY3 B;  3AG2 C;  5AG2 A;  1U96 A;  2DYR B;  4DUY O;  2Q6A A;  2D2C B;  2HFE C;  3KG2 A;  1GM7 A;  3JAL B;  3WFV A;  3P32 A;  4ZI7 A;  4F6E A;  5IY5 C;  4JI8 O;  2UXN A;  3H01 A;  1K4D C;  1K5S A;  4DR6 O;  1OCC C;  4J7Z A;  3RYH B;  1PM9 A;  3OGI B;  2BTQ B;  3ZS8 C;  2W6I G;  3JCZ A;  2IH3 C;  2PZS A;  3CCU V;  4JI7 B;  1VQ8 V;  3E8G A;  1DTO A;  2MK3 A;  2Q0A A;  5EBL C;  1GN4 A;  3M8A A;  4H44 B;  2FTK A;  2YIC A;  4LNU B;  3ABM B;  3QNE A;  1WA8 A;  2E74 B;  5L3D A;  5CA0 A;  4WFB V;  2GV9 A;  4JI3 O;  4DV4 B;  4OGQ B;  2UXB B;  1YSC A;  2LFS A;  3FB6 C;  5BMV A;  3E22 B;  3ZHU A;  2ZR2 A;  4FJC C;  2FL4 A;  1Q5O A;  3Q4H A;  5FPR A;  4EFE A;  4O2B A;  3U11 A;  3AG2 B;  2Y4U A;  1E1Q G;  1IXB A;  2Q68 A;  2RN9 A;  4TV9 B;  2QE7 G;  3IC9 A;  2N74 A;  2IH1 C;  4O2A B;  3BPZ A;  3OMI B;  3VQY A;  1KEC A;  3BY6 A;  1YTF D;  2HKO A;  2EZO A;  1P4R A;  3WB2 A;  1OCC B;  2QM7 A;  3CCJ V;  3SYA A;  4HAM A;  4ZOL A;  1Q8I A;  3CRQ A;  2DQ3 A;  1IBL O;  2PTM A;  3JYC A;  2YC0 A;  4JV5 B;  1W0K G;  2LO1 A;  5LYJ A;  2YIB A;  4FLW A;  3KZI Z;  4PDR A;  4TT3 G;  2WLL B;  1V54 C;  2P67 A;  1ZLZ A;  2F4V O;  2NN4 A;  5B66 Z;  4DRX A;  2VQF B;  1H2S B;  2HVK C;  3RBZ A;  2K9P A;  1OV9 A;  3H9V A;  1L8D A;  3RYF A;  4JTD B;  1RM1 C;  2X6B A;  2XAQ A;  1UFI A;  1MNG A;  4Z2W A;  2K1E A;  3TET A;  2XUM A;  1TUB A;  1VF7 A;  5KUM A;  2EIM C;  1IVS A;  5LP6 B;  1AR1 B;  1BCC H;  1FXH A;  1BSM A;  2GUZ A;  1AR5 A;  1HNW B;  4B3T O;  3ZJZ A;  2EUL A;  2DJV A;  3T4D A;  5L3B A;  1Z5V A;  2JJ2 G;  4TV8 A;  2WLI A;  3JAK A;  3G80 A;  2NLJ C;  3BAA A;  2CGN A;  2UXX A;  2OCH A;  1QLN A;  1KYO F;  2JS3 A;  5JCO A;  1AB3 A;  5GON B;  3N27 A;  2ITD C;  1WPB A;  2OCC C;  4LC1 A;  1VQ5 V;  3CC2 V;  3B4S A;  4FIP C;  4X1Y B;  4L87 A;  1XMO B;  4JI2 B;  3D36 C;  2KG7 A;  1V54 B;  2UUC B;  4UB6 Z;  1K33 A;  1NU1 H;  1R6T A;  4GKJ O;  4WFH A;  2AZ2 A;  4GZR B;  2QGN A;  2DW4 A;  1N8R W;  1DGS A;  1D2D A;  1RM1 B;  3TXS A;  2IJJ A;  3FAV B;  5JH7 A;  3AK1 A;  4MW8 A;  2WLH A;  2EIM B;  3IC7 A;  1OZ0 A;  4UCU A;  5KHH A;  3ZN0 A;  4DV1 O;  3TCU A;  1AIL A;  3I5D A;  3OUF A;  3NR7 A;  5L3E A;  