4DW1A

Crystal structure of the atp-gated p2x4 ion channel in the atp-bound, open state at 2.8 angstroms
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
324
structure length
324
Chain Sequence
RFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of ATP binding and ion channel activation in P2X receptors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transport protein
molecule keywords P2X purinoceptor
total genus 80
structure length 324
sequence length 324
ec nomenclature
pdb deposition date 2012-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.940 Mainly Alpha Orthogonal Bundle Helix Hairpins atp-gated p2x4 ion channel 4dw1A01
2.60.490.10 Mainly Beta Sandwich atp-gated p2x4 ion channel fold atp-gated p2x4 ion channel domain 4dw1A02
4DW1A 3H9VA 3I5DA 4DW0A
chains in the Genus database with same CATH superfamily
4TT3G 4HBNA 1V54C 3LDCA 3OT7A 2A06H 3ICXA 1XMQO 2QKAA 4LWSB 2HFEC 2ZNJA 4JZ2A 5D5PA 1YJWV 5A9GA 4JF3A 1IXMA 2RQ6A 1HNZO 4WF9V 3AG2C 1KU9A 2GDSA 4MVZA 4JZGA 1GAXA 2UXBO 2XUMA 4R6ZA 1L0LH 5CA0B 1OCZB 2YUAA 3E22A 3K08A 2A9HA 2FB5A 4JI3B 4NXMO 2QM8A 3E22B 4DV3O 2IJJA 2BTQA 3BA8A 4FMTA 4G27B 3AG7A 2EIJB 3E8BA 4JV5B 1XL6A 4XBFA 1MABG 4H37A 2JGDA 3CCLV 3SYAA 2ZE6A 4H44B 2B9ZA 1R3JC 4YHHO 1HNXB 5IWAO 1SESA 4QIWF 1YITV 4PDRA 3AK2A 4DR2O 2E75B 2D2CB 5L3CA 2E5LO 2F66C 1M90W 1ENVA 4RUFA 3JD2A 5JVDA 4HNAB 3GWKC 3EHBB 1V54B 2QKSA 3T1CA 4D6TH 1S72V 2EJ7A 5J9PC 3OUSA 4DV6B 1IURA 4LBEC 4IL6Z 3LDDA 1NKDA 5B1NA 3ZMVA 4X8AA 1MZFA 5CB4A 4LF8O 4F6EA 3LSUA 3AG1C 1AVMA 1QQCA 1FXVA 4I7ZB 1W59A 4BIOA 3IC7A 1LR1A 4IGGA 3ASOC 4IT5A 5CA1A 1UPGA 4JI5O 2XHBA 4B7KA 4YHHB 2PF4E 1Y76B 2AHYA 4EEQA 1XREA 3AG4C 4UCTA 3HKCA 4FLVA 1XOUA 3E35A 4LNUA 3T4ZA 2IM9A 1Q90D 1GTOA 1FXKC 3A0RA 4RQEA 3ZMZA 3B2EE 5E79Z 3JAWA 2JGDB 4UV9A 1YEWA 4QPJA 4JI2O 1MZEA 2N05A 4I4TA 1HDJA 4MVSA 5KX5A 4HZ3A 2XAHA 5B3SC 1H2NA 1KYOF 3Q4HB 5LHHA 5FL7G 3JAKB 3JD1A 4QJFB 2EIMB 2FKXA 2IJHA 5B1OA 1OCOC 3FAVA 4JV5O 4LF7O 1ZLZA 4CH3A 4LF4O 4B3RB 3TETA 1R6NA 1KP2A 1KC8W 4TV9A 1N0NA 2W0XA 3CE2A 4UCSA 1G4YB 1HNXO 2UXBB 2WLIB 4J41A 1N32O 2ZR2A 2YI9A 1F23A 2M6YA 3D3IA 4UVBA 4I9WA 4JAAA 4JTAB 4CH6A 2ZQMA 2Q0AA 4DV0O 5LMNB 4FLUA 3AK3A 4U3FH 2WLHA 1I94O 3SYQA 3K57A 4CS4A 4NR1A 4MSWC 3G4SV 4LFAB 1RFYA 2OCHA 3UO3A 5KHGA 1SETA 3RGBA 1GK9A 1OCCC 1SQBH 1SERA 2Y69B 3RYCB 1NTKH 4GX5A 4JYBA 1AR5A 4UCVA 1K9MW 2B5UA 2HHHO 4BIUA 1VQ8V 3JATA 1YTFB 4JI0B 5E1AC 3W7XA 2HVKC 5B66Z 3K9SA 1N8RW 2KSDA 1SA0A 3TJTA 3JCZA 1Z5WA 1M4UA 1ZAUA 4JI4B 1Q5OA 4WFHA 2XAFA 3F5WC 1Y74A 4FM2A 4I55A 4JI5B 2L6LA 5CBHA 2LFSA 4UVAA 3WB2A 5KAFZ 3L71H 4YJ3B 1SZTA 4LF6O 1BHAA 2F4VO 2UUCB 1TVKA 5L3FA 4LF8B 3JYCA 3OTOB 4CC5A 2K1EA 5GTIZ 5EYPA 4ZIBA 3STZC 1Q43A 3K58A 1GRJA 4UVCA 1Z2GA 4B3MO 3L75H 3T4DA 5IE9A 3RYIA 3E8FA 3O65A 2A79B 2YEVA 4J7JA 1VQMV 3EXAA 4JYAB 4GKJO 4X1KA 4P2ZA 2YDEA 4I55B 4JI0O 3D8CA 2NLJC 1WAZA 4GZRB 1Q86W 2X0LA 1LUWA 1JFFA 3G67A 3ZMSA 2IBZH 1V55B 2F43G 5BY1A 1RM1B 1MSWD 1AI5A 1H2SB 3ZHSA 3SPHA 3ZHTA 3ZHRA 4G28B 1TUEB 4UFZA 5H6QA 4JI1B 2IJIA 4Z1MG 3QG5A 1MNGA 1KD1W 1GN6A 1DTOA 1I5XA 2UUBO 4KP4A 4DR3O 3ZRVA 4I0XB 4WCEV 2WA3A 3A0HZ 4WFFA 3GWOA 4X1IA 1RPRA 2RMKB 1BZKA 4LH7A 4FLYA 1I7FA 5F2VO 2EIMC 2Q0OC 4QGPA 1Q8IA 1DK1A 3R65A 3AG2B 4EFEA 3QO8A 1T5EA 4U7NA 4EB6B 1VQKV 1IBLB 5LP6B 1N36O 2DQ3A 1IBKB 4O2AB 1KBHA 4K0KB 3CCJV 2GHYA 1VQ7V 3LUTB 3HKDB 4DW0A 3BABA 5BZBA 1HW7A 4RO2A 5JJNB 4DR7B 3JSLA 1VQ6V 3H1IH 2F23A 3O9OA 5BMVB 5LBQA 4DRXB 4JI7O 1PNLA 5IYZA 1OJHA 3K3WA 1CP9A 4FVMA 4AI8A 3OAAG 3CEIA 3LSQA 2YIDA 2BTOA 1NJIW 1KUQA 3RW0A 3ABMB 2LQTA 1DLBA 1R6KA 2ZINA 3OTOO 3FYIB 2VQEO 2JIZG 2DYSC 4DUZB 1U96A 3DGEA 5ITZB 3W7SA 1YVWA 1BMFG 4O2BB 4YIOA 4DV4O 1UJWB 4DR4O 2LGWA 4DO2A 3T1YB 2HJFC 5KUMA 3M8AA 4NKGB 4RQFA 3ASOB 