4DW1A

Crystal structure of the atp-gated p2x4 ion channel in the atp-bound, open state at 2.8 angstroms
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
324
structure length
324
Chain Sequence
RFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P2X purinoceptor
publication title Molecular mechanism of ATP binding and ion channel activation in P2X receptors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein
total genus 80
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2012-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 4dw1A01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 4dw1A02
3I5DA 4DW0A 4DW1A 3H9VA
chains in the Genus database with same CATH superfamily
3RW0A 1OCCC 4YIOA 1BZKA 3I55V 2BTOA 1YI2V 2FTKA 1MSDA 2WLIA 1VQ8V 3JAKB 2M6YA 1I0HA 5LOVB 1MG1A 5IWAB 4DV0B 5EBWC 2F1MA 3OFNG 4PJ0Z 4LH6A 1E79G 1XREA 5B3SC 2UXDO 3JALB 4X64O 3QO7A 4W4KA 3P32A 2JGDB 1MOFA 1G6UA 3S3XA 1N36B 3MHSC 2UUAB 2HJDA 4H0LB 2V4DA 2R9AA 2CUGA 4UV9A 3K5NA 1PP9H 1Q43A 1GN4A 2WLJA 3JATA 3L72H 5B1BB 2H8PC 4AQYB 1N33O 2A7WA 4JV5O 3MHHC 1M9NA 3ETQA 1B3QA 4DV5O 1NZ6A 3BFRA 3HKDA 3SR2C 1YTFB 2PUSA 4IYHA 2IJKA 5H6RA 2G38A 2GDSA 2BTQA 2Y0PA 2VQFB 3T1YB 3K5OA 3M99B 2AGAA 1ZAUA 5FPOA 4PDMA 1WB7A 3DC6A 2Q7HA 5K1XA 1IZ3A 5A2QN 2KG7B 2EINC 1Y6XA 4BR6A 1IURA 3ETDA 3CS5A 3CRAA 5LP6C 4XDJA 5JCOA 1Y67A 1KKCA 1DK1A 2OIGA 3GWKC 1TGOA 1M4UA 5FLXN 5L3CA 2PYLA 1Q82W 1FFTB 1PL4A 3ZEDA 3B4SA 2IU3A 4PA6A 1L0LH 2Q0AA 3ZX6A 2HKOA 3VQWA 3LNMB 2P6JA 4JI6O 1VQ7V 4HZ3A 5IYZB 1Y76B 3FFQA 3SJQC 1R3LC 3CP1A 3FB8C 4LNUB 1EN4A 5FNVA 1SQGA 3SPHA 4AI8A 1HR0O 1SZXA 1GKFA 3F7YC 3IAYA 3OR7C 3ZRVA 4AILC 2WLHA 4RQFA 1FS0G 4DV2O 3QO8A 5L3GA 3CC7V 4I0XB 4R6ZA 1RSOB 4I50A 4ZI7A 4DUYO 3U0ZA 3N2KB 2QJ1A 1Q3EA 2YI8A 1NI8A 3BABA 3TGUH 2YUAA 3ZHVA 1DF4A 3K9SA 3KZIZ 3C3TA 4DV3O 4X88A 5J2TB 4FIPC 1N34O 3D8CA 2WPDG 1VARA 4JYBA 4U3JB 5LYJB 3TCUA 1KECA 4DO2A 3CCJV 2F4VO 1H2LA 4IIJB 1HNZB 1JJOA 4A5UB 5LGNA 4BIOA 1WNSA 3OMIB 3F5TA 4NYKA 4DR3O 4KXRA 2ADQB 3T1HO 1THZA 1QCEA 1XMOO 3BY6A 1PM9A 1LUWA 4MVRA 3H9VA 4P30A 5LMUB 1V9PA 4LF8O 3OTFA 4ZHQA 1YHQV 3E8HA 1TUBA 2ITCC 2ZIOA 4UXNA 4G27B 1OHHG 1KQSU 2VWJA 3P3PA 2DYSB 2R9RB 2CTPA 1Y74B 1XMQB 2Q8VA 3WG7B 4NTWA 3A8TA 4WFAV 2YXLA 1BHAA 3W7SA 2OWOA 4GLXA 1SQPH 1SQXH 3IJ4A 2ARHA 3UQ8A 4LCUC 5C93A 2BOBC 3HKBA 3APOA 2Y0IA 4LF7B 1TVKB 2ZNJA 2FB5A 4F4LA 3ZRWA 4JI1O 3R66A 5LP6A 3OMNB 3JCUZ 4ZIBA 2PY5A 4H13B 5B1AB 4JZGA 1WAZA 4J9ZB 5IY5C 1YJ9V 1I5XA 3H1KH 4FLWA 4MTOA 1HDJA 3JAWA 3ZS8C 1ZWIC 1YITV 1FPOA 2OTJV 5JQGB 2DYRC 1PL0A 1WN7A 2E5LB 4EKWA 3SPGA 2UXBB 1NU1H 4ASUG 5CA0B 1BL8A 1N4CA 2OYQA 1P49A 3UT5B 4DV7O 4GCZA 5LXTB 3SGIA 2A3QA 2Q73A 4CBCA 2DE0X 1FKAO 2R72A 2QKAA 3CCLV 5LMNO 3K3WA 3NR7A 5EZYA 3AG4C 2QTOA 5H5NA 2LP7A 3SJCC 2Q0OC 1H8EG 2A9HA 2JGUA 1AI6A 1E1RG 3M7MX 2RCVA 2VQEO 1IBMO 3GVMA 1JCHA 2AHYA 3MDSA 1S77D 1N8RW 2P4KA 4QIWF 1JR9A 5C8YB 3L70H 1NTZH 4UVAA 4CZZA 1PPJH 3EFFK 2L6LA 5CA1A 5LGTA 5GTIZ 1GK9A 1F7YA 2LGQA 3BA8A 4JTAB 4XDKA 2UXDB 1LUVA 4DK0A 4E2LA 4X64B 2JIZG 3BA9A 3RYCB 2Q9LA 4JI5O 1TA8A 1GAXA 2UU9B 3T2MA 2W6JG 4CH4A 3JASB 2QWNB 1J95A 2OCHA 2UUCO 2Y4UA 3AK2A 1XILA 1M56B 3G67A 2YEVA 5IJ9A 4JV5B 2QM8A 2CTRA 4QE7A 5HFLA 4LC1A 1CPYA 5JH7B 4I9WA 2Y4TA 1S5LZ 4DR5O 2DJVA 3ABMB 2OTLV 5DEDA 2NLJC 4CS3A 5J2UA 4IL6Z 3AK1A 2QTSA 2X6BA 2KQXA 4IHJB 1JQ0A 4YJ3A 4QGPA 1AR5A 4O2AB 1JX9A 2R70A 1KD1W 4RAIA 2B1GA 4FFBB 3OM3B 3A0BZ 2LGWA 1IX9A 1J5EO 5ITZA 4LF9O 4J7ZA 3BAAA 2Y69C 1VF5B 3X2QC 4IGGA 2QGNA 1VQLV 4J11A 3OW2U 2LFSA 1M1KW 3W7WA 4JI6B 1QR9A 4PDRA 3B8MA 2YXYA 1NVPD 4QJFB 4KL1A 3STLC 4DR1O 4H44B 3RYHB 4PI2A 3RVYA 1AJQA 2CH7B 2V1DA 5KX5A 1FXKC 4BW9A 1HR0B 4DW1A 2EZOA 3CPWU 2ATKC 4Q6GA 3THOA 3JD2A 2V7QG 2PTMA 3H1HH 4DUYB 3JATB 4KUMA 