1L0N H;  3CD6 V;  1H2N A;  2F95 B;  3CJH A;  1XI1 A;  2C2A A;  2G38 A;  4JF3 A;  3OM3 B;  1SF9 A;  1NH2 B;  3IFX A;  5E79 Z;  4JAU A;  4IIJ B;  4K8Z A;  5CBG A;  2A79 B;  1Q43 A;  2YI9 A;  4FLY A;  2OTL V;  1I5Y A;  5EC2 C;  1XL4 A;  3HR0 A;  3FX7 A;  1WLE A;  2R9I A;  3CRR A;  4RUE A;  1IUR A;  4CZZ A;  3QF7 A;  3APO A;  4JI6 O;  4G2K A;  1Y6X A;  3EXA A;  3GVM A;  1PPJ H;  5IYB O;  1R6K A;  2H8P C;  4Q20 A;  2JS5 A;  3OEH G;  4X65 B;  4O4I B;  1EZJ A;  2QWN B;  4IYH A;  1Y74 B;  1JFF A;  1SQB H;  4FLV A;  3LSS A;  4DR1 O;  3B09 A;  2QTS A;  2YUA A;  1BS3 A;  2YXY A;  3ZCC A;  5EZY A;  3MAQ A;  2UUA O;  5KHI A;  4JZ2 A;  1GMG A;  1IXM A;  1ORQ C;  1KKD A;  4HBN A;  2QTO A;  1IBM O;  5E1A C;  2B1G A;  1SZT A;  4NXM B;  4DK0 A;  1VQL V;  4FLX A;  5IWA O;  4X8A A;  3CPW U;  3UQ8 A;  1XNR B;  4FZ1 A;  2RQ6 A;  2FKX A;  1WB7 A;  1L1F A;  3AG1 C;  4MSW C;  5EC1 C;  1YJN V;  3H1L H;  1SQG A;  1NBM G;  1XL6 A;  3F5T A;  4DR7 B;  3T4Z A;  4QE9 A;  1NTZ H;  1NTK H;  3LDD A;  3F7V C;  1QR8 A;  2H94 A;  5L3G A;  2FYU H;  1N33 O;  3ZRV A;  2RJZ A;  1WNS A;  4DR2 B;  1XQ8 A;  1GK9 A;  2QWR B;  4ZKI A;  1Q86 W;  4PA4 A;  3APQ A;  3WG7 C;  4DUY B;  3CME V;  5J2U B;  1CPY A;  3U0Z A;  4TWK A;  5CA1 B;  3HKB B;  2RNB A;  4JI8 B;  1QU7 A;  2UXC O;  1JQ0 A;  3EVK A;  2LW7 A;  1I0H A;  4FK5 C;  4YJ2 B;  4CS3 A;  4DR6 B;  1R3I C;  3ABL B;  5EYP A;  4TUY A;  3SJB C;  4MTG A;  1H8E G;  4X64 O;  4P30 A;  3UT5 A;  3T2M A;  3K04 A;  4PA3 A;  3ZHT A;  4B7E A;  3KCX A;  2YEV A;  2YI8 A;  2PGG A;  1OCZ C;  2CE4 A;  4JI3 B;  5JJJ B;  2QKS A;  1HNZ O;  1NVP B;  1GAX A;  4JI4 O;  4MVQ A;  3RW0 A;  4LCU C;  2CGO A;  2IU3 A;  1UJW B;  1JOY A;  1WA8 B;  3SYO A;  1BHA A;  3FKS G;  3DC5 A;  1GN3 A;  4UCR A;  1V55 C;  1S5L Z;  3WG7 B;  2R9A A;  5IT9 N;  1FJG O;  4CS4 A;  5FPO A;  3K3W A;  3PJS K;  3L75 H;  3AG4 C;  1F23 A;  4BW9 A;  1BZK A;  1K9M W;  5GW7 A;  2F23 A;  4GT1 A;  5D5Q A;  2Z0A A;  3CS5 A;  2EBO A;  3E86 A;  5LXT A;  2LFR A;  5CBF A;  4YHH O;  1NJI W;  1IBL B;  3KCY A;  3TJT A;  2IJI A;  4DXW A;  4WBN B;  4H33 A;  3B2E E;  1VIB A;  4I50 B;  4U3F H;  4ZOL B;  1E79 G;  4JYC A;  2B5U A;  