3S3WA 3H01A 2UUBB 4I5SA 2ITDC 4P9OA 3CC2V 1JVMA 3KCYA 2JVDA 4X64B 4O4JB 2EZOA 4DV7B 4UXNA 3CP1A 5KMGB 4O4IA 2ZXWC 2F1MA 4FLTA 1FFXB 3N2KA 3K79A 1BSMA 2CTQA 3JARB 5LP6A 1EN5A 2G38A 2OYQA 3THOA 3BY6A 2DYRC 4LFAO 4UB6Z 1Q3EA 4GX2A 4X64O 3E8GA 1XQ8A 4AILC 4D7TA 4LP8A 2EIKB 1OCOB 2RCVA 1BT8A 5J2TB 3J81N 3MD0A 3QO7A 2NN4A 3K03A 4O2AA 2OTLV 5EC2C 5LGUA 3TXQA 4DK1A 1K33A 2NNUA 3AEIA 4G2KA 2YIBA 4PA3A 2W6JG 2F4VB 3K5OA 2DMXA 1BL8A 5IJ0A 3HR0A 5KA6A 3CJHB 2ILMA 5JVDB 1IBMO 1QU7A 3PN1A 1D2DA 2VWJA 1F4MA 2JEUA 3CC7V 1M1KW 4FLWA 1QHTA 1P84F 4GUNA 1XMOB 3FX7A 2VWKA 5D5QA 2ZXWB 1S5LZ 1R1BA 5C8YB 2EIKC 3L70H 2ZD9A 3T1HO 4QE9A 4LFCO 1Z5VA 1SQPH 2A0LA 1VIBA 5LYJA 4JYYA 1B04A 5H5NA 1WPXA 1THZA 2IJKA 1KQSU 4NXNO 3OGIB 5B5EZ 4O4IB 4TUYB 5EYPB 4J80A 4E4EA 2P6JA 3JASB 3OUFA 1R73A 2EX3A 2QWPB 4YIPA 5LL6Y 3FD9A 1IZ3A 2R9RB 3G6EV 2P5OA 3RVZA 3HKCB 3QNEA 1FYJA 4EFBA 4TWKA 4LFCB 3UCSC 2YSUB 1NTZH 4FM0A 4O4HA 1JFFB 3WG7C 4WFGA 1DGSA 1M56C 2QR4A 4X1YA 4DV5O 1Q82W 2EINB 4ABMA 4WFBV 3MHSC 3VQWA 2CE4A 3SJBC 1XHXA 4FLXA 4TQFA 1FAFA 1R3LC 2KB1A 2ODMA 5CA1B 4FZ0A 4PDLA 3RYHA 3RYCA 3OEHG 5KHHA 4KXRA 1XDCA 1M93A 1K4CC 1DF5A 1WB8A 3W7WA 5ITZA 1BQ0A 2QWQB 1Q6IA 2EIJC 4TV8A 2DQ0A 1GKFA 2IU0A 4DR4B 5JCOC 2Q5ZA 4K8ZA 5KX5B 1VP7A 1IXBA 1NI8A 2QA4V 4AQYB 1XUQA 3E83A 2XT9A 4LF5B 5L3BA 2OWOA 2W0FC 1AJPA 3X2QB 3OE7G 1AP6A 2ZE7A 4MTFA 4K35A 1Y74B 1ZL8B 4LFBB 2MW2B 2C2AA 5LXTA 5AG2A 3UQ8A 1EBOA 3HKDA 3CRAA 3VOUA 3CCEV 1GMGA 2WPDG 2HG5C 4O4LB 4DUYB 2KQXA 1S77D 4AQYO 1QR8A 3T1YO 5FPOA 5DECA 1RP3B 3FAVB 2X6BA 1MSDA 5J2UB 4GX0A 3ZHQA 2Y4UA 3ZRSA 1V55C 1F51A 2CH7B 3H1JH 2EINC 1MG1A 1RPOA 1K92A 5FLXN 2HEPA 2VQEB 2BOBC 3J80N 1YHQV 3SYOA 3U10A 1N33B 2UUAO 2Q6AA 4I9QA 4W4KA 3AG1B 5LXTB 2PZSA 4JI7B 1ZX3A 2ZDIC 4LWSA 2PUSA 2V1DA 3ZX6A 4WBNB 3ZN1A 2ZE8A 5H9CA 1AILA 3RYFB 4KHPB 3F7VC 1ZTEA 4CBCA 1EZJA 2F93B 1MMMA 2N04A 1TGOA 1K7DA 4EKWA 2UXCO 4CS3A 2KG7A 4DR1O 2LJ2A 4C7UA 3IJ4A 3ABMC 3WU2Z 3FKSG 4JTCB 3J7AU 1XMOO 4DV0B 1U97A 3K0DA 3JCUZ 2BTQB 5LHIA 1OV9A 3ZRXA 2LW7A 1YSCA 2GUZB 2PI5A 5C8YA 2QE7G 3DC6A 4J9ZB 3B77A 4J9YB 3I55V 4NYKA 4X89A 4DW1A 2QM7A 2YS8A 3A2FA 4J7ZA 4OX9B 2XASA 2XNDG 4PA9A 4DR6O 1XEQA 5TISZ 4MS2A 4NTXA 1CXZB 3JSNA 1ZL8A 2QGNA 2ZKOA 2M7WA 4L8JA 4QNHB 2YXHA 5KLVH 2PGGA 3MAQA 2Q8VA 5DEDA 2YEVB 3WG7B 1X4TA 5BMVA 3ETEA 2XAQA 1L1FA 4DR3B 3D36C 1W2BU 2P22C 1S3JA 3FB5C 3IC9A 1R3IC 3CC4V 2QKCA 4X1IB 5EIBD 4PHZA 1FKAO 2PYLA 3UT5B 1PV0A 4IYHA 4R7CA 4J10A 1BS3A 3LNMB 3BPZA 5HFMA 3FB7C 3RN4A 2HR3A 1QR9A 4DV7O 1NH2B 1JJ2U 2RN9A 3IFXA 4Q20A 3D36A 2CDYA 1XBLA 4PDVA 3RYIB 4MT8A 1KKCA 4K3AA 5BR8O 4A5UB 2X7RB 1H8HG 1QLEC 1MA1A 3TCUA 3OW2U 1K8AW 2KG7B 4JGSA 3K59A 1VF5B 3OM3B 3S3XA 3OMIB 2CH7A 5B1AC 5K1PA 1FXKA 1LUVA 4ZI7B 1BE3H 3CXHF 4X20B 5JQGB 2OIGA 1M57C 4TV8B 3OGCC 1VQ5V 3K04A 4FLZA 3K9AA 4X1YB 1F4NA 2Q7EA 1TAEA 4UCRA 1QNMA 4EB6A 3CSXA 2GV9A 2WWWA 1D5AA 1J5EB 1FS0G 1JQ0A 1URFA 5GONA 4NVPA 1AR1B 3JALB 2QWNB 2QM4A 3F7YC 3OR6C 3FFQA 3CRCA 1HP8A 4PJ0Z 1IBKO 2LFRA 4PA6A 2R72A 4HAMA 3ZMTA 5J2UA 2O57A 4DR5B 5H2FZ 1NU1H 3C3SA 3K06A 3H1KH 5LMNO 4I50A 3ETDA 4YJ3A 4PI0A 2Y4TA 1B3QA 1J5EO 3BFRA 2JS3A 2AGAA 5LHGA 2YICA 5KHJA 2AZ0A 3OD4A 2RNBA 1I0HA 3CD6V 4ZHQA 1QLEB 4N21A 1RM1C 3JALA 2GTAA 4W4LA 3CWBH 4XDKA 3JD0A 1YZBA 4I4TB 2R9AA 2UU9B 1XILA 3OMNB 2H8PC 3ABKC 4HNAA 3DTUB 5EBMC 5LGTA 2ZNIA 4FZ1A 3E8HA 3G6BA 1AJQA 5CMUA 3A8TA 3CCQV 2DYRB 2Y0PA 3UKMA 5HFLA 3TXSA 2GUZA 4O4JA 1JA8A 1SS3A 4X66B 4BAYA 1PD3A 1JR9A 1MOFA 2HP8A 2ADQB 2YIAA 2ZT9B 3WB0A 2QTOA 4CC6A 1Q6HA 4MTOA 4X62B 2A7WA 2QSAA 1WLEA 4UUJC 3F5TA 3UM7A 2JJ1G 3DXRA 4X9QA 1A32A 1NTMH 4LC1A 4PI2A 4X65O 1D5NA 1KB9F 4GKKO 3CB2A 3HKBA 3R66A 1WP8A 5GTHZ 3ABUA 3VQXA 1GN4A 3D3QA 1N33O 3BCCH 4FPPA 3ZEDA 2OCCB 4YJ2A 1YTFD 3L73H 2FL4A 3KKYA 3ZHVA 1NZ6A 4LH6A 2VQFB 