3H1LH 4ZKIA 4PELA 5LHGA 1B04A 4DR7O 3ABTA 3K59A 3HKDB 1EBOA 3TETA 4PA9A 1IXBA 2XHBA 4G28B 4OPAA 5CA3A 1URFA 1N34B 2UXCO 1FJGO 2F4VB 4X20B 2GHYA 1K8AW 1YCIA 3TXQA 3RBZA 2CAZC 3SJBC 3OUFA 4O4JA 4CH5A 4DR3B 3P30A 3ZHUA 4CC5A 4LFCO 1V54C 3T1HB 1AP6A 1NJIW 3OT7A 2JVDA 1XMOB 4JI7O 3HKCB 3ETEA 1D5NA 4TT3G 1OCOB 4LF8B 2HG5C 3U11A 1P7BA 3SDLA 4MSWC 1GO3F 2ETNA 4DV6O 4I9QA 3B09A 3SYCA 4JF3A 1ZL8A 4YY3O 3LSQA 4JZ2A 1SESA 1GM7A 3T4ZA 4NTYA 3D36C 1NQTA 5LBQA 1OV9A 4P9OA 5FNVB 1CEZA 3IGAC 3WU2Z 2ZE5A 2WLLA 3FYIB 2CGOA 3LDEA 4JI1B 2EJRA 2M7WA 1XBLA 4O4LB 1HP8A 4O2BB 3ZHRA 4FFKA 4B7EA 4P9PA 2XAHA 3CC4V 1DGSA 2QWRB 4TQFA 4ZI7B 4JI0O 1VQ6V 4Z1VA 4I4TA 4ABMA 1AB3A 4K3AA 5B66Z 3E8BA 1YTFD 3QF7A 4WFHA 3ML0A 4JTCB 2ZT9B 4DW0A 4OGQB 4U3FH 3BHPA 3ABLC 4TSFG 2RN9A 4TV8A 2JJ1G 4MS2A 3G4SV 4X1YA 4DV7B 3L74H 1RM1B 1GM9A 1M57C 4X65O 2QWPB 3RYIA 3JSLA 3ABUA 2XNDG 1F4NA 3K0GA 5LMNB 5B1BC 4U7NA 4X8AA 2DWDC 4GKJO 1MMMA 5KHGA 1Z2GA 4BIUA 3JYCA 2X6CA 1FFXA 2CDYA 2VQEB 1IVSA 4GKKO 1WA8A 4C7UA 1AROP 4LWSB 2JS3A 3K0DA 1Q6IA 4NB5A 2UXXA 5DN6G 1A32A 2GUZB 4G2KA 1TAEA 2E75B 5D5QA 5EBLC 3E83A 4MTFA 5LA6A 2DWEC 2P90A 1Q81W 4YHHO 5L3EA 1F4MA 1VQ9V 5CB4A 1IDSA 2WLNA 3MAQA 5KUKA 5JJJB 3SYOA 5KHJA 1KBHA 1S5HC 4TV9A 4FZ1A 1GTOA 1QVFU 4JI5B 5BMVB 2N74A 2YIBD 5EBMC 4KHPO 1VEWA 2ZE7A 3B77A 1L0NH 1VF6C 4HNAA 2Q7EA 4J10A 4EB6A 4HBNA 2P4VA 4J42A 4PHZA 3ZMZA 2IJJA 3JAWB 1P84F 3ZBHA 3CRQA 1BS3A 2F66C 4DR5B 3CMEV 4K0KB 2HP8A 3ASNB 4UCTA 5IDJA 5JJNB 1ZTEA 2XASA 1UPGA 4L87A 1K73W 1ZX3A 3UKMA 4NXMO 3HKEA 5KAFZ 4B3TO 1S76D 5EZYB 1D2DA 4FLUA 5BR8O 1ZSPA 2NNUA 2WLKA 1XQ8A 1J5EB 4LF9B 2OCCB 4YJ2A 2QDOA 1MZEA 4WFEA 2PYJA 3HR0A 4UUJC 2ZE6A 2LQTA 4MVZA 5IYBO 3VOUA 1N0NA 4LF5O 3CRRA 4PA7A 2KSDA 3QO5A 3APQA 3DTUB 4DR6O 3J81N 1SQVH 4JYAO 2JEXA 4RO2A 1GN3A 5JWPA 5CA1B 2X7RB 1WP7A 3BCCH 5EYPA 3CCUV 4FLTA 4F6RA 1VQMV 2QWQB 3OD4A 4UCVA 1JFFB 2RNBA 1HW7A 3WB2A 3D3QA 4QPKA 4QE9A 2DQ0A 2IJHA 2P67A 3MD0A 4JGSA 2MK3A 3K03A 4DXWA 2HHHO 4DV1O 5IJ9B 2ZDIC 2DYSC 4GX1A 4CS2A 4FM2A 4DR7B 1EZVH 5A9GA 1KP2A 3AG7A 3WG7C 5K1PA 1K92A 3ASOB 2JS5A 4WFBV 3RGBA 5DECA 2UXCB 4W4LA 3A2FA 1FJGB 4X66O 3E2EA 1PKXA 1DF5A 2YIDA 1Q86W 3RT3C 4JI2O 1R3KC 3CXCU 5IYDO 2KG7A 3WFVA 3KCXA 1AVMA 3CWBH 4WFGA 4JAUA 4YJ3B 4KFMA 3GB7C 2X0LA 1GM8A 4B7KA 1NR1A 3AG1C 3BRCA 3N27A 2F95B 2IH3C 3E22B 1M93A 3DSQA 1XNQO 1AP5A 1F51A 4TWKA 4JI7B 3A0HZ 1XI1A 4JYYA 3CCEV 4DRXA 1Q90D 1M5IA 1R6NA 1NH2B 3HPLC 2GV9A 1I94O 5TISZ 3OE7G 4FZ0A 1OCZB 1ZLZA 4PI0A 5IYZA 1Y76A 4DV6B 5IWAO 4DV0O 4B3RO 5GONB 3ZIAG 3JARB 2HR3A 4IT5A 2DQ3A 5JVDB 1VQ4V 1FXHA 4YY3B 3PJSK 3TJTA 2ZXWB 2P22C 3CEIA 1NKDA 2ZNIA 1S72V 1XEQA 2QA4V 3ZMSA 1KB9F 2HEPA 4WBNB 3W7XA 3ZRSA 2YIBA 2MW2B 3EXAA 3JD3A 2EIKB 2XAFA 3STZC 1N36O 3WB0A 3WB1A 4D7SA 2IW5A 4RWUA 2W0XA 5DM6V 5IJ0A 1GRJA 3O9OA 4FLXA 3N2KA 3IC7A 2WAMA 2W6IG 4PDLA 4JI8O 3AG3B 4ZBMA 3CX5F 4P2ZA 2QR4A 2DW4A 4R8CA 3JAMN 1AI4A 4LF6O 2AZ0A 4ZOLB 2EIMB 3H01A 3OUSA 5J2TA 3NXSA 3CXHF 2VQFO 1Q6HA 1SETA 5H6QA 1BGYH 4X1KB 4JAAA 3L71H 5LYJA 4PV1B 2IU0A 4GZRB 1KUQA 3OAAG 2NN4A 1X59A 2JEUA 2Q4PA 2GTSA 4LFAO 1XDCA 1SA0B 2XTAA 4OX9O 3E89A 4X65B 3ZN1A 1Y66A 4XBFA 3UO2A 2ADPA 2EULA 2XAQA 4O4JB 1N33B 3G80A 1OCRC 1ENVA 1V55C 1M56C 4GKJB 3VBBA 4BWAA 1NTMH 1K3EA 2XAJA 4PDVA 4DV5B 3CRCA 3G6EV 3OEEG 4L8JA 4JPRA 3K5LA 4GKKB 2EIJB 4K8ZA 4J80A 4BAYA 3ABMC 1SQQH 4RUFA 5KHIA 1Y74A 3T1CA 2YS8A 3ICXA 1JMKC 1VP7A 4MVQA 2X6AA 4D6TH 4YHHB 1YEWA 2RJZA 4OXSA 2DN9A 4DK1A 4QPJA 1H2KA 2A79B 1L1FA 2ZINA 4HAMA 1TVKA 2ZD9A 5AG2A 1HWYA 5KMGB 2E74B 4UB6Z 2QE7G 1MA1A 1YVWA 3CJHB 4IYIA 1YJWV 2Q69A 3S3WA 2XAGA 2WLLB 1XNRO 1HNXO 3B8NA 4X1IA 2B1IA 3C3SA 2YICA 2YI9A 4MTXA 2EZPA 2FL4A 1EM1A 3SYQA 2WLIB 2HVKC 1EFRG 1QLEB 2H3OA 3JD0A 2E76B 4DR4O 4I4TB 2N04A 5KA6A 1P7GA 