1ROP A;  1N0J A;  1OCZ B;  4MTX A;  2A7W A;  4LF4 O;  2F4V B;  1NTM H;  1CP9 A;  4DR3 O;  3QO5 A;  3DGE A;  1YIJ V;  4I4T A;  3SR2 C;  5L3F A;  3CXH F;  5IE9 A;  5KUK A;  3W7S A;  4DRX B;  3C3T A;  2JJ1 G;  1BE3 H;  4UVA A;  3RYC A;  5JVD B;  1Q3E A;  3IJ4 A;  3RYF B;  1NT2 B;  1PL4 A;  3JAT B;  3AG4 B;  4B3T B;  1BQZ A;  2YXL A;  5JQG B;  5KLV H;  4WFA V;  1G1X B;  3H1H H;  2DWE C;  2CTR A;  4OX9 O;  4QGP A;  4I9Q A;  1VQK V;  3N2G A;  4JTC B;  4TV8 B;  4ZHQ A;  1TVK B;  1N36 O;  2Y48 A;  5CB4 B;  4P9P A;  4MVU A;  4CS2 A;  3A0H Z;  1JJ2 U;  3K57 A;  2E3C A;  4C7U A;  2ZT9 B;  3K5O A;  4GKJ B;  1QVF U;  1PD3 A;  1SQF A;  5BZB A;  1QLE C;  1KC8 W;  2KB1 A;  1GH6 A;  1WB8 A;  1WP8 A;  2XT9 A;  4N21 A;  2P6J A;  2KG7 B;  1Y76 A;  5IJ9 A;  2PYJ A;  3C3S A;  1K34 A;  1OCO C;  1NI8 A;  3AG3 B;  3CXC U;  2PI5 A;  2BSK B;  1FXK A;  4DV1 B;  1FAF A;  3X2Q B;  4FM0 A;  1TUE B;  5JH7 B;  5B5E Z;  2WLJ A;  5KAF Z;  1X4T A;  2GTS A;  3OTF A;  3LSQ A;  2UXD O;  4IHJ A;  4UV9 A;  3R66 A;  2ZM6 O;  2WSS G;  2JIZ G;  2XAF A;  4YIO A;  4NTY A;  3FYE B;  2WLN A;  2HLD G;  2ZE8 A;  2WAM A;  3ETG A;  3CRM A;  3W7U A;  2CK3 G;  3E8H A;  3HKD A;  2R70 A;  1BQ0 A;  2WA4 A;  4EKW A;  1QLE B;  2Q9L A;  5H5N A;  1R3L C;  4B3R O;  2GDS A;  3A8T A;  4JI6 B;  1ZTE A;  3E83 A;  2N04 A;  3HKE B;  1OCO B;  1OCR C;  4TSF G;  2PY5 A;  3RGB A;  3HPL C;  4EEQ A;  4FLZ A;  2DMX A;  1Q7Y W;  5IYC O;  2ZDI A;  3T1Y O;  1XNQ O;  1AJP A;  4DR1 B;  1JX9 A;  1GM9 A;  1AJQ A;  5HFM A;  3ZRW A;  4DO2 A;  2UUA B;  3SYQ A;  4HYO A;  4PHZ A;  4NTW A;  1S77 D;  4X89 A;  3QG5 A;  1JFF B;  4FPP A;  3SJA C;  2AHY A;  4CH6 A;  1E1R G;  1IBM B;  2P5O A;  4K8X A;  3GB7 C;  5EZY B;  5IWA B;  1A32 A;  3B8N A;  2EIJ C;  2L35 A;  2OIG A;  1SQV H;  2HEP A;  1LUV A;  5LA6 B;  3J7A U;  3FD9 A;  3G71 V;  4JI0 O;  4HZ3 A;  1YXB A;  4RQF A;  2UUB O;  3BA8 A;  3S3X A;  1OCR B;  1N33 B;  5ITZ A;  1JCH A;  3DSQ A;  3LDE A;  1SKV A;  1R3K C;  4LFA O;  5LP6 C;  5LHH A;  1EN4 A;  1TGO A;  5H2F Z;  4K35 A;  3ETD A;  4EB6 A;  2UXC B;  2QM8 A;  4KL1 A;  3HB3 B;  3DC6 A;  1KQS U;  1H2L A;  2XAH A;  1QR9 A;  4TOI A;  4PA9 A;  4CH5 A;  