4JI8O 1K73W 2P4KA 3JATB 1NVPB 4PV1B 1ZSPA 3SPJA 4TOIA 3CXCU 4DV2B 1KMIZ 2H3OA 3ABKB 1GM7A 2BSKB 2JK5C 2E76B 1W0KG 4WBNA 3ZRWB 1QBZA 4IHJB 2Y0IA 3QF7A 3HPLC 4BIZA 5JJEB 3I5DA 3ABTA 5IYDO 4O4HB 4ZBMA 2AHZA 4DV1O 2WLMA 1HR0O 4GX1A 2CTPA 1NT2B 5B1AB 2OCCC 3N27A 2MK3A 4NTYA 1VEWA 3MHHC 2V7QG 2P7TC 5LMUO 2CGOA 3CYOA 1P7BA 3ETGA 1FXKB 4K0KO 3B8NA 1I08A 4DXWA 1VF6A 5LGNA 4IHJA 2HVJC 2WLLA 2GTSA 4JI6O 3MDSA 1J95A 3ML0A 1VQOV 4PELA 1WNSA 4CH4A 4DR2B 4NXMB 3LNNA 4LF9B 4F6RB 4GT1A 2ATKC 1GM9A 1H2MA 3K0GA 4ICGA 5JH7A 1FPOA 4JTDB 1OCCB 4F4LA 2Y69C 5JH7B 2BCCH 3L9DA 5C93A 4RAIA 1SQXH 2UXDB 2CAZC 1SQVH 4B3SB 2Q67A 1SA0B 4TV9B 1JX9A 5BXZA 1H8EG 2B1IA 3OEEG 3ZRWA 4WFEA 3B40A 3SPIA 1QVFU 1JCHA 3CX5F 5IY5B 1SQGA 2Q9LA 3CRMA 5LA6A 3K5LA 4R50A 4B3RO 3P32A 1US6A 5IJ9A 2DE0X 1WP7A 1XL4A 2XAJA 2L35A 4WFAV 5KAIZ 4FFBA 2JS5A 1YCIA 2K9PA 3BA9A 4YY3B 3RBZA 4JI1O 2H94A 4B3MB 1ZWIC 5LMUB 3RT3C 1N34B 1ORQC 5KHIA 2GBOA 4B3TO 1UFIA 2GSMB 3I56V 2YXYA 3CCUV 4UB8Z 3HB3B 4OPHA 1QCEA 3ASNB 1AI6A 5L3DA 4X20A 1G8MA 3WFVA 4CZZA 4JYCA 1O9HA 1W0JG 3JD3A 3W7UA 4LF5O 2DOSA 3WB1A 5FPRA 1AI4A 3E86A 1H2LA 1KP3A 2EULA 1P4RA 4FK5C 1GO3F 3VQYA 2ADPA 4JI4O 2Z3YA 5EZYB 5LOVA 3U0ZA 1WPBA 3BEHA 3C90A 3FB8C 2ETNA 2CGNA 4OX9O 4B7EA 2IH3C 4BWAA 1TA8A 1H2GA 1NR7A 4U3JB 2E74B 2QJ1A 4ZI7A 1AI7A 5CBFA 3E2EA 3HKEB 2F95B 1N34O 2DN9A 4OXSA 2ZM6B 3ETQA 3JAMN 2Q4PA 5LA6B 3EVKA 1IVSA 5CA3A 1YJNV 2UXDO 1WJZA 1K97A 2E5LB 1GN3A 2EJRA 3W7TA 5CBGA 5IYZB 3CCVV 3M7MX 5A2QN 2ZM6O 1Q81W 4GCZA 3RYHB 3SPGA 1Y66A 5IDJA 4PA7A 1IX9A 4LCUC 3HKBB 4YXWG 1EN6A 4DUZO 1YXBA 1YJ9V 2PY5A 2ITCC 4PD4F 5IT9N 1YI2V 5KHKA 3SYCA 2FYUH 3APOA 1I94B 4JI3O 4P30A 1IBLO 1VF7A 4GKJB 2Y48A 3T1HB 1SKVA 4Z1VA 4LNUB 4J7KA 2ARHA 4MVRA 2JGUA 5IYBO 2ZDIA 1FJGO 1AR4A 4DR7O 4J42A 1XNRO 2OT5A 1K5QA 1N0JA 4JASA 2HKOA 2WAMA 4FIPC 5EZYA 5LOVB 1TVKB 3L72H 2UUAB 2YXLA 3ZMUA 4J11A 4JI6B 2QTSA 2Z5UA 3ZN0A 1LNQA 1JOYA 1E79G 3ZJZA 2BE3A 3AG4B 2HJDA 4TSFG 3QVNA 3A0BZ 1WA8A 3E89A 3OR7C 2R9IA 2W6IG 5CA0A 1K5SA 3CCSV 2ZIOA 2Q68A 3OTFA 4PA4A 1VQPV 1OCZC 4H0LB 4IYIA 4CH5A 1L0NH 4X65B 5B3SB 1VARA 4B3TB 4DYLA 3BAAA 2E3CA 1PL0A 4YJ2B 5JCOA 4MVQA 1NQTA 1FD9A 2RJZA 3JAKA 3L74H 4DR6B 1DF4A 2OTJV 4JI8B 3EFFK 2Q69A 4ZOLB 2YC0A 3IAYA 4KFMA 1S0VA 1SC5B 3ZCCA 4I0XA 4AHCA 4UV8A 1H2KA 2LGQA 3QTCA 1ROPA 1S76D 1FXHA 3P3PA 3OMAB 2NR5A 3ABLC 2XTAA 4DR1B 1AJNA 2ZR3A 1VQ4V 1CPYA 1Y76A 1R3KC 3DC5A 3H1HH 1XNQB 1PM9A 5EC1C 1GM8A 3DSQA 3CCMV 1VQLV 4NB5A 4XDJA 4TUYA 1BHBA 1X59A 3BVOA 4X66O 4R8CA 3RYFA 4MTGA 2WLKA 1K4DC 5CN0A 1TUBB 4DV5B 1VMGA 5KUKA 1E1QG 1EN4A 5B1BB 4L87A 3SDLA 2DW4A 4D7SA 2AXTZ 2PYJA 1P49A 1EZVH 5DM6V 4FM1A 2LP7A 1XNQO 4JAUA 1KKDA 4H13B 2Q73A 2DWDC 4O2BA 1NH2D 4FFBB 4RWUA 3P30A 1JJOA 4FJCC 3ABLB 3KG2A 3M99B 3N2GB 2CUGA 2PTMA 3N2GA 2JDIG 2P06A 1N4CA 2XOKG 3K5MA 3APQA 3B4SA 4BW9A 1YIJV 1RSOB 3GB7C 4DV1B 3N2KB 3HKEA 1H38A 1YF2A 2LO1A 1Q6UA 5KMGA 4JYAO 1AROP 2B1GA 3ASNC 1JMKC 3CRQA 2P67A 3CMEV 5H6RA 4GKKB 1NVPD 3AG3C 1BGYH 1V9PA 2DWEC 4QPKA 1L8DA 1KECA 1PNMA 4FFKA 5BR8B 3CJHA 2DJVA 3Q4HA 4DUYO 2X6AA 1PNKA 5GW7A 2XAGA 3B8MA 3JASA 4ZHQB 2QEXV 1FFTB 2Z0AA 2D3OW 1M56B 3SR2C 3CCRV 4B08A 2P90A 4H33A 2R70A 1M9NA 4UCOA 2RDCA 5B1BC 1G6UA 3G80A 5JJJB 4ASUG 1PPJH 4U3JA 4LR3A 3C3TA 2HLDG 4MW3A 2IH1C 3ZS8C 3H1LH 3PJSK 1HR0B 3LDEA 4X88A 1SQFA 2QWRB 2AW9A 4E2LA 1WA8B 1QLNA 1IDSA 1Y67A 5IJ0B 4LF6B 2WLNA 2Q7HA 5L3EA 1S5JA 3ZHUA 3G71V 4X1KB 3X2QC 4DV6O 2FTKA 2WLLB 4K8XA 3JD4A 4BR6A 3FB6C 4DV4B 1B06A 1XHZA 2KKWA 4B3SO 1WN7A 3AG3B 3IGAC 1HWYA 3UT5A 2CK3G 1SQQH 3SJCC 2JRIA 1COWG 2JJ2G 3H9VA 4CS2A 3JARA 2HHHB 2X6CA 1N36B 1SZXA 3RFRA 4O4LA 3CMAV 4Q6GA 3QO5A 1PKXA 2YIBD 3NXSA 2QWOB 1PP9H 4ZKIA 5JWPA 3ZIAG 1TUBA 5FNVA 3STLC 2CTRA 1CEZA 3CRRA 2BSKA 4KUMA 5FNVB 4LF9O 1GN2A 4NXNB 4DR5O 2UXCB 