2Y69B 3K08A 5JQGA 1HNWO 3CCVV 4U7OA 2Q5ZA 2EJ7A 3H1JH 1MABG 3UT5A 1I7FA 2Q68A 2QM4A 1SF9A 4TV8B 5LXTA 1IXMA 2DMXA 4UB8Z 3BEHA 4QNHB 4DV2B 2C2AA 5KHHA 4JI3O 1B06A 2EILC 4BIZA 3RYIB 2AXTZ 1YSCA 4NXMB 4FMTA 4B3TB 5KAIZ 2ZIMA 1NTKH 2AHZA 2LW7A 4Z1MG 1KP3A 3UCSC 1VQOV 4DV3B 1FFXB 3QTCA 1WA8B 3ZHQA 3G71V 2BTQB 4I7ZB 2OT5A 1KKDA 5CBHA 2HFEC 1XHZA 1AR1B 4JASA 3RYFA 1W0KG 4LR3A 2NR5A 2XOKG 2ZR2A 4DR6B 1ZUQA 4N23A 5H9CA 2WA4A 4LFBO 4B08A 4O4HA 4JYAB 2WA3A 3KCYA 1Z5WA 4LF7O 1FYJA 2D3OW 1WLEA 1CP9A 4X9QA 5JCOC 3H1IH 3QVNA 4H37A 3AG2B 4TV9B 1QVGU 3LNNA 3ABKC 4J7JA 1OCOC 1MZFA 3JASA 4BW5A 4WFFA 2UUBO 1SQBH 2EX3A 5B5EZ 4HNAB 4LF4O 2HHHB 1JA8A 3FAVA 2VWKA 3Q4HA 4DV1B 5JJEB 3HB3B 4NXNO 3K06A 4XDLA 2GSMB 1CXZB 4Z2WA 1H8HG 1N32O 2RDCA 1PNMA 3QG5A 4DYLA 1GN2A 3CHXA 2Z5UA 4EFEA 1DTOA 2XT9A 2YIAA 3SYAA 4X66B 3FB5C 4IHJA 2KB1A 5HFMA 2PI4A 3R65A 3ZMUA 2HVJC 2O57A 4I50B 3GWOA 2K1EA 5IT9N 1L8DA 4FPPA 1XNQB 2EBOA 1OCCB 4GYCB 4I55A 4O4IA 2AZ2A 2Z3YA 4J9YB 3EVKA 1K5QA 1I08A 4YJ2B 5KHKA 2A06H 1G1XB 1H2MA 5J9PC 2JDIG 3ZMVA 1I94B 2XUMA 4B3RB 1JVMA 1RM1C 3CYOA 3K79A 3SJAC 1AI5A 3RYHA 5IE9A 5B3SB 2WLMA 3ABLB 3QNEA 2CH7A 1FXKA 5GW7A 3J7AU 2IBZH 3AK3A 5EYPB 1IBLO 4CC6A 4N21A 4F6RB 3JD4A 2UU9O 4UCSA 4RQEA 1US6A 1M57B 4FLZA 3B2EE 1IBMB 2FYUH 4ZHQB 1WPBA 1TUBB 3CMAV 2VS0A 4JI8B 1MNGA 4K8XA 3K58A 4MVOA 4FM0A 4LF6B 4GT1A 2FKXA 1IBKO 1QLNA 1NR7A 2ILMA 5CN0A 3CRMA 3HKBB 3DXRA 4X20A 3VQYA 1XL6A 3A0RA 5KLVH 2UXNA 5LHIA 3F5WC 2EINB 3ZRWB 1ROPA 2YC0A 2JK5C 4LFAB 1K4DC 3I5DA 3K5MA 2Q7GA 2W0FC 2BSKA 1G8MA 5LP6B 2ZM6O 1BQZA 4OX9B 2VRZA 2CGNA 2F23A 2UUCB 3TK1A 1RP3B 1KC8W 3OTOO 2B5UA 4FK5C 1X4TA 3HKCA 1GN6A 5LL6Y 5D5PA 4B3SO 2PI5A 1K33A 3IFXA 1QQCA 3ZN0A 3ZHTA 1OJHA 3FB6C 4TUYA 4DRXB 1SS3A 1SERA 3FB7C 4DR2O 2YXHA 1XUQA 2RQ6A 1VQNV 3ASNC 3P3NA 4NR1A 3D36A 2CK3G 4X62O 4DUZO 1S0VA 1VQPV 3L9DA 1VF7A 3N2GA 4UVCA 1M90W 5CBFA 1EZJA 1BCCH 1K97A 2P06A 4JI4O 1BMFG 4UV8A 4DV4O 4O4LA 4B3MO 5EC2C 3LDDA 4O2BA 1XNRB 2OCCC 1D5AA 3KG2A 1HNXB 1XL4A 5IJ0B 2GBOA 1KYOF 3JAKA 3FKSG 1PNLA 3BVOA 3U10A 4RUEA 3OMAB 5LOVA 4DR4B 2N05A 3IC9A 5FPRA 4FJCC 4ICGA 4DR1B 5B1NA 1WP8A 5F2VO 3DGEA 1HNWB 3JALA 5EIBD 3C90A 3JSNA 2QEXV 3BPZA 2JGDA 4MVMA 1FD9A 2PF4E 5EC1C 3CC2V 2F43G 1OZ0A 1U96A 3RWRD 4JI3B 2RMKB 1R73A 3VQVA 1SKVA 4YIPA 2YEVB 2L35A 1O9GA 2Q67A 1COWG 2IJIA 5BY1A 4LWSA 1W0JG 1MSWD 1K7DA 1RPRA 1S3JA 3ASOC 5L3FA 4E4EA 1NH2D 3CE2A 2GUZA 5EIBC 3LSUA 1QU7A 2LW1A 3E8GA 2QSAA 1SQFA 1XOUA 3VQXA 4UCOA 1BQ0A 5J2UB 5L3BA 1AJPA 1QHTA 2B9ZA 3UO3A 4UCUA 2KKWA 4J7KA 4WF9V 4LFBB 1Z5VA 4GX5A 1R3IC 3D3IA 2PGGA 3OGIB 1TUEB 5B1AC 1BE3H 4LFCB 4UVBA 5BMVA 1RPOA 5ITZB 4FLVA 5IYCO 1WB8A 1VF6A 4PA4A 3SPIA 2UUBB 3AG1B 5IY5B 4X1IB 3K9AA 3CSXA 2LO1A 1Y4MA 2Y48A 2JJ2G 2QKSA 3JD1A 4LF4B 3O65A 2BCCH 3EHBB 4J41A 4NXNB 1OCZC 2DYRB 4AHCA 3J80N 1R1BA 1N32B 4LNUA 1YF2A 4EFBA 3F7VC 3E35A 2YDEA 1R6KA 3RN4A 1KMIZ 5KX5B 2ZXWC 1K34A 1VQ5V 1QNMA 4PA3A 2UUAO 3L75H 4MT8A 4I0XA 1YDXA 1YXBA 2EIKC 4LP8A 1RSOA 3W7TA 2ODMA 3AG4B 4AQYO 5E79Z 3CCRV 4JI0B 2QKCA 5BZBA 3AG3C 1XHXA 2P7TC 3FD9A 1AI7A 2CTQA 2EIMC 3T1YO 4X89A 1LNQA 3PN1A 4U3JA 4IIJA 1WJZA 1P4RA 4KP4A 3T4DA 2Q6AA 3RYFB 1EN5A 1RFYA 5LHHA 1PV0A 1SC5B 4O4HB 3I56V 3FX7A 1R3JC 2AW9A 1Q7YW 5GTHZ 2HJFC 2GTAA 3CCSV 2ITDC 1JFFA 3LDCA 1IBLB 4FM1A 4Q20A 3RVZA 2LJ2A 4NKGB 1ORQC 4MTGA 2EIJC 1OCRB 3KKYA 1V55B 2ZDIA 1VQKV 3FAVB 3Q4HB 4MVUA 1K5SA 1I5YA 1NBMG 4JYCA 3AEIA 1ZL8B 4EEQA 4F6EA 1IBKB 1VMGA 2ZKOA 2QWOB 5L3DA 4K0KO 1YIJV 1QBZA 2QM7A 4MVSA 2Z0AA 2F93B 2OIEA 1Q6UA 4KHPB 4CS4A 1O9HA 2ZM6B 5KA5A 4NVPA 1T5EA 1Q5OA 1S5JA 3E22A 1R6TA 3W7UA 1K9MW 3ZRXA 1GMGA 1PD3A 2BE3A 3OTOB 1JJ2U 3OEHG 1QLEC 2IM9A 1G4YB 4B3SB 4I55B 4O4IB 3FYEB 3X2QB 3LSSA 4OPHA 2WWWA 3ZMTA 2ZCEA 1YJNV 1DLBA 1Q8IA 4FVMA 5CA0A 1NT2B 