2EIJ B;  1SA0 A;  3ZHV A;  1WAZ A;  5DEC A;  1I7F A;  2RCV A;  5L3C A;  3RT3 C;  4X64 B;  4DV0 O;  1RPO A;  2PYL A;  1QQC A;  5FL7 G;  5EYP B;  1EM1 A;  5JJE B;  4JI1 O;  1HNZ B;  1ZSP A;  1EZV H;  4GLX A;  4JI4 B;  2HJF C;  1F4M A;  3W7T A;  5J2T A;  4K0K O;  5KHG A;  2YEV B;  1SRY A;  1QNM A;  1NH2 D;  1J95 A;  2RDC A;  3K08 A;  5BY1 A;  4RWU A;  1FJG B;  1SES A;  1IDS A;  1W2B U;  4TQD A;  2GSM B;  2W6J G;  3JSN A;  3BFR A;  4U3J B;  5C8Y A;  3MD0 A;  3GWK C;  2QM4 A;  4LF7 O;  4JYY A;  4GX1 A;  1PKX A;  4YHH B;  2DE0 X;  3K03 A;  3D8C A;  5F2V O;  1AR4 A;  3G67 A;  3ZMZ A;  2QDO A;  4G28 B;  1R73 A;  5KMG B;  3CRC A;  4IYI A;  4H13 B;  3CMA V;  4X88 A;  5H6R A;  3A0R A;  3R65 A;  4LF4 B;  4TQF A;  4XDJ A;  1QBZ A;  4F6R A;  3JSL A;  3CP1 A;  4DR3 B;  2Q0O C;  4P9O A;  2M7W A;  2KKW A;  1M90 W;  3JAW A;  2HR3 A;  3UO2 A;  2F93 B;  3SPH A;  1FFX A;  3JAR A;  4I4T B;  5BXZ A;  1SET A;  2EZP A;  2Y0P A;  3BVO A;  4R50 A;  3K58 A;  1ZX3 A;  4UFZ A;  2HG5 C;  4RAI A;  5D5P A;  3RYC B;  2EIL C;  1KP3 A;  2ZQM A;  2Y69 B;  3AG7 A;  3JD1 A;  3SPJ A;  4OX9 B;  4B08 A;  3VOU A;  5EBW C;  3HKC B;  1BT8 A;  1B3Q A;  4UUJ C;  3CSX A;  4OPH A;  2LW1 A;  2ATK C;  3H1I H;  1N36 B;  5DN6 G;  1F51 A;  1K3E A;  1F4N A;  4ZHQ B;  2UU9 O;  3UKM A;  3LDC A;  1QHT A;  1VF5 B;  3L73 H;  3ML0 A;  3CCV V;  5LMN B;  1YIT V;  4RQE A;  5IJ0 A;  3AK3 A;  2A9H A;  4X1K A;  3P3P A;  2F66 C;  1PP9 H;  1YCI A;  1ZL8 B;  5LHG A;  5EIB C;  1R6N A;  5B1O A;  3DXR A;  1YDX A;  4PDM A;  3JCU Z;  3JAS A;  1XIL A;  3OFN G;  4J7K A;  2XTA A;  4HNA A;  4LF6 O;  5IJ9 B;  1RPR A;  4PI0 A;  3BA9 A;  4PV1 B;  5LOV A;  1AI4 A;  4BR6 A;  2EIL B;  2UXD B;  1PL0 A;  2ZM6 B;  4O4J A;  3FFQ A;  3JAL A;  2P4V A;  3WB1 A;  2E5L O;  3SPI A;  1PNK A;  1O9G A;  1NVP D;  5JWP A;  5KX5 B;  1FYJ A;  5LHI A;  1S72 V;  1B04 A;  4O4L B;  3ABL C;  3SYP A;  2FML A;  4LF8 O;  4XDL A;  2Z5U A;  1Q6U A;  5B1A C;  4U7O A;  1KUQ A;  4FFB B;  1LNQ A;  1JVM A;  4PA7 A;  3RYI A;  4JI5 O;  3CCR V;  4GX2 A;  2Z3Y A;  3CYO A;  4B3S O;  1URF A;  4IT5 A;  4B3R B;  1YJW V;  5LGU A;  1PNL A;  4GX5 A;  4LNU A;  1HDJ A;  4YXW G;  1KMI