1FFXA 1VQ9V 2UU9O 2A3QA 4IIJA 3P3NA 1OZ0A 5DN6G 1AB3A 4DK0A 4DV3B 2EILC 1VF6C 1PL4A 1G1XB 1XNRB 4DRXA 4NTWA 4GLXA 1R6TA 5IJ9B 3SJAC 5LYJB 5CB4B 1BQZA 4MVUA 5EBWC 1K3EA 2ZCEA 4GYCB 4N23A 2IW5A 3CS5A 3VQVA 2P4VA 1IBMB 2JEXA 3SYPA 2LW1A 2N74A 4LF7B 2ZE5A 2Q7GA 4LF4B 3CHXA 1XMQB 3ZBHA 4MVOA 1GH6A 1BCCH 1JPXA 3KCXA 4MVMA 1HNWB 1NR1A 3JAWB 4KHPO 2IU3A 2UXXA 4JAVA 2VS0A 1E1RG 3U11A 4F6RA 4IIJB 4DV2O 4JI2B 4QE7A 3NR7A 1HNZB 4Z2WA 1RSOA 3RVYA 3UO2A 2VQFO 1OCRB 4BW5A 2PI4A 3SPCA 1QVGU 1SRYA 3B09A 1SF9A 1Y4MA 3FYEB 1I5YA 5LP6C 1OHHG 1O9GA 1NBMG 4OPAA 3LSSA 2EILB 2FMLA 3K5NA 1S5HC 1EM1A 1P7GA 4HYOA 4MTXA 4P9PA 2QDOA 2WLJA 4MW8A 1ZUQA 4RUEA 5IY5C 2UXNA 1M5IA 3AK1A 4OGQB 2UUCO 4LFBO 4UCUA 1F7YA 3TGUH 5K1XA 3T2MA 3TK1A 1OCRC 5EIBC 5EBLC 1NS1A 5JQGA 1YDXA 3KZIZ 1FJGB 5EK0A 2AZ2A 3BHPA 3SGIA 2EZPA 2DYSB 4TQDA 1Q7YW 4PDMA 4X62O 4U7OA 3SJQC 1AP5A 1HNWO 1K34A 2WLIA 5KA5A 5GONB 2BOCC 5J2TA 1WB7A 3BRCA 1VQNV 3GVMA 2EBOA 1Y6XA 4KL1A 2YI8A 2ZIMA 2VRZA 3RWRD 2WA4A 4I50B 1XI1A 4ZOLA 5IYCO 5IWAB 2WSSG 3CPWU 1B6QA 1M57B 5L3GA 3OFNG 4XDLA 1N32B 4JPRA 2CTWA 2OIEA 4YY3O 2V4DA 1EFRG 3VBBA 3DXRB
chains in the Genus database with same CATH topology
4DW1A 3H9VA 3I5DA 4DW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DW1 A;  3H9V A;  3I5D A;  4DW0 A; 
#chains in the Genus database with same CATH topology
 4TT3 G;  4HBN A;  1V54 C;  3LDC A;  3OT7 A;  2A06 H;  3ICX A;  1XMQ O;  2QKA A;  4LWS B;  2HFE C;  2ZNJ A;  4JZ2 A;  5D5P A;  1YJW V;  5A9G A;  4JF3 A;  1IXM A;  2RQ6 A;  1HNZ O;  4WF9 V;  3AG2 C;  1KU9 A;  2GDS A;  4MVZ A;  4JZG A;  1GAX A;  2UXB O;  2XUM A;  4R6Z A;  1L0L H;  5CA0 B;  1OCZ B;  2YUA A;  3E22 A;  3K08 A;  2A9H A;  2FB5 A;  4JI3 B;  4NXM O;  2QM8 A;  3E22 B;  4DV3 O;  2IJJ A;  2BTQ A;  3BA8 A;  4FMT A;  4G27 B;  3AG7 A;  2EIJ B;  3E8B A;  4JV5 B;  1XL6 A;  4XBF A;  1MAB G;  4H37 A;  2JGD A;  3CCL V;  3SYA A;  2ZE6 A;  4H44 B;  2B9Z A;  1R3J C;  4YHH O;  1HNX B;  5IWA O;  1SES A;  4QIW F;  1YIT V;  4PDR A;  3AK2 A;  4DR2 O;  2E75 B;  2D2C B;  5L3C A;  2E5L O;  2F66 C;  1M90 W;  1ENV A;  4RUF A;  3JD2 A;  5JVD A;  4HNA B;  3GWK C;  3EHB B;  1V54 B;  2QKS A;  3T1C A;  4D6T H;  1S72 V;  2EJ7 A;  5J9P C;  3OUS A;  4DV6 B;  1IUR A;  4LBE C;  4IL6 Z;  3LDD A;  1NKD A;  5B1N A;  3ZMV A;  4X8A A;  1MZF A;  5CB4 A;  4LF8 O;  4F6E A;  3LSU A;  3AG1 C;  1AVM A;  1QQC A;  1FXV A;  4I7Z B;  1W59 A;  4BIO A;  3IC7 A;  1LR1 A;  4IGG A;  3ASO C;  4IT5 A;  5CA1 A;  1UPG A;  4JI5 O;  2XHB A;  4B7K A;  4YHH B;  2PF4 E;  1Y76 B;  2AHY A;  4EEQ A;  1XRE A;  3AG4 C;  4UCT A;  3HKC A;  4FLV A;  1XOU A;  3E35 A;  4LNU A;  3T4Z A;  2IM9 A;  1Q90 D;  1GTO A;  1FXK C;  3A0R A;  4RQE A;  3ZMZ A;  3B2E E;  5E79 Z;  3JAW A;  2JGD B;  4UV9 A;  1YEW A;  4QPJ A;  4JI2 O;  1MZE A;  2N05 A;  4I4T A;  1HDJ A;  4MVS A;  5KX5 A;  4HZ3 A;  2XAH A;  5B3S C;  1H2N A;  1KYO F;  3Q4H B;  5LHH A;  5FL7 G;  3JAK B;  3JD1 A;  4QJF B;  2EIM B;  2FKX A;  2IJH A;  5B1O A;  1OCO C;  3FAV A;  4JV5 O;  4LF7 O;  1ZLZ A;  4CH3 A;  4LF4 O;  4B3R B;  3TET A;  1R6N A;  1KP2 A;  1KC8 W;  4TV9 A;  1N0N A;  2W0X A;  3CE2 A;  4UCS A;  1G4Y B;  1HNX O;  2UXB B;  2WLI B;  4J41 A;  1N32 O;  2ZR2 A;  2YI9 A;  1F23 A;  2M6Y A;  3D3I A;  4UVB A;  4I9W A;  4JAA A;  4JTA B;  4CH6 A;  2ZQM A;  2Q0A A;  4DV0 O;  5LMN B;  4FLU A;  3AK3 A;  4U3F H;  2WLH A;  1I94 O;  3SYQ A;  3K57 A;  4CS4 A;  4NR1 A;  4MSW C;  3G4S V;  4LFA B;  1RFY A;  2OCH A;  3UO3 A;  5KHG A;  1SET A;  3RGB A;  1GK9 A;  1OCC C;  1SQB H;  1SER A;  2Y69 B;  3RYC B;  1NTK H;  4GX5 A;  4JYB A;  1AR5 A;  4UCV A;  1K9M W;  2B5U A;  2HHH O;  4BIU A;  1VQ8 V;  3JAT A;  1YTF B;  4JI0 B;  5E1A C;  3W7X A;  2HVK C;  5B66 Z;  3K9S A;  1N8R W;  2KSD A;  1SA0 