4GX0A 2YSUB 4DR2B 4HYOA 1HNZO 2ZE8A 5GONA 3JARA 3K57A 5JVDA 4PD4F 4X1YB 3ZJZA 4TQDA 4UCRA 4X62B 1SRYA 2E3CA 3CCMV 5FL7G 1NS1A 5H2FZ 4DUZB 4FLYA 1K4CC 1B6QA 4CH6A 1FXKB 4WBNA 5BXZA 3ZCCA 4TOIA 5BR8B 4JI4B 3K04A 5LMUO 1AILA 1H2GA 4MW8A 4I5SA 4DV4B 2EILB 1F23A 4B3MB 3OR6C 1VIBA 2CTWA 3CCQV 5EK0A 1N0JA 4LF5B 5C8YA 4UFZA 5E1AC 1XMQO 2H94A 5KUMA 4JTDB 5LA6B 4ZOLA 4MW3A 1UJWB 2D2CB 2ZR3A 1EN6A 1NVPB 3SYPA 1W2BU 4D7TA 2FMLA 1H2NA 5CB4B 4X1KA 1GH6A 3UM7A 2ZQMA 1H38A 1KU9A 3SPJA 2WSSG 5CMUA 2LFRA 1H2SB 3RYCA 4WCEV 1YZBA 1BSMA 4K35A 2BOCC 2IH1C 3DXRB 3CD6V 4CH3A 3B40A 3AG2C 1BT8A 4H33A 1SA0A 1BHBA 3SPCA 4R50A 1QR8A 3OGCC 1E1QG 2BSKB 3M8AA 4LBEC 1V54B 4R7CA 3G6BA 4NTXA 3E8FA 1LR1A 5CBGA 4EB6B 3ABKB 5JH7A 3LUTB 1AR4A 3CB2A 1JPXA 4LH7A 2R9IA 1PNKA 3RFRA 1AJNA 1FAFA 2K9PA 2E5LO 2PZSA 3DC5A 2P5OA 4TUYB 2UXBO 2JRIA 5LGUA 1W59A 4GX2A 1JOYA 4JI2B 1SZTA 1UFIA 4O2AA 4GUNA 4YXWG 3TXSA 3ZHSA 2A0LA 4FFBA 4JAVA 2CE4A 3HKEB 5KMGA 1WPXA 3N2GB 1FXVA 3E86A 5B1OA 3CJHA 3ETGA 1U97A 2HLDG 3JCZA 2DOSA 3L73H
chains in the Genus database with same CATH topology
3I5DA 4DW0A 4DW1A 3H9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5D A;  4DW0 A;  4DW1 A;  3H9V A; 
#chains in the Genus database with same CATH topology
 3RW0 A;  1OCC C;  4YIO A;  1BZK A;  3I55 V;  2BTO A;  1YI2 V;  2FTK A;  1MSD A;  2WLI A;  1VQ8 V;  3JAK B;  2M6Y A;  1I0H A;  5LOV B;  1MG1 A;  5IWA B;  4DV0 B;  5EBW C;  2F1M A;  3OFN G;  4PJ0 Z;  4LH6 A;  1E79 G;  1XRE A;  5B3S C;  2UXD O;  3JAL B;  4X64 O;  3QO7 A;  4W4K A;  3P32 A;  2JGD B;  1MOF A;  1G6U A;  3S3X A;  1N36 B;  3MHS C;  2UUA B;  2HJD A;  4H0L B;  2V4D A;  2R9A A;  2CUG A;  4UV9 A;  3K5N A;  1PP9 H;  1Q43 A;  1GN4 A;  2WLJ A;  3JAT A;  3L72 H;  5B1B B;  2H8P C;  4AQY B;  1N33 O;  2A7W A;  4JV5 O;  3MHH C;  1M9N A;  3ETQ A;  1B3Q A;  4DV5 O;  1NZ6 A;  3BFR A;  3HKD A;  3SR2 C;  1YTF B;  2PUS A;  4IYH A;  2IJK A;  5H6R A;  2G38 A;  2GDS A;  2BTQ A;  2Y0P A;  2VQF B;  3T1Y B;  3K5O A;  3M99 B;  2AGA A;  1ZAU A;  5FPO A;  4PDM A;  1WB7 A;  3DC6 A;  2Q7H A;  5K1X A;  1IZ3 A;  5A2Q N;  2KG7 B;  2EIN C;  1Y6X A;  4BR6 A;  1IUR A;  3ETD A;  3CS5 A;  3CRA A;  5LP6 C;  4XDJ A;  5JCO A;  1Y67 A;  1KKC A;  1DK1 A;  2OIG A;  3GWK C;  1TGO A;  1M4U A;  5FLX N;  5L3C A;  2PYL A;  1Q82 W;  1FFT B;  1PL4 A;  3ZED A;  3B4S A;  2IU3 A;  4PA6 A;  1L0L H;  2Q0A A;  3ZX6 A;  2HKO A;  3VQW A;  3LNM B;  2P6J A;  4JI6 O;  1VQ7 V;  4HZ3 A;  5IYZ B;  1Y76 B;  3FFQ A;  3SJQ C;  1R3L C;  3CP1 A;  3FB8 C;  4LNU B;  1EN4 A;  5FNV A;  1SQG A;  3SPH A;  4AI8 A;  1HR0 O;  1SZX A;  1GKF A;  3F7Y C;  3IAY A;  3OR7 C;  3ZRV A;  4AIL C;  2WLH A;  4RQF A;  1FS0 G;  4DV2 O;  3QO8 A;  5L3G A;  3CC7 V;  4I0X B;  4R6Z A;  1RSO B;  4I50 A;  4ZI7 A;  4DUY O;  3U0Z A;  3N2K B;  2QJ1 A;  1Q3E A;  2YI8 A;  1NI8 A;  3BAB A;  3TGU H;  2YUA A;  3ZHV A;  1DF4 A;  3K9S A;  3KZI Z;  3C3T A;  4DV3 O;  4X88 A;  5J2T B;  4FIP C;  1N34 O;  3D8C A;  2WPD G;  1VAR A;  4JYB A;  4U3J B;  5LYJ B;  3TCU A;  1KEC A;  4DO2 A;  3CCJ V;  2F4V O;  1H2L A;  4IIJ B;  1HNZ B;  1JJO A;  4A5U B;  5LGN A;  4BIO A;  1WNS A;  3OMI B;  3F5T A;  4NYK A;  4DR3 O;  4KXR A;  2ADQ B;  3T1H O;  1THZ A;  1QCE A;  1XMO O;  3BY6 A;  1PM9 A;  1LUW A;  4MVR A;  3H9V A;  4P30 A;  5LMU B;  1V9P A;  4LF8 O;  3OTF A;  4ZHQ A;  1YHQ V;  3E8H A;  1TUB A;  2ITC C;  2ZIO A;  4UXN A;  4G27 B;  1OHH G;  1KQS U;  2VWJ A;  3P3P A;  2DYS B;  2R9R B;  2CTP A;  1Y74 B;  1XMQ B;  2Q8V A;  3WG7 B;  4NTW A;  3A8T A;  4WFA V;  2YXL A;  1BHA A;  3W7S A;  2OWO A;  4GLX A;  1SQP H;  1SQX H;  3IJ4 A;  2ARH A;  3UQ8 A;  4LCU C;  5C93 A;  2BOB C;  3HKB A;  3APO A;  2Y0I A;  4LF7 B;  1TVK B;  2ZNJ A;  2FB5 A;  4F4L A;  