Z;  1R3J C;  3HKD B;  4FLT A;  3FB8 C;  1FS0 G;  4X20 B;  4Z1V A;  4PDV A;  4UVC A;  4Z1M G;  3E22 A;  4H0L B;  2JGD B;  3K0G A;  2ODM A;  2P06 A;  3ZHS A;  1KU9 A;  4WCE V;  3T1Y B;  1XNQ B;  3OMN B;  2E75 B;  1I08 A;  3S3W A;  1NKD A;  3RN4 A;  2YIB D;  4P2Z A;  1IX9 A;  1QVG U;  3H1K H;  4ZI7 B;  4X1I A;  2YS8 A;  4MVZ A;  3TGU H;  1YVW A;  4L8J A;  3E2E A;  5B1A B;  2YIA A;  3CB2 A;  3QTC A;  3ZED A;  3E8B A;  1VQM V;  4J10 A;  2YXH A;  1S0V A;  2WLL A;  4JI0 B;  2JEU A;  1CEZ A;  5B1N A;  4MTO A;  1COW G;  2UUB B;  3MHH C;  4NYK A;  5LGT A;  1P84 F;  4J9Z B;  4JYA O;  5A2Q N;  3UCS C;  1XMQ O;  3ZMS A;  4LR3 A;  1M9N A;  3WU2 Z;  5CA0 B;  1FXV A;  1GRJ A;  4R6Z A;  4LFA B;  5BMV B;  1VQ4 V;  2X6A A;  1KKC A;  1AI6 A;  2ZNI A;  4NXN O;  1SQP H;  3Q4H B;  5CA3 A;  2IU0 A;  4O2B B;  5KHK A;  3RWR D;  4LP8 A;  2DYS C;  1OHH G;  2DN9 A;  3CWB H;  1ARO P;  3ABT A;  1FKA O;  4Q6G A;  1YJ9 V;  1VQP V;  4KXR A;  2Q69 A;  3CX5 F;  1ZWI C;  3OD4 A;  3STZ C;  1PV0 A;  3CCQ V;  3ASO C;  4DV0 B;  1L0L H;  1VEW A;  1P49 A;  1Z2G A;  2EX3 A;  1D5N A;  3J80 N;  1K92 A;  5JCO C;  3KKY A;  1RSO A;  5LYJ B;  1SA0 B;  3K06 A;  3K9A A;  4JI1 B;  1P7B A;  1SC5 B;  1HR0 O;  2Q7G A;  3B77 A;  4DR4 O;  2CDY A;  4K0K B;  2IBZ H;  2XOK G;  1WPX A;  2P22 C;  3E35 A;  4BW5 A;  4D7S A;  4DV3 O;  2EIN B;  3D3Q A;  4LFC O;  2R72 A;  4DUZ O;  3AG3 C;  2HHH O;  2A3Q A;  3FAV A;  3OTO O;  5GTI Z;  2LGQ A;  3L9D A;  1EBO A;  2HP8 A;  3X2Q C;  1TUB B;  1GM8 A;  1LR1 A;  5DM6 V;  2XHB A;  2DYS B;  1WN7 A;  4WFE A;  1PNM A;  4DW0 A;  2GUZ B;  3RVY A;  3OGC C;  2AHZ A;  4LF7 B;  4R8C A;  4JPR A;  1JR9 A;  3SJC C;  4X66 O;  1FFT B;  1SS3 A;  4AQY O;  1JA8 A;  4CC5 A;  3CEI A;  2WLI B;  2LP7 A;  3JAK B;  3CC7 V;  3ASO B;  4GUN A;  4MVR A;  4IIJ A;  1HNX O;  3ICX A;  3A0B Z;  5EBM C;  2LQT A;  3D36 A;  3VBB A;  5CMU A;  4I7Z B;  2IM9 A;  1S3J A;  4LFB O;  3IAY A;  1W0J G;  4RO2 A;  2ITC C;  1TAE A;  2V4D A;  3OW2 U;  4J42 A;  5TIS Z;  3L72 H;  5IYZ A;  1NQT A; 
#chains in the Genus database with same CATH homology
 4DW0 A;  4DW1 A;  3H9V A;  3I5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...