A;  3TJT A;  3JCZ A;  1Z5W A;  1M4U A;  1ZAU A;  4JI4 B;  1Q5O A;  4WFH A;  2XAF A;  3F5W C;  1Y74 A;  4FM2 A;  4I55 A;  4JI5 B;  2L6L A;  5CBH A;  2LFS A;  4UVA A;  3WB2 A;  5KAF Z;  3L71 H;  4YJ3 B;  1SZT A;  4LF6 O;  1BHA A;  2F4V O;  2UUC B;  1TVK A;  5L3F A;  4LF8 B;  3JYC A;  3OTO B;  4CC5 A;  2K1E A;  5GTI Z;  5EYP A;  4ZIB A;  3STZ C;  1Q43 A;  3K58 A;  1GRJ A;  4UVC A;  1Z2G A;  4B3M O;  3L75 H;  3T4D A;  5IE9 A;  3RYI A;  3E8F A;  3O65 A;  2A79 B;  2YEV A;  4J7J A;  1VQM V;  3EXA A;  4JYA B;  4GKJ O;  4X1K A;  4P2Z A;  2YDE A;  4I55 B;  4JI0 O;  3D8C A;  2NLJ C;  1WAZ A;  4GZR B;  1Q86 W;  2X0L A;  1LUW A;  1JFF A;  3G67 A;  3ZMS A;  2IBZ H;  1V55 B;  2F43 G;  5BY1 A;  1RM1 B;  1MSW D;  1AI5 A;  1H2S B;  3ZHS A;  3SPH A;  3ZHT A;  3ZHR A;  4G28 B;  1TUE B;  4UFZ A;  5H6Q A;  4JI1 B;  2IJI A;  4Z1M G;  3QG5 A;  1MNG A;  1KD1 W;  1GN6 A;  1DTO A;  1I5X A;  2UUB O;  4KP4 A;  4DR3 O;  3ZRV A;  4I0X B;  4WCE V;  2WA3 A;  3A0H Z;  4WFF A;  3GWO A;  4X1I A;  1RPR A;  2RMK B;  1BZK A;  4LH7 A;  4FLY A;  1I7F A;  5F2V O;  2EIM C;  2Q0O C;  4QGP A;  1Q8I A;  1DK1 A;  3R65 A;  3AG2 B;  4EFE A;  3QO8 A;  1T5E A;  4U7N A;  4EB6 B;  1VQK V;  1IBL B;  5LP6 B;  1N36 O;  2DQ3 A;  1IBK B;  4O2A B;  1KBH A;  4K0K B;  3CCJ V;  2GHY A;  1VQ7 V;  3LUT B;  3HKD B;  4DW0 A;  3BAB A;  5BZB A;  1HW7 A;  4RO2 A;  5JJN B;  4DR7 B;  3JSL A;  1VQ6 V;  3H1I H;  2F23 A;  3O9O A;  5BMV B;  5LBQ A;  4DRX B;  4JI7 O;  1PNL A;  5IYZ A;  1OJH A;  3K3W A;  1CP9 A;  4FVM A;  4AI8 A;  3OAA G;  3CEI A;  3LSQ A;  2YID A;  2BTO A;  1NJI W;  1KUQ A;  3RW0 A;  3ABM B;  2LQT A;  1DLB A;  1R6K A;  2ZIN A;  3OTO O;  3FYI B;  2VQE O;  2JIZ G;  2DYS C;  4DUZ B;  1U96 A;  3DGE A;  5ITZ B;  3W7S A;  1YVW A;  1BMF G;  4O2B B;  4YIO A;  4DV4 O;  1UJW B;  4DR4 O;  2LGW A;  4DO2 A;  3T1Y B;  2HJF C;  5KUM A;  3M8A A;  4NKG B;  4RQF A;  3ASO B;  3S3W A;  3H01 A;  2UUB B;  4I5S A;  2ITD C;  4P9O A;  3CC2 V;  1JVM A;  3KCY A;  2JVD A;  4X64 B;  4O4J B;  2EZO A;  4DV7 B;  4UXN A;  3CP1 A;  5KMG B;  4O4I A;  2ZXW C;  2F1M A;  4FLT A;  1FFX B;  3N2K A;  3K79 A;  1BSM A;  2CTQ A;  3JAR B;  5LP6 A;  1EN5 A;  2G38 A;  2OYQ A;  3THO A;  3BY6 A;  2DYR C;  4LFA O;  4UB6 Z;  1Q3E A;  4GX2 A;  4X64 O;  3E8G A;  1XQ8 A;  4AIL C;  4D7T A;  4LP8 A;  2EIK B;  1OCO B;  2RCV A;  1BT8 A;  5J2T B;  3J81 N;  3MD0 A;  3QO7 A;  2NN4 A;  3K03 A;  4O2A A;  2OTL V;  5EC2 C;  5LGU A;  3TXQ A;  4DK1 A;  1K33 A;  2NNU A;  3AEI A;  4G2K A;  2YIB A;  4PA3 A;  2W6J G;  2F4V B;  3K5O A;  2DMX A;  1BL8 A;  5IJ0 A;  3HR0 A;  5KA6 A;  3CJH B;  2ILM A;  5JVD B;  1IBM O;  1QU7 A;  3PN1 A;  1D2D A;  2VWJ A;  1F4M A;  2JEU A;  3CC7 V;  1M1K W;  4FLW A;  1QHT A;  1P84 F;  4GUN A;  1XMO B;  3FX7 A;  2VWK A;  5D5Q A;  2ZXW B;  1S5L Z;  1R1B A;  5C8Y B;  2EIK C;  3L70 H;  2ZD9 A;  3T1H O;  4QE9 A;  4LFC O;  1Z5V A;  1SQP H;  2A0L A;  1VIB A;  5LYJ A;  4JYY A;  1B04 A;  5H5N A;  1WPX A;  1THZ A;  2IJK A;  1KQS U;  4NXN O;  3OGI B;  5B5E Z;  4O4I B;  4TUY B;  5EYP B;  4J80 A;  4E4E A;  2P6J A;  3JAS B;  3OUF A;  1R73 A;  2EX3 A;  2QWP B;  4YIP A;  5LL6 Y;  3FD9 A;  1IZ3 A;  2R9R B;  3G6E V;  2P5O A;  3RVZ A;  3HKC B;  3QNE A;  1FYJ A;  4EFB A;  4TWK A;  4LFC B;  3UCS C;  2YSU B;  1NTZ H;  4FM0 A;  4O4H A;  1JFF B;  3WG7 C;  4WFG A;  1DGS A;  1M56 C;  2QR4 A;  4X1Y A;  4DV5 O;  1Q82 W;  2EIN B;  4ABM A;  4WFB V;  3MHS C;  3VQW A;  2CE4 A;  3SJB C;  1XHX A;  4FLX A;  4TQF A;  1FAF A;  1R3L C;  2KB1 A;  2ODM A;  5CA1 B;  4FZ0 A;  4PDL A;  3RYH A;  3RYC A;  3OEH G;  5KHH A;  4KXR A;  1XDC A;  1M93 A;  1K4C C;  1DF5 A;  1WB8 A;  3W7W A;  5ITZ A;  1BQ0 A;  2QWQ B;  1Q6I A;  2EIJ C;  4TV8 A;  2DQ0 A;  1GKF A;  2IU0 A;  4DR4 B;  