3ZRW A;  4JI1 O;  3R66 A;  5LP6 A;  3OMN B;  3JCU Z;  4ZIB A;  2PY5 A;  4H13 B;  5B1A B;  4JZG A;  1WAZ A;  4J9Z B;  5IY5 C;  1YJ9 V;  1I5X A;  3H1K H;  4FLW A;  4MTO A;  1HDJ A;  3JAW A;  3ZS8 C;  1ZWI C;  1YIT V;  1FPO A;  2OTJ V;  5JQG B;  2DYR C;  1PL0 A;  1WN7 A;  2E5L B;  4EKW A;  3SPG A;  2UXB B;  1NU1 H;  4ASU G;  5CA0 B;  1BL8 A;  1N4C A;  2OYQ A;  1P49 A;  3UT5 B;  4DV7 O;  4GCZ A;  5LXT B;  3SGI A;  2A3Q A;  2Q73 A;  4CBC A;  2DE0 X;  1FKA O;  2R72 A;  2QKA A;  3CCL V;  5LMN O;  3K3W A;  3NR7 A;  5EZY A;  3AG4 C;  2QTO A;  5H5N A;  2LP7 A;  3SJC C;  2Q0O C;  1H8E G;  2A9H A;  2JGU A;  1AI6 A;  1E1R G;  3M7M X;  2RCV A;  2VQE O;  1IBM O;  3GVM A;  1JCH A;  2AHY A;  3MDS A;  1S77 D;  1N8R W;  2P4K A;  4QIW F;  1JR9 A;  5C8Y B;  3L70 H;  1NTZ H;  4UVA A;  4CZZ A;  1PPJ H;  3EFF K;  2L6L A;  5CA1 A;  5LGT A;  5GTI Z;  1GK9 A;  1F7Y A;  2LGQ A;  3BA8 A;  4JTA B;  4XDK A;  2UXD B;  1LUV A;  4DK0 A;  4E2L A;  4X64 B;  2JIZ G;  3BA9 A;  3RYC B;  2Q9L A;  4JI5 O;  1TA8 A;  1GAX A;  2UU9 B;  3T2M A;  2W6J G;  4CH4 A;  3JAS B;  2QWN B;  1J95 A;  2OCH A;  2UUC O;  2Y4U A;  3AK2 A;  1XIL A;  1M56 B;  3G67 A;  2YEV A;  5IJ9 A;  4JV5 B;  2QM8 A;  2CTR A;  4QE7 A;  5HFL A;  4LC1 A;  1CPY A;  5JH7 B;  4I9W A;  2Y4T A;  1S5L Z;  4DR5 O;  2DJV A;  3ABM B;  2OTL V;  5DED A;  2NLJ C;  4CS3 A;  5J2U A;  4IL6 Z;  3AK1 A;  2QTS A;  2X6B A;  2KQX A;  4IHJ B;  1JQ0 A;  4YJ3 A;  4QGP A;  1AR5 A;  4O2A B;  1JX9 A;  2R70 A;  1KD1 W;  4RAI A;  2B1G A;  4FFB B;  3OM3 B;  3A0B Z;  2LGW A;  1IX9 A;  1J5E O;  5ITZ A;  4LF9 O;  4J7Z A;  3BAA A;  2Y69 C;  1VF5 B;  3X2Q C;  4IGG A;  2QGN A;  1VQL V;  4J11 A;  3OW2 U;  2LFS A;  1M1K W;  3W7W A;  4JI6 B;  1QR9 A;  4PDR A;  3B8M A;  2YXY A;  1NVP D;  4QJF B;  4KL1 A;  3STL C;  4DR1 O;  4H44 B;  3RYH B;  4PI2 A;  3RVY A;  1AJQ A;  2CH7 B;  2V1D A;  5KX5 A;  1FXK C;  4BW9 A;  1HR0 B;  4DW1 A;  2EZO A;  3CPW U;  2ATK C;  4Q6G A;  3THO A;  3JD2 A;  2V7Q G;  2PTM A;  3H1H H;  4DUY B;  3JAT B;  4KUM A;  3H1L H;  4ZKI A;  4PEL A;  5LHG A;  1B04 A;  4DR7 O;  3ABT A;  3K59 A;  3HKD B;  1EBO A;  3TET A;  4PA9 A;  1IXB A;  2XHB A;  4G28 B;  4OPA A;  5CA3 A;  1URF A;  1N34 B;  2UXC O;  1FJG O;  2F4V B;  4X20 B;  2GHY A;  1K8A W;  1YCI A;  3TXQ A;  3RBZ A;  2CAZ C;  3SJB C;  3OUF A;  4O4J A;  4CH5 A;  4DR3 B;  3P30 A;  3ZHU A;  4CC5 A;  4LFC O;  1V54 C;  3T1H B;  1AP6 A;  1NJI W;  3OT7 A;  2JVD A;  1XMO B;  4JI7 O;  3HKC B;  3ETE A;  1D5N A;  4TT3 G;  1OCO B;  4LF8 B;  2HG5 C;  3U11 A;  1P7B A;  3SDL A;  4MSW C;  1GO3 F;  2ETN A;  4DV6 O;  4I9Q A;  3B09 A;  3SYC A;  4JF3 A;  1ZL8 A;  4YY3 O;  3LSQ A;  4JZ2 A;  1SES A;  1GM7 A;  3T4Z A;  4NTY A;  3D36 C;  1NQT A;  5LBQ A;  1OV9 A;  4P9O A;  5FNV B;  1CEZ A;  3IGA C;  3WU2 Z;  2ZE5 A;  2WLL A;  3FYI B;  2CGO A;  3LDE A;  4JI1 B;  2EJR A;  2M7W A;  1XBL A;  4O4L B;  1HP8 A;  4O2B B;  3ZHR A;  4FFK A;  4B7E A;  4P9P A;  2XAH A;  3CC4 V;  1DGS A;  2QWR B;  4TQF A;  4ZI7 B;  4JI0 O;  1VQ6 V;  4Z1V A;  4I4T A;  4ABM A;  1AB3 A;  4K3A A;  5B66 Z;  3E8B A;  1YTF D;  3QF7 A;  4WFH A;  3ML0 A;  4JTC B;  2ZT9 B;  4DW0 A;  4OGQ B;  4U3F H;  3BHP A;  3ABL C;  4TSF G;  2RN9 A;  4TV8 A;  2JJ1 G;  4MS2 A;  3G4S V;  4X1Y A;  4DV7 B;  3L74 H;  1RM1 B;  1GM9 A;  1M57 C;  4X65 O;  2QWP B;  3RYI A;  3JSL A;  3ABU A;  2XND G;  1F4N A;  3K0G A;  5LMN B;  5B1B C;  4U7N A;  4X8A A;  2DWD C;  4GKJ O;  1MMM A;  5KHG A;  1Z2G A;  4BIU A;  3JYC A;  2X6C A;  1FFX A;  2CDY A;  2VQE B;  1IVS A;  4GKK O;  1WA8 A;  4C7U A;  1ARO P;  4LWS B;  2JS3 A;  3K0D A;  1Q6I A;  4NB5 A;  2UXX A;  5DN6 G;  1A32 A;  2GUZ B;  4G2K A;  1TAE A;  2E75 B;  5D5Q A;  5EBL C;  3E83 A;  4MTF A;  5LA6 A;  2DWE C;  