5JCO C;  2Q5Z A;  4K8Z A;  5KX5 B;  1VP7 A;  1IXB A;  1NI8 A;  2QA4 V;  4AQY B;  1XUQ A;  3E83 A;  2XT9 A;  4LF5 B;  5L3B A;  2OWO A;  2W0F C;  1AJP A;  3X2Q B;  3OE7 G;  1AP6 A;  2ZE7 A;  4MTF A;  4K35 A;  1Y74 B;  1ZL8 B;  4LFB B;  2MW2 B;  2C2A A;  5LXT A;  5AG2 A;  3UQ8 A;  1EBO A;  3HKD A;  3CRA A;  3VOU A;  3CCE V;  1GMG A;  2WPD G;  2HG5 C;  4O4L B;  4DUY B;  2KQX A;  1S77 D;  4AQY O;  1QR8 A;  3T1Y O;  5FPO A;  5DEC A;  1RP3 B;  3FAV B;  2X6B A;  1MSD A;  5J2U B;  4GX0 A;  3ZHQ A;  2Y4U A;  3ZRS A;  1V55 C;  1F51 A;  2CH7 B;  3H1J H;  2EIN C;  1MG1 A;  1RPO A;  1K92 A;  5FLX N;  2HEP A;  2VQE B;  2BOB C;  3J80 N;  1YHQ V;  3SYO A;  3U10 A;  1N33 B;  2UUA O;  2Q6A A;  4I9Q A;  4W4K A;  3AG1 B;  5LXT B;  2PZS A;  4JI7 B;  1ZX3 A;  2ZDI C;  4LWS A;  2PUS A;  2V1D A;  3ZX6 A;  4WBN B;  3ZN1 A;  2ZE8 A;  5H9C A;  1AIL A;  3RYF B;  4KHP B;  3F7V C;  1ZTE A;  4CBC A;  1EZJ A;  2F93 B;  1MMM A;  2N04 A;  1TGO A;  1K7D A;  4EKW A;  2UXC O;  4CS3 A;  2KG7 A;  4DR1 O;  2LJ2 A;  4C7U A;  3IJ4 A;  3ABM C;  3WU2 Z;  3FKS G;  4JTC B;  3J7A U;  1XMO O;  4DV0 B;  1U97 A;  3K0D A;  3JCU Z;  2BTQ B;  5LHI A;  1OV9 A;  3ZRX A;  2LW7 A;  1YSC A;  2GUZ B;  2PI5 A;  5C8Y A;  2QE7 G;  3DC6 A;  4J9Z B;  3B77 A;  4J9Y B;  3I55 V;  4NYK A;  4X89 A;  4DW1 A;  2QM7 A;  2YS8 A;  3A2F A;  4J7Z A;  4OX9 B;  2XAS A;  2XND G;  4PA9 A;  4DR6 O;  1XEQ A;  5TIS Z;  4MS2 A;  4NTX A;  1CXZ B;  3JSN A;  1ZL8 A;  2QGN A;  2ZKO A;  2M7W A;  4L8J A;  4QNH B;  2YXH A;  5KLV H;  2PGG A;  3MAQ A;  2Q8V A;  5DED A;  2YEV B;  3WG7 B;  1X4T A;  5BMV A;  3ETE A;  2XAQ A;  1L1F A;  4DR3 B;  3D36 C;  1W2B U;  2P22 C;  1S3J A;  3FB5 C;  3IC9 A;  1R3I C;  3CC4 V;  2QKC A;  4X1I B;  5EIB D;  4PHZ A;  1FKA O;  2PYL A;  3UT5 B;  1PV0 A;  4IYH A;  4R7C A;  4J10 A;  1BS3 A;  3LNM B;  3BPZ A;  5HFM A;  3FB7 C;  3RN4 A;  2HR3 A;  1QR9 A;  4DV7 O;  1NH2 B;  1JJ2 U;  2RN9 A;  3IFX A;  4Q20 A;  3D36 A;  2CDY A;  1XBL A;  4PDV A;  3RYI B;  4MT8 A;  1KKC A;  4K3A A;  5BR8 O;  4A5U B;  2X7R B;  1H8H G;  1QLE C;  1MA1 A;  3TCU A;  3OW2 U;  1K8A W;  2KG7 B;  4JGS A;  3K59 A;  1VF5 B;  3OM3 B;  3S3X A;  3OMI B;  2CH7 A;  5B1A C;  5K1P A;  1FXK A;  1LUV A;  4ZI7 B;  1BE3 H;  3CXH F;  4X20 B;  5JQG B;  2OIG A;  1M57 C;  4TV8 B;  3OGC C;  1VQ5 V;  3K04 A;  4FLZ A;  3K9A A;  4X1Y B;  1F4N A;  2Q7E A;  1TAE A;  4UCR A;  1QNM A;  4EB6 A;  3CSX A;  2GV9 A;  2WWW A;  1D5A A;  1J5E B;  1FS0 G;  1JQ0 A;  1URF A;  5GON A;  4NVP A;  1AR1 B;  3JAL B;  2QWN B;  2QM4 A;  3F7Y C;  3OR6 C;  3FFQ A;  3CRC A;  1HP8 A;  4PJ0 Z;  1IBK O;  2LFR A;  4PA6 A;  2R72 A;  4HAM A;  3ZMT A;  5J2U A;  2O57 A;  4DR5 B;  5H2F Z;  1NU1 H;  3C3S A;  3K06 A;  3H1K H;  5LMN O;  4I50 A;  3ETD A;  4YJ3 A;  4PI0 A;  2Y4T A;  1B3Q A;  1J5E O;  3BFR A;  2JS3 A;  2AGA A;  5LHG A;  2YIC A;  5KHJ A;  2AZ0 A;  3OD4 A;  2RNB A;  1I0H A;  3CD6 V;  4ZHQ A;  1QLE B;  4N21 A;  1RM1 C;  3JAL A;  2GTA A;  4W4L A;  3CWB H;  4XDK A;  3JD0 A;  1YZB A;  4I4T B;  2R9A A;  2UU9 B;  1XIL A;  3OMN B;  2H8P C;  3ABK C;  4HNA A;  3DTU B;  5EBM C;  5LGT A;  2ZNI A;  4FZ1 A;  3E8H A;  3G6B A;  1AJQ A;  5CMU A;  3A8T A;  3CCQ V;  2DYR B;  2Y0P A;  3UKM A;  5HFL A;  3TXS A;  2GUZ A;  4O4J A;  1JA8 A;  1SS3 A;  4X66 B;  4BAY A;  1PD3 A;  1JR9 A;  1MOF A;  2HP8 A;  2ADQ B;  2YIA A;  2ZT9 B;  3WB0 A;  2QTO A;  4CC6 A;  1Q6H A;  4MTO A;  4X62 B;  2A7W A;  2QSA A;  1WLE A;  4UUJ C;  3F5T A;  3UM7 A;  2JJ1 G;  3DXR A;  4X9Q A;  1A32 A;  1NTM H;  4LC1 A;  4PI2 A;  4X65 O;  1D5N A;  1KB9 F;  4GKK O;  3CB2 A;  3HKB A;  3R66 A;  1WP8 A;  5GTH Z;  3ABU A;  3VQX A;  1GN4 A;  3D3Q A;  1N33 O;  3BCC H;  4FPP A;  3ZED A;  2OCC B;  4YJ2 A;  1YTF D;  3L73 H;  2FL4 A;  3KKY A;  3ZHV A;  1NZ6 A;  4LH6 A;  2VQF B;  4JI8 O;  1K73 W;  2P4K A;  3JAT B;  1NVP B;  4PV1 B;  1ZSP A;  3SPJ A;  4TOI A;  3CXC U;  4DV2 B;  1KMI Z;  2H3O A;  3ABK B;  1GM7 A;  2BSK B;  2JK5 C;  2E76 B;  1W0K G;  4WBN A;  3ZRW B;  1QBZ A;  4IHJ B;  2Y0I A;  3QF7 A;  3HPL C;  4BIZ A;  5JJE B;  3I5D A;  3ABT A;  5IYD O;  4O4H B;  4ZBM A;  2AHZ A;  4DV1 O;  2WLM A;  1HR0 O;  4GX1 A;  2CTP A;  1NT2 B;  5B1A B;  2OCC C;  3N27 A;  2MK3 A;  4NTY A;  1VEW A;  3MHH C;  2V7Q G;  2P7T C;  5LMU O;  2CGO A;  3CYO A;  1P7B A;  3ETG A;  1FXK B;  4K0K O;  3B8N A;  1I08 A;  4DXW A;  1VF6 A;  5LGN A;  4IHJ A;  2HVJ C;  2WLL A;  2GTS A;  4JI6 O;  3MDS A;  1J95 A;  3ML0 A;  1VQO V;  4PEL A;  1WNS A;  4CH4 A;  4DR2 B;  4NXM B;  3LNN A;  4LF9 B;  4F6R B;  4GT1 A;  2ATK C;  1GM9 A;  1H2M A;  3K0G A;  4ICG A;  5JH7 A;  1FPO A;  4JTD B;  1OCC B;  4F4L A;  2Y69 C;  5JH7 B;  2BCC H;  3L9D A;  5C93 A;  4RAI A;  1SQX H;  2UXD B;  2CAZ C;  1SQV H;  4B3S B;  2Q67 A;  1SA0 B;  4TV9 B;  1JX9 A;  5BXZ A;  1H8E G;  2B1I A;  3OEE G;  3ZRW A;  4WFE A;  3B40 A;  3SPI A;  1QVF U;  1JCH A;  3CX5 F;  5IY5 B;  1SQG A;  2Q9L A;  3CRM A;  5LA6 A;  3K5L A;  4R50 A;  4B3R O;  3P32 A;  1US6 A;  5IJ9 A;  2DE0 X;  1WP7 A;  1XL4 A;  2XAJ A;  2L35 A;  4WFA V;  5KAI Z;  4FFB A;  2JS5 A;  1YCI A;  2K9P A;  3BA9 A;  4YY3 B;  3RBZ A;  4JI1 O;  2H94 A;  4B3M B;  1ZWI C;  5LMU B;  3RT3 C;  1N34 B;  1ORQ C;  5KHI A;  2GBO A;  4B3T O;  1UFI A;  2GSM B;  3I56 V;  2YXY A;  3CCU V;  4UB8 Z;  3HB3 B;  4OPH A;  1QCE A;  3ASN B;  1AI6 A;  5L3D A;  4X20 A;  1G8M A;  3WFV A;  4CZZ A;  4JYC A;  1O9H A;  1W0J G;  3JD3 A;  3W7U A;  4LF5 O;  2DOS A;  3WB1 A;  5FPR A;  1AI4 A;  3E86 A;  1H2L A;  1KP3 A;  2EUL A;  1P4R A;  4FK5 C;  1GO3 F;  3VQY A;  2ADP A;  4JI4 O;  2Z3Y A;  5EZY B;  5LOV A;  3U0Z A;  1WPB A;  3BEH A;  3C90 A;  3FB8 C;  2ETN A;  2CGN A;  4OX9 O;  4B7E A;  2IH3 C;  4BWA A;  1TA8 A;  1H2G A;  1NR7 A;  4U3J B;  2E74 B;  2QJ1 A;  4ZI7 A;  1AI7 A;  5CBF A;  3E2E A;  3HKE B;  2F95 B;  1N34 O;  2DN9 A;  4OXS A;  2ZM6 B;  3ETQ A;  3JAM N;  2Q4P A;  5LA6 B;  3EVK A;  1IVS A;  5CA3 A;  1YJN V;  2UXD O;  1WJZ A;  1K97 A;  2E5L B;  1GN3 A;  2EJR A;  3W7T A;  5CBG A;  5IYZ B;  3CCV V;  3M7M X;  5A2Q N;  2ZM6 O;  1Q81 W;  4GCZ A;  3RYH B;  3SPG A;  1Y66 A;  5IDJ A;  4PA7 A;  1IX9 A;  4LCU C;  3HKB B;  4YXW G;  1EN6 A;  4DUZ O;  1YXB A;  1YJ9 V;  2PY5 A;  2ITC C;  4PD4 F;  5IT9 N;  1YI2 V;  5KHK A;  3SYC A;  2FYU H;  3APO A;  1I94 B;  4JI3 O;  4P30 A;  1IBL O;  1VF7 A;  4GKJ B;  2Y48 A;  3T1H B;  1SKV A;  4Z1V A;  4LNU B;  4J7K A;  2ARH A;  4MVR A;  2JGU A;  5IYB O;  2ZDI A;  1FJG O;  1AR4 A;  4DR7 O;  4J42 A;  1XNR O;  2OT5 A;  1K5Q A;  1N0J A;  4JAS A;  2HKO A;  2WAM A;  4FIP C;  5EZY A;  5LOV B;  1TVK B;  3L72 H;  2UUA B;  2YXL A;  3ZMU A;  4J11 A;  4JI6 B;  2QTS A;  2Z5U A;  3ZN0 A;  1LNQ A;  1JOY A;  1E79 G;  3ZJZ A;  2BE3 A;  3AG4 B;  2HJD A;  4TSF G;  3QVN A;  3A0B Z;  1WA8 A;  3E89 A;  3OR7 C;  2R9I A;  2W6I G;  5CA0 A;  1K5S A;  3CCS V;  2ZIO A;  2Q68 A;  3OTF A;  4PA4 A;  1VQP V;  1OCZ C;  4H0L B;  4IYI A;  4CH5 A;  1L0N H;  4X65 B;  5B3S B;  1VAR A;  4B3T B;  4DYL A;  3BAA A;  2E3C A;  1PL0 A;  4YJ2 B;  5JCO A;  4MVQ A;  1NQT A;  1FD9 A;  2RJZ A;  3JAK A;  3L74 H;  4DR6 B;  1DF4 A;  2OTJ V;  4JI8 B;  3EFF K;  2Q69 A;  4ZOL B;  2YC0 A;  3IAY A;  4KFM A;  1S0V A;  1SC5 B;  3ZCC A;  4I0X A;  4AHC A;  4UV8 A;  1H2K A;  2LGQ A;  3QTC A;  1ROP A;  1S76 D;  1FXH A;  3P3P A;  3OMA B;  2NR5 A;  3ABL C;  2XTA A;  4DR1 B;  1AJN A;  2ZR3 A;  1VQ4 V;  1CPY A;  1Y76 A;  1R3K C;  3DC5 A;  3H1H H;  1XNQ B;  1PM9 A;  5EC1 C;  1GM8 A;  3DSQ A;  3CCM V;  1VQL V;  4NB5 A;  4XDJ A;  4TUY A;  1BHB A;  1X59 A;  