2P90 A;  1Q81 W;  4YHH O;  5L3E A;  1F4M A;  1VQ9 V;  5CB4 A;  1IDS A;  2WLN A;  3MAQ A;  5KUK A;  5JJJ B;  3SYO A;  5KHJ A;  1KBH A;  1S5H C;  4TV9 A;  4FZ1 A;  1GTO A;  1QVF U;  4JI5 B;  5BMV B;  2N74 A;  2YIB D;  5EBM C;  4KHP O;  1VEW A;  2ZE7 A;  3B77 A;  1L0N H;  1VF6 C;  4HNA A;  2Q7E A;  4J10 A;  4EB6 A;  4HBN A;  2P4V A;  4J42 A;  4PHZ A;  3ZMZ A;  2IJJ A;  3JAW B;  1P84 F;  3ZBH A;  3CRQ A;  1BS3 A;  2F66 C;  4DR5 B;  3CME V;  4K0K B;  2HP8 A;  3ASN B;  4UCT A;  5IDJ A;  5JJN B;  1ZTE A;  2XAS A;  1UPG A;  4L87 A;  1K73 W;  1ZX3 A;  3UKM A;  4NXM O;  3HKE A;  5KAF Z;  4B3T O;  1S76 D;  5EZY B;  1D2D A;  4FLU A;  5BR8 O;  1ZSP A;  2NNU A;  2WLK A;  1XQ8 A;  1J5E B;  4LF9 B;  2OCC B;  4YJ2 A;  2QDO A;  1MZE A;  4WFE A;  2PYJ A;  3HR0 A;  4UUJ C;  2ZE6 A;  2LQT A;  4MVZ A;  5IYB O;  3VOU A;  1N0N A;  4LF5 O;  3CRR A;  4PA7 A;  2KSD A;  3QO5 A;  3APQ A;  3DTU B;  4DR6 O;  3J81 N;  1SQV H;  4JYA O;  2JEX A;  4RO2 A;  1GN3 A;  5JWP A;  5CA1 B;  2X7R B;  1WP7 A;  3BCC H;  5EYP A;  3CCU V;  4FLT A;  4F6R A;  1VQM V;  2QWQ B;  3OD4 A;  4UCV A;  1JFF B;  2RNB A;  1HW7 A;  3WB2 A;  3D3Q A;  4QPK A;  4QE9 A;  2DQ0 A;  2IJH A;  2P67 A;  3MD0 A;  4JGS A;  2MK3 A;  3K03 A;  4DXW A;  2HHH O;  4DV1 O;  5IJ9 B;  2ZDI C;  2DYS C;  4GX1 A;  4CS2 A;  4FM2 A;  4DR7 B;  1EZV H;  5A9G A;  1KP2 A;  3AG7 A;  3WG7 C;  5K1P A;  1K92 A;  3ASO B;  2JS5 A;  4WFB V;  3RGB A;  5DEC A;  2UXC B;  4W4L A;  3A2F A;  1FJG B;  4X66 O;  3E2E A;  1PKX A;  1DF5 A;  2YID A;  1Q86 W;  3RT3 C;  4JI2 O;  1R3K C;  3CXC U;  5IYD O;  2KG7 A;  3WFV A;  3KCX A;  1AVM A;  3CWB H;  4WFG A;  4JAU A;  4YJ3 B;  4KFM A;  3GB7 C;  2X0L A;  1GM8 A;  4B7K A;  1NR1 A;  3AG1 C;  3BRC A;  3N27 A;  2F95 B;  2IH3 C;  3E22 B;  1M93 A;  3DSQ A;  1XNQ O;  1AP5 A;  1F51 A;  4TWK A;  4JI7 B;  3A0H Z;  1XI1 A;  4JYY A;  3CCE V;  4DRX A;  1Q90 D;  1M5I A;  1R6N A;  1NH2 B;  3HPL C;  2GV9 A;  1I94 O;  5TIS Z;  3OE7 G;  4FZ0 A;  1OCZ B;  1ZLZ A;  4PI0 A;  5IYZ A;  1Y76 A;  4DV6 B;  5IWA O;  4DV0 O;  4B3R O;  5GON B;  3ZIA G;  3JAR B;  2HR3 A;  4IT5 A;  2DQ3 A;  5JVD B;  1VQ4 V;  1FXH A;  4YY3 B;  3PJS K;  3TJT A;  2ZXW B;  2P22 C;  3CEI A;  1NKD A;  2ZNI A;  1S72 V;  1XEQ A;  2QA4 V;  3ZMS A;  1KB9 F;  2HEP A;  4WBN B;  3W7X A;  3ZRS A;  2YIB A;  2MW2 B;  3EXA A;  3JD3 A;  2EIK B;  2XAF A;  3STZ C;  1N36 O;  3WB0 A;  3WB1 A;  4D7S A;  2IW5 A;  4RWU A;  2W0X A;  5DM6 V;  5IJ0 A;  1GRJ A;  3O9O A;  4FLX A;  3N2K A;  3IC7 A;  2WAM A;  2W6I G;  4PDL A;  4JI8 O;  3AG3 B;  4ZBM A;  3CX5 F;  4P2Z A;  2QR4 A;  2DW4 A;  4R8C A;  3JAM N;  1AI4 A;  4LF6 O;  2AZ0 A;  4ZOL B;  2EIM B;  3H01 A;  3OUS A;  5J2T A;  3NXS A;  3CXH F;  2VQF O;  1Q6H A;  1SET A;  5H6Q A;  1BGY H;  4X1K B;  4JAA A;  3L71 H;  5LYJ A;  4PV1 B;  2IU0 A;  4GZR B;  1KUQ A;  3OAA G;  2NN4 A;  1X59 A;  2JEU A;  2Q4P A;  2GTS A;  4LFA O;  1XDC A;  1SA0 B;  2XTA A;  4OX9 O;  3E89 A;  4X65 B;  3ZN1 A;  1Y66 A;  4XBF A;  3UO2 A;  2ADP A;  2EUL A;  2XAQ A;  4O4J B;  1N33 B;  3G80 A;  1OCR C;  1ENV A;  1V55 C;  1M56 C;  4GKJ B;  3VBB A;  4BWA A;  1NTM H;  1K3E A;  2XAJ A;  4PDV A;  4DV5 B;  3CRC A;  3G6E V;  3OEE G;  4L8J A;  4JPR A;  3K5L A;  4GKK B;  2EIJ B;  4K8Z A;  4J80 A;  4BAY A;  3ABM C;  1SQQ H;  4RUF A;  5KHI A;  1Y74 A;  3T1C A;  2YS8 A;  3ICX A;  1JMK C;  1VP7 A;  4MVQ A;  2X6A A;  4D6T H;  4YHH B;  1YEW A;  2RJZ A;  4OXS A;  2DN9 A;  4DK1 A;  4QPJ A;  1H2K A;  2A79 B;  1L1F A;  2ZIN A;  4HAM A;  1TVK A;  2ZD9 A;  5AG2 A;  1HWY A;  5KMG B;  2E74 B;  4UB6 Z;  2QE7 G;  1MA1 A;  1YVW A;  3CJH B;  4IYI A;  1YJW V;  2Q69 A;  3S3W A;  2XAG A;  2WLL B;  1XNR O;  1HNX O;  3B8N A;  4X1I A;  2B1I A;  3C3S A;  2YIC A;  2YI9 A;  4MTX A;  2EZP A;  2FL4 A;  1EM1 A;  3SYQ A;  2WLI B;  2HVK C;  1EFR G;  1QLE B;  2H3O A;  3JD0 A;  2E76 B;  4DR4 O;  4I4T B;  2N04 A;  5KA6 A;  1P7G A;  2Y69 B;  3K08 A;  5JQG A;  1HNW O;  3CCV V;  4U7O A;  2Q5Z A;  2EJ7 A;  3H1J H;  1MAB G;  3UT5 A;  1I7F A;  2Q68 A;  2QM4 A;  1SF9 A;  4TV8 B;  5LXT A;  1IXM A;  2DMX A;  4UB8 Z;  3BEH A;  4QNH B;  4DV2 B;  2C2A A;  5KHH A;  4JI3 O;  1B06 A;  2EIL C;  4BIZ A;  3RYI B;  2AXT Z;  1YSC A;  4NXM B;  4FMT A;  4B3T B;  5KAI Z;  2ZIM A;  1NTK H;  2AHZ A;  2LW7 A;  4Z1M G;  1KP3 A;  3UCS C;  1VQO V;  4DV3 B;  1FFX B;  3QTC A;  1WA8 B;  3ZHQ A;  3G71 V;  2BTQ B;  4I7Z B;  2OT5 A;  1KKD A;  5CBH A;  2HFE C;  1XHZ A;  1AR1 B;  4JAS A;  3RYF A;  1W0K G;  4LR3 A;  2NR5 A;  2XOK G;  2ZR2 A;  4DR6 B;  1ZUQ A;  4N23 A;  5H9C A;  2WA4 A;  4LFB O;  4B08 A;  4O4H A;  4JYA B;  2WA3 A;  3KCY A;  1Z5W A;  4LF7 O;  1FYJ A;  2D3O W;  1WLE A;  1CP9 A;  4X9Q A;  5JCO C;  3H1I H;  3QVN A;  4H37 A;  3AG2 B;  4TV9 B;  1QVG U;  3LNN A;  3ABK C;  4J7J A;  1OCO C;  1MZF A;  3JAS A;  4BW5 A;  4WFF A;  2UUB O;  1SQB H;  2EX3 A;  5B5E Z;  4HNA B;  4LF4 O;  2HHH B;  1JA8 A;  3FAV A;  2VWK A;  3Q4H A;  4DV1 B;  5JJE B;  3HB3 B;  4NXN O;  3K06 A;  4XDL A;  2GSM B;  1CXZ B;  4Z2W A;  1H8H G;  1N32 O;  2RDC A;  1PNM A;  3QG5 A;  4DYL A;  1GN2 A;  3CHX A;  2Z5U A;  4EFE A;  1DTO A;  2XT9 A;  2YIA A;  3SYA A;  4X66 B;  3FB5 C;  4IHJ A;  2KB1 A;  5HFM A;  2PI4 A;  3R65 A;  3ZMU A;  2HVJ C;  2O57 A;  4I50 B;  3GWO A;  2K1E A;  5IT9 N;  1L8D A;  4FPP A;  1XNQ B;  2EBO A;  1OCC B;  4GYC B;  4I55 A;  4O4I A;  2AZ2 A;  2Z3Y A;  4J9Y B;  3EVK A;  1K5Q A;  1I08 A;  4YJ2 B;  5KHK A;  2A06 H;  1G1X B;  1H2M A;  5J9P C;  2JDI G;  3ZMV A;  1I94 B;  2XUM A;  4B3R B;  1JVM A;  1RM1 C;  3CYO A;  3K79 A;  3SJA C;  1AI5 A;  3RYH A;  5IE9 A;  5B3S B;  2WLM A;  3ABL B;  3QNE A;  2CH7 A;  1FXK A;  5GW7 A;  3J7A U;  2IBZ H;  3AK3 A;  5EYP B;  1IBL O;  4CC6 A;  4N21 A;  4F6R B;  3JD4 A;  2UU9 O;  4UCS A;  4RQE A;  1US6 A;  1M57 B;  4FLZ A;  3B2E E;  1IBM B;  2FYU H;  4ZHQ B;  1WPB A;  1TUB B;  3CMA V;  2VS0 A;  4JI8 B;  1MNG A;  4K8X A;  3K58 A;  4MVO A;  4FM0 A;  4LF6 B;  4GT1 A;  2FKX A;  1IBK O;  1QLN A;  1NR7 A;  2ILM A;  5CN0 A;  3CRM A;  3HKB B;  3DXR A;  4X20 A;  3VQY A;  1XL6 A;  3A0R A;  5KLV H;  2UXN A;  5LHI A;  3F5W C;  2EIN B;  3ZRW B;  1ROP A;  2YC0 A;  2JK5 C;  4LFA B;  1K4D C;  3I5D A;  3K5M A;  2Q7G A;  2W0F C;  2BSK A;  1G8M A;  5LP6 B;  2ZM6 O;  1BQZ A;  4OX9 B;  2VRZ A;  2CGN A;  2F23 A;  2UUC B;  3TK1 A;  1RP3 B;  1KC8 W;  3OTO O;  2B5U A;  4FK5 C;  1X4T A;  3HKC A;  1GN6 A;  5LL6 Y;  5D5P A;  4B3S O;  2PI5 A;  1K33 A;  3IFX A;  1QQC A;  3ZN0 A;  3ZHT A;  1OJH A;  3FB6 C;  4TUY A;  4DRX B;  1SS3 A;  1SER A;  3FB7 C;  4DR2 O;  2YXH A;  1XUQ A;  2RQ6 A;  1VQN V;  3ASN C;  3P3N A;  4NR1 A;  3D36 A;  2CK3 G;  4X62 O;  4DUZ O;  1S0V A;  1VQP V;  3L9D A;  1VF7 A;  3N2G A;  4UVC A;  1M90 W;  5CBF A;  1EZJ A;  1BCC H;  1K97 A;  2P06 A;  4JI4 O;  1BMF G;  4UV8 A;  4DV4 O;  4O4L A;  4B3M O;  5EC2 C;  3LDD A;  4O2B A;  1XNR B;  2OCC C;  1D5A A;  3KG2 A;  1HNX B;  1XL4 A;  5IJ0 B;  2GBO A;  1KYO F;  3JAK A;  3FKS G;  1PNL A;  3BVO A;  3U10 A;  4RUE A;  3OMA B;  5LOV A;  4DR4 B;  2N05 A;  3IC9 A;  5FPR A;  4FJC C;  4ICG A;  4DR1 B;  5B1N A;  1WP8 A;  5F2V O;  3DGE A;  1HNW B;  3JAL A;  5EIB D;  3C90 A;  3JSN A;  2QEX V;  3BPZ A;  2JGD A;  4MVM A;  1FD9 A;  2PF4 E;  5EC1 C;  3CC2 V;  2F43 G;  1OZ0 A;  1U96 A;  3RWR D;  4JI3 B;  2RMK B;  1R73 A;  3VQV A;  1SKV A;  4YIP A;  2YEV B;  2L35 A;  1O9G A;  2Q67 A;  1COW G;  2IJI A;  5BY1 A;  4LWS A;  1W0J G;  1MSW D;  1K7D A;  1RPR A;  1S3J A;  3ASO C;  5L3F A;  4E4E A;  