3BVO A;  4X66 O;  4R8C A;  3RYF A;  4MTG A;  2WLK A;  1K4D C;  5CN0 A;  1TUB B;  4DV5 B;  1VMG A;  5KUK A;  1E1Q G;  1EN4 A;  5B1B B;  4L87 A;  3SDL A;  2DW4 A;  4D7S A;  2AXT Z;  2PYJ A;  1P49 A;  1EZV H;  5DM6 V;  4FM1 A;  2LP7 A;  1XNQ O;  4JAU A;  1KKD A;  4H13 B;  2Q73 A;  2DWD C;  4O2B A;  1NH2 D;  4FFB B;  4RWU A;  3P30 A;  1JJO A;  4FJC C;  3ABL B;  3KG2 A;  3M99 B;  3N2G B;  2CUG A;  2PTM A;  3N2G A;  2JDI G;  2P06 A;  1N4C A;  2XOK G;  3K5M A;  3APQ A;  3B4S A;  4BW9 A;  1YIJ V;  1RSO B;  3GB7 C;  4DV1 B;  3N2K B;  3HKE A;  1H38 A;  1YF2 A;  2LO1 A;  1Q6U A;  5KMG A;  4JYA O;  1ARO P;  2B1G A;  3ASN C;  1JMK C;  3CRQ A;  2P67 A;  3CME V;  5H6R A;  4GKK B;  1NVP D;  3AG3 C;  1BGY H;  1V9P A;  2DWE C;  4QPK A;  1L8D A;  1KEC A;  1PNM A;  4FFK A;  5BR8 B;  3CJH A;  2DJV A;  3Q4H A;  4DUY O;  2X6A A;  1PNK A;  5GW7 A;  2XAG A;  3B8M A;  3JAS A;  4ZHQ B;  2QEX V;  1FFT B;  2Z0A A;  2D3O W;  1M56 B;  3SR2 C;  3CCR V;  4B08 A;  2P90 A;  4H33 A;  2R70 A;  1M9N A;  4UCO A;  2RDC A;  5B1B C;  1G6U A;  3G80 A;  5JJJ B;  4ASU G;  1PPJ H;  4U3J A;  4LR3 A;  3C3T A;  2HLD G;  4MW3 A;  2IH1 C;  3ZS8 C;  3H1L H;  3PJS K;  1HR0 B;  3LDE A;  4X88 A;  1SQF A;  2QWR B;  2AW9 A;  4E2L A;  1WA8 B;  1QLN A;  1IDS A;  1Y67 A;  5IJ0 B;  4LF6 B;  2WLN A;  2Q7H A;  5L3E A;  1S5J A;  3ZHU A;  3G71 V;  4X1K B;  3X2Q C;  4DV6 O;  2FTK A;  2WLL B;  4K8X A;  3JD4 A;  4BR6 A;  3FB6 C;  4DV4 B;  1B06 A;  1XHZ A;  2KKW A;  4B3S O;  1WN7 A;  3AG3 B;  3IGA C;  1HWY A;  3UT5 A;  2CK3 G;  1SQQ H;  3SJC C;  2JRI A;  1COW G;  2JJ2 G;  3H9V A;  4CS2 A;  3JAR A;  2HHH B;  2X6C A;  1N36 B;  1SZX A;  3RFR A;  4O4L A;  3CMA V;  4Q6G A;  3QO5 A;  1PKX A;  2YIB D;  3NXS A;  2QWO B;  1PP9 H;  4ZKI A;  5JWP A;  3ZIA G;  1TUB A;  5FNV A;  3STL C;  2CTR A;  1CEZ A;  3CRR A;  2BSK A;  4KUM A;  5FNV B;  4LF9 O;  1GN2 A;  4NXN B;  4DR5 O;  2UXC B;  1FFX A;  1VQ9 V;  2UU9 O;  2A3Q A;  4IIJ A;  3P3N A;  1OZ0 A;  5DN6 G;  1AB3 A;  4DK0 A;  4DV3 B;  2EIL C;  1VF6 C;  1PL4 A;  1G1X B;  1XNR B;  4DRX A;  4NTW A;  4GLX A;  1R6T A;  5IJ9 B;  3SJA C;  5LYJ B;  5CB4 B;  1BQZ A;  4MVU A;  5EBW C;  1K3E A;  2ZCE A;  4GYC B;  4N23 A;  2IW5 A;  3CS5 A;  3VQV A;  2P4V A;  1IBM B;  2JEX A;  3SYP A;  2LW1 A;  2N74 A;  4LF7 B;  2ZE5 A;  2Q7G A;  4LF4 B;  3CHX A;  1XMQ B;  3ZBH A;  4MVO A;  1GH6 A;  1BCC H;  1JPX A;  3KCX A;  4MVM A;  1HNW B;  1NR1 A;  3JAW B;  4KHP O;  2IU3 A;  2UXX A;  4JAV A;  2VS0 A;  1E1R G;  3U11 A;  4F6R A;  4IIJ B;  4DV2 O;  4JI2 B;  4QE7 A;  3NR7 A;  1HNZ B;  4Z2W A;  1RSO A;  3RVY A;  3UO2 A;  2VQF O;  1OCR B;  4BW5 A;  2PI4 A;  3SPC A;  1QVG U;  1SRY A;  3B09 A;  1SF9 A;  1Y4M A;  3FYE B;  1I5Y A;  5LP6 C;  1OHH G;  1O9G A;  1NBM G;  4OPA A;  3LSS A;  2EIL B;  2FML A;  3K5N A;  1S5H C;  1EM1 A;  1P7G A;  4HYO A;  4MTX A;  4P9P A;  2QDO A;  2WLJ A;  4MW8 A;  1ZUQ A;  4RUE A;  5IY5 C;  2UXN A;  1M5I A;  3AK1 A;  4OGQ B;  2UUC O;  4LFB O;  4UCU A;  1F7Y A;  3TGU H;  5K1X A;  3T2M A;  3TK1 A;  1OCR C;  5EIB C;  5EBL C;  1NS1 A;  5JQG A;  1YDX A;  3KZI Z;  1FJG B;  5EK0 A;  2AZ2 A;  3BHP A;  3SGI A;  2EZP A;  2DYS B;  4TQD A;  1Q7Y W;  4PDM A;  4X62 O;  4U7O A;  3SJQ C;  1AP5 A;  1HNW O;  1K34 A;  2WLI A;  5KA5 A;  5GON B;  2BOC C;  5J2T A;  1WB7 A;  3BRC A;  1VQN V;  3GVM A;  2EBO A;  1Y6X A;  4KL1 A;  2YI8 A;  2ZIM A;  2VRZ A;  3RWR D;  2WA4 A;  4I50 B;  1XI1 A;  4ZOL A;  5IYC O;  5IWA B;  2WSS G;  3CPW U;  1B6Q A;  1M57 B;  5L3G A;  3OFN G;  4XDL A;  1N32 B;  4JPR A;  2CTW A;  2OIE A;  4YY3 O;  2V4D A;  1EFR G;  3VBB A;  3DXR B; 
#chains in the Genus database with same CATH homology
 4DW1 A;  3H9V A;  3I5D A;  4DW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...