1NH2 D;  3CE2 A;  2GUZ A;  5EIB C;  3LSU A;  1QU7 A;  2LW1 A;  3E8G A;  2QSA A;  1SQF A;  1XOU A;  3VQX A;  4UCO A;  1BQ0 A;  5J2U B;  5L3B A;  1AJP A;  1QHT A;  2B9Z A;  3UO3 A;  4UCU A;  2KKW A;  4J7K A;  4WF9 V;  4LFB B;  1Z5V A;  4GX5 A;  1R3I C;  3D3I A;  2PGG A;  3OGI B;  1TUE B;  5B1A C;  1BE3 H;  4LFC B;  4UVB A;  5BMV A;  1RPO A;  5ITZ B;  4FLV A;  5IYC O;  1WB8 A;  1VF6 A;  4PA4 A;  3SPI A;  2UUB B;  3AG1 B;  5IY5 B;  4X1I B;  3K9A A;  3CSX A;  2LO1 A;  1Y4M A;  2Y48 A;  2JJ2 G;  2QKS A;  3JD1 A;  4LF4 B;  3O65 A;  2BCC H;  3EHB B;  4J41 A;  4NXN B;  1OCZ C;  2DYR B;  4AHC A;  3J80 N;  1R1B A;  1N32 B;  4LNU A;  1YF2 A;  4EFB A;  3F7V C;  3E35 A;  2YDE A;  1R6K A;  3RN4 A;  1KMI Z;  5KX5 B;  2ZXW C;  1K34 A;  1VQ5 V;  1QNM A;  4PA3 A;  2UUA O;  3L75 H;  4MT8 A;  4I0X A;  1YDX A;  1YXB A;  2EIK C;  4LP8 A;  1RSO A;  3W7T A;  2ODM A;  3AG4 B;  4AQY O;  5E79 Z;  3CCR V;  4JI0 B;  2QKC A;  5BZB A;  3AG3 C;  1XHX A;  2P7T C;  3FD9 A;  1AI7 A;  2CTQ A;  2EIM C;  3T1Y O;  4X89 A;  1LNQ A;  3PN1 A;  4U3J A;  4IIJ A;  1WJZ A;  1P4R A;  4KP4 A;  3T4D A;  2Q6A A;  3RYF B;  1EN5 A;  1RFY A;  5LHH A;  1PV0 A;  1SC5 B;  4O4H B;  3I56 V;  3FX7 A;  1R3J C;  2AW9 A;  1Q7Y W;  5GTH Z;  2HJF C;  2GTA A;  3CCS V;  2ITD C;  1JFF A;  3LDC A;  1IBL B;  4FM1 A;  4Q20 A;  3RVZ A;  2LJ2 A;  4NKG B;  1ORQ C;  4MTG A;  2EIJ C;  1OCR B;  3KKY A;  1V55 B;  2ZDI A;  1VQK V;  3FAV B;  3Q4H B;  4MVU A;  1K5S A;  1I5Y A;  1NBM G;  4JYC A;  3AEI A;  1ZL8 B;  4EEQ A;  4F6E A;  1IBK B;  1VMG A;  2ZKO A;  2QWO B;  5L3D A;  4K0K O;  1YIJ V;  1QBZ A;  2QM7 A;  4MVS A;  2Z0A A;  2F93 B;  2OIE A;  1Q6U A;  4KHP B;  4CS4 A;  1O9H A;  2ZM6 B;  5KA5 A;  4NVP A;  1T5E A;  1Q5O A;  1S5J A;  3E22 A;  1R6T A;  3W7U A;  1K9M W;  3ZRX A;  1GMG A;  1PD3 A;  2BE3 A;  3OTO B;  1JJ2 U;  3OEH G;  1QLE C;  2IM9 A;  1G4Y B;  4B3S B;  4I55 B;  4O4I B;  3FYE B;  3X2Q B;  3LSS A;  4OPH A;  2WWW A;  3ZMT A;  2ZCE A;  1YJN V;  1DLB A;  1Q8I A;  4FVM A;  5CA0 A;  1NT2 B;  4GX0 A;  2YSU B;  4DR2 B;  4HYO A;  1HNZ O;  2ZE8 A;  5GON A;  3JAR A;  3K57 A;  5JVD A;  4PD4 F;  4X1Y B;  3ZJZ A;  4TQD A;  4UCR A;  4X62 B;  1SRY A;  2E3C A;  3CCM V;  5FL7 G;  1NS1 A;  5H2F Z;  4DUZ B;  4FLY A;  1K4C C;  1B6Q A;  4CH6 A;  1FXK B;  4WBN A;  5BXZ A;  3ZCC A;  4TOI A;  5BR8 B;  4JI4 B;  3K04 A;  5LMU O;  1AIL A;  1H2G A;  4MW8 A;  4I5S A;  4DV4 B;  2EIL B;  1F23 A;  4B3M B;  3OR6 C;  1VIB A;  2CTW A;  3CCQ V;  5EK0 A;  1N0J A;  4LF5 B;  5C8Y A;  4UFZ A;  5E1A C;  1XMQ O;  2H94 A;  5KUM A;  4JTD B;  5LA6 B;  4ZOL A;  4MW3 A;  1UJW B;  2D2C B;  2ZR3 A;  1EN6 A;  1NVP B;  3SYP A;  1W2B U;  4D7T A;  2FML A;  1H2N A;  5CB4 B;  4X1K A;  1GH6 A;  3UM7 A;  2ZQM A;  1H38 A;  1KU9 A;  3SPJ A;  2WSS G;  5CMU A;  2LFR A;  1H2S B;  3RYC A;  4WCE V;  1YZB A;  1BSM A;  4K35 A;  2BOC C;  2IH1 C;  3DXR B;  3CD6 V;  4CH3 A;  3B40 A;  3AG2 C;  1BT8 A;  4H33 A;  1SA0 A;  1BHB A;  3SPC A;  4R50 A;  1QR8 A;  3OGC C;  1E1Q G;  2BSK B;  3M8A A;  4LBE C;  1V54 B;  4R7C A;  3G6B A;  4NTX A;  3E8F A;  1LR1 A;  5CBG A;  4EB6 B;  3ABK B;  5JH7 A;  3LUT B;  1AR4 A;  3CB2 A;  1JPX A;  4LH7 A;  2R9I A;  1PNK A;  3RFR A;  1AJN A;  1FAF A;  2K9P A;  2E5L O;  2PZS A;  3DC5 A;  2P5O A;  4TUY B;  2UXB O;  2JRI A;  5LGU A;  1W59 A;  4GX2 A;  1JOY A;  4JI2 B;  1SZT A;  1UFI A;  4O2A A;  4GUN A;  4YXW G;  3TXS A;  3ZHS A;  2A0L A;  4FFB A;  4JAV A;  2CE4 A;  3HKE B;  5KMG A;  1WPX A;  3N2G B;  1FXV A;  3E86 A;  5B1O A;  3CJH A;  3ETG A;  1U97 A;  2HLD G;  3JCZ A;  2DOS A;  3L73 H; 
#chains in the Genus database with same CATH homology
 3I5D A;  4DW0 A;  4DW1 A;  3H9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...